data_2V1N
# 
_entry.id   2V1N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2V1N         
PDBE  EBI-32695    
WWPDB D_1290032695 
BMRB  6938         
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  2CKK unspecified 'HIGH RESOLUTION CRYSTAL STRUCTURE OF THE HUMAN KIN17 C-TERMINAL DOMAIN CONTAINING A KOW MOTIF' 
BMRB 6938 unspecified .                                                                                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2V1N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Carlier, L.'     1 
'Le Maire, A.'    2 
'Gondry, M.'      3 
'Guilhaudis, L.'  4 
'Milazzo, I.'     5 
'Davoust, D.'     6 
'Couprie, J.'     7 
'Gilquin, B.'     8 
'Zinn-Justin, S.' 9 
# 
_citation.id                        primary 
_citation.title                     
'Solution Structure of the Region 51-160 of Human Kin17 Reveals an Atypical Winged Helix Domain' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            16 
_citation.page_first                2750 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18029424 
_citation.pdbx_database_id_DOI      10.1110/PS.073079107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Carlier, L.'     1 ? 
primary 'Le Maire, A.'    2 ? 
primary 'Gondry, M.'      3 ? 
primary 'Guilhaudis, L.'  4 ? 
primary 'Milazzo, I.'     5 ? 
primary 'Davoust, D.'     6 ? 
primary 'Couprie, J.'     7 ? 
primary 'Gilquin, B.'     8 ? 
primary 'Zinn-Justin, S.' 9 ? 
# 
_cell.entry_id           2V1N 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2V1N 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEIN KIN HOMOLOG' 
_entity.formula_weight             13686.452 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RESIDUES 51-160' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        KIN17 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCK
VDETPKGWYIQYIDRDPETIRRQLELEKKKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCK
VDETPKGWYIQYIDRDPETIRRQLELEKKKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLN n 
1 3   ARG n 
1 4   GLN n 
1 5   LEU n 
1 6   LEU n 
1 7   LEU n 
1 8   ALA n 
1 9   SER n 
1 10  GLU n 
1 11  ASN n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  PHE n 
1 16  MET n 
1 17  ASP n 
1 18  TYR n 
1 19  PHE n 
1 20  SER n 
1 21  GLU n 
1 22  GLU n 
1 23  PHE n 
1 24  ARG n 
1 25  ASN n 
1 26  ASP n 
1 27  PHE n 
1 28  LEU n 
1 29  GLU n 
1 30  LEU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  PHE n 
1 36  GLY n 
1 37  THR n 
1 38  LYS n 
1 39  ARG n 
1 40  VAL n 
1 41  HIS n 
1 42  ASN n 
1 43  ASN n 
1 44  ILE n 
1 45  VAL n 
1 46  TYR n 
1 47  ASN n 
1 48  GLU n 
1 49  TYR n 
1 50  ILE n 
1 51  SER n 
1 52  HIS n 
1 53  ARG n 
1 54  GLU n 
1 55  HIS n 
1 56  ILE n 
1 57  HIS n 
1 58  MET n 
1 59  ASN n 
1 60  ALA n 
1 61  THR n 
1 62  GLN n 
1 63  TRP n 
1 64  GLU n 
1 65  THR n 
1 66  LEU n 
1 67  THR n 
1 68  ASP n 
1 69  PHE n 
1 70  THR n 
1 71  LYS n 
1 72  TRP n 
1 73  LEU n 
1 74  GLY n 
1 75  ARG n 
1 76  GLU n 
1 77  GLY n 
1 78  LEU n 
1 79  CYS n 
1 80  LYS n 
1 81  VAL n 
1 82  ASP n 
1 83  GLU n 
1 84  THR n 
1 85  PRO n 
1 86  LYS n 
1 87  GLY n 
1 88  TRP n 
1 89  TYR n 
1 90  ILE n 
1 91  GLN n 
1 92  TYR n 
1 93  ILE n 
1 94  ASP n 
1 95  ARG n 
1 96  ASP n 
1 97  PRO n 
1 98  GLU n 
1 99  THR n 
1 100 ILE n 
1 101 ARG n 
1 102 ARG n 
1 103 GLN n 
1 104 LEU n 
1 105 GLU n 
1 106 LEU n 
1 107 GLU n 
1 108 LYS n 
1 109 LYS n 
1 110 LYS n 
1 111 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)ROSETTA PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PEXP-TH5 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2V1N         1 ? ? 2V1N   ? 
2 UNP O60870_HUMAN 1 ? ? O60870 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2V1N A 1 ? 1   ? 2V1N   1  ? 1   ? 1 1   
2 2 2V1N A 2 ? 111 ? O60870 51 ? 160 ? 2 111 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 15N-NOESY-HSQC              1 
2 1 '13C-NOESY- HSQC ALIPHATIC' 1 
3 2 '13C-NOESY- HSQC AROMATIC'  1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 303.0 ? ? 6.0 '50MM PHOSPHATE , 150MM NACL' ? pH K 
2 303.0 ? ? 6.0 '50MM PHOSPHATE , 150MM NACL' ? pH K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      '90%WATER / 10%D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 INOVA Varian 800 
2 DMX   Bruker 600 
# 
_pdbx_nmr_refine.entry_id           2V1N 
_pdbx_nmr_refine.method             'SIMULATED ANNEALING USING CNS' 
_pdbx_nmr_refine.details            
'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. THE REGIONS 3-15 AND 108-111 ARE DISORDERED' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2V1N 
_pdbx_nmr_details.text       
'THE STRUCTURE WAS DETERMINATED USING TRIPLE- RESONANCE NMR SPECTROSCOPY ON 15N- AND 15N-13C- LABELED PROTEINS' 
# 
_pdbx_nmr_ensemble.entry_id                             2V1N 
_pdbx_nmr_ensemble.conformers_calculated_total_number   400 
_pdbx_nmr_ensemble.conformers_submitted_total_number    12 
_pdbx_nmr_ensemble.conformer_selection_criteria         
'STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY, WITH THE LEAST RESTRAINT VIOLATIONS, WITH THE LOWEST ENERGY' 
# 
_pdbx_nmr_representative.entry_id             2V1N 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS     1.0 
'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 
'structure solution' NMRView ?   ? 2 
'structure solution' NMRPipe ?   ? 3 
'structure solution' Felix   ?   ? 4 
'structure solution' CNS     ?   ? 5 
# 
_exptl.entry_id          2V1N 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2V1N 
_struct.title                     'SOLUTION STRUCTURE OF THE REGION 51-160 OF HUMAN KIN17 REVEALS A WINGED HELIX FOLD' 
_struct.pdbx_descriptor           'PROTEIN KIN HOMOLOG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2V1N 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
_struct_keywords.text            'KIN17, NUCLEAR PROTEIN, WINGED HELIX MOTIF' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 11 ? GLN A 14  ? ASN A 11 GLN A 14  5 ? 4  
HELX_P HELX_P2 1 MET A 16 ? ARG A 34  ? MET A 16 ARG A 34  1 ? 19 
HELX_P HELX_P3 2 ASN A 42 ? ILE A 50  ? ASN A 42 ILE A 50  1 ? 9  
HELX_P HELX_P4 3 MET A 58 ? ALA A 60  ? MET A 58 ALA A 60  5 ? 3  
HELX_P HELX_P5 4 LEU A 66 ? ARG A 75  ? LEU A 66 ARG A 75  1 ? 10 
HELX_P HELX_P6 5 GLU A 98 ? GLU A 107 ? GLU A 98 GLU A 107 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 87 ? TYR A 92 ? GLY A 87 TYR A 92 
AA 2 CYS A 79 ? THR A 84 ? CYS A 79 THR A 84 
AA 3 ARG A 39 ? HIS A 41 ? ARG A 39 HIS A 41 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O TYR A 92 ? O TYR A 92 N TRP A 88 ? N TRP A 88 
AA 2 3 O TYR A 92 ? O TYR A 92 N TRP A 88 ? N TRP A 88 
# 
_database_PDB_matrix.entry_id          2V1N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2V1N 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 23.746  19.300  15.391  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 22.315  19.218  15.223  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 21.954  19.666  13.856  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 20.780  19.824  13.526  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H    . GLY A 1 1   ? 24.107  19.382  16.320  1.00 0.00 ? 1   GLY A H    1  
ATOM 6     H HA2  . GLY A 1 1   ? 22.017  18.186  15.320  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 21.845  19.900  15.912  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . GLN A 1 2   ? 22.985  19.876  13.014  1.00 0.00 ? 2   GLN A N    1  
ATOM 9     C CA   . GLN A 1 2   ? 22.888  20.374  11.657  1.00 0.00 ? 2   GLN A CA   1  
ATOM 10    C C    . GLN A 1 2   ? 22.692  19.309  10.591  1.00 0.00 ? 2   GLN A C    1  
ATOM 11    O O    . GLN A 1 2   ? 21.648  19.240  9.951   1.00 0.00 ? 2   GLN A O    1  
ATOM 12    C CB   . GLN A 1 2   ? 24.130  21.231  11.324  1.00 0.00 ? 2   GLN A CB   1  
ATOM 13    C CG   . GLN A 1 2   ? 23.835  22.269  10.227  1.00 0.00 ? 2   GLN A CG   1  
ATOM 14    C CD   . GLN A 1 2   ? 25.133  22.943  9.801   1.00 0.00 ? 2   GLN A CD   1  
ATOM 15    O OE1  . GLN A 1 2   ? 25.914  22.349  9.053   1.00 0.00 ? 2   GLN A OE1  1  
ATOM 16    N NE2  . GLN A 1 2   ? 25.379  24.183  10.285  1.00 0.00 ? 2   GLN A NE2  1  
ATOM 17    H H    . GLN A 1 2   ? 23.893  19.721  13.401  1.00 0.00 ? 2   GLN A H    1  
ATOM 18    H HA   . GLN A 1 2   ? 22.027  21.030  11.589  1.00 0.00 ? 2   GLN A HA   1  
ATOM 19    H HB2  . GLN A 1 2   ? 24.417  21.786  12.246  1.00 0.00 ? 2   GLN A HB2  1  
ATOM 20    H HB3  . GLN A 1 2   ? 25.006  20.600  11.039  1.00 0.00 ? 2   GLN A HB3  1  
ATOM 21    H HG2  . GLN A 1 2   ? 23.408  21.767  9.333   1.00 0.00 ? 2   GLN A HG2  1  
ATOM 22    H HG3  . GLN A 1 2   ? 23.096  23.006  10.604  1.00 0.00 ? 2   GLN A HG3  1  
ATOM 23    H HE21 . GLN A 1 2   ? 24.754  24.583  10.950  1.00 0.00 ? 2   GLN A HE21 1  
ATOM 24    H HE22 . GLN A 1 2   ? 26.227  24.620  10.002  1.00 0.00 ? 2   GLN A HE22 1  
ATOM 25    N N    . ARG A 1 3   ? 23.715  18.446  10.355  1.00 0.00 ? 3   ARG A N    1  
ATOM 26    C CA   . ARG A 1 3   ? 23.771  17.430  9.306   1.00 0.00 ? 3   ARG A CA   1  
ATOM 27    C C    . ARG A 1 3   ? 22.965  16.143  9.566   1.00 0.00 ? 3   ARG A C    1  
ATOM 28    O O    . ARG A 1 3   ? 23.470  15.025  9.467   1.00 0.00 ? 3   ARG A O    1  
ATOM 29    C CB   . ARG A 1 3   ? 25.275  17.150  9.010   1.00 0.00 ? 3   ARG A CB   1  
ATOM 30    C CG   . ARG A 1 3   ? 25.669  16.806  7.568   1.00 0.00 ? 3   ARG A CG   1  
ATOM 31    C CD   . ARG A 1 3   ? 25.651  17.953  6.543   1.00 0.00 ? 3   ARG A CD   1  
ATOM 32    N NE   . ARG A 1 3   ? 24.252  18.397  6.202   1.00 0.00 ? 3   ARG A NE   1  
ATOM 33    C CZ   . ARG A 1 3   ? 23.461  17.798  5.258   1.00 0.00 ? 3   ARG A CZ   1  
ATOM 34    N NH1  . ARG A 1 3   ? 23.929  16.769  4.495   1.00 0.00 ? 3   ARG A NH1  1  
ATOM 35    N NH2  . ARG A 1 3   ? 22.180  18.238  5.085   1.00 0.00 ? 3   ARG A NH2  1  
ATOM 36    H H    . ARG A 1 3   ? 24.554  18.521  10.886  1.00 0.00 ? 3   ARG A H    1  
ATOM 37    H HA   . ARG A 1 3   ? 23.328  17.865  8.426   1.00 0.00 ? 3   ARG A HA   1  
ATOM 38    H HB2  . ARG A 1 3   ? 25.864  18.046  9.306   1.00 0.00 ? 3   ARG A HB2  1  
ATOM 39    H HB3  . ARG A 1 3   ? 25.630  16.285  9.607   1.00 0.00 ? 3   ARG A HB3  1  
ATOM 40    H HG2  . ARG A 1 3   ? 26.720  16.431  7.595   1.00 0.00 ? 3   ARG A HG2  1  
ATOM 41    H HG3  . ARG A 1 3   ? 25.044  15.961  7.256   1.00 0.00 ? 3   ARG A HG3  1  
ATOM 42    H HD2  . ARG A 1 3   ? 26.193  18.828  6.960   1.00 0.00 ? 3   ARG A HD2  1  
ATOM 43    H HD3  . ARG A 1 3   ? 26.169  17.601  5.626   1.00 0.00 ? 3   ARG A HD3  1  
ATOM 44    H HE   . ARG A 1 3   ? 23.862  19.148  6.735   1.00 0.00 ? 3   ARG A HE   1  
ATOM 45    H HH11 . ARG A 1 3   ? 24.865  16.440  4.620   1.00 0.00 ? 3   ARG A HH11 1  
ATOM 46    H HH12 . ARG A 1 3   ? 23.334  16.340  3.814   1.00 0.00 ? 3   ARG A HH12 1  
ATOM 47    H HH21 . ARG A 1 3   ? 21.830  18.990  5.643   1.00 0.00 ? 3   ARG A HH21 1  
ATOM 48    H HH22 . ARG A 1 3   ? 21.591  17.806  4.402   1.00 0.00 ? 3   ARG A HH22 1  
ATOM 49    N N    . GLN A 1 4   ? 21.655  16.322  9.899   1.00 0.00 ? 4   GLN A N    1  
ATOM 50    C CA   . GLN A 1 4   ? 20.678  15.292  10.241  1.00 0.00 ? 4   GLN A CA   1  
ATOM 51    C C    . GLN A 1 4   ? 19.929  14.697  9.067   1.00 0.00 ? 4   GLN A C    1  
ATOM 52    O O    . GLN A 1 4   ? 19.389  13.597  9.177   1.00 0.00 ? 4   GLN A O    1  
ATOM 53    C CB   . GLN A 1 4   ? 19.637  15.788  11.286  1.00 0.00 ? 4   GLN A CB   1  
ATOM 54    C CG   . GLN A 1 4   ? 18.825  17.046  10.896  1.00 0.00 ? 4   GLN A CG   1  
ATOM 55    C CD   . GLN A 1 4   ? 17.965  17.510  12.076  1.00 0.00 ? 4   GLN A CD   1  
ATOM 56    O OE1  . GLN A 1 4   ? 16.881  16.962  12.289  1.00 0.00 ? 4   GLN A OE1  1  
ATOM 57    N NE2  . GLN A 1 4   ? 18.407  18.530  12.847  1.00 0.00 ? 4   GLN A NE2  1  
ATOM 58    H H    . GLN A 1 4   ? 21.341  17.273  9.965   1.00 0.00 ? 4   GLN A H    1  
ATOM 59    H HA   . GLN A 1 4   ? 21.194  14.469  10.709  1.00 0.00 ? 4   GLN A HA   1  
ATOM 60    H HB2  . GLN A 1 4   ? 18.920  14.964  11.529  1.00 0.00 ? 4   GLN A HB2  1  
ATOM 61    H HB3  . GLN A 1 4   ? 20.209  16.014  12.213  1.00 0.00 ? 4   GLN A HB3  1  
ATOM 62    H HG2  . GLN A 1 4   ? 19.494  17.868  10.578  1.00 0.00 ? 4   GLN A HG2  1  
ATOM 63    H HG3  . GLN A 1 4   ? 18.117  16.801  10.068  1.00 0.00 ? 4   GLN A HG3  1  
ATOM 64    H HE21 . GLN A 1 4   ? 19.333  18.920  12.763  1.00 0.00 ? 4   GLN A HE21 1  
ATOM 65    H HE22 . GLN A 1 4   ? 17.798  18.839  13.570  1.00 0.00 ? 4   GLN A HE22 1  
ATOM 66    N N    . LEU A 1 5   ? 19.833  15.429  7.920   1.00 0.00 ? 5   LEU A N    1  
ATOM 67    C CA   . LEU A 1 5   ? 19.150  15.061  6.668   1.00 0.00 ? 5   LEU A CA   1  
ATOM 68    C C    . LEU A 1 5   ? 17.620  15.078  6.778   1.00 0.00 ? 5   LEU A C    1  
ATOM 69    O O    . LEU A 1 5   ? 16.926  15.799  6.063   1.00 0.00 ? 5   LEU A O    1  
ATOM 70    C CB   . LEU A 1 5   ? 19.649  13.730  6.004   1.00 0.00 ? 5   LEU A CB   1  
ATOM 71    C CG   . LEU A 1 5   ? 21.062  13.761  5.358   1.00 0.00 ? 5   LEU A CG   1  
ATOM 72    C CD1  . LEU A 1 5   ? 21.109  14.671  4.119   1.00 0.00 ? 5   LEU A CD1  1  
ATOM 73    C CD2  . LEU A 1 5   ? 22.205  14.094  6.335   1.00 0.00 ? 5   LEU A CD2  1  
ATOM 74    H H    . LEU A 1 5   ? 20.283  16.316  7.909   1.00 0.00 ? 5   LEU A H    1  
ATOM 75    H HA   . LEU A 1 5   ? 19.373  15.861  5.977   1.00 0.00 ? 5   LEU A HA   1  
ATOM 76    H HB2  . LEU A 1 5   ? 19.636  12.915  6.759   1.00 0.00 ? 5   LEU A HB2  1  
ATOM 77    H HB3  . LEU A 1 5   ? 18.957  13.426  5.184   1.00 0.00 ? 5   LEU A HB3  1  
ATOM 78    H HG   . LEU A 1 5   ? 21.254  12.720  4.993   1.00 0.00 ? 5   LEU A HG   1  
ATOM 79    H HD11 . LEU A 1 5   ? 20.323  14.383  3.391   1.00 0.00 ? 5   LEU A HD11 1  
ATOM 80    H HD12 . LEU A 1 5   ? 20.960  15.733  4.405   1.00 0.00 ? 5   LEU A HD12 1  
ATOM 81    H HD13 . LEU A 1 5   ? 22.096  14.581  3.616   1.00 0.00 ? 5   LEU A HD13 1  
ATOM 82    H HD21 . LEU A 1 5   ? 22.146  13.451  7.240   1.00 0.00 ? 5   LEU A HD21 1  
ATOM 83    H HD22 . LEU A 1 5   ? 23.188  13.924  5.847   1.00 0.00 ? 5   LEU A HD22 1  
ATOM 84    H HD23 . LEU A 1 5   ? 22.163  15.155  6.657   1.00 0.00 ? 5   LEU A HD23 1  
ATOM 85    N N    . LEU A 1 6   ? 17.078  14.247  7.706   1.00 0.00 ? 6   LEU A N    1  
ATOM 86    C CA   . LEU A 1 6   ? 15.688  14.092  8.106   1.00 0.00 ? 6   LEU A CA   1  
ATOM 87    C C    . LEU A 1 6   ? 14.727  13.487  7.082   1.00 0.00 ? 6   LEU A C    1  
ATOM 88    O O    . LEU A 1 6   ? 14.106  12.458  7.329   1.00 0.00 ? 6   LEU A O    1  
ATOM 89    C CB   . LEU A 1 6   ? 15.156  15.335  8.841   1.00 0.00 ? 6   LEU A CB   1  
ATOM 90    C CG   . LEU A 1 6   ? 13.951  15.079  9.770   1.00 0.00 ? 6   LEU A CG   1  
ATOM 91    C CD1  . LEU A 1 6   ? 14.148  15.710  11.153  1.00 0.00 ? 6   LEU A CD1  1  
ATOM 92    C CD2  . LEU A 1 6   ? 12.687  15.622  9.107   1.00 0.00 ? 6   LEU A CD2  1  
ATOM 93    H H    . LEU A 1 6   ? 17.746  13.724  8.250   1.00 0.00 ? 6   LEU A H    1  
ATOM 94    H HA   . LEU A 1 6   ? 15.690  13.417  8.928   1.00 0.00 ? 6   LEU A HA   1  
ATOM 95    H HB2  . LEU A 1 6   ? 15.983  15.742  9.466   1.00 0.00 ? 6   LEU A HB2  1  
ATOM 96    H HB3  . LEU A 1 6   ? 14.900  16.100  8.095   1.00 0.00 ? 6   LEU A HB3  1  
ATOM 97    H HG   . LEU A 1 6   ? 13.828  13.979  9.920   1.00 0.00 ? 6   LEU A HG   1  
ATOM 98    H HD11 . LEU A 1 6   ? 15.056  15.297  11.643  1.00 0.00 ? 6   LEU A HD11 1  
ATOM 99    H HD12 . LEU A 1 6   ? 14.268  16.812  11.072  1.00 0.00 ? 6   LEU A HD12 1  
ATOM 100   H HD13 . LEU A 1 6   ? 13.274  15.502  11.805  1.00 0.00 ? 6   LEU A HD13 1  
ATOM 101   H HD21 . LEU A 1 6   ? 12.611  15.190  8.091   1.00 0.00 ? 6   LEU A HD21 1  
ATOM 102   H HD22 . LEU A 1 6   ? 11.784  15.367  9.696   1.00 0.00 ? 6   LEU A HD22 1  
ATOM 103   H HD23 . LEU A 1 6   ? 12.786  16.725  9.018   1.00 0.00 ? 6   LEU A HD23 1  
ATOM 104   N N    . LEU A 1 7   ? 14.557  14.152  5.909   1.00 0.00 ? 7   LEU A N    1  
ATOM 105   C CA   . LEU A 1 7   ? 13.717  13.817  4.750   1.00 0.00 ? 7   LEU A CA   1  
ATOM 106   C C    . LEU A 1 7   ? 12.219  13.911  4.907   1.00 0.00 ? 7   LEU A C    1  
ATOM 107   O O    . LEU A 1 7   ? 11.538  14.267  3.949   1.00 0.00 ? 7   LEU A O    1  
ATOM 108   C CB   . LEU A 1 7   ? 14.143  12.516  4.007   1.00 0.00 ? 7   LEU A CB   1  
ATOM 109   C CG   . LEU A 1 7   ? 15.596  12.546  3.476   1.00 0.00 ? 7   LEU A CG   1  
ATOM 110   C CD1  . LEU A 1 7   ? 16.039  11.149  3.012   1.00 0.00 ? 7   LEU A CD1  1  
ATOM 111   C CD2  . LEU A 1 7   ? 15.782  13.568  2.341   1.00 0.00 ? 7   LEU A CD2  1  
ATOM 112   H H    . LEU A 1 7   ? 15.124  14.976  5.806   1.00 0.00 ? 7   LEU A H    1  
ATOM 113   H HA   . LEU A 1 7   ? 13.829  14.673  4.106   1.00 0.00 ? 7   LEU A HA   1  
ATOM 114   H HB2  . LEU A 1 7   ? 14.046  11.657  4.709   1.00 0.00 ? 7   LEU A HB2  1  
ATOM 115   H HB3  . LEU A 1 7   ? 13.478  12.317  3.135   1.00 0.00 ? 7   LEU A HB3  1  
ATOM 116   H HG   . LEU A 1 7   ? 16.266  12.840  4.318   1.00 0.00 ? 7   LEU A HG   1  
ATOM 117   H HD11 . LEU A 1 7   ? 15.953  10.422  3.848   1.00 0.00 ? 7   LEU A HD11 1  
ATOM 118   H HD12 . LEU A 1 7   ? 15.397  10.801  2.174   1.00 0.00 ? 7   LEU A HD12 1  
ATOM 119   H HD13 . LEU A 1 7   ? 17.096  11.174  2.671   1.00 0.00 ? 7   LEU A HD13 1  
ATOM 120   H HD21 . LEU A 1 7   ? 15.119  13.320  1.485   1.00 0.00 ? 7   LEU A HD21 1  
ATOM 121   H HD22 . LEU A 1 7   ? 15.546  14.595  2.689   1.00 0.00 ? 7   LEU A HD22 1  
ATOM 122   H HD23 . LEU A 1 7   ? 16.836  13.558  1.988   1.00 0.00 ? 7   LEU A HD23 1  
ATOM 123   N N    . ALA A 1 8   ? 11.701  13.640  6.129   1.00 0.00 ? 8   ALA A N    1  
ATOM 124   C CA   . ALA A 1 8   ? 10.339  13.889  6.567   1.00 0.00 ? 8   ALA A CA   1  
ATOM 125   C C    . ALA A 1 8   ? 9.286   12.845  6.179   1.00 0.00 ? 8   ALA A C    1  
ATOM 126   O O    . ALA A 1 8   ? 8.085   13.069  6.294   1.00 0.00 ? 8   ALA A O    1  
ATOM 127   C CB   . ALA A 1 8   ? 9.937   15.342  6.189   1.00 0.00 ? 8   ALA A CB   1  
ATOM 128   H H    . ALA A 1 8   ? 12.354  13.343  6.831   1.00 0.00 ? 8   ALA A H    1  
ATOM 129   H HA   . ALA A 1 8   ? 10.394  13.864  7.646   1.00 0.00 ? 8   ALA A HA   1  
ATOM 130   H HB1  . ALA A 1 8   ? 10.816  16.003  6.378   1.00 0.00 ? 8   ALA A HB1  1  
ATOM 131   H HB2  . ALA A 1 8   ? 9.053   15.697  6.755   1.00 0.00 ? 8   ALA A HB2  1  
ATOM 132   H HB3  . ALA A 1 8   ? 9.742   15.414  5.096   1.00 0.00 ? 8   ALA A HB3  1  
ATOM 133   N N    . SER A 1 9   ? 9.728   11.641  5.725   1.00 0.00 ? 9   SER A N    1  
ATOM 134   C CA   . SER A 1 9   ? 8.909   10.518  5.241   1.00 0.00 ? 9   SER A CA   1  
ATOM 135   C C    . SER A 1 9   ? 8.398   9.583   6.351   1.00 0.00 ? 9   SER A C    1  
ATOM 136   O O    . SER A 1 9   ? 8.608   8.370   6.313   1.00 0.00 ? 9   SER A O    1  
ATOM 137   C CB   . SER A 1 9   ? 9.715   9.724   4.160   1.00 0.00 ? 9   SER A CB   1  
ATOM 138   O OG   . SER A 1 9   ? 8.935   8.769   3.440   1.00 0.00 ? 9   SER A OG   1  
ATOM 139   H H    . SER A 1 9   ? 10.715  11.519  5.670   1.00 0.00 ? 9   SER A H    1  
ATOM 140   H HA   . SER A 1 9   ? 8.034   10.919  4.744   1.00 0.00 ? 9   SER A HA   1  
ATOM 141   H HB2  . SER A 1 9   ? 10.097  10.458  3.415   1.00 0.00 ? 9   SER A HB2  1  
ATOM 142   H HB3  . SER A 1 9   ? 10.596  9.220   4.616   1.00 0.00 ? 9   SER A HB3  1  
ATOM 143   H HG   . SER A 1 9   ? 8.647   8.120   4.097   1.00 0.00 ? 9   SER A HG   1  
ATOM 144   N N    . GLU A 1 10  ? 7.708   10.166  7.358   1.00 0.00 ? 10  GLU A N    1  
ATOM 145   C CA   . GLU A 1 10  ? 7.168   9.504   8.536   1.00 0.00 ? 10  GLU A CA   1  
ATOM 146   C C    . GLU A 1 10  ? 5.662   9.631   8.607   1.00 0.00 ? 10  GLU A C    1  
ATOM 147   O O    . GLU A 1 10  ? 5.014   10.126  7.687   1.00 0.00 ? 10  GLU A O    1  
ATOM 148   C CB   . GLU A 1 10  ? 7.779   10.126  9.828   1.00 0.00 ? 10  GLU A CB   1  
ATOM 149   C CG   . GLU A 1 10  ? 7.556   11.646  10.008  1.00 0.00 ? 10  GLU A CG   1  
ATOM 150   C CD   . GLU A 1 10  ? 8.326   12.135  11.234  1.00 0.00 ? 10  GLU A CD   1  
ATOM 151   O OE1  . GLU A 1 10  ? 9.258   12.965  11.058  1.00 0.00 ? 10  GLU A OE1  1  
ATOM 152   O OE2  . GLU A 1 10  ? 7.991   11.685  12.362  1.00 0.00 ? 10  GLU A OE2  1  
ATOM 153   H H    . GLU A 1 10  ? 7.563   11.156  7.309   1.00 0.00 ? 10  GLU A H    1  
ATOM 154   H HA   . GLU A 1 10  ? 7.397   8.445   8.516   1.00 0.00 ? 10  GLU A HA   1  
ATOM 155   H HB2  . GLU A 1 10  ? 7.450   9.575   10.739  1.00 0.00 ? 10  GLU A HB2  1  
ATOM 156   H HB3  . GLU A 1 10  ? 8.870   9.979   9.743   1.00 0.00 ? 10  GLU A HB3  1  
ATOM 157   H HG2  . GLU A 1 10  ? 7.915   12.188  9.108   1.00 0.00 ? 10  GLU A HG2  1  
ATOM 158   H HG3  . GLU A 1 10  ? 6.479   11.876  10.149  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 159   N N    . ASN A 1 11  ? 5.098   9.208   9.773   1.00 0.00 ? 11  ASN A N    1  
ATOM 160   C CA   . ASN A 1 11  ? 3.706   9.301   10.214  1.00 0.00 ? 11  ASN A CA   1  
ATOM 161   C C    . ASN A 1 11  ? 2.650   8.539   9.383   1.00 0.00 ? 11  ASN A C    1  
ATOM 162   O O    . ASN A 1 11  ? 1.823   9.159   8.719   1.00 0.00 ? 11  ASN A O    1  
ATOM 163   C CB   . ASN A 1 11  ? 3.335   10.796  10.456  1.00 0.00 ? 11  ASN A CB   1  
ATOM 164   C CG   . ASN A 1 11  ? 3.978   11.327  11.742  1.00 0.00 ? 11  ASN A CG   1  
ATOM 165   O OD1  . ASN A 1 11  ? 4.837   10.680  12.345  1.00 0.00 ? 11  ASN A OD1  1  
ATOM 166   N ND2  . ASN A 1 11  ? 3.512   12.523  12.190  1.00 0.00 ? 11  ASN A ND2  1  
ATOM 167   H H    . ASN A 1 11  ? 5.676   8.840   10.493  1.00 0.00 ? 11  ASN A H    1  
ATOM 168   H HA   . ASN A 1 11  ? 3.673   8.828   11.186  1.00 0.00 ? 11  ASN A HA   1  
ATOM 169   H HB2  . ASN A 1 11  ? 3.756   11.395  9.616   1.00 0.00 ? 11  ASN A HB2  1  
ATOM 170   H HB3  . ASN A 1 11  ? 2.237   10.938  10.540  1.00 0.00 ? 11  ASN A HB3  1  
ATOM 171   H HD21 . ASN A 1 11  ? 2.738   12.948  11.722  1.00 0.00 ? 11  ASN A HD21 1  
ATOM 172   H HD22 . ASN A 1 11  ? 3.879   12.873  13.048  1.00 0.00 ? 11  ASN A HD22 1  
ATOM 173   N N    . PRO A 1 12  ? 2.617   7.188   9.400   1.00 0.00 ? 12  PRO A N    1  
ATOM 174   C CA   . PRO A 1 12  ? 1.709   6.351   8.594   1.00 0.00 ? 12  PRO A CA   1  
ATOM 175   C C    . PRO A 1 12  ? 0.271   6.210   9.144   1.00 0.00 ? 12  PRO A C    1  
ATOM 176   O O    . PRO A 1 12  ? -0.626  5.833   8.388   1.00 0.00 ? 12  PRO A O    1  
ATOM 177   C CB   . PRO A 1 12  ? 2.450   5.003   8.564   1.00 0.00 ? 12  PRO A CB   1  
ATOM 178   C CG   . PRO A 1 12  ? 3.208   4.939   9.896   1.00 0.00 ? 12  PRO A CG   1  
ATOM 179   C CD   . PRO A 1 12  ? 3.607   6.391   10.132  1.00 0.00 ? 12  PRO A CD   1  
ATOM 180   H HA   . PRO A 1 12  ? 1.619   6.750   7.592   1.00 0.00 ? 12  PRO A HA   1  
ATOM 181   H HB2  . PRO A 1 12  ? 1.782   4.114   8.439   1.00 0.00 ? 12  PRO A HB2  1  
ATOM 182   H HB3  . PRO A 1 12  ? 3.209   5.039   7.738   1.00 0.00 ? 12  PRO A HB3  1  
ATOM 183   H HG2  . PRO A 1 12  ? 2.520   4.591   10.697  1.00 0.00 ? 12  PRO A HG2  1  
ATOM 184   H HG3  . PRO A 1 12  ? 4.089   4.267   9.844   1.00 0.00 ? 12  PRO A HG3  1  
ATOM 185   H HD2  . PRO A 1 12  ? 3.610   6.631   11.219  1.00 0.00 ? 12  PRO A HD2  1  
ATOM 186   H HD3  . PRO A 1 12  ? 4.626   6.566   9.708   1.00 0.00 ? 12  PRO A HD3  1  
ATOM 187   N N    . GLN A 1 13  ? 0.005   6.530   10.439  1.00 0.00 ? 13  GLN A N    1  
ATOM 188   C CA   . GLN A 1 13  ? -1.285  6.459   11.110  1.00 0.00 ? 13  GLN A CA   1  
ATOM 189   C C    . GLN A 1 13  ? -2.265  7.601   10.821  1.00 0.00 ? 13  GLN A C    1  
ATOM 190   O O    . GLN A 1 13  ? -3.352  7.660   11.389  1.00 0.00 ? 13  GLN A O    1  
ATOM 191   C CB   . GLN A 1 13  ? -1.078  6.275   12.636  1.00 0.00 ? 13  GLN A CB   1  
ATOM 192   C CG   . GLN A 1 13  ? -0.237  7.386   13.294  1.00 0.00 ? 13  GLN A CG   1  
ATOM 193   C CD   . GLN A 1 13  ? -0.149  7.182   14.804  1.00 0.00 ? 13  GLN A CD   1  
ATOM 194   O OE1  . GLN A 1 13  ? 0.902   6.901   15.383  1.00 0.00 ? 13  GLN A OE1  1  
ATOM 195   N NE2  . GLN A 1 13  ? -1.310  7.335   15.493  1.00 0.00 ? 13  GLN A NE2  1  
ATOM 196   H H    . GLN A 1 13  ? 0.748   6.825   11.026  1.00 0.00 ? 13  GLN A H    1  
ATOM 197   H HA   . GLN A 1 13  ? -1.775  5.572   10.761  1.00 0.00 ? 13  GLN A HA   1  
ATOM 198   H HB2  . GLN A 1 13  ? -2.070  6.191   13.137  1.00 0.00 ? 13  GLN A HB2  1  
ATOM 199   H HB3  . GLN A 1 13  ? -0.554  5.302   12.788  1.00 0.00 ? 13  GLN A HB3  1  
ATOM 200   H HG2  . GLN A 1 13  ? 0.795   7.374   12.892  1.00 0.00 ? 13  GLN A HG2  1  
ATOM 201   H HG3  . GLN A 1 13  ? -0.682  8.384   13.097  1.00 0.00 ? 13  GLN A HG3  1  
ATOM 202   H HE21 . GLN A 1 13  ? -2.165  7.464   14.995  1.00 0.00 ? 13  GLN A HE21 1  
ATOM 203   H HE22 . GLN A 1 13  ? -1.262  7.302   16.490  1.00 0.00 ? 13  GLN A HE22 1  
ATOM 204   N N    . GLN A 1 14  ? -1.876  8.530   9.911   1.00 0.00 ? 14  GLN A N    1  
ATOM 205   C CA   . GLN A 1 14  ? -2.649  9.683   9.469   1.00 0.00 ? 14  GLN A CA   1  
ATOM 206   C C    . GLN A 1 14  ? -3.067  9.568   8.002   1.00 0.00 ? 14  GLN A C    1  
ATOM 207   O O    . GLN A 1 14  ? -3.821  10.396  7.503   1.00 0.00 ? 14  GLN A O    1  
ATOM 208   C CB   . GLN A 1 14  ? -1.878  11.009  9.741   1.00 0.00 ? 14  GLN A CB   1  
ATOM 209   C CG   . GLN A 1 14  ? -0.709  11.300  8.770   1.00 0.00 ? 14  GLN A CG   1  
ATOM 210   C CD   . GLN A 1 14  ? 0.303   12.297  9.339   1.00 0.00 ? 14  GLN A CD   1  
ATOM 211   O OE1  . GLN A 1 14  ? 0.352   12.614  10.529  1.00 0.00 ? 14  GLN A OE1  1  
ATOM 212   N NE2  . GLN A 1 14  ? 1.201   12.774  8.437   1.00 0.00 ? 14  GLN A NE2  1  
ATOM 213   H H    . GLN A 1 14  ? -0.964  8.450   9.517   1.00 0.00 ? 14  GLN A H    1  
ATOM 214   H HA   . GLN A 1 14  ? -3.571  9.746   10.035  1.00 0.00 ? 14  GLN A HA   1  
ATOM 215   H HB2  . GLN A 1 14  ? -2.584  11.870  9.711   1.00 0.00 ? 14  GLN A HB2  1  
ATOM 216   H HB3  . GLN A 1 14  ? -1.485  10.943  10.782  1.00 0.00 ? 14  GLN A HB3  1  
ATOM 217   H HG2  . GLN A 1 14  ? -0.169  10.362  8.535   1.00 0.00 ? 14  GLN A HG2  1  
ATOM 218   H HG3  . GLN A 1 14  ? -1.114  11.703  7.817   1.00 0.00 ? 14  GLN A HG3  1  
ATOM 219   H HE21 . GLN A 1 14  ? 1.256   12.363  7.528   1.00 0.00 ? 14  GLN A HE21 1  
ATOM 220   H HE22 . GLN A 1 14  ? 1.883   13.432  8.745   1.00 0.00 ? 14  GLN A HE22 1  
ATOM 221   N N    . PHE A 1 15  ? -2.591  8.534   7.254   1.00 0.00 ? 15  PHE A N    1  
ATOM 222   C CA   . PHE A 1 15  ? -2.909  8.302   5.850   1.00 0.00 ? 15  PHE A CA   1  
ATOM 223   C C    . PHE A 1 15  ? -3.813  7.073   5.712   1.00 0.00 ? 15  PHE A C    1  
ATOM 224   O O    . PHE A 1 15  ? -3.946  6.501   4.626   1.00 0.00 ? 15  PHE A O    1  
ATOM 225   C CB   . PHE A 1 15  ? -1.635  8.174   4.959   1.00 0.00 ? 15  PHE A CB   1  
ATOM 226   C CG   . PHE A 1 15  ? -0.704  9.360   5.114   1.00 0.00 ? 15  PHE A CG   1  
ATOM 227   C CD1  . PHE A 1 15  ? -1.075  10.632  4.702   1.00 0.00 ? 15  PHE A CD1  1  
ATOM 228   C CD2  . PHE A 1 15  ? 0.570   9.188   5.637   1.00 0.00 ? 15  PHE A CD2  1  
ATOM 229   C CE1  . PHE A 1 15  ? -0.199  11.695  4.804   1.00 0.00 ? 15  PHE A CE1  1  
ATOM 230   C CE2  . PHE A 1 15  ? 1.450   10.248  5.738   1.00 0.00 ? 15  PHE A CE2  1  
ATOM 231   C CZ   . PHE A 1 15  ? 1.066   11.506  5.319   1.00 0.00 ? 15  PHE A CZ   1  
ATOM 232   H H    . PHE A 1 15  ? -1.963  7.873   7.655   1.00 0.00 ? 15  PHE A H    1  
ATOM 233   H HA   . PHE A 1 15  ? -3.482  9.131   5.451   1.00 0.00 ? 15  PHE A HA   1  
ATOM 234   H HB2  . PHE A 1 15  ? -1.068  7.252   5.203   1.00 0.00 ? 15  PHE A HB2  1  
ATOM 235   H HB3  . PHE A 1 15  ? -1.918  8.119   3.884   1.00 0.00 ? 15  PHE A HB3  1  
ATOM 236   H HD1  . PHE A 1 15  ? -2.054  10.800  4.276   1.00 0.00 ? 15  PHE A HD1  1  
ATOM 237   H HD2  . PHE A 1 15  ? 0.885   8.204   5.957   1.00 0.00 ? 15  PHE A HD2  1  
ATOM 238   H HE1  . PHE A 1 15  ? -0.503  12.677  4.465   1.00 0.00 ? 15  PHE A HE1  1  
ATOM 239   H HE2  . PHE A 1 15  ? 2.445   10.092  6.142   1.00 0.00 ? 15  PHE A HE2  1  
ATOM 240   H HZ   . PHE A 1 15  ? 1.756   12.337  5.378   1.00 0.00 ? 15  PHE A HZ   1  
ATOM 241   N N    . MET A 1 16  ? -4.516  6.682   6.831   1.00 0.00 ? 16  MET A N    1  
ATOM 242   C CA   . MET A 1 16  ? -5.481  5.571   6.971   1.00 0.00 ? 16  MET A CA   1  
ATOM 243   C C    . MET A 1 16  ? -6.719  5.722   6.087   1.00 0.00 ? 16  MET A C    1  
ATOM 244   O O    . MET A 1 16  ? -7.263  4.753   5.570   1.00 0.00 ? 16  MET A O    1  
ATOM 245   C CB   . MET A 1 16  ? -5.903  5.362   8.456   1.00 0.00 ? 16  MET A CB   1  
ATOM 246   C CG   . MET A 1 16  ? -6.885  4.198   8.797   1.00 0.00 ? 16  MET A CG   1  
ATOM 247   S SD   . MET A 1 16  ? -6.259  2.487   8.686   1.00 0.00 ? 16  MET A SD   1  
ATOM 248   C CE   . MET A 1 16  ? -7.841  1.597   8.975   1.00 0.00 ? 16  MET A CE   1  
ATOM 249   H H    . MET A 1 16  ? -4.355  7.196   7.673   1.00 0.00 ? 16  MET A H    1  
ATOM 250   H HA   . MET A 1 16  ? -4.986  4.666   6.648   1.00 0.00 ? 16  MET A HA   1  
ATOM 251   H HB2  . MET A 1 16  ? -4.979  5.200   9.055   1.00 0.00 ? 16  MET A HB2  1  
ATOM 252   H HB3  . MET A 1 16  ? -6.363  6.304   8.834   1.00 0.00 ? 16  MET A HB3  1  
ATOM 253   H HG2  . MET A 1 16  ? -7.178  4.362   9.854   1.00 0.00 ? 16  MET A HG2  1  
ATOM 254   H HG3  . MET A 1 16  ? -7.801  4.285   8.181   1.00 0.00 ? 16  MET A HG3  1  
ATOM 255   H HE1  . MET A 1 16  ? -8.703  2.277   9.132   1.00 0.00 ? 16  MET A HE1  1  
ATOM 256   H HE2  . MET A 1 16  ? -8.107  0.921   8.125   1.00 0.00 ? 16  MET A HE2  1  
ATOM 257   H HE3  . MET A 1 16  ? -7.783  0.903   9.844   1.00 0.00 ? 16  MET A HE3  1  
ATOM 258   N N    . ASP A 1 17  ? -7.163  6.976   5.799   1.00 0.00 ? 17  ASP A N    1  
ATOM 259   C CA   . ASP A 1 17  ? -8.251  7.311   4.872   1.00 0.00 ? 17  ASP A CA   1  
ATOM 260   C C    . ASP A 1 17  ? -7.907  6.931   3.421   1.00 0.00 ? 17  ASP A C    1  
ATOM 261   O O    . ASP A 1 17  ? -8.646  6.204   2.770   1.00 0.00 ? 17  ASP A O    1  
ATOM 262   C CB   . ASP A 1 17  ? -8.626  8.823   4.997   1.00 0.00 ? 17  ASP A CB   1  
ATOM 263   C CG   . ASP A 1 17  ? -9.949  9.188   4.306   1.00 0.00 ? 17  ASP A CG   1  
ATOM 264   O OD1  . ASP A 1 17  ? -11.000 8.615   4.699   1.00 0.00 ? 17  ASP A OD1  1  
ATOM 265   O OD2  . ASP A 1 17  ? -9.918  10.042  3.380   1.00 0.00 ? 17  ASP A OD2  1  
ATOM 266   H H    . ASP A 1 17  ? -6.704  7.755   6.218   1.00 0.00 ? 17  ASP A H    1  
ATOM 267   H HA   . ASP A 1 17  ? -9.114  6.723   5.157   1.00 0.00 ? 17  ASP A HA   1  
ATOM 268   H HB2  . ASP A 1 17  ? -8.741  9.058   6.078   1.00 0.00 ? 17  ASP A HB2  1  
ATOM 269   H HB3  . ASP A 1 17  ? -7.803  9.461   4.610   1.00 0.00 ? 17  ASP A HB3  1  
ATOM 270   N N    . TYR A 1 18  ? -6.734  7.387   2.909   1.00 0.00 ? 18  TYR A N    1  
ATOM 271   C CA   . TYR A 1 18  ? -6.188  7.029   1.603   1.00 0.00 ? 18  TYR A CA   1  
ATOM 272   C C    . TYR A 1 18  ? -5.654  5.596   1.432   1.00 0.00 ? 18  TYR A C    1  
ATOM 273   O O    . TYR A 1 18  ? -6.055  4.874   0.513   1.00 0.00 ? 18  TYR A O    1  
ATOM 274   C CB   . TYR A 1 18  ? -5.090  8.091   1.267   1.00 0.00 ? 18  TYR A CB   1  
ATOM 275   C CG   . TYR A 1 18  ? -4.434  7.961   -0.091  1.00 0.00 ? 18  TYR A CG   1  
ATOM 276   C CD1  . TYR A 1 18  ? -3.057  7.853   -0.182  1.00 0.00 ? 18  TYR A CD1  1  
ATOM 277   C CD2  . TYR A 1 18  ? -5.195  7.891   -1.245  1.00 0.00 ? 18  TYR A CD2  1  
ATOM 278   C CE1  . TYR A 1 18  ? -2.455  7.655   -1.410  1.00 0.00 ? 18  TYR A CE1  1  
ATOM 279   C CE2  . TYR A 1 18  ? -4.594  7.673   -2.469  1.00 0.00 ? 18  TYR A CE2  1  
ATOM 280   C CZ   . TYR A 1 18  ? -3.226  7.542   -2.550  1.00 0.00 ? 18  TYR A CZ   1  
ATOM 281   O OH   . TYR A 1 18  ? -2.629  7.273   -3.799  1.00 0.00 ? 18  TYR A OH   1  
ATOM 282   H H    . TYR A 1 18  ? -6.144  7.962   3.467   1.00 0.00 ? 18  TYR A H    1  
ATOM 283   H HA   . TYR A 1 18  ? -6.995  7.094   0.890   1.00 0.00 ? 18  TYR A HA   1  
ATOM 284   H HB2  . TYR A 1 18  ? -5.576  9.097   1.281   1.00 0.00 ? 18  TYR A HB2  1  
ATOM 285   H HB3  . TYR A 1 18  ? -4.291  8.047   2.050   1.00 0.00 ? 18  TYR A HB3  1  
ATOM 286   H HD1  . TYR A 1 18  ? -2.454  7.875   0.723   1.00 0.00 ? 18  TYR A HD1  1  
ATOM 287   H HD2  . TYR A 1 18  ? -6.273  7.968   -1.189  1.00 0.00 ? 18  TYR A HD2  1  
ATOM 288   H HE1  . TYR A 1 18  ? -1.379  7.569   -1.466  1.00 0.00 ? 18  TYR A HE1  1  
ATOM 289   H HE2  . TYR A 1 18  ? -5.195  7.594   -3.367  1.00 0.00 ? 18  TYR A HE2  1  
ATOM 290   H HH   . TYR A 1 18  ? -1.690  7.146   -3.653  1.00 0.00 ? 18  TYR A HH   1  
ATOM 291   N N    . PHE A 1 19  ? -4.732  5.146   2.330   1.00 0.00 ? 19  PHE A N    1  
ATOM 292   C CA   . PHE A 1 19  ? -4.072  3.843   2.269   1.00 0.00 ? 19  PHE A CA   1  
ATOM 293   C C    . PHE A 1 19  ? -4.974  2.691   2.659   1.00 0.00 ? 19  PHE A C    1  
ATOM 294   O O    . PHE A 1 19  ? -4.925  1.648   2.019   1.00 0.00 ? 19  PHE A O    1  
ATOM 295   C CB   . PHE A 1 19  ? -2.692  3.848   2.994   1.00 0.00 ? 19  PHE A CB   1  
ATOM 296   C CG   . PHE A 1 19  ? -1.651  4.701   2.281   1.00 0.00 ? 19  PHE A CG   1  
ATOM 297   C CD1  . PHE A 1 19  ? -1.520  4.765   0.897   1.00 0.00 ? 19  PHE A CD1  1  
ATOM 298   C CD2  . PHE A 1 19  ? -0.713  5.382   3.039   1.00 0.00 ? 19  PHE A CD2  1  
ATOM 299   C CE1  . PHE A 1 19  ? -0.477  5.458   0.315   1.00 0.00 ? 19  PHE A CE1  1  
ATOM 300   C CE2  . PHE A 1 19  ? 0.333   6.077   2.462   1.00 0.00 ? 19  PHE A CE2  1  
ATOM 301   C CZ   . PHE A 1 19  ? 0.451   6.118   1.089   1.00 0.00 ? 19  PHE A CZ   1  
ATOM 302   H H    . PHE A 1 19  ? -4.410  5.726   3.095   1.00 0.00 ? 19  PHE A H    1  
ATOM 303   H HA   . PHE A 1 19  ? -3.873  3.610   1.227   1.00 0.00 ? 19  PHE A HA   1  
ATOM 304   H HB2  . PHE A 1 19  ? -2.821  4.236   4.029   1.00 0.00 ? 19  PHE A HB2  1  
ATOM 305   H HB3  . PHE A 1 19  ? -2.241  2.835   3.070   1.00 0.00 ? 19  PHE A HB3  1  
ATOM 306   H HD1  . PHE A 1 19  ? -2.207  4.254   0.239   1.00 0.00 ? 19  PHE A HD1  1  
ATOM 307   H HD2  . PHE A 1 19  ? -0.789  5.346   4.115   1.00 0.00 ? 19  PHE A HD2  1  
ATOM 308   H HE1  . PHE A 1 19  ? -0.384  5.485   -0.763  1.00 0.00 ? 19  PHE A HE1  1  
ATOM 309   H HE2  . PHE A 1 19  ? 1.068   6.579   3.079   1.00 0.00 ? 19  PHE A HE2  1  
ATOM 310   H HZ   . PHE A 1 19  ? 1.270   6.651   0.620   1.00 0.00 ? 19  PHE A HZ   1  
ATOM 311   N N    . SER A 1 20  ? -5.910  2.875   3.648   1.00 0.00 ? 20  SER A N    1  
ATOM 312   C CA   . SER A 1 20  ? -6.923  1.845   3.976   1.00 0.00 ? 20  SER A CA   1  
ATOM 313   C C    . SER A 1 20  ? -8.006  1.719   2.922   1.00 0.00 ? 20  SER A C    1  
ATOM 314   O O    . SER A 1 20  ? -8.524  0.620   2.745   1.00 0.00 ? 20  SER A O    1  
ATOM 315   C CB   . SER A 1 20  ? -7.582  1.867   5.380   1.00 0.00 ? 20  SER A CB   1  
ATOM 316   O OG   . SER A 1 20  ? -8.180  0.610   5.718   1.00 0.00 ? 20  SER A OG   1  
ATOM 317   H H    . SER A 1 20  ? -5.980  3.759   4.124   1.00 0.00 ? 20  SER A H    1  
ATOM 318   H HA   . SER A 1 20  ? -6.401  0.893   3.970   1.00 0.00 ? 20  SER A HA   1  
ATOM 319   H HB2  . SER A 1 20  ? -6.764  2.062   6.113   1.00 0.00 ? 20  SER A HB2  1  
ATOM 320   H HB3  . SER A 1 20  ? -8.357  2.670   5.460   1.00 0.00 ? 20  SER A HB3  1  
ATOM 321   H HG   . SER A 1 20  ? -8.684  0.322   4.941   1.00 0.00 ? 20  SER A HG   1  
ATOM 322   N N    . GLU A 1 21  ? -8.360  2.826   2.194   1.00 0.00 ? 21  GLU A N    1  
ATOM 323   C CA   . GLU A 1 21  ? -9.276  2.787   1.050   1.00 0.00 ? 21  GLU A CA   1  
ATOM 324   C C    . GLU A 1 21  ? -8.664  2.099   -0.171  1.00 0.00 ? 21  GLU A C    1  
ATOM 325   O O    . GLU A 1 21  ? -9.233  1.138   -0.664  1.00 0.00 ? 21  GLU A O    1  
ATOM 326   C CB   . GLU A 1 21  ? -9.762  4.207   0.678   1.00 0.00 ? 21  GLU A CB   1  
ATOM 327   C CG   . GLU A 1 21  ? -10.838 4.284   -0.424  1.00 0.00 ? 21  GLU A CG   1  
ATOM 328   C CD   . GLU A 1 21  ? -11.264 5.740   -0.613  1.00 0.00 ? 21  GLU A CD   1  
ATOM 329   O OE1  . GLU A 1 21  ? -11.055 6.280   -1.732  1.00 0.00 ? 21  GLU A OE1  1  
ATOM 330   O OE2  . GLU A 1 21  ? -11.803 6.332   0.361   1.00 0.00 ? 21  GLU A OE2  1  
ATOM 331   H H    . GLU A 1 21  ? -7.936  3.714   2.377   1.00 0.00 ? 21  GLU A H    1  
ATOM 332   H HA   . GLU A 1 21  ? -10.152 2.207   1.320   1.00 0.00 ? 21  GLU A HA   1  
ATOM 333   H HB2  . GLU A 1 21  ? -10.201 4.642   1.606   1.00 0.00 ? 21  GLU A HB2  1  
ATOM 334   H HB3  . GLU A 1 21  ? -8.894  4.847   0.404   1.00 0.00 ? 21  GLU A HB3  1  
ATOM 335   H HG2  . GLU A 1 21  ? -10.444 3.893   -1.386  1.00 0.00 ? 21  GLU A HG2  1  
ATOM 336   H HG3  . GLU A 1 21  ? -11.721 3.678   -0.131  1.00 0.00 ? 21  GLU A HG3  1  
ATOM 337   N N    . GLU A 1 22  ? -7.425  2.478   -0.616  1.00 0.00 ? 22  GLU A N    1  
ATOM 338   C CA   . GLU A 1 22  ? -6.686  1.841   -1.718  1.00 0.00 ? 22  GLU A CA   1  
ATOM 339   C C    . GLU A 1 22  ? -6.243  0.415   -1.422  1.00 0.00 ? 22  GLU A C    1  
ATOM 340   O O    . GLU A 1 22  ? -6.351  -0.466  -2.276  1.00 0.00 ? 22  GLU A O    1  
ATOM 341   C CB   . GLU A 1 22  ? -5.443  2.682   -2.097  1.00 0.00 ? 22  GLU A CB   1  
ATOM 342   C CG   . GLU A 1 22  ? -5.777  3.964   -2.882  1.00 0.00 ? 22  GLU A CG   1  
ATOM 343   C CD   . GLU A 1 22  ? -6.349  3.607   -4.254  1.00 0.00 ? 22  GLU A CD   1  
ATOM 344   O OE1  . GLU A 1 22  ? -5.618  2.962   -5.053  1.00 0.00 ? 22  GLU A OE1  1  
ATOM 345   O OE2  . GLU A 1 22  ? -7.525  3.974   -4.521  1.00 0.00 ? 22  GLU A OE2  1  
ATOM 346   H H    . GLU A 1 22  ? -6.955  3.256   -0.186  1.00 0.00 ? 22  GLU A H    1  
ATOM 347   H HA   . GLU A 1 22  ? -7.354  1.755   -2.568  1.00 0.00 ? 22  GLU A HA   1  
ATOM 348   H HB2  . GLU A 1 22  ? -4.979  2.993   -1.140  1.00 0.00 ? 22  GLU A HB2  1  
ATOM 349   H HB3  . GLU A 1 22  ? -4.675  2.102   -2.661  1.00 0.00 ? 22  GLU A HB3  1  
ATOM 350   H HG2  . GLU A 1 22  ? -6.509  4.575   -2.312  1.00 0.00 ? 22  GLU A HG2  1  
ATOM 351   H HG3  . GLU A 1 22  ? -4.852  4.565   -3.020  1.00 0.00 ? 22  GLU A HG3  1  
ATOM 352   N N    . PHE A 1 23  ? -5.792  0.140   -0.156  1.00 0.00 ? 23  PHE A N    1  
ATOM 353   C CA   . PHE A 1 23  ? -5.473  -1.206  0.302   1.00 0.00 ? 23  PHE A CA   1  
ATOM 354   C C    . PHE A 1 23  ? -6.720  -2.062  0.490   1.00 0.00 ? 23  PHE A C    1  
ATOM 355   O O    . PHE A 1 23  ? -6.770  -3.099  -0.136  1.00 0.00 ? 23  PHE A O    1  
ATOM 356   C CB   . PHE A 1 23  ? -4.647  -1.184  1.633   1.00 0.00 ? 23  PHE A CB   1  
ATOM 357   C CG   . PHE A 1 23  ? -4.252  -2.521  2.213   1.00 0.00 ? 23  PHE A CG   1  
ATOM 358   C CD1  . PHE A 1 23  ? -3.717  -3.503  1.410   1.00 0.00 ? 23  PHE A CD1  1  
ATOM 359   C CD2  . PHE A 1 23  ? -4.459  -2.797  3.552   1.00 0.00 ? 23  PHE A CD2  1  
ATOM 360   C CE1  . PHE A 1 23  ? -3.402  -4.739  1.917   1.00 0.00 ? 23  PHE A CE1  1  
ATOM 361   C CE2  . PHE A 1 23  ? -4.083  -4.010  4.079   1.00 0.00 ? 23  PHE A CE2  1  
ATOM 362   C CZ   . PHE A 1 23  ? -3.585  -5.000  3.256   1.00 0.00 ? 23  PHE A CZ   1  
ATOM 363   H H    . PHE A 1 23  ? -5.676  0.857   0.546   1.00 0.00 ? 23  PHE A H    1  
ATOM 364   H HA   . PHE A 1 23  ? -4.882  -1.683  -0.478  1.00 0.00 ? 23  PHE A HA   1  
ATOM 365   H HB2  . PHE A 1 23  ? -3.688  -0.641  1.416   1.00 0.00 ? 23  PHE A HB2  1  
ATOM 366   H HB3  . PHE A 1 23  ? -5.251  -0.654  2.418   1.00 0.00 ? 23  PHE A HB3  1  
ATOM 367   H HD1  . PHE A 1 23  ? -3.596  -3.321  0.356   1.00 0.00 ? 23  PHE A HD1  1  
ATOM 368   H HD2  . PHE A 1 23  ? -4.943  -2.074  4.194   1.00 0.00 ? 23  PHE A HD2  1  
ATOM 369   H HE1  . PHE A 1 23  ? -2.963  -5.482  1.266   1.00 0.00 ? 23  PHE A HE1  1  
ATOM 370   H HE2  . PHE A 1 23  ? -4.178  -4.177  5.144   1.00 0.00 ? 23  PHE A HE2  1  
ATOM 371   H HZ   . PHE A 1 23  ? -3.302  -5.964  3.654   1.00 0.00 ? 23  PHE A HZ   1  
ATOM 372   N N    . ARG A 1 24  ? -7.798  -1.686  1.252   1.00 0.00 ? 24  ARG A N    1  
ATOM 373   C CA   . ARG A 1 24  ? -8.999  -2.538  1.350   1.00 0.00 ? 24  ARG A CA   1  
ATOM 374   C C    . ARG A 1 24  ? -9.851  -2.611  0.094   1.00 0.00 ? 24  ARG A C    1  
ATOM 375   O O    . ARG A 1 24  ? -10.425 -3.656  -0.161  1.00 0.00 ? 24  ARG A O    1  
ATOM 376   C CB   . ARG A 1 24  ? -9.838  -2.392  2.640   1.00 0.00 ? 24  ARG A CB   1  
ATOM 377   C CG   . ARG A 1 24  ? -10.702 -3.636  3.021   1.00 0.00 ? 24  ARG A CG   1  
ATOM 378   C CD   . ARG A 1 24  ? -11.308 -3.440  4.418   1.00 0.00 ? 24  ARG A CD   1  
ATOM 379   N NE   . ARG A 1 24  ? -12.190 -2.220  4.529   1.00 0.00 ? 24  ARG A NE   1  
ATOM 380   C CZ   . ARG A 1 24  ? -13.395 -2.007  3.915   1.00 0.00 ? 24  ARG A CZ   1  
ATOM 381   N NH1  . ARG A 1 24  ? -13.943 -2.913  3.062   1.00 0.00 ? 24  ARG A NH1  1  
ATOM 382   N NH2  . ARG A 1 24  ? -14.065 -0.843  4.170   1.00 0.00 ? 24  ARG A NH2  1  
ATOM 383   H H    . ARG A 1 24  ? -7.854  -0.828  1.786   1.00 0.00 ? 24  ARG A H    1  
ATOM 384   H HA   . ARG A 1 24  ? -8.648  -3.556  1.480   1.00 0.00 ? 24  ARG A HA   1  
ATOM 385   H HB2  . ARG A 1 24  ? -9.077  -2.322  3.470   1.00 0.00 ? 24  ARG A HB2  1  
ATOM 386   H HB3  . ARG A 1 24  ? -10.425 -1.444  2.641   1.00 0.00 ? 24  ARG A HB3  1  
ATOM 387   H HG2  . ARG A 1 24  ? -11.479 -4.069  2.305   1.00 0.00 ? 24  ARG A HG2  1  
ATOM 388   H HG3  . ARG A 1 24  ? -9.945  -4.454  3.123   1.00 0.00 ? 24  ARG A HG3  1  
ATOM 389   H HD2  . ARG A 1 24  ? -11.777 -4.343  4.849   1.00 0.00 ? 24  ARG A HD2  1  
ATOM 390   H HD3  . ARG A 1 24  ? -10.459 -3.226  5.085   1.00 0.00 ? 24  ARG A HD3  1  
ATOM 391   H HE   . ARG A 1 24  ? -11.862 -1.496  5.137   1.00 0.00 ? 24  ARG A HE   1  
ATOM 392   H HH11 . ARG A 1 24  ? -13.463 -3.769  2.867   1.00 0.00 ? 24  ARG A HH11 1  
ATOM 393   H HH12 . ARG A 1 24  ? -14.825 -2.725  2.631   1.00 0.00 ? 24  ARG A HH12 1  
ATOM 394   H HH21 . ARG A 1 24  ? -13.673 -0.168  4.795   1.00 0.00 ? 24  ARG A HH21 1  
ATOM 395   H HH22 . ARG A 1 24  ? -14.947 -0.667  3.732   1.00 0.00 ? 24  ARG A HH22 1  
ATOM 396   N N    . ASN A 1 25  ? -9.912  -1.581  -0.807  1.00 0.00 ? 25  ASN A N    1  
ATOM 397   C CA   . ASN A 1 25  ? -10.634 -1.682  -2.090  1.00 0.00 ? 25  ASN A CA   1  
ATOM 398   C C    . ASN A 1 25  ? -10.041 -2.703  -3.048  1.00 0.00 ? 25  ASN A C    1  
ATOM 399   O O    . ASN A 1 25  ? -10.740 -3.600  -3.488  1.00 0.00 ? 25  ASN A O    1  
ATOM 400   C CB   . ASN A 1 25  ? -10.714 -0.318  -2.830  1.00 0.00 ? 25  ASN A CB   1  
ATOM 401   C CG   . ASN A 1 25  ? -11.955 0.405   -2.319  1.00 0.00 ? 25  ASN A CG   1  
ATOM 402   O OD1  . ASN A 1 25  ? -12.204 0.490   -1.115  1.00 0.00 ? 25  ASN A OD1  1  
ATOM 403   N ND2  . ASN A 1 25  ? -12.783 0.933   -3.256  1.00 0.00 ? 25  ASN A ND2  1  
ATOM 404   H H    . ASN A 1 25  ? -9.452  -0.701  -0.625  1.00 0.00 ? 25  ASN A H    1  
ATOM 405   H HA   . ASN A 1 25  ? -11.636 -2.051  -1.888  1.00 0.00 ? 25  ASN A HA   1  
ATOM 406   H HB2  . ASN A 1 25  ? -9.811  0.276   -2.614  1.00 0.00 ? 25  ASN A HB2  1  
ATOM 407   H HB3  . ASN A 1 25  ? -10.732 -0.368  -3.933  1.00 0.00 ? 25  ASN A HB3  1  
ATOM 408   H HD21 . ASN A 1 25  ? -12.591 0.834   -4.228  1.00 0.00 ? 25  ASN A HD21 1  
ATOM 409   H HD22 . ASN A 1 25  ? -13.592 1.411   -2.922  1.00 0.00 ? 25  ASN A HD22 1  
ATOM 410   N N    . ASP A 1 26  ? -8.718  -2.646  -3.328  1.00 0.00 ? 26  ASP A N    1  
ATOM 411   C CA   . ASP A 1 26  ? -8.030  -3.639  -4.153  1.00 0.00 ? 26  ASP A CA   1  
ATOM 412   C C    . ASP A 1 26  ? -7.733  -4.954  -3.441  1.00 0.00 ? 26  ASP A C    1  
ATOM 413   O O    . ASP A 1 26  ? -7.880  -5.997  -4.056  1.00 0.00 ? 26  ASP A O    1  
ATOM 414   C CB   . ASP A 1 26  ? -6.739  -3.016  -4.738  1.00 0.00 ? 26  ASP A CB   1  
ATOM 415   C CG   . ASP A 1 26  ? -7.068  -1.990  -5.825  1.00 0.00 ? 26  ASP A CG   1  
ATOM 416   O OD1  . ASP A 1 26  ? -7.507  -2.414  -6.927  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 417   O OD2  . ASP A 1 26  ? -6.871  -0.772  -5.570  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 418   H H    . ASP A 1 26  ? -8.145  -1.918  -2.939  1.00 0.00 ? 26  ASP A H    1  
ATOM 419   H HA   . ASP A 1 26  ? -8.695  -3.980  -4.959  1.00 0.00 ? 26  ASP A HA   1  
ATOM 420   H HB2  . ASP A 1 26  ? -6.218  -2.485  -3.916  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 421   H HB3  . ASP A 1 26  ? -6.049  -3.774  -5.156  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 422   N N    . PHE A 1 27  ? -7.359  -4.978  -2.128  1.00 0.00 ? 27  PHE A N    1  
ATOM 423   C CA   . PHE A 1 27  ? -7.085  -6.190  -1.322  1.00 0.00 ? 27  PHE A CA   1  
ATOM 424   C C    . PHE A 1 27  ? -8.330  -6.992  -1.048  1.00 0.00 ? 27  PHE A C    1  
ATOM 425   O O    . PHE A 1 27  ? -8.310  -8.195  -1.266  1.00 0.00 ? 27  PHE A O    1  
ATOM 426   C CB   . PHE A 1 27  ? -6.385  -5.889  0.044   1.00 0.00 ? 27  PHE A CB   1  
ATOM 427   C CG   . PHE A 1 27  ? -5.945  -7.046  0.926   1.00 0.00 ? 27  PHE A CG   1  
ATOM 428   C CD1  . PHE A 1 27  ? -6.754  -7.545  1.946   1.00 0.00 ? 27  PHE A CD1  1  
ATOM 429   C CD2  . PHE A 1 27  ? -4.655  -7.514  0.821   1.00 0.00 ? 27  PHE A CD2  1  
ATOM 430   C CE1  . PHE A 1 27  ? -6.272  -8.470  2.855   1.00 0.00 ? 27  PHE A CE1  1  
ATOM 431   C CE2  . PHE A 1 27  ? -4.150  -8.359  1.781   1.00 0.00 ? 27  PHE A CE2  1  
ATOM 432   C CZ   . PHE A 1 27  ? -4.951  -8.851  2.779   1.00 0.00 ? 27  PHE A CZ   1  
ATOM 433   H H    . PHE A 1 27  ? -7.258  -4.113  -1.621  1.00 0.00 ? 27  PHE A H    1  
ATOM 434   H HA   . PHE A 1 27  ? -6.427  -6.831  -1.893  1.00 0.00 ? 27  PHE A HA   1  
ATOM 435   H HB2  . PHE A 1 27  ? -5.468  -5.294  -0.196  1.00 0.00 ? 27  PHE A HB2  1  
ATOM 436   H HB3  . PHE A 1 27  ? -7.049  -5.259  0.683   1.00 0.00 ? 27  PHE A HB3  1  
ATOM 437   H HD1  . PHE A 1 27  ? -7.766  -7.177  2.046   1.00 0.00 ? 27  PHE A HD1  1  
ATOM 438   H HD2  . PHE A 1 27  ? -4.009  -7.127  0.045   1.00 0.00 ? 27  PHE A HD2  1  
ATOM 439   H HE1  . PHE A 1 27  ? -6.884  -8.872  3.658   1.00 0.00 ? 27  PHE A HE1  1  
ATOM 440   H HE2  . PHE A 1 27  ? -3.114  -8.644  1.763   1.00 0.00 ? 27  PHE A HE2  1  
ATOM 441   H HZ   . PHE A 1 27  ? -4.530  -9.534  3.497   1.00 0.00 ? 27  PHE A HZ   1  
ATOM 442   N N    . LEU A 1 28  ? -9.449  -6.345  -0.601  1.00 0.00 ? 28  LEU A N    1  
ATOM 443   C CA   . LEU A 1 28  ? -10.749 -6.968  -0.370  1.00 0.00 ? 28  LEU A CA   1  
ATOM 444   C C    . LEU A 1 28  ? -11.411 -7.454  -1.657  1.00 0.00 ? 28  LEU A C    1  
ATOM 445   O O    . LEU A 1 28  ? -11.986 -8.535  -1.656  1.00 0.00 ? 28  LEU A O    1  
ATOM 446   C CB   . LEU A 1 28  ? -11.640 -6.099  0.544   1.00 0.00 ? 28  LEU A CB   1  
ATOM 447   C CG   . LEU A 1 28  ? -12.574 -6.868  1.482   1.00 0.00 ? 28  LEU A CG   1  
ATOM 448   C CD1  . LEU A 1 28  ? -11.864 -7.425  2.726   1.00 0.00 ? 28  LEU A CD1  1  
ATOM 449   C CD2  . LEU A 1 28  ? -13.879 -6.158  1.835   1.00 0.00 ? 28  LEU A CD2  1  
ATOM 450   H H    . LEU A 1 28  ? -9.447  -5.350  -0.448  1.00 0.00 ? 28  LEU A H    1  
ATOM 451   H HA   . LEU A 1 28  ? -10.564 -7.867  0.205   1.00 0.00 ? 28  LEU A HA   1  
ATOM 452   H HB2  . LEU A 1 28  ? -10.930 -5.576  1.214   1.00 0.00 ? 28  LEU A HB2  1  
ATOM 453   H HB3  . LEU A 1 28  ? -12.205 -5.342  -0.047  1.00 0.00 ? 28  LEU A HB3  1  
ATOM 454   H HG   . LEU A 1 28  ? -12.879 -7.693  0.870   1.00 0.00 ? 28  LEU A HG   1  
ATOM 455   H HD11 . LEU A 1 28  ? -10.886 -7.873  2.451   1.00 0.00 ? 28  LEU A HD11 1  
ATOM 456   H HD12 . LEU A 1 28  ? -11.678 -6.600  3.443   1.00 0.00 ? 28  LEU A HD12 1  
ATOM 457   H HD13 . LEU A 1 28  ? -12.484 -8.199  3.220   1.00 0.00 ? 28  LEU A HD13 1  
ATOM 458   H HD21 . LEU A 1 28  ? -14.394 -5.787  0.926   1.00 0.00 ? 28  LEU A HD21 1  
ATOM 459   H HD22 . LEU A 1 28  ? -14.557 -6.883  2.347   1.00 0.00 ? 28  LEU A HD22 1  
ATOM 460   H HD23 . LEU A 1 28  ? -13.677 -5.317  2.519   1.00 0.00 ? 28  LEU A HD23 1  
ATOM 461   N N    . GLU A 1 29  ? -11.216 -6.723  -2.816  1.00 0.00 ? 29  GLU A N    1  
ATOM 462   C CA   . GLU A 1 29  ? -11.627 -7.194  -4.155  1.00 0.00 ? 29  GLU A CA   1  
ATOM 463   C C    . GLU A 1 29  ? -10.797 -8.380  -4.657  1.00 0.00 ? 29  GLU A C    1  
ATOM 464   O O    . GLU A 1 29  ? -11.345 -9.372  -5.116  1.00 0.00 ? 29  GLU A O    1  
ATOM 465   C CB   . GLU A 1 29  ? -11.715 -6.055  -5.223  1.00 0.00 ? 29  GLU A CB   1  
ATOM 466   C CG   . GLU A 1 29  ? -10.608 -5.920  -6.291  1.00 0.00 ? 29  GLU A CG   1  
ATOM 467   C CD   . GLU A 1 29  ? -10.922 -4.742  -7.213  1.00 0.00 ? 29  GLU A CD   1  
ATOM 468   O OE1  . GLU A 1 29  ? -10.167 -3.735  -7.175  1.00 0.00 ? 29  GLU A OE1  1  
ATOM 469   O OE2  . GLU A 1 29  ? -11.924 -4.838  -7.972  1.00 0.00 ? 29  GLU A OE2  1  
ATOM 470   H H    . GLU A 1 29  ? -10.735 -5.837  -2.801  1.00 0.00 ? 29  GLU A H    1  
ATOM 471   H HA   . GLU A 1 29  ? -12.634 -7.590  -4.057  1.00 0.00 ? 29  GLU A HA   1  
ATOM 472   H HB2  . GLU A 1 29  ? -12.652 -6.168  -5.788  1.00 0.00 ? 29  GLU A HB2  1  
ATOM 473   H HB3  . GLU A 1 29  ? -11.815 -5.096  -4.690  1.00 0.00 ? 29  GLU A HB3  1  
ATOM 474   H HG2  . GLU A 1 29  ? -9.630  -5.770  -5.799  1.00 0.00 ? 29  GLU A HG2  1  
ATOM 475   H HG3  . GLU A 1 29  ? -10.565 -6.843  -6.906  1.00 0.00 ? 29  GLU A HG3  1  
ATOM 476   N N    . LEU A 1 30  ? -9.442  -8.334  -4.507  1.00 0.00 ? 30  LEU A N    1  
ATOM 477   C CA   . LEU A 1 30  ? -8.474  -9.375  -4.872  1.00 0.00 ? 30  LEU A CA   1  
ATOM 478   C C    . LEU A 1 30  ? -8.596  -10.656 -4.066  1.00 0.00 ? 30  LEU A C    1  
ATOM 479   O O    . LEU A 1 30  ? -8.527  -11.751 -4.610  1.00 0.00 ? 30  LEU A O    1  
ATOM 480   C CB   . LEU A 1 30  ? -7.042  -8.834  -4.706  1.00 0.00 ? 30  LEU A CB   1  
ATOM 481   C CG   . LEU A 1 30  ? -5.954  -9.596  -5.472  1.00 0.00 ? 30  LEU A CG   1  
ATOM 482   C CD1  . LEU A 1 30  ? -5.260  -8.594  -6.390  1.00 0.00 ? 30  LEU A CD1  1  
ATOM 483   C CD2  . LEU A 1 30  ? -4.934  -10.309 -4.568  1.00 0.00 ? 30  LEU A CD2  1  
ATOM 484   H H    . LEU A 1 30  ? -9.016  -7.502  -4.126  1.00 0.00 ? 30  LEU A H    1  
ATOM 485   H HA   . LEU A 1 30  ? -8.655  -9.630  -5.916  1.00 0.00 ? 30  LEU A HA   1  
ATOM 486   H HB2  . LEU A 1 30  ? -7.059  -7.814  -5.152  1.00 0.00 ? 30  LEU A HB2  1  
ATOM 487   H HB3  . LEU A 1 30  ? -6.752  -8.698  -3.641  1.00 0.00 ? 30  LEU A HB3  1  
ATOM 488   H HG   . LEU A 1 30  ? -6.442  -10.368 -6.112  1.00 0.00 ? 30  LEU A HG   1  
ATOM 489   H HD11 . LEU A 1 30  ? -4.855  -7.749  -5.793  1.00 0.00 ? 30  LEU A HD11 1  
ATOM 490   H HD12 . LEU A 1 30  ? -4.443  -9.107  -6.936  1.00 0.00 ? 30  LEU A HD12 1  
ATOM 491   H HD13 . LEU A 1 30  ? -5.983  -8.164  -7.117  1.00 0.00 ? 30  LEU A HD13 1  
ATOM 492   H HD21 . LEU A 1 30  ? -5.449  -10.897 -3.779  1.00 0.00 ? 30  LEU A HD21 1  
ATOM 493   H HD22 . LEU A 1 30  ? -4.327  -10.995 -5.198  1.00 0.00 ? 30  LEU A HD22 1  
ATOM 494   H HD23 . LEU A 1 30  ? -4.249  -9.581  -4.093  1.00 0.00 ? 30  LEU A HD23 1  
ATOM 495   N N    . LEU A 1 31  ? -8.890  -10.510 -2.743  1.00 0.00 ? 31  LEU A N    1  
ATOM 496   C CA   . LEU A 1 31  ? -9.241  -11.507 -1.732  1.00 0.00 ? 31  LEU A CA   1  
ATOM 497   C C    . LEU A 1 31  ? -10.575 -12.148 -2.067  1.00 0.00 ? 31  LEU A C    1  
ATOM 498   O O    . LEU A 1 31  ? -10.760 -13.356 -1.948  1.00 0.00 ? 31  LEU A O    1  
ATOM 499   C CB   . LEU A 1 31  ? -9.341  -10.819 -0.338  1.00 0.00 ? 31  LEU A CB   1  
ATOM 500   C CG   . LEU A 1 31  ? -9.727  -11.654 0.906   1.00 0.00 ? 31  LEU A CG   1  
ATOM 501   C CD1  . LEU A 1 31  ? -8.654  -12.719 1.205   1.00 0.00 ? 31  LEU A CD1  1  
ATOM 502   C CD2  . LEU A 1 31  ? -9.984  -10.726 2.119   1.00 0.00 ? 31  LEU A CD2  1  
ATOM 503   H H    . LEU A 1 31  ? -8.933  -9.573  -2.375  1.00 0.00 ? 31  LEU A H    1  
ATOM 504   H HA   . LEU A 1 31  ? -8.484  -12.278 -1.723  1.00 0.00 ? 31  LEU A HA   1  
ATOM 505   H HB2  . LEU A 1 31  ? -8.327  -10.385 -0.128  1.00 0.00 ? 31  LEU A HB2  1  
ATOM 506   H HB3  . LEU A 1 31  ? -10.095 -9.990  -0.416  1.00 0.00 ? 31  LEU A HB3  1  
ATOM 507   H HG   . LEU A 1 31  ? -10.685 -12.188 0.707   1.00 0.00 ? 31  LEU A HG   1  
ATOM 508   H HD11 . LEU A 1 31  ? -8.483  -13.354 0.307   1.00 0.00 ? 31  LEU A HD11 1  
ATOM 509   H HD12 . LEU A 1 31  ? -7.694  -12.230 1.474   1.00 0.00 ? 31  LEU A HD12 1  
ATOM 510   H HD13 . LEU A 1 31  ? -8.974  -13.368 2.048   1.00 0.00 ? 31  LEU A HD13 1  
ATOM 511   H HD21 . LEU A 1 31  ? -9.093  -10.100 2.328   1.00 0.00 ? 31  LEU A HD21 1  
ATOM 512   H HD22 . LEU A 1 31  ? -10.851 -10.046 1.955   1.00 0.00 ? 31  LEU A HD22 1  
ATOM 513   H HD23 . LEU A 1 31  ? -10.224 -11.315 3.034   1.00 0.00 ? 31  LEU A HD23 1  
ATOM 514   N N    . ARG A 1 32  ? -11.550 -11.343 -2.558  1.00 0.00 ? 32  ARG A N    1  
ATOM 515   C CA   . ARG A 1 32  ? -12.824 -11.863 -2.983  1.00 0.00 ? 32  ARG A CA   1  
ATOM 516   C C    . ARG A 1 32  ? -12.854 -12.610 -4.325  1.00 0.00 ? 32  ARG A C    1  
ATOM 517   O O    . ARG A 1 32  ? -13.417 -13.700 -4.376  1.00 0.00 ? 32  ARG A O    1  
ATOM 518   C CB   . ARG A 1 32  ? -13.769 -10.659 -3.036  1.00 0.00 ? 32  ARG A CB   1  
ATOM 519   C CG   . ARG A 1 32  ? -14.461 -10.418 -1.696  1.00 0.00 ? 32  ARG A CG   1  
ATOM 520   C CD   . ARG A 1 32  ? -15.559 -9.340  -1.714  1.00 0.00 ? 32  ARG A CD   1  
ATOM 521   N NE   . ARG A 1 32  ? -14.954 -8.025  -2.112  1.00 0.00 ? 32  ARG A NE   1  
ATOM 522   C CZ   . ARG A 1 32  ? -15.607 -6.827  -1.999  1.00 0.00 ? 32  ARG A CZ   1  
ATOM 523   N NH1  . ARG A 1 32  ? -16.887 -6.768  -1.530  1.00 0.00 ? 32  ARG A NH1  1  
ATOM 524   N NH2  . ARG A 1 32  ? -14.961 -5.678  -2.357  1.00 0.00 ? 32  ARG A NH2  1  
ATOM 525   H H    . ARG A 1 32  ? -11.448 -10.348 -2.660  1.00 0.00 ? 32  ARG A H    1  
ATOM 526   H HA   . ARG A 1 32  ? -13.206 -12.559 -2.247  1.00 0.00 ? 32  ARG A HA   1  
ATOM 527   H HB2  . ARG A 1 32  ? -13.226 -9.749  -3.375  1.00 0.00 ? 32  ARG A HB2  1  
ATOM 528   H HB3  . ARG A 1 32  ? -14.573 -10.846 -3.750  1.00 0.00 ? 32  ARG A HB3  1  
ATOM 529   H HG2  . ARG A 1 32  ? -14.898 -11.413 -1.447  1.00 0.00 ? 32  ARG A HG2  1  
ATOM 530   H HG3  . ARG A 1 32  ? -13.734 -10.173 -0.891  1.00 0.00 ? 32  ARG A HG3  1  
ATOM 531   H HD2  . ARG A 1 32  ? -16.357 -9.601  -2.439  1.00 0.00 ? 32  ARG A HD2  1  
ATOM 532   H HD3  . ARG A 1 32  ? -16.000 -9.244  -0.698  1.00 0.00 ? 32  ARG A HD3  1  
ATOM 533   H HE   . ARG A 1 32  ? -14.015 -8.024  -2.458  1.00 0.00 ? 32  ARG A HE   1  
ATOM 534   H HH11 . ARG A 1 32  ? -17.361 -7.608  -1.266  1.00 0.00 ? 32  ARG A HH11 1  
ATOM 535   H HH12 . ARG A 1 32  ? -17.351 -5.886  -1.452  1.00 0.00 ? 32  ARG A HH12 1  
ATOM 536   H HH21 . ARG A 1 32  ? -14.022 -5.719  -2.698  1.00 0.00 ? 32  ARG A HH21 1  
ATOM 537   H HH22 . ARG A 1 32  ? -15.427 -4.797  -2.277  1.00 0.00 ? 32  ARG A HH22 1  
ATOM 538   N N    . ARG A 1 33  ? -12.255 -12.080 -5.430  1.00 0.00 ? 33  ARG A N    1  
ATOM 539   C CA   . ARG A 1 33  ? -12.083 -12.781 -6.709  1.00 0.00 ? 33  ARG A CA   1  
ATOM 540   C C    . ARG A 1 33  ? -11.084 -13.863 -6.822  1.00 0.00 ? 33  ARG A C    1  
ATOM 541   O O    . ARG A 1 33  ? -11.347 -14.890 -7.431  1.00 0.00 ? 33  ARG A O    1  
ATOM 542   C CB   . ARG A 1 33  ? -11.973 -11.906 -7.965  1.00 0.00 ? 33  ARG A CB   1  
ATOM 543   C CG   . ARG A 1 33  ? -11.051 -10.690 -7.838  1.00 0.00 ? 33  ARG A CG   1  
ATOM 544   C CD   . ARG A 1 33  ? -10.427 -10.223 -9.154  1.00 0.00 ? 33  ARG A CD   1  
ATOM 545   N NE   . ARG A 1 33  ? -9.632  -8.979  -8.860  1.00 0.00 ? 33  ARG A NE   1  
ATOM 546   C CZ   . ARG A 1 33  ? -9.129  -8.162  -9.835  1.00 0.00 ? 33  ARG A CZ   1  
ATOM 547   N NH1  . ARG A 1 33  ? -9.336  -8.439  -11.155 1.00 0.00 ? 33  ARG A NH1  1  
ATOM 548   N NH2  . ARG A 1 33  ? -8.409  -7.057  -9.479  1.00 0.00 ? 33  ARG A NH2  1  
ATOM 549   H H    . ARG A 1 33  ? -11.823 -11.172 -5.370  1.00 0.00 ? 33  ARG A H    1  
ATOM 550   H HA   . ARG A 1 33  ? -12.996 -13.338 -6.865  1.00 0.00 ? 33  ARG A HA   1  
ATOM 551   H HB2  . ARG A 1 33  ? -11.845 -12.445 -8.924  1.00 0.00 ? 33  ARG A HB2  1  
ATOM 552   H HB3  . ARG A 1 33  ? -13.016 -11.667 -8.137  1.00 0.00 ? 33  ARG A HB3  1  
ATOM 553   H HG2  . ARG A 1 33  ? -11.617 -9.849  -7.383  1.00 0.00 ? 33  ARG A HG2  1  
ATOM 554   H HG3  . ARG A 1 33  ? -10.219 -10.943 -7.143  1.00 0.00 ? 33  ARG A HG3  1  
ATOM 555   H HD2  . ARG A 1 33  ? -9.731  -11.000 -9.537  1.00 0.00 ? 33  ARG A HD2  1  
ATOM 556   H HD3  . ARG A 1 33  ? -11.219 -10.003 -9.902  1.00 0.00 ? 33  ARG A HD3  1  
ATOM 557   H HE   . ARG A 1 33  ? -9.461  -8.743  -7.903  1.00 0.00 ? 33  ARG A HE   1  
ATOM 558   H HH11 . ARG A 1 33  ? -9.864  -9.246  -11.418 1.00 0.00 ? 33  ARG A HH11 1  
ATOM 559   H HH12 . ARG A 1 33  ? -8.964  -7.832  -11.858 1.00 0.00 ? 33  ARG A HH12 1  
ATOM 560   H HH21 . ARG A 1 33  ? -8.256  -6.852  -8.513  1.00 0.00 ? 33  ARG A HH21 1  
ATOM 561   H HH22 . ARG A 1 33  ? -8.037  -6.455  -10.185 1.00 0.00 ? 33  ARG A HH22 1  
ATOM 562   N N    . ARG A 1 34  ? -9.861  -13.625 -6.315  1.00 0.00 ? 34  ARG A N    1  
ATOM 563   C CA   . ARG A 1 34  ? -8.770  -14.553 -6.483  1.00 0.00 ? 34  ARG A CA   1  
ATOM 564   C C    . ARG A 1 34  ? -8.756  -15.689 -5.459  1.00 0.00 ? 34  ARG A C    1  
ATOM 565   O O    . ARG A 1 34  ? -8.132  -16.728 -5.661  1.00 0.00 ? 34  ARG A O    1  
ATOM 566   C CB   . ARG A 1 34  ? -7.442  -13.790 -6.630  1.00 0.00 ? 34  ARG A CB   1  
ATOM 567   C CG   . ARG A 1 34  ? -7.615  -12.625 -7.627  1.00 0.00 ? 34  ARG A CG   1  
ATOM 568   C CD   . ARG A 1 34  ? -6.385  -12.432 -8.507  1.00 0.00 ? 34  ARG A CD   1  
ATOM 569   N NE   . ARG A 1 34  ? -6.678  -11.322 -9.479  1.00 0.00 ? 34  ARG A NE   1  
ATOM 570   C CZ   . ARG A 1 34  ? -5.800  -10.928 -10.451 1.00 0.00 ? 34  ARG A CZ   1  
ATOM 571   N NH1  . ARG A 1 34  ? -4.566  -11.499 -10.556 1.00 0.00 ? 34  ARG A NH1  1  
ATOM 572   N NH2  . ARG A 1 34  ? -6.168  -9.947  -11.328 1.00 0.00 ? 34  ARG A NH2  1  
ATOM 573   H H    . ARG A 1 34  ? -9.627  -12.774 -5.829  1.00 0.00 ? 34  ARG A H    1  
ATOM 574   H HA   . ARG A 1 34  ? -8.874  -14.975 -7.473  1.00 0.00 ? 34  ARG A HA   1  
ATOM 575   H HB2  . ARG A 1 34  ? -7.082  -13.390 -5.658  1.00 0.00 ? 34  ARG A HB2  1  
ATOM 576   H HB3  . ARG A 1 34  ? -6.669  -14.490 -7.018  1.00 0.00 ? 34  ARG A HB3  1  
ATOM 577   H HG2  . ARG A 1 34  ? -8.482  -12.834 -8.301  1.00 0.00 ? 34  ARG A HG2  1  
ATOM 578   H HG3  . ARG A 1 34  ? -7.873  -11.693 -7.080  1.00 0.00 ? 34  ARG A HG3  1  
ATOM 579   H HD2  . ARG A 1 34  ? -5.494  -12.178 -7.894  1.00 0.00 ? 34  ARG A HD2  1  
ATOM 580   H HD3  . ARG A 1 34  ? -6.227  -13.387 -9.061  1.00 0.00 ? 34  ARG A HD3  1  
ATOM 581   H HE   . ARG A 1 34  ? -7.572  -10.876 -9.432  1.00 0.00 ? 34  ARG A HE   1  
ATOM 582   H HH11 . ARG A 1 34  ? -4.293  -12.218 -9.917  1.00 0.00 ? 34  ARG A HH11 1  
ATOM 583   H HH12 . ARG A 1 34  ? -3.935  -11.199 -11.271 1.00 0.00 ? 34  ARG A HH12 1  
ATOM 584   H HH21 . ARG A 1 34  ? -7.070  -9.523  -11.253 1.00 0.00 ? 34  ARG A HH21 1  
ATOM 585   H HH22 . ARG A 1 34  ? -5.531  -9.650  -12.040 1.00 0.00 ? 34  ARG A HH22 1  
ATOM 586   N N    . PHE A 1 35  ? -9.440  -15.479 -4.298  1.00 0.00 ? 35  PHE A N    1  
ATOM 587   C CA   . PHE A 1 35  ? -9.450  -16.412 -3.182  1.00 0.00 ? 35  PHE A CA   1  
ATOM 588   C C    . PHE A 1 35  ? -10.868 -16.925 -2.827  1.00 0.00 ? 35  PHE A C    1  
ATOM 589   O O    . PHE A 1 35  ? -10.990 -18.101 -2.473  1.00 0.00 ? 35  PHE A O    1  
ATOM 590   C CB   . PHE A 1 35  ? -8.638  -15.865 -1.940  1.00 0.00 ? 35  PHE A CB   1  
ATOM 591   C CG   . PHE A 1 35  ? -7.183  -15.528 -2.208  1.00 0.00 ? 35  PHE A CG   1  
ATOM 592   C CD1  . PHE A 1 35  ? -6.889  -14.373 -2.911  1.00 0.00 ? 35  PHE A CD1  1  
ATOM 593   C CD2  . PHE A 1 35  ? -6.116  -16.222 -1.651  1.00 0.00 ? 35  PHE A CD2  1  
ATOM 594   C CE1  . PHE A 1 35  ? -5.602  -13.949 -3.122  1.00 0.00 ? 35  PHE A CE1  1  
ATOM 595   C CE2  . PHE A 1 35  ? -4.817  -15.780 -1.829  1.00 0.00 ? 35  PHE A CE2  1  
ATOM 596   C CZ   . PHE A 1 35  ? -4.555  -14.648 -2.567  1.00 0.00 ? 35  PHE A CZ   1  
ATOM 597   H H    . PHE A 1 35  ? -9.931  -14.619 -4.164  1.00 0.00 ? 35  PHE A H    1  
ATOM 598   H HA   . PHE A 1 35  ? -8.931  -17.325 -3.457  1.00 0.00 ? 35  PHE A HA   1  
ATOM 599   H HB2  . PHE A 1 35  ? -9.033  -14.871 -1.638  1.00 0.00 ? 35  PHE A HB2  1  
ATOM 600   H HB3  . PHE A 1 35  ? -8.669  -16.609 -1.103  1.00 0.00 ? 35  PHE A HB3  1  
ATOM 601   H HD1  . PHE A 1 35  ? -7.691  -13.773 -3.312  1.00 0.00 ? 35  PHE A HD1  1  
ATOM 602   H HD2  . PHE A 1 35  ? -6.272  -17.093 -1.035  1.00 0.00 ? 35  PHE A HD2  1  
ATOM 603   H HE1  . PHE A 1 35  ? -5.446  -13.070 -3.731  1.00 0.00 ? 35  PHE A HE1  1  
ATOM 604   H HE2  . PHE A 1 35  ? -4.001  -16.318 -1.366  1.00 0.00 ? 35  PHE A HE2  1  
ATOM 605   H HZ   . PHE A 1 35  ? -3.538  -14.305 -2.696  1.00 0.00 ? 35  PHE A HZ   1  
ATOM 606   N N    . GLY A 1 36  ? -11.995 -16.111 -2.832  1.00 0.00 ? 36  GLY A N    1  
ATOM 607   C CA   . GLY A 1 36  ? -13.313 -16.542 -2.347  1.00 0.00 ? 36  GLY A CA   1  
ATOM 608   C C    . GLY A 1 36  ? -13.376 -16.462 -0.875  1.00 0.00 ? 36  GLY A C    1  
ATOM 609   O O    . GLY A 1 36  ? -13.193 -15.383 -0.343  1.00 0.00 ? 36  GLY A O    1  
ATOM 610   H H    . GLY A 1 36  ? -12.066 -15.138 -3.091  1.00 0.00 ? 36  GLY A H    1  
ATOM 611   H HA2  . GLY A 1 36  ? -14.010 -15.772 -2.660  1.00 0.00 ? 36  GLY A HA2  1  
ATOM 612   H HA3  . GLY A 1 36  ? -13.515 -17.566 -2.621  1.00 0.00 ? 36  GLY A HA3  1  
ATOM 613   N N    . THR A 1 37  ? -13.584 -17.576 -0.140  1.00 0.00 ? 37  THR A N    1  
ATOM 614   C CA   . THR A 1 37  ? -13.409 -17.518 1.297   1.00 0.00 ? 37  THR A CA   1  
ATOM 615   C C    . THR A 1 37  ? -12.542 -18.732 1.579   1.00 0.00 ? 37  THR A C    1  
ATOM 616   O O    . THR A 1 37  ? -12.996 -19.872 1.527   1.00 0.00 ? 37  THR A O    1  
ATOM 617   C CB   . THR A 1 37  ? -14.735 -17.555 2.073   1.00 0.00 ? 37  THR A CB   1  
ATOM 618   O OG1  . THR A 1 37  ? -15.583 -18.630 1.684   1.00 0.00 ? 37  THR A OG1  1  
ATOM 619   C CG2  . THR A 1 37  ? -15.550 -16.266 1.866   1.00 0.00 ? 37  THR A CG2  1  
ATOM 620   H H    . THR A 1 37  ? -13.742 -18.479 -0.533  1.00 0.00 ? 37  THR A H    1  
ATOM 621   H HA   . THR A 1 37  ? -12.853 -16.644 1.631   1.00 0.00 ? 37  THR A HA   1  
ATOM 622   H HB   . THR A 1 37  ? -14.528 -17.656 3.165   1.00 0.00 ? 37  THR A HB   1  
ATOM 623   H HG1  . THR A 1 37  ? -15.087 -19.433 1.893   1.00 0.00 ? 37  THR A HG1  1  
ATOM 624   H HG21 . THR A 1 37  ? -15.033 -15.324 2.115   1.00 0.00 ? 37  THR A HG21 1  
ATOM 625   H HG22 . THR A 1 37  ? -15.934 -16.153 0.835   1.00 0.00 ? 37  THR A HG22 1  
ATOM 626   H HG23 . THR A 1 37  ? -16.399 -16.287 2.578   1.00 0.00 ? 37  THR A HG23 1  
ATOM 627   N N    . LYS A 1 38  ? -11.280 -18.478 1.929   1.00 0.00 ? 38  LYS A N    1  
ATOM 628   C CA   . LYS A 1 38  ? -10.284 -19.478 2.234   1.00 0.00 ? 38  LYS A CA   1  
ATOM 629   C C    . LYS A 1 38  ? -9.514  -19.025 3.437   1.00 0.00 ? 38  LYS A C    1  
ATOM 630   O O    . LYS A 1 38  ? -9.212  -17.842 3.559   1.00 0.00 ? 38  LYS A O    1  
ATOM 631   C CB   . LYS A 1 38  ? -9.303  -19.656 1.065   1.00 0.00 ? 38  LYS A CB   1  
ATOM 632   C CG   . LYS A 1 38  ? -8.551  -20.986 1.187   1.00 0.00 ? 38  LYS A CG   1  
ATOM 633   C CD   . LYS A 1 38  ? -7.429  -21.092 0.167   1.00 0.00 ? 38  LYS A CD   1  
ATOM 634   C CE   . LYS A 1 38  ? -7.863  -21.141 -1.305  1.00 0.00 ? 38  LYS A CE   1  
ATOM 635   N NZ   . LYS A 1 38  ? -8.719  -22.319 -1.576  1.00 0.00 ? 38  LYS A NZ   1  
ATOM 636   H H    . LYS A 1 38  ? -10.970 -17.534 1.868   1.00 0.00 ? 38  LYS A H    1  
ATOM 637   H HA   . LYS A 1 38  ? -10.658 -20.476 2.389   1.00 0.00 ? 38  LYS A HA   1  
ATOM 638   H HB2  . LYS A 1 38  ? -9.891  -19.664 0.120   1.00 0.00 ? 38  LYS A HB2  1  
ATOM 639   H HB3  . LYS A 1 38  ? -8.586  -18.805 0.979   1.00 0.00 ? 38  LYS A HB3  1  
ATOM 640   H HG2  . LYS A 1 38  ? -8.055  -21.057 2.185   1.00 0.00 ? 38  LYS A HG2  1  
ATOM 641   H HG3  . LYS A 1 38  ? -9.252  -21.847 1.111   1.00 0.00 ? 38  LYS A HG3  1  
ATOM 642   H HD2  . LYS A 1 38  ? -6.812  -20.186 0.344   1.00 0.00 ? 38  LYS A HD2  1  
ATOM 643   H HD3  . LYS A 1 38  ? -6.847  -21.999 0.426   1.00 0.00 ? 38  LYS A HD3  1  
ATOM 644   H HE2  . LYS A 1 38  ? -8.436  -20.234 -1.586  1.00 0.00 ? 38  LYS A HE2  1  
ATOM 645   H HE3  . LYS A 1 38  ? -6.970  -21.219 -1.961  1.00 0.00 ? 38  LYS A HE3  1  
ATOM 646   H HZ1  . LYS A 1 38  ? -8.197  -23.188 -1.343  1.00 0.00 ? 38  LYS A HZ1  1  
ATOM 647   H HZ2  . LYS A 1 38  ? -9.579  -22.263 -0.993  1.00 0.00 ? 38  LYS A HZ2  1  
ATOM 648   H HZ3  . LYS A 1 38  ? -8.983  -22.332 -2.583  1.00 0.00 ? 38  LYS A HZ3  1  
ATOM 649   N N    . ARG A 1 39  ? -9.064  -19.960 4.324   1.00 0.00 ? 39  ARG A N    1  
ATOM 650   C CA   . ARG A 1 39  ? -8.111  -19.675 5.390   1.00 0.00 ? 39  ARG A CA   1  
ATOM 651   C C    . ARG A 1 39  ? -6.707  -19.540 4.755   1.00 0.00 ? 39  ARG A C    1  
ATOM 652   O O    . ARG A 1 39  ? -6.127  -20.466 4.198   1.00 0.00 ? 39  ARG A O    1  
ATOM 653   C CB   . ARG A 1 39  ? -8.163  -20.656 6.577   1.00 0.00 ? 39  ARG A CB   1  
ATOM 654   C CG   . ARG A 1 39  ? -7.556  -22.052 6.376   1.00 0.00 ? 39  ARG A CG   1  
ATOM 655   C CD   . ARG A 1 39  ? -8.264  -22.964 5.358   1.00 0.00 ? 39  ARG A CD   1  
ATOM 656   N NE   . ARG A 1 39  ? -9.717  -23.107 5.737   1.00 0.00 ? 39  ARG A NE   1  
ATOM 657   C CZ   . ARG A 1 39  ? -10.729 -23.294 4.831   1.00 0.00 ? 39  ARG A CZ   1  
ATOM 658   N NH1  . ARG A 1 39  ? -10.474 -23.361 3.492   1.00 0.00 ? 39  ARG A NH1  1  
ATOM 659   N NH2  . ARG A 1 39  ? -12.014 -23.410 5.277   1.00 0.00 ? 39  ARG A NH2  1  
ATOM 660   H H    . ARG A 1 39  ? -9.306  -20.917 4.219   1.00 0.00 ? 39  ARG A H    1  
ATOM 661   H HA   . ARG A 1 39  ? -8.417  -18.742 5.841   1.00 0.00 ? 39  ARG A HA   1  
ATOM 662   H HB2  . ARG A 1 39  ? -7.625  -20.187 7.434   1.00 0.00 ? 39  ARG A HB2  1  
ATOM 663   H HB3  . ARG A 1 39  ? -9.223  -20.759 6.900   1.00 0.00 ? 39  ARG A HB3  1  
ATOM 664   H HG2  . ARG A 1 39  ? -6.485  -21.972 6.088   1.00 0.00 ? 39  ARG A HG2  1  
ATOM 665   H HG3  . ARG A 1 39  ? -7.558  -22.488 7.387   1.00 0.00 ? 39  ARG A HG3  1  
ATOM 666   H HD2  . ARG A 1 39  ? -8.159  -22.541 4.331   1.00 0.00 ? 39  ARG A HD2  1  
ATOM 667   H HD3  . ARG A 1 39  ? -7.798  -23.968 5.380   1.00 0.00 ? 39  ARG A HD3  1  
ATOM 668   H HE   . ARG A 1 39  ? -9.954  -23.060 6.707   1.00 0.00 ? 39  ARG A HE   1  
ATOM 669   H HH11 . ARG A 1 39  ? -9.536  -23.272 3.157   1.00 0.00 ? 39  ARG A HH11 1  
ATOM 670   H HH12 . ARG A 1 39  ? -11.226 -23.494 2.846   1.00 0.00 ? 39  ARG A HH12 1  
ATOM 671   H HH21 . ARG A 1 39  ? -12.209 -23.358 6.257   1.00 0.00 ? 39  ARG A HH21 1  
ATOM 672   H HH22 . ARG A 1 39  ? -12.759 -23.543 4.625   1.00 0.00 ? 39  ARG A HH22 1  
ATOM 673   N N    . VAL A 1 40  ? -6.206  -18.303 4.715   1.00 0.00 ? 40  VAL A N    1  
ATOM 674   C CA   . VAL A 1 40  ? -5.023  -17.895 3.959   1.00 0.00 ? 40  VAL A CA   1  
ATOM 675   C C    . VAL A 1 40  ? -4.312  -16.839 4.766   1.00 0.00 ? 40  VAL A C    1  
ATOM 676   O O    . VAL A 1 40  ? -4.938  -16.170 5.584   1.00 0.00 ? 40  VAL A O    1  
ATOM 677   C CB   . VAL A 1 40  ? -5.378  -17.417 2.532   1.00 0.00 ? 40  VAL A CB   1  
ATOM 678   C CG1  . VAL A 1 40  ? -6.203  -16.108 2.509   1.00 0.00 ? 40  VAL A CG1  1  
ATOM 679   C CG2  . VAL A 1 40  ? -4.138  -17.328 1.615   1.00 0.00 ? 40  VAL A CG2  1  
ATOM 680   H H    . VAL A 1 40  ? -6.755  -17.599 5.177   1.00 0.00 ? 40  VAL A H    1  
ATOM 681   H HA   . VAL A 1 40  ? -4.344  -18.737 3.884   1.00 0.00 ? 40  VAL A HA   1  
ATOM 682   H HB   . VAL A 1 40  ? -6.033  -18.197 2.085   1.00 0.00 ? 40  VAL A HB   1  
ATOM 683   H HG11 . VAL A 1 40  ? -7.084  -16.183 3.184   1.00 0.00 ? 40  VAL A HG11 1  
ATOM 684   H HG12 . VAL A 1 40  ? -5.570  -15.242 2.798   1.00 0.00 ? 40  VAL A HG12 1  
ATOM 685   H HG13 . VAL A 1 40  ? -6.577  -15.932 1.475   1.00 0.00 ? 40  VAL A HG13 1  
ATOM 686   H HG21 . VAL A 1 40  ? -3.553  -18.271 1.638   1.00 0.00 ? 40  VAL A HG21 1  
ATOM 687   H HG22 . VAL A 1 40  ? -4.474  -17.160 0.570   1.00 0.00 ? 40  VAL A HG22 1  
ATOM 688   H HG23 . VAL A 1 40  ? -3.482  -16.480 1.900   1.00 0.00 ? 40  VAL A HG23 1  
ATOM 689   N N    . HIS A 1 41  ? -2.978  -16.672 4.573   1.00 0.00 ? 41  HIS A N    1  
ATOM 690   C CA   . HIS A 1 41  ? -2.140  -15.738 5.314   1.00 0.00 ? 41  HIS A CA   1  
ATOM 691   C C    . HIS A 1 41  ? -2.119  -14.373 4.640   1.00 0.00 ? 41  HIS A C    1  
ATOM 692   O O    . HIS A 1 41  ? -1.765  -14.246 3.466   1.00 0.00 ? 41  HIS A O    1  
ATOM 693   C CB   . HIS A 1 41  ? -0.706  -16.320 5.464   1.00 0.00 ? 41  HIS A CB   1  
ATOM 694   C CG   . HIS A 1 41  ? 0.162   -15.612 6.466   1.00 0.00 ? 41  HIS A CG   1  
ATOM 695   N ND1  . HIS A 1 41  ? 0.853   -14.436 6.265   1.00 0.00 ? 41  HIS A ND1  1  
ATOM 696   C CD2  . HIS A 1 41  ? 0.342   -15.935 7.769   1.00 0.00 ? 41  HIS A CD2  1  
ATOM 697   C CE1  . HIS A 1 41  ? 1.394   -14.089 7.466   1.00 0.00 ? 41  HIS A CE1  1  
ATOM 698   N NE2  . HIS A 1 41  ? 1.085   -14.962 8.414   1.00 0.00 ? 41  HIS A NE2  1  
ATOM 699   H H    . HIS A 1 41  ? -2.520  -17.214 3.873   1.00 0.00 ? 41  HIS A H    1  
ATOM 700   H HA   . HIS A 1 41  ? -2.533  -15.614 6.317   1.00 0.00 ? 41  HIS A HA   1  
ATOM 701   H HB2  . HIS A 1 41  ? -0.809  -17.361 5.843   1.00 0.00 ? 41  HIS A HB2  1  
ATOM 702   H HB3  . HIS A 1 41  ? -0.196  -16.391 4.488   1.00 0.00 ? 41  HIS A HB3  1  
ATOM 703   H HD1  . HIS A 1 41  ? 1.023   -14.018 5.373   1.00 0.00 ? 41  HIS A HD1  1  
ATOM 704   H HD2  . HIS A 1 41  ? 0.036   -16.845 8.257   1.00 0.00 ? 41  HIS A HD2  1  
ATOM 705   H HE1  . HIS A 1 41  ? 2.026   -13.197 7.593   1.00 0.00 ? 41  HIS A HE1  1  
ATOM 706   N N    . ASN A 1 42  ? -2.490  -13.277 5.364   1.00 0.00 ? 42  ASN A N    1  
ATOM 707   C CA   . ASN A 1 42  ? -2.580  -11.888 4.863   1.00 0.00 ? 42  ASN A CA   1  
ATOM 708   C C    . ASN A 1 42  ? -1.343  -11.304 4.147   1.00 0.00 ? 42  ASN A C    1  
ATOM 709   O O    . ASN A 1 42  ? -1.454  -10.525 3.203   1.00 0.00 ? 42  ASN A O    1  
ATOM 710   C CB   . ASN A 1 42  ? -3.023  -10.917 5.997   1.00 0.00 ? 42  ASN A CB   1  
ATOM 711   C CG   . ASN A 1 42  ? -4.537  -10.740 6.015   1.00 0.00 ? 42  ASN A CG   1  
ATOM 712   O OD1  . ASN A 1 42  ? -5.213  -11.161 5.084   1.00 0.00 ? 42  ASN A OD1  1  
ATOM 713   N ND2  . ASN A 1 42  ? -5.059  -10.005 7.021   1.00 0.00 ? 42  ASN A ND2  1  
ATOM 714   H H    . ASN A 1 42  ? -2.790  -13.428 6.307   1.00 0.00 ? 42  ASN A H    1  
ATOM 715   H HA   . ASN A 1 42  ? -3.343  -11.924 4.088   1.00 0.00 ? 42  ASN A HA   1  
ATOM 716   H HB2  . ASN A 1 42  ? -2.680  -11.318 6.980   1.00 0.00 ? 42  ASN A HB2  1  
ATOM 717   H HB3  . ASN A 1 42  ? -2.669  -9.867  5.833   1.00 0.00 ? 42  ASN A HB3  1  
ATOM 718   H HD21 . ASN A 1 42  ? -4.494  -9.725  7.792   1.00 0.00 ? 42  ASN A HD21 1  
ATOM 719   H HD22 . ASN A 1 42  ? -6.042  -9.846  6.989   1.00 0.00 ? 42  ASN A HD22 1  
ATOM 720   N N    . ASN A 1 43  ? -0.107  -11.748 4.540   1.00 0.00 ? 43  ASN A N    1  
ATOM 721   C CA   . ASN A 1 43  ? 1.161   -11.406 3.868   1.00 0.00 ? 43  ASN A CA   1  
ATOM 722   C C    . ASN A 1 43  ? 1.273   -12.054 2.471   1.00 0.00 ? 43  ASN A C    1  
ATOM 723   O O    . ASN A 1 43  ? 1.852   -11.470 1.566   1.00 0.00 ? 43  ASN A O    1  
ATOM 724   C CB   . ASN A 1 43  ? 2.416   -11.671 4.764   1.00 0.00 ? 43  ASN A CB   1  
ATOM 725   C CG   . ASN A 1 43  ? 3.677   -10.859 4.395   1.00 0.00 ? 43  ASN A CG   1  
ATOM 726   O OD1  . ASN A 1 43  ? 4.533   -11.282 3.617   1.00 0.00 ? 43  ASN A OD1  1  
ATOM 727   N ND2  . ASN A 1 43  ? 3.856   -9.668  5.030   1.00 0.00 ? 43  ASN A ND2  1  
ATOM 728   H H    . ASN A 1 43  ? -0.068  -12.376 5.313   1.00 0.00 ? 43  ASN A H    1  
ATOM 729   H HA   . ASN A 1 43  ? 1.137   -10.340 3.684   1.00 0.00 ? 43  ASN A HA   1  
ATOM 730   H HB2  . ASN A 1 43  ? 2.158   -11.415 5.814   1.00 0.00 ? 43  ASN A HB2  1  
ATOM 731   H HB3  . ASN A 1 43  ? 2.702   -12.745 4.744   1.00 0.00 ? 43  ASN A HB3  1  
ATOM 732   H HD21 . ASN A 1 43  ? 3.159   -9.219  5.587   1.00 0.00 ? 43  ASN A HD21 1  
ATOM 733   H HD22 . ASN A 1 43  ? 4.786   -9.320  5.065   1.00 0.00 ? 43  ASN A HD22 1  
ATOM 734   N N    . ILE A 1 44  ? 0.618   -13.232 2.228   1.00 0.00 ? 44  ILE A N    1  
ATOM 735   C CA   . ILE A 1 44  ? 0.498   -13.919 0.932   1.00 0.00 ? 44  ILE A CA   1  
ATOM 736   C C    . ILE A 1 44  ? -0.454  -13.163 0.010   1.00 0.00 ? 44  ILE A C    1  
ATOM 737   O O    . ILE A 1 44  ? -0.212  -13.002 -1.182  1.00 0.00 ? 44  ILE A O    1  
ATOM 738   C CB   . ILE A 1 44  ? 0.051   -15.370 1.087   1.00 0.00 ? 44  ILE A CB   1  
ATOM 739   C CG1  . ILE A 1 44  ? 1.048   -16.066 2.049   1.00 0.00 ? 44  ILE A CG1  1  
ATOM 740   C CG2  . ILE A 1 44  ? -0.053  -16.065 -0.304  1.00 0.00 ? 44  ILE A CG2  1  
ATOM 741   C CD1  . ILE A 1 44  ? 0.825   -17.572 2.122   1.00 0.00 ? 44  ILE A CD1  1  
ATOM 742   H H    . ILE A 1 44  ? 0.083   -13.679 2.948   1.00 0.00 ? 44  ILE A H    1  
ATOM 743   H HA   . ILE A 1 44  ? 1.468   -13.972 0.461   1.00 0.00 ? 44  ILE A HA   1  
ATOM 744   H HB   . ILE A 1 44  ? -0.963  -15.428 1.556   1.00 0.00 ? 44  ILE A HB   1  
ATOM 745   H HG12 . ILE A 1 44  ? 2.092   -15.869 1.726   1.00 0.00 ? 44  ILE A HG12 1  
ATOM 746   H HG13 . ILE A 1 44  ? 0.954   -15.645 3.080   1.00 0.00 ? 44  ILE A HG13 1  
ATOM 747   H HG21 . ILE A 1 44  ? 0.862   -15.860 -0.901  1.00 0.00 ? 44  ILE A HG21 1  
ATOM 748   H HG22 . ILE A 1 44  ? -0.192  -17.160 -0.211  1.00 0.00 ? 44  ILE A HG22 1  
ATOM 749   H HG23 . ILE A 1 44  ? -0.941  -15.707 -0.872  1.00 0.00 ? 44  ILE A HG23 1  
ATOM 750   H HD11 . ILE A 1 44  ? -0.262  -17.786 2.207   1.00 0.00 ? 44  ILE A HD11 1  
ATOM 751   H HD12 . ILE A 1 44  ? 1.204   -18.043 1.190   1.00 0.00 ? 44  ILE A HD12 1  
ATOM 752   H HD13 . ILE A 1 44  ? 1.363   -18.006 2.990   1.00 0.00 ? 44  ILE A HD13 1  
ATOM 753   N N    . VAL A 1 45  ? -1.559  -12.628 0.603   1.00 0.00 ? 45  VAL A N    1  
ATOM 754   C CA   . VAL A 1 45  ? -2.574  -11.812 -0.072  1.00 0.00 ? 45  VAL A CA   1  
ATOM 755   C C    . VAL A 1 45  ? -2.038  -10.400 -0.386  1.00 0.00 ? 45  VAL A C    1  
ATOM 756   O O    . VAL A 1 45  ? -2.232  -9.920  -1.497  1.00 0.00 ? 45  VAL A O    1  
ATOM 757   C CB   . VAL A 1 45  ? -3.915  -11.814 0.679   1.00 0.00 ? 45  VAL A CB   1  
ATOM 758   C CG1  . VAL A 1 45  ? -5.032  -11.175 -0.178  1.00 0.00 ? 45  VAL A CG1  1  
ATOM 759   C CG2  . VAL A 1 45  ? -4.325  -13.265 1.033   1.00 0.00 ? 45  VAL A CG2  1  
ATOM 760   H H    . VAL A 1 45  ? -1.690  -12.796 1.586   1.00 0.00 ? 45  VAL A H    1  
ATOM 761   H HA   . VAL A 1 45  ? -2.765  -12.260 -1.046  1.00 0.00 ? 45  VAL A HA   1  
ATOM 762   H HB   . VAL A 1 45  ? -3.821  -11.251 1.637   1.00 0.00 ? 45  VAL A HB   1  
ATOM 763   H HG11 . VAL A 1 45  ? -5.087  -11.651 -1.179  1.00 0.00 ? 45  VAL A HG11 1  
ATOM 764   H HG12 . VAL A 1 45  ? -6.016  -11.291 0.321   1.00 0.00 ? 45  VAL A HG12 1  
ATOM 765   H HG13 . VAL A 1 45  ? -4.860  -10.089 -0.319  1.00 0.00 ? 45  VAL A HG13 1  
ATOM 766   H HG21 . VAL A 1 45  ? -4.347  -13.908 0.131   1.00 0.00 ? 45  VAL A HG21 1  
ATOM 767   H HG22 . VAL A 1 45  ? -3.645  -13.727 1.777   1.00 0.00 ? 45  VAL A HG22 1  
ATOM 768   H HG23 . VAL A 1 45  ? -5.347  -13.276 1.470   1.00 0.00 ? 45  VAL A HG23 1  
ATOM 769   N N    . TYR A 1 46  ? -1.270  -9.752  0.562   1.00 0.00 ? 46  TYR A N    1  
ATOM 770   C CA   . TYR A 1 46  ? -0.562  -8.442  0.466   1.00 0.00 ? 46  TYR A CA   1  
ATOM 771   C C    . TYR A 1 46  ? 0.492   -8.435  -0.623  1.00 0.00 ? 46  TYR A C    1  
ATOM 772   O O    . TYR A 1 46  ? 0.459   -7.568  -1.479  1.00 0.00 ? 46  TYR A O    1  
ATOM 773   C CB   . TYR A 1 46  ? 0.083   -7.952  1.824   1.00 0.00 ? 46  TYR A CB   1  
ATOM 774   C CG   . TYR A 1 46  ? 0.048   -6.450  2.159   1.00 0.00 ? 46  TYR A CG   1  
ATOM 775   C CD1  . TYR A 1 46  ? 0.051   -5.359  1.282   1.00 0.00 ? 46  TYR A CD1  1  
ATOM 776   C CD2  . TYR A 1 46  ? -0.051  -6.136  3.509   1.00 0.00 ? 46  TYR A CD2  1  
ATOM 777   C CE1  . TYR A 1 46  ? -0.214  -4.078  1.731   1.00 0.00 ? 46  TYR A CE1  1  
ATOM 778   C CE2  . TYR A 1 46  ? -0.517  -4.910  3.914   1.00 0.00 ? 46  TYR A CE2  1  
ATOM 779   C CZ   . TYR A 1 46  ? -0.591  -3.863  3.033   1.00 0.00 ? 46  TYR A CZ   1  
ATOM 780   O OH   . TYR A 1 46  ? -1.052  -2.606  3.479   1.00 0.00 ? 46  TYR A OH   1  
ATOM 781   H H    . TYR A 1 46  ? -1.151  -10.202 1.456   1.00 0.00 ? 46  TYR A H    1  
ATOM 782   H HA   . TYR A 1 46  ? -1.295  -7.708  0.164   1.00 0.00 ? 46  TYR A HA   1  
ATOM 783   H HB2  . TYR A 1 46  ? -0.585  -8.403  2.602   1.00 0.00 ? 46  TYR A HB2  1  
ATOM 784   H HB3  . TYR A 1 46  ? 1.124   -8.333  1.983   1.00 0.00 ? 46  TYR A HB3  1  
ATOM 785   H HD1  . TYR A 1 46  ? 0.222   -5.419  0.221   1.00 0.00 ? 46  TYR A HD1  1  
ATOM 786   H HD2  . TYR A 1 46  ? 0.142   -6.872  4.277   1.00 0.00 ? 46  TYR A HD2  1  
ATOM 787   H HE1  . TYR A 1 46  ? -0.184  -3.257  1.029   1.00 0.00 ? 46  TYR A HE1  1  
ATOM 788   H HE2  . TYR A 1 46  ? -0.848  -4.790  4.938   1.00 0.00 ? 46  TYR A HE2  1  
ATOM 789   H HH   . TYR A 1 46  ? -1.725  -2.312  2.855   1.00 0.00 ? 46  TYR A HH   1  
ATOM 790   N N    . ASN A 1 47  ? 1.404   -9.448  -0.651  1.00 0.00 ? 47  ASN A N    1  
ATOM 791   C CA   . ASN A 1 47  ? 2.466   -9.702  -1.640  1.00 0.00 ? 47  ASN A CA   1  
ATOM 792   C C    . ASN A 1 47  ? 1.922   -10.072 -3.001  1.00 0.00 ? 47  ASN A C    1  
ATOM 793   O O    . ASN A 1 47  ? 2.542   -9.813  -4.026  1.00 0.00 ? 47  ASN A O    1  
ATOM 794   C CB   . ASN A 1 47  ? 3.446   -10.803 -1.152  1.00 0.00 ? 47  ASN A CB   1  
ATOM 795   C CG   . ASN A 1 47  ? 4.371   -10.099 -0.175  1.00 0.00 ? 47  ASN A CG   1  
ATOM 796   O OD1  . ASN A 1 47  ? 5.486   -9.712  -0.520  1.00 0.00 ? 47  ASN A OD1  1  
ATOM 797   N ND2  . ASN A 1 47  ? 3.831   -9.793  1.023   1.00 0.00 ? 47  ASN A ND2  1  
ATOM 798   H H    . ASN A 1 47  ? 1.373   -10.138 0.078   1.00 0.00 ? 47  ASN A H    1  
ATOM 799   H HA   . ASN A 1 47  ? 2.993   -8.752  -1.815  1.00 0.00 ? 47  ASN A HA   1  
ATOM 800   H HB2  . ASN A 1 47  ? 2.903   -11.628 -0.648  1.00 0.00 ? 47  ASN A HB2  1  
ATOM 801   H HB3  . ASN A 1 47  ? 4.079   -11.227 -1.962  1.00 0.00 ? 47  ASN A HB3  1  
ATOM 802   H HD21 . ASN A 1 47  ? 3.091   -10.399 1.360   1.00 0.00 ? 47  ASN A HD21 1  
ATOM 803   H HD22 . ASN A 1 47  ? 3.909   -8.842  1.285   1.00 0.00 ? 47  ASN A HD22 1  
ATOM 804   N N    . GLU A 1 48  ? 0.700   -10.656 -3.023  1.00 0.00 ? 48  GLU A N    1  
ATOM 805   C CA   . GLU A 1 48  ? -0.074  -10.953 -4.243  1.00 0.00 ? 48  GLU A CA   1  
ATOM 806   C C    . GLU A 1 48  ? -0.704  -9.689  -4.848  1.00 0.00 ? 48  GLU A C    1  
ATOM 807   O O    . GLU A 1 48  ? -0.532  -9.392  -6.031  1.00 0.00 ? 48  GLU A O    1  
ATOM 808   C CB   . GLU A 1 48  ? -1.172  -12.035 -4.035  1.00 0.00 ? 48  GLU A CB   1  
ATOM 809   C CG   . GLU A 1 48  ? -1.839  -12.468 -5.358  1.00 0.00 ? 48  GLU A CG   1  
ATOM 810   C CD   . GLU A 1 48  ? -2.588  -13.795 -5.258  1.00 0.00 ? 48  GLU A CD   1  
ATOM 811   O OE1  . GLU A 1 48  ? -3.775  -13.836 -5.680  1.00 0.00 ? 48  GLU A OE1  1  
ATOM 812   O OE2  . GLU A 1 48  ? -1.974  -14.792 -4.792  1.00 0.00 ? 48  GLU A OE2  1  
ATOM 813   H H    . GLU A 1 48  ? 0.291   -10.798 -2.115  1.00 0.00 ? 48  GLU A H    1  
ATOM 814   H HA   . GLU A 1 48  ? 0.613   -11.335 -4.988  1.00 0.00 ? 48  GLU A HA   1  
ATOM 815   H HB2  . GLU A 1 48  ? -0.671  -12.919 -3.588  1.00 0.00 ? 48  GLU A HB2  1  
ATOM 816   H HB3  . GLU A 1 48  ? -1.951  -11.693 -3.321  1.00 0.00 ? 48  GLU A HB3  1  
ATOM 817   H HG2  . GLU A 1 48  ? -2.517  -11.678 -5.736  1.00 0.00 ? 48  GLU A HG2  1  
ATOM 818   H HG3  . GLU A 1 48  ? -1.037  -12.586 -6.099  1.00 0.00 ? 48  GLU A HG3  1  
ATOM 819   N N    . TYR A 1 49  ? -1.384  -8.886  -3.973  1.00 0.00 ? 49  TYR A N    1  
ATOM 820   C CA   . TYR A 1 49  ? -2.060  -7.602  -4.179  1.00 0.00 ? 49  TYR A CA   1  
ATOM 821   C C    . TYR A 1 49  ? -1.129  -6.530  -4.755  1.00 0.00 ? 49  TYR A C    1  
ATOM 822   O O    . TYR A 1 49  ? -1.421  -5.953  -5.794  1.00 0.00 ? 49  TYR A O    1  
ATOM 823   C CB   . TYR A 1 49  ? -2.851  -7.239  -2.856  1.00 0.00 ? 49  TYR A CB   1  
ATOM 824   C CG   . TYR A 1 49  ? -2.945  -5.798  -2.454  1.00 0.00 ? 49  TYR A CG   1  
ATOM 825   C CD1  . TYR A 1 49  ? -3.905  -4.936  -2.921  1.00 0.00 ? 49  TYR A CD1  1  
ATOM 826   C CD2  . TYR A 1 49  ? -1.920  -5.292  -1.695  1.00 0.00 ? 49  TYR A CD2  1  
ATOM 827   C CE1  . TYR A 1 49  ? -3.753  -3.587  -2.694  1.00 0.00 ? 49  TYR A CE1  1  
ATOM 828   C CE2  . TYR A 1 49  ? -1.733  -3.948  -1.530  1.00 0.00 ? 49  TYR A CE2  1  
ATOM 829   C CZ   . TYR A 1 49  ? -2.659  -3.076  -2.038  1.00 0.00 ? 49  TYR A CZ   1  
ATOM 830   O OH   . TYR A 1 49  ? -2.521  -1.682  -1.910  1.00 0.00 ? 49  TYR A OH   1  
ATOM 831   H H    . TYR A 1 49  ? -1.484  -9.204  -3.024  1.00 0.00 ? 49  TYR A H    1  
ATOM 832   H HA   . TYR A 1 49  ? -2.833  -7.702  -4.917  1.00 0.00 ? 49  TYR A HA   1  
ATOM 833   H HB2  . TYR A 1 49  ? -3.883  -7.660  -2.922  1.00 0.00 ? 49  TYR A HB2  1  
ATOM 834   H HB3  . TYR A 1 49  ? -2.305  -7.722  -2.017  1.00 0.00 ? 49  TYR A HB3  1  
ATOM 835   H HD1  . TYR A 1 49  ? -4.700  -5.278  -3.569  1.00 0.00 ? 49  TYR A HD1  1  
ATOM 836   H HD2  . TYR A 1 49  ? -1.173  -5.965  -1.323  1.00 0.00 ? 49  TYR A HD2  1  
ATOM 837   H HE1  . TYR A 1 49  ? -4.475  -2.924  -3.112  1.00 0.00 ? 49  TYR A HE1  1  
ATOM 838   H HE2  . TYR A 1 49  ? -0.818  -3.632  -1.057  1.00 0.00 ? 49  TYR A HE2  1  
ATOM 839   H HH   . TYR A 1 49  ? -1.765  -1.393  -2.461  1.00 0.00 ? 49  TYR A HH   1  
ATOM 840   N N    . ILE A 1 50  ? 0.046   -6.274  -4.148  1.00 0.00 ? 50  ILE A N    1  
ATOM 841   C CA   . ILE A 1 50  ? 0.995   -5.243  -4.603  1.00 0.00 ? 50  ILE A CA   1  
ATOM 842   C C    . ILE A 1 50  ? 1.806   -5.434  -5.871  1.00 0.00 ? 50  ILE A C    1  
ATOM 843   O O    . ILE A 1 50  ? 2.538   -4.538  -6.286  1.00 0.00 ? 50  ILE A O    1  
ATOM 844   C CB   . ILE A 1 50  ? 1.995   -4.850  -3.561  1.00 0.00 ? 50  ILE A CB   1  
ATOM 845   C CG1  . ILE A 1 50  ? 2.813   -6.030  -2.986  1.00 0.00 ? 50  ILE A CG1  1  
ATOM 846   C CG2  . ILE A 1 50  ? 1.259   -4.119  -2.468  1.00 0.00 ? 50  ILE A CG2  1  
ATOM 847   C CD1  . ILE A 1 50  ? 3.595   -5.772  -1.693  1.00 0.00 ? 50  ILE A CD1  1  
ATOM 848   H H    . ILE A 1 50  ? 0.255   -6.790  -3.315  1.00 0.00 ? 50  ILE A H    1  
ATOM 849   H HA   . ILE A 1 50  ? 0.415   -4.352  -4.806  1.00 0.00 ? 50  ILE A HA   1  
ATOM 850   H HB   . ILE A 1 50  ? 2.641   -4.069  -4.006  1.00 0.00 ? 50  ILE A HB   1  
ATOM 851   H HG12 . ILE A 1 50  ? 2.064   -6.768  -2.679  1.00 0.00 ? 50  ILE A HG12 1  
ATOM 852   H HG13 . ILE A 1 50  ? 3.466   -6.492  -3.755  1.00 0.00 ? 50  ILE A HG13 1  
ATOM 853   H HG21 . ILE A 1 50  ? 0.505   -3.414  -2.877  1.00 0.00 ? 50  ILE A HG21 1  
ATOM 854   H HG22 . ILE A 1 50  ? 0.788   -4.849  -1.781  1.00 0.00 ? 50  ILE A HG22 1  
ATOM 855   H HG23 . ILE A 1 50  ? 2.020   -3.549  -1.905  1.00 0.00 ? 50  ILE A HG23 1  
ATOM 856   H HD11 . ILE A 1 50  ? 2.914   -5.398  -0.890  1.00 0.00 ? 50  ILE A HD11 1  
ATOM 857   H HD12 . ILE A 1 50  ? 4.024   -6.738  -1.350  1.00 0.00 ? 50  ILE A HD12 1  
ATOM 858   H HD13 . ILE A 1 50  ? 4.436   -5.074  -1.846  1.00 0.00 ? 50  ILE A HD13 1  
ATOM 859   N N    . SER A 1 51  ? 1.671   -6.597  -6.525  1.00 0.00 ? 51  SER A N    1  
ATOM 860   C CA   . SER A 1 51  ? 2.290   -6.965  -7.807  1.00 0.00 ? 51  SER A CA   1  
ATOM 861   C C    . SER A 1 51  ? 1.674   -6.225  -9.030  1.00 0.00 ? 51  SER A C    1  
ATOM 862   O O    . SER A 1 51  ? 2.183   -6.241  -10.146 1.00 0.00 ? 51  SER A O    1  
ATOM 863   C CB   . SER A 1 51  ? 2.353   -8.515  -8.018  1.00 0.00 ? 51  SER A CB   1  
ATOM 864   O OG   . SER A 1 51  ? 1.079   -9.155  -8.160  1.00 0.00 ? 51  SER A OG   1  
ATOM 865   H H    . SER A 1 51  ? 1.118   -7.247  -6.022  1.00 0.00 ? 51  SER A H    1  
ATOM 866   H HA   . SER A 1 51  ? 3.321   -6.639  -7.723  1.00 0.00 ? 51  SER A HA   1  
ATOM 867   H HB2  . SER A 1 51  ? 2.957   -8.743  -8.925  1.00 0.00 ? 51  SER A HB2  1  
ATOM 868   H HB3  . SER A 1 51  ? 2.882   -8.969  -7.150  1.00 0.00 ? 51  SER A HB3  1  
ATOM 869   H HG   . SER A 1 51  ? 0.613   -9.194  -7.297  1.00 0.00 ? 51  SER A HG   1  
ATOM 870   N N    . HIS A 1 52  ? 0.545   -5.527  -8.757  1.00 0.00 ? 52  HIS A N    1  
ATOM 871   C CA   . HIS A 1 52  ? -0.263  -4.648  -9.587  1.00 0.00 ? 52  HIS A CA   1  
ATOM 872   C C    . HIS A 1 52  ? 0.168   -3.169  -9.359  1.00 0.00 ? 52  HIS A C    1  
ATOM 873   O O    . HIS A 1 52  ? 1.301   -2.890  -8.973  1.00 0.00 ? 52  HIS A O    1  
ATOM 874   C CB   . HIS A 1 52  ? -1.744  -4.881  -9.165  1.00 0.00 ? 52  HIS A CB   1  
ATOM 875   C CG   . HIS A 1 52  ? -2.264  -6.306  -9.328  1.00 0.00 ? 52  HIS A CG   1  
ATOM 876   N ND1  . HIS A 1 52  ? -3.151  -6.705  -10.313 1.00 0.00 ? 52  HIS A ND1  1  
ATOM 877   C CD2  . HIS A 1 52  ? -2.113  -7.398  -8.520  1.00 0.00 ? 52  HIS A CD2  1  
ATOM 878   C CE1  . HIS A 1 52  ? -3.497  -7.991  -10.042 1.00 0.00 ? 52  HIS A CE1  1  
ATOM 879   N NE2  . HIS A 1 52  ? -2.897  -8.452  -8.968  1.00 0.00 ? 52  HIS A NE2  1  
ATOM 880   H H    . HIS A 1 52  ? 0.233   -5.605  -7.816  1.00 0.00 ? 52  HIS A H    1  
ATOM 881   H HA   . HIS A 1 52  ? -0.119  -4.891  -10.632 1.00 0.00 ? 52  HIS A HA   1  
ATOM 882   H HB2  . HIS A 1 52  ? -1.798  -4.653  -8.073  1.00 0.00 ? 52  HIS A HB2  1  
ATOM 883   H HB3  . HIS A 1 52  ? -2.447  -4.205  -9.692  1.00 0.00 ? 52  HIS A HB3  1  
ATOM 884   H HD1  . HIS A 1 52  ? -3.494  -6.145  -11.067 1.00 0.00 ? 52  HIS A HD1  1  
ATOM 885   H HD2  . HIS A 1 52  ? -1.505  -7.533  -7.638  1.00 0.00 ? 52  HIS A HD2  1  
ATOM 886   H HE1  . HIS A 1 52  ? -4.224  -8.577  -10.602 1.00 0.00 ? 52  HIS A HE1  1  
ATOM 887   N N    . ARG A 1 53  ? -0.728  -2.147  -9.563  1.00 0.00 ? 53  ARG A N    1  
ATOM 888   C CA   . ARG A 1 53  ? -0.451  -0.704  -9.418  1.00 0.00 ? 53  ARG A CA   1  
ATOM 889   C C    . ARG A 1 53  ? -0.111  -0.206  -8.009  1.00 0.00 ? 53  ARG A C    1  
ATOM 890   O O    . ARG A 1 53  ? 0.743   0.645   -7.775  1.00 0.00 ? 53  ARG A O    1  
ATOM 891   C CB   . ARG A 1 53  ? -1.637  0.123   -10.046 1.00 0.00 ? 53  ARG A CB   1  
ATOM 892   C CG   . ARG A 1 53  ? -2.639  0.870   -9.118  1.00 0.00 ? 53  ARG A CG   1  
ATOM 893   C CD   . ARG A 1 53  ? -3.737  0.065   -8.389  1.00 0.00 ? 53  ARG A CD   1  
ATOM 894   N NE   . ARG A 1 53  ? -4.925  -0.143  -9.292  1.00 0.00 ? 53  ARG A NE   1  
ATOM 895   C CZ   . ARG A 1 53  ? -6.136  0.477   -9.127  1.00 0.00 ? 53  ARG A CZ   1  
ATOM 896   N NH1  . ARG A 1 53  ? -6.341  1.376   -8.122  1.00 0.00 ? 53  ARG A NH1  1  
ATOM 897   N NH2  . ARG A 1 53  ? -7.157  0.185   -9.986  1.00 0.00 ? 53  ARG A NH2  1  
ATOM 898   H H    . ARG A 1 53  ? -1.650  -2.348  -9.876  1.00 0.00 ? 53  ARG A H    1  
ATOM 899   H HA   . ARG A 1 53  ? 0.389   -0.429  -10.017 1.00 0.00 ? 53  ARG A HA   1  
ATOM 900   H HB2  . ARG A 1 53  ? -1.153  0.919   -10.662 1.00 0.00 ? 53  ARG A HB2  1  
ATOM 901   H HB3  . ARG A 1 53  ? -2.196  -0.516  -10.759 1.00 0.00 ? 53  ARG A HB3  1  
ATOM 902   H HG2  . ARG A 1 53  ? -2.031  1.356   -8.331  1.00 0.00 ? 53  ARG A HG2  1  
ATOM 903   H HG3  . ARG A 1 53  ? -3.109  1.689   -9.695  1.00 0.00 ? 53  ARG A HG3  1  
ATOM 904   H HD2  . ARG A 1 53  ? -3.368  -0.937  -8.113  1.00 0.00 ? 53  ARG A HD2  1  
ATOM 905   H HD3  . ARG A 1 53  ? -4.010  0.565   -7.419  1.00 0.00 ? 53  ARG A HD3  1  
ATOM 906   H HE   . ARG A 1 53  ? -4.827  -0.793  -10.046 1.00 0.00 ? 53  ARG A HE   1  
ATOM 907   H HH11 . ARG A 1 53  ? -5.600  1.593   -7.487  1.00 0.00 ? 53  ARG A HH11 1  
ATOM 908   H HH12 . ARG A 1 53  ? -7.234  1.815   -8.019  1.00 0.00 ? 53  ARG A HH12 1  
ATOM 909   H HH21 . ARG A 1 53  ? -7.015  -0.474  -10.725 1.00 0.00 ? 53  ARG A HH21 1  
ATOM 910   H HH22 . ARG A 1 53  ? -8.045  0.631   -9.875  1.00 0.00 ? 53  ARG A HH22 1  
ATOM 911   N N    . GLU A 1 54  ? -0.920  -0.751  -7.092  1.00 0.00 ? 54  GLU A N    1  
ATOM 912   C CA   . GLU A 1 54  ? -1.233  -0.559  -5.698  1.00 0.00 ? 54  GLU A CA   1  
ATOM 913   C C    . GLU A 1 54  ? -0.189  -0.745  -4.642  1.00 0.00 ? 54  GLU A C    1  
ATOM 914   O O    . GLU A 1 54  ? -0.573  -0.819  -3.475  1.00 0.00 ? 54  GLU A O    1  
ATOM 915   C CB   . GLU A 1 54  ? -2.434  -1.481  -5.399  1.00 0.00 ? 54  GLU A CB   1  
ATOM 916   C CG   . GLU A 1 54  ? -2.120  -2.952  -5.723  1.00 0.00 ? 54  GLU A CG   1  
ATOM 917   C CD   . GLU A 1 54  ? -3.368  -3.622  -6.314  1.00 0.00 ? 54  GLU A CD   1  
ATOM 918   O OE1  . GLU A 1 54  ? -3.888  -3.102  -7.338  1.00 0.00 ? 54  GLU A OE1  1  
ATOM 919   O OE2  . GLU A 1 54  ? -3.816  -4.671  -5.792  1.00 0.00 ? 54  GLU A OE2  1  
ATOM 920   H H    . GLU A 1 54  ? -1.535  -1.412  -7.498  1.00 0.00 ? 54  GLU A H    1  
ATOM 921   H HA   . GLU A 1 54  ? -1.570  0.464   -5.592  1.00 0.00 ? 54  GLU A HA   1  
ATOM 922   H HB2  . GLU A 1 54  ? -2.819  -1.383  -4.365  1.00 0.00 ? 54  GLU A HB2  1  
ATOM 923   H HB3  . GLU A 1 54  ? -3.275  -1.120  -6.026  1.00 0.00 ? 54  GLU A HB3  1  
ATOM 924   H HG2  . GLU A 1 54  ? -1.293  -3.022  -6.463  1.00 0.00 ? 54  GLU A HG2  1  
ATOM 925   H HG3  . GLU A 1 54  ? -1.710  -3.457  -4.819  1.00 0.00 ? 54  GLU A HG3  1  
ATOM 926   N N    . HIS A 1 55  ? 1.120   -0.867  -5.011  1.00 0.00 ? 55  HIS A N    1  
ATOM 927   C CA   . HIS A 1 55  ? 2.286   -1.055  -4.131  1.00 0.00 ? 55  HIS A CA   1  
ATOM 928   C C    . HIS A 1 55  ? 2.408   -0.175  -2.876  1.00 0.00 ? 55  HIS A C    1  
ATOM 929   O O    . HIS A 1 55  ? 3.040   0.877   -2.838  1.00 0.00 ? 55  HIS A O    1  
ATOM 930   C CB   . HIS A 1 55  ? 3.652   -1.175  -4.866  1.00 0.00 ? 55  HIS A CB   1  
ATOM 931   C CG   . HIS A 1 55  ? 4.751   -1.647  -3.929  1.00 0.00 ? 55  HIS A CG   1  
ATOM 932   N ND1  . HIS A 1 55  ? 5.759   -0.834  -3.446  1.00 0.00 ? 55  HIS A ND1  1  
ATOM 933   C CD2  . HIS A 1 55  ? 4.793   -2.776  -3.167  1.00 0.00 ? 55  HIS A CD2  1  
ATOM 934   C CE1  . HIS A 1 55  ? 6.358   -1.503  -2.430  1.00 0.00 ? 55  HIS A CE1  1  
ATOM 935   N NE2  . HIS A 1 55  ? 5.798   -2.675  -2.215  1.00 0.00 ? 55  HIS A NE2  1  
ATOM 936   H H    . HIS A 1 55  ? 1.306   -0.828  -5.995  1.00 0.00 ? 55  HIS A H    1  
ATOM 937   H HA   . HIS A 1 55  ? 2.151   -2.044  -3.741  1.00 0.00 ? 55  HIS A HA   1  
ATOM 938   H HB2  . HIS A 1 55  ? 3.544   -1.947  -5.667  1.00 0.00 ? 55  HIS A HB2  1  
ATOM 939   H HB3  . HIS A 1 55  ? 3.927   -0.193  -5.322  1.00 0.00 ? 55  HIS A HB3  1  
ATOM 940   H HD1  . HIS A 1 55  ? 5.909   0.122   -3.705  1.00 0.00 ? 55  HIS A HD1  1  
ATOM 941   H HD2  . HIS A 1 55  ? 4.119   -3.634  -3.185  1.00 0.00 ? 55  HIS A HD2  1  
ATOM 942   H HE1  . HIS A 1 55  ? 7.181   -1.096  -1.843  1.00 0.00 ? 55  HIS A HE1  1  
ATOM 943   N N    . ILE A 1 56  ? 1.758   -0.710  -1.822  1.00 0.00 ? 56  ILE A N    1  
ATOM 944   C CA   . ILE A 1 56  ? 1.614   -0.294  -0.453  1.00 0.00 ? 56  ILE A CA   1  
ATOM 945   C C    . ILE A 1 56  ? 2.216   -1.416  0.352   1.00 0.00 ? 56  ILE A C    1  
ATOM 946   O O    . ILE A 1 56  ? 2.012   -2.587  0.059   1.00 0.00 ? 56  ILE A O    1  
ATOM 947   C CB   . ILE A 1 56  ? 0.155   -0.174  -0.070  1.00 0.00 ? 56  ILE A CB   1  
ATOM 948   C CG1  . ILE A 1 56  ? -0.415  1.036   -0.822  1.00 0.00 ? 56  ILE A CG1  1  
ATOM 949   C CG2  . ILE A 1 56  ? -0.113  -0.016  1.457   1.00 0.00 ? 56  ILE A CG2  1  
ATOM 950   C CD1  . ILE A 1 56  ? -1.885  1.108   -0.493  1.00 0.00 ? 56  ILE A CD1  1  
ATOM 951   H H    . ILE A 1 56  ? 1.268   -1.558  -1.996  1.00 0.00 ? 56  ILE A H    1  
ATOM 952   H HA   . ILE A 1 56  ? 2.039   0.673   -0.254  1.00 0.00 ? 56  ILE A HA   1  
ATOM 953   H HB   . ILE A 1 56  ? -0.392  -1.084  -0.417  1.00 0.00 ? 56  ILE A HB   1  
ATOM 954   H HG12 . ILE A 1 56  ? 0.098   1.974   -0.517  1.00 0.00 ? 56  ILE A HG12 1  
ATOM 955   H HG13 . ILE A 1 56  ? -0.288  0.928   -1.920  1.00 0.00 ? 56  ILE A HG13 1  
ATOM 956   H HG21 . ILE A 1 56  ? 0.280   -0.851  2.065   1.00 0.00 ? 56  ILE A HG21 1  
ATOM 957   H HG22 . ILE A 1 56  ? 0.335   0.934   1.805   1.00 0.00 ? 56  ILE A HG22 1  
ATOM 958   H HG23 . ILE A 1 56  ? -1.201  0.013   1.673   1.00 0.00 ? 56  ILE A HG23 1  
ATOM 959   H HD11 . ILE A 1 56  ? -2.217  0.052   -0.341  1.00 0.00 ? 56  ILE A HD11 1  
ATOM 960   H HD12 . ILE A 1 56  ? -1.975  1.657   0.473   1.00 0.00 ? 56  ILE A HD12 1  
ATOM 961   H HD13 . ILE A 1 56  ? -2.453  1.559   -1.335  1.00 0.00 ? 56  ILE A HD13 1  
ATOM 962   N N    . HIS A 1 57  ? 2.897   -1.100  1.463   1.00 0.00 ? 57  HIS A N    1  
ATOM 963   C CA   . HIS A 1 57  ? 3.335   -2.085  2.435   1.00 0.00 ? 57  HIS A CA   1  
ATOM 964   C C    . HIS A 1 57  ? 2.449   -1.879  3.655   1.00 0.00 ? 57  HIS A C    1  
ATOM 965   O O    . HIS A 1 57  ? 2.018   -0.753  3.894   1.00 0.00 ? 57  HIS A O    1  
ATOM 966   C CB   . HIS A 1 57  ? 4.824   -1.879  2.802   1.00 0.00 ? 57  HIS A CB   1  
ATOM 967   C CG   . HIS A 1 57  ? 5.523   -3.181  3.080   1.00 0.00 ? 57  HIS A CG   1  
ATOM 968   N ND1  . HIS A 1 57  ? 6.892   -3.324  3.168   1.00 0.00 ? 57  HIS A ND1  1  
ATOM 969   C CD2  . HIS A 1 57  ? 5.007   -4.425  3.292   1.00 0.00 ? 57  HIS A CD2  1  
ATOM 970   C CE1  . HIS A 1 57  ? 7.131   -4.633  3.437   1.00 0.00 ? 57  HIS A CE1  1  
ATOM 971   N NE2  . HIS A 1 57  ? 6.015   -5.327  3.530   1.00 0.00 ? 57  HIS A NE2  1  
ATOM 972   H H    . HIS A 1 57  ? 3.012   -0.144  1.713   1.00 0.00 ? 57  HIS A H    1  
ATOM 973   H HA   . HIS A 1 57  ? 3.197   -3.092  2.047   1.00 0.00 ? 57  HIS A HA   1  
ATOM 974   H HB2  . HIS A 1 57  ? 5.304   -1.409  1.920   1.00 0.00 ? 57  HIS A HB2  1  
ATOM 975   H HB3  . HIS A 1 57  ? 4.981   -1.171  3.649   1.00 0.00 ? 57  HIS A HB3  1  
ATOM 976   H HD1  . HIS A 1 57  ? 7.587   -2.640  2.933   1.00 0.00 ? 57  HIS A HD1  1  
ATOM 977   H HD2  . HIS A 1 57  ? 3.991   -4.801  3.296   1.00 0.00 ? 57  HIS A HD2  1  
ATOM 978   H HE1  . HIS A 1 57  ? 8.129   -5.062  3.522   1.00 0.00 ? 57  HIS A HE1  1  
ATOM 979   N N    . MET A 1 58  ? 2.173   -2.917  4.514   1.00 0.00 ? 58  MET A N    1  
ATOM 980   C CA   . MET A 1 58  ? 1.304   -2.889  5.730   1.00 0.00 ? 58  MET A CA   1  
ATOM 981   C C    . MET A 1 58  ? 1.580   -1.816  6.737   1.00 0.00 ? 58  MET A C    1  
ATOM 982   O O    . MET A 1 58  ? 0.748   -1.356  7.506   1.00 0.00 ? 58  MET A O    1  
ATOM 983   C CB   . MET A 1 58  ? 1.247   -4.264  6.467   1.00 0.00 ? 58  MET A CB   1  
ATOM 984   C CG   . MET A 1 58  ? 2.070   -4.529  7.756   1.00 0.00 ? 58  MET A CG   1  
ATOM 985   S SD   . MET A 1 58  ? 1.485   -3.896  9.371   1.00 0.00 ? 58  MET A SD   1  
ATOM 986   C CE   . MET A 1 58  ? -0.291  -4.242  9.202   1.00 0.00 ? 58  MET A CE   1  
ATOM 987   H H    . MET A 1 58  ? 2.538   -3.811  4.294   1.00 0.00 ? 58  MET A H    1  
ATOM 988   H HA   . MET A 1 58  ? 0.306   -2.674  5.392   1.00 0.00 ? 58  MET A HA   1  
ATOM 989   H HB2  . MET A 1 58  ? 0.185   -4.475  6.702   1.00 0.00 ? 58  MET A HB2  1  
ATOM 990   H HB3  . MET A 1 58  ? 1.543   -5.045  5.732   1.00 0.00 ? 58  MET A HB3  1  
ATOM 991   H HG2  . MET A 1 58  ? 2.032   -5.613  7.859   1.00 0.00 ? 58  MET A HG2  1  
ATOM 992   H HG3  . MET A 1 58  ? 3.138   -4.284  7.593   1.00 0.00 ? 58  MET A HG3  1  
ATOM 993   H HE1  . MET A 1 58  ? -0.472  -5.291  8.898   1.00 0.00 ? 58  MET A HE1  1  
ATOM 994   H HE2  . MET A 1 58  ? -0.818  -4.070  10.163  1.00 0.00 ? 58  MET A HE2  1  
ATOM 995   H HE3  . MET A 1 58  ? -0.770  -3.572  8.457   1.00 0.00 ? 58  MET A HE3  1  
ATOM 996   N N    . ASN A 1 59  ? 2.841   -1.399  6.673   1.00 0.00 ? 59  ASN A N    1  
ATOM 997   C CA   . ASN A 1 59  ? 3.588   -0.456  7.436   1.00 0.00 ? 59  ASN A CA   1  
ATOM 998   C C    . ASN A 1 59  ? 3.169   1.022   7.094   1.00 0.00 ? 59  ASN A C    1  
ATOM 999   O O    . ASN A 1 59  ? 3.419   1.958   7.849   1.00 0.00 ? 59  ASN A O    1  
ATOM 1000  C CB   . ASN A 1 59  ? 5.078   -0.887  7.176   1.00 0.00 ? 59  ASN A CB   1  
ATOM 1001  C CG   . ASN A 1 59  ? 5.199   -2.435  7.307   1.00 0.00 ? 59  ASN A CG   1  
ATOM 1002  O OD1  . ASN A 1 59  ? 5.206   -2.983  8.409   1.00 0.00 ? 59  ASN A OD1  1  
ATOM 1003  N ND2  . ASN A 1 59  ? 5.172   -3.188  6.161   1.00 0.00 ? 59  ASN A ND2  1  
ATOM 1004  H H    . ASN A 1 59  ? 3.388   -1.863  5.980   1.00 0.00 ? 59  ASN A H    1  
ATOM 1005  H HA   . ASN A 1 59  ? 3.341   -0.683  8.474   1.00 0.00 ? 59  ASN A HA   1  
ATOM 1006  H HB2  . ASN A 1 59  ? 5.390   -0.578  6.161   1.00 0.00 ? 59  ASN A HB2  1  
ATOM 1007  H HB3  . ASN A 1 59  ? 5.742   -0.419  7.928   1.00 0.00 ? 59  ASN A HB3  1  
ATOM 1008  H HD21 . ASN A 1 59  ? 5.560   -2.841  5.309   1.00 0.00 ? 59  ASN A HD21 1  
ATOM 1009  H HD22 . ASN A 1 59  ? 4.774   -4.125  6.181   1.00 0.00 ? 59  ASN A HD22 1  
ATOM 1010  N N    . ALA A 1 60  ? 2.424   1.216   5.941   1.00 0.00 ? 60  ALA A N    1  
ATOM 1011  C CA   . ALA A 1 60  ? 1.769   2.452   5.450   1.00 0.00 ? 60  ALA A CA   1  
ATOM 1012  C C    . ALA A 1 60  ? 0.402   2.782   6.103   1.00 0.00 ? 60  ALA A C    1  
ATOM 1013  O O    . ALA A 1 60  ? -0.246  3.790   5.819   1.00 0.00 ? 60  ALA A O    1  
ATOM 1014  C CB   . ALA A 1 60  ? 1.540   2.357   3.916   1.00 0.00 ? 60  ALA A CB   1  
ATOM 1015  H H    . ALA A 1 60  ? 2.277   0.428   5.319   1.00 0.00 ? 60  ALA A H    1  
ATOM 1016  H HA   . ALA A 1 60  ? 2.417   3.294   5.637   1.00 0.00 ? 60  ALA A HA   1  
ATOM 1017  H HB1  . ALA A 1 60  ? 2.487   2.077   3.412   1.00 0.00 ? 60  ALA A HB1  1  
ATOM 1018  H HB2  . ALA A 1 60  ? 0.769   1.597   3.649   1.00 0.00 ? 60  ALA A HB2  1  
ATOM 1019  H HB3  . ALA A 1 60  ? 1.195   3.318   3.480   1.00 0.00 ? 60  ALA A HB3  1  
ATOM 1020  N N    . THR A 1 61  ? -0.048  1.890   7.012   1.00 0.00 ? 61  THR A N    1  
ATOM 1021  C CA   . THR A 1 61  ? -1.311  1.890   7.748   1.00 0.00 ? 61  THR A CA   1  
ATOM 1022  C C    . THR A 1 61  ? -1.107  2.393   9.187   1.00 0.00 ? 61  THR A C    1  
ATOM 1023  O O    . THR A 1 61  ? 0.015   2.569   9.662   1.00 0.00 ? 61  THR A O    1  
ATOM 1024  C CB   . THR A 1 61  ? -1.912  0.455   7.750   1.00 0.00 ? 61  THR A CB   1  
ATOM 1025  O OG1  . THR A 1 61  ? -1.315  -0.437  8.695   1.00 0.00 ? 61  THR A OG1  1  
ATOM 1026  C CG2  . THR A 1 61  ? -1.813  -0.247  6.370   1.00 0.00 ? 61  THR A CG2  1  
ATOM 1027  H H    . THR A 1 61  ? 0.540   1.109   7.219   1.00 0.00 ? 61  THR A H    1  
ATOM 1028  H HA   . THR A 1 61  ? -2.047  2.548   7.288   1.00 0.00 ? 61  THR A HA   1  
ATOM 1029  H HB   . THR A 1 61  ? -2.992  0.529   8.018   1.00 0.00 ? 61  THR A HB   1  
ATOM 1030  H HG1  . THR A 1 61  ? -0.506  -0.827  8.285   1.00 0.00 ? 61  THR A HG1  1  
ATOM 1031  H HG21 . THR A 1 61  ? -0.789  -0.220  5.947   1.00 0.00 ? 61  THR A HG21 1  
ATOM 1032  H HG22 . THR A 1 61  ? -2.037  -1.333  6.478   1.00 0.00 ? 61  THR A HG22 1  
ATOM 1033  H HG23 . THR A 1 61  ? -2.513  0.206   5.641   1.00 0.00 ? 61  THR A HG23 1  
ATOM 1034  N N    . GLN A 1 62  ? -2.217  2.532   9.976   1.00 0.00 ? 62  GLN A N    1  
ATOM 1035  C CA   . GLN A 1 62  ? -2.191  2.863   11.400  1.00 0.00 ? 62  GLN A CA   1  
ATOM 1036  C C    . GLN A 1 62  ? -2.060  1.635   12.297  1.00 0.00 ? 62  GLN A C    1  
ATOM 1037  O O    . GLN A 1 62  ? -2.022  1.723   13.526  1.00 0.00 ? 62  GLN A O    1  
ATOM 1038  C CB   . GLN A 1 62  ? -3.443  3.681   11.802  1.00 0.00 ? 62  GLN A CB   1  
ATOM 1039  C CG   . GLN A 1 62  ? -4.748  2.884   12.004  1.00 0.00 ? 62  GLN A CG   1  
ATOM 1040  C CD   . GLN A 1 62  ? -5.887  3.865   12.238  1.00 0.00 ? 62  GLN A CD   1  
ATOM 1041  O OE1  . GLN A 1 62  ? -5.696  5.082   12.234  1.00 0.00 ? 62  GLN A OE1  1  
ATOM 1042  N NE2  . GLN A 1 62  ? -7.106  3.324   12.480  1.00 0.00 ? 62  GLN A NE2  1  
ATOM 1043  H H    . GLN A 1 62  ? -3.132  2.380   9.614   1.00 0.00 ? 62  GLN A H    1  
ATOM 1044  H HA   . GLN A 1 62  ? -1.324  3.479   11.603  1.00 0.00 ? 62  GLN A HA   1  
ATOM 1045  H HB2  . GLN A 1 62  ? -3.223  4.225   12.749  1.00 0.00 ? 62  GLN A HB2  1  
ATOM 1046  H HB3  . GLN A 1 62  ? -3.602  4.454   11.014  1.00 0.00 ? 62  GLN A HB3  1  
ATOM 1047  H HG2  . GLN A 1 62  ? -4.974  2.268   11.102  1.00 0.00 ? 62  GLN A HG2  1  
ATOM 1048  H HG3  . GLN A 1 62  ? -4.676  2.246   12.923  1.00 0.00 ? 62  GLN A HG3  1  
ATOM 1049  H HE21 . GLN A 1 62  ? -7.241  2.339   12.421  1.00 0.00 ? 62  GLN A HE21 1  
ATOM 1050  H HE22 . GLN A 1 62  ? -7.866  3.932   12.695  1.00 0.00 ? 62  GLN A HE22 1  
ATOM 1051  N N    . TRP A 1 63  ? -1.987  0.437   11.658  1.00 0.00 ? 63  TRP A N    1  
ATOM 1052  C CA   . TRP A 1 63  ? -1.807  -0.868  12.248  1.00 0.00 ? 63  TRP A CA   1  
ATOM 1053  C C    . TRP A 1 63  ? -0.293  -1.145  12.284  1.00 0.00 ? 63  TRP A C    1  
ATOM 1054  O O    . TRP A 1 63  ? 0.345   -1.401  11.269  1.00 0.00 ? 63  TRP A O    1  
ATOM 1055  C CB   . TRP A 1 63  ? -2.599  -1.968  11.462  1.00 0.00 ? 63  TRP A CB   1  
ATOM 1056  C CG   . TRP A 1 63  ? -4.030  -1.592  11.018  1.00 0.00 ? 63  TRP A CG   1  
ATOM 1057  C CD1  . TRP A 1 63  ? -5.110  -1.227  11.780  1.00 0.00 ? 63  TRP A CD1  1  
ATOM 1058  C CD2  . TRP A 1 63  ? -4.516  -1.638  9.654   1.00 0.00 ? 63  TRP A CD2  1  
ATOM 1059  N NE1  . TRP A 1 63  ? -6.226  -1.035  10.978  1.00 0.00 ? 63  TRP A NE1  1  
ATOM 1060  C CE2  . TRP A 1 63  ? -5.858  -1.284  9.671   1.00 0.00 ? 63  TRP A CE2  1  
ATOM 1061  C CE3  . TRP A 1 63  ? -3.912  -1.974  8.473   1.00 0.00 ? 63  TRP A CE3  1  
ATOM 1062  C CZ2  . TRP A 1 63  ? -6.586  -1.268  8.517   1.00 0.00 ? 63  TRP A CZ2  1  
ATOM 1063  C CZ3  . TRP A 1 63  ? -4.637  -1.887  7.297   1.00 0.00 ? 63  TRP A CZ3  1  
ATOM 1064  C CH2  . TRP A 1 63  ? -5.973  -1.543  7.312   1.00 0.00 ? 63  TRP A CH2  1  
ATOM 1065  H H    . TRP A 1 63  ? -1.992  0.404   10.656  1.00 0.00 ? 63  TRP A H    1  
ATOM 1066  H HA   . TRP A 1 63  ? -2.187  -0.865  13.259  1.00 0.00 ? 63  TRP A HA   1  
ATOM 1067  H HB2  . TRP A 1 63  ? -2.034  -2.232  10.530  1.00 0.00 ? 63  TRP A HB2  1  
ATOM 1068  H HB3  . TRP A 1 63  ? -2.686  -2.868  12.133  1.00 0.00 ? 63  TRP A HB3  1  
ATOM 1069  H HD1  . TRP A 1 63  ? -5.095  -1.165  12.858  1.00 0.00 ? 63  TRP A HD1  1  
ATOM 1070  H HE1  . TRP A 1 63  ? -7.153  -0.988  11.298  1.00 0.00 ? 63  TRP A HE1  1  
ATOM 1071  H HE3  . TRP A 1 63  ? -2.883  -2.294  8.434   1.00 0.00 ? 63  TRP A HE3  1  
ATOM 1072  H HZ2  . TRP A 1 63  ? -7.629  -1.023  8.522   1.00 0.00 ? 63  TRP A HZ2  1  
ATOM 1073  H HZ3  . TRP A 1 63  ? -4.152  -2.128  6.361   1.00 0.00 ? 63  TRP A HZ3  1  
ATOM 1074  H HH2  . TRP A 1 63  ? -6.558  -1.514  6.390   1.00 0.00 ? 63  TRP A HH2  1  
ATOM 1075  N N    . GLU A 1 64  ? 0.327   -1.064  13.494  1.00 0.00 ? 64  GLU A N    1  
ATOM 1076  C CA   . GLU A 1 64  ? 1.762   -1.232  13.764  1.00 0.00 ? 64  GLU A CA   1  
ATOM 1077  C C    . GLU A 1 64  ? 2.270   -2.668  13.711  1.00 0.00 ? 64  GLU A C    1  
ATOM 1078  O O    . GLU A 1 64  ? 3.466   -2.950  13.743  1.00 0.00 ? 64  GLU A O    1  
ATOM 1079  C CB   . GLU A 1 64  ? 2.150   -0.589  15.115  1.00 0.00 ? 64  GLU A CB   1  
ATOM 1080  C CG   . GLU A 1 64  ? 1.335   -1.192  16.254  1.00 0.00 ? 64  GLU A CG   1  
ATOM 1081  C CD   . GLU A 1 64  ? 1.507   -0.401  17.544  1.00 0.00 ? 64  GLU A CD   1  
ATOM 1082  O OE1  . GLU A 1 64  ? 0.487   0.138   18.051  1.00 0.00 ? 64  GLU A OE1  1  
ATOM 1083  O OE2  . GLU A 1 64  ? 2.661   -0.327  18.045  1.00 0.00 ? 64  GLU A OE2  1  
ATOM 1084  H H    . GLU A 1 64  ? -0.222  -0.809  14.287  1.00 0.00 ? 64  GLU A H    1  
ATOM 1085  H HA   . GLU A 1 64  ? 2.313   -0.682  13.050  1.00 0.00 ? 64  GLU A HA   1  
ATOM 1086  H HB2  . GLU A 1 64  ? 3.233   -0.740  15.333  1.00 0.00 ? 64  GLU A HB2  1  
ATOM 1087  H HB3  . GLU A 1 64  ? 1.951   0.504   15.050  1.00 0.00 ? 64  GLU A HB3  1  
ATOM 1088  H HG2  . GLU A 1 64  ? 0.283   -1.222  15.922  1.00 0.00 ? 64  GLU A HG2  1  
ATOM 1089  H HG3  . GLU A 1 64  ? 1.686   -2.229  16.376  1.00 0.00 ? 64  GLU A HG3  1  
ATOM 1090  N N    . THR A 1 65  ? 1.311   -3.610  13.666  1.00 0.00 ? 65  THR A N    1  
ATOM 1091  C CA   . THR A 1 65  ? 1.480   -5.046  13.642  1.00 0.00 ? 65  THR A CA   1  
ATOM 1092  C C    . THR A 1 65  ? 0.405   -5.503  12.673  1.00 0.00 ? 65  THR A C    1  
ATOM 1093  O O    . THR A 1 65  ? -0.575  -4.785  12.485  1.00 0.00 ? 65  THR A O    1  
ATOM 1094  C CB   . THR A 1 65  ? 1.284   -5.687  15.036  1.00 0.00 ? 65  THR A CB   1  
ATOM 1095  O OG1  . THR A 1 65  ? 0.059   -5.307  15.663  1.00 0.00 ? 65  THR A OG1  1  
ATOM 1096  C CG2  . THR A 1 65  ? 2.404   -5.232  15.986  1.00 0.00 ? 65  THR A CG2  1  
ATOM 1097  H H    . THR A 1 65  ? 0.361   -3.311  13.607  1.00 0.00 ? 65  THR A H    1  
ATOM 1098  H HA   . THR A 1 65  ? 2.447   -5.298  13.236  1.00 0.00 ? 65  THR A HA   1  
ATOM 1099  H HB   . THR A 1 65  ? 1.322   -6.800  14.963  1.00 0.00 ? 65  THR A HB   1  
ATOM 1100  H HG1  . THR A 1 65  ? 0.189   -4.384  15.911  1.00 0.00 ? 65  THR A HG1  1  
ATOM 1101  H HG21 . THR A 1 65  ? 3.397   -5.505  15.572  1.00 0.00 ? 65  THR A HG21 1  
ATOM 1102  H HG22 . THR A 1 65  ? 2.393   -4.130  16.135  1.00 0.00 ? 65  THR A HG22 1  
ATOM 1103  H HG23 . THR A 1 65  ? 2.288   -5.714  16.981  1.00 0.00 ? 65  THR A HG23 1  
ATOM 1104  N N    . LEU A 1 66  ? 0.478   -6.731  12.070  1.00 0.00 ? 66  LEU A N    1  
ATOM 1105  C CA   . LEU A 1 66  ? -0.553  -7.294  11.177  1.00 0.00 ? 66  LEU A CA   1  
ATOM 1106  C C    . LEU A 1 66  ? -1.812  -7.690  11.952  1.00 0.00 ? 66  LEU A C    1  
ATOM 1107  O O    . LEU A 1 66  ? -2.929  -7.627  11.455  1.00 0.00 ? 66  LEU A O    1  
ATOM 1108  C CB   . LEU A 1 66  ? 0.022   -8.486  10.355  1.00 0.00 ? 66  LEU A CB   1  
ATOM 1109  C CG   . LEU A 1 66  ? -0.644  -8.913  9.006   1.00 0.00 ? 66  LEU A CG   1  
ATOM 1110  C CD1  . LEU A 1 66  ? -2.175  -9.071  9.006   1.00 0.00 ? 66  LEU A CD1  1  
ATOM 1111  C CD2  . LEU A 1 66  ? -0.218  -8.040  7.811   1.00 0.00 ? 66  LEU A CD2  1  
ATOM 1112  H H    . LEU A 1 66  ? 1.276   -7.312  12.212  1.00 0.00 ? 66  LEU A H    1  
ATOM 1113  H HA   . LEU A 1 66  ? -0.854  -6.531  10.479  1.00 0.00 ? 66  LEU A HA   1  
ATOM 1114  H HB2  . LEU A 1 66  ? 1.069   -8.199  10.090  1.00 0.00 ? 66  LEU A HB2  1  
ATOM 1115  H HB3  . LEU A 1 66  ? 0.096   -9.386  11.007  1.00 0.00 ? 66  LEU A HB3  1  
ATOM 1116  H HG   . LEU A 1 66  ? -0.228  -9.931  8.790   1.00 0.00 ? 66  LEU A HG   1  
ATOM 1117  H HD11 . LEU A 1 66  ? -2.524  -9.794  9.781   1.00 0.00 ? 66  LEU A HD11 1  
ATOM 1118  H HD12 . LEU A 1 66  ? -2.672  -8.097  9.174   1.00 0.00 ? 66  LEU A HD12 1  
ATOM 1119  H HD13 . LEU A 1 66  ? -2.493  -9.416  8.010   1.00 0.00 ? 66  LEU A HD13 1  
ATOM 1120  H HD21 . LEU A 1 66  ? 0.888   -7.952  7.767   1.00 0.00 ? 66  LEU A HD21 1  
ATOM 1121  H HD22 . LEU A 1 66  ? -0.562  -8.512  6.863   1.00 0.00 ? 66  LEU A HD22 1  
ATOM 1122  H HD23 . LEU A 1 66  ? -0.660  -7.026  7.874   1.00 0.00 ? 66  LEU A HD23 1  
ATOM 1123  N N    . THR A 1 67  ? -1.648  -8.005  13.264  1.00 0.00 ? 67  THR A N    1  
ATOM 1124  C CA   . THR A 1 67  ? -2.549  -8.408  14.321  1.00 0.00 ? 67  THR A CA   1  
ATOM 1125  C C    . THR A 1 67  ? -3.611  -7.383  14.526  1.00 0.00 ? 67  THR A C    1  
ATOM 1126  O O    . THR A 1 67  ? -4.765  -7.764  14.565  1.00 0.00 ? 67  THR A O    1  
ATOM 1127  C CB   . THR A 1 67  ? -1.762  -8.619  15.616  1.00 0.00 ? 67  THR A CB   1  
ATOM 1128  O OG1  . THR A 1 67  ? -0.706  -9.537  15.376  1.00 0.00 ? 67  THR A OG1  1  
ATOM 1129  C CG2  . THR A 1 67  ? -2.668  -9.209  16.700  1.00 0.00 ? 67  THR A CG2  1  
ATOM 1130  H H    . THR A 1 67  ? -0.762  -7.968  13.659  1.00 0.00 ? 67  THR A H    1  
ATOM 1131  H HA   . THR A 1 67  ? -3.072  -9.325  14.023  1.00 0.00 ? 67  THR A HA   1  
ATOM 1132  H HB   . THR A 1 67  ? -1.289  -7.676  15.982  1.00 0.00 ? 67  THR A HB   1  
ATOM 1133  H HG1  . THR A 1 67  ? -1.147  -10.343 15.075  1.00 0.00 ? 67  THR A HG1  1  
ATOM 1134  H HG21 . THR A 1 67  ? -3.372  -9.918  16.217  1.00 0.00 ? 67  THR A HG21 1  
ATOM 1135  H HG22 . THR A 1 67  ? -2.084  -9.737  17.483  1.00 0.00 ? 67  THR A HG22 1  
ATOM 1136  H HG23 . THR A 1 67  ? -3.276  -8.420  17.190  1.00 0.00 ? 67  THR A HG23 1  
ATOM 1137  N N    . ASP A 1 68  ? -3.262  -6.073  14.524  1.00 0.00 ? 68  ASP A N    1  
ATOM 1138  C CA   . ASP A 1 68  ? -4.161  -4.922  14.587  1.00 0.00 ? 68  ASP A CA   1  
ATOM 1139  C C    . ASP A 1 68  ? -4.984  -4.628  13.334  1.00 0.00 ? 68  ASP A C    1  
ATOM 1140  O O    . ASP A 1 68  ? -6.089  -4.098  13.425  1.00 0.00 ? 68  ASP A O    1  
ATOM 1141  C CB   . ASP A 1 68  ? -3.389  -3.658  15.078  1.00 0.00 ? 68  ASP A CB   1  
ATOM 1142  C CG   . ASP A 1 68  ? -4.150  -2.925  16.186  1.00 0.00 ? 68  ASP A CG   1  
ATOM 1143  O OD1  . ASP A 1 68  ? -3.648  -2.918  17.342  1.00 0.00 ? 68  ASP A OD1  1  
ATOM 1144  O OD2  . ASP A 1 68  ? -5.237  -2.360  15.891  1.00 0.00 ? 68  ASP A OD2  1  
ATOM 1145  H H    . ASP A 1 68  ? -2.296  -5.826  14.430  1.00 0.00 ? 68  ASP A H    1  
ATOM 1146  H HA   . ASP A 1 68  ? -4.934  -5.249  15.280  1.00 0.00 ? 68  ASP A HA   1  
ATOM 1147  H HB2  . ASP A 1 68  ? -2.405  -3.999  15.474  1.00 0.00 ? 68  ASP A HB2  1  
ATOM 1148  H HB3  . ASP A 1 68  ? -3.157  -2.947  14.259  1.00 0.00 ? 68  ASP A HB3  1  
ATOM 1149  N N    . PHE A 1 69  ? -4.480  -5.027  12.129  1.00 0.00 ? 69  PHE A N    1  
ATOM 1150  C CA   . PHE A 1 69  ? -5.171  -4.991  10.829  1.00 0.00 ? 69  PHE A CA   1  
ATOM 1151  C C    . PHE A 1 69  ? -6.216  -6.108  10.796  1.00 0.00 ? 69  PHE A C    1  
ATOM 1152  O O    . PHE A 1 69  ? -7.334  -5.942  10.314  1.00 0.00 ? 69  PHE A O    1  
ATOM 1153  C CB   . PHE A 1 69  ? -4.125  -5.114  9.668   1.00 0.00 ? 69  PHE A CB   1  
ATOM 1154  C CG   . PHE A 1 69  ? -4.644  -5.362  8.255   1.00 0.00 ? 69  PHE A CG   1  
ATOM 1155  C CD1  . PHE A 1 69  ? -5.838  -4.840  7.780   1.00 0.00 ? 69  PHE A CD1  1  
ATOM 1156  C CD2  . PHE A 1 69  ? -3.940  -6.223  7.434   1.00 0.00 ? 69  PHE A CD2  1  
ATOM 1157  C CE1  . PHE A 1 69  ? -6.346  -5.233  6.559   1.00 0.00 ? 69  PHE A CE1  1  
ATOM 1158  C CE2  . PHE A 1 69  ? -4.466  -6.658  6.236   1.00 0.00 ? 69  PHE A CE2  1  
ATOM 1159  C CZ   . PHE A 1 69  ? -5.683  -6.180  5.804   1.00 0.00 ? 69  PHE A CZ   1  
ATOM 1160  H H    . PHE A 1 69  ? -3.593  -5.488  12.113  1.00 0.00 ? 69  PHE A H    1  
ATOM 1161  H HA   . PHE A 1 69  ? -5.706  -4.055  10.723  1.00 0.00 ? 69  PHE A HA   1  
ATOM 1162  H HB2  . PHE A 1 69  ? -3.516  -4.186  9.667   1.00 0.00 ? 69  PHE A HB2  1  
ATOM 1163  H HB3  . PHE A 1 69  ? -3.430  -5.941  9.906   1.00 0.00 ? 69  PHE A HB3  1  
ATOM 1164  H HD1  . PHE A 1 69  ? -6.414  -4.158  8.391   1.00 0.00 ? 69  PHE A HD1  1  
ATOM 1165  H HD2  . PHE A 1 69  ? -2.983  -6.600  7.755   1.00 0.00 ? 69  PHE A HD2  1  
ATOM 1166  H HE1  . PHE A 1 69  ? -7.295  -4.839  6.222   1.00 0.00 ? 69  PHE A HE1  1  
ATOM 1167  H HE2  . PHE A 1 69  ? -3.921  -7.370  5.632   1.00 0.00 ? 69  PHE A HE2  1  
ATOM 1168  H HZ   . PHE A 1 69  ? -6.092  -6.513  4.859   1.00 0.00 ? 69  PHE A HZ   1  
ATOM 1169  N N    . THR A 1 70  ? -5.866  -7.273  11.405  1.00 0.00 ? 70  THR A N    1  
ATOM 1170  C CA   . THR A 1 70  ? -6.726  -8.440  11.612  1.00 0.00 ? 70  THR A CA   1  
ATOM 1171  C C    . THR A 1 70  ? -7.784  -8.163  12.677  1.00 0.00 ? 70  THR A C    1  
ATOM 1172  O O    . THR A 1 70  ? -8.945  -8.539  12.519  1.00 0.00 ? 70  THR A O    1  
ATOM 1173  C CB   . THR A 1 70  ? -5.932  -9.715  11.821  1.00 0.00 ? 70  THR A CB   1  
ATOM 1174  O OG1  . THR A 1 70  ? -4.714  -9.493  12.468  1.00 0.00 ? 70  THR A OG1  1  
ATOM 1175  C CG2  . THR A 1 70  ? -5.606  -10.303 10.439  1.00 0.00 ? 70  THR A CG2  1  
ATOM 1176  H H    . THR A 1 70  ? -4.948  -7.360  11.816  1.00 0.00 ? 70  THR A H    1  
ATOM 1177  H HA   . THR A 1 70  ? -7.301  -8.598  10.708  1.00 0.00 ? 70  THR A HA   1  
ATOM 1178  H HB   . THR A 1 70  ? -6.398  -10.418 12.517  1.00 0.00 ? 70  THR A HB   1  
ATOM 1179  H HG1  . THR A 1 70  ? -4.925  -8.962  13.258  1.00 0.00 ? 70  THR A HG1  1  
ATOM 1180  H HG21 . THR A 1 70  ? -5.112  -9.520  9.826   1.00 0.00 ? 70  THR A HG21 1  
ATOM 1181  H HG22 . THR A 1 70  ? -4.893  -11.150 10.532  1.00 0.00 ? 70  THR A HG22 1  
ATOM 1182  H HG23 . THR A 1 70  ? -6.522  -10.650 9.922   1.00 0.00 ? 70  THR A HG23 1  
ATOM 1183  N N    . LYS A 1 71  ? -7.406  -7.377  13.744  1.00 0.00 ? 71  LYS A N    1  
ATOM 1184  C CA   . LYS A 1 71  ? -8.378  -6.834  14.725  1.00 0.00 ? 71  LYS A CA   1  
ATOM 1185  C C    . LYS A 1 71  ? -9.429  -5.841  14.153  1.00 0.00 ? 71  LYS A C    1  
ATOM 1186  O O    . LYS A 1 71  ? -10.577 -5.857  14.581  1.00 0.00 ? 71  LYS A O    1  
ATOM 1187  C CB   . LYS A 1 71  ? -7.757  -6.158  15.997  1.00 0.00 ? 71  LYS A CB   1  
ATOM 1188  C CG   . LYS A 1 71  ? -6.754  -6.995  16.823  1.00 0.00 ? 71  LYS A CG   1  
ATOM 1189  C CD   . LYS A 1 71  ? -7.136  -8.477  16.940  1.00 0.00 ? 71  LYS A CD   1  
ATOM 1190  C CE   . LYS A 1 71  ? -6.133  -9.399  17.650  1.00 0.00 ? 71  LYS A CE   1  
ATOM 1191  N NZ   . LYS A 1 71  ? -6.797  -10.636 18.126  1.00 0.00 ? 71  LYS A NZ   1  
ATOM 1192  H H    . LYS A 1 71  ? -6.405  -7.152  13.889  1.00 0.00 ? 71  LYS A H    1  
ATOM 1193  H HA   . LYS A 1 71  ? -8.951  -7.680  15.085  1.00 0.00 ? 71  LYS A HA   1  
ATOM 1194  H HB2  . LYS A 1 71  ? -7.251  -5.204  15.716  1.00 0.00 ? 71  LYS A HB2  1  
ATOM 1195  H HB3  . LYS A 1 71  ? -8.601  -5.926  16.699  1.00 0.00 ? 71  LYS A HB3  1  
ATOM 1196  H HG2  . LYS A 1 71  ? -5.738  -6.895  16.400  1.00 0.00 ? 71  LYS A HG2  1  
ATOM 1197  H HG3  . LYS A 1 71  ? -6.682  -6.553  17.835  1.00 0.00 ? 71  LYS A HG3  1  
ATOM 1198  H HD2  . LYS A 1 71  ? -8.135  -8.535  17.419  1.00 0.00 ? 71  LYS A HD2  1  
ATOM 1199  H HD3  . LYS A 1 71  ? -7.190  -8.865  15.900  1.00 0.00 ? 71  LYS A HD3  1  
ATOM 1200  H HE2  . LYS A 1 71  ? -5.350  -9.702  16.926  1.00 0.00 ? 71  LYS A HE2  1  
ATOM 1201  H HE3  . LYS A 1 71  ? -5.638  -8.938  18.520  1.00 0.00 ? 71  LYS A HE3  1  
ATOM 1202  H HZ1  . LYS A 1 71  ? -7.229  -11.129 17.318  1.00 0.00 ? 71  LYS A HZ1  1  
ATOM 1203  H HZ2  . LYS A 1 71  ? -6.093  -11.257 18.574  1.00 0.00 ? 71  LYS A HZ2  1  
ATOM 1204  H HZ3  . LYS A 1 71  ? -7.533  -10.390 18.818  1.00 0.00 ? 71  LYS A HZ3  1  
ATOM 1205  N N    . TRP A 1 72  ? -9.042  -4.974  13.173  1.00 0.00 ? 72  TRP A N    1  
ATOM 1206  C CA   . TRP A 1 72  ? -9.906  -3.995  12.490  1.00 0.00 ? 72  TRP A CA   1  
ATOM 1207  C C    . TRP A 1 72  ? -10.754 -4.589  11.360  1.00 0.00 ? 72  TRP A C    1  
ATOM 1208  O O    . TRP A 1 72  ? -11.966 -4.428  11.354  1.00 0.00 ? 72  TRP A O    1  
ATOM 1209  C CB   . TRP A 1 72  ? -9.103  -2.736  12.006  1.00 0.00 ? 72  TRP A CB   1  
ATOM 1210  C CG   . TRP A 1 72  ? -9.884  -1.610  11.291  1.00 0.00 ? 72  TRP A CG   1  
ATOM 1211  C CD1  . TRP A 1 72  ? -10.561 -0.535  11.800  1.00 0.00 ? 72  TRP A CD1  1  
ATOM 1212  C CD2  . TRP A 1 72  ? -10.078 -1.565  9.862   1.00 0.00 ? 72  TRP A CD2  1  
ATOM 1213  N NE1  . TRP A 1 72  ? -11.161 0.175   10.776  1.00 0.00 ? 72  TRP A NE1  1  
ATOM 1214  C CE2  . TRP A 1 72  ? -10.853 -0.442  9.577   1.00 0.00 ? 72  TRP A CE2  1  
ATOM 1215  C CE3  . TRP A 1 72  ? -9.648  -2.395  8.866   1.00 0.00 ? 72  TRP A CE3  1  
ATOM 1216  C CZ2  . TRP A 1 72  ? -11.175 -0.117  8.284   1.00 0.00 ? 72  TRP A CZ2  1  
ATOM 1217  C CZ3  . TRP A 1 72  ? -9.956  -2.062  7.570   1.00 0.00 ? 72  TRP A CZ3  1  
ATOM 1218  C CH2  . TRP A 1 72  ? -10.691 -0.931  7.273   1.00 0.00 ? 72  TRP A CH2  1  
ATOM 1219  H H    . TRP A 1 72  ? -8.087  -5.030  12.874  1.00 0.00 ? 72  TRP A H    1  
ATOM 1220  H HA   . TRP A 1 72  ? -10.636 -3.635  13.208  1.00 0.00 ? 72  TRP A HA   1  
ATOM 1221  H HB2  . TRP A 1 72  ? -8.623  -2.300  12.913  1.00 0.00 ? 72  TRP A HB2  1  
ATOM 1222  H HB3  . TRP A 1 72  ? -8.289  -3.082  11.326  1.00 0.00 ? 72  TRP A HB3  1  
ATOM 1223  H HD1  . TRP A 1 72  ? -10.618 -0.284  12.849  1.00 0.00 ? 72  TRP A HD1  1  
ATOM 1224  H HE1  . TRP A 1 72  ? -11.822 0.888   10.893  1.00 0.00 ? 72  TRP A HE1  1  
ATOM 1225  H HE3  . TRP A 1 72  ? -9.030  -3.258  9.060   1.00 0.00 ? 72  TRP A HE3  1  
ATOM 1226  H HZ2  . TRP A 1 72  ? -11.755 0.762   8.046   1.00 0.00 ? 72  TRP A HZ2  1  
ATOM 1227  H HZ3  . TRP A 1 72  ? -9.598  -2.699  6.776   1.00 0.00 ? 72  TRP A HZ3  1  
ATOM 1228  H HH2  . TRP A 1 72  ? -10.865 -0.690  6.228   1.00 0.00 ? 72  TRP A HH2  1  
ATOM 1229  N N    . LEU A 1 73  ? -10.145 -5.282  10.356  1.00 0.00 ? 73  LEU A N    1  
ATOM 1230  C CA   . LEU A 1 73  ? -10.767 -5.926  9.175   1.00 0.00 ? 73  LEU A CA   1  
ATOM 1231  C C    . LEU A 1 73  ? -11.696 -7.099  9.457   1.00 0.00 ? 73  LEU A C    1  
ATOM 1232  O O    . LEU A 1 73  ? -12.734 -7.300  8.824   1.00 0.00 ? 73  LEU A O    1  
ATOM 1233  C CB   . LEU A 1 73  ? -9.642  -6.232  8.171   1.00 0.00 ? 73  LEU A CB   1  
ATOM 1234  C CG   . LEU A 1 73  ? -9.820  -7.232  6.992   1.00 0.00 ? 73  LEU A CG   1  
ATOM 1235  C CD1  . LEU A 1 73  ? -10.080 -6.485  5.685   1.00 0.00 ? 73  LEU A CD1  1  
ATOM 1236  C CD2  . LEU A 1 73  ? -8.532  -8.060  6.835   1.00 0.00 ? 73  LEU A CD2  1  
ATOM 1237  H H    . LEU A 1 73  ? -9.144  -5.403  10.393  1.00 0.00 ? 73  LEU A H    1  
ATOM 1238  H HA   . LEU A 1 73  ? -11.399 -5.181  8.711   1.00 0.00 ? 73  LEU A HA   1  
ATOM 1239  H HB2  . LEU A 1 73  ? -9.331  -5.184  7.857   1.00 0.00 ? 73  LEU A HB2  1  
ATOM 1240  H HB3  . LEU A 1 73  ? -8.819  -6.688  8.752   1.00 0.00 ? 73  LEU A HB3  1  
ATOM 1241  H HG   . LEU A 1 73  ? -10.616 -8.025  7.176   1.00 0.00 ? 73  LEU A HG   1  
ATOM 1242  H HD11 . LEU A 1 73  ? -9.317  -5.686  5.523   1.00 0.00 ? 73  LEU A HD11 1  
ATOM 1243  H HD12 . LEU A 1 73  ? -10.031 -7.173  4.815   1.00 0.00 ? 73  LEU A HD12 1  
ATOM 1244  H HD13 . LEU A 1 73  ? -11.085 -6.029  5.722   1.00 0.00 ? 73  LEU A HD13 1  
ATOM 1245  H HD21 . LEU A 1 73  ? -7.651  -7.397  6.857   1.00 0.00 ? 73  LEU A HD21 1  
ATOM 1246  H HD22 . LEU A 1 73  ? -8.439  -8.772  7.682   1.00 0.00 ? 73  LEU A HD22 1  
ATOM 1247  H HD23 . LEU A 1 73  ? -8.533  -8.626  5.881   1.00 0.00 ? 73  LEU A HD23 1  
ATOM 1248  N N    . GLY A 1 74  ? -11.322 -7.881  10.509  1.00 0.00 ? 74  GLY A N    1  
ATOM 1249  C CA   . GLY A 1 74  ? -12.077 -8.947  11.175  1.00 0.00 ? 74  GLY A CA   1  
ATOM 1250  C C    . GLY A 1 74  ? -13.357 -8.485  11.835  1.00 0.00 ? 74  GLY A C    1  
ATOM 1251  O O    . GLY A 1 74  ? -14.316 -9.216  12.059  1.00 0.00 ? 74  GLY A O    1  
ATOM 1252  H H    . GLY A 1 74  ? -10.450 -7.674  10.966  1.00 0.00 ? 74  GLY A H    1  
ATOM 1253  H HA2  . GLY A 1 74  ? -12.336 -9.667  10.426  1.00 0.00 ? 74  GLY A HA2  1  
ATOM 1254  H HA3  . GLY A 1 74  ? -11.452 -9.355  11.956  1.00 0.00 ? 74  GLY A HA3  1  
ATOM 1255  N N    . ARG A 1 75  ? -13.352 -7.190  12.221  1.00 0.00 ? 75  ARG A N    1  
ATOM 1256  C CA   . ARG A 1 75  ? -14.419 -6.494  12.941  1.00 0.00 ? 75  ARG A CA   1  
ATOM 1257  C C    . ARG A 1 75  ? -15.553 -5.962  12.094  1.00 0.00 ? 75  ARG A C    1  
ATOM 1258  O O    . ARG A 1 75  ? -16.629 -5.649  12.597  1.00 0.00 ? 75  ARG A O    1  
ATOM 1259  C CB   . ARG A 1 75  ? -13.780 -5.315  13.679  1.00 0.00 ? 75  ARG A CB   1  
ATOM 1260  C CG   . ARG A 1 75  ? -13.997 -5.275  15.195  1.00 0.00 ? 75  ARG A CG   1  
ATOM 1261  C CD   . ARG A 1 75  ? -13.311 -4.043  15.805  1.00 0.00 ? 75  ARG A CD   1  
ATOM 1262  N NE   . ARG A 1 75  ? -13.516 -4.029  17.298  1.00 0.00 ? 75  ARG A NE   1  
ATOM 1263  C CZ   . ARG A 1 75  ? -12.680 -4.650  18.190  1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1264  N NH1  . ARG A 1 75  ? -11.577 -5.333  17.768  1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1265  N NH2  . ARG A 1 75  ? -12.959 -4.582  19.525  1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1266  H H    . ARG A 1 75  ? -12.537 -6.633  11.987  1.00 0.00 ? 75  ARG A H    1  
ATOM 1267  H HA   . ARG A 1 75  ? -14.850 -7.125  13.696  1.00 0.00 ? 75  ARG A HA   1  
ATOM 1268  H HB2  . ARG A 1 75  ? -12.711 -5.452  13.450  1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1269  H HB3  . ARG A 1 75  ? -14.033 -4.322  13.264  1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1270  H HG2  . ARG A 1 75  ? -15.089 -5.234  15.406  1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1271  H HG3  . ARG A 1 75  ? -13.586 -6.206  15.645  1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1272  H HD2  . ARG A 1 75  ? -12.226 -4.026  15.560  1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1273  H HD3  . ARG A 1 75  ? -13.774 -3.125  15.381  1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1274  H HE   . ARG A 1 75  ? -14.312 -3.540  17.656  1.00 0.00 ? 75  ARG A HE   1  
ATOM 1275  H HH11 . ARG A 1 75  ? -11.366 -5.386  16.792  1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1276  H HH12 . ARG A 1 75  ? -10.979 -5.778  18.435  1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1277  H HH21 . ARG A 1 75  ? -13.766 -4.083  19.842  1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1278  H HH22 . ARG A 1 75  ? -12.357 -5.030  20.185  1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1279  N N    . GLU A 1 76  ? -15.309 -5.800  10.773  1.00 0.00 ? 76  GLU A N    1  
ATOM 1280  C CA   . GLU A 1 76  ? -16.225 -5.192  9.826   1.00 0.00 ? 76  GLU A CA   1  
ATOM 1281  C C    . GLU A 1 76  ? -17.199 -6.174  9.221   1.00 0.00 ? 76  GLU A C    1  
ATOM 1282  O O    . GLU A 1 76  ? -18.204 -5.773  8.639   1.00 0.00 ? 76  GLU A O    1  
ATOM 1283  C CB   . GLU A 1 76  ? -15.407 -4.492  8.714   1.00 0.00 ? 76  GLU A CB   1  
ATOM 1284  C CG   . GLU A 1 76  ? -14.634 -3.284  9.268   1.00 0.00 ? 76  GLU A CG   1  
ATOM 1285  C CD   . GLU A 1 76  ? -13.809 -2.646  8.157   1.00 0.00 ? 76  GLU A CD   1  
ATOM 1286  O OE1  . GLU A 1 76  ? -12.852 -3.311  7.681   1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1287  O OE2  . GLU A 1 76  ? -14.123 -1.489  7.768   1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1288  H H    . GLU A 1 76  ? -14.408 -6.036  10.411  1.00 0.00 ? 76  GLU A H    1  
ATOM 1289  H HA   . GLU A 1 76  ? -16.823 -4.434  10.319  1.00 0.00 ? 76  GLU A HA   1  
ATOM 1290  H HB2  . GLU A 1 76  ? -14.676 -5.215  8.288   1.00 0.00 ? 76  GLU A HB2  1  
ATOM 1291  H HB3  . GLU A 1 76  ? -16.067 -4.139  7.889   1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1292  H HG2  . GLU A 1 76  ? -15.351 -2.543  9.683   1.00 0.00 ? 76  GLU A HG2  1  
ATOM 1293  H HG3  . GLU A 1 76  ? -13.964 -3.624  10.084  1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1294  N N    . GLY A 1 77  ? -16.897 -7.504  9.317   1.00 0.00 ? 77  GLY A N    1  
ATOM 1295  C CA   . GLY A 1 77  ? -17.768 -8.514  8.710   1.00 0.00 ? 77  GLY A CA   1  
ATOM 1296  C C    . GLY A 1 77  ? -17.305 -8.853  7.324   1.00 0.00 ? 77  GLY A C    1  
ATOM 1297  O O    . GLY A 1 77  ? -18.060 -9.315  6.477   1.00 0.00 ? 77  GLY A O    1  
ATOM 1298  H H    . GLY A 1 77  ? -16.065 -7.832  9.805   1.00 0.00 ? 77  GLY A H    1  
ATOM 1299  H HA2  . GLY A 1 77  ? -17.670 -9.411  9.304   1.00 0.00 ? 77  GLY A HA2  1  
ATOM 1300  H HA3  . GLY A 1 77  ? -18.799 -8.177  8.644   1.00 0.00 ? 77  GLY A HA3  1  
ATOM 1301  N N    . LEU A 1 78  ? -15.986 -8.646  7.090   1.00 0.00 ? 78  LEU A N    1  
ATOM 1302  C CA   . LEU A 1 78  ? -15.313 -8.981  5.841   1.00 0.00 ? 78  LEU A CA   1  
ATOM 1303  C C    . LEU A 1 78  ? -14.419 -10.143 6.053   1.00 0.00 ? 78  LEU A C    1  
ATOM 1304  O O    . LEU A 1 78  ? -14.300 -10.972 5.177   1.00 0.00 ? 78  LEU A O    1  
ATOM 1305  C CB   . LEU A 1 78  ? -14.464 -7.870  5.199   1.00 0.00 ? 78  LEU A CB   1  
ATOM 1306  C CG   . LEU A 1 78  ? -15.058 -6.484  5.452   1.00 0.00 ? 78  LEU A CG   1  
ATOM 1307  C CD1  . LEU A 1 78  ? -13.918 -5.487  5.546   1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1308  C CD2  . LEU A 1 78  ? -16.117 -6.161  4.394   1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1309  H H    . LEU A 1 78  ? -15.449 -8.207  7.807   1.00 0.00 ? 78  LEU A H    1  
ATOM 1310  H HA   . LEU A 1 78  ? -16.040 -9.307  5.102   1.00 0.00 ? 78  LEU A HA   1  
ATOM 1311  H HB2  . LEU A 1 78  ? -13.369 -7.894  5.468   1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1312  H HB3  . LEU A 1 78  ? -14.487 -8.040  4.094   1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1313  H HG   . LEU A 1 78  ? -15.566 -6.427  6.432   1.00 0.00 ? 78  LEU A HG   1  
ATOM 1314  H HD11 . LEU A 1 78  ? -13.306 -5.582  4.629   1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1315  H HD12 . LEU A 1 78  ? -14.291 -4.447  5.635   1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1316  H HD13 . LEU A 1 78  ? -13.276 -5.727  6.422   1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1317  H HD21 . LEU A 1 78  ? -16.498 -7.111  3.920   1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1318  H HD22 . LEU A 1 78  ? -16.971 -5.629  4.858   1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1319  H HD23 . LEU A 1 78  ? -15.678 -5.485  3.631   1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1320  N N    . CYS A 1 79  ? -13.769 -10.269 7.224   1.00 0.00 ? 79  CYS A N    1  
ATOM 1321  C CA   . CYS A 1 79  ? -12.866 -11.372 7.533   1.00 0.00 ? 79  CYS A CA   1  
ATOM 1322  C C    . CYS A 1 79  ? -13.082 -12.073 8.878   1.00 0.00 ? 79  CYS A C    1  
ATOM 1323  O O    . CYS A 1 79  ? -13.544 -11.500 9.856   1.00 0.00 ? 79  CYS A O    1  
ATOM 1324  C CB   . CYS A 1 79  ? -11.392 -10.931 7.386   1.00 0.00 ? 79  CYS A CB   1  
ATOM 1325  S SG   . CYS A 1 79  ? -11.054 -10.125 5.773   1.00 0.00 ? 79  CYS A SG   1  
ATOM 1326  H H    . CYS A 1 79  ? -13.880 -9.548  7.883   1.00 0.00 ? 79  CYS A H    1  
ATOM 1327  H HA   . CYS A 1 79  ? -12.999 -12.139 6.818   1.00 0.00 ? 79  CYS A HA   1  
ATOM 1328  H HB2  . CYS A 1 79  ? -11.182 -10.328 8.300   1.00 0.00 ? 79  CYS A HB2  1  
ATOM 1329  H HB3  . CYS A 1 79  ? -10.708 -11.790 7.375   1.00 0.00 ? 79  CYS A HB3  1  
ATOM 1330  H HG   . CYS A 1 79  ? -9.744  -10.002 5.946   1.00 0.00 ? 79  CYS A HG   1  
ATOM 1331  N N    . LYS A 1 80  ? -12.694 -13.366 8.961   1.00 0.00 ? 80  LYS A N    1  
ATOM 1332  C CA   . LYS A 1 80  ? -12.633 -14.226 10.131  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1333  C C    . LYS A 1 80  ? -11.150 -14.470 10.390  1.00 0.00 ? 80  LYS A C    1  
ATOM 1334  O O    . LYS A 1 80  ? -10.363 -14.499 9.455   1.00 0.00 ? 80  LYS A O    1  
ATOM 1335  C CB   . LYS A 1 80  ? -13.408 -15.570 9.923   1.00 0.00 ? 80  LYS A CB   1  
ATOM 1336  C CG   . LYS A 1 80  ? -14.429 -15.867 11.026  1.00 0.00 ? 80  LYS A CG   1  
ATOM 1337  C CD   . LYS A 1 80  ? -15.608 -14.880 11.035  1.00 0.00 ? 80  LYS A CD   1  
ATOM 1338  C CE   . LYS A 1 80  ? -16.560 -15.053 12.227  1.00 0.00 ? 80  LYS A CE   1  
ATOM 1339  N NZ   . LYS A 1 80  ? -17.182 -16.398 12.234  1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1340  H H    . LYS A 1 80  ? -12.345 -13.882 8.158   1.00 0.00 ? 80  LYS A H    1  
ATOM 1341  H HA   . LYS A 1 80  ? -12.984 -13.636 10.964  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1342  H HB2  . LYS A 1 80  ? -13.915 -15.554 8.927   1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1343  H HB3  . LYS A 1 80  ? -12.726 -16.449 9.848   1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1344  H HG2  . LYS A 1 80  ? -14.823 -16.899 10.879  1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1345  H HG3  . LYS A 1 80  ? -13.913 -15.846 12.010  1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1346  H HD2  . LYS A 1 80  ? -15.229 -13.832 11.041  1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1347  H HD3  . LYS A 1 80  ? -16.174 -15.026 10.088  1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1348  H HE2  . LYS A 1 80  ? -16.012 -14.927 13.184  1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1349  H HE3  . LYS A 1 80  ? -17.380 -14.306 12.173  1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1350  H HZ1  . LYS A 1 80  ? -17.718 -16.536 11.354  1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1351  H HZ2  . LYS A 1 80  ? -16.438 -17.121 12.304  1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1352  H HZ3  . LYS A 1 80  ? -17.824 -16.480 13.048  1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1353  N N    . VAL A 1 81  ? -10.668 -14.571 11.648  1.00 0.00 ? 81  VAL A N    1  
ATOM 1354  C CA   . VAL A 1 81  ? -9.246  -14.663 11.936  1.00 0.00 ? 81  VAL A CA   1  
ATOM 1355  C C    . VAL A 1 81  ? -8.926  -15.728 12.970  1.00 0.00 ? 81  VAL A C    1  
ATOM 1356  O O    . VAL A 1 81  ? -9.655  -15.937 13.939  1.00 0.00 ? 81  VAL A O    1  
ATOM 1357  C CB   . VAL A 1 81  ? -8.699  -13.321 12.432  1.00 0.00 ? 81  VAL A CB   1  
ATOM 1358  C CG1  . VAL A 1 81  ? -8.057  -12.535 11.289  1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1359  C CG2  . VAL A 1 81  ? -9.761  -12.448 13.126  1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1360  H H    . VAL A 1 81  ? -11.230 -14.561 12.464  1.00 0.00 ? 81  VAL A H    1  
ATOM 1361  H HA   . VAL A 1 81  ? -8.675  -14.950 11.061  1.00 0.00 ? 81  VAL A HA   1  
ATOM 1362  H HB   . VAL A 1 81  ? -7.880  -13.480 13.155  1.00 0.00 ? 81  VAL A HB   1  
ATOM 1363  H HG11 . VAL A 1 81  ? -8.605  -12.668 10.335  1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1364  H HG12 . VAL A 1 81  ? -8.055  -11.457 11.559  1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1365  H HG13 . VAL A 1 81  ? -6.993  -12.859 11.187  1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1366  H HG21 . VAL A 1 81  ? -10.288 -13.017 13.918  1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1367  H HG22 . VAL A 1 81  ? -9.253  -11.574 13.591  1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1368  H HG23 . VAL A 1 81  ? -10.486 -12.055 12.382  1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1369  N N    . ASP A 1 82  ? -7.735  -16.369 12.779  1.00 0.00 ? 82  ASP A N    1  
ATOM 1370  C CA   . ASP A 1 82  ? -7.140  -17.348 13.700  1.00 0.00 ? 82  ASP A CA   1  
ATOM 1371  C C    . ASP A 1 82  ? -5.614  -17.220 13.703  1.00 0.00 ? 82  ASP A C    1  
ATOM 1372  O O    . ASP A 1 82  ? -5.010  -16.806 12.713  1.00 0.00 ? 82  ASP A O    1  
ATOM 1373  C CB   . ASP A 1 82  ? -7.488  -18.829 13.341  1.00 0.00 ? 82  ASP A CB   1  
ATOM 1374  C CG   . ASP A 1 82  ? -8.986  -19.102 13.501  1.00 0.00 ? 82  ASP A CG   1  
ATOM 1375  O OD1  . ASP A 1 82  ? -9.479  -19.032 14.659  1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1376  O OD2  . ASP A 1 82  ? -9.654  -19.385 12.471  1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1377  H H    . ASP A 1 82  ? -7.192  -16.156 11.940  1.00 0.00 ? 82  ASP A H    1  
ATOM 1378  H HA   . ASP A 1 82  ? -7.455  -17.112 14.710  1.00 0.00 ? 82  ASP A HA   1  
ATOM 1379  H HB2  . ASP A 1 82  ? -7.192  -19.041 12.290  1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1380  H HB3  . ASP A 1 82  ? -6.950  -19.541 14.007  1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1381  N N    . GLU A 1 83  ? -4.921  -17.596 14.820  1.00 0.00 ? 83  GLU A N    1  
ATOM 1382  C CA   . GLU A 1 83  ? -3.465  -17.560 14.921  1.00 0.00 ? 83  GLU A CA   1  
ATOM 1383  C C    . GLU A 1 83  ? -2.936  -18.949 15.259  1.00 0.00 ? 83  GLU A C    1  
ATOM 1384  O O    . GLU A 1 83  ? -3.501  -19.692 16.066  1.00 0.00 ? 83  GLU A O    1  
ATOM 1385  C CB   . GLU A 1 83  ? -2.950  -16.499 15.926  1.00 0.00 ? 83  GLU A CB   1  
ATOM 1386  C CG   . GLU A 1 83  ? -1.415  -16.310 15.887  1.00 0.00 ? 83  GLU A CG   1  
ATOM 1387  C CD   . GLU A 1 83  ? -0.961  -15.132 16.748  1.00 0.00 ? 83  GLU A CD   1  
ATOM 1388  O OE1  . GLU A 1 83  ? 0.261   -14.824 16.707  1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1389  O OE2  . GLU A 1 83  ? -1.809  -14.529 17.458  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1390  H H    . GLU A 1 83  ? -5.380  -17.952 15.631  1.00 0.00 ? 83  GLU A H    1  
ATOM 1391  H HA   . GLU A 1 83  ? -3.029  -17.289 13.960  1.00 0.00 ? 83  GLU A HA   1  
ATOM 1392  H HB2  . GLU A 1 83  ? -3.418  -15.529 15.638  1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1393  H HB3  . GLU A 1 83  ? -3.284  -16.746 16.957  1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1394  H HG2  . GLU A 1 83  ? -0.910  -17.224 16.266  1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1395  H HG3  . GLU A 1 83  ? -1.098  -16.159 14.827  1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1396  N N    . THR A 1 84  ? -1.810  -19.294 14.579  1.00 0.00 ? 84  THR A N    1  
ATOM 1397  C CA   . THR A 1 84  ? -1.086  -20.554 14.616  1.00 0.00 ? 84  THR A CA   1  
ATOM 1398  C C    . THR A 1 84  ? 0.348   -20.311 14.967  1.00 0.00 ? 84  THR A C    1  
ATOM 1399  O O    . THR A 1 84  ? 0.792   -19.165 15.037  1.00 0.00 ? 84  THR A O    1  
ATOM 1400  C CB   . THR A 1 84  ? -1.078  -21.260 13.223  1.00 0.00 ? 84  THR A CB   1  
ATOM 1401  O OG1  . THR A 1 84  ? -0.303  -20.657 12.196  1.00 0.00 ? 84  THR A OG1  1  
ATOM 1402  C CG2  . THR A 1 84  ? -2.479  -21.300 12.609  1.00 0.00 ? 84  THR A CG2  1  
ATOM 1403  H H    . THR A 1 84  ? -1.398  -18.618 13.956  1.00 0.00 ? 84  THR A H    1  
ATOM 1404  H HA   . THR A 1 84  ? -1.437  -21.206 15.402  1.00 0.00 ? 84  THR A HA   1  
ATOM 1405  H HB   . THR A 1 84  ? -0.596  -22.246 13.378  1.00 0.00 ? 84  THR A HB   1  
ATOM 1406  H HG1  . THR A 1 84  ? -0.951  -20.302 11.576  1.00 0.00 ? 84  THR A HG1  1  
ATOM 1407  H HG21 . THR A 1 84  ? -3.221  -21.711 13.324  1.00 0.00 ? 84  THR A HG21 1  
ATOM 1408  H HG22 . THR A 1 84  ? -2.796  -20.269 12.313  1.00 0.00 ? 84  THR A HG22 1  
ATOM 1409  H HG23 . THR A 1 84  ? -2.480  -21.921 11.687  1.00 0.00 ? 84  THR A HG23 1  
ATOM 1410  N N    . PRO A 1 85  ? 1.143   -21.392 15.133  1.00 0.00 ? 85  PRO A N    1  
ATOM 1411  C CA   . PRO A 1 85  ? 2.579   -21.287 15.176  1.00 0.00 ? 85  PRO A CA   1  
ATOM 1412  C C    . PRO A 1 85  ? 3.315   -20.886 13.879  1.00 0.00 ? 85  PRO A C    1  
ATOM 1413  O O    . PRO A 1 85  ? 4.533   -20.720 13.933  1.00 0.00 ? 85  PRO A O    1  
ATOM 1414  C CB   . PRO A 1 85  ? 3.023   -22.665 15.677  1.00 0.00 ? 85  PRO A CB   1  
ATOM 1415  C CG   . PRO A 1 85  ? 1.799   -23.306 16.322  1.00 0.00 ? 85  PRO A CG   1  
ATOM 1416  C CD   . PRO A 1 85  ? 0.699   -22.762 15.434  1.00 0.00 ? 85  PRO A CD   1  
ATOM 1417  H HA   . PRO A 1 85  ? 2.762   -20.523 15.885  1.00 0.00 ? 85  PRO A HA   1  
ATOM 1418  H HB2  . PRO A 1 85  ? 3.418   -23.331 14.877  1.00 0.00 ? 85  PRO A HB2  1  
ATOM 1419  H HB3  . PRO A 1 85  ? 3.786   -22.464 16.422  1.00 0.00 ? 85  PRO A HB3  1  
ATOM 1420  H HG2  . PRO A 1 85  ? 1.848   -24.414 16.336  1.00 0.00 ? 85  PRO A HG2  1  
ATOM 1421  H HG3  . PRO A 1 85  ? 1.676   -22.927 17.362  1.00 0.00 ? 85  PRO A HG3  1  
ATOM 1422  H HD2  . PRO A 1 85  ? 0.677   -23.358 14.493  1.00 0.00 ? 85  PRO A HD2  1  
ATOM 1423  H HD3  . PRO A 1 85  ? -0.283  -22.819 15.958  1.00 0.00 ? 85  PRO A HD3  1  
ATOM 1424  N N    . LYS A 1 86  ? 2.605   -20.732 12.729  1.00 0.00 ? 86  LYS A N    1  
ATOM 1425  C CA   . LYS A 1 86  ? 3.144   -20.371 11.439  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1426  C C    . LYS A 1 86  ? 2.585   -19.041 10.928  1.00 0.00 ? 86  LYS A C    1  
ATOM 1427  O O    . LYS A 1 86  ? 2.626   -18.771 9.725   1.00 0.00 ? 86  LYS A O    1  
ATOM 1428  C CB   . LYS A 1 86  ? 2.838   -21.483 10.410  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1429  C CG   . LYS A 1 86  ? 3.668   -22.755 10.647  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1430  C CD   . LYS A 1 86  ? 5.184   -22.581 10.446  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1431  C CE   . LYS A 1 86  ? 5.945   -23.914 10.516  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1432  N NZ   . LYS A 1 86  ? 7.398   -23.705 10.319  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1433  H H    . LYS A 1 86  ? 1.611   -20.878 12.713  1.00 0.00 ? 86  LYS A H    1  
ATOM 1434  H HA   . LYS A 1 86  ? 4.215   -20.295 11.510  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1435  H HB2  . LYS A 1 86  ? 1.757   -21.749 10.472  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1436  H HB3  . LYS A 1 86  ? 3.030   -21.132 9.370   1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1437  H HG2  . LYS A 1 86  ? 3.472   -23.159 11.663  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1438  H HG3  . LYS A 1 86  ? 3.317   -23.499 9.911   1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1439  H HD2  . LYS A 1 86  ? 5.362   -22.107 9.454   1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1440  H HD3  . LYS A 1 86  ? 5.588   -21.896 11.226  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1441  H HE2  . LYS A 1 86  ? 5.805   -24.396 11.507  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1442  H HE3  . LYS A 1 86  ? 5.595   -24.610 9.723   1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1443  H HZ1  . LYS A 1 86  ? 7.563   -23.272 9.388   1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1444  H HZ2  . LYS A 1 86  ? 7.761   -23.075 11.063  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1445  H HZ3  . LYS A 1 86  ? 7.890   -24.620 10.368  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1446  N N    . GLY A 1 87  ? 2.003   -18.175 11.808  1.00 0.00 ? 87  GLY A N    1  
ATOM 1447  C CA   . GLY A 1 87  ? 1.495   -16.862 11.402  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1448  C C    . GLY A 1 87  ? 0.085   -16.518 11.788  1.00 0.00 ? 87  GLY A C    1  
ATOM 1449  O O    . GLY A 1 87  ? -0.545  -17.129 12.650  1.00 0.00 ? 87  GLY A O    1  
ATOM 1450  H H    . GLY A 1 87  ? 1.905   -18.398 12.779  1.00 0.00 ? 87  GLY A H    1  
ATOM 1451  H HA2  . GLY A 1 87  ? 2.145   -16.116 11.833  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1452  H HA3  . GLY A 1 87  ? 1.445   -16.814 10.327  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1453  N N    . TRP A 1 88  ? -0.449  -15.500 11.053  1.00 0.00 ? 88  TRP A N    1  
ATOM 1454  C CA   . TRP A 1 88  ? -1.804  -14.955 11.127  1.00 0.00 ? 88  TRP A CA   1  
ATOM 1455  C C    . TRP A 1 88  ? -2.529  -15.370 9.837   1.00 0.00 ? 88  TRP A C    1  
ATOM 1456  O O    . TRP A 1 88  ? -2.176  -15.007 8.711   1.00 0.00 ? 88  TRP A O    1  
ATOM 1457  C CB   . TRP A 1 88  ? -1.830  -13.399 11.352  1.00 0.00 ? 88  TRP A CB   1  
ATOM 1458  C CG   . TRP A 1 88  ? -1.921  -12.959 12.822  1.00 0.00 ? 88  TRP A CG   1  
ATOM 1459  C CD1  . TRP A 1 88  ? -0.943  -12.784 13.761  1.00 0.00 ? 88  TRP A CD1  1  
ATOM 1460  C CD2  . TRP A 1 88  ? -3.164  -12.692 13.499  1.00 0.00 ? 88  TRP A CD2  1  
ATOM 1461  N NE1  . TRP A 1 88  ? -1.505  -12.433 14.980  1.00 0.00 ? 88  TRP A NE1  1  
ATOM 1462  C CE2  . TRP A 1 88  ? -2.876  -12.443 14.839  1.00 0.00 ? 88  TRP A CE2  1  
ATOM 1463  C CE3  . TRP A 1 88  ? -4.445  -12.645 13.045  1.00 0.00 ? 88  TRP A CE3  1  
ATOM 1464  C CZ2  . TRP A 1 88  ? -3.881  -12.234 15.745  1.00 0.00 ? 88  TRP A CZ2  1  
ATOM 1465  C CZ3  . TRP A 1 88  ? -5.437  -12.389 13.961  1.00 0.00 ? 88  TRP A CZ3  1  
ATOM 1466  C CH2  . TRP A 1 88  ? -5.173  -12.205 15.292  1.00 0.00 ? 88  TRP A CH2  1  
ATOM 1467  H H    . TRP A 1 88  ? 0.097   -15.080 10.312  1.00 0.00 ? 88  TRP A H    1  
ATOM 1468  H HA   . TRP A 1 88  ? -2.341  -15.428 11.945  1.00 0.00 ? 88  TRP A HA   1  
ATOM 1469  H HB2  . TRP A 1 88  ? -0.926  -12.945 10.885  1.00 0.00 ? 88  TRP A HB2  1  
ATOM 1470  H HB3  . TRP A 1 88  ? -2.722  -12.949 10.862  1.00 0.00 ? 88  TRP A HB3  1  
ATOM 1471  H HD1  . TRP A 1 88  ? 0.106   -12.930 13.564  1.00 0.00 ? 88  TRP A HD1  1  
ATOM 1472  H HE1  . TRP A 1 88  ? -1.015  -12.295 15.820  1.00 0.00 ? 88  TRP A HE1  1  
ATOM 1473  H HE3  . TRP A 1 88  ? -4.680  -12.671 11.996  1.00 0.00 ? 88  TRP A HE3  1  
ATOM 1474  H HZ2  . TRP A 1 88  ? -3.738  -11.993 16.778  1.00 0.00 ? 88  TRP A HZ2  1  
ATOM 1475  H HZ3  . TRP A 1 88  ? -6.446  -12.266 13.633  1.00 0.00 ? 88  TRP A HZ3  1  
ATOM 1476  H HH2  . TRP A 1 88  ? -5.982  -11.982 15.978  1.00 0.00 ? 88  TRP A HH2  1  
ATOM 1477  N N    . TYR A 1 89  ? -3.590  -16.199 10.014  1.00 0.00 ? 89  TYR A N    1  
ATOM 1478  C CA   . TYR A 1 89  ? -4.398  -16.807 8.978   1.00 0.00 ? 89  TYR A CA   1  
ATOM 1479  C C    . TYR A 1 89  ? -5.771  -16.227 9.124   1.00 0.00 ? 89  TYR A C    1  
ATOM 1480  O O    . TYR A 1 89  ? -6.356  -16.220 10.205  1.00 0.00 ? 89  TYR A O    1  
ATOM 1481  C CB   . TYR A 1 89  ? -4.493  -18.360 9.106   1.00 0.00 ? 89  TYR A CB   1  
ATOM 1482  C CG   . TYR A 1 89  ? -3.129  -18.916 8.836   1.00 0.00 ? 89  TYR A CG   1  
ATOM 1483  C CD1  . TYR A 1 89  ? -2.168  -18.889 9.824   1.00 0.00 ? 89  TYR A CD1  1  
ATOM 1484  C CD2  . TYR A 1 89  ? -2.771  -19.322 7.566   1.00 0.00 ? 89  TYR A CD2  1  
ATOM 1485  C CE1  . TYR A 1 89  ? -0.849  -19.118 9.517   1.00 0.00 ? 89  TYR A CE1  1  
ATOM 1486  C CE2  . TYR A 1 89  ? -1.452  -19.610 7.269   1.00 0.00 ? 89  TYR A CE2  1  
ATOM 1487  C CZ   . TYR A 1 89  ? -0.478  -19.455 8.234   1.00 0.00 ? 89  TYR A CZ   1  
ATOM 1488  O OH   . TYR A 1 89  ? 0.882   -19.588 7.873   1.00 0.00 ? 89  TYR A OH   1  
ATOM 1489  H H    . TYR A 1 89  ? -3.913  -16.451 10.932  1.00 0.00 ? 89  TYR A H    1  
ATOM 1490  H HA   . TYR A 1 89  ? -4.012  -16.547 8.000   1.00 0.00 ? 89  TYR A HA   1  
ATOM 1491  H HB2  . TYR A 1 89  ? -4.814  -18.660 10.129  1.00 0.00 ? 89  TYR A HB2  1  
ATOM 1492  H HB3  . TYR A 1 89  ? -5.194  -18.792 8.357   1.00 0.00 ? 89  TYR A HB3  1  
ATOM 1493  H HD1  . TYR A 1 89  ? -2.435  -18.560 10.820  1.00 0.00 ? 89  TYR A HD1  1  
ATOM 1494  H HD2  . TYR A 1 89  ? -3.522  -19.361 6.787   1.00 0.00 ? 89  TYR A HD2  1  
ATOM 1495  H HE1  . TYR A 1 89  ? -0.131  -18.971 10.307  1.00 0.00 ? 89  TYR A HE1  1  
ATOM 1496  H HE2  . TYR A 1 89  ? -1.174  -19.883 6.261   1.00 0.00 ? 89  TYR A HE2  1  
ATOM 1497  H HH   . TYR A 1 89  ? 1.457   -19.301 8.615   1.00 0.00 ? 89  TYR A HH   1  
ATOM 1498  N N    . ILE A 1 90  ? -6.313  -15.711 8.019   1.00 0.00 ? 90  ILE A N    1  
ATOM 1499  C CA   . ILE A 1 90  ? -7.622  -15.126 7.896   1.00 0.00 ? 90  ILE A CA   1  
ATOM 1500  C C    . ILE A 1 90  ? -8.428  -16.011 6.964   1.00 0.00 ? 90  ILE A C    1  
ATOM 1501  O O    . ILE A 1 90  ? -7.943  -16.476 5.934   1.00 0.00 ? 90  ILE A O    1  
ATOM 1502  C CB   . ILE A 1 90  ? -7.627  -13.653 7.433   1.00 0.00 ? 90  ILE A CB   1  
ATOM 1503  C CG1  . ILE A 1 90  ? -7.508  -13.370 5.905   1.00 0.00 ? 90  ILE A CG1  1  
ATOM 1504  C CG2  . ILE A 1 90  ? -6.477  -12.898 8.130   1.00 0.00 ? 90  ILE A CG2  1  
ATOM 1505  C CD1  . ILE A 1 90  ? -7.976  -11.961 5.515   1.00 0.00 ? 90  ILE A CD1  1  
ATOM 1506  H H    . ILE A 1 90  ? -5.788  -15.759 7.180   1.00 0.00 ? 90  ILE A H    1  
ATOM 1507  H HA   . ILE A 1 90  ? -8.114  -15.132 8.863   1.00 0.00 ? 90  ILE A HA   1  
ATOM 1508  H HB   . ILE A 1 90  ? -8.576  -13.214 7.833   1.00 0.00 ? 90  ILE A HB   1  
ATOM 1509  H HG12 . ILE A 1 90  ? -6.443  -13.504 5.603   1.00 0.00 ? 90  ILE A HG12 1  
ATOM 1510  H HG13 . ILE A 1 90  ? -8.111  -14.056 5.277   1.00 0.00 ? 90  ILE A HG13 1  
ATOM 1511  H HG21 . ILE A 1 90  ? -6.407  -13.156 9.202   1.00 0.00 ? 90  ILE A HG21 1  
ATOM 1512  H HG22 . ILE A 1 90  ? -5.508  -13.135 7.642   1.00 0.00 ? 90  ILE A HG22 1  
ATOM 1513  H HG23 . ILE A 1 90  ? -6.638  -11.806 8.012   1.00 0.00 ? 90  ILE A HG23 1  
ATOM 1514  H HD11 . ILE A 1 90  ? -7.447  -11.194 6.119   1.00 0.00 ? 90  ILE A HD11 1  
ATOM 1515  H HD12 . ILE A 1 90  ? -7.724  -11.763 4.450   1.00 0.00 ? 90  ILE A HD12 1  
ATOM 1516  H HD13 . ILE A 1 90  ? -9.067  -11.884 5.659   1.00 0.00 ? 90  ILE A HD13 1  
ATOM 1517  N N    . GLN A 1 91  ? -9.713  -16.214 7.277   1.00 0.00 ? 91  GLN A N    1  
ATOM 1518  C CA   . GLN A 1 91  ? -10.720 -16.846 6.470   1.00 0.00 ? 91  GLN A CA   1  
ATOM 1519  C C    . GLN A 1 91  ? -11.660 -15.704 6.241   1.00 0.00 ? 91  GLN A C    1  
ATOM 1520  O O    . GLN A 1 91  ? -12.200 -15.158 7.178   1.00 0.00 ? 91  GLN A O    1  
ATOM 1521  C CB   . GLN A 1 91  ? -11.318 -18.102 7.143   1.00 0.00 ? 91  GLN A CB   1  
ATOM 1522  C CG   . GLN A 1 91  ? -12.854 -18.190 7.111   1.00 0.00 ? 91  GLN A CG   1  
ATOM 1523  C CD   . GLN A 1 91  ? -13.353 -19.489 7.722   1.00 0.00 ? 91  GLN A CD   1  
ATOM 1524  O OE1  . GLN A 1 91  ? -13.981 -19.527 8.779   1.00 0.00 ? 91  GLN A OE1  1  
ATOM 1525  N NE2  . GLN A 1 91  ? -13.038 -20.607 7.023   1.00 0.00 ? 91  GLN A NE2  1  
ATOM 1526  H H    . GLN A 1 91  ? -10.069 -15.784 8.113   1.00 0.00 ? 91  GLN A H    1  
ATOM 1527  H HA   . GLN A 1 91  ? -10.392 -17.146 5.507   1.00 0.00 ? 91  GLN A HA   1  
ATOM 1528  H HB2  . GLN A 1 91  ? -10.897 -18.986 6.611   1.00 0.00 ? 91  GLN A HB2  1  
ATOM 1529  H HB3  . GLN A 1 91  ? -10.940 -18.146 8.189   1.00 0.00 ? 91  GLN A HB3  1  
ATOM 1530  H HG2  . GLN A 1 91  ? -13.241 -17.332 7.684   1.00 0.00 ? 91  GLN A HG2  1  
ATOM 1531  H HG3  . GLN A 1 91  ? -13.242 -18.077 6.083   1.00 0.00 ? 91  GLN A HG3  1  
ATOM 1532  H HE21 . GLN A 1 91  ? -12.475 -20.536 6.204   1.00 0.00 ? 91  GLN A HE21 1  
ATOM 1533  H HE22 . GLN A 1 91  ? -13.408 -21.472 7.352   1.00 0.00 ? 91  GLN A HE22 1  
ATOM 1534  N N    . TYR A 1 92  ? -11.875 -15.261 5.009   1.00 0.00 ? 92  TYR A N    1  
ATOM 1535  C CA   . TYR A 1 92  ? -12.750 -14.163 4.640   1.00 0.00 ? 92  TYR A CA   1  
ATOM 1536  C C    . TYR A 1 92  ? -14.249 -14.572 4.660   1.00 0.00 ? 92  TYR A C    1  
ATOM 1537  O O    . TYR A 1 92  ? -14.587 -15.741 4.539   1.00 0.00 ? 92  TYR A O    1  
ATOM 1538  C CB   . TYR A 1 92  ? -12.027 -13.255 3.592   1.00 0.00 ? 92  TYR A CB   1  
ATOM 1539  C CG   . TYR A 1 92  ? -12.889 -12.579 2.584   1.00 0.00 ? 92  TYR A CG   1  
ATOM 1540  C CD1  . TYR A 1 92  ? -13.557 -13.359 1.689   1.00 0.00 ? 92  TYR A CD1  1  
ATOM 1541  C CD2  . TYR A 1 92  ? -13.179 -11.239 2.670   1.00 0.00 ? 92  TYR A CD2  1  
ATOM 1542  C CE1  . TYR A 1 92  ? -14.652 -12.883 1.007   1.00 0.00 ? 92  TYR A CE1  1  
ATOM 1543  C CE2  . TYR A 1 92  ? -14.306 -10.746 2.066   1.00 0.00 ? 92  TYR A CE2  1  
ATOM 1544  C CZ   . TYR A 1 92  ? -15.029 -11.581 1.236   1.00 0.00 ? 92  TYR A CZ   1  
ATOM 1545  O OH   . TYR A 1 92  ? -16.331 -11.282 0.868   1.00 0.00 ? 92  TYR A OH   1  
ATOM 1546  H H    . TYR A 1 92  ? -11.409 -15.699 4.246   1.00 0.00 ? 92  TYR A H    1  
ATOM 1547  H HA   . TYR A 1 92  ? -12.765 -13.439 5.451   1.00 0.00 ? 92  TYR A HA   1  
ATOM 1548  H HB2  . TYR A 1 92  ? -11.522 -12.448 4.166   1.00 0.00 ? 92  TYR A HB2  1  
ATOM 1549  H HB3  . TYR A 1 92  ? -11.208 -13.805 3.098   1.00 0.00 ? 92  TYR A HB3  1  
ATOM 1550  H HD1  . TYR A 1 92  ? -13.302 -14.403 1.679   1.00 0.00 ? 92  TYR A HD1  1  
ATOM 1551  H HD2  . TYR A 1 92  ? -12.659 -10.614 3.383   1.00 0.00 ? 92  TYR A HD2  1  
ATOM 1552  H HE1  . TYR A 1 92  ? -15.300 -13.572 0.453   1.00 0.00 ? 92  TYR A HE1  1  
ATOM 1553  H HE2  . TYR A 1 92  ? -14.648 -9.774  2.414   1.00 0.00 ? 92  TYR A HE2  1  
ATOM 1554  H HH   . TYR A 1 92  ? -16.824 -11.832 1.502   1.00 0.00 ? 92  TYR A HH   1  
ATOM 1555  N N    . ILE A 1 93  ? -15.176 -13.635 4.956   1.00 0.00 ? 93  ILE A N    1  
ATOM 1556  C CA   . ILE A 1 93  ? -16.625 -13.729 5.123   1.00 0.00 ? 93  ILE A CA   1  
ATOM 1557  C C    . ILE A 1 93  ? -17.245 -13.595 3.733   1.00 0.00 ? 93  ILE A C    1  
ATOM 1558  O O    . ILE A 1 93  ? -17.002 -12.599 3.063   1.00 0.00 ? 93  ILE A O    1  
ATOM 1559  C CB   . ILE A 1 93  ? -17.057 -12.479 5.921   1.00 0.00 ? 93  ILE A CB   1  
ATOM 1560  C CG1  . ILE A 1 93  ? -16.406 -12.380 7.326   1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1561  C CG2  . ILE A 1 93  ? -18.588 -12.259 5.928   1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1562  C CD1  . ILE A 1 93  ? -17.157 -12.915 8.522   1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1563  H H    . ILE A 1 93  ? -14.881 -12.685 5.041   1.00 0.00 ? 93  ILE A H    1  
ATOM 1564  H HA   . ILE A 1 93  ? -16.913 -14.661 5.590   1.00 0.00 ? 93  ILE A HA   1  
ATOM 1565  H HB   . ILE A 1 93  ? -16.647 -11.555 5.408   1.00 0.00 ? 93  ILE A HB   1  
ATOM 1566  H HG12 . ILE A 1 93  ? -15.358 -12.722 7.362   1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1567  H HG13 . ILE A 1 93  ? -16.291 -11.298 7.523   1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1568  H HG21 . ILE A 1 93  ? -19.132 -13.202 6.126   1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1569  H HG22 . ILE A 1 93  ? -18.847 -11.522 6.713   1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1570  H HG23 . ILE A 1 93  ? -18.903 -11.801 4.961   1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1571  H HD11 . ILE A 1 93  ? -18.124 -12.383 8.632   1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1572  H HD12 . ILE A 1 93  ? -17.309 -14.008 8.432   1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1573  H HD13 . ILE A 1 93  ? -16.505 -12.692 9.402   1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1574  N N    . ASP A 1 94  ? -18.068 -14.538 3.194   1.00 0.00 ? 94  ASP A N    1  
ATOM 1575  C CA   . ASP A 1 94  ? -18.520 -14.466 1.786   1.00 0.00 ? 94  ASP A CA   1  
ATOM 1576  C C    . ASP A 1 94  ? -19.581 -13.446 1.388   1.00 0.00 ? 94  ASP A C    1  
ATOM 1577  O O    . ASP A 1 94  ? -20.369 -13.696 0.477   1.00 0.00 ? 94  ASP A O    1  
ATOM 1578  C CB   . ASP A 1 94  ? -18.801 -15.847 1.100   1.00 0.00 ? 94  ASP A CB   1  
ATOM 1579  C CG   . ASP A 1 94  ? -20.114 -16.577 1.437   1.00 0.00 ? 94  ASP A CG   1  
ATOM 1580  O OD1  . ASP A 1 94  ? -20.768 -16.230 2.455   1.00 0.00 ? 94  ASP A OD1  1  
ATOM 1581  O OD2  . ASP A 1 94  ? -20.457 -17.519 0.673   1.00 0.00 ? 94  ASP A OD2  1  
ATOM 1582  H H    . ASP A 1 94  ? -18.346 -15.354 3.691   1.00 0.00 ? 94  ASP A H    1  
ATOM 1583  H HA   . ASP A 1 94  ? -17.656 -14.147 1.216   1.00 0.00 ? 94  ASP A HA   1  
ATOM 1584  H HB2  . ASP A 1 94  ? -18.678 -15.666 0.005   1.00 0.00 ? 94  ASP A HB2  1  
ATOM 1585  H HB3  . ASP A 1 94  ? -18.008 -16.564 1.380   1.00 0.00 ? 94  ASP A HB3  1  
ATOM 1586  N N    . ARG A 1 95  ? -19.572 -12.248 2.033   1.00 0.00 ? 95  ARG A N    1  
ATOM 1587  C CA   . ARG A 1 95  ? -20.352 -11.020 1.898   1.00 0.00 ? 95  ARG A CA   1  
ATOM 1588  C C    . ARG A 1 95  ? -21.732 -11.177 1.247   1.00 0.00 ? 95  ARG A C    1  
ATOM 1589  O O    . ARG A 1 95  ? -22.668 -11.708 1.840   1.00 0.00 ? 95  ARG A O    1  
ATOM 1590  C CB   . ARG A 1 95  ? -19.400 -10.014 1.235   1.00 0.00 ? 95  ARG A CB   1  
ATOM 1591  C CG   . ARG A 1 95  ? -18.356 -9.508  2.258   1.00 0.00 ? 95  ARG A CG   1  
ATOM 1592  C CD   . ARG A 1 95  ? -18.868 -8.271  2.990   1.00 0.00 ? 95  ARG A CD   1  
ATOM 1593  N NE   . ARG A 1 95  ? -18.732 -7.085  2.072   1.00 0.00 ? 95  ARG A NE   1  
ATOM 1594  C CZ   . ARG A 1 95  ? -19.147 -5.824  2.405   1.00 0.00 ? 95  ARG A CZ   1  
ATOM 1595  N NH1  . ARG A 1 95  ? -19.704 -5.569  3.624   1.00 0.00 ? 95  ARG A NH1  1  
ATOM 1596  N NH2  . ARG A 1 95  ? -18.992 -4.808  1.505   1.00 0.00 ? 95  ARG A NH2  1  
ATOM 1597  H H    . ARG A 1 95  ? -18.843 -12.150 2.702   1.00 0.00 ? 95  ARG A H    1  
ATOM 1598  H HA   . ARG A 1 95  ? -20.501 -10.629 2.889   1.00 0.00 ? 95  ARG A HA   1  
ATOM 1599  H HB2  . ARG A 1 95  ? -18.872 -10.533 0.404   1.00 0.00 ? 95  ARG A HB2  1  
ATOM 1600  H HB3  . ARG A 1 95  ? -19.926 -9.128  0.816   1.00 0.00 ? 95  ARG A HB3  1  
ATOM 1601  H HG2  . ARG A 1 95  ? -17.996 -10.257 3.003   1.00 0.00 ? 95  ARG A HG2  1  
ATOM 1602  H HG3  . ARG A 1 95  ? -17.420 -9.293  1.731   1.00 0.00 ? 95  ARG A HG3  1  
ATOM 1603  H HD2  . ARG A 1 95  ? -19.941 -8.422  3.232   1.00 0.00 ? 95  ARG A HD2  1  
ATOM 1604  H HD3  . ARG A 1 95  ? -18.269 -8.114  3.910   1.00 0.00 ? 95  ARG A HD3  1  
ATOM 1605  H HE   . ARG A 1 95  ? -18.326 -7.231  1.170   1.00 0.00 ? 95  ARG A HE   1  
ATOM 1606  H HH11 . ARG A 1 95  ? -19.810 -6.308  4.289   1.00 0.00 ? 95  ARG A HH11 1  
ATOM 1607  H HH12 . ARG A 1 95  ? -19.993 -4.641  3.857   1.00 0.00 ? 95  ARG A HH12 1  
ATOM 1608  H HH21 . ARG A 1 95  ? -18.581 -4.991  0.612   1.00 0.00 ? 95  ARG A HH21 1  
ATOM 1609  H HH22 . ARG A 1 95  ? -19.288 -3.882  1.740   1.00 0.00 ? 95  ARG A HH22 1  
ATOM 1610  N N    . ASP A 1 96  ? -21.830 -10.817 -0.047  1.00 0.00 ? 96  ASP A N    1  
ATOM 1611  C CA   . ASP A 1 96  ? -22.890 -11.291 -0.937  1.00 0.00 ? 96  ASP A CA   1  
ATOM 1612  C C    . ASP A 1 96  ? -22.263 -12.357 -1.806  1.00 0.00 ? 96  ASP A C    1  
ATOM 1613  O O    . ASP A 1 96  ? -21.449 -11.968 -2.642  1.00 0.00 ? 96  ASP A O    1  
ATOM 1614  C CB   . ASP A 1 96  ? -23.616 -10.174 -1.725  1.00 0.00 ? 96  ASP A CB   1  
ATOM 1615  C CG   . ASP A 1 96  ? -24.695 -10.653 -2.714  1.00 0.00 ? 96  ASP A CG   1  
ATOM 1616  O OD1  . ASP A 1 96  ? -25.660 -11.321 -2.259  1.00 0.00 ? 96  ASP A OD1  1  
ATOM 1617  O OD2  . ASP A 1 96  ? -24.557 -10.352 -3.929  1.00 0.00 ? 96  ASP A OD2  1  
ATOM 1618  H H    . ASP A 1 96  ? -21.011 -10.433 -0.462  1.00 0.00 ? 96  ASP A H    1  
ATOM 1619  H HA   . ASP A 1 96  ? -23.660 -11.783 -0.367  1.00 0.00 ? 96  ASP A HA   1  
ATOM 1620  H HB2  . ASP A 1 96  ? -24.144 -9.610  -0.933  1.00 0.00 ? 96  ASP A HB2  1  
ATOM 1621  H HB3  . ASP A 1 96  ? -22.885 -9.522  -2.239  1.00 0.00 ? 96  ASP A HB3  1  
ATOM 1622  N N    . PRO A 1 97  ? -22.613 -13.669 -1.753  1.00 0.00 ? 97  PRO A N    1  
ATOM 1623  C CA   . PRO A 1 97  ? -21.930 -14.754 -2.462  1.00 0.00 ? 97  PRO A CA   1  
ATOM 1624  C C    . PRO A 1 97  ? -22.006 -14.673 -3.965  1.00 0.00 ? 97  PRO A C    1  
ATOM 1625  O O    . PRO A 1 97  ? -21.040 -15.018 -4.630  1.00 0.00 ? 97  PRO A O    1  
ATOM 1626  C CB   . PRO A 1 97  ? -22.504 -16.056 -1.933  1.00 0.00 ? 97  PRO A CB   1  
ATOM 1627  C CG   . PRO A 1 97  ? -23.298 -15.667 -0.682  1.00 0.00 ? 97  PRO A CG   1  
ATOM 1628  C CD   . PRO A 1 97  ? -23.616 -14.179 -0.833  1.00 0.00 ? 97  PRO A CD   1  
ATOM 1629  H HA   . PRO A 1 97  ? -20.885 -14.705 -2.201  1.00 0.00 ? 97  PRO A HA   1  
ATOM 1630  H HB2  . PRO A 1 97  ? -23.156 -16.604 -2.664  1.00 0.00 ? 97  PRO A HB2  1  
ATOM 1631  H HB3  . PRO A 1 97  ? -21.622 -16.671 -1.652  1.00 0.00 ? 97  PRO A HB3  1  
ATOM 1632  H HG2  . PRO A 1 97  ? -24.190 -16.302 -0.593  1.00 0.00 ? 97  PRO A HG2  1  
ATOM 1633  H HG3  . PRO A 1 97  ? -22.656 -15.805 0.217   1.00 0.00 ? 97  PRO A HG3  1  
ATOM 1634  H HD2  . PRO A 1 97  ? -24.611 -13.960 -1.276  1.00 0.00 ? 97  PRO A HD2  1  
ATOM 1635  H HD3  . PRO A 1 97  ? -23.560 -13.675 0.163   1.00 0.00 ? 97  PRO A HD3  1  
ATOM 1636  N N    . GLU A 1 98  ? -23.094 -14.088 -4.527  1.00 0.00 ? 98  GLU A N    1  
ATOM 1637  C CA   . GLU A 1 98  ? -23.257 -13.750 -5.936  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1638  C C    . GLU A 1 98  ? -22.236 -12.696 -6.375  1.00 0.00 ? 98  GLU A C    1  
ATOM 1639  O O    . GLU A 1 98  ? -21.823 -12.655 -7.518  1.00 0.00 ? 98  GLU A O    1  
ATOM 1640  C CB   . GLU A 1 98  ? -24.692 -13.276 -6.264  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1641  C CG   . GLU A 1 98  ? -25.783 -14.364 -6.136  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1642  C CD   . GLU A 1 98  ? -26.081 -14.723 -4.679  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1643  O OE1  . GLU A 1 98  ? -25.879 -15.909 -4.306  1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1644  O OE2  . GLU A 1 98  ? -26.516 -13.814 -3.922  1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1645  H H    . GLU A 1 98  ? -23.854 -13.813 -3.944  1.00 0.00 ? 98  GLU A H    1  
ATOM 1646  H HA   . GLU A 1 98  ? -23.060 -14.635 -6.528  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1647  H HB2  . GLU A 1 98  ? -24.947 -12.408 -5.620  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1648  H HB3  . GLU A 1 98  ? -24.734 -12.939 -7.326  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1649  H HG2  . GLU A 1 98  ? -26.720 -13.985 -6.600  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1650  H HG3  . GLU A 1 98  ? -25.463 -15.269 -6.695  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1651  N N    . THR A 1 99  ? -21.693 -11.878 -5.425  1.00 0.00 ? 99  THR A N    1  
ATOM 1652  C CA   . THR A 1 99  ? -20.555 -10.990 -5.671  1.00 0.00 ? 99  THR A CA   1  
ATOM 1653  C C    . THR A 1 99  ? -19.238 -11.774 -5.702  1.00 0.00 ? 99  THR A C    1  
ATOM 1654  O O    . THR A 1 99  ? -18.390 -11.519 -6.541  1.00 0.00 ? 99  THR A O    1  
ATOM 1655  C CB   . THR A 1 99  ? -20.536 -9.766  -4.726  1.00 0.00 ? 99  THR A CB   1  
ATOM 1656  O OG1  . THR A 1 99  ? -20.404 -8.570  -5.479  1.00 0.00 ? 99  THR A OG1  1  
ATOM 1657  C CG2  . THR A 1 99  ? -19.428 -9.733  -3.651  1.00 0.00 ? 99  THR A CG2  1  
ATOM 1658  H H    . THR A 1 99  ? -21.990 -11.931 -4.464  1.00 0.00 ? 99  THR A H    1  
ATOM 1659  H HA   . THR A 1 99  ? -20.667 -10.601 -6.679  1.00 0.00 ? 99  THR A HA   1  
ATOM 1660  H HB   . THR A 1 99  ? -21.522 -9.733  -4.212  1.00 0.00 ? 99  THR A HB   1  
ATOM 1661  H HG1  . THR A 1 99  ? -19.518 -8.595  -5.850  1.00 0.00 ? 99  THR A HG1  1  
ATOM 1662  H HG21 . THR A 1 99  ? -19.352 -10.695 -3.099  1.00 0.00 ? 99  THR A HG21 1  
ATOM 1663  H HG22 . THR A 1 99  ? -18.467 -9.509  -4.156  1.00 0.00 ? 99  THR A HG22 1  
ATOM 1664  H HG23 . THR A 1 99  ? -19.629 -8.935  -2.903  1.00 0.00 ? 99  THR A HG23 1  
ATOM 1665  N N    . ILE A 1 100 ? -19.054 -12.780 -4.795  1.00 0.00 ? 100 ILE A N    1  
ATOM 1666  C CA   . ILE A 1 100 ? -17.912 -13.700 -4.568  1.00 0.00 ? 100 ILE A CA   1  
ATOM 1667  C C    . ILE A 1 100 ? -17.739 -14.631 -5.747  1.00 0.00 ? 100 ILE A C    1  
ATOM 1668  O O    . ILE A 1 100 ? -16.657 -14.690 -6.312  1.00 0.00 ? 100 ILE A O    1  
ATOM 1669  C CB   . ILE A 1 100 ? -18.116 -14.478 -3.264  1.00 0.00 ? 100 ILE A CB   1  
ATOM 1670  C CG1  . ILE A 1 100 ? -18.454 -13.506 -2.116  1.00 0.00 ? 100 ILE A CG1  1  
ATOM 1671  C CG2  . ILE A 1 100 ? -16.844 -15.286 -2.905  1.00 0.00 ? 100 ILE A CG2  1  
ATOM 1672  C CD1  . ILE A 1 100 ? -17.397 -12.457 -1.817  1.00 0.00 ? 100 ILE A CD1  1  
ATOM 1673  H H    . ILE A 1 100 ? -19.829 -12.957 -4.196  1.00 0.00 ? 100 ILE A H    1  
ATOM 1674  H HA   . ILE A 1 100 ? -16.934 -13.205 -4.446  1.00 0.00 ? 100 ILE A HA   1  
ATOM 1675  H HB   . ILE A 1 100 ? -19.011 -15.157 -3.327  1.00 0.00 ? 100 ILE A HB   1  
ATOM 1676  H HG12 . ILE A 1 100 ? -19.411 -12.987 -2.317  1.00 0.00 ? 100 ILE A HG12 1  
ATOM 1677  H HG13 . ILE A 1 100 ? -18.608 -14.116 -1.204  1.00 0.00 ? 100 ILE A HG13 1  
ATOM 1678  H HG21 . ILE A 1 100 ? -15.936 -14.658 -3.041  1.00 0.00 ? 100 ILE A HG21 1  
ATOM 1679  H HG22 . ILE A 1 100 ? -16.886 -15.626 -1.847  1.00 0.00 ? 100 ILE A HG22 1  
ATOM 1680  H HG23 . ILE A 1 100 ? -16.746 -16.187 -3.545  1.00 0.00 ? 100 ILE A HG23 1  
ATOM 1681  H HD11 . ILE A 1 100 ? -17.119 -11.881 -2.719  1.00 0.00 ? 100 ILE A HD11 1  
ATOM 1682  H HD12 . ILE A 1 100 ? -17.793 -11.745 -1.064  1.00 0.00 ? 100 ILE A HD12 1  
ATOM 1683  H HD13 . ILE A 1 100 ? -16.489 -12.935 -1.396  1.00 0.00 ? 100 ILE A HD13 1  
ATOM 1684  N N    . ARG A 1 101 ? -18.832 -15.294 -6.209  1.00 0.00 ? 101 ARG A N    1  
ATOM 1685  C CA   . ARG A 1 101 ? -18.911 -16.196 -7.353  1.00 0.00 ? 101 ARG A CA   1  
ATOM 1686  C C    . ARG A 1 101 ? -18.826 -15.467 -8.722  1.00 0.00 ? 101 ARG A C    1  
ATOM 1687  O O    . ARG A 1 101 ? -18.275 -15.987 -9.692  1.00 0.00 ? 101 ARG A O    1  
ATOM 1688  C CB   . ARG A 1 101 ? -20.148 -17.114 -7.219  1.00 0.00 ? 101 ARG A CB   1  
ATOM 1689  C CG   . ARG A 1 101 ? -20.226 -17.860 -5.858  1.00 0.00 ? 101 ARG A CG   1  
ATOM 1690  C CD   . ARG A 1 101 ? -19.003 -18.731 -5.508  1.00 0.00 ? 101 ARG A CD   1  
ATOM 1691  N NE   . ARG A 1 101 ? -19.314 -19.599 -4.312  1.00 0.00 ? 101 ARG A NE   1  
ATOM 1692  C CZ   . ARG A 1 101 ? -19.305 -19.167 -3.011  1.00 0.00 ? 101 ARG A CZ   1  
ATOM 1693  N NH1  . ARG A 1 101 ? -18.993 -17.879 -2.690  1.00 0.00 ? 101 ARG A NH1  1  
ATOM 1694  N NH2  . ARG A 1 101 ? -19.618 -20.047 -2.014  1.00 0.00 ? 101 ARG A NH2  1  
ATOM 1695  H H    . ARG A 1 101 ? -19.708 -15.195 -5.712  1.00 0.00 ? 101 ARG A H    1  
ATOM 1696  H HA   . ARG A 1 101 ? -18.085 -16.897 -7.291  1.00 0.00 ? 101 ARG A HA   1  
ATOM 1697  H HB2  . ARG A 1 101 ? -21.078 -16.512 -7.317  1.00 0.00 ? 101 ARG A HB2  1  
ATOM 1698  H HB3  . ARG A 1 101 ? -20.142 -17.877 -8.030  1.00 0.00 ? 101 ARG A HB3  1  
ATOM 1699  H HG2  . ARG A 1 101 ? -20.409 -17.149 -5.030  1.00 0.00 ? 101 ARG A HG2  1  
ATOM 1700  H HG3  . ARG A 1 101 ? -21.120 -18.497 -5.866  1.00 0.00 ? 101 ARG A HG3  1  
ATOM 1701  H HD2  . ARG A 1 101 ? -18.778 -19.414 -6.355  1.00 0.00 ? 101 ARG A HD2  1  
ATOM 1702  H HD3  . ARG A 1 101 ? -18.104 -18.110 -5.301  1.00 0.00 ? 101 ARG A HD3  1  
ATOM 1703  H HE   . ARG A 1 101 ? -19.549 -20.555 -4.485  1.00 0.00 ? 101 ARG A HE   1  
ATOM 1704  H HH11 . ARG A 1 101 ? -18.764 -17.227 -3.413  1.00 0.00 ? 101 ARG A HH11 1  
ATOM 1705  H HH12 . ARG A 1 101 ? -18.994 -17.588 -1.734  1.00 0.00 ? 101 ARG A HH12 1  
ATOM 1706  H HH21 . ARG A 1 101 ? -19.849 -20.994 -2.237  1.00 0.00 ? 101 ARG A HH21 1  
ATOM 1707  H HH22 . ARG A 1 101 ? -19.616 -19.743 -1.061  1.00 0.00 ? 101 ARG A HH22 1  
ATOM 1708  N N    . ARG A 1 102 ? -19.303 -14.178 -8.809  1.00 0.00 ? 102 ARG A N    1  
ATOM 1709  C CA   . ARG A 1 102 ? -19.198 -13.299 -9.996  1.00 0.00 ? 102 ARG A CA   1  
ATOM 1710  C C    . ARG A 1 102 ? -17.802 -12.689 -10.113 1.00 0.00 ? 102 ARG A C    1  
ATOM 1711  O O    . ARG A 1 102 ? -17.307 -12.470 -11.215 1.00 0.00 ? 102 ARG A O    1  
ATOM 1712  C CB   . ARG A 1 102 ? -20.258 -12.164 -10.056 1.00 0.00 ? 102 ARG A CB   1  
ATOM 1713  C CG   . ARG A 1 102 ? -21.678 -12.564 -10.542 1.00 0.00 ? 102 ARG A CG   1  
ATOM 1714  C CD   . ARG A 1 102 ? -22.095 -14.035 -10.352 1.00 0.00 ? 102 ARG A CD   1  
ATOM 1715  N NE   . ARG A 1 102 ? -23.560 -14.172 -10.671 1.00 0.00 ? 102 ARG A NE   1  
ATOM 1716  C CZ   . ARG A 1 102 ? -24.350 -15.173 -10.168 1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1717  N NH1  . ARG A 1 102 ? -23.833 -16.129 -9.342  1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1718  N NH2  . ARG A 1 102 ? -25.674 -15.210 -10.496 1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1719  H H    . ARG A 1 102 ? -19.746 -13.762 -8.009  1.00 0.00 ? 102 ARG A H    1  
ATOM 1720  H HA   . ARG A 1 102 ? -19.320 -13.903 -10.885 1.00 0.00 ? 102 ARG A HA   1  
ATOM 1721  H HB2  . ARG A 1 102 ? -20.328 -11.709 -9.044  1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1722  H HB3  . ARG A 1 102 ? -19.947 -11.339 -10.741 1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1723  H HG2  . ARG A 1 102 ? -22.406 -11.910 -10.005 1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1724  H HG3  . ARG A 1 102 ? -21.756 -12.319 -11.621 1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1725  H HD2  . ARG A 1 102 ? -21.523 -14.698 -11.037 1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1726  H HD3  . ARG A 1 102 ? -21.914 -14.345 -9.300  1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1727  H HE   . ARG A 1 102 ? -23.978 -13.491 -11.272 1.00 0.00 ? 102 ARG A HE   1  
ATOM 1728  H HH11 . ARG A 1 102 ? -22.864 -16.106 -9.096  1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1729  H HH12 . ARG A 1 102 ? -24.424 -16.850 -8.982  1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1730  H HH21 . ARG A 1 102 ? -26.060 -14.511 -11.099 1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1731  H HH22 . ARG A 1 102 ? -26.259 -15.935 -10.132 1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1732  N N    . GLN A 1 103 ? -17.110 -12.489 -8.960  1.00 0.00 ? 103 GLN A N    1  
ATOM 1733  C CA   . GLN A 1 103 ? -15.694 -12.120 -8.827  1.00 0.00 ? 103 GLN A CA   1  
ATOM 1734  C C    . GLN A 1 103 ? -14.762 -13.189 -9.395  1.00 0.00 ? 103 GLN A C    1  
ATOM 1735  O O    . GLN A 1 103 ? -14.032 -12.973 -10.358 1.00 0.00 ? 103 GLN A O    1  
ATOM 1736  C CB   . GLN A 1 103 ? -15.472 -11.710 -7.362  1.00 0.00 ? 103 GLN A CB   1  
ATOM 1737  C CG   . GLN A 1 103 ? -15.747 -10.197 -7.257  1.00 0.00 ? 103 GLN A CG   1  
ATOM 1738  C CD   . GLN A 1 103 ? -15.712 -9.678  -5.829  1.00 0.00 ? 103 GLN A CD   1  
ATOM 1739  O OE1  . GLN A 1 103 ? -15.039 -8.704  -5.486  1.00 0.00 ? 103 GLN A OE1  1  
ATOM 1740  N NE2  . GLN A 1 103 ? -16.475 -10.384 -4.965  1.00 0.00 ? 103 GLN A NE2  1  
ATOM 1741  H H    . GLN A 1 103 ? -17.586 -12.656 -8.090  1.00 0.00 ? 103 GLN A H    1  
ATOM 1742  H HA   . GLN A 1 103 ? -15.424 -11.230 -9.345  1.00 0.00 ? 103 GLN A HA   1  
ATOM 1743  H HB2  . GLN A 1 103 ? -16.154 -12.311 -6.728  1.00 0.00 ? 103 GLN A HB2  1  
ATOM 1744  H HB3  . GLN A 1 103 ? -14.475 -11.901 -6.956  1.00 0.00 ? 103 GLN A HB3  1  
ATOM 1745  H HG2  . GLN A 1 103 ? -14.995 -9.627  -7.842  1.00 0.00 ? 103 GLN A HG2  1  
ATOM 1746  H HG3  . GLN A 1 103 ? -16.760 -10.039 -7.670  1.00 0.00 ? 103 GLN A HG3  1  
ATOM 1747  H HE21 . GLN A 1 103 ? -17.179 -10.991 -5.358  1.00 0.00 ? 103 GLN A HE21 1  
ATOM 1748  H HE22 . GLN A 1 103 ? -16.422 -10.163 -3.994  1.00 0.00 ? 103 GLN A HE22 1  
ATOM 1749  N N    . LEU A 1 104 ? -14.886 -14.385 -8.816  1.00 0.00 ? 104 LEU A N    1  
ATOM 1750  C CA   . LEU A 1 104 ? -14.328 -15.708 -9.090  1.00 0.00 ? 104 LEU A CA   1  
ATOM 1751  C C    . LEU A 1 104 ? -14.418 -16.206 -10.540 1.00 0.00 ? 104 LEU A C    1  
ATOM 1752  O O    . LEU A 1 104 ? -13.415 -16.568 -11.147 1.00 0.00 ? 104 LEU A O    1  
ATOM 1753  C CB   . LEU A 1 104 ? -15.264 -16.627 -8.257  1.00 0.00 ? 104 LEU A CB   1  
ATOM 1754  C CG   . LEU A 1 104 ? -14.866 -17.092 -6.846  1.00 0.00 ? 104 LEU A CG   1  
ATOM 1755  C CD1  . LEU A 1 104 ? -14.346 -18.540 -6.878  1.00 0.00 ? 104 LEU A CD1  1  
ATOM 1756  C CD2  . LEU A 1 104 ? -13.951 -16.110 -6.113  1.00 0.00 ? 104 LEU A CD2  1  
ATOM 1757  H H    . LEU A 1 104 ? -15.511 -14.370 -8.040  1.00 0.00 ? 104 LEU A H    1  
ATOM 1758  H HA   . LEU A 1 104 ? -13.297 -15.767 -8.770  1.00 0.00 ? 104 LEU A HA   1  
ATOM 1759  H HB2  . LEU A 1 104 ? -16.131 -15.958 -8.092  1.00 0.00 ? 104 LEU A HB2  1  
ATOM 1760  H HB3  . LEU A 1 104 ? -15.678 -17.503 -8.785  1.00 0.00 ? 104 LEU A HB3  1  
ATOM 1761  H HG   . LEU A 1 104 ? -15.822 -17.100 -6.259  1.00 0.00 ? 104 LEU A HG   1  
ATOM 1762  H HD11 . LEU A 1 104 ? -13.464 -18.619 -7.550  1.00 0.00 ? 104 LEU A HD11 1  
ATOM 1763  H HD12 . LEU A 1 104 ? -14.050 -18.874 -5.861  1.00 0.00 ? 104 LEU A HD12 1  
ATOM 1764  H HD13 . LEU A 1 104 ? -15.151 -19.210 -7.260  1.00 0.00 ? 104 LEU A HD13 1  
ATOM 1765  H HD21 . LEU A 1 104 ? -14.268 -15.048 -6.278  1.00 0.00 ? 104 LEU A HD21 1  
ATOM 1766  H HD22 . LEU A 1 104 ? -13.956 -16.305 -5.024  1.00 0.00 ? 104 LEU A HD22 1  
ATOM 1767  H HD23 . LEU A 1 104 ? -12.914 -16.232 -6.473  1.00 0.00 ? 104 LEU A HD23 1  
ATOM 1768  N N    . GLU A 1 105 ? -15.658 -16.297 -11.102 1.00 0.00 ? 105 GLU A N    1  
ATOM 1769  C CA   . GLU A 1 105 ? -15.966 -16.713 -12.470 1.00 0.00 ? 105 GLU A CA   1  
ATOM 1770  C C    . GLU A 1 105 ? -15.925 -15.663 -13.594 1.00 0.00 ? 105 GLU A C    1  
ATOM 1771  O O    . GLU A 1 105 ? -15.243 -15.824 -14.602 1.00 0.00 ? 105 GLU A O    1  
ATOM 1772  C CB   . GLU A 1 105 ? -17.334 -17.454 -12.515 1.00 0.00 ? 105 GLU A CB   1  
ATOM 1773  C CG   . GLU A 1 105 ? -17.403 -18.656 -11.550 1.00 0.00 ? 105 GLU A CG   1  
ATOM 1774  C CD   . GLU A 1 105 ? -18.793 -19.288 -11.616 1.00 0.00 ? 105 GLU A CD   1  
ATOM 1775  O OE1  . GLU A 1 105 ? -18.890 -20.471 -12.038 1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1776  O OE2  . GLU A 1 105 ? -19.776 -18.595 -11.239 1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1777  H H    . GLU A 1 105 ? -16.468 -16.059 -10.555 1.00 0.00 ? 105 GLU A H    1  
ATOM 1778  H HA   . GLU A 1 105 ? -15.226 -17.450 -12.760 1.00 0.00 ? 105 GLU A HA   1  
ATOM 1779  H HB2  . GLU A 1 105 ? -18.146 -16.743 -12.246 1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1780  H HB3  . GLU A 1 105 ? -17.533 -17.839 -13.541 1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1781  H HG2  . GLU A 1 105 ? -16.632 -19.403 -11.833 1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1782  H HG3  . GLU A 1 105 ? -17.211 -18.333 -10.505 1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1783  N N    . LEU A 1 106 ? -16.754 -14.587 -13.466 1.00 0.00 ? 106 LEU A N    1  
ATOM 1784  C CA   . LEU A 1 106 ? -17.063 -13.599 -14.508 1.00 0.00 ? 106 LEU A CA   1  
ATOM 1785  C C    . LEU A 1 106 ? -16.088 -12.464 -14.698 1.00 0.00 ? 106 LEU A C    1  
ATOM 1786  O O    . LEU A 1 106 ? -15.712 -12.122 -15.816 1.00 0.00 ? 106 LEU A O    1  
ATOM 1787  C CB   . LEU A 1 106 ? -18.404 -12.910 -14.230 1.00 0.00 ? 106 LEU A CB   1  
ATOM 1788  C CG   . LEU A 1 106 ? -19.617 -13.839 -13.992 1.00 0.00 ? 106 LEU A CG   1  
ATOM 1789  C CD1  . LEU A 1 106 ? -20.878 -13.056 -14.363 1.00 0.00 ? 106 LEU A CD1  1  
ATOM 1790  C CD2  . LEU A 1 106 ? -19.626 -15.147 -14.803 1.00 0.00 ? 106 LEU A CD2  1  
ATOM 1791  H H    . LEU A 1 106 ? -17.304 -14.477 -12.639 1.00 0.00 ? 106 LEU A H    1  
ATOM 1792  H HA   . LEU A 1 106 ? -17.190 -14.082 -15.470 1.00 0.00 ? 106 LEU A HA   1  
ATOM 1793  H HB2  . LEU A 1 106 ? -18.233 -12.272 -13.332 1.00 0.00 ? 106 LEU A HB2  1  
ATOM 1794  H HB3  . LEU A 1 106 ? -18.675 -12.244 -15.088 1.00 0.00 ? 106 LEU A HB3  1  
ATOM 1795  H HG   . LEU A 1 106 ? -19.640 -14.110 -12.911 1.00 0.00 ? 106 LEU A HG   1  
ATOM 1796  H HD11 . LEU A 1 106 ? -20.909 -12.079 -13.839 1.00 0.00 ? 106 LEU A HD11 1  
ATOM 1797  H HD12 . LEU A 1 106 ? -20.855 -12.874 -15.460 1.00 0.00 ? 106 LEU A HD12 1  
ATOM 1798  H HD13 . LEU A 1 106 ? -21.791 -13.637 -14.117 1.00 0.00 ? 106 LEU A HD13 1  
ATOM 1799  H HD21 . LEU A 1 106 ? -19.530 -14.930 -15.888 1.00 0.00 ? 106 LEU A HD21 1  
ATOM 1800  H HD22 . LEU A 1 106 ? -18.798 -15.816 -14.499 1.00 0.00 ? 106 LEU A HD22 1  
ATOM 1801  H HD23 . LEU A 1 106 ? -20.579 -15.689 -14.630 1.00 0.00 ? 106 LEU A HD23 1  
ATOM 1802  N N    . GLU A 1 107 ? -15.635 -11.812 -13.577 1.00 0.00 ? 107 GLU A N    1  
ATOM 1803  C CA   . GLU A 1 107 ? -14.736 -10.648 -13.528 1.00 0.00 ? 107 GLU A CA   1  
ATOM 1804  C C    . GLU A 1 107 ? -13.354 -10.920 -14.100 1.00 0.00 ? 107 GLU A C    1  
ATOM 1805  O O    . GLU A 1 107 ? -12.618 -10.028 -14.507 1.00 0.00 ? 107 GLU A O    1  
ATOM 1806  C CB   . GLU A 1 107 ? -14.661 -10.100 -12.079 1.00 0.00 ? 107 GLU A CB   1  
ATOM 1807  C CG   . GLU A 1 107 ? -13.934 -8.756  -11.896 1.00 0.00 ? 107 GLU A CG   1  
ATOM 1808  C CD   . GLU A 1 107 ? -14.110 -8.251  -10.463 1.00 0.00 ? 107 GLU A CD   1  
ATOM 1809  O OE1  . GLU A 1 107 ? -13.081 -8.100  -9.752  1.00 0.00 ? 107 GLU A OE1  1  
ATOM 1810  O OE2  . GLU A 1 107 ? -15.279 -8.001  -10.065 1.00 0.00 ? 107 GLU A OE2  1  
ATOM 1811  H H    . GLU A 1 107 ? -15.967 -12.104 -12.673 1.00 0.00 ? 107 GLU A H    1  
ATOM 1812  H HA   . GLU A 1 107 ? -15.173 -9.876  -14.144 1.00 0.00 ? 107 GLU A HA   1  
ATOM 1813  H HB2  . GLU A 1 107 ? -15.712 -9.979  -11.731 1.00 0.00 ? 107 GLU A HB2  1  
ATOM 1814  H HB3  . GLU A 1 107 ? -14.178 -10.850 -11.416 1.00 0.00 ? 107 GLU A HB3  1  
ATOM 1815  H HG2  . GLU A 1 107 ? -12.855 -8.891  -12.115 1.00 0.00 ? 107 GLU A HG2  1  
ATOM 1816  H HG3  . GLU A 1 107 ? -14.350 -8.004  -12.596 1.00 0.00 ? 107 GLU A HG3  1  
ATOM 1817  N N    . LYS A 1 108 ? -13.066 -12.236 -14.231 1.00 0.00 ? 108 LYS A N    1  
ATOM 1818  C CA   . LYS A 1 108 ? -11.902 -12.864 -14.837 1.00 0.00 ? 108 LYS A CA   1  
ATOM 1819  C C    . LYS A 1 108 ? -11.853 -12.763 -16.374 1.00 0.00 ? 108 LYS A C    1  
ATOM 1820  O O    . LYS A 1 108 ? -10.796 -12.848 -16.990 1.00 0.00 ? 108 LYS A O    1  
ATOM 1821  C CB   . LYS A 1 108 ? -11.915 -14.353 -14.427 1.00 0.00 ? 108 LYS A CB   1  
ATOM 1822  C CG   . LYS A 1 108 ? -11.752 -14.597 -12.917 1.00 0.00 ? 108 LYS A CG   1  
ATOM 1823  C CD   . LYS A 1 108 ? -10.367 -14.239 -12.359 1.00 0.00 ? 108 LYS A CD   1  
ATOM 1824  C CE   . LYS A 1 108 ? -10.222 -14.611 -10.877 1.00 0.00 ? 108 LYS A CE   1  
ATOM 1825  N NZ   . LYS A 1 108 ? -8.839  -14.370 -10.415 1.00 0.00 ? 108 LYS A NZ   1  
ATOM 1826  H H    . LYS A 1 108 ? -13.794 -12.858 -13.904 1.00 0.00 ? 108 LYS A H    1  
ATOM 1827  H HA   . LYS A 1 108 ? -11.009 -12.389 -14.457 1.00 0.00 ? 108 LYS A HA   1  
ATOM 1828  H HB2  . LYS A 1 108 ? -12.876 -14.814 -14.750 1.00 0.00 ? 108 LYS A HB2  1  
ATOM 1829  H HB3  . LYS A 1 108 ? -11.106 -14.904 -14.937 1.00 0.00 ? 108 LYS A HB3  1  
ATOM 1830  H HG2  . LYS A 1 108 ? -12.532 -14.055 -12.339 1.00 0.00 ? 108 LYS A HG2  1  
ATOM 1831  H HG3  . LYS A 1 108 ? -11.904 -15.686 -12.733 1.00 0.00 ? 108 LYS A HG3  1  
ATOM 1832  H HD2  . LYS A 1 108 ? -9.601  -14.792 -12.949 1.00 0.00 ? 108 LYS A HD2  1  
ATOM 1833  H HD3  . LYS A 1 108 ? -10.177 -13.150 -12.492 1.00 0.00 ? 108 LYS A HD3  1  
ATOM 1834  H HE2  . LYS A 1 108 ? -10.906 -14.005 -10.247 1.00 0.00 ? 108 LYS A HE2  1  
ATOM 1835  H HE3  . LYS A 1 108 ? -10.446 -15.688 -10.718 1.00 0.00 ? 108 LYS A HE3  1  
ATOM 1836  H HZ1  . LYS A 1 108 ? -8.601  -13.366 -10.542 1.00 0.00 ? 108 LYS A HZ1  1  
ATOM 1837  H HZ2  . LYS A 1 108 ? -8.761  -14.620 -9.408  1.00 0.00 ? 108 LYS A HZ2  1  
ATOM 1838  H HZ3  . LYS A 1 108 ? -8.181  -14.955 -10.969 1.00 0.00 ? 108 LYS A HZ3  1  
ATOM 1839  N N    . LYS A 1 109 ? -13.036 -12.558 -17.015 1.00 0.00 ? 109 LYS A N    1  
ATOM 1840  C CA   . LYS A 1 109 ? -13.275 -12.441 -18.443 1.00 0.00 ? 109 LYS A CA   1  
ATOM 1841  C C    . LYS A 1 109 ? -13.041 -11.029 -18.981 1.00 0.00 ? 109 LYS A C    1  
ATOM 1842  O O    . LYS A 1 109 ? -12.934 -10.816 -20.185 1.00 0.00 ? 109 LYS A O    1  
ATOM 1843  C CB   . LYS A 1 109 ? -14.718 -12.890 -18.739 1.00 0.00 ? 109 LYS A CB   1  
ATOM 1844  C CG   . LYS A 1 109 ? -14.993 -14.316 -18.240 1.00 0.00 ? 109 LYS A CG   1  
ATOM 1845  C CD   . LYS A 1 109 ? -16.408 -14.740 -18.623 1.00 0.00 ? 109 LYS A CD   1  
ATOM 1846  C CE   . LYS A 1 109 ? -16.804 -16.116 -18.073 1.00 0.00 ? 109 LYS A CE   1  
ATOM 1847  N NZ   . LYS A 1 109 ? -18.193 -16.457 -18.457 1.00 0.00 ? 109 LYS A NZ   1  
ATOM 1848  H H    . LYS A 1 109 ? -13.882 -12.501 -16.474 1.00 0.00 ? 109 LYS A H    1  
ATOM 1849  H HA   . LYS A 1 109 ? -12.655 -13.136 -18.988 1.00 0.00 ? 109 LYS A HA   1  
ATOM 1850  H HB2  . LYS A 1 109 ? -15.448 -12.204 -18.253 1.00 0.00 ? 109 LYS A HB2  1  
ATOM 1851  H HB3  . LYS A 1 109 ? -14.921 -12.869 -19.831 1.00 0.00 ? 109 LYS A HB3  1  
ATOM 1852  H HG2  . LYS A 1 109 ? -14.259 -15.024 -18.687 1.00 0.00 ? 109 LYS A HG2  1  
ATOM 1853  H HG3  . LYS A 1 109 ? -14.894 -14.369 -17.132 1.00 0.00 ? 109 LYS A HG3  1  
ATOM 1854  H HD2  . LYS A 1 109 ? -17.102 -13.958 -18.242 1.00 0.00 ? 109 LYS A HD2  1  
ATOM 1855  H HD3  . LYS A 1 109 ? -16.444 -14.726 -19.735 1.00 0.00 ? 109 LYS A HD3  1  
ATOM 1856  H HE2  . LYS A 1 109 ? -16.137 -16.909 -18.473 1.00 0.00 ? 109 LYS A HE2  1  
ATOM 1857  H HE3  . LYS A 1 109 ? -16.752 -16.125 -16.963 1.00 0.00 ? 109 LYS A HE3  1  
ATOM 1858  H HZ1  . LYS A 1 109 ? -18.843 -15.742 -18.074 1.00 0.00 ? 109 LYS A HZ1  1  
ATOM 1859  H HZ2  . LYS A 1 109 ? -18.271 -16.477 -19.494 1.00 0.00 ? 109 LYS A HZ2  1  
ATOM 1860  H HZ3  . LYS A 1 109 ? -18.440 -17.391 -18.073 1.00 0.00 ? 109 LYS A HZ3  1  
ATOM 1861  N N    . LYS A 1 110 ? -12.975 -10.034 -18.064 1.00 0.00 ? 110 LYS A N    1  
ATOM 1862  C CA   . LYS A 1 110 ? -12.777 -8.621  -18.338 1.00 0.00 ? 110 LYS A CA   1  
ATOM 1863  C C    . LYS A 1 110 ? -11.516 -8.115  -17.650 1.00 0.00 ? 110 LYS A C    1  
ATOM 1864  O O    . LYS A 1 110 ? -10.700 -7.439  -18.273 1.00 0.00 ? 110 LYS A O    1  
ATOM 1865  C CB   . LYS A 1 110 ? -14.055 -7.798  -18.012 1.00 0.00 ? 110 LYS A CB   1  
ATOM 1866  C CG   . LYS A 1 110 ? -14.782 -8.144  -16.700 1.00 0.00 ? 110 LYS A CG   1  
ATOM 1867  C CD   . LYS A 1 110 ? -16.139 -7.428  -16.619 1.00 0.00 ? 110 LYS A CD   1  
ATOM 1868  C CE   . LYS A 1 110 ? -16.998 -7.820  -15.406 1.00 0.00 ? 110 LYS A CE   1  
ATOM 1869  N NZ   . LYS A 1 110 ? -16.409 -7.316  -14.145 1.00 0.00 ? 110 LYS A NZ   1  
ATOM 1870  H H    . LYS A 1 110 ? -13.080 -10.288 -17.107 1.00 0.00 ? 110 LYS A H    1  
ATOM 1871  H HA   . LYS A 1 110 ? -12.577 -8.469  -19.393 1.00 0.00 ? 110 LYS A HA   1  
ATOM 1872  H HB2  . LYS A 1 110 ? -13.840 -6.707  -18.045 1.00 0.00 ? 110 LYS A HB2  1  
ATOM 1873  H HB3  . LYS A 1 110 ? -14.779 -8.004  -18.836 1.00 0.00 ? 110 LYS A HB3  1  
ATOM 1874  H HG2  . LYS A 1 110 ? -14.978 -9.239  -16.650 1.00 0.00 ? 110 LYS A HG2  1  
ATOM 1875  H HG3  . LYS A 1 110 ? -14.154 -7.870  -15.826 1.00 0.00 ? 110 LYS A HG3  1  
ATOM 1876  H HD2  . LYS A 1 110 ? -15.973 -6.328  -16.628 1.00 0.00 ? 110 LYS A HD2  1  
ATOM 1877  H HD3  . LYS A 1 110 ? -16.708 -7.676  -17.546 1.00 0.00 ? 110 LYS A HD3  1  
ATOM 1878  H HE2  . LYS A 1 110 ? -18.017 -7.382  -15.487 1.00 0.00 ? 110 LYS A HE2  1  
ATOM 1879  H HE3  . LYS A 1 110 ? -17.085 -8.924  -15.322 1.00 0.00 ? 110 LYS A HE3  1  
ATOM 1880  H HZ1  . LYS A 1 110 ? -16.327 -6.280  -14.190 1.00 0.00 ? 110 LYS A HZ1  1  
ATOM 1881  H HZ2  . LYS A 1 110 ? -17.020 -7.581  -13.346 1.00 0.00 ? 110 LYS A HZ2  1  
ATOM 1882  H HZ3  . LYS A 1 110 ? -15.465 -7.733  -14.012 1.00 0.00 ? 110 LYS A HZ3  1  
ATOM 1883  N N    . LYS A 1 111 ? -11.302 -8.441  -16.346 1.00 0.00 ? 111 LYS A N    1  
ATOM 1884  C CA   . LYS A 1 111 ? -10.098 -8.102  -15.596 1.00 0.00 ? 111 LYS A CA   1  
ATOM 1885  C C    . LYS A 1 111 ? -9.461  -9.422  -15.177 1.00 0.00 ? 111 LYS A C    1  
ATOM 1886  O O    . LYS A 1 111 ? -8.541  -9.471  -14.360 1.00 0.00 ? 111 LYS A O    1  
ATOM 1887  C CB   . LYS A 1 111 ? -10.366 -7.195  -14.354 1.00 0.00 ? 111 LYS A CB   1  
ATOM 1888  C CG   . LYS A 1 111 ? -10.633 -5.703  -14.662 1.00 0.00 ? 111 LYS A CG   1  
ATOM 1889  C CD   . LYS A 1 111 ? -12.048 -5.327  -15.148 1.00 0.00 ? 111 LYS A CD   1  
ATOM 1890  C CE   . LYS A 1 111 ? -13.180 -5.637  -14.153 1.00 0.00 ? 111 LYS A CE   1  
ATOM 1891  N NZ   . LYS A 1 111 ? -12.988 -4.935  -12.862 1.00 0.00 ? 111 LYS A NZ   1  
ATOM 1892  H H    . LYS A 1 111 ? -11.964 -8.982  -15.809 1.00 0.00 ? 111 LYS A H    1  
ATOM 1893  H HA   . LYS A 1 111 ? -9.367  -7.598  -16.219 1.00 0.00 ? 111 LYS A HA   1  
ATOM 1894  H HB2  . LYS A 1 111 ? -11.189 -7.620  -13.741 1.00 0.00 ? 111 LYS A HB2  1  
ATOM 1895  H HB3  . LYS A 1 111 ? -9.451  -7.184  -13.712 1.00 0.00 ? 111 LYS A HB3  1  
ATOM 1896  H HG2  . LYS A 1 111 ? -10.435 -5.126  -13.730 1.00 0.00 ? 111 LYS A HG2  1  
ATOM 1897  H HG3  . LYS A 1 111 ? -9.890  -5.359  -15.417 1.00 0.00 ? 111 LYS A HG3  1  
ATOM 1898  H HD2  . LYS A 1 111 ? -12.054 -4.234  -15.365 1.00 0.00 ? 111 LYS A HD2  1  
ATOM 1899  H HD3  . LYS A 1 111 ? -12.255 -5.847  -16.107 1.00 0.00 ? 111 LYS A HD3  1  
ATOM 1900  H HE2  . LYS A 1 111 ? -14.162 -5.313  -14.561 1.00 0.00 ? 111 LYS A HE2  1  
ATOM 1901  H HE3  . LYS A 1 111 ? -13.227 -6.725  -13.940 1.00 0.00 ? 111 LYS A HE3  1  
ATOM 1902  H HZ1  . LYS A 1 111 ? -12.967 -3.908  -13.026 1.00 0.00 ? 111 LYS A HZ1  1  
ATOM 1903  H HZ2  . LYS A 1 111 ? -13.772 -5.168  -12.220 1.00 0.00 ? 111 LYS A HZ2  1  
ATOM 1904  H HZ3  . LYS A 1 111 ? -12.088 -5.236  -12.436 1.00 0.00 ? 111 LYS A HZ3  1  
ATOM 1905  N N    . GLY A 1 1   ? -11.334 14.562  -9.743  1.00 0.00 ? 1   GLY A N    2  
ATOM 1906  C CA   . GLY A 1 1   ? -10.901 15.247  -10.938 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1907  C C    . GLY A 1 1   ? -9.665  14.593  -11.461 1.00 0.00 ? 1   GLY A C    2  
ATOM 1908  O O    . GLY A 1 1   ? -9.642  14.093  -12.582 1.00 0.00 ? 1   GLY A O    2  
ATOM 1909  H H    . GLY A 1 1   ? -12.232 14.114  -9.721  1.00 0.00 ? 1   GLY A H    2  
ATOM 1910  H HA2  . GLY A 1 1   ? -11.674 15.149  -11.686 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1911  H HA3  . GLY A 1 1   ? -10.664 16.266  -10.673 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1912  N N    . GLN A 1 2   ? -8.582  14.575  -10.643 1.00 0.00 ? 2   GLN A N    2  
ATOM 1913  C CA   . GLN A 1 2   ? -7.291  13.953  -10.933 1.00 0.00 ? 2   GLN A CA   2  
ATOM 1914  C C    . GLN A 1 2   ? -7.258  12.459  -10.631 1.00 0.00 ? 2   GLN A C    2  
ATOM 1915  O O    . GLN A 1 2   ? -6.646  11.679  -11.355 1.00 0.00 ? 2   GLN A O    2  
ATOM 1916  C CB   . GLN A 1 2   ? -6.114  14.607  -10.131 1.00 0.00 ? 2   GLN A CB   2  
ATOM 1917  C CG   . GLN A 1 2   ? -6.421  14.954  -8.650  1.00 0.00 ? 2   GLN A CG   2  
ATOM 1918  C CD   . GLN A 1 2   ? -5.123  15.204  -7.879  1.00 0.00 ? 2   GLN A CD   2  
ATOM 1919  O OE1  . GLN A 1 2   ? -4.513  16.272  -7.934  1.00 0.00 ? 2   GLN A OE1  2  
ATOM 1920  N NE2  . GLN A 1 2   ? -4.670  14.168  -7.127  1.00 0.00 ? 2   GLN A NE2  2  
ATOM 1921  H H    . GLN A 1 2   ? -8.659  15.018  -9.756  1.00 0.00 ? 2   GLN A H    2  
ATOM 1922  H HA   . GLN A 1 2   ? -7.069  14.048  -11.990 1.00 0.00 ? 2   GLN A HA   2  
ATOM 1923  H HB2  . GLN A 1 2   ? -5.203  13.951  -10.170 1.00 0.00 ? 2   GLN A HB2  2  
ATOM 1924  H HB3  . GLN A 1 2   ? -5.841  15.559  -10.642 1.00 0.00 ? 2   GLN A HB3  2  
ATOM 1925  H HG2  . GLN A 1 2   ? -7.031  15.879  -8.599  1.00 0.00 ? 2   GLN A HG2  2  
ATOM 1926  H HG3  . GLN A 1 2   ? -6.981  14.142  -8.147  1.00 0.00 ? 2   GLN A HG3  2  
ATOM 1927  H HE21 . GLN A 1 2   ? -5.189  13.319  -7.074  1.00 0.00 ? 2   GLN A HE21 2  
ATOM 1928  H HE22 . GLN A 1 2   ? -3.810  14.301  -6.639  1.00 0.00 ? 2   GLN A HE22 2  
ATOM 1929  N N    . ARG A 1 3   ? -7.866  12.051  -9.494  1.00 0.00 ? 3   ARG A N    2  
ATOM 1930  C CA   . ARG A 1 3   ? -7.790  10.707  -8.978  1.00 0.00 ? 3   ARG A CA   2  
ATOM 1931  C C    . ARG A 1 3   ? -8.853  10.621  -7.899  1.00 0.00 ? 3   ARG A C    2  
ATOM 1932  O O    . ARG A 1 3   ? -9.564  11.597  -7.652  1.00 0.00 ? 3   ARG A O    2  
ATOM 1933  C CB   . ARG A 1 3   ? -6.358  10.439  -8.426  1.00 0.00 ? 3   ARG A CB   2  
ATOM 1934  C CG   . ARG A 1 3   ? -5.885  8.985   -8.426  1.00 0.00 ? 3   ARG A CG   2  
ATOM 1935  C CD   . ARG A 1 3   ? -4.375  8.918   -8.153  1.00 0.00 ? 3   ARG A CD   2  
ATOM 1936  N NE   . ARG A 1 3   ? -3.898  7.491   -8.237  1.00 0.00 ? 3   ARG A NE   2  
ATOM 1937  C CZ   . ARG A 1 3   ? -3.460  6.893   -9.392  1.00 0.00 ? 3   ARG A CZ   2  
ATOM 1938  N NH1  . ARG A 1 3   ? -3.436  7.574   -10.573 1.00 0.00 ? 3   ARG A NH1  2  
ATOM 1939  N NH2  . ARG A 1 3   ? -3.040  5.594   -9.356  1.00 0.00 ? 3   ARG A NH2  2  
ATOM 1940  H H    . ARG A 1 3   ? -8.372  12.687  -8.913  1.00 0.00 ? 3   ARG A H    2  
ATOM 1941  H HA   . ARG A 1 3   ? -8.045  10.008  -9.768  1.00 0.00 ? 3   ARG A HA   2  
ATOM 1942  H HB2  . ARG A 1 3   ? -5.639  10.907  -9.140  1.00 0.00 ? 3   ARG A HB2  2  
ATOM 1943  H HB3  . ARG A 1 3   ? -6.188  10.921  -7.443  1.00 0.00 ? 3   ARG A HB3  2  
ATOM 1944  H HG2  . ARG A 1 3   ? -6.441  8.363   -7.695  1.00 0.00 ? 3   ARG A HG2  2  
ATOM 1945  H HG3  . ARG A 1 3   ? -6.065  8.610   -9.455  1.00 0.00 ? 3   ARG A HG3  2  
ATOM 1946  H HD2  . ARG A 1 3   ? -3.839  9.572   -8.879  1.00 0.00 ? 3   ARG A HD2  2  
ATOM 1947  H HD3  . ARG A 1 3   ? -4.164  9.289   -7.127  1.00 0.00 ? 3   ARG A HD3  2  
ATOM 1948  H HE   . ARG A 1 3   ? -3.899  6.948   -7.397  1.00 0.00 ? 3   ARG A HE   2  
ATOM 1949  H HH11 . ARG A 1 3   ? -3.740  8.527   -10.608 1.00 0.00 ? 3   ARG A HH11 2  
ATOM 1950  H HH12 . ARG A 1 3   ? -3.110  7.124   -11.404 1.00 0.00 ? 3   ARG A HH12 2  
ATOM 1951  H HH21 . ARG A 1 3   ? -3.057  5.086   -8.495  1.00 0.00 ? 3   ARG A HH21 2  
ATOM 1952  H HH22 . ARG A 1 3   ? -2.717  5.150   -10.192 1.00 0.00 ? 3   ARG A HH22 2  
ATOM 1953  N N    . GLN A 1 4   ? -9.000  9.447   -7.233  1.00 0.00 ? 4   GLN A N    2  
ATOM 1954  C CA   . GLN A 1 4   ? -9.961  9.085   -6.183  1.00 0.00 ? 4   GLN A CA   2  
ATOM 1955  C C    . GLN A 1 4   ? -11.432 9.015   -6.569  1.00 0.00 ? 4   GLN A C    2  
ATOM 1956  O O    . GLN A 1 4   ? -12.028 7.942   -6.544  1.00 0.00 ? 4   GLN A O    2  
ATOM 1957  C CB   . GLN A 1 4   ? -9.780  9.721   -4.764  1.00 0.00 ? 4   GLN A CB   2  
ATOM 1958  C CG   . GLN A 1 4   ? -9.670  11.259  -4.620  1.00 0.00 ? 4   GLN A CG   2  
ATOM 1959  C CD   . GLN A 1 4   ? -9.723  11.712  -3.156  1.00 0.00 ? 4   GLN A CD   2  
ATOM 1960  O OE1  . GLN A 1 4   ? -10.439 12.649  -2.792  1.00 0.00 ? 4   GLN A OE1  2  
ATOM 1961  N NE2  . GLN A 1 4   ? -8.971  11.018  -2.265  1.00 0.00 ? 4   GLN A NE2  2  
ATOM 1962  H H    . GLN A 1 4   ? -8.399  8.697   -7.488  1.00 0.00 ? 4   GLN A H    2  
ATOM 1963  H HA   . GLN A 1 4   ? -9.735  8.048   -5.996  1.00 0.00 ? 4   GLN A HA   2  
ATOM 1964  H HB2  . GLN A 1 4   ? -10.644 9.411   -4.128  1.00 0.00 ? 4   GLN A HB2  2  
ATOM 1965  H HB3  . GLN A 1 4   ? -8.855  9.276   -4.346  1.00 0.00 ? 4   GLN A HB3  2  
ATOM 1966  H HG2  . GLN A 1 4   ? -8.731  11.623  -5.080  1.00 0.00 ? 4   GLN A HG2  2  
ATOM 1967  H HG3  . GLN A 1 4   ? -10.533 11.734  -5.130  1.00 0.00 ? 4   GLN A HG3  2  
ATOM 1968  H HE21 . GLN A 1 4   ? -8.331  10.312  -2.563  1.00 0.00 ? 4   GLN A HE21 2  
ATOM 1969  H HE22 . GLN A 1 4   ? -9.028  11.272  -1.303  1.00 0.00 ? 4   GLN A HE22 2  
ATOM 1970  N N    . LEU A 1 5   ? -12.023 10.194  -6.886  1.00 0.00 ? 5   LEU A N    2  
ATOM 1971  C CA   . LEU A 1 5   ? -13.411 10.476  -7.265  1.00 0.00 ? 5   LEU A CA   2  
ATOM 1972  C C    . LEU A 1 5   ? -14.336 10.357  -6.058  1.00 0.00 ? 5   LEU A C    2  
ATOM 1973  O O    . LEU A 1 5   ? -15.270 9.565   -6.008  1.00 0.00 ? 5   LEU A O    2  
ATOM 1974  C CB   . LEU A 1 5   ? -13.902 9.723   -8.537  1.00 0.00 ? 5   LEU A CB   2  
ATOM 1975  C CG   . LEU A 1 5   ? -12.902 9.718   -9.726  1.00 0.00 ? 5   LEU A CG   2  
ATOM 1976  C CD1  . LEU A 1 5   ? -13.602 9.303   -11.030 1.00 0.00 ? 5   LEU A CD1  2  
ATOM 1977  C CD2  . LEU A 1 5   ? -12.148 11.046  -9.931  1.00 0.00 ? 5   LEU A CD2  2  
ATOM 1978  H H    . LEU A 1 5   ? -11.406 10.984  -6.908  1.00 0.00 ? 5   LEU A H    2  
ATOM 1979  H HA   . LEU A 1 5   ? -13.423 11.524  -7.523  1.00 0.00 ? 5   LEU A HA   2  
ATOM 1980  H HB2  . LEU A 1 5   ? -14.126 8.663   -8.284  1.00 0.00 ? 5   LEU A HB2  2  
ATOM 1981  H HB3  . LEU A 1 5   ? -14.854 10.191  -8.875  1.00 0.00 ? 5   LEU A HB3  2  
ATOM 1982  H HG   . LEU A 1 5   ? -12.132 8.942   -9.502  1.00 0.00 ? 5   LEU A HG   2  
ATOM 1983  H HD11 . LEU A 1 5   ? -14.094 8.315   -10.910 1.00 0.00 ? 5   LEU A HD11 2  
ATOM 1984  H HD12 . LEU A 1 5   ? -14.373 10.053  -11.308 1.00 0.00 ? 5   LEU A HD12 2  
ATOM 1985  H HD13 . LEU A 1 5   ? -12.863 9.235   -11.857 1.00 0.00 ? 5   LEU A HD13 2  
ATOM 1986  H HD21 . LEU A 1 5   ? -12.859 11.875  -10.111 1.00 0.00 ? 5   LEU A HD21 2  
ATOM 1987  H HD22 . LEU A 1 5   ? -11.526 11.284  -9.040  1.00 0.00 ? 5   LEU A HD22 2  
ATOM 1988  H HD23 . LEU A 1 5   ? -11.460 10.965  -10.798 1.00 0.00 ? 5   LEU A HD23 2  
ATOM 1989  N N    . LEU A 1 6   ? -13.979 11.145  -5.015  1.00 0.00 ? 6   LEU A N    2  
ATOM 1990  C CA   . LEU A 1 6   ? -14.539 11.137  -3.674  1.00 0.00 ? 6   LEU A CA   2  
ATOM 1991  C C    . LEU A 1 6   ? -15.594 12.215  -3.403  1.00 0.00 ? 6   LEU A C    2  
ATOM 1992  O O    . LEU A 1 6   ? -16.026 12.963  -4.280  1.00 0.00 ? 6   LEU A O    2  
ATOM 1993  C CB   . LEU A 1 6   ? -13.353 11.201  -2.673  1.00 0.00 ? 6   LEU A CB   2  
ATOM 1994  C CG   . LEU A 1 6   ? -13.049 9.892   -1.887  1.00 0.00 ? 6   LEU A CG   2  
ATOM 1995  C CD1  . LEU A 1 6   ? -13.965 9.684   -0.675  1.00 0.00 ? 6   LEU A CD1  2  
ATOM 1996  C CD2  . LEU A 1 6   ? -13.055 8.620   -2.754  1.00 0.00 ? 6   LEU A CD2  2  
ATOM 1997  H H    . LEU A 1 6   ? -13.211 11.765  -5.116  1.00 0.00 ? 6   LEU A H    2  
ATOM 1998  H HA   . LEU A 1 6   ? -14.994 10.186  -3.492  1.00 0.00 ? 6   LEU A HA   2  
ATOM 1999  H HB2  . LEU A 1 6   ? -12.446 11.413  -3.279  1.00 0.00 ? 6   LEU A HB2  2  
ATOM 2000  H HB3  . LEU A 1 6   ? -13.435 12.045  -1.961  1.00 0.00 ? 6   LEU A HB3  2  
ATOM 2001  H HG   . LEU A 1 6   ? -12.011 10.011  -1.487  1.00 0.00 ? 6   LEU A HG   2  
ATOM 2002  H HD11 . LEU A 1 6   ? -13.932 10.564  0.002   1.00 0.00 ? 6   LEU A HD11 2  
ATOM 2003  H HD12 . LEU A 1 6   ? -15.008 9.508   -0.998  1.00 0.00 ? 6   LEU A HD12 2  
ATOM 2004  H HD13 . LEU A 1 6   ? -13.633 8.789   -0.106  1.00 0.00 ? 6   LEU A HD13 2  
ATOM 2005  H HD21 . LEU A 1 6   ? -12.482 8.765   -3.687  1.00 0.00 ? 6   LEU A HD21 2  
ATOM 2006  H HD22 . LEU A 1 6   ? -12.613 7.771   -2.190  1.00 0.00 ? 6   LEU A HD22 2  
ATOM 2007  H HD23 . LEU A 1 6   ? -14.088 8.333   -3.039  1.00 0.00 ? 6   LEU A HD23 2  
ATOM 2008  N N    . LEU A 1 7   ? -16.026 12.319  -2.117  1.00 0.00 ? 7   LEU A N    2  
ATOM 2009  C CA   . LEU A 1 7   ? -17.017 13.277  -1.629  1.00 0.00 ? 7   LEU A CA   2  
ATOM 2010  C C    . LEU A 1 7   ? -16.412 14.333  -0.740  1.00 0.00 ? 7   LEU A C    2  
ATOM 2011  O O    . LEU A 1 7   ? -17.125 15.115  -0.115  1.00 0.00 ? 7   LEU A O    2  
ATOM 2012  C CB   . LEU A 1 7   ? -18.276 12.604  -0.993  1.00 0.00 ? 7   LEU A CB   2  
ATOM 2013  C CG   . LEU A 1 7   ? -18.103 11.495  0.089   1.00 0.00 ? 7   LEU A CG   2  
ATOM 2014  C CD1  . LEU A 1 7   ? -17.868 10.106  -0.528  1.00 0.00 ? 7   LEU A CD1  2  
ATOM 2015  C CD2  . LEU A 1 7   ? -17.083 11.791  1.203   1.00 0.00 ? 7   LEU A CD2  2  
ATOM 2016  H H    . LEU A 1 7   ? -15.668 11.695  -1.424  1.00 0.00 ? 7   LEU A H    2  
ATOM 2017  H HA   . LEU A 1 7   ? -17.355 13.901  -2.444  1.00 0.00 ? 7   LEU A HA   2  
ATOM 2018  H HB2  . LEU A 1 7   ? -18.946 13.389  -0.578  1.00 0.00 ? 7   LEU A HB2  2  
ATOM 2019  H HB3  . LEU A 1 7   ? -18.844 12.139  -1.830  1.00 0.00 ? 7   LEU A HB3  2  
ATOM 2020  H HG   . LEU A 1 7   ? -19.097 11.428  0.600   1.00 0.00 ? 7   LEU A HG   2  
ATOM 2021  H HD11 . LEU A 1 7   ? -18.731 9.828   -1.167  1.00 0.00 ? 7   LEU A HD11 2  
ATOM 2022  H HD12 . LEU A 1 7   ? -16.959 10.085  -1.155  1.00 0.00 ? 7   LEU A HD12 2  
ATOM 2023  H HD13 . LEU A 1 7   ? -17.768 9.339   0.269   1.00 0.00 ? 7   LEU A HD13 2  
ATOM 2024  H HD21 . LEU A 1 7   ? -17.309 12.772  1.674   1.00 0.00 ? 7   LEU A HD21 2  
ATOM 2025  H HD22 . LEU A 1 7   ? -17.126 11.005  1.985   1.00 0.00 ? 7   LEU A HD22 2  
ATOM 2026  H HD23 . LEU A 1 7   ? -16.053 11.819  0.795   1.00 0.00 ? 7   LEU A HD23 2  
ATOM 2027  N N    . ALA A 1 8   ? -15.059 14.387  -0.718  1.00 0.00 ? 8   ALA A N    2  
ATOM 2028  C CA   . ALA A 1 8   ? -14.237 15.396  -0.074  1.00 0.00 ? 8   ALA A CA   2  
ATOM 2029  C C    . ALA A 1 8   ? -14.183 15.346  1.457   1.00 0.00 ? 8   ALA A C    2  
ATOM 2030  O O    . ALA A 1 8   ? -14.367 16.332  2.164   1.00 0.00 ? 8   ALA A O    2  
ATOM 2031  C CB   . ALA A 1 8   ? -14.582 16.771  -0.680  1.00 0.00 ? 8   ALA A CB   2  
ATOM 2032  H H    . ALA A 1 8   ? -14.577 13.726  -1.277  1.00 0.00 ? 8   ALA A H    2  
ATOM 2033  H HA   . ALA A 1 8   ? -13.228 15.179  -0.395  1.00 0.00 ? 8   ALA A HA   2  
ATOM 2034  H HB1  . ALA A 1 8   ? -15.579 17.114  -0.331  1.00 0.00 ? 8   ALA A HB1  2  
ATOM 2035  H HB2  . ALA A 1 8   ? -13.814 17.531  -0.437  1.00 0.00 ? 8   ALA A HB2  2  
ATOM 2036  H HB3  . ALA A 1 8   ? -14.653 16.629  -1.784  1.00 0.00 ? 8   ALA A HB3  2  
ATOM 2037  N N    . SER A 1 9   ? -13.898 14.125  1.968   1.00 0.00 ? 9   SER A N    2  
ATOM 2038  C CA   . SER A 1 9   ? -13.740 13.777  3.365   1.00 0.00 ? 9   SER A CA   2  
ATOM 2039  C C    . SER A 1 9   ? -13.033 12.430  3.343   1.00 0.00 ? 9   SER A C    2  
ATOM 2040  O O    . SER A 1 9   ? -13.266 11.638  2.429   1.00 0.00 ? 9   SER A O    2  
ATOM 2041  C CB   . SER A 1 9   ? -15.093 13.714  4.139   1.00 0.00 ? 9   SER A CB   2  
ATOM 2042  O OG   . SER A 1 9   ? -14.903 13.562  5.546   1.00 0.00 ? 9   SER A OG   2  
ATOM 2043  H H    . SER A 1 9   ? -13.762 13.344  1.360   1.00 0.00 ? 9   SER A H    2  
ATOM 2044  H HA   . SER A 1 9   ? -13.082 14.496  3.838   1.00 0.00 ? 9   SER A HA   2  
ATOM 2045  H HB2  . SER A 1 9   ? -15.626 14.675  3.963   1.00 0.00 ? 9   SER A HB2  2  
ATOM 2046  H HB3  . SER A 1 9   ? -15.736 12.894  3.749   1.00 0.00 ? 9   SER A HB3  2  
ATOM 2047  H HG   . SER A 1 9   ? -15.709 13.876  5.977   1.00 0.00 ? 9   SER A HG   2  
ATOM 2048  N N    . GLU A 1 10  ? -12.157 12.172  4.344   1.00 0.00 ? 10  GLU A N    2  
ATOM 2049  C CA   . GLU A 1 10  ? -11.363 10.979  4.571   1.00 0.00 ? 10  GLU A CA   2  
ATOM 2050  C C    . GLU A 1 10  ? -10.821 11.252  5.959   1.00 0.00 ? 10  GLU A C    2  
ATOM 2051  O O    . GLU A 1 10  ? -10.816 12.405  6.391   1.00 0.00 ? 10  GLU A O    2  
ATOM 2052  C CB   . GLU A 1 10  ? -10.148 10.756  3.600   1.00 0.00 ? 10  GLU A CB   2  
ATOM 2053  C CG   . GLU A 1 10  ? -10.497 10.134  2.229   1.00 0.00 ? 10  GLU A CG   2  
ATOM 2054  C CD   . GLU A 1 10  ? -9.217  9.802   1.458   1.00 0.00 ? 10  GLU A CD   2  
ATOM 2055  O OE1  . GLU A 1 10  ? -9.033  8.609   1.099   1.00 0.00 ? 10  GLU A OE1  2  
ATOM 2056  O OE2  . GLU A 1 10  ? -8.412  10.740  1.212   1.00 0.00 ? 10  GLU A OE2  2  
ATOM 2057  H H    . GLU A 1 10  ? -12.012 12.846  5.080   1.00 0.00 ? 10  GLU A H    2  
ATOM 2058  H HA   . GLU A 1 10  ? -12.010 10.113  4.624   1.00 0.00 ? 10  GLU A HA   2  
ATOM 2059  H HB2  . GLU A 1 10  ? -9.639  11.731  3.427   1.00 0.00 ? 10  GLU A HB2  2  
ATOM 2060  H HB3  . GLU A 1 10  ? -9.410  10.059  4.061   1.00 0.00 ? 10  GLU A HB3  2  
ATOM 2061  H HG2  . GLU A 1 10  ? -11.090 9.208   2.384   1.00 0.00 ? 10  GLU A HG2  2  
ATOM 2062  H HG3  . GLU A 1 10  ? -11.095 10.845  1.624   1.00 0.00 ? 10  GLU A HG3  2  
ATOM 2063  N N    . ASN A 1 11  ? -10.328 10.217  6.671   1.00 0.00 ? 11  ASN A N    2  
ATOM 2064  C CA   . ASN A 1 11  ? -9.725  10.316  7.990   1.00 0.00 ? 11  ASN A CA   2  
ATOM 2065  C C    . ASN A 1 11  ? -8.229  9.999   7.859   1.00 0.00 ? 11  ASN A C    2  
ATOM 2066  O O    . ASN A 1 11  ? -7.875  8.820   7.771   1.00 0.00 ? 11  ASN A O    2  
ATOM 2067  C CB   . ASN A 1 11  ? -10.430 9.313   8.956   1.00 0.00 ? 11  ASN A CB   2  
ATOM 2068  C CG   . ASN A 1 11  ? -11.150 10.072  10.065  1.00 0.00 ? 11  ASN A CG   2  
ATOM 2069  O OD1  . ASN A 1 11  ? -11.742 11.122  9.815   1.00 0.00 ? 11  ASN A OD1  2  
ATOM 2070  N ND2  . ASN A 1 11  ? -11.106 9.531   11.310  1.00 0.00 ? 11  ASN A ND2  2  
ATOM 2071  H H    . ASN A 1 11  ? -10.333 9.296   6.292   1.00 0.00 ? 11  ASN A H    2  
ATOM 2072  H HA   . ASN A 1 11  ? -9.842  11.325  8.377   1.00 0.00 ? 11  ASN A HA   2  
ATOM 2073  H HB2  . ASN A 1 11  ? -11.210 8.778   8.372   1.00 0.00 ? 11  ASN A HB2  2  
ATOM 2074  H HB3  . ASN A 1 11  ? -9.759  8.550   9.402   1.00 0.00 ? 11  ASN A HB3  2  
ATOM 2075  H HD21 . ASN A 1 11  ? -10.587 8.680   11.483  1.00 0.00 ? 11  ASN A HD21 2  
ATOM 2076  H HD22 . ASN A 1 11  ? -11.640 9.974   12.027  1.00 0.00 ? 11  ASN A HD22 2  
ATOM 2077  N N    . PRO A 1 12  ? -7.277  10.958  7.841   1.00 0.00 ? 12  PRO A N    2  
ATOM 2078  C CA   . PRO A 1 12  ? -5.837  10.694  7.730   1.00 0.00 ? 12  PRO A CA   2  
ATOM 2079  C C    . PRO A 1 12  ? -5.224  10.340  9.095   1.00 0.00 ? 12  PRO A C    2  
ATOM 2080  O O    . PRO A 1 12  ? -4.148  10.837  9.421   1.00 0.00 ? 12  PRO A O    2  
ATOM 2081  C CB   . PRO A 1 12  ? -5.320  12.031  7.157   1.00 0.00 ? 12  PRO A CB   2  
ATOM 2082  C CG   . PRO A 1 12  ? -6.207  13.093  7.817   1.00 0.00 ? 12  PRO A CG   2  
ATOM 2083  C CD   . PRO A 1 12  ? -7.569  12.394  7.898   1.00 0.00 ? 12  PRO A CD   2  
ATOM 2084  H HA   . PRO A 1 12  ? -5.583  9.876   7.055   1.00 0.00 ? 12  PRO A HA   2  
ATOM 2085  H HB2  . PRO A 1 12  ? -4.235  12.215  7.357   1.00 0.00 ? 12  PRO A HB2  2  
ATOM 2086  H HB3  . PRO A 1 12  ? -5.528  12.054  6.054   1.00 0.00 ? 12  PRO A HB3  2  
ATOM 2087  H HG2  . PRO A 1 12  ? -5.838  13.314  8.845   1.00 0.00 ? 12  PRO A HG2  2  
ATOM 2088  H HG3  . PRO A 1 12  ? -6.247  14.037  7.236   1.00 0.00 ? 12  PRO A HG3  2  
ATOM 2089  H HD2  . PRO A 1 12  ? -8.089  12.656  8.846   1.00 0.00 ? 12  PRO A HD2  2  
ATOM 2090  H HD3  . PRO A 1 12  ? -8.203  12.684  7.026   1.00 0.00 ? 12  PRO A HD3  2  
ATOM 2091  N N    . GLN A 1 13  ? -5.837  9.417   9.898   1.00 0.00 ? 13  GLN A N    2  
ATOM 2092  C CA   . GLN A 1 13  ? -5.391  8.910   11.201  1.00 0.00 ? 13  GLN A CA   2  
ATOM 2093  C C    . GLN A 1 13  ? -4.165  8.003   11.082  1.00 0.00 ? 13  GLN A C    2  
ATOM 2094  O O    . GLN A 1 13  ? -4.195  6.788   11.244  1.00 0.00 ? 13  GLN A O    2  
ATOM 2095  C CB   . GLN A 1 13  ? -6.563  8.296   12.015  1.00 0.00 ? 13  GLN A CB   2  
ATOM 2096  C CG   . GLN A 1 13  ? -7.359  7.215   11.260  1.00 0.00 ? 13  GLN A CG   2  
ATOM 2097  C CD   . GLN A 1 13  ? -8.516  6.682   12.096  1.00 0.00 ? 13  GLN A CD   2  
ATOM 2098  O OE1  . GLN A 1 13  ? -9.676  7.067   11.901  1.00 0.00 ? 13  GLN A OE1  2  
ATOM 2099  N NE2  . GLN A 1 13  ? -8.185  5.756   13.037  1.00 0.00 ? 13  GLN A NE2  2  
ATOM 2100  H H    . GLN A 1 13  ? -6.702  9.041   9.574   1.00 0.00 ? 13  GLN A H    2  
ATOM 2101  H HA   . GLN A 1 13  ? -5.064  9.749   11.779  1.00 0.00 ? 13  GLN A HA   2  
ATOM 2102  H HB2  . GLN A 1 13  ? -6.184  7.893   12.983  1.00 0.00 ? 13  GLN A HB2  2  
ATOM 2103  H HB3  . GLN A 1 13  ? -7.267  9.122   12.270  1.00 0.00 ? 13  GLN A HB3  2  
ATOM 2104  H HG2  . GLN A 1 13  ? -7.770  7.621   10.315  1.00 0.00 ? 13  GLN A HG2  2  
ATOM 2105  H HG3  . GLN A 1 13  ? -6.681  6.371   11.031  1.00 0.00 ? 13  GLN A HG3  2  
ATOM 2106  H HE21 . GLN A 1 13  ? -7.255  5.354   13.087  1.00 0.00 ? 13  GLN A HE21 2  
ATOM 2107  H HE22 . GLN A 1 13  ? -8.923  5.398   13.602  1.00 0.00 ? 13  GLN A HE22 2  
ATOM 2108  N N    . GLN A 1 14  ? -3.046  8.677   10.695  1.00 0.00 ? 14  GLN A N    2  
ATOM 2109  C CA   . GLN A 1 14  ? -1.706  8.227   10.339  1.00 0.00 ? 14  GLN A CA   2  
ATOM 2110  C C    . GLN A 1 14  ? -1.694  7.647   8.930   1.00 0.00 ? 14  GLN A C    2  
ATOM 2111  O O    . GLN A 1 14  ? -1.063  6.636   8.637   1.00 0.00 ? 14  GLN A O    2  
ATOM 2112  C CB   . GLN A 1 14  ? -1.020  7.400   11.451  1.00 0.00 ? 14  GLN A CB   2  
ATOM 2113  C CG   . GLN A 1 14  ? -0.865  8.286   12.705  1.00 0.00 ? 14  GLN A CG   2  
ATOM 2114  C CD   . GLN A 1 14  ? -0.187  7.586   13.875  1.00 0.00 ? 14  GLN A CD   2  
ATOM 2115  O OE1  . GLN A 1 14  ? 0.817   8.069   14.402  1.00 0.00 ? 14  GLN A OE1  2  
ATOM 2116  N NE2  . GLN A 1 14  ? -0.760  6.442   14.323  1.00 0.00 ? 14  GLN A NE2  2  
ATOM 2117  H H    . GLN A 1 14  ? -3.198  9.663   10.578  1.00 0.00 ? 14  GLN A H    2  
ATOM 2118  H HA   . GLN A 1 14  ? -1.119  9.130   10.253  1.00 0.00 ? 14  GLN A HA   2  
ATOM 2119  H HB2  . GLN A 1 14  ? -1.643  6.515   11.694  1.00 0.00 ? 14  GLN A HB2  2  
ATOM 2120  H HB3  . GLN A 1 14  ? -0.018  7.051   11.122  1.00 0.00 ? 14  GLN A HB3  2  
ATOM 2121  H HG2  . GLN A 1 14  ? -0.256  9.181   12.442  1.00 0.00 ? 14  GLN A HG2  2  
ATOM 2122  H HG3  . GLN A 1 14  ? -1.867  8.612   13.043  1.00 0.00 ? 14  GLN A HG3  2  
ATOM 2123  H HE21 . GLN A 1 14  ? -1.576  6.092   13.869  1.00 0.00 ? 14  GLN A HE21 2  
ATOM 2124  H HE22 . GLN A 1 14  ? -0.334  6.012   15.118  1.00 0.00 ? 14  GLN A HE22 2  
ATOM 2125  N N    . PHE A 1 15  ? -2.483  8.351   8.061   1.00 0.00 ? 15  PHE A N    2  
ATOM 2126  C CA   . PHE A 1 15  ? -2.797  8.197   6.647   1.00 0.00 ? 15  PHE A CA   2  
ATOM 2127  C C    . PHE A 1 15  ? -3.623  6.958   6.344   1.00 0.00 ? 15  PHE A C    2  
ATOM 2128  O O    . PHE A 1 15  ? -3.656  6.444   5.222   1.00 0.00 ? 15  PHE A O    2  
ATOM 2129  C CB   . PHE A 1 15  ? -1.590  8.414   5.699   1.00 0.00 ? 15  PHE A CB   2  
ATOM 2130  C CG   . PHE A 1 15  ? -0.710  9.520   6.218   1.00 0.00 ? 15  PHE A CG   2  
ATOM 2131  C CD1  . PHE A 1 15  ? 0.526   9.232   6.774   1.00 0.00 ? 15  PHE A CD1  2  
ATOM 2132  C CD2  . PHE A 1 15  ? -1.176  10.822  6.260   1.00 0.00 ? 15  PHE A CD2  2  
ATOM 2133  C CE1  . PHE A 1 15  ? 1.244   10.211  7.427   1.00 0.00 ? 15  PHE A CE1  2  
ATOM 2134  C CE2  . PHE A 1 15  ? -0.448  11.805  6.891   1.00 0.00 ? 15  PHE A CE2  2  
ATOM 2135  C CZ   . PHE A 1 15  ? 0.759   11.502  7.490   1.00 0.00 ? 15  PHE A CZ   2  
ATOM 2136  H H    . PHE A 1 15  ? -2.892  9.155   8.481   1.00 0.00 ? 15  PHE A H    2  
ATOM 2137  H HA   . PHE A 1 15  ? -3.465  9.018   6.427   1.00 0.00 ? 15  PHE A HA   2  
ATOM 2138  H HB2  . PHE A 1 15  ? -1.002  7.487   5.665   1.00 0.00 ? 15  PHE A HB2  2  
ATOM 2139  H HB3  . PHE A 1 15  ? -1.911  8.702   4.678   1.00 0.00 ? 15  PHE A HB3  2  
ATOM 2140  H HD1  . PHE A 1 15  ? 0.895   8.214   6.755   1.00 0.00 ? 15  PHE A HD1  2  
ATOM 2141  H HD2  . PHE A 1 15  ? -2.140  11.061  5.832   1.00 0.00 ? 15  PHE A HD2  2  
ATOM 2142  H HE1  . PHE A 1 15  ? 2.182   9.963   7.905   1.00 0.00 ? 15  PHE A HE1  2  
ATOM 2143  H HE2  . PHE A 1 15  ? -0.842  12.812  6.930   1.00 0.00 ? 15  PHE A HE2  2  
ATOM 2144  H HZ   . PHE A 1 15  ? 1.323   12.268  8.005   1.00 0.00 ? 15  PHE A HZ   2  
ATOM 2145  N N    . MET A 1 16  ? -4.378  6.488   7.390   1.00 0.00 ? 16  MET A N    2  
ATOM 2146  C CA   . MET A 1 16  ? -5.268  5.326   7.414   1.00 0.00 ? 16  MET A CA   2  
ATOM 2147  C C    . MET A 1 16  ? -6.332  5.325   6.367   1.00 0.00 ? 16  MET A C    2  
ATOM 2148  O O    . MET A 1 16  ? -6.348  4.363   5.628   1.00 0.00 ? 16  MET A O    2  
ATOM 2149  C CB   . MET A 1 16  ? -5.973  5.066   8.780   1.00 0.00 ? 16  MET A CB   2  
ATOM 2150  C CG   . MET A 1 16  ? -6.684  3.681   8.958   1.00 0.00 ? 16  MET A CG   2  
ATOM 2151  S SD   . MET A 1 16  ? -8.408  3.460   8.366   1.00 0.00 ? 16  MET A SD   2  
ATOM 2152  C CE   . MET A 1 16  ? -8.655  1.652   8.551   1.00 0.00 ? 16  MET A CE   2  
ATOM 2153  H H    . MET A 1 16  ? -4.290  6.949   8.270   1.00 0.00 ? 16  MET A H    2  
ATOM 2154  H HA   . MET A 1 16  ? -4.627  4.478   7.152   1.00 0.00 ? 16  MET A HA   2  
ATOM 2155  H HB2  . MET A 1 16  ? -5.189  5.160   9.571   1.00 0.00 ? 16  MET A HB2  2  
ATOM 2156  H HB3  . MET A 1 16  ? -6.716  5.866   8.988   1.00 0.00 ? 16  MET A HB3  2  
ATOM 2157  H HG2  . MET A 1 16  ? -6.032  2.905   8.509   1.00 0.00 ? 16  MET A HG2  2  
ATOM 2158  H HG3  . MET A 1 16  ? -6.710  3.472   10.044  1.00 0.00 ? 16  MET A HG3  2  
ATOM 2159  H HE1  . MET A 1 16  ? -8.483  1.291   9.589   1.00 0.00 ? 16  MET A HE1  2  
ATOM 2160  H HE2  . MET A 1 16  ? -9.693  1.359   8.294   1.00 0.00 ? 16  MET A HE2  2  
ATOM 2161  H HE3  . MET A 1 16  ? -8.009  1.036   7.884   1.00 0.00 ? 16  MET A HE3  2  
ATOM 2162  N N    . ASP A 1 17  ? -7.211  6.352   6.182   1.00 0.00 ? 17  ASP A N    2  
ATOM 2163  C CA   . ASP A 1 17  ? -8.217  6.303   5.100   1.00 0.00 ? 17  ASP A CA   2  
ATOM 2164  C C    . ASP A 1 17  ? -7.647  6.490   3.696   1.00 0.00 ? 17  ASP A C    2  
ATOM 2165  O O    . ASP A 1 17  ? -8.250  6.024   2.739   1.00 0.00 ? 17  ASP A O    2  
ATOM 2166  C CB   . ASP A 1 17  ? -9.432  7.245   5.302   1.00 0.00 ? 17  ASP A CB   2  
ATOM 2167  C CG   . ASP A 1 17  ? -10.337 6.723   6.426   1.00 0.00 ? 17  ASP A CG   2  
ATOM 2168  O OD1  . ASP A 1 17  ? -9.832  6.485   7.555   1.00 0.00 ? 17  ASP A OD1  2  
ATOM 2169  O OD2  . ASP A 1 17  ? -11.558 6.557   6.162   1.00 0.00 ? 17  ASP A OD2  2  
ATOM 2170  H H    . ASP A 1 17  ? -7.239  7.171   6.770   1.00 0.00 ? 17  ASP A H    2  
ATOM 2171  H HA   . ASP A 1 17  ? -8.640  5.305   5.074   1.00 0.00 ? 17  ASP A HA   2  
ATOM 2172  H HB2  . ASP A 1 17  ? -9.067  8.260   5.547   1.00 0.00 ? 17  ASP A HB2  2  
ATOM 2173  H HB3  . ASP A 1 17  ? -10.058 7.320   4.383   1.00 0.00 ? 17  ASP A HB3  2  
ATOM 2174  N N    . TYR A 1 18  ? -6.442  7.116   3.534   1.00 0.00 ? 18  TYR A N    2  
ATOM 2175  C CA   . TYR A 1 18  ? -5.694  7.178   2.275   1.00 0.00 ? 18  TYR A CA   2  
ATOM 2176  C C    . TYR A 1 18  ? -5.068  5.831   1.860   1.00 0.00 ? 18  TYR A C    2  
ATOM 2177  O O    . TYR A 1 18  ? -5.331  5.323   0.768   1.00 0.00 ? 18  TYR A O    2  
ATOM 2178  C CB   . TYR A 1 18  ? -4.613  8.313   2.374   1.00 0.00 ? 18  TYR A CB   2  
ATOM 2179  C CG   . TYR A 1 18  ? -3.896  8.614   1.063   1.00 0.00 ? 18  TYR A CG   2  
ATOM 2180  C CD1  . TYR A 1 18  ? -2.719  7.954   0.741   1.00 0.00 ? 18  TYR A CD1  2  
ATOM 2181  C CD2  . TYR A 1 18  ? -4.401  9.527   0.151   1.00 0.00 ? 18  TYR A CD2  2  
ATOM 2182  C CE1  . TYR A 1 18  ? -2.075  8.177   -0.458  1.00 0.00 ? 18  TYR A CE1  2  
ATOM 2183  C CE2  . TYR A 1 18  ? -3.742  9.777   -1.042  1.00 0.00 ? 18  TYR A CE2  2  
ATOM 2184  C CZ   . TYR A 1 18  ? -2.572  9.108   -1.345  1.00 0.00 ? 18  TYR A CZ   2  
ATOM 2185  O OH   . TYR A 1 18  ? -1.888  9.379   -2.552  1.00 0.00 ? 18  TYR A OH   2  
ATOM 2186  H H    . TYR A 1 18  ? -5.964  7.457   4.338   1.00 0.00 ? 18  TYR A H    2  
ATOM 2187  H HA   . TYR A 1 18  ? -6.394  7.415   1.488   1.00 0.00 ? 18  TYR A HA   2  
ATOM 2188  H HB2  . TYR A 1 18  ? -5.133  9.254   2.682   1.00 0.00 ? 18  TYR A HB2  2  
ATOM 2189  H HB3  . TYR A 1 18  ? -3.843  8.047   3.139   1.00 0.00 ? 18  TYR A HB3  2  
ATOM 2190  H HD1  . TYR A 1 18  ? -2.312  7.224   1.429   1.00 0.00 ? 18  TYR A HD1  2  
ATOM 2191  H HD2  . TYR A 1 18  ? -5.317  10.059  0.373   1.00 0.00 ? 18  TYR A HD2  2  
ATOM 2192  H HE1  . TYR A 1 18  ? -1.182  7.614   -0.695  1.00 0.00 ? 18  TYR A HE1  2  
ATOM 2193  H HE2  . TYR A 1 18  ? -4.142  10.498  -1.741  1.00 0.00 ? 18  TYR A HE2  2  
ATOM 2194  H HH   . TYR A 1 18  ? -1.059  8.896   -2.542  1.00 0.00 ? 18  TYR A HH   2  
ATOM 2195  N N    . PHE A 1 19  ? -4.265  5.190   2.759   1.00 0.00 ? 19  PHE A N    2  
ATOM 2196  C CA   . PHE A 1 19  ? -3.624  3.887   2.584   1.00 0.00 ? 19  PHE A CA   2  
ATOM 2197  C C    . PHE A 1 19  ? -4.577  2.698   2.705   1.00 0.00 ? 19  PHE A C    2  
ATOM 2198  O O    . PHE A 1 19  ? -4.508  1.727   1.954   1.00 0.00 ? 19  PHE A O    2  
ATOM 2199  C CB   . PHE A 1 19  ? -2.333  3.770   3.457   1.00 0.00 ? 19  PHE A CB   2  
ATOM 2200  C CG   . PHE A 1 19  ? -1.201  4.601   2.863   1.00 0.00 ? 19  PHE A CG   2  
ATOM 2201  C CD1  . PHE A 1 19  ? -0.860  4.541   1.519   1.00 0.00 ? 19  PHE A CD1  2  
ATOM 2202  C CD2  . PHE A 1 19  ? -0.464  5.451   3.670   1.00 0.00 ? 19  PHE A CD2  2  
ATOM 2203  C CE1  . PHE A 1 19  ? 0.129   5.350   0.994   1.00 0.00 ? 19  PHE A CE1  2  
ATOM 2204  C CE2  . PHE A 1 19  ? 0.559   6.230   3.164   1.00 0.00 ? 19  PHE A CE2  2  
ATOM 2205  C CZ   . PHE A 1 19  ? 0.841   6.200   1.813   1.00 0.00 ? 19  PHE A CZ   2  
ATOM 2206  H H    . PHE A 1 19  ? -4.049  5.620   3.645   1.00 0.00 ? 19  PHE A H    2  
ATOM 2207  H HA   . PHE A 1 19  ? -3.325  3.819   1.547   1.00 0.00 ? 19  PHE A HA   2  
ATOM 2208  H HB2  . PHE A 1 19  ? -2.481  4.133   4.497   1.00 0.00 ? 19  PHE A HB2  2  
ATOM 2209  H HB3  . PHE A 1 19  ? -1.993  2.722   3.573   1.00 0.00 ? 19  PHE A HB3  2  
ATOM 2210  H HD1  . PHE A 1 19  ? -1.370  3.859   0.857   1.00 0.00 ? 19  PHE A HD1  2  
ATOM 2211  H HD2  . PHE A 1 19  ? -0.681  5.488   4.730   1.00 0.00 ? 19  PHE A HD2  2  
ATOM 2212  H HE1  . PHE A 1 19  ? 0.360   5.306   -0.062  1.00 0.00 ? 19  PHE A HE1  2  
ATOM 2213  H HE2  . PHE A 1 19  ? 1.135   6.869   3.821   1.00 0.00 ? 19  PHE A HE2  2  
ATOM 2214  H HZ   . PHE A 1 19  ? 1.627   6.822   1.402   1.00 0.00 ? 19  PHE A HZ   2  
ATOM 2215  N N    . SER A 1 20  ? -5.556  2.788   3.640   1.00 0.00 ? 20  SER A N    2  
ATOM 2216  C CA   . SER A 1 20  ? -6.619  1.803   3.907   1.00 0.00 ? 20  SER A CA   2  
ATOM 2217  C C    . SER A 1 20  ? -7.685  1.743   2.869   1.00 0.00 ? 20  SER A C    2  
ATOM 2218  O O    . SER A 1 20  ? -8.278  0.694   2.684   1.00 0.00 ? 20  SER A O    2  
ATOM 2219  C CB   . SER A 1 20  ? -7.169  1.640   5.324   1.00 0.00 ? 20  SER A CB   2  
ATOM 2220  O OG   . SER A 1 20  ? -6.059  1.778   6.194   1.00 0.00 ? 20  SER A OG   2  
ATOM 2221  H H    . SER A 1 20  ? -5.606  3.619   4.220   1.00 0.00 ? 20  SER A H    2  
ATOM 2222  H HA   . SER A 1 20  ? -6.124  0.846   3.795   1.00 0.00 ? 20  SER A HA   2  
ATOM 2223  H HB2  . SER A 1 20  ? -7.917  2.437   5.569   1.00 0.00 ? 20  SER A HB2  2  
ATOM 2224  H HB3  . SER A 1 20  ? -7.622  0.629   5.468   1.00 0.00 ? 20  SER A HB3  2  
ATOM 2225  H HG   . SER A 1 20  ? -5.901  2.742   6.143   1.00 0.00 ? 20  SER A HG   2  
ATOM 2226  N N    . GLU A 1 21  ? -7.983  2.853   2.124   1.00 0.00 ? 21  GLU A N    2  
ATOM 2227  C CA   . GLU A 1 21  ? -8.859  2.829   0.951   1.00 0.00 ? 21  GLU A CA   2  
ATOM 2228  C C    . GLU A 1 21  ? -8.191  2.069   -0.202  1.00 0.00 ? 21  GLU A C    2  
ATOM 2229  O O    . GLU A 1 21  ? -8.766  1.123   -0.714  1.00 0.00 ? 21  GLU A O    2  
ATOM 2230  C CB   . GLU A 1 21  ? -9.255  4.261   0.514   1.00 0.00 ? 21  GLU A CB   2  
ATOM 2231  C CG   . GLU A 1 21  ? -10.214 4.367   -0.689  1.00 0.00 ? 21  GLU A CG   2  
ATOM 2232  C CD   . GLU A 1 21  ? -10.583 5.836   -0.910  1.00 0.00 ? 21  GLU A CD   2  
ATOM 2233  O OE1  . GLU A 1 21  ? -10.217 6.385   -1.985  1.00 0.00 ? 21  GLU A OE1  2  
ATOM 2234  O OE2  . GLU A 1 21  ? -11.234 6.428   -0.008  1.00 0.00 ? 21  GLU A OE2  2  
ATOM 2235  H H    . GLU A 1 21  ? -7.523  3.725   2.293   1.00 0.00 ? 21  GLU A H    2  
ATOM 2236  H HA   . GLU A 1 21  ? -9.769  2.294   1.196   1.00 0.00 ? 21  GLU A HA   2  
ATOM 2237  H HB2  . GLU A 1 21  ? -9.768  4.720   1.392   1.00 0.00 ? 21  GLU A HB2  2  
ATOM 2238  H HB3  . GLU A 1 21  ? -8.341  4.869   0.322   1.00 0.00 ? 21  GLU A HB3  2  
ATOM 2239  H HG2  . GLU A 1 21  ? -9.732  3.971   -1.607  1.00 0.00 ? 21  GLU A HG2  2  
ATOM 2240  H HG3  . GLU A 1 21  ? -11.136 3.783   -0.490  1.00 0.00 ? 21  GLU A HG3  2  
ATOM 2241  N N    . GLU A 1 22  ? -6.903  2.381   -0.543  1.00 0.00 ? 22  GLU A N    2  
ATOM 2242  C CA   . GLU A 1 22  ? -6.103  1.694   -1.566  1.00 0.00 ? 22  GLU A CA   2  
ATOM 2243  C C    . GLU A 1 22  ? -5.741  0.240   -1.237  1.00 0.00 ? 22  GLU A C    2  
ATOM 2244  O O    . GLU A 1 22  ? -5.676  -0.626  -2.114  1.00 0.00 ? 22  GLU A O    2  
ATOM 2245  C CB   . GLU A 1 22  ? -4.810  2.526   -1.819  1.00 0.00 ? 22  GLU A CB   2  
ATOM 2246  C CG   . GLU A 1 22  ? -3.947  2.148   -3.038  1.00 0.00 ? 22  GLU A CG   2  
ATOM 2247  C CD   . GLU A 1 22  ? -4.785  2.181   -4.312  1.00 0.00 ? 22  GLU A CD   2  
ATOM 2248  O OE1  . GLU A 1 22  ? -4.925  1.106   -4.955  1.00 0.00 ? 22  GLU A OE1  2  
ATOM 2249  O OE2  . GLU A 1 22  ? -5.298  3.277   -4.658  1.00 0.00 ? 22  GLU A OE2  2  
ATOM 2250  H H    . GLU A 1 22  ? -6.437  3.137   -0.075  1.00 0.00 ? 22  GLU A H    2  
ATOM 2251  H HA   . GLU A 1 22  ? -6.734  1.626   -2.460  1.00 0.00 ? 22  GLU A HA   2  
ATOM 2252  H HB2  . GLU A 1 22  ? -5.117  3.587   -1.952  1.00 0.00 ? 22  GLU A HB2  2  
ATOM 2253  H HB3  . GLU A 1 22  ? -4.155  2.493   -0.915  1.00 0.00 ? 22  GLU A HB3  2  
ATOM 2254  H HG2  . GLU A 1 22  ? -3.117  2.887   -3.125  1.00 0.00 ? 22  GLU A HG2  2  
ATOM 2255  H HG3  . GLU A 1 22  ? -3.501  1.141   -2.899  1.00 0.00 ? 22  GLU A HG3  2  
ATOM 2256  N N    . PHE A 1 23  ? -5.509  -0.105  0.064   1.00 0.00 ? 23  PHE A N    2  
ATOM 2257  C CA   . PHE A 1 23  ? -5.361  -1.472  0.548   1.00 0.00 ? 23  PHE A CA   2  
ATOM 2258  C C    . PHE A 1 23  ? -6.707  -2.189  0.583   1.00 0.00 ? 23  PHE A C    2  
ATOM 2259  O O    . PHE A 1 23  ? -6.835  -3.231  -0.031  1.00 0.00 ? 23  PHE A O    2  
ATOM 2260  C CB   . PHE A 1 23  ? -4.716  -1.490  1.973   1.00 0.00 ? 23  PHE A CB   2  
ATOM 2261  C CG   . PHE A 1 23  ? -4.459  -2.844  2.618   1.00 0.00 ? 23  PHE A CG   2  
ATOM 2262  C CD1  . PHE A 1 23  ? -4.583  -2.963  3.993   1.00 0.00 ? 23  PHE A CD1  2  
ATOM 2263  C CD2  . PHE A 1 23  ? -4.060  -3.959  1.896   1.00 0.00 ? 23  PHE A CD2  2  
ATOM 2264  C CE1  . PHE A 1 23  ? -4.157  -4.090  4.654   1.00 0.00 ? 23  PHE A CE1  2  
ATOM 2265  C CE2  . PHE A 1 23  ? -3.749  -5.137  2.548   1.00 0.00 ? 23  PHE A CE2  2  
ATOM 2266  C CZ   . PHE A 1 23  ? -3.769  -5.191  3.925   1.00 0.00 ? 23  PHE A CZ   2  
ATOM 2267  H H    . PHE A 1 23  ? -5.479  0.601   0.776   1.00 0.00 ? 23  PHE A H    2  
ATOM 2268  H HA   . PHE A 1 23  ? -4.718  -2.022  -0.136  1.00 0.00 ? 23  PHE A HA   2  
ATOM 2269  H HB2  . PHE A 1 23  ? -3.704  -1.006  1.873   1.00 0.00 ? 23  PHE A HB2  2  
ATOM 2270  H HB3  . PHE A 1 23  ? -5.374  -0.903  2.671   1.00 0.00 ? 23  PHE A HB3  2  
ATOM 2271  H HD1  . PHE A 1 23  ? -5.014  -2.161  4.570   1.00 0.00 ? 23  PHE A HD1  2  
ATOM 2272  H HD2  . PHE A 1 23  ? -3.997  -3.923  0.817   1.00 0.00 ? 23  PHE A HD2  2  
ATOM 2273  H HE1  . PHE A 1 23  ? -4.132  -4.119  5.740   1.00 0.00 ? 23  PHE A HE1  2  
ATOM 2274  H HE2  . PHE A 1 23  ? -3.400  -5.993  1.986   1.00 0.00 ? 23  PHE A HE2  2  
ATOM 2275  H HZ   . PHE A 1 23  ? -3.448  -6.078  4.445   1.00 0.00 ? 23  PHE A HZ   2  
ATOM 2276  N N    . ARG A 1 24  ? -7.773  -1.653  1.235   1.00 0.00 ? 24  ARG A N    2  
ATOM 2277  C CA   . ARG A 1 24  ? -9.068  -2.327  1.365   1.00 0.00 ? 24  ARG A CA   2  
ATOM 2278  C C    . ARG A 1 24  ? -9.940  -2.469  0.118   1.00 0.00 ? 24  ARG A C    2  
ATOM 2279  O O    . ARG A 1 24  ? -10.557 -3.517  -0.069  1.00 0.00 ? 24  ARG A O    2  
ATOM 2280  C CB   . ARG A 1 24  ? -9.830  -1.934  2.670   1.00 0.00 ? 24  ARG A CB   2  
ATOM 2281  C CG   . ARG A 1 24  ? -10.840 -3.020  3.133   1.00 0.00 ? 24  ARG A CG   2  
ATOM 2282  C CD   . ARG A 1 24  ? -10.408 -3.849  4.359   1.00 0.00 ? 24  ARG A CD   2  
ATOM 2283  N NE   . ARG A 1 24  ? -8.920  -4.122  4.328   1.00 0.00 ? 24  ARG A NE   2  
ATOM 2284  C CZ   . ARG A 1 24  ? -8.360  -5.109  3.561   1.00 0.00 ? 24  ARG A CZ   2  
ATOM 2285  N NH1  . ARG A 1 24  ? -9.152  -5.935  2.826   1.00 0.00 ? 24  ARG A NH1  2  
ATOM 2286  N NH2  . ARG A 1 24  ? -7.007  -5.258  3.518   1.00 0.00 ? 24  ARG A NH2  2  
ATOM 2287  H H    . ARG A 1 24  ? -7.712  -0.784  1.741   1.00 0.00 ? 24  ARG A H    2  
ATOM 2288  H HA   . ARG A 1 24  ? -8.823  -3.360  1.558   1.00 0.00 ? 24  ARG A HA   2  
ATOM 2289  H HB2  . ARG A 1 24  ? -9.045  -1.836  3.471   1.00 0.00 ? 24  ARG A HB2  2  
ATOM 2290  H HB3  . ARG A 1 24  ? -10.315 -0.935  2.586   1.00 0.00 ? 24  ARG A HB3  2  
ATOM 2291  H HG2  . ARG A 1 24  ? -11.835 -2.578  3.356   1.00 0.00 ? 24  ARG A HG2  2  
ATOM 2292  H HG3  . ARG A 1 24  ? -10.985 -3.758  2.311   1.00 0.00 ? 24  ARG A HG3  2  
ATOM 2293  H HD2  . ARG A 1 24  ? -10.651 -3.305  5.290   1.00 0.00 ? 24  ARG A HD2  2  
ATOM 2294  H HD3  . ARG A 1 24  ? -10.960 -4.814  4.418   1.00 0.00 ? 24  ARG A HD3  2  
ATOM 2295  H HE   . ARG A 1 24  ? -8.316  -3.525  4.857   1.00 0.00 ? 24  ARG A HE   2  
ATOM 2296  H HH11 . ARG A 1 24  ? -10.146 -5.825  2.850   1.00 0.00 ? 24  ARG A HH11 2  
ATOM 2297  H HH12 . ARG A 1 24  ? -8.740  -6.650  2.261   1.00 0.00 ? 24  ARG A HH12 2  
ATOM 2298  H HH21 . ARG A 1 24  ? -6.420  -4.650  4.052   1.00 0.00 ? 24  ARG A HH21 2  
ATOM 2299  H HH22 . ARG A 1 24  ? -6.603  -5.974  2.951   1.00 0.00 ? 24  ARG A HH22 2  
ATOM 2300  N N    . ASN A 1 25  ? -9.987  -1.476  -0.819  1.00 0.00 ? 25  ASN A N    2  
ATOM 2301  C CA   . ASN A 1 25  ? -10.756 -1.557  -2.073  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2302  C C    . ASN A 1 25  ? -10.263 -2.608  -3.058  1.00 0.00 ? 25  ASN A C    2  
ATOM 2303  O O    . ASN A 1 25  ? -10.992 -3.489  -3.505  1.00 0.00 ? 25  ASN A O    2  
ATOM 2304  C CB   . ASN A 1 25  ? -10.747 -0.175  -2.782  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2305  C CG   . ASN A 1 25  ? -12.153 0.380   -2.695  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2306  O OD1  . ASN A 1 25  ? -12.989 0.169   -3.573  1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2307  N ND2  . ASN A 1 25  ? -12.436 1.100   -1.576  1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2308  H H    . ASN A 1 25  ? -9.468  -0.623  -0.681  1.00 0.00 ? 25  ASN A H    2  
ATOM 2309  H HA   . ASN A 1 25  ? -11.764 -1.874  -1.816  1.00 0.00 ? 25  ASN A HA   2  
ATOM 2310  H HB2  . ASN A 1 25  ? -10.080 0.519   -2.265  1.00 0.00 ? 25  ASN A HB2  2  
ATOM 2311  H HB3  . ASN A 1 25  ? -10.350 -0.137  -3.815  1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2312  H HD21 . ASN A 1 25  ? -11.715 1.322   -0.923  1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2313  H HD22 . ASN A 1 25  ? -13.366 1.444   -1.481  1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2314  N N    . ASP A 1 26  ? -8.945  -2.568  -3.347  1.00 0.00 ? 26  ASP A N    2  
ATOM 2315  C CA   . ASP A 1 26  ? -8.236  -3.521  -4.186  1.00 0.00 ? 26  ASP A CA   2  
ATOM 2316  C C    . ASP A 1 26  ? -8.036  -4.858  -3.492  1.00 0.00 ? 26  ASP A C    2  
ATOM 2317  O O    . ASP A 1 26  ? -8.254  -5.876  -4.136  1.00 0.00 ? 26  ASP A O    2  
ATOM 2318  C CB   . ASP A 1 26  ? -6.938  -2.876  -4.707  1.00 0.00 ? 26  ASP A CB   2  
ATOM 2319  C CG   . ASP A 1 26  ? -7.218  -2.018  -5.943  1.00 0.00 ? 26  ASP A CG   2  
ATOM 2320  O OD1  . ASP A 1 26  ? -7.128  -0.767  -5.834  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2321  O OD2  . ASP A 1 26  ? -7.525  -2.609  -7.013  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2322  H H    . ASP A 1 26  ? -8.378  -1.851  -2.943  1.00 0.00 ? 26  ASP A H    2  
ATOM 2323  H HA   . ASP A 1 26  ? -8.823  -3.796  -5.054  1.00 0.00 ? 26  ASP A HA   2  
ATOM 2324  H HB2  . ASP A 1 26  ? -6.543  -2.215  -3.905  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2325  H HB3  . ASP A 1 26  ? -6.157  -3.624  -4.950  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2326  N N    . PHE A 1 27  ? -7.722  -4.918  -2.155  1.00 0.00 ? 27  PHE A N    2  
ATOM 2327  C CA   . PHE A 1 27  ? -7.601  -6.172  -1.385  1.00 0.00 ? 27  PHE A CA   2  
ATOM 2328  C C    . PHE A 1 27  ? -8.924  -6.894  -1.204  1.00 0.00 ? 27  PHE A C    2  
ATOM 2329  O O    . PHE A 1 27  ? -8.944  -8.105  -1.375  1.00 0.00 ? 27  PHE A O    2  
ATOM 2330  C CB   . PHE A 1 27  ? -6.861  -6.045  -0.022  1.00 0.00 ? 27  PHE A CB   2  
ATOM 2331  C CG   . PHE A 1 27  ? -6.373  -7.327  0.637   1.00 0.00 ? 27  PHE A CG   2  
ATOM 2332  C CD1  . PHE A 1 27  ? -7.185  -8.124  1.441   1.00 0.00 ? 27  PHE A CD1  2  
ATOM 2333  C CD2  . PHE A 1 27  ? -5.028  -7.627  0.558   1.00 0.00 ? 27  PHE A CD2  2  
ATOM 2334  C CE1  . PHE A 1 27  ? -6.661  -9.185  2.150   1.00 0.00 ? 27  PHE A CE1  2  
ATOM 2335  C CE2  . PHE A 1 27  ? -4.505  -8.684  1.262   1.00 0.00 ? 27  PHE A CE2  2  
ATOM 2336  C CZ   . PHE A 1 27  ? -5.335  -9.492  2.002   1.00 0.00 ? 27  PHE A CZ   2  
ATOM 2337  H H    . PHE A 1 27  ? -7.569  -4.082  -1.615  1.00 0.00 ? 27  PHE A H    2  
ATOM 2338  H HA   . PHE A 1 27  ? -6.980  -6.838  -1.974  1.00 0.00 ? 27  PHE A HA   2  
ATOM 2339  H HB2  . PHE A 1 27  ? -5.947  -5.429  -0.221  1.00 0.00 ? 27  PHE A HB2  2  
ATOM 2340  H HB3  . PHE A 1 27  ? -7.493  -5.495  0.714   1.00 0.00 ? 27  PHE A HB3  2  
ATOM 2341  H HD1  . PHE A 1 27  ? -8.239  -7.908  1.530   1.00 0.00 ? 27  PHE A HD1  2  
ATOM 2342  H HD2  . PHE A 1 27  ? -4.373  -6.986  -0.018  1.00 0.00 ? 27  PHE A HD2  2  
ATOM 2343  H HE1  . PHE A 1 27  ? -7.219  -9.753  2.895   1.00 0.00 ? 27  PHE A HE1  2  
ATOM 2344  H HE2  . PHE A 1 27  ? -3.436  -8.861  1.285   1.00 0.00 ? 27  PHE A HE2  2  
ATOM 2345  H HZ   . PHE A 1 27  ? -4.937  -10.338 2.543   1.00 0.00 ? 27  PHE A HZ   2  
ATOM 2346  N N    . LEU A 1 28  ? -10.099 -6.220  -0.939  1.00 0.00 ? 28  LEU A N    2  
ATOM 2347  C CA   . LEU A 1 28  ? -11.395 -6.930  -0.925  1.00 0.00 ? 28  LEU A CA   2  
ATOM 2348  C C    . LEU A 1 28  ? -11.778 -7.475  -2.286  1.00 0.00 ? 28  LEU A C    2  
ATOM 2349  O O    . LEU A 1 28  ? -12.199 -8.626  -2.334  1.00 0.00 ? 28  LEU A O    2  
ATOM 2350  C CB   . LEU A 1 28  ? -12.598 -6.235  -0.231  1.00 0.00 ? 28  LEU A CB   2  
ATOM 2351  C CG   . LEU A 1 28  ? -12.648 -6.327  1.318   1.00 0.00 ? 28  LEU A CG   2  
ATOM 2352  C CD1  . LEU A 1 28  ? -14.108 -6.455  1.771   1.00 0.00 ? 28  LEU A CD1  2  
ATOM 2353  C CD2  . LEU A 1 28  ? -11.883 -7.485  1.989   1.00 0.00 ? 28  LEU A CD2  2  
ATOM 2354  H H    . LEU A 1 28  ? -10.137 -5.221  -0.788  1.00 0.00 ? 28  LEU A H    2  
ATOM 2355  H HA   . LEU A 1 28  ? -11.251 -7.847  -0.375  1.00 0.00 ? 28  LEU A HA   2  
ATOM 2356  H HB2  . LEU A 1 28  ? -12.638 -5.169  -0.544  1.00 0.00 ? 28  LEU A HB2  2  
ATOM 2357  H HB3  . LEU A 1 28  ? -13.555 -6.709  -0.564  1.00 0.00 ? 28  LEU A HB3  2  
ATOM 2358  H HG   . LEU A 1 28  ? -12.225 -5.379  1.722   1.00 0.00 ? 28  LEU A HG   2  
ATOM 2359  H HD11 . LEU A 1 28  ? -14.596 -7.343  1.312   1.00 0.00 ? 28  LEU A HD11 2  
ATOM 2360  H HD12 . LEU A 1 28  ? -14.130 -6.614  2.865   1.00 0.00 ? 28  LEU A HD12 2  
ATOM 2361  H HD13 . LEU A 1 28  ? -14.692 -5.548  1.516   1.00 0.00 ? 28  LEU A HD13 2  
ATOM 2362  H HD21 . LEU A 1 28  ? -10.824 -7.519  1.665   1.00 0.00 ? 28  LEU A HD21 2  
ATOM 2363  H HD22 . LEU A 1 28  ? -11.868 -7.334  3.092   1.00 0.00 ? 28  LEU A HD22 2  
ATOM 2364  H HD23 . LEU A 1 28  ? -12.364 -8.456  1.758   1.00 0.00 ? 28  LEU A HD23 2  
ATOM 2365  N N    . GLU A 1 29  ? -11.507 -6.759  -3.434  1.00 0.00 ? 29  GLU A N    2  
ATOM 2366  C CA   . GLU A 1 29  ? -11.624 -7.357  -4.781  1.00 0.00 ? 29  GLU A CA   2  
ATOM 2367  C C    . GLU A 1 29  ? -10.707 -8.561  -5.001  1.00 0.00 ? 29  GLU A C    2  
ATOM 2368  O O    . GLU A 1 29  ? -11.197 -9.602  -5.392  1.00 0.00 ? 29  GLU A O    2  
ATOM 2369  C CB   . GLU A 1 29  ? -11.242 -6.426  -5.972  1.00 0.00 ? 29  GLU A CB   2  
ATOM 2370  C CG   . GLU A 1 29  ? -12.324 -5.477  -6.493  1.00 0.00 ? 29  GLU A CG   2  
ATOM 2371  C CD   . GLU A 1 29  ? -13.584 -6.215  -6.930  1.00 0.00 ? 29  GLU A CD   2  
ATOM 2372  O OE1  . GLU A 1 29  ? -13.462 -7.127  -7.793  1.00 0.00 ? 29  GLU A OE1  2  
ATOM 2373  O OE2  . GLU A 1 29  ? -14.686 -5.869  -6.427  1.00 0.00 ? 29  GLU A OE2  2  
ATOM 2374  H H    . GLU A 1 29  ? -11.142 -5.820  -3.391  1.00 0.00 ? 29  GLU A H    2  
ATOM 2375  H HA   . GLU A 1 29  ? -12.646 -7.729  -4.862  1.00 0.00 ? 29  GLU A HA   2  
ATOM 2376  H HB2  . GLU A 1 29  ? -10.353 -5.816  -5.691  1.00 0.00 ? 29  GLU A HB2  2  
ATOM 2377  H HB3  . GLU A 1 29  ? -10.971 -6.984  -6.905  1.00 0.00 ? 29  GLU A HB3  2  
ATOM 2378  H HG2  . GLU A 1 29  ? -12.546 -4.702  -5.738  1.00 0.00 ? 29  GLU A HG2  2  
ATOM 2379  H HG3  . GLU A 1 29  ? -11.869 -5.038  -7.410  1.00 0.00 ? 29  GLU A HG3  2  
ATOM 2380  N N    . LEU A 1 30  ? -9.378  -8.445  -4.720  1.00 0.00 ? 30  LEU A N    2  
ATOM 2381  C CA   . LEU A 1 30  ? -8.310  -9.452  -4.842  1.00 0.00 ? 30  LEU A CA   2  
ATOM 2382  C C    . LEU A 1 30  ? -8.556  -10.736 -4.055  1.00 0.00 ? 30  LEU A C    2  
ATOM 2383  O O    . LEU A 1 30  ? -8.405  -11.837 -4.582  1.00 0.00 ? 30  LEU A O    2  
ATOM 2384  C CB   . LEU A 1 30  ? -6.990  -8.815  -4.323  1.00 0.00 ? 30  LEU A CB   2  
ATOM 2385  C CG   . LEU A 1 30  ? -5.646  -9.259  -4.936  1.00 0.00 ? 30  LEU A CG   2  
ATOM 2386  C CD1  . LEU A 1 30  ? -5.357  -10.758 -4.972  1.00 0.00 ? 30  LEU A CD1  2  
ATOM 2387  C CD2  . LEU A 1 30  ? -5.468  -8.628  -6.310  1.00 0.00 ? 30  LEU A CD2  2  
ATOM 2388  H H    . LEU A 1 30  ? -9.045  -7.551  -4.395  1.00 0.00 ? 30  LEU A H    2  
ATOM 2389  H HA   . LEU A 1 30  ? -8.211  -9.708  -5.888  1.00 0.00 ? 30  LEU A HA   2  
ATOM 2390  H HB2  . LEU A 1 30  ? -7.055  -7.739  -4.586  1.00 0.00 ? 30  LEU A HB2  2  
ATOM 2391  H HB3  . LEU A 1 30  ? -6.916  -8.842  -3.213  1.00 0.00 ? 30  LEU A HB3  2  
ATOM 2392  H HG   . LEU A 1 30  ? -4.851  -8.821  -4.293  1.00 0.00 ? 30  LEU A HG   2  
ATOM 2393  H HD11 . LEU A 1 30  ? -5.548  -11.195 -3.970  1.00 0.00 ? 30  LEU A HD11 2  
ATOM 2394  H HD12 . LEU A 1 30  ? -5.978  -11.265 -5.737  1.00 0.00 ? 30  LEU A HD12 2  
ATOM 2395  H HD13 . LEU A 1 30  ? -4.290  -10.927 -5.227  1.00 0.00 ? 30  LEU A HD13 2  
ATOM 2396  H HD21 . LEU A 1 30  ? -5.632  -7.525  -6.253  1.00 0.00 ? 30  LEU A HD21 2  
ATOM 2397  H HD22 . LEU A 1 30  ? -4.437  -8.841  -6.664  1.00 0.00 ? 30  LEU A HD22 2  
ATOM 2398  H HD23 . LEU A 1 30  ? -6.183  -9.077  -7.026  1.00 0.00 ? 30  LEU A HD23 2  
ATOM 2399  N N    . LEU A 1 31  ? -9.044  -10.564 -2.788  1.00 0.00 ? 31  LEU A N    2  
ATOM 2400  C CA   . LEU A 1 31  ? -9.482  -11.533 -1.795  1.00 0.00 ? 31  LEU A CA   2  
ATOM 2401  C C    . LEU A 1 31  ? -10.698 -12.283 -2.286  1.00 0.00 ? 31  LEU A C    2  
ATOM 2402  O O    . LEU A 1 31  ? -10.668 -13.503 -2.379  1.00 0.00 ? 31  LEU A O    2  
ATOM 2403  C CB   . LEU A 1 31  ? -9.767  -10.788 -0.451  1.00 0.00 ? 31  LEU A CB   2  
ATOM 2404  C CG   . LEU A 1 31  ? -9.956  -11.620 0.837   1.00 0.00 ? 31  LEU A CG   2  
ATOM 2405  C CD1  . LEU A 1 31  ? -8.740  -12.544 1.040   1.00 0.00 ? 31  LEU A CD1  2  
ATOM 2406  C CD2  . LEU A 1 31  ? -10.193 -10.695 2.067   1.00 0.00 ? 31  LEU A CD2  2  
ATOM 2407  H H    . LEU A 1 31  ? -9.144  -9.620  -2.448  1.00 0.00 ? 31  LEU A H    2  
ATOM 2408  H HA   . LEU A 1 31  ? -8.689  -12.253 -1.674  1.00 0.00 ? 31  LEU A HA   2  
ATOM 2409  H HB2  . LEU A 1 31  ? -8.846  -10.173 -0.261  1.00 0.00 ? 31  LEU A HB2  2  
ATOM 2410  H HB3  . LEU A 1 31  ? -10.655 -10.112 -0.573  1.00 0.00 ? 31  LEU A HB3  2  
ATOM 2411  H HG   . LEU A 1 31  ? -10.860 -12.262 0.714   1.00 0.00 ? 31  LEU A HG   2  
ATOM 2412  H HD11 . LEU A 1 31  ? -7.813  -11.935 1.120   1.00 0.00 ? 31  LEU A HD11 2  
ATOM 2413  H HD12 . LEU A 1 31  ? -8.857  -13.147 1.965   1.00 0.00 ? 31  LEU A HD12 2  
ATOM 2414  H HD13 . LEU A 1 31  ? -8.606  -13.241 0.183   1.00 0.00 ? 31  LEU A HD13 2  
ATOM 2415  H HD21 . LEU A 1 31  ? -9.410  -9.915  2.129   1.00 0.00 ? 31  LEU A HD21 2  
ATOM 2416  H HD22 . LEU A 1 31  ? -11.176 -10.175 2.032   1.00 0.00 ? 31  LEU A HD22 2  
ATOM 2417  H HD23 . LEU A 1 31  ? -10.194 -11.270 3.020   1.00 0.00 ? 31  LEU A HD23 2  
ATOM 2418  N N    . ARG A 1 32  ? -11.761 -11.543 -2.709  1.00 0.00 ? 32  ARG A N    2  
ATOM 2419  C CA   . ARG A 1 32  ? -12.984 -12.061 -3.318  1.00 0.00 ? 32  ARG A CA   2  
ATOM 2420  C C    . ARG A 1 32  ? -12.833 -12.774 -4.670  1.00 0.00 ? 32  ARG A C    2  
ATOM 2421  O O    . ARG A 1 32  ? -13.409 -13.840 -4.821  1.00 0.00 ? 32  ARG A O    2  
ATOM 2422  C CB   . ARG A 1 32  ? -14.016 -10.928 -3.496  1.00 0.00 ? 32  ARG A CB   2  
ATOM 2423  C CG   . ARG A 1 32  ? -14.681 -10.469 -2.196  1.00 0.00 ? 32  ARG A CG   2  
ATOM 2424  C CD   . ARG A 1 32  ? -15.697 -9.331  -2.418  1.00 0.00 ? 32  ARG A CD   2  
ATOM 2425  N NE   . ARG A 1 32  ? -15.028 -8.054  -2.829  1.00 0.00 ? 32  ARG A NE   2  
ATOM 2426  C CZ   . ARG A 1 32  ? -15.697 -6.866  -2.971  1.00 0.00 ? 32  ARG A CZ   2  
ATOM 2427  N NH1  . ARG A 1 32  ? -17.051 -6.804  -2.821  1.00 0.00 ? 32  ARG A NH1  2  
ATOM 2428  N NH2  . ARG A 1 32  ? -14.994 -5.734  -3.265  1.00 0.00 ? 32  ARG A NH2  2  
ATOM 2429  H H    . ARG A 1 32  ? -11.734 -10.539 -2.634  1.00 0.00 ? 32  ARG A H    2  
ATOM 2430  H HA   . ARG A 1 32  ? -13.409 -12.794 -2.642  1.00 0.00 ? 32  ARG A HA   2  
ATOM 2431  H HB2  . ARG A 1 32  ? -13.504 -10.063 -3.971  1.00 0.00 ? 32  ARG A HB2  2  
ATOM 2432  H HB3  . ARG A 1 32  ? -14.864 -11.240 -4.154  1.00 0.00 ? 32  ARG A HB3  2  
ATOM 2433  H HG2  . ARG A 1 32  ? -15.215 -11.369 -1.806  1.00 0.00 ? 32  ARG A HG2  2  
ATOM 2434  H HG3  . ARG A 1 32  ? -13.949 -10.174 -1.414  1.00 0.00 ? 32  ARG A HG3  2  
ATOM 2435  H HD2  . ARG A 1 32  ? -16.429 -9.623  -3.195  1.00 0.00 ? 32  ARG A HD2  2  
ATOM 2436  H HD3  . ARG A 1 32  ? -16.208 -9.111  -1.473  1.00 0.00 ? 32  ARG A HD3  2  
ATOM 2437  H HE   . ARG A 1 32  ? -14.036 -8.060  -2.955  1.00 0.00 ? 32  ARG A HE   2  
ATOM 2438  H HH11 . ARG A 1 32  ? -17.567 -7.633  -2.607  1.00 0.00 ? 32  ARG A HH11 2  
ATOM 2439  H HH12 . ARG A 1 32  ? -17.526 -5.931  -2.926  1.00 0.00 ? 32  ARG A HH12 2  
ATOM 2440  H HH21 . ARG A 1 32  ? -14.000 -5.777  -3.375  1.00 0.00 ? 32  ARG A HH21 2  
ATOM 2441  H HH22 . ARG A 1 32  ? -15.472 -4.862  -3.369  1.00 0.00 ? 32  ARG A HH22 2  
ATOM 2442  N N    . ARG A 1 33  ? -12.082 -12.254 -5.692  1.00 0.00 ? 33  ARG A N    2  
ATOM 2443  C CA   . ARG A 1 33  ? -11.773 -12.953 -6.931  1.00 0.00 ? 33  ARG A CA   2  
ATOM 2444  C C    . ARG A 1 33  ? -10.800 -14.076 -6.857  1.00 0.00 ? 33  ARG A C    2  
ATOM 2445  O O    . ARG A 1 33  ? -11.052 -15.148 -7.396  1.00 0.00 ? 33  ARG A O    2  
ATOM 2446  C CB   . ARG A 1 33  ? -11.251 -12.125 -8.145  1.00 0.00 ? 33  ARG A CB   2  
ATOM 2447  C CG   . ARG A 1 33  ? -10.368 -10.887 -7.919  1.00 0.00 ? 33  ARG A CG   2  
ATOM 2448  C CD   . ARG A 1 33  ? -9.586  -10.422 -9.156  1.00 0.00 ? 33  ARG A CD   2  
ATOM 2449  N NE   . ARG A 1 33  ? -8.619  -9.341  -8.738  1.00 0.00 ? 33  ARG A NE   2  
ATOM 2450  C CZ   . ARG A 1 33  ? -8.868  -7.998  -8.842  1.00 0.00 ? 33  ARG A CZ   2  
ATOM 2451  N NH1  . ARG A 1 33  ? -10.016 -7.533  -9.415  1.00 0.00 ? 33  ARG A NH1  2  
ATOM 2452  N NH2  . ARG A 1 33  ? -7.953  -7.107  -8.354  1.00 0.00 ? 33  ARG A NH2  2  
ATOM 2453  H H    . ARG A 1 33  ? -11.609 -11.376 -5.615  1.00 0.00 ? 33  ARG A H    2  
ATOM 2454  H HA   . ARG A 1 33  ? -12.685 -13.413 -7.276  1.00 0.00 ? 33  ARG A HA   2  
ATOM 2455  H HB2  . ARG A 1 33  ? -10.822 -12.789 -8.915  1.00 0.00 ? 33  ARG A HB2  2  
ATOM 2456  H HB3  . ARG A 1 33  ? -12.132 -11.813 -8.675  1.00 0.00 ? 33  ARG A HB3  2  
ATOM 2457  H HG2  . ARG A 1 33  ? -11.032 -10.032 -7.642  1.00 0.00 ? 33  ARG A HG2  2  
ATOM 2458  H HG3  . ARG A 1 33  ? -9.654  -11.097 -7.094  1.00 0.00 ? 33  ARG A HG3  2  
ATOM 2459  H HD2  . ARG A 1 33  ? -8.984  -11.260 -9.562  1.00 0.00 ? 33  ARG A HD2  2  
ATOM 2460  H HD3  . ARG A 1 33  ? -10.285 -10.048 -9.938  1.00 0.00 ? 33  ARG A HD3  2  
ATOM 2461  H HE   . ARG A 1 33  ? -7.762  -9.627  -8.310  1.00 0.00 ? 33  ARG A HE   2  
ATOM 2462  H HH11 . ARG A 1 33  ? -10.692 -8.179  -9.770  1.00 0.00 ? 33  ARG A HH11 2  
ATOM 2463  H HH12 . ARG A 1 33  ? -10.181 -6.550  -9.478  1.00 0.00 ? 33  ARG A HH12 2  
ATOM 2464  H HH21 . ARG A 1 33  ? -7.112  -7.439  -7.927  1.00 0.00 ? 33  ARG A HH21 2  
ATOM 2465  H HH22 . ARG A 1 33  ? -8.127  -6.125  -8.421  1.00 0.00 ? 33  ARG A HH22 2  
ATOM 2466  N N    . ARG A 1 34  ? -9.587  -13.829 -6.307  1.00 0.00 ? 34  ARG A N    2  
ATOM 2467  C CA   . ARG A 1 34  ? -8.525  -14.794 -6.466  1.00 0.00 ? 34  ARG A CA   2  
ATOM 2468  C C    . ARG A 1 34  ? -8.576  -15.946 -5.449  1.00 0.00 ? 34  ARG A C    2  
ATOM 2469  O O    . ARG A 1 34  ? -8.032  -17.027 -5.668  1.00 0.00 ? 34  ARG A O    2  
ATOM 2470  C CB   . ARG A 1 34  ? -7.126  -14.119 -6.469  1.00 0.00 ? 34  ARG A CB   2  
ATOM 2471  C CG   . ARG A 1 34  ? -6.885  -13.121 -7.625  1.00 0.00 ? 34  ARG A CG   2  
ATOM 2472  C CD   . ARG A 1 34  ? -6.972  -13.711 -9.043  1.00 0.00 ? 34  ARG A CD   2  
ATOM 2473  N NE   . ARG A 1 34  ? -5.947  -14.806 -9.170  1.00 0.00 ? 34  ARG A NE   2  
ATOM 2474  C CZ   . ARG A 1 34  ? -5.901  -15.684 -10.220 1.00 0.00 ? 34  ARG A CZ   2  
ATOM 2475  N NH1  . ARG A 1 34  ? -6.807  -15.609 -11.236 1.00 0.00 ? 34  ARG A NH1  2  
ATOM 2476  N NH2  . ARG A 1 34  ? -4.936  -16.648 -10.245 1.00 0.00 ? 34  ARG A NH2  2  
ATOM 2477  H H    . ARG A 1 34  ? -9.328  -12.954 -5.881  1.00 0.00 ? 34  ARG A H    2  
ATOM 2478  H HA   . ARG A 1 34  ? -8.676  -15.158 -7.479  1.00 0.00 ? 34  ARG A HA   2  
ATOM 2479  H HB2  . ARG A 1 34  ? -6.982  -13.577 -5.511  1.00 0.00 ? 34  ARG A HB2  2  
ATOM 2480  H HB3  . ARG A 1 34  ? -6.335  -14.899 -6.533  1.00 0.00 ? 34  ARG A HB3  2  
ATOM 2481  H HG2  . ARG A 1 34  ? -7.613  -12.286 -7.542  1.00 0.00 ? 34  ARG A HG2  2  
ATOM 2482  H HG3  . ARG A 1 34  ? -5.867  -12.688 -7.499  1.00 0.00 ? 34  ARG A HG3  2  
ATOM 2483  H HD2  . ARG A 1 34  ? -7.989  -14.118 -9.236  1.00 0.00 ? 34  ARG A HD2  2  
ATOM 2484  H HD3  . ARG A 1 34  ? -6.743  -12.923 -9.794  1.00 0.00 ? 34  ARG A HD3  2  
ATOM 2485  H HE   . ARG A 1 34  ? -5.266  -14.897 -8.444  1.00 0.00 ? 34  ARG A HE   2  
ATOM 2486  H HH11 . ARG A 1 34  ? -7.517  -14.905 -11.224 1.00 0.00 ? 34  ARG A HH11 2  
ATOM 2487  H HH12 . ARG A 1 34  ? -6.762  -16.260 -11.995 1.00 0.00 ? 34  ARG A HH12 2  
ATOM 2488  H HH21 . ARG A 1 34  ? -4.270  -16.708 -9.500  1.00 0.00 ? 34  ARG A HH21 2  
ATOM 2489  H HH22 . ARG A 1 34  ? -4.895  -17.294 -11.007 1.00 0.00 ? 34  ARG A HH22 2  
ATOM 2490  N N    . PHE A 1 35  ? -9.224  -15.686 -4.282  1.00 0.00 ? 35  PHE A N    2  
ATOM 2491  C CA   . PHE A 1 35  ? -9.304  -16.607 -3.156  1.00 0.00 ? 35  PHE A CA   2  
ATOM 2492  C C    . PHE A 1 35  ? -10.764 -16.969 -2.816  1.00 0.00 ? 35  PHE A C    2  
ATOM 2493  O O    . PHE A 1 35  ? -11.022 -18.081 -2.342  1.00 0.00 ? 35  PHE A O    2  
ATOM 2494  C CB   . PHE A 1 35  ? -8.513  -16.086 -1.886  1.00 0.00 ? 35  PHE A CB   2  
ATOM 2495  C CG   . PHE A 1 35  ? -7.083  -15.666 -2.153  1.00 0.00 ? 35  PHE A CG   2  
ATOM 2496  C CD1  . PHE A 1 35  ? -6.030  -16.380 -1.605  1.00 0.00 ? 35  PHE A CD1  2  
ATOM 2497  C CD2  . PHE A 1 35  ? -6.770  -14.511 -2.852  1.00 0.00 ? 35  PHE A CD2  2  
ATOM 2498  C CE1  . PHE A 1 35  ? -4.729  -15.998 -1.813  1.00 0.00 ? 35  PHE A CE1  2  
ATOM 2499  C CE2  . PHE A 1 35  ? -5.465  -14.159 -3.119  1.00 0.00 ? 35  PHE A CE2  2  
ATOM 2500  C CZ   . PHE A 1 35  ? -4.432  -14.906 -2.596  1.00 0.00 ? 35  PHE A CZ   2  
ATOM 2501  H H    . PHE A 1 35  ? -9.641  -14.788 -4.155  1.00 0.00 ? 35  PHE A H    2  
ATOM 2502  H HA   . PHE A 1 35  ? -8.844  -17.555 -3.417  1.00 0.00 ? 35  PHE A HA   2  
ATOM 2503  H HB2  . PHE A 1 35  ? -9.022  -15.197 -1.438  1.00 0.00 ? 35  PHE A HB2  2  
ATOM 2504  H HB3  . PHE A 1 35  ? -8.399  -16.918 -1.148  1.00 0.00 ? 35  PHE A HB3  2  
ATOM 2505  H HD1  . PHE A 1 35  ? -6.188  -17.243 -0.975  1.00 0.00 ? 35  PHE A HD1  2  
ATOM 2506  H HD2  . PHE A 1 35  ? -7.566  -13.885 -3.228  1.00 0.00 ? 35  PHE A HD2  2  
ATOM 2507  H HE1  . PHE A 1 35  ? -3.970  -16.572 -1.314  1.00 0.00 ? 35  PHE A HE1  2  
ATOM 2508  H HE2  . PHE A 1 35  ? -5.257  -13.284 -3.725  1.00 0.00 ? 35  PHE A HE2  2  
ATOM 2509  H HZ   . PHE A 1 35  ? -3.406  -14.613 -2.766  1.00 0.00 ? 35  PHE A HZ   2  
ATOM 2510  N N    . GLY A 1 36  ? -11.774 -16.034 -2.948  1.00 0.00 ? 36  GLY A N    2  
ATOM 2511  C CA   . GLY A 1 36  ? -13.134 -16.181 -2.435  1.00 0.00 ? 36  GLY A CA   2  
ATOM 2512  C C    . GLY A 1 36  ? -13.180 -15.976 -0.964  1.00 0.00 ? 36  GLY A C    2  
ATOM 2513  O O    . GLY A 1 36  ? -12.849 -14.915 -0.449  1.00 0.00 ? 36  GLY A O    2  
ATOM 2514  H H    . GLY A 1 36  ? -11.670 -15.099 -3.310  1.00 0.00 ? 36  GLY A H    2  
ATOM 2515  H HA2  . GLY A 1 36  ? -13.727 -15.369 -2.832  1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2516  H HA3  . GLY A 1 36  ? -13.489 -17.182 -2.625  1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2517  N N    . THR A 1 37  ? -13.545 -17.054 -0.239  1.00 0.00 ? 37  THR A N    2  
ATOM 2518  C CA   . THR A 1 37  ? -13.502 -17.104 1.196   1.00 0.00 ? 37  THR A CA   2  
ATOM 2519  C C    . THR A 1 37  ? -12.622 -18.330 1.460   1.00 0.00 ? 37  THR A C    2  
ATOM 2520  O O    . THR A 1 37  ? -13.060 -19.473 1.333   1.00 0.00 ? 37  THR A O    2  
ATOM 2521  C CB   . THR A 1 37  ? -14.932 -17.300 1.746   1.00 0.00 ? 37  THR A CB   2  
ATOM 2522  O OG1  . THR A 1 37  ? -15.641 -18.319 1.045   1.00 0.00 ? 37  THR A OG1  2  
ATOM 2523  C CG2  . THR A 1 37  ? -15.808 -16.046 1.587   1.00 0.00 ? 37  THR A CG2  2  
ATOM 2524  H H    . THR A 1 37  ? -13.787 -17.913 -0.678  1.00 0.00 ? 37  THR A H    2  
ATOM 2525  H HA   . THR A 1 37  ? -13.045 -16.231 1.644   1.00 0.00 ? 37  THR A HA   2  
ATOM 2526  H HB   . THR A 1 37  ? -14.908 -17.561 2.829   1.00 0.00 ? 37  THR A HB   2  
ATOM 2527  H HG1  . THR A 1 37  ? -15.090 -19.108 1.135   1.00 0.00 ? 37  THR A HG1  2  
ATOM 2528  H HG21 . THR A 1 37  ? -15.921 -15.726 0.532   1.00 0.00 ? 37  THR A HG21 2  
ATOM 2529  H HG22 . THR A 1 37  ? -16.813 -16.290 1.983   1.00 0.00 ? 37  THR A HG22 2  
ATOM 2530  H HG23 . THR A 1 37  ? -15.502 -15.155 2.165   1.00 0.00 ? 37  THR A HG23 2  
ATOM 2531  N N    . LYS A 1 38  ? -11.387 -18.095 1.920   1.00 0.00 ? 38  LYS A N    2  
ATOM 2532  C CA   . LYS A 1 38  ? -10.411 -19.126 2.236   1.00 0.00 ? 38  LYS A CA   2  
ATOM 2533  C C    . LYS A 1 38  ? -9.557  -18.655 3.386   1.00 0.00 ? 38  LYS A C    2  
ATOM 2534  O O    . LYS A 1 38  ? -9.157  -17.499 3.436   1.00 0.00 ? 38  LYS A O    2  
ATOM 2535  C CB   . LYS A 1 38  ? -9.501  -19.478 1.037   1.00 0.00 ? 38  LYS A CB   2  
ATOM 2536  C CG   . LYS A 1 38  ? -8.802  -20.842 1.206   1.00 0.00 ? 38  LYS A CG   2  
ATOM 2537  C CD   . LYS A 1 38  ? -7.405  -20.846 0.591   1.00 0.00 ? 38  LYS A CD   2  
ATOM 2538  C CE   . LYS A 1 38  ? -7.378  -20.633 -0.928  1.00 0.00 ? 38  LYS A CE   2  
ATOM 2539  N NZ   . LYS A 1 38  ? -5.984  -20.610 -1.432  1.00 0.00 ? 38  LYS A NZ   2  
ATOM 2540  H H    . LYS A 1 38  ? -11.080 -17.152 1.910   1.00 0.00 ? 38  LYS A H    2  
ATOM 2541  H HA   . LYS A 1 38  ? -10.854 -20.069 2.512   1.00 0.00 ? 38  LYS A HA   2  
ATOM 2542  H HB2  . LYS A 1 38  ? -10.131 -19.529 0.120   1.00 0.00 ? 38  LYS A HB2  2  
ATOM 2543  H HB3  . LYS A 1 38  ? -8.747  -18.676 0.857   1.00 0.00 ? 38  LYS A HB3  2  
ATOM 2544  H HG2  . LYS A 1 38  ? -8.643  -21.065 2.285   1.00 0.00 ? 38  LYS A HG2  2  
ATOM 2545  H HG3  . LYS A 1 38  ? -9.432  -21.662 0.803   1.00 0.00 ? 38  LYS A HG3  2  
ATOM 2546  H HD2  . LYS A 1 38  ? -6.862  -20.026 1.108   1.00 0.00 ? 38  LYS A HD2  2  
ATOM 2547  H HD3  . LYS A 1 38  ? -6.927  -21.814 0.852   1.00 0.00 ? 38  LYS A HD3  2  
ATOM 2548  H HE2  . LYS A 1 38  ? -7.911  -21.458 -1.446  1.00 0.00 ? 38  LYS A HE2  2  
ATOM 2549  H HE3  . LYS A 1 38  ? -7.844  -19.663 -1.207  1.00 0.00 ? 38  LYS A HE3  2  
ATOM 2550  H HZ1  . LYS A 1 38  ? -5.520  -21.514 -1.208  1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 2551  H HZ2  . LYS A 1 38  ? -5.990  -20.468 -2.461  1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 2552  H HZ3  . LYS A 1 38  ? -5.465  -19.832 -0.977  1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 2553  N N    . ARG A 1 39  ? -9.187  -19.562 4.331   1.00 0.00 ? 39  ARG A N    2  
ATOM 2554  C CA   . ARG A 1 39  ? -8.257  -19.328 5.439   1.00 0.00 ? 39  ARG A CA   2  
ATOM 2555  C C    . ARG A 1 39  ? -6.808  -19.186 4.889   1.00 0.00 ? 39  ARG A C    2  
ATOM 2556  O O    . ARG A 1 39  ? -6.218  -20.120 4.356   1.00 0.00 ? 39  ARG A O    2  
ATOM 2557  C CB   . ARG A 1 39  ? -8.358  -20.446 6.527   1.00 0.00 ? 39  ARG A CB   2  
ATOM 2558  C CG   . ARG A 1 39  ? -7.863  -21.879 6.202   1.00 0.00 ? 39  ARG A CG   2  
ATOM 2559  C CD   . ARG A 1 39  ? -8.684  -22.649 5.149   1.00 0.00 ? 39  ARG A CD   2  
ATOM 2560  N NE   . ARG A 1 39  ? -8.190  -24.068 5.099   1.00 0.00 ? 39  ARG A NE   2  
ATOM 2561  C CZ   . ARG A 1 39  ? -8.632  -24.979 4.175   1.00 0.00 ? 39  ARG A CZ   2  
ATOM 2562  N NH1  . ARG A 1 39  ? -9.565  -24.630 3.241   1.00 0.00 ? 39  ARG A NH1  2  
ATOM 2563  N NH2  . ARG A 1 39  ? -8.131  -26.247 4.190   1.00 0.00 ? 39  ARG A NH2  2  
ATOM 2564  H H    . ARG A 1 39  ? -9.535  -20.490 4.271   1.00 0.00 ? 39  ARG A H    2  
ATOM 2565  H HA   . ARG A 1 39  ? -8.591  -18.416 5.940   1.00 0.00 ? 39  ARG A HA   2  
ATOM 2566  H HB2  . ARG A 1 39  ? -7.799  -20.097 7.425   1.00 0.00 ? 39  ARG A HB2  2  
ATOM 2567  H HB3  . ARG A 1 39  ? -9.426  -20.527 6.832   1.00 0.00 ? 39  ARG A HB3  2  
ATOM 2568  H HG2  . ARG A 1 39  ? -6.801  -21.850 5.883   1.00 0.00 ? 39  ARG A HG2  2  
ATOM 2569  H HG3  . ARG A 1 39  ? -7.874  -22.438 7.162   1.00 0.00 ? 39  ARG A HG3  2  
ATOM 2570  H HD2  . ARG A 1 39  ? -9.759  -22.652 5.433   1.00 0.00 ? 39  ARG A HD2  2  
ATOM 2571  H HD3  . ARG A 1 39  ? -8.558  -22.199 4.137   1.00 0.00 ? 39  ARG A HD3  2  
ATOM 2572  H HE   . ARG A 1 39  ? -7.506  -24.357 5.769   1.00 0.00 ? 39  ARG A HE   2  
ATOM 2573  H HH11 . ARG A 1 39  ? -9.935  -23.702 3.228   1.00 0.00 ? 39  ARG A HH11 2  
ATOM 2574  H HH12 . ARG A 1 39  ? -9.877  -25.304 2.572   1.00 0.00 ? 39  ARG A HH12 2  
ATOM 2575  H HH21 . ARG A 1 39  ? -7.446  -26.508 4.871   1.00 0.00 ? 39  ARG A HH21 2  
ATOM 2576  H HH22 . ARG A 1 39  ? -8.446  -26.917 3.516   1.00 0.00 ? 39  ARG A HH22 2  
ATOM 2577  N N    . VAL A 1 40  ? -6.228  -17.968 4.897   1.00 0.00 ? 40  VAL A N    2  
ATOM 2578  C CA   . VAL A 1 40  ? -4.956  -17.691 4.232   1.00 0.00 ? 40  VAL A CA   2  
ATOM 2579  C C    . VAL A 1 40  ? -4.294  -16.571 4.962   1.00 0.00 ? 40  VAL A C    2  
ATOM 2580  O O    . VAL A 1 40  ? -4.990  -15.764 5.574   1.00 0.00 ? 40  VAL A O    2  
ATOM 2581  C CB   . VAL A 1 40  ? -5.195  -17.331 2.755   1.00 0.00 ? 40  VAL A CB   2  
ATOM 2582  C CG1  . VAL A 1 40  ? -6.144  -16.120 2.553   1.00 0.00 ? 40  VAL A CG1  2  
ATOM 2583  C CG2  . VAL A 1 40  ? -3.919  -17.168 1.902   1.00 0.00 ? 40  VAL A CG2  2  
ATOM 2584  H H    . VAL A 1 40  ? -6.715  -17.171 5.276   1.00 0.00 ? 40  VAL A H    2  
ATOM 2585  H HA   . VAL A 1 40  ? -4.301  -18.552 4.294   1.00 0.00 ? 40  VAL A HA   2  
ATOM 2586  H HB   . VAL A 1 40  ? -5.692  -18.243 2.376   1.00 0.00 ? 40  VAL A HB   2  
ATOM 2587  H HG11 . VAL A 1 40  ? -7.097  -16.246 3.106   1.00 0.00 ? 40  VAL A HG11 2  
ATOM 2588  H HG12 . VAL A 1 40  ? -5.670  -15.172 2.893   1.00 0.00 ? 40  VAL A HG12 2  
ATOM 2589  H HG13 . VAL A 1 40  ? -6.391  -16.011 1.475   1.00 0.00 ? 40  VAL A HG13 2  
ATOM 2590  H HG21 . VAL A 1 40  ? -3.231  -18.027 2.039   1.00 0.00 ? 40  VAL A HG21 2  
ATOM 2591  H HG22 . VAL A 1 40  ? -4.213  -17.122 0.829   1.00 0.00 ? 40  VAL A HG22 2  
ATOM 2592  H HG23 . VAL A 1 40  ? -3.385  -16.222 2.140   1.00 0.00 ? 40  VAL A HG23 2  
ATOM 2593  N N    . HIS A 1 41  ? -2.926  -16.444 4.907   1.00 0.00 ? 41  HIS A N    2  
ATOM 2594  C CA   . HIS A 1 41  ? -2.206  -15.316 5.494   1.00 0.00 ? 41  HIS A CA   2  
ATOM 2595  C C    . HIS A 1 41  ? -2.314  -14.165 4.545   1.00 0.00 ? 41  HIS A C    2  
ATOM 2596  O O    . HIS A 1 41  ? -1.936  -14.192 3.368   1.00 0.00 ? 41  HIS A O    2  
ATOM 2597  C CB   . HIS A 1 41  ? -0.685  -15.438 5.864   1.00 0.00 ? 41  HIS A CB   2  
ATOM 2598  C CG   . HIS A 1 41  ? -0.181  -14.444 6.939   1.00 0.00 ? 41  HIS A CG   2  
ATOM 2599  N ND1  . HIS A 1 41  ? -0.448  -13.084 7.056   1.00 0.00 ? 41  HIS A ND1  2  
ATOM 2600  C CD2  . HIS A 1 41  ? 0.595   -14.729 8.016   1.00 0.00 ? 41  HIS A CD2  2  
ATOM 2601  C CE1  . HIS A 1 41  ? 0.191   -12.633 8.170   1.00 0.00 ? 41  HIS A CE1  2  
ATOM 2602  N NE2  . HIS A 1 41  ? 0.812   -13.601 8.797   1.00 0.00 ? 41  HIS A NE2  2  
ATOM 2603  H H    . HIS A 1 41  ? -2.396  -17.105 4.387   1.00 0.00 ? 41  HIS A H    2  
ATOM 2604  H HA   . HIS A 1 41  ? -2.708  -15.050 6.415   1.00 0.00 ? 41  HIS A HA   2  
ATOM 2605  H HB2  . HIS A 1 41  ? -0.514  -16.463 6.256   1.00 0.00 ? 41  HIS A HB2  2  
ATOM 2606  H HB3  . HIS A 1 41  ? -0.023  -15.328 4.971   1.00 0.00 ? 41  HIS A HB3  2  
ATOM 2607  H HD1  . HIS A 1 41  ? -1.271  -12.646 6.695   1.00 0.00 ? 41  HIS A HD1  2  
ATOM 2608  H HD2  . HIS A 1 41  ? 0.973   -15.697 8.302   1.00 0.00 ? 41  HIS A HD2  2  
ATOM 2609  H HE1  . HIS A 1 41  ? 0.235   -11.586 8.482   1.00 0.00 ? 41  HIS A HE1  2  
ATOM 2610  N N    . ASN A 1 42  ? -2.808  -13.061 5.123   1.00 0.00 ? 42  ASN A N    2  
ATOM 2611  C CA   . ASN A 1 42  ? -2.982  -11.765 4.500   1.00 0.00 ? 42  ASN A CA   2  
ATOM 2612  C C    . ASN A 1 42  ? -1.676  -11.172 3.919   1.00 0.00 ? 42  ASN A C    2  
ATOM 2613  O O    . ASN A 1 42  ? -1.717  -10.357 3.012   1.00 0.00 ? 42  ASN A O    2  
ATOM 2614  C CB   . ASN A 1 42  ? -3.622  -10.824 5.546   1.00 0.00 ? 42  ASN A CB   2  
ATOM 2615  C CG   . ASN A 1 42  ? -4.265  -9.573  4.950   1.00 0.00 ? 42  ASN A CG   2  
ATOM 2616  O OD1  . ASN A 1 42  ? -5.465  -9.356  5.080   1.00 0.00 ? 42  ASN A OD1  2  
ATOM 2617  N ND2  . ASN A 1 42  ? -3.463  -8.713  4.280   1.00 0.00 ? 42  ASN A ND2  2  
ATOM 2618  H H    . ASN A 1 42  ? -3.095  -13.168 6.077   1.00 0.00 ? 42  ASN A H    2  
ATOM 2619  H HA   . ASN A 1 42  ? -3.697  -11.902 3.692   1.00 0.00 ? 42  ASN A HA   2  
ATOM 2620  H HB2  . ASN A 1 42  ? -4.469  -11.382 6.031   1.00 0.00 ? 42  ASN A HB2  2  
ATOM 2621  H HB3  . ASN A 1 42  ? -2.858  -10.520 6.299   1.00 0.00 ? 42  ASN A HB3  2  
ATOM 2622  H HD21 . ASN A 1 42  ? -2.597  -9.077  3.919   1.00 0.00 ? 42  ASN A HD21 2  
ATOM 2623  H HD22 . ASN A 1 42  ? -3.926  -7.969  3.805   1.00 0.00 ? 42  ASN A HD22 2  
ATOM 2624  N N    . ASN A 1 43  ? -0.474  -11.606 4.407   1.00 0.00 ? 43  ASN A N    2  
ATOM 2625  C CA   . ASN A 1 43  ? 0.825   -11.194 3.894   1.00 0.00 ? 43  ASN A CA   2  
ATOM 2626  C C    . ASN A 1 43  ? 1.150   -11.867 2.563   1.00 0.00 ? 43  ASN A C    2  
ATOM 2627  O O    . ASN A 1 43  ? 1.804   -11.272 1.728   1.00 0.00 ? 43  ASN A O    2  
ATOM 2628  C CB   . ASN A 1 43  ? 1.991   -11.307 4.913   1.00 0.00 ? 43  ASN A CB   2  
ATOM 2629  C CG   . ASN A 1 43  ? 2.896   -10.059 4.900   1.00 0.00 ? 43  ASN A CG   2  
ATOM 2630  O OD1  . ASN A 1 43  ? 4.037   -10.141 4.443   1.00 0.00 ? 43  ASN A OD1  2  
ATOM 2631  N ND2  . ASN A 1 43  ? 2.405   -8.882  5.386   1.00 0.00 ? 43  ASN A ND2  2  
ATOM 2632  H H    . ASN A 1 43  ? -0.443  -12.298 5.123   1.00 0.00 ? 43  ASN A H    2  
ATOM 2633  H HA   . ASN A 1 43  ? 0.699   -10.143 3.691   1.00 0.00 ? 43  ASN A HA   2  
ATOM 2634  H HB2  . ASN A 1 43  ? 1.561   -11.450 5.913   1.00 0.00 ? 43  ASN A HB2  2  
ATOM 2635  H HB3  . ASN A 1 43  ? 2.645   -12.190 4.723   1.00 0.00 ? 43  ASN A HB3  2  
ATOM 2636  H HD21 . ASN A 1 43  ? 1.474   -8.730  5.688   1.00 0.00 ? 43  ASN A HD21 2  
ATOM 2637  H HD22 . ASN A 1 43  ? 3.063   -8.148  5.514   1.00 0.00 ? 43  ASN A HD22 2  
ATOM 2638  N N    . ILE A 1 44  ? 0.608   -13.093 2.296   1.00 0.00 ? 44  ILE A N    2  
ATOM 2639  C CA   . ILE A 1 44  ? 0.679   -13.852 1.032   1.00 0.00 ? 44  ILE A CA   2  
ATOM 2640  C C    . ILE A 1 44  ? -0.152  -13.138 -0.024  1.00 0.00 ? 44  ILE A C    2  
ATOM 2641  O O    . ILE A 1 44  ? 0.279   -12.862 -1.144  1.00 0.00 ? 44  ILE A O    2  
ATOM 2642  C CB   . ILE A 1 44  ? 0.193   -15.283 1.206   1.00 0.00 ? 44  ILE A CB   2  
ATOM 2643  C CG1  . ILE A 1 44  ? 1.146   -15.983 2.197   1.00 0.00 ? 44  ILE A CG1  2  
ATOM 2644  C CG2  . ILE A 1 44  ? 0.045   -16.058 -0.135  1.00 0.00 ? 44  ILE A CG2  2  
ATOM 2645  C CD1  . ILE A 1 44  ? 0.492   -17.219 2.771   1.00 0.00 ? 44  ILE A CD1  2  
ATOM 2646  H H    . ILE A 1 44  ? 0.037   -13.533 2.990   1.00 0.00 ? 44  ILE A H    2  
ATOM 2647  H HA   . ILE A 1 44  ? 1.703   -13.953 0.716   1.00 0.00 ? 44  ILE A HA   2  
ATOM 2648  H HB   . ILE A 1 44  ? -0.817  -15.284 1.670   1.00 0.00 ? 44  ILE A HB   2  
ATOM 2649  H HG12 . ILE A 1 44  ? 2.107   -16.242 1.710   1.00 0.00 ? 44  ILE A HG12 2  
ATOM 2650  H HG13 . ILE A 1 44  ? 1.377   -15.319 3.061   1.00 0.00 ? 44  ILE A HG13 2  
ATOM 2651  H HG21 . ILE A 1 44  ? 0.930   -15.877 -0.782  1.00 0.00 ? 44  ILE A HG21 2  
ATOM 2652  H HG22 . ILE A 1 44  ? -0.057  -17.149 0.041   1.00 0.00 ? 44  ILE A HG22 2  
ATOM 2653  H HG23 . ILE A 1 44  ? -0.877  -15.748 -0.678  1.00 0.00 ? 44  ILE A HG23 2  
ATOM 2654  H HD11 . ILE A 1 44  ? -0.474  -16.906 3.217   1.00 0.00 ? 44  ILE A HD11 2  
ATOM 2655  H HD12 . ILE A 1 44  ? 0.294   -17.956 1.966   1.00 0.00 ? 44  ILE A HD12 2  
ATOM 2656  H HD13 . ILE A 1 44  ? 1.139   -17.657 3.558   1.00 0.00 ? 44  ILE A HD13 2  
ATOM 2657  N N    . VAL A 1 45  ? -1.380  -12.752 0.419   1.00 0.00 ? 45  VAL A N    2  
ATOM 2658  C CA   . VAL A 1 45  ? -2.383  -11.983 -0.315  1.00 0.00 ? 45  VAL A CA   2  
ATOM 2659  C C    . VAL A 1 45  ? -1.955  -10.525 -0.552  1.00 0.00 ? 45  VAL A C    2  
ATOM 2660  O O    . VAL A 1 45  ? -2.258  -9.959  -1.597  1.00 0.00 ? 45  VAL A O    2  
ATOM 2661  C CB   . VAL A 1 45  ? -3.764  -12.054 0.336   1.00 0.00 ? 45  VAL A CB   2  
ATOM 2662  C CG1  . VAL A 1 45  ? -4.858  -11.533 -0.628  1.00 0.00 ? 45  VAL A CG1  2  
ATOM 2663  C CG2  . VAL A 1 45  ? -4.108  -13.497 0.749   1.00 0.00 ? 45  VAL A CG2  2  
ATOM 2664  H H    . VAL A 1 45  ? -1.623  -13.010 1.358   1.00 0.00 ? 45  VAL A H    2  
ATOM 2665  H HA   . VAL A 1 45  ? -2.483  -12.436 -1.293  1.00 0.00 ? 45  VAL A HA   2  
ATOM 2666  H HB   . VAL A 1 45  ? -3.768  -11.451 1.269   1.00 0.00 ? 45  VAL A HB   2  
ATOM 2667  H HG11 . VAL A 1 45  ? -4.853  -12.114 -1.571  1.00 0.00 ? 45  VAL A HG11 2  
ATOM 2668  H HG12 . VAL A 1 45  ? -5.859  -11.637 -0.160  1.00 0.00 ? 45  VAL A HG12 2  
ATOM 2669  H HG13 . VAL A 1 45  ? -4.721  -10.462 -0.880  1.00 0.00 ? 45  VAL A HG13 2  
ATOM 2670  H HG21 . VAL A 1 45  ? -3.923  -14.201 -0.085  1.00 0.00 ? 45  VAL A HG21 2  
ATOM 2671  H HG22 . VAL A 1 45  ? -3.524  -13.832 1.627   1.00 0.00 ? 45  VAL A HG22 2  
ATOM 2672  H HG23 . VAL A 1 45  ? -5.184  -13.565 1.017   1.00 0.00 ? 45  VAL A HG23 2  
ATOM 2673  N N    . TYR A 1 46  ? -1.172  -9.885  0.391   1.00 0.00 ? 46  TYR A N    2  
ATOM 2674  C CA   . TYR A 1 46  ? -0.619  -8.515  0.316   1.00 0.00 ? 46  TYR A CA   2  
ATOM 2675  C C    . TYR A 1 46  ? 0.338   -8.395  -0.846  1.00 0.00 ? 46  TYR A C    2  
ATOM 2676  O O    . TYR A 1 46  ? 0.099   -7.574  -1.717  1.00 0.00 ? 46  TYR A O    2  
ATOM 2677  C CB   . TYR A 1 46  ? 0.116   -8.076  1.646   1.00 0.00 ? 46  TYR A CB   2  
ATOM 2678  C CG   . TYR A 1 46  ? -0.075  -6.634  2.094   1.00 0.00 ? 46  TYR A CG   2  
ATOM 2679  C CD1  . TYR A 1 46  ? -0.164  -6.397  3.458   1.00 0.00 ? 46  TYR A CD1  2  
ATOM 2680  C CD2  . TYR A 1 46  ? -0.223  -5.534  1.255   1.00 0.00 ? 46  TYR A CD2  2  
ATOM 2681  C CE1  . TYR A 1 46  ? -0.688  -5.222  3.932   1.00 0.00 ? 46  TYR A CE1  2  
ATOM 2682  C CE2  . TYR A 1 46  ? -0.559  -4.297  1.758   1.00 0.00 ? 46  TYR A CE2  2  
ATOM 2683  C CZ   . TYR A 1 46  ? -0.836  -4.143  3.091   1.00 0.00 ? 46  TYR A CZ   2  
ATOM 2684  O OH   . TYR A 1 46  ? -1.282  -2.898  3.568   1.00 0.00 ? 46  TYR A OH   2  
ATOM 2685  H H    . TYR A 1 46  ? -0.953  -10.370 1.240   1.00 0.00 ? 46  TYR A H    2  
ATOM 2686  H HA   . TYR A 1 46  ? -1.441  -7.842  0.097   1.00 0.00 ? 46  TYR A HA   2  
ATOM 2687  H HB2  . TYR A 1 46  ? -0.384  -8.655  2.461   1.00 0.00 ? 46  TYR A HB2  2  
ATOM 2688  H HB3  . TYR A 1 46  ? 1.211   -8.303  1.653   1.00 0.00 ? 46  TYR A HB3  2  
ATOM 2689  H HD1  . TYR A 1 46  ? 0.125   -7.127  4.203   1.00 0.00 ? 46  TYR A HD1  2  
ATOM 2690  H HD2  . TYR A 1 46  ? -0.086  -5.582  0.190   1.00 0.00 ? 46  TYR A HD2  2  
ATOM 2691  H HE1  . TYR A 1 46  ? -0.966  -5.183  4.985   1.00 0.00 ? 46  TYR A HE1  2  
ATOM 2692  H HE2  . TYR A 1 46  ? -0.666  -3.459  1.087   1.00 0.00 ? 46  TYR A HE2  2  
ATOM 2693  H HH   . TYR A 1 46  ? -1.781  -2.483  2.855   1.00 0.00 ? 46  TYR A HH   2  
ATOM 2694  N N    . ASN A 1 47  ? 1.331   -9.325  -0.932  1.00 0.00 ? 47  ASN A N    2  
ATOM 2695  C CA   . ASN A 1 47  ? 2.351   -9.512  -1.974  1.00 0.00 ? 47  ASN A CA   2  
ATOM 2696  C C    . ASN A 1 47  ? 1.795   -9.804  -3.349  1.00 0.00 ? 47  ASN A C    2  
ATOM 2697  O O    . ASN A 1 47  ? 2.335   -9.406  -4.380  1.00 0.00 ? 47  ASN A O    2  
ATOM 2698  C CB   . ASN A 1 47  ? 3.247   -10.694 -1.527  1.00 0.00 ? 47  ASN A CB   2  
ATOM 2699  C CG   . ASN A 1 47  ? 4.207   -10.033 -0.566  1.00 0.00 ? 47  ASN A CG   2  
ATOM 2700  O OD1  . ASN A 1 47  ? 5.199   -9.452  -1.009  1.00 0.00 ? 47  ASN A OD1  2  
ATOM 2701  N ND2  . ASN A 1 47  ? 3.833   -9.959  0.732   1.00 0.00 ? 47  ASN A ND2  2  
ATOM 2702  H H    . ASN A 1 47  ? 1.403   -9.993  -0.193  1.00 0.00 ? 47  ASN A H    2  
ATOM 2703  H HA   . ASN A 1 47  ? 2.907   -8.577  -2.087  1.00 0.00 ? 47  ASN A HA   2  
ATOM 2704  H HB2  . ASN A 1 47  ? 2.647   -11.471 -1.003  1.00 0.00 ? 47  ASN A HB2  2  
ATOM 2705  H HB3  . ASN A 1 47  ? 3.842   -11.162 -2.340  1.00 0.00 ? 47  ASN A HB3  2  
ATOM 2706  H HD21 . ASN A 1 47  ? 3.133   -10.584 1.139   1.00 0.00 ? 47  ASN A HD21 2  
ATOM 2707  H HD22 . ASN A 1 47  ? 4.009   -9.074  1.137   1.00 0.00 ? 47  ASN A HD22 2  
ATOM 2708  N N    . GLU A 1 48  ? 0.616   -10.466 -3.339  1.00 0.00 ? 48  GLU A N    2  
ATOM 2709  C CA   . GLU A 1 48  ? -0.209  -10.756 -4.525  1.00 0.00 ? 48  GLU A CA   2  
ATOM 2710  C C    . GLU A 1 48  ? -0.953  -9.521  -5.046  1.00 0.00 ? 48  GLU A C    2  
ATOM 2711  O O    . GLU A 1 48  ? -0.969  -9.230  -6.239  1.00 0.00 ? 48  GLU A O    2  
ATOM 2712  C CB   . GLU A 1 48  ? -1.230  -11.902 -4.291  1.00 0.00 ? 48  GLU A CB   2  
ATOM 2713  C CG   . GLU A 1 48  ? -1.888  -12.392 -5.599  1.00 0.00 ? 48  GLU A CG   2  
ATOM 2714  C CD   . GLU A 1 48  ? -2.527  -13.770 -5.447  1.00 0.00 ? 48  GLU A CD   2  
ATOM 2715  O OE1  . GLU A 1 48  ? -3.727  -13.909 -5.803  1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2716  O OE2  . GLU A 1 48  ? -1.817  -14.712 -4.998  1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2717  H H    . GLU A 1 48  ? 0.300   -10.696 -2.407  1.00 0.00 ? 48  GLU A H    2  
ATOM 2718  H HA   . GLU A 1 48  ? 0.454   -11.073 -5.321  1.00 0.00 ? 48  GLU A HA   2  
ATOM 2719  H HB2  . GLU A 1 48  ? -0.674  -12.743 -3.831  1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2720  H HB3  . GLU A 1 48  ? -2.022  -11.597 -3.572  1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2721  H HG2  . GLU A 1 48  ? -2.640  -11.665 -5.958  1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2722  H HG3  . GLU A 1 48  ? -1.116  -12.436 -6.382  1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2723  N N    . TYR A 1 49  ? -1.540  -8.744  -4.094  1.00 0.00 ? 49  TYR A N    2  
ATOM 2724  C CA   . TYR A 1 49  ? -2.272  -7.489  -4.224  1.00 0.00 ? 49  TYR A CA   2  
ATOM 2725  C C    . TYR A 1 49  ? -1.379  -6.335  -4.682  1.00 0.00 ? 49  TYR A C    2  
ATOM 2726  O O    . TYR A 1 49  ? -1.696  -5.657  -5.648  1.00 0.00 ? 49  TYR A O    2  
ATOM 2727  C CB   . TYR A 1 49  ? -3.065  -7.199  -2.887  1.00 0.00 ? 49  TYR A CB   2  
ATOM 2728  C CG   . TYR A 1 49  ? -3.288  -5.757  -2.494  1.00 0.00 ? 49  TYR A CG   2  
ATOM 2729  C CD1  . TYR A 1 49  ? -4.133  -4.924  -3.189  1.00 0.00 ? 49  TYR A CD1  2  
ATOM 2730  C CD2  . TYR A 1 49  ? -2.392  -5.200  -1.610  1.00 0.00 ? 49  TYR A CD2  2  
ATOM 2731  C CE1  . TYR A 1 49  ? -4.087  -3.574  -2.935  1.00 0.00 ? 49  TYR A CE1  2  
ATOM 2732  C CE2  . TYR A 1 49  ? -2.255  -3.837  -1.471  1.00 0.00 ? 49  TYR A CE2  2  
ATOM 2733  C CZ   . TYR A 1 49  ? -3.176  -3.012  -2.082  1.00 0.00 ? 49  TYR A CZ   2  
ATOM 2734  O OH   . TYR A 1 49  ? -3.195  -1.604  -1.960  1.00 0.00 ? 49  TYR A OH   2  
ATOM 2735  H H    . TYR A 1 49  ? -1.463  -9.062  -3.148  1.00 0.00 ? 49  TYR A H    2  
ATOM 2736  H HA   . TYR A 1 49  ? -3.006  -7.618  -5.000  1.00 0.00 ? 49  TYR A HA   2  
ATOM 2737  H HB2  . TYR A 1 49  ? -4.062  -7.691  -2.916  1.00 0.00 ? 49  TYR A HB2  2  
ATOM 2738  H HB3  . TYR A 1 49  ? -2.467  -7.659  -2.070  1.00 0.00 ? 49  TYR A HB3  2  
ATOM 2739  H HD1  . TYR A 1 49  ? -4.733  -5.283  -4.017  1.00 0.00 ? 49  TYR A HD1  2  
ATOM 2740  H HD2  . TYR A 1 49  ? -1.677  -5.856  -1.146  1.00 0.00 ? 49  TYR A HD2  2  
ATOM 2741  H HE1  . TYR A 1 49  ? -4.689  -2.916  -3.518  1.00 0.00 ? 49  TYR A HE1  2  
ATOM 2742  H HE2  . TYR A 1 49  ? -1.368  -3.465  -0.966  1.00 0.00 ? 49  TYR A HE2  2  
ATOM 2743  H HH   . TYR A 1 49  ? -4.126  -1.297  -2.071  1.00 0.00 ? 49  TYR A HH   2  
ATOM 2744  N N    . ILE A 1 50  ? -0.233  -6.090  -3.993  1.00 0.00 ? 50  ILE A N    2  
ATOM 2745  C CA   . ILE A 1 50  ? 0.700   -4.984  -4.290  1.00 0.00 ? 50  ILE A CA   2  
ATOM 2746  C C    . ILE A 1 50  ? 1.551   -5.131  -5.541  1.00 0.00 ? 50  ILE A C    2  
ATOM 2747  O O    . ILE A 1 50  ? 2.177   -4.174  -5.998  1.00 0.00 ? 50  ILE A O    2  
ATOM 2748  C CB   . ILE A 1 50  ? 1.641   -4.601  -3.162  1.00 0.00 ? 50  ILE A CB   2  
ATOM 2749  C CG1  . ILE A 1 50  ? 2.515   -5.771  -2.684  1.00 0.00 ? 50  ILE A CG1  2  
ATOM 2750  C CG2  . ILE A 1 50  ? 0.837   -3.999  -2.027  1.00 0.00 ? 50  ILE A CG2  2  
ATOM 2751  C CD1  . ILE A 1 50  ? 3.345   -5.593  -1.416  1.00 0.00 ? 50  ILE A CD1  2  
ATOM 2752  H H    . ILE A 1 50  ? -0.038  -6.698  -3.204  1.00 0.00 ? 50  ILE A H    2  
ATOM 2753  H HA   . ILE A 1 50  ? 0.098   -4.101  -4.466  1.00 0.00 ? 50  ILE A HA   2  
ATOM 2754  H HB   . ILE A 1 50  ? 2.261   -3.786  -3.534  1.00 0.00 ? 50  ILE A HB   2  
ATOM 2755  H HG12 . ILE A 1 50  ? 1.766   -6.513  -2.423  1.00 0.00 ? 50  ILE A HG12 2  
ATOM 2756  H HG13 . ILE A 1 50  ? 3.160   -6.161  -3.499  1.00 0.00 ? 50  ILE A HG13 2  
ATOM 2757  H HG21 . ILE A 1 50  ? 0.254   -3.122  -2.386  1.00 0.00 ? 50  ILE A HG21 2  
ATOM 2758  H HG22 . ILE A 1 50  ? 0.169   -4.793  -1.654  1.00 0.00 ? 50  ILE A HG22 2  
ATOM 2759  H HG23 . ILE A 1 50  ? 1.480   -3.681  -1.187  1.00 0.00 ? 50  ILE A HG23 2  
ATOM 2760  H HD11 . ILE A 1 50  ? 2.693   -5.384  -0.542  1.00 0.00 ? 50  ILE A HD11 2  
ATOM 2761  H HD12 . ILE A 1 50  ? 3.911   -6.529  -1.218  1.00 0.00 ? 50  ILE A HD12 2  
ATOM 2762  H HD13 . ILE A 1 50  ? 4.087   -4.779  -1.513  1.00 0.00 ? 50  ILE A HD13 2  
ATOM 2763  N N    . SER A 1 51  ? 1.534   -6.334  -6.148  1.00 0.00 ? 51  SER A N    2  
ATOM 2764  C CA   . SER A 1 51  ? 2.165   -6.692  -7.421  1.00 0.00 ? 51  SER A CA   2  
ATOM 2765  C C    . SER A 1 51  ? 1.227   -6.326  -8.584  1.00 0.00 ? 51  SER A C    2  
ATOM 2766  O O    . SER A 1 51  ? 0.894   -7.129  -9.446  1.00 0.00 ? 51  SER A O    2  
ATOM 2767  C CB   . SER A 1 51  ? 2.537   -8.197  -7.521  1.00 0.00 ? 51  SER A CB   2  
ATOM 2768  O OG   . SER A 1 51  ? 3.493   -8.539  -6.521  1.00 0.00 ? 51  SER A OG   2  
ATOM 2769  H H    . SER A 1 51  ? 1.014   -7.028  -5.662  1.00 0.00 ? 51  SER A H    2  
ATOM 2770  H HA   . SER A 1 51  ? 3.085   -6.127  -7.503  1.00 0.00 ? 51  SER A HA   2  
ATOM 2771  H HB2  . SER A 1 51  ? 1.633   -8.835  -7.396  1.00 0.00 ? 51  SER A HB2  2  
ATOM 2772  H HB3  . SER A 1 51  ? 2.997   -8.421  -8.509  1.00 0.00 ? 51  SER A HB3  2  
ATOM 2773  H HG   . SER A 1 51  ? 2.988   -8.852  -5.735  1.00 0.00 ? 51  SER A HG   2  
ATOM 2774  N N    . HIS A 1 52  ? 0.767   -5.058  -8.571  1.00 0.00 ? 52  HIS A N    2  
ATOM 2775  C CA   . HIS A 1 52  ? -0.183  -4.394  -9.443  1.00 0.00 ? 52  HIS A CA   2  
ATOM 2776  C C    . HIS A 1 52  ? 0.311   -2.945  -9.388  1.00 0.00 ? 52  HIS A C    2  
ATOM 2777  O O    . HIS A 1 52  ? 1.493   -2.702  -9.150  1.00 0.00 ? 52  HIS A O    2  
ATOM 2778  C CB   . HIS A 1 52  ? -1.624  -4.574  -8.854  1.00 0.00 ? 52  HIS A CB   2  
ATOM 2779  C CG   . HIS A 1 52  ? -2.329  -5.887  -9.146  1.00 0.00 ? 52  HIS A CG   2  
ATOM 2780  N ND1  . HIS A 1 52  ? -3.267  -6.084  -10.148 1.00 0.00 ? 52  HIS A ND1  2  
ATOM 2781  C CD2  . HIS A 1 52  ? -2.338  -7.037  -8.414  1.00 0.00 ? 52  HIS A CD2  2  
ATOM 2782  C CE1  . HIS A 1 52  ? -3.798  -7.321  -9.956  1.00 0.00 ? 52  HIS A CE1  2  
ATOM 2783  N NE2  . HIS A 1 52  ? -3.269  -7.932  -8.922  1.00 0.00 ? 52  HIS A NE2  2  
ATOM 2784  H H    . HIS A 1 52  ? 1.123   -4.472  -7.835  1.00 0.00 ? 52  HIS A H    2  
ATOM 2785  H HA   . HIS A 1 52  ? -0.099  -4.751  -10.462 1.00 0.00 ? 52  HIS A HA   2  
ATOM 2786  H HB2  . HIS A 1 52  ? -1.502  -4.525  -7.744  1.00 0.00 ? 52  HIS A HB2  2  
ATOM 2787  H HB3  . HIS A 1 52  ? -2.344  -3.778  -9.131  1.00 0.00 ? 52  HIS A HB3  2  
ATOM 2788  H HD1  . HIS A 1 52  ? -3.524  -5.436  -10.865 1.00 0.00 ? 52  HIS A HD1  2  
ATOM 2789  H HD2  . HIS A 1 52  ? -1.753  -7.300  -7.547  1.00 0.00 ? 52  HIS A HD2  2  
ATOM 2790  H HE1  . HIS A 1 52  ? -4.602  -7.762  -10.550 1.00 0.00 ? 52  HIS A HE1  2  
ATOM 2791  N N    . ARG A 1 53  ? -0.555  -1.900  -9.549  1.00 0.00 ? 53  ARG A N    2  
ATOM 2792  C CA   . ARG A 1 53  ? -0.173  -0.478  -9.456  1.00 0.00 ? 53  ARG A CA   2  
ATOM 2793  C C    . ARG A 1 53  ? 0.149   0.029   -8.045  1.00 0.00 ? 53  ARG A C    2  
ATOM 2794  O O    . ARG A 1 53  ? 1.060   0.815   -7.806  1.00 0.00 ? 53  ARG A O    2  
ATOM 2795  C CB   . ARG A 1 53  ? -1.180  0.484   -10.144 1.00 0.00 ? 53  ARG A CB   2  
ATOM 2796  C CG   . ARG A 1 53  ? -2.652  0.313   -9.737  1.00 0.00 ? 53  ARG A CG   2  
ATOM 2797  C CD   . ARG A 1 53  ? -3.172  1.118   -8.521  1.00 0.00 ? 53  ARG A CD   2  
ATOM 2798  N NE   . ARG A 1 53  ? -4.675  0.998   -8.505  1.00 0.00 ? 53  ARG A NE   2  
ATOM 2799  C CZ   . ARG A 1 53  ? -5.533  2.025   -8.208  1.00 0.00 ? 53  ARG A CZ   2  
ATOM 2800  N NH1  . ARG A 1 53  ? -5.067  3.270   -7.907  1.00 0.00 ? 53  ARG A NH1  2  
ATOM 2801  N NH2  . ARG A 1 53  ? -6.878  1.792   -8.203  1.00 0.00 ? 53  ARG A NH2  2  
ATOM 2802  H H    . ARG A 1 53  ? -1.512  -2.067  -9.752  1.00 0.00 ? 53  ARG A H    2  
ATOM 2803  H HA   . ARG A 1 53  ? 0.687   -0.343  -10.058 1.00 0.00 ? 53  ARG A HA   2  
ATOM 2804  H HB2  . ARG A 1 53  ? -0.873  1.550   -10.046 1.00 0.00 ? 53  ARG A HB2  2  
ATOM 2805  H HB3  . ARG A 1 53  ? -1.127  0.246   -11.235 1.00 0.00 ? 53  ARG A HB3  2  
ATOM 2806  H HG2  . ARG A 1 53  ? -3.239  0.610   -10.635 1.00 0.00 ? 53  ARG A HG2  2  
ATOM 2807  H HG3  . ARG A 1 53  ? -2.781  -0.770  -9.579  1.00 0.00 ? 53  ARG A HG3  2  
ATOM 2808  H HD2  . ARG A 1 53  ? -2.820  0.725   -7.539  1.00 0.00 ? 53  ARG A HD2  2  
ATOM 2809  H HD3  . ARG A 1 53  ? -2.851  2.178   -8.600  1.00 0.00 ? 53  ARG A HD3  2  
ATOM 2810  H HE   . ARG A 1 53  ? -5.070  0.103   -8.711  1.00 0.00 ? 53  ARG A HE   2  
ATOM 2811  H HH11 . ARG A 1 53  ? -4.082  3.448   -7.904  1.00 0.00 ? 53  ARG A HH11 2  
ATOM 2812  H HH12 . ARG A 1 53  ? -5.708  4.006   -7.687  1.00 0.00 ? 53  ARG A HH12 2  
ATOM 2813  H HH21 . ARG A 1 53  ? -7.227  0.879   -8.418  1.00 0.00 ? 53  ARG A HH21 2  
ATOM 2814  H HH22 . ARG A 1 53  ? -7.513  2.531   -7.984  1.00 0.00 ? 53  ARG A HH22 2  
ATOM 2815  N N    . GLU A 1 54  ? -0.666  -0.448  -7.095  1.00 0.00 ? 54  GLU A N    2  
ATOM 2816  C CA   . GLU A 1 54  ? -0.831  -0.169  -5.684  1.00 0.00 ? 54  GLU A CA   2  
ATOM 2817  C C    . GLU A 1 54  ? 0.296   -0.409  -4.699  1.00 0.00 ? 54  GLU A C    2  
ATOM 2818  O O    . GLU A 1 54  ? -0.012  -0.453  -3.512  1.00 0.00 ? 54  GLU A O    2  
ATOM 2819  C CB   . GLU A 1 54  ? -2.099  -0.939  -5.223  1.00 0.00 ? 54  GLU A CB   2  
ATOM 2820  C CG   . GLU A 1 54  ? -2.053  -2.444  -5.561  1.00 0.00 ? 54  GLU A CG   2  
ATOM 2821  C CD   . GLU A 1 54  ? -3.255  -2.835  -6.427  1.00 0.00 ? 54  GLU A CD   2  
ATOM 2822  O OE1  . GLU A 1 54  ? -3.918  -3.856  -6.111  1.00 0.00 ? 54  GLU A OE1  2  
ATOM 2823  O OE2  . GLU A 1 54  ? -3.520  -2.125  -7.433  1.00 0.00 ? 54  GLU A OE2  2  
ATOM 2824  H H    . GLU A 1 54  ? -1.361  -1.085  -7.407  1.00 0.00 ? 54  GLU A H    2  
ATOM 2825  H HA   . GLU A 1 54  ? -1.056  0.884   -5.599  1.00 0.00 ? 54  GLU A HA   2  
ATOM 2826  H HB2  . GLU A 1 54  ? -2.299  -0.811  -4.139  1.00 0.00 ? 54  GLU A HB2  2  
ATOM 2827  H HB3  . GLU A 1 54  ? -2.963  -0.452  -5.723  1.00 0.00 ? 54  GLU A HB3  2  
ATOM 2828  H HG2  . GLU A 1 54  ? -1.113  -2.709  -6.093  1.00 0.00 ? 54  GLU A HG2  2  
ATOM 2829  H HG3  . GLU A 1 54  ? -2.032  -3.032  -4.621  1.00 0.00 ? 54  GLU A HG3  2  
ATOM 2830  N N    . HIS A 1 55  ? 1.567   -0.656  -5.145  1.00 0.00 ? 55  HIS A N    2  
ATOM 2831  C CA   . HIS A 1 55  ? 2.753   -1.065  -4.367  1.00 0.00 ? 55  HIS A CA   2  
ATOM 2832  C C    . HIS A 1 55  ? 3.099   -0.452  -2.993  1.00 0.00 ? 55  HIS A C    2  
ATOM 2833  O O    . HIS A 1 55  ? 4.098   0.226   -2.786  1.00 0.00 ? 55  HIS A O    2  
ATOM 2834  C CB   . HIS A 1 55  ? 4.024   -1.353  -5.223  1.00 0.00 ? 55  HIS A CB   2  
ATOM 2835  C CG   . HIS A 1 55  ? 4.883   -2.489  -4.677  1.00 0.00 ? 55  HIS A CG   2  
ATOM 2836  N ND1  . HIS A 1 55  ? 6.047   -2.941  -5.273  1.00 0.00 ? 55  HIS A ND1  2  
ATOM 2837  C CD2  . HIS A 1 55  ? 4.678   -3.319  -3.610  1.00 0.00 ? 55  HIS A CD2  2  
ATOM 2838  C CE1  . HIS A 1 55  ? 6.475   -4.010  -4.551  1.00 0.00 ? 55  HIS A CE1  2  
ATOM 2839  N NE2  . HIS A 1 55  ? 5.680   -4.273  -3.536  1.00 0.00 ? 55  HIS A NE2  2  
ATOM 2840  H H    . HIS A 1 55  ? 1.710   -0.598  -6.135  1.00 0.00 ? 55  HIS A H    2  
ATOM 2841  H HA   . HIS A 1 55  ? 2.462   -2.056  -4.109  1.00 0.00 ? 55  HIS A HA   2  
ATOM 2842  H HB2  . HIS A 1 55  ? 3.679   -1.697  -6.230  1.00 0.00 ? 55  HIS A HB2  2  
ATOM 2843  H HB3  . HIS A 1 55  ? 4.635   -0.424  -5.334  1.00 0.00 ? 55  HIS A HB3  2  
ATOM 2844  H HD1  . HIS A 1 55  ? 6.533   -2.515  -6.038  1.00 0.00 ? 55  HIS A HD1  2  
ATOM 2845  H HD2  . HIS A 1 55  ? 3.848   -3.360  -2.900  1.00 0.00 ? 55  HIS A HD2  2  
ATOM 2846  H HE1  . HIS A 1 55  ? 7.384   -4.566  -4.776  1.00 0.00 ? 55  HIS A HE1  2  
ATOM 2847  N N    . ILE A 1 56  ? 2.218   -0.788  -2.021  1.00 0.00 ? 56  ILE A N    2  
ATOM 2848  C CA   . ILE A 1 56  ? 2.129   -0.516  -0.594  1.00 0.00 ? 56  ILE A CA   2  
ATOM 2849  C C    . ILE A 1 56  ? 2.901   -1.583  0.206   1.00 0.00 ? 56  ILE A C    2  
ATOM 2850  O O    . ILE A 1 56  ? 3.378   -2.582  -0.319  1.00 0.00 ? 56  ILE A O    2  
ATOM 2851  C CB   . ILE A 1 56  ? 0.624   -0.436  -0.257  1.00 0.00 ? 56  ILE A CB   2  
ATOM 2852  C CG1  . ILE A 1 56  ? 0.167   0.970   -0.690  1.00 0.00 ? 56  ILE A CG1  2  
ATOM 2853  C CG2  . ILE A 1 56  ? 0.142   -0.712  1.195   1.00 0.00 ? 56  ILE A CG2  2  
ATOM 2854  C CD1  . ILE A 1 56  ? -1.337  1.061   -0.571  1.00 0.00 ? 56  ILE A CD1  2  
ATOM 2855  H H    . ILE A 1 56  ? 1.419   -1.295  -2.343  1.00 0.00 ? 56  ILE A H    2  
ATOM 2856  H HA   . ILE A 1 56  ? 2.498   0.472   -0.379  1.00 0.00 ? 56  ILE A HA   2  
ATOM 2857  H HB   . ILE A 1 56  ? 0.064   -1.177  -0.889  1.00 0.00 ? 56  ILE A HB   2  
ATOM 2858  H HG12 . ILE A 1 56  ? 0.638   1.754   -0.056  1.00 0.00 ? 56  ILE A HG12 2  
ATOM 2859  H HG13 . ILE A 1 56  ? 0.452   1.160   -1.749  1.00 0.00 ? 56  ILE A HG13 2  
ATOM 2860  H HG21 . ILE A 1 56  ? 0.467   -1.706  1.549   1.00 0.00 ? 56  ILE A HG21 2  
ATOM 2861  H HG22 . ILE A 1 56  ? 0.489   0.076   1.893   1.00 0.00 ? 56  ILE A HG22 2  
ATOM 2862  H HG23 . ILE A 1 56  ? -0.966  -0.729  1.234   1.00 0.00 ? 56  ILE A HG23 2  
ATOM 2863  H HD11 . ILE A 1 56  ? -1.743  0.098   -0.962  1.00 0.00 ? 56  ILE A HD11 2  
ATOM 2864  H HD12 . ILE A 1 56  ? -1.592  1.180   0.506   1.00 0.00 ? 56  ILE A HD12 2  
ATOM 2865  H HD13 . ILE A 1 56  ? -1.723  1.893   -1.191  1.00 0.00 ? 56  ILE A HD13 2  
ATOM 2866  N N    . HIS A 1 57  ? 2.986   -1.399  1.535   1.00 0.00 ? 57  HIS A N    2  
ATOM 2867  C CA   . HIS A 1 57  ? 3.429   -2.353  2.534   1.00 0.00 ? 57  HIS A CA   2  
ATOM 2868  C C    . HIS A 1 57  ? 2.398   -2.268  3.654   1.00 0.00 ? 57  HIS A C    2  
ATOM 2869  O O    . HIS A 1 57  ? 1.779   -1.225  3.839   1.00 0.00 ? 57  HIS A O    2  
ATOM 2870  C CB   . HIS A 1 57  ? 4.815   -2.000  3.131   1.00 0.00 ? 57  HIS A CB   2  
ATOM 2871  C CG   . HIS A 1 57  ? 5.402   -3.066  4.031   1.00 0.00 ? 57  HIS A CG   2  
ATOM 2872  N ND1  . HIS A 1 57  ? 6.397   -2.784  4.941   1.00 0.00 ? 57  HIS A ND1  2  
ATOM 2873  C CD2  . HIS A 1 57  ? 5.101   -4.388  4.211   1.00 0.00 ? 57  HIS A CD2  2  
ATOM 2874  C CE1  . HIS A 1 57  ? 6.627   -3.923  5.639   1.00 0.00 ? 57  HIS A CE1  2  
ATOM 2875  N NE2  . HIS A 1 57  ? 5.856   -4.912  5.238   1.00 0.00 ? 57  HIS A NE2  2  
ATOM 2876  H H    . HIS A 1 57  ? 2.578   -0.574  1.914   1.00 0.00 ? 57  HIS A H    2  
ATOM 2877  H HA   . HIS A 1 57  ? 3.426   -3.357  2.123   1.00 0.00 ? 57  HIS A HA   2  
ATOM 2878  H HB2  . HIS A 1 57  ? 5.510   -1.827  2.291   1.00 0.00 ? 57  HIS A HB2  2  
ATOM 2879  H HB3  . HIS A 1 57  ? 4.766   -1.036  3.694   1.00 0.00 ? 57  HIS A HB3  2  
ATOM 2880  H HD1  . HIS A 1 57  ? 6.908   -1.927  5.021   1.00 0.00 ? 57  HIS A HD1  2  
ATOM 2881  H HD2  . HIS A 1 57  ? 4.391   -5.052  3.723   1.00 0.00 ? 57  HIS A HD2  2  
ATOM 2882  H HE1  . HIS A 1 57  ? 7.335   -3.993  6.463   1.00 0.00 ? 57  HIS A HE1  2  
ATOM 2883  N N    . MET A 1 58  ? 2.235   -3.326  4.494   1.00 0.00 ? 58  MET A N    2  
ATOM 2884  C CA   . MET A 1 58  ? 1.351   -3.444  5.671   1.00 0.00 ? 58  MET A CA   2  
ATOM 2885  C C    . MET A 1 58  ? 1.602   -2.438  6.778   1.00 0.00 ? 58  MET A C    2  
ATOM 2886  O O    . MET A 1 58  ? 0.757   -2.047  7.578   1.00 0.00 ? 58  MET A O    2  
ATOM 2887  C CB   . MET A 1 58  ? 1.585   -4.876  6.203   1.00 0.00 ? 58  MET A CB   2  
ATOM 2888  C CG   . MET A 1 58  ? 0.555   -5.551  7.127   1.00 0.00 ? 58  MET A CG   2  
ATOM 2889  S SD   . MET A 1 58  ? -1.018  -4.681  7.461   1.00 0.00 ? 58  MET A SD   2  
ATOM 2890  C CE   . MET A 1 58  ? -0.512  -4.562  9.159   1.00 0.00 ? 58  MET A CE   2  
ATOM 2891  H H    . MET A 1 58  ? 2.764   -4.149  4.332   1.00 0.00 ? 58  MET A H    2  
ATOM 2892  H HA   . MET A 1 58  ? 0.329   -3.300  5.363   1.00 0.00 ? 58  MET A HA   2  
ATOM 2893  H HB2  . MET A 1 58  ? 1.638   -5.507  5.292   1.00 0.00 ? 58  MET A HB2  2  
ATOM 2894  H HB3  . MET A 1 58  ? 2.557   -4.968  6.720   1.00 0.00 ? 58  MET A HB3  2  
ATOM 2895  H HG2  . MET A 1 58  ? 0.318   -6.531  6.662   1.00 0.00 ? 58  MET A HG2  2  
ATOM 2896  H HG3  . MET A 1 58  ? 1.108   -5.797  8.061   1.00 0.00 ? 58  MET A HG3  2  
ATOM 2897  H HE1  . MET A 1 58  ? 0.456   -4.019  9.204   1.00 0.00 ? 58  MET A HE1  2  
ATOM 2898  H HE2  . MET A 1 58  ? -1.281  -4.033  9.744   1.00 0.00 ? 58  MET A HE2  2  
ATOM 2899  H HE3  . MET A 1 58  ? -0.378  -5.576  9.568   1.00 0.00 ? 58  MET A HE3  2  
ATOM 2900  N N    . ASN A 1 59  ? 2.860   -1.976  6.779   1.00 0.00 ? 59  ASN A N    2  
ATOM 2901  C CA   . ASN A 1 59  ? 3.433   -1.031  7.684   1.00 0.00 ? 59  ASN A CA   2  
ATOM 2902  C C    . ASN A 1 59  ? 3.198   0.453   7.242   1.00 0.00 ? 59  ASN A C    2  
ATOM 2903  O O    . ASN A 1 59  ? 3.577   1.384   7.942   1.00 0.00 ? 59  ASN A O    2  
ATOM 2904  C CB   . ASN A 1 59  ? 4.885   -1.519  7.933   1.00 0.00 ? 59  ASN A CB   2  
ATOM 2905  C CG   . ASN A 1 59  ? 5.000   -2.932  8.576   1.00 0.00 ? 59  ASN A CG   2  
ATOM 2906  O OD1  . ASN A 1 59  ? 5.686   -3.005  9.597   1.00 0.00 ? 59  ASN A OD1  2  
ATOM 2907  N ND2  . ASN A 1 59  ? 4.463   -4.079  8.055   1.00 0.00 ? 59  ASN A ND2  2  
ATOM 2908  H H    . ASN A 1 59  ? 3.488   -2.322  6.084   1.00 0.00 ? 59  ASN A H    2  
ATOM 2909  H HA   . ASN A 1 59  ? 2.929   -1.120  8.644   1.00 0.00 ? 59  ASN A HA   2  
ATOM 2910  H HB2  . ASN A 1 59  ? 5.460   -1.511  6.992   1.00 0.00 ? 59  ASN A HB2  2  
ATOM 2911  H HB3  . ASN A 1 59  ? 5.382   -0.828  8.650   1.00 0.00 ? 59  ASN A HB3  2  
ATOM 2912  H HD21 . ASN A 1 59  ? 3.893   -4.172  7.219   1.00 0.00 ? 59  ASN A HD21 2  
ATOM 2913  H HD22 . ASN A 1 59  ? 4.629   -4.904  8.591   1.00 0.00 ? 59  ASN A HD22 2  
ATOM 2914  N N    . ALA A 1 60  ? 2.460   0.693   6.090   1.00 0.00 ? 60  ALA A N    2  
ATOM 2915  C CA   . ALA A 1 60  ? 1.918   1.983   5.577   1.00 0.00 ? 60  ALA A CA   2  
ATOM 2916  C C    . ALA A 1 60  ? 0.549   2.343   6.191   1.00 0.00 ? 60  ALA A C    2  
ATOM 2917  O O    . ALA A 1 60  ? -0.171  3.248   5.770   1.00 0.00 ? 60  ALA A O    2  
ATOM 2918  C CB   . ALA A 1 60  ? 1.758   1.961   4.028   1.00 0.00 ? 60  ALA A CB   2  
ATOM 2919  H H    . ALA A 1 60  ? 2.212   -0.087  5.500   1.00 0.00 ? 60  ALA A H    2  
ATOM 2920  H HA   . ALA A 1 60  ? 2.562   2.810   5.834   1.00 0.00 ? 60  ALA A HA   2  
ATOM 2921  H HB1  . ALA A 1 60  ? 2.727   1.719   3.549   1.00 0.00 ? 60  ALA A HB1  2  
ATOM 2922  H HB2  . ALA A 1 60  ? 0.995   1.226   3.688   1.00 0.00 ? 60  ALA A HB2  2  
ATOM 2923  H HB3  . ALA A 1 60  ? 1.423   2.952   3.643   1.00 0.00 ? 60  ALA A HB3  2  
ATOM 2924  N N    . THR A 1 61  ? 0.178   1.575   7.233   1.00 0.00 ? 61  THR A N    2  
ATOM 2925  C CA   . THR A 1 61  ? -1.073  1.614   7.968   1.00 0.00 ? 61  THR A CA   2  
ATOM 2926  C C    . THR A 1 61  ? -0.835  2.032   9.430   1.00 0.00 ? 61  THR A C    2  
ATOM 2927  O O    . THR A 1 61  ? 0.301   2.123   9.894   1.00 0.00 ? 61  THR A O    2  
ATOM 2928  C CB   . THR A 1 61  ? -1.779  0.238   7.873   1.00 0.00 ? 61  THR A CB   2  
ATOM 2929  O OG1  . THR A 1 61  ? -1.240  -0.777  8.724   1.00 0.00 ? 61  THR A OG1  2  
ATOM 2930  C CG2  . THR A 1 61  ? -1.762  -0.332  6.436   1.00 0.00 ? 61  THR A CG2  2  
ATOM 2931  H H    . THR A 1 61  ? 0.821   0.877   7.536   1.00 0.00 ? 61  THR A H    2  
ATOM 2932  H HA   . THR A 1 61  ? -1.737  2.354   7.538   1.00 0.00 ? 61  THR A HA   2  
ATOM 2933  H HB   . THR A 1 61  ? -2.845  0.391   8.164   1.00 0.00 ? 61  THR A HB   2  
ATOM 2934  H HG1  . THR A 1 61  ? -0.506  -1.253  8.269   1.00 0.00 ? 61  THR A HG1  2  
ATOM 2935  H HG21 . THR A 1 61  ? -2.225  0.390   5.733   1.00 0.00 ? 61  THR A HG21 2  
ATOM 2936  H HG22 . THR A 1 61  ? -0.733  -0.567  6.090   1.00 0.00 ? 61  THR A HG22 2  
ATOM 2937  H HG23 . THR A 1 61  ? -2.324  -1.287  6.389   1.00 0.00 ? 61  THR A HG23 2  
ATOM 2938  N N    . GLN A 1 62  ? -1.933  2.212   10.234  1.00 0.00 ? 62  GLN A N    2  
ATOM 2939  C CA   . GLN A 1 62  ? -1.935  2.502   11.676  1.00 0.00 ? 62  GLN A CA   2  
ATOM 2940  C C    . GLN A 1 62  ? -1.837  1.227   12.543  1.00 0.00 ? 62  GLN A C    2  
ATOM 2941  O O    . GLN A 1 62  ? -1.903  1.258   13.770  1.00 0.00 ? 62  GLN A O    2  
ATOM 2942  C CB   . GLN A 1 62  ? -3.254  3.255   12.052  1.00 0.00 ? 62  GLN A CB   2  
ATOM 2943  C CG   . GLN A 1 62  ? -4.536  2.483   11.643  1.00 0.00 ? 62  GLN A CG   2  
ATOM 2944  C CD   . GLN A 1 62  ? -5.801  2.965   12.366  1.00 0.00 ? 62  GLN A CD   2  
ATOM 2945  O OE1  . GLN A 1 62  ? -5.914  4.071   12.906  1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2946  N NE2  . GLN A 1 62  ? -6.822  2.063   12.360  1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2947  H H    . GLN A 1 62  ? -2.853  2.131   9.861   1.00 0.00 ? 62  GLN A H    2  
ATOM 2948  H HA   . GLN A 1 62  ? -1.081  3.120   11.926  1.00 0.00 ? 62  GLN A HA   2  
ATOM 2949  H HB2  . GLN A 1 62  ? -3.269  3.466   13.144  1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2950  H HB3  . GLN A 1 62  ? -3.269  4.243   11.537  1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2951  H HG2  . GLN A 1 62  ? -4.695  2.609   10.545  1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2952  H HG3  . GLN A 1 62  ? -4.423  1.400   11.904  1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2953  H HE21 . GLN A 1 62  ? -6.734  1.210   11.847  1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2954  H HE22 . GLN A 1 62  ? -7.643  2.265   12.890  1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2955  N N    . TRP A 1 63  ? -1.715  0.071   11.858  1.00 0.00 ? 63  TRP A N    2  
ATOM 2956  C CA   . TRP A 1 63  ? -1.634  -1.283  12.334  1.00 0.00 ? 63  TRP A CA   2  
ATOM 2957  C C    . TRP A 1 63  ? -0.145  -1.673  12.317  1.00 0.00 ? 63  TRP A C    2  
ATOM 2958  O O    . TRP A 1 63  ? 0.462   -1.841  11.263  1.00 0.00 ? 63  TRP A O    2  
ATOM 2959  C CB   . TRP A 1 63  ? -2.575  -2.177  11.479  1.00 0.00 ? 63  TRP A CB   2  
ATOM 2960  C CG   . TRP A 1 63  ? -4.001  -1.618  11.211  1.00 0.00 ? 63  TRP A CG   2  
ATOM 2961  C CD1  . TRP A 1 63  ? -4.974  -1.295  12.118  1.00 0.00 ? 63  TRP A CD1  2  
ATOM 2962  C CD2  . TRP A 1 63  ? -4.635  -1.499  9.909   1.00 0.00 ? 63  TRP A CD2  2  
ATOM 2963  N NE1  . TRP A 1 63  ? -6.164  -0.988  11.472  1.00 0.00 ? 63  TRP A NE1  2  
ATOM 2964  C CE2  . TRP A 1 63  ? -5.955  -1.117  10.113  1.00 0.00 ? 63  TRP A CE2  2  
ATOM 2965  C CE3  . TRP A 1 63  ? -4.189  -1.754  8.638   1.00 0.00 ? 63  TRP A CE3  2  
ATOM 2966  C CZ2  . TRP A 1 63  ? -6.817  -0.993  9.059   1.00 0.00 ? 63  TRP A CZ2  2  
ATOM 2967  C CZ3  . TRP A 1 63  ? -5.044  -1.556  7.572   1.00 0.00 ? 63  TRP A CZ3  2  
ATOM 2968  C CH2  . TRP A 1 63  ? -6.364  -1.203  7.766   1.00 0.00 ? 63  TRP A CH2  2  
ATOM 2969  H H    . TRP A 1 63  ? -1.654  0.154   10.864  1.00 0.00 ? 63  TRP A H    2  
ATOM 2970  H HA   . TRP A 1 63  ? -2.020  -1.392  13.332  1.00 0.00 ? 63  TRP A HA   2  
ATOM 2971  H HB2  . TRP A 1 63  ? -2.104  -2.344  10.479  1.00 0.00 ? 63  TRP A HB2  2  
ATOM 2972  H HB3  . TRP A 1 63  ? -2.695  -3.151  12.033  1.00 0.00 ? 63  TRP A HB3  2  
ATOM 2973  H HD1  . TRP A 1 63  ? -4.837  -1.363  13.187  1.00 0.00 ? 63  TRP A HD1  2  
ATOM 2974  H HE1  . TRP A 1 63  ? -7.046  -1.029  11.900  1.00 0.00 ? 63  TRP A HE1  2  
ATOM 2975  H HE3  . TRP A 1 63  ? -3.203  -2.146  8.442   1.00 0.00 ? 63  TRP A HE3  2  
ATOM 2976  H HZ2  . TRP A 1 63  ? -7.849  -0.761  9.233   1.00 0.00 ? 63  TRP A HZ2  2  
ATOM 2977  H HZ3  . TRP A 1 63  ? -4.669  -1.714  6.574   1.00 0.00 ? 63  TRP A HZ3  2  
ATOM 2978  H HH2  . TRP A 1 63  ? -7.040  -1.116  6.905   1.00 0.00 ? 63  TRP A HH2  2  
ATOM 2979  N N    . GLU A 1 64  ? 0.479   -1.769  13.530  1.00 0.00 ? 64  GLU A N    2  
ATOM 2980  C CA   . GLU A 1 64  ? 1.897   -2.016  13.821  1.00 0.00 ? 64  GLU A CA   2  
ATOM 2981  C C    . GLU A 1 64  ? 2.422   -3.385  13.394  1.00 0.00 ? 64  GLU A C    2  
ATOM 2982  O O    . GLU A 1 64  ? 3.605   -3.606  13.150  1.00 0.00 ? 64  GLU A O    2  
ATOM 2983  C CB   . GLU A 1 64  ? 2.096   -1.791  15.351  1.00 0.00 ? 64  GLU A CB   2  
ATOM 2984  C CG   . GLU A 1 64  ? 3.496   -2.101  15.917  1.00 0.00 ? 64  GLU A CG   2  
ATOM 2985  C CD   . GLU A 1 64  ? 3.615   -1.559  17.341  1.00 0.00 ? 64  GLU A CD   2  
ATOM 2986  O OE1  . GLU A 1 64  ? 2.840   -2.024  18.219  1.00 0.00 ? 64  GLU A OE1  2  
ATOM 2987  O OE2  . GLU A 1 64  ? 4.482   -0.673  17.569  1.00 0.00 ? 64  GLU A OE2  2  
ATOM 2988  H H    . GLU A 1 64  ? -0.065  -1.569  14.340  1.00 0.00 ? 64  GLU A H    2  
ATOM 2989  H HA   . GLU A 1 64  ? 2.495   -1.287  13.289  1.00 0.00 ? 64  GLU A HA   2  
ATOM 2990  H HB2  . GLU A 1 64  ? 1.866   -0.717  15.543  1.00 0.00 ? 64  GLU A HB2  2  
ATOM 2991  H HB3  . GLU A 1 64  ? 1.352   -2.393  15.916  1.00 0.00 ? 64  GLU A HB3  2  
ATOM 2992  H HG2  . GLU A 1 64  ? 3.667   -3.197  15.933  1.00 0.00 ? 64  GLU A HG2  2  
ATOM 2993  H HG3  . GLU A 1 64  ? 4.263   -1.643  15.266  1.00 0.00 ? 64  GLU A HG3  2  
ATOM 2994  N N    . THR A 1 65  ? 1.492   -4.345  13.297  1.00 0.00 ? 65  THR A N    2  
ATOM 2995  C CA   . THR A 1 65  ? 1.729   -5.715  12.918  1.00 0.00 ? 65  THR A CA   2  
ATOM 2996  C C    . THR A 1 65  ? 0.410   -6.082  12.282  1.00 0.00 ? 65  THR A C    2  
ATOM 2997  O O    . THR A 1 65  ? -0.557  -5.321  12.369  1.00 0.00 ? 65  THR A O    2  
ATOM 2998  C CB   . THR A 1 65  ? 2.138   -6.581  14.127  1.00 0.00 ? 65  THR A CB   2  
ATOM 2999  O OG1  . THR A 1 65  ? 2.096   -7.984  13.886  1.00 0.00 ? 65  THR A OG1  2  
ATOM 3000  C CG2  . THR A 1 65  ? 1.281   -6.267  15.373  1.00 0.00 ? 65  THR A CG2  2  
ATOM 3001  H H    . THR A 1 65  ? 0.530   -4.125  13.467  1.00 0.00 ? 65  THR A H    2  
ATOM 3002  H HA   . THR A 1 65  ? 2.487   -5.771  12.147  1.00 0.00 ? 65  THR A HA   2  
ATOM 3003  H HB   . THR A 1 65  ? 3.195   -6.317  14.375  1.00 0.00 ? 65  THR A HB   2  
ATOM 3004  H HG1  . THR A 1 65  ? 1.969   -8.389  14.750  1.00 0.00 ? 65  THR A HG1  2  
ATOM 3005  H HG21 . THR A 1 65  ? 0.204   -6.426  15.171  1.00 0.00 ? 65  THR A HG21 2  
ATOM 3006  H HG22 . THR A 1 65  ? 1.585   -6.911  16.225  1.00 0.00 ? 65  THR A HG22 2  
ATOM 3007  H HG23 . THR A 1 65  ? 1.438   -5.211  15.687  1.00 0.00 ? 65  THR A HG23 2  
ATOM 3008  N N    . LEU A 1 66  ? 0.301   -7.286  11.646  1.00 0.00 ? 66  LEU A N    2  
ATOM 3009  C CA   . LEU A 1 66  ? -0.889  -7.851  10.979  1.00 0.00 ? 66  LEU A CA   2  
ATOM 3010  C C    . LEU A 1 66  ? -2.042  -8.066  11.943  1.00 0.00 ? 66  LEU A C    2  
ATOM 3011  O O    . LEU A 1 66  ? -3.196  -7.934  11.571  1.00 0.00 ? 66  LEU A O    2  
ATOM 3012  C CB   . LEU A 1 66  ? -0.558  -9.132  10.157  1.00 0.00 ? 66  LEU A CB   2  
ATOM 3013  C CG   . LEU A 1 66  ? -1.406  -9.465  8.878   1.00 0.00 ? 66  LEU A CG   2  
ATOM 3014  C CD1  . LEU A 1 66  ? -2.941  -9.507  8.981   1.00 0.00 ? 66  LEU A CD1  2  
ATOM 3015  C CD2  . LEU A 1 66  ? -1.027  -8.559  7.700   1.00 0.00 ? 66  LEU A CD2  2  
ATOM 3016  H H    . LEU A 1 66  ? 1.113   -7.870  11.652  1.00 0.00 ? 66  LEU A H    2  
ATOM 3017  H HA   . LEU A 1 66  ? -1.253  -7.127  10.272  1.00 0.00 ? 66  LEU A HA   2  
ATOM 3018  H HB2  . LEU A 1 66  ? 0.485   -8.991  9.782   1.00 0.00 ? 66  LEU A HB2  2  
ATOM 3019  H HB3  . LEU A 1 66  ? -0.548  -10.005 10.836  1.00 0.00 ? 66  LEU A HB3  2  
ATOM 3020  H HG   . LEU A 1 66  ? -1.112  -10.495 8.572   1.00 0.00 ? 66  LEU A HG   2  
ATOM 3021  H HD11 . LEU A 1 66  ? -3.331  -8.519  9.313   1.00 0.00 ? 66  LEU A HD11 2  
ATOM 3022  H HD12 . LEU A 1 66  ? -3.331  -9.616  7.942   1.00 0.00 ? 66  LEU A HD12 2  
ATOM 3023  H HD13 . LEU A 1 66  ? -3.316  -10.328 9.654   1.00 0.00 ? 66  LEU A HD13 2  
ATOM 3024  H HD21 . LEU A 1 66  ? 0.056   -8.644  7.479   1.00 0.00 ? 66  LEU A HD21 2  
ATOM 3025  H HD22 . LEU A 1 66  ? -1.591  -8.808  6.771   1.00 0.00 ? 66  LEU A HD22 2  
ATOM 3026  H HD23 . LEU A 1 66  ? -1.244  -7.503  7.955   1.00 0.00 ? 66  LEU A HD23 2  
ATOM 3027  N N    . THR A 1 67  ? -1.735  -8.261  13.254  1.00 0.00 ? 67  THR A N    2  
ATOM 3028  C CA   . THR A 1 67  ? -2.648  -8.498  14.365  1.00 0.00 ? 67  THR A CA   2  
ATOM 3029  C C    . THR A 1 67  ? -3.722  -7.433  14.585  1.00 0.00 ? 67  THR A C    2  
ATOM 3030  O O    . THR A 1 67  ? -4.896  -7.753  14.658  1.00 0.00 ? 67  THR A O    2  
ATOM 3031  C CB   . THR A 1 67  ? -1.872  -8.573  15.705  1.00 0.00 ? 67  THR A CB   2  
ATOM 3032  O OG1  . THR A 1 67  ? -0.686  -9.355  15.600  1.00 0.00 ? 67  THR A OG1  2  
ATOM 3033  C CG2  . THR A 1 67  ? -2.780  -9.212  16.760  1.00 0.00 ? 67  THR A CG2  2  
ATOM 3034  H H    . THR A 1 67  ? -0.773  -8.345  13.494  1.00 0.00 ? 67  THR A H    2  
ATOM 3035  H HA   . THR A 1 67  ? -3.145  -9.440  14.180  1.00 0.00 ? 67  THR A HA   2  
ATOM 3036  H HB   . THR A 1 67  ? -1.528  -7.572  16.061  1.00 0.00 ? 67  THR A HB   2  
ATOM 3037  H HG1  . THR A 1 67  ? -0.381  -9.500  16.507  1.00 0.00 ? 67  THR A HG1  2  
ATOM 3038  H HG21 . THR A 1 67  ? -3.500  -9.869  16.219  1.00 0.00 ? 67  THR A HG21 2  
ATOM 3039  H HG22 . THR A 1 67  ? -2.226  -9.812  17.510  1.00 0.00 ? 67  THR A HG22 2  
ATOM 3040  H HG23 . THR A 1 67  ? -3.379  -8.446  17.294  1.00 0.00 ? 67  THR A HG23 2  
ATOM 3041  N N    . ASP A 1 68  ? -3.375  -6.124  14.635  1.00 0.00 ? 68  ASP A N    2  
ATOM 3042  C CA   . ASP A 1 68  ? -4.281  -4.976  14.790  1.00 0.00 ? 68  ASP A CA   2  
ATOM 3043  C C    . ASP A 1 68  ? -5.129  -4.603  13.599  1.00 0.00 ? 68  ASP A C    2  
ATOM 3044  O O    . ASP A 1 68  ? -6.212  -4.043  13.740  1.00 0.00 ? 68  ASP A O    2  
ATOM 3045  C CB   . ASP A 1 68  ? -3.633  -3.788  15.522  1.00 0.00 ? 68  ASP A CB   2  
ATOM 3046  C CG   . ASP A 1 68  ? -3.454  -4.031  17.031  1.00 0.00 ? 68  ASP A CG   2  
ATOM 3047  O OD1  . ASP A 1 68  ? -3.925  -5.075  17.553  1.00 0.00 ? 68  ASP A OD1  2  
ATOM 3048  O OD2  . ASP A 1 68  ? -2.829  -3.148  17.680  1.00 0.00 ? 68  ASP A OD2  2  
ATOM 3049  H H    . ASP A 1 68  ? -2.419  -5.864  14.502  1.00 0.00 ? 68  ASP A H    2  
ATOM 3050  H HA   . ASP A 1 68  ? -5.080  -5.331  15.419  1.00 0.00 ? 68  ASP A HA   2  
ATOM 3051  H HB2  . ASP A 1 68  ? -2.630  -3.730  15.089  1.00 0.00 ? 68  ASP A HB2  2  
ATOM 3052  H HB3  . ASP A 1 68  ? -4.177  -2.830  15.380  1.00 0.00 ? 68  ASP A HB3  2  
ATOM 3053  N N    . PHE A 1 69  ? -4.660  -4.944  12.380  1.00 0.00 ? 69  PHE A N    2  
ATOM 3054  C CA   . PHE A 1 69  ? -5.360  -4.838  11.110  1.00 0.00 ? 69  PHE A CA   2  
ATOM 3055  C C    . PHE A 1 69  ? -6.445  -5.924  10.997  1.00 0.00 ? 69  PHE A C    2  
ATOM 3056  O O    . PHE A 1 69  ? -7.568  -5.670  10.572  1.00 0.00 ? 69  PHE A O    2  
ATOM 3057  C CB   . PHE A 1 69  ? -4.256  -4.828  10.028  1.00 0.00 ? 69  PHE A CB   2  
ATOM 3058  C CG   . PHE A 1 69  ? -4.676  -5.250  8.659   1.00 0.00 ? 69  PHE A CG   2  
ATOM 3059  C CD1  . PHE A 1 69  ? -3.968  -6.257  8.075   1.00 0.00 ? 69  PHE A CD1  2  
ATOM 3060  C CD2  . PHE A 1 69  ? -5.822  -4.769  8.047   1.00 0.00 ? 69  PHE A CD2  2  
ATOM 3061  C CE1  . PHE A 1 69  ? -4.452  -6.871  6.955   1.00 0.00 ? 69  PHE A CE1  2  
ATOM 3062  C CE2  . PHE A 1 69  ? -6.305  -5.373  6.910   1.00 0.00 ? 69  PHE A CE2  2  
ATOM 3063  C CZ   . PHE A 1 69  ? -5.628  -6.448  6.377   1.00 0.00 ? 69  PHE A CZ   2  
ATOM 3064  H H    . PHE A 1 69  ? -3.777  -5.400  12.330  1.00 0.00 ? 69  PHE A H    2  
ATOM 3065  H HA   . PHE A 1 69  ? -5.878  -3.906  11.028  1.00 0.00 ? 69  PHE A HA   2  
ATOM 3066  H HB2  . PHE A 1 69  ? -3.870  -3.813  9.902   1.00 0.00 ? 69  PHE A HB2  2  
ATOM 3067  H HB3  . PHE A 1 69  ? -3.379  -5.406  10.401  1.00 0.00 ? 69  PHE A HB3  2  
ATOM 3068  H HD1  . PHE A 1 69  ? -3.072  -6.618  8.553   1.00 0.00 ? 69  PHE A HD1  2  
ATOM 3069  H HD2  . PHE A 1 69  ? -6.397  -3.983  8.515   1.00 0.00 ? 69  PHE A HD2  2  
ATOM 3070  H HE1  . PHE A 1 69  ? -3.886  -7.691  6.562   1.00 0.00 ? 69  PHE A HE1  2  
ATOM 3071  H HE2  . PHE A 1 69  ? -7.227  -5.024  6.466   1.00 0.00 ? 69  PHE A HE2  2  
ATOM 3072  H HZ   . PHE A 1 69  ? -6.006  -6.945  5.494   1.00 0.00 ? 69  PHE A HZ   2  
ATOM 3073  N N    . THR A 1 70  ? -6.098  -7.133  11.497  1.00 0.00 ? 70  THR A N    2  
ATOM 3074  C CA   . THR A 1 70  ? -6.912  -8.352  11.631  1.00 0.00 ? 70  THR A CA   2  
ATOM 3075  C C    . THR A 1 70  ? -7.982  -8.167  12.705  1.00 0.00 ? 70  THR A C    2  
ATOM 3076  O O    . THR A 1 70  ? -9.114  -8.617  12.551  1.00 0.00 ? 70  THR A O    2  
ATOM 3077  C CB   . THR A 1 70  ? -5.990  -9.556  11.801  1.00 0.00 ? 70  THR A CB   2  
ATOM 3078  O OG1  . THR A 1 70  ? -6.051  -10.471 10.712  1.00 0.00 ? 70  THR A OG1  2  
ATOM 3079  C CG2  . THR A 1 70  ? -6.047  -10.316 13.123  1.00 0.00 ? 70  THR A CG2  2  
ATOM 3080  H H    . THR A 1 70  ? -5.166  -7.204  11.860  1.00 0.00 ? 70  THR A H    2  
ATOM 3081  H HA   . THR A 1 70  ? -7.456  -8.486  10.704  1.00 0.00 ? 70  THR A HA   2  
ATOM 3082  H HB   . THR A 1 70  ? -4.979  -9.125  11.775  1.00 0.00 ? 70  THR A HB   2  
ATOM 3083  H HG1  . THR A 1 70  ? -5.148  -10.763 10.552  1.00 0.00 ? 70  THR A HG1  2  
ATOM 3084  H HG21 . THR A 1 70  ? -6.137  -9.668  14.013  1.00 0.00 ? 70  THR A HG21 2  
ATOM 3085  H HG22 . THR A 1 70  ? -6.860  -11.068 13.128  1.00 0.00 ? 70  THR A HG22 2  
ATOM 3086  H HG23 . THR A 1 70  ? -5.064  -10.825 13.209  1.00 0.00 ? 70  THR A HG23 2  
ATOM 3087  N N    . LYS A 1 71  ? -7.646  -7.387  13.796  1.00 0.00 ? 71  LYS A N    2  
ATOM 3088  C CA   . LYS A 1 71  ? -8.603  -6.910  14.806  1.00 0.00 ? 71  LYS A CA   2  
ATOM 3089  C C    . LYS A 1 71  ? -9.683  -5.952  14.219  1.00 0.00 ? 71  LYS A C    2  
ATOM 3090  O O    . LYS A 1 71  ? -10.866 -6.129  14.485  1.00 0.00 ? 71  LYS A O    2  
ATOM 3091  C CB   . LYS A 1 71  ? -7.976  -6.169  16.043  1.00 0.00 ? 71  LYS A CB   2  
ATOM 3092  C CG   . LYS A 1 71  ? -6.908  -6.926  16.867  1.00 0.00 ? 71  LYS A CG   2  
ATOM 3093  C CD   . LYS A 1 71  ? -7.288  -8.403  17.078  1.00 0.00 ? 71  LYS A CD   2  
ATOM 3094  C CE   . LYS A 1 71  ? -6.272  -9.310  17.780  1.00 0.00 ? 71  LYS A CE   2  
ATOM 3095  N NZ   . LYS A 1 71  ? -6.926  -10.554 18.254  1.00 0.00 ? 71  LYS A NZ   2  
ATOM 3096  H H    . LYS A 1 71  ? -6.696  -7.072  13.923  1.00 0.00 ? 71  LYS A H    2  
ATOM 3097  H HA   . LYS A 1 71  ? -9.089  -7.812  15.184  1.00 0.00 ? 71  LYS A HA   2  
ATOM 3098  H HB2  . LYS A 1 71  ? -7.524  -5.201  15.723  1.00 0.00 ? 71  LYS A HB2  2  
ATOM 3099  H HB3  . LYS A 1 71  ? -8.817  -5.958  16.757  1.00 0.00 ? 71  LYS A HB3  2  
ATOM 3100  H HG2  . LYS A 1 71  ? -5.892  -6.788  16.426  1.00 0.00 ? 71  LYS A HG2  2  
ATOM 3101  H HG3  . LYS A 1 71  ? -6.840  -6.438  17.860  1.00 0.00 ? 71  LYS A HG3  2  
ATOM 3102  H HD2  . LYS A 1 71  ? -8.256  -8.417  17.625  1.00 0.00 ? 71  LYS A HD2  2  
ATOM 3103  H HD3  . LYS A 1 71  ? -7.428  -8.855  16.072  1.00 0.00 ? 71  LYS A HD3  2  
ATOM 3104  H HE2  . LYS A 1 71  ? -5.479  -9.600  17.062  1.00 0.00 ? 71  LYS A HE2  2  
ATOM 3105  H HE3  . LYS A 1 71  ? -5.805  -8.845  18.659  1.00 0.00 ? 71  LYS A HE3  2  
ATOM 3106  H HZ1  . LYS A 1 71  ? -7.347  -11.053 17.445  1.00 0.00 ? 71  LYS A HZ1  2  
ATOM 3107  H HZ2  . LYS A 1 71  ? -6.218  -11.166 18.709  1.00 0.00 ? 71  LYS A HZ2  2  
ATOM 3108  H HZ3  . LYS A 1 71  ? -7.670  -10.314 18.941  1.00 0.00 ? 71  LYS A HZ3  2  
ATOM 3109  N N    . TRP A 1 72  ? -9.284  -4.935  13.384  1.00 0.00 ? 72  TRP A N    2  
ATOM 3110  C CA   . TRP A 1 72  ? -10.157 -3.963  12.700  1.00 0.00 ? 72  TRP A CA   2  
ATOM 3111  C C    . TRP A 1 72  ? -11.017 -4.557  11.569  1.00 0.00 ? 72  TRP A C    2  
ATOM 3112  O O    . TRP A 1 72  ? -12.228 -4.398  11.550  1.00 0.00 ? 72  TRP A O    2  
ATOM 3113  C CB   . TRP A 1 72  ? -9.325  -2.744  12.158  1.00 0.00 ? 72  TRP A CB   2  
ATOM 3114  C CG   . TRP A 1 72  ? -10.071 -1.699  11.305  1.00 0.00 ? 72  TRP A CG   2  
ATOM 3115  C CD1  . TRP A 1 72  ? -10.865 -0.656  11.685  1.00 0.00 ? 72  TRP A CD1  2  
ATOM 3116  C CD2  . TRP A 1 72  ? -10.159 -1.769  9.865   1.00 0.00 ? 72  TRP A CD2  2  
ATOM 3117  N NE1  . TRP A 1 72  ? -11.437 -0.072  10.575  1.00 0.00 ? 72  TRP A NE1  2  
ATOM 3118  C CE2  . TRP A 1 72  ? -11.016 -0.753  9.448   1.00 0.00 ? 72  TRP A CE2  2  
ATOM 3119  C CE3  . TRP A 1 72  ? -9.583  -2.618  8.961   1.00 0.00 ? 72  TRP A CE3  2  
ATOM 3120  C CZ2  . TRP A 1 72  ? -11.264 -0.540  8.117   1.00 0.00 ? 72  TRP A CZ2  2  
ATOM 3121  C CZ3  . TRP A 1 72  ? -9.835  -2.407  7.626   1.00 0.00 ? 72  TRP A CZ3  2  
ATOM 3122  C CH2  . TRP A 1 72  ? -10.630 -1.357  7.199   1.00 0.00 ? 72  TRP A CH2  2  
ATOM 3123  H H    . TRP A 1 72  ? -8.305  -4.842  13.193  1.00 0.00 ? 72  TRP A H    2  
ATOM 3124  H HA   . TRP A 1 72  ? -10.860 -3.577  13.428  1.00 0.00 ? 72  TRP A HA   2  
ATOM 3125  H HB2  . TRP A 1 72  ? -8.888  -2.230  13.045  1.00 0.00 ? 72  TRP A HB2  2  
ATOM 3126  H HB3  . TRP A 1 72  ? -8.481  -3.144  11.549  1.00 0.00 ? 72  TRP A HB3  2  
ATOM 3127  H HD1  . TRP A 1 72  ? -11.019 -0.339  12.707  1.00 0.00 ? 72  TRP A HD1  2  
ATOM 3128  H HE1  . TRP A 1 72  ? -11.897 0.790   10.571  1.00 0.00 ? 72  TRP A HE1  2  
ATOM 3129  H HE3  . TRP A 1 72  ? -8.918  -3.413  9.260   1.00 0.00 ? 72  TRP A HE3  2  
ATOM 3130  H HZ2  . TRP A 1 72  ? -11.889 0.278   7.784   1.00 0.00 ? 72  TRP A HZ2  2  
ATOM 3131  H HZ3  . TRP A 1 72  ? -9.402  -3.087  6.906   1.00 0.00 ? 72  TRP A HZ3  2  
ATOM 3132  H HH2  . TRP A 1 72  ? -10.741 -1.183  6.132   1.00 0.00 ? 72  TRP A HH2  2  
ATOM 3133  N N    . LEU A 1 73  ? -10.401 -5.256  10.581  1.00 0.00 ? 73  LEU A N    2  
ATOM 3134  C CA   . LEU A 1 73  ? -10.989 -5.913  9.390   1.00 0.00 ? 73  LEU A CA   2  
ATOM 3135  C C    . LEU A 1 73  ? -11.912 -7.064  9.687   1.00 0.00 ? 73  LEU A C    2  
ATOM 3136  O O    . LEU A 1 73  ? -12.962 -7.249  9.069   1.00 0.00 ? 73  LEU A O    2  
ATOM 3137  C CB   . LEU A 1 73  ? -9.839  -6.330  8.448   1.00 0.00 ? 73  LEU A CB   2  
ATOM 3138  C CG   . LEU A 1 73  ? -10.010 -7.435  7.354   1.00 0.00 ? 73  LEU A CG   2  
ATOM 3139  C CD1  . LEU A 1 73  ? -10.258 -6.731  6.037   1.00 0.00 ? 73  LEU A CD1  2  
ATOM 3140  C CD2  . LEU A 1 73  ? -8.714  -8.245  7.191   1.00 0.00 ? 73  LEU A CD2  2  
ATOM 3141  H H    . LEU A 1 73  ? -9.405  -5.366  10.644  1.00 0.00 ? 73  LEU A H    2  
ATOM 3142  H HA   . LEU A 1 73  ? -11.597 -5.179  8.878   1.00 0.00 ? 73  LEU A HA   2  
ATOM 3143  H HB2  . LEU A 1 73  ? -9.541  -5.311  8.031   1.00 0.00 ? 73  LEU A HB2  2  
ATOM 3144  H HB3  . LEU A 1 73  ? -9.006  -6.705  9.072   1.00 0.00 ? 73  LEU A HB3  2  
ATOM 3145  H HG   . LEU A 1 73  ? -10.796 -8.243  7.532   1.00 0.00 ? 73  LEU A HG   2  
ATOM 3146  H HD11 . LEU A 1 73  ? -9.400  -6.034  5.888   1.00 0.00 ? 73  LEU A HD11 2  
ATOM 3147  H HD12 . LEU A 1 73  ? -10.273 -7.436  5.180   1.00 0.00 ? 73  LEU A HD12 2  
ATOM 3148  H HD13 . LEU A 1 73  ? -11.199 -6.149  6.068   1.00 0.00 ? 73  LEU A HD13 2  
ATOM 3149  H HD21 . LEU A 1 73  ? -7.838  -7.571  7.165   1.00 0.00 ? 73  LEU A HD21 2  
ATOM 3150  H HD22 . LEU A 1 73  ? -8.594  -8.957  8.034   1.00 0.00 ? 73  LEU A HD22 2  
ATOM 3151  H HD23 . LEU A 1 73  ? -8.745  -8.817  6.236   1.00 0.00 ? 73  LEU A HD23 2  
ATOM 3152  N N    . GLY A 1 74  ? -11.536 -7.819  10.758  1.00 0.00 ? 74  GLY A N    2  
ATOM 3153  C CA   . GLY A 1 74  ? -12.298 -8.848  11.458  1.00 0.00 ? 74  GLY A CA   2  
ATOM 3154  C C    . GLY A 1 74  ? -13.538 -8.333  12.137  1.00 0.00 ? 74  GLY A C    2  
ATOM 3155  O O    . GLY A 1 74  ? -14.518 -9.043  12.343  1.00 0.00 ? 74  GLY A O    2  
ATOM 3156  H H    . GLY A 1 74  ? -10.659 -7.608  11.200  1.00 0.00 ? 74  GLY A H    2  
ATOM 3157  H HA2  . GLY A 1 74  ? -12.607 -9.572  10.729  1.00 0.00 ? 74  GLY A HA2  2  
ATOM 3158  H HA3  . GLY A 1 74  ? -11.673 -9.264  12.231  1.00 0.00 ? 74  GLY A HA3  2  
ATOM 3159  N N    . ARG A 1 75  ? -13.503 -7.028  12.519  1.00 0.00 ? 75  ARG A N    2  
ATOM 3160  C CA   . ARG A 1 75  ? -14.600 -6.338  13.198  1.00 0.00 ? 75  ARG A CA   2  
ATOM 3161  C C    . ARG A 1 75  ? -15.725 -5.897  12.281  1.00 0.00 ? 75  ARG A C    2  
ATOM 3162  O O    . ARG A 1 75  ? -16.835 -5.622  12.728  1.00 0.00 ? 75  ARG A O    2  
ATOM 3163  C CB   . ARG A 1 75  ? -14.083 -5.053  13.884  1.00 0.00 ? 75  ARG A CB   2  
ATOM 3164  C CG   . ARG A 1 75  ? -14.853 -4.576  15.117  1.00 0.00 ? 75  ARG A CG   2  
ATOM 3165  C CD   . ARG A 1 75  ? -14.015 -3.586  15.935  1.00 0.00 ? 75  ARG A CD   2  
ATOM 3166  N NE   . ARG A 1 75  ? -14.864 -2.955  17.010  1.00 0.00 ? 75  ARG A NE   2  
ATOM 3167  C CZ   . ARG A 1 75  ? -15.613 -1.821  16.829  1.00 0.00 ? 75  ARG A CZ   2  
ATOM 3168  N NH1  . ARG A 1 75  ? -15.640 -1.176  15.627  1.00 0.00 ? 75  ARG A NH1  2  
ATOM 3169  N NH2  . ARG A 1 75  ? -16.345 -1.332  17.872  1.00 0.00 ? 75  ARG A NH2  2  
ATOM 3170  H H    . ARG A 1 75  ? -12.682 -6.472  12.299  1.00 0.00 ? 75  ARG A H    2  
ATOM 3171  H HA   . ARG A 1 75  ? -15.022 -6.987  13.956  1.00 0.00 ? 75  ARG A HA   2  
ATOM 3172  H HB2  . ARG A 1 75  ? -13.074 -5.244  14.245  1.00 0.00 ? 75  ARG A HB2  2  
ATOM 3173  H HB3  . ARG A 1 75  ? -13.967 -4.212  13.164  1.00 0.00 ? 75  ARG A HB3  2  
ATOM 3174  H HG2  . ARG A 1 75  ? -15.765 -4.091  14.730  1.00 0.00 ? 75  ARG A HG2  2  
ATOM 3175  H HG3  . ARG A 1 75  ? -15.142 -5.439  15.756  1.00 0.00 ? 75  ARG A HG3  2  
ATOM 3176  H HD2  . ARG A 1 75  ? -13.184 -4.124  16.440  1.00 0.00 ? 75  ARG A HD2  2  
ATOM 3177  H HD3  . ARG A 1 75  ? -13.572 -2.816  15.267  1.00 0.00 ? 75  ARG A HD3  2  
ATOM 3178  H HE   . ARG A 1 75  ? -14.876 -3.389  17.910  1.00 0.00 ? 75  ARG A HE   2  
ATOM 3179  H HH11 . ARG A 1 75  ? -15.106 -1.529  14.859  1.00 0.00 ? 75  ARG A HH11 2  
ATOM 3180  H HH12 . ARG A 1 75  ? -16.193 -0.350  15.515  1.00 0.00 ? 75  ARG A HH12 2  
ATOM 3181  H HH21 . ARG A 1 75  ? -16.330 -1.800  18.756  1.00 0.00 ? 75  ARG A HH21 2  
ATOM 3182  H HH22 . ARG A 1 75  ? -16.896 -0.507  17.752  1.00 0.00 ? 75  ARG A HH22 2  
ATOM 3183  N N    . GLU A 1 76  ? -15.438 -5.760  10.962  1.00 0.00 ? 76  GLU A N    2  
ATOM 3184  C CA   . GLU A 1 76  ? -16.341 -5.175  9.990   1.00 0.00 ? 76  GLU A CA   2  
ATOM 3185  C C    . GLU A 1 76  ? -17.361 -6.136  9.395   1.00 0.00 ? 76  GLU A C    2  
ATOM 3186  O O    . GLU A 1 76  ? -18.366 -5.714  8.828   1.00 0.00 ? 76  GLU A O    2  
ATOM 3187  C CB   . GLU A 1 76  ? -15.532 -4.512  8.844   1.00 0.00 ? 76  GLU A CB   2  
ATOM 3188  C CG   . GLU A 1 76  ? -14.739 -3.289  9.331   1.00 0.00 ? 76  GLU A CG   2  
ATOM 3189  C CD   . GLU A 1 76  ? -13.969 -2.683  8.164   1.00 0.00 ? 76  GLU A CD   2  
ATOM 3190  O OE1  . GLU A 1 76  ? -14.333 -1.558  7.729   1.00 0.00 ? 76  GLU A OE1  2  
ATOM 3191  O OE2  . GLU A 1 76  ? -13.006 -3.340  7.692   1.00 0.00 ? 76  GLU A OE2  2  
ATOM 3192  H H    . GLU A 1 76  ? -14.518 -5.969  10.636  1.00 0.00 ? 76  GLU A H    2  
ATOM 3193  H HA   . GLU A 1 76  ? -16.878 -4.385  10.503  1.00 0.00 ? 76  GLU A HA   2  
ATOM 3194  H HB2  . GLU A 1 76  ? -14.840 -5.268  8.406   1.00 0.00 ? 76  GLU A HB2  2  
ATOM 3195  H HB3  . GLU A 1 76  ? -16.211 -4.154  8.035   1.00 0.00 ? 76  GLU A HB3  2  
ATOM 3196  H HG2  . GLU A 1 76  ? -15.444 -2.537  9.749   1.00 0.00 ? 76  GLU A HG2  2  
ATOM 3197  H HG3  . GLU A 1 76  ? -14.028 -3.581  10.128  1.00 0.00 ? 76  GLU A HG3  2  
ATOM 3198  N N    . GLY A 1 77  ? -17.088 -7.469  9.477   1.00 0.00 ? 77  GLY A N    2  
ATOM 3199  C CA   . GLY A 1 77  ? -17.953 -8.494  8.893   1.00 0.00 ? 77  GLY A CA   2  
ATOM 3200  C C    . GLY A 1 77  ? -17.463 -8.913  7.538   1.00 0.00 ? 77  GLY A C    2  
ATOM 3201  O O    . GLY A 1 77  ? -18.194 -9.491  6.747   1.00 0.00 ? 77  GLY A O    2  
ATOM 3202  H H    . GLY A 1 77  ? -16.262 -7.797  9.949   1.00 0.00 ? 77  GLY A H    2  
ATOM 3203  H HA2  . GLY A 1 77  ? -17.893 -9.361  9.532   1.00 0.00 ? 77  GLY A HA2  2  
ATOM 3204  H HA3  . GLY A 1 77  ? -18.972 -8.138  8.776   1.00 0.00 ? 77  GLY A HA3  2  
ATOM 3205  N N    . LEU A 1 78  ? -16.168 -8.631  7.244   1.00 0.00 ? 78  LEU A N    2  
ATOM 3206  C CA   . LEU A 1 78  ? -15.508 -8.975  5.986   1.00 0.00 ? 78  LEU A CA   2  
ATOM 3207  C C    . LEU A 1 78  ? -14.680 -10.187 6.145   1.00 0.00 ? 78  LEU A C    2  
ATOM 3208  O O    . LEU A 1 78  ? -14.647 -11.009 5.253   1.00 0.00 ? 78  LEU A O    2  
ATOM 3209  C CB   . LEU A 1 78  ? -14.555 -7.919  5.369   1.00 0.00 ? 78  LEU A CB   2  
ATOM 3210  C CG   . LEU A 1 78  ? -15.100 -6.500  5.543   1.00 0.00 ? 78  LEU A CG   2  
ATOM 3211  C CD1  . LEU A 1 78  ? -13.936 -5.507  5.556   1.00 0.00 ? 78  LEU A CD1  2  
ATOM 3212  C CD2  . LEU A 1 78  ? -16.187 -6.235  4.487   1.00 0.00 ? 78  LEU A CD2  2  
ATOM 3213  H H    . LEU A 1 78  ? -15.635 -8.123  7.913   1.00 0.00 ? 78  LEU A H    2  
ATOM 3214  H HA   . LEU A 1 78  ? -16.251 -9.207  5.233   1.00 0.00 ? 78  LEU A HA   2  
ATOM 3215  H HB2  . LEU A 1 78  ? -13.485 -7.976  5.717   1.00 0.00 ? 78  LEU A HB2  2  
ATOM 3216  H HB3  . LEU A 1 78  ? -14.502 -8.120  4.270   1.00 0.00 ? 78  LEU A HB3  2  
ATOM 3217  H HG   . LEU A 1 78  ? -15.589 -6.400  6.534   1.00 0.00 ? 78  LEU A HG   2  
ATOM 3218  H HD11 . LEU A 1 78  ? -13.308 -5.646  4.654   1.00 0.00 ? 78  LEU A HD11 2  
ATOM 3219  H HD12 . LEU A 1 78  ? -14.311 -4.464  5.583   1.00 0.00 ? 78  LEU A HD12 2  
ATOM 3220  H HD13 . LEU A 1 78  ? -13.304 -5.691  6.453   1.00 0.00 ? 78  LEU A HD13 2  
ATOM 3221  H HD21 . LEU A 1 78  ? -16.535 -7.202  4.029   1.00 0.00 ? 78  LEU A HD21 2  
ATOM 3222  H HD22 . LEU A 1 78  ? -17.060 -5.731  4.949   1.00 0.00 ? 78  LEU A HD22 2  
ATOM 3223  H HD23 . LEU A 1 78  ? -15.790 -5.566  3.694   1.00 0.00 ? 78  LEU A HD23 2  
ATOM 3224  N N    . CYS A 1 79  ? -13.937 -10.315 7.255   1.00 0.00 ? 79  CYS A N    2  
ATOM 3225  C CA   . CYS A 1 79  ? -13.030 -11.432 7.490   1.00 0.00 ? 79  CYS A CA   2  
ATOM 3226  C C    . CYS A 1 79  ? -13.155 -12.064 8.874   1.00 0.00 ? 79  CYS A C    2  
ATOM 3227  O O    . CYS A 1 79  ? -13.523 -11.436 9.858   1.00 0.00 ? 79  CYS A O    2  
ATOM 3228  C CB   . CYS A 1 79  ? -11.559 -11.073 7.166   1.00 0.00 ? 79  CYS A CB   2  
ATOM 3229  S SG   . CYS A 1 79  ? -11.338 -10.091 5.641   1.00 0.00 ? 79  CYS A SG   2  
ATOM 3230  H H    . CYS A 1 79  ? -13.963 -9.579  7.911   1.00 0.00 ? 79  CYS A H    2  
ATOM 3231  H HA   . CYS A 1 79  ? -13.245 -12.229 6.819   1.00 0.00 ? 79  CYS A HA   2  
ATOM 3232  H HB2  . CYS A 1 79  ? -11.134 -10.621 8.093   1.00 0.00 ? 79  CYS A HB2  2  
ATOM 3233  H HB3  . CYS A 1 79  ? -10.997 -11.985 6.909   1.00 0.00 ? 79  CYS A HB3  2  
ATOM 3234  H HG   . CYS A 1 79  ? -12.056 -10.912 4.882   1.00 0.00 ? 79  CYS A HG   2  
ATOM 3235  N N    . LYS A 1 80  ? -12.806 -13.362 8.983   1.00 0.00 ? 80  LYS A N    2  
ATOM 3236  C CA   . LYS A 1 80  ? -12.744 -14.178 10.180  1.00 0.00 ? 80  LYS A CA   2  
ATOM 3237  C C    . LYS A 1 80  ? -11.270 -14.403 10.487  1.00 0.00 ? 80  LYS A C    2  
ATOM 3238  O O    . LYS A 1 80  ? -10.476 -14.493 9.568   1.00 0.00 ? 80  LYS A O    2  
ATOM 3239  C CB   . LYS A 1 80  ? -13.489 -15.522 9.905   1.00 0.00 ? 80  LYS A CB   2  
ATOM 3240  C CG   . LYS A 1 80  ? -14.480 -15.927 11.003  1.00 0.00 ? 80  LYS A CG   2  
ATOM 3241  C CD   . LYS A 1 80  ? -15.653 -14.955 11.218  1.00 0.00 ? 80  LYS A CD   2  
ATOM 3242  C CE   . LYS A 1 80  ? -17.025 -15.564 10.881  1.00 0.00 ? 80  LYS A CE   2  
ATOM 3243  N NZ   . LYS A 1 80  ? -17.095 -16.021 9.473   1.00 0.00 ? 80  LYS A NZ   2  
ATOM 3244  H H    . LYS A 1 80  ? -12.520 -13.895 8.169   1.00 0.00 ? 80  LYS A H    2  
ATOM 3245  H HA   . LYS A 1 80  ? -13.144 -13.591 10.990  1.00 0.00 ? 80  LYS A HA   2  
ATOM 3246  H HB2  . LYS A 1 80  ? -13.979 -15.445 8.908   1.00 0.00 ? 80  LYS A HB2  2  
ATOM 3247  H HB3  . LYS A 1 80  ? -12.789 -16.369 9.767   1.00 0.00 ? 80  LYS A HB3  2  
ATOM 3248  H HG2  . LYS A 1 80  ? -14.881 -16.940 10.777  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 3249  H HG3  . LYS A 1 80  ? -13.907 -15.994 11.950  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 3250  H HD2  . LYS A 1 80  ? -15.683 -14.656 12.292  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 3251  H HD3  . LYS A 1 80  ? -15.475 -14.038 10.625  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 3252  H HE2  . LYS A 1 80  ? -17.223 -16.443 11.528  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 3253  H HE3  . LYS A 1 80  ? -17.827 -14.811 11.031  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 3254  H HZ1  . LYS A 1 80  ? -16.360 -16.738 9.306   1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 3255  H HZ2  . LYS A 1 80  ? -18.031 -16.435 9.289   1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 3256  H HZ3  . LYS A 1 80  ? -16.942 -15.212 8.838   1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 3257  N N    . VAL A 1 81  ? -10.796 -14.440 11.749  1.00 0.00 ? 81  VAL A N    2  
ATOM 3258  C CA   . VAL A 1 81  ? -9.374  -14.472 12.027  1.00 0.00 ? 81  VAL A CA   2  
ATOM 3259  C C    . VAL A 1 81  ? -8.973  -15.531 13.032  1.00 0.00 ? 81  VAL A C    2  
ATOM 3260  O O    . VAL A 1 81  ? -9.666  -15.817 14.010  1.00 0.00 ? 81  VAL A O    2  
ATOM 3261  C CB   . VAL A 1 81  ? -8.922  -13.077 12.453  1.00 0.00 ? 81  VAL A CB   2  
ATOM 3262  C CG1  . VAL A 1 81  ? -8.314  -12.369 11.238  1.00 0.00 ? 81  VAL A CG1  2  
ATOM 3263  C CG2  . VAL A 1 81  ? -10.048 -12.255 13.122  1.00 0.00 ? 81  VAL A CG2  2  
ATOM 3264  H H    . VAL A 1 81  ? -11.348 -14.378 12.565  1.00 0.00 ? 81  VAL A H    2  
ATOM 3265  H HA   . VAL A 1 81  ? -8.798  -14.731 11.144  1.00 0.00 ? 81  VAL A HA   2  
ATOM 3266  H HB   . VAL A 1 81  ? -8.112  -13.103 13.195  1.00 0.00 ? 81  VAL A HB   2  
ATOM 3267  H HG11 . VAL A 1 81  ? -8.842  -12.576 10.284  1.00 0.00 ? 81  VAL A HG11 2  
ATOM 3268  H HG12 . VAL A 1 81  ? -8.310  -11.273 11.419  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 3269  H HG13 . VAL A 1 81  ? -7.243  -12.684 11.153  1.00 0.00 ? 81  VAL A HG13 2  
ATOM 3270  H HG21 . VAL A 1 81  ? -10.509 -12.824 13.957  1.00 0.00 ? 81  VAL A HG21 2  
ATOM 3271  H HG22 . VAL A 1 81  ? -9.614  -11.319 13.535  1.00 0.00 ? 81  VAL A HG22 2  
ATOM 3272  H HG23 . VAL A 1 81  ? -10.820 -11.956 12.384  1.00 0.00 ? 81  VAL A HG23 2  
ATOM 3273  N N    . ASP A 1 82  ? -7.766  -16.117 12.770  1.00 0.00 ? 82  ASP A N    2  
ATOM 3274  C CA   . ASP A 1 82  ? -7.078  -17.130 13.582  1.00 0.00 ? 82  ASP A CA   2  
ATOM 3275  C C    . ASP A 1 82  ? -5.565  -16.864 13.608  1.00 0.00 ? 82  ASP A C    2  
ATOM 3276  O O    . ASP A 1 82  ? -5.017  -16.274 12.674  1.00 0.00 ? 82  ASP A O    2  
ATOM 3277  C CB   . ASP A 1 82  ? -7.287  -18.577 13.036  1.00 0.00 ? 82  ASP A CB   2  
ATOM 3278  C CG   . ASP A 1 82  ? -8.765  -18.973 13.093  1.00 0.00 ? 82  ASP A CG   2  
ATOM 3279  O OD1  . ASP A 1 82  ? -9.311  -19.061 14.225  1.00 0.00 ? 82  ASP A OD1  2  
ATOM 3280  O OD2  . ASP A 1 82  ? -9.364  -19.192 12.007  1.00 0.00 ? 82  ASP A OD2  2  
ATOM 3281  H H    . ASP A 1 82  ? -7.282  -15.857 11.909  1.00 0.00 ? 82  ASP A H    2  
ATOM 3282  H HA   . ASP A 1 82  ? -7.423  -17.073 14.608  1.00 0.00 ? 82  ASP A HA   2  
ATOM 3283  H HB2  . ASP A 1 82  ? -6.939  -18.640 11.981  1.00 0.00 ? 82  ASP A HB2  2  
ATOM 3284  H HB3  . ASP A 1 82  ? -6.718  -19.320 13.639  1.00 0.00 ? 82  ASP A HB3  2  
ATOM 3285  N N    . GLU A 1 83  ? -4.829  -17.323 14.672  1.00 0.00 ? 83  GLU A N    2  
ATOM 3286  C CA   . GLU A 1 83  ? -3.374  -17.224 14.775  1.00 0.00 ? 83  GLU A CA   2  
ATOM 3287  C C    . GLU A 1 83  ? -2.745  -18.579 15.098  1.00 0.00 ? 83  GLU A C    2  
ATOM 3288  O O    . GLU A 1 83  ? -3.253  -19.378 15.890  1.00 0.00 ? 83  GLU A O    2  
ATOM 3289  C CB   . GLU A 1 83  ? -2.875  -16.125 15.748  1.00 0.00 ? 83  GLU A CB   2  
ATOM 3290  C CG   . GLU A 1 83  ? -1.363  -15.827 15.595  1.00 0.00 ? 83  GLU A CG   2  
ATOM 3291  C CD   . GLU A 1 83  ? -0.927  -14.610 16.410  1.00 0.00 ? 83  GLU A CD   2  
ATOM 3292  O OE1  . GLU A 1 83  ? -1.725  -14.122 17.255  1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3293  O OE2  . GLU A 1 83  ? 0.231   -14.158 16.200  1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3294  H H    . GLU A 1 83  ? -5.252  -17.804 15.435  1.00 0.00 ? 83  GLU A H    2  
ATOM 3295  H HA   . GLU A 1 83  ? -2.976  -16.944 13.806  1.00 0.00 ? 83  GLU A HA   2  
ATOM 3296  H HB2  . GLU A 1 83  ? -3.429  -15.193 15.491  1.00 0.00 ? 83  GLU A HB2  2  
ATOM 3297  H HB3  . GLU A 1 83  ? -3.119  -16.387 16.800  1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3298  H HG2  . GLU A 1 83  ? -0.769  -16.695 15.947  1.00 0.00 ? 83  GLU A HG2  2  
ATOM 3299  H HG3  . GLU A 1 83  ? -1.135  -15.672 14.512  1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3300  N N    . THR A 1 84  ? -1.594  -18.820 14.416  1.00 0.00 ? 84  THR A N    2  
ATOM 3301  C CA   . THR A 1 84  ? -0.728  -19.991 14.410  1.00 0.00 ? 84  THR A CA   2  
ATOM 3302  C C    . THR A 1 84  ? 0.669   -19.608 14.799  1.00 0.00 ? 84  THR A C    2  
ATOM 3303  O O    . THR A 1 84  ? 0.985   -18.420 14.872  1.00 0.00 ? 84  THR A O    2  
ATOM 3304  C CB   . THR A 1 84  ? -0.584  -20.566 12.965  1.00 0.00 ? 84  THR A CB   2  
ATOM 3305  O OG1  . THR A 1 84  ? 0.068   -19.722 12.019  1.00 0.00 ? 84  THR A OG1  2  
ATOM 3306  C CG2  . THR A 1 84  ? -1.953  -20.828 12.338  1.00 0.00 ? 84  THR A CG2  2  
ATOM 3307  H H    . THR A 1 84  ? -1.263  -18.086 13.815  1.00 0.00 ? 84  THR A H    2  
ATOM 3308  H HA   . THR A 1 84  ? -1.027  -20.728 15.139  1.00 0.00 ? 84  THR A HA   2  
ATOM 3309  H HB   . THR A 1 84  ? 0.062   -21.468 13.025  1.00 0.00 ? 84  THR A HB   2  
ATOM 3310  H HG1  . THR A 1 84  ? -0.464  -18.914 11.966  1.00 0.00 ? 84  THR A HG1  2  
ATOM 3311  H HG21 . THR A 1 84  ? -2.574  -21.494 12.969  1.00 0.00 ? 84  THR A HG21 2  
ATOM 3312  H HG22 . THR A 1 84  ? -2.478  -19.857 12.180  1.00 0.00 ? 84  THR A HG22 2  
ATOM 3313  H HG23 . THR A 1 84  ? -1.815  -21.279 11.332  1.00 0.00 ? 84  THR A HG23 2  
ATOM 3314  N N    . PRO A 1 85  ? 1.576   -20.594 14.948  1.00 0.00 ? 85  PRO A N    2  
ATOM 3315  C CA   . PRO A 1 85  ? 2.994   -20.330 15.016  1.00 0.00 ? 85  PRO A CA   2  
ATOM 3316  C C    . PRO A 1 85  ? 3.704   -19.824 13.737  1.00 0.00 ? 85  PRO A C    2  
ATOM 3317  O O    . PRO A 1 85  ? 4.905   -19.573 13.804  1.00 0.00 ? 85  PRO A O    2  
ATOM 3318  C CB   . PRO A 1 85  ? 3.580   -21.662 15.505  1.00 0.00 ? 85  PRO A CB   2  
ATOM 3319  C CG   . PRO A 1 85  ? 2.414   -22.476 16.062  1.00 0.00 ? 85  PRO A CG   2  
ATOM 3320  C CD   . PRO A 1 85  ? 1.284   -22.020 15.162  1.00 0.00 ? 85  PRO A CD   2  
ATOM 3321  H HA   . PRO A 1 85  ? 3.096   -19.560 15.738  1.00 0.00 ? 85  PRO A HA   2  
ATOM 3322  H HB2  . PRO A 1 85  ? 4.100   -22.244 14.712  1.00 0.00 ? 85  PRO A HB2  2  
ATOM 3323  H HB3  . PRO A 1 85  ? 4.269   -21.396 16.302  1.00 0.00 ? 85  PRO A HB3  2  
ATOM 3324  H HG2  . PRO A 1 85  ? 2.595   -23.571 16.025  1.00 0.00 ? 85  PRO A HG2  2  
ATOM 3325  H HG3  . PRO A 1 85  ? 2.211   -22.173 17.115  1.00 0.00 ? 85  PRO A HG3  2  
ATOM 3326  H HD2  . PRO A 1 85  ? 1.356   -22.562 14.193  1.00 0.00 ? 85  PRO A HD2  2  
ATOM 3327  H HD3  . PRO A 1 85  ? 0.302   -22.218 15.651  1.00 0.00 ? 85  PRO A HD3  2  
ATOM 3328  N N    . LYS A 1 86  ? 3.007   -19.668 12.580  1.00 0.00 ? 86  LYS A N    2  
ATOM 3329  C CA   . LYS A 1 86  ? 3.583   -19.209 11.329  1.00 0.00 ? 86  LYS A CA   2  
ATOM 3330  C C    . LYS A 1 86  ? 3.024   -17.840 10.905  1.00 0.00 ? 86  LYS A C    2  
ATOM 3331  O O    . LYS A 1 86  ? 3.435   -17.261 9.899   1.00 0.00 ? 86  LYS A O    2  
ATOM 3332  C CB   . LYS A 1 86  ? 3.364   -20.304 10.255  1.00 0.00 ? 86  LYS A CB   2  
ATOM 3333  C CG   . LYS A 1 86  ? 4.216   -20.143 8.985   1.00 0.00 ? 86  LYS A CG   2  
ATOM 3334  C CD   . LYS A 1 86  ? 4.290   -21.436 8.164   1.00 0.00 ? 86  LYS A CD   2  
ATOM 3335  C CE   . LYS A 1 86  ? 2.955   -21.853 7.530   1.00 0.00 ? 86  LYS A CE   2  
ATOM 3336  N NZ   . LYS A 1 86  ? 3.111   -23.099 6.742   1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3337  H H    . LYS A 1 86  ? 2.029   -19.891 12.545  1.00 0.00 ? 86  LYS A H    2  
ATOM 3338  H HA   . LYS A 1 86  ? 4.655   -19.112 11.445  1.00 0.00 ? 86  LYS A HA   2  
ATOM 3339  H HB2  . LYS A 1 86  ? 3.673   -21.271 10.725  1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3340  H HB3  . LYS A 1 86  ? 2.288   -20.398 10.000  1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3341  H HG2  . LYS A 1 86  ? 3.823   -19.314 8.356   1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3342  H HG3  . LYS A 1 86  ? 5.253   -19.872 9.291   1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3343  H HD2  . LYS A 1 86  ? 5.048   -21.290 7.363   1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3344  H HD3  . LYS A 1 86  ? 4.665   -22.239 8.841   1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3345  H HE2  . LYS A 1 86  ? 2.181   -22.044 8.303   1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3346  H HE3  . LYS A 1 86  ? 2.587   -21.066 6.839   1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3347  H HZ1  . LYS A 1 86  ? 3.815   -22.946 5.992   1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3348  H HZ2  . LYS A 1 86  ? 3.430   -23.867 7.368   1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3349  H HZ3  . LYS A 1 86  ? 2.199   -23.354 6.316   1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3350  N N    . GLY A 1 87  ? 2.045   -17.285 11.675  1.00 0.00 ? 87  GLY A N    2  
ATOM 3351  C CA   . GLY A 1 87  ? 1.425   -15.996 11.376  1.00 0.00 ? 87  GLY A CA   2  
ATOM 3352  C C    . GLY A 1 87  ? -0.045  -15.938 11.632  1.00 0.00 ? 87  GLY A C    2  
ATOM 3353  O O    . GLY A 1 87  ? -0.639  -16.854 12.209  1.00 0.00 ? 87  GLY A O    2  
ATOM 3354  H H    . GLY A 1 87  ? 1.698   -17.745 12.494  1.00 0.00 ? 87  GLY A H    2  
ATOM 3355  H HA2  . GLY A 1 87  ? 1.906   -15.228 11.964  1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3356  H HA3  . GLY A 1 87  ? 1.468   -15.837 10.317  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3357  N N    . TRP A 1 88  ? -0.680  -14.841 11.119  1.00 0.00 ? 88  TRP A N    2  
ATOM 3358  C CA   . TRP A 1 88  ? -2.114  -14.575 11.138  1.00 0.00 ? 88  TRP A CA   2  
ATOM 3359  C C    . TRP A 1 88  ? -2.749  -15.061 9.841   1.00 0.00 ? 88  TRP A C    2  
ATOM 3360  O O    . TRP A 1 88  ? -2.365  -14.700 8.731   1.00 0.00 ? 88  TRP A O    2  
ATOM 3361  C CB   . TRP A 1 88  ? -2.456  -13.069 11.365  1.00 0.00 ? 88  TRP A CB   2  
ATOM 3362  C CG   . TRP A 1 88  ? -2.395  -12.655 12.817  1.00 0.00 ? 88  TRP A CG   2  
ATOM 3363  C CD1  . TRP A 1 88  ? -1.391  -12.102 13.543  1.00 0.00 ? 88  TRP A CD1  2  
ATOM 3364  C CD2  . TRP A 1 88  ? -3.512  -12.767 13.702  1.00 0.00 ? 88  TRP A CD2  2  
ATOM 3365  N NE1  . TRP A 1 88  ? -1.826  -11.850 14.827  1.00 0.00 ? 88  TRP A NE1  2  
ATOM 3366  C CE2  . TRP A 1 88  ? -3.127  -12.285 14.938  1.00 0.00 ? 88  TRP A CE2  2  
ATOM 3367  C CE3  . TRP A 1 88  ? -4.778  -13.178 13.475  1.00 0.00 ? 88  TRP A CE3  2  
ATOM 3368  C CZ2  . TRP A 1 88  ? -4.031  -12.197 15.959  1.00 0.00 ? 88  TRP A CZ2  2  
ATOM 3369  C CZ3  . TRP A 1 88  ? -5.675  -13.121 14.523  1.00 0.00 ? 88  TRP A CZ3  2  
ATOM 3370  C CH2  . TRP A 1 88  ? -5.339  -12.527 15.717  1.00 0.00 ? 88  TRP A CH2  2  
ATOM 3371  H H    . TRP A 1 88  ? -0.174  -14.128 10.615  1.00 0.00 ? 88  TRP A H    2  
ATOM 3372  H HA   . TRP A 1 88  ? -2.577  -15.142 11.938  1.00 0.00 ? 88  TRP A HA   2  
ATOM 3373  H HB2  . TRP A 1 88  ? -1.773  -12.416 10.788  1.00 0.00 ? 88  TRP A HB2  2  
ATOM 3374  H HB3  . TRP A 1 88  ? -3.498  -12.843 11.040  1.00 0.00 ? 88  TRP A HB3  2  
ATOM 3375  H HD1  . TRP A 1 88  ? -0.432  -11.850 13.128  1.00 0.00 ? 88  TRP A HD1  2  
ATOM 3376  H HE1  . TRP A 1 88  ? -1.423  -11.147 15.388  1.00 0.00 ? 88  TRP A HE1  2  
ATOM 3377  H HE3  . TRP A 1 88  ? -5.096  -13.209 12.442  1.00 0.00 ? 88  TRP A HE3  2  
ATOM 3378  H HZ2  . TRP A 1 88  ? -3.809  -11.766 16.907  1.00 0.00 ? 88  TRP A HZ2  2  
ATOM 3379  H HZ3  . TRP A 1 88  ? -6.674  -13.481 14.410  1.00 0.00 ? 88  TRP A HZ3  2  
ATOM 3380  H HH2  . TRP A 1 88  ? -6.118  -12.181 16.406  1.00 0.00 ? 88  TRP A HH2  2  
ATOM 3381  N N    . TYR A 1 89  ? -3.792  -15.906 9.992   1.00 0.00 ? 89  TYR A N    2  
ATOM 3382  C CA   . TYR A 1 89  ? -4.563  -16.518 8.932   1.00 0.00 ? 89  TYR A CA   2  
ATOM 3383  C C    . TYR A 1 89  ? -5.920  -15.907 9.097   1.00 0.00 ? 89  TYR A C    2  
ATOM 3384  O O    . TYR A 1 89  ? -6.507  -15.916 10.179  1.00 0.00 ? 89  TYR A O    2  
ATOM 3385  C CB   . TYR A 1 89  ? -4.612  -18.073 9.059   1.00 0.00 ? 89  TYR A CB   2  
ATOM 3386  C CG   . TYR A 1 89  ? -3.233  -18.564 8.720   1.00 0.00 ? 89  TYR A CG   2  
ATOM 3387  C CD1  . TYR A 1 89  ? -2.208  -18.484 9.641   1.00 0.00 ? 89  TYR A CD1  2  
ATOM 3388  C CD2  . TYR A 1 89  ? -2.931  -18.924 7.424   1.00 0.00 ? 89  TYR A CD2  2  
ATOM 3389  C CE1  . TYR A 1 89  ? -0.896  -18.634 9.247   1.00 0.00 ? 89  TYR A CE1  2  
ATOM 3390  C CE2  . TYR A 1 89  ? -1.622  -19.112 7.026   1.00 0.00 ? 89  TYR A CE2  2  
ATOM 3391  C CZ   . TYR A 1 89  ? -0.594  -18.953 7.943   1.00 0.00 ? 89  TYR A CZ   2  
ATOM 3392  O OH   . TYR A 1 89  ? 0.764   -19.099 7.580   1.00 0.00 ? 89  TYR A OH   2  
ATOM 3393  H H    . TYR A 1 89  ? -4.138  -16.141 10.912  1.00 0.00 ? 89  TYR A H    2  
ATOM 3394  H HA   . TYR A 1 89  ? -4.202  -16.248 7.936   1.00 0.00 ? 89  TYR A HA   2  
ATOM 3395  H HB2  . TYR A 1 89  ? -4.878  -18.389 10.092  1.00 0.00 ? 89  TYR A HB2  2  
ATOM 3396  H HB3  . TYR A 1 89  ? -5.329  -18.520 8.336   1.00 0.00 ? 89  TYR A HB3  2  
ATOM 3397  H HD1  . TYR A 1 89  ? -2.429  -18.190 10.658  1.00 0.00 ? 89  TYR A HD1  2  
ATOM 3398  H HD2  . TYR A 1 89  ? -3.729  -18.998 6.698   1.00 0.00 ? 89  TYR A HD2  2  
ATOM 3399  H HE1  . TYR A 1 89  ? -0.122  -18.448 9.978   1.00 0.00 ? 89  TYR A HE1  2  
ATOM 3400  H HE2  . TYR A 1 89  ? -1.448  -19.349 5.982   1.00 0.00 ? 89  TYR A HE2  2  
ATOM 3401  H HH   . TYR A 1 89  ? 1.287   -19.231 8.380   1.00 0.00 ? 89  TYR A HH   2  
ATOM 3402  N N    . ILE A 1 90  ? -6.419  -15.330 8.002   1.00 0.00 ? 90  ILE A N    2  
ATOM 3403  C CA   . ILE A 1 90  ? -7.708  -14.705 7.893   1.00 0.00 ? 90  ILE A CA   2  
ATOM 3404  C C    . ILE A 1 90  ? -8.481  -15.570 6.910   1.00 0.00 ? 90  ILE A C    2  
ATOM 3405  O O    . ILE A 1 90  ? -7.981  -15.971 5.862   1.00 0.00 ? 90  ILE A O    2  
ATOM 3406  C CB   . ILE A 1 90  ? -7.668  -13.213 7.480   1.00 0.00 ? 90  ILE A CB   2  
ATOM 3407  C CG1  . ILE A 1 90  ? -7.671  -12.892 5.962   1.00 0.00 ? 90  ILE A CG1  2  
ATOM 3408  C CG2  . ILE A 1 90  ? -6.445  -12.520 8.114   1.00 0.00 ? 90  ILE A CG2  2  
ATOM 3409  C CD1  . ILE A 1 90  ? -7.871  -11.406 5.664   1.00 0.00 ? 90  ILE A CD1  2  
ATOM 3410  H H    . ILE A 1 90  ? -5.890  -15.354 7.164   1.00 0.00 ? 90  ILE A H    2  
ATOM 3411  H HA   . ILE A 1 90  ? -8.211  -14.731 8.853   1.00 0.00 ? 90  ILE A HA   2  
ATOM 3412  H HB   . ILE A 1 90  ? -8.581  -12.742 7.919   1.00 0.00 ? 90  ILE A HB   2  
ATOM 3413  H HG12 . ILE A 1 90  ? -6.727  -13.248 5.496   1.00 0.00 ? 90  ILE A HG12 2  
ATOM 3414  H HG13 . ILE A 1 90  ? -8.514  -13.405 5.468   1.00 0.00 ? 90  ILE A HG13 2  
ATOM 3415  H HG21 . ILE A 1 90  ? -6.357  -12.743 9.195   1.00 0.00 ? 90  ILE A HG21 2  
ATOM 3416  H HG22 . ILE A 1 90  ? -5.520  -12.841 7.592   1.00 0.00 ? 90  ILE A HG22 2  
ATOM 3417  H HG23 . ILE A 1 90  ? -6.521  -11.421 7.967   1.00 0.00 ? 90  ILE A HG23 2  
ATOM 3418  H HD11 . ILE A 1 90  ? -8.768  -11.026 6.189   1.00 0.00 ? 90  ILE A HD11 2  
ATOM 3419  H HD12 . ILE A 1 90  ? -6.992  -10.825 6.004   1.00 0.00 ? 90  ILE A HD12 2  
ATOM 3420  H HD13 . ILE A 1 90  ? -7.984  -11.248 4.569   1.00 0.00 ? 90  ILE A HD13 2  
ATOM 3421  N N    . GLN A 1 91  ? -9.752  -15.857 7.186   1.00 0.00 ? 91  GLN A N    2  
ATOM 3422  C CA   . GLN A 1 91  ? -10.677 -16.478 6.280   1.00 0.00 ? 91  GLN A CA   2  
ATOM 3423  C C    . GLN A 1 91  ? -11.706 -15.428 6.075   1.00 0.00 ? 91  GLN A C    2  
ATOM 3424  O O    . GLN A 1 91  ? -12.292 -14.962 7.032   1.00 0.00 ? 91  GLN A O    2  
ATOM 3425  C CB   . GLN A 1 91  ? -11.278 -17.804 6.794   1.00 0.00 ? 91  GLN A CB   2  
ATOM 3426  C CG   . GLN A 1 91  ? -12.517 -18.259 5.985   1.00 0.00 ? 91  GLN A CG   2  
ATOM 3427  C CD   . GLN A 1 91  ? -12.677 -19.773 6.020   1.00 0.00 ? 91  GLN A CD   2  
ATOM 3428  O OE1  . GLN A 1 91  ? -12.838 -20.386 7.079   1.00 0.00 ? 91  GLN A OE1  2  
ATOM 3429  N NE2  . GLN A 1 91  ? -12.623 -20.406 4.816   1.00 0.00 ? 91  GLN A NE2  2  
ATOM 3430  H H    . GLN A 1 91  ? -10.146 -15.521 8.048   1.00 0.00 ? 91  GLN A H    2  
ATOM 3431  H HA   . GLN A 1 91  ? -10.254 -16.645 5.317   1.00 0.00 ? 91  GLN A HA   2  
ATOM 3432  H HB2  . GLN A 1 91  ? -10.494 -18.582 6.692   1.00 0.00 ? 91  GLN A HB2  2  
ATOM 3433  H HB3  . GLN A 1 91  ? -11.474 -17.723 7.883   1.00 0.00 ? 91  GLN A HB3  2  
ATOM 3434  H HG2  . GLN A 1 91  ? -13.422 -17.783 6.406   1.00 0.00 ? 91  GLN A HG2  2  
ATOM 3435  H HG3  . GLN A 1 91  ? -12.415 -17.937 4.925   1.00 0.00 ? 91  GLN A HG3  2  
ATOM 3436  H HE21 . GLN A 1 91  ? -12.642 -19.887 3.961   1.00 0.00 ? 91  GLN A HE21 2  
ATOM 3437  H HE22 . GLN A 1 91  ? -12.671 -21.399 4.823   1.00 0.00 ? 91  GLN A HE22 2  
ATOM 3438  N N    . TYR A 1 92  ? -11.953 -15.010 4.820   1.00 0.00 ? 92  TYR A N    2  
ATOM 3439  C CA   . TYR A 1 92  ? -12.941 -14.013 4.444   1.00 0.00 ? 92  TYR A CA   2  
ATOM 3440  C C    . TYR A 1 92  ? -14.376 -14.580 4.548   1.00 0.00 ? 92  TYR A C    2  
ATOM 3441  O O    . TYR A 1 92  ? -14.603 -15.779 4.393   1.00 0.00 ? 92  TYR A O    2  
ATOM 3442  C CB   . TYR A 1 92  ? -12.454 -13.231 3.185   1.00 0.00 ? 92  TYR A CB   2  
ATOM 3443  C CG   . TYR A 1 92  ? -13.473 -12.428 2.396   1.00 0.00 ? 92  TYR A CG   2  
ATOM 3444  C CD1  . TYR A 1 92  ? -14.286 -13.014 1.455   1.00 0.00 ? 92  TYR A CD1  2  
ATOM 3445  C CD2  . TYR A 1 92  ? -13.673 -11.090 2.654   1.00 0.00 ? 92  TYR A CD2  2  
ATOM 3446  C CE1  . TYR A 1 92  ? -15.316 -12.339 0.841   1.00 0.00 ? 92  TYR A CE1  2  
ATOM 3447  C CE2  . TYR A 1 92  ? -14.724 -10.399 2.100   1.00 0.00 ? 92  TYR A CE2  2  
ATOM 3448  C CZ   . TYR A 1 92  ? -15.523 -11.014 1.153   1.00 0.00 ? 92  TYR A CZ   2  
ATOM 3449  O OH   . TYR A 1 92  ? -16.558 -10.331 0.505   1.00 0.00 ? 92  TYR A OH   2  
ATOM 3450  H H    . TYR A 1 92  ? -11.443 -15.416 4.069   1.00 0.00 ? 92  TYR A H    2  
ATOM 3451  H HA   . TYR A 1 92  ? -12.892 -13.221 5.171   1.00 0.00 ? 92  TYR A HA   2  
ATOM 3452  H HB2  . TYR A 1 92  ? -11.704 -12.497 3.549   1.00 0.00 ? 92  TYR A HB2  2  
ATOM 3453  H HB3  . TYR A 1 92  ? -11.873 -13.901 2.546   1.00 0.00 ? 92  TYR A HB3  2  
ATOM 3454  H HD1  . TYR A 1 92  ? -14.145 -14.047 1.228   1.00 0.00 ? 92  TYR A HD1  2  
ATOM 3455  H HD2  . TYR A 1 92  ? -13.060 -10.582 3.381   1.00 0.00 ? 92  TYR A HD2  2  
ATOM 3456  H HE1  . TYR A 1 92  ? -15.998 -12.869 0.178   1.00 0.00 ? 92  TYR A HE1  2  
ATOM 3457  H HE2  . TYR A 1 92  ? -14.896 -9.402  2.491   1.00 0.00 ? 92  TYR A HE2  2  
ATOM 3458  H HH   . TYR A 1 92  ? -16.439 -9.396  0.701   1.00 0.00 ? 92  TYR A HH   2  
ATOM 3459  N N    . ILE A 1 93  ? -15.339 -13.703 4.906   1.00 0.00 ? 93  ILE A N    2  
ATOM 3460  C CA   . ILE A 1 93  ? -16.769 -13.825 5.114   1.00 0.00 ? 93  ILE A CA   2  
ATOM 3461  C C    . ILE A 1 93  ? -17.395 -13.555 3.776   1.00 0.00 ? 93  ILE A C    2  
ATOM 3462  O O    . ILE A 1 93  ? -17.199 -12.471 3.235   1.00 0.00 ? 93  ILE A O    2  
ATOM 3463  C CB   . ILE A 1 93  ? -17.219 -12.738 6.122   1.00 0.00 ? 93  ILE A CB   2  
ATOM 3464  C CG1  . ILE A 1 93  ? -16.578 -13.078 7.494   1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3465  C CG2  . ILE A 1 93  ? -18.745 -12.449 6.082   1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3466  C CD1  . ILE A 1 93  ? -17.265 -12.597 8.768   1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3467  H H    . ILE A 1 93  ? -15.088 -12.742 4.990   1.00 0.00 ? 93  ILE A H    2  
ATOM 3468  H HA   . ILE A 1 93  ? -17.027 -14.824 5.441   1.00 0.00 ? 93  ILE A HA   2  
ATOM 3469  H HB   . ILE A 1 93  ? -16.778 -11.736 5.849   1.00 0.00 ? 93  ILE A HB   2  
ATOM 3470  H HG12 . ILE A 1 93  ? -16.401 -14.171 7.570   1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3471  H HG13 . ILE A 1 93  ? -15.588 -12.567 7.510   1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3472  H HG21 . ILE A 1 93  ? -19.348 -13.374 6.095   1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3473  H HG22 . ILE A 1 93  ? -19.037 -11.802 6.931   1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3474  H HG23 . ILE A 1 93  ? -18.966 -11.840 5.163   1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3475  H HD11 . ILE A 1 93  ? -17.540 -11.529 8.681   1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3476  H HD12 . ILE A 1 93  ? -18.162 -13.209 8.999   1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3477  H HD13 . ILE A 1 93  ? -16.529 -12.697 9.603   1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3478  N N    . ASP A 1 94  ? -18.175 -14.493 3.162   1.00 0.00 ? 94  ASP A N    2  
ATOM 3479  C CA   . ASP A 1 94  ? -18.799 -14.233 1.859   1.00 0.00 ? 94  ASP A CA   2  
ATOM 3480  C C    . ASP A 1 94  ? -20.039 -13.406 1.996   1.00 0.00 ? 94  ASP A C    2  
ATOM 3481  O O    . ASP A 1 94  ? -21.149 -13.902 2.167   1.00 0.00 ? 94  ASP A O    2  
ATOM 3482  C CB   . ASP A 1 94  ? -19.041 -15.403 0.851   1.00 0.00 ? 94  ASP A CB   2  
ATOM 3483  C CG   . ASP A 1 94  ? -19.668 -16.687 1.413   1.00 0.00 ? 94  ASP A CG   2  
ATOM 3484  O OD1  . ASP A 1 94  ? -20.049 -16.729 2.611   1.00 0.00 ? 94  ASP A OD1  2  
ATOM 3485  O OD2  . ASP A 1 94  ? -19.771 -17.661 0.618   1.00 0.00 ? 94  ASP A OD2  2  
ATOM 3486  H H    . ASP A 1 94  ? -18.381 -15.379 3.571   1.00 0.00 ? 94  ASP A H    2  
ATOM 3487  H HA   . ASP A 1 94  ? -18.114 -13.622 1.285   1.00 0.00 ? 94  ASP A HA   2  
ATOM 3488  H HB2  . ASP A 1 94  ? -19.621 -15.014 -0.019  1.00 0.00 ? 94  ASP A HB2  2  
ATOM 3489  H HB3  . ASP A 1 94  ? -18.056 -15.677 0.416   1.00 0.00 ? 94  ASP A HB3  2  
ATOM 3490  N N    . ARG A 1 95  ? -19.791 -12.077 1.896   1.00 0.00 ? 95  ARG A N    2  
ATOM 3491  C CA   . ARG A 1 95  ? -20.656 -10.912 1.901   1.00 0.00 ? 95  ARG A CA   2  
ATOM 3492  C C    . ARG A 1 95  ? -21.956 -11.086 1.124   1.00 0.00 ? 95  ARG A C    2  
ATOM 3493  O O    . ARG A 1 95  ? -22.969 -11.527 1.658   1.00 0.00 ? 95  ARG A O    2  
ATOM 3494  C CB   . ARG A 1 95  ? -19.757 -9.771  1.436   1.00 0.00 ? 95  ARG A CB   2  
ATOM 3495  C CG   . ARG A 1 95  ? -18.745 -9.395  2.540   1.00 0.00 ? 95  ARG A CG   2  
ATOM 3496  C CD   . ARG A 1 95  ? -19.229 -8.224  3.403   1.00 0.00 ? 95  ARG A CD   2  
ATOM 3497  N NE   . ARG A 1 95  ? -20.379 -8.635  4.280   1.00 0.00 ? 95  ARG A NE   2  
ATOM 3498  C CZ   . ARG A 1 95  ? -20.883 -7.836  5.272   1.00 0.00 ? 95  ARG A CZ   2  
ATOM 3499  N NH1  . ARG A 1 95  ? -20.350 -6.605  5.520   1.00 0.00 ? 95  ARG A NH1  2  
ATOM 3500  N NH2  . ARG A 1 95  ? -21.929 -8.284  6.028   1.00 0.00 ? 95  ARG A NH2  2  
ATOM 3501  H H    . ARG A 1 95  ? -18.822 -11.823 1.829   1.00 0.00 ? 95  ARG A H    2  
ATOM 3502  H HA   . ARG A 1 95  ? -20.896 -10.673 2.904   1.00 0.00 ? 95  ARG A HA   2  
ATOM 3503  H HB2  . ARG A 1 95  ? -19.190 -10.120 0.541   1.00 0.00 ? 95  ARG A HB2  2  
ATOM 3504  H HB3  . ARG A 1 95  ? -20.328 -8.859  1.146   1.00 0.00 ? 95  ARG A HB3  2  
ATOM 3505  H HG2  . ARG A 1 95  ? -18.295 -10.218 3.142   1.00 0.00 ? 95  ARG A HG2  2  
ATOM 3506  H HG3  . ARG A 1 95  ? -17.864 -9.039  2.006   1.00 0.00 ? 95  ARG A HG3  2  
ATOM 3507  H HD2  . ARG A 1 95  ? -18.399 -7.894  4.051   1.00 0.00 ? 95  ARG A HD2  2  
ATOM 3508  H HD3  . ARG A 1 95  ? -19.549 -7.413  2.707   1.00 0.00 ? 95  ARG A HD3  2  
ATOM 3509  H HE   . ARG A 1 95  ? -20.792 -9.532  4.131   1.00 0.00 ? 95  ARG A HE   2  
ATOM 3510  H HH11 . ARG A 1 95  ? -19.582 -6.272  4.971   1.00 0.00 ? 95  ARG A HH11 2  
ATOM 3511  H HH12 . ARG A 1 95  ? -20.728 -6.032  6.249   1.00 0.00 ? 95  ARG A HH12 2  
ATOM 3512  H HH21 . ARG A 1 95  ? -22.319 -9.188  5.852   1.00 0.00 ? 95  ARG A HH21 2  
ATOM 3513  H HH22 . ARG A 1 95  ? -22.304 -7.709  6.753   1.00 0.00 ? 95  ARG A HH22 2  
ATOM 3514  N N    . ASP A 1 96  ? -21.925 -10.837 -0.193  1.00 0.00 ? 96  ASP A N    2  
ATOM 3515  C CA   . ASP A 1 96  ? -22.927 -11.348 -1.121  1.00 0.00 ? 96  ASP A CA   2  
ATOM 3516  C C    . ASP A 1 96  ? -22.262 -12.533 -1.838  1.00 0.00 ? 96  ASP A C    2  
ATOM 3517  O O    . ASP A 1 96  ? -21.449 -12.195 -2.691  1.00 0.00 ? 96  ASP A O    2  
ATOM 3518  C CB   . ASP A 1 96  ? -23.414 -10.233 -2.088  1.00 0.00 ? 96  ASP A CB   2  
ATOM 3519  C CG   . ASP A 1 96  ? -24.508 -10.659 -3.075  1.00 0.00 ? 96  ASP A CG   2  
ATOM 3520  O OD1  . ASP A 1 96  ? -25.525 -11.250 -2.625  1.00 0.00 ? 96  ASP A OD1  2  
ATOM 3521  O OD2  . ASP A 1 96  ? -24.336 -10.386 -4.294  1.00 0.00 ? 96  ASP A OD2  2  
ATOM 3522  H H    . ASP A 1 96  ? -21.088 -10.481 -0.595  1.00 0.00 ? 96  ASP A H    2  
ATOM 3523  H HA   . ASP A 1 96  ? -23.806 -11.709 -0.600  1.00 0.00 ? 96  ASP A HA   2  
ATOM 3524  H HB2  . ASP A 1 96  ? -23.843 -9.430  -1.448  1.00 0.00 ? 96  ASP A HB2  2  
ATOM 3525  H HB3  . ASP A 1 96  ? -22.553 -9.810  -2.637  1.00 0.00 ? 96  ASP A HB3  2  
ATOM 3526  N N    . PRO A 1 97  ? -22.461 -13.874 -1.637  1.00 0.00 ? 97  PRO A N    2  
ATOM 3527  C CA   . PRO A 1 97  ? -21.761 -14.993 -2.311  1.00 0.00 ? 97  PRO A CA   2  
ATOM 3528  C C    . PRO A 1 97  ? -21.811 -15.024 -3.830  1.00 0.00 ? 97  PRO A C    2  
ATOM 3529  O O    . PRO A 1 97  ? -20.860 -15.494 -4.454  1.00 0.00 ? 97  PRO A O    2  
ATOM 3530  C CB   . PRO A 1 97  ? -22.392 -16.260 -1.744  1.00 0.00 ? 97  PRO A CB   2  
ATOM 3531  C CG   . PRO A 1 97  ? -22.801 -15.827 -0.339  1.00 0.00 ? 97  PRO A CG   2  
ATOM 3532  C CD   . PRO A 1 97  ? -23.223 -14.360 -0.505  1.00 0.00 ? 97  PRO A CD   2  
ATOM 3533  H HA   . PRO A 1 97  ? -20.716 -14.930 -2.042  1.00 0.00 ? 97  PRO A HA   2  
ATOM 3534  H HB2  . PRO A 1 97  ? -23.338 -16.549 -2.279  1.00 0.00 ? 97  PRO A HB2  2  
ATOM 3535  H HB3  . PRO A 1 97  ? -21.643 -17.096 -1.770  1.00 0.00 ? 97  PRO A HB3  2  
ATOM 3536  H HG2  . PRO A 1 97  ? -23.595 -16.472 0.067   1.00 0.00 ? 97  PRO A HG2  2  
ATOM 3537  H HG3  . PRO A 1 97  ? -21.922 -15.870 0.337   1.00 0.00 ? 97  PRO A HG3  2  
ATOM 3538  H HD2  . PRO A 1 97  ? -24.291 -14.228 -0.739  1.00 0.00 ? 97  PRO A HD2  2  
ATOM 3539  H HD3  . PRO A 1 97  ? -22.966 -13.812 0.424   1.00 0.00 ? 97  PRO A HD3  2  
ATOM 3540  N N    . GLU A 1 98  ? -22.866 -14.396 -4.433  1.00 0.00 ? 98  GLU A N    2  
ATOM 3541  C CA   . GLU A 1 98  ? -23.019 -14.070 -5.846  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3542  C C    . GLU A 1 98  ? -21.911 -13.125 -6.285  1.00 0.00 ? 98  GLU A C    2  
ATOM 3543  O O    . GLU A 1 98  ? -21.330 -13.292 -7.336  1.00 0.00 ? 98  GLU A O    2  
ATOM 3544  C CB   . GLU A 1 98  ? -24.400 -13.445 -6.131  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3545  C CG   . GLU A 1 98  ? -25.570 -14.382 -5.766  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3546  C CD   . GLU A 1 98  ? -26.921 -13.728 -6.068  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3547  O OE1  . GLU A 1 98  ? -27.957 -14.403 -5.819  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3548  O OE2  . GLU A 1 98  ? -26.947 -12.563 -6.545  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3549  H H    . GLU A 1 98  ? -23.591 -14.035 -3.852  1.00 0.00 ? 98  GLU A H    2  
ATOM 3550  H HA   . GLU A 1 98  ? -22.915 -14.962 -6.448  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3551  H HB2  . GLU A 1 98  ? -24.507 -12.509 -5.546  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3552  H HB3  . GLU A 1 98  ? -24.485 -13.199 -7.215  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3553  H HG2  . GLU A 1 98  ? -25.482 -15.322 -6.350  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3554  H HG3  . GLU A 1 98  ? -25.529 -14.630 -4.683  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3555  N N    . THR A 1 99  ? -21.454 -12.183 -5.406  1.00 0.00 ? 99  THR A N    2  
ATOM 3556  C CA   . THR A 1 99  ? -20.268 -11.345 -5.638  1.00 0.00 ? 99  THR A CA   2  
ATOM 3557  C C    . THR A 1 99  ? -18.972 -12.157 -5.625  1.00 0.00 ? 99  THR A C    2  
ATOM 3558  O O    . THR A 1 99  ? -18.173 -11.980 -6.519  1.00 0.00 ? 99  THR A O    2  
ATOM 3559  C CB   . THR A 1 99  ? -20.215 -10.054 -4.785  1.00 0.00 ? 99  THR A CB   2  
ATOM 3560  O OG1  . THR A 1 99  ? -19.905 -8.912  -5.575  1.00 0.00 ? 99  THR A OG1  2  
ATOM 3561  C CG2  . THR A 1 99  ? -19.214 -10.051 -3.619  1.00 0.00 ? 99  THR A CG2  2  
ATOM 3562  H H    . THR A 1 99  ? -21.864 -12.095 -4.491  1.00 0.00 ? 99  THR A H    2  
ATOM 3563  H HA   . THR A 1 99  ? -20.350 -11.014 -6.670  1.00 0.00 ? 99  THR A HA   2  
ATOM 3564  H HB   . THR A 1 99  ? -21.226 -9.929  -4.346  1.00 0.00 ? 99  THR A HB   2  
ATOM 3565  H HG1  . THR A 1 99  ? -18.928 -8.915  -5.656  1.00 0.00 ? 99  THR A HG1  2  
ATOM 3566  H HG21 . THR A 1 99  ? -18.187 -10.212 -4.018  1.00 0.00 ? 99  THR A HG21 2  
ATOM 3567  H HG22 . THR A 1 99  ? -19.233 -9.085  -3.065  1.00 0.00 ? 99  THR A HG22 2  
ATOM 3568  H HG23 . THR A 1 99  ? -19.467 -10.843 -2.890  1.00 0.00 ? 99  THR A HG23 2  
ATOM 3569  N N    . ILE A 1 100 ? -18.749 -13.146 -4.704  1.00 0.00 ? 100 ILE A N    2  
ATOM 3570  C CA   . ILE A 1 100 ? -17.594 -14.052 -4.664  1.00 0.00 ? 100 ILE A CA   2  
ATOM 3571  C C    . ILE A 1 100 ? -17.567 -14.993 -5.882  1.00 0.00 ? 100 ILE A C    2  
ATOM 3572  O O    . ILE A 1 100 ? -16.580 -15.031 -6.605  1.00 0.00 ? 100 ILE A O    2  
ATOM 3573  C CB   . ILE A 1 100 ? -17.698 -14.852 -3.365  1.00 0.00 ? 100 ILE A CB   2  
ATOM 3574  C CG1  . ILE A 1 100 ? -17.286 -14.002 -2.140  1.00 0.00 ? 100 ILE A CG1  2  
ATOM 3575  C CG2  . ILE A 1 100 ? -16.769 -16.091 -3.348  1.00 0.00 ? 100 ILE A CG2  2  
ATOM 3576  C CD1  . ILE A 1 100 ? -18.107 -12.770 -1.765  1.00 0.00 ? 100 ILE A CD1  2  
ATOM 3577  H H    . ILE A 1 100 ? -19.391 -13.369 -3.978  1.00 0.00 ? 100 ILE A H    2  
ATOM 3578  H HA   . ILE A 1 100 ? -16.641 -13.497 -4.653  1.00 0.00 ? 100 ILE A HA   2  
ATOM 3579  H HB   . ILE A 1 100 ? -18.758 -15.188 -3.208  1.00 0.00 ? 100 ILE A HB   2  
ATOM 3580  H HG12 . ILE A 1 100 ? -17.399 -14.700 -1.303  1.00 0.00 ? 100 ILE A HG12 2  
ATOM 3581  H HG13 . ILE A 1 100 ? -16.220 -13.715 -2.238  1.00 0.00 ? 100 ILE A HG13 2  
ATOM 3582  H HG21 . ILE A 1 100 ? -15.755 -15.804 -3.694  1.00 0.00 ? 100 ILE A HG21 2  
ATOM 3583  H HG22 . ILE A 1 100 ? -16.676 -16.477 -2.309  1.00 0.00 ? 100 ILE A HG22 2  
ATOM 3584  H HG23 . ILE A 1 100 ? -17.148 -16.923 -3.977  1.00 0.00 ? 100 ILE A HG23 2  
ATOM 3585  H HD11 . ILE A 1 100 ? -19.193 -12.974 -1.855  1.00 0.00 ? 100 ILE A HD11 2  
ATOM 3586  H HD12 . ILE A 1 100 ? -17.895 -12.442 -0.724  1.00 0.00 ? 100 ILE A HD12 2  
ATOM 3587  H HD13 . ILE A 1 100 ? -17.820 -11.934 -2.433  1.00 0.00 ? 100 ILE A HD13 2  
ATOM 3588  N N    . ARG A 1 101 ? -18.688 -15.695 -6.219  1.00 0.00 ? 101 ARG A N    2  
ATOM 3589  C CA   . ARG A 1 101 ? -18.825 -16.585 -7.380  1.00 0.00 ? 101 ARG A CA   2  
ATOM 3590  C C    . ARG A 1 101 ? -18.825 -15.862 -8.729  1.00 0.00 ? 101 ARG A C    2  
ATOM 3591  O O    . ARG A 1 101 ? -18.354 -16.395 -9.733  1.00 0.00 ? 101 ARG A O    2  
ATOM 3592  C CB   . ARG A 1 101 ? -20.075 -17.491 -7.245  1.00 0.00 ? 101 ARG A CB   2  
ATOM 3593  C CG   . ARG A 1 101 ? -20.011 -18.432 -6.020  1.00 0.00 ? 101 ARG A CG   2  
ATOM 3594  C CD   . ARG A 1 101 ? -21.086 -19.530 -6.024  1.00 0.00 ? 101 ARG A CD   2  
ATOM 3595  N NE   . ARG A 1 101 ? -20.838 -20.452 -7.189  1.00 0.00 ? 101 ARG A NE   2  
ATOM 3596  C CZ   . ARG A 1 101 ? -21.662 -21.496 -7.514  1.00 0.00 ? 101 ARG A CZ   2  
ATOM 3597  N NH1  . ARG A 1 101 ? -22.779 -21.763 -6.776  1.00 0.00 ? 101 ARG A NH1  2  
ATOM 3598  N NH2  . ARG A 1 101 ? -21.360 -22.278 -8.590  1.00 0.00 ? 101 ARG A NH2  2  
ATOM 3599  H H    . ARG A 1 101 ? -19.514 -15.631 -5.640  1.00 0.00 ? 101 ARG A H    2  
ATOM 3600  H HA   . ARG A 1 101 ? -17.952 -17.233 -7.415  1.00 0.00 ? 101 ARG A HA   2  
ATOM 3601  H HB2  . ARG A 1 101 ? -20.990 -16.866 -7.153  1.00 0.00 ? 101 ARG A HB2  2  
ATOM 3602  H HB3  . ARG A 1 101 ? -20.183 -18.127 -8.154  1.00 0.00 ? 101 ARG A HB3  2  
ATOM 3603  H HG2  . ARG A 1 101 ? -18.999 -18.901 -6.031  1.00 0.00 ? 101 ARG A HG2  2  
ATOM 3604  H HG3  . ARG A 1 101 ? -20.139 -17.847 -5.071  1.00 0.00 ? 101 ARG A HG3  2  
ATOM 3605  H HD2  . ARG A 1 101 ? -21.024 -20.121 -5.084  1.00 0.00 ? 101 ARG A HD2  2  
ATOM 3606  H HD3  . ARG A 1 101 ? -22.096 -19.074 -6.117  1.00 0.00 ? 101 ARG A HD3  2  
ATOM 3607  H HE   . ARG A 1 101 ? -20.029 -20.288 -7.755  1.00 0.00 ? 101 ARG A HE   2  
ATOM 3608  H HH11 . ARG A 1 101 ? -23.004 -21.191 -5.987  1.00 0.00 ? 101 ARG A HH11 2  
ATOM 3609  H HH12 . ARG A 1 101 ? -23.371 -22.529 -7.025  1.00 0.00 ? 101 ARG A HH12 2  
ATOM 3610  H HH21 . ARG A 1 101 ? -20.542 -22.087 -9.134  1.00 0.00 ? 101 ARG A HH21 2  
ATOM 3611  H HH22 . ARG A 1 101 ? -21.955 -23.044 -8.834  1.00 0.00 ? 101 ARG A HH22 2  
ATOM 3612  N N    . ARG A 1 102 ? -19.278 -14.568 -8.760  1.00 0.00 ? 102 ARG A N    2  
ATOM 3613  C CA   . ARG A 1 102 ? -19.186 -13.679 -9.924  1.00 0.00 ? 102 ARG A CA   2  
ATOM 3614  C C    . ARG A 1 102 ? -17.785 -13.131 -10.064 1.00 0.00 ? 102 ARG A C    2  
ATOM 3615  O O    . ARG A 1 102 ? -17.277 -13.056 -11.185 1.00 0.00 ? 102 ARG A O    2  
ATOM 3616  C CB   . ARG A 1 102 ? -20.203 -12.527 -9.985  1.00 0.00 ? 102 ARG A CB   2  
ATOM 3617  C CG   . ARG A 1 102 ? -21.602 -13.101 -10.244 1.00 0.00 ? 102 ARG A CG   2  
ATOM 3618  C CD   . ARG A 1 102 ? -22.715 -12.065 -10.365 1.00 0.00 ? 102 ARG A CD   2  
ATOM 3619  N NE   . ARG A 1 102 ? -22.711 -11.177 -9.148  1.00 0.00 ? 102 ARG A NE   2  
ATOM 3620  C CZ   . ARG A 1 102 ? -23.778 -10.416 -8.756  1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3621  N NH1  . ARG A 1 102 ? -24.931 -10.391 -9.484  1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3622  N NH2  . ARG A 1 102 ? -23.685 -9.679  -7.610  1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3623  H H    . ARG A 1 102 ? -19.653 -14.143 -7.922  1.00 0.00 ? 102 ARG A H    2  
ATOM 3624  H HA   . ARG A 1 102 ? -19.415 -14.240 -10.812 1.00 0.00 ? 102 ARG A HA   2  
ATOM 3625  H HB2  . ARG A 1 102 ? -20.178 -11.941 -9.041  1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3626  H HB3  . ARG A 1 102 ? -19.981 -11.829 -10.830 1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3627  H HG2  . ARG A 1 102 ? -21.550 -13.664 -11.194 1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3628  H HG3  . ARG A 1 102 ? -21.877 -13.835 -9.455  1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3629  H HD2  . ARG A 1 102 ? -22.518 -11.455 -11.270 1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3630  H HD3  . ARG A 1 102 ? -23.676 -12.619 -10.435 1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3631  H HE   . ARG A 1 102 ? -21.887 -11.168 -8.580  1.00 0.00 ? 102 ARG A HE   2  
ATOM 3632  H HH11 . ARG A 1 102 ? -25.004 -10.935 -10.321 1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3633  H HH12 . ARG A 1 102 ? -25.701 -9.832  -9.180  1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3634  H HH21 . ARG A 1 102 ? -22.843 -9.696  -7.071  1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3635  H HH22 . ARG A 1 102 ? -24.459 -9.120  -7.310  1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3636  N N    . GLN A 1 103 ? -17.122 -12.806 -8.904  1.00 0.00 ? 103 GLN A N    2  
ATOM 3637  C CA   . GLN A 1 103 ? -15.739 -12.344 -8.808  1.00 0.00 ? 103 GLN A CA   2  
ATOM 3638  C C    . GLN A 1 103 ? -14.691 -13.333 -9.312  1.00 0.00 ? 103 GLN A C    2  
ATOM 3639  O O    . GLN A 1 103 ? -13.693 -12.929 -9.894  1.00 0.00 ? 103 GLN A O    2  
ATOM 3640  C CB   . GLN A 1 103 ? -15.409 -11.638 -7.461  1.00 0.00 ? 103 GLN A CB   2  
ATOM 3641  C CG   . GLN A 1 103 ? -16.078 -10.235 -7.510  1.00 0.00 ? 103 GLN A CG   2  
ATOM 3642  C CD   . GLN A 1 103 ? -16.118 -9.360  -6.252  1.00 0.00 ? 103 GLN A CD   2  
ATOM 3643  O OE1  . GLN A 1 103 ? -17.167 -8.950  -5.735  1.00 0.00 ? 103 GLN A OE1  2  
ATOM 3644  N NE2  . GLN A 1 103 ? -14.906 -8.978  -5.782  1.00 0.00 ? 103 GLN A NE2  2  
ATOM 3645  H H    . GLN A 1 103 ? -17.591 -12.864 -8.006  1.00 0.00 ? 103 GLN A H    2  
ATOM 3646  H HA   . GLN A 1 103 ? -15.668 -11.519 -9.475  1.00 0.00 ? 103 GLN A HA   2  
ATOM 3647  H HB2  . GLN A 1 103 ? -15.779 -12.245 -6.612  1.00 0.00 ? 103 GLN A HB2  2  
ATOM 3648  H HB3  . GLN A 1 103 ? -14.314 -11.499 -7.334  1.00 0.00 ? 103 GLN A HB3  2  
ATOM 3649  H HG2  . GLN A 1 103 ? -15.519 -9.698  -8.288  1.00 0.00 ? 103 GLN A HG2  2  
ATOM 3650  H HG3  . GLN A 1 103 ? -17.127 -10.358 -7.840  1.00 0.00 ? 103 GLN A HG3  2  
ATOM 3651  H HE21 . GLN A 1 103 ? -14.054 -9.302  -6.188  1.00 0.00 ? 103 GLN A HE21 2  
ATOM 3652  H HE22 . GLN A 1 103 ? -14.896 -8.379  -4.983  1.00 0.00 ? 103 GLN A HE22 2  
ATOM 3653  N N    . LEU A 1 104 ? -14.915 -14.659 -9.130  1.00 0.00 ? 104 LEU A N    2  
ATOM 3654  C CA   . LEU A 1 104 ? -14.071 -15.719 -9.678  1.00 0.00 ? 104 LEU A CA   2  
ATOM 3655  C C    . LEU A 1 104 ? -14.383 -16.072 -11.138 1.00 0.00 ? 104 LEU A C    2  
ATOM 3656  O O    . LEU A 1 104 ? -13.503 -16.124 -11.990 1.00 0.00 ? 104 LEU A O    2  
ATOM 3657  C CB   . LEU A 1 104 ? -14.050 -17.071 -8.888  1.00 0.00 ? 104 LEU A CB   2  
ATOM 3658  C CG   . LEU A 1 104 ? -14.539 -17.091 -7.436  1.00 0.00 ? 104 LEU A CG   2  
ATOM 3659  C CD1  . LEU A 1 104 ? -14.424 -18.504 -6.835  1.00 0.00 ? 104 LEU A CD1  2  
ATOM 3660  C CD2  . LEU A 1 104 ? -13.820 -16.084 -6.541  1.00 0.00 ? 104 LEU A CD2  2  
ATOM 3661  H H    . LEU A 1 104 ? -15.726 -14.930 -8.611  1.00 0.00 ? 104 LEU A H    2  
ATOM 3662  H HA   . LEU A 1 104 ? -13.042 -15.375 -9.653  1.00 0.00 ? 104 LEU A HA   2  
ATOM 3663  H HB2  . LEU A 1 104 ? -14.709 -17.838 -9.353  1.00 0.00 ? 104 LEU A HB2  2  
ATOM 3664  H HB3  . LEU A 1 104 ? -12.987 -17.409 -8.902  1.00 0.00 ? 104 LEU A HB3  2  
ATOM 3665  H HG   . LEU A 1 104 ? -15.626 -16.854 -7.480  1.00 0.00 ? 104 LEU A HG   2  
ATOM 3666  H HD11 . LEU A 1 104 ? -14.964 -19.258 -7.447  1.00 0.00 ? 104 LEU A HD11 2  
ATOM 3667  H HD12 . LEU A 1 104 ? -13.354 -18.800 -6.771  1.00 0.00 ? 104 LEU A HD12 2  
ATOM 3668  H HD13 . LEU A 1 104 ? -14.843 -18.503 -5.805  1.00 0.00 ? 104 LEU A HD13 2  
ATOM 3669  H HD21 . LEU A 1 104 ? -13.841 -15.044 -6.950  1.00 0.00 ? 104 LEU A HD21 2  
ATOM 3670  H HD22 . LEU A 1 104 ? -14.294 -16.043 -5.540  1.00 0.00 ? 104 LEU A HD22 2  
ATOM 3671  H HD23 . LEU A 1 104 ? -12.758 -16.366 -6.412  1.00 0.00 ? 104 LEU A HD23 2  
ATOM 3672  N N    . GLU A 1 105 ? -15.665 -16.461 -11.401 1.00 0.00 ? 105 GLU A N    2  
ATOM 3673  C CA   . GLU A 1 105 ? -16.122 -17.048 -12.660 1.00 0.00 ? 105 GLU A CA   2  
ATOM 3674  C C    . GLU A 1 105 ? -16.493 -16.135 -13.842 1.00 0.00 ? 105 GLU A C    2  
ATOM 3675  O O    . GLU A 1 105 ? -15.943 -16.277 -14.928 1.00 0.00 ? 105 GLU A O    2  
ATOM 3676  C CB   . GLU A 1 105 ? -17.305 -18.021 -12.364 1.00 0.00 ? 105 GLU A CB   2  
ATOM 3677  C CG   . GLU A 1 105 ? -17.052 -19.005 -11.197 1.00 0.00 ? 105 GLU A CG   2  
ATOM 3678  C CD   . GLU A 1 105 ? -18.222 -19.986 -11.094 1.00 0.00 ? 105 GLU A CD   2  
ATOM 3679  O OE1  . GLU A 1 105 ? -18.430 -20.767 -12.060 1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3680  O OE2  . GLU A 1 105 ? -18.923 -19.966 -10.045 1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3681  H H    . GLU A 1 105 ? -16.360 -16.447 -10.678 1.00 0.00 ? 105 GLU A H    2  
ATOM 3682  H HA   . GLU A 1 105 ? -15.322 -17.676 -13.036 1.00 0.00 ? 105 GLU A HA   2  
ATOM 3683  H HB2  . GLU A 1 105 ? -18.214 -17.436 -12.096 1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3684  H HB3  . GLU A 1 105 ? -17.529 -18.614 -13.280 1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3685  H HG2  . GLU A 1 105 ? -16.113 -19.572 -11.379 1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3686  H HG3  . GLU A 1 105 ? -16.966 -18.469 -10.223 1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3687  N N    . LEU A 1 106 ? -17.482 -15.214 -13.659 1.00 0.00 ? 106 LEU A N    2  
ATOM 3688  C CA   . LEU A 1 106 ? -18.108 -14.331 -14.648 1.00 0.00 ? 106 LEU A CA   2  
ATOM 3689  C C    . LEU A 1 106 ? -17.377 -13.043 -14.944 1.00 0.00 ? 106 LEU A C    2  
ATOM 3690  O O    . LEU A 1 106 ? -17.164 -12.681 -16.097 1.00 0.00 ? 106 LEU A O    2  
ATOM 3691  C CB   . LEU A 1 106 ? -19.484 -13.907 -14.081 1.00 0.00 ? 106 LEU A CB   2  
ATOM 3692  C CG   . LEU A 1 106 ? -20.644 -14.929 -14.225 1.00 0.00 ? 106 LEU A CG   2  
ATOM 3693  C CD1  . LEU A 1 106 ? -21.116 -15.019 -15.689 1.00 0.00 ? 106 LEU A CD1  2  
ATOM 3694  C CD2  . LEU A 1 106 ? -20.370 -16.346 -13.697 1.00 0.00 ? 106 LEU A CD2  2  
ATOM 3695  H H    . LEU A 1 106 ? -17.914 -15.135 -12.766 1.00 0.00 ? 106 LEU A H    2  
ATOM 3696  H HA   . LEU A 1 106 ? -18.206 -14.836 -15.604 1.00 0.00 ? 106 LEU A HA   2  
ATOM 3697  H HB2  . LEU A 1 106 ? -19.255 -13.655 -13.018 1.00 0.00 ? 106 LEU A HB2  2  
ATOM 3698  H HB3  . LEU A 1 106 ? -19.888 -12.982 -14.557 1.00 0.00 ? 106 LEU A HB3  2  
ATOM 3699  H HG   . LEU A 1 106 ? -21.490 -14.515 -13.623 1.00 0.00 ? 106 LEU A HG   2  
ATOM 3700  H HD11 . LEU A 1 106 ? -21.399 -14.023 -16.088 1.00 0.00 ? 106 LEU A HD11 2  
ATOM 3701  H HD12 . LEU A 1 106 ? -20.311 -15.441 -16.329 1.00 0.00 ? 106 LEU A HD12 2  
ATOM 3702  H HD13 . LEU A 1 106 ? -21.997 -15.690 -15.764 1.00 0.00 ? 106 LEU A HD13 2  
ATOM 3703  H HD21 . LEU A 1 106 ? -20.061 -16.321 -12.632 1.00 0.00 ? 106 LEU A HD21 2  
ATOM 3704  H HD22 . LEU A 1 106 ? -21.284 -16.974 -13.782 1.00 0.00 ? 106 LEU A HD22 2  
ATOM 3705  H HD23 . LEU A 1 106 ? -19.570 -16.832 -14.298 1.00 0.00 ? 106 LEU A HD23 2  
ATOM 3706  N N    . GLU A 1 107 ? -16.983 -12.292 -13.867 1.00 0.00 ? 107 GLU A N    2  
ATOM 3707  C CA   . GLU A 1 107 ? -16.311 -10.982 -13.898 1.00 0.00 ? 107 GLU A CA   2  
ATOM 3708  C C    . GLU A 1 107 ? -14.918 -11.032 -14.511 1.00 0.00 ? 107 GLU A C    2  
ATOM 3709  O O    . GLU A 1 107 ? -14.354 -10.062 -15.007 1.00 0.00 ? 107 GLU A O    2  
ATOM 3710  C CB   . GLU A 1 107 ? -16.235 -10.416 -12.454 1.00 0.00 ? 107 GLU A CB   2  
ATOM 3711  C CG   . GLU A 1 107 ? -15.649 -8.996  -12.349 1.00 0.00 ? 107 GLU A CG   2  
ATOM 3712  C CD   . GLU A 1 107 ? -15.870 -8.428  -10.949 1.00 0.00 ? 107 GLU A CD   2  
ATOM 3713  O OE1  . GLU A 1 107 ? -14.852 -8.109  -10.277 1.00 0.00 ? 107 GLU A OE1  2  
ATOM 3714  O OE2  . GLU A 1 107 ? -17.053 -8.303  -10.534 1.00 0.00 ? 107 GLU A OE2  2  
ATOM 3715  H H    . GLU A 1 107 ? -17.174 -12.621 -12.928 1.00 0.00 ? 107 GLU A H    2  
ATOM 3716  H HA   . GLU A 1 107 ? -16.898 -10.303 -14.500 1.00 0.00 ? 107 GLU A HA   2  
ATOM 3717  H HB2  . GLU A 1 107 ? -17.272 -10.411 -12.049 1.00 0.00 ? 107 GLU A HB2  2  
ATOM 3718  H HB3  . GLU A 1 107 ? -15.634 -11.101 -11.813 1.00 0.00 ? 107 GLU A HB3  2  
ATOM 3719  H HG2  . GLU A 1 107 ? -14.561 -9.018  -12.569 1.00 0.00 ? 107 GLU A HG2  2  
ATOM 3720  H HG3  . GLU A 1 107 ? -16.135 -8.355  -13.109 1.00 0.00 ? 107 GLU A HG3  2  
ATOM 3721  N N    . LYS A 1 108 ? -14.377 -12.266 -14.497 1.00 0.00 ? 108 LYS A N    2  
ATOM 3722  C CA   . LYS A 1 108 ? -13.066 -12.625 -15.023 1.00 0.00 ? 108 LYS A CA   2  
ATOM 3723  C C    . LYS A 1 108 ? -13.043 -12.991 -16.513 1.00 0.00 ? 108 LYS A C    2  
ATOM 3724  O O    . LYS A 1 108 ? -11.993 -13.242 -17.097 1.00 0.00 ? 108 LYS A O    2  
ATOM 3725  C CB   . LYS A 1 108 ? -12.449 -13.774 -14.199 1.00 0.00 ? 108 LYS A CB   2  
ATOM 3726  C CG   . LYS A 1 108 ? -12.103 -13.392 -12.744 1.00 0.00 ? 108 LYS A CG   2  
ATOM 3727  C CD   . LYS A 1 108 ? -11.133 -12.210 -12.545 1.00 0.00 ? 108 LYS A CD   2  
ATOM 3728  C CE   . LYS A 1 108 ? -9.751  -12.378 -13.201 1.00 0.00 ? 108 LYS A CE   2  
ATOM 3729  N NZ   . LYS A 1 108 ? -9.031  -13.541 -12.634 1.00 0.00 ? 108 LYS A NZ   2  
ATOM 3730  H H    . LYS A 1 108 ? -14.972 -12.971 -14.085 1.00 0.00 ? 108 LYS A H    2  
ATOM 3731  H HA   . LYS A 1 108 ? -12.424 -11.757 -14.923 1.00 0.00 ? 108 LYS A HA   2  
ATOM 3732  H HB2  . LYS A 1 108 ? -13.165 -14.627 -14.160 1.00 0.00 ? 108 LYS A HB2  2  
ATOM 3733  H HB3  . LYS A 1 108 ? -11.536 -14.139 -14.706 1.00 0.00 ? 108 LYS A HB3  2  
ATOM 3734  H HG2  . LYS A 1 108 ? -13.054 -13.153 -12.219 1.00 0.00 ? 108 LYS A HG2  2  
ATOM 3735  H HG3  . LYS A 1 108 ? -11.677 -14.290 -12.242 1.00 0.00 ? 108 LYS A HG3  2  
ATOM 3736  H HD2  . LYS A 1 108 ? -11.614 -11.283 -12.928 1.00 0.00 ? 108 LYS A HD2  2  
ATOM 3737  H HD3  . LYS A 1 108 ? -10.989 -12.065 -11.449 1.00 0.00 ? 108 LYS A HD3  2  
ATOM 3738  H HE2  . LYS A 1 108 ? -9.841  -12.536 -14.296 1.00 0.00 ? 108 LYS A HE2  2  
ATOM 3739  H HE3  . LYS A 1 108 ? -9.120  -11.480 -13.022 1.00 0.00 ? 108 LYS A HE3  2  
ATOM 3740  H HZ1  . LYS A 1 108 ? -8.906  -13.406 -11.610 1.00 0.00 ? 108 LYS A HZ1  2  
ATOM 3741  H HZ2  . LYS A 1 108 ? -9.584  -14.405 -12.805 1.00 0.00 ? 108 LYS A HZ2  2  
ATOM 3742  H HZ3  . LYS A 1 108 ? -8.101  -13.628 -13.089 1.00 0.00 ? 108 LYS A HZ3  2  
ATOM 3743  N N    . LYS A 1 109 ? -14.216 -12.990 -17.185 1.00 0.00 ? 109 LYS A N    2  
ATOM 3744  C CA   . LYS A 1 109 ? -14.438 -13.248 -18.609 1.00 0.00 ? 109 LYS A CA   2  
ATOM 3745  C C    . LYS A 1 109 ? -14.153 -12.021 -19.492 1.00 0.00 ? 109 LYS A C    2  
ATOM 3746  O O    . LYS A 1 109 ? -15.029 -11.459 -20.153 1.00 0.00 ? 109 LYS A O    2  
ATOM 3747  C CB   . LYS A 1 109 ? -15.876 -13.761 -18.839 1.00 0.00 ? 109 LYS A CB   2  
ATOM 3748  C CG   . LYS A 1 109 ? -16.133 -15.115 -18.165 1.00 0.00 ? 109 LYS A CG   2  
ATOM 3749  C CD   . LYS A 1 109 ? -17.486 -15.683 -18.603 1.00 0.00 ? 109 LYS A CD   2  
ATOM 3750  C CE   . LYS A 1 109 ? -17.883 -16.989 -17.895 1.00 0.00 ? 109 LYS A CE   2  
ATOM 3751  N NZ   . LYS A 1 109 ? -16.905 -18.067 -18.166 1.00 0.00 ? 109 LYS A NZ   2  
ATOM 3752  H H    . LYS A 1 109 ? -15.025 -12.788 -16.643 1.00 0.00 ? 109 LYS A H    2  
ATOM 3753  H HA   . LYS A 1 109 ? -13.795 -14.054 -18.935 1.00 0.00 ? 109 LYS A HA   2  
ATOM 3754  H HB2  . LYS A 1 109 ? -16.611 -13.019 -18.454 1.00 0.00 ? 109 LYS A HB2  2  
ATOM 3755  H HB3  . LYS A 1 109 ? -16.090 -13.903 -19.917 1.00 0.00 ? 109 LYS A HB3  2  
ATOM 3756  H HG2  . LYS A 1 109 ? -15.324 -15.830 -18.432 1.00 0.00 ? 109 LYS A HG2  2  
ATOM 3757  H HG3  . LYS A 1 109 ? -16.118 -14.992 -17.061 1.00 0.00 ? 109 LYS A HG3  2  
ATOM 3758  H HD2  . LYS A 1 109 ? -18.257 -14.906 -18.400 1.00 0.00 ? 109 LYS A HD2  2  
ATOM 3759  H HD3  . LYS A 1 109 ? -17.433 -15.832 -19.705 1.00 0.00 ? 109 LYS A HD3  2  
ATOM 3760  H HE2  . LYS A 1 109 ? -17.922 -16.843 -16.795 1.00 0.00 ? 109 LYS A HE2  2  
ATOM 3761  H HE3  . LYS A 1 109 ? -18.877 -17.344 -18.246 1.00 0.00 ? 109 LYS A HE3  2  
ATOM 3762  H HZ1  . LYS A 1 109 ? -15.966 -17.774 -17.830 1.00 0.00 ? 109 LYS A HZ1  2  
ATOM 3763  H HZ2  . LYS A 1 109 ? -17.197 -18.933 -17.668 1.00 0.00 ? 109 LYS A HZ2  2  
ATOM 3764  H HZ3  . LYS A 1 109 ? -16.866 -18.253 -19.189 1.00 0.00 ? 109 LYS A HZ3  2  
ATOM 3765  N N    . LYS A 1 110 ? -12.865 -11.576 -19.522 1.00 0.00 ? 110 LYS A N    2  
ATOM 3766  C CA   . LYS A 1 110 ? -12.315 -10.398 -20.198 1.00 0.00 ? 110 LYS A CA   2  
ATOM 3767  C C    . LYS A 1 110 ? -12.298 -10.445 -21.734 1.00 0.00 ? 110 LYS A C    2  
ATOM 3768  O O    . LYS A 1 110 ? -11.263 -10.271 -22.370 1.00 0.00 ? 110 LYS A O    2  
ATOM 3769  C CB   . LYS A 1 110 ? -10.872 -10.103 -19.681 1.00 0.00 ? 110 LYS A CB   2  
ATOM 3770  C CG   . LYS A 1 110 ? -10.716 -9.995  -18.150 1.00 0.00 ? 110 LYS A CG   2  
ATOM 3771  C CD   . LYS A 1 110 ? -11.478 -8.828  -17.505 1.00 0.00 ? 110 LYS A CD   2  
ATOM 3772  C CE   . LYS A 1 110 ? -11.216 -8.731  -15.993 1.00 0.00 ? 110 LYS A CE   2  
ATOM 3773  N NZ   . LYS A 1 110 ? -11.999 -7.629  -15.385 1.00 0.00 ? 110 LYS A NZ   2  
ATOM 3774  H H    . LYS A 1 110 ? -12.213 -12.076 -18.951 1.00 0.00 ? 110 LYS A H    2  
ATOM 3775  H HA   . LYS A 1 110 ? -12.934 -9.550  -19.931 1.00 0.00 ? 110 LYS A HA   2  
ATOM 3776  H HB2  . LYS A 1 110 ? -10.193 -10.923 -20.018 1.00 0.00 ? 110 LYS A HB2  2  
ATOM 3777  H HB3  . LYS A 1 110 ? -10.494 -9.153  -20.123 1.00 0.00 ? 110 LYS A HB3  2  
ATOM 3778  H HG2  . LYS A 1 110 ? -11.025 -10.944 -17.664 1.00 0.00 ? 110 LYS A HG2  2  
ATOM 3779  H HG3  . LYS A 1 110 ? -9.631  -9.858  -17.928 1.00 0.00 ? 110 LYS A HG3  2  
ATOM 3780  H HD2  . LYS A 1 110 ? -11.175 -7.878  -17.997 1.00 0.00 ? 110 LYS A HD2  2  
ATOM 3781  H HD3  . LYS A 1 110 ? -12.571 -8.968  -17.672 1.00 0.00 ? 110 LYS A HD3  2  
ATOM 3782  H HE2  . LYS A 1 110 ? -11.512 -9.671  -15.483 1.00 0.00 ? 110 LYS A HE2  2  
ATOM 3783  H HE3  . LYS A 1 110 ? -10.142 -8.533  -15.791 1.00 0.00 ? 110 LYS A HE3  2  
ATOM 3784  H HZ1  . LYS A 1 110 ? -11.732 -6.727  -15.830 1.00 0.00 ? 110 LYS A HZ1  2  
ATOM 3785  H HZ2  . LYS A 1 110 ? -13.013 -7.802  -15.536 1.00 0.00 ? 110 LYS A HZ2  2  
ATOM 3786  H HZ3  . LYS A 1 110 ? -11.802 -7.585  -14.365 1.00 0.00 ? 110 LYS A HZ3  2  
ATOM 3787  N N    . LYS A 1 111 ? -13.479 -10.678 -22.355 1.00 0.00 ? 111 LYS A N    2  
ATOM 3788  C CA   . LYS A 1 111 ? -13.684 -10.772 -23.793 1.00 0.00 ? 111 LYS A CA   2  
ATOM 3789  C C    . LYS A 1 111 ? -14.719 -9.751  -24.231 1.00 0.00 ? 111 LYS A C    2  
ATOM 3790  O O    . LYS A 1 111 ? -14.666 -9.222  -25.341 1.00 0.00 ? 111 LYS A O    2  
ATOM 3791  C CB   . LYS A 1 111 ? -14.103 -12.217 -24.177 1.00 0.00 ? 111 LYS A CB   2  
ATOM 3792  C CG   . LYS A 1 111 ? -14.199 -12.504 -25.685 1.00 0.00 ? 111 LYS A CG   2  
ATOM 3793  C CD   . LYS A 1 111 ? -14.506 -13.982 -25.976 1.00 0.00 ? 111 LYS A CD   2  
ATOM 3794  C CE   . LYS A 1 111 ? -14.634 -14.301 -27.477 1.00 0.00 ? 111 LYS A CE   2  
ATOM 3795  N NZ   . LYS A 1 111 ? -15.792 -13.597 -28.080 1.00 0.00 ? 111 LYS A NZ   2  
ATOM 3796  H H    . LYS A 1 111 ? -14.273 -10.839 -21.755 1.00 0.00 ? 111 LYS A H    2  
ATOM 3797  H HA   . LYS A 1 111 ? -12.773 -10.532 -24.331 1.00 0.00 ? 111 LYS A HA   2  
ATOM 3798  H HB2  . LYS A 1 111 ? -13.333 -12.905 -23.754 1.00 0.00 ? 111 LYS A HB2  2  
ATOM 3799  H HB3  . LYS A 1 111 ? -15.066 -12.482 -23.687 1.00 0.00 ? 111 LYS A HB3  2  
ATOM 3800  H HG2  . LYS A 1 111 ? -14.996 -11.873 -26.139 1.00 0.00 ? 111 LYS A HG2  2  
ATOM 3801  H HG3  . LYS A 1 111 ? -13.236 -12.232 -26.176 1.00 0.00 ? 111 LYS A HG3  2  
ATOM 3802  H HD2  . LYS A 1 111 ? -13.686 -14.599 -25.545 1.00 0.00 ? 111 LYS A HD2  2  
ATOM 3803  H HD3  . LYS A 1 111 ? -15.446 -14.264 -25.452 1.00 0.00 ? 111 LYS A HD3  2  
ATOM 3804  H HE2  . LYS A 1 111 ? -13.723 -13.977 -28.025 1.00 0.00 ? 111 LYS A HE2  2  
ATOM 3805  H HE3  . LYS A 1 111 ? -14.787 -15.390 -27.640 1.00 0.00 ? 111 LYS A HE3  2  
ATOM 3806  H HZ1  . LYS A 1 111 ? -15.673 -12.570 -27.960 1.00 0.00 ? 111 LYS A HZ1  2  
ATOM 3807  H HZ2  . LYS A 1 111 ? -15.847 -13.825 -29.093 1.00 0.00 ? 111 LYS A HZ2  2  
ATOM 3808  H HZ3  . LYS A 1 111 ? -16.667 -13.903 -27.607 1.00 0.00 ? 111 LYS A HZ3  2  
ATOM 3809  N N    . GLY A 1 1   ? -3.653  29.519  9.892   1.00 0.00 ? 1   GLY A N    3  
ATOM 3810  C CA   . GLY A 1 1   ? -3.723  28.709  8.699   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3811  C C    . GLY A 1 1   ? -2.773  27.565  8.808   1.00 0.00 ? 1   GLY A C    3  
ATOM 3812  O O    . GLY A 1 1   ? -3.014  26.481  8.287   1.00 0.00 ? 1   GLY A O    3  
ATOM 3813  H H    . GLY A 1 1   ? -4.042  30.441  9.854   1.00 0.00 ? 1   GLY A H    3  
ATOM 3814  H HA2  . GLY A 1 1   ? -4.719  28.301  8.623   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3815  H HA3  . GLY A 1 1   ? -3.425  29.315  7.856   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3816  N N    . GLN A 1 2   ? -1.628  27.782  9.488   1.00 0.00 ? 2   GLN A N    3  
ATOM 3817  C CA   . GLN A 1 2   ? -0.587  26.801  9.743   1.00 0.00 ? 2   GLN A CA   3  
ATOM 3818  C C    . GLN A 1 2   ? -0.303  26.820  11.222  1.00 0.00 ? 2   GLN A C    3  
ATOM 3819  O O    . GLN A 1 2   ? -0.352  27.873  11.854  1.00 0.00 ? 2   GLN A O    3  
ATOM 3820  C CB   . GLN A 1 2   ? 0.741   27.091  8.982   1.00 0.00 ? 2   GLN A CB   3  
ATOM 3821  C CG   . GLN A 1 2   ? 0.636   26.898  7.451   1.00 0.00 ? 2   GLN A CG   3  
ATOM 3822  C CD   . GLN A 1 2   ? 0.287   25.452  7.083   1.00 0.00 ? 2   GLN A CD   3  
ATOM 3823  O OE1  . GLN A 1 2   ? 1.141   24.564  7.115   1.00 0.00 ? 2   GLN A OE1  3  
ATOM 3824  N NE2  . GLN A 1 2   ? -0.997  25.194  6.739   1.00 0.00 ? 2   GLN A NE2  3  
ATOM 3825  H H    . GLN A 1 2   ? -1.490  28.679  9.906   1.00 0.00 ? 2   GLN A H    3  
ATOM 3826  H HA   . GLN A 1 2   ? -0.928  25.802  9.499   1.00 0.00 ? 2   GLN A HA   3  
ATOM 3827  H HB2  . GLN A 1 2   ? 1.044   28.147  9.170   1.00 0.00 ? 2   GLN A HB2  3  
ATOM 3828  H HB3  . GLN A 1 2   ? 1.565   26.442  9.379   1.00 0.00 ? 2   GLN A HB3  3  
ATOM 3829  H HG2  . GLN A 1 2   ? -0.121  27.590  7.025   1.00 0.00 ? 2   GLN A HG2  3  
ATOM 3830  H HG3  . GLN A 1 2   ? 1.616   27.131  6.981   1.00 0.00 ? 2   GLN A HG3  3  
ATOM 3831  H HE21 . GLN A 1 2   ? -1.739  25.822  7.003   1.00 0.00 ? 2   GLN A HE21 3  
ATOM 3832  H HE22 . GLN A 1 2   ? -1.215  24.266  6.452   1.00 0.00 ? 2   GLN A HE22 3  
ATOM 3833  N N    . ARG A 1 3   ? 0.023   25.621  11.779  1.00 0.00 ? 3   ARG A N    3  
ATOM 3834  C CA   . ARG A 1 3   ? 0.438   25.378  13.153  1.00 0.00 ? 3   ARG A CA   3  
ATOM 3835  C C    . ARG A 1 3   ? -0.680  25.407  14.211  1.00 0.00 ? 3   ARG A C    3  
ATOM 3836  O O    . ARG A 1 3   ? -0.457  25.739  15.370  1.00 0.00 ? 3   ARG A O    3  
ATOM 3837  C CB   . ARG A 1 3   ? 1.696   26.239  13.501  1.00 0.00 ? 3   ARG A CB   3  
ATOM 3838  C CG   . ARG A 1 3   ? 2.701   25.639  14.493  1.00 0.00 ? 3   ARG A CG   3  
ATOM 3839  C CD   . ARG A 1 3   ? 3.359   24.331  14.026  1.00 0.00 ? 3   ARG A CD   3  
ATOM 3840  N NE   . ARG A 1 3   ? 4.270   23.806  15.105  1.00 0.00 ? 3   ARG A NE   3  
ATOM 3841  C CZ   . ARG A 1 3   ? 5.575   24.188  15.267  1.00 0.00 ? 3   ARG A CZ   3  
ATOM 3842  N NH1  . ARG A 1 3   ? 6.154   25.101  14.434  1.00 0.00 ? 3   ARG A NH1  3  
ATOM 3843  N NH2  . ARG A 1 3   ? 6.308   23.643  16.283  1.00 0.00 ? 3   ARG A NH2  3  
ATOM 3844  H H    . ARG A 1 3   ? 0.062   24.814  11.196  1.00 0.00 ? 3   ARG A H    3  
ATOM 3845  H HA   . ARG A 1 3   ? 0.774   24.354  13.146  1.00 0.00 ? 3   ARG A HA   3  
ATOM 3846  H HB2  . ARG A 1 3   ? 2.233   26.442  12.544  1.00 0.00 ? 3   ARG A HB2  3  
ATOM 3847  H HB3  . ARG A 1 3   ? 1.375   27.208  13.934  1.00 0.00 ? 3   ARG A HB3  3  
ATOM 3848  H HG2  . ARG A 1 3   ? 3.499   26.394  14.678  1.00 0.00 ? 3   ARG A HG2  3  
ATOM 3849  H HG3  . ARG A 1 3   ? 2.140   25.510  15.440  1.00 0.00 ? 3   ARG A HG3  3  
ATOM 3850  H HD2  . ARG A 1 3   ? 2.589   23.551  13.851  1.00 0.00 ? 3   ARG A HD2  3  
ATOM 3851  H HD3  . ARG A 1 3   ? 3.919   24.488  13.077  1.00 0.00 ? 3   ARG A HD3  3  
ATOM 3852  H HE   . ARG A 1 3   ? 3.895   23.133  15.743  1.00 0.00 ? 3   ARG A HE   3  
ATOM 3853  H HH11 . ARG A 1 3   ? 5.622   25.507  13.691  1.00 0.00 ? 3   ARG A HH11 3  
ATOM 3854  H HH12 . ARG A 1 3   ? 7.108   25.370  14.572  1.00 0.00 ? 3   ARG A HH12 3  
ATOM 3855  H HH21 . ARG A 1 3   ? 5.892   22.973  16.896  1.00 0.00 ? 3   ARG A HH21 3  
ATOM 3856  H HH22 . ARG A 1 3   ? 7.264   23.915  16.411  1.00 0.00 ? 3   ARG A HH22 3  
ATOM 3857  N N    . GLN A 1 4   ? -1.931  25.027  13.818  1.00 0.00 ? 4   GLN A N    3  
ATOM 3858  C CA   . GLN A 1 4   ? -3.106  24.986  14.693  1.00 0.00 ? 4   GLN A CA   3  
ATOM 3859  C C    . GLN A 1 4   ? -3.296  23.631  15.367  1.00 0.00 ? 4   GLN A C    3  
ATOM 3860  O O    . GLN A 1 4   ? -3.576  23.556  16.561  1.00 0.00 ? 4   GLN A O    3  
ATOM 3861  C CB   . GLN A 1 4   ? -4.410  25.328  13.907  1.00 0.00 ? 4   GLN A CB   3  
ATOM 3862  C CG   . GLN A 1 4   ? -5.679  25.534  14.776  1.00 0.00 ? 4   GLN A CG   3  
ATOM 3863  C CD   . GLN A 1 4   ? -5.613  26.751  15.696  1.00 0.00 ? 4   GLN A CD   3  
ATOM 3864  O OE1  . GLN A 1 4   ? -5.586  26.641  16.922  1.00 0.00 ? 4   GLN A OE1  3  
ATOM 3865  N NE2  . GLN A 1 4   ? -5.630  27.966  15.093  1.00 0.00 ? 4   GLN A NE2  3  
ATOM 3866  H H    . GLN A 1 4   ? -2.079  24.779  12.867  1.00 0.00 ? 4   GLN A H    3  
ATOM 3867  H HA   . GLN A 1 4   ? -2.995  25.717  15.486  1.00 0.00 ? 4   GLN A HA   3  
ATOM 3868  H HB2  . GLN A 1 4   ? -4.225  26.246  13.308  1.00 0.00 ? 4   GLN A HB2  3  
ATOM 3869  H HB3  . GLN A 1 4   ? -4.656  24.512  13.183  1.00 0.00 ? 4   GLN A HB3  3  
ATOM 3870  H HG2  . GLN A 1 4   ? -6.566  25.642  14.117  1.00 0.00 ? 4   GLN A HG2  3  
ATOM 3871  H HG3  . GLN A 1 4   ? -5.848  24.641  15.417  1.00 0.00 ? 4   GLN A HG3  3  
ATOM 3872  H HE21 . GLN A 1 4   ? -5.689  28.037  14.102  1.00 0.00 ? 4   GLN A HE21 3  
ATOM 3873  H HE22 . GLN A 1 4   ? -5.638  28.762  15.692  1.00 0.00 ? 4   GLN A HE22 3  
ATOM 3874  N N    . LEU A 1 5   ? -3.182  22.536  14.555  1.00 0.00 ? 5   LEU A N    3  
ATOM 3875  C CA   . LEU A 1 5   ? -3.385  21.123  14.886  1.00 0.00 ? 5   LEU A CA   3  
ATOM 3876  C C    . LEU A 1 5   ? -4.880  20.813  14.857  1.00 0.00 ? 5   LEU A C    3  
ATOM 3877  O O    . LEU A 1 5   ? -5.459  20.258  15.785  1.00 0.00 ? 5   LEU A O    3  
ATOM 3878  C CB   . LEU A 1 5   ? -2.676  20.606  16.177  1.00 0.00 ? 5   LEU A CB   3  
ATOM 3879  C CG   . LEU A 1 5   ? -1.192  21.021  16.360  1.00 0.00 ? 5   LEU A CG   3  
ATOM 3880  C CD1  . LEU A 1 5   ? -0.548  20.190  17.481  1.00 0.00 ? 5   LEU A CD1  3  
ATOM 3881  C CD2  . LEU A 1 5   ? -0.344  20.951  15.075  1.00 0.00 ? 5   LEU A CD2  3  
ATOM 3882  H H    . LEU A 1 5   ? -2.935  22.692  13.608  1.00 0.00 ? 5   LEU A H    3  
ATOM 3883  H HA   . LEU A 1 5   ? -2.954  20.565  14.068  1.00 0.00 ? 5   LEU A HA   3  
ATOM 3884  H HB2  . LEU A 1 5   ? -3.230  20.965  17.075  1.00 0.00 ? 5   LEU A HB2  3  
ATOM 3885  H HB3  . LEU A 1 5   ? -2.724  19.495  16.186  1.00 0.00 ? 5   LEU A HB3  3  
ATOM 3886  H HG   . LEU A 1 5   ? -1.182  22.086  16.699  1.00 0.00 ? 5   LEU A HG   3  
ATOM 3887  H HD11 . LEU A 1 5   ? -1.133  20.289  18.420  1.00 0.00 ? 5   LEU A HD11 3  
ATOM 3888  H HD12 . LEU A 1 5   ? -0.515  19.117  17.196  1.00 0.00 ? 5   LEU A HD12 3  
ATOM 3889  H HD13 . LEU A 1 5   ? 0.488   20.538  17.673  1.00 0.00 ? 5   LEU A HD13 3  
ATOM 3890  H HD21 . LEU A 1 5   ? -0.395  19.934  14.632  1.00 0.00 ? 5   LEU A HD21 3  
ATOM 3891  H HD22 . LEU A 1 5   ? -0.698  21.692  14.328  1.00 0.00 ? 5   LEU A HD22 3  
ATOM 3892  H HD23 . LEU A 1 5   ? 0.716   21.184  15.310  1.00 0.00 ? 5   LEU A HD23 3  
ATOM 3893  N N    . LEU A 1 6   ? -5.539  21.252  13.751  1.00 0.00 ? 6   LEU A N    3  
ATOM 3894  C CA   . LEU A 1 6   ? -6.978  21.262  13.561  1.00 0.00 ? 6   LEU A CA   3  
ATOM 3895  C C    . LEU A 1 6   ? -7.495  20.048  12.793  1.00 0.00 ? 6   LEU A C    3  
ATOM 3896  O O    . LEU A 1 6   ? -8.555  19.501  13.080  1.00 0.00 ? 6   LEU A O    3  
ATOM 3897  C CB   . LEU A 1 6   ? -7.291  22.612  12.883  1.00 0.00 ? 6   LEU A CB   3  
ATOM 3898  C CG   . LEU A 1 6   ? -8.681  23.266  13.087  1.00 0.00 ? 6   LEU A CG   3  
ATOM 3899  C CD1  . LEU A 1 6   ? -9.793  22.603  12.270  1.00 0.00 ? 6   LEU A CD1  3  
ATOM 3900  C CD2  . LEU A 1 6   ? -9.083  23.404  14.566  1.00 0.00 ? 6   LEU A CD2  3  
ATOM 3901  H H    . LEU A 1 6   ? -5.036  21.721  13.034  1.00 0.00 ? 6   LEU A H    3  
ATOM 3902  H HA   . LEU A 1 6   ? -7.474  21.325  14.494  1.00 0.00 ? 6   LEU A HA   3  
ATOM 3903  H HB2  . LEU A 1 6   ? -6.564  23.344  13.299  1.00 0.00 ? 6   LEU A HB2  3  
ATOM 3904  H HB3  . LEU A 1 6   ? -7.058  22.517  11.817  1.00 0.00 ? 6   LEU A HB3  3  
ATOM 3905  H HG   . LEU A 1 6   ? -8.584  24.308  12.689  1.00 0.00 ? 6   LEU A HG   3  
ATOM 3906  H HD11 . LEU A 1 6   ? -9.482  22.516  11.208  1.00 0.00 ? 6   LEU A HD11 3  
ATOM 3907  H HD12 . LEU A 1 6   ? -10.014 21.590  12.666  1.00 0.00 ? 6   LEU A HD12 3  
ATOM 3908  H HD13 . LEU A 1 6   ? -10.724 23.207  12.324  1.00 0.00 ? 6   LEU A HD13 3  
ATOM 3909  H HD21 . LEU A 1 6   ? -8.272  23.893  15.149  1.00 0.00 ? 6   LEU A HD21 3  
ATOM 3910  H HD22 . LEU A 1 6   ? -10.003 24.018  14.659  1.00 0.00 ? 6   LEU A HD22 3  
ATOM 3911  H HD23 . LEU A 1 6   ? -9.291  22.409  15.013  1.00 0.00 ? 6   LEU A HD23 3  
ATOM 3912  N N    . LEU A 1 7   ? -6.677  19.672  11.788  1.00 0.00 ? 7   LEU A N    3  
ATOM 3913  C CA   . LEU A 1 7   ? -6.764  18.614  10.795  1.00 0.00 ? 7   LEU A CA   3  
ATOM 3914  C C    . LEU A 1 7   ? -6.092  19.087  9.563   1.00 0.00 ? 7   LEU A C    3  
ATOM 3915  O O    . LEU A 1 7   ? -5.617  18.281  8.764   1.00 0.00 ? 7   LEU A O    3  
ATOM 3916  C CB   . LEU A 1 7   ? -8.087  17.884  10.502  1.00 0.00 ? 7   LEU A CB   3  
ATOM 3917  C CG   . LEU A 1 7   ? -9.282  18.724  10.028  1.00 0.00 ? 7   LEU A CG   3  
ATOM 3918  C CD1  . LEU A 1 7   ? -9.449  18.769  8.499   1.00 0.00 ? 7   LEU A CD1  3  
ATOM 3919  C CD2  . LEU A 1 7   ? -10.481 18.088  10.723  1.00 0.00 ? 7   LEU A CD2  3  
ATOM 3920  H H    . LEU A 1 7   ? -5.836  20.199  11.743  1.00 0.00 ? 7   LEU A H    3  
ATOM 3921  H HA   . LEU A 1 7   ? -6.115  17.849  11.143  1.00 0.00 ? 7   LEU A HA   3  
ATOM 3922  H HB2  . LEU A 1 7   ? -7.931  17.047  9.782   1.00 0.00 ? 7   LEU A HB2  3  
ATOM 3923  H HB3  . LEU A 1 7   ? -8.369  17.395  11.465  1.00 0.00 ? 7   LEU A HB3  3  
ATOM 3924  H HG   . LEU A 1 7   ? -9.191  19.765  10.414  1.00 0.00 ? 7   LEU A HG   3  
ATOM 3925  H HD11 . LEU A 1 7   ? -9.474  17.744  8.074   1.00 0.00 ? 7   LEU A HD11 3  
ATOM 3926  H HD12 . LEU A 1 7   ? -10.397 19.281  8.229   1.00 0.00 ? 7   LEU A HD12 3  
ATOM 3927  H HD13 . LEU A 1 7   ? -8.617  19.328  8.028   1.00 0.00 ? 7   LEU A HD13 3  
ATOM 3928  H HD21 . LEU A 1 7   ? -10.273 18.125  11.817  1.00 0.00 ? 7   LEU A HD21 3  
ATOM 3929  H HD22 . LEU A 1 7   ? -11.425 18.622  10.499  1.00 0.00 ? 7   LEU A HD22 3  
ATOM 3930  H HD23 . LEU A 1 7   ? -10.544 17.021  10.424  1.00 0.00 ? 7   LEU A HD23 3  
ATOM 3931  N N    . ALA A 1 8   ? -5.998  20.433  9.395   1.00 0.00 ? 8   ALA A N    3  
ATOM 3932  C CA   . ALA A 1 8   ? -5.218  21.093  8.363   1.00 0.00 ? 8   ALA A CA   3  
ATOM 3933  C C    . ALA A 1 8   ? -5.801  21.121  6.951   1.00 0.00 ? 8   ALA A C    3  
ATOM 3934  O O    . ALA A 1 8   ? -5.819  22.168  6.307   1.00 0.00 ? 8   ALA A O    3  
ATOM 3935  C CB   . ALA A 1 8   ? -3.768  20.564  8.440   1.00 0.00 ? 8   ALA A CB   3  
ATOM 3936  H H    . ALA A 1 8   ? -6.432  21.038  10.056  1.00 0.00 ? 8   ALA A H    3  
ATOM 3937  H HA   . ALA A 1 8   ? -5.177  22.131  8.662   1.00 0.00 ? 8   ALA A HA   3  
ATOM 3938  H HB1  . ALA A 1 8   ? -3.543  20.429  9.528   1.00 0.00 ? 8   ALA A HB1  3  
ATOM 3939  H HB2  . ALA A 1 8   ? -3.042  21.255  7.970   1.00 0.00 ? 8   ALA A HB2  3  
ATOM 3940  H HB3  . ALA A 1 8   ? -3.683  19.551  7.993   1.00 0.00 ? 8   ALA A HB3  3  
ATOM 3941  N N    . SER A 1 9   ? -6.292  19.963  6.452   1.00 0.00 ? 9   SER A N    3  
ATOM 3942  C CA   . SER A 1 9   ? -6.966  19.791  5.164   1.00 0.00 ? 9   SER A CA   3  
ATOM 3943  C C    . SER A 1 9   ? -7.498  18.386  5.065   1.00 0.00 ? 9   SER A C    3  
ATOM 3944  O O    . SER A 1 9   ? -8.701  18.151  5.016   1.00 0.00 ? 9   SER A O    3  
ATOM 3945  C CB   . SER A 1 9   ? -6.141  20.142  3.889   1.00 0.00 ? 9   SER A CB   3  
ATOM 3946  O OG   . SER A 1 9   ? -6.056  21.553  3.729   1.00 0.00 ? 9   SER A OG   3  
ATOM 3947  H H    . SER A 1 9   ? -6.229  19.168  7.064   1.00 0.00 ? 9   SER A H    3  
ATOM 3948  H HA   . SER A 1 9   ? -7.849  20.400  5.168   1.00 0.00 ? 9   SER A HA   3  
ATOM 3949  H HB2  . SER A 1 9   ? -5.116  19.721  3.963   1.00 0.00 ? 9   SER A HB2  3  
ATOM 3950  H HB3  . SER A 1 9   ? -6.618  19.754  2.959   1.00 0.00 ? 9   SER A HB3  3  
ATOM 3951  H HG   . SER A 1 9   ? -5.926  21.923  4.629   1.00 0.00 ? 9   SER A HG   3  
ATOM 3952  N N    . GLU A 1 10  ? -6.587  17.391  5.021   1.00 0.00 ? 10  GLU A N    3  
ATOM 3953  C CA   . GLU A 1 10  ? -6.902  15.968  4.872   1.00 0.00 ? 10  GLU A CA   3  
ATOM 3954  C C    . GLU A 1 10  ? -6.857  15.168  6.188   1.00 0.00 ? 10  GLU A C    3  
ATOM 3955  O O    . GLU A 1 10  ? -7.334  15.580  7.246   1.00 0.00 ? 10  GLU A O    3  
ATOM 3956  C CB   . GLU A 1 10  ? -6.023  15.298  3.768   1.00 0.00 ? 10  GLU A CB   3  
ATOM 3957  C CG   . GLU A 1 10  ? -6.071  15.998  2.386   1.00 0.00 ? 10  GLU A CG   3  
ATOM 3958  C CD   . GLU A 1 10  ? -5.047  17.128  2.219   1.00 0.00 ? 10  GLU A CD   3  
ATOM 3959  O OE1  . GLU A 1 10  ? -5.160  17.858  1.197   1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3960  O OE2  . GLU A 1 10  ? -4.144  17.276  3.084   1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3961  H H    . GLU A 1 10  ? -5.632  17.658  5.062   1.00 0.00 ? 10  GLU A H    3  
ATOM 3962  H HA   . GLU A 1 10  ? -7.924  15.869  4.524   1.00 0.00 ? 10  GLU A HA   3  
ATOM 3963  H HB2  . GLU A 1 10  ? -4.965  15.194  4.088   1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3964  H HB3  . GLU A 1 10  ? -6.422  14.275  3.569   1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3965  H HG2  . GLU A 1 10  ? -5.858  15.239  1.601   1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3966  H HG3  . GLU A 1 10  ? -7.096  16.392  2.214   1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3967  N N    . ASN A 1 11  ? -6.289  13.935  6.160   1.00 0.00 ? 11  ASN A N    3  
ATOM 3968  C CA   . ASN A 1 11  ? -6.222  13.059  7.322   1.00 0.00 ? 11  ASN A CA   3  
ATOM 3969  C C    . ASN A 1 11  ? -4.909  12.271  7.377   1.00 0.00 ? 11  ASN A C    3  
ATOM 3970  O O    . ASN A 1 11  ? -4.896  11.108  6.971   1.00 0.00 ? 11  ASN A O    3  
ATOM 3971  C CB   . ASN A 1 11  ? -7.440  12.073  7.298   1.00 0.00 ? 11  ASN A CB   3  
ATOM 3972  C CG   . ASN A 1 11  ? -8.343  12.195  8.525   1.00 0.00 ? 11  ASN A CG   3  
ATOM 3973  O OD1  . ASN A 1 11  ? -8.689  11.170  9.120   1.00 0.00 ? 11  ASN A OD1  3  
ATOM 3974  N ND2  . ASN A 1 11  ? -8.726  13.433  8.906   1.00 0.00 ? 11  ASN A ND2  3  
ATOM 3975  H H    . ASN A 1 11  ? -5.916  13.562  5.314   1.00 0.00 ? 11  ASN A H    3  
ATOM 3976  H HA   . ASN A 1 11  ? -6.242  13.650  8.234   1.00 0.00 ? 11  ASN A HA   3  
ATOM 3977  H HB2  . ASN A 1 11  ? -8.055  12.309  6.406   1.00 0.00 ? 11  ASN A HB2  3  
ATOM 3978  H HB3  . ASN A 1 11  ? -7.164  10.995  7.248   1.00 0.00 ? 11  ASN A HB3  3  
ATOM 3979  H HD21 . ASN A 1 11  ? -8.427  14.242  8.388   1.00 0.00 ? 11  ASN A HD21 3  
ATOM 3980  H HD22 . ASN A 1 11  ? -9.318  13.524  9.706   1.00 0.00 ? 11  ASN A HD22 3  
ATOM 3981  N N    . PRO A 1 12  ? -3.756  12.779  7.854   1.00 0.00 ? 12  PRO A N    3  
ATOM 3982  C CA   . PRO A 1 12  ? -2.509  12.006  7.990   1.00 0.00 ? 12  PRO A CA   3  
ATOM 3983  C C    . PRO A 1 12  ? -2.512  11.003  9.170   1.00 0.00 ? 12  PRO A C    3  
ATOM 3984  O O    . PRO A 1 12  ? -1.576  11.004  9.965   1.00 0.00 ? 12  PRO A O    3  
ATOM 3985  C CB   . PRO A 1 12  ? -1.431  13.111  8.168   1.00 0.00 ? 12  PRO A CB   3  
ATOM 3986  C CG   . PRO A 1 12  ? -2.111  14.419  7.738   1.00 0.00 ? 12  PRO A CG   3  
ATOM 3987  C CD   . PRO A 1 12  ? -3.556  14.185  8.176   1.00 0.00 ? 12  PRO A CD   3  
ATOM 3988  H HA   . PRO A 1 12  ? -2.315  11.418  7.091   1.00 0.00 ? 12  PRO A HA   3  
ATOM 3989  H HB2  . PRO A 1 12  ? -1.142  13.257  9.244   1.00 0.00 ? 12  PRO A HB2  3  
ATOM 3990  H HB3  . PRO A 1 12  ? -0.534  12.892  7.541   1.00 0.00 ? 12  PRO A HB3  3  
ATOM 3991  H HG2  . PRO A 1 12  ? -1.655  15.311  8.217   1.00 0.00 ? 12  PRO A HG2  3  
ATOM 3992  H HG3  . PRO A 1 12  ? -2.053  14.519  6.633   1.00 0.00 ? 12  PRO A HG3  3  
ATOM 3993  H HD2  . PRO A 1 12  ? -3.654  14.312  9.276   1.00 0.00 ? 12  PRO A HD2  3  
ATOM 3994  H HD3  . PRO A 1 12  ? -4.254  14.876  7.652   1.00 0.00 ? 12  PRO A HD3  3  
ATOM 3995  N N    . GLN A 1 13  ? -3.512  10.071  9.265   1.00 0.00 ? 13  GLN A N    3  
ATOM 3996  C CA   . GLN A 1 13  ? -3.671  8.998   10.264  1.00 0.00 ? 13  GLN A CA   3  
ATOM 3997  C C    . GLN A 1 13  ? -2.710  7.844   9.985   1.00 0.00 ? 13  GLN A C    3  
ATOM 3998  O O    . GLN A 1 13  ? -3.118  6.716   9.742   1.00 0.00 ? 13  GLN A O    3  
ATOM 3999  C CB   . GLN A 1 13  ? -5.123  8.429   10.258  1.00 0.00 ? 13  GLN A CB   3  
ATOM 4000  C CG   . GLN A 1 13  ? -6.256  9.475   10.303  1.00 0.00 ? 13  GLN A CG   3  
ATOM 4001  C CD   . GLN A 1 13  ? -6.316  10.329  11.575  1.00 0.00 ? 13  GLN A CD   3  
ATOM 4002  O OE1  . GLN A 1 13  ? -5.497  10.340  12.494  1.00 0.00 ? 13  GLN A OE1  3  
ATOM 4003  N NE2  . GLN A 1 13  ? -7.412  11.132  11.614  1.00 0.00 ? 13  GLN A NE2  3  
ATOM 4004  H H    . GLN A 1 13  ? -4.234  10.125  8.572   1.00 0.00 ? 13  GLN A H    3  
ATOM 4005  H HA   . GLN A 1 13  ? -3.476  9.382   11.243  1.00 0.00 ? 13  GLN A HA   3  
ATOM 4006  H HB2  . GLN A 1 13  ? -5.303  7.840   9.327   1.00 0.00 ? 13  GLN A HB2  3  
ATOM 4007  H HB3  . GLN A 1 13  ? -5.250  7.734   11.123  1.00 0.00 ? 13  GLN A HB3  3  
ATOM 4008  H HG2  . GLN A 1 13  ? -6.186  10.151  9.427   1.00 0.00 ? 13  GLN A HG2  3  
ATOM 4009  H HG3  . GLN A 1 13  ? -7.228  8.936   10.227  1.00 0.00 ? 13  GLN A HG3  3  
ATOM 4010  H HE21 . GLN A 1 13  ? -8.036  11.138  10.820  1.00 0.00 ? 13  GLN A HE21 3  
ATOM 4011  H HE22 . GLN A 1 13  ? -7.558  11.681  12.430  1.00 0.00 ? 13  GLN A HE22 3  
ATOM 4012  N N    . GLN A 1 14  ? -1.388  8.163   9.819   1.00 0.00 ? 14  GLN A N    3  
ATOM 4013  C CA   . GLN A 1 14  ? -0.289  7.350   9.277   1.00 0.00 ? 14  GLN A CA   3  
ATOM 4014  C C    . GLN A 1 14  ? -0.556  6.948   7.818   1.00 0.00 ? 14  GLN A C    3  
ATOM 4015  O O    . GLN A 1 14  ? -0.035  5.971   7.290   1.00 0.00 ? 14  GLN A O    3  
ATOM 4016  C CB   . GLN A 1 14  ? 0.179   6.190   10.194  1.00 0.00 ? 14  GLN A CB   3  
ATOM 4017  C CG   . GLN A 1 14  ? 1.720   6.045   10.286  1.00 0.00 ? 14  GLN A CG   3  
ATOM 4018  C CD   . GLN A 1 14  ? 2.404   5.324   9.113   1.00 0.00 ? 14  GLN A CD   3  
ATOM 4019  O OE1  . GLN A 1 14  ? 3.042   5.972   8.280   1.00 0.00 ? 14  GLN A OE1  3  
ATOM 4020  N NE2  . GLN A 1 14  ? 2.365   3.973   9.101   1.00 0.00 ? 14  GLN A NE2  3  
ATOM 4021  H H    . GLN A 1 14  ? -1.148  9.125   10.003  1.00 0.00 ? 14  GLN A H    3  
ATOM 4022  H HA   . GLN A 1 14  ? 0.542   8.037   9.225   1.00 0.00 ? 14  GLN A HA   3  
ATOM 4023  H HB2  . GLN A 1 14  ? -0.174  6.436   11.223  1.00 0.00 ? 14  GLN A HB2  3  
ATOM 4024  H HB3  . GLN A 1 14  ? -0.307  5.229   9.935   1.00 0.00 ? 14  GLN A HB3  3  
ATOM 4025  H HG2  . GLN A 1 14  ? 2.180   7.058   10.343  1.00 0.00 ? 14  GLN A HG2  3  
ATOM 4026  H HG3  . GLN A 1 14  ? 1.974   5.491   11.214  1.00 0.00 ? 14  GLN A HG3  3  
ATOM 4027  H HE21 . GLN A 1 14  ? 1.666   3.482   9.642   1.00 0.00 ? 14  GLN A HE21 3  
ATOM 4028  H HE22 . GLN A 1 14  ? 2.963   3.494   8.439   1.00 0.00 ? 14  GLN A HE22 3  
ATOM 4029  N N    . PHE A 1 15  ? -1.470  7.767   7.206   1.00 0.00 ? 15  PHE A N    3  
ATOM 4030  C CA   . PHE A 1 15  ? -2.068  7.765   5.886   1.00 0.00 ? 15  PHE A CA   3  
ATOM 4031  C C    . PHE A 1 15  ? -3.126  6.664   5.709   1.00 0.00 ? 15  PHE A C    3  
ATOM 4032  O O    . PHE A 1 15  ? -3.436  6.236   4.595   1.00 0.00 ? 15  PHE A O    3  
ATOM 4033  C CB   . PHE A 1 15  ? -1.009  7.899   4.762   1.00 0.00 ? 15  PHE A CB   3  
ATOM 4034  C CG   . PHE A 1 15  ? -0.139  9.110   5.017   1.00 0.00 ? 15  PHE A CG   3  
ATOM 4035  C CD1  . PHE A 1 15  ? 1.099   8.979   5.629   1.00 0.00 ? 15  PHE A CD1  3  
ATOM 4036  C CD2  . PHE A 1 15  ? -0.585  10.381  4.705   1.00 0.00 ? 15  PHE A CD2  3  
ATOM 4037  C CE1  . PHE A 1 15  ? 1.836   10.086  5.996   1.00 0.00 ? 15  PHE A CE1  3  
ATOM 4038  C CE2  . PHE A 1 15  ? 0.161   11.492  5.040   1.00 0.00 ? 15  PHE A CE2  3  
ATOM 4039  C CZ   . PHE A 1 15  ? 1.364   11.348  5.706   1.00 0.00 ? 15  PHE A CZ   3  
ATOM 4040  H H    . PHE A 1 15  ? -1.814  8.498   7.787   1.00 0.00 ? 15  PHE A H    3  
ATOM 4041  H HA   . PHE A 1 15  ? -2.645  8.679   5.839   1.00 0.00 ? 15  PHE A HA   3  
ATOM 4042  H HB2  . PHE A 1 15  ? -0.353  7.016   4.787   1.00 0.00 ? 15  PHE A HB2  3  
ATOM 4043  H HB3  . PHE A 1 15  ? -1.471  8.015   3.760   1.00 0.00 ? 15  PHE A HB3  3  
ATOM 4044  H HD1  . PHE A 1 15  ? 1.474   7.994   5.873   1.00 0.00 ? 15  PHE A HD1  3  
ATOM 4045  H HD2  . PHE A 1 15  ? -1.540  10.504  4.212   1.00 0.00 ? 15  PHE A HD2  3  
ATOM 4046  H HE1  . PHE A 1 15  ? 2.771   9.955   6.528   1.00 0.00 ? 15  PHE A HE1  3  
ATOM 4047  H HE2  . PHE A 1 15  ? -0.209  12.475  4.796   1.00 0.00 ? 15  PHE A HE2  3  
ATOM 4048  H HZ   . PHE A 1 15  ? 1.940   12.216  5.991   1.00 0.00 ? 15  PHE A HZ   3  
ATOM 4049  N N    . MET A 1 16  ? -3.759  6.223   6.854   1.00 0.00 ? 16  MET A N    3  
ATOM 4050  C CA   . MET A 1 16  ? -4.782  5.173   6.984   1.00 0.00 ? 16  MET A CA   3  
ATOM 4051  C C    . MET A 1 16  ? -6.065  5.413   6.212   1.00 0.00 ? 16  MET A C    3  
ATOM 4052  O O    . MET A 1 16  ? -6.591  4.490   5.612   1.00 0.00 ? 16  MET A O    3  
ATOM 4053  C CB   . MET A 1 16  ? -5.111  4.840   8.472   1.00 0.00 ? 16  MET A CB   3  
ATOM 4054  C CG   . MET A 1 16  ? -5.781  3.468   8.753   1.00 0.00 ? 16  MET A CG   3  
ATOM 4055  S SD   . MET A 1 16  ? -7.562  3.484   9.165   1.00 0.00 ? 16  MET A SD   3  
ATOM 4056  C CE   . MET A 1 16  ? -7.804  1.679   9.345   1.00 0.00 ? 16  MET A CE   3  
ATOM 4057  H H    . MET A 1 16  ? -3.485  6.623   7.734   1.00 0.00 ? 16  MET A H    3  
ATOM 4058  H HA   . MET A 1 16  ? -4.342  4.277   6.560   1.00 0.00 ? 16  MET A HA   3  
ATOM 4059  H HB2  . MET A 1 16  ? -4.141  4.843   9.018   1.00 0.00 ? 16  MET A HB2  3  
ATOM 4060  H HB3  . MET A 1 16  ? -5.699  5.649   8.951   1.00 0.00 ? 16  MET A HB3  3  
ATOM 4061  H HG2  . MET A 1 16  ? -5.575  2.789   7.901   1.00 0.00 ? 16  MET A HG2  3  
ATOM 4062  H HG3  . MET A 1 16  ? -5.262  3.018   9.621   1.00 0.00 ? 16  MET A HG3  3  
ATOM 4063  H HE1  . MET A 1 16  ? -6.844  1.170   9.555   1.00 0.00 ? 16  MET A HE1  3  
ATOM 4064  H HE2  . MET A 1 16  ? -8.486  1.424   10.182  1.00 0.00 ? 16  MET A HE2  3  
ATOM 4065  H HE3  . MET A 1 16  ? -8.246  1.186   8.444   1.00 0.00 ? 16  MET A HE3  3  
ATOM 4066  N N    . ASP A 1 17  ? -6.576  6.674   6.127   1.00 0.00 ? 17  ASP A N    3  
ATOM 4067  C CA   . ASP A 1 17  ? -7.771  7.080   5.361   1.00 0.00 ? 17  ASP A CA   3  
ATOM 4068  C C    . ASP A 1 17  ? -7.700  6.739   3.858   1.00 0.00 ? 17  ASP A C    3  
ATOM 4069  O O    . ASP A 1 17  ? -8.538  6.021   3.326   1.00 0.00 ? 17  ASP A O    3  
ATOM 4070  C CB   . ASP A 1 17  ? -8.048  8.597   5.606   1.00 0.00 ? 17  ASP A CB   3  
ATOM 4071  C CG   . ASP A 1 17  ? -9.439  9.060   5.150   1.00 0.00 ? 17  ASP A CG   3  
ATOM 4072  O OD1  . ASP A 1 17  ? -9.505  9.972   4.284   1.00 0.00 ? 17  ASP A OD1  3  
ATOM 4073  O OD2  . ASP A 1 17  ? -10.446 8.508   5.668   1.00 0.00 ? 17  ASP A OD2  3  
ATOM 4074  H H    . ASP A 1 17  ? -6.105  7.407   6.614   1.00 0.00 ? 17  ASP A H    3  
ATOM 4075  H HA   . ASP A 1 17  ? -8.603  6.510   5.755   1.00 0.00 ? 17  ASP A HA   3  
ATOM 4076  H HB2  . ASP A 1 17  ? -7.985  8.779   6.703   1.00 0.00 ? 17  ASP A HB2  3  
ATOM 4077  H HB3  . ASP A 1 17  ? -7.260  9.218   5.133   1.00 0.00 ? 17  ASP A HB3  3  
ATOM 4078  N N    . TYR A 1 18  ? -6.625  7.199   3.164   1.00 0.00 ? 18  TYR A N    3  
ATOM 4079  C CA   . TYR A 1 18  ? -6.308  6.842   1.780   1.00 0.00 ? 18  TYR A CA   3  
ATOM 4080  C C    . TYR A 1 18  ? -5.839  5.387   1.591   1.00 0.00 ? 18  TYR A C    3  
ATOM 4081  O O    . TYR A 1 18  ? -6.367  4.651   0.755   1.00 0.00 ? 18  TYR A O    3  
ATOM 4082  C CB   . TYR A 1 18  ? -5.258  7.849   1.215   1.00 0.00 ? 18  TYR A CB   3  
ATOM 4083  C CG   . TYR A 1 18  ? -4.946  7.690   -0.262  1.00 0.00 ? 18  TYR A CG   3  
ATOM 4084  C CD1  . TYR A 1 18  ? -5.939  7.788   -1.220  1.00 0.00 ? 18  TYR A CD1  3  
ATOM 4085  C CD2  . TYR A 1 18  ? -3.654  7.406   -0.668  1.00 0.00 ? 18  TYR A CD2  3  
ATOM 4086  C CE1  . TYR A 1 18  ? -5.645  7.597   -2.557  1.00 0.00 ? 18  TYR A CE1  3  
ATOM 4087  C CE2  . TYR A 1 18  ? -3.354  7.229   -2.007  1.00 0.00 ? 18  TYR A CE2  3  
ATOM 4088  C CZ   . TYR A 1 18  ? -4.354  7.318   -2.954  1.00 0.00 ? 18  TYR A CZ   3  
ATOM 4089  O OH   . TYR A 1 18  ? -4.074  7.138   -4.327  1.00 0.00 ? 18  TYR A OH   3  
ATOM 4090  H H    . TYR A 1 18  ? -5.944  7.756   3.633   1.00 0.00 ? 18  TYR A H    3  
ATOM 4091  H HA   . TYR A 1 18  ? -7.217  6.939   1.200   1.00 0.00 ? 18  TYR A HA   3  
ATOM 4092  H HB2  . TYR A 1 18  ? -5.674  8.880   1.336   1.00 0.00 ? 18  TYR A HB2  3  
ATOM 4093  H HB3  . TYR A 1 18  ? -4.302  7.755   1.788   1.00 0.00 ? 18  TYR A HB3  3  
ATOM 4094  H HD1  . TYR A 1 18  ? -6.956  8.004   -0.919  1.00 0.00 ? 18  TYR A HD1  3  
ATOM 4095  H HD2  . TYR A 1 18  ? -2.875  7.309   0.081   1.00 0.00 ? 18  TYR A HD2  3  
ATOM 4096  H HE1  . TYR A 1 18  ? -6.427  7.673   -3.303  1.00 0.00 ? 18  TYR A HE1  3  
ATOM 4097  H HE2  . TYR A 1 18  ? -2.334  7.021   -2.297  1.00 0.00 ? 18  TYR A HE2  3  
ATOM 4098  H HH   . TYR A 1 18  ? -3.138  6.954   -4.428  1.00 0.00 ? 18  TYR A HH   3  
ATOM 4099  N N    . PHE A 1 19  ? -4.819  4.936   2.382   1.00 0.00 ? 19  PHE A N    3  
ATOM 4100  C CA   . PHE A 1 19  ? -4.216  3.614   2.246   1.00 0.00 ? 19  PHE A CA   3  
ATOM 4101  C C    . PHE A 1 19  ? -5.070  2.452   2.736   1.00 0.00 ? 19  PHE A C    3  
ATOM 4102  O O    . PHE A 1 19  ? -5.107  1.418   2.077   1.00 0.00 ? 19  PHE A O    3  
ATOM 4103  C CB   . PHE A 1 19  ? -2.746  3.570   2.751   1.00 0.00 ? 19  PHE A CB   3  
ATOM 4104  C CG   . PHE A 1 19  ? -1.807  4.412   1.882   1.00 0.00 ? 19  PHE A CG   3  
ATOM 4105  C CD1  . PHE A 1 19  ? -0.812  5.174   2.474   1.00 0.00 ? 19  PHE A CD1  3  
ATOM 4106  C CD2  . PHE A 1 19  ? -1.840  4.388   0.489   1.00 0.00 ? 19  PHE A CD2  3  
ATOM 4107  C CE1  . PHE A 1 19  ? 0.124   5.863   1.722   1.00 0.00 ? 19  PHE A CE1  3  
ATOM 4108  C CE2  . PHE A 1 19  ? -0.895  5.053   -0.265  1.00 0.00 ? 19  PHE A CE2  3  
ATOM 4109  C CZ   . PHE A 1 19  ? 0.090   5.795   0.344   1.00 0.00 ? 19  PHE A CZ   3  
ATOM 4110  H H    . PHE A 1 19  ? -4.375  5.518   3.077   1.00 0.00 ? 19  PHE A H    3  
ATOM 4111  H HA   . PHE A 1 19  ? -4.159  3.395   1.187   1.00 0.00 ? 19  PHE A HA   3  
ATOM 4112  H HB2  . PHE A 1 19  ? -2.683  3.905   3.811   1.00 0.00 ? 19  PHE A HB2  3  
ATOM 4113  H HB3  . PHE A 1 19  ? -2.343  2.536   2.709   1.00 0.00 ? 19  PHE A HB3  3  
ATOM 4114  H HD1  . PHE A 1 19  ? -0.743  5.208   3.553   1.00 0.00 ? 19  PHE A HD1  3  
ATOM 4115  H HD2  . PHE A 1 19  ? -2.590  3.827   -0.047  1.00 0.00 ? 19  PHE A HD2  3  
ATOM 4116  H HE1  . PHE A 1 19  ? 0.900   6.443   2.203   1.00 0.00 ? 19  PHE A HE1  3  
ATOM 4117  H HE2  . PHE A 1 19  ? -0.928  4.990   -1.346  1.00 0.00 ? 19  PHE A HE2  3  
ATOM 4118  H HZ   . PHE A 1 19  ? 0.830   6.318   -0.252  1.00 0.00 ? 19  PHE A HZ   3  
ATOM 4119  N N    . SER A 1 20  ? -5.874  2.584   3.837   1.00 0.00 ? 20  SER A N    3  
ATOM 4120  C CA   . SER A 1 20  ? -6.812  1.522   4.258   1.00 0.00 ? 20  SER A CA   3  
ATOM 4121  C C    . SER A 1 20  ? -8.017  1.379   3.341   1.00 0.00 ? 20  SER A C    3  
ATOM 4122  O O    . SER A 1 20  ? -8.474  0.266   3.128   1.00 0.00 ? 20  SER A O    3  
ATOM 4123  C CB   . SER A 1 20  ? -7.257  1.517   5.752   1.00 0.00 ? 20  SER A CB   3  
ATOM 4124  O OG   . SER A 1 20  ? -8.142  2.578   6.103   1.00 0.00 ? 20  SER A OG   3  
ATOM 4125  H H    . SER A 1 20  ? -5.891  3.438   4.381   1.00 0.00 ? 20  SER A H    3  
ATOM 4126  H HA   . SER A 1 20  ? -6.285  0.581   4.157   1.00 0.00 ? 20  SER A HA   3  
ATOM 4127  H HB2  . SER A 1 20  ? -7.756  0.547   5.997   1.00 0.00 ? 20  SER A HB2  3  
ATOM 4128  H HB3  . SER A 1 20  ? -6.331  1.613   6.370   1.00 0.00 ? 20  SER A HB3  3  
ATOM 4129  H HG   . SER A 1 20  ? -7.603  3.384   5.940   1.00 0.00 ? 20  SER A HG   3  
ATOM 4130  N N    . GLU A 1 21  ? -8.507  2.489   2.708   1.00 0.00 ? 21  GLU A N    3  
ATOM 4131  C CA   . GLU A 1 21  ? -9.526  2.473   1.658   1.00 0.00 ? 21  GLU A CA   3  
ATOM 4132  C C    . GLU A 1 21  ? -9.013  1.894   0.341   1.00 0.00 ? 21  GLU A C    3  
ATOM 4133  O O    . GLU A 1 21  ? -9.644  0.981   -0.184  1.00 0.00 ? 21  GLU A O    3  
ATOM 4134  C CB   . GLU A 1 21  ? -10.233 3.835   1.467   1.00 0.00 ? 21  GLU A CB   3  
ATOM 4135  C CG   . GLU A 1 21  ? -11.087 4.242   2.688   1.00 0.00 ? 21  GLU A CG   3  
ATOM 4136  C CD   . GLU A 1 21  ? -12.227 3.247   2.910   1.00 0.00 ? 21  GLU A CD   3  
ATOM 4137  O OE1  . GLU A 1 21  ? -13.093 3.123   2.003   1.00 0.00 ? 21  GLU A OE1  3  
ATOM 4138  O OE2  . GLU A 1 21  ? -12.244 2.594   3.989   1.00 0.00 ? 21  GLU A OE2  3  
ATOM 4139  H H    . GLU A 1 21  ? -8.112  3.385   2.910   1.00 0.00 ? 21  GLU A H    3  
ATOM 4140  H HA   . GLU A 1 21  ? -10.297 1.778   1.966   1.00 0.00 ? 21  GLU A HA   3  
ATOM 4141  H HB2  . GLU A 1 21  ? -9.466  4.623   1.293   1.00 0.00 ? 21  GLU A HB2  3  
ATOM 4142  H HB3  . GLU A 1 21  ? -10.910 3.827   0.581   1.00 0.00 ? 21  GLU A HB3  3  
ATOM 4143  H HG2  . GLU A 1 21  ? -10.446 4.281   3.595   1.00 0.00 ? 21  GLU A HG2  3  
ATOM 4144  H HG3  . GLU A 1 21  ? -11.515 5.253   2.521   1.00 0.00 ? 21  GLU A HG3  3  
ATOM 4145  N N    . GLU A 1 22  ? -7.824  2.333   -0.188  1.00 0.00 ? 22  GLU A N    3  
ATOM 4146  C CA   . GLU A 1 22  ? -7.183  1.802   -1.409  1.00 0.00 ? 22  GLU A CA   3  
ATOM 4147  C C    . GLU A 1 22  ? -6.760  0.334   -1.304  1.00 0.00 ? 22  GLU A C    3  
ATOM 4148  O O    . GLU A 1 22  ? -7.049  -0.483  -2.184  1.00 0.00 ? 22  GLU A O    3  
ATOM 4149  C CB   . GLU A 1 22  ? -5.948  2.666   -1.802  1.00 0.00 ? 22  GLU A CB   3  
ATOM 4150  C CG   . GLU A 1 22  ? -5.633  2.739   -3.312  1.00 0.00 ? 22  GLU A CG   3  
ATOM 4151  C CD   . GLU A 1 22  ? -4.856  1.514   -3.785  1.00 0.00 ? 22  GLU A CD   3  
ATOM 4152  O OE1  . GLU A 1 22  ? -5.393  0.757   -4.635  1.00 0.00 ? 22  GLU A OE1  3  
ATOM 4153  O OE2  . GLU A 1 22  ? -3.709  1.323   -3.301  1.00 0.00 ? 22  GLU A OE2  3  
ATOM 4154  H H    . GLU A 1 22  ? -7.316  3.083   0.260   1.00 0.00 ? 22  GLU A H    3  
ATOM 4155  H HA   . GLU A 1 22  ? -7.926  1.842   -2.205  1.00 0.00 ? 22  GLU A HA   3  
ATOM 4156  H HB2  . GLU A 1 22  ? -6.177  3.712   -1.501  1.00 0.00 ? 22  GLU A HB2  3  
ATOM 4157  H HB3  . GLU A 1 22  ? -5.039  2.386   -1.222  1.00 0.00 ? 22  GLU A HB3  3  
ATOM 4158  H HG2  . GLU A 1 22  ? -6.577  2.846   -3.886  1.00 0.00 ? 22  GLU A HG2  3  
ATOM 4159  H HG3  . GLU A 1 22  ? -5.008  3.640   -3.504  1.00 0.00 ? 22  GLU A HG3  3  
ATOM 4160  N N    . PHE A 1 23  ? -6.122  -0.034  -0.141  1.00 0.00 ? 23  PHE A N    3  
ATOM 4161  C CA   . PHE A 1 23  ? -5.749  -1.395  0.250   1.00 0.00 ? 23  PHE A CA   3  
ATOM 4162  C C    . PHE A 1 23  ? -6.966  -2.258  0.472   1.00 0.00 ? 23  PHE A C    3  
ATOM 4163  O O    . PHE A 1 23  ? -7.067  -3.287  -0.164  1.00 0.00 ? 23  PHE A O    3  
ATOM 4164  C CB   . PHE A 1 23  ? -4.884  -1.437  1.556   1.00 0.00 ? 23  PHE A CB   3  
ATOM 4165  C CG   . PHE A 1 23  ? -4.447  -2.797  2.078   1.00 0.00 ? 23  PHE A CG   3  
ATOM 4166  C CD1  . PHE A 1 23  ? -4.117  -3.849  1.243   1.00 0.00 ? 23  PHE A CD1  3  
ATOM 4167  C CD2  . PHE A 1 23  ? -4.418  -3.018  3.439   1.00 0.00 ? 23  PHE A CD2  3  
ATOM 4168  C CE1  . PHE A 1 23  ? -3.783  -5.085  1.746   1.00 0.00 ? 23  PHE A CE1  3  
ATOM 4169  C CE2  . PHE A 1 23  ? -4.005  -4.225  3.948   1.00 0.00 ? 23  PHE A CE2  3  
ATOM 4170  C CZ   . PHE A 1 23  ? -3.706  -5.274  3.106   1.00 0.00 ? 23  PHE A CZ   3  
ATOM 4171  H H    . PHE A 1 23  ? -5.902  0.650   0.571   1.00 0.00 ? 23  PHE A H    3  
ATOM 4172  H HA   . PHE A 1 23  ? -5.189  -1.833  -0.567  1.00 0.00 ? 23  PHE A HA   3  
ATOM 4173  H HB2  . PHE A 1 23  ? -3.939  -0.869  1.356   1.00 0.00 ? 23  PHE A HB2  3  
ATOM 4174  H HB3  . PHE A 1 23  ? -5.472  -0.947  2.381   1.00 0.00 ? 23  PHE A HB3  3  
ATOM 4175  H HD1  . PHE A 1 23  ? -4.170  -3.725  0.176   1.00 0.00 ? 23  PHE A HD1  3  
ATOM 4176  H HD2  . PHE A 1 23  ? -4.751  -2.249  4.121   1.00 0.00 ? 23  PHE A HD2  3  
ATOM 4177  H HE1  . PHE A 1 23  ? -3.506  -5.879  1.067   1.00 0.00 ? 23  PHE A HE1  3  
ATOM 4178  H HE2  . PHE A 1 23  ? -3.919  -4.332  5.021   1.00 0.00 ? 23  PHE A HE2  3  
ATOM 4179  H HZ   . PHE A 1 23  ? -3.375  -6.223  3.499   1.00 0.00 ? 23  PHE A HZ   3  
ATOM 4180  N N    . ARG A 1 24  ? -7.978  -1.871  1.302   1.00 0.00 ? 24  ARG A N    3  
ATOM 4181  C CA   . ARG A 1 24  ? -9.180  -2.678  1.515   1.00 0.00 ? 24  ARG A CA   3  
ATOM 4182  C C    . ARG A 1 24  ? -10.113 -2.800  0.308   1.00 0.00 ? 24  ARG A C    3  
ATOM 4183  O O    . ARG A 1 24  ? -10.758 -3.825  0.123   1.00 0.00 ? 24  ARG A O    3  
ATOM 4184  C CB   . ARG A 1 24  ? -9.917  -2.258  2.799   1.00 0.00 ? 24  ARG A CB   3  
ATOM 4185  C CG   . ARG A 1 24  ? -10.932 -3.284  3.326   1.00 0.00 ? 24  ARG A CG   3  
ATOM 4186  C CD   . ARG A 1 24  ? -11.474 -2.863  4.692   1.00 0.00 ? 24  ARG A CD   3  
ATOM 4187  N NE   . ARG A 1 24  ? -12.327 -1.623  4.577   1.00 0.00 ? 24  ARG A NE   3  
ATOM 4188  C CZ   . ARG A 1 24  ? -13.582 -1.567  4.030   1.00 0.00 ? 24  ARG A CZ   3  
ATOM 4189  N NH1  . ARG A 1 24  ? -14.186 -2.670  3.502   1.00 0.00 ? 24  ARG A NH1  3  
ATOM 4190  N NH2  . ARG A 1 24  ? -14.241 -0.370  4.008   1.00 0.00 ? 24  ARG A NH2  3  
ATOM 4191  H H    . ARG A 1 24  ? -7.972  -1.018  1.850   1.00 0.00 ? 24  ARG A H    3  
ATOM 4192  H HA   . ARG A 1 24  ? -8.853  -3.693  1.713   1.00 0.00 ? 24  ARG A HA   3  
ATOM 4193  H HB2  . ARG A 1 24  ? -9.130  -2.171  3.600   1.00 0.00 ? 24  ARG A HB2  3  
ATOM 4194  H HB3  . ARG A 1 24  ? -10.400 -1.259  2.657   1.00 0.00 ? 24  ARG A HB3  3  
ATOM 4195  H HG2  . ARG A 1 24  ? -11.755 -3.445  2.597   1.00 0.00 ? 24  ARG A HG2  3  
ATOM 4196  H HG3  . ARG A 1 24  ? -10.386 -4.246  3.460   1.00 0.00 ? 24  ARG A HG3  3  
ATOM 4197  H HD2  . ARG A 1 24  ? -11.986 -3.648  5.283   1.00 0.00 ? 24  ARG A HD2  3  
ATOM 4198  H HD3  . ARG A 1 24  ? -10.573 -2.600  5.278   1.00 0.00 ? 24  ARG A HD3  3  
ATOM 4199  H HE   . ARG A 1 24  ? -11.945 -0.775  4.943   1.00 0.00 ? 24  ARG A HE   3  
ATOM 4200  H HH11 . ARG A 1 24  ? -13.712 -3.550  3.509   1.00 0.00 ? 24  ARG A HH11 3  
ATOM 4201  H HH12 . ARG A 1 24  ? -15.102 -2.597  3.108   1.00 0.00 ? 24  ARG A HH12 3  
ATOM 4202  H HH21 . ARG A 1 24  ? -13.806 0.446   4.389   1.00 0.00 ? 24  ARG A HH21 3  
ATOM 4203  H HH22 . ARG A 1 24  ? -15.157 -0.310  3.611   1.00 0.00 ? 24  ARG A HH22 3  
ATOM 4204  N N    . ASN A 1 25  ? -10.153 -1.789  -0.611  1.00 0.00 ? 25  ASN A N    3  
ATOM 4205  C CA   . ASN A 1 25  ? -10.900 -1.859  -1.872  1.00 0.00 ? 25  ASN A CA   3  
ATOM 4206  C C    . ASN A 1 25  ? -10.292 -2.817  -2.884  1.00 0.00 ? 25  ASN A C    3  
ATOM 4207  O O    . ASN A 1 25  ? -10.996 -3.706  -3.347  1.00 0.00 ? 25  ASN A O    3  
ATOM 4208  C CB   . ASN A 1 25  ? -11.022 -0.469  -2.554  1.00 0.00 ? 25  ASN A CB   3  
ATOM 4209  C CG   . ASN A 1 25  ? -12.315 0.180   -2.084  1.00 0.00 ? 25  ASN A CG   3  
ATOM 4210  O OD1  . ASN A 1 25  ? -13.308 0.222   -2.808  1.00 0.00 ? 25  ASN A OD1  3  
ATOM 4211  N ND2  . ASN A 1 25  ? -12.302 0.724   -0.846  1.00 0.00 ? 25  ASN A ND2  3  
ATOM 4212  H H    . ASN A 1 25  ? -9.622  -0.947  -0.468  1.00 0.00 ? 25  ASN A H    3  
ATOM 4213  H HA   . ASN A 1 25  ? -11.887 -2.271  -1.667  1.00 0.00 ? 25  ASN A HA   3  
ATOM 4214  H HB2  . ASN A 1 25  ? -10.148 0.161   -2.305  1.00 0.00 ? 25  ASN A HB2  3  
ATOM 4215  H HB3  . ASN A 1 25  ? -11.076 -0.483  -3.661  1.00 0.00 ? 25  ASN A HB3  3  
ATOM 4216  H HD21 . ASN A 1 25  ? -11.412 0.797   -0.373  1.00 0.00 ? 25  ASN A HD21 3  
ATOM 4217  H HD22 . ASN A 1 25  ? -13.130 1.183   -0.535  1.00 0.00 ? 25  ASN A HD22 3  
ATOM 4218  N N    . ASP A 1 26  ? -8.966  -2.719  -3.206  1.00 0.00 ? 26  ASP A N    3  
ATOM 4219  C CA   . ASP A 1 26  ? -8.291  -3.626  -4.153  1.00 0.00 ? 26  ASP A CA   3  
ATOM 4220  C C    . ASP A 1 26  ? -7.993  -4.996  -3.560  1.00 0.00 ? 26  ASP A C    3  
ATOM 4221  O O    . ASP A 1 26  ? -8.088  -6.009  -4.253  1.00 0.00 ? 26  ASP A O    3  
ATOM 4222  C CB   . ASP A 1 26  ? -7.016  -2.998  -4.783  1.00 0.00 ? 26  ASP A CB   3  
ATOM 4223  C CG   . ASP A 1 26  ? -7.388  -1.834  -5.712  1.00 0.00 ? 26  ASP A CG   3  
ATOM 4224  O OD1  . ASP A 1 26  ? -7.902  -0.800  -5.210  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 4225  O OD2  . ASP A 1 26  ? -7.149  -1.966  -6.942  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 4226  H H    . ASP A 1 26  ? -8.394  -1.994  -2.802  1.00 0.00 ? 26  ASP A H    3  
ATOM 4227  H HA   . ASP A 1 26  ? -8.957  -3.875  -4.973  1.00 0.00 ? 26  ASP A HA   3  
ATOM 4228  H HB2  . ASP A 1 26  ? -6.348  -2.615  -3.987  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 4229  H HB3  . ASP A 1 26  ? -6.458  -3.751  -5.385  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 4230  N N    . PHE A 1 27  ? -7.726  -5.066  -2.227  1.00 0.00 ? 27  PHE A N    3  
ATOM 4231  C CA   . PHE A 1 27  ? -7.514  -6.301  -1.458  1.00 0.00 ? 27  PHE A CA   3  
ATOM 4232  C C    . PHE A 1 27  ? -8.792  -7.089  -1.266  1.00 0.00 ? 27  PHE A C    3  
ATOM 4233  O O    . PHE A 1 27  ? -8.728  -8.300  -1.399  1.00 0.00 ? 27  PHE A O    3  
ATOM 4234  C CB   . PHE A 1 27  ? -6.819  -6.076  -0.070  1.00 0.00 ? 27  PHE A CB   3  
ATOM 4235  C CG   . PHE A 1 27  ? -6.431  -7.277  0.776   1.00 0.00 ? 27  PHE A CG   3  
ATOM 4236  C CD1  . PHE A 1 27  ? -7.257  -7.704  1.808   1.00 0.00 ? 27  PHE A CD1  3  
ATOM 4237  C CD2  . PHE A 1 27  ? -5.194  -7.877  0.627   1.00 0.00 ? 27  PHE A CD2  3  
ATOM 4238  C CE1  . PHE A 1 27  ? -6.867  -8.719  2.655   1.00 0.00 ? 27  PHE A CE1  3  
ATOM 4239  C CE2  . PHE A 1 27  ? -4.773  -8.845  1.516   1.00 0.00 ? 27  PHE A CE2  3  
ATOM 4240  C CZ   . PHE A 1 27  ? -5.636  -9.301  2.488   1.00 0.00 ? 27  PHE A CZ   3  
ATOM 4241  H H    . PHE A 1 27  ? -7.690  -4.217  -1.676  1.00 0.00 ? 27  PHE A H    3  
ATOM 4242  H HA   . PHE A 1 27  ? -6.850  -6.937  -2.031  1.00 0.00 ? 27  PHE A HA   3  
ATOM 4243  H HB2  . PHE A 1 27  ? -5.879  -5.504  -0.265  1.00 0.00 ? 27  PHE A HB2  3  
ATOM 4244  H HB3  . PHE A 1 27  ? -7.487  -5.449  0.571   1.00 0.00 ? 27  PHE A HB3  3  
ATOM 4245  H HD1  . PHE A 1 27  ? -8.212  -7.222  1.965   1.00 0.00 ? 27  PHE A HD1  3  
ATOM 4246  H HD2  . PHE A 1 27  ? -4.526  -7.543  -0.155  1.00 0.00 ? 27  PHE A HD2  3  
ATOM 4247  H HE1  . PHE A 1 27  ? -7.488  -9.056  3.476   1.00 0.00 ? 27  PHE A HE1  3  
ATOM 4248  H HE2  . PHE A 1 27  ? -3.785  -9.294  1.413   1.00 0.00 ? 27  PHE A HE2  3  
ATOM 4249  H HZ   . PHE A 1 27  ? -5.345  -10.095 3.157   1.00 0.00 ? 27  PHE A HZ   3  
ATOM 4250  N N    . LEU A 1 28  ? -10.001 -6.464  -1.001  1.00 0.00 ? 28  LEU A N    3  
ATOM 4251  C CA   . LEU A 1 28  ? -11.297 -7.181  -0.845  1.00 0.00 ? 28  LEU A CA   3  
ATOM 4252  C C    . LEU A 1 28  ? -11.703 -7.773  -2.164  1.00 0.00 ? 28  LEU A C    3  
ATOM 4253  O O    . LEU A 1 28  ? -12.005 -8.951  -2.279  1.00 0.00 ? 28  LEU A O    3  
ATOM 4254  C CB   . LEU A 1 28  ? -12.501 -6.369  -0.285  1.00 0.00 ? 28  LEU A CB   3  
ATOM 4255  C CG   . LEU A 1 28  ? -12.547 -6.120  1.243   1.00 0.00 ? 28  LEU A CG   3  
ATOM 4256  C CD1  . LEU A 1 28  ? -13.738 -6.861  1.862   1.00 0.00 ? 28  LEU A CD1  3  
ATOM 4257  C CD2  . LEU A 1 28  ? -11.269 -6.462  2.025   1.00 0.00 ? 28  LEU A CD2  3  
ATOM 4258  H H    . LEU A 1 28  ? -10.062 -5.459  -1.012  1.00 0.00 ? 28  LEU A H    3  
ATOM 4259  H HA   . LEU A 1 28  ? -11.145 -8.030  -0.190  1.00 0.00 ? 28  LEU A HA   3  
ATOM 4260  H HB2  . LEU A 1 28  ? -12.538 -5.383  -0.791  1.00 0.00 ? 28  LEU A HB2  3  
ATOM 4261  H HB3  . LEU A 1 28  ? -13.469 -6.886  -0.510  1.00 0.00 ? 28  LEU A HB3  3  
ATOM 4262  H HG   . LEU A 1 28  ? -12.746 -5.027  1.373   1.00 0.00 ? 28  LEU A HG   3  
ATOM 4263  H HD11 . LEU A 1 28  ? -14.664 -6.700  1.275   1.00 0.00 ? 28  LEU A HD11 3  
ATOM 4264  H HD12 . LEU A 1 28  ? -13.533 -7.949  1.928   1.00 0.00 ? 28  LEU A HD12 3  
ATOM 4265  H HD13 . LEU A 1 28  ? -13.907 -6.476  2.887   1.00 0.00 ? 28  LEU A HD13 3  
ATOM 4266  H HD21 . LEU A 1 28  ? -10.395 -5.914  1.617   1.00 0.00 ? 28  LEU A HD21 3  
ATOM 4267  H HD22 . LEU A 1 28  ? -11.403 -6.177  3.089   1.00 0.00 ? 28  LEU A HD22 3  
ATOM 4268  H HD23 . LEU A 1 28  ? -11.073 -7.553  1.992   1.00 0.00 ? 28  LEU A HD23 3  
ATOM 4269  N N    . GLU A 1 29  ? -11.586 -6.929  -3.212  1.00 0.00 ? 29  GLU A N    3  
ATOM 4270  C CA   . GLU A 1 29  ? -11.782 -7.217  -4.618  1.00 0.00 ? 29  GLU A CA   3  
ATOM 4271  C C    . GLU A 1 29  ? -10.945 -8.384  -5.174  1.00 0.00 ? 29  GLU A C    3  
ATOM 4272  O O    . GLU A 1 29  ? -11.511 -9.311  -5.753  1.00 0.00 ? 29  GLU A O    3  
ATOM 4273  C CB   . GLU A 1 29  ? -11.410 -5.889  -5.298  1.00 0.00 ? 29  GLU A CB   3  
ATOM 4274  C CG   . GLU A 1 29  ? -11.350 -5.810  -6.815  1.00 0.00 ? 29  GLU A CG   3  
ATOM 4275  C CD   . GLU A 1 29  ? -12.706 -6.139  -7.426  1.00 0.00 ? 29  GLU A CD   3  
ATOM 4276  O OE1  . GLU A 1 29  ? -13.679 -5.386  -7.150  1.00 0.00 ? 29  GLU A OE1  3  
ATOM 4277  O OE2  . GLU A 1 29  ? -12.797 -7.150  -8.173  1.00 0.00 ? 29  GLU A OE2  3  
ATOM 4278  H H    . GLU A 1 29  ? -11.299 -5.982  -3.034  1.00 0.00 ? 29  GLU A H    3  
ATOM 4279  H HA   . GLU A 1 29  ? -12.830 -7.468  -4.758  1.00 0.00 ? 29  GLU A HA   3  
ATOM 4280  H HB2  . GLU A 1 29  ? -12.072 -5.079  -4.924  1.00 0.00 ? 29  GLU A HB2  3  
ATOM 4281  H HB3  . GLU A 1 29  ? -10.391 -5.607  -4.953  1.00 0.00 ? 29  GLU A HB3  3  
ATOM 4282  H HG2  . GLU A 1 29  ? -11.051 -4.762  -7.024  1.00 0.00 ? 29  GLU A HG2  3  
ATOM 4283  H HG3  . GLU A 1 29  ? -10.547 -6.488  -7.158  1.00 0.00 ? 29  GLU A HG3  3  
ATOM 4284  N N    . LEU A 1 30  ? -9.591  -8.393  -4.943  1.00 0.00 ? 30  LEU A N    3  
ATOM 4285  C CA   . LEU A 1 30  ? -8.653  -9.463  -5.314  1.00 0.00 ? 30  LEU A CA   3  
ATOM 4286  C C    . LEU A 1 30  ? -8.705  -10.713 -4.441  1.00 0.00 ? 30  LEU A C    3  
ATOM 4287  O O    . LEU A 1 30  ? -8.585  -11.821 -4.959  1.00 0.00 ? 30  LEU A O    3  
ATOM 4288  C CB   . LEU A 1 30  ? -7.269  -8.944  -5.759  1.00 0.00 ? 30  LEU A CB   3  
ATOM 4289  C CG   . LEU A 1 30  ? -5.958  -9.320  -5.055  1.00 0.00 ? 30  LEU A CG   3  
ATOM 4290  C CD1  . LEU A 1 30  ? -5.396  -10.721 -5.353  1.00 0.00 ? 30  LEU A CD1  3  
ATOM 4291  C CD2  . LEU A 1 30  ? -4.943  -8.305  -5.588  1.00 0.00 ? 30  LEU A CD2  3  
ATOM 4292  H H    . LEU A 1 30  ? -9.159  -7.613  -4.473  1.00 0.00 ? 30  LEU A H    3  
ATOM 4293  H HA   . LEU A 1 30  ? -9.021  -9.831  -6.258  1.00 0.00 ? 30  LEU A HA   3  
ATOM 4294  H HB2  . LEU A 1 30  ? -7.134  -9.166  -6.841  1.00 0.00 ? 30  LEU A HB2  3  
ATOM 4295  H HB3  . LEU A 1 30  ? -7.328  -7.838  -5.673  1.00 0.00 ? 30  LEU A HB3  3  
ATOM 4296  H HG   . LEU A 1 30  ? -6.064  -9.184  -3.954  1.00 0.00 ? 30  LEU A HG   3  
ATOM 4297  H HD11 . LEU A 1 30  ? -5.307  -10.875 -6.451  1.00 0.00 ? 30  LEU A HD11 3  
ATOM 4298  H HD12 . LEU A 1 30  ? -4.374  -10.809 -4.914  1.00 0.00 ? 30  LEU A HD12 3  
ATOM 4299  H HD13 . LEU A 1 30  ? -6.014  -11.525 -4.907  1.00 0.00 ? 30  LEU A HD13 3  
ATOM 4300  H HD21 . LEU A 1 30  ? -4.933  -8.310  -6.700  1.00 0.00 ? 30  LEU A HD21 3  
ATOM 4301  H HD22 . LEU A 1 30  ? -5.217  -7.274  -5.248  1.00 0.00 ? 30  LEU A HD22 3  
ATOM 4302  H HD23 . LEU A 1 30  ? -3.938  -8.603  -5.241  1.00 0.00 ? 30  LEU A HD23 3  
ATOM 4303  N N    . LEU A 1 31  ? -8.980  -10.572 -3.100  1.00 0.00 ? 31  LEU A N    3  
ATOM 4304  C CA   . LEU A 1 31  ? -9.276  -11.603 -2.087  1.00 0.00 ? 31  LEU A CA   3  
ATOM 4305  C C    . LEU A 1 31  ? -10.465 -12.443 -2.509  1.00 0.00 ? 31  LEU A C    3  
ATOM 4306  O O    . LEU A 1 31  ? -10.366 -13.655 -2.649  1.00 0.00 ? 31  LEU A O    3  
ATOM 4307  C CB   . LEU A 1 31  ? -9.577  -10.896 -0.732  1.00 0.00 ? 31  LEU A CB   3  
ATOM 4308  C CG   . LEU A 1 31  ? -10.042 -11.658 0.522   1.00 0.00 ? 31  LEU A CG   3  
ATOM 4309  C CD1  . LEU A 1 31  ? -8.981  -12.698 0.920   1.00 0.00 ? 31  LEU A CD1  3  
ATOM 4310  C CD2  . LEU A 1 31  ? -10.337 -10.616 1.643   1.00 0.00 ? 31  LEU A CD2  3  
ATOM 4311  H H    . LEU A 1 31  ? -9.063  -9.644  -2.710  1.00 0.00 ? 31  LEU A H    3  
ATOM 4312  H HA   . LEU A 1 31  ? -8.421  -12.253 -1.987  1.00 0.00 ? 31  LEU A HA   3  
ATOM 4313  H HB2  . LEU A 1 31  ? -8.605  -10.410 -0.435  1.00 0.00 ? 31  LEU A HB2  3  
ATOM 4314  H HB3  . LEU A 1 31  ? -10.349 -10.105 -0.921  1.00 0.00 ? 31  LEU A HB3  3  
ATOM 4315  H HG   . LEU A 1 31  ? -10.994 -12.197 0.305   1.00 0.00 ? 31  LEU A HG   3  
ATOM 4316  H HD11 . LEU A 1 31  ? -8.786  -13.401 0.081   1.00 0.00 ? 31  LEU A HD11 3  
ATOM 4317  H HD12 . LEU A 1 31  ? -8.023  -12.195 1.175   1.00 0.00 ? 31  LEU A HD12 3  
ATOM 4318  H HD13 . LEU A 1 31  ? -9.325  -13.282 1.801   1.00 0.00 ? 31  LEU A HD13 3  
ATOM 4319  H HD21 . LEU A 1 31  ? -9.454  -9.968  1.816   1.00 0.00 ? 31  LEU A HD21 3  
ATOM 4320  H HD22 . LEU A 1 31  ? -11.200 -9.955  1.398   1.00 0.00 ? 31  LEU A HD22 3  
ATOM 4321  H HD23 . LEU A 1 31  ? -10.597 -11.096 2.610   1.00 0.00 ? 31  LEU A HD23 3  
ATOM 4322  N N    . ARG A 1 32  ? -11.589 -11.752 -2.830  1.00 0.00 ? 32  ARG A N    3  
ATOM 4323  C CA   . ARG A 1 32  ? -12.841 -12.272 -3.367  1.00 0.00 ? 32  ARG A CA   3  
ATOM 4324  C C    . ARG A 1 32  ? -12.774 -12.941 -4.736  1.00 0.00 ? 32  ARG A C    3  
ATOM 4325  O O    . ARG A 1 32  ? -13.451 -13.950 -4.893  1.00 0.00 ? 32  ARG A O    3  
ATOM 4326  C CB   . ARG A 1 32  ? -13.945 -11.199 -3.347  1.00 0.00 ? 32  ARG A CB   3  
ATOM 4327  C CG   . ARG A 1 32  ? -14.332 -10.805 -1.913  1.00 0.00 ? 32  ARG A CG   3  
ATOM 4328  C CD   . ARG A 1 32  ? -15.362 -9.668  -1.822  1.00 0.00 ? 32  ARG A CD   3  
ATOM 4329  N NE   . ARG A 1 32  ? -14.992 -8.509  -2.702  1.00 0.00 ? 32  ARG A NE   3  
ATOM 4330  C CZ   . ARG A 1 32  ? -15.761 -7.382  -2.824  1.00 0.00 ? 32  ARG A CZ   3  
ATOM 4331  N NH1  . ARG A 1 32  ? -16.943 -7.264  -2.154  1.00 0.00 ? 32  ARG A NH1  3  
ATOM 4332  N NH2  . ARG A 1 32  ? -15.334 -6.366  -3.630  1.00 0.00 ? 32  ARG A NH2  3  
ATOM 4333  H H    . ARG A 1 32  ? -11.595 -10.752 -2.710  1.00 0.00 ? 32  ARG A H    3  
ATOM 4334  H HA   . ARG A 1 32  ? -13.166 -13.054 -2.692  1.00 0.00 ? 32  ARG A HA   3  
ATOM 4335  H HB2  . ARG A 1 32  ? -13.575 -10.313 -3.907  1.00 0.00 ? 32  ARG A HB2  3  
ATOM 4336  H HB3  . ARG A 1 32  ? -14.876 -11.556 -3.846  1.00 0.00 ? 32  ARG A HB3  3  
ATOM 4337  H HG2  . ARG A 1 32  ? -14.752 -11.710 -1.427  1.00 0.00 ? 32  ARG A HG2  3  
ATOM 4338  H HG3  . ARG A 1 32  ? -13.442 -10.514 -1.316  1.00 0.00 ? 32  ARG A HG3  3  
ATOM 4339  H HD2  . ARG A 1 32  ? -16.334 -10.070 -2.151  1.00 0.00 ? 32  ARG A HD2  3  
ATOM 4340  H HD3  . ARG A 1 32  ? -15.435 -9.304  -0.775  1.00 0.00 ? 32  ARG A HD3  3  
ATOM 4341  H HE   . ARG A 1 32  ? -14.132 -8.558  -3.210  1.00 0.00 ? 32  ARG A HE   3  
ATOM 4342  H HH11 . ARG A 1 32  ? -17.258 -8.007  -1.564  1.00 0.00 ? 32  ARG A HH11 3  
ATOM 4343  H HH12 . ARG A 1 32  ? -17.494 -6.435  -2.254  1.00 0.00 ? 32  ARG A HH12 3  
ATOM 4344  H HH21 . ARG A 1 32  ? -14.466 -6.450  -4.123  1.00 0.00 ? 32  ARG A HH21 3  
ATOM 4345  H HH22 . ARG A 1 32  ? -15.886 -5.538  -3.726  1.00 0.00 ? 32  ARG A HH22 3  
ATOM 4346  N N    . ARG A 1 33  ? -11.997 -12.468 -5.767  1.00 0.00 ? 33  ARG A N    3  
ATOM 4347  C CA   . ARG A 1 33  ? -11.689 -13.278 -6.952  1.00 0.00 ? 33  ARG A CA   3  
ATOM 4348  C C    . ARG A 1 33  ? -10.725 -14.417 -6.791  1.00 0.00 ? 33  ARG A C    3  
ATOM 4349  O O    . ARG A 1 33  ? -10.970 -15.514 -7.278  1.00 0.00 ? 33  ARG A O    3  
ATOM 4350  C CB   . ARG A 1 33  ? -11.174 -12.585 -8.232  1.00 0.00 ? 33  ARG A CB   3  
ATOM 4351  C CG   . ARG A 1 33  ? -10.282 -11.361 -8.103  1.00 0.00 ? 33  ARG A CG   3  
ATOM 4352  C CD   . ARG A 1 33  ? -9.667  -10.946 -9.446  1.00 0.00 ? 33  ARG A CD   3  
ATOM 4353  N NE   . ARG A 1 33  ? -8.708  -9.805  -9.219  1.00 0.00 ? 33  ARG A NE   3  
ATOM 4354  C CZ   . ARG A 1 33  ? -9.036  -8.484  -9.372  1.00 0.00 ? 33  ARG A CZ   3  
ATOM 4355  N NH1  . ARG A 1 33  ? -10.276 -8.109  -9.797  1.00 0.00 ? 33  ARG A NH1  3  
ATOM 4356  N NH2  . ARG A 1 33  ? -8.102  -7.526  -9.089  1.00 0.00 ? 33  ARG A NH2  3  
ATOM 4357  H H    . ARG A 1 33  ? -11.453 -11.632 -5.720  1.00 0.00 ? 33  ARG A H    3  
ATOM 4358  H HA   . ARG A 1 33  ? -12.605 -13.756 -7.266  1.00 0.00 ? 33  ARG A HA   3  
ATOM 4359  H HB2  . ARG A 1 33  ? -10.739 -13.300 -8.950  1.00 0.00 ? 33  ARG A HB2  3  
ATOM 4360  H HB3  . ARG A 1 33  ? -12.045 -12.300 -8.788  1.00 0.00 ? 33  ARG A HB3  3  
ATOM 4361  H HG2  . ARG A 1 33  ? -10.909 -10.538 -7.717  1.00 0.00 ? 33  ARG A HG2  3  
ATOM 4362  H HG3  . ARG A 1 33  ? -9.493  -11.579 -7.363  1.00 0.00 ? 33  ARG A HG3  3  
ATOM 4363  H HD2  . ARG A 1 33  ? -9.080  -11.790 -9.865  1.00 0.00 ? 33  ARG A HD2  3  
ATOM 4364  H HD3  . ARG A 1 33  ? -10.456 -10.673 -10.181 1.00 0.00 ? 33  ARG A HD3  3  
ATOM 4365  H HE   . ARG A 1 33  ? -7.784  -10.029 -8.907  1.00 0.00 ? 33  ARG A HE   3  
ATOM 4366  H HH11 . ARG A 1 33  ? -10.964 -8.805  -10.004 1.00 0.00 ? 33  ARG A HH11 3  
ATOM 4367  H HH12 . ARG A 1 33  ? -10.496 -7.139  -9.899  1.00 0.00 ? 33  ARG A HH12 3  
ATOM 4368  H HH21 . ARG A 1 33  ? -7.192  -7.794  -8.775  1.00 0.00 ? 33  ARG A HH21 3  
ATOM 4369  H HH22 . ARG A 1 33  ? -8.331  -6.559  -9.196  1.00 0.00 ? 33  ARG A HH22 3  
ATOM 4370  N N    . ARG A 1 34  ? -9.512  -14.156 -6.244  1.00 0.00 ? 34  ARG A N    3  
ATOM 4371  C CA   . ARG A 1 34  ? -8.449  -15.128 -6.354  1.00 0.00 ? 34  ARG A CA   3  
ATOM 4372  C C    . ARG A 1 34  ? -8.513  -16.253 -5.303  1.00 0.00 ? 34  ARG A C    3  
ATOM 4373  O O    . ARG A 1 34  ? -8.067  -17.374 -5.525  1.00 0.00 ? 34  ARG A O    3  
ATOM 4374  C CB   . ARG A 1 34  ? -7.052  -14.460 -6.295  1.00 0.00 ? 34  ARG A CB   3  
ATOM 4375  C CG   . ARG A 1 34  ? -6.799  -13.363 -7.347  1.00 0.00 ? 34  ARG A CG   3  
ATOM 4376  C CD   . ARG A 1 34  ? -6.748  -13.852 -8.804  1.00 0.00 ? 34  ARG A CD   3  
ATOM 4377  N NE   . ARG A 1 34  ? -6.526  -12.672 -9.715  1.00 0.00 ? 34  ARG A NE   3  
ATOM 4378  C CZ   . ARG A 1 34  ? -5.321  -12.043 -9.894  1.00 0.00 ? 34  ARG A CZ   3  
ATOM 4379  N NH1  . ARG A 1 34  ? -4.184  -12.506 -9.296  1.00 0.00 ? 34  ARG A NH1  3  
ATOM 4380  N NH2  . ARG A 1 34  ? -5.261  -10.928 -10.680 1.00 0.00 ? 34  ARG A NH2  3  
ATOM 4381  H H    . ARG A 1 34  ? -9.249  -13.257 -5.866  1.00 0.00 ? 34  ARG A H    3  
ATOM 4382  H HA   . ARG A 1 34  ? -8.567  -15.507 -7.366  1.00 0.00 ? 34  ARG A HA   3  
ATOM 4383  H HB2  . ARG A 1 34  ? -6.920  -13.981 -5.300  1.00 0.00 ? 34  ARG A HB2  3  
ATOM 4384  H HB3  . ARG A 1 34  ? -6.254  -15.228 -6.415  1.00 0.00 ? 34  ARG A HB3  3  
ATOM 4385  H HG2  . ARG A 1 34  ? -7.555  -12.557 -7.241  1.00 0.00 ? 34  ARG A HG2  3  
ATOM 4386  H HG3  . ARG A 1 34  ? -5.810  -12.916 -7.103  1.00 0.00 ? 34  ARG A HG3  3  
ATOM 4387  H HD2  . ARG A 1 34  ? -5.942  -14.605 -8.950  1.00 0.00 ? 34  ARG A HD2  3  
ATOM 4388  H HD3  . ARG A 1 34  ? -7.720  -14.306 -9.089  1.00 0.00 ? 34  ARG A HD3  3  
ATOM 4389  H HE   . ARG A 1 34  ? -7.327  -12.290 -10.178 1.00 0.00 ? 34  ARG A HE   3  
ATOM 4390  H HH11 . ARG A 1 34  ? -4.222  -13.318 -8.714  1.00 0.00 ? 34  ARG A HH11 3  
ATOM 4391  H HH12 . ARG A 1 34  ? -3.316  -12.030 -9.438  1.00 0.00 ? 34  ARG A HH12 3  
ATOM 4392  H HH21 . ARG A 1 34  ? -6.091  -10.582 -11.118 1.00 0.00 ? 34  ARG A HH21 3  
ATOM 4393  H HH22 . ARG A 1 34  ? -4.390  -10.458 -10.815 1.00 0.00 ? 34  ARG A HH22 3  
ATOM 4394  N N    . PHE A 1 35  ? -9.056  -15.907 -4.109  1.00 0.00 ? 35  PHE A N    3  
ATOM 4395  C CA   . PHE A 1 35  ? -9.156  -16.759 -2.939  1.00 0.00 ? 35  PHE A CA   3  
ATOM 4396  C C    . PHE A 1 35  ? -10.633 -17.071 -2.624  1.00 0.00 ? 35  PHE A C    3  
ATOM 4397  O O    . PHE A 1 35  ? -10.929 -18.136 -2.079  1.00 0.00 ? 35  PHE A O    3  
ATOM 4398  C CB   . PHE A 1 35  ? -8.403  -16.132 -1.696  1.00 0.00 ? 35  PHE A CB   3  
ATOM 4399  C CG   . PHE A 1 35  ? -6.966  -15.749 -1.979  1.00 0.00 ? 35  PHE A CG   3  
ATOM 4400  C CD1  . PHE A 1 35  ? -5.851  -16.432 -1.513  1.00 0.00 ? 35  PHE A CD1  3  
ATOM 4401  C CD2  . PHE A 1 35  ? -6.742  -14.566 -2.653  1.00 0.00 ? 35  PHE A CD2  3  
ATOM 4402  C CE1  . PHE A 1 35  ? -4.573  -15.983 -1.807  1.00 0.00 ? 35  PHE A CE1  3  
ATOM 4403  C CE2  . PHE A 1 35  ? -5.484  -14.130 -2.968  1.00 0.00 ? 35  PHE A CE2  3  
ATOM 4404  C CZ   . PHE A 1 35  ? -4.384  -14.841 -2.551  1.00 0.00 ? 35  PHE A CZ   3  
ATOM 4405  H H    . PHE A 1 35  ? -9.391  -14.973 -3.965  1.00 0.00 ? 35  PHE A H    3  
ATOM 4406  H HA   . PHE A 1 35  ? -8.688  -17.718 -3.127  1.00 0.00 ? 35  PHE A HA   3  
ATOM 4407  H HB2  . PHE A 1 35  ? -8.859  -15.149 -1.432  1.00 0.00 ? 35  PHE A HB2  3  
ATOM 4408  H HB3  . PHE A 1 35  ? -8.411  -16.850 -0.837  1.00 0.00 ? 35  PHE A HB3  3  
ATOM 4409  H HD1  . PHE A 1 35  ? -5.951  -17.297 -0.877  1.00 0.00 ? 35  PHE A HD1  3  
ATOM 4410  H HD2  . PHE A 1 35  ? -7.585  -13.971 -2.967  1.00 0.00 ? 35  PHE A HD2  3  
ATOM 4411  H HE1  . PHE A 1 35  ? -3.716  -16.518 -1.421  1.00 0.00 ? 35  PHE A HE1  3  
ATOM 4412  H HE2  . PHE A 1 35  ? -5.403  -13.231 -3.556  1.00 0.00 ? 35  PHE A HE2  3  
ATOM 4413  H HZ   . PHE A 1 35  ? -3.388  -14.492 -2.779  1.00 0.00 ? 35  PHE A HZ   3  
ATOM 4414  N N    . GLY A 1 36  ? -11.626 -16.139 -2.883  1.00 0.00 ? 36  GLY A N    3  
ATOM 4415  C CA   . GLY A 1 36  ? -13.011 -16.240 -2.439  1.00 0.00 ? 36  GLY A CA   3  
ATOM 4416  C C    . GLY A 1 36  ? -13.148 -15.872 -1.002  1.00 0.00 ? 36  GLY A C    3  
ATOM 4417  O O    . GLY A 1 36  ? -12.890 -14.751 -0.575  1.00 0.00 ? 36  GLY A O    3  
ATOM 4418  H H    . GLY A 1 36  ? -11.489 -15.241 -3.315  1.00 0.00 ? 36  GLY A H    3  
ATOM 4419  H HA2  . GLY A 1 36  ? -13.582 -15.502 -2.973  1.00 0.00 ? 36  GLY A HA2  3  
ATOM 4420  H HA3  . GLY A 1 36  ? -13.347 -17.263 -2.540  1.00 0.00 ? 36  GLY A HA3  3  
ATOM 4421  N N    . THR A 1 37  ? -13.490 -16.914 -0.216  1.00 0.00 ? 37  THR A N    3  
ATOM 4422  C CA   . THR A 1 37  ? -13.477 -16.925 1.221   1.00 0.00 ? 37  THR A CA   3  
ATOM 4423  C C    . THR A 1 37  ? -12.625 -18.182 1.467   1.00 0.00 ? 37  THR A C    3  
ATOM 4424  O O    . THR A 1 37  ? -13.099 -19.305 1.311   1.00 0.00 ? 37  THR A O    3  
ATOM 4425  C CB   . THR A 1 37  ? -14.916 -17.095 1.781   1.00 0.00 ? 37  THR A CB   3  
ATOM 4426  O OG1  . THR A 1 37  ? -15.665 -18.057 1.045   1.00 0.00 ? 37  THR A OG1  3  
ATOM 4427  C CG2  . THR A 1 37  ? -15.791 -15.836 1.690   1.00 0.00 ? 37  THR A CG2  3  
ATOM 4428  H H    . THR A 1 37  ? -13.664 -17.804 -0.626  1.00 0.00 ? 37  THR A H    3  
ATOM 4429  H HA   . THR A 1 37  ? -12.985 -16.065 1.651   1.00 0.00 ? 37  THR A HA   3  
ATOM 4430  H HB   . THR A 1 37  ? -14.881 -17.404 2.852   1.00 0.00 ? 37  THR A HB   3  
ATOM 4431  H HG1  . THR A 1 37  ? -15.177 -18.885 1.149   1.00 0.00 ? 37  THR A HG1  3  
ATOM 4432  H HG21 . THR A 1 37  ? -15.967 -15.499 0.650   1.00 0.00 ? 37  THR A HG21 3  
ATOM 4433  H HG22 . THR A 1 37  ? -16.767 -16.077 2.151   1.00 0.00 ? 37  THR A HG22 3  
ATOM 4434  H HG23 . THR A 1 37  ? -15.459 -14.960 2.269   1.00 0.00 ? 37  THR A HG23 3  
ATOM 4435  N N    . LYS A 1 38  ? -11.374 -18.012 1.925   1.00 0.00 ? 38  LYS A N    3  
ATOM 4436  C CA   . LYS A 1 38  ? -10.435 -19.081 2.201   1.00 0.00 ? 38  LYS A CA   3  
ATOM 4437  C C    . LYS A 1 38  ? -9.573  -18.647 3.346   1.00 0.00 ? 38  LYS A C    3  
ATOM 4438  O O    . LYS A 1 38  ? -9.235  -17.472 3.446   1.00 0.00 ? 38  LYS A O    3  
ATOM 4439  C CB   . LYS A 1 38  ? -9.478  -19.342 1.012   1.00 0.00 ? 38  LYS A CB   3  
ATOM 4440  C CG   . LYS A 1 38  ? -8.916  -20.771 1.050   1.00 0.00 ? 38  LYS A CG   3  
ATOM 4441  C CD   . LYS A 1 38  ? -7.435  -20.855 0.665   1.00 0.00 ? 38  LYS A CD   3  
ATOM 4442  C CE   . LYS A 1 38  ? -7.133  -20.411 -0.773  1.00 0.00 ? 38  LYS A CE   3  
ATOM 4443  N NZ   . LYS A 1 38  ? -5.681  -20.490 -1.056  1.00 0.00 ? 38  LYS A NZ   3  
ATOM 4444  H H    . LYS A 1 38  ? -10.988 -17.104 1.967   1.00 0.00 ? 38  LYS A H    3  
ATOM 4445  H HA   . LYS A 1 38  ? -10.915 -20.015 2.453   1.00 0.00 ? 38  LYS A HA   3  
ATOM 4446  H HB2  . LYS A 1 38  ? -10.051 -19.214 0.068   1.00 0.00 ? 38  LYS A HB2  3  
ATOM 4447  H HB3  . LYS A 1 38  ? -8.643  -18.602 0.953   1.00 0.00 ? 38  LYS A HB3  3  
ATOM 4448  H HG2  . LYS A 1 38  ? -8.992  -21.196 2.076   1.00 0.00 ? 38  LYS A HG2  3  
ATOM 4449  H HG3  . LYS A 1 38  ? -9.559  -21.392 0.398   1.00 0.00 ? 38  LYS A HG3  3  
ATOM 4450  H HD2  . LYS A 1 38  ? -6.890  -20.211 1.388   1.00 0.00 ? 38  LYS A HD2  3  
ATOM 4451  H HD3  . LYS A 1 38  ? -7.099  -21.905 0.812   1.00 0.00 ? 38  LYS A HD3  3  
ATOM 4452  H HE2  . LYS A 1 38  ? -7.655  -21.068 -1.500  1.00 0.00 ? 38  LYS A HE2  3  
ATOM 4453  H HE3  . LYS A 1 38  ? -7.444  -19.359 -0.942  1.00 0.00 ? 38  LYS A HE3  3  
ATOM 4454  H HZ1  . LYS A 1 38  ? -5.355  -21.470 -0.922  1.00 0.00 ? 38  LYS A HZ1  3  
ATOM 4455  H HZ2  . LYS A 1 38  ? -5.503  -20.197 -2.038  1.00 0.00 ? 38  LYS A HZ2  3  
ATOM 4456  H HZ3  . LYS A 1 38  ? -5.167  -19.862 -0.408  1.00 0.00 ? 38  LYS A HZ3  3  
ATOM 4457  N N    . ARG A 1 39  ? -9.093  -19.580 4.216   1.00 0.00 ? 39  ARG A N    3  
ATOM 4458  C CA   . ARG A 1 39  ? -8.097  -19.297 5.249   1.00 0.00 ? 39  ARG A CA   3  
ATOM 4459  C C    . ARG A 1 39  ? -6.721  -19.061 4.583   1.00 0.00 ? 39  ARG A C    3  
ATOM 4460  O O    . ARG A 1 39  ? -6.110  -19.948 3.999   1.00 0.00 ? 39  ARG A O    3  
ATOM 4461  C CB   . ARG A 1 39  ? -8.021  -20.383 6.370   1.00 0.00 ? 39  ARG A CB   3  
ATOM 4462  C CG   . ARG A 1 39  ? -7.337  -21.738 6.061   1.00 0.00 ? 39  ARG A CG   3  
ATOM 4463  C CD   . ARG A 1 39  ? -8.132  -22.654 5.106   1.00 0.00 ? 39  ARG A CD   3  
ATOM 4464  N NE   . ARG A 1 39  ? -7.419  -23.975 4.968   1.00 0.00 ? 39  ARG A NE   3  
ATOM 4465  C CZ   . ARG A 1 39  ? -6.405  -24.211 4.076   1.00 0.00 ? 39  ARG A CZ   3  
ATOM 4466  N NH1  . ARG A 1 39  ? -5.962  -23.233 3.233   1.00 0.00 ? 39  ARG A NH1  3  
ATOM 4467  N NH2  . ARG A 1 39  ? -5.831  -25.449 4.030   1.00 0.00 ? 39  ARG A NH2  3  
ATOM 4468  H H    . ARG A 1 39  ? -9.349  -20.533 4.133   1.00 0.00 ? 39  ARG A H    3  
ATOM 4469  H HA   . ARG A 1 39  ? -8.439  -18.394 5.757   1.00 0.00 ? 39  ARG A HA   3  
ATOM 4470  H HB2  . ARG A 1 39  ? -7.480  -19.932 7.233   1.00 0.00 ? 39  ARG A HB2  3  
ATOM 4471  H HB3  . ARG A 1 39  ? -9.057  -20.583 6.722   1.00 0.00 ? 39  ARG A HB3  3  
ATOM 4472  H HG2  . ARG A 1 39  ? -6.324  -21.570 5.646   1.00 0.00 ? 39  ARG A HG2  3  
ATOM 4473  H HG3  . ARG A 1 39  ? -7.142  -22.244 7.031   1.00 0.00 ? 39  ARG A HG3  3  
ATOM 4474  H HD2  . ARG A 1 39  ? -9.131  -22.862 5.541   1.00 0.00 ? 39  ARG A HD2  3  
ATOM 4475  H HD3  . ARG A 1 39  ? -8.272  -22.198 4.097   1.00 0.00 ? 39  ARG A HD3  3  
ATOM 4476  H HE   . ARG A 1 39  ? -7.708  -24.725 5.563   1.00 0.00 ? 39  ARG A HE   3  
ATOM 4477  H HH11 . ARG A 1 39  ? -6.375  -22.323 3.263   1.00 0.00 ? 39  ARG A HH11 3  
ATOM 4478  H HH12 . ARG A 1 39  ? -5.220  -23.426 2.591   1.00 0.00 ? 39  ARG A HH12 3  
ATOM 4479  H HH21 . ARG A 1 39  ? -6.153  -26.172 4.643   1.00 0.00 ? 39  ARG A HH21 3  
ATOM 4480  H HH22 . ARG A 1 39  ? -5.091  -25.634 3.383   1.00 0.00 ? 39  ARG A HH22 3  
ATOM 4481  N N    . VAL A 1 40  ? -6.233  -17.814 4.564   1.00 0.00 ? 40  VAL A N    3  
ATOM 4482  C CA   . VAL A 1 40  ? -5.011  -17.448 3.870   1.00 0.00 ? 40  VAL A CA   3  
ATOM 4483  C C    . VAL A 1 40  ? -4.326  -16.533 4.815   1.00 0.00 ? 40  VAL A C    3  
ATOM 4484  O O    . VAL A 1 40  ? -4.974  -15.906 5.646   1.00 0.00 ? 40  VAL A O    3  
ATOM 4485  C CB   . VAL A 1 40  ? -5.242  -16.815 2.484   1.00 0.00 ? 40  VAL A CB   3  
ATOM 4486  C CG1  . VAL A 1 40  ? -6.098  -15.530 2.511   1.00 0.00 ? 40  VAL A CG1  3  
ATOM 4487  C CG2  . VAL A 1 40  ? -3.931  -16.576 1.702   1.00 0.00 ? 40  VAL A CG2  3  
ATOM 4488  H H    . VAL A 1 40  ? -6.740  -17.056 5.000   1.00 0.00 ? 40  VAL A H    3  
ATOM 4489  H HA   . VAL A 1 40  ? -4.360  -18.306 3.748   1.00 0.00 ? 40  VAL A HA   3  
ATOM 4490  H HB   . VAL A 1 40  ? -5.818  -17.566 1.908   1.00 0.00 ? 40  VAL A HB   3  
ATOM 4491  H HG11 . VAL A 1 40  ? -7.081  -15.722 2.995   1.00 0.00 ? 40  VAL A HG11 3  
ATOM 4492  H HG12 . VAL A 1 40  ? -5.545  -14.717 3.028   1.00 0.00 ? 40  VAL A HG12 3  
ATOM 4493  H HG13 . VAL A 1 40  ? -6.280  -15.198 1.463   1.00 0.00 ? 40  VAL A HG13 3  
ATOM 4494  H HG21 . VAL A 1 40  ? -3.361  -17.522 1.581   1.00 0.00 ? 40  VAL A HG21 3  
ATOM 4495  H HG22 . VAL A 1 40  ? -4.171  -16.176 0.697   1.00 0.00 ? 40  VAL A HG22 3  
ATOM 4496  H HG23 . VAL A 1 40  ? -3.288  -15.814 2.186   1.00 0.00 ? 40  VAL A HG23 3  
ATOM 4497  N N    . HIS A 1 41  ? -2.982  -16.408 4.719   1.00 0.00 ? 41  HIS A N    3  
ATOM 4498  C CA   . HIS A 1 41  ? -2.183  -15.489 5.501   1.00 0.00 ? 41  HIS A CA   3  
ATOM 4499  C C    . HIS A 1 41  ? -2.191  -14.169 4.761   1.00 0.00 ? 41  HIS A C    3  
ATOM 4500  O O    . HIS A 1 41  ? -1.819  -14.072 3.589   1.00 0.00 ? 41  HIS A O    3  
ATOM 4501  C CB   . HIS A 1 41  ? -0.759  -16.051 5.734   1.00 0.00 ? 41  HIS A CB   3  
ATOM 4502  C CG   . HIS A 1 41  ? 0.097   -15.233 6.662   1.00 0.00 ? 41  HIS A CG   3  
ATOM 4503  N ND1  . HIS A 1 41  ? 0.787   -14.066 6.389   1.00 0.00 ? 41  HIS A ND1  3  
ATOM 4504  C CD2  . HIS A 1 41  ? 0.245   -15.450 7.988   1.00 0.00 ? 41  HIS A CD2  3  
ATOM 4505  C CE1  . HIS A 1 41  ? 1.306   -13.627 7.570   1.00 0.00 ? 41  HIS A CE1  3  
ATOM 4506  N NE2  . HIS A 1 41  ? 0.982   -14.433 8.569   1.00 0.00 ? 41  HIS A NE2  3  
ATOM 4507  H H    . HIS A 1 41  ? -2.510  -16.930 4.014   1.00 0.00 ? 41  HIS A H    3  
ATOM 4508  H HA   . HIS A 1 41  ? -2.640  -15.331 6.471   1.00 0.00 ? 41  HIS A HA   3  
ATOM 4509  H HB2  . HIS A 1 41  ? -0.892  -17.037 6.241   1.00 0.00 ? 41  HIS A HB2  3  
ATOM 4510  H HB3  . HIS A 1 41  ? -0.250  -16.251 4.775   1.00 0.00 ? 41  HIS A HB3  3  
ATOM 4511  H HD1  . HIS A 1 41  ? 0.971   -13.698 5.480   1.00 0.00 ? 41  HIS A HD1  3  
ATOM 4512  H HD2  . HIS A 1 41  ? -0.155  -16.293 8.540   1.00 0.00 ? 41  HIS A HD2  3  
ATOM 4513  H HE1  . HIS A 1 41  ? 1.916   -12.711 7.652   1.00 0.00 ? 41  HIS A HE1  3  
ATOM 4514  N N    . ASN A 1 42  ? -2.675  -13.086 5.428   1.00 0.00 ? 42  ASN A N    3  
ATOM 4515  C CA   . ASN A 1 42  ? -2.897  -11.748 4.872   1.00 0.00 ? 42  ASN A CA   3  
ATOM 4516  C C    . ASN A 1 42  ? -1.678  -11.074 4.217   1.00 0.00 ? 42  ASN A C    3  
ATOM 4517  O O    . ASN A 1 42  ? -1.827  -10.312 3.267   1.00 0.00 ? 42  ASN A O    3  
ATOM 4518  C CB   . ASN A 1 42  ? -3.618  -10.911 5.954   1.00 0.00 ? 42  ASN A CB   3  
ATOM 4519  C CG   . ASN A 1 42  ? -4.227  -9.527  5.621   1.00 0.00 ? 42  ASN A CG   3  
ATOM 4520  O OD1  . ASN A 1 42  ? -5.199  -9.132  6.273   1.00 0.00 ? 42  ASN A OD1  3  
ATOM 4521  N ND2  . ASN A 1 42  ? -3.614  -8.734  4.715   1.00 0.00 ? 42  ASN A ND2  3  
ATOM 4522  H H    . ASN A 1 42  ? -2.992  -13.217 6.368   1.00 0.00 ? 42  ASN A H    3  
ATOM 4523  H HA   . ASN A 1 42  ? -3.630  -11.875 4.090   1.00 0.00 ? 42  ASN A HA   3  
ATOM 4524  H HB2  . ASN A 1 42  ? -4.504  -11.522 6.280   1.00 0.00 ? 42  ASN A HB2  3  
ATOM 4525  H HB3  . ASN A 1 42  ? -2.902  -10.790 6.802   1.00 0.00 ? 42  ASN A HB3  3  
ATOM 4526  H HD21 . ASN A 1 42  ? -2.904  -9.127  4.120   1.00 0.00 ? 42  ASN A HD21 3  
ATOM 4527  H HD22 . ASN A 1 42  ? -4.011  -7.833  4.557   1.00 0.00 ? 42  ASN A HD22 3  
ATOM 4528  N N    . ASN A 1 43  ? -0.427  -11.401 4.656   1.00 0.00 ? 43  ASN A N    3  
ATOM 4529  C CA   . ASN A 1 43  ? 0.804   -10.946 3.984   1.00 0.00 ? 43  ASN A CA   3  
ATOM 4530  C C    . ASN A 1 43  ? 1.044   -11.662 2.649   1.00 0.00 ? 43  ASN A C    3  
ATOM 4531  O O    . ASN A 1 43  ? 1.544   -11.040 1.731   1.00 0.00 ? 43  ASN A O    3  
ATOM 4532  C CB   . ASN A 1 43  ? 2.025   -10.765 4.943   1.00 0.00 ? 43  ASN A CB   3  
ATOM 4533  C CG   . ASN A 1 43  ? 3.053   -9.725  4.445   1.00 0.00 ? 43  ASN A CG   3  
ATOM 4534  O OD1  . ASN A 1 43  ? 3.580   -9.860  3.341   1.00 0.00 ? 43  ASN A OD1  3  
ATOM 4535  N ND2  . ASN A 1 43  ? 3.443   -8.730  5.293   1.00 0.00 ? 43  ASN A ND2  3  
ATOM 4536  H H    . ASN A 1 43  ? -0.346  -12.021 5.438   1.00 0.00 ? 43  ASN A H    3  
ATOM 4537  H HA   . ASN A 1 43  ? 0.629   -9.957  3.592   1.00 0.00 ? 43  ASN A HA   3  
ATOM 4538  H HB2  . ASN A 1 43  ? 1.651   -10.449 5.939   1.00 0.00 ? 43  ASN A HB2  3  
ATOM 4539  H HB3  . ASN A 1 43  ? 2.558   -11.730 5.076   1.00 0.00 ? 43  ASN A HB3  3  
ATOM 4540  H HD21 . ASN A 1 43  ? 2.868   -8.354  6.012   1.00 0.00 ? 43  ASN A HD21 3  
ATOM 4541  H HD22 . ASN A 1 43  ? 4.416   -8.532  5.286   1.00 0.00 ? 43  ASN A HD22 3  
ATOM 4542  N N    . ILE A 1 44  ? 0.562   -12.924 2.444   1.00 0.00 ? 44  ILE A N    3  
ATOM 4543  C CA   . ILE A 1 44  ? 0.541   -13.672 1.170   1.00 0.00 ? 44  ILE A CA   3  
ATOM 4544  C C    . ILE A 1 44  ? -0.387  -13.012 0.157   1.00 0.00 ? 44  ILE A C    3  
ATOM 4545  O O    . ILE A 1 44  ? -0.053  -12.837 -1.011  1.00 0.00 ? 44  ILE A O    3  
ATOM 4546  C CB   . ILE A 1 44  ? 0.126   -15.137 1.338   1.00 0.00 ? 44  ILE A CB   3  
ATOM 4547  C CG1  . ILE A 1 44  ? 1.100   -15.773 2.358   1.00 0.00 ? 44  ILE A CG1  3  
ATOM 4548  C CG2  . ILE A 1 44  ? 0.125   -15.884 -0.031  1.00 0.00 ? 44  ILE A CG2  3  
ATOM 4549  C CD1  . ILE A 1 44  ? 0.947   -17.289 2.439   1.00 0.00 ? 44  ILE A CD1  3  
ATOM 4550  H H    . ILE A 1 44  ? 0.077   -13.397 3.175   1.00 0.00 ? 44  ILE A H    3  
ATOM 4551  H HA   . ILE A 1 44  ? 1.539   -13.700 0.758   1.00 0.00 ? 44  ILE A HA   3  
ATOM 4552  H HB   . ILE A 1 44  ? -0.914  -15.226 1.752   1.00 0.00 ? 44  ILE A HB   3  
ATOM 4553  H HG12 . ILE A 1 44  ? 2.150   -15.528 2.077   1.00 0.00 ? 44  ILE A HG12 3  
ATOM 4554  H HG13 . ILE A 1 44  ? 0.914   -15.351 3.376   1.00 0.00 ? 44  ILE A HG13 3  
ATOM 4555  H HG21 . ILE A 1 44  ? 1.085   -15.724 -0.562  1.00 0.00 ? 44  ILE A HG21 3  
ATOM 4556  H HG22 . ILE A 1 44  ? -0.033  -16.972 0.099   1.00 0.00 ? 44  ILE A HG22 3  
ATOM 4557  H HG23 . ILE A 1 44  ? -0.710  -15.554 -0.685  1.00 0.00 ? 44  ILE A HG23 3  
ATOM 4558  H HD11 . ILE A 1 44  ? -0.131  -17.562 2.483   1.00 0.00 ? 44  ILE A HD11 3  
ATOM 4559  H HD12 . ILE A 1 44  ? 1.391   -17.750 1.530   1.00 0.00 ? 44  ILE A HD12 3  
ATOM 4560  H HD13 . ILE A 1 44  ? 1.468   -17.684 3.335   1.00 0.00 ? 44  ILE A HD13 3  
ATOM 4561  N N    . VAL A 1 45  ? -1.581  -12.580 0.641   1.00 0.00 ? 45  VAL A N    3  
ATOM 4562  C CA   . VAL A 1 45  ? -2.587  -11.837 -0.149  1.00 0.00 ? 45  VAL A CA   3  
ATOM 4563  C C    . VAL A 1 45  ? -2.196  -10.398 -0.395  1.00 0.00 ? 45  VAL A C    3  
ATOM 4564  O O    . VAL A 1 45  ? -2.481  -9.856  -1.458  1.00 0.00 ? 45  VAL A O    3  
ATOM 4565  C CB   . VAL A 1 45  ? -4.063  -12.154 0.112   1.00 0.00 ? 45  VAL A CB   3  
ATOM 4566  C CG1  . VAL A 1 45  ? -4.463  -12.399 1.575   1.00 0.00 ? 45  VAL A CG1  3  
ATOM 4567  C CG2  . VAL A 1 45  ? -5.076  -11.360 -0.751  1.00 0.00 ? 45  VAL A CG2  3  
ATOM 4568  H H    . VAL A 1 45  ? -1.688  -12.727 1.627   1.00 0.00 ? 45  VAL A H    3  
ATOM 4569  H HA   . VAL A 1 45  ? -2.518  -12.230 -1.157  1.00 0.00 ? 45  VAL A HA   3  
ATOM 4570  H HB   . VAL A 1 45  ? -4.139  -13.163 -0.282  1.00 0.00 ? 45  VAL A HB   3  
ATOM 4571  H HG11 . VAL A 1 45  ? -4.179  -11.537 2.199   1.00 0.00 ? 45  VAL A HG11 3  
ATOM 4572  H HG12 . VAL A 1 45  ? -5.562  -12.576 1.625   1.00 0.00 ? 45  VAL A HG12 3  
ATOM 4573  H HG13 . VAL A 1 45  ? -3.982  -13.331 1.953   1.00 0.00 ? 45  VAL A HG13 3  
ATOM 4574  H HG21 . VAL A 1 45  ? -4.811  -11.394 -1.830  1.00 0.00 ? 45  VAL A HG21 3  
ATOM 4575  H HG22 . VAL A 1 45  ? -6.096  -11.784 -0.646  1.00 0.00 ? 45  VAL A HG22 3  
ATOM 4576  H HG23 . VAL A 1 45  ? -5.134  -10.297 -0.462  1.00 0.00 ? 45  VAL A HG23 3  
ATOM 4577  N N    . TYR A 1 46  ? -1.406  -9.787  0.560   1.00 0.00 ? 46  TYR A N    3  
ATOM 4578  C CA   . TYR A 1 46  ? -0.711  -8.472  0.448   1.00 0.00 ? 46  TYR A CA   3  
ATOM 4579  C C    . TYR A 1 46  ? 0.324   -8.602  -0.628  1.00 0.00 ? 46  TYR A C    3  
ATOM 4580  O O    . TYR A 1 46  ? 0.197   -7.955  -1.646  1.00 0.00 ? 46  TYR A O    3  
ATOM 4581  C CB   . TYR A 1 46  ? -0.043  -7.991  1.807   1.00 0.00 ? 46  TYR A CB   3  
ATOM 4582  C CG   . TYR A 1 46  ? -0.143  -6.528  2.219   1.00 0.00 ? 46  TYR A CG   3  
ATOM 4583  C CD1  . TYR A 1 46  ? 0.183   -6.198  3.529   1.00 0.00 ? 46  TYR A CD1  3  
ATOM 4584  C CD2  . TYR A 1 46  ? -0.620  -5.502  1.426   1.00 0.00 ? 46  TYR A CD2  3  
ATOM 4585  C CE1  . TYR A 1 46  ? -0.199  -4.994  4.079   1.00 0.00 ? 46  TYR A CE1  3  
ATOM 4586  C CE2  . TYR A 1 46  ? -0.845  -4.240  1.935   1.00 0.00 ? 46  TYR A CE2  3  
ATOM 4587  C CZ   . TYR A 1 46  ? -0.715  -4.005  3.282   1.00 0.00 ? 46  TYR A CZ   3  
ATOM 4588  O OH   . TYR A 1 46  ? -1.194  -2.808  3.852   1.00 0.00 ? 46  TYR A OH   3  
ATOM 4589  H H    . TYR A 1 46  ? -1.257  -10.326 1.394   1.00 0.00 ? 46  TYR A H    3  
ATOM 4590  H HA   . TYR A 1 46  ? -1.319  -7.679  0.053   1.00 0.00 ? 46  TYR A HA   3  
ATOM 4591  H HB2  . TYR A 1 46  ? -0.657  -8.487  2.594   1.00 0.00 ? 46  TYR A HB2  3  
ATOM 4592  H HB3  . TYR A 1 46  ? 1.030   -8.293  1.927   1.00 0.00 ? 46  TYR A HB3  3  
ATOM 4593  H HD1  . TYR A 1 46  ? 0.678   -6.904  4.174   1.00 0.00 ? 46  TYR A HD1  3  
ATOM 4594  H HD2  . TYR A 1 46  ? -0.843  -5.653  0.385   1.00 0.00 ? 46  TYR A HD2  3  
ATOM 4595  H HE1  . TYR A 1 46  ? -0.139  -4.849  5.150   1.00 0.00 ? 46  TYR A HE1  3  
ATOM 4596  H HE2  . TYR A 1 46  ? -1.229  -3.473  1.275   1.00 0.00 ? 46  TYR A HE2  3  
ATOM 4597  H HH   . TYR A 1 46  ? -1.906  -2.520  3.271   1.00 0.00 ? 46  TYR A HH   3  
ATOM 4598  N N    . ASN A 1 47  ? 1.244   -9.573  -0.586  1.00 0.00 ? 47  ASN A N    3  
ATOM 4599  C CA   . ASN A 1 47  ? 2.220   -9.827  -1.638  1.00 0.00 ? 47  ASN A CA   3  
ATOM 4600  C C    . ASN A 1 47  ? 1.683   -10.154 -3.051  1.00 0.00 ? 47  ASN A C    3  
ATOM 4601  O O    . ASN A 1 47  ? 2.325   -9.833  -4.046  1.00 0.00 ? 47  ASN A O    3  
ATOM 4602  C CB   . ASN A 1 47  ? 3.075   -10.973 -1.150  1.00 0.00 ? 47  ASN A CB   3  
ATOM 4603  C CG   . ASN A 1 47  ? 4.063   -10.535 -0.082  1.00 0.00 ? 47  ASN A CG   3  
ATOM 4604  O OD1  . ASN A 1 47  ? 4.698   -9.488  -0.183  1.00 0.00 ? 47  ASN A OD1  3  
ATOM 4605  N ND2  . ASN A 1 47  ? 4.132   -11.388 0.965   1.00 0.00 ? 47  ASN A ND2  3  
ATOM 4606  H H    . ASN A 1 47  ? 1.308   -10.160 0.235   1.00 0.00 ? 47  ASN A H    3  
ATOM 4607  H HA   . ASN A 1 47  ? 2.828   -8.928  -1.761  1.00 0.00 ? 47  ASN A HA   3  
ATOM 4608  H HB2  . ASN A 1 47  ? 2.349   -11.668 -0.657  1.00 0.00 ? 47  ASN A HB2  3  
ATOM 4609  H HB3  . ASN A 1 47  ? 3.672   -11.355 -1.986  1.00 0.00 ? 47  ASN A HB3  3  
ATOM 4610  H HD21 . ASN A 1 47  ? 4.065   -12.357 0.752   1.00 0.00 ? 47  ASN A HD21 3  
ATOM 4611  H HD22 . ASN A 1 47  ? 3.538   -11.091 1.731   1.00 0.00 ? 47  ASN A HD22 3  
ATOM 4612  N N    . GLU A 1 48  ? 0.455   -10.740 -3.150  1.00 0.00 ? 48  GLU A N    3  
ATOM 4613  C CA   . GLU A 1 48  ? -0.304  -10.969 -4.392  1.00 0.00 ? 48  GLU A CA   3  
ATOM 4614  C C    . GLU A 1 48  ? -0.865  -9.663  -4.984  1.00 0.00 ? 48  GLU A C    3  
ATOM 4615  O O    . GLU A 1 48  ? -0.805  -9.413  -6.185  1.00 0.00 ? 48  GLU A O    3  
ATOM 4616  C CB   . GLU A 1 48  ? -1.417  -12.037 -4.204  1.00 0.00 ? 48  GLU A CB   3  
ATOM 4617  C CG   . GLU A 1 48  ? -2.067  -12.456 -5.538  1.00 0.00 ? 48  GLU A CG   3  
ATOM 4618  C CD   . GLU A 1 48  ? -2.634  -13.872 -5.480  1.00 0.00 ? 48  GLU A CD   3  
ATOM 4619  O OE1  . GLU A 1 48  ? -1.855  -14.816 -5.182  1.00 0.00 ? 48  GLU A OE1  3  
ATOM 4620  O OE2  . GLU A 1 48  ? -3.853  -14.031 -5.751  1.00 0.00 ? 48  GLU A OE2  3  
ATOM 4621  H H    . GLU A 1 48  ? 0.007   -10.969 -2.287  1.00 0.00 ? 48  GLU A H    3  
ATOM 4622  H HA   . GLU A 1 48  ? 0.364   -11.367 -5.138  1.00 0.00 ? 48  GLU A HA   3  
ATOM 4623  H HB2  . GLU A 1 48  ? -0.934  -12.928 -3.745  1.00 0.00 ? 48  GLU A HB2  3  
ATOM 4624  H HB3  . GLU A 1 48  ? -2.201  -11.680 -3.500  1.00 0.00 ? 48  GLU A HB3  3  
ATOM 4625  H HG2  . GLU A 1 48  ? -2.854  -11.737 -5.832  1.00 0.00 ? 48  GLU A HG2  3  
ATOM 4626  H HG3  . GLU A 1 48  ? -1.300  -12.410 -6.327  1.00 0.00 ? 48  GLU A HG3  3  
ATOM 4627  N N    . TYR A 1 49  ? -1.359  -8.781  -4.077  1.00 0.00 ? 49  TYR A N    3  
ATOM 4628  C CA   . TYR A 1 49  ? -1.834  -7.407  -4.215  1.00 0.00 ? 49  TYR A CA   3  
ATOM 4629  C C    . TYR A 1 49  ? -0.710  -6.383  -4.518  1.00 0.00 ? 49  TYR A C    3  
ATOM 4630  O O    . TYR A 1 49  ? -0.909  -5.425  -5.255  1.00 0.00 ? 49  TYR A O    3  
ATOM 4631  C CB   . TYR A 1 49  ? -2.848  -7.146  -3.032  1.00 0.00 ? 49  TYR A CB   3  
ATOM 4632  C CG   . TYR A 1 49  ? -3.006  -5.741  -2.579  1.00 0.00 ? 49  TYR A CG   3  
ATOM 4633  C CD1  . TYR A 1 49  ? -1.936  -5.268  -1.882  1.00 0.00 ? 49  TYR A CD1  3  
ATOM 4634  C CD2  . TYR A 1 49  ? -4.042  -4.902  -2.888  1.00 0.00 ? 49  TYR A CD2  3  
ATOM 4635  C CE1  . TYR A 1 49  ? -1.694  -3.939  -1.685  1.00 0.00 ? 49  TYR A CE1  3  
ATOM 4636  C CE2  . TYR A 1 49  ? -3.931  -3.588  -2.497  1.00 0.00 ? 49  TYR A CE2  3  
ATOM 4637  C CZ   . TYR A 1 49  ? -2.767  -3.102  -1.935  1.00 0.00 ? 49  TYR A CZ   3  
ATOM 4638  O OH   . TYR A 1 49  ? -2.753  -1.737  -1.661  1.00 0.00 ? 49  TYR A OH   3  
ATOM 4639  H H    . TYR A 1 49  ? -1.363  -9.081  -3.120  1.00 0.00 ? 49  TYR A H    3  
ATOM 4640  H HA   . TYR A 1 49  ? -2.427  -7.336  -5.109  1.00 0.00 ? 49  TYR A HA   3  
ATOM 4641  H HB2  . TYR A 1 49  ? -3.851  -7.558  -3.287  1.00 0.00 ? 49  TYR A HB2  3  
ATOM 4642  H HB3  . TYR A 1 49  ? -2.446  -7.683  -2.144  1.00 0.00 ? 49  TYR A HB3  3  
ATOM 4643  H HD1  . TYR A 1 49  ? -1.204  -6.005  -1.635  1.00 0.00 ? 49  TYR A HD1  3  
ATOM 4644  H HD2  . TYR A 1 49  ? -4.886  -5.236  -3.473  1.00 0.00 ? 49  TYR A HD2  3  
ATOM 4645  H HE1  . TYR A 1 49  ? -0.679  -3.670  -1.356  1.00 0.00 ? 49  TYR A HE1  3  
ATOM 4646  H HE2  . TYR A 1 49  ? -4.749  -2.923  -2.709  1.00 0.00 ? 49  TYR A HE2  3  
ATOM 4647  H HH   . TYR A 1 49  ? -2.037  -1.336  -2.198  1.00 0.00 ? 49  TYR A HH   3  
ATOM 4648  N N    . ILE A 1 50  ? 0.488   -6.562  -3.896  1.00 0.00 ? 50  ILE A N    3  
ATOM 4649  C CA   . ILE A 1 50  ? 1.703   -5.728  -3.845  1.00 0.00 ? 50  ILE A CA   3  
ATOM 4650  C C    . ILE A 1 50  ? 2.316   -5.431  -5.165  1.00 0.00 ? 50  ILE A C    3  
ATOM 4651  O O    . ILE A 1 50  ? 2.760   -4.311  -5.411  1.00 0.00 ? 50  ILE A O    3  
ATOM 4652  C CB   . ILE A 1 50  ? 2.759   -6.462  -2.976  1.00 0.00 ? 50  ILE A CB   3  
ATOM 4653  C CG1  . ILE A 1 50  ? 2.609   -6.231  -1.473  1.00 0.00 ? 50  ILE A CG1  3  
ATOM 4654  C CG2  . ILE A 1 50  ? 4.245   -6.168  -3.199  1.00 0.00 ? 50  ILE A CG2  3  
ATOM 4655  C CD1  . ILE A 1 50  ? 1.477   -5.368  -1.076  1.00 0.00 ? 50  ILE A CD1  3  
ATOM 4656  H H    . ILE A 1 50  ? 0.530   -7.339  -3.254  1.00 0.00 ? 50  ILE A H    3  
ATOM 4657  H HA   . ILE A 1 50  ? 1.436   -4.753  -3.476  1.00 0.00 ? 50  ILE A HA   3  
ATOM 4658  H HB   . ILE A 1 50  ? 2.633   -7.542  -3.190  1.00 0.00 ? 50  ILE A HB   3  
ATOM 4659  H HG12 . ILE A 1 50  ? 2.675   -7.167  -0.885  1.00 0.00 ? 50  ILE A HG12 3  
ATOM 4660  H HG13 . ILE A 1 50  ? 3.369   -5.592  -1.088  1.00 0.00 ? 50  ILE A HG13 3  
ATOM 4661  H HG21 . ILE A 1 50  ? 4.373   -5.077  -3.141  1.00 0.00 ? 50  ILE A HG21 3  
ATOM 4662  H HG22 . ILE A 1 50  ? 4.790   -6.627  -2.345  1.00 0.00 ? 50  ILE A HG22 3  
ATOM 4663  H HG23 . ILE A 1 50  ? 4.627   -6.564  -4.154  1.00 0.00 ? 50  ILE A HG23 3  
ATOM 4664  H HD11 . ILE A 1 50  ? 0.611   -5.866  -1.480  1.00 0.00 ? 50  ILE A HD11 3  
ATOM 4665  H HD12 . ILE A 1 50  ? 1.455   -5.351  0.028   1.00 0.00 ? 50  ILE A HD12 3  
ATOM 4666  H HD13 . ILE A 1 50  ? 1.587   -4.362  -1.529  1.00 0.00 ? 50  ILE A HD13 3  
ATOM 4667  N N    . SER A 1 51  ? 2.322   -6.429  -6.063  1.00 0.00 ? 51  SER A N    3  
ATOM 4668  C CA   . SER A 1 51  ? 2.803   -6.246  -7.434  1.00 0.00 ? 51  SER A CA   3  
ATOM 4669  C C    . SER A 1 51  ? 1.681   -5.839  -8.402  1.00 0.00 ? 51  SER A C    3  
ATOM 4670  O O    . SER A 1 51  ? 1.229   -6.627  -9.226  1.00 0.00 ? 51  SER A O    3  
ATOM 4671  C CB   . SER A 1 51  ? 3.568   -7.467  -8.025  1.00 0.00 ? 51  SER A CB   3  
ATOM 4672  O OG   . SER A 1 51  ? 4.859   -7.591  -7.436  1.00 0.00 ? 51  SER A OG   3  
ATOM 4673  H H    . SER A 1 51  ? 1.949   -7.301  -5.732  1.00 0.00 ? 51  SER A H    3  
ATOM 4674  H HA   . SER A 1 51  ? 3.491   -5.414  -7.377  1.00 0.00 ? 51  SER A HA   3  
ATOM 4675  H HB2  . SER A 1 51  ? 2.986   -8.401  -7.858  1.00 0.00 ? 51  SER A HB2  3  
ATOM 4676  H HB3  . SER A 1 51  ? 3.742   -7.357  -9.120  1.00 0.00 ? 51  SER A HB3  3  
ATOM 4677  H HG   . SER A 1 51  ? 4.741   -7.524  -6.484  1.00 0.00 ? 51  SER A HG   3  
ATOM 4678  N N    . HIS A 1 52  ? 1.223   -4.563  -8.285  1.00 0.00 ? 52  HIS A N    3  
ATOM 4679  C CA   . HIS A 1 52  ? 0.154   -3.940  -9.066  1.00 0.00 ? 52  HIS A CA   3  
ATOM 4680  C C    . HIS A 1 52  ? 0.343   -2.416  -8.953  1.00 0.00 ? 52  HIS A C    3  
ATOM 4681  O O    . HIS A 1 52  ? 1.421   -1.945  -8.600  1.00 0.00 ? 52  HIS A O    3  
ATOM 4682  C CB   . HIS A 1 52  ? -1.237  -4.379  -8.504  1.00 0.00 ? 52  HIS A CB   3  
ATOM 4683  C CG   . HIS A 1 52  ? -1.785  -5.697  -8.982  1.00 0.00 ? 52  HIS A CG   3  
ATOM 4684  N ND1  . HIS A 1 52  ? -2.537  -5.859  -10.132 1.00 0.00 ? 52  HIS A ND1  3  
ATOM 4685  C CD2  . HIS A 1 52  ? -1.848  -6.892  -8.329  1.00 0.00 ? 52  HIS A CD2  3  
ATOM 4686  C CE1  . HIS A 1 52  ? -3.025  -7.125  -10.103 1.00 0.00 ? 52  HIS A CE1  3  
ATOM 4687  N NE2  . HIS A 1 52  ? -2.642  -7.781  -9.031  1.00 0.00 ? 52  HIS A NE2  3  
ATOM 4688  H H    . HIS A 1 52  ? 1.642   -3.995  -7.572  1.00 0.00 ? 52  HIS A H    3  
ATOM 4689  H HA   . HIS A 1 52  ? 0.249   -4.208  -10.112 1.00 0.00 ? 52  HIS A HA   3  
ATOM 4690  H HB2  . HIS A 1 52  ? -1.119  -4.485  -7.403  1.00 0.00 ? 52  HIS A HB2  3  
ATOM 4691  H HB3  . HIS A 1 52  ? -2.057  -3.656  -8.688  1.00 0.00 ? 52  HIS A HB3  3  
ATOM 4692  H HD1  . HIS A 1 52  ? -2.695  -5.184  -10.852 1.00 0.00 ? 52  HIS A HD1  3  
ATOM 4693  H HD2  . HIS A 1 52  ? -1.402  -7.204  -7.394  1.00 0.00 ? 52  HIS A HD2  3  
ATOM 4694  H HE1  . HIS A 1 52  ? -3.695  -7.547  -10.854 1.00 0.00 ? 52  HIS A HE1  3  
ATOM 4695  N N    . ARG A 1 53  ? -0.721  -1.587  -9.200  1.00 0.00 ? 53  ARG A N    3  
ATOM 4696  C CA   . ARG A 1 53  ? -0.768  -0.106  -9.110  1.00 0.00 ? 53  ARG A CA   3  
ATOM 4697  C C    . ARG A 1 53  ? -0.769  0.493   -7.701  1.00 0.00 ? 53  ARG A C    3  
ATOM 4698  O O    . ARG A 1 53  ? -0.463  1.657   -7.457  1.00 0.00 ? 53  ARG A O    3  
ATOM 4699  C CB   . ARG A 1 53  ? -2.013  0.475   -9.842  1.00 0.00 ? 53  ARG A CB   3  
ATOM 4700  C CG   . ARG A 1 53  ? -3.363  -0.039  -9.297  1.00 0.00 ? 53  ARG A CG   3  
ATOM 4701  C CD   . ARG A 1 53  ? -4.092  0.783   -8.199  1.00 0.00 ? 53  ARG A CD   3  
ATOM 4702  N NE   . ARG A 1 53  ? -4.498  2.108   -8.787  1.00 0.00 ? 53  ARG A NE   3  
ATOM 4703  C CZ   . ARG A 1 53  ? -5.428  2.937   -8.221  1.00 0.00 ? 53  ARG A CZ   3  
ATOM 4704  N NH1  . ARG A 1 53  ? -6.076  2.590   -7.072  1.00 0.00 ? 53  ARG A NH1  3  
ATOM 4705  N NH2  . ARG A 1 53  ? -5.713  4.132   -8.818  1.00 0.00 ? 53  ARG A NH2  3  
ATOM 4706  H H    . ARG A 1 53  ? -1.578  -1.983  -9.515  1.00 0.00 ? 53  ARG A H    3  
ATOM 4707  H HA   . ARG A 1 53  ? 0.053   0.280   -9.644  1.00 0.00 ? 53  ARG A HA   3  
ATOM 4708  H HB2  . ARG A 1 53  ? -1.999  1.587   -9.862  1.00 0.00 ? 53  ARG A HB2  3  
ATOM 4709  H HB3  . ARG A 1 53  ? -1.937  0.144   -10.905 1.00 0.00 ? 53  ARG A HB3  3  
ATOM 4710  H HG2  . ARG A 1 53  ? -4.044  -0.156  -10.166 1.00 0.00 ? 53  ARG A HG2  3  
ATOM 4711  H HG3  . ARG A 1 53  ? -3.123  -1.043  -8.905  1.00 0.00 ? 53  ARG A HG3  3  
ATOM 4712  H HD2  . ARG A 1 53  ? -4.992  0.220   -7.859  1.00 0.00 ? 53  ARG A HD2  3  
ATOM 4713  H HD3  . ARG A 1 53  ? -3.477  0.971   -7.286  1.00 0.00 ? 53  ARG A HD3  3  
ATOM 4714  H HE   . ARG A 1 53  ? -4.050  2.403   -9.632  1.00 0.00 ? 53  ARG A HE   3  
ATOM 4715  H HH11 . ARG A 1 53  ? -5.872  1.717   -6.628  1.00 0.00 ? 53  ARG A HH11 3  
ATOM 4716  H HH12 . ARG A 1 53  ? -6.754  3.207   -6.674  1.00 0.00 ? 53  ARG A HH12 3  
ATOM 4717  H HH21 . ARG A 1 53  ? -5.242  4.393   -9.661  1.00 0.00 ? 53  ARG A HH21 3  
ATOM 4718  H HH22 . ARG A 1 53  ? -6.391  4.744   -8.412  1.00 0.00 ? 53  ARG A HH22 3  
ATOM 4719  N N    . GLU A 1 54  ? -1.255  -0.381  -6.807  1.00 0.00 ? 54  GLU A N    3  
ATOM 4720  C CA   . GLU A 1 54  ? -1.667  -0.278  -5.432  1.00 0.00 ? 54  GLU A CA   3  
ATOM 4721  C C    . GLU A 1 54  ? -0.640  -0.564  -4.366  1.00 0.00 ? 54  GLU A C    3  
ATOM 4722  O O    . GLU A 1 54  ? -1.027  -0.742  -3.216  1.00 0.00 ? 54  GLU A O    3  
ATOM 4723  C CB   . GLU A 1 54  ? -2.862  -1.261  -5.267  1.00 0.00 ? 54  GLU A CB   3  
ATOM 4724  C CG   . GLU A 1 54  ? -2.510  -2.743  -5.531  1.00 0.00 ? 54  GLU A CG   3  
ATOM 4725  C CD   . GLU A 1 54  ? -3.635  -3.481  -6.264  1.00 0.00 ? 54  GLU A CD   3  
ATOM 4726  O OE1  . GLU A 1 54  ? -3.938  -4.641  -5.881  1.00 0.00 ? 54  GLU A OE1  3  
ATOM 4727  O OE2  . GLU A 1 54  ? -4.181  -2.911  -7.247  1.00 0.00 ? 54  GLU A OE2  3  
ATOM 4728  H H    . GLU A 1 54  ? -1.467  -1.262  -7.212  1.00 0.00 ? 54  GLU A H    3  
ATOM 4729  H HA   . GLU A 1 54  ? -2.015  0.732   -5.258  1.00 0.00 ? 54  GLU A HA   3  
ATOM 4730  H HB2  . GLU A 1 54  ? -3.334  -1.172  -4.263  1.00 0.00 ? 54  GLU A HB2  3  
ATOM 4731  H HB3  . GLU A 1 54  ? -3.638  -0.929  -5.989  1.00 0.00 ? 54  GLU A HB3  3  
ATOM 4732  H HG2  . GLU A 1 54  ? -1.585  -2.843  -6.130  1.00 0.00 ? 54  GLU A HG2  3  
ATOM 4733  H HG3  . GLU A 1 54  ? -2.277  -3.246  -4.570  1.00 0.00 ? 54  GLU A HG3  3  
ATOM 4734  N N    . HIS A 1 55  ? 0.678   -0.681  -4.698  1.00 0.00 ? 55  HIS A N    3  
ATOM 4735  C CA   . HIS A 1 55  ? 1.783   -1.036  -3.799  1.00 0.00 ? 55  HIS A CA   3  
ATOM 4736  C C    . HIS A 1 55  ? 1.965   -0.251  -2.487  1.00 0.00 ? 55  HIS A C    3  
ATOM 4737  O O    . HIS A 1 55  ? 2.747   0.680   -2.331  1.00 0.00 ? 55  HIS A O    3  
ATOM 4738  C CB   . HIS A 1 55  ? 3.147   -1.200  -4.512  1.00 0.00 ? 55  HIS A CB   3  
ATOM 4739  C CG   . HIS A 1 55  ? 4.182   -1.831  -3.604  1.00 0.00 ? 55  HIS A CG   3  
ATOM 4740  N ND1  . HIS A 1 55  ? 5.423   -1.275  -3.395  1.00 0.00 ? 55  HIS A ND1  3  
ATOM 4741  C CD2  . HIS A 1 55  ? 4.068   -2.840  -2.693  1.00 0.00 ? 55  HIS A CD2  3  
ATOM 4742  C CE1  . HIS A 1 55  ? 6.002   -1.961  -2.382  1.00 0.00 ? 55  HIS A CE1  3  
ATOM 4743  N NE2  . HIS A 1 55  ? 5.216   -2.913  -1.920  1.00 0.00 ? 55  HIS A NE2  3  
ATOM 4744  H H    . HIS A 1 55  ? 0.936   -0.544  -5.652  1.00 0.00 ? 55  HIS A H    3  
ATOM 4745  H HA   . HIS A 1 55  ? 1.550   -2.046  -3.488  1.00 0.00 ? 55  HIS A HA   3  
ATOM 4746  H HB2  . HIS A 1 55  ? 3.011   -1.868  -5.397  1.00 0.00 ? 55  HIS A HB2  3  
ATOM 4747  H HB3  . HIS A 1 55  ? 3.506   -0.196  -4.851  1.00 0.00 ? 55  HIS A HB3  3  
ATOM 4748  H HD1  . HIS A 1 55  ? 5.762   -0.455  -3.851  1.00 0.00 ? 55  HIS A HD1  3  
ATOM 4749  H HD2  . HIS A 1 55  ? 3.257   -3.549  -2.512  1.00 0.00 ? 55  HIS A HD2  3  
ATOM 4750  H HE1  . HIS A 1 55  ? 6.992   -1.722  -1.991  1.00 0.00 ? 55  HIS A HE1  3  
ATOM 4751  N N    . ILE A 1 56  ? 1.200   -0.758  -1.507  1.00 0.00 ? 56  ILE A N    3  
ATOM 4752  C CA   . ILE A 1 56  ? 1.080   -0.420  -0.118  1.00 0.00 ? 56  ILE A CA   3  
ATOM 4753  C C    . ILE A 1 56  ? 1.593   -1.641  0.585   1.00 0.00 ? 56  ILE A C    3  
ATOM 4754  O O    . ILE A 1 56  ? 1.119   -2.734  0.300   1.00 0.00 ? 56  ILE A O    3  
ATOM 4755  C CB   . ILE A 1 56  ? -0.368  -0.244  0.258   1.00 0.00 ? 56  ILE A CB   3  
ATOM 4756  C CG1  . ILE A 1 56  ? -0.880  0.998   -0.485  1.00 0.00 ? 56  ILE A CG1  3  
ATOM 4757  C CG2  . ILE A 1 56  ? -0.641  -0.087  1.779   1.00 0.00 ? 56  ILE A CG2  3  
ATOM 4758  C CD1  . ILE A 1 56  ? -2.353  1.096   -0.199  1.00 0.00 ? 56  ILE A CD1  3  
ATOM 4759  H H    . ILE A 1 56  ? 0.581   -1.492  -1.768  1.00 0.00 ? 56  ILE A H    3  
ATOM 4760  H HA   . ILE A 1 56  ? 1.559   0.502   0.153   1.00 0.00 ? 56  ILE A HA   3  
ATOM 4761  H HB   . ILE A 1 56  ? -0.948  -1.128  -0.097  1.00 0.00 ? 56  ILE A HB   3  
ATOM 4762  H HG12 . ILE A 1 56  ? -0.347  1.909   -0.132  1.00 0.00 ? 56  ILE A HG12 3  
ATOM 4763  H HG13 . ILE A 1 56  ? -0.719  0.916   -1.578  1.00 0.00 ? 56  ILE A HG13 3  
ATOM 4764  H HG21 . ILE A 1 56  ? -0.126  -0.826  2.422   1.00 0.00 ? 56  ILE A HG21 3  
ATOM 4765  H HG22 . ILE A 1 56  ? -0.339  0.929   2.099   1.00 0.00 ? 56  ILE A HG22 3  
ATOM 4766  H HG23 . ILE A 1 56  ? -1.726  -0.195  1.988   1.00 0.00 ? 56  ILE A HG23 3  
ATOM 4767  H HD11 . ILE A 1 56  ? -2.748  0.054   -0.182  1.00 0.00 ? 56  ILE A HD11 3  
ATOM 4768  H HD12 . ILE A 1 56  ? -2.433  1.525   0.821   1.00 0.00 ? 56  ILE A HD12 3  
ATOM 4769  H HD13 . ILE A 1 56  ? -2.889  1.694   -0.967  1.00 0.00 ? 56  ILE A HD13 3  
ATOM 4770  N N    . HIS A 1 57  ? 2.508   -1.499  1.552   1.00 0.00 ? 57  HIS A N    3  
ATOM 4771  C CA   . HIS A 1 57  ? 2.913   -2.567  2.439   1.00 0.00 ? 57  HIS A CA   3  
ATOM 4772  C C    . HIS A 1 57  ? 2.345   -2.136  3.780   1.00 0.00 ? 57  HIS A C    3  
ATOM 4773  O O    . HIS A 1 57  ? 1.992   -0.967  3.940   1.00 0.00 ? 57  HIS A O    3  
ATOM 4774  C CB   . HIS A 1 57  ? 4.451   -2.730  2.439   1.00 0.00 ? 57  HIS A CB   3  
ATOM 4775  C CG   . HIS A 1 57  ? 4.813   -4.092  1.914   1.00 0.00 ? 57  HIS A CG   3  
ATOM 4776  N ND1  . HIS A 1 57  ? 5.089   -4.457  0.611   1.00 0.00 ? 57  HIS A ND1  3  
ATOM 4777  C CD2  . HIS A 1 57  ? 4.761   -5.249  2.618   1.00 0.00 ? 57  HIS A CD2  3  
ATOM 4778  C CE1  . HIS A 1 57  ? 5.213   -5.814  0.608   1.00 0.00 ? 57  HIS A CE1  3  
ATOM 4779  N NE2  . HIS A 1 57  ? 5.004   -6.333  1.806   1.00 0.00 ? 57  HIS A NE2  3  
ATOM 4780  H H    . HIS A 1 57  ? 2.870   -0.611  1.809   1.00 0.00 ? 57  HIS A H    3  
ATOM 4781  H HA   . HIS A 1 57  ? 2.444   -3.513  2.181   1.00 0.00 ? 57  HIS A HA   3  
ATOM 4782  H HB2  . HIS A 1 57  ? 4.901   -1.910  1.835   1.00 0.00 ? 57  HIS A HB2  3  
ATOM 4783  H HB3  . HIS A 1 57  ? 4.904   -2.666  3.452   1.00 0.00 ? 57  HIS A HB3  3  
ATOM 4784  H HD1  . HIS A 1 57  ? 5.098   -3.856  -0.209  1.00 0.00 ? 57  HIS A HD1  3  
ATOM 4785  H HD2  . HIS A 1 57  ? 4.505   -5.370  3.661   1.00 0.00 ? 57  HIS A HD2  3  
ATOM 4786  H HE1  . HIS A 1 57  ? 5.430   -6.401  -0.287  1.00 0.00 ? 57  HIS A HE1  3  
ATOM 4787  N N    . MET A 1 58  ? 2.279   -3.038  4.805   1.00 0.00 ? 58  MET A N    3  
ATOM 4788  C CA   . MET A 1 58  ? 1.697   -2.887  6.164   1.00 0.00 ? 58  MET A CA   3  
ATOM 4789  C C    . MET A 1 58  ? 2.134   -1.673  6.992   1.00 0.00 ? 58  MET A C    3  
ATOM 4790  O O    . MET A 1 58  ? 1.548   -1.250  7.982   1.00 0.00 ? 58  MET A O    3  
ATOM 4791  C CB   . MET A 1 58  ? 2.089   -4.190  6.932   1.00 0.00 ? 58  MET A CB   3  
ATOM 4792  C CG   . MET A 1 58  ? 1.774   -4.268  8.439   1.00 0.00 ? 58  MET A CG   3  
ATOM 4793  S SD   . MET A 1 58  ? 0.062   -3.891  8.909   1.00 0.00 ? 58  MET A SD   3  
ATOM 4794  C CE   . MET A 1 58  ? -0.487  -5.490  8.328   1.00 0.00 ? 58  MET A CE   3  
ATOM 4795  H H    . MET A 1 58  ? 2.586   -3.967  4.623   1.00 0.00 ? 58  MET A H    3  
ATOM 4796  H HA   . MET A 1 58  ? 0.622   -2.828  6.073   1.00 0.00 ? 58  MET A HA   3  
ATOM 4797  H HB2  . MET A 1 58  ? 1.600   -5.049  6.425   1.00 0.00 ? 58  MET A HB2  3  
ATOM 4798  H HB3  . MET A 1 58  ? 3.185   -4.357  6.832   1.00 0.00 ? 58  MET A HB3  3  
ATOM 4799  H HG2  . MET A 1 58  ? 2.047   -5.279  8.807   1.00 0.00 ? 58  MET A HG2  3  
ATOM 4800  H HG3  . MET A 1 58  ? 2.456   -3.572  8.977   1.00 0.00 ? 58  MET A HG3  3  
ATOM 4801  H HE1  . MET A 1 58  ? 0.182   -6.273  8.752   1.00 0.00 ? 58  MET A HE1  3  
ATOM 4802  H HE2  . MET A 1 58  ? -1.527  -5.674  8.665   1.00 0.00 ? 58  MET A HE2  3  
ATOM 4803  H HE3  . MET A 1 58  ? -0.458  -5.563  7.224   1.00 0.00 ? 58  MET A HE3  3  
ATOM 4804  N N    . ASN A 1 59  ? 3.232   -1.090  6.527   1.00 0.00 ? 59  ASN A N    3  
ATOM 4805  C CA   . ASN A 1 59  ? 4.035   -0.017  6.980   1.00 0.00 ? 59  ASN A CA   3  
ATOM 4806  C C    . ASN A 1 59  ? 3.423   1.366   6.671   1.00 0.00 ? 59  ASN A C    3  
ATOM 4807  O O    . ASN A 1 59  ? 3.729   2.353   7.335   1.00 0.00 ? 59  ASN A O    3  
ATOM 4808  C CB   . ASN A 1 59  ? 5.361   -0.338  6.232   1.00 0.00 ? 59  ASN A CB   3  
ATOM 4809  C CG   . ASN A 1 59  ? 5.941   -1.707  6.658   1.00 0.00 ? 59  ASN A CG   3  
ATOM 4810  O OD1  . ASN A 1 59  ? 6.868   -1.673  7.468   1.00 0.00 ? 59  ASN A OD1  3  
ATOM 4811  N ND2  . ASN A 1 59  ? 5.516   -2.921  6.164   1.00 0.00 ? 59  ASN A ND2  3  
ATOM 4812  H H    . ASN A 1 59  ? 3.597   -1.481  5.688   1.00 0.00 ? 59  ASN A H    3  
ATOM 4813  H HA   . ASN A 1 59  ? 4.152   -0.091  8.058   1.00 0.00 ? 59  ASN A HA   3  
ATOM 4814  H HB2  . ASN A 1 59  ? 5.210   -0.338  5.133   1.00 0.00 ? 59  ASN A HB2  3  
ATOM 4815  H HB3  . ASN A 1 59  ? 6.128   0.426   6.491   1.00 0.00 ? 59  ASN A HB3  3  
ATOM 4816  H HD21 . ASN A 1 59  ? 4.586   -3.210  5.875   1.00 0.00 ? 59  ASN A HD21 3  
ATOM 4817  H HD22 . ASN A 1 59  ? 6.130   -3.666  6.413   1.00 0.00 ? 59  ASN A HD22 3  
ATOM 4818  N N    . ALA A 1 60  ? 2.502   1.446   5.660   1.00 0.00 ? 60  ALA A N    3  
ATOM 4819  C CA   . ALA A 1 60  ? 1.774   2.632   5.181   1.00 0.00 ? 60  ALA A CA   3  
ATOM 4820  C C    . ALA A 1 60  ? 0.387   2.893   5.834   1.00 0.00 ? 60  ALA A C    3  
ATOM 4821  O O    . ALA A 1 60  ? -0.546  3.367   5.181   1.00 0.00 ? 60  ALA A O    3  
ATOM 4822  C CB   . ALA A 1 60  ? 1.550   2.415   3.658   1.00 0.00 ? 60  ALA A CB   3  
ATOM 4823  H H    . ALA A 1 60  ? 2.301   0.612   5.124   1.00 0.00 ? 60  ALA A H    3  
ATOM 4824  H HA   . ALA A 1 60  ? 2.380   3.517   5.337   1.00 0.00 ? 60  ALA A HA   3  
ATOM 4825  H HB1  . ALA A 1 60  ? 2.526   2.281   3.146   1.00 0.00 ? 60  ALA A HB1  3  
ATOM 4826  H HB2  . ALA A 1 60  ? 0.940   1.503   3.465   1.00 0.00 ? 60  ALA A HB2  3  
ATOM 4827  H HB3  . ALA A 1 60  ? 1.020   3.262   3.173   1.00 0.00 ? 60  ALA A HB3  3  
ATOM 4828  N N    . THR A 1 61  ? 0.205   2.510   7.128   1.00 0.00 ? 61  THR A N    3  
ATOM 4829  C CA   . THR A 1 61  ? -1.094  2.508   7.819   1.00 0.00 ? 61  THR A CA   3  
ATOM 4830  C C    . THR A 1 61  ? -0.943  2.488   9.362   1.00 0.00 ? 61  THR A C    3  
ATOM 4831  O O    . THR A 1 61  ? 0.158   2.622   9.889   1.00 0.00 ? 61  THR A O    3  
ATOM 4832  C CB   . THR A 1 61  ? -2.068  1.535   7.150   1.00 0.00 ? 61  THR A CB   3  
ATOM 4833  O OG1  . THR A 1 61  ? -3.301  1.358   7.846   1.00 0.00 ? 61  THR A OG1  3  
ATOM 4834  C CG2  . THR A 1 61  ? -1.387  0.194   6.816   1.00 0.00 ? 61  THR A CG2  3  
ATOM 4835  H H    . THR A 1 61  ? 0.964   2.126   7.653   1.00 0.00 ? 61  THR A H    3  
ATOM 4836  H HA   . THR A 1 61  ? -1.610  3.420   7.631   1.00 0.00 ? 61  THR A HA   3  
ATOM 4837  H HB   . THR A 1 61  ? -2.356  1.983   6.165   1.00 0.00 ? 61  THR A HB   3  
ATOM 4838  H HG1  . THR A 1 61  ? -3.543  0.438   7.666   1.00 0.00 ? 61  THR A HG1  3  
ATOM 4839  H HG21 . THR A 1 61  ? -0.518  0.317   6.142   1.00 0.00 ? 61  THR A HG21 3  
ATOM 4840  H HG22 . THR A 1 61  ? -1.038  -0.330  7.730   1.00 0.00 ? 61  THR A HG22 3  
ATOM 4841  H HG23 . THR A 1 61  ? -2.089  -0.438  6.242   1.00 0.00 ? 61  THR A HG23 3  
ATOM 4842  N N    . GLN A 1 62  ? -2.074  2.375   10.125  1.00 0.00 ? 62  GLN A N    3  
ATOM 4843  C CA   . GLN A 1 62  ? -2.277  2.471   11.591  1.00 0.00 ? 62  GLN A CA   3  
ATOM 4844  C C    . GLN A 1 62  ? -2.232  1.122   12.338  1.00 0.00 ? 62  GLN A C    3  
ATOM 4845  O O    . GLN A 1 62  ? -2.486  0.959   13.536  1.00 0.00 ? 62  GLN A O    3  
ATOM 4846  C CB   . GLN A 1 62  ? -3.666  3.151   11.769  1.00 0.00 ? 62  GLN A CB   3  
ATOM 4847  C CG   . GLN A 1 62  ? -4.083  3.696   13.155  1.00 0.00 ? 62  GLN A CG   3  
ATOM 4848  C CD   . GLN A 1 62  ? -5.419  4.445   13.001  1.00 0.00 ? 62  GLN A CD   3  
ATOM 4849  O OE1  . GLN A 1 62  ? -5.471  5.677   12.999  1.00 0.00 ? 62  GLN A OE1  3  
ATOM 4850  N NE2  . GLN A 1 62  ? -6.527  3.682   12.779  1.00 0.00 ? 62  GLN A NE2  3  
ATOM 4851  H H    . GLN A 1 62  ? -2.919  2.255   9.597   1.00 0.00 ? 62  GLN A H    3  
ATOM 4852  H HA   . GLN A 1 62  ? -1.502  3.103   12.007  1.00 0.00 ? 62  GLN A HA   3  
ATOM 4853  H HB2  . GLN A 1 62  ? -3.674  4.023   11.073  1.00 0.00 ? 62  GLN A HB2  3  
ATOM 4854  H HB3  . GLN A 1 62  ? -4.452  2.444   11.419  1.00 0.00 ? 62  GLN A HB3  3  
ATOM 4855  H HG2  . GLN A 1 62  ? -4.212  2.865   13.891  1.00 0.00 ? 62  GLN A HG2  3  
ATOM 4856  H HG3  . GLN A 1 62  ? -3.321  4.437   13.501  1.00 0.00 ? 62  GLN A HG3  3  
ATOM 4857  H HE21 . GLN A 1 62  ? -6.531  2.686   12.883  1.00 0.00 ? 62  GLN A HE21 3  
ATOM 4858  H HE22 . GLN A 1 62  ? -7.342  4.158   12.461  1.00 0.00 ? 62  GLN A HE22 3  
ATOM 4859  N N    . TRP A 1 63  ? -1.866  0.095   11.555  1.00 0.00 ? 63  TRP A N    3  
ATOM 4860  C CA   . TRP A 1 63  ? -1.678  -1.292  11.916  1.00 0.00 ? 63  TRP A CA   3  
ATOM 4861  C C    . TRP A 1 63  ? -0.165  -1.521  11.846  1.00 0.00 ? 63  TRP A C    3  
ATOM 4862  O O    . TRP A 1 63  ? 0.509   -0.802  11.114  1.00 0.00 ? 63  TRP A O    3  
ATOM 4863  C CB   . TRP A 1 63  ? -2.558  -2.206  11.052  1.00 0.00 ? 63  TRP A CB   3  
ATOM 4864  C CG   . TRP A 1 63  ? -3.934  -1.620  10.650  1.00 0.00 ? 63  TRP A CG   3  
ATOM 4865  C CD1  . TRP A 1 63  ? -5.047  -1.358  11.409  1.00 0.00 ? 63  TRP A CD1  3  
ATOM 4866  C CD2  . TRP A 1 63  ? -4.341  -1.430  9.282   1.00 0.00 ? 63  TRP A CD2  3  
ATOM 4867  N NE1  . TRP A 1 63  ? -6.125  -1.065  10.587  1.00 0.00 ? 63  TRP A NE1  3  
ATOM 4868  C CE2  . TRP A 1 63  ? -5.693  -1.113  9.279   1.00 0.00 ? 63  TRP A CE2  3  
ATOM 4869  C CE3  . TRP A 1 63  ? -3.655  -1.558  8.115   1.00 0.00 ? 63  TRP A CE3  3  
ATOM 4870  C CZ2  . TRP A 1 63  ? -6.363  -0.942  8.099   1.00 0.00 ? 63  TRP A CZ2  3  
ATOM 4871  C CZ3  . TRP A 1 63  ? -4.345  -1.455  6.922   1.00 0.00 ? 63  TRP A CZ3  3  
ATOM 4872  C CH2  . TRP A 1 63  ? -5.687  -1.156  6.916   1.00 0.00 ? 63  TRP A CH2  3  
ATOM 4873  H H    . TRP A 1 63  ? -1.649  0.314   10.608  1.00 0.00 ? 63  TRP A H    3  
ATOM 4874  H HA   . TRP A 1 63  ? -2.044  -1.561  12.884  1.00 0.00 ? 63  TRP A HA   3  
ATOM 4875  H HB2  . TRP A 1 63  ? -1.997  -2.527  10.146  1.00 0.00 ? 63  TRP A HB2  3  
ATOM 4876  H HB3  . TRP A 1 63  ? -2.780  -3.104  11.690  1.00 0.00 ? 63  TRP A HB3  3  
ATOM 4877  H HD1  . TRP A 1 63  ? -5.081  -1.423  12.486  1.00 0.00 ? 63  TRP A HD1  3  
ATOM 4878  H HE1  . TRP A 1 63  ? -7.050  -0.908  10.885  1.00 0.00 ? 63  TRP A HE1  3  
ATOM 4879  H HE3  . TRP A 1 63  ? -2.583  -1.665  8.118   1.00 0.00 ? 63  TRP A HE3  3  
ATOM 4880  H HZ2  . TRP A 1 63  ? -7.418  -0.733  8.063   1.00 0.00 ? 63  TRP A HZ2  3  
ATOM 4881  H HZ3  . TRP A 1 63  ? -3.821  -1.600  5.984   1.00 0.00 ? 63  TRP A HZ3  3  
ATOM 4882  H HH2  . TRP A 1 63  ? -6.232  -1.115  5.981   1.00 0.00 ? 63  TRP A HH2  3  
ATOM 4883  N N    . GLU A 1 64  ? 0.428   -2.473  12.611  1.00 0.00 ? 64  GLU A N    3  
ATOM 4884  C CA   . GLU A 1 64  ? 1.884   -2.635  12.616  1.00 0.00 ? 64  GLU A CA   3  
ATOM 4885  C C    . GLU A 1 64  ? 2.362   -3.983  12.121  1.00 0.00 ? 64  GLU A C    3  
ATOM 4886  O O    . GLU A 1 64  ? 3.194   -4.072  11.221  1.00 0.00 ? 64  GLU A O    3  
ATOM 4887  C CB   . GLU A 1 64  ? 2.479   -2.332  14.002  1.00 0.00 ? 64  GLU A CB   3  
ATOM 4888  C CG   . GLU A 1 64  ? 4.019   -2.231  14.003  1.00 0.00 ? 64  GLU A CG   3  
ATOM 4889  C CD   . GLU A 1 64  ? 4.533   -1.133  13.069  1.00 0.00 ? 64  GLU A CD   3  
ATOM 4890  O OE1  . GLU A 1 64  ? 5.303   -1.464  12.129  1.00 0.00 ? 64  GLU A OE1  3  
ATOM 4891  O OE2  . GLU A 1 64  ? 4.162   0.052   13.285  1.00 0.00 ? 64  GLU A OE2  3  
ATOM 4892  H H    . GLU A 1 64  ? -0.101  -3.047  13.231  1.00 0.00 ? 64  GLU A H    3  
ATOM 4893  H HA   . GLU A 1 64  ? 2.395   -1.906  11.997  1.00 0.00 ? 64  GLU A HA   3  
ATOM 4894  H HB2  . GLU A 1 64  ? 2.071   -1.354  14.345  1.00 0.00 ? 64  GLU A HB2  3  
ATOM 4895  H HB3  . GLU A 1 64  ? 2.165   -3.088  14.754  1.00 0.00 ? 64  GLU A HB3  3  
ATOM 4896  H HG2  . GLU A 1 64  ? 4.303   -1.976  15.026  1.00 0.00 ? 64  GLU A HG2  3  
ATOM 4897  H HG3  . GLU A 1 64  ? 4.486   -3.206  13.749  1.00 0.00 ? 64  GLU A HG3  3  
ATOM 4898  N N    . THR A 1 65  ? 1.881   -5.074  12.766  1.00 0.00 ? 65  THR A N    3  
ATOM 4899  C CA   . THR A 1 65  ? 2.330   -6.457  12.576  1.00 0.00 ? 65  THR A CA   3  
ATOM 4900  C C    . THR A 1 65  ? 1.606   -7.200  11.453  1.00 0.00 ? 65  THR A C    3  
ATOM 4901  O O    . THR A 1 65  ? 2.178   -7.558  10.426  1.00 0.00 ? 65  THR A O    3  
ATOM 4902  C CB   . THR A 1 65  ? 2.252   -7.220  13.922  1.00 0.00 ? 65  THR A CB   3  
ATOM 4903  O OG1  . THR A 1 65  ? 0.920   -7.351  14.421  1.00 0.00 ? 65  THR A OG1  3  
ATOM 4904  C CG2  . THR A 1 65  ? 2.981   -6.412  15.007  1.00 0.00 ? 65  THR A CG2  3  
ATOM 4905  H H    . THR A 1 65  ? 1.237   -4.960  13.515  1.00 0.00 ? 65  THR A H    3  
ATOM 4906  H HA   . THR A 1 65  ? 3.361   -6.428  12.256  1.00 0.00 ? 65  THR A HA   3  
ATOM 4907  H HB   . THR A 1 65  ? 2.738   -8.220  13.818  1.00 0.00 ? 65  THR A HB   3  
ATOM 4908  H HG1  . THR A 1 65  ? 0.877   -8.173  14.949  1.00 0.00 ? 65  THR A HG1  3  
ATOM 4909  H HG21 . THR A 1 65  ? 3.987   -6.096  14.659  1.00 0.00 ? 65  THR A HG21 3  
ATOM 4910  H HG22 . THR A 1 65  ? 2.386   -5.506  15.274  1.00 0.00 ? 65  THR A HG22 3  
ATOM 4911  H HG23 . THR A 1 65  ? 3.099   -7.018  15.929  1.00 0.00 ? 65  THR A HG23 3  
ATOM 4912  N N    . LEU A 1 66  ? 0.300   -7.385  11.683  1.00 0.00 ? 66  LEU A N    3  
ATOM 4913  C CA   . LEU A 1 66  ? -0.730  -7.945  10.839  1.00 0.00 ? 66  LEU A CA   3  
ATOM 4914  C C    . LEU A 1 66  ? -1.916  -7.993  11.766  1.00 0.00 ? 66  LEU A C    3  
ATOM 4915  O O    . LEU A 1 66  ? -3.037  -7.713  11.364  1.00 0.00 ? 66  LEU A O    3  
ATOM 4916  C CB   . LEU A 1 66  ? -0.439  -9.282  10.058  1.00 0.00 ? 66  LEU A CB   3  
ATOM 4917  C CG   . LEU A 1 66  ? -1.265  -9.553  8.751   1.00 0.00 ? 66  LEU A CG   3  
ATOM 4918  C CD1  . LEU A 1 66  ? -2.713  -9.051  8.825   1.00 0.00 ? 66  LEU A CD1  3  
ATOM 4919  C CD2  . LEU A 1 66  ? -0.593  -9.046  7.458   1.00 0.00 ? 66  LEU A CD2  3  
ATOM 4920  H H    . LEU A 1 66  ? 0.011   -7.040  12.577  1.00 0.00 ? 66  LEU A H    3  
ATOM 4921  H HA   . LEU A 1 66  ? -0.976  -7.189  10.125  1.00 0.00 ? 66  LEU A HA   3  
ATOM 4922  H HB2  . LEU A 1 66  ? 0.622   -9.263  9.725   1.00 0.00 ? 66  LEU A HB2  3  
ATOM 4923  H HB3  . LEU A 1 66  ? -0.554  -10.150 10.748  1.00 0.00 ? 66  LEU A HB3  3  
ATOM 4924  H HG   . LEU A 1 66  ? -1.305  -10.666 8.643   1.00 0.00 ? 66  LEU A HG   3  
ATOM 4925  H HD11 . LEU A 1 66  ? -3.230  -9.557  9.677   1.00 0.00 ? 66  LEU A HD11 3  
ATOM 4926  H HD12 . LEU A 1 66  ? -2.753  -7.948  8.959   1.00 0.00 ? 66  LEU A HD12 3  
ATOM 4927  H HD13 . LEU A 1 66  ? -3.280  -9.247  7.913   1.00 0.00 ? 66  LEU A HD13 3  
ATOM 4928  H HD21 . LEU A 1 66  ? 0.442   -9.432  7.371   1.00 0.00 ? 66  LEU A HD21 3  
ATOM 4929  H HD22 . LEU A 1 66  ? -1.163  -9.335  6.545   1.00 0.00 ? 66  LEU A HD22 3  
ATOM 4930  H HD23 . LEU A 1 66  ? -0.540  -7.945  7.443   1.00 0.00 ? 66  LEU A HD23 3  
ATOM 4931  N N    . THR A 1 67  ? -1.693  -8.262  13.082  1.00 0.00 ? 67  THR A N    3  
ATOM 4932  C CA   . THR A 1 67  ? -2.578  -8.497  14.211  1.00 0.00 ? 67  THR A CA   3  
ATOM 4933  C C    . THR A 1 67  ? -3.540  -7.392  14.449  1.00 0.00 ? 67  THR A C    3  
ATOM 4934  O O    . THR A 1 67  ? -4.712  -7.642  14.613  1.00 0.00 ? 67  THR A O    3  
ATOM 4935  C CB   . THR A 1 67  ? -1.727  -8.614  15.487  1.00 0.00 ? 67  THR A CB   3  
ATOM 4936  O OG1  . THR A 1 67  ? -0.641  -9.499  15.250  1.00 0.00 ? 67  THR A OG1  3  
ATOM 4937  C CG2  . THR A 1 67  ? -2.566  -9.130  16.661  1.00 0.00 ? 67  THR A CG2  3  
ATOM 4938  H H    . THR A 1 67  ? -0.790  -8.453  13.416  1.00 0.00 ? 67  THR A H    3  
ATOM 4939  H HA   . THR A 1 67  ? -3.168  -9.396  14.024  1.00 0.00 ? 67  THR A HA   3  
ATOM 4940  H HB   . THR A 1 67  ? -1.253  -7.647  15.782  1.00 0.00 ? 67  THR A HB   3  
ATOM 4941  H HG1  . THR A 1 67  ? -1.080  -10.348 15.064  1.00 0.00 ? 67  THR A HG1  3  
ATOM 4942  H HG21 . THR A 1 67  ? -3.355  -9.799  16.266  1.00 0.00 ? 67  THR A HG21 3  
ATOM 4943  H HG22 . THR A 1 67  ? -1.955  -9.669  17.413  1.00 0.00 ? 67  THR A HG22 3  
ATOM 4944  H HG23 . THR A 1 67  ? -3.091  -8.291  17.170  1.00 0.00 ? 67  THR A HG23 3  
ATOM 4945  N N    . ASP A 1 68  ? -3.094  -6.125  14.400  1.00 0.00 ? 68  ASP A N    3  
ATOM 4946  C CA   . ASP A 1 68  ? -3.911  -4.921  14.513  1.00 0.00 ? 68  ASP A CA   3  
ATOM 4947  C C    . ASP A 1 68  ? -4.797  -4.585  13.314  1.00 0.00 ? 68  ASP A C    3  
ATOM 4948  O O    . ASP A 1 68  ? -5.871  -4.011  13.462  1.00 0.00 ? 68  ASP A O    3  
ATOM 4949  C CB   . ASP A 1 68  ? -2.977  -3.723  14.841  1.00 0.00 ? 68  ASP A CB   3  
ATOM 4950  C CG   . ASP A 1 68  ? -3.583  -2.797  15.896  1.00 0.00 ? 68  ASP A CG   3  
ATOM 4951  O OD1  . ASP A 1 68  ? -3.836  -3.278  17.032  1.00 0.00 ? 68  ASP A OD1  3  
ATOM 4952  O OD2  . ASP A 1 68  ? -3.800  -1.597  15.577  1.00 0.00 ? 68  ASP A OD2  3  
ATOM 4953  H H    . ASP A 1 68  ? -2.128  -5.943  14.232  1.00 0.00 ? 68  ASP A H    3  
ATOM 4954  H HA   . ASP A 1 68  ? -4.635  -5.154  15.293  1.00 0.00 ? 68  ASP A HA   3  
ATOM 4955  H HB2  . ASP A 1 68  ? -2.015  -4.142  15.206  1.00 0.00 ? 68  ASP A HB2  3  
ATOM 4956  H HB3  . ASP A 1 68  ? -2.706  -3.143  13.938  1.00 0.00 ? 68  ASP A HB3  3  
ATOM 4957  N N    . PHE A 1 69  ? -4.371  -4.991  12.083  1.00 0.00 ? 69  PHE A N    3  
ATOM 4958  C CA   . PHE A 1 69  ? -5.153  -4.920  10.841  1.00 0.00 ? 69  PHE A CA   3  
ATOM 4959  C C    . PHE A 1 69  ? -6.193  -6.027  10.819  1.00 0.00 ? 69  PHE A C    3  
ATOM 4960  O O    . PHE A 1 69  ? -7.299  -5.856  10.326  1.00 0.00 ? 69  PHE A O    3  
ATOM 4961  C CB   . PHE A 1 69  ? -4.261  -4.867  9.563   1.00 0.00 ? 69  PHE A CB   3  
ATOM 4962  C CG   . PHE A 1 69  ? -4.998  -5.025  8.226   1.00 0.00 ? 69  PHE A CG   3  
ATOM 4963  C CD1  . PHE A 1 69  ? -6.073  -4.193  7.963   1.00 0.00 ? 69  PHE A CD1  3  
ATOM 4964  C CD2  . PHE A 1 69  ? -4.705  -5.989  7.280   1.00 0.00 ? 69  PHE A CD2  3  
ATOM 4965  C CE1  . PHE A 1 69  ? -6.776  -4.235  6.778   1.00 0.00 ? 69  PHE A CE1  3  
ATOM 4966  C CE2  . PHE A 1 69  ? -5.457  -6.077  6.122   1.00 0.00 ? 69  PHE A CE2  3  
ATOM 4967  C CZ   . PHE A 1 69  ? -6.466  -5.184  5.843   1.00 0.00 ? 69  PHE A CZ   3  
ATOM 4968  H H    . PHE A 1 69  ? -3.500  -5.473  12.000  1.00 0.00 ? 69  PHE A H    3  
ATOM 4969  H HA   . PHE A 1 69  ? -5.715  -4.003  10.832  1.00 0.00 ? 69  PHE A HA   3  
ATOM 4970  H HB2  . PHE A 1 69  ? -3.826  -3.863  9.488   1.00 0.00 ? 69  PHE A HB2  3  
ATOM 4971  H HB3  . PHE A 1 69  ? -3.364  -5.496  9.705   1.00 0.00 ? 69  PHE A HB3  3  
ATOM 4972  H HD1  . PHE A 1 69  ? -6.387  -3.486  8.713   1.00 0.00 ? 69  PHE A HD1  3  
ATOM 4973  H HD2  . PHE A 1 69  ? -3.907  -6.693  7.450   1.00 0.00 ? 69  PHE A HD2  3  
ATOM 4974  H HE1  . PHE A 1 69  ? -7.573  -3.530  6.589   1.00 0.00 ? 69  PHE A HE1  3  
ATOM 4975  H HE2  . PHE A 1 69  ? -5.257  -6.835  5.385   1.00 0.00 ? 69  PHE A HE2  3  
ATOM 4976  H HZ   . PHE A 1 69  ? -7.018  -5.260  4.914   1.00 0.00 ? 69  PHE A HZ   3  
ATOM 4977  N N    . THR A 1 70  ? -5.852  -7.188  11.426  1.00 0.00 ? 70  THR A N    3  
ATOM 4978  C CA   . THR A 1 70  ? -6.718  -8.351  11.625  1.00 0.00 ? 70  THR A CA   3  
ATOM 4979  C C    . THR A 1 70  ? -7.767  -8.075  12.688  1.00 0.00 ? 70  THR A C    3  
ATOM 4980  O O    . THR A 1 70  ? -8.937  -8.417  12.527  1.00 0.00 ? 70  THR A O    3  
ATOM 4981  C CB   . THR A 1 70  ? -5.975  -9.668  11.734  1.00 0.00 ? 70  THR A CB   3  
ATOM 4982  O OG1  . THR A 1 70  ? -4.652  -9.533  12.180  1.00 0.00 ? 70  THR A OG1  3  
ATOM 4983  C CG2  . THR A 1 70  ? -5.880  -10.266 10.326  1.00 0.00 ? 70  THR A CG2  3  
ATOM 4984  H H    . THR A 1 70  ? -4.945  -7.246  11.862  1.00 0.00 ? 70  THR A H    3  
ATOM 4985  H HA   . THR A 1 70  ? -7.316  -8.460  10.728  1.00 0.00 ? 70  THR A HA   3  
ATOM 4986  H HB   . THR A 1 70  ? -6.421  -10.346 12.478  1.00 0.00 ? 70  THR A HB   3  
ATOM 4987  H HG1  . THR A 1 70  ? -4.193  -8.965  11.534  1.00 0.00 ? 70  THR A HG1  3  
ATOM 4988  H HG21 . THR A 1 70  ? -5.456  -9.531  9.611   1.00 0.00 ? 70  THR A HG21 3  
ATOM 4989  H HG22 . THR A 1 70  ? -5.225  -11.164 10.336  1.00 0.00 ? 70  THR A HG22 3  
ATOM 4990  H HG23 . THR A 1 70  ? -6.881  -10.561 9.948   1.00 0.00 ? 70  THR A HG23 3  
ATOM 4991  N N    . LYS A 1 71  ? -7.364  -7.296  13.750  1.00 0.00 ? 71  LYS A N    3  
ATOM 4992  C CA   . LYS A 1 71  ? -8.306  -6.698  14.723  1.00 0.00 ? 71  LYS A CA   3  
ATOM 4993  C C    . LYS A 1 71  ? -9.322  -5.682  14.131  1.00 0.00 ? 71  LYS A C    3  
ATOM 4994  O O    . LYS A 1 71  ? -10.479 -5.659  14.535  1.00 0.00 ? 71  LYS A O    3  
ATOM 4995  C CB   . LYS A 1 71  ? -7.659  -5.964  15.948  1.00 0.00 ? 71  LYS A CB   3  
ATOM 4996  C CG   . LYS A 1 71  ? -6.644  -6.752  16.804  1.00 0.00 ? 71  LYS A CG   3  
ATOM 4997  C CD   . LYS A 1 71  ? -7.015  -8.232  16.976  1.00 0.00 ? 71  LYS A CD   3  
ATOM 4998  C CE   . LYS A 1 71  ? -6.010  -9.140  17.696  1.00 0.00 ? 71  LYS A CE   3  
ATOM 4999  N NZ   . LYS A 1 71  ? -6.684  -10.331 18.268  1.00 0.00 ? 71  LYS A NZ   3  
ATOM 5000  H H    . LYS A 1 71  ? -6.356  -7.117  13.886  1.00 0.00 ? 71  LYS A H    3  
ATOM 5001  H HA   . LYS A 1 71  ? -8.882  -7.515  15.132  1.00 0.00 ? 71  LYS A HA   3  
ATOM 5002  H HB2  . LYS A 1 71  ? -7.151  -5.027  15.617  1.00 0.00 ? 71  LYS A HB2  3  
ATOM 5003  H HB3  . LYS A 1 71  ? -8.510  -5.695  16.629  1.00 0.00 ? 71  LYS A HB3  3  
ATOM 5004  H HG2  . LYS A 1 71  ? -5.621  -6.641  16.391  1.00 0.00 ? 71  LYS A HG2  3  
ATOM 5005  H HG3  . LYS A 1 71  ? -6.593  -6.276  17.802  1.00 0.00 ? 71  LYS A HG3  3  
ATOM 5006  H HD2  . LYS A 1 71  ? -8.013  -8.279  17.459  1.00 0.00 ? 71  LYS A HD2  3  
ATOM 5007  H HD3  . LYS A 1 71  ? -7.071  -8.648  15.946  1.00 0.00 ? 71  LYS A HD3  3  
ATOM 5008  H HE2  . LYS A 1 71  ? -5.272  -9.504  16.955  1.00 0.00 ? 71  LYS A HE2  3  
ATOM 5009  H HE3  . LYS A 1 71  ? -5.460  -8.654  18.515  1.00 0.00 ? 71  LYS A HE3  3  
ATOM 5010  H HZ1  . LYS A 1 71  ? -7.175  -10.848 17.511  1.00 0.00 ? 71  LYS A HZ1  3  
ATOM 5011  H HZ2  . LYS A 1 71  ? -5.977  -10.952 18.710  1.00 0.00 ? 71  LYS A HZ2  3  
ATOM 5012  H HZ3  . LYS A 1 71  ? -7.375  -10.027 18.984  1.00 0.00 ? 71  LYS A HZ3  3  
ATOM 5013  N N    . TRP A 1 72  ? -8.886  -4.825  13.166  1.00 0.00 ? 72  TRP A N    3  
ATOM 5014  C CA   . TRP A 1 72  ? -9.691  -3.796  12.498  1.00 0.00 ? 72  TRP A CA   3  
ATOM 5015  C C    . TRP A 1 72  ? -10.576 -4.337  11.364  1.00 0.00 ? 72  TRP A C    3  
ATOM 5016  O O    . TRP A 1 72  ? -11.778 -4.134  11.375  1.00 0.00 ? 72  TRP A O    3  
ATOM 5017  C CB   . TRP A 1 72  ? -8.808  -2.580  12.055  1.00 0.00 ? 72  TRP A CB   3  
ATOM 5018  C CG   . TRP A 1 72  ? -9.523  -1.403  11.375  1.00 0.00 ? 72  TRP A CG   3  
ATOM 5019  C CD1  . TRP A 1 72  ? -10.151 -0.309  11.901  1.00 0.00 ? 72  TRP A CD1  3  
ATOM 5020  C CD2  . TRP A 1 72  ? -9.751  -1.357  9.955   1.00 0.00 ? 72  TRP A CD2  3  
ATOM 5021  N NE1  . TRP A 1 72  ? -10.773 0.409   10.898  1.00 0.00 ? 72  TRP A NE1  3  
ATOM 5022  C CE2  . TRP A 1 72  ? -10.548 -0.243  9.693   1.00 0.00 ? 72  TRP A CE2  3  
ATOM 5023  C CE3  . TRP A 1 72  ? -9.362  -2.203  8.958   1.00 0.00 ? 72  TRP A CE3  3  
ATOM 5024  C CZ2  . TRP A 1 72  ? -10.951 0.039   8.413   1.00 0.00 ? 72  TRP A CZ2  3  
ATOM 5025  C CZ3  . TRP A 1 72  ? -9.774  -1.921  7.683   1.00 0.00 ? 72  TRP A CZ3  3  
ATOM 5026  C CH2  . TRP A 1 72  ? -10.524 -0.800  7.402   1.00 0.00 ? 72  TRP A CH2  3  
ATOM 5027  H H    . TRP A 1 72  ? -7.927  -4.908  12.890  1.00 0.00 ? 72  TRP A H    3  
ATOM 5028  H HA   . TRP A 1 72  ? -10.391 -3.398  13.225  1.00 0.00 ? 72  TRP A HA   3  
ATOM 5029  H HB2  . TRP A 1 72  ? -8.307  -2.191  12.973  1.00 0.00 ? 72  TRP A HB2  3  
ATOM 5030  H HB3  . TRP A 1 72  ? -8.014  -2.955  11.371  1.00 0.00 ? 72  TRP A HB3  3  
ATOM 5031  H HD1  . TRP A 1 72  ? -10.164 -0.054  12.951  1.00 0.00 ? 72  TRP A HD1  3  
ATOM 5032  H HE1  . TRP A 1 72  ? -11.335 1.195   11.035  1.00 0.00 ? 72  TRP A HE1  3  
ATOM 5033  H HE3  . TRP A 1 72  ? -8.757  -3.080  9.128   1.00 0.00 ? 72  TRP A HE3  3  
ATOM 5034  H HZ2  . TRP A 1 72  ? -11.595 0.864   8.157   1.00 0.00 ? 72  TRP A HZ2  3  
ATOM 5035  H HZ3  . TRP A 1 72  ? -9.502  -2.611  6.899   1.00 0.00 ? 72  TRP A HZ3  3  
ATOM 5036  H HH2  . TRP A 1 72  ? -10.790 -0.590  6.372   1.00 0.00 ? 72  TRP A HH2  3  
ATOM 5037  N N    . LEU A 1 73  ? -10.031 -5.051  10.342  1.00 0.00 ? 73  LEU A N    3  
ATOM 5038  C CA   . LEU A 1 73  ? -10.719 -5.685  9.192   1.00 0.00 ? 73  LEU A CA   3  
ATOM 5039  C C    . LEU A 1 73  ? -11.659 -6.828  9.521   1.00 0.00 ? 73  LEU A C    3  
ATOM 5040  O O    . LEU A 1 73  ? -12.744 -6.983  8.958   1.00 0.00 ? 73  LEU A O    3  
ATOM 5041  C CB   . LEU A 1 73  ? -9.673  -6.011  8.116   1.00 0.00 ? 73  LEU A CB   3  
ATOM 5042  C CG   . LEU A 1 73  ? -9.918  -7.068  6.991   1.00 0.00 ? 73  LEU A CG   3  
ATOM 5043  C CD1  . LEU A 1 73  ? -10.216 -6.352  5.668   1.00 0.00 ? 73  LEU A CD1  3  
ATOM 5044  C CD2  . LEU A 1 73  ? -8.625  -7.881  6.804   1.00 0.00 ? 73  LEU A CD2  3  
ATOM 5045  H H    . LEU A 1 73  ? -9.038  -5.217  10.348  1.00 0.00 ? 73  LEU A H    3  
ATOM 5046  H HA   . LEU A 1 73  ? -11.363 -4.930  8.766   1.00 0.00 ? 73  LEU A HA   3  
ATOM 5047  H HB2  . LEU A 1 73  ? -9.447  -4.961  7.748   1.00 0.00 ? 73  LEU A HB2  3  
ATOM 5048  H HB3  . LEU A 1 73  ? -8.764  -6.377  8.628   1.00 0.00 ? 73  LEU A HB3  3  
ATOM 5049  H HG   . LEU A 1 73  ? -10.684 -7.891  7.223   1.00 0.00 ? 73  LEU A HG   3  
ATOM 5050  H HD11 . LEU A 1 73  ? -9.371  -5.662  5.421   1.00 0.00 ? 73  LEU A HD11 3  
ATOM 5051  H HD12 . LEU A 1 73  ? -10.307 -7.080  4.836   1.00 0.00 ? 73  LEU A HD12 3  
ATOM 5052  H HD13 . LEU A 1 73  ? -11.136 -5.745  5.732   1.00 0.00 ? 73  LEU A HD13 3  
ATOM 5053  H HD21 . LEU A 1 73  ? -7.748  -7.210  6.746   1.00 0.00 ? 73  LEU A HD21 3  
ATOM 5054  H HD22 . LEU A 1 73  ? -8.469  -8.557  7.672   1.00 0.00 ? 73  LEU A HD22 3  
ATOM 5055  H HD23 . LEU A 1 73  ? -8.669  -8.491  5.877   1.00 0.00 ? 73  LEU A HD23 3  
ATOM 5056  N N    . GLY A 1 74  ? -11.261 -7.614  10.556  1.00 0.00 ? 74  GLY A N    3  
ATOM 5057  C CA   . GLY A 1 74  ? -12.046 -8.603  11.289  1.00 0.00 ? 74  GLY A CA   3  
ATOM 5058  C C    . GLY A 1 74  ? -13.241 -8.046  12.020  1.00 0.00 ? 74  GLY A C    3  
ATOM 5059  O O    . GLY A 1 74  ? -14.236 -8.725  12.257  1.00 0.00 ? 74  GLY A O    3  
ATOM 5060  H H    . GLY A 1 74  ? -10.348 -7.454  10.948  1.00 0.00 ? 74  GLY A H    3  
ATOM 5061  H HA2  . GLY A 1 74  ? -12.422 -9.304  10.570  1.00 0.00 ? 74  GLY A HA2  3  
ATOM 5062  H HA3  . GLY A 1 74  ? -11.419 -9.055  12.035  1.00 0.00 ? 74  GLY A HA3  3  
ATOM 5063  N N    . ARG A 1 75  ? -13.161 -6.744  12.409  1.00 0.00 ? 75  ARG A N    3  
ATOM 5064  C CA   . ARG A 1 75  ? -14.229 -6.032  13.117  1.00 0.00 ? 75  ARG A CA   3  
ATOM 5065  C C    . ARG A 1 75  ? -15.428 -5.656  12.259  1.00 0.00 ? 75  ARG A C    3  
ATOM 5066  O O    . ARG A 1 75  ? -16.538 -5.468  12.752  1.00 0.00 ? 75  ARG A O    3  
ATOM 5067  C CB   . ARG A 1 75  ? -13.690 -4.690  13.657  1.00 0.00 ? 75  ARG A CB   3  
ATOM 5068  C CG   . ARG A 1 75  ? -14.386 -4.073  14.860  1.00 0.00 ? 75  ARG A CG   3  
ATOM 5069  C CD   . ARG A 1 75  ? -13.568 -2.865  15.323  1.00 0.00 ? 75  ARG A CD   3  
ATOM 5070  N NE   . ARG A 1 75  ? -13.859 -1.703  14.409  1.00 0.00 ? 75  ARG A NE   3  
ATOM 5071  C CZ   . ARG A 1 75  ? -13.093 -0.568  14.366  1.00 0.00 ? 75  ARG A CZ   3  
ATOM 5072  N NH1  . ARG A 1 75  ? -12.018 -0.415  15.191  1.00 0.00 ? 75  ARG A NH1  3  
ATOM 5073  N NH2  . ARG A 1 75  ? -13.410 0.420   13.477  1.00 0.00 ? 75  ARG A NH2  3  
ATOM 5074  H H    . ARG A 1 75  ? -12.333 -6.199  12.182  1.00 0.00 ? 75  ARG A H    3  
ATOM 5075  H HA   . ARG A 1 75  ? -14.578 -6.635  13.946  1.00 0.00 ? 75  ARG A HA   3  
ATOM 5076  H HB2  . ARG A 1 75  ? -12.690 -4.839  14.073  1.00 0.00 ? 75  ARG A HB2  3  
ATOM 5077  H HB3  . ARG A 1 75  ? -13.575 -3.930  12.853  1.00 0.00 ? 75  ARG A HB3  3  
ATOM 5078  H HG2  . ARG A 1 75  ? -15.415 -3.794  14.590  1.00 0.00 ? 75  ARG A HG2  3  
ATOM 5079  H HG3  . ARG A 1 75  ? -14.424 -4.824  15.682  1.00 0.00 ? 75  ARG A HG3  3  
ATOM 5080  H HD2  . ARG A 1 75  ? -13.844 -2.614  16.356  1.00 0.00 ? 75  ARG A HD2  3  
ATOM 5081  H HD3  . ARG A 1 75  ? -12.483 -3.109  15.283  1.00 0.00 ? 75  ARG A HD3  3  
ATOM 5082  H HE   . ARG A 1 75  ? -14.638 -1.775  13.787  1.00 0.00 ? 75  ARG A HE   3  
ATOM 5083  H HH11 . ARG A 1 75  ? -11.781 -1.137  15.841  1.00 0.00 ? 75  ARG A HH11 3  
ATOM 5084  H HH12 . ARG A 1 75  ? -11.467 0.418   15.145  1.00 0.00 ? 75  ARG A HH12 3  
ATOM 5085  H HH21 . ARG A 1 75  ? -14.195 0.311   12.867  1.00 0.00 ? 75  ARG A HH21 3  
ATOM 5086  H HH22 . ARG A 1 75  ? -12.854 1.250   13.435  1.00 0.00 ? 75  ARG A HH22 3  
ATOM 5087  N N    . GLU A 1 76  ? -15.189 -5.468  10.938  1.00 0.00 ? 76  GLU A N    3  
ATOM 5088  C CA   . GLU A 1 76  ? -16.133 -4.906  9.994   1.00 0.00 ? 76  GLU A CA   3  
ATOM 5089  C C    . GLU A 1 76  ? -17.169 -5.854  9.409   1.00 0.00 ? 76  GLU A C    3  
ATOM 5090  O O    . GLU A 1 76  ? -18.188 -5.410  8.887   1.00 0.00 ? 76  GLU A O    3  
ATOM 5091  C CB   . GLU A 1 76  ? -15.346 -4.228  8.847   1.00 0.00 ? 76  GLU A CB   3  
ATOM 5092  C CG   . GLU A 1 76  ? -14.481 -3.066  9.366   1.00 0.00 ? 76  GLU A CG   3  
ATOM 5093  C CD   . GLU A 1 76  ? -13.700 -2.443  8.215   1.00 0.00 ? 76  GLU A CD   3  
ATOM 5094  O OE1  . GLU A 1 76  ? -12.787 -3.131  7.691   1.00 0.00 ? 76  GLU A OE1  3  
ATOM 5095  O OE2  . GLU A 1 76  ? -14.001 -1.276  7.848   1.00 0.00 ? 76  GLU A OE2  3  
ATOM 5096  H H    . GLU A 1 76  ? -14.264 -5.604  10.587  1.00 0.00 ? 76  GLU A H    3  
ATOM 5097  H HA   . GLU A 1 76  ? -16.666 -4.123  10.520  1.00 0.00 ? 76  GLU A HA   3  
ATOM 5098  H HB2  . GLU A 1 76  ? -14.701 -4.988  8.347   1.00 0.00 ? 76  GLU A HB2  3  
ATOM 5099  H HB3  . GLU A 1 76  ? -16.041 -3.804  8.084   1.00 0.00 ? 76  GLU A HB3  3  
ATOM 5100  H HG2  . GLU A 1 76  ? -15.136 -2.301  9.837   1.00 0.00 ? 76  GLU A HG2  3  
ATOM 5101  H HG3  . GLU A 1 76  ? -13.768 -3.434  10.133  1.00 0.00 ? 76  GLU A HG3  3  
ATOM 5102  N N    . GLY A 1 77  ? -16.918 -7.193  9.440   1.00 0.00 ? 77  GLY A N    3  
ATOM 5103  C CA   . GLY A 1 77  ? -17.845 -8.160  8.841   1.00 0.00 ? 77  GLY A CA   3  
ATOM 5104  C C    . GLY A 1 77  ? -17.377 -8.597  7.481   1.00 0.00 ? 77  GLY A C    3  
ATOM 5105  O O    . GLY A 1 77  ? -18.134 -9.119  6.668   1.00 0.00 ? 77  GLY A O    3  
ATOM 5106  H H    . GLY A 1 77  ? -16.086 -7.557  9.876   1.00 0.00 ? 77  GLY A H    3  
ATOM 5107  H HA2  . GLY A 1 77  ? -17.836 -9.035  9.474   1.00 0.00 ? 77  GLY A HA2  3  
ATOM 5108  H HA3  . GLY A 1 77  ? -18.843 -7.753  8.724   1.00 0.00 ? 77  GLY A HA3  3  
ATOM 5109  N N    . LEU A 1 78  ? -16.060 -8.416  7.229   1.00 0.00 ? 78  LEU A N    3  
ATOM 5110  C CA   . LEU A 1 78  ? -15.407 -8.816  5.986   1.00 0.00 ? 78  LEU A CA   3  
ATOM 5111  C C    . LEU A 1 78  ? -14.585 -10.014 6.198   1.00 0.00 ? 78  LEU A C    3  
ATOM 5112  O O    . LEU A 1 78  ? -14.586 -10.877 5.350   1.00 0.00 ? 78  LEU A O    3  
ATOM 5113  C CB   . LEU A 1 78  ? -14.504 -7.773  5.285   1.00 0.00 ? 78  LEU A CB   3  
ATOM 5114  C CG   . LEU A 1 78  ? -15.015 -6.359  5.557   1.00 0.00 ? 78  LEU A CG   3  
ATOM 5115  C CD1  . LEU A 1 78  ? -13.869 -5.352  5.511   1.00 0.00 ? 78  LEU A CD1  3  
ATOM 5116  C CD2  . LEU A 1 78  ? -16.228 -6.108  4.646   1.00 0.00 ? 78  LEU A CD2  3  
ATOM 5117  H H    . LEU A 1 78  ? -15.512 -7.942  7.913   1.00 0.00 ? 78  LEU A H    3  
ATOM 5118  H HA   . LEU A 1 78  ? -16.147 -9.103  5.250   1.00 0.00 ? 78  LEU A HA   3  
ATOM 5119  H HB2  . LEU A 1 78  ? -13.396 -7.868  5.463   1.00 0.00 ? 78  LEU A HB2  3  
ATOM 5120  H HB3  . LEU A 1 78  ? -14.623 -7.955  4.188   1.00 0.00 ? 78  LEU A HB3  3  
ATOM 5121  H HG   . LEU A 1 78  ? -15.387 -6.263  6.597   1.00 0.00 ? 78  LEU A HG   3  
ATOM 5122  H HD11 . LEU A 1 78  ? -13.314 -5.409  4.557   1.00 0.00 ? 78  LEU A HD11 3  
ATOM 5123  H HD12 . LEU A 1 78  ? -14.256 -4.322  5.646   1.00 0.00 ? 78  LEU A HD12 3  
ATOM 5124  H HD13 . LEU A 1 78  ? -13.159 -5.562  6.343   1.00 0.00 ? 78  LEU A HD13 3  
ATOM 5125  H HD21 . LEU A 1 78  ? -16.950 -6.973  4.721   1.00 0.00 ? 78  LEU A HD21 3  
ATOM 5126  H HD22 . LEU A 1 78  ? -16.756 -5.173  4.912   1.00 0.00 ? 78  LEU A HD22 3  
ATOM 5127  H HD23 . LEU A 1 78  ? -15.918 -6.053  3.583   1.00 0.00 ? 78  LEU A HD23 3  
ATOM 5128  N N    . CYS A 1 79  ? -13.822 -10.096 7.295   1.00 0.00 ? 79  CYS A N    3  
ATOM 5129  C CA   . CYS A 1 79  ? -12.914 -11.214 7.552   1.00 0.00 ? 79  CYS A CA   3  
ATOM 5130  C C    . CYS A 1 79  ? -13.044 -11.892 8.915   1.00 0.00 ? 79  CYS A C    3  
ATOM 5131  O O    . CYS A 1 79  ? -13.320 -11.268 9.931   1.00 0.00 ? 79  CYS A O    3  
ATOM 5132  C CB   . CYS A 1 79  ? -11.438 -10.830 7.274   1.00 0.00 ? 79  CYS A CB   3  
ATOM 5133  S SG   . CYS A 1 79  ? -11.190 -9.938  5.698   1.00 0.00 ? 79  CYS A SG   3  
ATOM 5134  H H    . CYS A 1 79  ? -13.844 -9.315  7.890   1.00 0.00 ? 79  CYS A H    3  
ATOM 5135  H HA   . CYS A 1 79  ? -13.119 -11.994 6.864   1.00 0.00 ? 79  CYS A HA   3  
ATOM 5136  H HB2  . CYS A 1 79  ? -11.049 -10.332 8.198   1.00 0.00 ? 79  CYS A HB2  3  
ATOM 5137  H HB3  . CYS A 1 79  ? -10.829 -11.719 7.085   1.00 0.00 ? 79  CYS A HB3  3  
ATOM 5138  H HG   . CYS A 1 79  ? -11.694 -8.795  6.142   1.00 0.00 ? 79  CYS A HG   3  
ATOM 5139  N N    . LYS A 1 80  ? -12.789 -13.225 8.976   1.00 0.00 ? 80  LYS A N    3  
ATOM 5140  C CA   . LYS A 1 80  ? -12.701 -14.061 10.167  1.00 0.00 ? 80  LYS A CA   3  
ATOM 5141  C C    . LYS A 1 80  ? -11.227 -14.322 10.443  1.00 0.00 ? 80  LYS A C    3  
ATOM 5142  O O    . LYS A 1 80  ? -10.433 -14.421 9.518   1.00 0.00 ? 80  LYS A O    3  
ATOM 5143  C CB   . LYS A 1 80  ? -13.449 -15.420 9.984   1.00 0.00 ? 80  LYS A CB   3  
ATOM 5144  C CG   . LYS A 1 80  ? -14.952 -15.239 9.758   1.00 0.00 ? 80  LYS A CG   3  
ATOM 5145  C CD   . LYS A 1 80  ? -15.783 -16.533 9.759   1.00 0.00 ? 80  LYS A CD   3  
ATOM 5146  C CE   . LYS A 1 80  ? -15.426 -17.505 8.628   1.00 0.00 ? 80  LYS A CE   3  
ATOM 5147  N NZ   . LYS A 1 80  ? -16.339 -18.671 8.619   1.00 0.00 ? 80  LYS A NZ   3  
ATOM 5148  H H    . LYS A 1 80  ? -12.566 -13.772 8.150   1.00 0.00 ? 80  LYS A H    3  
ATOM 5149  H HA   . LYS A 1 80  ? -13.055 -13.457 10.988  1.00 0.00 ? 80  LYS A HA   3  
ATOM 5150  H HB2  . LYS A 1 80  ? -13.031 -15.955 9.099   1.00 0.00 ? 80  LYS A HB2  3  
ATOM 5151  H HB3  . LYS A 1 80  ? -13.310 -16.103 10.838  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 5152  H HG2  . LYS A 1 80  ? -15.356 -14.562 10.542  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 5153  H HG3  . LYS A 1 80  ? -15.068 -14.748 8.771   1.00 0.00 ? 80  LYS A HG3  3  
ATOM 5154  H HD2  . LYS A 1 80  ? -15.665 -17.043 10.741  1.00 0.00 ? 80  LYS A HD2  3  
ATOM 5155  H HD3  . LYS A 1 80  ? -16.851 -16.235 9.648   1.00 0.00 ? 80  LYS A HD3  3  
ATOM 5156  H HE2  . LYS A 1 80  ? -15.511 -17.003 7.642   1.00 0.00 ? 80  LYS A HE2  3  
ATOM 5157  H HE3  . LYS A 1 80  ? -14.395 -17.893 8.760   1.00 0.00 ? 80  LYS A HE3  3  
ATOM 5158  H HZ1  . LYS A 1 80  ? -17.316 -18.344 8.484   1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 5159  H HZ2  . LYS A 1 80  ? -16.076 -19.310 7.842   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 5160  H HZ3  . LYS A 1 80  ? -16.265 -19.177 9.526   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 5161  N N    . VAL A 1 81  ? -10.768 -14.382 11.711  1.00 0.00 ? 81  VAL A N    3  
ATOM 5162  C CA   . VAL A 1 81  ? -9.359  -14.466 12.029  1.00 0.00 ? 81  VAL A CA   3  
ATOM 5163  C C    . VAL A 1 81  ? -9.044  -15.558 13.024  1.00 0.00 ? 81  VAL A C    3  
ATOM 5164  O O    . VAL A 1 81  ? -9.756  -15.772 14.004  1.00 0.00 ? 81  VAL A O    3  
ATOM 5165  C CB   . VAL A 1 81  ? -8.855  -13.127 12.565  1.00 0.00 ? 81  VAL A CB   3  
ATOM 5166  C CG1  . VAL A 1 81  ? -8.178  -12.368 11.428  1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5167  C CG2  . VAL A 1 81  ? -9.960  -12.241 13.171  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5168  H H    . VAL A 1 81  ? -11.344 -14.322 12.513  1.00 0.00 ? 81  VAL A H    3  
ATOM 5169  H HA   . VAL A 1 81  ? -8.764  -14.717 11.156  1.00 0.00 ? 81  VAL A HA   3  
ATOM 5170  H HB   . VAL A 1 81  ? -8.087  -13.267 13.351  1.00 0.00 ? 81  VAL A HB   3  
ATOM 5171  H HG11 . VAL A 1 81  ? -8.750  -12.448 10.479  1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5172  H HG12 . VAL A 1 81  ? -8.120  -11.298 11.722  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5173  H HG13 . VAL A 1 81  ? -7.137  -12.751 11.300  1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5174  H HG21 . VAL A 1 81  ? -10.514 -12.784 13.962  1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5175  H HG22 . VAL A 1 81  ? -9.489  -11.340 13.621  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5176  H HG23 . VAL A 1 81  ? -10.653 -11.884 12.379  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5177  N N    . ASP A 1 82  ? -7.877  -16.223 12.788  1.00 0.00 ? 82  ASP A N    3  
ATOM 5178  C CA   . ASP A 1 82  ? -7.293  -17.238 13.674  1.00 0.00 ? 82  ASP A CA   3  
ATOM 5179  C C    . ASP A 1 82  ? -5.767  -17.117 13.680  1.00 0.00 ? 82  ASP A C    3  
ATOM 5180  O O    . ASP A 1 82  ? -5.163  -16.704 12.689  1.00 0.00 ? 82  ASP A O    3  
ATOM 5181  C CB   . ASP A 1 82  ? -7.649  -18.700 13.258  1.00 0.00 ? 82  ASP A CB   3  
ATOM 5182  C CG   . ASP A 1 82  ? -9.154  -18.958 13.380  1.00 0.00 ? 82  ASP A CG   3  
ATOM 5183  O OD1  . ASP A 1 82  ? -9.668  -18.921 14.529  1.00 0.00 ? 82  ASP A OD1  3  
ATOM 5184  O OD2  . ASP A 1 82  ? -9.804  -19.197 12.327  1.00 0.00 ? 82  ASP A OD2  3  
ATOM 5185  H H    . ASP A 1 82  ? -7.347  -16.001 11.941  1.00 0.00 ? 82  ASP A H    3  
ATOM 5186  H HA   . ASP A 1 82  ? -7.605  -17.038 14.692  1.00 0.00 ? 82  ASP A HA   3  
ATOM 5187  H HB2  . ASP A 1 82  ? -7.338  -18.880 12.205  1.00 0.00 ? 82  ASP A HB2  3  
ATOM 5188  H HB3  . ASP A 1 82  ? -7.132  -19.441 13.908  1.00 0.00 ? 82  ASP A HB3  3  
ATOM 5189  N N    . GLU A 1 83  ? -5.075  -17.501 14.795  1.00 0.00 ? 83  GLU A N    3  
ATOM 5190  C CA   . GLU A 1 83  ? -3.619  -17.467 14.894  1.00 0.00 ? 83  GLU A CA   3  
ATOM 5191  C C    . GLU A 1 83  ? -3.074  -18.849 15.236  1.00 0.00 ? 83  GLU A C    3  
ATOM 5192  O O    . GLU A 1 83  ? -3.633  -19.603 16.036  1.00 0.00 ? 83  GLU A O    3  
ATOM 5193  C CB   . GLU A 1 83  ? -3.083  -16.386 15.866  1.00 0.00 ? 83  GLU A CB   3  
ATOM 5194  C CG   . GLU A 1 83  ? -1.552  -16.182 15.764  1.00 0.00 ? 83  GLU A CG   3  
ATOM 5195  C CD   . GLU A 1 83  ? -1.074  -14.997 16.602  1.00 0.00 ? 83  GLU A CD   3  
ATOM 5196  O OE1  . GLU A 1 83  ? 0.140   -14.671 16.500  1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5197  O OE2  . GLU A 1 83  ? -1.895  -14.405 17.352  1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5198  H H    . GLU A 1 83  ? -5.538  -17.854 15.605  1.00 0.00 ? 83  GLU A H    3  
ATOM 5199  H HA   . GLU A 1 83  ? -3.193  -17.209 13.928  1.00 0.00 ? 83  GLU A HA   3  
ATOM 5200  H HB2  . GLU A 1 83  ? -3.568  -15.425 15.579  1.00 0.00 ? 83  GLU A HB2  3  
ATOM 5201  H HB3  . GLU A 1 83  ? -3.379  -16.622 16.912  1.00 0.00 ? 83  GLU A HB3  3  
ATOM 5202  H HG2  . GLU A 1 83  ? -1.025  -17.088 16.132  1.00 0.00 ? 83  GLU A HG2  3  
ATOM 5203  H HG3  . GLU A 1 83  ? -1.278  -16.039 14.690  1.00 0.00 ? 83  GLU A HG3  3  
ATOM 5204  N N    . THR A 1 84  ? -1.940  -19.172 14.560  1.00 0.00 ? 84  THR A N    3  
ATOM 5205  C CA   . THR A 1 84  ? -1.173  -20.408 14.586  1.00 0.00 ? 84  THR A CA   3  
ATOM 5206  C C    . THR A 1 84  ? 0.247   -20.120 14.976  1.00 0.00 ? 84  THR A C    3  
ATOM 5207  O O    . THR A 1 84  ? 0.648   -18.959 15.045  1.00 0.00 ? 84  THR A O    3  
ATOM 5208  C CB   . THR A 1 84  ? -1.083  -21.061 13.169  1.00 0.00 ? 84  THR A CB   3  
ATOM 5209  O OG1  . THR A 1 84  ? -0.332  -20.352 12.189  1.00 0.00 ? 84  THR A OG1  3  
ATOM 5210  C CG2  . THR A 1 84  ? -2.468  -21.183 12.528  1.00 0.00 ? 84  THR A CG2  3  
ATOM 5211  H H    . THR A 1 84  ? -1.544  -18.478 13.948  1.00 0.00 ? 84  THR A H    3  
ATOM 5212  H HA   . THR A 1 84  ? -1.529  -21.093 15.341  1.00 0.00 ? 84  THR A HA   3  
ATOM 5213  H HB   . THR A 1 84  ? -0.538  -22.020 13.291  1.00 0.00 ? 84  THR A HB   3  
ATOM 5214  H HG1  . THR A 1 84  ? -0.961  -19.731 11.805  1.00 0.00 ? 84  THR A HG1  3  
ATOM 5215  H HG21 . THR A 1 84  ? -3.184  -21.703 13.195  1.00 0.00 ? 84  THR A HG21 3  
ATOM 5216  H HG22 . THR A 1 84  ? -2.864  -20.168 12.279  1.00 0.00 ? 84  THR A HG22 3  
ATOM 5217  H HG23 . THR A 1 84  ? -2.386  -21.737 11.566  1.00 0.00 ? 84  THR A HG23 3  
ATOM 5218  N N    . PRO A 1 85  ? 1.076   -21.172 15.151  1.00 0.00 ? 85  PRO A N    3  
ATOM 5219  C CA   . PRO A 1 85  ? 2.507   -21.016 15.234  1.00 0.00 ? 85  PRO A CA   3  
ATOM 5220  C C    . PRO A 1 85  ? 3.271   -20.593 13.957  1.00 0.00 ? 85  PRO A C    3  
ATOM 5221  O O    . PRO A 1 85  ? 4.487   -20.435 14.041  1.00 0.00 ? 85  PRO A O    3  
ATOM 5222  C CB   . PRO A 1 85  ? 2.984   -22.376 15.765  1.00 0.00 ? 85  PRO A CB   3  
ATOM 5223  C CG   . PRO A 1 85  ? 1.755   -23.081 16.332  1.00 0.00 ? 85  PRO A CG   3  
ATOM 5224  C CD   . PRO A 1 85  ? 0.675   -22.564 15.405  1.00 0.00 ? 85  PRO A CD   3  
ATOM 5225  H HA   . PRO A 1 85  ? 2.651   -20.240 15.942  1.00 0.00 ? 85  PRO A HA   3  
ATOM 5226  H HB2  . PRO A 1 85  ? 3.464   -23.017 14.992  1.00 0.00 ? 85  PRO A HB2  3  
ATOM 5227  H HB3  . PRO A 1 85  ? 3.685   -22.144 16.562  1.00 0.00 ? 85  PRO A HB3  3  
ATOM 5228  H HG2  . PRO A 1 85  ? 1.851   -24.187 16.326  1.00 0.00 ? 85  PRO A HG2  3  
ATOM 5229  H HG3  . PRO A 1 85  ? 1.567   -22.733 17.373  1.00 0.00 ? 85  PRO A HG3  3  
ATOM 5230  H HD2  . PRO A 1 85  ? 0.717   -23.141 14.453  1.00 0.00 ? 85  PRO A HD2  3  
ATOM 5231  H HD3  . PRO A 1 85  ? -0.327  -22.672 15.886  1.00 0.00 ? 85  PRO A HD3  3  
ATOM 5232  N N    . LYS A 1 86  ? 2.600   -20.410 12.787  1.00 0.00 ? 86  LYS A N    3  
ATOM 5233  C CA   . LYS A 1 86  ? 3.224   -20.030 11.534  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5234  C C    . LYS A 1 86  ? 2.813   -18.624 11.077  1.00 0.00 ? 86  LYS A C    3  
ATOM 5235  O O    . LYS A 1 86  ? 3.316   -18.105 10.080  1.00 0.00 ? 86  LYS A O    3  
ATOM 5236  C CB   . LYS A 1 86  ? 2.872   -21.092 10.460  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5237  C CG   . LYS A 1 86  ? 3.805   -21.104 9.237   1.00 0.00 ? 86  LYS A CG   3  
ATOM 5238  C CD   . LYS A 1 86  ? 3.759   -22.433 8.469   1.00 0.00 ? 86  LYS A CD   3  
ATOM 5239  C CE   . LYS A 1 86  ? 2.403   -22.740 7.818   1.00 0.00 ? 86  LYS A CE   3  
ATOM 5240  N NZ   . LYS A 1 86  ? 2.447   -24.030 7.091   1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5241  H H    . LYS A 1 86  ? 1.608   -20.559 12.747  1.00 0.00 ? 86  LYS A H    3  
ATOM 5242  H HA   . LYS A 1 86  ? 4.300   -20.042 11.654  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5243  H HB2  . LYS A 1 86  ? 2.974   -22.087 10.953  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5244  H HB3  . LYS A 1 86  ? 1.811   -20.989 10.137  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5245  H HG2  . LYS A 1 86  ? 3.562   -20.258 8.557   1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5246  H HG3  . LYS A 1 86  ? 4.854   -20.958 9.591   1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5247  H HD2  . LYS A 1 86  ? 4.547   -22.403 7.681   1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5248  H HD3  . LYS A 1 86  ? 4.031   -23.244 9.182   1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5249  H HE2  . LYS A 1 86  ? 1.596   -22.816 8.578   1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5250  H HE3  . LYS A 1 86  ? 2.132   -21.952 7.083   1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5251  H HZ1  . LYS A 1 86  ? 2.684   -24.793 7.755   1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5252  H HZ2  . LYS A 1 86  ? 1.518   -24.218 6.661   1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5253  H HZ3  . LYS A 1 86  ? 3.171   -23.982 6.346   1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5254  N N    . GLY A 1 87  ? 1.857   -17.969 11.793  1.00 0.00 ? 87  GLY A N    3  
ATOM 5255  C CA   . GLY A 1 87  ? 1.378   -16.642 11.419  1.00 0.00 ? 87  GLY A CA   3  
ATOM 5256  C C    . GLY A 1 87  ? -0.047  -16.353 11.785  1.00 0.00 ? 87  GLY A C    3  
ATOM 5257  O O    . GLY A 1 87  ? -0.697  -17.077 12.544  1.00 0.00 ? 87  GLY A O    3  
ATOM 5258  H H    . GLY A 1 87  ? 1.429   -18.376 12.603  1.00 0.00 ? 87  GLY A H    3  
ATOM 5259  H HA2  . GLY A 1 87  ? 2.012   -15.903 11.887  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5260  H HA3  . GLY A 1 87  ? 1.353   -16.585 10.345  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5261  N N    . TRP A 1 88  ? -0.579  -15.270 11.148  1.00 0.00 ? 88  TRP A N    3  
ATOM 5262  C CA   . TRP A 1 88  ? -1.956  -14.777 11.208  1.00 0.00 ? 88  TRP A CA   3  
ATOM 5263  C C    . TRP A 1 88  ? -2.663  -15.224 9.922   1.00 0.00 ? 88  TRP A C    3  
ATOM 5264  O O    . TRP A 1 88  ? -2.292  -14.872 8.803   1.00 0.00 ? 88  TRP A O    3  
ATOM 5265  C CB   . TRP A 1 88  ? -2.047  -13.214 11.379  1.00 0.00 ? 88  TRP A CB   3  
ATOM 5266  C CG   . TRP A 1 88  ? -2.095  -12.734 12.830  1.00 0.00 ? 88  TRP A CG   3  
ATOM 5267  C CD1  . TRP A 1 88  ? -1.076  -12.516 13.709  1.00 0.00 ? 88  TRP A CD1  3  
ATOM 5268  C CD2  . TRP A 1 88  ? -3.309  -12.506 13.565  1.00 0.00 ? 88  TRP A CD2  3  
ATOM 5269  N NE1  . TRP A 1 88  ? -1.583  -12.218 14.967  1.00 0.00 ? 88  TRP A NE1  3  
ATOM 5270  C CE2  . TRP A 1 88  ? -2.960  -12.263 14.889  1.00 0.00 ? 88  TRP A CE2  3  
ATOM 5271  C CE3  . TRP A 1 88  ? -4.611  -12.494 13.171  1.00 0.00 ? 88  TRP A CE3  3  
ATOM 5272  C CZ2  . TRP A 1 88  ? -3.923  -12.097 15.844  1.00 0.00 ? 88  TRP A CZ2  3  
ATOM 5273  C CZ3  . TRP A 1 88  ? -5.562  -12.249 14.134  1.00 0.00 ? 88  TRP A CZ3  3  
ATOM 5274  C CH2  . TRP A 1 88  ? -5.235  -12.068 15.455  1.00 0.00 ? 88  TRP A CH2  3  
ATOM 5275  H H    . TRP A 1 88  ? -0.019  -14.742 10.495  1.00 0.00 ? 88  TRP A H    3  
ATOM 5276  H HA   . TRP A 1 88  ? -2.479  -15.250 12.032  1.00 0.00 ? 88  TRP A HA   3  
ATOM 5277  H HB2  . TRP A 1 88  ? -1.186  -12.740 10.855  1.00 0.00 ? 88  TRP A HB2  3  
ATOM 5278  H HB3  . TRP A 1 88  ? -2.980  -12.819 10.916  1.00 0.00 ? 88  TRP A HB3  3  
ATOM 5279  H HD1  . TRP A 1 88  ? -0.044  -12.576 13.417  1.00 0.00 ? 88  TRP A HD1  3  
ATOM 5280  H HE1  . TRP A 1 88  ? -1.086  -12.312 15.811  1.00 0.00 ? 88  TRP A HE1  3  
ATOM 5281  H HE3  . TRP A 1 88  ? -4.893  -12.520 12.131  1.00 0.00 ? 88  TRP A HE3  3  
ATOM 5282  H HZ2  . TRP A 1 88  ? -3.721  -11.858 16.869  1.00 0.00 ? 88  TRP A HZ2  3  
ATOM 5283  H HZ3  . TRP A 1 88  ? -6.589  -12.142 13.854  1.00 0.00 ? 88  TRP A HZ3  3  
ATOM 5284  H HH2  . TRP A 1 88  ? -6.006  -11.843 16.181  1.00 0.00 ? 88  TRP A HH2  3  
ATOM 5285  N N    . TYR A 1 89  ? -3.740  -16.029 10.083  1.00 0.00 ? 89  TYR A N    3  
ATOM 5286  C CA   . TYR A 1 89  ? -4.534  -16.603 9.020   1.00 0.00 ? 89  TYR A CA   3  
ATOM 5287  C C    . TYR A 1 89  ? -5.891  -15.975 9.150   1.00 0.00 ? 89  TYR A C    3  
ATOM 5288  O O    . TYR A 1 89  ? -6.518  -16.014 10.206  1.00 0.00 ? 89  TYR A O    3  
ATOM 5289  C CB   . TYR A 1 89  ? -4.672  -18.145 9.158   1.00 0.00 ? 89  TYR A CB   3  
ATOM 5290  C CG   . TYR A 1 89  ? -3.338  -18.743 8.864   1.00 0.00 ? 89  TYR A CG   3  
ATOM 5291  C CD1  . TYR A 1 89  ? -2.324  -18.710 9.799   1.00 0.00 ? 89  TYR A CD1  3  
ATOM 5292  C CD2  . TYR A 1 89  ? -3.074  -19.216 7.597   1.00 0.00 ? 89  TYR A CD2  3  
ATOM 5293  C CE1  . TYR A 1 89  ? -1.036  -19.020 9.434   1.00 0.00 ? 89  TYR A CE1  3  
ATOM 5294  C CE2  . TYR A 1 89  ? -1.803  -19.613 7.249   1.00 0.00 ? 89  TYR A CE2  3  
ATOM 5295  C CZ   . TYR A 1 89  ? -0.771  -19.475 8.161   1.00 0.00 ? 89  TYR A CZ   3  
ATOM 5296  O OH   . TYR A 1 89  ? 0.554   -19.780 7.795   1.00 0.00 ? 89  TYR A OH   3  
ATOM 5297  H H    . TYR A 1 89  ? -4.097  -16.281 10.992  1.00 0.00 ? 89  TYR A H    3  
ATOM 5298  H HA   . TYR A 1 89  ? -4.124  -16.375 8.036   1.00 0.00 ? 89  TYR A HA   3  
ATOM 5299  H HB2  . TYR A 1 89  ? -5.001  -18.445 10.177  1.00 0.00 ? 89  TYR A HB2  3  
ATOM 5300  H HB3  . TYR A 1 89  ? -5.376  -18.545 8.400   1.00 0.00 ? 89  TYR A HB3  3  
ATOM 5301  H HD1  . TYR A 1 89  ? -2.527  -18.330 10.793  1.00 0.00 ? 89  TYR A HD1  3  
ATOM 5302  H HD2  . TYR A 1 89  ? -3.859  -19.235 6.852   1.00 0.00 ? 89  TYR A HD2  3  
ATOM 5303  H HE1  . TYR A 1 89  ? -0.259  -18.871 10.174  1.00 0.00 ? 89  TYR A HE1  3  
ATOM 5304  H HE2  . TYR A 1 89  ? -1.659  -19.985 6.243   1.00 0.00 ? 89  TYR A HE2  3  
ATOM 5305  H HH   . TYR A 1 89  ? 1.103   -19.751 8.583   1.00 0.00 ? 89  TYR A HH   3  
ATOM 5306  N N    . ILE A 1 90  ? -6.363  -15.383 8.051   1.00 0.00 ? 90  ILE A N    3  
ATOM 5307  C CA   . ILE A 1 90  ? -7.637  -14.730 7.893   1.00 0.00 ? 90  ILE A CA   3  
ATOM 5308  C C    . ILE A 1 90  ? -8.387  -15.532 6.861   1.00 0.00 ? 90  ILE A C    3  
ATOM 5309  O O    . ILE A 1 90  ? -7.869  -15.918 5.813   1.00 0.00 ? 90  ILE A O    3  
ATOM 5310  C CB   . ILE A 1 90  ? -7.565  -13.232 7.514   1.00 0.00 ? 90  ILE A CB   3  
ATOM 5311  C CG1  . ILE A 1 90  ? -7.638  -12.859 6.000   1.00 0.00 ? 90  ILE A CG1  3  
ATOM 5312  C CG2  . ILE A 1 90  ? -6.286  -12.646 8.127   1.00 0.00 ? 90  ILE A CG2  3  
ATOM 5313  C CD1  . ILE A 1 90  ? -7.712  -11.347 5.747   1.00 0.00 ? 90  ILE A CD1  3  
ATOM 5314  H H    . ILE A 1 90  ? -5.805  -15.410 7.234   1.00 0.00 ? 90  ILE A H    3  
ATOM 5315  H HA   . ILE A 1 90  ? -8.183  -14.775 8.830   1.00 0.00 ? 90  ILE A HA   3  
ATOM 5316  H HB   . ILE A 1 90  ? -8.419  -12.735 8.036   1.00 0.00 ? 90  ILE A HB   3  
ATOM 5317  H HG12 . ILE A 1 90  ? -6.759  -13.288 5.468   1.00 0.00 ? 90  ILE A HG12 3  
ATOM 5318  H HG13 . ILE A 1 90  ? -8.555  -13.283 5.534   1.00 0.00 ? 90  ILE A HG13 3  
ATOM 5319  H HG21 . ILE A 1 90  ? -6.226  -12.875 9.211   1.00 0.00 ? 90  ILE A HG21 3  
ATOM 5320  H HG22 . ILE A 1 90  ? -5.386  -13.047 7.621   1.00 0.00 ? 90  ILE A HG22 3  
ATOM 5321  H HG23 . ILE A 1 90  ? -6.267  -11.545 7.971   1.00 0.00 ? 90  ILE A HG23 3  
ATOM 5322  H HD11 . ILE A 1 90  ? -8.535  -10.894 6.338   1.00 0.00 ? 90  ILE A HD11 3  
ATOM 5323  H HD12 . ILE A 1 90  ? -6.765  -10.860 6.039   1.00 0.00 ? 90  ILE A HD12 3  
ATOM 5324  H HD13 . ILE A 1 90  ? -7.884  -11.144 4.668   1.00 0.00 ? 90  ILE A HD13 3  
ATOM 5325  N N    . GLN A 1 91  ? -9.672  -15.759 7.110   1.00 0.00 ? 91  GLN A N    3  
ATOM 5326  C CA   . GLN A 1 91  ? -10.594 -16.352 6.194   1.00 0.00 ? 91  GLN A CA   3  
ATOM 5327  C C    . GLN A 1 91  ? -11.659 -15.317 6.071   1.00 0.00 ? 91  GLN A C    3  
ATOM 5328  O O    . GLN A 1 91  ? -12.218 -14.881 7.061   1.00 0.00 ? 91  GLN A O    3  
ATOM 5329  C CB   . GLN A 1 91  ? -11.112 -17.706 6.713   1.00 0.00 ? 91  GLN A CB   3  
ATOM 5330  C CG   . GLN A 1 91  ? -12.503 -18.103 6.185   1.00 0.00 ? 91  GLN A CG   3  
ATOM 5331  C CD   . GLN A 1 91  ? -12.644 -19.615 6.115   1.00 0.00 ? 91  GLN A CD   3  
ATOM 5332  O OE1  . GLN A 1 91  ? -12.704 -20.296 7.141   1.00 0.00 ? 91  GLN A OE1  3  
ATOM 5333  N NE2  . GLN A 1 91  ? -12.685 -20.163 4.871   1.00 0.00 ? 91  GLN A NE2  3  
ATOM 5334  H H    . GLN A 1 91  ? -10.071 -15.424 7.971   1.00 0.00 ? 91  GLN A H    3  
ATOM 5335  H HA   . GLN A 1 91  ? -10.176 -16.463 5.211   1.00 0.00 ? 91  GLN A HA   3  
ATOM 5336  H HB2  . GLN A 1 91  ? -10.372 -18.484 6.438   1.00 0.00 ? 91  GLN A HB2  3  
ATOM 5337  H HB3  . GLN A 1 91  ? -11.135 -17.676 7.825   1.00 0.00 ? 91  GLN A HB3  3  
ATOM 5338  H HG2  . GLN A 1 91  ? -13.193 -17.696 6.951   1.00 0.00 ? 91  GLN A HG2  3  
ATOM 5339  H HG3  . GLN A 1 91  ? -12.733 -17.666 5.192   1.00 0.00 ? 91  GLN A HG3  3  
ATOM 5340  H HE21 . GLN A 1 91  ? -12.703 -19.579 4.061   1.00 0.00 ? 91  GLN A HE21 3  
ATOM 5341  H HE22 . GLN A 1 91  ? -12.720 -21.155 4.806   1.00 0.00 ? 91  GLN A HE22 3  
ATOM 5342  N N    . TYR A 1 92  ? -11.964 -14.879 4.841   1.00 0.00 ? 92  TYR A N    3  
ATOM 5343  C CA   . TYR A 1 92  ? -12.963 -13.878 4.524   1.00 0.00 ? 92  TYR A CA   3  
ATOM 5344  C C    . TYR A 1 92  ? -14.413 -14.416 4.656   1.00 0.00 ? 92  TYR A C    3  
ATOM 5345  O O    . TYR A 1 92  ? -14.684 -15.603 4.489   1.00 0.00 ? 92  TYR A O    3  
ATOM 5346  C CB   . TYR A 1 92  ? -12.456 -12.983 3.339   1.00 0.00 ? 92  TYR A CB   3  
ATOM 5347  C CG   . TYR A 1 92  ? -13.483 -12.286 2.474   1.00 0.00 ? 92  TYR A CG   3  
ATOM 5348  C CD1  . TYR A 1 92  ? -14.215 -12.990 1.552   1.00 0.00 ? 92  TYR A CD1  3  
ATOM 5349  C CD2  . TYR A 1 92  ? -13.800 -10.960 2.667   1.00 0.00 ? 92  TYR A CD2  3  
ATOM 5350  C CE1  . TYR A 1 92  ? -15.363 -12.486 0.984   1.00 0.00 ? 92  TYR A CE1  3  
ATOM 5351  C CE2  . TYR A 1 92  ? -14.946 -10.425 2.126   1.00 0.00 ? 92  TYR A CE2  3  
ATOM 5352  C CZ   . TYR A 1 92  ? -15.724 -11.192 1.265   1.00 0.00 ? 92  TYR A CZ   3  
ATOM 5353  O OH   . TYR A 1 92  ? -16.928 -10.751 0.691   1.00 0.00 ? 92  TYR A OH   3  
ATOM 5354  H H    . TYR A 1 92  ? -11.476 -15.261 4.064   1.00 0.00 ? 92  TYR A H    3  
ATOM 5355  H HA   . TYR A 1 92  ? -12.916 -13.145 5.312   1.00 0.00 ? 92  TYR A HA   3  
ATOM 5356  H HB2  . TYR A 1 92  ? -11.852 -12.173 3.805   1.00 0.00 ? 92  TYR A HB2  3  
ATOM 5357  H HB3  . TYR A 1 92  ? -11.727 -13.537 2.733   1.00 0.00 ? 92  TYR A HB3  3  
ATOM 5358  H HD1  . TYR A 1 92  ? -13.944 -14.007 1.363   1.00 0.00 ? 92  TYR A HD1  3  
ATOM 5359  H HD2  . TYR A 1 92  ? -13.228 -10.353 3.353   1.00 0.00 ? 92  TYR A HD2  3  
ATOM 5360  H HE1  . TYR A 1 92  ? -16.026 -13.142 0.414   1.00 0.00 ? 92  TYR A HE1  3  
ATOM 5361  H HE2  . TYR A 1 92  ? -15.208 -9.438  2.493   1.00 0.00 ? 92  TYR A HE2  3  
ATOM 5362  H HH   . TYR A 1 92  ? -17.226 -11.431 0.086   1.00 0.00 ? 92  TYR A HH   3  
ATOM 5363  N N    . ILE A 1 93  ? -15.356 -13.534 5.057   1.00 0.00 ? 93  ILE A N    3  
ATOM 5364  C CA   . ILE A 1 93  ? -16.784 -13.634 5.300   1.00 0.00 ? 93  ILE A CA   3  
ATOM 5365  C C    . ILE A 1 93  ? -17.434 -13.390 3.970   1.00 0.00 ? 93  ILE A C    3  
ATOM 5366  O O    . ILE A 1 93  ? -17.243 -12.323 3.402   1.00 0.00 ? 93  ILE A O    3  
ATOM 5367  C CB   . ILE A 1 93  ? -17.212 -12.500 6.263   1.00 0.00 ? 93  ILE A CB   3  
ATOM 5368  C CG1  . ILE A 1 93  ? -16.538 -12.764 7.625   1.00 0.00 ? 93  ILE A CG1  3  
ATOM 5369  C CG2  . ILE A 1 93  ? -18.751 -12.349 6.364   1.00 0.00 ? 93  ILE A CG2  3  
ATOM 5370  C CD1  . ILE A 1 93  ? -17.162 -12.053 8.815   1.00 0.00 ? 93  ILE A CD1  3  
ATOM 5371  H H    . ILE A 1 93  ? -15.079 -12.584 5.154   1.00 0.00 ? 93  ILE A H    3  
ATOM 5372  H HA   . ILE A 1 93  ? -17.049 -14.615 5.670   1.00 0.00 ? 93  ILE A HA   3  
ATOM 5373  H HB   . ILE A 1 93  ? -16.827 -11.490 5.925   1.00 0.00 ? 93  ILE A HB   3  
ATOM 5374  H HG12 . ILE A 1 93  ? -16.519 -13.852 7.810   1.00 0.00 ? 93  ILE A HG12 3  
ATOM 5375  H HG13 . ILE A 1 93  ? -15.494 -12.391 7.565   1.00 0.00 ? 93  ILE A HG13 3  
ATOM 5376  H HG21 . ILE A 1 93  ? -19.214 -13.296 6.700   1.00 0.00 ? 93  ILE A HG21 3  
ATOM 5377  H HG22 . ILE A 1 93  ? -18.996 -11.539 7.082   1.00 0.00 ? 93  ILE A HG22 3  
ATOM 5378  H HG23 . ILE A 1 93  ? -19.188 -12.016 5.399   1.00 0.00 ? 93  ILE A HG23 3  
ATOM 5379  H HD11 . ILE A 1 93  ? -17.267 -10.985 8.542   1.00 0.00 ? 93  ILE A HD11 3  
ATOM 5380  H HD12 . ILE A 1 93  ? -18.164 -12.465 9.054   1.00 0.00 ? 93  ILE A HD12 3  
ATOM 5381  H HD13 . ILE A 1 93  ? -16.499 -12.138 9.705   1.00 0.00 ? 93  ILE A HD13 3  
ATOM 5382  N N    . ASP A 1 94  ? -18.227 -14.332 3.393   1.00 0.00 ? 94  ASP A N    3  
ATOM 5383  C CA   . ASP A 1 94  ? -18.849 -14.135 2.083   1.00 0.00 ? 94  ASP A CA   3  
ATOM 5384  C C    . ASP A 1 94  ? -20.047 -13.225 2.109   1.00 0.00 ? 94  ASP A C    3  
ATOM 5385  O O    . ASP A 1 94  ? -21.187 -13.672 2.175   1.00 0.00 ? 94  ASP A O    3  
ATOM 5386  C CB   . ASP A 1 94  ? -19.170 -15.408 1.233   1.00 0.00 ? 94  ASP A CB   3  
ATOM 5387  C CG   . ASP A 1 94  ? -19.868 -16.575 1.949   1.00 0.00 ? 94  ASP A CG   3  
ATOM 5388  O OD1  . ASP A 1 94  ? -20.038 -17.629 1.278   1.00 0.00 ? 94  ASP A OD1  3  
ATOM 5389  O OD2  . ASP A 1 94  ? -20.243 -16.448 3.144   1.00 0.00 ? 94  ASP A OD2  3  
ATOM 5390  H H    . ASP A 1 94  ? -18.431 -15.196 3.836   1.00 0.00 ? 94  ASP A H    3  
ATOM 5391  H HA   . ASP A 1 94  ? -18.134 -13.623 1.454   1.00 0.00 ? 94  ASP A HA   3  
ATOM 5392  H HB2  . ASP A 1 94  ? -19.754 -15.096 0.340   1.00 0.00 ? 94  ASP A HB2  3  
ATOM 5393  H HB3  . ASP A 1 94  ? -18.216 -15.782 0.804   1.00 0.00 ? 94  ASP A HB3  3  
ATOM 5394  N N    . ARG A 1 95  ? -19.744 -11.895 2.025   1.00 0.00 ? 95  ARG A N    3  
ATOM 5395  C CA   . ARG A 1 95  ? -20.595 -10.710 1.971   1.00 0.00 ? 95  ARG A CA   3  
ATOM 5396  C C    . ARG A 1 95  ? -21.876 -10.865 1.156   1.00 0.00 ? 95  ARG A C    3  
ATOM 5397  O O    . ARG A 1 95  ? -22.907 -11.286 1.676   1.00 0.00 ? 95  ARG A O    3  
ATOM 5398  C CB   . ARG A 1 95  ? -19.716 -9.513  1.620   1.00 0.00 ? 95  ARG A CB   3  
ATOM 5399  C CG   . ARG A 1 95  ? -18.697 -9.219  2.742   1.00 0.00 ? 95  ARG A CG   3  
ATOM 5400  C CD   . ARG A 1 95  ? -17.785 -8.074  2.355   1.00 0.00 ? 95  ARG A CD   3  
ATOM 5401  N NE   . ARG A 1 95  ? -18.554 -6.778  2.397   1.00 0.00 ? 95  ARG A NE   3  
ATOM 5402  C CZ   . ARG A 1 95  ? -18.241 -5.678  1.642   1.00 0.00 ? 95  ARG A CZ   3  
ATOM 5403  N NH1  . ARG A 1 95  ? -17.161 -5.680  0.809   1.00 0.00 ? 95  ARG A NH1  3  
ATOM 5404  N NH2  . ARG A 1 95  ? -19.022 -4.562  1.732   1.00 0.00 ? 95  ARG A NH2  3  
ATOM 5405  H H    . ARG A 1 95  ? -18.764 -11.663 2.038   1.00 0.00 ? 95  ARG A H    3  
ATOM 5406  H HA   . ARG A 1 95  ? -20.899 -10.478 2.950   1.00 0.00 ? 95  ARG A HA   3  
ATOM 5407  H HB2  . ARG A 1 95  ? -19.165 -9.729  0.679   1.00 0.00 ? 95  ARG A HB2  3  
ATOM 5408  H HB3  . ARG A 1 95  ? -20.327 -8.594  1.470   1.00 0.00 ? 95  ARG A HB3  3  
ATOM 5409  H HG2  . ARG A 1 95  ? -19.227 -9.017  3.696   1.00 0.00 ? 95  ARG A HG2  3  
ATOM 5410  H HG3  . ARG A 1 95  ? -17.943 -10.016 2.983   1.00 0.00 ? 95  ARG A HG3  3  
ATOM 5411  H HD2  . ARG A 1 95  ? -16.978 -8.118  3.118   1.00 0.00 ? 95  ARG A HD2  3  
ATOM 5412  H HD3  . ARG A 1 95  ? -17.372 -8.271  1.346   1.00 0.00 ? 95  ARG A HD3  3  
ATOM 5413  H HE   . ARG A 1 95  ? -19.353 -6.728  2.997   1.00 0.00 ? 95  ARG A HE   3  
ATOM 5414  H HH11 . ARG A 1 95  ? -16.584 -6.494  0.743   1.00 0.00 ? 95  ARG A HH11 3  
ATOM 5415  H HH12 . ARG A 1 95  ? -16.948 -4.867  0.268   1.00 0.00 ? 95  ARG A HH12 3  
ATOM 5416  H HH21 . ARG A 1 95  ? -19.814 -4.553  2.341   1.00 0.00 ? 95  ARG A HH21 3  
ATOM 5417  H HH22 . ARG A 1 95  ? -18.802 -3.755  1.183   1.00 0.00 ? 95  ARG A HH22 3  
ATOM 5418  N N    . ASP A 1 96  ? -21.827 -10.634 -0.165  1.00 0.00 ? 96  ASP A N    3  
ATOM 5419  C CA   . ASP A 1 96  ? -22.832 -11.174 -1.078  1.00 0.00 ? 96  ASP A CA   3  
ATOM 5420  C C    . ASP A 1 96  ? -22.169 -12.368 -1.774  1.00 0.00 ? 96  ASP A C    3  
ATOM 5421  O O    . ASP A 1 96  ? -21.337 -12.031 -2.612  1.00 0.00 ? 96  ASP A O    3  
ATOM 5422  C CB   . ASP A 1 96  ? -23.356 -10.108 -2.082  1.00 0.00 ? 96  ASP A CB   3  
ATOM 5423  C CG   . ASP A 1 96  ? -24.581 -10.527 -2.917  1.00 0.00 ? 96  ASP A CG   3  
ATOM 5424  O OD1  . ASP A 1 96  ? -25.190 -11.592 -2.629  1.00 0.00 ? 96  ASP A OD1  3  
ATOM 5425  O OD2  . ASP A 1 96  ? -24.922 -9.760  -3.857  1.00 0.00 ? 96  ASP A OD2  3  
ATOM 5426  H H    . ASP A 1 96  ? -20.984 -10.293 -0.570  1.00 0.00 ? 96  ASP A H    3  
ATOM 5427  H HA   . ASP A 1 96  ? -23.703 -11.530 -0.541  1.00 0.00 ? 96  ASP A HA   3  
ATOM 5428  H HB2  . ASP A 1 96  ? -23.678 -9.244  -1.464  1.00 0.00 ? 96  ASP A HB2  3  
ATOM 5429  H HB3  . ASP A 1 96  ? -22.544 -9.771  -2.755  1.00 0.00 ? 96  ASP A HB3  3  
ATOM 5430  N N    . PRO A 1 97  ? -22.399 -13.709 -1.581  1.00 0.00 ? 97  PRO A N    3  
ATOM 5431  C CA   . PRO A 1 97  ? -21.715 -14.849 -2.242  1.00 0.00 ? 97  PRO A CA   3  
ATOM 5432  C C    . PRO A 1 97  ? -21.696 -14.850 -3.754  1.00 0.00 ? 97  PRO A C    3  
ATOM 5433  O O    . PRO A 1 97  ? -20.727 -15.319 -4.346  1.00 0.00 ? 97  PRO A O    3  
ATOM 5434  C CB   . PRO A 1 97  ? -22.415 -16.092 -1.720  1.00 0.00 ? 97  PRO A CB   3  
ATOM 5435  C CG   . PRO A 1 97  ? -22.817 -15.661 -0.314  1.00 0.00 ? 97  PRO A CG   3  
ATOM 5436  C CD   . PRO A 1 97  ? -23.216 -14.186 -0.483  1.00 0.00 ? 97  PRO A CD   3  
ATOM 5437  H HA   . PRO A 1 97  ? -20.685 -14.841 -1.929  1.00 0.00 ? 97  PRO A HA   3  
ATOM 5438  H HB2  . PRO A 1 97  ? -23.365 -16.319 -2.279  1.00 0.00 ? 97  PRO A HB2  3  
ATOM 5439  H HB3  . PRO A 1 97  ? -21.710 -16.961 -1.756  1.00 0.00 ? 97  PRO A HB3  3  
ATOM 5440  H HG2  . PRO A 1 97  ? -23.618 -16.298 0.090   1.00 0.00 ? 97  PRO A HG2  3  
ATOM 5441  H HG3  . PRO A 1 97  ? -21.936 -15.715 0.359   1.00 0.00 ? 97  PRO A HG3  3  
ATOM 5442  H HD2  . PRO A 1 97  ? -24.278 -14.035 -0.750  1.00 0.00 ? 97  PRO A HD2  3  
ATOM 5443  H HD3  . PRO A 1 97  ? -22.977 -13.646 0.456   1.00 0.00 ? 97  PRO A HD3  3  
ATOM 5444  N N    . GLU A 1 98  ? -22.709 -14.177 -4.368  1.00 0.00 ? 98  GLU A N    3  
ATOM 5445  C CA   . GLU A 1 98  ? -22.830 -13.766 -5.756  1.00 0.00 ? 98  GLU A CA   3  
ATOM 5446  C C    . GLU A 1 98  ? -21.623 -12.940 -6.177  1.00 0.00 ? 98  GLU A C    3  
ATOM 5447  O O    . GLU A 1 98  ? -21.001 -13.231 -7.178  1.00 0.00 ? 98  GLU A O    3  
ATOM 5448  C CB   . GLU A 1 98  ? -24.102 -12.915 -5.918  1.00 0.00 ? 98  GLU A CB   3  
ATOM 5449  C CG   . GLU A 1 98  ? -25.391 -13.696 -5.588  1.00 0.00 ? 98  GLU A CG   3  
ATOM 5450  C CD   . GLU A 1 98  ? -26.636 -12.820 -5.744  1.00 0.00 ? 98  GLU A CD   3  
ATOM 5451  O OE1  . GLU A 1 98  ? -26.501 -11.617 -6.093  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5452  O OE2  . GLU A 1 98  ? -27.753 -13.355 -5.505  1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5453  H H    . GLU A 1 98  ? -23.434 -13.820 -3.784  1.00 0.00 ? 98  GLU A H    3  
ATOM 5454  H HA   . GLU A 1 98  ? -22.875 -14.626 -6.413  1.00 0.00 ? 98  GLU A HA   3  
ATOM 5455  H HB2  . GLU A 1 98  ? -24.029 -12.049 -5.222  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5456  H HB3  . GLU A 1 98  ? -24.183 -12.537 -6.961  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5457  H HG2  . GLU A 1 98  ? -25.474 -14.568 -6.272  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5458  H HG3  . GLU A 1 98  ? -25.352 -14.071 -4.543  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5459  N N    . THR A 1 99  ? -21.142 -11.972 -5.336  1.00 0.00 ? 99  THR A N    3  
ATOM 5460  C CA   . THR A 1 99  ? -19.923 -11.177 -5.582  1.00 0.00 ? 99  THR A CA   3  
ATOM 5461  C C    . THR A 1 99  ? -18.665 -12.020 -5.754  1.00 0.00 ? 99  THR A C    3  
ATOM 5462  O O    . THR A 1 99  ? -17.947 -11.814 -6.707  1.00 0.00 ? 99  THR A O    3  
ATOM 5463  C CB   . THR A 1 99  ? -19.715 -10.015 -4.588  1.00 0.00 ? 99  THR A CB   3  
ATOM 5464  O OG1  . THR A 1 99  ? -19.331 -8.819  -5.254  1.00 0.00 ? 99  THR A OG1  3  
ATOM 5465  C CG2  . THR A 1 99  ? -18.658 -10.264 -3.499  1.00 0.00 ? 99  THR A CG2  3  
ATOM 5466  H H    . THR A 1 99  ? -21.583 -11.802 -4.447  1.00 0.00 ? 99  THR A H    3  
ATOM 5467  H HA   . THR A 1 99  ? -20.089 -10.734 -6.559  1.00 0.00 ? 99  THR A HA   3  
ATOM 5468  H HB   . THR A 1 99  ? -20.690 -9.846  -4.084  1.00 0.00 ? 99  THR A HB   3  
ATOM 5469  H HG1  . THR A 1 99  ? -18.389 -8.944  -5.526  1.00 0.00 ? 99  THR A HG1  3  
ATOM 5470  H HG21 . THR A 1 99  ? -18.874 -11.202 -2.948  1.00 0.00 ? 99  THR A HG21 3  
ATOM 5471  H HG22 . THR A 1 99  ? -17.651 -10.331 -3.986  1.00 0.00 ? 99  THR A HG22 3  
ATOM 5472  H HG23 . THR A 1 99  ? -18.663 -9.450  -2.746  1.00 0.00 ? 99  THR A HG23 3  
ATOM 5473  N N    . ILE A 1 100 ? -18.427 -13.053 -4.901  1.00 0.00 ? 100 ILE A N    3  
ATOM 5474  C CA   . ILE A 1 100 ? -17.364 -14.048 -4.941  1.00 0.00 ? 100 ILE A CA   3  
ATOM 5475  C C    . ILE A 1 100 ? -17.518 -15.006 -6.133  1.00 0.00 ? 100 ILE A C    3  
ATOM 5476  O O    . ILE A 1 100 ? -16.598 -15.120 -6.930  1.00 0.00 ? 100 ILE A O    3  
ATOM 5477  C CB   . ILE A 1 100 ? -17.485 -14.752 -3.608  1.00 0.00 ? 100 ILE A CB   3  
ATOM 5478  C CG1  . ILE A 1 100 ? -17.195 -13.707 -2.505  1.00 0.00 ? 100 ILE A CG1  3  
ATOM 5479  C CG2  . ILE A 1 100 ? -16.496 -15.924 -3.489  1.00 0.00 ? 100 ILE A CG2  3  
ATOM 5480  C CD1  . ILE A 1 100 ? -18.390 -13.487 -1.591  1.00 0.00 ? 100 ILE A CD1  3  
ATOM 5481  H H    . ILE A 1 100 ? -19.028 -13.229 -4.132  1.00 0.00 ? 100 ILE A H    3  
ATOM 5482  H HA   . ILE A 1 100 ? -16.355 -13.602 -4.978  1.00 0.00 ? 100 ILE A HA   3  
ATOM 5483  H HB   . ILE A 1 100 ? -18.543 -15.114 -3.454  1.00 0.00 ? 100 ILE A HB   3  
ATOM 5484  H HG12 . ILE A 1 100 ? -16.366 -14.099 -1.899  1.00 0.00 ? 100 ILE A HG12 3  
ATOM 5485  H HG13 . ILE A 1 100 ? -16.849 -12.739 -2.932  1.00 0.00 ? 100 ILE A HG13 3  
ATOM 5486  H HG21 . ILE A 1 100 ? -15.485 -15.582 -3.788  1.00 0.00 ? 100 ILE A HG21 3  
ATOM 5487  H HG22 . ILE A 1 100 ? -16.454 -16.286 -2.438  1.00 0.00 ? 100 ILE A HG22 3  
ATOM 5488  H HG23 . ILE A 1 100 ? -16.783 -16.785 -4.126  1.00 0.00 ? 100 ILE A HG23 3  
ATOM 5489  H HD11 . ILE A 1 100 ? -18.673 -14.464 -1.158  1.00 0.00 ? 100 ILE A HD11 3  
ATOM 5490  H HD12 . ILE A 1 100 ? -18.168 -12.774 -0.777  1.00 0.00 ? 100 ILE A HD12 3  
ATOM 5491  H HD13 . ILE A 1 100 ? -19.258 -13.108 -2.163  1.00 0.00 ? 100 ILE A HD13 3  
ATOM 5492  N N    . ARG A 1 101 ? -18.712 -15.626 -6.374  1.00 0.00 ? 101 ARG A N    3  
ATOM 5493  C CA   . ARG A 1 101 ? -19.001 -16.507 -7.524  1.00 0.00 ? 101 ARG A CA   3  
ATOM 5494  C C    . ARG A 1 101 ? -18.928 -15.792 -8.882  1.00 0.00 ? 101 ARG A C    3  
ATOM 5495  O O    . ARG A 1 101 ? -18.399 -16.310 -9.864  1.00 0.00 ? 101 ARG A O    3  
ATOM 5496  C CB   . ARG A 1 101 ? -20.369 -17.216 -7.359  1.00 0.00 ? 101 ARG A CB   3  
ATOM 5497  C CG   . ARG A 1 101 ? -20.434 -18.157 -6.138  1.00 0.00 ? 101 ARG A CG   3  
ATOM 5498  C CD   . ARG A 1 101 ? -21.713 -19.002 -6.117  1.00 0.00 ? 101 ARG A CD   3  
ATOM 5499  N NE   . ARG A 1 101 ? -21.688 -19.870 -4.888  1.00 0.00 ? 101 ARG A NE   3  
ATOM 5500  C CZ   . ARG A 1 101 ? -22.709 -20.716 -4.548  1.00 0.00 ? 101 ARG A CZ   3  
ATOM 5501  N NH1  . ARG A 1 101 ? -23.821 -20.824 -5.332  1.00 0.00 ? 101 ARG A NH1  3  
ATOM 5502  N NH2  . ARG A 1 101 ? -22.610 -21.464 -3.410  1.00 0.00 ? 101 ARG A NH2  3  
ATOM 5503  H H    . ARG A 1 101 ? -19.484 -15.495 -5.739  1.00 0.00 ? 101 ARG A H    3  
ATOM 5504  H HA   . ARG A 1 101 ? -18.226 -17.271 -7.562  1.00 0.00 ? 101 ARG A HA   3  
ATOM 5505  H HB2  . ARG A 1 101 ? -21.177 -16.461 -7.244  1.00 0.00 ? 101 ARG A HB2  3  
ATOM 5506  H HB3  . ARG A 1 101 ? -20.598 -17.838 -8.255  1.00 0.00 ? 101 ARG A HB3  3  
ATOM 5507  H HG2  . ARG A 1 101 ? -19.539 -18.821 -6.214  1.00 0.00 ? 101 ARG A HG2  3  
ATOM 5508  H HG3  . ARG A 1 101 ? -20.393 -17.575 -5.180  1.00 0.00 ? 101 ARG A HG3  3  
ATOM 5509  H HD2  . ARG A 1 101 ? -22.605 -18.337 -6.075  1.00 0.00 ? 101 ARG A HD2  3  
ATOM 5510  H HD3  . ARG A 1 101 ? -21.765 -19.649 -7.021  1.00 0.00 ? 101 ARG A HD3  3  
ATOM 5511  H HE   . ARG A 1 101 ? -20.889 -19.818 -4.288  1.00 0.00 ? 101 ARG A HE   3  
ATOM 5512  H HH11 . ARG A 1 101 ? -23.895 -20.278 -6.167  1.00 0.00 ? 101 ARG A HH11 3  
ATOM 5513  H HH12 . ARG A 1 101 ? -24.557 -21.448 -5.073  1.00 0.00 ? 101 ARG A HH12 3  
ATOM 5514  H HH21 . ARG A 1 101 ? -21.798 -21.390 -2.832  1.00 0.00 ? 101 ARG A HH21 3  
ATOM 5515  H HH22 . ARG A 1 101 ? -23.350 -22.086 -3.156  1.00 0.00 ? 101 ARG A HH22 3  
ATOM 5516  N N    . ARG A 1 102 ? -19.364 -14.497 -8.917  1.00 0.00 ? 102 ARG A N    3  
ATOM 5517  C CA   . ARG A 1 102 ? -19.193 -13.581 -10.046 1.00 0.00 ? 102 ARG A CA   3  
ATOM 5518  C C    . ARG A 1 102 ? -17.739 -13.130 -10.148 1.00 0.00 ? 102 ARG A C    3  
ATOM 5519  O O    . ARG A 1 102 ? -17.186 -13.109 -11.245 1.00 0.00 ? 102 ARG A O    3  
ATOM 5520  C CB   . ARG A 1 102 ? -20.139 -12.347 -10.042 1.00 0.00 ? 102 ARG A CB   3  
ATOM 5521  C CG   . ARG A 1 102 ? -21.644 -12.649 -9.919  1.00 0.00 ? 102 ARG A CG   3  
ATOM 5522  C CD   . ARG A 1 102 ? -22.456 -13.013 -11.158 1.00 0.00 ? 102 ARG A CD   3  
ATOM 5523  N NE   . ARG A 1 102 ? -21.944 -14.272 -11.814 1.00 0.00 ? 102 ARG A NE   3  
ATOM 5524  C CZ   . ARG A 1 102 ? -22.182 -15.545 -11.363 1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5525  N NH1  . ARG A 1 102 ? -22.974 -15.777 -10.277 1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5526  N NH2  . ARG A 1 102 ? -21.597 -16.598 -12.007 1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5527  H H    . ARG A 1 102 ? -19.783 -14.083 -8.087  1.00 0.00 ? 102 ARG A H    3  
ATOM 5528  H HA   . ARG A 1 102 ? -19.388 -14.137 -10.945 1.00 0.00 ? 102 ARG A HA   3  
ATOM 5529  H HB2  . ARG A 1 102 ? -19.908 -11.748 -9.130  1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5530  H HB3  . ARG A 1 102 ? -19.981 -11.710 -10.939 1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5531  H HG2  . ARG A 1 102 ? -21.758 -13.489 -9.214  1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5532  H HG3  . ARG A 1 102 ? -22.125 -11.753 -9.458  1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5533  H HD2  . ARG A 1 102 ? -23.507 -13.156 -10.813 1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5534  H HD3  . ARG A 1 102 ? -22.400 -12.173 -11.877 1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5535  H HE   . ARG A 1 102 ? -21.353 -14.164 -12.615 1.00 0.00 ? 102 ARG A HE   3  
ATOM 5536  H HH11 . ARG A 1 102 ? -23.396 -15.009 -9.796  1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5537  H HH12 . ARG A 1 102 ? -23.125 -16.712 -9.960  1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5538  H HH21 . ARG A 1 102 ? -21.009 -16.436 -12.800 1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5539  H HH22 . ARG A 1 102 ? -21.756 -17.532 -11.685 1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5540  N N    . GLN A 1 103 ? -17.046 -12.847 -8.998  1.00 0.00 ? 103 GLN A N    3  
ATOM 5541  C CA   . GLN A 1 103 ? -15.615 -12.521 -8.939  1.00 0.00 ? 103 GLN A CA   3  
ATOM 5542  C C    . GLN A 1 103 ? -14.656 -13.608 -9.413  1.00 0.00 ? 103 GLN A C    3  
ATOM 5543  O O    . GLN A 1 103 ? -13.656 -13.308 -10.050 1.00 0.00 ? 103 GLN A O    3  
ATOM 5544  C CB   . GLN A 1 103 ? -15.146 -11.787 -7.650  1.00 0.00 ? 103 GLN A CB   3  
ATOM 5545  C CG   . GLN A 1 103 ? -15.615 -10.311 -7.775  1.00 0.00 ? 103 GLN A CG   3  
ATOM 5546  C CD   . GLN A 1 103 ? -15.776 -9.474  -6.500  1.00 0.00 ? 103 GLN A CD   3  
ATOM 5547  O OE1  . GLN A 1 103 ? -16.853 -9.047  -6.063  1.00 0.00 ? 103 GLN A OE1  3  
ATOM 5548  N NE2  . GLN A 1 103 ? -14.609 -9.148  -5.889  1.00 0.00 ? 103 GLN A NE2  3  
ATOM 5549  H H    . GLN A 1 103 ? -17.505 -12.835 -8.090  1.00 0.00 ? 103 GLN A H    3  
ATOM 5550  H HA   . GLN A 1 103 ? -15.499 -11.735 -9.640  1.00 0.00 ? 103 GLN A HA   3  
ATOM 5551  H HB2  . GLN A 1 103 ? -15.564 -12.314 -6.770  1.00 0.00 ? 103 GLN A HB2  3  
ATOM 5552  H HB3  . GLN A 1 103 ? -14.034 -11.780 -7.544  1.00 0.00 ? 103 GLN A HB3  3  
ATOM 5553  H HG2  . GLN A 1 103 ? -14.877 -9.811  -8.427  1.00 0.00 ? 103 GLN A HG2  3  
ATOM 5554  H HG3  . GLN A 1 103 ? -16.584 -10.327 -8.304  1.00 0.00 ? 103 GLN A HG3  3  
ATOM 5555  H HE21 . GLN A 1 103 ? -13.718 -9.470  -6.228  1.00 0.00 ? 103 GLN A HE21 3  
ATOM 5556  H HE22 . GLN A 1 103 ? -14.665 -8.613  -5.050  1.00 0.00 ? 103 GLN A HE22 3  
ATOM 5557  N N    . LEU A 1 104 ? -14.951 -14.908 -9.167  1.00 0.00 ? 104 LEU A N    3  
ATOM 5558  C CA   . LEU A 1 104 ? -14.150 -16.028 -9.657  1.00 0.00 ? 104 LEU A CA   3  
ATOM 5559  C C    . LEU A 1 104 ? -14.477 -16.382 -11.101 1.00 0.00 ? 104 LEU A C    3  
ATOM 5560  O O    . LEU A 1 104 ? -13.598 -16.510 -11.944 1.00 0.00 ? 104 LEU A O    3  
ATOM 5561  C CB   . LEU A 1 104 ? -14.194 -17.363 -8.842  1.00 0.00 ? 104 LEU A CB   3  
ATOM 5562  C CG   . LEU A 1 104 ? -14.614 -17.328 -7.367  1.00 0.00 ? 104 LEU A CG   3  
ATOM 5563  C CD1  . LEU A 1 104 ? -14.495 -18.729 -6.734  1.00 0.00 ? 104 LEU A CD1  3  
ATOM 5564  C CD2  . LEU A 1 104 ? -13.861 -16.299 -6.526  1.00 0.00 ? 104 LEU A CD2  3  
ATOM 5565  H H    . LEU A 1 104 ? -15.761 -15.101 -8.608  1.00 0.00 ? 104 LEU A H    3  
ATOM 5566  H HA   . LEU A 1 104 ? -13.108 -15.729 -9.638  1.00 0.00 ? 104 LEU A HA   3  
ATOM 5567  H HB2  . LEU A 1 104 ? -14.928 -18.081 -9.283  1.00 0.00 ? 104 LEU A HB2  3  
ATOM 5568  H HB3  . LEU A 1 104 ? -13.164 -17.786 -8.909  1.00 0.00 ? 104 LEU A HB3  3  
ATOM 5569  H HG   . LEU A 1 104 ? -15.695 -17.069 -7.366  1.00 0.00 ? 104 LEU A HG   3  
ATOM 5570  H HD11 . LEU A 1 104 ? -15.110 -19.470 -7.289  1.00 0.00 ? 104 LEU A HD11 3  
ATOM 5571  H HD12 . LEU A 1 104 ? -13.435 -19.064 -6.742  1.00 0.00 ? 104 LEU A HD12 3  
ATOM 5572  H HD13 . LEU A 1 104 ? -14.843 -18.693 -5.680  1.00 0.00 ? 104 LEU A HD13 3  
ATOM 5573  H HD21 . LEU A 1 104 ? -13.948 -15.257 -6.925  1.00 0.00 ? 104 LEU A HD21 3  
ATOM 5574  H HD22 . LEU A 1 104 ? -14.262 -16.271 -5.494  1.00 0.00 ? 104 LEU A HD22 3  
ATOM 5575  H HD23 . LEU A 1 104 ? -12.791 -16.566 -6.466  1.00 0.00 ? 104 LEU A HD23 3  
ATOM 5576  N N    . GLU A 1 105 ? -15.782 -16.612 -11.409 1.00 0.00 ? 105 GLU A N    3  
ATOM 5577  C CA   . GLU A 1 105 ? -16.248 -17.114 -12.700 1.00 0.00 ? 105 GLU A CA   3  
ATOM 5578  C C    . GLU A 1 105 ? -16.327 -16.121 -13.869 1.00 0.00 ? 105 GLU A C    3  
ATOM 5579  O O    . GLU A 1 105 ? -15.974 -16.465 -14.994 1.00 0.00 ? 105 GLU A O    3  
ATOM 5580  C CB   . GLU A 1 105 ? -17.620 -17.834 -12.534 1.00 0.00 ? 105 GLU A CB   3  
ATOM 5581  C CG   . GLU A 1 105 ? -17.633 -18.938 -11.449 1.00 0.00 ? 105 GLU A CG   3  
ATOM 5582  C CD   . GLU A 1 105 ? -19.006 -19.611 -11.434 1.00 0.00 ? 105 GLU A CD   3  
ATOM 5583  O OE1  . GLU A 1 105 ? -19.366 -20.248 -12.461 1.00 0.00 ? 105 GLU A OE1  3  
ATOM 5584  O OE2  . GLU A 1 105 ? -19.713 -19.497 -10.397 1.00 0.00 ? 105 GLU A OE2  3  
ATOM 5585  H H    . GLU A 1 105 ? -16.492 -16.514 -10.706 1.00 0.00 ? 105 GLU A H    3  
ATOM 5586  H HA   . GLU A 1 105 ? -15.530 -17.858 -13.026 1.00 0.00 ? 105 GLU A HA   3  
ATOM 5587  H HB2  . GLU A 1 105 ? -18.401 -17.085 -12.269 1.00 0.00 ? 105 GLU A HB2  3  
ATOM 5588  H HB3  . GLU A 1 105 ? -17.910 -18.304 -13.500 1.00 0.00 ? 105 GLU A HB3  3  
ATOM 5589  H HG2  . GLU A 1 105 ? -16.852 -19.695 -11.674 1.00 0.00 ? 105 GLU A HG2  3  
ATOM 5590  H HG3  . GLU A 1 105 ? -17.442 -18.521 -10.431 1.00 0.00 ? 105 GLU A HG3  3  
ATOM 5591  N N    . LEU A 1 106 ? -16.822 -14.872 -13.643 1.00 0.00 ? 106 LEU A N    3  
ATOM 5592  C CA   . LEU A 1 106 ? -16.984 -13.835 -14.672 1.00 0.00 ? 106 LEU A CA   3  
ATOM 5593  C C    . LEU A 1 106 ? -15.723 -13.039 -14.961 1.00 0.00 ? 106 LEU A C    3  
ATOM 5594  O O    . LEU A 1 106 ? -15.332 -12.822 -16.104 1.00 0.00 ? 106 LEU A O    3  
ATOM 5595  C CB   . LEU A 1 106 ? -18.037 -12.801 -14.282 1.00 0.00 ? 106 LEU A CB   3  
ATOM 5596  C CG   . LEU A 1 106 ? -19.449 -13.366 -14.029 1.00 0.00 ? 106 LEU A CG   3  
ATOM 5597  C CD1  . LEU A 1 106 ? -20.428 -12.200 -14.157 1.00 0.00 ? 106 LEU A CD1  3  
ATOM 5598  C CD2  . LEU A 1 106 ? -19.900 -14.486 -14.989 1.00 0.00 ? 106 LEU A CD2  3  
ATOM 5599  H H    . LEU A 1 106 ? -17.116 -14.601 -12.720 1.00 0.00 ? 106 LEU A H    3  
ATOM 5600  H HA   . LEU A 1 106 ? -17.347 -14.255 -15.597 1.00 0.00 ? 106 LEU A HA   3  
ATOM 5601  H HB2  . LEU A 1 106 ? -17.659 -12.286 -13.370 1.00 0.00 ? 106 LEU A HB2  3  
ATOM 5602  H HB3  . LEU A 1 106 ? -18.141 -12.037 -15.092 1.00 0.00 ? 106 LEU A HB3  3  
ATOM 5603  H HG   . LEU A 1 106 ? -19.476 -13.778 -12.993 1.00 0.00 ? 106 LEU A HG   3  
ATOM 5604  H HD11 . LEU A 1 106 ? -20.174 -11.390 -13.444 1.00 0.00 ? 106 LEU A HD11 3  
ATOM 5605  H HD12 . LEU A 1 106 ? -20.344 -11.810 -15.195 1.00 0.00 ? 106 LEU A HD12 3  
ATOM 5606  H HD13 . LEU A 1 106 ? -21.471 -12.532 -13.989 1.00 0.00 ? 106 LEU A HD13 3  
ATOM 5607  H HD21 . LEU A 1 106 ? -19.802 -14.151 -16.042 1.00 0.00 ? 106 LEU A HD21 3  
ATOM 5608  H HD22 . LEU A 1 106 ? -19.295 -15.407 -14.850 1.00 0.00 ? 106 LEU A HD22 3  
ATOM 5609  H HD23 . LEU A 1 106 ? -20.962 -14.745 -14.799 1.00 0.00 ? 106 LEU A HD23 3  
ATOM 5610  N N    . GLU A 1 107 ? -15.052 -12.576 -13.868 1.00 0.00 ? 107 GLU A N    3  
ATOM 5611  C CA   . GLU A 1 107 ? -13.834 -11.766 -13.845 1.00 0.00 ? 107 GLU A CA   3  
ATOM 5612  C C    . GLU A 1 107 ? -12.587 -12.507 -14.348 1.00 0.00 ? 107 GLU A C    3  
ATOM 5613  O O    . GLU A 1 107 ? -11.563 -11.930 -14.719 1.00 0.00 ? 107 GLU A O    3  
ATOM 5614  C CB   . GLU A 1 107 ? -13.646 -11.155 -12.452 1.00 0.00 ? 107 GLU A CB   3  
ATOM 5615  C CG   . GLU A 1 107 ? -12.880 -9.830  -12.520 1.00 0.00 ? 107 GLU A CG   3  
ATOM 5616  C CD   . GLU A 1 107 ? -13.684 -8.717  -13.198 1.00 0.00 ? 107 GLU A CD   3  
ATOM 5617  O OE1  . GLU A 1 107 ? -13.195 -8.171  -14.222 1.00 0.00 ? 107 GLU A OE1  3  
ATOM 5618  O OE2  . GLU A 1 107 ? -14.796 -8.399  -12.697 1.00 0.00 ? 107 GLU A OE2  3  
ATOM 5619  H H    . GLU A 1 107 ? -15.428 -12.772 -12.963 1.00 0.00 ? 107 GLU A H    3  
ATOM 5620  H HA   . GLU A 1 107 ? -13.955 -10.875 -14.433 1.00 0.00 ? 107 GLU A HA   3  
ATOM 5621  H HB2  . GLU A 1 107 ? -14.637 -10.962 -11.967 1.00 0.00 ? 107 GLU A HB2  3  
ATOM 5622  H HB3  . GLU A 1 107 ? -13.112 -11.851 -11.770 1.00 0.00 ? 107 GLU A HB3  3  
ATOM 5623  H HG2  . GLU A 1 107 ? -12.707 -9.552  -11.485 1.00 0.00 ? 107 GLU A HG2  3  
ATOM 5624  H HG3  . GLU A 1 107 ? -11.902 -9.972  -13.019 1.00 0.00 ? 107 GLU A HG3  3  
ATOM 5625  N N    . LYS A 1 108 ? -12.742 -13.853 -14.363 1.00 0.00 ? 108 LYS A N    3  
ATOM 5626  C CA   . LYS A 1 108 ? -11.764 -14.831 -14.840 1.00 0.00 ? 108 LYS A CA   3  
ATOM 5627  C C    . LYS A 1 108 ? -12.372 -15.839 -15.812 1.00 0.00 ? 108 LYS A C    3  
ATOM 5628  O O    . LYS A 1 108 ? -12.099 -17.040 -15.801 1.00 0.00 ? 108 LYS A O    3  
ATOM 5629  C CB   . LYS A 1 108 ? -11.048 -15.608 -13.718 1.00 0.00 ? 108 LYS A CB   3  
ATOM 5630  C CG   . LYS A 1 108 ? -10.615 -14.751 -12.519 1.00 0.00 ? 108 LYS A CG   3  
ATOM 5631  C CD   . LYS A 1 108 ? -9.592  -15.407 -11.574 1.00 0.00 ? 108 LYS A CD   3  
ATOM 5632  C CE   . LYS A 1 108 ? -10.163 -16.411 -10.554 1.00 0.00 ? 108 LYS A CE   3  
ATOM 5633  N NZ   . LYS A 1 108 ? -10.609 -17.675 -11.185 1.00 0.00 ? 108 LYS A NZ   3  
ATOM 5634  H H    . LYS A 1 108 ? -13.649 -14.143 -14.027 1.00 0.00 ? 108 LYS A H    3  
ATOM 5635  H HA   . LYS A 1 108 ? -10.991 -14.313 -15.395 1.00 0.00 ? 108 LYS A HA   3  
ATOM 5636  H HB2  . LYS A 1 108 ? -11.674 -16.440 -13.327 1.00 0.00 ? 108 LYS A HB2  3  
ATOM 5637  H HB3  . LYS A 1 108 ? -10.180 -16.049 -14.240 1.00 0.00 ? 108 LYS A HB3  3  
ATOM 5638  H HG2  . LYS A 1 108 ? -10.161 -13.811 -12.914 1.00 0.00 ? 108 LYS A HG2  3  
ATOM 5639  H HG3  . LYS A 1 108 ? -11.533 -14.486 -11.941 1.00 0.00 ? 108 LYS A HG3  3  
ATOM 5640  H HD2  . LYS A 1 108 ? -8.784  -15.881 -12.174 1.00 0.00 ? 108 LYS A HD2  3  
ATOM 5641  H HD3  . LYS A 1 108 ? -9.124  -14.581 -10.988 1.00 0.00 ? 108 LYS A HD3  3  
ATOM 5642  H HE2  . LYS A 1 108 ? -9.389  -16.682 -9.803  1.00 0.00 ? 108 LYS A HE2  3  
ATOM 5643  H HE3  . LYS A 1 108 ? -11.031 -15.972 -10.023 1.00 0.00 ? 108 LYS A HE3  3  
ATOM 5644  H HZ1  . LYS A 1 108 ? -9.805  -18.124 -11.668 1.00 0.00 ? 108 LYS A HZ1  3  
ATOM 5645  H HZ2  . LYS A 1 108 ? -10.977 -18.317 -10.454 1.00 0.00 ? 108 LYS A HZ2  3  
ATOM 5646  H HZ3  . LYS A 1 108 ? -11.359 -17.470 -11.877 1.00 0.00 ? 108 LYS A HZ3  3  
ATOM 5647  N N    . LYS A 1 109 ? -13.228 -15.335 -16.709 1.00 0.00 ? 109 LYS A N    3  
ATOM 5648  C CA   . LYS A 1 109 ? -14.005 -16.079 -17.708 1.00 0.00 ? 109 LYS A CA   3  
ATOM 5649  C C    . LYS A 1 109 ? -13.241 -16.413 -18.983 1.00 0.00 ? 109 LYS A C    3  
ATOM 5650  O O    . LYS A 1 109 ? -13.502 -15.920 -20.081 1.00 0.00 ? 109 LYS A O    3  
ATOM 5651  C CB   . LYS A 1 109 ? -15.325 -15.355 -18.045 1.00 0.00 ? 109 LYS A CB   3  
ATOM 5652  C CG   . LYS A 1 109 ? -16.394 -16.217 -18.730 1.00 0.00 ? 109 LYS A CG   3  
ATOM 5653  C CD   . LYS A 1 109 ? -17.775 -15.555 -18.657 1.00 0.00 ? 109 LYS A CD   3  
ATOM 5654  C CE   . LYS A 1 109 ? -18.889 -16.387 -19.304 1.00 0.00 ? 109 LYS A CE   3  
ATOM 5655  N NZ   . LYS A 1 109 ? -20.202 -15.721 -19.145 1.00 0.00 ? 109 LYS A NZ   3  
ATOM 5656  H H    . LYS A 1 109 ? -13.348 -14.357 -16.603 1.00 0.00 ? 109 LYS A H    3  
ATOM 5657  H HA   . LYS A 1 109 ? -14.313 -17.019 -17.263 1.00 0.00 ? 109 LYS A HA   3  
ATOM 5658  H HB2  . LYS A 1 109 ? -15.766 -15.051 -17.071 1.00 0.00 ? 109 LYS A HB2  3  
ATOM 5659  H HB3  . LYS A 1 109 ? -15.128 -14.421 -18.613 1.00 0.00 ? 109 LYS A HB3  3  
ATOM 5660  H HG2  . LYS A 1 109 ? -16.119 -16.397 -19.792 1.00 0.00 ? 109 LYS A HG2  3  
ATOM 5661  H HG3  . LYS A 1 109 ? -16.454 -17.203 -18.211 1.00 0.00 ? 109 LYS A HG3  3  
ATOM 5662  H HD2  . LYS A 1 109 ? -18.010 -15.396 -17.580 1.00 0.00 ? 109 LYS A HD2  3  
ATOM 5663  H HD3  . LYS A 1 109 ? -17.715 -14.554 -19.145 1.00 0.00 ? 109 LYS A HD3  3  
ATOM 5664  H HE2  . LYS A 1 109 ? -18.706 -16.516 -20.392 1.00 0.00 ? 109 LYS A HE2  3  
ATOM 5665  H HE3  . LYS A 1 109 ? -18.962 -17.388 -18.826 1.00 0.00 ? 109 LYS A HE3  3  
ATOM 5666  H HZ1  . LYS A 1 109 ? -20.406 -15.599 -18.132 1.00 0.00 ? 109 LYS A HZ1  3  
ATOM 5667  H HZ2  . LYS A 1 109 ? -20.175 -14.789 -19.607 1.00 0.00 ? 109 LYS A HZ2  3  
ATOM 5668  H HZ3  . LYS A 1 109 ? -20.943 -16.304 -19.581 1.00 0.00 ? 109 LYS A HZ3  3  
ATOM 5669  N N    . LYS A 1 110 ? -12.244 -17.314 -18.858 1.00 0.00 ? 110 LYS A N    3  
ATOM 5670  C CA   . LYS A 1 110 ? -11.320 -17.760 -19.898 1.00 0.00 ? 110 LYS A CA   3  
ATOM 5671  C C    . LYS A 1 110 ? -11.881 -18.708 -20.973 1.00 0.00 ? 110 LYS A C    3  
ATOM 5672  O O    . LYS A 1 110 ? -11.349 -19.785 -21.222 1.00 0.00 ? 110 LYS A O    3  
ATOM 5673  C CB   . LYS A 1 110 ? -10.052 -18.364 -19.235 1.00 0.00 ? 110 LYS A CB   3  
ATOM 5674  C CG   . LYS A 1 110 ? -9.313  -17.346 -18.347 1.00 0.00 ? 110 LYS A CG   3  
ATOM 5675  C CD   . LYS A 1 110 ? -8.029  -17.903 -17.702 1.00 0.00 ? 110 LYS A CD   3  
ATOM 5676  C CE   . LYS A 1 110 ? -8.262  -18.980 -16.628 1.00 0.00 ? 110 LYS A CE   3  
ATOM 5677  N NZ   . LYS A 1 110 ? -9.050  -18.449 -15.490 1.00 0.00 ? 110 LYS A NZ   3  
ATOM 5678  H H    . LYS A 1 110 ? -12.075 -17.662 -17.934 1.00 0.00 ? 110 LYS A H    3  
ATOM 5679  H HA   . LYS A 1 110 ? -10.987 -16.878 -20.431 1.00 0.00 ? 110 LYS A HA   3  
ATOM 5680  H HB2  . LYS A 1 110 ? -10.347 -19.242 -18.618 1.00 0.00 ? 110 LYS A HB2  3  
ATOM 5681  H HB3  . LYS A 1 110 ? -9.332  -18.715 -20.009 1.00 0.00 ? 110 LYS A HB3  3  
ATOM 5682  H HG2  . LYS A 1 110 ? -9.028  -16.474 -18.980 1.00 0.00 ? 110 LYS A HG2  3  
ATOM 5683  H HG3  . LYS A 1 110 ? -9.985  -16.969 -17.545 1.00 0.00 ? 110 LYS A HG3  3  
ATOM 5684  H HD2  . LYS A 1 110 ? -7.381  -18.314 -18.509 1.00 0.00 ? 110 LYS A HD2  3  
ATOM 5685  H HD3  . LYS A 1 110 ? -7.483  -17.048 -17.238 1.00 0.00 ? 110 LYS A HD3  3  
ATOM 5686  H HE2  . LYS A 1 110 ? -8.817  -19.848 -17.043 1.00 0.00 ? 110 LYS A HE2  3  
ATOM 5687  H HE3  . LYS A 1 110 ? -7.294  -19.342 -16.218 1.00 0.00 ? 110 LYS A HE3  3  
ATOM 5688  H HZ1  . LYS A 1 110 ? -8.541  -17.650 -15.060 1.00 0.00 ? 110 LYS A HZ1  3  
ATOM 5689  H HZ2  . LYS A 1 110 ? -9.977  -18.125 -15.833 1.00 0.00 ? 110 LYS A HZ2  3  
ATOM 5690  H HZ3  . LYS A 1 110 ? -9.185  -19.198 -14.781 1.00 0.00 ? 110 LYS A HZ3  3  
ATOM 5691  N N    . LYS A 1 111 ? -12.967 -18.274 -21.665 1.00 0.00 ? 111 LYS A N    3  
ATOM 5692  C CA   . LYS A 1 111 ? -13.619 -18.973 -22.772 1.00 0.00 ? 111 LYS A CA   3  
ATOM 5693  C C    . LYS A 1 111 ? -13.235 -18.328 -24.099 1.00 0.00 ? 111 LYS A C    3  
ATOM 5694  O O    . LYS A 1 111 ? -13.750 -18.687 -25.159 1.00 0.00 ? 111 LYS A O    3  
ATOM 5695  C CB   . LYS A 1 111 ? -15.165 -19.001 -22.610 1.00 0.00 ? 111 LYS A CB   3  
ATOM 5696  C CG   . LYS A 1 111 ? -15.628 -19.909 -21.457 1.00 0.00 ? 111 LYS A CG   3  
ATOM 5697  C CD   . LYS A 1 111 ? -17.147 -19.858 -21.201 1.00 0.00 ? 111 LYS A CD   3  
ATOM 5698  C CE   . LYS A 1 111 ? -18.022 -20.387 -22.350 1.00 0.00 ? 111 LYS A CE   3  
ATOM 5699  N NZ   . LYS A 1 111 ? -17.731 -21.812 -22.638 1.00 0.00 ? 111 LYS A NZ   3  
ATOM 5700  H H    . LYS A 1 111 ? -13.359 -17.388 -21.385 1.00 0.00 ? 111 LYS A H    3  
ATOM 5701  H HA   . LYS A 1 111 ? -13.281 -20.002 -22.823 1.00 0.00 ? 111 LYS A HA   3  
ATOM 5702  H HB2  . LYS A 1 111 ? -15.541 -17.969 -22.427 1.00 0.00 ? 111 LYS A HB2  3  
ATOM 5703  H HB3  . LYS A 1 111 ? -15.647 -19.382 -23.540 1.00 0.00 ? 111 LYS A HB3  3  
ATOM 5704  H HG2  . LYS A 1 111 ? -15.317 -20.956 -21.665 1.00 0.00 ? 111 LYS A HG2  3  
ATOM 5705  H HG3  . LYS A 1 111 ? -15.112 -19.589 -20.524 1.00 0.00 ? 111 LYS A HG3  3  
ATOM 5706  H HD2  . LYS A 1 111 ? -17.366 -20.447 -20.281 1.00 0.00 ? 111 LYS A HD2  3  
ATOM 5707  H HD3  . LYS A 1 111 ? -17.423 -18.800 -20.987 1.00 0.00 ? 111 LYS A HD3  3  
ATOM 5708  H HE2  . LYS A 1 111 ? -19.100 -20.318 -22.086 1.00 0.00 ? 111 LYS A HE2  3  
ATOM 5709  H HE3  . LYS A 1 111 ? -17.852 -19.815 -23.286 1.00 0.00 ? 111 LYS A HE3  3  
ATOM 5710  H HZ1  . LYS A 1 111 ? -16.732 -21.912 -22.909 1.00 0.00 ? 111 LYS A HZ1  3  
ATOM 5711  H HZ2  . LYS A 1 111 ? -17.921 -22.383 -21.791 1.00 0.00 ? 111 LYS A HZ2  3  
ATOM 5712  H HZ3  . LYS A 1 111 ? -18.335 -22.138 -23.420 1.00 0.00 ? 111 LYS A HZ3  3  
ATOM 5713  N N    . GLY A 1 1   ? -10.442 9.740   20.907  1.00 0.00 ? 1   GLY A N    4  
ATOM 5714  C CA   . GLY A 1 1   ? -11.643 10.375  20.416  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5715  C C    . GLY A 1 1   ? -11.996 11.520  21.308  1.00 0.00 ? 1   GLY A C    4  
ATOM 5716  O O    . GLY A 1 1   ? -13.158 11.885  21.465  1.00 0.00 ? 1   GLY A O    4  
ATOM 5717  H H    . GLY A 1 1   ? -10.418 8.742   20.968  1.00 0.00 ? 1   GLY A H    4  
ATOM 5718  H HA2  . GLY A 1 1   ? -11.433 10.768  19.432  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5719  H HA3  . GLY A 1 1   ? -12.452 9.661   20.447  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5720  N N    . GLN A 1 2   ? -10.970 12.140  21.933  1.00 0.00 ? 2   GLN A N    4  
ATOM 5721  C CA   . GLN A 1 2   ? -11.109 13.251  22.866  1.00 0.00 ? 2   GLN A CA   4  
ATOM 5722  C C    . GLN A 1 2   ? -9.815  14.056  22.854  1.00 0.00 ? 2   GLN A C    4  
ATOM 5723  O O    . GLN A 1 2   ? -8.874  13.731  22.136  1.00 0.00 ? 2   GLN A O    4  
ATOM 5724  C CB   . GLN A 1 2   ? -11.440 12.719  24.304  1.00 0.00 ? 2   GLN A CB   4  
ATOM 5725  C CG   . GLN A 1 2   ? -12.792 13.216  24.869  1.00 0.00 ? 2   GLN A CG   4  
ATOM 5726  C CD   . GLN A 1 2   ? -12.656 14.620  25.460  1.00 0.00 ? 2   GLN A CD   4  
ATOM 5727  O OE1  . GLN A 1 2   ? -12.171 15.556  24.820  1.00 0.00 ? 2   GLN A OE1  4  
ATOM 5728  N NE2  . GLN A 1 2   ? -13.064 14.792  26.739  1.00 0.00 ? 2   GLN A NE2  4  
ATOM 5729  H H    . GLN A 1 2   ? -10.042 11.800  21.771  1.00 0.00 ? 2   GLN A H    4  
ATOM 5730  H HA   . GLN A 1 2   ? -11.892 13.921  22.527  1.00 0.00 ? 2   GLN A HA   4  
ATOM 5731  H HB2  . GLN A 1 2   ? -11.525 11.610  24.220  1.00 0.00 ? 2   GLN A HB2  4  
ATOM 5732  H HB3  . GLN A 1 2   ? -10.628 12.898  25.047  1.00 0.00 ? 2   GLN A HB3  4  
ATOM 5733  H HG2  . GLN A 1 2   ? -13.553 13.237  24.060  1.00 0.00 ? 2   GLN A HG2  4  
ATOM 5734  H HG3  . GLN A 1 2   ? -13.141 12.513  25.655  1.00 0.00 ? 2   GLN A HG3  4  
ATOM 5735  H HE21 . GLN A 1 2   ? -13.431 14.027  27.260  1.00 0.00 ? 2   GLN A HE21 4  
ATOM 5736  H HE22 . GLN A 1 2   ? -12.941 15.699  27.132  1.00 0.00 ? 2   GLN A HE22 4  
ATOM 5737  N N    . ARG A 1 3   ? -9.740  15.143  23.669  1.00 0.00 ? 3   ARG A N    4  
ATOM 5738  C CA   . ARG A 1 3   ? -8.578  16.002  23.950  1.00 0.00 ? 3   ARG A CA   4  
ATOM 5739  C C    . ARG A 1 3   ? -8.175  17.019  22.873  1.00 0.00 ? 3   ARG A C    4  
ATOM 5740  O O    . ARG A 1 3   ? -7.864  18.173  23.165  1.00 0.00 ? 3   ARG A O    4  
ATOM 5741  C CB   . ARG A 1 3   ? -7.372  15.189  24.513  1.00 0.00 ? 3   ARG A CB   4  
ATOM 5742  C CG   . ARG A 1 3   ? -6.391  15.969  25.402  1.00 0.00 ? 3   ARG A CG   4  
ATOM 5743  C CD   . ARG A 1 3   ? -7.012  16.543  26.683  1.00 0.00 ? 3   ARG A CD   4  
ATOM 5744  N NE   . ARG A 1 3   ? -5.931  17.218  27.482  1.00 0.00 ? 3   ARG A NE   4  
ATOM 5745  C CZ   . ARG A 1 3   ? -6.169  17.845  28.677  1.00 0.00 ? 3   ARG A CZ   4  
ATOM 5746  N NH1  . ARG A 1 3   ? -7.422  17.879  29.215  1.00 0.00 ? 3   ARG A NH1  4  
ATOM 5747  N NH2  . ARG A 1 3   ? -5.135  18.443  29.337  1.00 0.00 ? 3   ARG A NH2  4  
ATOM 5748  H H    . ARG A 1 3   ? -10.571 15.368  24.203  1.00 0.00 ? 3   ARG A H    4  
ATOM 5749  H HA   . ARG A 1 3   ? -8.911  16.617  24.770  1.00 0.00 ? 3   ARG A HA   4  
ATOM 5750  H HB2  . ARG A 1 3   ? -7.773  14.338  25.106  1.00 0.00 ? 3   ARG A HB2  4  
ATOM 5751  H HB3  . ARG A 1 3   ? -6.772  14.777  23.676  1.00 0.00 ? 3   ARG A HB3  4  
ATOM 5752  H HG2  . ARG A 1 3   ? -5.558  15.286  25.683  1.00 0.00 ? 3   ARG A HG2  4  
ATOM 5753  H HG3  . ARG A 1 3   ? -5.977  16.766  24.756  1.00 0.00 ? 3   ARG A HG3  4  
ATOM 5754  H HD2  . ARG A 1 3   ? -7.795  17.292  26.436  1.00 0.00 ? 3   ARG A HD2  4  
ATOM 5755  H HD3  . ARG A 1 3   ? -7.457  15.720  27.286  1.00 0.00 ? 3   ARG A HD3  4  
ATOM 5756  H HE   . ARG A 1 3   ? -4.999  17.213  27.120  1.00 0.00 ? 3   ARG A HE   4  
ATOM 5757  H HH11 . ARG A 1 3   ? -8.183  17.440  28.736  1.00 0.00 ? 3   ARG A HH11 4  
ATOM 5758  H HH12 . ARG A 1 3   ? -7.580  18.340  30.086  1.00 0.00 ? 3   ARG A HH12 4  
ATOM 5759  H HH21 . ARG A 1 3   ? -4.212  18.418  28.950  1.00 0.00 ? 3   ARG A HH21 4  
ATOM 5760  H HH22 . ARG A 1 3   ? -5.300  18.904  30.210  1.00 0.00 ? 3   ARG A HH22 4  
ATOM 5761  N N    . GLN A 1 4   ? -8.200  16.584  21.585  1.00 0.00 ? 4   GLN A N    4  
ATOM 5762  C CA   . GLN A 1 4   ? -7.956  17.355  20.367  1.00 0.00 ? 4   GLN A CA   4  
ATOM 5763  C C    . GLN A 1 4   ? -9.205  18.109  19.934  1.00 0.00 ? 4   GLN A C    4  
ATOM 5764  O O    . GLN A 1 4   ? -9.129  19.248  19.469  1.00 0.00 ? 4   GLN A O    4  
ATOM 5765  C CB   . GLN A 1 4   ? -7.558  16.406  19.193  1.00 0.00 ? 4   GLN A CB   4  
ATOM 5766  C CG   . GLN A 1 4   ? -7.369  17.044  17.788  1.00 0.00 ? 4   GLN A CG   4  
ATOM 5767  C CD   . GLN A 1 4   ? -6.279  18.121  17.743  1.00 0.00 ? 4   GLN A CD   4  
ATOM 5768  O OE1  . GLN A 1 4   ? -5.130  17.867  17.379  1.00 0.00 ? 4   GLN A OE1  4  
ATOM 5769  N NE2  . GLN A 1 4   ? -6.658  19.372  18.103  1.00 0.00 ? 4   GLN A NE2  4  
ATOM 5770  H H    . GLN A 1 4   ? -8.427  15.615  21.463  1.00 0.00 ? 4   GLN A H    4  
ATOM 5771  H HA   . GLN A 1 4   ? -7.172  18.078  20.549  1.00 0.00 ? 4   GLN A HA   4  
ATOM 5772  H HB2  . GLN A 1 4   ? -6.615  15.886  19.475  1.00 0.00 ? 4   GLN A HB2  4  
ATOM 5773  H HB3  . GLN A 1 4   ? -8.346  15.623  19.079  1.00 0.00 ? 4   GLN A HB3  4  
ATOM 5774  H HG2  . GLN A 1 4   ? -7.079  16.252  17.067  1.00 0.00 ? 4   GLN A HG2  4  
ATOM 5775  H HG3  . GLN A 1 4   ? -8.332  17.479  17.436  1.00 0.00 ? 4   GLN A HG3  4  
ATOM 5776  H HE21 . GLN A 1 4   ? -7.580  19.507  18.490  1.00 0.00 ? 4   GLN A HE21 4  
ATOM 5777  H HE22 . GLN A 1 4   ? -5.982  20.101  18.059  1.00 0.00 ? 4   GLN A HE22 4  
ATOM 5778  N N    . LEU A 1 5   ? -10.359 17.398  20.066  1.00 0.00 ? 5   LEU A N    4  
ATOM 5779  C CA   . LEU A 1 5   ? -11.724 17.779  19.736  1.00 0.00 ? 5   LEU A CA   4  
ATOM 5780  C C    . LEU A 1 5   ? -12.013 17.627  18.246  1.00 0.00 ? 5   LEU A C    4  
ATOM 5781  O O    . LEU A 1 5   ? -12.139 18.601  17.510  1.00 0.00 ? 5   LEU A O    4  
ATOM 5782  C CB   . LEU A 1 5   ? -12.167 19.145  20.333  1.00 0.00 ? 5   LEU A CB   4  
ATOM 5783  C CG   . LEU A 1 5   ? -11.926 19.288  21.861  1.00 0.00 ? 5   LEU A CG   4  
ATOM 5784  C CD1  . LEU A 1 5   ? -12.632 20.542  22.396  1.00 0.00 ? 5   LEU A CD1  4  
ATOM 5785  C CD2  . LEU A 1 5   ? -12.338 18.052  22.683  1.00 0.00 ? 5   LEU A CD2  4  
ATOM 5786  H H    . LEU A 1 5   ? -10.275 16.491  20.466  1.00 0.00 ? 5   LEU A H    4  
ATOM 5787  H HA   . LEU A 1 5   ? -12.353 17.040  20.210  1.00 0.00 ? 5   LEU A HA   4  
ATOM 5788  H HB2  . LEU A 1 5   ? -11.613 19.963  19.818  1.00 0.00 ? 5   LEU A HB2  4  
ATOM 5789  H HB3  . LEU A 1 5   ? -13.250 19.301  20.133  1.00 0.00 ? 5   LEU A HB3  4  
ATOM 5790  H HG   . LEU A 1 5   ? -10.830 19.425  22.021  1.00 0.00 ? 5   LEU A HG   4  
ATOM 5791  H HD11 . LEU A 1 5   ? -12.261 21.445  21.865  1.00 0.00 ? 5   LEU A HD11 4  
ATOM 5792  H HD12 . LEU A 1 5   ? -13.729 20.462  22.238  1.00 0.00 ? 5   LEU A HD12 4  
ATOM 5793  H HD13 . LEU A 1 5   ? -12.440 20.667  23.483  1.00 0.00 ? 5   LEU A HD13 4  
ATOM 5794  H HD21 . LEU A 1 5   ? -13.410 17.814  22.523  1.00 0.00 ? 5   LEU A HD21 4  
ATOM 5795  H HD22 . LEU A 1 5   ? -11.720 17.173  22.404  1.00 0.00 ? 5   LEU A HD22 4  
ATOM 5796  H HD23 . LEU A 1 5   ? -12.175 18.242  23.765  1.00 0.00 ? 5   LEU A HD23 4  
ATOM 5797  N N    . LEU A 1 6   ? -12.100 16.342  17.789  1.00 0.00 ? 6   LEU A N    4  
ATOM 5798  C CA   . LEU A 1 6   ? -12.292 15.843  16.423  1.00 0.00 ? 6   LEU A CA   4  
ATOM 5799  C C    . LEU A 1 6   ? -13.546 16.324  15.658  1.00 0.00 ? 6   LEU A C    4  
ATOM 5800  O O    . LEU A 1 6   ? -14.582 16.644  16.239  1.00 0.00 ? 6   LEU A O    4  
ATOM 5801  C CB   . LEU A 1 6   ? -12.261 14.282  16.407  1.00 0.00 ? 6   LEU A CB   4  
ATOM 5802  C CG   . LEU A 1 6   ? -10.861 13.616  16.314  1.00 0.00 ? 6   LEU A CG   4  
ATOM 5803  C CD1  . LEU A 1 6   ? -10.214 13.796  14.929  1.00 0.00 ? 6   LEU A CD1  4  
ATOM 5804  C CD2  . LEU A 1 6   ? -9.892  14.056  17.420  1.00 0.00 ? 6   LEU A CD2  4  
ATOM 5805  H H    . LEU A 1 6   ? -11.967 15.610  18.447  1.00 0.00 ? 6   LEU A H    4  
ATOM 5806  H HA   . LEU A 1 6   ? -11.419 16.171  15.882  1.00 0.00 ? 6   LEU A HA   4  
ATOM 5807  H HB2  . LEU A 1 6   ? -12.752 13.946  17.343  1.00 0.00 ? 6   LEU A HB2  4  
ATOM 5808  H HB3  . LEU A 1 6   ? -12.845 13.853  15.559  1.00 0.00 ? 6   LEU A HB3  4  
ATOM 5809  H HG   . LEU A 1 6   ? -11.028 12.519  16.443  1.00 0.00 ? 6   LEU A HG   4  
ATOM 5810  H HD11 . LEU A 1 6   ? -10.868 13.368  14.137  1.00 0.00 ? 6   LEU A HD11 4  
ATOM 5811  H HD12 . LEU A 1 6   ? -10.041 14.869  14.703  1.00 0.00 ? 6   LEU A HD12 4  
ATOM 5812  H HD13 . LEU A 1 6   ? -9.236  13.269  14.896  1.00 0.00 ? 6   LEU A HD13 4  
ATOM 5813  H HD21 . LEU A 1 6   ? -10.337 13.901  18.425  1.00 0.00 ? 6   LEU A HD21 4  
ATOM 5814  H HD22 . LEU A 1 6   ? -8.949  13.468  17.359  1.00 0.00 ? 6   LEU A HD22 4  
ATOM 5815  H HD23 . LEU A 1 6   ? -9.638  15.128  17.293  1.00 0.00 ? 6   LEU A HD23 4  
ATOM 5816  N N    . LEU A 1 7   ? -13.455 16.364  14.299  1.00 0.00 ? 7   LEU A N    4  
ATOM 5817  C CA   . LEU A 1 7   ? -14.512 16.842  13.403  1.00 0.00 ? 7   LEU A CA   4  
ATOM 5818  C C    . LEU A 1 7   ? -15.144 15.773  12.538  1.00 0.00 ? 7   LEU A C    4  
ATOM 5819  O O    . LEU A 1 7   ? -15.893 16.093  11.612  1.00 0.00 ? 7   LEU A O    4  
ATOM 5820  C CB   . LEU A 1 7   ? -14.025 18.020  12.505  1.00 0.00 ? 7   LEU A CB   4  
ATOM 5821  C CG   . LEU A 1 7   ? -13.440 19.234  13.263  1.00 0.00 ? 7   LEU A CG   4  
ATOM 5822  C CD1  . LEU A 1 7   ? -13.008 20.314  12.257  1.00 0.00 ? 7   LEU A CD1  4  
ATOM 5823  C CD2  . LEU A 1 7   ? -14.417 19.832  14.293  1.00 0.00 ? 7   LEU A CD2  4  
ATOM 5824  H H    . LEU A 1 7   ? -12.600 16.099  13.864  1.00 0.00 ? 7   LEU A H    4  
ATOM 5825  H HA   . LEU A 1 7   ? -15.369 17.168  13.977  1.00 0.00 ? 7   LEU A HA   4  
ATOM 5826  H HB2  . LEU A 1 7   ? -13.248 17.653  11.796  1.00 0.00 ? 7   LEU A HB2  4  
ATOM 5827  H HB3  . LEU A 1 7   ? -14.876 18.399  11.893  1.00 0.00 ? 7   LEU A HB3  4  
ATOM 5828  H HG   . LEU A 1 7   ? -12.533 18.898  13.816  1.00 0.00 ? 7   LEU A HG   4  
ATOM 5829  H HD11 . LEU A 1 7   ? -12.287 19.888  11.526  1.00 0.00 ? 7   LEU A HD11 4  
ATOM 5830  H HD12 . LEU A 1 7   ? -13.890 20.692  11.698  1.00 0.00 ? 7   LEU A HD12 4  
ATOM 5831  H HD13 . LEU A 1 7   ? -12.526 21.165  12.783  1.00 0.00 ? 7   LEU A HD13 4  
ATOM 5832  H HD21 . LEU A 1 7   ? -15.359 20.145  13.797  1.00 0.00 ? 7   LEU A HD21 4  
ATOM 5833  H HD22 . LEU A 1 7   ? -14.658 19.092  15.085  1.00 0.00 ? 7   LEU A HD22 4  
ATOM 5834  H HD23 . LEU A 1 7   ? -13.959 20.717  14.785  1.00 0.00 ? 7   LEU A HD23 4  
ATOM 5835  N N    . ALA A 1 8   ? -14.901 14.472  12.838  1.00 0.00 ? 8   ALA A N    4  
ATOM 5836  C CA   . ALA A 1 8   ? -15.565 13.306  12.256  1.00 0.00 ? 8   ALA A CA   4  
ATOM 5837  C C    . ALA A 1 8   ? -15.383 12.968  10.762  1.00 0.00 ? 8   ALA A C    4  
ATOM 5838  O O    . ALA A 1 8   ? -15.411 11.802  10.380  1.00 0.00 ? 8   ALA A O    4  
ATOM 5839  C CB   . ALA A 1 8   ? -17.052 13.358  12.676  1.00 0.00 ? 8   ALA A CB   4  
ATOM 5840  H H    . ALA A 1 8   ? -14.299 14.277  13.604  1.00 0.00 ? 8   ALA A H    4  
ATOM 5841  H HA   . ALA A 1 8   ? -15.131 12.461  12.771  1.00 0.00 ? 8   ALA A HA   4  
ATOM 5842  H HB1  . ALA A 1 8   ? -17.582 14.174  12.140  1.00 0.00 ? 8   ALA A HB1  4  
ATOM 5843  H HB2  . ALA A 1 8   ? -17.089 13.620  13.759  1.00 0.00 ? 8   ALA A HB2  4  
ATOM 5844  H HB3  . ALA A 1 8   ? -17.573 12.392  12.509  1.00 0.00 ? 8   ALA A HB3  4  
ATOM 5845  N N    . SER A 1 9   ? -15.184 14.007  9.903   1.00 0.00 ? 9   SER A N    4  
ATOM 5846  C CA   . SER A 1 9   ? -14.949 14.082  8.459   1.00 0.00 ? 9   SER A CA   4  
ATOM 5847  C C    . SER A 1 9   ? -13.742 13.292  7.965   1.00 0.00 ? 9   SER A C    4  
ATOM 5848  O O    . SER A 1 9   ? -13.857 12.199  7.421   1.00 0.00 ? 9   SER A O    4  
ATOM 5849  C CB   . SER A 1 9   ? -14.812 15.590  8.063   1.00 0.00 ? 9   SER A CB   4  
ATOM 5850  O OG   . SER A 1 9   ? -13.847 16.286  8.868   1.00 0.00 ? 9   SER A OG   4  
ATOM 5851  H H    . SER A 1 9   ? -15.198 14.918  10.334  1.00 0.00 ? 9   SER A H    4  
ATOM 5852  H HA   . SER A 1 9   ? -15.803 13.665  7.958   1.00 0.00 ? 9   SER A HA   4  
ATOM 5853  H HB2  . SER A 1 9   ? -14.577 15.706  6.981   1.00 0.00 ? 9   SER A HB2  4  
ATOM 5854  H HB3  . SER A 1 9   ? -15.798 16.074  8.250   1.00 0.00 ? 9   SER A HB3  4  
ATOM 5855  H HG   . SER A 1 9   ? -13.827 17.196  8.547   1.00 0.00 ? 9   SER A HG   4  
ATOM 5856  N N    . GLU A 1 10  ? -12.542 13.856  8.202   1.00 0.00 ? 10  GLU A N    4  
ATOM 5857  C CA   . GLU A 1 10  ? -11.255 13.228  7.982   1.00 0.00 ? 10  GLU A CA   4  
ATOM 5858  C C    . GLU A 1 10  ? -10.605 13.088  9.337   1.00 0.00 ? 10  GLU A C    4  
ATOM 5859  O O    . GLU A 1 10  ? -10.416 14.054  10.076  1.00 0.00 ? 10  GLU A O    4  
ATOM 5860  C CB   . GLU A 1 10  ? -10.271 13.971  7.050   1.00 0.00 ? 10  GLU A CB   4  
ATOM 5861  C CG   . GLU A 1 10  ? -10.840 14.216  5.642   1.00 0.00 ? 10  GLU A CG   4  
ATOM 5862  C CD   . GLU A 1 10  ? -9.791  14.911  4.777   1.00 0.00 ? 10  GLU A CD   4  
ATOM 5863  O OE1  . GLU A 1 10  ? -10.051 16.065  4.340   1.00 0.00 ? 10  GLU A OE1  4  
ATOM 5864  O OE2  . GLU A 1 10  ? -8.716  14.298  4.539   1.00 0.00 ? 10  GLU A OE2  4  
ATOM 5865  H H    . GLU A 1 10  ? -12.558 14.755  8.644   1.00 0.00 ? 10  GLU A H    4  
ATOM 5866  H HA   . GLU A 1 10  ? -11.388 12.231  7.576   1.00 0.00 ? 10  GLU A HA   4  
ATOM 5867  H HB2  . GLU A 1 10  ? -9.964  14.943  7.501   1.00 0.00 ? 10  GLU A HB2  4  
ATOM 5868  H HB3  . GLU A 1 10  ? -9.370  13.315  6.967   1.00 0.00 ? 10  GLU A HB3  4  
ATOM 5869  H HG2  . GLU A 1 10  ? -11.119 13.247  5.176   1.00 0.00 ? 10  GLU A HG2  4  
ATOM 5870  H HG3  . GLU A 1 10  ? -11.751 14.851  5.710   1.00 0.00 ? 10  GLU A HG3  4  
ATOM 5871  N N    . ASN A 1 11  ? -10.231 11.844  9.662   1.00 0.00 ? 11  ASN A N    4  
ATOM 5872  C CA   . ASN A 1 11  ? -9.638  11.438  10.912  1.00 0.00 ? 11  ASN A CA   4  
ATOM 5873  C C    . ASN A 1 11  ? -8.162  11.047  10.708  1.00 0.00 ? 11  ASN A C    4  
ATOM 5874  O O    . ASN A 1 11  ? -7.922  9.972   10.155  1.00 0.00 ? 11  ASN A O    4  
ATOM 5875  C CB   . ASN A 1 11  ? -10.452 10.199  11.367  1.00 0.00 ? 11  ASN A CB   4  
ATOM 5876  C CG   . ASN A 1 11  ? -11.888 10.595  11.737  1.00 0.00 ? 11  ASN A CG   4  
ATOM 5877  O OD1  . ASN A 1 11  ? -12.212 11.758  11.983  1.00 0.00 ? 11  ASN A OD1  4  
ATOM 5878  N ND2  . ASN A 1 11  ? -12.785 9.577   11.805  1.00 0.00 ? 11  ASN A ND2  4  
ATOM 5879  H H    . ASN A 1 11  ? -10.406 11.091  9.034   1.00 0.00 ? 11  ASN A H    4  
ATOM 5880  H HA   . ASN A 1 11  ? -9.719  12.204  11.675  1.00 0.00 ? 11  ASN A HA   4  
ATOM 5881  H HB2  . ASN A 1 11  ? -10.494 9.510   10.493  1.00 0.00 ? 11  ASN A HB2  4  
ATOM 5882  H HB3  . ASN A 1 11  ? -10.001 9.686   12.241  1.00 0.00 ? 11  ASN A HB3  4  
ATOM 5883  H HD21 . ASN A 1 11  ? -12.470 8.630   11.745  1.00 0.00 ? 11  ASN A HD21 4  
ATOM 5884  H HD22 . ASN A 1 11  ? -13.745 9.837   11.888  1.00 0.00 ? 11  ASN A HD22 4  
ATOM 5885  N N    . PRO A 1 12  ? -7.123  11.833  11.087  1.00 0.00 ? 12  PRO A N    4  
ATOM 5886  C CA   . PRO A 1 12  ? -5.683  11.500  10.960  1.00 0.00 ? 12  PRO A CA   4  
ATOM 5887  C C    . PRO A 1 12  ? -5.151  10.304  11.785  1.00 0.00 ? 12  PRO A C    4  
ATOM 5888  O O    . PRO A 1 12  ? -4.183  10.467  12.526  1.00 0.00 ? 12  PRO A O    4  
ATOM 5889  C CB   . PRO A 1 12  ? -4.989  12.804  11.427  1.00 0.00 ? 12  PRO A CB   4  
ATOM 5890  C CG   . PRO A 1 12  ? -5.993  13.904  11.097  1.00 0.00 ? 12  PRO A CG   4  
ATOM 5891  C CD   . PRO A 1 12  ? -7.314  13.235  11.469  1.00 0.00 ? 12  PRO A CD   4  
ATOM 5892  H HA   . PRO A 1 12  ? -5.431  11.284  9.919   1.00 0.00 ? 12  PRO A HA   4  
ATOM 5893  H HB2  . PRO A 1 12  ? -4.857  12.833  12.544  1.00 0.00 ? 12  PRO A HB2  4  
ATOM 5894  H HB3  . PRO A 1 12  ? -4.012  12.948  10.909  1.00 0.00 ? 12  PRO A HB3  4  
ATOM 5895  H HG2  . PRO A 1 12  ? -5.810  14.835  11.673  1.00 0.00 ? 12  PRO A HG2  4  
ATOM 5896  H HG3  . PRO A 1 12  ? -5.977  14.135  10.009  1.00 0.00 ? 12  PRO A HG3  4  
ATOM 5897  H HD2  . PRO A 1 12  ? -7.479  13.296  12.567  1.00 0.00 ? 12  PRO A HD2  4  
ATOM 5898  H HD3  . PRO A 1 12  ? -8.149  13.740  10.922  1.00 0.00 ? 12  PRO A HD3  4  
ATOM 5899  N N    . GLN A 1 13  ? -5.701  9.065   11.620  1.00 0.00 ? 13  GLN A N    4  
ATOM 5900  C CA   . GLN A 1 13  ? -5.331  7.787   12.248  1.00 0.00 ? 13  GLN A CA   4  
ATOM 5901  C C    . GLN A 1 13  ? -4.091  7.222   11.556  1.00 0.00 ? 13  GLN A C    4  
ATOM 5902  O O    . GLN A 1 13  ? -4.129  6.213   10.860  1.00 0.00 ? 13  GLN A O    4  
ATOM 5903  C CB   . GLN A 1 13  ? -6.516  6.788   12.095  1.00 0.00 ? 13  GLN A CB   4  
ATOM 5904  C CG   . GLN A 1 13  ? -7.805  7.191   12.848  1.00 0.00 ? 13  GLN A CG   4  
ATOM 5905  C CD   . GLN A 1 13  ? -9.034  6.395   12.376  1.00 0.00 ? 13  GLN A CD   4  
ATOM 5906  O OE1  . GLN A 1 13  ? -10.057 6.985   12.010  1.00 0.00 ? 13  GLN A OE1  4  
ATOM 5907  N NE2  . GLN A 1 13  ? -8.928  5.043   12.354  1.00 0.00 ? 13  GLN A NE2  4  
ATOM 5908  H H    . GLN A 1 13  ? -6.491  9.026   10.999  1.00 0.00 ? 13  GLN A H    4  
ATOM 5909  H HA   . GLN A 1 13  ? -5.101  7.933   13.294  1.00 0.00 ? 13  GLN A HA   4  
ATOM 5910  H HB2  . GLN A 1 13  ? -6.782  6.723   11.016  1.00 0.00 ? 13  GLN A HB2  4  
ATOM 5911  H HB3  . GLN A 1 13  ? -6.203  5.777   12.438  1.00 0.00 ? 13  GLN A HB3  4  
ATOM 5912  H HG2  . GLN A 1 13  ? -7.680  7.052   13.941  1.00 0.00 ? 13  GLN A HG2  4  
ATOM 5913  H HG3  . GLN A 1 13  ? -8.042  8.261   12.668  1.00 0.00 ? 13  GLN A HG3  4  
ATOM 5914  H HE21 . GLN A 1 13  ? -8.046  4.598   12.576  1.00 0.00 ? 13  GLN A HE21 4  
ATOM 5915  H HE22 . GLN A 1 13  ? -9.702  4.502   12.037  1.00 0.00 ? 13  GLN A HE22 4  
ATOM 5916  N N    . GLN A 1 14  ? -2.990  8.028   11.614  1.00 0.00 ? 14  GLN A N    4  
ATOM 5917  C CA   . GLN A 1 14  ? -1.712  7.984   10.896  1.00 0.00 ? 14  GLN A CA   4  
ATOM 5918  C C    . GLN A 1 14  ? -1.863  8.124   9.386   1.00 0.00 ? 14  GLN A C    4  
ATOM 5919  O O    . GLN A 1 14  ? -0.954  7.856   8.606   1.00 0.00 ? 14  GLN A O    4  
ATOM 5920  C CB   . GLN A 1 14  ? -0.708  6.910   11.377  1.00 0.00 ? 14  GLN A CB   4  
ATOM 5921  C CG   . GLN A 1 14  ? -0.113  7.340   12.735  1.00 0.00 ? 14  GLN A CG   4  
ATOM 5922  C CD   . GLN A 1 14  ? 0.960   6.375   13.245  1.00 0.00 ? 14  GLN A CD   4  
ATOM 5923  O OE1  . GLN A 1 14  ? 2.123   6.726   13.453  1.00 0.00 ? 14  GLN A OE1  4  
ATOM 5924  N NE2  . GLN A 1 14  ? 0.532   5.107   13.463  1.00 0.00 ? 14  GLN A NE2  4  
ATOM 5925  H H    . GLN A 1 14  ? -3.113  8.852   12.179  1.00 0.00 ? 14  GLN A H    4  
ATOM 5926  H HA   . GLN A 1 14  ? -1.237  8.918   11.158  1.00 0.00 ? 14  GLN A HA   4  
ATOM 5927  H HB2  . GLN A 1 14  ? -1.223  5.933   11.467  1.00 0.00 ? 14  GLN A HB2  4  
ATOM 5928  H HB3  . GLN A 1 14  ? 0.134   6.794   10.657  1.00 0.00 ? 14  GLN A HB3  4  
ATOM 5929  H HG2  . GLN A 1 14  ? 0.344   8.352   12.630  1.00 0.00 ? 14  GLN A HG2  4  
ATOM 5930  H HG3  . GLN A 1 14  ? -0.934  7.382   13.478  1.00 0.00 ? 14  GLN A HG3  4  
ATOM 5931  H HE21 . GLN A 1 14  ? -0.388  4.860   13.174  1.00 0.00 ? 14  GLN A HE21 4  
ATOM 5932  H HE22 . GLN A 1 14  ? 1.216   4.417   13.685  1.00 0.00 ? 14  GLN A HE22 4  
ATOM 5933  N N    . PHE A 1 15  ? -3.083  8.604   9.001   1.00 0.00 ? 15  PHE A N    4  
ATOM 5934  C CA   . PHE A 1 15  ? -3.612  8.901   7.681   1.00 0.00 ? 15  PHE A CA   4  
ATOM 5935  C C    . PHE A 1 15  ? -4.133  7.647   6.969   1.00 0.00 ? 15  PHE A C    4  
ATOM 5936  O O    . PHE A 1 15  ? -4.214  7.600   5.743   1.00 0.00 ? 15  PHE A O    4  
ATOM 5937  C CB   . PHE A 1 15  ? -2.708  9.830   6.812   1.00 0.00 ? 15  PHE A CB   4  
ATOM 5938  C CG   . PHE A 1 15  ? -2.313  11.072  7.587   1.00 0.00 ? 15  PHE A CG   4  
ATOM 5939  C CD1  . PHE A 1 15  ? -3.192  12.129  7.724   1.00 0.00 ? 15  PHE A CD1  4  
ATOM 5940  C CD2  . PHE A 1 15  ? -1.084  11.151  8.230   1.00 0.00 ? 15  PHE A CD2  4  
ATOM 5941  C CE1  . PHE A 1 15  ? -2.874  13.212  8.520   1.00 0.00 ? 15  PHE A CE1  4  
ATOM 5942  C CE2  . PHE A 1 15  ? -0.786  12.198  9.079   1.00 0.00 ? 15  PHE A CE2  4  
ATOM 5943  C CZ   . PHE A 1 15  ? -1.685  13.235  9.222   1.00 0.00 ? 15  PHE A CZ   4  
ATOM 5944  H H    . PHE A 1 15  ? -3.708  8.776   9.759   1.00 0.00 ? 15  PHE A H    4  
ATOM 5945  H HA   . PHE A 1 15  ? -4.500  9.485   7.869   1.00 0.00 ? 15  PHE A HA   4  
ATOM 5946  H HB2  . PHE A 1 15  ? -1.785  9.292   6.553   1.00 0.00 ? 15  PHE A HB2  4  
ATOM 5947  H HB3  . PHE A 1 15  ? -3.222  10.144  5.880   1.00 0.00 ? 15  PHE A HB3  4  
ATOM 5948  H HD1  . PHE A 1 15  ? -4.147  12.100  7.217   1.00 0.00 ? 15  PHE A HD1  4  
ATOM 5949  H HD2  . PHE A 1 15  ? -0.368  10.346  8.124   1.00 0.00 ? 15  PHE A HD2  4  
ATOM 5950  H HE1  . PHE A 1 15  ? -3.581  14.025  8.624   1.00 0.00 ? 15  PHE A HE1  4  
ATOM 5951  H HE2  . PHE A 1 15  ? 0.141   12.186  9.641   1.00 0.00 ? 15  PHE A HE2  4  
ATOM 5952  H HZ   . PHE A 1 15  ? -1.454  14.063  9.879   1.00 0.00 ? 15  PHE A HZ   4  
ATOM 5953  N N    . MET A 1 16  ? -4.571  6.617   7.774   1.00 0.00 ? 16  MET A N    4  
ATOM 5954  C CA   . MET A 1 16  ? -5.201  5.308   7.493   1.00 0.00 ? 16  MET A CA   4  
ATOM 5955  C C    . MET A 1 16  ? -6.256  5.288   6.427   1.00 0.00 ? 16  MET A C    4  
ATOM 5956  O O    . MET A 1 16  ? -6.323  4.340   5.657   1.00 0.00 ? 16  MET A O    4  
ATOM 5957  C CB   . MET A 1 16  ? -5.908  4.828   8.810   1.00 0.00 ? 16  MET A CB   4  
ATOM 5958  C CG   . MET A 1 16  ? -6.945  3.660   8.858   1.00 0.00 ? 16  MET A CG   4  
ATOM 5959  S SD   . MET A 1 16  ? -6.301  1.976   8.585   1.00 0.00 ? 16  MET A SD   4  
ATOM 5960  C CE   . MET A 1 16  ? -7.895  1.076   8.724   1.00 0.00 ? 16  MET A CE   4  
ATOM 5961  H H    . MET A 1 16  ? -4.463  6.760   8.759   1.00 0.00 ? 16  MET A H    4  
ATOM 5962  H HA   . MET A 1 16  ? -4.433  4.615   7.135   1.00 0.00 ? 16  MET A HA   4  
ATOM 5963  H HB2  . MET A 1 16  ? -5.109  4.571   9.536   1.00 0.00 ? 16  MET A HB2  4  
ATOM 5964  H HB3  . MET A 1 16  ? -6.440  5.712   9.227   1.00 0.00 ? 16  MET A HB3  4  
ATOM 5965  H HG2  . MET A 1 16  ? -7.382  3.676   9.882   1.00 0.00 ? 16  MET A HG2  4  
ATOM 5966  H HG3  . MET A 1 16  ? -7.797  3.861   8.174   1.00 0.00 ? 16  MET A HG3  4  
ATOM 5967  H HE1  . MET A 1 16  ? -8.768  1.758   8.781   1.00 0.00 ? 16  MET A HE1  4  
ATOM 5968  H HE2  . MET A 1 16  ? -8.066  0.374   7.869   1.00 0.00 ? 16  MET A HE2  4  
ATOM 5969  H HE3  . MET A 1 16  ? -7.920  0.405   9.613   1.00 0.00 ? 16  MET A HE3  4  
ATOM 5970  N N    . ASP A 1 17  ? -7.117  6.339   6.327   1.00 0.00 ? 17  ASP A N    4  
ATOM 5971  C CA   . ASP A 1 17  ? -8.216  6.491   5.361   1.00 0.00 ? 17  ASP A CA   4  
ATOM 5972  C C    . ASP A 1 17  ? -7.795  6.458   3.894   1.00 0.00 ? 17  ASP A C    4  
ATOM 5973  O O    . ASP A 1 17  ? -8.482  5.884   3.058   1.00 0.00 ? 17  ASP A O    4  
ATOM 5974  C CB   . ASP A 1 17  ? -9.047  7.781   5.613   1.00 0.00 ? 17  ASP A CB   4  
ATOM 5975  C CG   . ASP A 1 17  ? -9.583  7.788   7.048   1.00 0.00 ? 17  ASP A CG   4  
ATOM 5976  O OD1  . ASP A 1 17  ? -10.335 6.843   7.406   1.00 0.00 ? 17  ASP A OD1  4  
ATOM 5977  O OD2  . ASP A 1 17  ? -9.251  8.743   7.800   1.00 0.00 ? 17  ASP A OD2  4  
ATOM 5978  H H    . ASP A 1 17  ? -7.016  7.099   6.968   1.00 0.00 ? 17  ASP A H    4  
ATOM 5979  H HA   . ASP A 1 17  ? -8.874  5.640   5.492   1.00 0.00 ? 17  ASP A HA   4  
ATOM 5980  H HB2  . ASP A 1 17  ? -8.416  8.684   5.458   1.00 0.00 ? 17  ASP A HB2  4  
ATOM 5981  H HB3  . ASP A 1 17  ? -9.918  7.835   4.922   1.00 0.00 ? 17  ASP A HB3  4  
ATOM 5982  N N    . TYR A 1 18  ? -6.604  7.027   3.565   1.00 0.00 ? 18  TYR A N    4  
ATOM 5983  C CA   . TYR A 1 18  ? -5.971  7.023   2.246   1.00 0.00 ? 18  TYR A CA   4  
ATOM 5984  C C    . TYR A 1 18  ? -5.451  5.642   1.816   1.00 0.00 ? 18  TYR A C    4  
ATOM 5985  O O    . TYR A 1 18  ? -5.780  5.134   0.746   1.00 0.00 ? 18  TYR A O    4  
ATOM 5986  C CB   . TYR A 1 18  ? -4.853  8.126   2.282   1.00 0.00 ? 18  TYR A CB   4  
ATOM 5987  C CG   . TYR A 1 18  ? -4.019  8.306   1.031   1.00 0.00 ? 18  TYR A CG   4  
ATOM 5988  C CD1  . TYR A 1 18  ? -2.645  8.161   1.104   1.00 0.00 ? 18  TYR A CD1  4  
ATOM 5989  C CD2  . TYR A 1 18  ? -4.589  8.629   -0.187  1.00 0.00 ? 18  TYR A CD2  4  
ATOM 5990  C CE1  . TYR A 1 18  ? -1.859  8.306   -0.021  1.00 0.00 ? 18  TYR A CE1  4  
ATOM 5991  C CE2  . TYR A 1 18  ? -3.802  8.800   -1.315  1.00 0.00 ? 18  TYR A CE2  4  
ATOM 5992  C CZ   . TYR A 1 18  ? -2.433  8.635   -1.231  1.00 0.00 ? 18  TYR A CZ   4  
ATOM 5993  O OH   . TYR A 1 18  ? -1.610  8.808   -2.368  1.00 0.00 ? 18  TYR A OH   4  
ATOM 5994  H H    . TYR A 1 18  ? -6.059  7.447   4.292   1.00 0.00 ? 18  TYR A H    4  
ATOM 5995  H HA   . TYR A 1 18  ? -6.726  7.268   1.521   1.00 0.00 ? 18  TYR A HA   4  
ATOM 5996  H HB2  . TYR A 1 18  ? -5.348  9.110   2.474   1.00 0.00 ? 18  TYR A HB2  4  
ATOM 5997  H HB3  . TYR A 1 18  ? -4.160  7.889   3.129   1.00 0.00 ? 18  TYR A HB3  4  
ATOM 5998  H HD1  . TYR A 1 18  ? -2.187  7.915   2.057   1.00 0.00 ? 18  TYR A HD1  4  
ATOM 5999  H HD2  . TYR A 1 18  ? -5.662  8.749   -0.257  1.00 0.00 ? 18  TYR A HD2  4  
ATOM 6000  H HE1  . TYR A 1 18  ? -0.789  8.172   0.049   1.00 0.00 ? 18  TYR A HE1  4  
ATOM 6001  H HE2  . TYR A 1 18  ? -4.266  9.062   -2.256  1.00 0.00 ? 18  TYR A HE2  4  
ATOM 6002  H HH   . TYR A 1 18  ? -2.149  9.132   -3.091  1.00 0.00 ? 18  TYR A HH   4  
ATOM 6003  N N    . PHE A 1 19  ? -4.643  5.003   2.697   1.00 0.00 ? 19  PHE A N    4  
ATOM 6004  C CA   . PHE A 1 19  ? -4.013  3.694   2.552   1.00 0.00 ? 19  PHE A CA   4  
ATOM 6005  C C    . PHE A 1 19  ? -4.976  2.518   2.702   1.00 0.00 ? 19  PHE A C    4  
ATOM 6006  O O    . PHE A 1 19  ? -4.939  1.553   1.933   1.00 0.00 ? 19  PHE A O    4  
ATOM 6007  C CB   . PHE A 1 19  ? -2.813  3.562   3.529   1.00 0.00 ? 19  PHE A CB   4  
ATOM 6008  C CG   . PHE A 1 19  ? -1.819  4.684   3.358   1.00 0.00 ? 19  PHE A CG   4  
ATOM 6009  C CD1  . PHE A 1 19  ? -1.016  4.772   2.236   1.00 0.00 ? 19  PHE A CD1  4  
ATOM 6010  C CD2  . PHE A 1 19  ? -1.627  5.592   4.386   1.00 0.00 ? 19  PHE A CD2  4  
ATOM 6011  C CE1  . PHE A 1 19  ? -0.015  5.723   2.168   1.00 0.00 ? 19  PHE A CE1  4  
ATOM 6012  C CE2  . PHE A 1 19  ? -0.635  6.548   4.323   1.00 0.00 ? 19  PHE A CE2  4  
ATOM 6013  C CZ   . PHE A 1 19  ? 0.182   6.608   3.211   1.00 0.00 ? 19  PHE A CZ   4  
ATOM 6014  H H    . PHE A 1 19  ? -4.405  5.467   3.543   1.00 0.00 ? 19  PHE A H    4  
ATOM 6015  H HA   . PHE A 1 19  ? -3.632  3.615   1.537   1.00 0.00 ? 19  PHE A HA   4  
ATOM 6016  H HB2  . PHE A 1 19  ? -3.072  3.569   4.608   1.00 0.00 ? 19  PHE A HB2  4  
ATOM 6017  H HB3  . PHE A 1 19  ? -2.268  2.610   3.386   1.00 0.00 ? 19  PHE A HB3  4  
ATOM 6018  H HD1  . PHE A 1 19  ? -1.131  4.056   1.434   1.00 0.00 ? 19  PHE A HD1  4  
ATOM 6019  H HD2  . PHE A 1 19  ? -2.233  5.522   5.280   1.00 0.00 ? 19  PHE A HD2  4  
ATOM 6020  H HE1  . PHE A 1 19  ? 0.634   5.755   1.304   1.00 0.00 ? 19  PHE A HE1  4  
ATOM 6021  H HE2  . PHE A 1 19  ? -0.487  7.223   5.157   1.00 0.00 ? 19  PHE A HE2  4  
ATOM 6022  H HZ   . PHE A 1 19  ? 0.980   7.337   3.165   1.00 0.00 ? 19  PHE A HZ   4  
ATOM 6023  N N    . SER A 1 20  ? -5.930  2.603   3.682   1.00 0.00 ? 20  SER A N    4  
ATOM 6024  C CA   . SER A 1 20  ? -6.962  1.580   3.929   1.00 0.00 ? 20  SER A CA   4  
ATOM 6025  C C    . SER A 1 20  ? -8.042  1.536   2.892   1.00 0.00 ? 20  SER A C    4  
ATOM 6026  O O    . SER A 1 20  ? -8.541  0.455   2.620   1.00 0.00 ? 20  SER A O    4  
ATOM 6027  C CB   . SER A 1 20  ? -7.581  1.455   5.347   1.00 0.00 ? 20  SER A CB   4  
ATOM 6028  O OG   . SER A 1 20  ? -8.230  2.640   5.796   1.00 0.00 ? 20  SER A OG   4  
ATOM 6029  H H    . SER A 1 20  ? -5.964  3.427   4.276   1.00 0.00 ? 20  SER A H    4  
ATOM 6030  H HA   . SER A 1 20  ? -6.470  0.621   3.816   1.00 0.00 ? 20  SER A HA   4  
ATOM 6031  H HB2  . SER A 1 20  ? -8.312  0.606   5.396   1.00 0.00 ? 20  SER A HB2  4  
ATOM 6032  H HB3  . SER A 1 20  ? -6.729  1.240   6.037   1.00 0.00 ? 20  SER A HB3  4  
ATOM 6033  H HG   . SER A 1 20  ? -7.507  3.301   5.809   1.00 0.00 ? 20  SER A HG   4  
ATOM 6034  N N    . GLU A 1 21  ? -8.416  2.669   2.227   1.00 0.00 ? 21  GLU A N    4  
ATOM 6035  C CA   . GLU A 1 21  ? -9.320  2.619   1.075   1.00 0.00 ? 21  GLU A CA   4  
ATOM 6036  C C    . GLU A 1 21  ? -8.689  1.998   -0.180  1.00 0.00 ? 21  GLU A C    4  
ATOM 6037  O O    . GLU A 1 21  ? -9.330  1.168   -0.808  1.00 0.00 ? 21  GLU A O    4  
ATOM 6038  C CB   . GLU A 1 21  ? -10.003 3.972   0.772   1.00 0.00 ? 21  GLU A CB   4  
ATOM 6039  C CG   . GLU A 1 21  ? -11.031 4.350   1.858   1.00 0.00 ? 21  GLU A CG   4  
ATOM 6040  C CD   . GLU A 1 21  ? -11.629 5.723   1.562   1.00 0.00 ? 21  GLU A CD   4  
ATOM 6041  O OE1  . GLU A 1 21  ? -12.268 5.873   0.486   1.00 0.00 ? 21  GLU A OE1  4  
ATOM 6042  O OE2  . GLU A 1 21  ? -11.460 6.641   2.410   1.00 0.00 ? 21  GLU A OE2  4  
ATOM 6043  H H    . GLU A 1 21  ? -8.029  3.564   2.461   1.00 0.00 ? 21  GLU A H    4  
ATOM 6044  H HA   . GLU A 1 21  ? -10.110 1.909   1.335   1.00 0.00 ? 21  GLU A HA   4  
ATOM 6045  H HB2  . GLU A 1 21  ? -9.225  4.766   0.700   1.00 0.00 ? 21  GLU A HB2  4  
ATOM 6046  H HB3  . GLU A 1 21  ? -10.552 3.942   -0.195  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 6047  H HG2  . GLU A 1 21  ? -11.845 3.593   1.876   1.00 0.00 ? 21  GLU A HG2  4  
ATOM 6048  H HG3  . GLU A 1 21  ? -10.544 4.359   2.857   1.00 0.00 ? 21  GLU A HG3  4  
ATOM 6049  N N    . GLU A 1 22  ? -7.409  2.291   -0.554  1.00 0.00 ? 22  GLU A N    4  
ATOM 6050  C CA   . GLU A 1 22  ? -6.686  1.653   -1.674  1.00 0.00 ? 22  GLU A CA   4  
ATOM 6051  C C    . GLU A 1 22  ? -6.367  0.180   -1.429  1.00 0.00 ? 22  GLU A C    4  
ATOM 6052  O O    . GLU A 1 22  ? -6.626  -0.682  -2.274  1.00 0.00 ? 22  GLU A O    4  
ATOM 6053  C CB   . GLU A 1 22  ? -5.355  2.406   -1.947  1.00 0.00 ? 22  GLU A CB   4  
ATOM 6054  C CG   . GLU A 1 22  ? -5.531  3.660   -2.823  1.00 0.00 ? 22  GLU A CG   4  
ATOM 6055  C CD   . GLU A 1 22  ? -5.979  3.256   -4.228  1.00 0.00 ? 22  GLU A CD   4  
ATOM 6056  O OE1  . GLU A 1 22  ? -7.074  3.707   -4.655  1.00 0.00 ? 22  GLU A OE1  4  
ATOM 6057  O OE2  . GLU A 1 22  ? -5.231  2.487   -4.892  1.00 0.00 ? 22  GLU A OE2  4  
ATOM 6058  H H    . GLU A 1 22  ? -6.893  2.972   -0.035  1.00 0.00 ? 22  GLU A H    4  
ATOM 6059  H HA   . GLU A 1 22  ? -7.330  1.653   -2.552  1.00 0.00 ? 22  GLU A HA   4  
ATOM 6060  H HB2  . GLU A 1 22  ? -4.955  2.751   -0.964  1.00 0.00 ? 22  GLU A HB2  4  
ATOM 6061  H HB3  . GLU A 1 22  ? -4.561  1.764   -2.400  1.00 0.00 ? 22  GLU A HB3  4  
ATOM 6062  H HG2  . GLU A 1 22  ? -6.282  4.337   -2.363  1.00 0.00 ? 22  GLU A HG2  4  
ATOM 6063  H HG3  . GLU A 1 22  ? -4.563  4.202   -2.893  1.00 0.00 ? 22  GLU A HG3  4  
ATOM 6064  N N    . PHE A 1 23  ? -5.850  -0.139  -0.200  1.00 0.00 ? 23  PHE A N    4  
ATOM 6065  C CA   . PHE A 1 23  ? -5.605  -1.498  0.274   1.00 0.00 ? 23  PHE A CA   4  
ATOM 6066  C C    . PHE A 1 23  ? -6.898  -2.311  0.407   1.00 0.00 ? 23  PHE A C    4  
ATOM 6067  O O    . PHE A 1 23  ? -6.989  -3.362  -0.199  1.00 0.00 ? 23  PHE A O    4  
ATOM 6068  C CB   . PHE A 1 23  ? -4.819  -1.467  1.621   1.00 0.00 ? 23  PHE A CB   4  
ATOM 6069  C CG   . PHE A 1 23  ? -4.416  -2.806  2.206   1.00 0.00 ? 23  PHE A CG   4  
ATOM 6070  C CD1  . PHE A 1 23  ? -3.923  -3.820  1.409   1.00 0.00 ? 23  PHE A CD1  4  
ATOM 6071  C CD2  . PHE A 1 23  ? -4.512  -3.026  3.568   1.00 0.00 ? 23  PHE A CD2  4  
ATOM 6072  C CE1  . PHE A 1 23  ? -3.542  -5.022  1.958   1.00 0.00 ? 23  PHE A CE1  4  
ATOM 6073  C CE2  . PHE A 1 23  ? -4.084  -4.206  4.128   1.00 0.00 ? 23  PHE A CE2  4  
ATOM 6074  C CZ   . PHE A 1 23  ? -3.644  -5.227  3.313   1.00 0.00 ? 23  PHE A CZ   4  
ATOM 6075  H H    . PHE A 1 23  ? -5.624  0.571   0.483   1.00 0.00 ? 23  PHE A H    4  
ATOM 6076  H HA   . PHE A 1 23  ? -4.997  -1.976  -0.487  1.00 0.00 ? 23  PHE A HA   4  
ATOM 6077  H HB2  . PHE A 1 23  ? -3.856  -0.921  1.420   1.00 0.00 ? 23  PHE A HB2  4  
ATOM 6078  H HB3  . PHE A 1 23  ? -5.439  -0.932  2.391   1.00 0.00 ? 23  PHE A HB3  4  
ATOM 6079  H HD1  . PHE A 1 23  ? -3.866  -3.689  0.340   1.00 0.00 ? 23  PHE A HD1  4  
ATOM 6080  H HD2  . PHE A 1 23  ? -4.936  -2.274  4.218   1.00 0.00 ? 23  PHE A HD2  4  
ATOM 6081  H HE1  . PHE A 1 23  ? -3.120  -5.792  1.331   1.00 0.00 ? 23  PHE A HE1  4  
ATOM 6082  H HE2  . PHE A 1 23  ? -4.080  -4.315  5.207   1.00 0.00 ? 23  PHE A HE2  4  
ATOM 6083  H HZ   . PHE A 1 23  ? -3.324  -6.171  3.730   1.00 0.00 ? 23  PHE A HZ   4  
ATOM 6084  N N    . ARG A 1 24  ? -7.961  -1.832  1.112   1.00 0.00 ? 24  ARG A N    4  
ATOM 6085  C CA   . ARG A 1 24  ? -9.252  -2.528  1.201   1.00 0.00 ? 24  ARG A CA   4  
ATOM 6086  C C    . ARG A 1 24  ? -10.079 -2.557  -0.089  1.00 0.00 ? 24  ARG A C    4  
ATOM 6087  O O    . ARG A 1 24  ? -10.753 -3.550  -0.333  1.00 0.00 ? 24  ARG A O    4  
ATOM 6088  C CB   . ARG A 1 24  ? -10.045 -2.187  2.491   1.00 0.00 ? 24  ARG A CB   4  
ATOM 6089  C CG   . ARG A 1 24  ? -11.097 -3.260  2.929   1.00 0.00 ? 24  ARG A CG   4  
ATOM 6090  C CD   . ARG A 1 24  ? -10.605 -4.094  4.121   1.00 0.00 ? 24  ARG A CD   4  
ATOM 6091  N NE   . ARG A 1 24  ? -9.381  -4.879  3.702   1.00 0.00 ? 24  ARG A NE   4  
ATOM 6092  C CZ   . ARG A 1 24  ? -8.082  -4.560  3.998   1.00 0.00 ? 24  ARG A CZ   4  
ATOM 6093  N NH1  . ARG A 1 24  ? -7.770  -3.525  4.827   1.00 0.00 ? 24  ARG A NH1  4  
ATOM 6094  N NH2  . ARG A 1 24  ? -7.077  -5.288  3.435   1.00 0.00 ? 24  ARG A NH2  4  
ATOM 6095  H H    . ARG A 1 24  ? -7.934  -0.958  1.616   1.00 0.00 ? 24  ARG A H    4  
ATOM 6096  H HA   . ARG A 1 24  ? -9.029  -3.576  1.368   1.00 0.00 ? 24  ARG A HA   4  
ATOM 6097  H HB2  . ARG A 1 24  ? -9.257  -2.142  3.291   1.00 0.00 ? 24  ARG A HB2  4  
ATOM 6098  H HB3  . ARG A 1 24  ? -10.434 -1.144  2.506   1.00 0.00 ? 24  ARG A HB3  4  
ATOM 6099  H HG2  . ARG A 1 24  ? -12.013 -2.715  3.257   1.00 0.00 ? 24  ARG A HG2  4  
ATOM 6100  H HG3  . ARG A 1 24  ? -11.415 -4.029  2.150   1.00 0.00 ? 24  ARG A HG3  4  
ATOM 6101  H HD2  . ARG A 1 24  ? -10.417 -3.444  4.994   1.00 0.00 ? 24  ARG A HD2  4  
ATOM 6102  H HD3  . ARG A 1 24  ? -11.388 -4.828  4.407   1.00 0.00 ? 24  ARG A HD3  4  
ATOM 6103  H HE   . ARG A 1 24  ? -9.534  -5.658  3.094   1.00 0.00 ? 24  ARG A HE   4  
ATOM 6104  H HH11 . ARG A 1 24  ? -8.498  -2.980  5.241   1.00 0.00 ? 24  ARG A HH11 4  
ATOM 6105  H HH12 . ARG A 1 24  ? -6.813  -3.310  5.021   1.00 0.00 ? 24  ARG A HH12 4  
ATOM 6106  H HH21 . ARG A 1 24  ? -7.295  -6.047  2.819   1.00 0.00 ? 24  ARG A HH21 4  
ATOM 6107  H HH22 . ARG A 1 24  ? -6.123  -5.063  3.636   1.00 0.00 ? 24  ARG A HH22 4  
ATOM 6108  N N    . ASN A 1 25  ? -9.993  -1.561  -1.033  1.00 0.00 ? 25  ASN A N    4  
ATOM 6109  C CA   . ASN A 1 25  ? -10.655 -1.669  -2.354  1.00 0.00 ? 25  ASN A CA   4  
ATOM 6110  C C    . ASN A 1 25  ? -10.037 -2.766  -3.236  1.00 0.00 ? 25  ASN A C    4  
ATOM 6111  O O    . ASN A 1 25  ? -10.733 -3.675  -3.674  1.00 0.00 ? 25  ASN A O    4  
ATOM 6112  C CB   . ASN A 1 25  ? -10.576 -0.322  -3.154  1.00 0.00 ? 25  ASN A CB   4  
ATOM 6113  C CG   . ASN A 1 25  ? -11.819 0.541   -2.904  1.00 0.00 ? 25  ASN A CG   4  
ATOM 6114  O OD1  . ASN A 1 25  ? -12.873 0.310   -3.491  1.00 0.00 ? 25  ASN A OD1  4  
ATOM 6115  N ND2  . ASN A 1 25  ? -11.694 1.548   -2.010  1.00 0.00 ? 25  ASN A ND2  4  
ATOM 6116  H H    . ASN A 1 25  ? -9.440  -0.732  -0.881  1.00 0.00 ? 25  ASN A H    4  
ATOM 6117  H HA   . ASN A 1 25  ? -11.692 -1.956  -2.214  1.00 0.00 ? 25  ASN A HA   4  
ATOM 6118  H HB2  . ASN A 1 25  ? -9.651  0.220   -2.885  1.00 0.00 ? 25  ASN A HB2  4  
ATOM 6119  H HB3  . ASN A 1 25  ? -10.525 -0.446  -4.254  1.00 0.00 ? 25  ASN A HB3  4  
ATOM 6120  H HD21 . ASN A 1 25  ? -10.828 1.629   -1.499  1.00 0.00 ? 25  ASN A HD21 4  
ATOM 6121  H HD22 . ASN A 1 25  ? -12.492 2.109   -1.814  1.00 0.00 ? 25  ASN A HD22 4  
ATOM 6122  N N    . ASP A 1 26  ? -8.691  -2.747  -3.428  1.00 0.00 ? 26  ASP A N    4  
ATOM 6123  C CA   . ASP A 1 26  ? -7.955  -3.719  -4.241  1.00 0.00 ? 26  ASP A CA   4  
ATOM 6124  C C    . ASP A 1 26  ? -7.740  -5.088  -3.598  1.00 0.00 ? 26  ASP A C    4  
ATOM 6125  O O    . ASP A 1 26  ? -8.107  -6.090  -4.206  1.00 0.00 ? 26  ASP A O    4  
ATOM 6126  C CB   . ASP A 1 26  ? -6.628  -3.108  -4.732  1.00 0.00 ? 26  ASP A CB   4  
ATOM 6127  C CG   . ASP A 1 26  ? -6.881  -1.930  -5.679  1.00 0.00 ? 26  ASP A CG   4  
ATOM 6128  O OD1  . ASP A 1 26  ? -7.496  -2.157  -6.755  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 6129  O OD2  . ASP A 1 26  ? -6.456  -0.792  -5.342  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 6130  H H    . ASP A 1 26  ? -8.129  -2.020  -3.017  1.00 0.00 ? 26  ASP A H    4  
ATOM 6131  H HA   . ASP A 1 26  ? -8.527  -3.946  -5.132  1.00 0.00 ? 26  ASP A HA   4  
ATOM 6132  H HB2  . ASP A 1 26  ? -6.083  -2.739  -3.842  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 6133  H HB3  . ASP A 1 26  ? -6.005  -3.854  -5.266  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 6134  N N    . PHE A 1 27  ? -7.218  -5.188  -2.336  1.00 0.00 ? 27  PHE A N    4  
ATOM 6135  C CA   . PHE A 1 27  ? -7.025  -6.424  -1.554  1.00 0.00 ? 27  PHE A CA   4  
ATOM 6136  C C    . PHE A 1 27  ? -8.321  -7.139  -1.257  1.00 0.00 ? 27  PHE A C    4  
ATOM 6137  O O    . PHE A 1 27  ? -8.377  -8.352  -1.418  1.00 0.00 ? 27  PHE A O    4  
ATOM 6138  C CB   . PHE A 1 27  ? -6.295  -6.172  -0.182  1.00 0.00 ? 27  PHE A CB   4  
ATOM 6139  C CG   . PHE A 1 27  ? -6.019  -7.338  0.764   1.00 0.00 ? 27  PHE A CG   4  
ATOM 6140  C CD1  . PHE A 1 27  ? -4.739  -7.816  0.899   1.00 0.00 ? 27  PHE A CD1  4  
ATOM 6141  C CD2  . PHE A 1 27  ? -6.990  -7.817  1.641   1.00 0.00 ? 27  PHE A CD2  4  
ATOM 6142  C CE1  . PHE A 1 27  ? -4.414  -8.657  1.942   1.00 0.00 ? 27  PHE A CE1  4  
ATOM 6143  C CE2  . PHE A 1 27  ? -6.686  -8.728  2.630   1.00 0.00 ? 27  PHE A CE2  4  
ATOM 6144  C CZ   . PHE A 1 27  ? -5.385  -9.140  2.792   1.00 0.00 ? 27  PHE A CZ   4  
ATOM 6145  H H    . PHE A 1 27  ? -6.955  -4.368  -1.814  1.00 0.00 ? 27  PHE A H    4  
ATOM 6146  H HA   . PHE A 1 27  ? -6.420  -7.099  -2.141  1.00 0.00 ? 27  PHE A HA   4  
ATOM 6147  H HB2  . PHE A 1 27  ? -5.319  -5.682  -0.414  1.00 0.00 ? 27  PHE A HB2  4  
ATOM 6148  H HB3  . PHE A 1 27  ? -6.903  -5.477  0.439   1.00 0.00 ? 27  PHE A HB3  4  
ATOM 6149  H HD1  . PHE A 1 27  ? -3.965  -7.464  0.233   1.00 0.00 ? 27  PHE A HD1  4  
ATOM 6150  H HD2  . PHE A 1 27  ? -7.993  -7.422  1.592   1.00 0.00 ? 27  PHE A HD2  4  
ATOM 6151  H HE1  . PHE A 1 27  ? -3.388  -8.968  2.061   1.00 0.00 ? 27  PHE A HE1  4  
ATOM 6152  H HE2  . PHE A 1 27  ? -7.452  -9.091  3.302   1.00 0.00 ? 27  PHE A HE2  4  
ATOM 6153  H HZ   . PHE A 1 27  ? -5.144  -9.846  3.574   1.00 0.00 ? 27  PHE A HZ   4  
ATOM 6154  N N    . LEU A 1 28  ? -9.398  -6.422  -0.803  1.00 0.00 ? 28  LEU A N    4  
ATOM 6155  C CA   . LEU A 1 28  ? -10.692 -7.016  -0.487  1.00 0.00 ? 28  LEU A CA   4  
ATOM 6156  C C    . LEU A 1 28  ? -11.415 -7.541  -1.735  1.00 0.00 ? 28  LEU A C    4  
ATOM 6157  O O    . LEU A 1 28  ? -12.027 -8.607  -1.683  1.00 0.00 ? 28  LEU A O    4  
ATOM 6158  C CB   . LEU A 1 28  ? -11.486 -6.158  0.527   1.00 0.00 ? 28  LEU A CB   4  
ATOM 6159  C CG   . LEU A 1 28  ? -12.209 -6.944  1.638   1.00 0.00 ? 28  LEU A CG   4  
ATOM 6160  C CD1  . LEU A 1 28  ? -11.321 -7.492  2.787   1.00 0.00 ? 28  LEU A CD1  4  
ATOM 6161  C CD2  . LEU A 1 28  ? -13.478 -6.258  2.161   1.00 0.00 ? 28  LEU A CD2  4  
ATOM 6162  H H    . LEU A 1 28  ? -9.394  -5.421  -0.713  1.00 0.00 ? 28  LEU A H    4  
ATOM 6163  H HA   . LEU A 1 28  ? -10.480 -7.911  0.084   1.00 0.00 ? 28  LEU A HA   4  
ATOM 6164  H HB2  . LEU A 1 28  ? -10.736 -5.520  1.044   1.00 0.00 ? 28  LEU A HB2  4  
ATOM 6165  H HB3  . LEU A 1 28  ? -12.204 -5.494  -0.010  1.00 0.00 ? 28  LEU A HB3  4  
ATOM 6166  H HG   . LEU A 1 28  ? -12.584 -7.793  1.085   1.00 0.00 ? 28  LEU A HG   4  
ATOM 6167  H HD11 . LEU A 1 28  ? -10.325 -7.815  2.423   1.00 0.00 ? 28  LEU A HD11 4  
ATOM 6168  H HD12 . LEU A 1 28  ? -11.163 -6.732  3.571   1.00 0.00 ? 28  LEU A HD12 4  
ATOM 6169  H HD13 . LEU A 1 28  ? -11.795 -8.359  3.290   1.00 0.00 ? 28  LEU A HD13 4  
ATOM 6170  H HD21 . LEU A 1 28  ? -14.174 -6.029  1.329   1.00 0.00 ? 28  LEU A HD21 4  
ATOM 6171  H HD22 . LEU A 1 28  ? -14.003 -6.939  2.871   1.00 0.00 ? 28  LEU A HD22 4  
ATOM 6172  H HD23 . LEU A 1 28  ? -13.232 -5.321  2.694   1.00 0.00 ? 28  LEU A HD23 4  
ATOM 6173  N N    . GLU A 1 29  ? -11.212 -6.854  -2.920  1.00 0.00 ? 29  GLU A N    4  
ATOM 6174  C CA   . GLU A 1 29  ? -11.614 -7.317  -4.255  1.00 0.00 ? 29  GLU A CA   4  
ATOM 6175  C C    . GLU A 1 29  ? -10.903 -8.547  -4.743  1.00 0.00 ? 29  GLU A C    4  
ATOM 6176  O O    . GLU A 1 29  ? -11.542 -9.477  -5.210  1.00 0.00 ? 29  GLU A O    4  
ATOM 6177  C CB   . GLU A 1 29  ? -11.386 -6.260  -5.365  1.00 0.00 ? 29  GLU A CB   4  
ATOM 6178  C CG   . GLU A 1 29  ? -12.754 -5.743  -5.769  1.00 0.00 ? 29  GLU A CG   4  
ATOM 6179  C CD   . GLU A 1 29  ? -12.638 -4.565  -6.723  1.00 0.00 ? 29  GLU A CD   4  
ATOM 6180  O OE1  . GLU A 1 29  ? -12.096 -4.759  -7.846  1.00 0.00 ? 29  GLU A OE1  4  
ATOM 6181  O OE2  . GLU A 1 29  ? -13.086 -3.450  -6.344  1.00 0.00 ? 29  GLU A OE2  4  
ATOM 6182  H H    . GLU A 1 29  ? -10.718 -5.972  -2.940  1.00 0.00 ? 29  GLU A H    4  
ATOM 6183  H HA   . GLU A 1 29  ? -12.667 -7.586  -4.208  1.00 0.00 ? 29  GLU A HA   4  
ATOM 6184  H HB2  . GLU A 1 29  ? -10.721 -5.465  -4.991  1.00 0.00 ? 29  GLU A HB2  4  
ATOM 6185  H HB3  . GLU A 1 29  ? -10.911 -6.614  -6.311  1.00 0.00 ? 29  GLU A HB3  4  
ATOM 6186  H HG2  . GLU A 1 29  ? -13.233 -6.629  -6.257  1.00 0.00 ? 29  GLU A HG2  4  
ATOM 6187  H HG3  . GLU A 1 29  ? -13.265 -5.461  -4.821  1.00 0.00 ? 29  GLU A HG3  4  
ATOM 6188  N N    . LEU A 1 30  ? -9.550  -8.549  -4.632  1.00 0.00 ? 30  LEU A N    4  
ATOM 6189  C CA   . LEU A 1 30  ? -8.598  -9.603  -4.994  1.00 0.00 ? 30  LEU A CA   4  
ATOM 6190  C C    . LEU A 1 30  ? -8.744  -10.859 -4.154  1.00 0.00 ? 30  LEU A C    4  
ATOM 6191  O O    . LEU A 1 30  ? -8.647  -11.974 -4.657  1.00 0.00 ? 30  LEU A O    4  
ATOM 6192  C CB   . LEU A 1 30  ? -7.166  -9.045  -4.948  1.00 0.00 ? 30  LEU A CB   4  
ATOM 6193  C CG   . LEU A 1 30  ? -6.138  -9.713  -5.881  1.00 0.00 ? 30  LEU A CG   4  
ATOM 6194  C CD1  . LEU A 1 30  ? -5.088  -8.657  -6.228  1.00 0.00 ? 30  LEU A CD1  4  
ATOM 6195  C CD2  . LEU A 1 30  ? -5.425  -10.946 -5.310  1.00 0.00 ? 30  LEU A CD2  4  
ATOM 6196  H H    . LEU A 1 30  ? -9.111  -7.717  -4.264  1.00 0.00 ? 30  LEU A H    4  
ATOM 6197  H HA   . LEU A 1 30  ? -8.829  -9.880  -6.017  1.00 0.00 ? 30  LEU A HA   4  
ATOM 6198  H HB2  . LEU A 1 30  ? -7.259  -7.996  -5.318  1.00 0.00 ? 30  LEU A HB2  4  
ATOM 6199  H HB3  . LEU A 1 30  ? -6.775  -8.971  -3.910  1.00 0.00 ? 30  LEU A HB3  4  
ATOM 6200  H HG   . LEU A 1 30  ? -6.656  -10.010 -6.824  1.00 0.00 ? 30  LEU A HG   4  
ATOM 6201  H HD11 . LEU A 1 30  ? -5.565  -7.763  -6.689  1.00 0.00 ? 30  LEU A HD11 4  
ATOM 6202  H HD12 . LEU A 1 30  ? -4.605  -8.344  -5.282  1.00 0.00 ? 30  LEU A HD12 4  
ATOM 6203  H HD13 . LEU A 1 30  ? -4.320  -9.073  -6.914  1.00 0.00 ? 30  LEU A HD13 4  
ATOM 6204  H HD21 . LEU A 1 30  ? -6.136  -11.755 -5.053  1.00 0.00 ? 30  LEU A HD21 4  
ATOM 6205  H HD22 . LEU A 1 30  ? -4.717  -11.335 -6.073  1.00 0.00 ? 30  LEU A HD22 4  
ATOM 6206  H HD23 . LEU A 1 30  ? -4.841  -10.694 -4.397  1.00 0.00 ? 30  LEU A HD23 4  
ATOM 6207  N N    . LEU A 1 31  ? -9.097  -10.665 -2.850  1.00 0.00 ? 31  LEU A N    4  
ATOM 6208  C CA   . LEU A 1 31  ? -9.509  -11.623 -1.836  1.00 0.00 ? 31  LEU A CA   4  
ATOM 6209  C C    . LEU A 1 31  ? -10.819 -12.267 -2.253  1.00 0.00 ? 31  LEU A C    4  
ATOM 6210  O O    . LEU A 1 31  ? -10.877 -13.483 -2.372  1.00 0.00 ? 31  LEU A O    4  
ATOM 6211  C CB   . LEU A 1 31  ? -9.637  -10.899 -0.470  1.00 0.00 ? 31  LEU A CB   4  
ATOM 6212  C CG   . LEU A 1 31  ? -10.033 -11.718 0.775   1.00 0.00 ? 31  LEU A CG   4  
ATOM 6213  C CD1  . LEU A 1 31  ? -9.001  -12.832 1.042   1.00 0.00 ? 31  LEU A CD1  4  
ATOM 6214  C CD2  . LEU A 1 31  ? -10.208 -10.741 1.963   1.00 0.00 ? 31  LEU A CD2  4  
ATOM 6215  H H    . LEU A 1 31  ? -9.141  -9.716  -2.507  1.00 0.00 ? 31  LEU A H    4  
ATOM 6216  H HA   . LEU A 1 31  ? -8.761  -12.398 -1.770  1.00 0.00 ? 31  LEU A HA   4  
ATOM 6217  H HB2  . LEU A 1 31  ? -8.625  -10.463 -0.251  1.00 0.00 ? 31  LEU A HB2  4  
ATOM 6218  H HB3  . LEU A 1 31  ? -10.387 -10.072 -0.574  1.00 0.00 ? 31  LEU A HB3  4  
ATOM 6219  H HG   . LEU A 1 31  ? -11.021 -12.205 0.602   1.00 0.00 ? 31  LEU A HG   4  
ATOM 6220  H HD11 . LEU A 1 31  ? -7.988  -12.394 1.178   1.00 0.00 ? 31  LEU A HD11 4  
ATOM 6221  H HD12 . LEU A 1 31  ? -9.271  -13.409 1.953   1.00 0.00 ? 31  LEU A HD12 4  
ATOM 6222  H HD13 . LEU A 1 31  ? -8.947  -13.533 0.179   1.00 0.00 ? 31  LEU A HD13 4  
ATOM 6223  H HD21 . LEU A 1 31  ? -9.279  -10.161 2.140   1.00 0.00 ? 31  LEU A HD21 4  
ATOM 6224  H HD22 . LEU A 1 31  ? -11.040 -10.019 1.789   1.00 0.00 ? 31  LEU A HD22 4  
ATOM 6225  H HD23 . LEU A 1 31  ? -10.472 -11.280 2.900   1.00 0.00 ? 31  LEU A HD23 4  
ATOM 6226  N N    . ARG A 1 32  ? -11.858 -11.446 -2.601  1.00 0.00 ? 32  ARG A N    4  
ATOM 6227  C CA   . ARG A 1 32  ? -13.151 -11.846 -3.148  1.00 0.00 ? 32  ARG A CA   4  
ATOM 6228  C C    . ARG A 1 32  ? -13.124 -12.621 -4.479  1.00 0.00 ? 32  ARG A C    4  
ATOM 6229  O O    . ARG A 1 32  ? -13.838 -13.604 -4.600  1.00 0.00 ? 32  ARG A O    4  
ATOM 6230  C CB   . ARG A 1 32  ? -14.032 -10.580 -3.312  1.00 0.00 ? 32  ARG A CB   4  
ATOM 6231  C CG   . ARG A 1 32  ? -15.040 -10.378 -2.176  1.00 0.00 ? 32  ARG A CG   4  
ATOM 6232  C CD   . ARG A 1 32  ? -15.910 -9.130  -2.374  1.00 0.00 ? 32  ARG A CD   4  
ATOM 6233  N NE   . ARG A 1 32  ? -15.043 -7.910  -2.224  1.00 0.00 ? 32  ARG A NE   4  
ATOM 6234  C CZ   . ARG A 1 32  ? -15.492 -6.635  -2.442  1.00 0.00 ? 32  ARG A CZ   4  
ATOM 6235  N NH1  . ARG A 1 32  ? -16.778 -6.403  -2.837  1.00 0.00 ? 32  ARG A NH1  4  
ATOM 6236  N NH2  . ARG A 1 32  ? -14.639 -5.584  -2.261  1.00 0.00 ? 32  ARG A NH2  4  
ATOM 6237  H H    . ARG A 1 32  ? -11.787 -10.447 -2.519  1.00 0.00 ? 32  ARG A H    4  
ATOM 6238  H HA   . ARG A 1 32  ? -13.627 -12.500 -2.427  1.00 0.00 ? 32  ARG A HA   4  
ATOM 6239  H HB2  . ARG A 1 32  ? -13.372 -9.688  -3.380  1.00 0.00 ? 32  ARG A HB2  4  
ATOM 6240  H HB3  . ARG A 1 32  ? -14.637 -10.596 -4.242  1.00 0.00 ? 32  ARG A HB3  4  
ATOM 6241  H HG2  . ARG A 1 32  ? -15.676 -11.287 -2.156  1.00 0.00 ? 32  ARG A HG2  4  
ATOM 6242  H HG3  . ARG A 1 32  ? -14.537 -10.308 -1.186  1.00 0.00 ? 32  ARG A HG3  4  
ATOM 6243  H HD2  . ARG A 1 32  ? -16.363 -9.136  -3.389  1.00 0.00 ? 32  ARG A HD2  4  
ATOM 6244  H HD3  . ARG A 1 32  ? -16.704 -9.099  -1.597  1.00 0.00 ? 32  ARG A HD3  4  
ATOM 6245  H HE   . ARG A 1 32  ? -14.093 -8.038  -1.941  1.00 0.00 ? 32  ARG A HE   4  
ATOM 6246  H HH11 . ARG A 1 32  ? -17.404 -7.170  -2.972  1.00 0.00 ? 32  ARG A HH11 4  
ATOM 6247  H HH12 . ARG A 1 32  ? -17.089 -5.466  -2.993  1.00 0.00 ? 32  ARG A HH12 4  
ATOM 6248  H HH21 . ARG A 1 32  ? -13.696 -5.753  -1.971  1.00 0.00 ? 32  ARG A HH21 4  
ATOM 6249  H HH22 . ARG A 1 32  ? -14.954 -4.649  -2.417  1.00 0.00 ? 32  ARG A HH22 4  
ATOM 6250  N N    . ARG A 1 33  ? -12.342 -12.190 -5.512  1.00 0.00 ? 33  ARG A N    4  
ATOM 6251  C CA   . ARG A 1 33  ? -12.025 -12.900 -6.761  1.00 0.00 ? 33  ARG A CA   4  
ATOM 6252  C C    . ARG A 1 33  ? -11.084 -14.067 -6.789  1.00 0.00 ? 33  ARG A C    4  
ATOM 6253  O O    . ARG A 1 33  ? -11.385 -15.098 -7.380  1.00 0.00 ? 33  ARG A O    4  
ATOM 6254  C CB   . ARG A 1 33  ? -11.767 -12.036 -8.016  1.00 0.00 ? 33  ARG A CB   4  
ATOM 6255  C CG   . ARG A 1 33  ? -10.974 -10.729 -7.860  1.00 0.00 ? 33  ARG A CG   4  
ATOM 6256  C CD   . ARG A 1 33  ? -9.951  -10.472 -8.972  1.00 0.00 ? 33  ARG A CD   4  
ATOM 6257  N NE   . ARG A 1 33  ? -9.116  -9.279  -8.588  1.00 0.00 ? 33  ARG A NE   4  
ATOM 6258  C CZ   . ARG A 1 33  ? -8.258  -8.656  -9.453  1.00 0.00 ? 33  ARG A CZ   4  
ATOM 6259  N NH1  . ARG A 1 33  ? -8.170  -9.049  -10.756 1.00 0.00 ? 33  ARG A NH1  4  
ATOM 6260  N NH2  . ARG A 1 33  ? -7.477  -7.630  -9.001  1.00 0.00 ? 33  ARG A NH2  4  
ATOM 6261  H H    . ARG A 1 33  ? -11.828 -11.339 -5.377  1.00 0.00 ? 33  ARG A H    4  
ATOM 6262  H HA   . ARG A 1 33  ? -12.943 -13.410 -7.008  1.00 0.00 ? 33  ARG A HA   4  
ATOM 6263  H HB2  . ARG A 1 33  ? -11.540 -12.593 -8.942  1.00 0.00 ? 33  ARG A HB2  4  
ATOM 6264  H HB3  . ARG A 1 33  ? -12.780 -11.860 -8.336  1.00 0.00 ? 33  ARG A HB3  4  
ATOM 6265  H HG2  . ARG A 1 33  ? -11.659 -9.857  -7.803  1.00 0.00 ? 33  ARG A HG2  4  
ATOM 6266  H HG3  . ARG A 1 33  ? -10.479 -10.719 -6.873  1.00 0.00 ? 33  ARG A HG3  4  
ATOM 6267  H HD2  . ARG A 1 33  ? -9.282  -11.349 -9.097  1.00 0.00 ? 33  ARG A HD2  4  
ATOM 6268  H HD3  . ARG A 1 33  ? -10.481 -10.255 -9.923  1.00 0.00 ? 33  ARG A HD3  4  
ATOM 6269  H HE   . ARG A 1 33  ? -9.155  -8.962  -7.641  1.00 0.00 ? 33  ARG A HE   4  
ATOM 6270  H HH11 . ARG A 1 33  ? -8.739  -9.801  -11.090 1.00 0.00 ? 33  ARG A HH11 4  
ATOM 6271  H HH12 . ARG A 1 33  ? -7.534  -8.589  -11.375 1.00 0.00 ? 33  ARG A HH12 4  
ATOM 6272  H HH21 . ARG A 1 33  ? -7.535  -7.341  -8.045  1.00 0.00 ? 33  ARG A HH21 4  
ATOM 6273  H HH22 . ARG A 1 33  ? -6.847  -7.170  -9.626  1.00 0.00 ? 33  ARG A HH22 4  
ATOM 6274  N N    . ARG A 1 34  ? -9.858  -13.909 -6.249  1.00 0.00 ? 34  ARG A N    4  
ATOM 6275  C CA   . ARG A 1 34  ? -8.823  -14.913 -6.393  1.00 0.00 ? 34  ARG A CA   4  
ATOM 6276  C C    . ARG A 1 34  ? -8.911  -16.055 -5.392  1.00 0.00 ? 34  ARG A C    4  
ATOM 6277  O O    . ARG A 1 34  ? -8.604  -17.206 -5.689  1.00 0.00 ? 34  ARG A O    4  
ATOM 6278  C CB   . ARG A 1 34  ? -7.448  -14.244 -6.480  1.00 0.00 ? 34  ARG A CB   4  
ATOM 6279  C CG   . ARG A 1 34  ? -7.477  -13.157 -7.570  1.00 0.00 ? 34  ARG A CG   4  
ATOM 6280  C CD   . ARG A 1 34  ? -6.139  -13.099 -8.303  1.00 0.00 ? 34  ARG A CD   4  
ATOM 6281  N NE   . ARG A 1 34  ? -6.142  -11.931 -9.250  1.00 0.00 ? 34  ARG A NE   4  
ATOM 6282  C CZ   . ARG A 1 34  ? -4.995  -11.339 -9.711  1.00 0.00 ? 34  ARG A CZ   4  
ATOM 6283  N NH1  . ARG A 1 34  ? -3.768  -11.730 -9.259  1.00 0.00 ? 34  ARG A NH1  4  
ATOM 6284  N NH2  . ARG A 1 34  ? -5.085  -10.342 -10.637 1.00 0.00 ? 34  ARG A NH2  4  
ATOM 6285  H H    . ARG A 1 34  ? -9.574  -13.062 -5.779  1.00 0.00 ? 34  ARG A H    4  
ATOM 6286  H HA   . ARG A 1 34  ? -8.896  -15.336 -7.382  1.00 0.00 ? 34  ARG A HA   4  
ATOM 6287  H HB2  . ARG A 1 34  ? -7.153  -13.791 -5.509  1.00 0.00 ? 34  ARG A HB2  4  
ATOM 6288  H HB3  . ARG A 1 34  ? -6.683  -15.010 -6.753  1.00 0.00 ? 34  ARG A HB3  4  
ATOM 6289  H HG2  . ARG A 1 34  ? -8.293  -13.373 -8.306  1.00 0.00 ? 34  ARG A HG2  4  
ATOM 6290  H HG3  . ARG A 1 34  ? -7.729  -12.179 -7.102  1.00 0.00 ? 34  ARG A HG3  4  
ATOM 6291  H HD2  . ARG A 1 34  ? -5.319  -13.002 -7.561  1.00 0.00 ? 34  ARG A HD2  4  
ATOM 6292  H HD3  . ARG A 1 34  ? -6.025  -14.044 -8.882  1.00 0.00 ? 34  ARG A HD3  4  
ATOM 6293  H HE   . ARG A 1 34  ? -7.020  -11.606 -9.599  1.00 0.00 ? 34  ARG A HE   4  
ATOM 6294  H HH11 . ARG A 1 34  ? -3.698  -12.461 -8.580  1.00 0.00 ? 34  ARG A HH11 4  
ATOM 6295  H HH12 . ARG A 1 34  ? -2.942  -11.284 -9.604  1.00 0.00 ? 34  ARG A HH12 4  
ATOM 6296  H HH21 . ARG A 1 34  ? -5.980  -10.047 -10.970 1.00 0.00 ? 34  ARG A HH21 4  
ATOM 6297  H HH22 . ARG A 1 34  ? -4.254  -9.899  -10.977 1.00 0.00 ? 34  ARG A HH22 4  
ATOM 6298  N N    . PHE A 1 35  ? -9.345  -15.720 -4.157  1.00 0.00 ? 35  PHE A N    4  
ATOM 6299  C CA   . PHE A 1 35  ? -9.447  -16.620 -3.028  1.00 0.00 ? 35  PHE A CA   4  
ATOM 6300  C C    . PHE A 1 35  ? -10.921 -16.948 -2.725  1.00 0.00 ? 35  PHE A C    4  
ATOM 6301  O O    . PHE A 1 35  ? -11.234 -18.063 -2.296  1.00 0.00 ? 35  PHE A O    4  
ATOM 6302  C CB   . PHE A 1 35  ? -8.693  -16.010 -1.785  1.00 0.00 ? 35  PHE A CB   4  
ATOM 6303  C CG   . PHE A 1 35  ? -7.242  -15.691 -2.063  1.00 0.00 ? 35  PHE A CG   4  
ATOM 6304  C CD1  . PHE A 1 35  ? -6.173  -16.444 -1.594  1.00 0.00 ? 35  PHE A CD1  4  
ATOM 6305  C CD2  . PHE A 1 35  ? -6.946  -14.523 -2.742  1.00 0.00 ? 35  PHE A CD2  4  
ATOM 6306  C CE1  . PHE A 1 35  ? -4.875  -16.055 -1.853  1.00 0.00 ? 35  PHE A CE1  4  
ATOM 6307  C CE2  . PHE A 1 35  ? -5.660  -14.150 -3.028  1.00 0.00 ? 35  PHE A CE2  4  
ATOM 6308  C CZ   . PHE A 1 35  ? -4.611  -14.918 -2.583  1.00 0.00 ? 35  PHE A CZ   4  
ATOM 6309  H H    . PHE A 1 35  ? -9.568  -14.765 -3.956  1.00 0.00 ? 35  PHE A H    4  
ATOM 6310  H HA   . PHE A 1 35  ? -8.976  -17.571 -3.251  1.00 0.00 ? 35  PHE A HA   4  
ATOM 6311  H HB2  . PHE A 1 35  ? -9.110  -15.002 -1.552  1.00 0.00 ? 35  PHE A HB2  4  
ATOM 6312  H HB3  . PHE A 1 35  ? -8.736  -16.711 -0.912  1.00 0.00 ? 35  PHE A HB3  4  
ATOM 6313  H HD1  . PHE A 1 35  ? -6.319  -17.329 -0.994  1.00 0.00 ? 35  PHE A HD1  4  
ATOM 6314  H HD2  . PHE A 1 35  ? -7.746  -13.882 -3.084  1.00 0.00 ? 35  PHE A HD2  4  
ATOM 6315  H HE1  . PHE A 1 35  ? -4.059  -16.648 -1.469  1.00 0.00 ? 35  PHE A HE1  4  
ATOM 6316  H HE2  . PHE A 1 35  ? -5.512  -13.258 -3.613  1.00 0.00 ? 35  PHE A HE2  4  
ATOM 6317  H HZ   . PHE A 1 35  ? -3.591  -14.619 -2.775  1.00 0.00 ? 35  PHE A HZ   4  
ATOM 6318  N N    . GLY A 1 36  ? -11.879 -15.964 -2.862  1.00 0.00 ? 36  GLY A N    4  
ATOM 6319  C CA   . GLY A 1 36  ? -13.265 -16.042 -2.416  1.00 0.00 ? 36  GLY A CA   4  
ATOM 6320  C C    . GLY A 1 36  ? -13.356 -15.819 -0.954  1.00 0.00 ? 36  GLY A C    4  
ATOM 6321  O O    . GLY A 1 36  ? -13.200 -14.729 -0.409  1.00 0.00 ? 36  GLY A O    4  
ATOM 6322  H H    . GLY A 1 36  ? -11.690 -15.029 -3.187  1.00 0.00 ? 36  GLY A H    4  
ATOM 6323  H HA2  . GLY A 1 36  ? -13.826 -15.238 -2.865  1.00 0.00 ? 36  GLY A HA2  4  
ATOM 6324  H HA3  . GLY A 1 36  ? -13.634 -17.039 -2.596  1.00 0.00 ? 36  GLY A HA3  4  
ATOM 6325  N N    . THR A 1 37  ? -13.566 -16.958 -0.272  1.00 0.00 ? 37  THR A N    4  
ATOM 6326  C CA   . THR A 1 37  ? -13.517 -17.070 1.160   1.00 0.00 ? 37  THR A CA   4  
ATOM 6327  C C    . THR A 1 37  ? -12.704 -18.333 1.389   1.00 0.00 ? 37  THR A C    4  
ATOM 6328  O O    . THR A 1 37  ? -13.198 -19.447 1.231   1.00 0.00 ? 37  THR A O    4  
ATOM 6329  C CB   . THR A 1 37  ? -14.927 -17.206 1.758   1.00 0.00 ? 37  THR A CB   4  
ATOM 6330  O OG1  . THR A 1 37  ? -15.747 -18.144 1.063   1.00 0.00 ? 37  THR A OG1  4  
ATOM 6331  C CG2  . THR A 1 37  ? -15.653 -15.866 1.667   1.00 0.00 ? 37  THR A CG2  4  
ATOM 6332  H H    . THR A 1 37  ? -13.667 -17.817 -0.766  1.00 0.00 ? 37  THR A H    4  
ATOM 6333  H HA   . THR A 1 37  ? -13.000 -16.240 1.619   1.00 0.00 ? 37  THR A HA   4  
ATOM 6334  H HB   . THR A 1 37  ? -14.885 -17.482 2.837   1.00 0.00 ? 37  THR A HB   4  
ATOM 6335  H HG1  . THR A 1 37  ? -15.244 -18.971 1.066   1.00 0.00 ? 37  THR A HG1  4  
ATOM 6336  H HG21 . THR A 1 37  ? -15.076 -15.066 2.155   1.00 0.00 ? 37  THR A HG21 4  
ATOM 6337  H HG22 . THR A 1 37  ? -15.856 -15.528 0.633   1.00 0.00 ? 37  THR A HG22 4  
ATOM 6338  H HG23 . THR A 1 37  ? -16.607 -15.921 2.222   1.00 0.00 ? 37  THR A HG23 4  
ATOM 6339  N N    . LYS A 1 38  ? -11.464 -18.156 1.864   1.00 0.00 ? 38  LYS A N    4  
ATOM 6340  C CA   . LYS A 1 38  ? -10.522 -19.218 2.186   1.00 0.00 ? 38  LYS A CA   4  
ATOM 6341  C C    . LYS A 1 38  ? -9.679  -18.751 3.348   1.00 0.00 ? 38  LYS A C    4  
ATOM 6342  O O    . LYS A 1 38  ? -9.431  -17.557 3.485   1.00 0.00 ? 38  LYS A O    4  
ATOM 6343  C CB   . LYS A 1 38  ? -9.610  -19.576 0.998   1.00 0.00 ? 38  LYS A CB   4  
ATOM 6344  C CG   . LYS A 1 38  ? -8.953  -20.956 1.173   1.00 0.00 ? 38  LYS A CG   4  
ATOM 6345  C CD   . LYS A 1 38  ? -7.717  -21.094 0.296   1.00 0.00 ? 38  LYS A CD   4  
ATOM 6346  C CE   . LYS A 1 38  ? -7.993  -21.102 -1.213  1.00 0.00 ? 38  LYS A CE   4  
ATOM 6347  N NZ   . LYS A 1 38  ? -6.728  -21.222 -1.973  1.00 0.00 ? 38  LYS A NZ   4  
ATOM 6348  H H    . LYS A 1 38  ? -11.128 -17.218 1.884   1.00 0.00 ? 38  LYS A H    4  
ATOM 6349  H HA   . LYS A 1 38  ? -10.979 -20.158 2.440   1.00 0.00 ? 38  LYS A HA   4  
ATOM 6350  H HB2  . LYS A 1 38  ? -10.237 -19.607 0.076   1.00 0.00 ? 38  LYS A HB2  4  
ATOM 6351  H HB3  . LYS A 1 38  ? -8.836  -18.793 0.825   1.00 0.00 ? 38  LYS A HB3  4  
ATOM 6352  H HG2  . LYS A 1 38  ? -8.566  -21.080 2.209   1.00 0.00 ? 38  LYS A HG2  4  
ATOM 6353  H HG3  . LYS A 1 38  ? -9.680  -21.779 1.005   1.00 0.00 ? 38  LYS A HG3  4  
ATOM 6354  H HD2  . LYS A 1 38  ? -7.094  -20.214 0.567   1.00 0.00 ? 38  LYS A HD2  4  
ATOM 6355  H HD3  . LYS A 1 38  ? -7.201  -22.026 0.603   1.00 0.00 ? 38  LYS A HD3  4  
ATOM 6356  H HE2  . LYS A 1 38  ? -8.635  -21.964 -1.488  1.00 0.00 ? 38  LYS A HE2  4  
ATOM 6357  H HE3  . LYS A 1 38  ? -8.483  -20.160 -1.534  1.00 0.00 ? 38  LYS A HE3  4  
ATOM 6358  H HZ1  . LYS A 1 38  ? -6.249  -22.106 -1.710  1.00 0.00 ? 38  LYS A HZ1  4  
ATOM 6359  H HZ2  . LYS A 1 38  ? -6.933  -21.231 -2.992  1.00 0.00 ? 38  LYS A HZ2  4  
ATOM 6360  H HZ3  . LYS A 1 38  ? -6.112  -20.414 -1.750  1.00 0.00 ? 38  LYS A HZ3  4  
ATOM 6361  N N    . ARG A 1 39  ? -9.150  -19.675 4.199   1.00 0.00 ? 39  ARG A N    4  
ATOM 6362  C CA   . ARG A 1 39  ? -8.202  -19.393 5.270   1.00 0.00 ? 39  ARG A CA   4  
ATOM 6363  C C    . ARG A 1 39  ? -6.785  -19.211 4.695   1.00 0.00 ? 39  ARG A C    4  
ATOM 6364  O O    . ARG A 1 39  ? -6.154  -20.133 4.185   1.00 0.00 ? 39  ARG A O    4  
ATOM 6365  C CB   . ARG A 1 39  ? -8.298  -20.417 6.438   1.00 0.00 ? 39  ARG A CB   4  
ATOM 6366  C CG   . ARG A 1 39  ? -7.716  -21.830 6.241   1.00 0.00 ? 39  ARG A CG   4  
ATOM 6367  C CD   . ARG A 1 39  ? -8.460  -22.722 5.229   1.00 0.00 ? 39  ARG A CD   4  
ATOM 6368  N NE   . ARG A 1 39  ? -7.844  -24.097 5.225   1.00 0.00 ? 39  ARG A NE   4  
ATOM 6369  C CZ   . ARG A 1 39  ? -8.232  -25.114 6.057   1.00 0.00 ? 39  ARG A CZ   4  
ATOM 6370  N NH1  . ARG A 1 39  ? -9.237  -24.944 6.962   1.00 0.00 ? 39  ARG A NH1  4  
ATOM 6371  N NH2  . ARG A 1 39  ? -7.598  -26.323 5.974   1.00 0.00 ? 39  ARG A NH2  4  
ATOM 6372  H H    . ARG A 1 39  ? -9.353  -20.638 4.082   1.00 0.00 ? 39  ARG A H    4  
ATOM 6373  H HA   . ARG A 1 39  ? -8.483  -18.452 5.715   1.00 0.00 ? 39  ARG A HA   4  
ATOM 6374  H HB2  . ARG A 1 39  ? -7.789  -19.973 7.322   1.00 0.00 ? 39  ARG A HB2  4  
ATOM 6375  H HB3  . ARG A 1 39  ? -9.372  -20.528 6.712   1.00 0.00 ? 39  ARG A HB3  4  
ATOM 6376  H HG2  . ARG A 1 39  ? -6.654  -21.730 5.948   1.00 0.00 ? 39  ARG A HG2  4  
ATOM 6377  H HG3  . ARG A 1 39  ? -7.717  -22.309 7.248   1.00 0.00 ? 39  ARG A HG3  4  
ATOM 6378  H HD2  . ARG A 1 39  ? -9.544  -22.780 5.471   1.00 0.00 ? 39  ARG A HD2  4  
ATOM 6379  H HD3  . ARG A 1 39  ? -8.352  -22.330 4.193   1.00 0.00 ? 39  ARG A HD3  4  
ATOM 6380  H HE   . ARG A 1 39  ? -7.103  -24.273 4.577   1.00 0.00 ? 39  ARG A HE   4  
ATOM 6381  H HH11 . ARG A 1 39  ? -9.704  -24.061 7.029   1.00 0.00 ? 39  ARG A HH11 4  
ATOM 6382  H HH12 . ARG A 1 39  ? -9.506  -25.699 7.560   1.00 0.00 ? 39  ARG A HH12 4  
ATOM 6383  H HH21 . ARG A 1 39  ? -6.859  -26.455 5.315   1.00 0.00 ? 39  ARG A HH21 4  
ATOM 6384  H HH22 . ARG A 1 39  ? -7.874  -27.073 6.575   1.00 0.00 ? 39  ARG A HH22 4  
ATOM 6385  N N    . VAL A 1 40  ? -6.287  -17.959 4.695   1.00 0.00 ? 40  VAL A N    4  
ATOM 6386  C CA   . VAL A 1 40  ? -5.026  -17.588 4.071   1.00 0.00 ? 40  VAL A CA   4  
ATOM 6387  C C    . VAL A 1 40  ? -4.500  -16.455 4.888   1.00 0.00 ? 40  VAL A C    4  
ATOM 6388  O O    . VAL A 1 40  ? -5.284  -15.732 5.497   1.00 0.00 ? 40  VAL A O    4  
ATOM 6389  C CB   . VAL A 1 40  ? -5.212  -17.213 2.590   1.00 0.00 ? 40  VAL A CB   4  
ATOM 6390  C CG1  . VAL A 1 40  ? -6.252  -16.086 2.371   1.00 0.00 ? 40  VAL A CG1  4  
ATOM 6391  C CG2  . VAL A 1 40  ? -3.885  -16.902 1.863   1.00 0.00 ? 40  VAL A CG2  4  
ATOM 6392  H H    . VAL A 1 40  ? -6.822  -17.193 5.077   1.00 0.00 ? 40  VAL A H    4  
ATOM 6393  H HA   . VAL A 1 40  ? -4.315  -18.401 4.147   1.00 0.00 ? 40  VAL A HA   4  
ATOM 6394  H HB   . VAL A 1 40  ? -5.607  -18.141 2.129   1.00 0.00 ? 40  VAL A HB   4  
ATOM 6395  H HG11 . VAL A 1 40  ? -7.236  -16.339 2.822   1.00 0.00 ? 40  VAL A HG11 4  
ATOM 6396  H HG12 . VAL A 1 40  ? -5.885  -15.127 2.790   1.00 0.00 ? 40  VAL A HG12 4  
ATOM 6397  H HG13 . VAL A 1 40  ? -6.414  -15.931 1.282   1.00 0.00 ? 40  VAL A HG13 4  
ATOM 6398  H HG21 . VAL A 1 40  ? -3.145  -17.709 2.045   1.00 0.00 ? 40  VAL A HG21 4  
ATOM 6399  H HG22 . VAL A 1 40  ? -4.070  -16.845 0.769   1.00 0.00 ? 40  VAL A HG22 4  
ATOM 6400  H HG23 . VAL A 1 40  ? -3.462  -15.926 2.185   1.00 0.00 ? 40  VAL A HG23 4  
ATOM 6401  N N    . HIS A 1 41  ? -3.148  -16.257 4.937   1.00 0.00 ? 41  HIS A N    4  
ATOM 6402  C CA   . HIS A 1 41  ? -2.503  -15.166 5.658   1.00 0.00 ? 41  HIS A CA   4  
ATOM 6403  C C    . HIS A 1 41  ? -2.496  -13.942 4.789   1.00 0.00 ? 41  HIS A C    4  
ATOM 6404  O O    . HIS A 1 41  ? -2.224  -13.967 3.583   1.00 0.00 ? 41  HIS A O    4  
ATOM 6405  C CB   . HIS A 1 41  ? -1.046  -15.478 6.131   1.00 0.00 ? 41  HIS A CB   4  
ATOM 6406  C CG   . HIS A 1 41  ? -0.295  -14.513 7.067   1.00 0.00 ? 41  HIS A CG   4  
ATOM 6407  N ND1  . HIS A 1 41  ? -0.512  -13.185 7.394   1.00 0.00 ? 41  HIS A ND1  4  
ATOM 6408  C CD2  . HIS A 1 41  ? 0.819   -14.851 7.754   1.00 0.00 ? 41  HIS A CD2  4  
ATOM 6409  C CE1  . HIS A 1 41  ? 0.477   -12.804 8.244   1.00 0.00 ? 41  HIS A CE1  4  
ATOM 6410  N NE2  . HIS A 1 41  ? 1.288   -13.792 8.517   1.00 0.00 ? 41  HIS A NE2  4  
ATOM 6411  H H    . HIS A 1 41  ? -2.552  -16.852 4.410   1.00 0.00 ? 41  HIS A H    4  
ATOM 6412  H HA   . HIS A 1 41  ? -3.088  -14.943 6.538   1.00 0.00 ? 41  HIS A HA   4  
ATOM 6413  H HB2  . HIS A 1 41  ? -1.108  -16.439 6.689   1.00 0.00 ? 41  HIS A HB2  4  
ATOM 6414  H HB3  . HIS A 1 41  ? -0.391  -15.662 5.255   1.00 0.00 ? 41  HIS A HB3  4  
ATOM 6415  H HD1  . HIS A 1 41  ? -1.414  -12.750 7.391   1.00 0.00 ? 41  HIS A HD1  4  
ATOM 6416  H HD2  . HIS A 1 41  ? 1.305   -15.804 7.679   1.00 0.00 ? 41  HIS A HD2  4  
ATOM 6417  H HE1  . HIS A 1 41  ? 0.686   -11.778 8.544   1.00 0.00 ? 41  HIS A HE1  4  
ATOM 6418  N N    . ASN A 1 42  ? -2.794  -12.790 5.428   1.00 0.00 ? 42  ASN A N    4  
ATOM 6419  C CA   . ASN A 1 42  ? -2.857  -11.469 4.763   1.00 0.00 ? 42  ASN A CA   4  
ATOM 6420  C C    . ASN A 1 42  ? -1.570  -11.032 4.034   1.00 0.00 ? 42  ASN A C    4  
ATOM 6421  O O    . ASN A 1 42  ? -1.602  -10.327 3.040   1.00 0.00 ? 42  ASN A O    4  
ATOM 6422  C CB   . ASN A 1 42  ? -3.150  -10.249 5.660   1.00 0.00 ? 42  ASN A CB   4  
ATOM 6423  C CG   . ASN A 1 42  ? -4.139  -10.576 6.747   1.00 0.00 ? 42  ASN A CG   4  
ATOM 6424  O OD1  . ASN A 1 42  ? -3.846  -11.430 7.593   1.00 0.00 ? 42  ASN A OD1  4  
ATOM 6425  N ND2  . ASN A 1 42  ? -5.266  -9.822  6.761   1.00 0.00 ? 42  ASN A ND2  4  
ATOM 6426  H H    . ASN A 1 42  ? -3.016  -12.898 6.413   1.00 0.00 ? 42  ASN A H    4  
ATOM 6427  H HA   . ASN A 1 42  ? -3.693  -11.551 4.064   1.00 0.00 ? 42  ASN A HA   4  
ATOM 6428  H HB2  . ASN A 1 42  ? -2.253  -9.921  6.233   1.00 0.00 ? 42  ASN A HB2  4  
ATOM 6429  H HB3  . ASN A 1 42  ? -3.543  -9.409  5.030   1.00 0.00 ? 42  ASN A HB3  4  
ATOM 6430  H HD21 . ASN A 1 42  ? -5.466  -9.195  6.009   1.00 0.00 ? 42  ASN A HD21 4  
ATOM 6431  H HD22 . ASN A 1 42  ? -5.906  -9.969  7.512   1.00 0.00 ? 42  ASN A HD22 4  
ATOM 6432  N N    . ASN A 1 43  ? -0.391  -11.504 4.540   1.00 0.00 ? 43  ASN A N    4  
ATOM 6433  C CA   . ASN A 1 43  ? 0.962   -11.310 4.020   1.00 0.00 ? 43  ASN A CA   4  
ATOM 6434  C C    . ASN A 1 43  ? 1.167   -12.020 2.675   1.00 0.00 ? 43  ASN A C    4  
ATOM 6435  O O    . ASN A 1 43  ? 1.901   -11.538 1.827   1.00 0.00 ? 43  ASN A O    4  
ATOM 6436  C CB   . ASN A 1 43  ? 2.008   -11.671 5.117   1.00 0.00 ? 43  ASN A CB   4  
ATOM 6437  C CG   . ASN A 1 43  ? 3.365   -10.971 4.961   1.00 0.00 ? 43  ASN A CG   4  
ATOM 6438  O OD1  . ASN A 1 43  ? 4.322   -11.526 4.425   1.00 0.00 ? 43  ASN A OD1  4  
ATOM 6439  N ND2  . ASN A 1 43  ? 3.492   -9.717  5.478   1.00 0.00 ? 43  ASN A ND2  4  
ATOM 6440  H H    . ASN A 1 43  ? -0.440  -12.083 5.353   1.00 0.00 ? 43  ASN A H    4  
ATOM 6441  H HA   . ASN A 1 43  ? 1.063   -10.258 3.788   1.00 0.00 ? 43  ASN A HA   4  
ATOM 6442  H HB2  . ASN A 1 43  ? 1.594   -11.364 6.103   1.00 0.00 ? 43  ASN A HB2  4  
ATOM 6443  H HB3  . ASN A 1 43  ? 2.188   -12.767 5.156   1.00 0.00 ? 43  ASN A HB3  4  
ATOM 6444  H HD21 . ASN A 1 43  ? 2.740   -9.136  5.776   1.00 0.00 ? 43  ASN A HD21 4  
ATOM 6445  H HD22 . ASN A 1 43  ? 4.410   -9.338  5.502   1.00 0.00 ? 43  ASN A HD22 4  
ATOM 6446  N N    . ILE A 1 44  ? 0.421   -13.132 2.404   1.00 0.00 ? 44  ILE A N    4  
ATOM 6447  C CA   . ILE A 1 44  ? 0.338   -13.822 1.107   1.00 0.00 ? 44  ILE A CA   4  
ATOM 6448  C C    . ILE A 1 44  ? -0.545  -13.027 0.141   1.00 0.00 ? 44  ILE A C    4  
ATOM 6449  O O    . ILE A 1 44  ? -0.219  -12.855 -1.031  1.00 0.00 ? 44  ILE A O    4  
ATOM 6450  C CB   . ILE A 1 44  ? -0.180  -15.263 1.236   1.00 0.00 ? 44  ILE A CB   4  
ATOM 6451  C CG1  . ILE A 1 44  ? 0.653   -15.988 2.329   1.00 0.00 ? 44  ILE A CG1  4  
ATOM 6452  C CG2  . ILE A 1 44  ? -0.182  -15.976 -0.147  1.00 0.00 ? 44  ILE A CG2  4  
ATOM 6453  C CD1  . ILE A 1 44  ? 0.686   -17.513 2.210   1.00 0.00 ? 44  ILE A CD1  4  
ATOM 6454  H H    . ILE A 1 44  ? -0.203  -13.487 3.103   1.00 0.00 ? 44  ILE A H    4  
ATOM 6455  H HA   . ILE A 1 44  ? 1.327   -13.876 0.672   1.00 0.00 ? 44  ILE A HA   4  
ATOM 6456  H HB   . ILE A 1 44  ? -1.238  -15.263 1.596   1.00 0.00 ? 44  ILE A HB   4  
ATOM 6457  H HG12 . ILE A 1 44  ? 1.698   -15.611 2.354   1.00 0.00 ? 44  ILE A HG12 4  
ATOM 6458  H HG13 . ILE A 1 44  ? 0.214   -15.715 3.311   1.00 0.00 ? 44  ILE A HG13 4  
ATOM 6459  H HG21 . ILE A 1 44  ? 0.805   -15.859 -0.642  1.00 0.00 ? 44  ILE A HG21 4  
ATOM 6460  H HG22 . ILE A 1 44  ? -0.428  -17.054 -0.055  1.00 0.00 ? 44  ILE A HG22 4  
ATOM 6461  H HG23 . ILE A 1 44  ? -0.967  -15.559 -0.815  1.00 0.00 ? 44  ILE A HG23 4  
ATOM 6462  H HD11 . ILE A 1 44  ? -0.344  -17.915 2.101   1.00 0.00 ? 44  ILE A HD11 4  
ATOM 6463  H HD12 . ILE A 1 44  ? 1.283   -17.820 1.324   1.00 0.00 ? 44  ILE A HD12 4  
ATOM 6464  H HD13 . ILE A 1 44  ? 1.150   -17.948 3.120   1.00 0.00 ? 44  ILE A HD13 4  
ATOM 6465  N N    . VAL A 1 45  ? -1.693  -12.488 0.660   1.00 0.00 ? 45  VAL A N    4  
ATOM 6466  C CA   . VAL A 1 45  ? -2.662  -11.677 -0.103  1.00 0.00 ? 45  VAL A CA   4  
ATOM 6467  C C    . VAL A 1 45  ? -2.143  -10.251 -0.419  1.00 0.00 ? 45  VAL A C    4  
ATOM 6468  O O    . VAL A 1 45  ? -2.340  -9.770  -1.528  1.00 0.00 ? 45  VAL A O    4  
ATOM 6469  C CB   . VAL A 1 45  ? -4.081  -11.701 0.493   1.00 0.00 ? 45  VAL A CB   4  
ATOM 6470  C CG1  . VAL A 1 45  ? -5.124  -11.057 -0.457  1.00 0.00 ? 45  VAL A CG1  4  
ATOM 6471  C CG2  . VAL A 1 45  ? -4.522  -13.156 0.768   1.00 0.00 ? 45  VAL A CG2  4  
ATOM 6472  H H    . VAL A 1 45  ? -1.898  -12.659 1.629   1.00 0.00 ? 45  VAL A H    4  
ATOM 6473  H HA   . VAL A 1 45  ? -2.792  -12.156 -1.067  1.00 0.00 ? 45  VAL A HA   4  
ATOM 6474  H HB   . VAL A 1 45  ? -4.089  -11.169 1.467   1.00 0.00 ? 45  VAL A HB   4  
ATOM 6475  H HG11 . VAL A 1 45  ? -5.112  -11.558 -1.449  1.00 0.00 ? 45  VAL A HG11 4  
ATOM 6476  H HG12 . VAL A 1 45  ? -6.142  -11.167 -0.027  1.00 0.00 ? 45  VAL A HG12 4  
ATOM 6477  H HG13 . VAL A 1 45  ? -4.940  -9.977  -0.615  1.00 0.00 ? 45  VAL A HG13 4  
ATOM 6478  H HG21 . VAL A 1 45  ? -4.409  -13.783 -0.140  1.00 0.00 ? 45  VAL A HG21 4  
ATOM 6479  H HG22 . VAL A 1 45  ? -3.937  -13.616 1.592   1.00 0.00 ? 45  VAL A HG22 4  
ATOM 6480  H HG23 . VAL A 1 45  ? -5.592  -13.179 1.064   1.00 0.00 ? 45  VAL A HG23 4  
ATOM 6481  N N    . TYR A 1 46  ? -1.406  -9.563  0.531   1.00 0.00 ? 46  TYR A N    4  
ATOM 6482  C CA   . TYR A 1 46  ? -0.747  -8.230  0.431   1.00 0.00 ? 46  TYR A CA   4  
ATOM 6483  C C    . TYR A 1 46  ? 0.286   -8.221  -0.677  1.00 0.00 ? 46  TYR A C    4  
ATOM 6484  O O    . TYR A 1 46  ? 0.194   -7.410  -1.583  1.00 0.00 ? 46  TYR A O    4  
ATOM 6485  C CB   . TYR A 1 46  ? -0.063  -7.764  1.786   1.00 0.00 ? 46  TYR A CB   4  
ATOM 6486  C CG   . TYR A 1 46  ? -0.117  -6.277  2.169   1.00 0.00 ? 46  TYR A CG   4  
ATOM 6487  C CD1  . TYR A 1 46  ? -0.100  -5.150  1.338   1.00 0.00 ? 46  TYR A CD1  4  
ATOM 6488  C CD2  . TYR A 1 46  ? -0.233  -6.023  3.528   1.00 0.00 ? 46  TYR A CD2  4  
ATOM 6489  C CE1  . TYR A 1 46  ? -0.368  -3.891  1.845   1.00 0.00 ? 46  TYR A CE1  4  
ATOM 6490  C CE2  . TYR A 1 46  ? -0.711  -4.821  3.990   1.00 0.00 ? 46  TYR A CE2  4  
ATOM 6491  C CZ   . TYR A 1 46  ? -0.776  -3.735  3.151   1.00 0.00 ? 46  TYR A CZ   4  
ATOM 6492  O OH   . TYR A 1 46  ? -1.257  -2.494  3.617   1.00 0.00 ? 46  TYR A OH   4  
ATOM 6493  H H    . TYR A 1 46  ? -1.283  -9.991  1.442   1.00 0.00 ? 46  TYR A H    4  
ATOM 6494  H HA   . TYR A 1 46  ? -1.508  -7.521  0.138   1.00 0.00 ? 46  TYR A HA   4  
ATOM 6495  H HB2  . TYR A 1 46  ? -0.664  -8.264  2.597   1.00 0.00 ? 46  TYR A HB2  4  
ATOM 6496  H HB3  . TYR A 1 46  ? 1.001   -8.106  1.872   1.00 0.00 ? 46  TYR A HB3  4  
ATOM 6497  H HD1  . TYR A 1 46  ? 0.084   -5.166  0.275   1.00 0.00 ? 46  TYR A HD1  4  
ATOM 6498  H HD2  . TYR A 1 46  ? -0.053  -6.793  4.263   1.00 0.00 ? 46  TYR A HD2  4  
ATOM 6499  H HE1  . TYR A 1 46  ? -0.318  -3.039  1.181   1.00 0.00 ? 46  TYR A HE1  4  
ATOM 6500  H HE2  . TYR A 1 46  ? -1.063  -4.778  5.019   1.00 0.00 ? 46  TYR A HE2  4  
ATOM 6501  H HH   . TYR A 1 46  ? -1.834  -2.163  2.920   1.00 0.00 ? 46  TYR A HH   4  
ATOM 6502  N N    . ASN A 1 47  ? 1.208   -9.225  -0.667  1.00 0.00 ? 47  ASN A N    4  
ATOM 6503  C CA   . ASN A 1 47  ? 2.252   -9.558  -1.645  1.00 0.00 ? 47  ASN A CA   4  
ATOM 6504  C C    . ASN A 1 47  ? 1.713   -9.949  -3.009  1.00 0.00 ? 47  ASN A C    4  
ATOM 6505  O O    . ASN A 1 47  ? 2.358   -9.769  -4.034  1.00 0.00 ? 47  ASN A O    4  
ATOM 6506  C CB   . ASN A 1 47  ? 3.203   -10.643 -1.084  1.00 0.00 ? 47  ASN A CB   4  
ATOM 6507  C CG   . ASN A 1 47  ? 4.097   -9.862  -0.136  1.00 0.00 ? 47  ASN A CG   4  
ATOM 6508  O OD1  . ASN A 1 47  ? 5.099   -9.296  -0.567  1.00 0.00 ? 47  ASN A OD1  4  
ATOM 6509  N ND2  . ASN A 1 47  ? 3.613   -9.671  1.110   1.00 0.00 ? 47  ASN A ND2  4  
ATOM 6510  H H    . ASN A 1 47  ? 1.183   -9.864  0.101   1.00 0.00 ? 47  ASN A H    4  
ATOM 6511  H HA   . ASN A 1 47  ? 2.807   -8.638  -1.852  1.00 0.00 ? 47  ASN A HA   4  
ATOM 6512  H HB2  . ASN A 1 47  ? 2.642   -11.434 -0.545  1.00 0.00 ? 47  ASN A HB2  4  
ATOM 6513  H HB3  . ASN A 1 47  ? 3.851   -11.103 -1.860  1.00 0.00 ? 47  ASN A HB3  4  
ATOM 6514  H HD21 . ASN A 1 47  ? 2.940   -10.347 1.470   1.00 0.00 ? 47  ASN A HD21 4  
ATOM 6515  H HD22 . ASN A 1 47  ? 3.645   -8.726  1.416   1.00 0.00 ? 47  ASN A HD22 4  
ATOM 6516  N N    . GLU A 1 48  ? 0.465   -10.474 -3.027  1.00 0.00 ? 48  GLU A N    4  
ATOM 6517  C CA   . GLU A 1 48  ? -0.305  -10.802 -4.248  1.00 0.00 ? 48  GLU A CA   4  
ATOM 6518  C C    . GLU A 1 48  ? -0.928  -9.551  -4.894  1.00 0.00 ? 48  GLU A C    4  
ATOM 6519  O O    . GLU A 1 48  ? -0.890  -9.345  -6.105  1.00 0.00 ? 48  GLU A O    4  
ATOM 6520  C CB   . GLU A 1 48  ? -1.408  -11.880 -4.033  1.00 0.00 ? 48  GLU A CB   4  
ATOM 6521  C CG   . GLU A 1 48  ? -2.021  -12.379 -5.360  1.00 0.00 ? 48  GLU A CG   4  
ATOM 6522  C CD   . GLU A 1 48  ? -2.632  -13.774 -5.248  1.00 0.00 ? 48  GLU A CD   4  
ATOM 6523  O OE1  . GLU A 1 48  ? -3.826  -13.932 -5.614  1.00 0.00 ? 48  GLU A OE1  4  
ATOM 6524  O OE2  . GLU A 1 48  ? -1.900  -14.709 -4.825  1.00 0.00 ? 48  GLU A OE2  4  
ATOM 6525  H H    . GLU A 1 48  ? 0.045   -10.534 -2.117  1.00 0.00 ? 48  GLU A H    4  
ATOM 6526  H HA   . GLU A 1 48  ? 0.380   -11.208 -4.979  1.00 0.00 ? 48  GLU A HA   4  
ATOM 6527  H HB2  . GLU A 1 48  ? -0.943  -12.739 -3.507  1.00 0.00 ? 48  GLU A HB2  4  
ATOM 6528  H HB3  . GLU A 1 48  ? -2.225  -11.499 -3.380  1.00 0.00 ? 48  GLU A HB3  4  
ATOM 6529  H HG2  . GLU A 1 48  ? -2.775  -11.651 -5.716  1.00 0.00 ? 48  GLU A HG2  4  
ATOM 6530  H HG3  . GLU A 1 48  ? -1.233  -12.416 -6.128  1.00 0.00 ? 48  GLU A HG3  4  
ATOM 6531  N N    . TYR A 1 49  ? -1.477  -8.667  -4.021  1.00 0.00 ? 49  TYR A N    4  
ATOM 6532  C CA   . TYR A 1 49  ? -2.107  -7.371  -4.250  1.00 0.00 ? 49  TYR A CA   4  
ATOM 6533  C C    . TYR A 1 49  ? -1.141  -6.320  -4.801  1.00 0.00 ? 49  TYR A C    4  
ATOM 6534  O O    . TYR A 1 49  ? -1.447  -5.643  -5.772  1.00 0.00 ? 49  TYR A O    4  
ATOM 6535  C CB   . TYR A 1 49  ? -2.958  -7.004  -2.968  1.00 0.00 ? 49  TYR A CB   4  
ATOM 6536  C CG   . TYR A 1 49  ? -3.040  -5.555  -2.567  1.00 0.00 ? 49  TYR A CG   4  
ATOM 6537  C CD1  . TYR A 1 49  ? -2.145  -5.108  -1.626  1.00 0.00 ? 49  TYR A CD1  4  
ATOM 6538  C CD2  . TYR A 1 49  ? -3.802  -4.626  -3.235  1.00 0.00 ? 49  TYR A CD2  4  
ATOM 6539  C CE1  . TYR A 1 49  ? -1.897  -3.774  -1.434  1.00 0.00 ? 49  TYR A CE1  4  
ATOM 6540  C CE2  . TYR A 1 49  ? -3.624  -3.286  -2.966  1.00 0.00 ? 49  TYR A CE2  4  
ATOM 6541  C CZ   . TYR A 1 49  ? -2.668  -2.846  -2.084  1.00 0.00 ? 49  TYR A CZ   4  
ATOM 6542  O OH   . TYR A 1 49  ? -2.452  -1.464  -1.940  1.00 0.00 ? 49  TYR A OH   4  
ATOM 6543  H H    . TYR A 1 49  ? -1.477  -8.926  -3.054  1.00 0.00 ? 49  TYR A H    4  
ATOM 6544  H HA   . TYR A 1 49  ? -2.835  -7.455  -5.027  1.00 0.00 ? 49  TYR A HA   4  
ATOM 6545  H HB2  . TYR A 1 49  ? -3.996  -7.397  -3.100  1.00 0.00 ? 49  TYR A HB2  4  
ATOM 6546  H HB3  . TYR A 1 49  ? -2.478  -7.524  -2.105  1.00 0.00 ? 49  TYR A HB3  4  
ATOM 6547  H HD1  . TYR A 1 49  ? -1.503  -5.817  -1.140  1.00 0.00 ? 49  TYR A HD1  4  
ATOM 6548  H HD2  . TYR A 1 49  ? -4.440  -4.929  -4.055  1.00 0.00 ? 49  TYR A HD2  4  
ATOM 6549  H HE1  . TYR A 1 49  ? -1.003  -3.512  -0.882  1.00 0.00 ? 49  TYR A HE1  4  
ATOM 6550  H HE2  . TYR A 1 49  ? -4.155  -2.566  -3.554  1.00 0.00 ? 49  TYR A HE2  4  
ATOM 6551  H HH   . TYR A 1 49  ? -1.730  -1.196  -2.541  1.00 0.00 ? 49  TYR A HH   4  
ATOM 6552  N N    . ILE A 1 50  ? 0.053   -6.154  -4.210  1.00 0.00 ? 50  ILE A N    4  
ATOM 6553  C CA   . ILE A 1 50  ? 1.018   -5.111  -4.582  1.00 0.00 ? 50  ILE A CA   4  
ATOM 6554  C C    . ILE A 1 50  ? 1.930   -5.258  -5.770  1.00 0.00 ? 50  ILE A C    4  
ATOM 6555  O O    . ILE A 1 50  ? 2.683   -4.335  -6.073  1.00 0.00 ? 50  ILE A O    4  
ATOM 6556  C CB   . ILE A 1 50  ? 1.883   -4.698  -3.441  1.00 0.00 ? 50  ILE A CB   4  
ATOM 6557  C CG1  . ILE A 1 50  ? 2.682   -5.877  -2.839  1.00 0.00 ? 50  ILE A CG1  4  
ATOM 6558  C CG2  . ILE A 1 50  ? 0.941   -4.104  -2.429  1.00 0.00 ? 50  ILE A CG2  4  
ATOM 6559  C CD1  . ILE A 1 50  ? 3.425   -5.642  -1.531  1.00 0.00 ? 50  ILE A CD1  4  
ATOM 6560  H H    . ILE A 1 50  ? 0.245   -6.734  -3.416  1.00 0.00 ? 50  ILE A H    4  
ATOM 6561  H HA   . ILE A 1 50  ? 0.446   -4.224  -4.827  1.00 0.00 ? 50  ILE A HA   4  
ATOM 6562  H HB   . ILE A 1 50  ? 2.518   -3.859  -3.775  1.00 0.00 ? 50  ILE A HB   4  
ATOM 6563  H HG12 . ILE A 1 50  ? 1.923   -6.602  -2.537  1.00 0.00 ? 50  ILE A HG12 4  
ATOM 6564  H HG13 . ILE A 1 50  ? 3.354   -6.356  -3.583  1.00 0.00 ? 50  ILE A HG13 4  
ATOM 6565  H HG21 . ILE A 1 50  ? 0.289   -3.317  -2.867  1.00 0.00 ? 50  ILE A HG21 4  
ATOM 6566  H HG22 . ILE A 1 50  ? 0.328   -4.914  -1.998  1.00 0.00 ? 50  ILE A HG22 4  
ATOM 6567  H HG23 . ILE A 1 50  ? 1.510   -3.684  -1.601  1.00 0.00 ? 50  ILE A HG23 4  
ATOM 6568  H HD11 . ILE A 1 50  ? 2.765   -5.162  -0.767  1.00 0.00 ? 50  ILE A HD11 4  
ATOM 6569  H HD12 . ILE A 1 50  ? 3.735   -6.629  -1.124  1.00 0.00 ? 50  ILE A HD12 4  
ATOM 6570  H HD13 . ILE A 1 50  ? 4.342   -5.043  -1.681  1.00 0.00 ? 50  ILE A HD13 4  
ATOM 6571  N N    . SER A 1 51  ? 1.875   -6.391  -6.494  1.00 0.00 ? 51  SER A N    4  
ATOM 6572  C CA   . SER A 1 51  ? 2.629   -6.610  -7.743  1.00 0.00 ? 51  SER A CA   4  
ATOM 6573  C C    . SER A 1 51  ? 1.958   -5.941  -8.975  1.00 0.00 ? 51  SER A C    4  
ATOM 6574  O O    . SER A 1 51  ? 2.454   -6.003  -10.097 1.00 0.00 ? 51  SER A O    4  
ATOM 6575  C CB   . SER A 1 51  ? 2.969   -8.097  -8.029  1.00 0.00 ? 51  SER A CB   4  
ATOM 6576  O OG   . SER A 1 51  ? 4.013   -8.205  -9.000  1.00 0.00 ? 51  SER A OG   4  
ATOM 6577  H H    . SER A 1 51  ? 1.314   -7.098  -6.075  1.00 0.00 ? 51  SER A H    4  
ATOM 6578  H HA   . SER A 1 51  ? 3.591   -6.129  -7.601  1.00 0.00 ? 51  SER A HA   4  
ATOM 6579  H HB2  . SER A 1 51  ? 3.332   -8.568  -7.087  1.00 0.00 ? 51  SER A HB2  4  
ATOM 6580  H HB3  . SER A 1 51  ? 2.070   -8.663  -8.360  1.00 0.00 ? 51  SER A HB3  4  
ATOM 6581  H HG   . SER A 1 51  ? 3.756   -7.604  -9.721  1.00 0.00 ? 51  SER A HG   4  
ATOM 6582  N N    . HIS A 1 52  ? 0.818   -5.259  -8.707  1.00 0.00 ? 52  HIS A N    4  
ATOM 6583  C CA   . HIS A 1 52  ? -0.015  -4.390  -9.520  1.00 0.00 ? 52  HIS A CA   4  
ATOM 6584  C C    . HIS A 1 52  ? 0.452   -2.934  -9.241  1.00 0.00 ? 52  HIS A C    4  
ATOM 6585  O O    . HIS A 1 52  ? 1.509   -2.724  -8.650  1.00 0.00 ? 52  HIS A O    4  
ATOM 6586  C CB   . HIS A 1 52  ? -1.479  -4.614  -9.036  1.00 0.00 ? 52  HIS A CB   4  
ATOM 6587  C CG   . HIS A 1 52  ? -2.086  -5.981  -9.306  1.00 0.00 ? 52  HIS A CG   4  
ATOM 6588  N ND1  . HIS A 1 52  ? -2.945  -6.263  -10.356 1.00 0.00 ? 52  HIS A ND1  4  
ATOM 6589  C CD2  . HIS A 1 52  ? -2.074  -7.111  -8.540  1.00 0.00 ? 52  HIS A CD2  4  
ATOM 6590  C CE1  . HIS A 1 52  ? -3.413  -7.523  -10.160 1.00 0.00 ? 52  HIS A CE1  4  
ATOM 6591  N NE2  . HIS A 1 52  ? -2.914  -8.075  -9.077  1.00 0.00 ? 52  HIS A NE2  4  
ATOM 6592  H H    . HIS A 1 52  ? 0.531   -5.312  -7.756  1.00 0.00 ? 52  HIS A H    4  
ATOM 6593  H HA   . HIS A 1 52  ? 0.106   -4.612  -10.572 1.00 0.00 ? 52  HIS A HA   4  
ATOM 6594  H HB2  . HIS A 1 52  ? -1.449  -4.518  -7.923  1.00 0.00 ? 52  HIS A HB2  4  
ATOM 6595  H HB3  . HIS A 1 52  ? -2.195  -3.851  -9.409  1.00 0.00 ? 52  HIS A HB3  4  
ATOM 6596  H HD1  . HIS A 1 52  ? -3.207  -5.637  -11.092 1.00 0.00 ? 52  HIS A HD1  4  
ATOM 6597  H HD2  . HIS A 1 52  ? -1.538  -7.330  -7.627  1.00 0.00 ? 52  HIS A HD2  4  
ATOM 6598  H HE1  . HIS A 1 52  ? -4.148  -8.022  -10.794 1.00 0.00 ? 52  HIS A HE1  4  
ATOM 6599  N N    . ARG A 1 53  ? -0.314  -1.858  -9.608  1.00 0.00 ? 53  ARG A N    4  
ATOM 6600  C CA   . ARG A 1 53  ? 0.031   -0.431  -9.399  1.00 0.00 ? 53  ARG A CA   4  
ATOM 6601  C C    . ARG A 1 53  ? 0.253   0.061   -7.963  1.00 0.00 ? 53  ARG A C    4  
ATOM 6602  O O    . ARG A 1 53  ? 1.094   0.904   -7.667  1.00 0.00 ? 53  ARG A O    4  
ATOM 6603  C CB   . ARG A 1 53  ? -0.987  0.531   -10.087 1.00 0.00 ? 53  ARG A CB   4  
ATOM 6604  C CG   . ARG A 1 53  ? -2.433  0.412   -9.560  1.00 0.00 ? 53  ARG A CG   4  
ATOM 6605  C CD   . ARG A 1 53  ? -2.905  1.403   -8.462  1.00 0.00 ? 53  ARG A CD   4  
ATOM 6606  N NE   . ARG A 1 53  ? -2.975  2.783   -9.058  1.00 0.00 ? 53  ARG A NE   4  
ATOM 6607  C CZ   . ARG A 1 53  ? -3.099  3.922   -8.309  1.00 0.00 ? 53  ARG A CZ   4  
ATOM 6608  N NH1  . ARG A 1 53  ? -3.144  3.867   -6.945  1.00 0.00 ? 53  ARG A NH1  4  
ATOM 6609  N NH2  . ARG A 1 53  ? -3.180  5.132   -8.936  1.00 0.00 ? 53  ARG A NH2  4  
ATOM 6610  H H    . ARG A 1 53  ? -1.172  -1.991  -10.093 1.00 0.00 ? 53  ARG A H    4  
ATOM 6611  H HA   . ARG A 1 53  ? 0.923   -0.251  -9.936  1.00 0.00 ? 53  ARG A HA   4  
ATOM 6612  H HB2  . ARG A 1 53  ? -0.647  1.589   -10.041 1.00 0.00 ? 53  ARG A HB2  4  
ATOM 6613  H HB3  . ARG A 1 53  ? -0.997  0.253   -11.167 1.00 0.00 ? 53  ARG A HB3  4  
ATOM 6614  H HG2  . ARG A 1 53  ? -3.123  0.477   -10.426 1.00 0.00 ? 53  ARG A HG2  4  
ATOM 6615  H HG3  . ARG A 1 53  ? -2.477  -0.619  -9.167  1.00 0.00 ? 53  ARG A HG3  4  
ATOM 6616  H HD2  . ARG A 1 53  ? -3.915  1.115   -8.098  1.00 0.00 ? 53  ARG A HD2  4  
ATOM 6617  H HD3  . ARG A 1 53  ? -2.243  1.413   -7.566  1.00 0.00 ? 53  ARG A HD3  4  
ATOM 6618  H HE   . ARG A 1 53  ? -2.946  2.867   -10.053 1.00 0.00 ? 53  ARG A HE   4  
ATOM 6619  H HH11 . ARG A 1 53  ? -3.084  2.984   -6.479  1.00 0.00 ? 53  ARG A HH11 4  
ATOM 6620  H HH12 . ARG A 1 53  ? -3.234  4.709   -6.414  1.00 0.00 ? 53  ARG A HH12 4  
ATOM 6621  H HH21 . ARG A 1 53  ? -3.150  5.179   -9.935  1.00 0.00 ? 53  ARG A HH21 4  
ATOM 6622  H HH22 . ARG A 1 53  ? -3.272  5.970   -8.397  1.00 0.00 ? 53  ARG A HH22 4  
ATOM 6623  N N    . GLU A 1 54  ? -0.621  -0.474  -7.096  1.00 0.00 ? 54  GLU A N    4  
ATOM 6624  C CA   . GLU A 1 54  ? -0.986  -0.244  -5.719  1.00 0.00 ? 54  GLU A CA   4  
ATOM 6625  C C    . GLU A 1 54  ? -0.012  -0.461  -4.603  1.00 0.00 ? 54  GLU A C    4  
ATOM 6626  O O    . GLU A 1 54  ? -0.458  -0.499  -3.455  1.00 0.00 ? 54  GLU A O    4  
ATOM 6627  C CB   . GLU A 1 54  ? -2.248  -1.089  -5.481  1.00 0.00 ? 54  GLU A CB   4  
ATOM 6628  C CG   . GLU A 1 54  ? -2.000  -2.580  -5.787  1.00 0.00 ? 54  GLU A CG   4  
ATOM 6629  C CD   . GLU A 1 54  ? -3.178  -3.105  -6.612  1.00 0.00 ? 54  GLU A CD   4  
ATOM 6630  O OE1  . GLU A 1 54  ? -3.748  -4.169  -6.261  1.00 0.00 ? 54  GLU A OE1  4  
ATOM 6631  O OE2  . GLU A 1 54  ? -3.518  -2.452  -7.635  1.00 0.00 ? 54  GLU A OE2  4  
ATOM 6632  H H    . GLU A 1 54  ? -1.223  -1.145  -7.511  1.00 0.00 ? 54  GLU A H    4  
ATOM 6633  H HA   . GLU A 1 54  ? -1.269  0.797   -5.640  1.00 0.00 ? 54  GLU A HA   4  
ATOM 6634  H HB2  . GLU A 1 54  ? -2.676  -0.963  -4.466  1.00 0.00 ? 54  GLU A HB2  4  
ATOM 6635  H HB3  . GLU A 1 54  ? -3.015  -0.656  -6.162  1.00 0.00 ? 54  GLU A HB3  4  
ATOM 6636  H HG2  . GLU A 1 54  ? -1.048  -2.749  -6.337  1.00 0.00 ? 54  GLU A HG2  4  
ATOM 6637  H HG3  . GLU A 1 54  ? -1.831  -3.141  -4.843  1.00 0.00 ? 54  GLU A HG3  4  
ATOM 6638  N N    . HIS A 1 55  ? 1.309   -0.651  -4.900  1.00 0.00 ? 55  HIS A N    4  
ATOM 6639  C CA   . HIS A 1 55  ? 2.410   -0.867  -3.949  1.00 0.00 ? 55  HIS A CA   4  
ATOM 6640  C C    . HIS A 1 55  ? 2.481   0.064   -2.732  1.00 0.00 ? 55  HIS A C    4  
ATOM 6641  O O    . HIS A 1 55  ? 2.935   1.206   -2.761  1.00 0.00 ? 55  HIS A O    4  
ATOM 6642  C CB   . HIS A 1 55  ? 3.815   -1.053  -4.584  1.00 0.00 ? 55  HIS A CB   4  
ATOM 6643  C CG   . HIS A 1 55  ? 4.820   -1.577  -3.574  1.00 0.00 ? 55  HIS A CG   4  
ATOM 6644  N ND1  . HIS A 1 55  ? 5.861   -0.842  -3.040  1.00 0.00 ? 55  HIS A ND1  4  
ATOM 6645  C CD2  . HIS A 1 55  ? 4.764   -2.721  -2.839  1.00 0.00 ? 55  HIS A CD2  4  
ATOM 6646  C CE1  . HIS A 1 55  ? 6.388   -1.574  -2.027  1.00 0.00 ? 55  HIS A CE1  4  
ATOM 6647  N NE2  . HIS A 1 55  ? 5.749   -2.717  -1.855  1.00 0.00 ? 55  HIS A NE2  4  
ATOM 6648  H H    . HIS A 1 55  ? 1.562   -0.629  -5.869  1.00 0.00 ? 55  HIS A H    4  
ATOM 6649  H HA   . HIS A 1 55  ? 2.198   -1.840  -3.539  1.00 0.00 ? 55  HIS A HA   4  
ATOM 6650  H HB2  . HIS A 1 55  ? 3.729   -1.827  -5.386  1.00 0.00 ? 55  HIS A HB2  4  
ATOM 6651  H HB3  . HIS A 1 55  ? 4.167   -0.089  -5.029  1.00 0.00 ? 55  HIS A HB3  4  
ATOM 6652  H HD1  . HIS A 1 55  ? 6.091   0.099   -3.293  1.00 0.00 ? 55  HIS A HD1  4  
ATOM 6653  H HD2  . HIS A 1 55  ? 4.026   -3.518  -2.935  1.00 0.00 ? 55  HIS A HD2  4  
ATOM 6654  H HE1  . HIS A 1 55  ? 7.231   -1.239  -1.425  1.00 0.00 ? 55  HIS A HE1  4  
ATOM 6655  N N    . ILE A 1 56  ? 1.949   -0.532  -1.649  1.00 0.00 ? 56  ILE A N    4  
ATOM 6656  C CA   . ILE A 1 56  ? 1.751   -0.124  -0.289  1.00 0.00 ? 56  ILE A CA   4  
ATOM 6657  C C    . ILE A 1 56  ? 2.323   -1.318  0.425   1.00 0.00 ? 56  ILE A C    4  
ATOM 6658  O O    . ILE A 1 56  ? 2.328   -2.415  -0.112  1.00 0.00 ? 56  ILE A O    4  
ATOM 6659  C CB   . ILE A 1 56  ? 0.268   -0.008  0.014   1.00 0.00 ? 56  ILE A CB   4  
ATOM 6660  C CG1  . ILE A 1 56  ? -0.211  1.274   -0.682  1.00 0.00 ? 56  ILE A CG1  4  
ATOM 6661  C CG2  . ILE A 1 56  ? -0.126  0.004   1.524   1.00 0.00 ? 56  ILE A CG2  4  
ATOM 6662  C CD1  . ILE A 1 56  ? -1.680  1.443   -0.391  1.00 0.00 ? 56  ILE A CD1  4  
ATOM 6663  H H    . ILE A 1 56  ? 1.631   -1.472  -1.763  1.00 0.00 ? 56  ILE A H    4  
ATOM 6664  H HA   . ILE A 1 56  ? 2.206   0.817   -0.041  1.00 0.00 ? 56  ILE A HA   4  
ATOM 6665  H HB   . ILE A 1 56  ? -0.277  -0.865  -0.456  1.00 0.00 ? 56  ILE A HB   4  
ATOM 6666  H HG12 . ILE A 1 56  ? 0.362   2.159   -0.331  1.00 0.00 ? 56  ILE A HG12 4  
ATOM 6667  H HG13 . ILE A 1 56  ? -0.079  1.194   -1.783  1.00 0.00 ? 56  ILE A HG13 4  
ATOM 6668  H HG21 . ILE A 1 56  ? 0.229   -0.885  2.077   1.00 0.00 ? 56  ILE A HG21 4  
ATOM 6669  H HG22 . ILE A 1 56  ? 0.271   0.917   2.006   1.00 0.00 ? 56  ILE A HG22 4  
ATOM 6670  H HG23 . ILE A 1 56  ? -1.229  0.001   1.642   1.00 0.00 ? 56  ILE A HG23 4  
ATOM 6671  H HD11 . ILE A 1 56  ? -2.114  0.412   -0.403  1.00 0.00 ? 56  ILE A HD11 4  
ATOM 6672  H HD12 . ILE A 1 56  ? -1.756  1.881   0.630   1.00 0.00 ? 56  ILE A HD12 4  
ATOM 6673  H HD13 . ILE A 1 56  ? -2.150  2.062   -1.185  1.00 0.00 ? 56  ILE A HD13 4  
ATOM 6674  N N    . HIS A 1 57  ? 2.749   -1.183  1.683   1.00 0.00 ? 57  HIS A N    4  
ATOM 6675  C CA   . HIS A 1 57  ? 3.032   -2.322  2.525   1.00 0.00 ? 57  HIS A CA   4  
ATOM 6676  C C    . HIS A 1 57  ? 2.353   -1.951  3.827   1.00 0.00 ? 57  HIS A C    4  
ATOM 6677  O O    . HIS A 1 57  ? 2.133   -0.767  4.085   1.00 0.00 ? 57  HIS A O    4  
ATOM 6678  C CB   . HIS A 1 57  ? 4.537   -2.668  2.607   1.00 0.00 ? 57  HIS A CB   4  
ATOM 6679  C CG   . HIS A 1 57  ? 4.754   -4.084  2.109   1.00 0.00 ? 57  HIS A CG   4  
ATOM 6680  N ND1  . HIS A 1 57  ? 5.344   -4.475  0.921   1.00 0.00 ? 57  HIS A ND1  4  
ATOM 6681  C CD2  . HIS A 1 57  ? 4.291   -5.232  2.679   1.00 0.00 ? 57  HIS A CD2  4  
ATOM 6682  C CE1  . HIS A 1 57  ? 5.232   -5.832  0.857   1.00 0.00 ? 57  HIS A CE1  4  
ATOM 6683  N NE2  . HIS A 1 57  ? 4.580   -6.329  1.892   1.00 0.00 ? 57  HIS A NE2  4  
ATOM 6684  H H    . HIS A 1 57  ? 2.725   -0.309  2.158   1.00 0.00 ? 57  HIS A H    4  
ATOM 6685  H HA   . HIS A 1 57  ? 2.507   -3.201  2.160   1.00 0.00 ? 57  HIS A HA   4  
ATOM 6686  H HB2  . HIS A 1 57  ? 5.084   -1.906  2.011   1.00 0.00 ? 57  HIS A HB2  4  
ATOM 6687  H HB3  . HIS A 1 57  ? 4.941   -2.609  3.635   1.00 0.00 ? 57  HIS A HB3  4  
ATOM 6688  H HD1  . HIS A 1 57  ? 5.631   -3.873  0.163   1.00 0.00 ? 57  HIS A HD1  4  
ATOM 6689  H HD2  . HIS A 1 57  ? 3.722   -5.349  3.591   1.00 0.00 ? 57  HIS A HD2  4  
ATOM 6690  H HE1  . HIS A 1 57  ? 5.606   -6.427  0.021   1.00 0.00 ? 57  HIS A HE1  4  
ATOM 6691  N N    . MET A 1 58  ? 1.997   -2.951  4.685   1.00 0.00 ? 58  MET A N    4  
ATOM 6692  C CA   . MET A 1 58  ? 1.199   -2.899  5.936   1.00 0.00 ? 58  MET A CA   4  
ATOM 6693  C C    . MET A 1 58  ? 1.567   -1.904  7.018   1.00 0.00 ? 58  MET A C    4  
ATOM 6694  O O    . MET A 1 58  ? 0.835   -1.610  7.957   1.00 0.00 ? 58  MET A O    4  
ATOM 6695  C CB   . MET A 1 58  ? 1.066   -4.329  6.540   1.00 0.00 ? 58  MET A CB   4  
ATOM 6696  C CG   . MET A 1 58  ? 1.991   -4.816  7.678   1.00 0.00 ? 58  MET A CG   4  
ATOM 6697  S SD   . MET A 1 58  ? 1.601   -4.306  9.384   1.00 0.00 ? 58  MET A SD   4  
ATOM 6698  C CE   . MET A 1 58  ? -0.213  -4.407  9.304   1.00 0.00 ? 58  MET A CE   4  
ATOM 6699  H H    . MET A 1 58  ? 2.197   -3.875  4.390   1.00 0.00 ? 58  MET A H    4  
ATOM 6700  H HA   . MET A 1 58  ? 0.208   -2.603  5.627   1.00 0.00 ? 58  MET A HA   4  
ATOM 6701  H HB2  . MET A 1 58  ? 0.008   -4.473  6.832   1.00 0.00 ? 58  MET A HB2  4  
ATOM 6702  H HB3  . MET A 1 58  ? 1.235   -5.048  5.709   1.00 0.00 ? 58  MET A HB3  4  
ATOM 6703  H HG2  . MET A 1 58  ? 1.887   -5.916  7.651   1.00 0.00 ? 58  MET A HG2  4  
ATOM 6704  H HG3  . MET A 1 58  ? 3.051   -4.583  7.448   1.00 0.00 ? 58  MET A HG3  4  
ATOM 6705  H HE1  . MET A 1 58  ? -0.548  -5.343  8.810   1.00 0.00 ? 58  MET A HE1  4  
ATOM 6706  H HE2  . MET A 1 58  ? -0.653  -4.405  10.321  1.00 0.00 ? 58  MET A HE2  4  
ATOM 6707  H HE3  . MET A 1 58  ? -0.653  -3.547  8.751   1.00 0.00 ? 58  MET A HE3  4  
ATOM 6708  N N    . ASN A 1 59  ? 2.761   -1.358  6.825   1.00 0.00 ? 59  ASN A N    4  
ATOM 6709  C CA   . ASN A 1 59  ? 3.564   -0.424  7.546   1.00 0.00 ? 59  ASN A CA   4  
ATOM 6710  C C    . ASN A 1 59  ? 3.072   1.019   7.235   1.00 0.00 ? 59  ASN A C    4  
ATOM 6711  O O    . ASN A 1 59  ? 3.143   1.902   8.082   1.00 0.00 ? 59  ASN A O    4  
ATOM 6712  C CB   . ASN A 1 59  ? 5.023   -0.842  7.140   1.00 0.00 ? 59  ASN A CB   4  
ATOM 6713  C CG   . ASN A 1 59  ? 5.158   -2.389  7.293   1.00 0.00 ? 59  ASN A CG   4  
ATOM 6714  O OD1  . ASN A 1 59  ? 5.237   -2.906  8.405   1.00 0.00 ? 59  ASN A OD1  4  
ATOM 6715  N ND2  . ASN A 1 59  ? 5.054   -3.165  6.168   1.00 0.00 ? 59  ASN A ND2  4  
ATOM 6716  H H    . ASN A 1 59  ? 3.220   -1.689  6.005   1.00 0.00 ? 59  ASN A H    4  
ATOM 6717  H HA   . ASN A 1 59  ? 3.421   -0.587  8.614   1.00 0.00 ? 59  ASN A HA   4  
ATOM 6718  H HB2  . ASN A 1 59  ? 5.219   -0.565  6.087   1.00 0.00 ? 59  ASN A HB2  4  
ATOM 6719  H HB3  . ASN A 1 59  ? 5.762   -0.352  7.803   1.00 0.00 ? 59  ASN A HB3  4  
ATOM 6720  H HD21 . ASN A 1 59  ? 5.391   -2.820  5.296   1.00 0.00 ? 59  ASN A HD21 4  
ATOM 6721  H HD22 . ASN A 1 59  ? 4.575   -4.064  6.232   1.00 0.00 ? 59  ASN A HD22 4  
ATOM 6722  N N    . ALA A 1 60  ? 2.428   1.244   6.033   1.00 0.00 ? 60  ALA A N    4  
ATOM 6723  C CA   . ALA A 1 60  ? 1.683   2.459   5.623   1.00 0.00 ? 60  ALA A CA   4  
ATOM 6724  C C    . ALA A 1 60  ? 0.231   2.433   6.110   1.00 0.00 ? 60  ALA A C    4  
ATOM 6725  O O    . ALA A 1 60  ? -0.709  2.572   5.335   1.00 0.00 ? 60  ALA A O    4  
ATOM 6726  C CB   . ALA A 1 60  ? 1.634   2.599   4.076   1.00 0.00 ? 60  ALA A CB   4  
ATOM 6727  H H    . ALA A 1 60  ? 2.378   0.494   5.348   1.00 0.00 ? 60  ALA A H    4  
ATOM 6728  H HA   . ALA A 1 60  ? 2.113   3.350   6.047   1.00 0.00 ? 60  ALA A HA   4  
ATOM 6729  H HB1  . ALA A 1 60  ? 2.660   2.706   3.669   1.00 0.00 ? 60  ALA A HB1  4  
ATOM 6730  H HB2  . ALA A 1 60  ? 1.147   1.717   3.607   1.00 0.00 ? 60  ALA A HB2  4  
ATOM 6731  H HB3  . ALA A 1 60  ? 1.028   3.480   3.758   1.00 0.00 ? 60  ALA A HB3  4  
ATOM 6732  N N    . THR A 1 61  ? 0.014   2.178   7.422   1.00 0.00 ? 61  THR A N    4  
ATOM 6733  C CA   . THR A 1 61  ? -1.309  1.988   8.023   1.00 0.00 ? 61  THR A CA   4  
ATOM 6734  C C    . THR A 1 61  ? -1.313  2.553   9.456   1.00 0.00 ? 61  THR A C    4  
ATOM 6735  O O    . THR A 1 61  ? -0.352  3.177   9.901   1.00 0.00 ? 61  THR A O    4  
ATOM 6736  C CB   . THR A 1 61  ? -1.779  0.494   8.006   1.00 0.00 ? 61  THR A CB   4  
ATOM 6737  O OG1  . THR A 1 61  ? -1.148  -0.340  8.985   1.00 0.00 ? 61  THR A OG1  4  
ATOM 6738  C CG2  . THR A 1 61  ? -1.590  -0.205  6.639   1.00 0.00 ? 61  THR A CG2  4  
ATOM 6739  H H    . THR A 1 61  ? 0.792   2.060   8.040   1.00 0.00 ? 61  THR A H    4  
ATOM 6740  H HA   . THR A 1 61  ? -2.040  2.570   7.478   1.00 0.00 ? 61  THR A HA   4  
ATOM 6741  H HB   . THR A 1 61  ? -2.876  0.481   8.215   1.00 0.00 ? 61  THR A HB   4  
ATOM 6742  H HG1  . THR A 1 61  ? -0.373  -0.802  8.579   1.00 0.00 ? 61  THR A HG1  4  
ATOM 6743  H HG21 . THR A 1 61  ? -0.535  -0.177  6.309   1.00 0.00 ? 61  THR A HG21 4  
ATOM 6744  H HG22 . THR A 1 61  ? -1.838  -1.285  6.691   1.00 0.00 ? 61  THR A HG22 4  
ATOM 6745  H HG23 . THR A 1 61  ? -2.214  0.276   5.858   1.00 0.00 ? 61  THR A HG23 4  
ATOM 6746  N N    . GLN A 1 62  ? -2.397  2.269   10.246  1.00 0.00 ? 62  GLN A N    4  
ATOM 6747  C CA   . GLN A 1 62  ? -2.517  2.567   11.682  1.00 0.00 ? 62  GLN A CA   4  
ATOM 6748  C C    . GLN A 1 62  ? -2.175  1.328   12.531  1.00 0.00 ? 62  GLN A C    4  
ATOM 6749  O O    . GLN A 1 62  ? -2.297  1.317   13.759  1.00 0.00 ? 62  GLN A O    4  
ATOM 6750  C CB   . GLN A 1 62  ? -3.967  3.023   12.050  1.00 0.00 ? 62  GLN A CB   4  
ATOM 6751  C CG   . GLN A 1 62  ? -5.032  1.897   11.999  1.00 0.00 ? 62  GLN A CG   4  
ATOM 6752  C CD   . GLN A 1 62  ? -6.453  2.369   12.307  1.00 0.00 ? 62  GLN A CD   4  
ATOM 6753  O OE1  . GLN A 1 62  ? -6.725  3.469   12.792  1.00 0.00 ? 62  GLN A OE1  4  
ATOM 6754  N NE2  . GLN A 1 62  ? -7.417  1.440   12.069  1.00 0.00 ? 62  GLN A NE2  4  
ATOM 6755  H H    . GLN A 1 62  ? -3.175  1.777   9.863   1.00 0.00 ? 62  GLN A H    4  
ATOM 6756  H HA   . GLN A 1 62  ? -1.829  3.355   11.959  1.00 0.00 ? 62  GLN A HA   4  
ATOM 6757  H HB2  . GLN A 1 62  ? -3.958  3.465   13.073  1.00 0.00 ? 62  GLN A HB2  4  
ATOM 6758  H HB3  . GLN A 1 62  ? -4.262  3.834   11.351  1.00 0.00 ? 62  GLN A HB3  4  
ATOM 6759  H HG2  . GLN A 1 62  ? -5.018  1.433   10.984  1.00 0.00 ? 62  GLN A HG2  4  
ATOM 6760  H HG3  . GLN A 1 62  ? -4.805  1.139   12.793  1.00 0.00 ? 62  GLN A HG3  4  
ATOM 6761  H HE21 . GLN A 1 62  ? -7.173  0.585   11.620  1.00 0.00 ? 62  GLN A HE21 4  
ATOM 6762  H HE22 . GLN A 1 62  ? -8.341  1.600   12.409  1.00 0.00 ? 62  GLN A HE22 4  
ATOM 6763  N N    . TRP A 1 63  ? -1.811  0.223   11.839  1.00 0.00 ? 63  TRP A N    4  
ATOM 6764  C CA   . TRP A 1 63  ? -1.561  -1.102  12.351  1.00 0.00 ? 63  TRP A CA   4  
ATOM 6765  C C    . TRP A 1 63  ? -0.035  -1.326  12.405  1.00 0.00 ? 63  TRP A C    4  
ATOM 6766  O O    . TRP A 1 63  ? 0.629   -1.417  11.376  1.00 0.00 ? 63  TRP A O    4  
ATOM 6767  C CB   . TRP A 1 63  ? -2.313  -2.142  11.424  1.00 0.00 ? 63  TRP A CB   4  
ATOM 6768  C CG   . TRP A 1 63  ? -3.765  -1.804  10.949  1.00 0.00 ? 63  TRP A CG   4  
ATOM 6769  C CD1  . TRP A 1 63  ? -4.867  -1.547  11.725  1.00 0.00 ? 63  TRP A CD1  4  
ATOM 6770  C CD2  . TRP A 1 63  ? -4.274  -1.846  9.579   1.00 0.00 ? 63  TRP A CD2  4  
ATOM 6771  N NE1  . TRP A 1 63  ? -6.004  -1.414  10.934  1.00 0.00 ? 63  TRP A NE1  4  
ATOM 6772  C CE2  . TRP A 1 63  ? -5.640  -1.606  9.618   1.00 0.00 ? 63  TRP A CE2  4  
ATOM 6773  C CE3  . TRP A 1 63  ? -3.686  -2.111  8.372   1.00 0.00 ? 63  TRP A CE3  4  
ATOM 6774  C CZ2  . TRP A 1 63  ? -6.395  -1.626  8.471   1.00 0.00 ? 63  TRP A CZ2  4  
ATOM 6775  C CZ3  . TRP A 1 63  ? -4.448  -2.037  7.203   1.00 0.00 ? 63  TRP A CZ3  4  
ATOM 6776  C CH2  . TRP A 1 63  ? -5.811  -1.785  7.230   1.00 0.00 ? 63  TRP A CH2  4  
ATOM 6777  H H    . TRP A 1 63  ? -1.714  0.253   10.838  1.00 0.00 ? 63  TRP A H    4  
ATOM 6778  H HA   . TRP A 1 63  ? -1.951  -1.181  13.358  1.00 0.00 ? 63  TRP A HA   4  
ATOM 6779  H HB2  . TRP A 1 63  ? -1.703  -2.277  10.496  1.00 0.00 ? 63  TRP A HB2  4  
ATOM 6780  H HB3  . TRP A 1 63  ? -2.372  -3.109  11.995  1.00 0.00 ? 63  TRP A HB3  4  
ATOM 6781  H HD1  . TRP A 1 63  ? -4.850  -1.525  12.804  1.00 0.00 ? 63  TRP A HD1  4  
ATOM 6782  H HE1  . TRP A 1 63  ? -6.932  -1.420  11.248  1.00 0.00 ? 63  TRP A HE1  4  
ATOM 6783  H HE3  . TRP A 1 63  ? -2.639  -2.360  8.315   1.00 0.00 ? 63  TRP A HE3  4  
ATOM 6784  H HZ2  . TRP A 1 63  ? -7.450  -1.475  8.518   1.00 0.00 ? 63  TRP A HZ2  4  
ATOM 6785  H HZ3  . TRP A 1 63  ? -3.950  -2.187  6.256   1.00 0.00 ? 63  TRP A HZ3  4  
ATOM 6786  H HH2  . TRP A 1 63  ? -6.438  -1.728  6.314   1.00 0.00 ? 63  TRP A HH2  4  
ATOM 6787  N N    . GLU A 1 64  ? 0.572   -1.399  13.628  1.00 0.00 ? 64  GLU A N    4  
ATOM 6788  C CA   . GLU A 1 64  ? 2.017   -1.516  13.882  1.00 0.00 ? 64  GLU A CA   4  
ATOM 6789  C C    . GLU A 1 64  ? 2.635   -2.887  13.576  1.00 0.00 ? 64  GLU A C    4  
ATOM 6790  O O    . GLU A 1 64  ? 3.847   -3.080  13.522  1.00 0.00 ? 64  GLU A O    4  
ATOM 6791  C CB   . GLU A 1 64  ? 2.240   -1.088  15.365  1.00 0.00 ? 64  GLU A CB   4  
ATOM 6792  C CG   . GLU A 1 64  ? 3.667   -1.238  15.928  1.00 0.00 ? 64  GLU A CG   4  
ATOM 6793  C CD   . GLU A 1 64  ? 3.788   -0.513  17.267  1.00 0.00 ? 64  GLU A CD   4  
ATOM 6794  O OE1  . GLU A 1 64  ? 4.010   -1.201  18.299  1.00 0.00 ? 64  GLU A OE1  4  
ATOM 6795  O OE2  . GLU A 1 64  ? 3.663   0.741   17.276  1.00 0.00 ? 64  GLU A OE2  4  
ATOM 6796  H H    . GLU A 1 64  ? 0.012   -1.283  14.444  1.00 0.00 ? 64  GLU A H    4  
ATOM 6797  H HA   . GLU A 1 64  ? 2.547   -0.821  13.235  1.00 0.00 ? 64  GLU A HA   4  
ATOM 6798  H HB2  . GLU A 1 64  ? 1.939   -0.016  15.430  1.00 0.00 ? 64  GLU A HB2  4  
ATOM 6799  H HB3  . GLU A 1 64  ? 1.553   -1.667  16.021  1.00 0.00 ? 64  GLU A HB3  4  
ATOM 6800  H HG2  . GLU A 1 64  ? 3.891   -2.316  16.068  1.00 0.00 ? 64  GLU A HG2  4  
ATOM 6801  H HG3  . GLU A 1 64  ? 4.399   -0.832  15.208  1.00 0.00 ? 64  GLU A HG3  4  
ATOM 6802  N N    . THR A 1 65  ? 1.774   -3.891  13.363  1.00 0.00 ? 65  THR A N    4  
ATOM 6803  C CA   . THR A 1 65  ? 2.120   -5.263  13.065  1.00 0.00 ? 65  THR A CA   4  
ATOM 6804  C C    . THR A 1 65  ? 0.834   -5.788  12.453  1.00 0.00 ? 65  THR A C    4  
ATOM 6805  O O    . THR A 1 65  ? -0.232  -5.207  12.666  1.00 0.00 ? 65  THR A O    4  
ATOM 6806  C CB   . THR A 1 65  ? 2.666   -6.038  14.281  1.00 0.00 ? 65  THR A CB   4  
ATOM 6807  O OG1  . THR A 1 65  ? 2.709   -7.445  14.083  1.00 0.00 ? 65  THR A OG1  4  
ATOM 6808  C CG2  . THR A 1 65  ? 1.887   -5.740  15.577  1.00 0.00 ? 65  THR A CG2  4  
ATOM 6809  H H    . THR A 1 65  ? 0.788   -3.726  13.380  1.00 0.00 ? 65  THR A H    4  
ATOM 6810  H HA   . THR A 1 65  ? 2.859   -5.276  12.275  1.00 0.00 ? 65  THR A HA   4  
ATOM 6811  H HB   . THR A 1 65  ? 3.718   -5.690  14.439  1.00 0.00 ? 65  THR A HB   4  
ATOM 6812  H HG1  . THR A 1 65  ? 2.697   -7.832  14.964  1.00 0.00 ? 65  THR A HG1  4  
ATOM 6813  H HG21 . THR A 1 65  ? 0.813   -6.005  15.471  1.00 0.00 ? 65  THR A HG21 4  
ATOM 6814  H HG22 . THR A 1 65  ? 2.315   -6.307  16.430  1.00 0.00 ? 65  THR A HG22 4  
ATOM 6815  H HG23 . THR A 1 65  ? 1.968   -4.658  15.829  1.00 0.00 ? 65  THR A HG23 4  
ATOM 6816  N N    . LEU A 1 66  ? 0.907   -6.892  11.646  1.00 0.00 ? 66  LEU A N    4  
ATOM 6817  C CA   . LEU A 1 66  ? -0.121  -7.551  10.830  1.00 0.00 ? 66  LEU A CA   4  
ATOM 6818  C C    . LEU A 1 66  ? -1.370  -7.993  11.578  1.00 0.00 ? 66  LEU A C    4  
ATOM 6819  O O    . LEU A 1 66  ? -2.485  -7.955  11.058  1.00 0.00 ? 66  LEU A O    4  
ATOM 6820  C CB   . LEU A 1 66  ? 0.554   -8.703  10.050  1.00 0.00 ? 66  LEU A CB   4  
ATOM 6821  C CG   . LEU A 1 66  ? -0.072  -9.194  8.717   1.00 0.00 ? 66  LEU A CG   4  
ATOM 6822  C CD1  . LEU A 1 66  ? -1.544  -9.632  8.773   1.00 0.00 ? 66  LEU A CD1  4  
ATOM 6823  C CD2  . LEU A 1 66  ? 0.165   -8.216  7.555   1.00 0.00 ? 66  LEU A CD2  4  
ATOM 6824  H H    . LEU A 1 66  ? 1.798   -7.338  11.560  1.00 0.00 ? 66  LEU A H    4  
ATOM 6825  H HA   . LEU A 1 66  ? -0.452  -6.838  10.103  1.00 0.00 ? 66  LEU A HA   4  
ATOM 6826  H HB2  . LEU A 1 66  ? 1.585   -8.353  9.787   1.00 0.00 ? 66  LEU A HB2  4  
ATOM 6827  H HB3  . LEU A 1 66  ? 0.669   -9.565  10.735  1.00 0.00 ? 66  LEU A HB3  4  
ATOM 6828  H HG   . LEU A 1 66  ? 0.521   -10.095 8.437   1.00 0.00 ? 66  LEU A HG   4  
ATOM 6829  H HD11 . LEU A 1 66  ? -1.864  -10.125 9.727   1.00 0.00 ? 66  LEU A HD11 4  
ATOM 6830  H HD12 . LEU A 1 66  ? -2.208  -8.753  8.573   1.00 0.00 ? 66  LEU A HD12 4  
ATOM 6831  H HD13 . LEU A 1 66  ? -1.705  -10.376 7.978   1.00 0.00 ? 66  LEU A HD13 4  
ATOM 6832  H HD21 . LEU A 1 66  ? -0.265  -7.223  7.790   1.00 0.00 ? 66  LEU A HD21 4  
ATOM 6833  H HD22 . LEU A 1 66  ? 1.256   -8.085  7.385   1.00 0.00 ? 66  LEU A HD22 4  
ATOM 6834  H HD23 . LEU A 1 66  ? -0.288  -8.597  6.614   1.00 0.00 ? 66  LEU A HD23 4  
ATOM 6835  N N    . THR A 1 67  ? -1.176  -8.337  12.866  1.00 0.00 ? 67  THR A N    4  
ATOM 6836  C CA   . THR A 1 67  ? -2.111  -8.709  13.924  1.00 0.00 ? 67  THR A CA   4  
ATOM 6837  C C    . THR A 1 67  ? -3.163  -7.643  14.244  1.00 0.00 ? 67  THR A C    4  
ATOM 6838  O O    . THR A 1 67  ? -4.334  -7.949  14.418  1.00 0.00 ? 67  THR A O    4  
ATOM 6839  C CB   . THR A 1 67  ? -1.266  -9.057  15.147  1.00 0.00 ? 67  THR A CB   4  
ATOM 6840  O OG1  . THR A 1 67  ? -0.397  -10.138 14.822  1.00 0.00 ? 67  THR A OG1  4  
ATOM 6841  C CG2  . THR A 1 67  ? -2.115  -9.435  16.363  1.00 0.00 ? 67  THR A CG2  4  
ATOM 6842  H H    . THR A 1 67  ? -0.231  -8.334  13.185  1.00 0.00 ? 67  THR A H    4  
ATOM 6843  H HA   . THR A 1 67  ? -2.683  -9.587  13.621  1.00 0.00 ? 67  THR A HA   4  
ATOM 6844  H HB   . THR A 1 67  ? -0.612  -8.194  15.418  1.00 0.00 ? 67  THR A HB   4  
ATOM 6845  H HG1  . THR A 1 67  ? -0.979  -10.907 14.683  1.00 0.00 ? 67  THR A HG1  4  
ATOM 6846  H HG21 . THR A 1 67  ? -3.072  -9.920  16.067  1.00 0.00 ? 67  THR A HG21 4  
ATOM 6847  H HG22 . THR A 1 67  ? -1.569  -10.096 17.067  1.00 0.00 ? 67  THR A HG22 4  
ATOM 6848  H HG23 . THR A 1 67  ? -2.383  -8.510  16.915  1.00 0.00 ? 67  THR A HG23 4  
ATOM 6849  N N    . ASP A 1 68  ? -2.793  -6.333  14.279  1.00 0.00 ? 68  ASP A N    4  
ATOM 6850  C CA   . ASP A 1 68  ? -3.683  -5.176  14.502  1.00 0.00 ? 68  ASP A CA   4  
ATOM 6851  C C    . ASP A 1 68  ? -4.602  -4.820  13.334  1.00 0.00 ? 68  ASP A C    4  
ATOM 6852  O O    . ASP A 1 68  ? -5.713  -4.321  13.506  1.00 0.00 ? 68  ASP A O    4  
ATOM 6853  C CB   . ASP A 1 68  ? -2.865  -3.914  14.919  1.00 0.00 ? 68  ASP A CB   4  
ATOM 6854  C CG   . ASP A 1 68  ? -3.639  -3.007  15.880  1.00 0.00 ? 68  ASP A CG   4  
ATOM 6855  O OD1  . ASP A 1 68  ? -3.877  -1.824  15.516  1.00 0.00 ? 68  ASP A OD1  4  
ATOM 6856  O OD2  . ASP A 1 68  ? -4.000  -3.487  16.988  1.00 0.00 ? 68  ASP A OD2  4  
ATOM 6857  H H    . ASP A 1 68  ? -1.844  -6.086  14.090  1.00 0.00 ? 68  ASP A H    4  
ATOM 6858  H HA   . ASP A 1 68  ? -4.375  -5.506  15.280  1.00 0.00 ? 68  ASP A HA   4  
ATOM 6859  H HB2  . ASP A 1 68  ? -1.929  -4.246  15.407  1.00 0.00 ? 68  ASP A HB2  4  
ATOM 6860  H HB3  . ASP A 1 68  ? -2.528  -3.329  14.041  1.00 0.00 ? 68  ASP A HB3  4  
ATOM 6861  N N    . PHE A 1 69  ? -4.147  -5.154  12.098  1.00 0.00 ? 69  PHE A N    4  
ATOM 6862  C CA   . PHE A 1 69  ? -4.849  -5.071  10.819  1.00 0.00 ? 69  PHE A CA   4  
ATOM 6863  C C    . PHE A 1 69  ? -5.908  -6.172  10.745  1.00 0.00 ? 69  PHE A C    4  
ATOM 6864  O O    . PHE A 1 69  ? -7.033  -5.989  10.274  1.00 0.00 ? 69  PHE A O    4  
ATOM 6865  C CB   . PHE A 1 69  ? -3.753  -5.172  9.709   1.00 0.00 ? 69  PHE A CB   4  
ATOM 6866  C CG   . PHE A 1 69  ? -4.173  -5.531  8.303   1.00 0.00 ? 69  PHE A CG   4  
ATOM 6867  C CD1  . PHE A 1 69  ? -3.324  -6.320  7.558   1.00 0.00 ? 69  PHE A CD1  4  
ATOM 6868  C CD2  . PHE A 1 69  ? -5.412  -5.210  7.778   1.00 0.00 ? 69  PHE A CD2  4  
ATOM 6869  C CE1  . PHE A 1 69  ? -3.744  -6.871  6.371   1.00 0.00 ? 69  PHE A CE1  4  
ATOM 6870  C CE2  . PHE A 1 69  ? -5.862  -5.830  6.641   1.00 0.00 ? 69  PHE A CE2  4  
ATOM 6871  C CZ   . PHE A 1 69  ? -5.037  -6.677  5.935   1.00 0.00 ? 69  PHE A CZ   4  
ATOM 6872  H H    . PHE A 1 69  ? -3.239  -5.566  12.032  1.00 0.00 ? 69  PHE A H    4  
ATOM 6873  H HA   . PHE A 1 69  ? -5.357  -4.130  10.722  1.00 0.00 ? 69  PHE A HA   4  
ATOM 6874  H HB2  . PHE A 1 69  ? -3.196  -4.220  9.663   1.00 0.00 ? 69  PHE A HB2  4  
ATOM 6875  H HB3  . PHE A 1 69  ? -3.024  -5.942  10.025  1.00 0.00 ? 69  PHE A HB3  4  
ATOM 6876  H HD1  . PHE A 1 69  ? -2.337  -6.551  7.933   1.00 0.00 ? 69  PHE A HD1  4  
ATOM 6877  H HD2  . PHE A 1 69  ? -6.095  -4.569  8.321   1.00 0.00 ? 69  PHE A HD2  4  
ATOM 6878  H HE1  . PHE A 1 69  ? -3.048  -7.468  5.806   1.00 0.00 ? 69  PHE A HE1  4  
ATOM 6879  H HE2  . PHE A 1 69  ? -6.876  -5.652  6.327   1.00 0.00 ? 69  PHE A HE2  4  
ATOM 6880  H HZ   . PHE A 1 69  ? -5.387  -7.113  5.009   1.00 0.00 ? 69  PHE A HZ   4  
ATOM 6881  N N    . THR A 1 70  ? -5.534  -7.347  11.285  1.00 0.00 ? 70  THR A N    4  
ATOM 6882  C CA   . THR A 1 70  ? -6.352  -8.536  11.412  1.00 0.00 ? 70  THR A CA   4  
ATOM 6883  C C    . THR A 1 70  ? -7.437  -8.403  12.476  1.00 0.00 ? 70  THR A C    4  
ATOM 6884  O O    . THR A 1 70  ? -8.557  -8.861  12.264  1.00 0.00 ? 70  THR A O    4  
ATOM 6885  C CB   . THR A 1 70  ? -5.532  -9.812  11.430  1.00 0.00 ? 70  THR A CB   4  
ATOM 6886  O OG1  . THR A 1 70  ? -4.222  -9.675  11.924  1.00 0.00 ? 70  THR A OG1  4  
ATOM 6887  C CG2  . THR A 1 70  ? -5.403  -10.319 9.995   1.00 0.00 ? 70  THR A CG2  4  
ATOM 6888  H H    . THR A 1 70  ? -4.631  -7.422  11.721  1.00 0.00 ? 70  THR A H    4  
ATOM 6889  H HA   . THR A 1 70  ? -6.948  -8.599  10.503  1.00 0.00 ? 70  THR A HA   4  
ATOM 6890  H HB   . THR A 1 70  ? -5.972  -10.545 12.111  1.00 0.00 ? 70  THR A HB   4  
ATOM 6891  H HG1  . THR A 1 70  ? -3.671  -9.205  11.270  1.00 0.00 ? 70  THR A HG1  4  
ATOM 6892  H HG21 . THR A 1 70  ? -4.895  -9.552  9.372   1.00 0.00 ? 70  THR A HG21 4  
ATOM 6893  H HG22 . THR A 1 70  ? -4.788  -11.246 9.957   1.00 0.00 ? 70  THR A HG22 4  
ATOM 6894  H HG23 . THR A 1 70  ? -6.404  -10.546 9.576   1.00 0.00 ? 70  THR A HG23 4  
ATOM 6895  N N    . LYS A 1 71  ? -7.133  -7.658  13.591  1.00 0.00 ? 71  LYS A N    4  
ATOM 6896  C CA   . LYS A 1 71  ? -8.088  -7.185  14.607  1.00 0.00 ? 71  LYS A CA   4  
ATOM 6897  C C    . LYS A 1 71  ? -9.157  -6.205  14.061  1.00 0.00 ? 71  LYS A C    4  
ATOM 6898  O O    . LYS A 1 71  ? -10.324 -6.291  14.425  1.00 0.00 ? 71  LYS A O    4  
ATOM 6899  C CB   . LYS A 1 71  ? -7.433  -6.420  15.800  1.00 0.00 ? 71  LYS A CB   4  
ATOM 6900  C CG   . LYS A 1 71  ? -6.408  -7.168  16.665  1.00 0.00 ? 71  LYS A CG   4  
ATOM 6901  C CD   . LYS A 1 71  ? -6.603  -8.683  16.799  1.00 0.00 ? 71  LYS A CD   4  
ATOM 6902  C CE   . LYS A 1 71  ? -5.837  -9.276  17.987  1.00 0.00 ? 71  LYS A CE   4  
ATOM 6903  N NZ   . LYS A 1 71  ? -4.482  -8.722  18.145  1.00 0.00 ? 71  LYS A NZ   4  
ATOM 6904  H H    . LYS A 1 71  ? -6.191  -7.345  13.750  1.00 0.00 ? 71  LYS A H    4  
ATOM 6905  H HA   . LYS A 1 71  ? -8.587  -8.058  15.002  1.00 0.00 ? 71  LYS A HA   4  
ATOM 6906  H HB2  . LYS A 1 71  ? -6.923  -5.495  15.432  1.00 0.00 ? 71  LYS A HB2  4  
ATOM 6907  H HB3  . LYS A 1 71  ? -8.226  -6.121  16.527  1.00 0.00 ? 71  LYS A HB3  4  
ATOM 6908  H HG2  . LYS A 1 71  ? -5.382  -6.985  16.287  1.00 0.00 ? 71  LYS A HG2  4  
ATOM 6909  H HG3  . LYS A 1 71  ? -6.443  -6.711  17.677  1.00 0.00 ? 71  LYS A HG3  4  
ATOM 6910  H HD2  . LYS A 1 71  ? -7.681  -8.922  16.934  1.00 0.00 ? 71  LYS A HD2  4  
ATOM 6911  H HD3  . LYS A 1 71  ? -6.252  -9.162  15.858  1.00 0.00 ? 71  LYS A HD3  4  
ATOM 6912  H HE2  . LYS A 1 71  ? -6.350  -8.980  18.905  1.00 0.00 ? 71  LYS A HE2  4  
ATOM 6913  H HE3  . LYS A 1 71  ? -5.770  -10.379 17.924  1.00 0.00 ? 71  LYS A HE3  4  
ATOM 6914  H HZ1  . LYS A 1 71  ? -4.540  -7.691  18.266  1.00 0.00 ? 71  LYS A HZ1  4  
ATOM 6915  H HZ2  . LYS A 1 71  ? -4.027  -9.144  18.979  1.00 0.00 ? 71  LYS A HZ2  4  
ATOM 6916  H HZ3  . LYS A 1 71  ? -3.920  -8.940  17.297  1.00 0.00 ? 71  LYS A HZ3  4  
ATOM 6917  N N    . TRP A 1 72  ? -8.742  -5.250  13.166  1.00 0.00 ? 72  TRP A N    4  
ATOM 6918  C CA   . TRP A 1 72  ? -9.579  -4.224  12.521  1.00 0.00 ? 72  TRP A CA   4  
ATOM 6919  C C    . TRP A 1 72  ? -10.427 -4.781  11.389  1.00 0.00 ? 72  TRP A C    4  
ATOM 6920  O O    . TRP A 1 72  ? -11.616 -4.527  11.337  1.00 0.00 ? 72  TRP A O    4  
ATOM 6921  C CB   . TRP A 1 72  ? -8.777  -2.976  12.005  1.00 0.00 ? 72  TRP A CB   4  
ATOM 6922  C CG   . TRP A 1 72  ? -9.564  -1.872  11.246  1.00 0.00 ? 72  TRP A CG   4  
ATOM 6923  C CD1  . TRP A 1 72  ? -10.251 -0.786  11.714  1.00 0.00 ? 72  TRP A CD1  4  
ATOM 6924  C CD2  . TRP A 1 72  ? -9.810  -1.916  9.823   1.00 0.00 ? 72  TRP A CD2  4  
ATOM 6925  N NE1  . TRP A 1 72  ? -10.870 -0.126  10.667  1.00 0.00 ? 72  TRP A NE1  4  
ATOM 6926  C CE2  . TRP A 1 72  ? -10.602 -0.815  9.495   1.00 0.00 ? 72  TRP A CE2  4  
ATOM 6927  C CE3  . TRP A 1 72  ? -9.422  -2.808  8.863   1.00 0.00 ? 72  TRP A CE3  4  
ATOM 6928  C CZ2  . TRP A 1 72  ? -10.970 -0.573  8.191   1.00 0.00 ? 72  TRP A CZ2  4  
ATOM 6929  C CZ3  . TRP A 1 72  ? -9.801  -2.574  7.566   1.00 0.00 ? 72  TRP A CZ3  4  
ATOM 6930  C CH2  . TRP A 1 72  ? -10.540 -1.463  7.216   1.00 0.00 ? 72  TRP A CH2  4  
ATOM 6931  H H    . TRP A 1 72  ? -7.769  -5.242  12.924  1.00 0.00 ? 72  TRP A H    4  
ATOM 6932  H HA   . TRP A 1 72  ? -10.280 -3.853  13.261  1.00 0.00 ? 72  TRP A HA   4  
ATOM 6933  H HB2  . TRP A 1 72  ? -8.288  -2.518  12.897  1.00 0.00 ? 72  TRP A HB2  4  
ATOM 6934  H HB3  . TRP A 1 72  ? -7.971  -3.348  11.331  1.00 0.00 ? 72  TRP A HB3  4  
ATOM 6935  H HD1  . TRP A 1 72  ? -10.328 -0.517  12.758  1.00 0.00 ? 72  TRP A HD1  4  
ATOM 6936  H HE1  . TRP A 1 72  ? -11.459 0.651   10.744  1.00 0.00 ? 72  TRP A HE1  4  
ATOM 6937  H HE3  . TRP A 1 72  ? -8.771  -3.645  9.062   1.00 0.00 ? 72  TRP A HE3  4  
ATOM 6938  H HZ2  . TRP A 1 72  ? -11.556 0.294   7.917   1.00 0.00 ? 72  TRP A HZ2  4  
ATOM 6939  H HZ3  . TRP A 1 72  ? -9.488  -3.282  6.815   1.00 0.00 ? 72  TRP A HZ3  4  
ATOM 6940  H HH2  . TRP A 1 72  ? -10.752 -1.304  6.161   1.00 0.00 ? 72  TRP A HH2  4  
ATOM 6941  N N    . LEU A 1 73  ? -9.862  -5.566  10.436  1.00 0.00 ? 73  LEU A N    4  
ATOM 6942  C CA   . LEU A 1 73  ? -10.555 -6.237  9.318   1.00 0.00 ? 73  LEU A CA   4  
ATOM 6943  C C    . LEU A 1 73  ? -11.538 -7.321  9.716   1.00 0.00 ? 73  LEU A C    4  
ATOM 6944  O O    . LEU A 1 73  ? -12.617 -7.486  9.145   1.00 0.00 ? 73  LEU A O    4  
ATOM 6945  C CB   . LEU A 1 73  ? -9.679  -6.429  8.070   1.00 0.00 ? 73  LEU A CB   4  
ATOM 6946  C CG   . LEU A 1 73  ? -9.551  -7.815  7.383   1.00 0.00 ? 73  LEU A CG   4  
ATOM 6947  C CD1  . LEU A 1 73  ? -9.379  -7.463  5.898   1.00 0.00 ? 73  LEU A CD1  4  
ATOM 6948  C CD2  . LEU A 1 73  ? -8.365  -8.671  7.823   1.00 0.00 ? 73  LEU A CD2  4  
ATOM 6949  H H    . LEU A 1 73  ? -8.878  -5.773  10.483  1.00 0.00 ? 73  LEU A H    4  
ATOM 6950  H HA   . LEU A 1 73  ? -11.235 -5.495  8.923   1.00 0.00 ? 73  LEU A HA   4  
ATOM 6951  H HB2  . LEU A 1 73  ? -10.197 -5.815  7.281   1.00 0.00 ? 73  LEU A HB2  4  
ATOM 6952  H HB3  . LEU A 1 73  ? -8.707  -5.884  8.290   1.00 0.00 ? 73  LEU A HB3  4  
ATOM 6953  H HG   . LEU A 1 73  ? -10.461 -8.497  7.497   1.00 0.00 ? 73  LEU A HG   4  
ATOM 6954  H HD11 . LEU A 1 73  ? -8.546  -6.736  5.778   1.00 0.00 ? 73  LEU A HD11 4  
ATOM 6955  H HD12 . LEU A 1 73  ? -9.163  -8.359  5.284   1.00 0.00 ? 73  LEU A HD12 4  
ATOM 6956  H HD13 . LEU A 1 73  ? -10.304 -6.965  5.533   1.00 0.00 ? 73  LEU A HD13 4  
ATOM 6957  H HD21 . LEU A 1 73  ? -7.423  -8.126  7.606   1.00 0.00 ? 73  LEU A HD21 4  
ATOM 6958  H HD22 . LEU A 1 73  ? -8.430  -8.910  8.903   1.00 0.00 ? 73  LEU A HD22 4  
ATOM 6959  H HD23 . LEU A 1 73  ? -8.379  -9.610  7.221   1.00 0.00 ? 73  LEU A HD23 4  
ATOM 6960  N N    . GLY A 1 74  ? -11.153 -8.016  10.829  1.00 0.00 ? 74  GLY A N    4  
ATOM 6961  C CA   . GLY A 1 74  ? -11.964 -8.878  11.683  1.00 0.00 ? 74  GLY A CA   4  
ATOM 6962  C C    . GLY A 1 74  ? -13.092 -8.182  12.410  1.00 0.00 ? 74  GLY A C    4  
ATOM 6963  O O    . GLY A 1 74  ? -14.121 -8.787  12.686  1.00 0.00 ? 74  GLY A O    4  
ATOM 6964  H H    . GLY A 1 74  ? -10.243 -7.831  11.209  1.00 0.00 ? 74  GLY A H    4  
ATOM 6965  H HA2  . GLY A 1 74  ? -12.431 -9.604  11.056  1.00 0.00 ? 74  GLY A HA2  4  
ATOM 6966  H HA3  . GLY A 1 74  ? -11.314 -9.310  12.431  1.00 0.00 ? 74  GLY A HA3  4  
ATOM 6967  N N    . ARG A 1 75  ? -12.930 -6.863  12.699  1.00 0.00 ? 75  ARG A N    4  
ATOM 6968  C CA   . ARG A 1 75  ? -13.915 -5.994  13.350  1.00 0.00 ? 75  ARG A CA   4  
ATOM 6969  C C    . ARG A 1 75  ? -15.038 -5.550  12.430  1.00 0.00 ? 75  ARG A C    4  
ATOM 6970  O O    . ARG A 1 75  ? -16.176 -5.393  12.859  1.00 0.00 ? 75  ARG A O    4  
ATOM 6971  C CB   . ARG A 1 75  ? -13.263 -4.680  13.857  1.00 0.00 ? 75  ARG A CB   4  
ATOM 6972  C CG   . ARG A 1 75  ? -13.999 -3.884  14.939  1.00 0.00 ? 75  ARG A CG   4  
ATOM 6973  C CD   . ARG A 1 75  ? -13.366 -2.491  15.066  1.00 0.00 ? 75  ARG A CD   4  
ATOM 6974  N NE   . ARG A 1 75  ? -13.965 -1.749  16.231  1.00 0.00 ? 75  ARG A NE   4  
ATOM 6975  C CZ   . ARG A 1 75  ? -13.474 -1.807  17.509  1.00 0.00 ? 75  ARG A CZ   4  
ATOM 6976  N NH1  . ARG A 1 75  ? -12.378 -2.560  17.811  1.00 0.00 ? 75  ARG A NH1  4  
ATOM 6977  N NH2  . ARG A 1 75  ? -14.095 -1.095  18.495  1.00 0.00 ? 75  ARG A NH2  4  
ATOM 6978  H H    . ARG A 1 75  ? -12.075 -6.401  12.433  1.00 0.00 ? 75  ARG A H    4  
ATOM 6979  H HA   . ARG A 1 75  ? -14.352 -6.519  14.190  1.00 0.00 ? 75  ARG A HA   4  
ATOM 6980  H HB2  . ARG A 1 75  ? -12.271 -4.930  14.257  1.00 0.00 ? 75  ARG A HB2  4  
ATOM 6981  H HB3  . ARG A 1 75  ? -13.057 -3.973  13.023  1.00 0.00 ? 75  ARG A HB3  4  
ATOM 6982  H HG2  . ARG A 1 75  ? -15.073 -3.761  14.673  1.00 0.00 ? 75  ARG A HG2  4  
ATOM 6983  H HG3  . ARG A 1 75  ? -13.941 -4.438  15.901  1.00 0.00 ? 75  ARG A HG3  4  
ATOM 6984  H HD2  . ARG A 1 75  ? -12.260 -2.565  15.150  1.00 0.00 ? 75  ARG A HD2  4  
ATOM 6985  H HD3  . ARG A 1 75  ? -13.590 -1.910  14.145  1.00 0.00 ? 75  ARG A HD3  4  
ATOM 6986  H HE   . ARG A 1 75  ? -14.770 -1.182  16.060  1.00 0.00 ? 75  ARG A HE   4  
ATOM 6987  H HH11 . ARG A 1 75  ? -11.918 -3.084  17.092  1.00 0.00 ? 75  ARG A HH11 4  
ATOM 6988  H HH12 . ARG A 1 75  ? -12.032 -2.589  18.749  1.00 0.00 ? 75  ARG A HH12 4  
ATOM 6989  H HH21 . ARG A 1 75  ? -14.899 -0.541  18.282  1.00 0.00 ? 75  ARG A HH21 4  
ATOM 6990  H HH22 . ARG A 1 75  ? -13.744 -1.130  19.432  1.00 0.00 ? 75  ARG A HH22 4  
ATOM 6991  N N    . GLU A 1 76  ? -14.717 -5.292  11.131  1.00 0.00 ? 76  GLU A N    4  
ATOM 6992  C CA   . GLU A 1 76  ? -15.633 -4.743  10.138  1.00 0.00 ? 76  GLU A CA   4  
ATOM 6993  C C    . GLU A 1 76  ? -16.723 -5.687  9.619   1.00 0.00 ? 76  GLU A C    4  
ATOM 6994  O O    . GLU A 1 76  ? -17.670 -5.258  8.963   1.00 0.00 ? 76  GLU A O    4  
ATOM 6995  C CB   . GLU A 1 76  ? -14.852 -4.198  8.910   1.00 0.00 ? 76  GLU A CB   4  
ATOM 6996  C CG   . GLU A 1 76  ? -13.844 -3.083  9.238   1.00 0.00 ? 76  GLU A CG   4  
ATOM 6997  C CD   . GLU A 1 76  ? -14.534 -1.858  9.831   1.00 0.00 ? 76  GLU A CD   4  
ATOM 6998  O OE1  . GLU A 1 76  ? -15.370 -1.242  9.116   1.00 0.00 ? 76  GLU A OE1  4  
ATOM 6999  O OE2  . GLU A 1 76  ? -14.232 -1.518  11.007  1.00 0.00 ? 76  GLU A OE2  4  
ATOM 7000  H H    . GLU A 1 76  ? -13.769 -5.398  10.830  1.00 0.00 ? 76  GLU A H    4  
ATOM 7001  H HA   . GLU A 1 76  ? -16.124 -3.911  10.627  1.00 0.00 ? 76  GLU A HA   4  
ATOM 7002  H HB2  . GLU A 1 76  ? -14.269 -5.033  8.462   1.00 0.00 ? 76  GLU A HB2  4  
ATOM 7003  H HB3  . GLU A 1 76  ? -15.545 -3.807  8.130   1.00 0.00 ? 76  GLU A HB3  4  
ATOM 7004  H HG2  . GLU A 1 76  ? -13.115 -3.488  9.963   1.00 0.00 ? 76  GLU A HG2  4  
ATOM 7005  H HG3  . GLU A 1 76  ? -13.296 -2.787  8.317   1.00 0.00 ? 76  GLU A HG3  4  
ATOM 7006  N N    . GLY A 1 77  ? -16.595 -7.010  9.894   1.00 0.00 ? 77  GLY A N    4  
ATOM 7007  C CA   . GLY A 1 77  ? -17.557 -8.038  9.498   1.00 0.00 ? 77  GLY A CA   4  
ATOM 7008  C C    . GLY A 1 77  ? -17.275 -8.649  8.153   1.00 0.00 ? 77  GLY A C    4  
ATOM 7009  O O    . GLY A 1 77  ? -18.135 -9.280  7.560   1.00 0.00 ? 77  GLY A O    4  
ATOM 7010  H H    . GLY A 1 77  ? -15.814 -7.321  10.439  1.00 0.00 ? 77  GLY A H    4  
ATOM 7011  H HA2  . GLY A 1 77  ? -17.483 -8.834  10.225  1.00 0.00 ? 77  GLY A HA2  4  
ATOM 7012  H HA3  . GLY A 1 77  ? -18.559 -7.620  9.455   1.00 0.00 ? 77  GLY A HA3  4  
ATOM 7013  N N    . LEU A 1 78  ? -16.033 -8.487  7.627   1.00 0.00 ? 78  LEU A N    4  
ATOM 7014  C CA   . LEU A 1 78  ? -15.592 -8.999  6.325   1.00 0.00 ? 78  LEU A CA   4  
ATOM 7015  C C    . LEU A 1 78  ? -14.685 -10.167 6.473   1.00 0.00 ? 78  LEU A C    4  
ATOM 7016  O O    . LEU A 1 78  ? -14.599 -10.933 5.530   1.00 0.00 ? 78  LEU A O    4  
ATOM 7017  C CB   . LEU A 1 78  ? -14.784 -8.026  5.414   1.00 0.00 ? 78  LEU A CB   4  
ATOM 7018  C CG   . LEU A 1 78  ? -15.235 -6.567  5.496   1.00 0.00 ? 78  LEU A CG   4  
ATOM 7019  C CD1  . LEU A 1 78  ? -13.994 -5.672  5.660   1.00 0.00 ? 78  LEU A CD1  4  
ATOM 7020  C CD2  . LEU A 1 78  ? -16.146 -6.236  4.297   1.00 0.00 ? 78  LEU A CD2  4  
ATOM 7021  H H    . LEU A 1 78  ? -15.376 -7.945  8.141   1.00 0.00 ? 78  LEU A H    4  
ATOM 7022  H HA   . LEU A 1 78  ? -16.443 -9.364  5.722   1.00 0.00 ? 78  LEU A HA   4  
ATOM 7023  H HB2  . LEU A 1 78  ? -13.656 -8.083  5.499   1.00 0.00 ? 78  LEU A HB2  4  
ATOM 7024  H HB3  . LEU A 1 78  ? -14.993 -8.367  4.371   1.00 0.00 ? 78  LEU A HB3  4  
ATOM 7025  H HG   . LEU A 1 78  ? -15.832 -6.392  6.417   1.00 0.00 ? 78  LEU A HG   4  
ATOM 7026  H HD11 . LEU A 1 78  ? -13.268 -5.869  4.850   1.00 0.00 ? 78  LEU A HD11 4  
ATOM 7027  H HD12 . LEU A 1 78  ? -14.278 -4.600  5.637   1.00 0.00 ? 78  LEU A HD12 4  
ATOM 7028  H HD13 . LEU A 1 78  ? -13.497 -5.904  6.626   1.00 0.00 ? 78  LEU A HD13 4  
ATOM 7029  H HD21 . LEU A 1 78  ? -16.466 -7.167  3.746   1.00 0.00 ? 78  LEU A HD21 4  
ATOM 7030  H HD22 . LEU A 1 78  ? -17.060 -5.715  4.652   1.00 0.00 ? 78  LEU A HD22 4  
ATOM 7031  H HD23 . LEU A 1 78  ? -15.619 -5.552  3.601   1.00 0.00 ? 78  LEU A HD23 4  
ATOM 7032  N N    . CYS A 1 79  ? -13.943 -10.374 7.582   1.00 0.00 ? 79  CYS A N    4  
ATOM 7033  C CA   . CYS A 1 79  ? -13.049 -11.532 7.675   1.00 0.00 ? 79  CYS A CA   4  
ATOM 7034  C C    . CYS A 1 79  ? -13.069 -12.158 9.064   1.00 0.00 ? 79  CYS A C    4  
ATOM 7035  O O    . CYS A 1 79  ? -13.062 -11.449 10.060  1.00 0.00 ? 79  CYS A O    4  
ATOM 7036  C CB   . CYS A 1 79  ? -11.580 -11.278 7.212   1.00 0.00 ? 79  CYS A CB   4  
ATOM 7037  S SG   . CYS A 1 79  ? -11.363 -10.124 5.827   1.00 0.00 ? 79  CYS A SG   4  
ATOM 7038  H H    . CYS A 1 79  ? -13.959 -9.752  8.354   1.00 0.00 ? 79  CYS A H    4  
ATOM 7039  H HA   . CYS A 1 79  ? -13.385 -12.290 7.013   1.00 0.00 ? 79  CYS A HA   4  
ATOM 7040  H HB2  . CYS A 1 79  ? -10.980 -11.015 8.113   1.00 0.00 ? 79  CYS A HB2  4  
ATOM 7041  H HB3  . CYS A 1 79  ? -11.178 -12.203 6.761   1.00 0.00 ? 79  CYS A HB3  4  
ATOM 7042  H HG   . CYS A 1 79  ? -11.832 -9.066  6.477   1.00 0.00 ? 79  CYS A HG   4  
ATOM 7043  N N    . LYS A 1 80  ? -13.048 -13.510 9.184   1.00 0.00 ? 80  LYS A N    4  
ATOM 7044  C CA   . LYS A 1 80  ? -12.928 -14.245 10.444  1.00 0.00 ? 80  LYS A CA   4  
ATOM 7045  C C    . LYS A 1 80  ? -11.480 -14.677 10.649  1.00 0.00 ? 80  LYS A C    4  
ATOM 7046  O O    . LYS A 1 80  ? -10.939 -15.472 9.897   1.00 0.00 ? 80  LYS A O    4  
ATOM 7047  C CB   . LYS A 1 80  ? -13.768 -15.559 10.510  1.00 0.00 ? 80  LYS A CB   4  
ATOM 7048  C CG   . LYS A 1 80  ? -15.253 -15.424 10.179  1.00 0.00 ? 80  LYS A CG   4  
ATOM 7049  C CD   . LYS A 1 80  ? -16.048 -16.680 10.582  1.00 0.00 ? 80  LYS A CD   4  
ATOM 7050  C CE   . LYS A 1 80  ? -17.540 -16.560 10.256  1.00 0.00 ? 80  LYS A CE   4  
ATOM 7051  N NZ   . LYS A 1 80  ? -18.282 -17.765 10.691  1.00 0.00 ? 80  LYS A NZ   4  
ATOM 7052  H H    . LYS A 1 80  ? -13.028 -14.097 8.357   1.00 0.00 ? 80  LYS A H    4  
ATOM 7053  H HA   . LYS A 1 80  ? -13.181 -13.570 11.245  1.00 0.00 ? 80  LYS A HA   4  
ATOM 7054  H HB2  . LYS A 1 80  ? -13.369 -16.312 9.790   1.00 0.00 ? 80  LYS A HB2  4  
ATOM 7055  H HB3  . LYS A 1 80  ? -13.695 -15.990 11.535  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 7056  H HG2  . LYS A 1 80  ? -15.674 -14.549 10.718  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 7057  H HG3  . LYS A 1 80  ? -15.358 -15.254 9.085   1.00 0.00 ? 80  LYS A HG3  4  
ATOM 7058  H HD2  . LYS A 1 80  ? -15.619 -17.565 10.062  1.00 0.00 ? 80  LYS A HD2  4  
ATOM 7059  H HD3  . LYS A 1 80  ? -15.934 -16.840 11.677  1.00 0.00 ? 80  LYS A HD3  4  
ATOM 7060  H HE2  . LYS A 1 80  ? -17.971 -15.682 10.782  1.00 0.00 ? 80  LYS A HE2  4  
ATOM 7061  H HE3  . LYS A 1 80  ? -17.687 -16.446 9.162   1.00 0.00 ? 80  LYS A HE3  4  
ATOM 7062  H HZ1  . LYS A 1 80  ? -18.167 -17.891 11.715  1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 7063  H HZ2  . LYS A 1 80  ? -19.291 -17.649 10.466  1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 7064  H HZ3  . LYS A 1 80  ? -17.908 -18.600 10.194  1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 7065  N N    . VAL A 1 81  ? -10.774 -14.181 11.676  1.00 0.00 ? 81  VAL A N    4  
ATOM 7066  C CA   . VAL A 1 81  ? -9.377  -14.455 11.902  1.00 0.00 ? 81  VAL A CA   4  
ATOM 7067  C C    . VAL A 1 81  ? -9.120  -15.521 12.951  1.00 0.00 ? 81  VAL A C    4  
ATOM 7068  O O    . VAL A 1 81  ? -9.849  -15.688 13.929  1.00 0.00 ? 81  VAL A O    4  
ATOM 7069  C CB   . VAL A 1 81  ? -8.673  -13.177 12.335  1.00 0.00 ? 81  VAL A CB   4  
ATOM 7070  C CG1  . VAL A 1 81  ? -8.073  -12.449 11.129  1.00 0.00 ? 81  VAL A CG1  4  
ATOM 7071  C CG2  . VAL A 1 81  ? -9.607  -12.232 13.117  1.00 0.00 ? 81  VAL A CG2  4  
ATOM 7072  H H    . VAL A 1 81  ? -11.130 -13.561 12.351  1.00 0.00 ? 81  VAL A H    4  
ATOM 7073  H HA   . VAL A 1 81  ? -8.885  -14.787 10.994  1.00 0.00 ? 81  VAL A HA   4  
ATOM 7074  H HB   . VAL A 1 81  ? -7.782  -13.415 12.947  1.00 0.00 ? 81  VAL A HB   4  
ATOM 7075  H HG11 . VAL A 1 81  ? -8.766  -12.442 10.261  1.00 0.00 ? 81  VAL A HG11 4  
ATOM 7076  H HG12 . VAL A 1 81  ? -7.841  -11.409 11.437  1.00 0.00 ? 81  VAL A HG12 4  
ATOM 7077  H HG13 . VAL A 1 81  ? -7.102  -12.933 10.876  1.00 0.00 ? 81  VAL A HG13 4  
ATOM 7078  H HG21 . VAL A 1 81  ? -10.105 -12.755 13.960  1.00 0.00 ? 81  VAL A HG21 4  
ATOM 7079  H HG22 . VAL A 1 81  ? -9.023  -11.389 13.541  1.00 0.00 ? 81  VAL A HG22 4  
ATOM 7080  H HG23 . VAL A 1 81  ? -10.362 -11.781 12.429  1.00 0.00 ? 81  VAL A HG23 4  
ATOM 7081  N N    . ASP A 1 82  ? -7.963  -16.200 12.752  1.00 0.00 ? 82  ASP A N    4  
ATOM 7082  C CA   . ASP A 1 82  ? -7.389  -17.188 13.678  1.00 0.00 ? 82  ASP A CA   4  
ATOM 7083  C C    . ASP A 1 82  ? -5.863  -17.171 13.608  1.00 0.00 ? 82  ASP A C    4  
ATOM 7084  O O    . ASP A 1 82  ? -5.283  -16.795 12.591  1.00 0.00 ? 82  ASP A O    4  
ATOM 7085  C CB   . ASP A 1 82  ? -7.862  -18.655 13.416  1.00 0.00 ? 82  ASP A CB   4  
ATOM 7086  C CG   . ASP A 1 82  ? -9.359  -18.825 13.697  1.00 0.00 ? 82  ASP A CG   4  
ATOM 7087  O OD1  . ASP A 1 82  ? -10.119 -19.095 12.730  1.00 0.00 ? 82  ASP A OD1  4  
ATOM 7088  O OD2  . ASP A 1 82  ? -9.754  -18.687 14.885  1.00 0.00 ? 82  ASP A OD2  4  
ATOM 7089  H H    . ASP A 1 82  ? -7.448  -15.969 11.898  1.00 0.00 ? 82  ASP A H    4  
ATOM 7090  H HA   . ASP A 1 82  ? -7.617  -16.854 14.684  1.00 0.00 ? 82  ASP A HA   4  
ATOM 7091  H HB2  . ASP A 1 82  ? -7.660  -18.931 12.358  1.00 0.00 ? 82  ASP A HB2  4  
ATOM 7092  H HB3  . ASP A 1 82  ? -7.323  -19.376 14.073  1.00 0.00 ? 82  ASP A HB3  4  
ATOM 7093  N N    . GLU A 1 83  ? -5.152  -17.584 14.701  1.00 0.00 ? 83  GLU A N    4  
ATOM 7094  C CA   . GLU A 1 83  ? -3.692  -17.572 14.787  1.00 0.00 ? 83  GLU A CA   4  
ATOM 7095  C C    . GLU A 1 83  ? -3.103  -18.969 15.012  1.00 0.00 ? 83  GLU A C    4  
ATOM 7096  O O    . GLU A 1 83  ? -3.623  -19.805 15.750  1.00 0.00 ? 83  GLU A O    4  
ATOM 7097  C CB   . GLU A 1 83  ? -3.148  -16.568 15.834  1.00 0.00 ? 83  GLU A CB   4  
ATOM 7098  C CG   . GLU A 1 83  ? -1.624  -16.333 15.710  1.00 0.00 ? 83  GLU A CG   4  
ATOM 7099  C CD   . GLU A 1 83  ? -1.128  -15.237 16.652  1.00 0.00 ? 83  GLU A CD   4  
ATOM 7100  O OE1  . GLU A 1 83  ? 0.087   -14.911 16.572  1.00 0.00 ? 83  GLU A OE1  4  
ATOM 7101  O OE2  . GLU A 1 83  ? -1.940  -14.712 17.461  1.00 0.00 ? 83  GLU A OE2  4  
ATOM 7102  H H    . GLU A 1 83  ? -5.614  -17.912 15.522  1.00 0.00 ? 83  GLU A H    4  
ATOM 7103  H HA   . GLU A 1 83  ? -3.290  -17.201 13.843  1.00 0.00 ? 83  GLU A HA   4  
ATOM 7104  H HB2  . GLU A 1 83  ? -3.655  -15.593 15.645  1.00 0.00 ? 83  GLU A HB2  4  
ATOM 7105  H HB3  . GLU A 1 83  ? -3.410  -16.895 16.865  1.00 0.00 ? 83  GLU A HB3  4  
ATOM 7106  H HG2  . GLU A 1 83  ? -1.080  -17.262 15.981  1.00 0.00 ? 83  GLU A HG2  4  
ATOM 7107  H HG3  . GLU A 1 83  ? -1.377  -16.091 14.643  1.00 0.00 ? 83  GLU A HG3  4  
ATOM 7108  N N    . THR A 1 84  ? -1.969  -19.193 14.307  1.00 0.00 ? 84  THR A N    4  
ATOM 7109  C CA   . THR A 1 84  ? -1.126  -20.376 14.213  1.00 0.00 ? 84  THR A CA   4  
ATOM 7110  C C    . THR A 1 84  ? 0.269   -20.070 14.686  1.00 0.00 ? 84  THR A C    4  
ATOM 7111  O O    . THR A 1 84  ? 0.590   -18.915 14.953  1.00 0.00 ? 84  THR A O    4  
ATOM 7112  C CB   . THR A 1 84  ? -0.958  -20.781 12.722  1.00 0.00 ? 84  THR A CB   4  
ATOM 7113  O OG1  . THR A 1 84  ? -0.289  -19.820 11.908  1.00 0.00 ? 84  THR A OG1  4  
ATOM 7114  C CG2  . THR A 1 84  ? -2.313  -21.018 12.046  1.00 0.00 ? 84  THR A CG2  4  
ATOM 7115  H H    . THR A 1 84  ? -1.629  -18.423 13.768  1.00 0.00 ? 84  THR A H    4  
ATOM 7116  H HA   . THR A 1 84  ? -1.466  -21.184 14.847  1.00 0.00 ? 84  THR A HA   4  
ATOM 7117  H HB   . THR A 1 84  ? -0.303  -21.676 12.679  1.00 0.00 ? 84  THR A HB   4  
ATOM 7118  H HG1  . THR A 1 84  ? -0.773  -18.977 11.978  1.00 0.00 ? 84  THR A HG1  4  
ATOM 7119  H HG21 . THR A 1 84  ? -2.913  -21.767 12.600  1.00 0.00 ? 84  THR A HG21 4  
ATOM 7120  H HG22 . THR A 1 84  ? -2.886  -20.066 11.977  1.00 0.00 ? 84  THR A HG22 4  
ATOM 7121  H HG23 . THR A 1 84  ? -2.151  -21.375 11.005  1.00 0.00 ? 84  THR A HG23 4  
ATOM 7122  N N    . PRO A 1 85  ? 1.175   -21.068 14.718  1.00 0.00 ? 85  PRO A N    4  
ATOM 7123  C CA   . PRO A 1 85  ? 2.587   -20.811 14.861  1.00 0.00 ? 85  PRO A CA   4  
ATOM 7124  C C    . PRO A 1 85  ? 3.335   -20.190 13.657  1.00 0.00 ? 85  PRO A C    4  
ATOM 7125  O O    . PRO A 1 85  ? 4.525   -19.917 13.811  1.00 0.00 ? 85  PRO A O    4  
ATOM 7126  C CB   . PRO A 1 85  ? 3.160   -22.190 15.231  1.00 0.00 ? 85  PRO A CB   4  
ATOM 7127  C CG   . PRO A 1 85  ? 1.975   -23.091 15.580  1.00 0.00 ? 85  PRO A CG   4  
ATOM 7128  C CD   . PRO A 1 85  ? 0.888   -22.508 14.701  1.00 0.00 ? 85  PRO A CD   4  
ATOM 7129  H HA   . PRO A 1 85  ? 2.675   -20.117 15.660  1.00 0.00 ? 85  PRO A HA   4  
ATOM 7130  H HB2  . PRO A 1 85  ? 3.769   -22.662 14.429  1.00 0.00 ? 85  PRO A HB2  4  
ATOM 7131  H HB3  . PRO A 1 85  ? 3.767   -22.018 16.118  1.00 0.00 ? 85  PRO A HB3  4  
ATOM 7132  H HG2  . PRO A 1 85  ? 2.177   -24.164 15.378  1.00 0.00 ? 85  PRO A HG2  4  
ATOM 7133  H HG3  . PRO A 1 85  ? 1.706   -22.965 16.654  1.00 0.00 ? 85  PRO A HG3  4  
ATOM 7134  H HD2  . PRO A 1 85  ? 1.021   -22.895 13.664  1.00 0.00 ? 85  PRO A HD2  4  
ATOM 7135  H HD3  . PRO A 1 85  ? -0.120  -22.777 15.094  1.00 0.00 ? 85  PRO A HD3  4  
ATOM 7136  N N    . LYS A 1 86  ? 2.700   -19.979 12.470  1.00 0.00 ? 86  LYS A N    4  
ATOM 7137  C CA   . LYS A 1 86  ? 3.369   -19.473 11.277  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7138  C C    . LYS A 1 86  ? 2.861   -18.110 10.799  1.00 0.00 ? 86  LYS A C    4  
ATOM 7139  O O    . LYS A 1 86  ? 3.388   -17.540 9.846   1.00 0.00 ? 86  LYS A O    4  
ATOM 7140  C CB   . LYS A 1 86  ? 3.265   -20.494 10.117  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7141  C CG   . LYS A 1 86  ? 3.803   -21.873 10.524  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7142  C CD   . LYS A 1 86  ? 4.059   -22.780 9.318   1.00 0.00 ? 86  LYS A CD   4  
ATOM 7143  C CE   . LYS A 1 86  ? 4.688   -24.128 9.704   1.00 0.00 ? 86  LYS A CE   4  
ATOM 7144  N NZ   . LYS A 1 86  ? 3.757   -24.937 10.528  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7145  H H    . LYS A 1 86  ? 1.732   -20.217 12.367  1.00 0.00 ? 86  LYS A H    4  
ATOM 7146  H HA   . LYS A 1 86  ? 4.429   -19.378 11.478  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7147  H HB2  . LYS A 1 86  ? 2.211   -20.603 9.779   1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7148  H HB3  . LYS A 1 86  ? 3.871   -20.133 9.253   1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7149  H HG2  . LYS A 1 86  ? 4.768   -21.734 11.064  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7150  H HG3  . LYS A 1 86  ? 3.092   -22.362 11.224  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7151  H HD2  . LYS A 1 86  ? 3.107   -22.940 8.764   1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7152  H HD3  . LYS A 1 86  ? 4.757   -22.235 8.640   1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7153  H HE2  . LYS A 1 86  ? 4.941   -24.724 8.803   1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7154  H HE3  . LYS A 1 86  ? 5.607   -23.960 10.304  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7155  H HZ1  . LYS A 1 86  ? 3.516   -24.411 11.391  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7156  H HZ2  . LYS A 1 86  ? 2.890   -25.125 9.983   1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7157  H HZ3  . LYS A 1 86  ? 4.211   -25.836 10.782  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7158  N N    . GLY A 1 87  ? 1.792   -17.562 11.424  1.00 0.00 ? 87  GLY A N    4  
ATOM 7159  C CA   . GLY A 1 87  ? 1.209   -16.294 11.018  1.00 0.00 ? 87  GLY A CA   4  
ATOM 7160  C C    . GLY A 1 87  ? -0.230  -16.158 11.413  1.00 0.00 ? 87  GLY A C    4  
ATOM 7161  O O    . GLY A 1 87  ? -0.806  -17.010 12.098  1.00 0.00 ? 87  GLY A O    4  
ATOM 7162  H H    . GLY A 1 87  ? 1.340   -18.021 12.189  1.00 0.00 ? 87  GLY A H    4  
ATOM 7163  H HA2  . GLY A 1 87  ? 1.765   -15.493 11.485  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 7164  H HA3  . GLY A 1 87  ? 1.191   -16.250 9.939   1.00 0.00 ? 87  GLY A HA3  4  
ATOM 7165  N N    . TRP A 1 88  ? -0.840  -15.062 10.908  1.00 0.00 ? 88  TRP A N    4  
ATOM 7166  C CA   . TRP A 1 88  ? -2.220  -14.649 11.085  1.00 0.00 ? 88  TRP A CA   4  
ATOM 7167  C C    . TRP A 1 88  ? -3.030  -14.981 9.830   1.00 0.00 ? 88  TRP A C    4  
ATOM 7168  O O    . TRP A 1 88  ? -2.860  -14.373 8.775   1.00 0.00 ? 88  TRP A O    4  
ATOM 7169  C CB   . TRP A 1 88  ? -2.196  -13.123 11.386  1.00 0.00 ? 88  TRP A CB   4  
ATOM 7170  C CG   . TRP A 1 88  ? -2.236  -12.848 12.873  1.00 0.00 ? 88  TRP A CG   4  
ATOM 7171  C CD1  . TRP A 1 88  ? -1.270  -12.882 13.828  1.00 0.00 ? 88  TRP A CD1  4  
ATOM 7172  C CD2  . TRP A 1 88  ? -3.466  -12.598 13.551  1.00 0.00 ? 88  TRP A CD2  4  
ATOM 7173  N NE1  . TRP A 1 88  ? -1.825  -12.602 15.065  1.00 0.00 ? 88  TRP A NE1  4  
ATOM 7174  C CE2  . TRP A 1 88  ? -3.186  -12.459 14.904  1.00 0.00 ? 88  TRP A CE2  4  
ATOM 7175  C CE3  . TRP A 1 88  ? -4.717  -12.477 13.064  1.00 0.00 ? 88  TRP A CE3  4  
ATOM 7176  C CZ2  . TRP A 1 88  ? -4.185  -12.205 15.802  1.00 0.00 ? 88  TRP A CZ2  4  
ATOM 7177  C CZ3  . TRP A 1 88  ? -5.708  -12.159 13.969  1.00 0.00 ? 88  TRP A CZ3  4  
ATOM 7178  C CH2  . TRP A 1 88  ? -5.456  -12.037 15.314  1.00 0.00 ? 88  TRP A CH2  4  
ATOM 7179  H H    . TRP A 1 88  ? -0.306  -14.437 10.336  1.00 0.00 ? 88  TRP A H    4  
ATOM 7180  H HA   . TRP A 1 88  ? -2.677  -15.198 11.909  1.00 0.00 ? 88  TRP A HA   4  
ATOM 7181  H HB2  . TRP A 1 88  ? -1.260  -12.686 10.971  1.00 0.00 ? 88  TRP A HB2  4  
ATOM 7182  H HB3  . TRP A 1 88  ? -3.052  -12.586 10.916  1.00 0.00 ? 88  TRP A HB3  4  
ATOM 7183  H HD1  . TRP A 1 88  ? -0.232  -13.085 13.618  1.00 0.00 ? 88  TRP A HD1  4  
ATOM 7184  H HE1  . TRP A 1 88  ? -1.345  -12.606 15.923  1.00 0.00 ? 88  TRP A HE1  4  
ATOM 7185  H HE3  . TRP A 1 88  ? -4.857  -12.466 11.983  1.00 0.00 ? 88  TRP A HE3  4  
ATOM 7186  H HZ2  . TRP A 1 88  ? -4.035  -12.049 16.852  1.00 0.00 ? 88  TRP A HZ2  4  
ATOM 7187  H HZ3  . TRP A 1 88  ? -6.702  -11.944 13.635  1.00 0.00 ? 88  TRP A HZ3  4  
ATOM 7188  H HH2  . TRP A 1 88  ? -6.265  -11.780 15.987  1.00 0.00 ? 88  TRP A HH2  4  
ATOM 7189  N N    . TYR A 1 89  ? -3.947  -15.982 9.942   1.00 0.00 ? 89  TYR A N    4  
ATOM 7190  C CA   . TYR A 1 89  ? -4.771  -16.517 8.864   1.00 0.00 ? 89  TYR A CA   4  
ATOM 7191  C C    . TYR A 1 89  ? -6.163  -15.976 9.056   1.00 0.00 ? 89  TYR A C    4  
ATOM 7192  O O    . TYR A 1 89  ? -6.716  -15.950 10.154  1.00 0.00 ? 89  TYR A O    4  
ATOM 7193  C CB   . TYR A 1 89  ? -4.805  -18.084 8.822   1.00 0.00 ? 89  TYR A CB   4  
ATOM 7194  C CG   . TYR A 1 89  ? -3.414  -18.564 8.511   1.00 0.00 ? 89  TYR A CG   4  
ATOM 7195  C CD1  . TYR A 1 89  ? -3.060  -18.911 7.221   1.00 0.00 ? 89  TYR A CD1  4  
ATOM 7196  C CD2  . TYR A 1 89  ? -2.434  -18.541 9.480   1.00 0.00 ? 89  TYR A CD2  4  
ATOM 7197  C CE1  . TYR A 1 89  ? -1.738  -19.139 6.883   1.00 0.00 ? 89  TYR A CE1  4  
ATOM 7198  C CE2  . TYR A 1 89  ? -1.113  -18.723 9.143   1.00 0.00 ? 89  TYR A CE2  4  
ATOM 7199  C CZ   . TYR A 1 89  ? -0.755  -19.025 7.852   1.00 0.00 ? 89  TYR A CZ   4  
ATOM 7200  O OH   . TYR A 1 89  ? 0.613   -19.202 7.555   1.00 0.00 ? 89  TYR A OH   4  
ATOM 7201  H H    . TYR A 1 89  ? -4.153  -16.419 10.825  1.00 0.00 ? 89  TYR A H    4  
ATOM 7202  H HA   . TYR A 1 89  ? -4.419  -16.145 7.895   1.00 0.00 ? 89  TYR A HA   4  
ATOM 7203  H HB2  . TYR A 1 89  ? -5.139  -18.524 9.788   1.00 0.00 ? 89  TYR A HB2  4  
ATOM 7204  H HB3  . TYR A 1 89  ? -5.476  -18.440 8.011   1.00 0.00 ? 89  TYR A HB3  4  
ATOM 7205  H HD1  . TYR A 1 89  ? -3.823  -18.956 6.458   1.00 0.00 ? 89  TYR A HD1  4  
ATOM 7206  H HD2  . TYR A 1 89  ? -2.691  -18.277 10.498  1.00 0.00 ? 89  TYR A HD2  4  
ATOM 7207  H HE1  . TYR A 1 89  ? -1.495  -19.367 5.853   1.00 0.00 ? 89  TYR A HE1  4  
ATOM 7208  H HE2  . TYR A 1 89  ? -0.374  -18.583 9.918   1.00 0.00 ? 89  TYR A HE2  4  
ATOM 7209  H HH   . TYR A 1 89  ? 1.096   -19.273 8.384   1.00 0.00 ? 89  TYR A HH   4  
ATOM 7210  N N    . ILE A 1 90  ? -6.728  -15.488 7.950   1.00 0.00 ? 90  ILE A N    4  
ATOM 7211  C CA   . ILE A 1 90  ? -7.993  -14.836 7.846   1.00 0.00 ? 90  ILE A CA   4  
ATOM 7212  C C    . ILE A 1 90  ? -8.801  -15.706 6.917   1.00 0.00 ? 90  ILE A C    4  
ATOM 7213  O O    . ILE A 1 90  ? -8.323  -16.119 5.862   1.00 0.00 ? 90  ILE A O    4  
ATOM 7214  C CB   . ILE A 1 90  ? -7.792  -13.392 7.292   1.00 0.00 ? 90  ILE A CB   4  
ATOM 7215  C CG1  . ILE A 1 90  ? -7.654  -13.226 5.742   1.00 0.00 ? 90  ILE A CG1  4  
ATOM 7216  C CG2  . ILE A 1 90  ? -6.516  -12.799 7.911   1.00 0.00 ? 90  ILE A CG2  4  
ATOM 7217  C CD1  . ILE A 1 90  ? -7.400  -11.807 5.225   1.00 0.00 ? 90  ILE A CD1  4  
ATOM 7218  H H    . ILE A 1 90  ? -6.243  -15.543 7.089   1.00 0.00 ? 90  ILE A H    4  
ATOM 7219  H HA   . ILE A 1 90  ? -8.495  -14.794 8.805   1.00 0.00 ? 90  ILE A HA   4  
ATOM 7220  H HB   . ILE A 1 90  ? -8.646  -12.786 7.682   1.00 0.00 ? 90  ILE A HB   4  
ATOM 7221  H HG12 . ILE A 1 90  ? -6.826  -13.875 5.376   1.00 0.00 ? 90  ILE A HG12 4  
ATOM 7222  H HG13 . ILE A 1 90  ? -8.576  -13.552 5.232   1.00 0.00 ? 90  ILE A HG13 4  
ATOM 7223  H HG21 . ILE A 1 90  ? -6.438  -12.998 8.993   1.00 0.00 ? 90  ILE A HG21 4  
ATOM 7224  H HG22 . ILE A 1 90  ? -5.598  -13.176 7.408   1.00 0.00 ? 90  ILE A HG22 4  
ATOM 7225  H HG23 . ILE A 1 90  ? -6.516  -11.706 7.764   1.00 0.00 ? 90  ILE A HG23 4  
ATOM 7226  H HD11 . ILE A 1 90  ? -8.007  -11.076 5.790   1.00 0.00 ? 90  ILE A HD11 4  
ATOM 7227  H HD12 . ILE A 1 90  ? -6.325  -11.562 5.315   1.00 0.00 ? 90  ILE A HD12 4  
ATOM 7228  H HD13 . ILE A 1 90  ? -7.674  -11.735 4.151   1.00 0.00 ? 90  ILE A HD13 4  
ATOM 7229  N N    . GLN A 1 91  ? -10.077 -15.976 7.227   1.00 0.00 ? 91  GLN A N    4  
ATOM 7230  C CA   . GLN A 1 91  ? -11.016 -16.598 6.329   1.00 0.00 ? 91  GLN A CA   4  
ATOM 7231  C C    . GLN A 1 91  ? -12.057 -15.537 6.161   1.00 0.00 ? 91  GLN A C    4  
ATOM 7232  O O    . GLN A 1 91  ? -12.624 -15.045 7.124   1.00 0.00 ? 91  GLN A O    4  
ATOM 7233  C CB   . GLN A 1 91  ? -11.525 -18.006 6.708   1.00 0.00 ? 91  GLN A CB   4  
ATOM 7234  C CG   . GLN A 1 91  ? -12.583 -18.020 7.813   1.00 0.00 ? 91  GLN A CG   4  
ATOM 7235  C CD   . GLN A 1 91  ? -13.186 -19.384 8.133   1.00 0.00 ? 91  GLN A CD   4  
ATOM 7236  O OE1  . GLN A 1 91  ? -13.930 -19.509 9.104   1.00 0.00 ? 91  GLN A OE1  4  
ATOM 7237  N NE2  . GLN A 1 91  ? -12.884 -20.415 7.310   1.00 0.00 ? 91  GLN A NE2  4  
ATOM 7238  H H    . GLN A 1 91  ? -10.475 -15.682 8.102   1.00 0.00 ? 91  GLN A H    4  
ATOM 7239  H HA   . GLN A 1 91  ? -10.609 -16.738 5.361   1.00 0.00 ? 91  GLN A HA   4  
ATOM 7240  H HB2  . GLN A 1 91  ? -12.004 -18.429 5.793   1.00 0.00 ? 91  GLN A HB2  4  
ATOM 7241  H HB3  . GLN A 1 91  ? -10.642 -18.635 6.976   1.00 0.00 ? 91  GLN A HB3  4  
ATOM 7242  H HG2  . GLN A 1 91  ? -12.148 -17.589 8.737   1.00 0.00 ? 91  GLN A HG2  4  
ATOM 7243  H HG3  . GLN A 1 91  ? -13.417 -17.379 7.449   1.00 0.00 ? 91  GLN A HG3  4  
ATOM 7244  H HE21 . GLN A 1 91  ? -12.351 -20.268 6.482   1.00 0.00 ? 91  GLN A HE21 4  
ATOM 7245  H HE22 . GLN A 1 91  ? -13.271 -21.301 7.550   1.00 0.00 ? 91  GLN A HE22 4  
ATOM 7246  N N    . TYR A 1 92  ? -12.310 -15.115 4.926   1.00 0.00 ? 92  TYR A N    4  
ATOM 7247  C CA   . TYR A 1 92  ? -13.236 -14.084 4.533   1.00 0.00 ? 92  TYR A CA   4  
ATOM 7248  C C    . TYR A 1 92  ? -14.710 -14.501 4.685   1.00 0.00 ? 92  TYR A C    4  
ATOM 7249  O O    . TYR A 1 92  ? -15.079 -15.666 4.577   1.00 0.00 ? 92  TYR A O    4  
ATOM 7250  C CB   . TYR A 1 92  ? -12.735 -13.507 3.184   1.00 0.00 ? 92  TYR A CB   4  
ATOM 7251  C CG   . TYR A 1 92  ? -13.565 -12.423 2.520   1.00 0.00 ? 92  TYR A CG   4  
ATOM 7252  C CD1  . TYR A 1 92  ? -14.520 -12.561 1.516   1.00 0.00 ? 92  TYR A CD1  4  
ATOM 7253  C CD2  . TYR A 1 92  ? -13.326 -11.162 2.979   1.00 0.00 ? 92  TYR A CD2  4  
ATOM 7254  C CE1  . TYR A 1 92  ? -15.214 -11.465 1.041   1.00 0.00 ? 92  TYR A CE1  4  
ATOM 7255  C CE2  . TYR A 1 92  ? -13.986 -10.065 2.505   1.00 0.00 ? 92  TYR A CE2  4  
ATOM 7256  C CZ   . TYR A 1 92  ? -14.897 -10.199 1.496   1.00 0.00 ? 92  TYR A CZ   4  
ATOM 7257  O OH   . TYR A 1 92  ? -15.444 -9.028  0.942   1.00 0.00 ? 92  TYR A OH   4  
ATOM 7258  H H    . TYR A 1 92  ? -11.808 -15.532 4.175   1.00 0.00 ? 92  TYR A H    4  
ATOM 7259  H HA   . TYR A 1 92  ? -13.103 -13.253 5.214   1.00 0.00 ? 92  TYR A HA   4  
ATOM 7260  H HB2  . TYR A 1 92  ? -11.731 -13.063 3.390   1.00 0.00 ? 92  TYR A HB2  4  
ATOM 7261  H HB3  . TYR A 1 92  ? -12.510 -14.317 2.511   1.00 0.00 ? 92  TYR A HB3  4  
ATOM 7262  H HD1  . TYR A 1 92  ? -14.774 -13.501 1.064   1.00 0.00 ? 92  TYR A HD1  4  
ATOM 7263  H HD2  . TYR A 1 92  ? -12.589 -11.035 3.746   1.00 0.00 ? 92  TYR A HD2  4  
ATOM 7264  H HE1  . TYR A 1 92  ? -16.002 -11.635 0.312   1.00 0.00 ? 92  TYR A HE1  4  
ATOM 7265  H HE2  . TYR A 1 92  ? -13.753 -9.113  2.952   1.00 0.00 ? 92  TYR A HE2  4  
ATOM 7266  H HH   . TYR A 1 92  ? -15.073 -8.274  1.411   1.00 0.00 ? 92  TYR A HH   4  
ATOM 7267  N N    . ILE A 1 93  ? -15.568 -13.516 4.995   1.00 0.00 ? 93  ILE A N    4  
ATOM 7268  C CA   . ILE A 1 93  ? -17.010 -13.518 5.125   1.00 0.00 ? 93  ILE A CA   4  
ATOM 7269  C C    . ILE A 1 93  ? -17.516 -13.269 3.732   1.00 0.00 ? 93  ILE A C    4  
ATOM 7270  O O    . ILE A 1 93  ? -17.243 -12.211 3.167   1.00 0.00 ? 93  ILE A O    4  
ATOM 7271  C CB   . ILE A 1 93  ? -17.439 -12.318 5.976   1.00 0.00 ? 93  ILE A CB   4  
ATOM 7272  C CG1  . ILE A 1 93  ? -16.933 -12.473 7.420   1.00 0.00 ? 93  ILE A CG1  4  
ATOM 7273  C CG2  . ILE A 1 93  ? -18.953 -12.000 5.917   1.00 0.00 ? 93  ILE A CG2  4  
ATOM 7274  C CD1  . ILE A 1 93  ? -17.432 -13.696 8.146   1.00 0.00 ? 93  ILE A CD1  4  
ATOM 7275  H H    . ILE A 1 93  ? -15.213 -12.585 5.072   1.00 0.00 ? 93  ILE A H    4  
ATOM 7276  H HA   . ILE A 1 93  ? -17.382 -14.454 5.508   1.00 0.00 ? 93  ILE A HA   4  
ATOM 7277  H HB   . ILE A 1 93  ? -16.948 -11.387 5.589   1.00 0.00 ? 93  ILE A HB   4  
ATOM 7278  H HG12 . ILE A 1 93  ? -15.823 -12.511 7.430   1.00 0.00 ? 93  ILE A HG12 4  
ATOM 7279  H HG13 . ILE A 1 93  ? -17.252 -11.574 7.986   1.00 0.00 ? 93  ILE A HG13 4  
ATOM 7280  H HG21 . ILE A 1 93  ? -19.565 -12.916 6.033   1.00 0.00 ? 93  ILE A HG21 4  
ATOM 7281  H HG22 . ILE A 1 93  ? -19.190 -11.290 6.734   1.00 0.00 ? 93  ILE A HG22 4  
ATOM 7282  H HG23 . ILE A 1 93  ? -19.187 -11.481 4.960   1.00 0.00 ? 93  ILE A HG23 4  
ATOM 7283  H HD11 . ILE A 1 93  ? -18.533 -13.768 8.052   1.00 0.00 ? 93  ILE A HD11 4  
ATOM 7284  H HD12 . ILE A 1 93  ? -16.935 -14.602 7.736   1.00 0.00 ? 93  ILE A HD12 4  
ATOM 7285  H HD13 . ILE A 1 93  ? -17.151 -13.574 9.213   1.00 0.00 ? 93  ILE A HD13 4  
ATOM 7286  N N    . ASP A 1 94  ? -18.260 -14.218 3.101   1.00 0.00 ? 94  ASP A N    4  
ATOM 7287  C CA   . ASP A 1 94  ? -18.761 -14.017 1.745   1.00 0.00 ? 94  ASP A CA   4  
ATOM 7288  C C    . ASP A 1 94  ? -19.994 -13.146 1.730   1.00 0.00 ? 94  ASP A C    4  
ATOM 7289  O O    . ASP A 1 94  ? -21.121 -13.593 1.926   1.00 0.00 ? 94  ASP A O    4  
ATOM 7290  C CB   . ASP A 1 94  ? -18.928 -15.240 0.796   1.00 0.00 ? 94  ASP A CB   4  
ATOM 7291  C CG   . ASP A 1 94  ? -19.815 -16.401 1.268   1.00 0.00 ? 94  ASP A CG   4  
ATOM 7292  O OD1  . ASP A 1 94  ? -19.989 -17.349 0.455   1.00 0.00 ? 94  ASP A OD1  4  
ATOM 7293  O OD2  . ASP A 1 94  ? -20.307 -16.381 2.427   1.00 0.00 ? 94  ASP A OD2  4  
ATOM 7294  H H    . ASP A 1 94  ? -18.518 -15.072 3.544   1.00 0.00 ? 94  ASP A H    4  
ATOM 7295  H HA   . ASP A 1 94  ? -17.995 -13.476 1.200   1.00 0.00 ? 94  ASP A HA   4  
ATOM 7296  H HB2  . ASP A 1 94  ? -19.249 -14.824 -0.187  1.00 0.00 ? 94  ASP A HB2  4  
ATOM 7297  H HB3  . ASP A 1 94  ? -17.931 -15.681 0.598   1.00 0.00 ? 94  ASP A HB3  4  
ATOM 7298  N N    . ARG A 1 95  ? -19.716 -11.838 1.490   1.00 0.00 ? 95  ARG A N    4  
ATOM 7299  C CA   . ARG A 1 95  ? -20.518 -10.632 1.360   1.00 0.00 ? 95  ARG A CA   4  
ATOM 7300  C C    . ARG A 1 95  ? -21.867 -10.846 0.684   1.00 0.00 ? 95  ARG A C    4  
ATOM 7301  O O    . ARG A 1 95  ? -22.817 -11.288 1.320   1.00 0.00 ? 95  ARG A O    4  
ATOM 7302  C CB   . ARG A 1 95  ? -19.556 -9.586  0.780   1.00 0.00 ? 95  ARG A CB   4  
ATOM 7303  C CG   . ARG A 1 95  ? -18.448 -9.200  1.804   1.00 0.00 ? 95  ARG A CG   4  
ATOM 7304  C CD   . ARG A 1 95  ? -18.966 -8.511  3.063   1.00 0.00 ? 95  ARG A CD   4  
ATOM 7305  N NE   . ARG A 1 95  ? -19.651 -7.217  2.727   1.00 0.00 ? 95  ARG A NE   4  
ATOM 7306  C CZ   . ARG A 1 95  ? -20.124 -6.362  3.687   1.00 0.00 ? 95  ARG A CZ   4  
ATOM 7307  N NH1  . ARG A 1 95  ? -19.973 -6.648  5.013   1.00 0.00 ? 95  ARG A NH1  4  
ATOM 7308  N NH2  . ARG A 1 95  ? -20.750 -5.211  3.310   1.00 0.00 ? 95  ARG A NH2  4  
ATOM 7309  H H    . ARG A 1 95  ? -18.745 -11.620 1.424   1.00 0.00 ? 95  ARG A H    4  
ATOM 7310  H HA   . ARG A 1 95  ? -20.746 -10.260 2.324   1.00 0.00 ? 95  ARG A HA   4  
ATOM 7311  H HB2  . ARG A 1 95  ? -19.065 -9.989  -0.136  1.00 0.00 ? 95  ARG A HB2  4  
ATOM 7312  H HB3  . ARG A 1 95  ? -20.100 -8.659  0.495   1.00 0.00 ? 95  ARG A HB3  4  
ATOM 7313  H HG2  . ARG A 1 95  ? -17.729 -9.969  2.230   1.00 0.00 ? 95  ARG A HG2  4  
ATOM 7314  H HG3  . ARG A 1 95  ? -17.824 -8.483  1.260   1.00 0.00 ? 95  ARG A HG3  4  
ATOM 7315  H HD2  . ARG A 1 95  ? -19.667 -9.199  3.570   1.00 0.00 ? 95  ARG A HD2  4  
ATOM 7316  H HD3  . ARG A 1 95  ? -18.078 -8.324  3.693   1.00 0.00 ? 95  ARG A HD3  4  
ATOM 7317  H HE   . ARG A 1 95  ? -19.776 -6.979  1.764   1.00 0.00 ? 95  ARG A HE   4  
ATOM 7318  H HH11 . ARG A 1 95  ? -19.514 -7.490  5.294   1.00 0.00 ? 95  ARG A HH11 4  
ATOM 7319  H HH12 . ARG A 1 95  ? -20.322 -6.014  5.702   1.00 0.00 ? 95  ARG A HH12 4  
ATOM 7320  H HH21 . ARG A 1 95  ? -20.865 -4.997  2.340   1.00 0.00 ? 95  ARG A HH21 4  
ATOM 7321  H HH22 . ARG A 1 95  ? -21.098 -4.581  4.005   1.00 0.00 ? 95  ARG A HH22 4  
ATOM 7322  N N    . ASP A 1 96  ? -21.973 -10.664 -0.638  1.00 0.00 ? 96  ASP A N    4  
ATOM 7323  C CA   . ASP A 1 96  ? -23.009 -11.298 -1.425  1.00 0.00 ? 96  ASP A CA   4  
ATOM 7324  C C    . ASP A 1 96  ? -22.294 -12.466 -2.118  1.00 0.00 ? 96  ASP A C    4  
ATOM 7325  O O    . ASP A 1 96  ? -21.411 -12.130 -2.904  1.00 0.00 ? 96  ASP A O    4  
ATOM 7326  C CB   . ASP A 1 96  ? -23.608 -10.368 -2.495  1.00 0.00 ? 96  ASP A CB   4  
ATOM 7327  C CG   . ASP A 1 96  ? -24.226 -9.131  -1.843  1.00 0.00 ? 96  ASP A CG   4  
ATOM 7328  O OD1  . ASP A 1 96  ? -25.206 -9.297  -1.070  1.00 0.00 ? 96  ASP A OD1  4  
ATOM 7329  O OD2  . ASP A 1 96  ? -23.724 -8.005  -2.108  1.00 0.00 ? 96  ASP A OD2  4  
ATOM 7330  H H    . ASP A 1 96  ? -21.241 -10.295 -1.188  1.00 0.00 ? 96  ASP A H    4  
ATOM 7331  H HA   . ASP A 1 96  ? -23.827 -11.669 -0.818  1.00 0.00 ? 96  ASP A HA   4  
ATOM 7332  H HB2  . ASP A 1 96  ? -22.831 -10.069 -3.217  1.00 0.00 ? 96  ASP A HB2  4  
ATOM 7333  H HB3  . ASP A 1 96  ? -24.384 -10.911 -3.056  1.00 0.00 ? 96  ASP A HB3  4  
ATOM 7334  N N    . PRO A 1 97  ? -22.514 -13.796 -1.957  1.00 0.00 ? 97  PRO A N    4  
ATOM 7335  C CA   . PRO A 1 97  ? -21.822 -14.904 -2.655  1.00 0.00 ? 97  PRO A CA   4  
ATOM 7336  C C    . PRO A 1 97  ? -21.916 -14.890 -4.188  1.00 0.00 ? 97  PRO A C    4  
ATOM 7337  O O    . PRO A 1 97  ? -21.017 -15.401 -4.852  1.00 0.00 ? 97  PRO A O    4  
ATOM 7338  C CB   . PRO A 1 97  ? -22.425 -16.184 -2.074  1.00 0.00 ? 97  PRO A CB   4  
ATOM 7339  C CG   . PRO A 1 97  ? -22.930 -15.743 -0.698  1.00 0.00 ? 97  PRO A CG   4  
ATOM 7340  C CD   . PRO A 1 97  ? -23.360 -14.288 -0.895  1.00 0.00 ? 97  PRO A CD   4  
ATOM 7341  H HA   . PRO A 1 97  ? -20.769 -14.835 -2.406  1.00 0.00 ? 97  PRO A HA   4  
ATOM 7342  H HB2  . PRO A 1 97  ? -23.312 -16.545 -2.661  1.00 0.00 ? 97  PRO A HB2  4  
ATOM 7343  H HB3  . PRO A 1 97  ? -21.639 -16.980 -2.008  1.00 0.00 ? 97  PRO A HB3  4  
ATOM 7344  H HG2  . PRO A 1 97  ? -23.738 -16.393 -0.326  1.00 0.00 ? 97  PRO A HG2  4  
ATOM 7345  H HG3  . PRO A 1 97  ? -22.086 -15.763 0.026   1.00 0.00 ? 97  PRO A HG3  4  
ATOM 7346  H HD2  . PRO A 1 97  ? -24.396 -14.155 -1.249  1.00 0.00 ? 97  PRO A HD2  4  
ATOM 7347  H HD3  . PRO A 1 97  ? -23.201 -13.738 0.061   1.00 0.00 ? 97  PRO A HD3  4  
ATOM 7348  N N    . GLU A 1 98  ? -22.944 -14.189 -4.750  1.00 0.00 ? 98  GLU A N    4  
ATOM 7349  C CA   . GLU A 1 98  ? -23.117 -13.818 -6.150  1.00 0.00 ? 98  GLU A CA   4  
ATOM 7350  C C    . GLU A 1 98  ? -22.065 -12.800 -6.584  1.00 0.00 ? 98  GLU A C    4  
ATOM 7351  O O    . GLU A 1 98  ? -21.754 -12.689 -7.752  1.00 0.00 ? 98  GLU A O    4  
ATOM 7352  C CB   . GLU A 1 98  ? -24.534 -13.293 -6.455  1.00 0.00 ? 98  GLU A CB   4  
ATOM 7353  C CG   . GLU A 1 98  ? -25.614 -14.365 -6.233  1.00 0.00 ? 98  GLU A CG   4  
ATOM 7354  C CD   . GLU A 1 98  ? -26.983 -13.807 -6.614  1.00 0.00 ? 98  GLU A CD   4  
ATOM 7355  O OE1  . GLU A 1 98  ? -27.433 -12.837 -5.947  1.00 0.00 ? 98  GLU A OE1  4  
ATOM 7356  O OE2  . GLU A 1 98  ? -27.596 -14.342 -7.578  1.00 0.00 ? 98  GLU A OE2  4  
ATOM 7357  H H    . GLU A 1 98  ? -23.635 -13.805 -4.143  1.00 0.00 ? 98  GLU A H    4  
ATOM 7358  H HA   . GLU A 1 98  ? -22.949 -14.699 -6.760  1.00 0.00 ? 98  GLU A HA   4  
ATOM 7359  H HB2  . GLU A 1 98  ? -24.751 -12.414 -5.809  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 7360  H HB3  . GLU A 1 98  ? -24.598 -12.966 -7.520  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 7361  H HG2  . GLU A 1 98  ? -25.379 -15.249 -6.867  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 7362  H HG3  . GLU A 1 98  ? -25.629 -14.685 -5.169  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 7363  N N    . THR A 1 99  ? -21.422 -12.070 -5.622  1.00 0.00 ? 99  THR A N    4  
ATOM 7364  C CA   . THR A 1 99  ? -20.222 -11.247 -5.828  1.00 0.00 ? 99  THR A CA   4  
ATOM 7365  C C    . THR A 1 99  ? -18.997 -12.161 -5.925  1.00 0.00 ? 99  THR A C    4  
ATOM 7366  O O    . THR A 1 99  ? -18.319 -12.102 -6.933  1.00 0.00 ? 99  THR A O    4  
ATOM 7367  C CB   . THR A 1 99  ? -20.070 -10.037 -4.860  1.00 0.00 ? 99  THR A CB   4  
ATOM 7368  O OG1  . THR A 1 99  ? -19.776 -8.837  -5.557  1.00 0.00 ? 99  THR A OG1  4  
ATOM 7369  C CG2  . THR A 1 99  ? -18.994 -10.158 -3.766  1.00 0.00 ? 99  THR A CG2  4  
ATOM 7370  H H    . THR A 1 99  ? -21.676 -12.172 -4.651  1.00 0.00 ? 99  THR A H    4  
ATOM 7371  H HA   . THR A 1 99  ? -20.309 -10.823 -6.826  1.00 0.00 ? 99  THR A HA   4  
ATOM 7372  H HB   . THR A 1 99  ? -21.057 -9.904  -4.367  1.00 0.00 ? 99  THR A HB   4  
ATOM 7373  H HG1  . THR A 1 99  ? -18.832 -8.907  -5.837  1.00 0.00 ? 99  THR A HG1  4  
ATOM 7374  H HG21 . THR A 1 99  ? -17.994 -10.295 -4.248  1.00 0.00 ? 99  THR A HG21 4  
ATOM 7375  H HG22 . THR A 1 99  ? -18.962 -9.267  -3.100  1.00 0.00 ? 99  THR A HG22 4  
ATOM 7376  H HG23 . THR A 1 99  ? -19.221 -11.015 -3.105  1.00 0.00 ? 99  THR A HG23 4  
ATOM 7377  N N    . ILE A 1 100 ? -18.710 -13.101 -4.953  1.00 0.00 ? 100 ILE A N    4  
ATOM 7378  C CA   . ILE A 1 100 ? -17.614 -14.090 -4.905  1.00 0.00 ? 100 ILE A CA   4  
ATOM 7379  C C    . ILE A 1 100 ? -17.617 -15.024 -6.106  1.00 0.00 ? 100 ILE A C    4  
ATOM 7380  O O    . ILE A 1 100 ? -16.636 -15.111 -6.825  1.00 0.00 ? 100 ILE A O    4  
ATOM 7381  C CB   . ILE A 1 100 ? -17.844 -14.927 -3.627  1.00 0.00 ? 100 ILE A CB   4  
ATOM 7382  C CG1  . ILE A 1 100 ? -17.248 -14.231 -2.388  1.00 0.00 ? 100 ILE A CG1  4  
ATOM 7383  C CG2  . ILE A 1 100 ? -17.285 -16.378 -3.630  1.00 0.00 ? 100 ILE A CG2  4  
ATOM 7384  C CD1  . ILE A 1 100 ? -17.863 -12.907 -1.963  1.00 0.00 ? 100 ILE A CD1  4  
ATOM 7385  H H    . ILE A 1 100 ? -19.268 -13.214 -4.146  1.00 0.00 ? 100 ILE A H    4  
ATOM 7386  H HA   . ILE A 1 100 ? -16.616 -13.620 -4.851  1.00 0.00 ? 100 ILE A HA   4  
ATOM 7387  H HB   . ILE A 1 100 ? -18.947 -15.019 -3.455  1.00 0.00 ? 100 ILE A HB   4  
ATOM 7388  H HG12 . ILE A 1 100 ? -17.439 -14.928 -1.562  1.00 0.00 ? 100 ILE A HG12 4  
ATOM 7389  H HG13 . ILE A 1 100 ? -16.150 -14.116 -2.516  1.00 0.00 ? 100 ILE A HG13 4  
ATOM 7390  H HG21 . ILE A 1 100 ? -16.215 -16.382 -3.913  1.00 0.00 ? 100 ILE A HG21 4  
ATOM 7391  H HG22 . ILE A 1 100 ? -17.361 -16.808 -2.609  1.00 0.00 ? 100 ILE A HG22 4  
ATOM 7392  H HG23 . ILE A 1 100 ? -17.850 -17.054 -4.302  1.00 0.00 ? 100 ILE A HG23 4  
ATOM 7393  H HD11 . ILE A 1 100 ? -18.972 -12.981 -1.943  1.00 0.00 ? 100 ILE A HD11 4  
ATOM 7394  H HD12 . ILE A 1 100 ? -17.507 -12.622 -0.950  1.00 0.00 ? 100 ILE A HD12 4  
ATOM 7395  H HD13 . ILE A 1 100 ? -17.551 -12.111 -2.667  1.00 0.00 ? 100 ILE A HD13 4  
ATOM 7396  N N    . ARG A 1 101 ? -18.758 -15.674 -6.454  1.00 0.00 ? 101 ARG A N    4  
ATOM 7397  C CA   . ARG A 1 101 ? -18.849 -16.594 -7.591  1.00 0.00 ? 101 ARG A CA   4  
ATOM 7398  C C    . ARG A 1 101 ? -18.829 -15.893 -8.946  1.00 0.00 ? 101 ARG A C    4  
ATOM 7399  O O    . ARG A 1 101 ? -18.421 -16.482 -9.939  1.00 0.00 ? 101 ARG A O    4  
ATOM 7400  C CB   . ARG A 1 101 ? -20.052 -17.546 -7.451  1.00 0.00 ? 101 ARG A CB   4  
ATOM 7401  C CG   . ARG A 1 101 ? -20.013 -18.391 -6.159  1.00 0.00 ? 101 ARG A CG   4  
ATOM 7402  C CD   . ARG A 1 101 ? -18.763 -19.278 -6.007  1.00 0.00 ? 101 ARG A CD   4  
ATOM 7403  N NE   . ARG A 1 101 ? -18.855 -20.053 -4.718  1.00 0.00 ? 101 ARG A NE   4  
ATOM 7404  C CZ   . ARG A 1 101 ? -19.449 -21.283 -4.602  1.00 0.00 ? 101 ARG A CZ   4  
ATOM 7405  N NH1  . ARG A 1 101 ? -20.007 -21.904 -5.682  1.00 0.00 ? 101 ARG A NH1  4  
ATOM 7406  N NH2  . ARG A 1 101 ? -19.484 -21.896 -3.382  1.00 0.00 ? 101 ARG A NH2  4  
ATOM 7407  H H    . ARG A 1 101 ? -19.601 -15.586 -5.897  1.00 0.00 ? 101 ARG A H    4  
ATOM 7408  H HA   . ARG A 1 101 ? -17.966 -17.246 -7.591  1.00 0.00 ? 101 ARG A HA   4  
ATOM 7409  H HB2  . ARG A 1 101 ? -20.996 -16.958 -7.440  1.00 0.00 ? 101 ARG A HB2  4  
ATOM 7410  H HB3  . ARG A 1 101 ? -20.092 -18.256 -8.311  1.00 0.00 ? 101 ARG A HB3  4  
ATOM 7411  H HG2  . ARG A 1 101 ? -20.134 -17.737 -5.265  1.00 0.00 ? 101 ARG A HG2  4  
ATOM 7412  H HG3  . ARG A 1 101 ? -20.899 -19.044 -6.211  1.00 0.00 ? 101 ARG A HG3  4  
ATOM 7413  H HD2  . ARG A 1 101 ? -18.650 -19.965 -6.874  1.00 0.00 ? 101 ARG A HD2  4  
ATOM 7414  H HD3  . ARG A 1 101 ? -17.851 -18.653 -5.935  1.00 0.00 ? 101 ARG A HD3  4  
ATOM 7415  H HE   . ARG A 1 101 ? -18.460 -19.643 -3.897  1.00 0.00 ? 101 ARG A HE   4  
ATOM 7416  H HH11 . ARG A 1 101 ? -19.987 -21.461 -6.578  1.00 0.00 ? 101 ARG A HH11 4  
ATOM 7417  H HH12 . ARG A 1 101 ? -20.436 -22.801 -5.575  1.00 0.00 ? 101 ARG A HH12 4  
ATOM 7418  H HH21 . ARG A 1 101 ? -19.076 -21.449 -2.587  1.00 0.00 ? 101 ARG A HH21 4  
ATOM 7419  H HH22 . ARG A 1 101 ? -19.916 -22.793 -3.286  1.00 0.00 ? 101 ARG A HH22 4  
ATOM 7420  N N    . ARG A 1 102 ? -19.178 -14.570 -9.002  1.00 0.00 ? 102 ARG A N    4  
ATOM 7421  C CA   . ARG A 1 102 ? -19.043 -13.714 -10.196 1.00 0.00 ? 102 ARG A CA   4  
ATOM 7422  C C    . ARG A 1 102 ? -17.606 -13.215 -10.292 1.00 0.00 ? 102 ARG A C    4  
ATOM 7423  O O    . ARG A 1 102 ? -17.040 -13.182 -11.387 1.00 0.00 ? 102 ARG A O    4  
ATOM 7424  C CB   . ARG A 1 102 ? -20.013 -12.503 -10.228 1.00 0.00 ? 102 ARG A CB   4  
ATOM 7425  C CG   . ARG A 1 102 ? -21.462 -12.788 -10.698 1.00 0.00 ? 102 ARG A CG   4  
ATOM 7426  C CD   . ARG A 1 102 ? -21.999 -14.217 -10.496 1.00 0.00 ? 102 ARG A CD   4  
ATOM 7427  N NE   . ARG A 1 102 ? -23.473 -14.221 -10.808 1.00 0.00 ? 102 ARG A NE   4  
ATOM 7428  C CZ   . ARG A 1 102 ? -24.355 -15.129 -10.284 1.00 0.00 ? 102 ARG A CZ   4  
ATOM 7429  N NH1  . ARG A 1 102 ? -23.929 -16.124 -9.453  1.00 0.00 ? 102 ARG A NH1  4  
ATOM 7430  N NH2  . ARG A 1 102 ? -25.681 -15.031 -10.595 1.00 0.00 ? 102 ARG A NH2  4  
ATOM 7431  H H    . ARG A 1 102 ? -19.467 -14.107 -8.154  1.00 0.00 ? 102 ARG A H    4  
ATOM 7432  H HA   . ARG A 1 102 ? -19.201 -14.313 -11.081 1.00 0.00 ? 102 ARG A HA   4  
ATOM 7433  H HB2  . ARG A 1 102 ? -20.043 -12.062 -9.207  1.00 0.00 ? 102 ARG A HB2  4  
ATOM 7434  H HB3  . ARG A 1 102 ? -19.645 -11.690 -10.898 1.00 0.00 ? 102 ARG A HB3  4  
ATOM 7435  H HG2  . ARG A 1 102 ? -22.123 -12.084 -10.135 1.00 0.00 ? 102 ARG A HG2  4  
ATOM 7436  H HG3  . ARG A 1 102 ? -21.538 -12.515 -11.767 1.00 0.00 ? 102 ARG A HG3  4  
ATOM 7437  H HD2  . ARG A 1 102 ? -21.494 -14.934 -11.178 1.00 0.00 ? 102 ARG A HD2  4  
ATOM 7438  H HD3  . ARG A 1 102 ? -21.839 -14.531 -9.442  1.00 0.00 ? 102 ARG A HD3  4  
ATOM 7439  H HE   . ARG A 1 102 ? -23.827 -13.508 -11.413 1.00 0.00 ? 102 ARG A HE   4  
ATOM 7440  H HH11 . ARG A 1 102 ? -22.960 -16.196 -9.214  1.00 0.00 ? 102 ARG A HH11 4  
ATOM 7441  H HH12 . ARG A 1 102 ? -24.587 -16.776 -9.077  1.00 0.00 ? 102 ARG A HH12 4  
ATOM 7442  H HH21 . ARG A 1 102 ? -26.000 -14.303 -11.201 1.00 0.00 ? 102 ARG A HH21 4  
ATOM 7443  H HH22 . ARG A 1 102 ? -26.332 -15.688 -10.216 1.00 0.00 ? 102 ARG A HH22 4  
ATOM 7444  N N    . GLN A 1 103 ? -16.989 -12.897 -9.111  1.00 0.00 ? 103 GLN A N    4  
ATOM 7445  C CA   . GLN A 1 103 ? -15.592 -12.549 -8.867  1.00 0.00 ? 103 GLN A CA   4  
ATOM 7446  C C    . GLN A 1 103 ? -14.620 -13.638 -9.255  1.00 0.00 ? 103 GLN A C    4  
ATOM 7447  O O    . GLN A 1 103 ? -13.644 -13.367 -9.939  1.00 0.00 ? 103 GLN A O    4  
ATOM 7448  C CB   . GLN A 1 103 ? -15.442 -11.775 -7.523  1.00 0.00 ? 103 GLN A CB   4  
ATOM 7449  C CG   . GLN A 1 103 ? -16.040 -10.364 -7.781  1.00 0.00 ? 103 GLN A CG   4  
ATOM 7450  C CD   . GLN A 1 103 ? -16.185 -9.361  -6.630  1.00 0.00 ? 103 GLN A CD   4  
ATOM 7451  O OE1  . GLN A 1 103 ? -17.295 -8.969  -6.247  1.00 0.00 ? 103 GLN A OE1  4  
ATOM 7452  N NE2  . GLN A 1 103 ? -15.031 -8.840  -6.147  1.00 0.00 ? 103 GLN A NE2  4  
ATOM 7453  H H    . GLN A 1 103 ? -17.531 -12.910 -8.249  1.00 0.00 ? 103 GLN A H    4  
ATOM 7454  H HA   . GLN A 1 103 ? -15.237 -11.807 -9.527  1.00 0.00 ? 103 GLN A HA   4  
ATOM 7455  H HB2  . GLN A 1 103 ? -15.962 -12.321 -6.714  1.00 0.00 ? 103 GLN A HB2  4  
ATOM 7456  H HB3  . GLN A 1 103 ? -14.393 -11.650 -7.214  1.00 0.00 ? 103 GLN A HB3  4  
ATOM 7457  H HG2  . GLN A 1 103 ? -15.378 -9.913  -8.538  1.00 0.00 ? 103 GLN A HG2  4  
ATOM 7458  H HG3  . GLN A 1 103 ? -17.046 -10.480 -8.235  1.00 0.00 ? 103 GLN A HG3  4  
ATOM 7459  H HE21 . GLN A 1 103 ? -14.149 -9.251  -6.386  1.00 0.00 ? 103 GLN A HE21 4  
ATOM 7460  H HE22 . GLN A 1 103 ? -15.110 -8.005  -5.606  1.00 0.00 ? 103 GLN A HE22 4  
ATOM 7461  N N    . LEU A 1 104 ? -14.851 -14.905 -8.888  1.00 0.00 ? 104 LEU A N    4  
ATOM 7462  C CA   . LEU A 1 104 ? -14.024 -16.006 -9.314  1.00 0.00 ? 104 LEU A CA   4  
ATOM 7463  C C    . LEU A 1 104 ? -14.327 -16.571 -10.703 1.00 0.00 ? 104 LEU A C    4  
ATOM 7464  O O    . LEU A 1 104 ? -13.425 -16.814 -11.496 1.00 0.00 ? 104 LEU A O    4  
ATOM 7465  C CB   . LEU A 1 104 ? -13.871 -17.153 -8.285  1.00 0.00 ? 104 LEU A CB   4  
ATOM 7466  C CG   . LEU A 1 104 ? -14.542 -17.172 -6.908  1.00 0.00 ? 104 LEU A CG   4  
ATOM 7467  C CD1  . LEU A 1 104 ? -14.372 -18.549 -6.231  1.00 0.00 ? 104 LEU A CD1  4  
ATOM 7468  C CD2  . LEU A 1 104 ? -13.999 -16.085 -5.989  1.00 0.00 ? 104 LEU A CD2  4  
ATOM 7469  H H    . LEU A 1 104 ? -15.636 -15.119 -8.304  1.00 0.00 ? 104 LEU A H    4  
ATOM 7470  H HA   . LEU A 1 104 ? -13.006 -15.639 -9.409  1.00 0.00 ? 104 LEU A HA   4  
ATOM 7471  H HB2  . LEU A 1 104 ? -14.314 -18.076 -8.704  1.00 0.00 ? 104 LEU A HB2  4  
ATOM 7472  H HB3  . LEU A 1 104 ? -12.767 -17.125 -8.101  1.00 0.00 ? 104 LEU A HB3  4  
ATOM 7473  H HG   . LEU A 1 104 ? -15.633 -17.049 -7.079  1.00 0.00 ? 104 LEU A HG   4  
ATOM 7474  H HD11 . LEU A 1 104 ? -14.786 -19.364 -6.859  1.00 0.00 ? 104 LEU A HD11 4  
ATOM 7475  H HD12 . LEU A 1 104 ? -13.295 -18.748 -6.037  1.00 0.00 ? 104 LEU A HD12 4  
ATOM 7476  H HD13 . LEU A 1 104 ? -14.910 -18.547 -5.259  1.00 0.00 ? 104 LEU A HD13 4  
ATOM 7477  H HD21 . LEU A 1 104 ? -14.164 -15.070 -6.428  1.00 0.00 ? 104 LEU A HD21 4  
ATOM 7478  H HD22 . LEU A 1 104 ? -14.505 -16.099 -5.008  1.00 0.00 ? 104 LEU A HD22 4  
ATOM 7479  H HD23 . LEU A 1 104 ? -12.912 -16.221 -5.819  1.00 0.00 ? 104 LEU A HD23 4  
ATOM 7480  N N    . GLU A 1 105 ? -15.617 -16.899 -10.994 1.00 0.00 ? 105 GLU A N    4  
ATOM 7481  C CA   . GLU A 1 105 ? -16.018 -17.614 -12.209 1.00 0.00 ? 105 GLU A CA   4  
ATOM 7482  C C    . GLU A 1 105 ? -16.210 -16.795 -13.494 1.00 0.00 ? 105 GLU A C    4  
ATOM 7483  O O    . GLU A 1 105 ? -15.666 -17.156 -14.533 1.00 0.00 ? 105 GLU A O    4  
ATOM 7484  C CB   . GLU A 1 105 ? -17.263 -18.519 -11.952 1.00 0.00 ? 105 GLU A CB   4  
ATOM 7485  C CG   . GLU A 1 105 ? -17.163 -19.400 -10.684 1.00 0.00 ? 105 GLU A CG   4  
ATOM 7486  C CD   . GLU A 1 105 ? -16.020 -20.406 -10.814 1.00 0.00 ? 105 GLU A CD   4  
ATOM 7487  O OE1  . GLU A 1 105 ? -15.078 -20.345 -9.979  1.00 0.00 ? 105 GLU A OE1  4  
ATOM 7488  O OE2  . GLU A 1 105 ? -16.077 -21.250 -11.748 1.00 0.00 ? 105 GLU A OE2  4  
ATOM 7489  H H    . GLU A 1 105 ? -16.358 -16.734 -10.331 1.00 0.00 ? 105 GLU A H    4  
ATOM 7490  H HA   . GLU A 1 105 ? -15.222 -18.308 -12.457 1.00 0.00 ? 105 GLU A HA   4  
ATOM 7491  H HB2  . GLU A 1 105 ? -18.169 -17.887 -11.842 1.00 0.00 ? 105 GLU A HB2  4  
ATOM 7492  H HB3  . GLU A 1 105 ? -17.435 -19.189 -12.824 1.00 0.00 ? 105 GLU A HB3  4  
ATOM 7493  H HG2  . GLU A 1 105 ? -17.004 -18.764 -9.788  1.00 0.00 ? 105 GLU A HG2  4  
ATOM 7494  H HG3  . GLU A 1 105 ? -18.119 -19.948 -10.535 1.00 0.00 ? 105 GLU A HG3  4  
ATOM 7495  N N    . LEU A 1 106 ? -17.030 -15.711 -13.477 1.00 0.00 ? 106 LEU A N    4  
ATOM 7496  C CA   . LEU A 1 106 ? -17.406 -14.881 -14.632 1.00 0.00 ? 106 LEU A CA   4  
ATOM 7497  C C    . LEU A 1 106 ? -16.422 -13.791 -15.020 1.00 0.00 ? 106 LEU A C    4  
ATOM 7498  O O    . LEU A 1 106 ? -16.009 -13.684 -16.171 1.00 0.00 ? 106 LEU A O    4  
ATOM 7499  C CB   . LEU A 1 106 ? -18.717 -14.129 -14.326 1.00 0.00 ? 106 LEU A CB   4  
ATOM 7500  C CG   . LEU A 1 106 ? -19.961 -14.989 -13.988 1.00 0.00 ? 106 LEU A CG   4  
ATOM 7501  C CD1  . LEU A 1 106 ? -21.206 -14.284 -14.540 1.00 0.00 ? 106 LEU A CD1  4  
ATOM 7502  C CD2  . LEU A 1 106 ? -19.955 -16.426 -14.537 1.00 0.00 ? 106 LEU A CD2  4  
ATOM 7503  H H    . LEU A 1 106 ? -17.472 -15.451 -12.622 1.00 0.00 ? 106 LEU A H    4  
ATOM 7504  H HA   . LEU A 1 106 ? -17.541 -15.489 -15.523 1.00 0.00 ? 106 LEU A HA   4  
ATOM 7505  H HB2  . LEU A 1 106 ? -18.482 -13.460 -13.459 1.00 0.00 ? 106 LEU A HB2  4  
ATOM 7506  H HB3  . LEU A 1 106 ? -19.006 -13.493 -15.200 1.00 0.00 ? 106 LEU A HB3  4  
ATOM 7507  H HG   . LEU A 1 106 ? -20.033 -15.061 -12.877 1.00 0.00 ? 106 LEU A HG   4  
ATOM 7508  H HD11 . LEU A 1 106 ? -21.270 -13.238 -14.173 1.00 0.00 ? 106 LEU A HD11 4  
ATOM 7509  H HD12 . LEU A 1 106 ? -21.137 -14.270 -15.651 1.00 0.00 ? 106 LEU A HD12 4  
ATOM 7510  H HD13 . LEU A 1 106 ? -22.132 -14.825 -14.253 1.00 0.00 ? 106 LEU A HD13 4  
ATOM 7511  H HD21 . LEU A 1 106 ? -19.780 -16.424 -15.633 1.00 0.00 ? 106 LEU A HD21 4  
ATOM 7512  H HD22 . LEU A 1 106 ? -19.173 -17.036 -14.043 1.00 0.00 ? 106 LEU A HD22 4  
ATOM 7513  H HD23 . LEU A 1 106 ? -20.935 -16.911 -14.340 1.00 0.00 ? 106 LEU A HD23 4  
ATOM 7514  N N    . GLU A 1 107 ? -16.038 -12.924 -14.026 1.00 0.00 ? 107 GLU A N    4  
ATOM 7515  C CA   . GLU A 1 107 ? -15.141 -11.763 -14.126 1.00 0.00 ? 107 GLU A CA   4  
ATOM 7516  C C    . GLU A 1 107 ? -13.762 -12.088 -14.643 1.00 0.00 ? 107 GLU A C    4  
ATOM 7517  O O    . GLU A 1 107 ? -13.072 -11.292 -15.267 1.00 0.00 ? 107 GLU A O    4  
ATOM 7518  C CB   . GLU A 1 107 ? -14.962 -11.124 -12.730 1.00 0.00 ? 107 GLU A CB   4  
ATOM 7519  C CG   . GLU A 1 107 ? -13.983 -9.928  -12.665 1.00 0.00 ? 107 GLU A CG   4  
ATOM 7520  C CD   . GLU A 1 107 ? -12.577 -10.313 -12.193 1.00 0.00 ? 107 GLU A CD   4  
ATOM 7521  O OE1  . GLU A 1 107 ? -12.484 -10.974 -11.127 1.00 0.00 ? 107 GLU A OE1  4  
ATOM 7522  O OE2  . GLU A 1 107 ? -11.589 -9.948  -12.883 1.00 0.00 ? 107 GLU A OE2  4  
ATOM 7523  H H    . GLU A 1 107 ? -16.409 -13.058 -13.097 1.00 0.00 ? 107 GLU A H    4  
ATOM 7524  H HA   . GLU A 1 107 ? -15.567 -10.997 -14.753 1.00 0.00 ? 107 GLU A HA   4  
ATOM 7525  H HB2  . GLU A 1 107 ? -15.963 -10.748 -12.414 1.00 0.00 ? 107 GLU A HB2  4  
ATOM 7526  H HB3  . GLU A 1 107 ? -14.687 -11.892 -11.974 1.00 0.00 ? 107 GLU A HB3  4  
ATOM 7527  H HG2  . GLU A 1 107 ? -13.950 -9.376  -13.626 1.00 0.00 ? 107 GLU A HG2  4  
ATOM 7528  H HG3  . GLU A 1 107 ? -14.394 -9.253  -11.920 1.00 0.00 ? 107 GLU A HG3  4  
ATOM 7529  N N    . LYS A 1 108 ? -13.355 -13.328 -14.331 1.00 0.00 ? 108 LYS A N    4  
ATOM 7530  C CA   . LYS A 1 108 ? -12.028 -13.847 -14.620 1.00 0.00 ? 108 LYS A CA   4  
ATOM 7531  C C    . LYS A 1 108 ? -11.831 -14.389 -16.055 1.00 0.00 ? 108 LYS A C    4  
ATOM 7532  O O    . LYS A 1 108 ? -10.721 -14.702 -16.475 1.00 0.00 ? 108 LYS A O    4  
ATOM 7533  C CB   . LYS A 1 108 ? -11.636 -14.961 -13.614 1.00 0.00 ? 108 LYS A CB   4  
ATOM 7534  C CG   . LYS A 1 108 ? -11.461 -14.479 -12.160 1.00 0.00 ? 108 LYS A CG   4  
ATOM 7535  C CD   . LYS A 1 108 ? -10.320 -13.481 -11.894 1.00 0.00 ? 108 LYS A CD   4  
ATOM 7536  C CE   . LYS A 1 108 ? -8.917  -14.025 -12.197 1.00 0.00 ? 108 LYS A CE   4  
ATOM 7537  N NZ   . LYS A 1 108 ? -7.886  -13.013 -11.875 1.00 0.00 ? 108 LYS A NZ   4  
ATOM 7538  H H    . LYS A 1 108 ? -14.043 -13.873 -13.833 1.00 0.00 ? 108 LYS A H    4  
ATOM 7539  H HA   . LYS A 1 108 ? -11.358 -13.005 -14.461 1.00 0.00 ? 108 LYS A HA   4  
ATOM 7540  H HB2  . LYS A 1 108 ? -12.432 -15.744 -13.622 1.00 0.00 ? 108 LYS A HB2  4  
ATOM 7541  H HB3  . LYS A 1 108 ? -10.697 -15.455 -13.938 1.00 0.00 ? 108 LYS A HB3  4  
ATOM 7542  H HG2  . LYS A 1 108 ? -12.419 -14.018 -11.841 1.00 0.00 ? 108 LYS A HG2  4  
ATOM 7543  H HG3  . LYS A 1 108 ? -11.301 -15.370 -11.508 1.00 0.00 ? 108 LYS A HG3  4  
ATOM 7544  H HD2  . LYS A 1 108 ? -10.509 -12.558 -12.487 1.00 0.00 ? 108 LYS A HD2  4  
ATOM 7545  H HD3  . LYS A 1 108 ? -10.368 -13.192 -10.818 1.00 0.00 ? 108 LYS A HD3  4  
ATOM 7546  H HE2  . LYS A 1 108 ? -8.705  -14.929 -11.586 1.00 0.00 ? 108 LYS A HE2  4  
ATOM 7547  H HE3  . LYS A 1 108 ? -8.808  -14.280 -13.272 1.00 0.00 ? 108 LYS A HE3  4  
ATOM 7548  H HZ1  . LYS A 1 108 ? -7.944  -12.767 -10.866 1.00 0.00 ? 108 LYS A HZ1  4  
ATOM 7549  H HZ2  . LYS A 1 108 ? -6.943  -13.400 -12.084 1.00 0.00 ? 108 LYS A HZ2  4  
ATOM 7550  H HZ3  . LYS A 1 108 ? -8.044  -12.160 -12.449 1.00 0.00 ? 108 LYS A HZ3  4  
ATOM 7551  N N    . LYS A 1 109 ? -12.918 -14.501 -16.863 1.00 0.00 ? 109 LYS A N    4  
ATOM 7552  C CA   . LYS A 1 109 ? -13.007 -15.009 -18.235 1.00 0.00 ? 109 LYS A CA   4  
ATOM 7553  C C    . LYS A 1 109 ? -12.587 -13.999 -19.313 1.00 0.00 ? 109 LYS A C    4  
ATOM 7554  O O    . LYS A 1 109 ? -13.282 -13.733 -20.294 1.00 0.00 ? 109 LYS A O    4  
ATOM 7555  C CB   . LYS A 1 109 ? -14.454 -15.530 -18.456 1.00 0.00 ? 109 LYS A CB   4  
ATOM 7556  C CG   . LYS A 1 109 ? -14.764 -16.800 -17.643 1.00 0.00 ? 109 LYS A CG   4  
ATOM 7557  C CD   . LYS A 1 109 ? -14.061 -18.055 -18.189 1.00 0.00 ? 109 LYS A CD   4  
ATOM 7558  C CE   . LYS A 1 109 ? -14.356 -19.328 -17.376 1.00 0.00 ? 109 LYS A CE   4  
ATOM 7559  N NZ   . LYS A 1 109 ? -13.785 -19.236 -16.011 1.00 0.00 ? 109 LYS A NZ   4  
ATOM 7560  H H    . LYS A 1 109 ? -13.791 -14.229 -16.468 1.00 0.00 ? 109 LYS A H    4  
ATOM 7561  H HA   . LYS A 1 109 ? -12.323 -15.843 -18.332 1.00 0.00 ? 109 LYS A HA   4  
ATOM 7562  H HB2  . LYS A 1 109 ? -15.162 -14.727 -18.153 1.00 0.00 ? 109 LYS A HB2  4  
ATOM 7563  H HB3  . LYS A 1 109 ? -14.681 -15.761 -19.512 1.00 0.00 ? 109 LYS A HB3  4  
ATOM 7564  H HG2  . LYS A 1 109 ? -14.475 -16.638 -16.583 1.00 0.00 ? 109 LYS A HG2  4  
ATOM 7565  H HG3  . LYS A 1 109 ? -15.864 -16.977 -17.660 1.00 0.00 ? 109 LYS A HG3  4  
ATOM 7566  H HD2  . LYS A 1 109 ? -14.394 -18.211 -19.240 1.00 0.00 ? 109 LYS A HD2  4  
ATOM 7567  H HD3  . LYS A 1 109 ? -12.961 -17.886 -18.208 1.00 0.00 ? 109 LYS A HD3  4  
ATOM 7568  H HE2  . LYS A 1 109 ? -15.452 -19.483 -17.271 1.00 0.00 ? 109 LYS A HE2  4  
ATOM 7569  H HE3  . LYS A 1 109 ? -13.907 -20.221 -17.861 1.00 0.00 ? 109 LYS A HE3  4  
ATOM 7570  H HZ1  . LYS A 1 109 ? -12.754 -19.105 -16.076 1.00 0.00 ? 109 LYS A HZ1  4  
ATOM 7571  H HZ2  . LYS A 1 109 ? -14.207 -18.427 -15.512 1.00 0.00 ? 109 LYS A HZ2  4  
ATOM 7572  H HZ3  . LYS A 1 109 ? -13.990 -20.112 -15.490 1.00 0.00 ? 109 LYS A HZ3  4  
ATOM 7573  N N    . LYS A 1 110 ? -11.382 -13.419 -19.126 1.00 0.00 ? 110 LYS A N    4  
ATOM 7574  C CA   . LYS A 1 110 ? -10.757 -12.411 -19.957 1.00 0.00 ? 110 LYS A CA   4  
ATOM 7575  C C    . LYS A 1 110 ? -9.653  -13.020 -20.812 1.00 0.00 ? 110 LYS A C    4  
ATOM 7576  O O    . LYS A 1 110 ? -8.694  -13.608 -20.316 1.00 0.00 ? 110 LYS A O    4  
ATOM 7577  C CB   . LYS A 1 110 ? -10.215 -11.279 -19.049 1.00 0.00 ? 110 LYS A CB   4  
ATOM 7578  C CG   . LYS A 1 110 ? -9.693  -10.036 -19.790 1.00 0.00 ? 110 LYS A CG   4  
ATOM 7579  C CD   . LYS A 1 110 ? -9.344  -8.900  -18.818 1.00 0.00 ? 110 LYS A CD   4  
ATOM 7580  C CE   . LYS A 1 110 ? -8.786  -7.661  -19.530 1.00 0.00 ? 110 LYS A CE   4  
ATOM 7581  N NZ   . LYS A 1 110 ? -8.459  -6.593  -18.556 1.00 0.00 ? 110 LYS A NZ   4  
ATOM 7582  H H    . LYS A 1 110 ? -10.882 -13.696 -18.302 1.00 0.00 ? 110 LYS A H    4  
ATOM 7583  H HA   . LYS A 1 110 ? -11.490 -11.975 -20.625 1.00 0.00 ? 110 LYS A HA   4  
ATOM 7584  H HB2  . LYS A 1 110 ? -11.057 -10.952 -18.397 1.00 0.00 ? 110 LYS A HB2  4  
ATOM 7585  H HB3  . LYS A 1 110 ? -9.422  -11.671 -18.374 1.00 0.00 ? 110 LYS A HB3  4  
ATOM 7586  H HG2  . LYS A 1 110 ? -8.782  -10.296 -20.372 1.00 0.00 ? 110 LYS A HG2  4  
ATOM 7587  H HG3  . LYS A 1 110 ? -10.463 -9.671  -20.507 1.00 0.00 ? 110 LYS A HG3  4  
ATOM 7588  H HD2  . LYS A 1 110 ? -10.262 -8.624  -18.248 1.00 0.00 ? 110 LYS A HD2  4  
ATOM 7589  H HD3  . LYS A 1 110 ? -8.596  -9.281  -18.088 1.00 0.00 ? 110 LYS A HD3  4  
ATOM 7590  H HE2  . LYS A 1 110 ? -7.854  -7.909  -20.081 1.00 0.00 ? 110 LYS A HE2  4  
ATOM 7591  H HE3  . LYS A 1 110 ? -9.529  -7.247  -20.245 1.00 0.00 ? 110 LYS A HE3  4  
ATOM 7592  H HZ1  . LYS A 1 110 ? -7.750  -6.943  -17.882 1.00 0.00 ? 110 LYS A HZ1  4  
ATOM 7593  H HZ2  . LYS A 1 110 ? -8.079  -5.767  -19.061 1.00 0.00 ? 110 LYS A HZ2  4  
ATOM 7594  H HZ3  . LYS A 1 110 ? -9.320  -6.318  -18.041 1.00 0.00 ? 110 LYS A HZ3  4  
ATOM 7595  N N    . LYS A 1 111 ? -9.772  -12.883 -22.152 1.00 0.00 ? 111 LYS A N    4  
ATOM 7596  C CA   . LYS A 1 111 ? -8.814  -13.398 -23.112 1.00 0.00 ? 111 LYS A CA   4  
ATOM 7597  C C    . LYS A 1 111 ? -8.969  -12.566 -24.363 1.00 0.00 ? 111 LYS A C    4  
ATOM 7598  O O    . LYS A 1 111 ? -9.913  -11.777 -24.456 1.00 0.00 ? 111 LYS A O    4  
ATOM 7599  C CB   . LYS A 1 111 ? -9.012  -14.915 -23.405 1.00 0.00 ? 111 LYS A CB   4  
ATOM 7600  C CG   . LYS A 1 111 ? -10.414 -15.323 -23.895 1.00 0.00 ? 111 LYS A CG   4  
ATOM 7601  C CD   . LYS A 1 111 ? -10.585 -16.849 -23.940 1.00 0.00 ? 111 LYS A CD   4  
ATOM 7602  C CE   . LYS A 1 111 ? -11.984 -17.272 -24.413 1.00 0.00 ? 111 LYS A CE   4  
ATOM 7603  N NZ   . LYS A 1 111 ? -12.120 -18.749 -24.419 1.00 0.00 ? 111 LYS A NZ   4  
ATOM 7604  H H    . LYS A 1 111 ? -10.532 -12.395 -22.582 1.00 0.00 ? 111 LYS A H    4  
ATOM 7605  H HA   . LYS A 1 111 ? -7.806  -13.235 -22.746 1.00 0.00 ? 111 LYS A HA   4  
ATOM 7606  H HB2  . LYS A 1 111 ? -8.250  -15.274 -24.132 1.00 0.00 ? 111 LYS A HB2  4  
ATOM 7607  H HB3  . LYS A 1 111 ? -8.825  -15.458 -22.450 1.00 0.00 ? 111 LYS A HB3  4  
ATOM 7608  H HG2  . LYS A 1 111 ? -11.183 -14.911 -23.203 1.00 0.00 ? 111 LYS A HG2  4  
ATOM 7609  H HG3  . LYS A 1 111 ? -10.608 -14.906 -24.909 1.00 0.00 ? 111 LYS A HG3  4  
ATOM 7610  H HD2  . LYS A 1 111 ? -9.813  -17.278 -24.617 1.00 0.00 ? 111 LYS A HD2  4  
ATOM 7611  H HD3  . LYS A 1 111 ? -10.405 -17.247 -22.915 1.00 0.00 ? 111 LYS A HD3  4  
ATOM 7612  H HE2  . LYS A 1 111 ? -12.768 -16.865 -23.738 1.00 0.00 ? 111 LYS A HE2  4  
ATOM 7613  H HE3  . LYS A 1 111 ? -12.177 -16.912 -25.446 1.00 0.00 ? 111 LYS A HE3  4  
ATOM 7614  H HZ1  . LYS A 1 111 ? -11.966 -19.113 -23.458 1.00 0.00 ? 111 LYS A HZ1  4  
ATOM 7615  H HZ2  . LYS A 1 111 ? -13.074 -19.008 -24.742 1.00 0.00 ? 111 LYS A HZ2  4  
ATOM 7616  H HZ3  . LYS A 1 111 ? -11.412 -19.158 -25.064 1.00 0.00 ? 111 LYS A HZ3  4  
ATOM 7617  N N    . GLY A 1 1   ? 1.088   13.275  5.213   1.00 0.00 ? 1   GLY A N    5  
ATOM 7618  C CA   . GLY A 1 1   ? -0.250  13.674  5.588   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7619  C C    . GLY A 1 1   ? -0.698  14.808  4.727   1.00 0.00 ? 1   GLY A C    5  
ATOM 7620  O O    . GLY A 1 1   ? -1.886  15.003  4.492   1.00 0.00 ? 1   GLY A O    5  
ATOM 7621  H H    . GLY A 1 1   ? 1.315   12.300  5.279   1.00 0.00 ? 1   GLY A H    5  
ATOM 7622  H HA2  . GLY A 1 1   ? -0.921  12.844  5.415   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7623  H HA3  . GLY A 1 1   ? -0.221  14.021  6.609   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7624  N N    . GLN A 1 2   ? 0.288   15.588  4.229   1.00 0.00 ? 2   GLN A N    5  
ATOM 7625  C CA   . GLN A 1 2   ? 0.113   16.719  3.336   1.00 0.00 ? 2   GLN A CA   5  
ATOM 7626  C C    . GLN A 1 2   ? 0.941   16.491  2.081   1.00 0.00 ? 2   GLN A C    5  
ATOM 7627  O O    . GLN A 1 2   ? 2.065   15.981  2.132   1.00 0.00 ? 2   GLN A O    5  
ATOM 7628  C CB   . GLN A 1 2   ? 0.556   18.084  3.960   1.00 0.00 ? 2   GLN A CB   5  
ATOM 7629  C CG   . GLN A 1 2   ? -0.320  18.532  5.161   1.00 0.00 ? 2   GLN A CG   5  
ATOM 7630  C CD   . GLN A 1 2   ? 0.053   19.896  5.773   1.00 0.00 ? 2   GLN A CD   5  
ATOM 7631  O OE1  . GLN A 1 2   ? -0.493  20.300  6.804   1.00 0.00 ? 2   GLN A OE1  5  
ATOM 7632  N NE2  . GLN A 1 2   ? 0.988   20.638  5.128   1.00 0.00 ? 2   GLN A NE2  5  
ATOM 7633  H H    . GLN A 1 2   ? 1.226   15.334  4.461   1.00 0.00 ? 2   GLN A H    5  
ATOM 7634  H HA   . GLN A 1 2   ? -0.923  16.808  3.031   1.00 0.00 ? 2   GLN A HA   5  
ATOM 7635  H HB2  . GLN A 1 2   ? 1.608   18.001  4.315   1.00 0.00 ? 2   GLN A HB2  5  
ATOM 7636  H HB3  . GLN A 1 2   ? 0.521   18.876  3.170   1.00 0.00 ? 2   GLN A HB3  5  
ATOM 7637  H HG2  . GLN A 1 2   ? -1.386  18.597  4.851   1.00 0.00 ? 2   GLN A HG2  5  
ATOM 7638  H HG3  . GLN A 1 2   ? -0.253  17.779  5.975   1.00 0.00 ? 2   GLN A HG3  5  
ATOM 7639  H HE21 . GLN A 1 2   ? 1.434   20.284  4.314   1.00 0.00 ? 2   GLN A HE21 5  
ATOM 7640  H HE22 . GLN A 1 2   ? 1.212   21.530  5.514   1.00 0.00 ? 2   GLN A HE22 5  
ATOM 7641  N N    . ARG A 1 3   ? 0.381   16.949  0.930   1.00 0.00 ? 3   ARG A N    5  
ATOM 7642  C CA   . ARG A 1 3   ? 0.921   17.093  -0.422  1.00 0.00 ? 3   ARG A CA   5  
ATOM 7643  C C    . ARG A 1 3   ? 1.790   16.009  -1.062  1.00 0.00 ? 3   ARG A C    5  
ATOM 7644  O O    . ARG A 1 3   ? 1.384   15.374  -2.031  1.00 0.00 ? 3   ARG A O    5  
ATOM 7645  C CB   . ARG A 1 3   ? 1.584   18.496  -0.504  1.00 0.00 ? 3   ARG A CB   5  
ATOM 7646  C CG   . ARG A 1 3   ? 0.558   19.639  -0.510  1.00 0.00 ? 3   ARG A CG   5  
ATOM 7647  C CD   . ARG A 1 3   ? 1.204   21.017  -0.705  1.00 0.00 ? 3   ARG A CD   5  
ATOM 7648  N NE   . ARG A 1 3   ? 0.116   22.057  -0.705  1.00 0.00 ? 3   ARG A NE   5  
ATOM 7649  C CZ   . ARG A 1 3   ? 0.353   23.387  -0.934  1.00 0.00 ? 3   ARG A CZ   5  
ATOM 7650  N NH1  . ARG A 1 3   ? 1.617   23.842  -1.174  1.00 0.00 ? 3   ARG A NH1  5  
ATOM 7651  N NH2  . ARG A 1 3   ? -0.691  24.267  -0.921  1.00 0.00 ? 3   ARG A NH2  5  
ATOM 7652  H H    . ARG A 1 3   ? -0.529  17.345  0.998   1.00 0.00 ? 3   ARG A H    5  
ATOM 7653  H HA   . ARG A 1 3   ? 0.048   17.087  -1.058  1.00 0.00 ? 3   ARG A HA   5  
ATOM 7654  H HB2  . ARG A 1 3   ? 2.183   18.653  0.424   1.00 0.00 ? 3   ARG A HB2  5  
ATOM 7655  H HB3  . ARG A 1 3   ? 2.227   18.618  -1.402  1.00 0.00 ? 3   ARG A HB3  5  
ATOM 7656  H HG2  . ARG A 1 3   ? -0.192  19.460  -1.312  1.00 0.00 ? 3   ARG A HG2  5  
ATOM 7657  H HG3  . ARG A 1 3   ? 0.054   19.628  0.478   1.00 0.00 ? 3   ARG A HG3  5  
ATOM 7658  H HD2  . ARG A 1 3   ? 1.901   21.223  0.135   1.00 0.00 ? 3   ARG A HD2  5  
ATOM 7659  H HD3  . ARG A 1 3   ? 1.748   21.049  -1.674  1.00 0.00 ? 3   ARG A HD3  5  
ATOM 7660  H HE   . ARG A 1 3   ? -0.823  21.762  -0.532  1.00 0.00 ? 3   ARG A HE   5  
ATOM 7661  H HH11 . ARG A 1 3   ? 2.384   23.200  -1.186  1.00 0.00 ? 3   ARG A HH11 5  
ATOM 7662  H HH12 . ARG A 1 3   ? 1.775   24.815  -1.341  1.00 0.00 ? 3   ARG A HH12 5  
ATOM 7663  H HH21 . ARG A 1 3   ? -1.619  23.938  -0.748  1.00 0.00 ? 3   ARG A HH21 5  
ATOM 7664  H HH22 . ARG A 1 3   ? -0.528  25.239  -1.089  1.00 0.00 ? 3   ARG A HH22 5  
ATOM 7665  N N    . GLN A 1 4   ? 3.014   15.778  -0.520  1.00 0.00 ? 4   GLN A N    5  
ATOM 7666  C CA   . GLN A 1 4   ? 3.985   14.765  -0.932  1.00 0.00 ? 4   GLN A CA   5  
ATOM 7667  C C    . GLN A 1 4   ? 3.630   13.399  -0.363  1.00 0.00 ? 4   GLN A C    5  
ATOM 7668  O O    . GLN A 1 4   ? 3.964   12.367  -0.948  1.00 0.00 ? 4   GLN A O    5  
ATOM 7669  C CB   . GLN A 1 4   ? 5.409   15.159  -0.426  1.00 0.00 ? 4   GLN A CB   5  
ATOM 7670  C CG   . GLN A 1 4   ? 6.578   14.173  -0.703  1.00 0.00 ? 4   GLN A CG   5  
ATOM 7671  C CD   . GLN A 1 4   ? 6.800   13.924  -2.192  1.00 0.00 ? 4   GLN A CD   5  
ATOM 7672  O OE1  . GLN A 1 4   ? 7.512   14.678  -2.854  1.00 0.00 ? 4   GLN A OE1  5  
ATOM 7673  N NE2  . GLN A 1 4   ? 6.194   12.838  -2.735  1.00 0.00 ? 4   GLN A NE2  5  
ATOM 7674  H H    . GLN A 1 4   ? 3.268   16.327  0.274   1.00 0.00 ? 4   GLN A H    5  
ATOM 7675  H HA   . GLN A 1 4   ? 3.990   14.680  -2.012  1.00 0.00 ? 4   GLN A HA   5  
ATOM 7676  H HB2  . GLN A 1 4   ? 5.669   16.141  -0.880  1.00 0.00 ? 4   GLN A HB2  5  
ATOM 7677  H HB3  . GLN A 1 4   ? 5.374   15.302  0.680   1.00 0.00 ? 4   GLN A HB3  5  
ATOM 7678  H HG2  . GLN A 1 4   ? 7.517   14.612  -0.301  1.00 0.00 ? 4   GLN A HG2  5  
ATOM 7679  H HG3  . GLN A 1 4   ? 6.424   13.204  -0.186  1.00 0.00 ? 4   GLN A HG3  5  
ATOM 7680  H HE21 . GLN A 1 4   ? 5.498   12.351  -2.197  1.00 0.00 ? 4   GLN A HE21 5  
ATOM 7681  H HE22 . GLN A 1 4   ? 6.357   12.643  -3.698  1.00 0.00 ? 4   GLN A HE22 5  
ATOM 7682  N N    . LEU A 1 5   ? 2.955   13.432  0.830   1.00 0.00 ? 5   LEU A N    5  
ATOM 7683  C CA   . LEU A 1 5   ? 2.509   12.337  1.697   1.00 0.00 ? 5   LEU A CA   5  
ATOM 7684  C C    . LEU A 1 5   ? 3.713   11.773  2.452   1.00 0.00 ? 5   LEU A C    5  
ATOM 7685  O O    . LEU A 1 5   ? 3.937   10.572  2.525   1.00 0.00 ? 5   LEU A O    5  
ATOM 7686  C CB   . LEU A 1 5   ? 1.607   11.271  0.994   1.00 0.00 ? 5   LEU A CB   5  
ATOM 7687  C CG   . LEU A 1 5   ? 0.097   11.635  0.903   1.00 0.00 ? 5   LEU A CG   5  
ATOM 7688  C CD1  . LEU A 1 5   ? -0.614  11.431  2.255   1.00 0.00 ? 5   LEU A CD1  5  
ATOM 7689  C CD2  . LEU A 1 5   ? -0.196  13.039  0.337   1.00 0.00 ? 5   LEU A CD2  5  
ATOM 7690  H H    . LEU A 1 5   ? 2.723   14.343  1.178   1.00 0.00 ? 5   LEU A H    5  
ATOM 7691  H HA   . LEU A 1 5   ? 1.897   12.794  2.461   1.00 0.00 ? 5   LEU A HA   5  
ATOM 7692  H HB2  . LEU A 1 5   ? 2.001   11.081  -0.026  1.00 0.00 ? 5   LEU A HB2  5  
ATOM 7693  H HB3  . LEU A 1 5   ? 1.650   10.300  1.537   1.00 0.00 ? 5   LEU A HB3  5  
ATOM 7694  H HG   . LEU A 1 5   ? -0.358  10.901  0.193   1.00 0.00 ? 5   LEU A HG   5  
ATOM 7695  H HD11 . LEU A 1 5   ? -0.479  10.391  2.620   1.00 0.00 ? 5   LEU A HD11 5  
ATOM 7696  H HD12 . LEU A 1 5   ? -0.203  12.132  3.010   1.00 0.00 ? 5   LEU A HD12 5  
ATOM 7697  H HD13 . LEU A 1 5   ? -1.702  11.628  2.148   1.00 0.00 ? 5   LEU A HD13 5  
ATOM 7698  H HD21 . LEU A 1 5   ? 0.266   13.168  -0.665  1.00 0.00 ? 5   LEU A HD21 5  
ATOM 7699  H HD22 . LEU A 1 5   ? -1.289  13.199  0.236   1.00 0.00 ? 5   LEU A HD22 5  
ATOM 7700  H HD23 . LEU A 1 5   ? 0.208   13.833  0.997   1.00 0.00 ? 5   LEU A HD23 5  
ATOM 7701  N N    . LEU A 1 6   ? 4.542   12.708  2.983   1.00 0.00 ? 6   LEU A N    5  
ATOM 7702  C CA   . LEU A 1 6   ? 5.838   12.497  3.608   1.00 0.00 ? 6   LEU A CA   5  
ATOM 7703  C C    . LEU A 1 6   ? 5.806   12.154  5.102   1.00 0.00 ? 6   LEU A C    5  
ATOM 7704  O O    . LEU A 1 6   ? 6.547   11.303  5.590   1.00 0.00 ? 6   LEU A O    5  
ATOM 7705  C CB   . LEU A 1 6   ? 6.711   13.722  3.259   1.00 0.00 ? 6   LEU A CB   5  
ATOM 7706  C CG   . LEU A 1 6   ? 8.252   13.564  3.176   1.00 0.00 ? 6   LEU A CG   5  
ATOM 7707  C CD1  . LEU A 1 6   ? 8.923   13.580  4.554   1.00 0.00 ? 6   LEU A CD1  5  
ATOM 7708  C CD2  . LEU A 1 6   ? 8.715   12.359  2.342   1.00 0.00 ? 6   LEU A CD2  5  
ATOM 7709  H H    . LEU A 1 6   ? 4.295   13.663  2.864   1.00 0.00 ? 6   LEU A H    5  
ATOM 7710  H HA   . LEU A 1 6   ? 6.332   11.707  3.106   1.00 0.00 ? 6   LEU A HA   5  
ATOM 7711  H HB2  . LEU A 1 6   ? 6.386   14.072  2.255   1.00 0.00 ? 6   LEU A HB2  5  
ATOM 7712  H HB3  . LEU A 1 6   ? 6.470   14.517  3.969   1.00 0.00 ? 6   LEU A HB3  5  
ATOM 7713  H HG   . LEU A 1 6   ? 8.614   14.480  2.642   1.00 0.00 ? 6   LEU A HG   5  
ATOM 7714  H HD11 . LEU A 1 6   ? 8.577   14.464  5.131   1.00 0.00 ? 6   LEU A HD11 5  
ATOM 7715  H HD12 . LEU A 1 6   ? 8.685   12.656  5.117   1.00 0.00 ? 6   LEU A HD12 5  
ATOM 7716  H HD13 . LEU A 1 6   ? 10.026  13.639  4.442   1.00 0.00 ? 6   LEU A HD13 5  
ATOM 7717  H HD21 . LEU A 1 6   ? 8.202   12.344  1.357   1.00 0.00 ? 6   LEU A HD21 5  
ATOM 7718  H HD22 . LEU A 1 6   ? 9.811   12.409  2.169   1.00 0.00 ? 6   LEU A HD22 5  
ATOM 7719  H HD23 . LEU A 1 6   ? 8.498   11.407  2.875   1.00 0.00 ? 6   LEU A HD23 5  
ATOM 7720  N N    . LEU A 1 7   ? 4.945   12.865  5.885   1.00 0.00 ? 7   LEU A N    5  
ATOM 7721  C CA   . LEU A 1 7   ? 4.730   12.693  7.326   1.00 0.00 ? 7   LEU A CA   5  
ATOM 7722  C C    . LEU A 1 7   ? 5.799   13.200  8.252   1.00 0.00 ? 7   LEU A C    5  
ATOM 7723  O O    . LEU A 1 7   ? 5.471   13.763  9.291   1.00 0.00 ? 7   LEU A O    5  
ATOM 7724  C CB   . LEU A 1 7   ? 4.193   11.295  7.685   1.00 0.00 ? 7   LEU A CB   5  
ATOM 7725  C CG   . LEU A 1 7   ? 3.641   11.104  9.112   1.00 0.00 ? 7   LEU A CG   5  
ATOM 7726  C CD1  . LEU A 1 7   ? 2.538   12.094  9.524   1.00 0.00 ? 7   LEU A CD1  5  
ATOM 7727  C CD2  . LEU A 1 7   ? 3.062   9.696   9.184   1.00 0.00 ? 7   LEU A CD2  5  
ATOM 7728  H H    . LEU A 1 7   ? 4.367   13.551  5.448   1.00 0.00 ? 7   LEU A H    5  
ATOM 7729  H HA   . LEU A 1 7   ? 3.963   13.380  7.595   1.00 0.00 ? 7   LEU A HA   5  
ATOM 7730  H HB2  . LEU A 1 7   ? 3.379   11.070  6.961   1.00 0.00 ? 7   LEU A HB2  5  
ATOM 7731  H HB3  . LEU A 1 7   ? 4.994   10.541  7.519   1.00 0.00 ? 7   LEU A HB3  5  
ATOM 7732  H HG   . LEU A 1 7   ? 4.492   11.194  9.829   1.00 0.00 ? 7   LEU A HG   5  
ATOM 7733  H HD11 . LEU A 1 7   ? 1.702   12.062  8.796   1.00 0.00 ? 7   LEU A HD11 5  
ATOM 7734  H HD12 . LEU A 1 7   ? 2.141   11.820  10.527  1.00 0.00 ? 7   LEU A HD12 5  
ATOM 7735  H HD13 . LEU A 1 7   ? 2.931   13.131  9.580   1.00 0.00 ? 7   LEU A HD13 5  
ATOM 7736  H HD21 . LEU A 1 7   ? 3.838   8.948   8.921   1.00 0.00 ? 7   LEU A HD21 5  
ATOM 7737  H HD22 . LEU A 1 7   ? 2.662   9.485   10.197  1.00 0.00 ? 7   LEU A HD22 5  
ATOM 7738  H HD23 . LEU A 1 7   ? 2.241   9.635   8.441   1.00 0.00 ? 7   LEU A HD23 5  
ATOM 7739  N N    . ALA A 1 8   ? 7.090   13.031  7.870   1.00 0.00 ? 8   ALA A N    5  
ATOM 7740  C CA   . ALA A 1 8   ? 8.268   13.599  8.500   1.00 0.00 ? 8   ALA A CA   5  
ATOM 7741  C C    . ALA A 1 8   ? 8.842   12.747  9.629   1.00 0.00 ? 8   ALA A C    5  
ATOM 7742  O O    . ALA A 1 8   ? 9.708   13.161  10.395  1.00 0.00 ? 8   ALA A O    5  
ATOM 7743  C CB   . ALA A 1 8   ? 7.991   15.078  8.874   1.00 0.00 ? 8   ALA A CB   5  
ATOM 7744  H H    . ALA A 1 8   ? 7.243   12.520  7.021   1.00 0.00 ? 8   ALA A H    5  
ATOM 7745  H HA   . ALA A 1 8   ? 9.006   13.596  7.717   1.00 0.00 ? 8   ALA A HA   5  
ATOM 7746  H HB1  . ALA A 1 8   ? 7.362   15.512  8.057   1.00 0.00 ? 8   ALA A HB1  5  
ATOM 7747  H HB2  . ALA A 1 8   ? 8.921   15.661  9.019   1.00 0.00 ? 8   ALA A HB2  5  
ATOM 7748  H HB3  . ALA A 1 8   ? 7.355   15.135  9.784   1.00 0.00 ? 8   ALA A HB3  5  
ATOM 7749  N N    . SER A 1 9   ? 8.307   11.508  9.706   1.00 0.00 ? 9   SER A N    5  
ATOM 7750  C CA   . SER A 1 9   ? 8.547   10.433  10.651  1.00 0.00 ? 9   SER A CA   5  
ATOM 7751  C C    . SER A 1 9   ? 7.591   9.374   10.124  1.00 0.00 ? 9   SER A C    5  
ATOM 7752  O O    . SER A 1 9   ? 7.213   9.458   8.958   1.00 0.00 ? 9   SER A O    5  
ATOM 7753  C CB   . SER A 1 9   ? 8.250   10.824  12.132  1.00 0.00 ? 9   SER A CB   5  
ATOM 7754  O OG   . SER A 1 9   ? 8.622   9.796   13.056  1.00 0.00 ? 9   SER A OG   5  
ATOM 7755  H H    . SER A 1 9   ? 7.623   11.260  9.015   1.00 0.00 ? 9   SER A H    5  
ATOM 7756  H HA   . SER A 1 9   ? 9.562   10.079  10.536  1.00 0.00 ? 9   SER A HA   5  
ATOM 7757  H HB2  . SER A 1 9   ? 8.854   11.731  12.366  1.00 0.00 ? 9   SER A HB2  5  
ATOM 7758  H HB3  . SER A 1 9   ? 7.178   11.098  12.263  1.00 0.00 ? 9   SER A HB3  5  
ATOM 7759  H HG   . SER A 1 9   ? 8.892   10.247  13.865  1.00 0.00 ? 9   SER A HG   5  
ATOM 7760  N N    . GLU A 1 10  ? 7.141   8.381   10.927  1.00 0.00 ? 10  GLU A N    5  
ATOM 7761  C CA   . GLU A 1 10  ? 6.162   7.380   10.485  1.00 0.00 ? 10  GLU A CA   5  
ATOM 7762  C C    . GLU A 1 10  ? 4.919   7.386   11.365  1.00 0.00 ? 10  GLU A C    5  
ATOM 7763  O O    . GLU A 1 10  ? 4.610   8.353   12.058  1.00 0.00 ? 10  GLU A O    5  
ATOM 7764  C CB   . GLU A 1 10  ? 6.702   5.925   10.340  1.00 0.00 ? 10  GLU A CB   5  
ATOM 7765  C CG   . GLU A 1 10  ? 8.127   5.838   9.762   1.00 0.00 ? 10  GLU A CG   5  
ATOM 7766  C CD   . GLU A 1 10  ? 8.524   4.373   9.591   1.00 0.00 ? 10  GLU A CD   5  
ATOM 7767  O OE1  . GLU A 1 10  ? 8.741   3.947   8.424   1.00 0.00 ? 10  GLU A OE1  5  
ATOM 7768  O OE2  . GLU A 1 10  ? 8.618   3.659   10.625  1.00 0.00 ? 10  GLU A OE2  5  
ATOM 7769  H H    . GLU A 1 10  ? 7.456   8.363   11.877  1.00 0.00 ? 10  GLU A H    5  
ATOM 7770  H HA   . GLU A 1 10  ? 5.799   7.640   9.498   1.00 0.00 ? 10  GLU A HA   5  
ATOM 7771  H HB2  . GLU A 1 10  ? 6.660   5.388   11.310  1.00 0.00 ? 10  GLU A HB2  5  
ATOM 7772  H HB3  . GLU A 1 10  ? 6.029   5.377   9.639   1.00 0.00 ? 10  GLU A HB3  5  
ATOM 7773  H HG2  . GLU A 1 10  ? 8.156   6.354   8.778   1.00 0.00 ? 10  GLU A HG2  5  
ATOM 7774  H HG3  . GLU A 1 10  ? 8.851   6.332   10.444  1.00 0.00 ? 10  GLU A HG3  5  
ATOM 7775  N N    . ASN A 1 11  ? 4.167   6.258   11.319  1.00 0.00 ? 11  ASN A N    5  
ATOM 7776  C CA   . ASN A 1 11  ? 2.907   5.957   11.984  1.00 0.00 ? 11  ASN A CA   5  
ATOM 7777  C C    . ASN A 1 11  ? 1.707   6.752   11.441  1.00 0.00 ? 11  ASN A C    5  
ATOM 7778  O O    . ASN A 1 11  ? 1.097   7.546   12.160  1.00 0.00 ? 11  ASN A O    5  
ATOM 7779  C CB   . ASN A 1 11  ? 3.017   5.991   13.528  1.00 0.00 ? 11  ASN A CB   5  
ATOM 7780  C CG   . ASN A 1 11  ? 4.094   4.977   13.915  1.00 0.00 ? 11  ASN A CG   5  
ATOM 7781  O OD1  . ASN A 1 11  ? 4.093   3.845   13.423  1.00 0.00 ? 11  ASN A OD1  5  
ATOM 7782  N ND2  . ASN A 1 11  ? 5.057   5.394   14.771  1.00 0.00 ? 11  ASN A ND2  5  
ATOM 7783  H H    . ASN A 1 11  ? 4.486   5.509   10.748  1.00 0.00 ? 11  ASN A H    5  
ATOM 7784  H HA   . ASN A 1 11  ? 2.693   4.924   11.739  1.00 0.00 ? 11  ASN A HA   5  
ATOM 7785  H HB2  . ASN A 1 11  ? 3.320   7.009   13.845  1.00 0.00 ? 11  ASN A HB2  5  
ATOM 7786  H HB3  . ASN A 1 11  ? 2.066   5.701   14.019  1.00 0.00 ? 11  ASN A HB3  5  
ATOM 7787  H HD21 . ASN A 1 11  ? 5.058   6.338   15.093  1.00 0.00 ? 11  ASN A HD21 5  
ATOM 7788  H HD22 . ASN A 1 11  ? 5.742   4.725   15.054  1.00 0.00 ? 11  ASN A HD22 5  
ATOM 7789  N N    . PRO A 1 12  ? 1.323   6.558   10.148  1.00 0.00 ? 12  PRO A N    5  
ATOM 7790  C CA   . PRO A 1 12  ? 0.181   7.213   9.501   1.00 0.00 ? 12  PRO A CA   5  
ATOM 7791  C C    . PRO A 1 12  ? -1.165  6.633   9.971   1.00 0.00 ? 12  PRO A C    5  
ATOM 7792  O O    . PRO A 1 12  ? -1.864  5.975   9.211   1.00 0.00 ? 12  PRO A O    5  
ATOM 7793  C CB   . PRO A 1 12  ? 0.438   6.981   7.996   1.00 0.00 ? 12  PRO A CB   5  
ATOM 7794  C CG   . PRO A 1 12  ? 1.192   5.651   7.938   1.00 0.00 ? 12  PRO A CG   5  
ATOM 7795  C CD   . PRO A 1 12  ? 2.032   5.666   9.215   1.00 0.00 ? 12  PRO A CD   5  
ATOM 7796  H HA   . PRO A 1 12  ? 0.182   8.269   9.735   1.00 0.00 ? 12  PRO A HA   5  
ATOM 7797  H HB2  . PRO A 1 12  ? -0.491  6.969   7.373   1.00 0.00 ? 12  PRO A HB2  5  
ATOM 7798  H HB3  . PRO A 1 12  ? 1.139   7.778   7.639   1.00 0.00 ? 12  PRO A HB3  5  
ATOM 7799  H HG2  . PRO A 1 12  ? 0.458   4.817   7.995   1.00 0.00 ? 12  PRO A HG2  5  
ATOM 7800  H HG3  . PRO A 1 12  ? 1.816   5.535   7.030   1.00 0.00 ? 12  PRO A HG3  5  
ATOM 7801  H HD2  . PRO A 1 12  ? 2.148   4.632   9.619   1.00 0.00 ? 12  PRO A HD2  5  
ATOM 7802  H HD3  . PRO A 1 12  ? 3.050   6.078   9.003   1.00 0.00 ? 12  PRO A HD3  5  
ATOM 7803  N N    . GLN A 1 13  ? -1.545  6.921   11.240  1.00 0.00 ? 13  GLN A N    5  
ATOM 7804  C CA   . GLN A 1 13  ? -2.756  6.539   11.957  1.00 0.00 ? 13  GLN A CA   5  
ATOM 7805  C C    . GLN A 1 13  ? -3.992  7.281   11.466  1.00 0.00 ? 13  GLN A C    5  
ATOM 7806  O O    . GLN A 1 13  ? -4.997  6.704   11.059  1.00 0.00 ? 13  GLN A O    5  
ATOM 7807  C CB   . GLN A 1 13  ? -2.579  6.809   13.477  1.00 0.00 ? 13  GLN A CB   5  
ATOM 7808  C CG   . GLN A 1 13  ? -1.421  6.069   14.198  1.00 0.00 ? 13  GLN A CG   5  
ATOM 7809  C CD   . GLN A 1 13  ? -1.247  6.695   15.589  1.00 0.00 ? 13  GLN A CD   5  
ATOM 7810  O OE1  . GLN A 1 13  ? -1.654  7.844   15.797  1.00 0.00 ? 13  GLN A OE1  5  
ATOM 7811  N NE2  . GLN A 1 13  ? -0.651  5.960   16.565  1.00 0.00 ? 13  GLN A NE2  5  
ATOM 7812  H H    . GLN A 1 13  ? -0.873  7.434   11.782  1.00 0.00 ? 13  GLN A H    5  
ATOM 7813  H HA   . GLN A 1 13  ? -2.942  5.500   11.788  1.00 0.00 ? 13  GLN A HA   5  
ATOM 7814  H HB2  . GLN A 1 13  ? -2.373  7.897   13.585  1.00 0.00 ? 13  GLN A HB2  5  
ATOM 7815  H HB3  . GLN A 1 13  ? -3.521  6.588   14.034  1.00 0.00 ? 13  GLN A HB3  5  
ATOM 7816  H HG2  . GLN A 1 13  ? -1.645  4.987   14.286  1.00 0.00 ? 13  GLN A HG2  5  
ATOM 7817  H HG3  . GLN A 1 13  ? -0.471  6.201   13.646  1.00 0.00 ? 13  GLN A HG3  5  
ATOM 7818  H HE21 . GLN A 1 13  ? -0.271  5.067   16.344  1.00 0.00 ? 13  GLN A HE21 5  
ATOM 7819  H HE22 . GLN A 1 13  ? -0.581  6.366   17.476  1.00 0.00 ? 13  GLN A HE22 5  
ATOM 7820  N N    . GLN A 1 14  ? -3.879  8.630   11.451  1.00 0.00 ? 14  GLN A N    5  
ATOM 7821  C CA   . GLN A 1 14  ? -4.881  9.602   11.024  1.00 0.00 ? 14  GLN A CA   5  
ATOM 7822  C C    . GLN A 1 14  ? -4.911  9.756   9.504   1.00 0.00 ? 14  GLN A C    5  
ATOM 7823  O O    . GLN A 1 14  ? -5.784  10.425  8.958   1.00 0.00 ? 14  GLN A O    5  
ATOM 7824  C CB   . GLN A 1 14  ? -4.634  10.984  11.708  1.00 0.00 ? 14  GLN A CB   5  
ATOM 7825  C CG   . GLN A 1 14  ? -5.092  11.079  13.189  1.00 0.00 ? 14  GLN A CG   5  
ATOM 7826  C CD   . GLN A 1 14  ? -4.450  10.044  14.117  1.00 0.00 ? 14  GLN A CD   5  
ATOM 7827  O OE1  . GLN A 1 14  ? -5.124  9.139   14.615  1.00 0.00 ? 14  GLN A OE1  5  
ATOM 7828  N NE2  . GLN A 1 14  ? -3.120  10.177  14.361  1.00 0.00 ? 14  GLN A NE2  5  
ATOM 7829  H H    . GLN A 1 14  ? -3.037  9.047   11.780  1.00 0.00 ? 14  GLN A H    5  
ATOM 7830  H HA   . GLN A 1 14  ? -5.867  9.262   11.317  1.00 0.00 ? 14  GLN A HA   5  
ATOM 7831  H HB2  . GLN A 1 14  ? -3.560  11.255  11.623  1.00 0.00 ? 14  GLN A HB2  5  
ATOM 7832  H HB3  . GLN A 1 14  ? -5.213  11.781  11.182  1.00 0.00 ? 14  GLN A HB3  5  
ATOM 7833  H HG2  . GLN A 1 14  ? -4.872  12.095  13.580  1.00 0.00 ? 14  GLN A HG2  5  
ATOM 7834  H HG3  . GLN A 1 14  ? -6.192  10.926  13.239  1.00 0.00 ? 14  GLN A HG3  5  
ATOM 7835  H HE21 . GLN A 1 14  ? -2.617  10.953  13.989  1.00 0.00 ? 14  GLN A HE21 5  
ATOM 7836  H HE22 . GLN A 1 14  ? -2.681  9.475   14.932  1.00 0.00 ? 14  GLN A HE22 5  
ATOM 7837  N N    . PHE A 1 15  ? -3.949  9.112   8.790   1.00 0.00 ? 15  PHE A N    5  
ATOM 7838  C CA   . PHE A 1 15  ? -3.812  9.107   7.338   1.00 0.00 ? 15  PHE A CA   5  
ATOM 7839  C C    . PHE A 1 15  ? -3.908  7.679   6.818   1.00 0.00 ? 15  PHE A C    5  
ATOM 7840  O O    . PHE A 1 15  ? -3.548  7.399   5.676   1.00 0.00 ? 15  PHE A O    5  
ATOM 7841  C CB   . PHE A 1 15  ? -2.515  9.796   6.812   1.00 0.00 ? 15  PHE A CB   5  
ATOM 7842  C CG   . PHE A 1 15  ? -2.265  11.066  7.583   1.00 0.00 ? 15  PHE A CG   5  
ATOM 7843  C CD1  . PHE A 1 15  ? -2.986  12.214  7.302   1.00 0.00 ? 15  PHE A CD1  5  
ATOM 7844  C CD2  . PHE A 1 15  ? -1.380  11.082  8.647   1.00 0.00 ? 15  PHE A CD2  5  
ATOM 7845  C CE1  . PHE A 1 15  ? -2.824  13.352  8.065   1.00 0.00 ? 15  PHE A CE1  5  
ATOM 7846  C CE2  . PHE A 1 15  ? -1.228  12.214  9.422   1.00 0.00 ? 15  PHE A CE2  5  
ATOM 7847  C CZ   . PHE A 1 15  ? -1.946  13.356  9.129   1.00 0.00 ? 15  PHE A CZ   5  
ATOM 7848  H H    . PHE A 1 15  ? -3.265  8.597   9.298   1.00 0.00 ? 15  PHE A H    5  
ATOM 7849  H HA   . PHE A 1 15  ? -4.644  9.641   6.891   1.00 0.00 ? 15  PHE A HA   5  
ATOM 7850  H HB2  . PHE A 1 15  ? -1.624  9.140   6.895   1.00 0.00 ? 15  PHE A HB2  5  
ATOM 7851  H HB3  . PHE A 1 15  ? -2.636  10.069  5.742   1.00 0.00 ? 15  PHE A HB3  5  
ATOM 7852  H HD1  . PHE A 1 15  ? -3.699  12.217  6.488   1.00 0.00 ? 15  PHE A HD1  5  
ATOM 7853  H HD2  . PHE A 1 15  ? -0.825  10.189  8.896   1.00 0.00 ? 15  PHE A HD2  5  
ATOM 7854  H HE1  . PHE A 1 15  ? -3.393  14.241  7.823   1.00 0.00 ? 15  PHE A HE1  5  
ATOM 7855  H HE2  . PHE A 1 15  ? -0.561  12.195  10.273  1.00 0.00 ? 15  PHE A HE2  5  
ATOM 7856  H HZ   . PHE A 1 15  ? -1.821  14.250  9.727   1.00 0.00 ? 15  PHE A HZ   5  
ATOM 7857  N N    . MET A 1 16  ? -4.469  6.736   7.651   1.00 0.00 ? 16  MET A N    5  
ATOM 7858  C CA   . MET A 1 16  ? -4.762  5.320   7.376   1.00 0.00 ? 16  MET A CA   5  
ATOM 7859  C C    . MET A 1 16  ? -5.919  5.207   6.427   1.00 0.00 ? 16  MET A C    5  
ATOM 7860  O O    . MET A 1 16  ? -6.003  4.249   5.672   1.00 0.00 ? 16  MET A O    5  
ATOM 7861  C CB   . MET A 1 16  ? -5.095  4.543   8.693   1.00 0.00 ? 16  MET A CB   5  
ATOM 7862  C CG   . MET A 1 16  ? -5.792  3.142   8.665   1.00 0.00 ? 16  MET A CG   5  
ATOM 7863  S SD   . MET A 1 16  ? -7.637  3.181   8.613   1.00 0.00 ? 16  MET A SD   5  
ATOM 7864  C CE   . MET A 1 16  ? -8.204  1.438   8.565   1.00 0.00 ? 16  MET A CE   5  
ATOM 7865  H H    . MET A 1 16  ? -4.741  7.032   8.565   1.00 0.00 ? 16  MET A H    5  
ATOM 7866  H HA   . MET A 1 16  ? -3.911  4.863   6.871   1.00 0.00 ? 16  MET A HA   5  
ATOM 7867  H HB2  . MET A 1 16  ? -4.130  4.450   9.240   1.00 0.00 ? 16  MET A HB2  5  
ATOM 7868  H HB3  . MET A 1 16  ? -5.738  5.191   9.326   1.00 0.00 ? 16  MET A HB3  5  
ATOM 7869  H HG2  . MET A 1 16  ? -5.359  2.539   7.840   1.00 0.00 ? 16  MET A HG2  5  
ATOM 7870  H HG3  . MET A 1 16  ? -5.519  2.609   9.601   1.00 0.00 ? 16  MET A HG3  5  
ATOM 7871  H HE1  . MET A 1 16  ? -7.721  0.812   7.778   1.00 0.00 ? 16  MET A HE1  5  
ATOM 7872  H HE2  . MET A 1 16  ? -8.056  0.898   9.528   1.00 0.00 ? 16  MET A HE2  5  
ATOM 7873  H HE3  . MET A 1 16  ? -9.288  1.380   8.351   1.00 0.00 ? 16  MET A HE3  5  
ATOM 7874  N N    . ASP A 1 17  ? -6.823  6.229   6.404   1.00 0.00 ? 17  ASP A N    5  
ATOM 7875  C CA   . ASP A 1 17  ? -7.994  6.360   5.525   1.00 0.00 ? 17  ASP A CA   5  
ATOM 7876  C C    . ASP A 1 17  ? -7.657  6.461   4.032   1.00 0.00 ? 17  ASP A C    5  
ATOM 7877  O O    . ASP A 1 17  ? -8.381  5.953   3.182   1.00 0.00 ? 17  ASP A O    5  
ATOM 7878  C CB   . ASP A 1 17  ? -8.872  7.578   5.927   1.00 0.00 ? 17  ASP A CB   5  
ATOM 7879  C CG   . ASP A 1 17  ? -9.275  7.455   7.401   1.00 0.00 ? 17  ASP A CG   5  
ATOM 7880  O OD1  . ASP A 1 17  ? -8.863  8.335   8.204   1.00 0.00 ? 17  ASP A OD1  5  
ATOM 7881  O OD2  . ASP A 1 17  ? -9.994  6.477   7.739   1.00 0.00 ? 17  ASP A OD2  5  
ATOM 7882  H H    . ASP A 1 17  ? -6.685  6.988   7.039   1.00 0.00 ? 17  ASP A H    5  
ATOM 7883  H HA   . ASP A 1 17  ? -8.593  5.464   5.640   1.00 0.00 ? 17  ASP A HA   5  
ATOM 7884  H HB2  . ASP A 1 17  ? -8.306  8.525   5.788   1.00 0.00 ? 17  ASP A HB2  5  
ATOM 7885  H HB3  . ASP A 1 17  ? -9.800  7.622   5.315   1.00 0.00 ? 17  ASP A HB3  5  
ATOM 7886  N N    . TYR A 1 18  ? -6.486  7.085   3.706   1.00 0.00 ? 18  TYR A N    5  
ATOM 7887  C CA   . TYR A 1 18  ? -5.911  7.237   2.373   1.00 0.00 ? 18  TYR A CA   5  
ATOM 7888  C C    . TYR A 1 18  ? -5.395  5.916   1.774   1.00 0.00 ? 18  TYR A C    5  
ATOM 7889  O O    . TYR A 1 18  ? -5.784  5.512   0.684   1.00 0.00 ? 18  TYR A O    5  
ATOM 7890  C CB   . TYR A 1 18  ? -4.765  8.305   2.476   1.00 0.00 ? 18  TYR A CB   5  
ATOM 7891  C CG   . TYR A 1 18  ? -4.157  8.674   1.138   1.00 0.00 ? 18  TYR A CG   5  
ATOM 7892  C CD1  . TYR A 1 18  ? -4.928  9.216   0.126   1.00 0.00 ? 18  TYR A CD1  5  
ATOM 7893  C CD2  . TYR A 1 18  ? -2.831  8.373   0.879   1.00 0.00 ? 18  TYR A CD2  5  
ATOM 7894  C CE1  . TYR A 1 18  ? -4.392  9.430   -1.131  1.00 0.00 ? 18  TYR A CE1  5  
ATOM 7895  C CE2  . TYR A 1 18  ? -2.298  8.569   -0.379  1.00 0.00 ? 18  TYR A CE2  5  
ATOM 7896  C CZ   . TYR A 1 18  ? -3.077  9.106   -1.384  1.00 0.00 ? 18  TYR A CZ   5  
ATOM 7897  O OH   . TYR A 1 18  ? -2.545  9.324   -2.672  1.00 0.00 ? 18  TYR A OH   5  
ATOM 7898  H H    . TYR A 1 18  ? -5.920  7.454   4.440   1.00 0.00 ? 18  TYR A H    5  
ATOM 7899  H HA   . TYR A 1 18  ? -6.690  7.587   1.709   1.00 0.00 ? 18  TYR A HA   5  
ATOM 7900  H HB2  . TYR A 1 18  ? -5.178  9.247   2.919   1.00 0.00 ? 18  TYR A HB2  5  
ATOM 7901  H HB3  . TYR A 1 18  ? -3.950  7.922   3.143   1.00 0.00 ? 18  TYR A HB3  5  
ATOM 7902  H HD1  . TYR A 1 18  ? -5.972  9.441   0.301   1.00 0.00 ? 18  TYR A HD1  5  
ATOM 7903  H HD2  . TYR A 1 18  ? -2.225  7.930   1.662   1.00 0.00 ? 18  TYR A HD2  5  
ATOM 7904  H HE1  . TYR A 1 18  ? -5.004  9.838   -1.925  1.00 0.00 ? 18  TYR A HE1  5  
ATOM 7905  H HE2  . TYR A 1 18  ? -1.275  8.283   -0.574  1.00 0.00 ? 18  TYR A HE2  5  
ATOM 7906  H HH   . TYR A 1 18  ? -1.587  9.325   -2.602  1.00 0.00 ? 18  TYR A HH   5  
ATOM 7907  N N    . PHE A 1 19  ? -4.534  5.190   2.529   1.00 0.00 ? 19  PHE A N    5  
ATOM 7908  C CA   . PHE A 1 19  ? -3.913  3.900   2.234   1.00 0.00 ? 19  PHE A CA   5  
ATOM 7909  C C    . PHE A 1 19  ? -4.881  2.724   2.343   1.00 0.00 ? 19  PHE A C    5  
ATOM 7910  O O    . PHE A 1 19  ? -4.850  1.788   1.544   1.00 0.00 ? 19  PHE A O    5  
ATOM 7911  C CB   . PHE A 1 19  ? -2.669  3.727   3.147   1.00 0.00 ? 19  PHE A CB   5  
ATOM 7912  C CG   . PHE A 1 19  ? -1.622  4.771   2.826   1.00 0.00 ? 19  PHE A CG   5  
ATOM 7913  C CD1  . PHE A 1 19  ? -1.088  4.874   1.554   1.00 0.00 ? 19  PHE A CD1  5  
ATOM 7914  C CD2  . PHE A 1 19  ? -1.148  5.633   3.801   1.00 0.00 ? 19  PHE A CD2  5  
ATOM 7915  C CE1  . PHE A 1 19  ? -0.131  5.821   1.252   1.00 0.00 ? 19  PHE A CE1  5  
ATOM 7916  C CE2  . PHE A 1 19  ? -0.180  6.577   3.512   1.00 0.00 ? 19  PHE A CE2  5  
ATOM 7917  C CZ   . PHE A 1 19  ? 0.327   6.677   2.231   1.00 0.00 ? 19  PHE A CZ   5  
ATOM 7918  H H    . PHE A 1 19  ? -4.237  5.565   3.401   1.00 0.00 ? 19  PHE A H    5  
ATOM 7919  H HA   . PHE A 1 19  ? -3.605  3.892   1.191   1.00 0.00 ? 19  PHE A HA   5  
ATOM 7920  H HB2  . PHE A 1 19  ? -2.933  3.828   4.223   1.00 0.00 ? 19  PHE A HB2  5  
ATOM 7921  H HB3  . PHE A 1 19  ? -2.184  2.738   3.032   1.00 0.00 ? 19  PHE A HB3  5  
ATOM 7922  H HD1  . PHE A 1 19  ? -1.409  4.196   0.777   1.00 0.00 ? 19  PHE A HD1  5  
ATOM 7923  H HD2  . PHE A 1 19  ? -1.533  5.552   4.809   1.00 0.00 ? 19  PHE A HD2  5  
ATOM 7924  H HE1  . PHE A 1 19  ? 0.266   5.876   0.247   1.00 0.00 ? 19  PHE A HE1  5  
ATOM 7925  H HE2  . PHE A 1 19  ? 0.179   7.241   4.289   1.00 0.00 ? 19  PHE A HE2  5  
ATOM 7926  H HZ   . PHE A 1 19  ? 1.087   7.409   1.995   1.00 0.00 ? 19  PHE A HZ   5  
ATOM 7927  N N    . SER A 1 20  ? -5.852  2.814   3.298   1.00 0.00 ? 20  SER A N    5  
ATOM 7928  C CA   . SER A 1 20  ? -6.969  1.875   3.487   1.00 0.00 ? 20  SER A CA   5  
ATOM 7929  C C    . SER A 1 20  ? -8.018  1.943   2.403   1.00 0.00 ? 20  SER A C    5  
ATOM 7930  O O    . SER A 1 20  ? -8.643  0.937   2.107   1.00 0.00 ? 20  SER A O    5  
ATOM 7931  C CB   . SER A 1 20  ? -7.611  1.803   4.876   1.00 0.00 ? 20  SER A CB   5  
ATOM 7932  O OG   . SER A 1 20  ? -6.554  1.735   5.814   1.00 0.00 ? 20  SER A OG   5  
ATOM 7933  H H    . SER A 1 20  ? -5.847  3.598   3.933   1.00 0.00 ? 20  SER A H    5  
ATOM 7934  H HA   . SER A 1 20  ? -6.541  0.885   3.390   1.00 0.00 ? 20  SER A HA   5  
ATOM 7935  H HB2  . SER A 1 20  ? -8.240  2.703   5.097   1.00 0.00 ? 20  SER A HB2  5  
ATOM 7936  H HB3  . SER A 1 20  ? -8.205  0.862   4.987   1.00 0.00 ? 20  SER A HB3  5  
ATOM 7937  H HG   . SER A 1 20  ? -6.284  2.675   5.922   1.00 0.00 ? 20  SER A HG   5  
ATOM 7938  N N    . GLU A 1 21  ? -8.239  3.123   1.744   1.00 0.00 ? 21  GLU A N    5  
ATOM 7939  C CA   . GLU A 1 21  ? -9.113  3.265   0.566   1.00 0.00 ? 21  GLU A CA   5  
ATOM 7940  C C    . GLU A 1 21  ? -8.598  2.501   -0.665  1.00 0.00 ? 21  GLU A C    5  
ATOM 7941  O O    . GLU A 1 21  ? -9.366  1.850   -1.362  1.00 0.00 ? 21  GLU A O    5  
ATOM 7942  C CB   . GLU A 1 21  ? -9.353  4.757   0.214   1.00 0.00 ? 21  GLU A CB   5  
ATOM 7943  C CG   . GLU A 1 21  ? -10.385 5.054   -0.897  1.00 0.00 ? 21  GLU A CG   5  
ATOM 7944  C CD   . GLU A 1 21  ? -11.751 4.465   -0.543  1.00 0.00 ? 21  GLU A CD   5  
ATOM 7945  O OE1  . GLU A 1 21  ? -12.328 4.888   0.495   1.00 0.00 ? 21  GLU A OE1  5  
ATOM 7946  O OE2  . GLU A 1 21  ? -12.235 3.585   -1.305  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 7947  H H    . GLU A 1 21  ? -7.745  3.953   2.012   1.00 0.00 ? 21  GLU A H    5  
ATOM 7948  H HA   . GLU A 1 21  ? -10.071 2.823   0.814   1.00 0.00 ? 21  GLU A HA   5  
ATOM 7949  H HB2  . GLU A 1 21  ? -9.706  5.258   1.143   1.00 0.00 ? 21  GLU A HB2  5  
ATOM 7950  H HB3  . GLU A 1 21  ? -8.387  5.235   -0.064  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 7951  H HG2  . GLU A 1 21  ? -10.488 6.155   -1.010  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 7952  H HG3  . GLU A 1 21  ? -10.038 4.645   -1.869  1.00 0.00 ? 21  GLU A HG3  5  
ATOM 7953  N N    . GLU A 1 22  ? -7.258  2.514   -0.921  1.00 0.00 ? 22  GLU A N    5  
ATOM 7954  C CA   . GLU A 1 22  ? -6.570  1.706   -1.929  1.00 0.00 ? 22  GLU A CA   5  
ATOM 7955  C C    . GLU A 1 22  ? -6.425  0.233   -1.513  1.00 0.00 ? 22  GLU A C    5  
ATOM 7956  O O    . GLU A 1 22  ? -6.816  -0.672  -2.254  1.00 0.00 ? 22  GLU A O    5  
ATOM 7957  C CB   . GLU A 1 22  ? -5.179  2.335   -2.245  1.00 0.00 ? 22  GLU A CB   5  
ATOM 7958  C CG   . GLU A 1 22  ? -5.207  3.396   -3.369  1.00 0.00 ? 22  GLU A CG   5  
ATOM 7959  C CD   . GLU A 1 22  ? -6.065  4.607   -3.004  1.00 0.00 ? 22  GLU A CD   5  
ATOM 7960  O OE1  . GLU A 1 22  ? -7.189  4.732   -3.561  1.00 0.00 ? 22  GLU A OE1  5  
ATOM 7961  O OE2  . GLU A 1 22  ? -5.600  5.431   -2.173  1.00 0.00 ? 22  GLU A OE2  5  
ATOM 7962  H H    . GLU A 1 22  ? -6.663  3.071   -0.348  1.00 0.00 ? 22  GLU A H    5  
ATOM 7963  H HA   . GLU A 1 22  ? -7.164  1.684   -2.834  1.00 0.00 ? 22  GLU A HA   5  
ATOM 7964  H HB2  . GLU A 1 22  ? -4.768  2.788   -1.315  1.00 0.00 ? 22  GLU A HB2  5  
ATOM 7965  H HB3  . GLU A 1 22  ? -4.450  1.566   -2.585  1.00 0.00 ? 22  GLU A HB3  5  
ATOM 7966  H HG2  . GLU A 1 22  ? -4.170  3.746   -3.570  1.00 0.00 ? 22  GLU A HG2  5  
ATOM 7967  H HG3  . GLU A 1 22  ? -5.600  2.926   -4.296  1.00 0.00 ? 22  GLU A HG3  5  
ATOM 7968  N N    . PHE A 1 23  ? -5.917  -0.037  -0.268  1.00 0.00 ? 23  PHE A N    5  
ATOM 7969  C CA   . PHE A 1 23  ? -5.690  -1.377  0.280   1.00 0.00 ? 23  PHE A CA   5  
ATOM 7970  C C    . PHE A 1 23  ? -6.956  -2.189  0.532   1.00 0.00 ? 23  PHE A C    5  
ATOM 7971  O O    . PHE A 1 23  ? -7.095  -3.273  -0.005  1.00 0.00 ? 23  PHE A O    5  
ATOM 7972  C CB   . PHE A 1 23  ? -4.880  -1.246  1.615   1.00 0.00 ? 23  PHE A CB   5  
ATOM 7973  C CG   . PHE A 1 23  ? -4.435  -2.519  2.307   1.00 0.00 ? 23  PHE A CG   5  
ATOM 7974  C CD1  . PHE A 1 23  ? -3.942  -3.577  1.576   1.00 0.00 ? 23  PHE A CD1  5  
ATOM 7975  C CD2  . PHE A 1 23  ? -4.500  -2.648  3.688   1.00 0.00 ? 23  PHE A CD2  5  
ATOM 7976  C CE1  . PHE A 1 23  ? -3.509  -4.722  2.195   1.00 0.00 ? 23  PHE A CE1  5  
ATOM 7977  C CE2  . PHE A 1 23  ? -4.065  -3.799  4.313   1.00 0.00 ? 23  PHE A CE2  5  
ATOM 7978  C CZ   . PHE A 1 23  ? -3.592  -4.851  3.557   1.00 0.00 ? 23  PHE A CZ   5  
ATOM 7979  H H    . PHE A 1 23  ? -5.587  0.704   0.337   1.00 0.00 ? 23  PHE A H    5  
ATOM 7980  H HA   . PHE A 1 23  ? -5.089  -1.922  -0.442  1.00 0.00 ? 23  PHE A HA   5  
ATOM 7981  H HB2  . PHE A 1 23  ? -3.930  -0.702  1.352   1.00 0.00 ? 23  PHE A HB2  5  
ATOM 7982  H HB3  . PHE A 1 23  ? -5.492  -0.661  2.351   1.00 0.00 ? 23  PHE A HB3  5  
ATOM 7983  H HD1  . PHE A 1 23  ? -3.924  -3.532  0.500   1.00 0.00 ? 23  PHE A HD1  5  
ATOM 7984  H HD2  . PHE A 1 23  ? -4.956  -1.877  4.290   1.00 0.00 ? 23  PHE A HD2  5  
ATOM 7985  H HE1  . PHE A 1 23  ? -3.041  -5.503  1.619   1.00 0.00 ? 23  PHE A HE1  5  
ATOM 7986  H HE2  . PHE A 1 23  ? -4.111  -3.888  5.391   1.00 0.00 ? 23  PHE A HE2  5  
ATOM 7987  H HZ   . PHE A 1 23  ? -3.229  -5.758  4.016   1.00 0.00 ? 23  PHE A HZ   5  
ATOM 7988  N N    . ARG A 1 24  ? -7.964  -1.661  1.275   1.00 0.00 ? 24  ARG A N    5  
ATOM 7989  C CA   . ARG A 1 24  ? -9.236  -2.335  1.563   1.00 0.00 ? 24  ARG A CA   5  
ATOM 7990  C C    . ARG A 1 24  ? -10.131 -2.573  0.356   1.00 0.00 ? 24  ARG A C    5  
ATOM 7991  O O    . ARG A 1 24  ? -10.679 -3.656  0.204   1.00 0.00 ? 24  ARG A O    5  
ATOM 7992  C CB   . ARG A 1 24  ? -9.888  -1.793  2.863   1.00 0.00 ? 24  ARG A CB   5  
ATOM 7993  C CG   . ARG A 1 24  ? -10.997 -2.690  3.464   1.00 0.00 ? 24  ARG A CG   5  
ATOM 7994  C CD   . ARG A 1 24  ? -10.556 -3.980  4.205   1.00 0.00 ? 24  ARG A CD   5  
ATOM 7995  N NE   . ARG A 1 24  ? -9.054  -4.054  4.402   1.00 0.00 ? 24  ARG A NE   5  
ATOM 7996  C CZ   . ARG A 1 24  ? -8.210  -4.869  3.690   1.00 0.00 ? 24  ARG A CZ   5  
ATOM 7997  N NH1  . ARG A 1 24  ? -8.676  -5.877  2.911   1.00 0.00 ? 24  ARG A NH1  5  
ATOM 7998  N NH2  . ARG A 1 24  ? -6.876  -4.627  3.705   1.00 0.00 ? 24  ARG A NH2  5  
ATOM 7999  H H    . ARG A 1 24  ? -7.893  -0.737  1.675   1.00 0.00 ? 24  ARG A H    5  
ATOM 8000  H HA   . ARG A 1 24  ? -9.049  -3.348  1.854   1.00 0.00 ? 24  ARG A HA   5  
ATOM 8001  H HB2  . ARG A 1 24  ? -9.067  -1.717  3.628   1.00 0.00 ? 24  ARG A HB2  5  
ATOM 8002  H HB3  . ARG A 1 24  ? -10.270 -0.758  2.710   1.00 0.00 ? 24  ARG A HB3  5  
ATOM 8003  H HG2  . ARG A 1 24  ? -11.560 -2.072  4.200   1.00 0.00 ? 24  ARG A HG2  5  
ATOM 8004  H HG3  . ARG A 1 24  ? -11.715 -2.995  2.666   1.00 0.00 ? 24  ARG A HG3  5  
ATOM 8005  H HD2  . ARG A 1 24  ? -11.047 -4.011  5.206   1.00 0.00 ? 24  ARG A HD2  5  
ATOM 8006  H HD3  . ARG A 1 24  ? -10.917 -4.855  3.644   1.00 0.00 ? 24  ARG A HD3  5  
ATOM 8007  H HE   . ARG A 1 24  ? -8.638  -3.337  4.961   1.00 0.00 ? 24  ARG A HE   5  
ATOM 8008  H HH11 . ARG A 1 24  ? -9.658  -6.058  2.862   1.00 0.00 ? 24  ARG A HH11 5  
ATOM 8009  H HH12 . ARG A 1 24  ? -8.037  -6.437  2.383   1.00 0.00 ? 24  ARG A HH12 5  
ATOM 8010  H HH21 . ARG A 1 24  ? -6.509  -3.874  4.251   1.00 0.00 ? 24  ARG A HH21 5  
ATOM 8011  H HH22 . ARG A 1 24  ? -6.258  -5.202  3.167   1.00 0.00 ? 24  ARG A HH22 5  
ATOM 8012  N N    . ASN A 1 25  ? -10.230 -1.632  -0.618  1.00 0.00 ? 25  ASN A N    5  
ATOM 8013  C CA   . ASN A 1 25  ? -10.945 -1.825  -1.856  1.00 0.00 ? 25  ASN A CA   5  
ATOM 8014  C C    . ASN A 1 25  ? -10.295 -2.794  -2.850  1.00 0.00 ? 25  ASN A C    5  
ATOM 8015  O O    . ASN A 1 25  ? -10.942 -3.725  -3.310  1.00 0.00 ? 25  ASN A O    5  
ATOM 8016  C CB   . ASN A 1 25  ? -10.987 -0.423  -2.470  1.00 0.00 ? 25  ASN A CB   5  
ATOM 8017  C CG   . ASN A 1 25  ? -12.179 -0.211  -3.370  1.00 0.00 ? 25  ASN A CG   5  
ATOM 8018  O OD1  . ASN A 1 25  ? -13.148 -0.967  -3.455  1.00 0.00 ? 25  ASN A OD1  5  
ATOM 8019  N ND2  . ASN A 1 25  ? -12.143 0.966   -4.033  1.00 0.00 ? 25  ASN A ND2  5  
ATOM 8020  H H    . ASN A 1 25  ? -9.807  -0.728  -0.594  1.00 0.00 ? 25  ASN A H    5  
ATOM 8021  H HA   . ASN A 1 25  ? -11.937 -2.213  -1.628  1.00 0.00 ? 25  ASN A HA   5  
ATOM 8022  H HB2  . ASN A 1 25  ? -11.102 0.308   -1.640  1.00 0.00 ? 25  ASN A HB2  5  
ATOM 8023  H HB3  . ASN A 1 25  ? -10.045 -0.145  -2.992  1.00 0.00 ? 25  ASN A HB3  5  
ATOM 8024  H HD21 . ASN A 1 25  ? -11.382 1.596   -3.901  1.00 0.00 ? 25  ASN A HD21 5  
ATOM 8025  H HD22 . ASN A 1 25  ? -13.000 1.250   -4.418  1.00 0.00 ? 25  ASN A HD22 5  
ATOM 8026  N N    . ASP A 1 26  ? -8.977  -2.611  -3.174  1.00 0.00 ? 26  ASP A N    5  
ATOM 8027  C CA   . ASP A 1 26  ? -8.244  -3.455  -4.135  1.00 0.00 ? 26  ASP A CA   5  
ATOM 8028  C C    . ASP A 1 26  ? -7.880  -4.838  -3.611  1.00 0.00 ? 26  ASP A C    5  
ATOM 8029  O O    . ASP A 1 26  ? -8.026  -5.824  -4.335  1.00 0.00 ? 26  ASP A O    5  
ATOM 8030  C CB   . ASP A 1 26  ? -6.972  -2.760  -4.693  1.00 0.00 ? 26  ASP A CB   5  
ATOM 8031  C CG   . ASP A 1 26  ? -7.367  -1.560  -5.560  1.00 0.00 ? 26  ASP A CG   5  
ATOM 8032  O OD1  . ASP A 1 26  ? -6.961  -0.417  -5.219  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 8033  O OD2  . ASP A 1 26  ? -8.073  -1.776  -6.581  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 8034  H H    . ASP A 1 26  ? -8.448  -1.855  -2.772  1.00 0.00 ? 26  ASP A H    5  
ATOM 8035  H HA   . ASP A 1 26  ? -8.891  -3.666  -4.983  1.00 0.00 ? 26  ASP A HA   5  
ATOM 8036  H HB2  . ASP A 1 26  ? -6.344  -2.410  -3.850  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 8037  H HB3  . ASP A 1 26  ? -6.354  -3.445  -5.310  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 8038  N N    . PHE A 1 27  ? -7.464  -4.960  -2.308  1.00 0.00 ? 27  PHE A N    5  
ATOM 8039  C CA   . PHE A 1 27  ? -7.149  -6.218  -1.615  1.00 0.00 ? 27  PHE A CA   5  
ATOM 8040  C C    . PHE A 1 27  ? -8.380  -7.062  -1.430  1.00 0.00 ? 27  PHE A C    5  
ATOM 8041  O O    . PHE A 1 27  ? -8.316  -8.241  -1.750  1.00 0.00 ? 27  PHE A O    5  
ATOM 8042  C CB   . PHE A 1 27  ? -6.465  -5.982  -0.243  1.00 0.00 ? 27  PHE A CB   5  
ATOM 8043  C CG   . PHE A 1 27  ? -5.883  -7.141  0.523   1.00 0.00 ? 27  PHE A CG   5  
ATOM 8044  C CD1  . PHE A 1 27  ? -6.659  -7.910  1.381   1.00 0.00 ? 27  PHE A CD1  5  
ATOM 8045  C CD2  . PHE A 1 27  ? -4.515  -7.270  0.568   1.00 0.00 ? 27  PHE A CD2  5  
ATOM 8046  C CE1  . PHE A 1 27  ? -6.071  -8.695  2.352   1.00 0.00 ? 27  PHE A CE1  5  
ATOM 8047  C CE2  . PHE A 1 27  ? -3.928  -8.008  1.570   1.00 0.00 ? 27  PHE A CE2  5  
ATOM 8048  C CZ   . PHE A 1 27  ? -4.701  -8.697  2.469   1.00 0.00 ? 27  PHE A CZ   5  
ATOM 8049  H H    . PHE A 1 27  ? -7.387  -4.146  -1.719  1.00 0.00 ? 27  PHE A H    5  
ATOM 8050  H HA   . PHE A 1 27  ? -6.470  -6.785  -2.239  1.00 0.00 ? 27  PHE A HA   5  
ATOM 8051  H HB2  . PHE A 1 27  ? -5.632  -5.258  -0.427  1.00 0.00 ? 27  PHE A HB2  5  
ATOM 8052  H HB3  . PHE A 1 27  ? -7.188  -5.506  0.462   1.00 0.00 ? 27  PHE A HB3  5  
ATOM 8053  H HD1  . PHE A 1 27  ? -7.733  -7.824  1.352   1.00 0.00 ? 27  PHE A HD1  5  
ATOM 8054  H HD2  . PHE A 1 27  ? -3.904  -6.669  -0.092  1.00 0.00 ? 27  PHE A HD2  5  
ATOM 8055  H HE1  . PHE A 1 27  ? -6.669  -9.274  3.048   1.00 0.00 ? 27  PHE A HE1  5  
ATOM 8056  H HE2  . PHE A 1 27  ? -2.854  -8.037  1.680   1.00 0.00 ? 27  PHE A HE2  5  
ATOM 8057  H HZ   . PHE A 1 27  ? -4.207  -9.274  3.233   1.00 0.00 ? 27  PHE A HZ   5  
ATOM 8058  N N    . LEU A 1 28  ? -9.552  -6.484  -0.991  1.00 0.00 ? 28  LEU A N    5  
ATOM 8059  C CA   . LEU A 1 28  ? -10.819 -7.193  -0.946  1.00 0.00 ? 28  LEU A CA   5  
ATOM 8060  C C    . LEU A 1 28  ? -11.346 -7.546  -2.327  1.00 0.00 ? 28  LEU A C    5  
ATOM 8061  O O    . LEU A 1 28  ? -11.839 -8.648  -2.493  1.00 0.00 ? 28  LEU A O    5  
ATOM 8062  C CB   . LEU A 1 28  ? -11.881 -6.498  -0.081  1.00 0.00 ? 28  LEU A CB   5  
ATOM 8063  C CG   . LEU A 1 28  ? -11.587 -6.496  1.440   1.00 0.00 ? 28  LEU A CG   5  
ATOM 8064  C CD1  . LEU A 1 28  ? -12.865 -6.111  2.188   1.00 0.00 ? 28  LEU A CD1  5  
ATOM 8065  C CD2  . LEU A 1 28  ? -10.996 -7.790  2.060   1.00 0.00 ? 28  LEU A CD2  5  
ATOM 8066  H H    . LEU A 1 28  ? -9.671  -5.520  -0.738  1.00 0.00 ? 28  LEU A H    5  
ATOM 8067  H HA   . LEU A 1 28  ? -10.647 -8.156  -0.488  1.00 0.00 ? 28  LEU A HA   5  
ATOM 8068  H HB2  . LEU A 1 28  ? -12.013 -5.446  -0.430  1.00 0.00 ? 28  LEU A HB2  5  
ATOM 8069  H HB3  . LEU A 1 28  ? -12.855 -6.996  -0.219  1.00 0.00 ? 28  LEU A HB3  5  
ATOM 8070  H HG   . LEU A 1 28  ? -10.840 -5.686  1.610   1.00 0.00 ? 28  LEU A HG   5  
ATOM 8071  H HD11 . LEU A 1 28  ? -13.698 -6.810  1.970   1.00 0.00 ? 28  LEU A HD11 5  
ATOM 8072  H HD12 . LEU A 1 28  ? -12.667 -6.151  3.278   1.00 0.00 ? 28  LEU A HD12 5  
ATOM 8073  H HD13 . LEU A 1 28  ? -13.191 -5.089  1.915   1.00 0.00 ? 28  LEU A HD13 5  
ATOM 8074  H HD21 . LEU A 1 28  ? -11.677 -8.649  1.932   1.00 0.00 ? 28  LEU A HD21 5  
ATOM 8075  H HD22 . LEU A 1 28  ? -10.017 -8.041  1.607   1.00 0.00 ? 28  LEU A HD22 5  
ATOM 8076  H HD23 . LEU A 1 28  ? -10.794 -7.658  3.157   1.00 0.00 ? 28  LEU A HD23 5  
ATOM 8077  N N    . GLU A 1 29  ? -11.150 -6.687  -3.371  1.00 0.00 ? 29  GLU A N    5  
ATOM 8078  C CA   . GLU A 1 29  ? -11.477 -7.011  -4.771  1.00 0.00 ? 29  GLU A CA   5  
ATOM 8079  C C    . GLU A 1 29  ? -10.739 -8.209  -5.355  1.00 0.00 ? 29  GLU A C    5  
ATOM 8080  O O    . GLU A 1 29  ? -11.365 -9.159  -5.811  1.00 0.00 ? 29  GLU A O    5  
ATOM 8081  C CB   . GLU A 1 29  ? -11.176 -5.788  -5.683  1.00 0.00 ? 29  GLU A CB   5  
ATOM 8082  C CG   . GLU A 1 29  ? -12.467 -5.067  -6.061  1.00 0.00 ? 29  GLU A CG   5  
ATOM 8083  C CD   . GLU A 1 29  ? -12.147 -3.747  -6.756  1.00 0.00 ? 29  GLU A CD   5  
ATOM 8084  O OE1  . GLU A 1 29  ? -11.542 -3.789  -7.861  1.00 0.00 ? 29  GLU A OE1  5  
ATOM 8085  O OE2  . GLU A 1 29  ? -12.501 -2.677  -6.191  1.00 0.00 ? 29  GLU A OE2  5  
ATOM 8086  H H    . GLU A 1 29  ? -10.742 -5.777  -3.228  1.00 0.00 ? 29  GLU A H    5  
ATOM 8087  H HA   . GLU A 1 29  ? -12.534 -7.286  -4.798  1.00 0.00 ? 29  GLU A HA   5  
ATOM 8088  H HB2  . GLU A 1 29  ? -10.517 -5.106  -5.117  1.00 0.00 ? 29  GLU A HB2  5  
ATOM 8089  H HB3  . GLU A 1 29  ? -10.612 -5.997  -6.618  1.00 0.00 ? 29  GLU A HB3  5  
ATOM 8090  H HG2  . GLU A 1 29  ? -13.034 -5.739  -6.740  1.00 0.00 ? 29  GLU A HG2  5  
ATOM 8091  H HG3  . GLU A 1 29  ? -13.034 -4.886  -5.124  1.00 0.00 ? 29  GLU A HG3  5  
ATOM 8092  N N    . LEU A 1 30  ? -9.378  -8.208  -5.286  1.00 0.00 ? 30  LEU A N    5  
ATOM 8093  C CA   . LEU A 1 30  ? -8.492  -9.280  -5.755  1.00 0.00 ? 30  LEU A CA   5  
ATOM 8094  C C    . LEU A 1 30  ? -8.536  -10.547 -4.927  1.00 0.00 ? 30  LEU A C    5  
ATOM 8095  O O    . LEU A 1 30  ? -8.472  -11.647 -5.468  1.00 0.00 ? 30  LEU A O    5  
ATOM 8096  C CB   . LEU A 1 30  ? -7.062  -8.781  -6.029  1.00 0.00 ? 30  LEU A CB   5  
ATOM 8097  C CG   . LEU A 1 30  ? -5.929  -9.214  -5.073  1.00 0.00 ? 30  LEU A CG   5  
ATOM 8098  C CD1  . LEU A 1 30  ? -5.177  -10.495 -5.503  1.00 0.00 ? 30  LEU A CD1  5  
ATOM 8099  C CD2  . LEU A 1 30  ? -4.932  -8.079  -4.981  1.00 0.00 ? 30  LEU A CD2  5  
ATOM 8100  H H    . LEU A 1 30  ? -8.912  -7.410  -4.880  1.00 0.00 ? 30  LEU A H    5  
ATOM 8101  H HA   . LEU A 1 30  ? -8.862  -9.574  -6.727  1.00 0.00 ? 30  LEU A HA   5  
ATOM 8102  H HB2  . LEU A 1 30  ? -6.766  -9.052  -7.065  1.00 0.00 ? 30  LEU A HB2  5  
ATOM 8103  H HB3  . LEU A 1 30  ? -7.137  -7.669  -6.013  1.00 0.00 ? 30  LEU A HB3  5  
ATOM 8104  H HG   . LEU A 1 30  ? -6.315  -9.347  -4.036  1.00 0.00 ? 30  LEU A HG   5  
ATOM 8105  H HD11 . LEU A 1 30  ? -5.845  -11.377 -5.562  1.00 0.00 ? 30  LEU A HD11 5  
ATOM 8106  H HD12 . LEU A 1 30  ? -4.677  -10.334 -6.485  1.00 0.00 ? 30  LEU A HD12 5  
ATOM 8107  H HD13 . LEU A 1 30  ? -4.382  -10.733 -4.755  1.00 0.00 ? 30  LEU A HD13 5  
ATOM 8108  H HD21 . LEU A 1 30  ? -4.516  -7.840  -5.983  1.00 0.00 ? 30  LEU A HD21 5  
ATOM 8109  H HD22 . LEU A 1 30  ? -5.395  -7.162  -4.552  1.00 0.00 ? 30  LEU A HD22 5  
ATOM 8110  H HD23 . LEU A 1 30  ? -4.117  -8.435  -4.321  1.00 0.00 ? 30  LEU A HD23 5  
ATOM 8111  N N    . LEU A 1 31  ? -8.722  -10.414 -3.573  1.00 0.00 ? 31  LEU A N    5  
ATOM 8112  C CA   . LEU A 1 31  ? -8.983  -11.482 -2.604  1.00 0.00 ? 31  LEU A CA   5  
ATOM 8113  C C    . LEU A 1 31  ? -10.247 -12.200 -2.933  1.00 0.00 ? 31  LEU A C    5  
ATOM 8114  O O    . LEU A 1 31  ? -10.256 -13.422 -3.084  1.00 0.00 ? 31  LEU A O    5  
ATOM 8115  C CB   . LEU A 1 31  ? -9.189  -10.912 -1.178  1.00 0.00 ? 31  LEU A CB   5  
ATOM 8116  C CG   . LEU A 1 31  ? -9.853  -11.739 -0.039  1.00 0.00 ? 31  LEU A CG   5  
ATOM 8117  C CD1  . LEU A 1 31  ? -11.310 -11.362 0.282   1.00 0.00 ? 31  LEU A CD1  5  
ATOM 8118  C CD2  . LEU A 1 31  ? -9.531  -13.247 0.047   1.00 0.00 ? 31  LEU A CD2  5  
ATOM 8119  H H    . LEU A 1 31  ? -8.768  -9.494  -3.162  1.00 0.00 ? 31  LEU A H    5  
ATOM 8120  H HA   . LEU A 1 31  ? -8.167  -12.188 -2.604  1.00 0.00 ? 31  LEU A HA   5  
ATOM 8121  H HB2  . LEU A 1 31  ? -8.164  -10.629 -0.818  1.00 0.00 ? 31  LEU A HB2  5  
ATOM 8122  H HB3  . LEU A 1 31  ? -9.818  -9.985  -1.266  1.00 0.00 ? 31  LEU A HB3  5  
ATOM 8123  H HG   . LEU A 1 31  ? -9.371  -11.319 0.846   1.00 0.00 ? 31  LEU A HG   5  
ATOM 8124  H HD11 . LEU A 1 31  ? -11.518 -10.273 0.181   1.00 0.00 ? 31  LEU A HD11 5  
ATOM 8125  H HD12 . LEU A 1 31  ? -12.044 -11.957 -0.300  1.00 0.00 ? 31  LEU A HD12 5  
ATOM 8126  H HD13 . LEU A 1 31  ? -11.464 -11.578 1.361   1.00 0.00 ? 31  LEU A HD13 5  
ATOM 8127  H HD21 . LEU A 1 31  ? -8.469  -13.417 -0.249  1.00 0.00 ? 31  LEU A HD21 5  
ATOM 8128  H HD22 . LEU A 1 31  ? -9.692  -13.621 1.080   1.00 0.00 ? 31  LEU A HD22 5  
ATOM 8129  H HD23 . LEU A 1 31  ? -10.194 -13.835 -0.624  1.00 0.00 ? 31  LEU A HD23 5  
ATOM 8130  N N    . ARG A 1 32  ? -11.357 -11.419 -3.074  1.00 0.00 ? 32  ARG A N    5  
ATOM 8131  C CA   . ARG A 1 32  ? -12.677 -11.952 -3.315  1.00 0.00 ? 32  ARG A CA   5  
ATOM 8132  C C    . ARG A 1 32  ? -12.840 -12.711 -4.649  1.00 0.00 ? 32  ARG A C    5  
ATOM 8133  O O    . ARG A 1 32  ? -13.497 -13.746 -4.676  1.00 0.00 ? 32  ARG A O    5  
ATOM 8134  C CB   . ARG A 1 32  ? -13.778 -10.888 -3.240  1.00 0.00 ? 32  ARG A CB   5  
ATOM 8135  C CG   . ARG A 1 32  ? -14.168 -10.489 -1.812  1.00 0.00 ? 32  ARG A CG   5  
ATOM 8136  C CD   . ARG A 1 32  ? -15.270 -9.414  -1.824  1.00 0.00 ? 32  ARG A CD   5  
ATOM 8137  N NE   . ARG A 1 32  ? -14.788 -8.184  -2.538  1.00 0.00 ? 32  ARG A NE   5  
ATOM 8138  C CZ   . ARG A 1 32  ? -15.537 -7.045  -2.667  1.00 0.00 ? 32  ARG A CZ   5  
ATOM 8139  N NH1  . ARG A 1 32  ? -16.800 -6.978  -2.158  1.00 0.00 ? 32  ARG A NH1  5  
ATOM 8140  N NH2  . ARG A 1 32  ? -15.005 -5.965  -3.311  1.00 0.00 ? 32  ARG A NH2  5  
ATOM 8141  H H    . ARG A 1 32  ? -11.321 -10.415 -2.947  1.00 0.00 ? 32  ARG A H    5  
ATOM 8142  H HA   . ARG A 1 32  ? -12.781 -12.611 -2.444  1.00 0.00 ? 32  ARG A HA   5  
ATOM 8143  H HB2  . ARG A 1 32  ? -13.478 -10.001 -3.847  1.00 0.00 ? 32  ARG A HB2  5  
ATOM 8144  H HB3  . ARG A 1 32  ? -14.728 -11.273 -3.669  1.00 0.00 ? 32  ARG A HB3  5  
ATOM 8145  H HG2  . ARG A 1 32  ? -14.550 -11.403 -1.296  1.00 0.00 ? 32  ARG A HG2  5  
ATOM 8146  H HG3  . ARG A 1 32  ? -13.278 -10.141 -1.241  1.00 0.00 ? 32  ARG A HG3  5  
ATOM 8147  H HD2  . ARG A 1 32  ? -16.166 -9.801  -2.354  1.00 0.00 ? 32  ARG A HD2  5  
ATOM 8148  H HD3  . ARG A 1 32  ? -15.531 -9.125  -0.793  1.00 0.00 ? 32  ARG A HD3  5  
ATOM 8149  H HE   . ARG A 1 32  ? -13.865 -8.194  -2.924  1.00 0.00 ? 32  ARG A HE   5  
ATOM 8150  H HH11 . ARG A 1 32  ? -17.189 -7.767  -1.683  1.00 0.00 ? 32  ARG A HH11 5  
ATOM 8151  H HH12 . ARG A 1 32  ? -17.336 -6.139  -2.259  1.00 0.00 ? 32  ARG A HH12 5  
ATOM 8152  H HH21 . ARG A 1 32  ? -14.079 -6.012  -3.684  1.00 0.00 ? 32  ARG A HH21 5  
ATOM 8153  H HH22 . ARG A 1 32  ? -15.544 -5.129  -3.411  1.00 0.00 ? 32  ARG A HH22 5  
ATOM 8154  N N    . ARG A 1 33  ? -12.211 -12.251 -5.781  1.00 0.00 ? 33  ARG A N    5  
ATOM 8155  C CA   . ARG A 1 33  ? -12.049 -13.062 -6.987  1.00 0.00 ? 33  ARG A CA   5  
ATOM 8156  C C    . ARG A 1 33  ? -11.069 -14.185 -6.920  1.00 0.00 ? 33  ARG A C    5  
ATOM 8157  O O    . ARG A 1 33  ? -11.375 -15.275 -7.385  1.00 0.00 ? 33  ARG A O    5  
ATOM 8158  C CB   . ARG A 1 33  ? -11.695 -12.357 -8.318  1.00 0.00 ? 33  ARG A CB   5  
ATOM 8159  C CG   . ARG A 1 33  ? -11.045 -10.984 -8.176  1.00 0.00 ? 33  ARG A CG   5  
ATOM 8160  C CD   . ARG A 1 33  ? -10.569 -10.333 -9.479  1.00 0.00 ? 33  ARG A CD   5  
ATOM 8161  N NE   . ARG A 1 33  ? -10.008 -8.979  -9.122  1.00 0.00 ? 33  ARG A NE   5  
ATOM 8162  C CZ   . ARG A 1 33  ? -8.883  -8.428  -9.673  1.00 0.00 ? 33  ARG A CZ   5  
ATOM 8163  N NH1  . ARG A 1 33  ? -8.180  -9.075  -10.646 1.00 0.00 ? 33  ARG A NH1  5  
ATOM 8164  N NH2  . ARG A 1 33  ? -8.455  -7.209  -9.231  1.00 0.00 ? 33  ARG A NH2  5  
ATOM 8165  H H    . ARG A 1 33  ? -11.699 -11.392 -5.797  1.00 0.00 ? 33  ARG A H    5  
ATOM 8166  H HA   . ARG A 1 33  ? -12.986 -13.561 -7.173  1.00 0.00 ? 33  ARG A HA   5  
ATOM 8167  H HB2  . ARG A 1 33  ? -11.185 -13.032 -9.035  1.00 0.00 ? 33  ARG A HB2  5  
ATOM 8168  H HB3  . ARG A 1 33  ? -12.624 -12.259 -8.856  1.00 0.00 ? 33  ARG A HB3  5  
ATOM 8169  H HG2  . ARG A 1 33  ? -11.802 -10.306 -7.723  1.00 0.00 ? 33  ARG A HG2  5  
ATOM 8170  H HG3  . ARG A 1 33  ? -10.194 -11.080 -7.471  1.00 0.00 ? 33  ARG A HG3  5  
ATOM 8171  H HD2  . ARG A 1 33  ? -9.809  -10.976 -9.971  1.00 0.00 ? 33  ARG A HD2  5  
ATOM 8172  H HD3  . ARG A 1 33  ? -11.429 -10.162 -10.160 1.00 0.00 ? 33  ARG A HD3  5  
ATOM 8173  H HE   . ARG A 1 33  ? -10.479 -8.461  -8.409  1.00 0.00 ? 33  ARG A HE   5  
ATOM 8174  H HH11 . ARG A 1 33  ? -8.484  -9.971  -10.969 1.00 0.00 ? 33  ARG A HH11 5  
ATOM 8175  H HH12 . ARG A 1 33  ? -7.359  -8.656  -11.032 1.00 0.00 ? 33  ARG A HH12 5  
ATOM 8176  H HH21 . ARG A 1 33  ? -8.961  -6.732  -8.513  1.00 0.00 ? 33  ARG A HH21 5  
ATOM 8177  H HH22 . ARG A 1 33  ? -7.632  -6.796  -9.621  1.00 0.00 ? 33  ARG A HH22 5  
ATOM 8178  N N    . ARG A 1 34  ? -9.805  -13.948 -6.483  1.00 0.00 ? 34  ARG A N    5  
ATOM 8179  C CA   . ARG A 1 34  ? -8.787  -14.960 -6.675  1.00 0.00 ? 34  ARG A CA   5  
ATOM 8180  C C    . ARG A 1 34  ? -8.825  -16.107 -5.649  1.00 0.00 ? 34  ARG A C    5  
ATOM 8181  O O    . ARG A 1 34  ? -8.426  -17.232 -5.933  1.00 0.00 ? 34  ARG A O    5  
ATOM 8182  C CB   . ARG A 1 34  ? -7.368  -14.335 -6.787  1.00 0.00 ? 34  ARG A CB   5  
ATOM 8183  C CG   . ARG A 1 34  ? -7.216  -13.289 -7.919  1.00 0.00 ? 34  ARG A CG   5  
ATOM 8184  C CD   . ARG A 1 34  ? -7.475  -13.844 -9.329  1.00 0.00 ? 34  ARG A CD   5  
ATOM 8185  N NE   . ARG A 1 34  ? -7.297  -12.732 -10.328 1.00 0.00 ? 34  ARG A NE   5  
ATOM 8186  C CZ   . ARG A 1 34  ? -7.695  -12.835 -11.635 1.00 0.00 ? 34  ARG A CZ   5  
ATOM 8187  N NH1  . ARG A 1 34  ? -8.306  -13.964 -12.097 1.00 0.00 ? 34  ARG A NH1  5  
ATOM 8188  N NH2  . ARG A 1 34  ? -7.478  -11.789 -12.486 1.00 0.00 ? 34  ARG A NH2  5  
ATOM 8189  H H    . ARG A 1 34  ? -9.478  -13.060 -6.137  1.00 0.00 ? 34  ARG A H    5  
ATOM 8190  H HA   . ARG A 1 34  ? -8.996  -15.352 -7.659  1.00 0.00 ? 34  ARG A HA   5  
ATOM 8191  H HB2  . ARG A 1 34  ? -7.109  -13.839 -5.826  1.00 0.00 ? 34  ARG A HB2  5  
ATOM 8192  H HB3  . ARG A 1 34  ? -6.620  -15.137 -6.969  1.00 0.00 ? 34  ARG A HB3  5  
ATOM 8193  H HG2  . ARG A 1 34  ? -7.919  -12.447 -7.734  1.00 0.00 ? 34  ARG A HG2  5  
ATOM 8194  H HG3  . ARG A 1 34  ? -6.181  -12.878 -7.878  1.00 0.00 ? 34  ARG A HG3  5  
ATOM 8195  H HD2  . ARG A 1 34  ? -6.752  -14.655 -9.564  1.00 0.00 ? 34  ARG A HD2  5  
ATOM 8196  H HD3  . ARG A 1 34  ? -8.515  -14.232 -9.400  1.00 0.00 ? 34  ARG A HD3  5  
ATOM 8197  H HE   . ARG A 1 34  ? -6.856  -11.888 -10.025 1.00 0.00 ? 34  ARG A HE   5  
ATOM 8198  H HH11 . ARG A 1 34  ? -8.469  -14.732 -11.479 1.00 0.00 ? 34  ARG A HH11 5  
ATOM 8199  H HH12 . ARG A 1 34  ? -8.591  -14.021 -13.053 1.00 0.00 ? 34  ARG A HH12 5  
ATOM 8200  H HH21 . ARG A 1 34  ? -7.036  -10.957 -12.152 1.00 0.00 ? 34  ARG A HH21 5  
ATOM 8201  H HH22 . ARG A 1 34  ? -7.767  -11.854 -13.442 1.00 0.00 ? 34  ARG A HH22 5  
ATOM 8202  N N    . PHE A 1 35  ? -9.313  -15.805 -4.417  1.00 0.00 ? 35  PHE A N    5  
ATOM 8203  C CA   . PHE A 1 35  ? -9.355  -16.721 -3.288  1.00 0.00 ? 35  PHE A CA   5  
ATOM 8204  C C    . PHE A 1 35  ? -10.790 -17.007 -2.825  1.00 0.00 ? 35  PHE A C    5  
ATOM 8205  O O    . PHE A 1 35  ? -11.053 -18.082 -2.278  1.00 0.00 ? 35  PHE A O    5  
ATOM 8206  C CB   . PHE A 1 35  ? -8.508  -16.182 -2.080  1.00 0.00 ? 35  PHE A CB   5  
ATOM 8207  C CG   . PHE A 1 35  ? -7.103  -15.785 -2.443  1.00 0.00 ? 35  PHE A CG   5  
ATOM 8208  C CD1  . PHE A 1 35  ? -6.036  -16.547 -2.013  1.00 0.00 ? 35  PHE A CD1  5  
ATOM 8209  C CD2  . PHE A 1 35  ? -6.829  -14.620 -3.135  1.00 0.00 ? 35  PHE A CD2  5  
ATOM 8210  C CE1  . PHE A 1 35  ? -4.746  -16.165 -2.285  1.00 0.00 ? 35  PHE A CE1  5  
ATOM 8211  C CE2  . PHE A 1 35  ? -5.542  -14.244 -3.438  1.00 0.00 ? 35  PHE A CE2  5  
ATOM 8212  C CZ   . PHE A 1 35  ? -4.489  -15.014 -2.994  1.00 0.00 ? 35  PHE A CZ   5  
ATOM 8213  H H    . PHE A 1 35  ? -9.618  -14.867 -4.215  1.00 0.00 ? 35  PHE A H    5  
ATOM 8214  H HA   . PHE A 1 35  ? -8.939  -17.684 -3.564  1.00 0.00 ? 35  PHE A HA   5  
ATOM 8215  H HB2  . PHE A 1 35  ? -8.991  -15.272 -1.650  1.00 0.00 ? 35  PHE A HB2  5  
ATOM 8216  H HB3  . PHE A 1 35  ? -8.366  -16.981 -1.313  1.00 0.00 ? 35  PHE A HB3  5  
ATOM 8217  H HD1  . PHE A 1 35  ? -6.188  -17.439 -1.421  1.00 0.00 ? 35  PHE A HD1  5  
ATOM 8218  H HD2  . PHE A 1 35  ? -7.643  -14.002 -3.475  1.00 0.00 ? 35  PHE A HD2  5  
ATOM 8219  H HE1  . PHE A 1 35  ? -3.962  -16.795 -1.905  1.00 0.00 ? 35  PHE A HE1  5  
ATOM 8220  H HE2  . PHE A 1 35  ? -5.387  -13.359 -4.040  1.00 0.00 ? 35  PHE A HE2  5  
ATOM 8221  H HZ   . PHE A 1 35  ? -3.471  -14.715 -3.191  1.00 0.00 ? 35  PHE A HZ   5  
ATOM 8222  N N    . GLY A 1 36  ? -11.757 -16.034 -2.960  1.00 0.00 ? 36  GLY A N    5  
ATOM 8223  C CA   . GLY A 1 36  ? -13.122 -16.120 -2.459  1.00 0.00 ? 36  GLY A CA   5  
ATOM 8224  C C    . GLY A 1 36  ? -13.232 -15.929 -0.988  1.00 0.00 ? 36  GLY A C    5  
ATOM 8225  O O    . GLY A 1 36  ? -12.863 -14.894 -0.439  1.00 0.00 ? 36  GLY A O    5  
ATOM 8226  H H    . GLY A 1 36  ? -11.626 -15.140 -3.392  1.00 0.00 ? 36  GLY A H    5  
ATOM 8227  H HA2  . GLY A 1 36  ? -13.650 -15.281 -2.882  1.00 0.00 ? 36  GLY A HA2  5  
ATOM 8228  H HA3  . GLY A 1 36  ? -13.521 -17.096 -2.691  1.00 0.00 ? 36  GLY A HA3  5  
ATOM 8229  N N    . THR A 1 37  ? -13.696 -16.986 -0.303  1.00 0.00 ? 37  THR A N    5  
ATOM 8230  C CA   . THR A 1 37  ? -13.670 -17.056 1.136   1.00 0.00 ? 37  THR A CA   5  
ATOM 8231  C C    . THR A 1 37  ? -12.921 -18.351 1.340   1.00 0.00 ? 37  THR A C    5  
ATOM 8232  O O    . THR A 1 37  ? -13.460 -19.434 1.142   1.00 0.00 ? 37  THR A O    5  
ATOM 8233  C CB   . THR A 1 37  ? -15.088 -17.104 1.717   1.00 0.00 ? 37  THR A CB   5  
ATOM 8234  O OG1  . THR A 1 37  ? -15.944 -17.969 0.970   1.00 0.00 ? 37  THR A OG1  5  
ATOM 8235  C CG2  . THR A 1 37  ? -15.677 -15.689 1.649   1.00 0.00 ? 37  THR A CG2  5  
ATOM 8236  H H    . THR A 1 37  ? -13.979 -17.815 -0.778  1.00 0.00 ? 37  THR A H    5  
ATOM 8237  H HA   . THR A 1 37  ? -13.106 -16.255 1.596   1.00 0.00 ? 37  THR A HA   5  
ATOM 8238  H HB   . THR A 1 37  ? -15.071 -17.414 2.789   1.00 0.00 ? 37  THR A HB   5  
ATOM 8239  H HG1  . THR A 1 37  ? -15.515 -18.840 0.999   1.00 0.00 ? 37  THR A HG1  5  
ATOM 8240  H HG21 . THR A 1 37  ? -14.953 -14.956 2.045   1.00 0.00 ? 37  THR A HG21 5  
ATOM 8241  H HG22 . THR A 1 37  ? -15.930 -15.365 0.618   1.00 0.00 ? 37  THR A HG22 5  
ATOM 8242  H HG23 . THR A 1 37  ? -16.582 -15.573 2.274   1.00 0.00 ? 37  THR A HG23 5  
ATOM 8243  N N    . LYS A 1 38  ? -11.672 -18.235 1.799   1.00 0.00 ? 38  LYS A N    5  
ATOM 8244  C CA   . LYS A 1 38  ? -10.728 -19.307 1.999   1.00 0.00 ? 38  LYS A CA   5  
ATOM 8245  C C    . LYS A 1 38  ? -9.759  -18.764 2.996   1.00 0.00 ? 38  LYS A C    5  
ATOM 8246  O O    . LYS A 1 38  ? -9.397  -17.592 2.928   1.00 0.00 ? 38  LYS A O    5  
ATOM 8247  C CB   . LYS A 1 38  ? -9.923  -19.628 0.708   1.00 0.00 ? 38  LYS A CB   5  
ATOM 8248  C CG   . LYS A 1 38  ? -9.178  -20.980 0.755   1.00 0.00 ? 38  LYS A CG   5  
ATOM 8249  C CD   . LYS A 1 38  ? -7.672  -20.849 0.473   1.00 0.00 ? 38  LYS A CD   5  
ATOM 8250  C CE   . LYS A 1 38  ? -7.317  -20.289 -0.916  1.00 0.00 ? 38  LYS A CE   5  
ATOM 8251  N NZ   . LYS A 1 38  ? -7.784  -21.186 -1.999  1.00 0.00 ? 38  LYS A NZ   5  
ATOM 8252  H H    . LYS A 1 38  ? -11.295 -17.320 1.879   1.00 0.00 ? 38  LYS A H    5  
ATOM 8253  H HA   . LYS A 1 38  ? -11.190 -20.201 2.386   1.00 0.00 ? 38  LYS A HA   5  
ATOM 8254  H HB2  . LYS A 1 38  ? -10.632 -19.641 -0.145  1.00 0.00 ? 38  LYS A HB2  5  
ATOM 8255  H HB3  . LYS A 1 38  ? -9.207  -18.803 0.462   1.00 0.00 ? 38  LYS A HB3  5  
ATOM 8256  H HG2  . LYS A 1 38  ? -9.283  -21.434 1.767   1.00 0.00 ? 38  LYS A HG2  5  
ATOM 8257  H HG3  . LYS A 1 38  ? -9.630  -21.696 0.038   1.00 0.00 ? 38  LYS A HG3  5  
ATOM 8258  H HD2  . LYS A 1 38  ? -7.264  -20.170 1.253   1.00 0.00 ? 38  LYS A HD2  5  
ATOM 8259  H HD3  . LYS A 1 38  ? -7.198  -21.847 0.605   1.00 0.00 ? 38  LYS A HD3  5  
ATOM 8260  H HE2  . LYS A 1 38  ? -7.783  -19.295 -1.086  1.00 0.00 ? 38  LYS A HE2  5  
ATOM 8261  H HE3  . LYS A 1 38  ? -6.217  -20.189 -1.017  1.00 0.00 ? 38  LYS A HE3  5  
ATOM 8262  H HZ1  . LYS A 1 38  ? -7.350  -22.124 -1.883  1.00 0.00 ? 38  LYS A HZ1  5  
ATOM 8263  H HZ2  . LYS A 1 38  ? -8.820  -21.273 -1.953  1.00 0.00 ? 38  LYS A HZ2  5  
ATOM 8264  H HZ3  . LYS A 1 38  ? -7.510  -20.788 -2.920  1.00 0.00 ? 38  LYS A HZ3  5  
ATOM 8265  N N    . ARG A 1 39  ? -9.267  -19.598 3.942   1.00 0.00 ? 39  ARG A N    5  
ATOM 8266  C CA   . ARG A 1 39  ? -8.248  -19.248 4.914   1.00 0.00 ? 39  ARG A CA   5  
ATOM 8267  C C    . ARG A 1 39  ? -6.853  -19.083 4.261   1.00 0.00 ? 39  ARG A C    5  
ATOM 8268  O O    . ARG A 1 39  ? -6.214  -20.023 3.798   1.00 0.00 ? 39  ARG A O    5  
ATOM 8269  C CB   . ARG A 1 39  ? -8.257  -20.256 6.106   1.00 0.00 ? 39  ARG A CB   5  
ATOM 8270  C CG   . ARG A 1 39  ? -7.730  -21.689 5.874   1.00 0.00 ? 39  ARG A CG   5  
ATOM 8271  C CD   . ARG A 1 39  ? -8.519  -22.551 4.868   1.00 0.00 ? 39  ARG A CD   5  
ATOM 8272  N NE   . ARG A 1 39  ? -7.992  -23.963 4.883   1.00 0.00 ? 39  ARG A NE   5  
ATOM 8273  C CZ   . ARG A 1 39  ? -6.921  -24.389 4.142   1.00 0.00 ? 39  ARG A CZ   5  
ATOM 8274  N NH1  . ARG A 1 39  ? -6.233  -23.529 3.335   1.00 0.00 ? 39  ARG A NH1  5  
ATOM 8275  N NH2  . ARG A 1 39  ? -6.537  -25.697 4.212   1.00 0.00 ? 39  ARG A NH2  5  
ATOM 8276  H H    . ARG A 1 39  ? -9.584  -20.530 4.028   1.00 0.00 ? 39  ARG A H    5  
ATOM 8277  H HA   . ARG A 1 39  ? -8.558  -18.301 5.344   1.00 0.00 ? 39  ARG A HA   5  
ATOM 8278  H HB2  . ARG A 1 39  ? -7.652  -19.819 6.930   1.00 0.00 ? 39  ARG A HB2  5  
ATOM 8279  H HB3  . ARG A 1 39  ? -9.302  -20.334 6.481   1.00 0.00 ? 39  ARG A HB3  5  
ATOM 8280  H HG2  . ARG A 1 39  ? -6.679  -21.591 5.544   1.00 0.00 ? 39  ARG A HG2  5  
ATOM 8281  H HG3  . ARG A 1 39  ? -7.698  -22.202 6.861   1.00 0.00 ? 39  ARG A HG3  5  
ATOM 8282  H HD2  . ARG A 1 39  ? -9.586  -22.597 5.176   1.00 0.00 ? 39  ARG A HD2  5  
ATOM 8283  H HD3  . ARG A 1 39  ? -8.465  -22.147 3.830   1.00 0.00 ? 39  ARG A HD3  5  
ATOM 8284  H HE   . ARG A 1 39  ? -8.465  -24.632 5.458   1.00 0.00 ? 39  ARG A HE   5  
ATOM 8285  H HH11 . ARG A 1 39  ? -6.506  -22.569 3.281   1.00 0.00 ? 39  ARG A HH11 5  
ATOM 8286  H HH12 . ARG A 1 39  ? -5.453  -23.860 2.804   1.00 0.00 ? 39  ARG A HH12 5  
ATOM 8287  H HH21 . ARG A 1 39  ? -7.041  -26.334 4.797   1.00 0.00 ? 39  ARG A HH21 5  
ATOM 8288  H HH22 . ARG A 1 39  ? -5.759  -26.019 3.675   1.00 0.00 ? 39  ARG A HH22 5  
ATOM 8289  N N    . VAL A 1 40  ? -6.377  -17.830 4.160   1.00 0.00 ? 40  VAL A N    5  
ATOM 8290  C CA   . VAL A 1 40  ? -5.124  -17.475 3.513   1.00 0.00 ? 40  VAL A CA   5  
ATOM 8291  C C    . VAL A 1 40  ? -4.502  -16.390 4.336   1.00 0.00 ? 40  VAL A C    5  
ATOM 8292  O O    . VAL A 1 40  ? -5.179  -15.544 4.912   1.00 0.00 ? 40  VAL A O    5  
ATOM 8293  C CB   . VAL A 1 40  ? -5.265  -17.071 2.037   1.00 0.00 ? 40  VAL A CB   5  
ATOM 8294  C CG1  . VAL A 1 40  ? -6.248  -15.899 1.835   1.00 0.00 ? 40  VAL A CG1  5  
ATOM 8295  C CG2  . VAL A 1 40  ? -3.905  -16.797 1.345   1.00 0.00 ? 40  VAL A CG2  5  
ATOM 8296  H H    . VAL A 1 40  ? -6.932  -17.058 4.506   1.00 0.00 ? 40  VAL A H    5  
ATOM 8297  H HA   . VAL A 1 40  ? -4.442  -18.316 3.550   1.00 0.00 ? 40  VAL A HA   5  
ATOM 8298  H HB   . VAL A 1 40  ? -5.686  -17.959 1.527   1.00 0.00 ? 40  VAL A HB   5  
ATOM 8299  H HG11 . VAL A 1 40  ? -7.272  -16.177 2.180   1.00 0.00 ? 40  VAL A HG11 5  
ATOM 8300  H HG12 . VAL A 1 40  ? -5.882  -14.987 2.354   1.00 0.00 ? 40  VAL A HG12 5  
ATOM 8301  H HG13 . VAL A 1 40  ? -6.310  -15.661 0.751   1.00 0.00 ? 40  VAL A HG13 5  
ATOM 8302  H HG21 . VAL A 1 40  ? -3.198  -17.632 1.533   1.00 0.00 ? 40  VAL A HG21 5  
ATOM 8303  H HG22 . VAL A 1 40  ? -4.062  -16.721 0.250   1.00 0.00 ? 40  VAL A HG22 5  
ATOM 8304  H HG23 . VAL A 1 40  ? -3.456  -15.838 1.679   1.00 0.00 ? 40  VAL A HG23 5  
ATOM 8305  N N    . HIS A 1 41  ? -3.152  -16.404 4.394   1.00 0.00 ? 41  HIS A N    5  
ATOM 8306  C CA   . HIS A 1 41  ? -2.285  -15.499 5.112   1.00 0.00 ? 41  HIS A CA   5  
ATOM 8307  C C    . HIS A 1 41  ? -2.292  -14.090 4.527   1.00 0.00 ? 41  HIS A C    5  
ATOM 8308  O O    . HIS A 1 41  ? -2.252  -13.916 3.308   1.00 0.00 ? 41  HIS A O    5  
ATOM 8309  C CB   . HIS A 1 41  ? -0.869  -16.121 5.128   1.00 0.00 ? 41  HIS A CB   5  
ATOM 8310  C CG   . HIS A 1 41  ? 0.045   -15.545 6.154   1.00 0.00 ? 41  HIS A CG   5  
ATOM 8311  N ND1  . HIS A 1 41  ? 0.795   -14.398 6.042   1.00 0.00 ? 41  HIS A ND1  5  
ATOM 8312  C CD2  . HIS A 1 41  ? 0.231   -15.991 7.418   1.00 0.00 ? 41  HIS A CD2  5  
ATOM 8313  C CE1  . HIS A 1 41  ? 1.384   -14.201 7.249   1.00 0.00 ? 41  HIS A CE1  5  
ATOM 8314  N NE2  . HIS A 1 41  ? 1.054   -15.131 8.112   1.00 0.00 ? 41  HIS A NE2  5  
ATOM 8315  H H    . HIS A 1 41  ? -2.696  -17.121 3.881   1.00 0.00 ? 41  HIS A H    5  
ATOM 8316  H HA   . HIS A 1 41  ? -2.648  -15.442 6.124   1.00 0.00 ? 41  HIS A HA   5  
ATOM 8317  H HB2  . HIS A 1 41  ? -0.991  -17.187 5.427   1.00 0.00 ? 41  HIS A HB2  5  
ATOM 8318  H HB3  . HIS A 1 41  ? -0.411  -16.119 4.121   1.00 0.00 ? 41  HIS A HB3  5  
ATOM 8319  H HD1  . HIS A 1 41  ? 0.952   -13.870 5.209   1.00 0.00 ? 41  HIS A HD1  5  
ATOM 8320  H HD2  . HIS A 1 41  ? -0.136  -16.906 7.859   1.00 0.00 ? 41  HIS A HD2  5  
ATOM 8321  H HE1  . HIS A 1 41  ? 2.084   -13.400 7.481   1.00 0.00 ? 41  HIS A HE1  5  
ATOM 8322  N N    . ASN A 1 42  ? -2.367  -13.026 5.372   1.00 0.00 ? 42  ASN A N    5  
ATOM 8323  C CA   . ASN A 1 42  ? -2.487  -11.631 4.892   1.00 0.00 ? 42  ASN A CA   5  
ATOM 8324  C C    . ASN A 1 42  ? -1.290  -11.059 4.119   1.00 0.00 ? 42  ASN A C    5  
ATOM 8325  O O    . ASN A 1 42  ? -1.443  -10.271 3.190   1.00 0.00 ? 42  ASN A O    5  
ATOM 8326  C CB   . ASN A 1 42  ? -2.953  -10.666 6.020   1.00 0.00 ? 42  ASN A CB   5  
ATOM 8327  C CG   . ASN A 1 42  ? -4.457  -10.389 5.910   1.00 0.00 ? 42  ASN A CG   5  
ATOM 8328  O OD1  . ASN A 1 42  ? -5.073  -10.711 4.901   1.00 0.00 ? 42  ASN A OD1  5  
ATOM 8329  N ND2  . ASN A 1 42  ? -5.043  -9.707  6.920   1.00 0.00 ? 42  ASN A ND2  5  
ATOM 8330  H H    . ASN A 1 42  ? -2.415  -13.210 6.359   1.00 0.00 ? 42  ASN A H    5  
ATOM 8331  H HA   . ASN A 1 42  ? -3.244  -11.662 4.117   1.00 0.00 ? 42  ASN A HA   5  
ATOM 8332  H HB2  . ASN A 1 42  ? -2.743  -11.136 7.011   1.00 0.00 ? 42  ASN A HB2  5  
ATOM 8333  H HB3  . ASN A 1 42  ? -2.466  -9.660  5.937   1.00 0.00 ? 42  ASN A HB3  5  
ATOM 8334  H HD21 . ASN A 1 42  ? -4.515  -9.470  7.732   1.00 0.00 ? 42  ASN A HD21 5  
ATOM 8335  H HD22 . ASN A 1 42  ? -6.026  -9.545  6.846   1.00 0.00 ? 42  ASN A HD22 5  
ATOM 8336  N N    . ASN A 1 43  ? -0.057  -11.542 4.432   1.00 0.00 ? 43  ASN A N    5  
ATOM 8337  C CA   . ASN A 1 43  ? 1.186   -11.250 3.697   1.00 0.00 ? 43  ASN A CA   5  
ATOM 8338  C C    . ASN A 1 43  ? 1.201   -11.842 2.271   1.00 0.00 ? 43  ASN A C    5  
ATOM 8339  O O    . ASN A 1 43  ? 1.848   -11.292 1.386   1.00 0.00 ? 43  ASN A O    5  
ATOM 8340  C CB   . ASN A 1 43  ? 2.503   -11.576 4.463   1.00 0.00 ? 43  ASN A CB   5  
ATOM 8341  C CG   . ASN A 1 43  ? 2.486   -10.970 5.873   1.00 0.00 ? 43  ASN A CG   5  
ATOM 8342  O OD1  . ASN A 1 43  ? 1.880   -11.532 6.785   1.00 0.00 ? 43  ASN A OD1  5  
ATOM 8343  N ND2  . ASN A 1 43  ? 3.128   -9.791  6.078   1.00 0.00 ? 43  ASN A ND2  5  
ATOM 8344  H H    . ASN A 1 43  ? 0.015   -12.166 5.209   1.00 0.00 ? 43  ASN A H    5  
ATOM 8345  H HA   . ASN A 1 43  ? 1.213   -10.178 3.534   1.00 0.00 ? 43  ASN A HA   5  
ATOM 8346  H HB2  . ASN A 1 43  ? 2.631   -12.674 4.565   1.00 0.00 ? 43  ASN A HB2  5  
ATOM 8347  H HB3  . ASN A 1 43  ? 3.384   -11.181 3.912   1.00 0.00 ? 43  ASN A HB3  5  
ATOM 8348  H HD21 . ASN A 1 43  ? 3.578   -9.316  5.325   1.00 0.00 ? 43  ASN A HD21 5  
ATOM 8349  H HD22 . ASN A 1 43  ? 3.141   -9.396  6.995   1.00 0.00 ? 43  ASN A HD22 5  
ATOM 8350  N N    . ILE A 1 44  ? 0.444   -12.962 2.035   1.00 0.00 ? 44  ILE A N    5  
ATOM 8351  C CA   . ILE A 1 44  ? 0.205   -13.657 0.760   1.00 0.00 ? 44  ILE A CA   5  
ATOM 8352  C C    . ILE A 1 44  ? -0.784  -12.927 -0.116  1.00 0.00 ? 44  ILE A C    5  
ATOM 8353  O O    . ILE A 1 44  ? -0.526  -12.720 -1.298  1.00 0.00 ? 44  ILE A O    5  
ATOM 8354  C CB   . ILE A 1 44  ? -0.123  -15.137 0.871   1.00 0.00 ? 44  ILE A CB   5  
ATOM 8355  C CG1  . ILE A 1 44  ? 0.966   -15.796 1.756   1.00 0.00 ? 44  ILE A CG1  5  
ATOM 8356  C CG2  . ILE A 1 44  ? -0.143  -15.743 -0.566  1.00 0.00 ? 44  ILE A CG2  5  
ATOM 8357  C CD1  . ILE A 1 44  ? 0.872   -17.318 1.760   1.00 0.00 ? 44  ILE A CD1  5  
ATOM 8358  H H    . ILE A 1 44  ? -0.090  -13.335 2.788   1.00 0.00 ? 44  ILE A H    5  
ATOM 8359  H HA   . ILE A 1 44  ? 1.117   -13.636 0.197   1.00 0.00 ? 44  ILE A HA   5  
ATOM 8360  H HB   . ILE A 1 44  ? -1.128  -15.297 1.346   1.00 0.00 ? 44  ILE A HB   5  
ATOM 8361  H HG12 . ILE A 1 44  ? 1.975   -15.504 1.388   1.00 0.00 ? 44  ILE A HG12 5  
ATOM 8362  H HG13 . ILE A 1 44  ? 0.884   -15.433 2.807   1.00 0.00 ? 44  ILE A HG13 5  
ATOM 8363  H HG21 . ILE A 1 44  ? 0.766   -15.415 -1.126  1.00 0.00 ? 44  ILE A HG21 5  
ATOM 8364  H HG22 . ILE A 1 44  ? -0.179  -16.849 -0.552  1.00 0.00 ? 44  ILE A HG22 5  
ATOM 8365  H HG23 . ILE A 1 44  ? -1.044  -15.425 -1.132  1.00 0.00 ? 44  ILE A HG23 5  
ATOM 8366  H HD11 . ILE A 1 44  ? -0.182  -17.635 1.920   1.00 0.00 ? 44  ILE A HD11 5  
ATOM 8367  H HD12 . ILE A 1 44  ? 1.216   -17.715 0.780   1.00 0.00 ? 44  ILE A HD12 5  
ATOM 8368  H HD13 . ILE A 1 44  ? 1.512   -17.745 2.558   1.00 0.00 ? 44  ILE A HD13 5  
ATOM 8369  N N    . VAL A 1 45  ? -1.914  -12.416 0.458   1.00 0.00 ? 45  VAL A N    5  
ATOM 8370  C CA   . VAL A 1 45  ? -2.845  -11.538 -0.279  1.00 0.00 ? 45  VAL A CA   5  
ATOM 8371  C C    . VAL A 1 45  ? -2.169  -10.167 -0.521  1.00 0.00 ? 45  VAL A C    5  
ATOM 8372  O O    . VAL A 1 45  ? -2.299  -9.649  -1.625  1.00 0.00 ? 45  VAL A O    5  
ATOM 8373  C CB   . VAL A 1 45  ? -4.282  -11.390 0.286   1.00 0.00 ? 45  VAL A CB   5  
ATOM 8374  C CG1  . VAL A 1 45  ? -5.180  -10.580 -0.687  1.00 0.00 ? 45  VAL A CG1  5  
ATOM 8375  C CG2  . VAL A 1 45  ? -5.003  -12.741 0.522   1.00 0.00 ? 45  VAL A CG2  5  
ATOM 8376  H H    . VAL A 1 45  ? -2.071  -12.599 1.427   1.00 0.00 ? 45  VAL A H    5  
ATOM 8377  H HA   . VAL A 1 45  ? -2.971  -11.956 -1.280  1.00 0.00 ? 45  VAL A HA   5  
ATOM 8378  H HB   . VAL A 1 45  ? -4.256  -10.870 1.267   1.00 0.00 ? 45  VAL A HB   5  
ATOM 8379  H HG11 . VAL A 1 45  ? -4.797  -9.564  -0.903  1.00 0.00 ? 45  VAL A HG11 5  
ATOM 8380  H HG12 . VAL A 1 45  ? -5.291  -11.127 -1.648  1.00 0.00 ? 45  VAL A HG12 5  
ATOM 8381  H HG13 . VAL A 1 45  ? -6.181  -10.453 -0.225  1.00 0.00 ? 45  VAL A HG13 5  
ATOM 8382  H HG21 . VAL A 1 45  ? -5.032  -13.354 -0.402  1.00 0.00 ? 45  VAL A HG21 5  
ATOM 8383  H HG22 . VAL A 1 45  ? -4.534  -13.338 1.331   1.00 0.00 ? 45  VAL A HG22 5  
ATOM 8384  H HG23 . VAL A 1 45  ? -6.065  -12.534 0.808   1.00 0.00 ? 45  VAL A HG23 5  
ATOM 8385  N N    . TYR A 1 46  ? -1.348  -9.608  0.453   1.00 0.00 ? 46  TYR A N    5  
ATOM 8386  C CA   . TYR A 1 46  ? -0.561  -8.347  0.326   1.00 0.00 ? 46  TYR A CA   5  
ATOM 8387  C C    . TYR A 1 46  ? 0.511   -8.467  -0.711  1.00 0.00 ? 46  TYR A C    5  
ATOM 8388  O O    . TYR A 1 46  ? 0.473   -7.697  -1.652  1.00 0.00 ? 46  TYR A O    5  
ATOM 8389  C CB   . TYR A 1 46  ? 0.052   -7.834  1.685   1.00 0.00 ? 46  TYR A CB   5  
ATOM 8390  C CG   . TYR A 1 46  ? 0.057   -6.378  2.188   1.00 0.00 ? 46  TYR A CG   5  
ATOM 8391  C CD1  . TYR A 1 46  ? -0.078  -5.180  1.486   1.00 0.00 ? 46  TYR A CD1  5  
ATOM 8392  C CD2  . TYR A 1 46  ? 0.064   -6.253  3.578   1.00 0.00 ? 46  TYR A CD2  5  
ATOM 8393  C CE1  . TYR A 1 46  ? -0.428  -4.011  2.132   1.00 0.00 ? 46  TYR A CE1  5  
ATOM 8394  C CE2  . TYR A 1 46  ? -0.425  -5.126  4.192   1.00 0.00 ? 46  TYR A CE2  5  
ATOM 8395  C CZ   . TYR A 1 46  ? -0.669  -3.988  3.473   1.00 0.00 ? 46  TYR A CZ   5  
ATOM 8396  O OH   . TYR A 1 46  ? -1.242  -2.845  4.068   1.00 0.00 ? 46  TYR A OH   5  
ATOM 8397  H H    . TYR A 1 46  ? -1.250  -10.065 1.346   1.00 0.00 ? 46  TYR A H    5  
ATOM 8398  H HA   . TYR A 1 46  ? -1.258  -7.598  -0.018  1.00 0.00 ? 46  TYR A HA   5  
ATOM 8399  H HB2  . TYR A 1 46  ? -0.805  -8.192  2.279   1.00 0.00 ? 46  TYR A HB2  5  
ATOM 8400  H HB3  . TYR A 1 46  ? 0.996   -8.349  1.995   1.00 0.00 ? 46  TYR A HB3  5  
ATOM 8401  H HD1  . TYR A 1 46  ? 0.010   -5.047  0.427   1.00 0.00 ? 46  TYR A HD1  5  
ATOM 8402  H HD2  . TYR A 1 46  ? 0.330   -7.077  4.227   1.00 0.00 ? 46  TYR A HD2  5  
ATOM 8403  H HE1  . TYR A 1 46  ? -0.599  -3.115  1.556   1.00 0.00 ? 46  TYR A HE1  5  
ATOM 8404  H HE2  . TYR A 1 46  ? -0.678  -5.162  5.238   1.00 0.00 ? 46  TYR A HE2  5  
ATOM 8405  H HH   . TYR A 1 46  ? -2.072  -2.693  3.593   1.00 0.00 ? 46  TYR A HH   5  
ATOM 8406  N N    . ASN A 1 47  ? 1.410   -9.500  -0.704  1.00 0.00 ? 47  ASN A N    5  
ATOM 8407  C CA   . ASN A 1 47  ? 2.418   -9.713  -1.763  1.00 0.00 ? 47  ASN A CA   5  
ATOM 8408  C C    . ASN A 1 47  ? 1.874   -9.907  -3.147  1.00 0.00 ? 47  ASN A C    5  
ATOM 8409  O O    . ASN A 1 47  ? 2.509   -9.564  -4.141  1.00 0.00 ? 47  ASN A O    5  
ATOM 8410  C CB   . ASN A 1 47  ? 3.386   -10.900 -1.469  1.00 0.00 ? 47  ASN A CB   5  
ATOM 8411  C CG   . ASN A 1 47  ? 2.916   -12.362 -1.490  1.00 0.00 ? 47  ASN A CG   5  
ATOM 8412  O OD1  . ASN A 1 47  ? 2.363   -12.905 -2.445  1.00 0.00 ? 47  ASN A OD1  5  
ATOM 8413  N ND2  . ASN A 1 47  ? 3.277   -13.079 -0.401  1.00 0.00 ? 47  ASN A ND2  5  
ATOM 8414  H H    . ASN A 1 47  ? 1.429   -10.168 0.055   1.00 0.00 ? 47  ASN A H    5  
ATOM 8415  H HA   . ASN A 1 47  ? 2.999   -8.786  -1.807  1.00 0.00 ? 47  ASN A HA   5  
ATOM 8416  H HB2  . ASN A 1 47  ? 4.242   -10.928 -2.156  1.00 0.00 ? 47  ASN A HB2  5  
ATOM 8417  H HB3  . ASN A 1 47  ? 3.727   -10.667 -0.465  1.00 0.00 ? 47  ASN A HB3  5  
ATOM 8418  H HD21 . ASN A 1 47  ? 3.620   -12.597 0.401   1.00 0.00 ? 47  ASN A HD21 5  
ATOM 8419  H HD22 . ASN A 1 47  ? 2.837   -13.968 -0.311  1.00 0.00 ? 47  ASN A HD22 5  
ATOM 8420  N N    . GLU A 1 48  ? 0.620   -10.450 -3.184  1.00 0.00 ? 48  GLU A N    5  
ATOM 8421  C CA   . GLU A 1 48  ? -0.125  -10.691 -4.395  1.00 0.00 ? 48  GLU A CA   5  
ATOM 8422  C C    . GLU A 1 48  ? -0.699  -9.389  -4.970  1.00 0.00 ? 48  GLU A C    5  
ATOM 8423  O O    . GLU A 1 48  ? -0.599  -9.106  -6.157  1.00 0.00 ? 48  GLU A O    5  
ATOM 8424  C CB   . GLU A 1 48  ? -1.236  -11.766 -4.214  1.00 0.00 ? 48  GLU A CB   5  
ATOM 8425  C CG   . GLU A 1 48  ? -1.900  -12.153 -5.550  1.00 0.00 ? 48  GLU A CG   5  
ATOM 8426  C CD   . GLU A 1 48  ? -2.526  -13.545 -5.548  1.00 0.00 ? 48  GLU A CD   5  
ATOM 8427  O OE1  . GLU A 1 48  ? -1.817  -14.517 -5.173  1.00 0.00 ? 48  GLU A OE1  5  
ATOM 8428  O OE2  . GLU A 1 48  ? -3.710  -13.660 -5.963  1.00 0.00 ? 48  GLU A OE2  5  
ATOM 8429  H H    . GLU A 1 48  ? 0.157   -10.686 -2.317  1.00 0.00 ? 48  GLU A H    5  
ATOM 8430  H HA   . GLU A 1 48  ? 0.638   -11.079 -5.047  1.00 0.00 ? 48  GLU A HA   5  
ATOM 8431  H HB2  . GLU A 1 48  ? -0.748  -12.662 -3.776  1.00 0.00 ? 48  GLU A HB2  5  
ATOM 8432  H HB3  . GLU A 1 48  ? -2.015  -11.424 -3.499  1.00 0.00 ? 48  GLU A HB3  5  
ATOM 8433  H HG2  . GLU A 1 48  ? -2.646  -11.393 -5.850  1.00 0.00 ? 48  GLU A HG2  5  
ATOM 8434  H HG3  . GLU A 1 48  ? -1.107  -12.143 -6.310  1.00 0.00 ? 48  GLU A HG3  5  
ATOM 8435  N N    . TYR A 1 49  ? -1.262  -8.555  -4.059  1.00 0.00 ? 49  TYR A N    5  
ATOM 8436  C CA   . TYR A 1 49  ? -1.834  -7.222  -4.194  1.00 0.00 ? 49  TYR A CA   5  
ATOM 8437  C C    . TYR A 1 49  ? -0.835  -6.134  -4.613  1.00 0.00 ? 49  TYR A C    5  
ATOM 8438  O O    . TYR A 1 49  ? -1.066  -5.406  -5.571  1.00 0.00 ? 49  TYR A O    5  
ATOM 8439  C CB   . TYR A 1 49  ? -2.481  -6.971  -2.773  1.00 0.00 ? 49  TYR A CB   5  
ATOM 8440  C CG   . TYR A 1 49  ? -2.782  -5.573  -2.343  1.00 0.00 ? 49  TYR A CG   5  
ATOM 8441  C CD1  . TYR A 1 49  ? -1.889  -5.036  -1.459  1.00 0.00 ? 49  TYR A CD1  5  
ATOM 8442  C CD2  . TYR A 1 49  ? -3.783  -4.786  -2.855  1.00 0.00 ? 49  TYR A CD2  5  
ATOM 8443  C CE1  . TYR A 1 49  ? -1.864  -3.704  -1.156  1.00 0.00 ? 49  TYR A CE1  5  
ATOM 8444  C CE2  . TYR A 1 49  ? -3.795  -3.450  -2.518  1.00 0.00 ? 49  TYR A CE2  5  
ATOM 8445  C CZ   . TYR A 1 49  ? -2.821  -2.891  -1.716  1.00 0.00 ? 49  TYR A CZ   5  
ATOM 8446  O OH   . TYR A 1 49  ? -2.826  -1.500  -1.503  1.00 0.00 ? 49  TYR A OH   5  
ATOM 8447  H H    . TYR A 1 49  ? -1.319  -8.890  -3.115  1.00 0.00 ? 49  TYR A H    5  
ATOM 8448  H HA   . TYR A 1 49  ? -2.582  -7.208  -4.962  1.00 0.00 ? 49  TYR A HA   5  
ATOM 8449  H HB2  . TYR A 1 49  ? -3.361  -7.615  -2.526  1.00 0.00 ? 49  TYR A HB2  5  
ATOM 8450  H HB3  . TYR A 1 49  ? -1.692  -7.329  -2.077  1.00 0.00 ? 49  TYR A HB3  5  
ATOM 8451  H HD1  . TYR A 1 49  ? -1.091  -5.673  -1.114  1.00 0.00 ? 49  TYR A HD1  5  
ATOM 8452  H HD2  . TYR A 1 49  ? -4.494  -5.183  -3.566  1.00 0.00 ? 49  TYR A HD2  5  
ATOM 8453  H HE1  . TYR A 1 49  ? -0.970  -3.360  -0.640  1.00 0.00 ? 49  TYR A HE1  5  
ATOM 8454  H HE2  . TYR A 1 49  ? -4.537  -2.816  -2.960  1.00 0.00 ? 49  TYR A HE2  5  
ATOM 8455  H HH   . TYR A 1 49  ? -2.150  -1.293  -0.853  1.00 0.00 ? 49  TYR A HH   5  
ATOM 8456  N N    . ILE A 1 50  ? 0.294   -5.994  -3.884  1.00 0.00 ? 50  ILE A N    5  
ATOM 8457  C CA   . ILE A 1 50  ? 1.342   -4.982  -4.110  1.00 0.00 ? 50  ILE A CA   5  
ATOM 8458  C C    . ILE A 1 50  ? 2.404   -5.181  -5.143  1.00 0.00 ? 50  ILE A C    5  
ATOM 8459  O O    . ILE A 1 50  ? 3.175   -4.262  -5.417  1.00 0.00 ? 50  ILE A O    5  
ATOM 8460  C CB   . ILE A 1 50  ? 1.873   -4.353  -2.858  1.00 0.00 ? 50  ILE A CB   5  
ATOM 8461  C CG1  . ILE A 1 50  ? 1.980   -5.383  -1.735  1.00 0.00 ? 50  ILE A CG1  5  
ATOM 8462  C CG2  . ILE A 1 50  ? 0.825   -3.287  -2.574  1.00 0.00 ? 50  ILE A CG2  5  
ATOM 8463  C CD1  . ILE A 1 50  ? 3.059   -5.359  -0.671  1.00 0.00 ? 50  ILE A CD1  5  
ATOM 8464  H H    . ILE A 1 50  ? 0.413   -6.625  -3.103  1.00 0.00 ? 50  ILE A H    5  
ATOM 8465  H HA   . ILE A 1 50  ? 0.849   -4.142  -4.586  1.00 0.00 ? 50  ILE A HA   5  
ATOM 8466  H HB   . ILE A 1 50  ? 2.815   -3.835  -3.052  1.00 0.00 ? 50  ILE A HB   5  
ATOM 8467  H HG12 . ILE A 1 50  ? 0.998   -5.392  -1.228  1.00 0.00 ? 50  ILE A HG12 5  
ATOM 8468  H HG13 . ILE A 1 50  ? 2.113   -6.366  -2.203  1.00 0.00 ? 50  ILE A HG13 5  
ATOM 8469  H HG21 . ILE A 1 50  ? -0.172  -3.705  -2.785  1.00 0.00 ? 50  ILE A HG21 5  
ATOM 8470  H HG22 . ILE A 1 50  ? 0.881   -2.937  -1.540  1.00 0.00 ? 50  ILE A HG22 5  
ATOM 8471  H HG23 . ILE A 1 50  ? 0.919   -2.441  -3.265  1.00 0.00 ? 50  ILE A HG23 5  
ATOM 8472  H HD11 . ILE A 1 50  ? 3.131   -4.364  -0.197  1.00 0.00 ? 50  ILE A HD11 5  
ATOM 8473  H HD12 . ILE A 1 50  ? 2.786   -6.107  0.123   1.00 0.00 ? 50  ILE A HD12 5  
ATOM 8474  H HD13 . ILE A 1 50  ? 4.038   -5.626  -1.125  1.00 0.00 ? 50  ILE A HD13 5  
ATOM 8475  N N    . SER A 1 51  ? 2.415   -6.354  -5.804  1.00 0.00 ? 51  SER A N    5  
ATOM 8476  C CA   . SER A 1 51  ? 3.226   -6.664  -6.986  1.00 0.00 ? 51  SER A CA   5  
ATOM 8477  C C    . SER A 1 51  ? 2.412   -6.226  -8.222  1.00 0.00 ? 51  SER A C    5  
ATOM 8478  O O    . SER A 1 51  ? 2.085   -7.006  -9.112  1.00 0.00 ? 51  SER A O    5  
ATOM 8479  C CB   . SER A 1 51  ? 3.646   -8.162  -7.082  1.00 0.00 ? 51  SER A CB   5  
ATOM 8480  O OG   . SER A 1 51  ? 4.548   -8.393  -8.168  1.00 0.00 ? 51  SER A OG   5  
ATOM 8481  H H    . SER A 1 51  ? 1.777   -7.031  -5.466  1.00 0.00 ? 51  SER A H    5  
ATOM 8482  H HA   . SER A 1 51  ? 4.137   -6.079  -6.925  1.00 0.00 ? 51  SER A HA   5  
ATOM 8483  H HB2  . SER A 1 51  ? 4.159   -8.451  -6.138  1.00 0.00 ? 51  SER A HB2  5  
ATOM 8484  H HB3  . SER A 1 51  ? 2.751   -8.817  -7.186  1.00 0.00 ? 51  SER A HB3  5  
ATOM 8485  H HG   . SER A 1 51  ? 4.016   -8.203  -8.955  1.00 0.00 ? 51  SER A HG   5  
ATOM 8486  N N    . HIS A 1 52  ? 2.061   -4.924  -8.207  1.00 0.00 ? 52  HIS A N    5  
ATOM 8487  C CA   . HIS A 1 52  ? 1.213   -4.142  -9.080  1.00 0.00 ? 52  HIS A CA   5  
ATOM 8488  C C    . HIS A 1 52  ? 1.777   -2.736  -8.883  1.00 0.00 ? 52  HIS A C    5  
ATOM 8489  O O    . HIS A 1 52  ? 2.820   -2.564  -8.253  1.00 0.00 ? 52  HIS A O    5  
ATOM 8490  C CB   . HIS A 1 52  ? -0.267  -4.171  -8.549  1.00 0.00 ? 52  HIS A CB   5  
ATOM 8491  C CG   . HIS A 1 52  ? -1.160  -5.320  -8.984  1.00 0.00 ? 52  HIS A CG   5  
ATOM 8492  N ND1  . HIS A 1 52  ? -2.076  -5.236  -10.017 1.00 0.00 ? 52  HIS A ND1  5  
ATOM 8493  C CD2  . HIS A 1 52  ? -1.422  -6.511  -8.370  1.00 0.00 ? 52  HIS A CD2  5  
ATOM 8494  C CE1  . HIS A 1 52  ? -2.842  -6.357  -9.967  1.00 0.00 ? 52  HIS A CE1  5  
ATOM 8495  N NE2  . HIS A 1 52  ? -2.489  -7.155  -8.987  1.00 0.00 ? 52  HIS A NE2  5  
ATOM 8496  H H    . HIS A 1 52  ? 2.428   -4.385  -7.440  1.00 0.00 ? 52  HIS A H    5  
ATOM 8497  H HA   . HIS A 1 52  ? 1.317   -4.437  -10.116 1.00 0.00 ? 52  HIS A HA   5  
ATOM 8498  H HB2  . HIS A 1 52  ? -0.216  -4.240  -7.435  1.00 0.00 ? 52  HIS A HB2  5  
ATOM 8499  H HB3  . HIS A 1 52  ? -0.824  -3.236  -8.782  1.00 0.00 ? 52  HIS A HB3  5  
ATOM 8500  H HD1  . HIS A 1 52  ? -2.190  -4.482  -10.660 1.00 0.00 ? 52  HIS A HD1  5  
ATOM 8501  H HD2  . HIS A 1 52  ? -0.940  -6.975  -7.521  1.00 0.00 ? 52  HIS A HD2  5  
ATOM 8502  H HE1  . HIS A 1 52  ? -3.678  -6.573  -10.635 1.00 0.00 ? 52  HIS A HE1  5  
ATOM 8503  N N    . ARG A 1 53  ? 1.061   -1.670  -9.337  1.00 0.00 ? 53  ARG A N    5  
ATOM 8504  C CA   . ARG A 1 53  ? 1.393   -0.250  -9.148  1.00 0.00 ? 53  ARG A CA   5  
ATOM 8505  C C    . ARG A 1 53  ? 1.373   0.289   -7.716  1.00 0.00 ? 53  ARG A C    5  
ATOM 8506  O O    . ARG A 1 53  ? 2.045   1.254   -7.366  1.00 0.00 ? 53  ARG A O    5  
ATOM 8507  C CB   . ARG A 1 53  ? 0.482   0.683   -9.999  1.00 0.00 ? 53  ARG A CB   5  
ATOM 8508  C CG   . ARG A 1 53  ? -1.029  0.520   -9.735  1.00 0.00 ? 53  ARG A CG   5  
ATOM 8509  C CD   . ARG A 1 53  ? -1.712  1.453   -8.700  1.00 0.00 ? 53  ARG A CD   5  
ATOM 8510  N NE   . ARG A 1 53  ? -3.181  1.114   -8.690  1.00 0.00 ? 53  ARG A NE   5  
ATOM 8511  C CZ   . ARG A 1 53  ? -4.054  1.533   -7.718  1.00 0.00 ? 53  ARG A CZ   5  
ATOM 8512  N NH1  . ARG A 1 53  ? -3.633  2.326   -6.690  1.00 0.00 ? 53  ARG A NH1  5  
ATOM 8513  N NH2  . ARG A 1 53  ? -5.361  1.142   -7.778  1.00 0.00 ? 53  ARG A NH2  5  
ATOM 8514  H H    . ARG A 1 53  ? 0.219   -1.814  -9.844  1.00 0.00 ? 53  ARG A H    5  
ATOM 8515  H HA   . ARG A 1 53  ? 2.354   -0.091  -9.558  1.00 0.00 ? 53  ARG A HA   5  
ATOM 8516  H HB2  . ARG A 1 53  ? 0.773   1.754   -9.906  1.00 0.00 ? 53  ARG A HB2  5  
ATOM 8517  H HB3  . ARG A 1 53  ? 0.665   0.406   -11.064 1.00 0.00 ? 53  ARG A HB3  5  
ATOM 8518  H HG2  . ARG A 1 53  ? -1.535  0.653   -10.715 1.00 0.00 ? 53  ARG A HG2  5  
ATOM 8519  H HG3  . ARG A 1 53  ? -1.138  -0.535  -9.422  1.00 0.00 ? 53  ARG A HG3  5  
ATOM 8520  H HD2  . ARG A 1 53  ? -1.321  1.334   -7.662  1.00 0.00 ? 53  ARG A HD2  5  
ATOM 8521  H HD3  . ARG A 1 53  ? -1.600  2.518   -8.991  1.00 0.00 ? 53  ARG A HD3  5  
ATOM 8522  H HE   . ARG A 1 53  ? -3.533  0.532   -9.422  1.00 0.00 ? 53  ARG A HE   5  
ATOM 8523  H HH11 . ARG A 1 53  ? -2.675  2.609   -6.639  1.00 0.00 ? 53  ARG A HH11 5  
ATOM 8524  H HH12 . ARG A 1 53  ? -4.280  2.617   -5.986  1.00 0.00 ? 53  ARG A HH12 5  
ATOM 8525  H HH21 . ARG A 1 53  ? -5.672  0.557   -8.527  1.00 0.00 ? 53  ARG A HH21 5  
ATOM 8526  H HH22 . ARG A 1 53  ? -6.004  1.439   -7.072  1.00 0.00 ? 53  ARG A HH22 5  
ATOM 8527  N N    . GLU A 1 54  ? 0.494   -0.306  -6.886  1.00 0.00 ? 54  GLU A N    5  
ATOM 8528  C CA   . GLU A 1 54  ? 0.042   0.187   -5.602  1.00 0.00 ? 54  GLU A CA   5  
ATOM 8529  C C    . GLU A 1 54  ? 0.881   -0.022  -4.376  1.00 0.00 ? 54  GLU A C    5  
ATOM 8530  O O    . GLU A 1 54  ? 0.349   0.196   -3.295  1.00 0.00 ? 54  GLU A O    5  
ATOM 8531  C CB   . GLU A 1 54  ? -1.361  -0.425  -5.362  1.00 0.00 ? 54  GLU A CB   5  
ATOM 8532  C CG   . GLU A 1 54  ? -1.380  -1.960  -5.218  1.00 0.00 ? 54  GLU A CG   5  
ATOM 8533  C CD   . GLU A 1 54  ? -2.766  -2.444  -5.643  1.00 0.00 ? 54  GLU A CD   5  
ATOM 8534  O OE1  . GLU A 1 54  ? -2.849  -3.377  -6.484  1.00 0.00 ? 54  GLU A OE1  5  
ATOM 8535  O OE2  . GLU A 1 54  ? -3.768  -1.853  -5.159  1.00 0.00 ? 54  GLU A OE2  5  
ATOM 8536  H H    . GLU A 1 54  ? -0.017  -1.084  -7.233  1.00 0.00 ? 54  GLU A H    5  
ATOM 8537  H HA   . GLU A 1 54  ? -0.097  1.258   -5.680  1.00 0.00 ? 54  GLU A HA   5  
ATOM 8538  H HB2  . GLU A 1 54  ? -1.865  0.037   -4.482  1.00 0.00 ? 54  GLU A HB2  5  
ATOM 8539  H HB3  . GLU A 1 54  ? -1.976  -0.142  -6.246  1.00 0.00 ? 54  GLU A HB3  5  
ATOM 8540  H HG2  . GLU A 1 54  ? -0.595  -2.437  -5.844  1.00 0.00 ? 54  GLU A HG2  5  
ATOM 8541  H HG3  . GLU A 1 54  ? -1.156  -2.248  -4.168  1.00 0.00 ? 54  GLU A HG3  5  
ATOM 8542  N N    . HIS A 1 55  ? 2.162   -0.482  -4.498  1.00 0.00 ? 55  HIS A N    5  
ATOM 8543  C CA   . HIS A 1 55  ? 3.126   -0.856  -3.441  1.00 0.00 ? 55  HIS A CA   5  
ATOM 8544  C C    . HIS A 1 55  ? 3.124   -0.202  -2.038  1.00 0.00 ? 55  HIS A C    5  
ATOM 8545  O O    . HIS A 1 55  ? 4.029   0.515   -1.624  1.00 0.00 ? 55  HIS A O    5  
ATOM 8546  C CB   . HIS A 1 55  ? 4.565   -1.138  -3.949  1.00 0.00 ? 55  HIS A CB   5  
ATOM 8547  C CG   . HIS A 1 55  ? 5.423   -1.849  -2.915  1.00 0.00 ? 55  HIS A CG   5  
ATOM 8548  N ND1  . HIS A 1 55  ? 6.598   -1.319  -2.433  1.00 0.00 ? 55  HIS A ND1  5  
ATOM 8549  C CD2  . HIS A 1 55  ? 5.153   -2.930  -2.125  1.00 0.00 ? 55  HIS A CD2  5  
ATOM 8550  C CE1  . HIS A 1 55  ? 6.991   -2.095  -1.393  1.00 0.00 ? 55  HIS A CE1  5  
ATOM 8551  N NE2  . HIS A 1 55  ? 6.140   -3.078  -1.157  1.00 0.00 ? 55  HIS A NE2  5  
ATOM 8552  H H    . HIS A 1 55  ? 2.460   -0.646  -5.440  1.00 0.00 ? 55  HIS A H    5  
ATOM 8553  H HA   . HIS A 1 55  ? 2.828   -1.858  -3.224  1.00 0.00 ? 55  HIS A HA   5  
ATOM 8554  H HB2  . HIS A 1 55  ? 4.497   -1.813  -4.839  1.00 0.00 ? 55  HIS A HB2  5  
ATOM 8555  H HB3  . HIS A 1 55  ? 5.043   -0.173  -4.246  1.00 0.00 ? 55  HIS A HB3  5  
ATOM 8556  H HD1  . HIS A 1 55  ? 6.976   -0.437  -2.720  1.00 0.00 ? 55  HIS A HD1  5  
ATOM 8557  H HD2  . HIS A 1 55  ? 4.288   -3.592  -2.120  1.00 0.00 ? 55  HIS A HD2  5  
ATOM 8558  H HE1  . HIS A 1 55  ? 7.895   -1.901  -0.817  1.00 0.00 ? 55  HIS A HE1  5  
ATOM 8559  N N    . ILE A 1 56  ? 2.068   -0.573  -1.272  1.00 0.00 ? 56  ILE A N    5  
ATOM 8560  C CA   . ILE A 1 56  ? 1.728   -0.311  0.107   1.00 0.00 ? 56  ILE A CA   5  
ATOM 8561  C C    . ILE A 1 56  ? 2.080   -1.557  0.851   1.00 0.00 ? 56  ILE A C    5  
ATOM 8562  O O    . ILE A 1 56  ? 1.655   -2.647  0.501   1.00 0.00 ? 56  ILE A O    5  
ATOM 8563  C CB   . ILE A 1 56  ? 0.240   -0.063  0.272   1.00 0.00 ? 56  ILE A CB   5  
ATOM 8564  C CG1  . ILE A 1 56  ? 0.034   1.362   -0.249  1.00 0.00 ? 56  ILE A CG1  5  
ATOM 8565  C CG2  . ILE A 1 56  ? -0.375  -0.181  1.707   1.00 0.00 ? 56  ILE A CG2  5  
ATOM 8566  C CD1  . ILE A 1 56  ? -1.434  1.519   -0.528  1.00 0.00 ? 56  ILE A CD1  5  
ATOM 8567  H H    . ILE A 1 56  ? 1.379   -1.133  -1.724  1.00 0.00 ? 56  ILE A H    5  
ATOM 8568  H HA   . ILE A 1 56  ? 2.213   0.572   0.482   1.00 0.00 ? 56  ILE A HA   5  
ATOM 8569  H HB   . ILE A 1 56  ? -0.321  -0.781  -0.380  1.00 0.00 ? 56  ILE A HB   5  
ATOM 8570  H HG12 . ILE A 1 56  ? 0.381   2.108   0.501   1.00 0.00 ? 56  ILE A HG12 5  
ATOM 8571  H HG13 . ILE A 1 56  ? 0.603   1.529   -1.191  1.00 0.00 ? 56  ILE A HG13 5  
ATOM 8572  H HG21 . ILE A 1 56  ? -0.071  -1.077  2.279   1.00 0.00 ? 56  ILE A HG21 5  
ATOM 8573  H HG22 . ILE A 1 56  ? -0.120  0.713   2.304   1.00 0.00 ? 56  ILE A HG22 5  
ATOM 8574  H HG23 . ILE A 1 56  ? -1.483  -0.215  1.626   1.00 0.00 ? 56  ILE A HG23 5  
ATOM 8575  H HD11 . ILE A 1 56  ? -1.716  0.628   -1.139  1.00 0.00 ? 56  ILE A HD11 5  
ATOM 8576  H HD12 . ILE A 1 56  ? -1.948  1.528   0.458   1.00 0.00 ? 56  ILE A HD12 5  
ATOM 8577  H HD13 . ILE A 1 56  ? -1.602  2.436   -1.128  1.00 0.00 ? 56  ILE A HD13 5  
ATOM 8578  N N    . HIS A 1 57  ? 2.807   -1.434  1.964   1.00 0.00 ? 57  HIS A N    5  
ATOM 8579  C CA   . HIS A 1 57  ? 3.037   -2.523  2.882   1.00 0.00 ? 57  HIS A CA   5  
ATOM 8580  C C    . HIS A 1 57  ? 2.314   -2.077  4.143   1.00 0.00 ? 57  HIS A C    5  
ATOM 8581  O O    . HIS A 1 57  ? 2.023   -0.892  4.315   1.00 0.00 ? 57  HIS A O    5  
ATOM 8582  C CB   . HIS A 1 57  ? 4.548   -2.833  3.014   1.00 0.00 ? 57  HIS A CB   5  
ATOM 8583  C CG   . HIS A 1 57  ? 4.856   -4.217  2.495   1.00 0.00 ? 57  HIS A CG   5  
ATOM 8584  N ND1  . HIS A 1 57  ? 5.526   -4.540  1.332   1.00 0.00 ? 57  HIS A ND1  5  
ATOM 8585  C CD2  . HIS A 1 57  ? 4.486   -5.407  3.043   1.00 0.00 ? 57  HIS A CD2  5  
ATOM 8586  C CE1  . HIS A 1 57  ? 5.547   -5.898  1.256   1.00 0.00 ? 57  HIS A CE1  5  
ATOM 8587  N NE2  . HIS A 1 57  ? 4.916   -6.466  2.268   1.00 0.00 ? 57  HIS A NE2  5  
ATOM 8588  H H    . HIS A 1 57  ? 3.124   -0.548  2.282   1.00 0.00 ? 57  HIS A H    5  
ATOM 8589  H HA   . HIS A 1 57  ? 2.537   -3.434  2.564   1.00 0.00 ? 57  HIS A HA   5  
ATOM 8590  H HB2  . HIS A 1 57  ? 5.112   -2.059  2.448   1.00 0.00 ? 57  HIS A HB2  5  
ATOM 8591  H HB3  . HIS A 1 57  ? 4.914   -2.793  4.058   1.00 0.00 ? 57  HIS A HB3  5  
ATOM 8592  H HD1  . HIS A 1 57  ? 5.811   -3.914  0.584   1.00 0.00 ? 57  HIS A HD1  5  
ATOM 8593  H HD2  . HIS A 1 57  ? 3.898   -5.572  3.935   1.00 0.00 ? 57  HIS A HD2  5  
ATOM 8594  H HE1  . HIS A 1 57  ? 6.001   -6.442  0.429   1.00 0.00 ? 57  HIS A HE1  5  
ATOM 8595  N N    . MET A 1 58  ? 1.975   -3.017  5.070   1.00 0.00 ? 58  MET A N    5  
ATOM 8596  C CA   . MET A 1 58  ? 1.135   -2.883  6.288   1.00 0.00 ? 58  MET A CA   5  
ATOM 8597  C C    . MET A 1 58  ? 1.435   -1.798  7.277   1.00 0.00 ? 58  MET A C    5  
ATOM 8598  O O    . MET A 1 58  ? 0.635   -1.381  8.103   1.00 0.00 ? 58  MET A O    5  
ATOM 8599  C CB   . MET A 1 58  ? 0.970   -4.246  7.012   1.00 0.00 ? 58  MET A CB   5  
ATOM 8600  C CG   . MET A 1 58  ? 1.785   -4.629  8.270   1.00 0.00 ? 58  MET A CG   5  
ATOM 8601  S SD   . MET A 1 58  ? 1.295   -3.967  9.893   1.00 0.00 ? 58  MET A SD   5  
ATOM 8602  C CE   . MET A 1 58  ? -0.493  -4.131  9.644   1.00 0.00 ? 58  MET A CE   5  
ATOM 8603  H H    . MET A 1 58  ? 2.226   -3.952  4.871   1.00 0.00 ? 58  MET A H    5  
ATOM 8604  H HA   . MET A 1 58  ? 0.153   -2.625  5.934   1.00 0.00 ? 58  MET A HA   5  
ATOM 8605  H HB2  . MET A 1 58  ? -0.106  -4.357  7.211   1.00 0.00 ? 58  MET A HB2  5  
ATOM 8606  H HB3  . MET A 1 58  ? 1.187   -5.048  6.282   1.00 0.00 ? 58  MET A HB3  5  
ATOM 8607  H HG2  . MET A 1 58  ? 1.607   -5.719  8.328   1.00 0.00 ? 58  MET A HG2  5  
ATOM 8608  H HG3  . MET A 1 58  ? 2.869   -4.472  8.101   1.00 0.00 ? 58  MET A HG3  5  
ATOM 8609  H HE1  . MET A 1 58  ? -0.749  -5.086  9.144   1.00 0.00 ? 58  MET A HE1  5  
ATOM 8610  H HE2  . MET A 1 58  ? -1.035  -4.077  10.609  1.00 0.00 ? 58  MET A HE2  5  
ATOM 8611  H HE3  . MET A 1 58  ? -0.875  -3.302  9.011   1.00 0.00 ? 58  MET A HE3  5  
ATOM 8612  N N    . ASN A 1 59  ? 2.659   -1.321  7.120   1.00 0.00 ? 59  ASN A N    5  
ATOM 8613  C CA   . ASN A 1 59  ? 3.470   -0.349  7.773   1.00 0.00 ? 59  ASN A CA   5  
ATOM 8614  C C    . ASN A 1 59  ? 3.039   1.084   7.323   1.00 0.00 ? 59  ASN A C    5  
ATOM 8615  O O    . ASN A 1 59  ? 3.206   2.068   8.043   1.00 0.00 ? 59  ASN A O    5  
ATOM 8616  C CB   . ASN A 1 59  ? 4.911   -0.886  7.425   1.00 0.00 ? 59  ASN A CB   5  
ATOM 8617  C CG   . ASN A 1 59  ? 4.979   -2.431  7.678   1.00 0.00 ? 59  ASN A CG   5  
ATOM 8618  O OD1  . ASN A 1 59  ? 5.070   -2.872  8.822   1.00 0.00 ? 59  ASN A OD1  5  
ATOM 8619  N ND2  . ASN A 1 59  ? 4.821   -3.289  6.617   1.00 0.00 ? 59  ASN A ND2  5  
ATOM 8620  H H    . ASN A 1 59  ? 3.147   -1.772  6.381   1.00 0.00 ? 59  ASN A H    5  
ATOM 8621  H HA   . ASN A 1 59  ? 3.303   -0.418  8.847   1.00 0.00 ? 59  ASN A HA   5  
ATOM 8622  H HB2  . ASN A 1 59  ? 5.144   -0.690  6.362   1.00 0.00 ? 59  ASN A HB2  5  
ATOM 8623  H HB3  . ASN A 1 59  ? 5.660   -0.392  8.074   1.00 0.00 ? 59  ASN A HB3  5  
ATOM 8624  H HD21 . ASN A 1 59  ? 4.851   -2.962  5.682   1.00 0.00 ? 59  ASN A HD21 5  
ATOM 8625  H HD22 . ASN A 1 59  ? 4.490   -4.234  6.780   1.00 0.00 ? 59  ASN A HD22 5  
ATOM 8626  N N    . ALA A 1 60  ? 2.339   1.189   6.133   1.00 0.00 ? 60  ALA A N    5  
ATOM 8627  C CA   . ALA A 1 60  ? 1.622   2.358   5.575   1.00 0.00 ? 60  ALA A CA   5  
ATOM 8628  C C    . ALA A 1 60  ? 0.151   2.384   6.050   1.00 0.00 ? 60  ALA A C    5  
ATOM 8629  O O    . ALA A 1 60  ? -0.783  2.496   5.256   1.00 0.00 ? 60  ALA A O    5  
ATOM 8630  C CB   . ALA A 1 60  ? 1.618   2.356   4.011   1.00 0.00 ? 60  ALA A CB   5  
ATOM 8631  H H    . ALA A 1 60  ? 2.224   0.365   5.552   1.00 0.00 ? 60  ALA A H    5  
ATOM 8632  H HA   . ALA A 1 60  ? 2.083   3.273   5.919   1.00 0.00 ? 60  ALA A HA   5  
ATOM 8633  H HB1  . ALA A 1 60  ? 2.657   2.379   3.622   1.00 0.00 ? 60  ALA A HB1  5  
ATOM 8634  H HB2  . ALA A 1 60  ? 1.109   1.460   3.593   1.00 0.00 ? 60  ALA A HB2  5  
ATOM 8635  H HB3  . ALA A 1 60  ? 1.068   3.234   3.597   1.00 0.00 ? 60  ALA A HB3  5  
ATOM 8636  N N    . THR A 1 61  ? -0.063  2.229   7.385   1.00 0.00 ? 61  THR A N    5  
ATOM 8637  C CA   . THR A 1 61  ? -1.356  2.122   8.067   1.00 0.00 ? 61  THR A CA   5  
ATOM 8638  C C    . THR A 1 61  ? -1.248  2.700   9.499   1.00 0.00 ? 61  THR A C    5  
ATOM 8639  O O    . THR A 1 61  ? -0.206  3.202   9.916   1.00 0.00 ? 61  THR A O    5  
ATOM 8640  C CB   . THR A 1 61  ? -1.937  0.671   8.128   1.00 0.00 ? 61  THR A CB   5  
ATOM 8641  O OG1  . THR A 1 61  ? -1.357  -0.177  9.123   1.00 0.00 ? 61  THR A OG1  5  
ATOM 8642  C CG2  . THR A 1 61  ? -1.862  -0.095  6.786   1.00 0.00 ? 61  THR A CG2  5  
ATOM 8643  H H    . THR A 1 61  ? 0.733   2.147   7.988   1.00 0.00 ? 61  THR A H    5  
ATOM 8644  H HA   . THR A 1 61  ? -2.076  2.733   7.539   1.00 0.00 ? 61  THR A HA   5  
ATOM 8645  H HB   . THR A 1 61  ? -3.021  0.751   8.381   1.00 0.00 ? 61  THR A HB   5  
ATOM 8646  H HG1  . THR A 1 61  ? -0.561  -0.613  8.735   1.00 0.00 ? 61  THR A HG1  5  
ATOM 8647  H HG21 . THR A 1 61  ? -0.825  -0.161  6.402   1.00 0.00 ? 61  THR A HG21 5  
ATOM 8648  H HG22 . THR A 1 61  ? -2.172  -1.154  6.910   1.00 0.00 ? 61  THR A HG22 5  
ATOM 8649  H HG23 . THR A 1 61  ? -2.512  0.390   6.025   1.00 0.00 ? 61  THR A HG23 5  
ATOM 8650  N N    . GLN A 1 62  ? -2.347  2.541   10.301  1.00 0.00 ? 62  GLN A N    5  
ATOM 8651  C CA   . GLN A 1 62  ? -2.526  2.868   11.722  1.00 0.00 ? 62  GLN A CA   5  
ATOM 8652  C C    . GLN A 1 62  ? -2.120  1.723   12.631  1.00 0.00 ? 62  GLN A C    5  
ATOM 8653  O O    . GLN A 1 62  ? -1.869  1.866   13.830  1.00 0.00 ? 62  GLN A O    5  
ATOM 8654  C CB   . GLN A 1 62  ? -4.051  3.105   11.942  1.00 0.00 ? 62  GLN A CB   5  
ATOM 8655  C CG   . GLN A 1 62  ? -4.551  3.449   13.369  1.00 0.00 ? 62  GLN A CG   5  
ATOM 8656  C CD   . GLN A 1 62  ? -5.448  2.356   13.955  1.00 0.00 ? 62  GLN A CD   5  
ATOM 8657  O OE1  . GLN A 1 62  ? -5.220  1.816   15.039  1.00 0.00 ? 62  GLN A OE1  5  
ATOM 8658  N NE2  . GLN A 1 62  ? -6.543  2.025   13.214  1.00 0.00 ? 62  GLN A NE2  5  
ATOM 8659  H H    . GLN A 1 62  ? -3.157  2.133   9.892   1.00 0.00 ? 62  GLN A H    5  
ATOM 8660  H HA   . GLN A 1 62  ? -1.921  3.722   11.992  1.00 0.00 ? 62  GLN A HA   5  
ATOM 8661  H HB2  . GLN A 1 62  ? -4.335  3.972   11.307  1.00 0.00 ? 62  GLN A HB2  5  
ATOM 8662  H HB3  . GLN A 1 62  ? -4.607  2.229   11.533  1.00 0.00 ? 62  GLN A HB3  5  
ATOM 8663  H HG2  . GLN A 1 62  ? -3.693  3.594   14.073  1.00 0.00 ? 62  GLN A HG2  5  
ATOM 8664  H HG3  . GLN A 1 62  ? -5.165  4.381   13.300  1.00 0.00 ? 62  GLN A HG3  5  
ATOM 8665  H HE21 . GLN A 1 62  ? -6.699  2.505   12.348  1.00 0.00 ? 62  GLN A HE21 5  
ATOM 8666  H HE22 . GLN A 1 62  ? -7.183  1.359   13.592  1.00 0.00 ? 62  GLN A HE22 5  
ATOM 8667  N N    . TRP A 1 63  ? -2.088  0.530   12.010  1.00 0.00 ? 63  TRP A N    5  
ATOM 8668  C CA   . TRP A 1 63  ? -1.807  -0.768  12.572  1.00 0.00 ? 63  TRP A CA   5  
ATOM 8669  C C    . TRP A 1 63  ? -0.299  -1.048  12.626  1.00 0.00 ? 63  TRP A C    5  
ATOM 8670  O O    . TRP A 1 63  ? 0.338   -1.305  11.611  1.00 0.00 ? 63  TRP A O    5  
ATOM 8671  C CB   . TRP A 1 63  ? -2.562  -1.850  11.732  1.00 0.00 ? 63  TRP A CB   5  
ATOM 8672  C CG   . TRP A 1 63  ? -3.995  -1.488  11.298  1.00 0.00 ? 63  TRP A CG   5  
ATOM 8673  C CD1  . TRP A 1 63  ? -5.048  -1.107  12.086  1.00 0.00 ? 63  TRP A CD1  5  
ATOM 8674  C CD2  . TRP A 1 63  ? -4.520  -1.541  9.946   1.00 0.00 ? 63  TRP A CD2  5  
ATOM 8675  N NE1  . TRP A 1 63  ? -6.190  -0.963  11.321  1.00 0.00 ? 63  TRP A NE1  5  
ATOM 8676  C CE2  . TRP A 1 63  ? -5.869  -1.235  10.010  1.00 0.00 ? 63  TRP A CE2  5  
ATOM 8677  C CE3  . TRP A 1 63  ? -3.949  -1.847  8.742   1.00 0.00 ? 63  TRP A CE3  5  
ATOM 8678  C CZ2  . TRP A 1 63  ? -6.642  -1.259  8.888   1.00 0.00 ? 63  TRP A CZ2  5  
ATOM 8679  C CZ3  . TRP A 1 63  ? -4.718  -1.752  7.589   1.00 0.00 ? 63  TRP A CZ3  5  
ATOM 8680  C CH2  . TRP A 1 63  ? -6.068  -1.464  7.648   1.00 0.00 ? 63  TRP A CH2  5  
ATOM 8681  H H    . TRP A 1 63  ? -2.273  0.512   11.025  1.00 0.00 ? 63  TRP A H    5  
ATOM 8682  H HA   . TRP A 1 63  ? -2.202  -0.812  13.576  1.00 0.00 ? 63  TRP A HA   5  
ATOM 8683  H HB2  . TRP A 1 63  ? -1.987  -2.049  10.795  1.00 0.00 ? 63  TRP A HB2  5  
ATOM 8684  H HB3  . TRP A 1 63  ? -2.633  -2.788  12.347  1.00 0.00 ? 63  TRP A HB3  5  
ATOM 8685  H HD1  . TRP A 1 63  ? -4.988  -0.961  13.155  1.00 0.00 ? 63  TRP A HD1  5  
ATOM 8686  H HE1  . TRP A 1 63  ? -7.103  -0.921  11.677  1.00 0.00 ? 63  TRP A HE1  5  
ATOM 8687  H HE3  . TRP A 1 63  ? -2.909  -2.120  8.670   1.00 0.00 ? 63  TRP A HE3  5  
ATOM 8688  H HZ2  . TRP A 1 63  ? -7.692  -1.068  8.954   1.00 0.00 ? 63  TRP A HZ2  5  
ATOM 8689  H HZ3  . TRP A 1 63  ? -4.262  -1.930  6.624   1.00 0.00 ? 63  TRP A HZ3  5  
ATOM 8690  H HH2  . TRP A 1 63  ? -6.681  -1.408  6.738   1.00 0.00 ? 63  TRP A HH2  5  
ATOM 8691  N N    . GLU A 1 64  ? 0.308   -1.026  13.844  1.00 0.00 ? 64  GLU A N    5  
ATOM 8692  C CA   . GLU A 1 64  ? 1.731   -1.296  14.110  1.00 0.00 ? 64  GLU A CA   5  
ATOM 8693  C C    . GLU A 1 64  ? 2.200   -2.754  13.992  1.00 0.00 ? 64  GLU A C    5  
ATOM 8694  O O    . GLU A 1 64  ? 3.386   -3.077  14.062  1.00 0.00 ? 64  GLU A O    5  
ATOM 8695  C CB   . GLU A 1 64  ? 2.090   -0.717  15.490  1.00 0.00 ? 64  GLU A CB   5  
ATOM 8696  C CG   . GLU A 1 64  ? 1.385   -1.465  16.616  1.00 0.00 ? 64  GLU A CG   5  
ATOM 8697  C CD   . GLU A 1 64  ? 1.452   -0.699  17.931  1.00 0.00 ? 64  GLU A CD   5  
ATOM 8698  O OE1  . GLU A 1 64  ? 2.588   -0.405  18.391  1.00 0.00 ? 64  GLU A OE1  5  
ATOM 8699  O OE2  . GLU A 1 64  ? 0.366   -0.397  18.496  1.00 0.00 ? 64  GLU A OE2  5  
ATOM 8700  H H    . GLU A 1 64  ? -0.245  -0.780  14.640  1.00 0.00 ? 64  GLU A H    5  
ATOM 8701  H HA   . GLU A 1 64  ? 2.345   -0.748  13.443  1.00 0.00 ? 64  GLU A HA   5  
ATOM 8702  H HB2  . GLU A 1 64  ? 3.188   -0.809  15.669  1.00 0.00 ? 64  GLU A HB2  5  
ATOM 8703  H HB3  . GLU A 1 64  ? 1.808   0.357   15.504  1.00 0.00 ? 64  GLU A HB3  5  
ATOM 8704  H HG2  . GLU A 1 64  ? 0.347   -1.732  16.337  1.00 0.00 ? 64  GLU A HG2  5  
ATOM 8705  H HG3  . GLU A 1 64  ? 1.977   -2.389  16.667  1.00 0.00 ? 64  GLU A HG3  5  
ATOM 8706  N N    . THR A 1 65  ? 1.223   -3.678  13.861  1.00 0.00 ? 65  THR A N    5  
ATOM 8707  C CA   . THR A 1 65  ? 1.367   -5.126  13.829  1.00 0.00 ? 65  THR A CA   5  
ATOM 8708  C C    . THR A 1 65  ? 0.255   -5.603  12.906  1.00 0.00 ? 65  THR A C    5  
ATOM 8709  O O    . THR A 1 65  ? -0.778  -4.941  12.832  1.00 0.00 ? 65  THR A O    5  
ATOM 8710  C CB   . THR A 1 65  ? 1.177   -5.769  15.228  1.00 0.00 ? 65  THR A CB   5  
ATOM 8711  O OG1  . THR A 1 65  ? -0.049  -5.405  15.863  1.00 0.00 ? 65  THR A OG1  5  
ATOM 8712  C CG2  . THR A 1 65  ? 2.306   -5.351  16.181  1.00 0.00 ? 65  THR A CG2  5  
ATOM 8713  H H    . THR A 1 65  ? 0.278   -3.369  13.779  1.00 0.00 ? 65  THR A H    5  
ATOM 8714  H HA   . THR A 1 65  ? 2.317   -5.409  13.399  1.00 0.00 ? 65  THR A HA   5  
ATOM 8715  H HB   . THR A 1 65  ? 1.203   -6.875  15.150  1.00 0.00 ? 65  THR A HB   5  
ATOM 8716  H HG1  . THR A 1 65  ? 0.056   -4.475  16.095  1.00 0.00 ? 65  THR A HG1  5  
ATOM 8717  H HG21 . THR A 1 65  ? 3.295   -5.621  15.758  1.00 0.00 ? 65  THR A HG21 5  
ATOM 8718  H HG22 . THR A 1 65  ? 2.307   -4.256  16.354  1.00 0.00 ? 65  THR A HG22 5  
ATOM 8719  H HG23 . THR A 1 65  ? 2.186   -5.852  17.166  1.00 0.00 ? 65  THR A HG23 5  
ATOM 8720  N N    . LEU A 1 66  ? 0.351   -6.782  12.209  1.00 0.00 ? 66  LEU A N    5  
ATOM 8721  C CA   . LEU A 1 66  ? -0.698  -7.333  11.331  1.00 0.00 ? 66  LEU A CA   5  
ATOM 8722  C C    . LEU A 1 66  ? -1.886  -7.955  12.093  1.00 0.00 ? 66  LEU A C    5  
ATOM 8723  O O    . LEU A 1 66  ? -2.906  -8.322  11.526  1.00 0.00 ? 66  LEU A O    5  
ATOM 8724  C CB   . LEU A 1 66  ? -0.096  -8.271  10.233  1.00 0.00 ? 66  LEU A CB   5  
ATOM 8725  C CG   . LEU A 1 66  ? -0.766  -8.218  8.824   1.00 0.00 ? 66  LEU A CG   5  
ATOM 8726  C CD1  . LEU A 1 66  ? 0.057   -8.935  7.735   1.00 0.00 ? 66  LEU A CD1  5  
ATOM 8727  C CD2  . LEU A 1 66  ? -2.213  -8.741  8.749   1.00 0.00 ? 66  LEU A CD2  5  
ATOM 8728  H H    . LEU A 1 66  ? 1.181   -7.336  12.239  1.00 0.00 ? 66  LEU A H    5  
ATOM 8729  H HA   . LEU A 1 66  ? -1.117  -6.507  10.782  1.00 0.00 ? 66  LEU A HA   5  
ATOM 8730  H HB2  . LEU A 1 66  ? 0.949   -7.908  10.069  1.00 0.00 ? 66  LEU A HB2  5  
ATOM 8731  H HB3  . LEU A 1 66  ? -0.031  -9.323  10.590  1.00 0.00 ? 66  LEU A HB3  5  
ATOM 8732  H HG   . LEU A 1 66  ? -0.775  -7.142  8.524   1.00 0.00 ? 66  LEU A HG   5  
ATOM 8733  H HD11 . LEU A 1 66  ? 1.084   -8.524  7.669   1.00 0.00 ? 66  LEU A HD11 5  
ATOM 8734  H HD12 . LEU A 1 66  ? 0.115   -10.025 7.943   1.00 0.00 ? 66  LEU A HD12 5  
ATOM 8735  H HD13 . LEU A 1 66  ? -0.414  -8.801  6.728   1.00 0.00 ? 66  LEU A HD13 5  
ATOM 8736  H HD21 . LEU A 1 66  ? -2.313  -9.778  9.157   1.00 0.00 ? 66  LEU A HD21 5  
ATOM 8737  H HD22 . LEU A 1 66  ? -2.917  -8.083  9.293   1.00 0.00 ? 66  LEU A HD22 5  
ATOM 8738  H HD23 . LEU A 1 66  ? -2.543  -8.711  7.698   1.00 0.00 ? 66  LEU A HD23 5  
ATOM 8739  N N    . THR A 1 67  ? -1.815  -7.993  13.449  1.00 0.00 ? 67  THR A N    5  
ATOM 8740  C CA   . THR A 1 67  ? -2.780  -8.431  14.442  1.00 0.00 ? 67  THR A CA   5  
ATOM 8741  C C    . THR A 1 67  ? -3.766  -7.309  14.647  1.00 0.00 ? 67  THR A C    5  
ATOM 8742  O O    . THR A 1 67  ? -4.948  -7.557  14.761  1.00 0.00 ? 67  THR A O    5  
ATOM 8743  C CB   . THR A 1 67  ? -2.109  -8.820  15.766  1.00 0.00 ? 67  THR A CB   5  
ATOM 8744  O OG1  . THR A 1 67  ? -1.080  -9.776  15.546  1.00 0.00 ? 67  THR A OG1  5  
ATOM 8745  C CG2  . THR A 1 67  ? -3.146  -9.452  16.705  1.00 0.00 ? 67  THR A CG2  5  
ATOM 8746  H H    . THR A 1 67  ? -1.025  -7.620  13.894  1.00 0.00 ? 67  THR A H    5  
ATOM 8747  H HA   . THR A 1 67  ? -3.368  -9.277  14.066  1.00 0.00 ? 67  THR A HA   5  
ATOM 8748  H HB   . THR A 1 67  ? -1.629  -7.947  16.268  1.00 0.00 ? 67  THR A HB   5  
ATOM 8749  H HG1  . THR A 1 67  ? -1.487  -10.489 15.036  1.00 0.00 ? 67  THR A HG1  5  
ATOM 8750  H HG21 . THR A 1 67  ? -3.875  -10.048 16.111  1.00 0.00 ? 67  THR A HG21 5  
ATOM 8751  H HG22 . THR A 1 67  ? -2.660  -10.101 17.463  1.00 0.00 ? 67  THR A HG22 5  
ATOM 8752  H HG23 . THR A 1 67  ? -3.707  -8.658  17.238  1.00 0.00 ? 67  THR A HG23 5  
ATOM 8753  N N    . ASP A 1 68  ? -3.333  -6.019  14.620  1.00 0.00 ? 68  ASP A N    5  
ATOM 8754  C CA   . ASP A 1 68  ? -4.195  -4.830  14.682  1.00 0.00 ? 68  ASP A CA   5  
ATOM 8755  C C    . ASP A 1 68  ? -5.005  -4.524  13.426  1.00 0.00 ? 68  ASP A C    5  
ATOM 8756  O O    . ASP A 1 68  ? -6.131  -4.027  13.489  1.00 0.00 ? 68  ASP A O    5  
ATOM 8757  C CB   . ASP A 1 68  ? -3.375  -3.593  15.159  1.00 0.00 ? 68  ASP A CB   5  
ATOM 8758  C CG   . ASP A 1 68  ? -4.188  -2.676  16.075  1.00 0.00 ? 68  ASP A CG   5  
ATOM 8759  O OD1  . ASP A 1 68  ? -4.655  -3.164  17.139  1.00 0.00 ? 68  ASP A OD1  5  
ATOM 8760  O OD2  . ASP A 1 68  ? -4.349  -1.477  15.725  1.00 0.00 ? 68  ASP A OD2  5  
ATOM 8761  H H    . ASP A 1 68  ? -2.360  -5.817  14.504  1.00 0.00 ? 68  ASP A H    5  
ATOM 8762  H HA   . ASP A 1 68  ? -4.978  -5.104  15.378  1.00 0.00 ? 68  ASP A HA   5  
ATOM 8763  H HB2  . ASP A 1 68  ? -2.486  -3.967  15.709  1.00 0.00 ? 68  ASP A HB2  5  
ATOM 8764  H HB3  . ASP A 1 68  ? -2.967  -3.012  14.311  1.00 0.00 ? 68  ASP A HB3  5  
ATOM 8765  N N    . PHE A 1 69  ? -4.458  -4.911  12.239  1.00 0.00 ? 69  PHE A N    5  
ATOM 8766  C CA   . PHE A 1 69  ? -5.112  -4.880  10.929  1.00 0.00 ? 69  PHE A CA   5  
ATOM 8767  C C    . PHE A 1 69  ? -6.177  -5.988  10.836  1.00 0.00 ? 69  PHE A C    5  
ATOM 8768  O O    . PHE A 1 69  ? -7.272  -5.827  10.290  1.00 0.00 ? 69  PHE A O    5  
ATOM 8769  C CB   . PHE A 1 69  ? -3.992  -5.002  9.845   1.00 0.00 ? 69  PHE A CB   5  
ATOM 8770  C CG   . PHE A 1 69  ? -4.418  -5.234  8.410   1.00 0.00 ? 69  PHE A CG   5  
ATOM 8771  C CD1  . PHE A 1 69  ? -5.655  -4.863  7.911   1.00 0.00 ? 69  PHE A CD1  5  
ATOM 8772  C CD2  . PHE A 1 69  ? -3.589  -5.981  7.600   1.00 0.00 ? 69  PHE A CD2  5  
ATOM 8773  C CE1  . PHE A 1 69  ? -6.124  -5.413  6.744   1.00 0.00 ? 69  PHE A CE1  5  
ATOM 8774  C CE2  . PHE A 1 69  ? -4.059  -6.552  6.441   1.00 0.00 ? 69  PHE A CE2  5  
ATOM 8775  C CZ   . PHE A 1 69  ? -5.352  -6.310  6.035   1.00 0.00 ? 69  PHE A CZ   5  
ATOM 8776  H H    . PHE A 1 69  ? -3.545  -5.319  12.242  1.00 0.00 ? 69  PHE A H    5  
ATOM 8777  H HA   . PHE A 1 69  ? -5.621  -3.938  10.791  1.00 0.00 ? 69  PHE A HA   5  
ATOM 8778  H HB2  . PHE A 1 69  ? -3.370  -4.084  9.888   1.00 0.00 ? 69  PHE A HB2  5  
ATOM 8779  H HB3  . PHE A 1 69  ? -3.339  -5.855  10.128  1.00 0.00 ? 69  PHE A HB3  5  
ATOM 8780  H HD1  . PHE A 1 69  ? -6.320  -4.232  8.485   1.00 0.00 ? 69  PHE A HD1  5  
ATOM 8781  H HD2  . PHE A 1 69  ? -2.584  -6.195  7.924   1.00 0.00 ? 69  PHE A HD2  5  
ATOM 8782  H HE1  . PHE A 1 69  ? -7.119  -5.149  6.420   1.00 0.00 ? 69  PHE A HE1  5  
ATOM 8783  H HE2  . PHE A 1 69  ? -3.416  -7.201  5.864   1.00 0.00 ? 69  PHE A HE2  5  
ATOM 8784  H HZ   . PHE A 1 69  ? -5.727  -6.767  5.128   1.00 0.00 ? 69  PHE A HZ   5  
ATOM 8785  N N    . THR A 1 70  ? -5.858  -7.165  11.426  1.00 0.00 ? 70  THR A N    5  
ATOM 8786  C CA   . THR A 1 70  ? -6.757  -8.314  11.537  1.00 0.00 ? 70  THR A CA   5  
ATOM 8787  C C    . THR A 1 70  ? -7.865  -8.079  12.562  1.00 0.00 ? 70  THR A C    5  
ATOM 8788  O O    . THR A 1 70  ? -9.019  -8.440  12.336  1.00 0.00 ? 70  THR A O    5  
ATOM 8789  C CB   . THR A 1 70  ? -6.011  -9.628  11.667  1.00 0.00 ? 70  THR A CB   5  
ATOM 8790  O OG1  . THR A 1 70  ? -4.862  -9.539  12.454  1.00 0.00 ? 70  THR A OG1  5  
ATOM 8791  C CG2  . THR A 1 70  ? -5.572  -10.091 10.270  1.00 0.00 ? 70  THR A CG2  5  
ATOM 8792  H H    . THR A 1 70  ? -4.984  -7.265  11.920  1.00 0.00 ? 70  THR A H    5  
ATOM 8793  H HA   . THR A 1 70  ? -7.315  -8.376  10.598  1.00 0.00 ? 70  THR A HA   5  
ATOM 8794  H HB   . THR A 1 70  ? -6.554  -10.377 12.247  1.00 0.00 ? 70  THR A HB   5  
ATOM 8795  H HG1  . THR A 1 70  ? -4.140  -9.140  11.916  1.00 0.00 ? 70  THR A HG1  5  
ATOM 8796  H HG21 . THR A 1 70  ? -5.017  -9.271  9.769   1.00 0.00 ? 70  THR A HG21 5  
ATOM 8797  H HG22 . THR A 1 70  ? -4.882  -10.960 10.333  1.00 0.00 ? 70  THR A HG22 5  
ATOM 8798  H HG23 . THR A 1 70  ? -6.448  -10.372 9.652   1.00 0.00 ? 70  THR A HG23 5  
ATOM 8799  N N    . LYS A 1 71  ? -7.548  -7.344  13.684  1.00 0.00 ? 71  LYS A N    5  
ATOM 8800  C CA   . LYS A 1 71  ? -8.561  -6.848  14.641  1.00 0.00 ? 71  LYS A CA   5  
ATOM 8801  C C    . LYS A 1 71  ? -9.591  -5.843  14.036  1.00 0.00 ? 71  LYS A C    5  
ATOM 8802  O O    . LYS A 1 71  ? -10.770 -5.866  14.380  1.00 0.00 ? 71  LYS A O    5  
ATOM 8803  C CB   . LYS A 1 71  ? -7.970  -6.119  15.892  1.00 0.00 ? 71  LYS A CB   5  
ATOM 8804  C CG   . LYS A 1 71  ? -7.050  -6.916  16.837  1.00 0.00 ? 71  LYS A CG   5  
ATOM 8805  C CD   . LYS A 1 71  ? -7.252  -8.436  16.852  1.00 0.00 ? 71  LYS A CD   5  
ATOM 8806  C CE   . LYS A 1 71  ? -6.602  -9.135  18.052  1.00 0.00 ? 71  LYS A CE   5  
ATOM 8807  N NZ   . LYS A 1 71  ? -7.312  -8.823  19.315  1.00 0.00 ? 71  LYS A NZ   5  
ATOM 8808  H H    . LYS A 1 71  ? -6.570  -7.109  13.910  1.00 0.00 ? 71  LYS A H    5  
ATOM 8809  H HA   . LYS A 1 71  ? -9.106  -7.729  14.972  1.00 0.00 ? 71  LYS A HA   5  
ATOM 8810  H HB2  . LYS A 1 71  ? -7.404  -5.211  15.568  1.00 0.00 ? 71  LYS A HB2  5  
ATOM 8811  H HB3  . LYS A 1 71  ? -8.813  -5.793  16.555  1.00 0.00 ? 71  LYS A HB3  5  
ATOM 8812  H HG2  . LYS A 1 71  ? -5.979  -6.700  16.625  1.00 0.00 ? 71  LYS A HG2  5  
ATOM 8813  H HG3  . LYS A 1 71  ? -7.222  -6.516  17.850  1.00 0.00 ? 71  LYS A HG3  5  
ATOM 8814  H HD2  . LYS A 1 71  ? -8.334  -8.685  16.832  1.00 0.00 ? 71  LYS A HD2  5  
ATOM 8815  H HD3  . LYS A 1 71  ? -6.781  -8.835  15.924  1.00 0.00 ? 71  LYS A HD3  5  
ATOM 8816  H HE2  . LYS A 1 71  ? -6.640  -10.231 17.906  1.00 0.00 ? 71  LYS A HE2  5  
ATOM 8817  H HE3  . LYS A 1 71  ? -5.546  -8.824  18.171  1.00 0.00 ? 71  LYS A HE3  5  
ATOM 8818  H HZ1  . LYS A 1 71  ? -7.295  -7.795  19.476  1.00 0.00 ? 71  LYS A HZ1  5  
ATOM 8819  H HZ2  . LYS A 1 71  ? -8.298  -9.146  19.247  1.00 0.00 ? 71  LYS A HZ2  5  
ATOM 8820  H HZ3  . LYS A 1 71  ? -6.842  -9.305  20.107  1.00 0.00 ? 71  LYS A HZ3  5  
ATOM 8821  N N    . TRP A 1 72  ? -9.131  -4.961  13.094  1.00 0.00 ? 72  TRP A N    5  
ATOM 8822  C CA   . TRP A 1 72  ? -9.933  -3.973  12.355  1.00 0.00 ? 72  TRP A CA   5  
ATOM 8823  C C    . TRP A 1 72  ? -10.731 -4.599  11.202  1.00 0.00 ? 72  TRP A C    5  
ATOM 8824  O O    . TRP A 1 72  ? -11.924 -4.364  11.079  1.00 0.00 ? 72  TRP A O    5  
ATOM 8825  C CB   . TRP A 1 72  ? -9.083  -2.750  11.861  1.00 0.00 ? 72  TRP A CB   5  
ATOM 8826  C CG   . TRP A 1 72  ? -9.810  -1.637  11.079  1.00 0.00 ? 72  TRP A CG   5  
ATOM 8827  C CD1  . TRP A 1 72  ? -10.411 -0.485  11.506  1.00 0.00 ? 72  TRP A CD1  5  
ATOM 8828  C CD2  . TRP A 1 72  ? -10.021 -1.695  9.654   1.00 0.00 ? 72  TRP A CD2  5  
ATOM 8829  N NE1  . TRP A 1 72  ? -10.983 0.175   10.436  1.00 0.00 ? 72  TRP A NE1  5  
ATOM 8830  C CE2  . TRP A 1 72  ? -10.759 -0.571  9.290   1.00 0.00 ? 72  TRP A CE2  5  
ATOM 8831  C CE3  . TRP A 1 72  ? -9.616  -2.607  8.720   1.00 0.00 ? 72  TRP A CE3  5  
ATOM 8832  C CZ2  . TRP A 1 72  ? -11.119 -0.361  7.981   1.00 0.00 ? 72  TRP A CZ2  5  
ATOM 8833  C CZ3  . TRP A 1 72  ? -9.949  -2.379  7.410   1.00 0.00 ? 72  TRP A CZ3  5  
ATOM 8834  C CH2  . TRP A 1 72  ? -10.699 -1.285  7.037   1.00 0.00 ? 72  TRP A CH2  5  
ATOM 8835  H H    . TRP A 1 72  ? -8.154  -4.989  12.872  1.00 0.00 ? 72  TRP A H    5  
ATOM 8836  H HA   . TRP A 1 72  ? -10.669 -3.567  13.038  1.00 0.00 ? 72  TRP A HA   5  
ATOM 8837  H HB2  . TRP A 1 72  ? -8.624  -2.287  12.767  1.00 0.00 ? 72  TRP A HB2  5  
ATOM 8838  H HB3  . TRP A 1 72  ? -8.256  -3.135  11.222  1.00 0.00 ? 72  TRP A HB3  5  
ATOM 8839  H HD1  . TRP A 1 72  ? -10.440 -0.149  12.534  1.00 0.00 ? 72  TRP A HD1  5  
ATOM 8840  H HE1  . TRP A 1 72  ? -11.461 1.026   10.471  1.00 0.00 ? 72  TRP A HE1  5  
ATOM 8841  H HE3  . TRP A 1 72  ? -8.973  -3.440  8.963   1.00 0.00 ? 72  TRP A HE3  5  
ATOM 8842  H HZ2  . TRP A 1 72  ? -11.703 0.498   7.686   1.00 0.00 ? 72  TRP A HZ2  5  
ATOM 8843  H HZ3  . TRP A 1 72  ? -9.602  -3.082  6.673   1.00 0.00 ? 72  TRP A HZ3  5  
ATOM 8844  H HH2  . TRP A 1 72  ? -10.950 -1.177  5.989   1.00 0.00 ? 72  TRP A HH2  5  
ATOM 8845  N N    . LEU A 1 73  ? -10.123 -5.428  10.310  1.00 0.00 ? 73  LEU A N    5  
ATOM 8846  C CA   . LEU A 1 73  ? -10.763 -6.135  9.184   1.00 0.00 ? 73  LEU A CA   5  
ATOM 8847  C C    . LEU A 1 73  ? -11.787 -7.190  9.567   1.00 0.00 ? 73  LEU A C    5  
ATOM 8848  O O    . LEU A 1 73  ? -12.840 -7.366  8.947   1.00 0.00 ? 73  LEU A O    5  
ATOM 8849  C CB   . LEU A 1 73  ? -9.883  -6.264  7.932   1.00 0.00 ? 73  LEU A CB   5  
ATOM 8850  C CG   . LEU A 1 73  ? -9.662  -7.639  7.238   1.00 0.00 ? 73  LEU A CG   5  
ATOM 8851  C CD1  . LEU A 1 73  ? -9.319  -7.260  5.803   1.00 0.00 ? 73  LEU A CD1  5  
ATOM 8852  C CD2  . LEU A 1 73  ? -8.553  -8.556  7.745   1.00 0.00 ? 73  LEU A CD2  5  
ATOM 8853  H H    . LEU A 1 73  ? -9.142  -5.643  10.400  1.00 0.00 ? 73  LEU A H    5  
ATOM 8854  H HA   . LEU A 1 73  ? -11.437 -5.393  8.775   1.00 0.00 ? 73  LEU A HA   5  
ATOM 8855  H HB2  . LEU A 1 73  ? -10.456 -5.718  7.131   1.00 0.00 ? 73  LEU A HB2  5  
ATOM 8856  H HB3  . LEU A 1 73  ? -8.970  -5.610  8.133   1.00 0.00 ? 73  LEU A HB3  5  
ATOM 8857  H HG   . LEU A 1 73  ? -10.580 -8.305  7.189   1.00 0.00 ? 73  LEU A HG   5  
ATOM 8858  H HD11 . LEU A 1 73  ? -10.149 -6.657  5.373   1.00 0.00 ? 73  LEU A HD11 5  
ATOM 8859  H HD12 . LEU A 1 73  ? -8.405  -6.630  5.799   1.00 0.00 ? 73  LEU A HD12 5  
ATOM 8860  H HD13 . LEU A 1 73  ? -9.134  -8.144  5.163   1.00 0.00 ? 73  LEU A HD13 5  
ATOM 8861  H HD21 . LEU A 1 73  ? -7.579  -8.029  7.702   1.00 0.00 ? 73  LEU A HD21 5  
ATOM 8862  H HD22 . LEU A 1 73  ? -8.764  -8.924  8.769   1.00 0.00 ? 73  LEU A HD22 5  
ATOM 8863  H HD23 . LEU A 1 73  ? -8.530  -9.414  7.025   1.00 0.00 ? 73  LEU A HD23 5  
ATOM 8864  N N    . GLY A 1 74  ? -11.473 -7.816  10.743  1.00 0.00 ? 74  GLY A N    5  
ATOM 8865  C CA   . GLY A 1 74  ? -12.387 -8.571  11.605  1.00 0.00 ? 74  GLY A CA   5  
ATOM 8866  C C    . GLY A 1 74  ? -13.570 -7.795  12.170  1.00 0.00 ? 74  GLY A C    5  
ATOM 8867  O O    . GLY A 1 74  ? -14.627 -8.371  12.399  1.00 0.00 ? 74  GLY A O    5  
ATOM 8868  H H    . GLY A 1 74  ? -10.587 -7.620  11.184  1.00 0.00 ? 74  GLY A H    5  
ATOM 8869  H HA2  . GLY A 1 74  ? -12.816 -9.364  11.028  1.00 0.00 ? 74  GLY A HA2  5  
ATOM 8870  H HA3  . GLY A 1 74  ? -11.801 -8.935  12.440  1.00 0.00 ? 74  GLY A HA3  5  
ATOM 8871  N N    . ARG A 1 75  ? -13.412 -6.456  12.368  1.00 0.00 ? 75  ARG A N    5  
ATOM 8872  C CA   . ARG A 1 75  ? -14.424 -5.502  12.847  1.00 0.00 ? 75  ARG A CA   5  
ATOM 8873  C C    . ARG A 1 75  ? -15.354 -4.969  11.769  1.00 0.00 ? 75  ARG A C    5  
ATOM 8874  O O    . ARG A 1 75  ? -16.557 -4.842  11.975  1.00 0.00 ? 75  ARG A O    5  
ATOM 8875  C CB   . ARG A 1 75  ? -13.720 -4.366  13.601  1.00 0.00 ? 75  ARG A CB   5  
ATOM 8876  C CG   . ARG A 1 75  ? -14.591 -3.393  14.407  1.00 0.00 ? 75  ARG A CG   5  
ATOM 8877  C CD   . ARG A 1 75  ? -14.856 -2.073  13.659  1.00 0.00 ? 75  ARG A CD   5  
ATOM 8878  N NE   . ARG A 1 75  ? -15.527 -1.106  14.596  1.00 0.00 ? 75  ARG A NE   5  
ATOM 8879  C CZ   . ARG A 1 75  ? -15.784 0.197   14.263  1.00 0.00 ? 75  ARG A CZ   5  
ATOM 8880  N NH1  . ARG A 1 75  ? -15.438 0.690   13.038  1.00 0.00 ? 75  ARG A NH1  5  
ATOM 8881  N NH2  . ARG A 1 75  ? -16.394 1.014   15.172  1.00 0.00 ? 75  ARG A NH2  5  
ATOM 8882  H H    . ARG A 1 75  ? -12.523 -6.034  12.142  1.00 0.00 ? 75  ARG A H    5  
ATOM 8883  H HA   . ARG A 1 75  ? -15.046 -5.988  13.584  1.00 0.00 ? 75  ARG A HA   5  
ATOM 8884  H HB2  . ARG A 1 75  ? -13.048 -4.933  14.269  1.00 0.00 ? 75  ARG A HB2  5  
ATOM 8885  H HB3  . ARG A 1 75  ? -13.068 -3.761  12.945  1.00 0.00 ? 75  ARG A HB3  5  
ATOM 8886  H HG2  . ARG A 1 75  ? -15.550 -3.880  14.687  1.00 0.00 ? 75  ARG A HG2  5  
ATOM 8887  H HG3  . ARG A 1 75  ? -14.038 -3.169  15.344  1.00 0.00 ? 75  ARG A HG3  5  
ATOM 8888  H HD2  . ARG A 1 75  ? -13.893 -1.640  13.303  1.00 0.00 ? 75  ARG A HD2  5  
ATOM 8889  H HD3  . ARG A 1 75  ? -15.526 -2.244  12.788  1.00 0.00 ? 75  ARG A HD3  5  
ATOM 8890  H HE   . ARG A 1 75  ? -15.798 -1.433  15.501  1.00 0.00 ? 75  ARG A HE   5  
ATOM 8891  H HH11 . ARG A 1 75  ? -14.990 0.097   12.369  1.00 0.00 ? 75  ARG A HH11 5  
ATOM 8892  H HH12 . ARG A 1 75  ? -15.629 1.645   12.812  1.00 0.00 ? 75  ARG A HH12 5  
ATOM 8893  H HH21 . ARG A 1 75  ? -16.648 0.657   16.071  1.00 0.00 ? 75  ARG A HH21 5  
ATOM 8894  H HH22 . ARG A 1 75  ? -16.584 1.967   14.938  1.00 0.00 ? 75  ARG A HH22 5  
ATOM 8895  N N    . GLU A 1 76  ? -14.802 -4.694  10.558  1.00 0.00 ? 76  GLU A N    5  
ATOM 8896  C CA   . GLU A 1 76  ? -15.436 -4.232  9.322   1.00 0.00 ? 76  GLU A CA   5  
ATOM 8897  C C    . GLU A 1 76  ? -16.362 -5.251  8.703   1.00 0.00 ? 76  GLU A C    5  
ATOM 8898  O O    . GLU A 1 76  ? -17.286 -4.899  7.973   1.00 0.00 ? 76  GLU A O    5  
ATOM 8899  C CB   . GLU A 1 76  ? -14.324 -3.716  8.440   1.00 0.00 ? 76  GLU A CB   5  
ATOM 8900  C CG   . GLU A 1 76  ? -13.505 -2.547  8.962   1.00 0.00 ? 76  GLU A CG   5  
ATOM 8901  C CD   . GLU A 1 76  ? -14.277 -1.231  8.926   1.00 0.00 ? 76  GLU A CD   5  
ATOM 8902  O OE1  . GLU A 1 76  ? -14.454 -0.620  10.014  1.00 0.00 ? 76  GLU A OE1  5  
ATOM 8903  O OE2  . GLU A 1 76  ? -14.694 -0.812  7.812   1.00 0.00 ? 76  GLU A OE2  5  
ATOM 8904  H H    . GLU A 1 76  ? -13.805 -4.785  10.494  1.00 0.00 ? 76  GLU A H    5  
ATOM 8905  H HA   . GLU A 1 76  ? -16.033 -3.362  9.276   1.00 0.00 ? 76  GLU A HA   5  
ATOM 8906  H HB2  . GLU A 1 76  ? -13.593 -4.540  8.258   1.00 0.00 ? 76  GLU A HB2  5  
ATOM 8907  H HB3  . GLU A 1 76  ? -14.745 -3.342  7.481   1.00 0.00 ? 76  GLU A HB3  5  
ATOM 8908  H HG2  . GLU A 1 76  ? -13.092 -2.714  9.971   1.00 0.00 ? 76  GLU A HG2  5  
ATOM 8909  H HG3  . GLU A 1 76  ? -12.691 -2.571  8.210   1.00 0.00 ? 76  GLU A HG3  5  
ATOM 8910  N N    . GLY A 1 77  ? -16.172 -6.541  9.086   1.00 0.00 ? 77  GLY A N    5  
ATOM 8911  C CA   . GLY A 1 77  ? -17.147 -7.610  8.848   1.00 0.00 ? 77  GLY A CA   5  
ATOM 8912  C C    . GLY A 1 77  ? -16.891 -8.300  7.558   1.00 0.00 ? 77  GLY A C    5  
ATOM 8913  O O    . GLY A 1 77  ? -17.720 -9.020  7.015   1.00 0.00 ? 77  GLY A O    5  
ATOM 8914  H H    . GLY A 1 77  ? -15.385 -6.737  9.686   1.00 0.00 ? 77  GLY A H    5  
ATOM 8915  H HA2  . GLY A 1 77  ? -17.022 -8.342  9.632   1.00 0.00 ? 77  GLY A HA2  5  
ATOM 8916  H HA3  . GLY A 1 77  ? -18.154 -7.211  8.813   1.00 0.00 ? 77  GLY A HA3  5  
ATOM 8917  N N    . LEU A 1 78  ? -15.671 -8.060  7.035   1.00 0.00 ? 78  LEU A N    5  
ATOM 8918  C CA   . LEU A 1 78  ? -15.190 -8.577  5.768   1.00 0.00 ? 78  LEU A CA   5  
ATOM 8919  C C    . LEU A 1 78  ? -14.406 -9.819  5.954   1.00 0.00 ? 78  LEU A C    5  
ATOM 8920  O O    . LEU A 1 78  ? -14.381 -10.665 5.083   1.00 0.00 ? 78  LEU A O    5  
ATOM 8921  C CB   . LEU A 1 78  ? -14.293 -7.559  5.017   1.00 0.00 ? 78  LEU A CB   5  
ATOM 8922  C CG   . LEU A 1 78  ? -15.007 -6.211  4.868   1.00 0.00 ? 78  LEU A CG   5  
ATOM 8923  C CD1  . LEU A 1 78  ? -16.510 -6.324  4.529   1.00 0.00 ? 78  LEU A CD1  5  
ATOM 8924  C CD2  . LEU A 1 78  ? -14.489 -5.282  5.932   1.00 0.00 ? 78  LEU A CD2  5  
ATOM 8925  H H    . LEU A 1 78  ? -15.078 -7.397  7.513   1.00 0.00 ? 78  LEU A H    5  
ATOM 8926  H HA   . LEU A 1 78  ? -16.020 -8.856  5.121   1.00 0.00 ? 78  LEU A HA   5  
ATOM 8927  H HB2  . LEU A 1 78  ? -13.351 -7.366  5.586   1.00 0.00 ? 78  LEU A HB2  5  
ATOM 8928  H HB3  . LEU A 1 78  ? -13.991 -7.972  4.024   1.00 0.00 ? 78  LEU A HB3  5  
ATOM 8929  H HG   . LEU A 1 78  ? -14.615 -5.498  4.155   1.00 0.00 ? 78  LEU A HG   5  
ATOM 8930  H HD11 . LEU A 1 78  ? -16.690 -7.185  3.822   1.00 0.00 ? 78  LEU A HD11 5  
ATOM 8931  H HD12 . LEU A 1 78  ? -17.134 -6.527  5.419   1.00 0.00 ? 78  LEU A HD12 5  
ATOM 8932  H HD13 . LEU A 1 78  ? -16.880 -5.389  4.063   1.00 0.00 ? 78  LEU A HD13 5  
ATOM 8933  H HD21 . LEU A 1 78  ? -14.416 -5.806  6.896   1.00 0.00 ? 78  LEU A HD21 5  
ATOM 8934  H HD22 . LEU A 1 78  ? -13.454 -4.912  5.677   1.00 0.00 ? 78  LEU A HD22 5  
ATOM 8935  H HD23 . LEU A 1 78  ? -15.171 -4.407  5.970   1.00 0.00 ? 78  LEU A HD23 5  
ATOM 8936  N N    . CYS A 1 79  ? -13.687 -10.001 7.070   1.00 0.00 ? 79  CYS A N    5  
ATOM 8937  C CA   . CYS A 1 79  ? -12.867 -11.198 7.240   1.00 0.00 ? 79  CYS A CA   5  
ATOM 8938  C C    . CYS A 1 79  ? -12.881 -11.771 8.635   1.00 0.00 ? 79  CYS A C    5  
ATOM 8939  O O    . CYS A 1 79  ? -12.930 -11.059 9.627   1.00 0.00 ? 79  CYS A O    5  
ATOM 8940  C CB   . CYS A 1 79  ? -11.420 -11.049 6.702   1.00 0.00 ? 79  CYS A CB   5  
ATOM 8941  S SG   . CYS A 1 79  ? -11.205 -9.996  5.223   1.00 0.00 ? 79  CYS A SG   5  
ATOM 8942  H H    . CYS A 1 79  ? -13.690 -9.308  7.778   1.00 0.00 ? 79  CYS A H    5  
ATOM 8943  H HA   . CYS A 1 79  ? -13.257 -12.026 6.693   1.00 0.00 ? 79  CYS A HA   5  
ATOM 8944  H HB2  . CYS A 1 79  ? -10.774 -10.777 7.569   1.00 0.00 ? 79  CYS A HB2  5  
ATOM 8945  H HB3  . CYS A 1 79  ? -11.113 -12.027 6.302   1.00 0.00 ? 79  CYS A HB3  5  
ATOM 8946  H HG   . CYS A 1 79  ? -12.316 -10.424 4.626   1.00 0.00 ? 79  CYS A HG   5  
ATOM 8947  N N    . LYS A 1 80  ? -12.790 -13.117 8.721   1.00 0.00 ? 80  LYS A N    5  
ATOM 8948  C CA   . LYS A 1 80  ? -12.685 -13.951 9.899   1.00 0.00 ? 80  LYS A CA   5  
ATOM 8949  C C    . LYS A 1 80  ? -11.216 -14.305 10.072  1.00 0.00 ? 80  LYS A C    5  
ATOM 8950  O O    . LYS A 1 80  ? -10.488 -14.436 9.099   1.00 0.00 ? 80  LYS A O    5  
ATOM 8951  C CB   . LYS A 1 80  ? -13.593 -15.204 9.722   1.00 0.00 ? 80  LYS A CB   5  
ATOM 8952  C CG   . LYS A 1 80  ? -14.987 -15.014 10.331  1.00 0.00 ? 80  LYS A CG   5  
ATOM 8953  C CD   . LYS A 1 80  ? -16.003 -16.071 9.876   1.00 0.00 ? 80  LYS A CD   5  
ATOM 8954  C CE   . LYS A 1 80  ? -17.383 -15.885 10.520  1.00 0.00 ? 80  LYS A CE   5  
ATOM 8955  N NZ   . LYS A 1 80  ? -18.337 -16.906 10.026  1.00 0.00 ? 80  LYS A NZ   5  
ATOM 8956  H H    . LYS A 1 80  ? -12.719 -13.698 7.891   1.00 0.00 ? 80  LYS A H    5  
ATOM 8957  H HA   . LYS A 1 80  ? -12.942 -13.335 10.743  1.00 0.00 ? 80  LYS A HA   5  
ATOM 8958  H HB2  . LYS A 1 80  ? -13.724 -15.374 8.629   1.00 0.00 ? 80  LYS A HB2  5  
ATOM 8959  H HB3  . LYS A 1 80  ? -13.144 -16.145 10.105  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 8960  H HG2  . LYS A 1 80  ? -14.900 -15.038 11.440  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 8961  H HG3  . LYS A 1 80  ? -15.371 -14.013 10.040  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 8962  H HD2  . LYS A 1 80  ? -16.107 -15.996 8.769   1.00 0.00 ? 80  LYS A HD2  5  
ATOM 8963  H HD3  . LYS A 1 80  ? -15.608 -17.081 10.123  1.00 0.00 ? 80  LYS A HD3  5  
ATOM 8964  H HE2  . LYS A 1 80  ? -17.317 -15.990 11.623  1.00 0.00 ? 80  LYS A HE2  5  
ATOM 8965  H HE3  . LYS A 1 80  ? -17.798 -14.886 10.267  1.00 0.00 ? 80  LYS A HE3  5  
ATOM 8966  H HZ1  . LYS A 1 80  ? -17.981 -17.854 10.260  1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 8967  H HZ2  . LYS A 1 80  ? -19.263 -16.760 10.475  1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 8968  H HZ3  . LYS A 1 80  ? -18.435 -16.817 8.993   1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 8969  N N    . VAL A 1 81  ? -10.690 -14.394 11.309  1.00 0.00 ? 81  VAL A N    5  
ATOM 8970  C CA   . VAL A 1 81  ? -9.269  -14.530 11.540  1.00 0.00 ? 81  VAL A CA   5  
ATOM 8971  C C    . VAL A 1 81  ? -8.955  -15.629 12.522  1.00 0.00 ? 81  VAL A C    5  
ATOM 8972  O O    . VAL A 1 81  ? -9.647  -15.839 13.518  1.00 0.00 ? 81  VAL A O    5  
ATOM 8973  C CB   . VAL A 1 81  ? -8.687  -13.216 12.055  1.00 0.00 ? 81  VAL A CB   5  
ATOM 8974  C CG1  . VAL A 1 81  ? -8.043  -12.436 10.911  1.00 0.00 ? 81  VAL A CG1  5  
ATOM 8975  C CG2  . VAL A 1 81  ? -9.733  -12.324 12.742  1.00 0.00 ? 81  VAL A CG2  5  
ATOM 8976  H H    . VAL A 1 81  ? -11.222 -14.313 12.140  1.00 0.00 ? 81  VAL A H    5  
ATOM 8977  H HA   . VAL A 1 81  ? -8.731  -14.797 10.636  1.00 0.00 ? 81  VAL A HA   5  
ATOM 8978  H HB   . VAL A 1 81  ? -7.877  -13.395 12.788  1.00 0.00 ? 81  VAL A HB   5  
ATOM 8979  H HG11 . VAL A 1 81  ? -8.582  -12.588 9.951   1.00 0.00 ? 81  VAL A HG11 5  
ATOM 8980  H HG12 . VAL A 1 81  ? -8.076  -11.355 11.161  1.00 0.00 ? 81  VAL A HG12 5  
ATOM 8981  H HG13 . VAL A 1 81  ? -6.970  -12.741 10.831  1.00 0.00 ? 81  VAL A HG13 5  
ATOM 8982  H HG21 . VAL A 1 81  ? -10.267 -12.873 13.543  1.00 0.00 ? 81  VAL A HG21 5  
ATOM 8983  H HG22 . VAL A 1 81  ? -9.206  -11.450 13.186  1.00 0.00 ? 81  VAL A HG22 5  
ATOM 8984  H HG23 . VAL A 1 81  ? -10.453 -11.933 11.983  1.00 0.00 ? 81  VAL A HG23 5  
ATOM 8985  N N    . ASP A 1 82  ? -7.811  -16.308 12.244  1.00 0.00 ? 82  ASP A N    5  
ATOM 8986  C CA   . ASP A 1 82  ? -7.218  -17.333 13.107  1.00 0.00 ? 82  ASP A CA   5  
ATOM 8987  C C    . ASP A 1 82  ? -5.694  -17.234 13.076  1.00 0.00 ? 82  ASP A C    5  
ATOM 8988  O O    . ASP A 1 82  ? -5.099  -16.829 12.077  1.00 0.00 ? 82  ASP A O    5  
ATOM 8989  C CB   . ASP A 1 82  ? -7.610  -18.790 12.700  1.00 0.00 ? 82  ASP A CB   5  
ATOM 8990  C CG   . ASP A 1 82  ? -9.113  -19.030 12.876  1.00 0.00 ? 82  ASP A CG   5  
ATOM 8991  O OD1  . ASP A 1 82  ? -9.804  -19.259 11.848  1.00 0.00 ? 82  ASP A OD1  5  
ATOM 8992  O OD2  . ASP A 1 82  ? -9.583  -18.992 14.045  1.00 0.00 ? 82  ASP A OD2  5  
ATOM 8993  H H    . ASP A 1 82  ? -7.300  -16.078 11.387  1.00 0.00 ? 82  ASP A H    5  
ATOM 8994  H HA   . ASP A 1 82  ? -7.494  -17.121 14.133  1.00 0.00 ? 82  ASP A HA   5  
ATOM 8995  H HB2  . ASP A 1 82  ? -7.339  -18.971 11.636  1.00 0.00 ? 82  ASP A HB2  5  
ATOM 8996  H HB3  . ASP A 1 82  ? -7.078  -19.540 13.329  1.00 0.00 ? 82  ASP A HB3  5  
ATOM 8997  N N    . GLU A 1 83  ? -5.001  -17.625 14.185  1.00 0.00 ? 83  GLU A N    5  
ATOM 8998  C CA   . GLU A 1 83  ? -3.547  -17.617 14.282  1.00 0.00 ? 83  GLU A CA   5  
ATOM 8999  C C    . GLU A 1 83  ? -3.047  -19.019 14.590  1.00 0.00 ? 83  GLU A C    5  
ATOM 9000  O O    . GLU A 1 83  ? -3.628  -19.766 15.382  1.00 0.00 ? 83  GLU A O    5  
ATOM 9001  C CB   . GLU A 1 83  ? -3.026  -16.558 15.283  1.00 0.00 ? 83  GLU A CB   5  
ATOM 9002  C CG   . GLU A 1 83  ? -1.529  -16.200 15.109  1.00 0.00 ? 83  GLU A CG   5  
ATOM 9003  C CD   . GLU A 1 83  ? -0.578  -16.974 16.029  1.00 0.00 ? 83  GLU A CD   5  
ATOM 9004  O OE1  . GLU A 1 83  ? -1.050  -17.745 16.906  1.00 0.00 ? 83  GLU A OE1  5  
ATOM 9005  O OE2  . GLU A 1 83  ? 0.658   -16.781 15.864  1.00 0.00 ? 83  GLU A OE2  5  
ATOM 9006  H H    . GLU A 1 83  ? -5.466  -17.968 14.999  1.00 0.00 ? 83  GLU A H    5  
ATOM 9007  H HA   . GLU A 1 83  ? -3.119  -17.345 13.321  1.00 0.00 ? 83  GLU A HA   5  
ATOM 9008  H HB2  . GLU A 1 83  ? -3.578  -15.617 15.036  1.00 0.00 ? 83  GLU A HB2  5  
ATOM 9009  H HB3  . GLU A 1 83  ? -3.284  -16.814 16.332  1.00 0.00 ? 83  GLU A HB3  5  
ATOM 9010  H HG2  . GLU A 1 83  ? -1.239  -16.372 14.045  1.00 0.00 ? 83  GLU A HG2  5  
ATOM 9011  H HG3  . GLU A 1 83  ? -1.399  -15.121 15.337  1.00 0.00 ? 83  GLU A HG3  5  
ATOM 9012  N N    . THR A 1 84  ? -1.935  -19.382 13.894  1.00 0.00 ? 84  THR A N    5  
ATOM 9013  C CA   . THR A 1 84  ? -1.280  -20.683 13.894  1.00 0.00 ? 84  THR A CA   5  
ATOM 9014  C C    . THR A 1 84  ? 0.187   -20.558 14.261  1.00 0.00 ? 84  THR A C    5  
ATOM 9015  O O    . THR A 1 84  ? 0.698   -19.440 14.339  1.00 0.00 ? 84  THR A O    5  
ATOM 9016  C CB   . THR A 1 84  ? -1.287  -21.304 12.467  1.00 0.00 ? 84  THR A CB   5  
ATOM 9017  O OG1  . THR A 1 84  ? -0.513  -20.625 11.487  1.00 0.00 ? 84  THR A OG1  5  
ATOM 9018  C CG2  . THR A 1 84  ? -2.695  -21.304 11.866  1.00 0.00 ? 84  THR A CG2  5  
ATOM 9019  H H    . THR A 1 84  ? -1.513  -18.701 13.284  1.00 0.00 ? 84  THR A H    5  
ATOM 9020  H HA   . THR A 1 84  ? -1.758  -21.355 14.593  1.00 0.00 ? 84  THR A HA   5  
ATOM 9021  H HB   . THR A 1 84  ? -0.821  -22.311 12.549  1.00 0.00 ? 84  THR A HB   5  
ATOM 9022  H HG1  . THR A 1 84  ? -0.895  -19.741 11.423  1.00 0.00 ? 84  THR A HG1  5  
ATOM 9023  H HG21 . THR A 1 84  ? -3.432  -21.757 12.559  1.00 0.00 ? 84  THR A HG21 5  
ATOM 9024  H HG22 . THR A 1 84  ? -3.009  -20.258 11.631  1.00 0.00 ? 84  THR A HG22 5  
ATOM 9025  H HG23 . THR A 1 84  ? -2.697  -21.863 10.907  1.00 0.00 ? 84  THR A HG23 5  
ATOM 9026  N N    . PRO A 1 85  ? 0.939   -21.679 14.397  1.00 0.00 ? 85  PRO A N    5  
ATOM 9027  C CA   . PRO A 1 85  ? 2.396   -21.666 14.401  1.00 0.00 ? 85  PRO A CA   5  
ATOM 9028  C C    . PRO A 1 85  ? 3.110   -21.226 13.087  1.00 0.00 ? 85  PRO A C    5  
ATOM 9029  O O    . PRO A 1 85  ? 4.330   -21.089 13.107  1.00 0.00 ? 85  PRO A O    5  
ATOM 9030  C CB   . PRO A 1 85  ? 2.777   -23.107 14.817  1.00 0.00 ? 85  PRO A CB   5  
ATOM 9031  C CG   . PRO A 1 85  ? 1.530   -23.653 15.514  1.00 0.00 ? 85  PRO A CG   5  
ATOM 9032  C CD   . PRO A 1 85  ? 0.421   -23.022 14.679  1.00 0.00 ? 85  PRO A CD   5  
ATOM 9033  H HA   . PRO A 1 85  ? 2.637   -20.947 15.137  1.00 0.00 ? 85  PRO A HA   5  
ATOM 9034  H HB2  . PRO A 1 85  ? 2.955   -23.748 13.924  1.00 0.00 ? 85  PRO A HB2  5  
ATOM 9035  H HB3  . PRO A 1 85  ? 3.673   -23.128 15.469  1.00 0.00 ? 85  PRO A HB3  5  
ATOM 9036  H HG2  . PRO A 1 85  ? 1.491   -24.762 15.521  1.00 0.00 ? 85  PRO A HG2  5  
ATOM 9037  H HG3  . PRO A 1 85  ? 1.483   -23.275 16.560  1.00 0.00 ? 85  PRO A HG3  5  
ATOM 9038  H HD2  . PRO A 1 85  ? 0.317   -23.589 13.727  1.00 0.00 ? 85  PRO A HD2  5  
ATOM 9039  H HD3  . PRO A 1 85  ? -0.540  -23.022 15.243  1.00 0.00 ? 85  PRO A HD3  5  
ATOM 9040  N N    . LYS A 1 86  ? 2.374   -21.003 11.961  1.00 0.00 ? 86  LYS A N    5  
ATOM 9041  C CA   . LYS A 1 86  ? 2.857   -20.588 10.659  1.00 0.00 ? 86  LYS A CA   5  
ATOM 9042  C C    . LYS A 1 86  ? 2.245   -19.254 10.223  1.00 0.00 ? 86  LYS A C    5  
ATOM 9043  O O    . LYS A 1 86  ? 2.121   -18.987 9.025   1.00 0.00 ? 86  LYS A O    5  
ATOM 9044  C CB   . LYS A 1 86  ? 2.523   -21.677 9.613   1.00 0.00 ? 86  LYS A CB   5  
ATOM 9045  C CG   . LYS A 1 86  ? 3.281   -22.984 9.883   1.00 0.00 ? 86  LYS A CG   5  
ATOM 9046  C CD   . LYS A 1 86  ? 3.262   -23.927 8.677   1.00 0.00 ? 86  LYS A CD   5  
ATOM 9047  C CE   . LYS A 1 86  ? 3.970   -25.262 8.951   1.00 0.00 ? 86  LYS A CE   5  
ATOM 9048  N NZ   . LYS A 1 86  ? 3.949   -26.129 7.751   1.00 0.00 ? 86  LYS A NZ   5  
ATOM 9049  H H    . LYS A 1 86  ? 1.379   -21.119 11.959  1.00 0.00 ? 86  LYS A H    5  
ATOM 9050  H HA   . LYS A 1 86  ? 3.932   -20.466 10.655  1.00 0.00 ? 86  LYS A HA   5  
ATOM 9051  H HB2  . LYS A 1 86  ? 1.429   -21.888 9.609   1.00 0.00 ? 86  LYS A HB2  5  
ATOM 9052  H HB3  . LYS A 1 86  ? 2.792   -21.312 8.597   1.00 0.00 ? 86  LYS A HB3  5  
ATOM 9053  H HG2  . LYS A 1 86  ? 4.344   -22.748 10.123  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 9054  H HG3  . LYS A 1 86  ? 2.841   -23.493 10.769  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 9055  H HD2  . LYS A 1 86  ? 2.205   -24.111 8.381   1.00 0.00 ? 86  LYS A HD2  5  
ATOM 9056  H HD3  . LYS A 1 86  ? 3.766   -23.399 7.834   1.00 0.00 ? 86  LYS A HD3  5  
ATOM 9057  H HE2  . LYS A 1 86  ? 5.033   -25.095 9.227   1.00 0.00 ? 86  LYS A HE2  5  
ATOM 9058  H HE3  . LYS A 1 86  ? 3.466   -25.813 9.773   1.00 0.00 ? 86  LYS A HE3  5  
ATOM 9059  H HZ1  . LYS A 1 86  ? 2.964   -26.319 7.476   1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 9060  H HZ2  . LYS A 1 86  ? 4.440   -25.649 6.968   1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 9061  H HZ3  . LYS A 1 86  ? 4.430   -27.027 7.961   1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 9062  N N    . GLY A 1 87  ? 1.816   -18.376 11.178  1.00 0.00 ? 87  GLY A N    5  
ATOM 9063  C CA   . GLY A 1 87  ? 1.318   -17.029 10.878  1.00 0.00 ? 87  GLY A CA   5  
ATOM 9064  C C    . GLY A 1 87  ? -0.118  -16.705 11.186  1.00 0.00 ? 87  GLY A C    5  
ATOM 9065  O O    . GLY A 1 87  ? -0.835  -17.470 11.838  1.00 0.00 ? 87  GLY A O    5  
ATOM 9066  H H    . GLY A 1 87  ? 1.859   -18.609 12.148  1.00 0.00 ? 87  GLY A H    5  
ATOM 9067  H HA2  . GLY A 1 87  ? 1.927   -16.336 11.439  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 9068  H HA3  . GLY A 1 87  ? 1.372   -16.869 9.819   1.00 0.00 ? 87  GLY A HA3  5  
ATOM 9069  N N    . TRP A 1 88  ? -0.551  -15.527 10.641  1.00 0.00 ? 88  TRP A N    5  
ATOM 9070  C CA   . TRP A 1 88  ? -1.878  -14.910 10.676  1.00 0.00 ? 88  TRP A CA   5  
ATOM 9071  C C    . TRP A 1 88  ? -2.612  -15.243 9.372   1.00 0.00 ? 88  TRP A C    5  
ATOM 9072  O O    . TRP A 1 88  ? -2.280  -14.760 8.287   1.00 0.00 ? 88  TRP A O    5  
ATOM 9073  C CB   . TRP A 1 88  ? -1.831  -13.353 10.910  1.00 0.00 ? 88  TRP A CB   5  
ATOM 9074  C CG   . TRP A 1 88  ? -1.876  -12.947 12.384  1.00 0.00 ? 88  TRP A CG   5  
ATOM 9075  C CD1  . TRP A 1 88  ? -0.890  -12.838 13.323  1.00 0.00 ? 88  TRP A CD1  5  
ATOM 9076  C CD2  . TRP A 1 88  ? -3.111  -12.706 13.077  1.00 0.00 ? 88  TRP A CD2  5  
ATOM 9077  N NE1  . TRP A 1 88  ? -1.443  -12.562 14.565  1.00 0.00 ? 88  TRP A NE1  5  
ATOM 9078  C CE2  . TRP A 1 88  ? -2.819  -12.550 14.426  1.00 0.00 ? 88  TRP A CE2  5  
ATOM 9079  C CE3  . TRP A 1 88  ? -4.391  -12.622 12.626  1.00 0.00 ? 88  TRP A CE3  5  
ATOM 9080  C CZ2  . TRP A 1 88  ? -3.823  -12.389 15.339  1.00 0.00 ? 88  TRP A CZ2  5  
ATOM 9081  C CZ3  . TRP A 1 88  ? -5.381  -12.406 13.553  1.00 0.00 ? 88  TRP A CZ3  5  
ATOM 9082  C CH2  . TRP A 1 88  ? -5.121  -12.283 14.891  1.00 0.00 ? 88  TRP A CH2  5  
ATOM 9083  H H    . TRP A 1 88  ? 0.093   -15.013 10.061  1.00 0.00 ? 88  TRP A H    5  
ATOM 9084  H HA   . TRP A 1 88  ? -2.458  -15.352 11.478  1.00 0.00 ? 88  TRP A HA   5  
ATOM 9085  H HB2  . TRP A 1 88  ? -0.935  -12.920 10.411  1.00 0.00 ? 88  TRP A HB2  5  
ATOM 9086  H HB3  . TRP A 1 88  ? -2.722  -12.863 10.453  1.00 0.00 ? 88  TRP A HB3  5  
ATOM 9087  H HD1  . TRP A 1 88  ? 0.155   -12.991 13.110  1.00 0.00 ? 88  TRP A HD1  5  
ATOM 9088  H HE1  . TRP A 1 88  ? -0.944  -12.494 15.410  1.00 0.00 ? 88  TRP A HE1  5  
ATOM 9089  H HE3  . TRP A 1 88  ? -4.623  -12.554 11.579  1.00 0.00 ? 88  TRP A HE3  5  
ATOM 9090  H HZ2  . TRP A 1 88  ? -3.656  -12.262 16.385  1.00 0.00 ? 88  TRP A HZ2  5  
ATOM 9091  H HZ3  . TRP A 1 88  ? -6.383  -12.243 13.221  1.00 0.00 ? 88  TRP A HZ3  5  
ATOM 9092  H HH2  . TRP A 1 88  ? -5.938  -12.025 15.564  1.00 0.00 ? 88  TRP A HH2  5  
ATOM 9093  N N    . TYR A 1 89  ? -3.661  -16.106 9.488   1.00 0.00 ? 89  TYR A N    5  
ATOM 9094  C CA   . TYR A 1 89  ? -4.515  -16.622 8.428   1.00 0.00 ? 89  TYR A CA   5  
ATOM 9095  C C    . TYR A 1 89  ? -5.856  -15.976 8.588   1.00 0.00 ? 89  TYR A C    5  
ATOM 9096  O O    . TYR A 1 89  ? -6.420  -15.914 9.678   1.00 0.00 ? 89  TYR A O    5  
ATOM 9097  C CB   . TYR A 1 89  ? -4.733  -18.167 8.454   1.00 0.00 ? 89  TYR A CB   5  
ATOM 9098  C CG   . TYR A 1 89  ? -3.429  -18.793 8.105   1.00 0.00 ? 89  TYR A CG   5  
ATOM 9099  C CD1  . TYR A 1 89  ? -3.136  -19.130 6.801   1.00 0.00 ? 89  TYR A CD1  5  
ATOM 9100  C CD2  . TYR A 1 89  ? -2.454  -18.898 9.065   1.00 0.00 ? 89  TYR A CD2  5  
ATOM 9101  C CE1  . TYR A 1 89  ? -1.851  -19.489 6.443   1.00 0.00 ? 89  TYR A CE1  5  
ATOM 9102  C CE2  . TYR A 1 89  ? -1.166  -19.209 8.710   1.00 0.00 ? 89  TYR A CE2  5  
ATOM 9103  C CZ   . TYR A 1 89  ? -0.848  -19.480 7.397   1.00 0.00 ? 89  TYR A CZ   5  
ATOM 9104  O OH   . TYR A 1 89  ? 0.502   -19.690 7.040   1.00 0.00 ? 89  TYR A OH   5  
ATOM 9105  H H    . TYR A 1 89  ? -3.960  -16.435 10.390  1.00 0.00 ? 89  TYR A H    5  
ATOM 9106  H HA   . TYR A 1 89  ? -4.117  -16.346 7.462   1.00 0.00 ? 89  TYR A HA   5  
ATOM 9107  H HB2  . TYR A 1 89  ? -5.046  -18.524 9.457   1.00 0.00 ? 89  TYR A HB2  5  
ATOM 9108  H HB3  . TYR A 1 89  ? -5.476  -18.498 7.693   1.00 0.00 ? 89  TYR A HB3  5  
ATOM 9109  H HD1  . TYR A 1 89  ? -3.901  -19.056 6.041   1.00 0.00 ? 89  TYR A HD1  5  
ATOM 9110  H HD2  . TYR A 1 89  ? -2.677  -18.621 10.087  1.00 0.00 ? 89  TYR A HD2  5  
ATOM 9111  H HE1  . TYR A 1 89  ? -1.656  -19.697 5.399   1.00 0.00 ? 89  TYR A HE1  5  
ATOM 9112  H HE2  . TYR A 1 89  ? -0.425  -19.176 9.490   1.00 0.00 ? 89  TYR A HE2  5  
ATOM 9113  H HH   . TYR A 1 89  ? 1.077   -19.507 7.818   1.00 0.00 ? 89  TYR A HH   5  
ATOM 9114  N N    . ILE A 1 90  ? -6.401  -15.464 7.484   1.00 0.00 ? 90  ILE A N    5  
ATOM 9115  C CA   . ILE A 1 90  ? -7.675  -14.800 7.393   1.00 0.00 ? 90  ILE A CA   5  
ATOM 9116  C C    . ILE A 1 90  ? -8.497  -15.543 6.372   1.00 0.00 ? 90  ILE A C    5  
ATOM 9117  O O    . ILE A 1 90  ? -8.041  -15.892 5.284   1.00 0.00 ? 90  ILE A O    5  
ATOM 9118  C CB   . ILE A 1 90  ? -7.602  -13.294 7.055   1.00 0.00 ? 90  ILE A CB   5  
ATOM 9119  C CG1  . ILE A 1 90  ? -7.502  -12.890 5.552   1.00 0.00 ? 90  ILE A CG1  5  
ATOM 9120  C CG2  . ILE A 1 90  ? -6.409  -12.680 7.808   1.00 0.00 ? 90  ILE A CG2  5  
ATOM 9121  C CD1  . ILE A 1 90  ? -7.895  -11.438 5.267   1.00 0.00 ? 90  ILE A CD1  5  
ATOM 9122  H H    . ILE A 1 90  ? -5.919  -15.540 6.626   1.00 0.00 ? 90  ILE A H    5  
ATOM 9123  H HA   . ILE A 1 90  ? -8.196  -14.874 8.343   1.00 0.00 ? 90  ILE A HA   5  
ATOM 9124  H HB   . ILE A 1 90  ? -8.525  -12.843 7.496   1.00 0.00 ? 90  ILE A HB   5  
ATOM 9125  H HG12 . ILE A 1 90  ? -6.468  -13.088 5.188   1.00 0.00 ? 90  ILE A HG12 5  
ATOM 9126  H HG13 . ILE A 1 90  ? -8.203  -13.457 4.913   1.00 0.00 ? 90  ILE A HG13 5  
ATOM 9127  H HG21 . ILE A 1 90  ? -6.353  -13.051 8.848   1.00 0.00 ? 90  ILE A HG21 5  
ATOM 9128  H HG22 . ILE A 1 90  ? -5.454  -12.909 7.288   1.00 0.00 ? 90  ILE A HG22 5  
ATOM 9129  H HG23 . ILE A 1 90  ? -6.519  -11.580 7.820   1.00 0.00 ? 90  ILE A HG23 5  
ATOM 9130  H HD11 . ILE A 1 90  ? -7.304  -10.736 5.879   1.00 0.00 ? 90  ILE A HD11 5  
ATOM 9131  H HD12 . ILE A 1 90  ? -7.712  -11.207 4.193   1.00 0.00 ? 90  ILE A HD12 5  
ATOM 9132  H HD13 . ILE A 1 90  ? -8.963  -11.301 5.496   1.00 0.00 ? 90  ILE A HD13 5  
ATOM 9133  N N    . GLN A 1 91  ? -9.782  -15.755 6.669   1.00 0.00 ? 91  GLN A N    5  
ATOM 9134  C CA   . GLN A 1 91  ? -10.760 -16.288 5.773   1.00 0.00 ? 91  GLN A CA   5  
ATOM 9135  C C    . GLN A 1 91  ? -11.834 -15.230 5.753   1.00 0.00 ? 91  GLN A C    5  
ATOM 9136  O O    . GLN A 1 91  ? -12.343 -14.844 6.792   1.00 0.00 ? 91  GLN A O    5  
ATOM 9137  C CB   . GLN A 1 91  ? -11.261 -17.673 6.251   1.00 0.00 ? 91  GLN A CB   5  
ATOM 9138  C CG   . GLN A 1 91  ? -12.602 -18.079 5.615   1.00 0.00 ? 91  GLN A CG   5  
ATOM 9139  C CD   . GLN A 1 91  ? -12.889 -19.558 5.812   1.00 0.00 ? 91  GLN A CD   5  
ATOM 9140  O OE1  . GLN A 1 91  ? -12.815 -20.075 6.930   1.00 0.00 ? 91  GLN A OE1  5  
ATOM 9141  N NE2  . GLN A 1 91  ? -13.247 -20.261 4.703   1.00 0.00 ? 91  GLN A NE2  5  
ATOM 9142  H H    . GLN A 1 91  ? -10.131 -15.443 7.559   1.00 0.00 ? 91  GLN A H    5  
ATOM 9143  H HA   . GLN A 1 91  ? -10.389 -16.367 4.760   1.00 0.00 ? 91  GLN A HA   5  
ATOM 9144  H HB2  . GLN A 1 91  ? -10.484 -18.432 6.007   1.00 0.00 ? 91  GLN A HB2  5  
ATOM 9145  H HB3  . GLN A 1 91  ? -11.362 -17.686 7.356   1.00 0.00 ? 91  GLN A HB3  5  
ATOM 9146  H HG2  . GLN A 1 91  ? -13.369 -17.499 6.165   1.00 0.00 ? 91  GLN A HG2  5  
ATOM 9147  H HG3  . GLN A 1 91  ? -12.622 -17.822 4.536   1.00 0.00 ? 91  GLN A HG3  5  
ATOM 9148  H HE21 . GLN A 1 91  ? -13.230 -19.843 3.797   1.00 0.00 ? 91  GLN A HE21 5  
ATOM 9149  H HE22 . GLN A 1 91  ? -13.513 -21.214 4.830   1.00 0.00 ? 91  GLN A HE22 5  
ATOM 9150  N N    . TYR A 1 92  ? -12.213 -14.730 4.561   1.00 0.00 ? 92  TYR A N    5  
ATOM 9151  C CA   . TYR A 1 92  ? -13.246 -13.740 4.293   1.00 0.00 ? 92  TYR A CA   5  
ATOM 9152  C C    . TYR A 1 92  ? -14.678 -14.194 4.688   1.00 0.00 ? 92  TYR A C    5  
ATOM 9153  O O    . TYR A 1 92  ? -15.012 -15.378 4.670   1.00 0.00 ? 92  TYR A O    5  
ATOM 9154  C CB   . TYR A 1 92  ? -13.019 -13.193 2.865   1.00 0.00 ? 92  TYR A CB   5  
ATOM 9155  C CG   . TYR A 1 92  ? -13.943 -12.085 2.340   1.00 0.00 ? 92  TYR A CG   5  
ATOM 9156  C CD1  . TYR A 1 92  ? -15.190 -12.229 1.734   1.00 0.00 ? 92  TYR A CD1  5  
ATOM 9157  C CD2  . TYR A 1 92  ? -13.490 -10.794 2.469   1.00 0.00 ? 92  TYR A CD2  5  
ATOM 9158  C CE1  . TYR A 1 92  ? -15.984 -11.132 1.431   1.00 0.00 ? 92  TYR A CE1  5  
ATOM 9159  C CE2  . TYR A 1 92  ? -14.260 -9.717  2.136   1.00 0.00 ? 92  TYR A CE2  5  
ATOM 9160  C CZ   . TYR A 1 92  ? -15.542 -9.860  1.695   1.00 0.00 ? 92  TYR A CZ   5  
ATOM 9161  O OH   . TYR A 1 92  ? -16.349 -8.711  1.549   1.00 0.00 ? 92  TYR A OH   5  
ATOM 9162  H H    . TYR A 1 92  ? -11.748 -15.071 3.752   1.00 0.00 ? 92  TYR A H    5  
ATOM 9163  H HA   . TYR A 1 92  ? -13.003 -12.868 4.880   1.00 0.00 ? 92  TYR A HA   5  
ATOM 9164  H HB2  . TYR A 1 92  ? -11.988 -12.770 2.879   1.00 0.00 ? 92  TYR A HB2  5  
ATOM 9165  H HB3  . TYR A 1 92  ? -12.945 -14.034 2.191   1.00 0.00 ? 92  TYR A HB3  5  
ATOM 9166  H HD1  . TYR A 1 92  ? -15.632 -13.182 1.532   1.00 0.00 ? 92  TYR A HD1  5  
ATOM 9167  H HD2  . TYR A 1 92  ? -12.518 -10.615 2.900   1.00 0.00 ? 92  TYR A HD2  5  
ATOM 9168  H HE1  . TYR A 1 92  ? -16.984 -11.304 1.060   1.00 0.00 ? 92  TYR A HE1  5  
ATOM 9169  H HE2  . TYR A 1 92  ? -13.864 -8.743  2.319   1.00 0.00 ? 92  TYR A HE2  5  
ATOM 9170  H HH   . TYR A 1 92  ? -17.235 -8.988  1.291   1.00 0.00 ? 92  TYR A HH   5  
ATOM 9171  N N    . ILE A 1 93  ? -15.531 -13.234 5.116   1.00 0.00 ? 93  ILE A N    5  
ATOM 9172  C CA   . ILE A 1 93  ? -16.936 -13.306 5.505   1.00 0.00 ? 93  ILE A CA   5  
ATOM 9173  C C    . ILE A 1 93  ? -17.598 -12.944 4.199   1.00 0.00 ? 93  ILE A C    5  
ATOM 9174  O O    . ILE A 1 93  ? -17.537 -11.785 3.805   1.00 0.00 ? 93  ILE A O    5  
ATOM 9175  C CB   . ILE A 1 93  ? -17.278 -12.211 6.539   1.00 0.00 ? 93  ILE A CB   5  
ATOM 9176  C CG1  . ILE A 1 93  ? -16.392 -12.325 7.806   1.00 0.00 ? 93  ILE A CG1  5  
ATOM 9177  C CG2  . ILE A 1 93  ? -18.799 -12.098 6.810   1.00 0.00 ? 93  ILE A CG2  5  
ATOM 9178  C CD1  . ILE A 1 93  ? -17.004 -11.854 9.124   1.00 0.00 ? 93  ILE A CD1  5  
ATOM 9179  H H    . ILE A 1 93  ? -15.242 -12.279 5.046   1.00 0.00 ? 93  ILE A H    5  
ATOM 9180  H HA   . ILE A 1 93  ? -17.218 -14.297 5.832   1.00 0.00 ? 93  ILE A HA   5  
ATOM 9181  H HB   . ILE A 1 93  ? -16.999 -11.209 6.119   1.00 0.00 ? 93  ILE A HB   5  
ATOM 9182  H HG12 . ILE A 1 93  ? -15.990 -13.346 7.926   1.00 0.00 ? 93  ILE A HG12 5  
ATOM 9183  H HG13 . ILE A 1 93  ? -15.525 -11.658 7.636   1.00 0.00 ? 93  ILE A HG13 5  
ATOM 9184  H HG21 . ILE A 1 93  ? -19.211 -13.050 7.193   1.00 0.00 ? 93  ILE A HG21 5  
ATOM 9185  H HG22 . ILE A 1 93  ? -18.983 -11.274 7.531   1.00 0.00 ? 93  ILE A HG22 5  
ATOM 9186  H HG23 . ILE A 1 93  ? -19.325 -11.782 5.883   1.00 0.00 ? 93  ILE A HG23 5  
ATOM 9187  H HD11 . ILE A 1 93  ? -17.385 -10.816 9.009   1.00 0.00 ? 93  ILE A HD11 5  
ATOM 9188  H HD12 . ILE A 1 93  ? -17.831 -12.522 9.440   1.00 0.00 ? 93  ILE A HD12 5  
ATOM 9189  H HD13 . ILE A 1 93  ? -16.210 -11.849 9.903   1.00 0.00 ? 93  ILE A HD13 5  
ATOM 9190  N N    . ASP A 1 94  ? -18.214 -13.920 3.479   1.00 0.00 ? 94  ASP A N    5  
ATOM 9191  C CA   . ASP A 1 94  ? -18.695 -13.839 2.091   1.00 0.00 ? 94  ASP A CA   5  
ATOM 9192  C C    . ASP A 1 94  ? -19.558 -12.706 1.601   1.00 0.00 ? 94  ASP A C    5  
ATOM 9193  O O    . ASP A 1 94  ? -19.586 -12.360 0.422   1.00 0.00 ? 94  ASP A O    5  
ATOM 9194  C CB   . ASP A 1 94  ? -19.268 -15.191 1.579   1.00 0.00 ? 94  ASP A CB   5  
ATOM 9195  C CG   . ASP A 1 94  ? -20.372 -15.763 2.479   1.00 0.00 ? 94  ASP A CG   5  
ATOM 9196  O OD1  . ASP A 1 94  ? -20.114 -16.817 3.122   1.00 0.00 ? 94  ASP A OD1  5  
ATOM 9197  O OD2  . ASP A 1 94  ? -21.481 -15.168 2.532   1.00 0.00 ? 94  ASP A OD2  5  
ATOM 9198  H H    . ASP A 1 94  ? -18.252 -14.839 3.858   1.00 0.00 ? 94  ASP A H    5  
ATOM 9199  H HA   . ASP A 1 94  ? -17.812 -13.662 1.525   1.00 0.00 ? 94  ASP A HA   5  
ATOM 9200  H HB2  . ASP A 1 94  ? -19.615 -15.077 0.534   1.00 0.00 ? 94  ASP A HB2  5  
ATOM 9201  H HB3  . ASP A 1 94  ? -18.435 -15.925 1.544   1.00 0.00 ? 94  ASP A HB3  5  
ATOM 9202  N N    . ARG A 1 95  ? -20.302 -12.132 2.553   1.00 0.00 ? 95  ARG A N    5  
ATOM 9203  C CA   . ARG A 1 95  ? -21.236 -11.038 2.419   1.00 0.00 ? 95  ARG A CA   5  
ATOM 9204  C C    . ARG A 1 95  ? -22.499 -11.562 1.746   1.00 0.00 ? 95  ARG A C    5  
ATOM 9205  O O    . ARG A 1 95  ? -23.348 -12.165 2.392   1.00 0.00 ? 95  ARG A O    5  
ATOM 9206  C CB   . ARG A 1 95  ? -20.524 -9.767  1.895   1.00 0.00 ? 95  ARG A CB   5  
ATOM 9207  C CG   . ARG A 1 95  ? -19.350 -9.375  2.837   1.00 0.00 ? 95  ARG A CG   5  
ATOM 9208  C CD   . ARG A 1 95  ? -19.302 -7.882  3.167   1.00 0.00 ? 95  ARG A CD   5  
ATOM 9209  N NE   . ARG A 1 95  ? -20.649 -7.404  3.643   1.00 0.00 ? 95  ARG A NE   5  
ATOM 9210  C CZ   . ARG A 1 95  ? -20.866 -6.156  4.161   1.00 0.00 ? 95  ARG A CZ   5  
ATOM 9211  N NH1  . ARG A 1 95  ? -19.848 -5.257  4.283   1.00 0.00 ? 95  ARG A NH1  5  
ATOM 9212  N NH2  . ARG A 1 95  ? -22.124 -5.809  4.566   1.00 0.00 ? 95  ARG A NH2  5  
ATOM 9213  H H    . ARG A 1 95  ? -20.146 -12.519 3.446   1.00 0.00 ? 95  ARG A H    5  
ATOM 9214  H HA   . ARG A 1 95  ? -21.545 -10.784 3.406   1.00 0.00 ? 95  ARG A HA   5  
ATOM 9215  H HB2  . ARG A 1 95  ? -20.110 -9.924  0.876   1.00 0.00 ? 95  ARG A HB2  5  
ATOM 9216  H HB3  . ARG A 1 95  ? -21.269 -8.945  1.826   1.00 0.00 ? 95  ARG A HB3  5  
ATOM 9217  H HG2  . ARG A 1 95  ? -19.384 -9.844  3.841   1.00 0.00 ? 95  ARG A HG2  5  
ATOM 9218  H HG3  . ARG A 1 95  ? -18.365 -9.777  2.489   1.00 0.00 ? 95  ARG A HG3  5  
ATOM 9219  H HD2  . ARG A 1 95  ? -18.613 -7.798  4.029   1.00 0.00 ? 95  ARG A HD2  5  
ATOM 9220  H HD3  . ARG A 1 95  ? -18.965 -7.292  2.288   1.00 0.00 ? 95  ARG A HD3  5  
ATOM 9221  H HE   . ARG A 1 95  ? -21.423 -8.032  3.572   1.00 0.00 ? 95  ARG A HE   5  
ATOM 9222  H HH11 . ARG A 1 95  ? -18.923 -5.507  3.993   1.00 0.00 ? 95  ARG A HH11 5  
ATOM 9223  H HH12 . ARG A 1 95  ? -20.024 -4.350  4.665   1.00 0.00 ? 95  ARG A HH12 5  
ATOM 9224  H HH21 . ARG A 1 95  ? -22.874 -6.465  4.480   1.00 0.00 ? 95  ARG A HH21 5  
ATOM 9225  H HH22 . ARG A 1 95  ? -22.294 -4.900  4.946   1.00 0.00 ? 95  ARG A HH22 5  
ATOM 9226  N N    . ASP A 1 96  ? -22.566 -11.463 0.407   1.00 0.00 ? 96  ASP A N    5  
ATOM 9227  C CA   . ASP A 1 96  ? -23.436 -12.246 -0.451  1.00 0.00 ? 96  ASP A CA   5  
ATOM 9228  C C    . ASP A 1 96  ? -22.522 -13.313 -1.064  1.00 0.00 ? 96  ASP A C    5  
ATOM 9229  O O    . ASP A 1 96  ? -21.618 -12.884 -1.778  1.00 0.00 ? 96  ASP A O    5  
ATOM 9230  C CB   . ASP A 1 96  ? -24.010 -11.390 -1.590  1.00 0.00 ? 96  ASP A CB   5  
ATOM 9231  C CG   . ASP A 1 96  ? -24.991 -10.356 -1.038  1.00 0.00 ? 96  ASP A CG   5  
ATOM 9232  O OD1  . ASP A 1 96  ? -26.043 -10.775 -0.487  1.00 0.00 ? 96  ASP A OD1  5  
ATOM 9233  O OD2  . ASP A 1 96  ? -24.700 -9.136  -1.161  1.00 0.00 ? 96  ASP A OD2  5  
ATOM 9234  H H    . ASP A 1 96  ? -21.819 -11.012 -0.066  1.00 0.00 ? 96  ASP A H    5  
ATOM 9235  H HA   . ASP A 1 96  ? -24.240 -12.711 0.105   1.00 0.00 ? 96  ASP A HA   5  
ATOM 9236  H HB2  . ASP A 1 96  ? -23.158 -10.884 -2.072  1.00 0.00 ? 96  ASP A HB2  5  
ATOM 9237  H HB3  . ASP A 1 96  ? -24.513 -12.012 -2.349  1.00 0.00 ? 96  ASP A HB3  5  
ATOM 9238  N N    . PRO A 1 97  ? -22.617 -14.655 -0.951  1.00 0.00 ? 97  PRO A N    5  
ATOM 9239  C CA   . PRO A 1 97  ? -21.667 -15.628 -1.527  1.00 0.00 ? 97  PRO A CA   5  
ATOM 9240  C C    . PRO A 1 97  ? -21.800 -15.784 -3.043  1.00 0.00 ? 97  PRO A C    5  
ATOM 9241  O O    . PRO A 1 97  ? -20.914 -16.328 -3.698  1.00 0.00 ? 97  PRO A O    5  
ATOM 9242  C CB   . PRO A 1 97  ? -21.899 -16.909 -0.744  1.00 0.00 ? 97  PRO A CB   5  
ATOM 9243  C CG   . PRO A 1 97  ? -23.374 -16.799 -0.365  1.00 0.00 ? 97  PRO A CG   5  
ATOM 9244  C CD   . PRO A 1 97  ? -23.672 -15.301 -0.208  1.00 0.00 ? 97  PRO A CD   5  
ATOM 9245  H HA   . PRO A 1 97  ? -20.666 -15.308 -1.345  1.00 0.00 ? 97  PRO A HA   5  
ATOM 9246  H HB2  . PRO A 1 97  ? -21.672 -17.836 -1.338  1.00 0.00 ? 97  PRO A HB2  5  
ATOM 9247  H HB3  . PRO A 1 97  ? -21.280 -16.873 0.191   1.00 0.00 ? 97  PRO A HB3  5  
ATOM 9248  H HG2  . PRO A 1 97  ? -23.903 -17.152 -1.274  1.00 0.00 ? 97  PRO A HG2  5  
ATOM 9249  H HG3  . PRO A 1 97  ? -23.614 -17.418 0.513   1.00 0.00 ? 97  PRO A HG3  5  
ATOM 9250  H HD2  . PRO A 1 97  ? -24.666 -15.075 -0.659  1.00 0.00 ? 97  PRO A HD2  5  
ATOM 9251  H HD3  . PRO A 1 97  ? -23.638 -14.899 0.822   1.00 0.00 ? 97  PRO A HD3  5  
ATOM 9252  N N    . GLU A 1 98  ? -22.859 -15.172 -3.631  1.00 0.00 ? 98  GLU A N    5  
ATOM 9253  C CA   . GLU A 1 98  ? -23.089 -14.959 -5.043  1.00 0.00 ? 98  GLU A CA   5  
ATOM 9254  C C    . GLU A 1 98  ? -22.116 -13.909 -5.569  1.00 0.00 ? 98  GLU A C    5  
ATOM 9255  O O    . GLU A 1 98  ? -21.670 -13.979 -6.702  1.00 0.00 ? 98  GLU A O    5  
ATOM 9256  C CB   . GLU A 1 98  ? -24.537 -14.494 -5.291  1.00 0.00 ? 98  GLU A CB   5  
ATOM 9257  C CG   . GLU A 1 98  ? -25.579 -15.546 -4.865  1.00 0.00 ? 98  GLU A CG   5  
ATOM 9258  C CD   . GLU A 1 98  ? -27.008 -15.091 -5.178  1.00 0.00 ? 98  GLU A CD   5  
ATOM 9259  O OE1  . GLU A 1 98  ? -27.190 -13.959 -5.701  1.00 0.00 ? 98  GLU A OE1  5  
ATOM 9260  O OE2  . GLU A 1 98  ? -27.943 -15.887 -4.894  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 9261  H H    . GLU A 1 98  ? -23.528 -14.749 -3.026  1.00 0.00 ? 98  GLU A H    5  
ATOM 9262  H HA   . GLU A 1 98  ? -22.906 -15.880 -5.584  1.00 0.00 ? 98  GLU A HA   5  
ATOM 9263  H HB2  . GLU A 1 98  ? -24.719 -13.559 -4.714  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 9264  H HB3  . GLU A 1 98  ? -24.682 -14.285 -6.374  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 9265  H HG2  . GLU A 1 98  ? -25.380 -16.492 -5.413  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 9266  H HG3  . GLU A 1 98  ? -25.497 -15.744 -3.775  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 9267  N N    . THR A 1 99  ? -21.656 -12.949 -4.704  1.00 0.00 ? 99  THR A N    5  
ATOM 9268  C CA   . THR A 1 99  ? -20.630 -11.947 -5.037  1.00 0.00 ? 99  THR A CA   5  
ATOM 9269  C C    . THR A 1 99  ? -19.253 -12.591 -5.228  1.00 0.00 ? 99  THR A C    5  
ATOM 9270  O O    . THR A 1 99  ? -18.497 -12.210 -6.109  1.00 0.00 ? 99  THR A O    5  
ATOM 9271  C CB   . THR A 1 99  ? -20.590 -10.771 -4.027  1.00 0.00 ? 99  THR A CB   5  
ATOM 9272  O OG1  . THR A 1 99  ? -20.476 -9.511  -4.666  1.00 0.00 ? 99  THR A OG1  5  
ATOM 9273  C CG2  . THR A 1 99  ? -19.449 -10.827 -3.001  1.00 0.00 ? 99  THR A CG2  5  
ATOM 9274  H H    . THR A 1 99  ? -21.993 -12.927 -3.756  1.00 0.00 ? 99  THR A H    5  
ATOM 9275  H HA   . THR A 1 99  ? -20.898 -11.529 -5.997  1.00 0.00 ? 99  THR A HA   5  
ATOM 9276  H HB   . THR A 1 99  ? -21.561 -10.764 -3.489  1.00 0.00 ? 99  THR A HB   5  
ATOM 9277  H HG1  . THR A 1 99  ? -19.749 -9.585  -5.293  1.00 0.00 ? 99  THR A HG1  5  
ATOM 9278  H HG21 . THR A 1 99  ? -19.476 -11.791 -2.454  1.00 0.00 ? 99  THR A HG21 5  
ATOM 9279  H HG22 . THR A 1 99  ? -18.474 -10.723 -3.529  1.00 0.00 ? 99  THR A HG22 5  
ATOM 9280  H HG23 . THR A 1 99  ? -19.553 -10.018 -2.253  1.00 0.00 ? 99  THR A HG23 5  
ATOM 9281  N N    . ILE A 1 100 ? -18.936 -13.608 -4.374  1.00 0.00 ? 100 ILE A N    5  
ATOM 9282  C CA   . ILE A 1 100 ? -17.715 -14.419 -4.278  1.00 0.00 ? 100 ILE A CA   5  
ATOM 9283  C C    . ILE A 1 100 ? -17.651 -15.404 -5.426  1.00 0.00 ? 100 ILE A C    5  
ATOM 9284  O O    . ILE A 1 100 ? -16.706 -15.400 -6.208  1.00 0.00 ? 100 ILE A O    5  
ATOM 9285  C CB   . ILE A 1 100 ? -17.808 -15.182 -2.950  1.00 0.00 ? 100 ILE A CB   5  
ATOM 9286  C CG1  . ILE A 1 100 ? -17.969 -14.229 -1.745  1.00 0.00 ? 100 ILE A CG1  5  
ATOM 9287  C CG2  . ILE A 1 100 ? -16.562 -16.055 -2.746  1.00 0.00 ? 100 ILE A CG2  5  
ATOM 9288  C CD1  . ILE A 1 100 ? -16.902 -13.145 -1.587  1.00 0.00 ? 100 ILE A CD1  5  
ATOM 9289  H H    . ILE A 1 100 ? -19.623 -13.851 -3.695  1.00 0.00 ? 100 ILE A H    5  
ATOM 9290  H HA   . ILE A 1 100 ? -16.776 -13.833 -4.318  1.00 0.00 ? 100 ILE A HA   5  
ATOM 9291  H HB   . ILE A 1 100 ? -18.735 -15.821 -2.920  1.00 0.00 ? 100 ILE A HB   5  
ATOM 9292  H HG12 . ILE A 1 100 ? -18.973 -13.747 -1.771  1.00 0.00 ? 100 ILE A HG12 5  
ATOM 9293  H HG13 . ILE A 1 100 ? -17.926 -14.854 -0.829  1.00 0.00 ? 100 ILE A HG13 5  
ATOM 9294  H HG21 . ILE A 1 100 ? -15.670 -15.432 -2.952  1.00 0.00 ? 100 ILE A HG21 5  
ATOM 9295  H HG22 . ILE A 1 100 ? -16.503 -16.415 -1.697  1.00 0.00 ? 100 ILE A HG22 5  
ATOM 9296  H HG23 . ILE A 1 100 ? -16.545 -16.943 -3.410  1.00 0.00 ? 100 ILE A HG23 5  
ATOM 9297  H HD11 . ILE A 1 100 ? -16.799 -12.532 -2.506  1.00 0.00 ? 100 ILE A HD11 5  
ATOM 9298  H HD12 . ILE A 1 100 ? -17.206 -12.462 -0.762  1.00 0.00 ? 100 ILE A HD12 5  
ATOM 9299  H HD13 . ILE A 1 100 ? -15.922 -13.592 -1.324  1.00 0.00 ? 100 ILE A HD13 5  
ATOM 9300  N N    . ARG A 1 101 ? -18.738 -16.190 -5.674  1.00 0.00 ? 101 ARG A N    5  
ATOM 9301  C CA   . ARG A 1 101 ? -18.882 -17.122 -6.807  1.00 0.00 ? 101 ARG A CA   5  
ATOM 9302  C C    . ARG A 1 101 ? -18.948 -16.426 -8.174  1.00 0.00 ? 101 ARG A C    5  
ATOM 9303  O O    . ARG A 1 101 ? -18.387 -16.904 -9.160  1.00 0.00 ? 101 ARG A O    5  
ATOM 9304  C CB   . ARG A 1 101 ? -20.113 -18.054 -6.627  1.00 0.00 ? 101 ARG A CB   5  
ATOM 9305  C CG   . ARG A 1 101 ? -20.003 -19.010 -5.422  1.00 0.00 ? 101 ARG A CG   5  
ATOM 9306  C CD   . ARG A 1 101 ? -21.217 -19.938 -5.259  1.00 0.00 ? 101 ARG A CD   5  
ATOM 9307  N NE   . ARG A 1 101 ? -22.403 -19.105 -4.853  1.00 0.00 ? 101 ARG A NE   5  
ATOM 9308  C CZ   . ARG A 1 101 ? -23.611 -19.645 -4.500  1.00 0.00 ? 101 ARG A CZ   5  
ATOM 9309  N NH1  . ARG A 1 101 ? -23.823 -20.991 -4.570  1.00 0.00 ? 101 ARG A NH1  5  
ATOM 9310  N NH2  . ARG A 1 101 ? -24.612 -18.826 -4.066  1.00 0.00 ? 101 ARG A NH2  5  
ATOM 9311  H H    . ARG A 1 101 ? -19.525 -16.172 -5.046  1.00 0.00 ? 101 ARG A H    5  
ATOM 9312  H HA   . ARG A 1 101 ? -17.994 -17.748 -6.848  1.00 0.00 ? 101 ARG A HA   5  
ATOM 9313  H HB2  . ARG A 1 101 ? -21.022 -17.434 -6.484  1.00 0.00 ? 101 ARG A HB2  5  
ATOM 9314  H HB3  . ARG A 1 101 ? -20.266 -18.693 -7.528  1.00 0.00 ? 101 ARG A HB3  5  
ATOM 9315  H HG2  . ARG A 1 101 ? -19.091 -19.634 -5.562  1.00 0.00 ? 101 ARG A HG2  5  
ATOM 9316  H HG3  . ARG A 1 101 ? -19.893 -18.419 -4.485  1.00 0.00 ? 101 ARG A HG3  5  
ATOM 9317  H HD2  . ARG A 1 101 ? -21.441 -20.460 -6.215  1.00 0.00 ? 101 ARG A HD2  5  
ATOM 9318  H HD3  . ARG A 1 101 ? -21.007 -20.684 -4.460  1.00 0.00 ? 101 ARG A HD3  5  
ATOM 9319  H HE   . ARG A 1 101 ? -22.286 -18.114 -4.788  1.00 0.00 ? 101 ARG A HE   5  
ATOM 9320  H HH11 . ARG A 1 101 ? -23.090 -21.595 -4.883  1.00 0.00 ? 101 ARG A HH11 5  
ATOM 9321  H HH12 . ARG A 1 101 ? -24.709 -21.373 -4.307  1.00 0.00 ? 101 ARG A HH12 5  
ATOM 9322  H HH21 . ARG A 1 101 ? -24.461 -17.838 -4.011  1.00 0.00 ? 101 ARG A HH21 5  
ATOM 9323  H HH22 . ARG A 1 101 ? -25.496 -19.213 -3.804  1.00 0.00 ? 101 ARG A HH22 5  
ATOM 9324  N N    . ARG A 1 102 ? -19.577 -15.209 -8.240  1.00 0.00 ? 102 ARG A N    5  
ATOM 9325  C CA   . ARG A 1 102 ? -19.618 -14.343 -9.426  1.00 0.00 ? 102 ARG A CA   5  
ATOM 9326  C C    . ARG A 1 102 ? -18.284 -13.629 -9.634  1.00 0.00 ? 102 ARG A C    5  
ATOM 9327  O O    . ARG A 1 102 ? -17.924 -13.324 -10.769 1.00 0.00 ? 102 ARG A O    5  
ATOM 9328  C CB   . ARG A 1 102 ? -20.778 -13.299 -9.473  1.00 0.00 ? 102 ARG A CB   5  
ATOM 9329  C CG   . ARG A 1 102 ? -22.229 -13.825 -9.674  1.00 0.00 ? 102 ARG A CG   5  
ATOM 9330  C CD   . ARG A 1 102 ? -22.463 -15.345 -9.583  1.00 0.00 ? 102 ARG A CD   5  
ATOM 9331  N NE   . ARG A 1 102 ? -23.949 -15.601 -9.614  1.00 0.00 ? 102 ARG A NE   5  
ATOM 9332  C CZ   . ARG A 1 102 ? -24.592 -16.507 -8.809  1.00 0.00 ? 102 ARG A CZ   5  
ATOM 9333  N NH1  . ARG A 1 102 ? -23.898 -17.308 -7.949  1.00 0.00 ? 102 ARG A NH1  5  
ATOM 9334  N NH2  . ARG A 1 102 ? -25.953 -16.600 -8.863  1.00 0.00 ? 102 ARG A NH2  5  
ATOM 9335  H H    . ARG A 1 102 ? -20.054 -14.828 -7.441  1.00 0.00 ? 102 ARG A H    5  
ATOM 9336  H HA   . ARG A 1 102 ? -19.733 -14.982 -10.278 1.00 0.00 ? 102 ARG A HA   5  
ATOM 9337  H HB2  . ARG A 1 102 ? -20.750 -12.703 -8.534  1.00 0.00 ? 102 ARG A HB2  5  
ATOM 9338  H HB3  . ARG A 1 102 ? -20.616 -12.579 -10.311 1.00 0.00 ? 102 ARG A HB3  5  
ATOM 9339  H HG2  . ARG A 1 102 ? -22.857 -13.332 -8.892  1.00 0.00 ? 102 ARG A HG2  5  
ATOM 9340  H HG3  . ARG A 1 102 ? -22.603 -13.468 -10.658 1.00 0.00 ? 102 ARG A HG3  5  
ATOM 9341  H HD2  . ARG A 1 102 ? -21.999 -15.869 -10.446 1.00 0.00 ? 102 ARG A HD2  5  
ATOM 9342  H HD3  . ARG A 1 102 ? -22.032 -15.733 -8.636  1.00 0.00 ? 102 ARG A HD3  5  
ATOM 9343  H HE   . ARG A 1 102 ? -24.504 -15.041 -10.228 1.00 0.00 ? 102 ARG A HE   5  
ATOM 9344  H HH11 . ARG A 1 102 ? -22.902 -17.239 -7.896  1.00 0.00 ? 102 ARG A HH11 5  
ATOM 9345  H HH12 . ARG A 1 102 ? -24.388 -17.953 -7.362  1.00 0.00 ? 102 ARG A HH12 5  
ATOM 9346  H HH21 . ARG A 1 102 ? -26.469 -16.012 -9.486  1.00 0.00 ? 102 ARG A HH21 5  
ATOM 9347  H HH22 . ARG A 1 102 ? -26.434 -17.250 -8.275  1.00 0.00 ? 102 ARG A HH22 5  
ATOM 9348  N N    . GLN A 1 103 ? -17.494 -13.427 -8.541  1.00 0.00 ? 103 GLN A N    5  
ATOM 9349  C CA   . GLN A 1 103 ? -16.137 -12.897 -8.585  1.00 0.00 ? 103 GLN A CA   5  
ATOM 9350  C C    . GLN A 1 103 ? -15.112 -13.864 -9.140  1.00 0.00 ? 103 GLN A C    5  
ATOM 9351  O O    . GLN A 1 103 ? -14.247 -13.485 -9.918  1.00 0.00 ? 103 GLN A O    5  
ATOM 9352  C CB   . GLN A 1 103 ? -15.651 -12.222 -7.295  1.00 0.00 ? 103 GLN A CB   5  
ATOM 9353  C CG   . GLN A 1 103 ? -16.018 -10.732 -7.365  1.00 0.00 ? 103 GLN A CG   5  
ATOM 9354  C CD   . GLN A 1 103 ? -15.850 -10.056 -6.032  1.00 0.00 ? 103 GLN A CD   5  
ATOM 9355  O OE1  . GLN A 1 103 ? -15.111 -9.098  -5.814  1.00 0.00 ? 103 GLN A OE1  5  
ATOM 9356  N NE2  . GLN A 1 103 ? -16.600 -10.596 -5.062  1.00 0.00 ? 103 GLN A NE2  5  
ATOM 9357  H H    . GLN A 1 103 ? -17.836 -13.676 -7.632  1.00 0.00 ? 103 GLN A H    5  
ATOM 9358  H HA   . GLN A 1 103 ? -16.176 -12.064 -9.237  1.00 0.00 ? 103 GLN A HA   5  
ATOM 9359  H HB2  . GLN A 1 103 ? -16.081 -12.752 -6.423  1.00 0.00 ? 103 GLN A HB2  5  
ATOM 9360  H HB3  . GLN A 1 103 ? -14.544 -12.223 -7.184  1.00 0.00 ? 103 GLN A HB3  5  
ATOM 9361  H HG2  . GLN A 1 103 ? -15.333 -10.234 -8.069  1.00 0.00 ? 103 GLN A HG2  5  
ATOM 9362  H HG3  . GLN A 1 103 ? -17.063 -10.626 -7.715  1.00 0.00 ? 103 GLN A HG3  5  
ATOM 9363  H HE21 . GLN A 1 103 ? -17.282 -11.280 -5.356  1.00 0.00 ? 103 GLN A HE21 5  
ATOM 9364  H HE22 . GLN A 1 103 ? -16.477 -10.228 -4.147  1.00 0.00 ? 103 GLN A HE22 5  
ATOM 9365  N N    . LEU A 1 104 ? -15.195 -15.165 -8.769  1.00 0.00 ? 104 LEU A N    5  
ATOM 9366  C CA   . LEU A 1 104 ? -14.287 -16.196 -9.275  1.00 0.00 ? 104 LEU A CA   5  
ATOM 9367  C C    . LEU A 1 104 ? -14.651 -16.672 -10.680 1.00 0.00 ? 104 LEU A C    5  
ATOM 9368  O O    . LEU A 1 104 ? -13.815 -16.725 -11.575 1.00 0.00 ? 104 LEU A O    5  
ATOM 9369  C CB   . LEU A 1 104 ? -14.112 -17.472 -8.385  1.00 0.00 ? 104 LEU A CB   5  
ATOM 9370  C CG   . LEU A 1 104 ? -14.513 -17.422 -6.903  1.00 0.00 ? 104 LEU A CG   5  
ATOM 9371  C CD1  . LEU A 1 104 ? -14.258 -18.783 -6.228  1.00 0.00 ? 104 LEU A CD1  5  
ATOM 9372  C CD2  . LEU A 1 104 ? -13.823 -16.311 -6.115  1.00 0.00 ? 104 LEU A CD2  5  
ATOM 9373  H H    . LEU A 1 104 ? -15.902 -15.423 -8.106  1.00 0.00 ? 104 LEU A H    5  
ATOM 9374  H HA   . LEU A 1 104 ? -13.292 -15.766 -9.350  1.00 0.00 ? 104 LEU A HA   5  
ATOM 9375  H HB2  . LEU A 1 104 ? -14.742 -18.312 -8.756  1.00 0.00 ? 104 LEU A HB2  5  
ATOM 9376  H HB3  . LEU A 1 104 ? -13.032 -17.743 -8.450  1.00 0.00 ? 104 LEU A HB3  5  
ATOM 9377  H HG   . LEU A 1 104 ? -15.615 -17.261 -6.885  1.00 0.00 ? 104 LEU A HG   5  
ATOM 9378  H HD11 . LEU A 1 104 ? -14.746 -19.608 -6.788  1.00 0.00 ? 104 LEU A HD11 5  
ATOM 9379  H HD12 . LEU A 1 104 ? -13.165 -18.981 -6.172  1.00 0.00 ? 104 LEU A HD12 5  
ATOM 9380  H HD13 . LEU A 1 104 ? -14.661 -18.759 -5.193  1.00 0.00 ? 104 LEU A HD13 5  
ATOM 9381  H HD21 . LEU A 1 104 ? -13.799 -15.352 -6.685  1.00 0.00 ? 104 LEU A HD21 5  
ATOM 9382  H HD22 . LEU A 1 104 ? -14.345 -16.119 -5.157  1.00 0.00 ? 104 LEU A HD22 5  
ATOM 9383  H HD23 . LEU A 1 104 ? -12.767 -16.581 -5.908  1.00 0.00 ? 104 LEU A HD23 5  
ATOM 9384  N N    . GLU A 1 105 ? -15.927 -17.107 -10.874 1.00 0.00 ? 105 GLU A N    5  
ATOM 9385  C CA   . GLU A 1 105 ? -16.440 -17.709 -12.106 1.00 0.00 ? 105 GLU A CA   5  
ATOM 9386  C C    . GLU A 1 105 ? -16.906 -16.792 -13.241 1.00 0.00 ? 105 GLU A C    5  
ATOM 9387  O O    . GLU A 1 105 ? -16.449 -16.908 -14.376 1.00 0.00 ? 105 GLU A O    5  
ATOM 9388  C CB   . GLU A 1 105 ? -17.560 -18.736 -11.773 1.00 0.00 ? 105 GLU A CB   5  
ATOM 9389  C CG   . GLU A 1 105 ? -17.193 -19.674 -10.600 1.00 0.00 ? 105 GLU A CG   5  
ATOM 9390  C CD   . GLU A 1 105 ? -18.242 -20.772 -10.403 1.00 0.00 ? 105 GLU A CD   5  
ATOM 9391  O OE1  . GLU A 1 105 ? -18.033 -21.610 -9.484  1.00 0.00 ? 105 GLU A OE1  5  
ATOM 9392  O OE2  . GLU A 1 105 ? -19.257 -20.794 -11.147 1.00 0.00 ? 105 GLU A OE2  5  
ATOM 9393  H H    . GLU A 1 105 ? -16.595 -17.069 -10.123 1.00 0.00 ? 105 GLU A H    5  
ATOM 9394  H HA   . GLU A 1 105 ? -15.625 -18.274 -12.546 1.00 0.00 ? 105 GLU A HA   5  
ATOM 9395  H HB2  . GLU A 1 105 ? -18.497 -18.208 -11.490 1.00 0.00 ? 105 GLU A HB2  5  
ATOM 9396  H HB3  . GLU A 1 105 ? -17.765 -19.356 -12.676 1.00 0.00 ? 105 GLU A HB3  5  
ATOM 9397  H HG2  . GLU A 1 105 ? -16.204 -20.136 -10.794 1.00 0.00 ? 105 GLU A HG2  5  
ATOM 9398  H HG3  . GLU A 1 105 ? -17.126 -19.095 -9.651  1.00 0.00 ? 105 GLU A HG3  5  
ATOM 9399  N N    . LEU A 1 106 ? -17.888 -15.886 -12.967 1.00 0.00 ? 106 LEU A N    5  
ATOM 9400  C CA   . LEU A 1 106 ? -18.586 -15.007 -13.910 1.00 0.00 ? 106 LEU A CA   5  
ATOM 9401  C C    . LEU A 1 106 ? -17.764 -13.853 -14.466 1.00 0.00 ? 106 LEU A C    5  
ATOM 9402  O O    . LEU A 1 106 ? -17.779 -13.571 -15.661 1.00 0.00 ? 106 LEU A O    5  
ATOM 9403  C CB   . LEU A 1 106 ? -19.831 -14.400 -13.218 1.00 0.00 ? 106 LEU A CB   5  
ATOM 9404  C CG   . LEU A 1 106 ? -21.151 -14.401 -14.027 1.00 0.00 ? 106 LEU A CG   5  
ATOM 9405  C CD1  . LEU A 1 106 ? -21.031 -13.818 -15.447 1.00 0.00 ? 106 LEU A CD1  5  
ATOM 9406  C CD2  . LEU A 1 106 ? -21.769 -15.815 -14.049 1.00 0.00 ? 106 LEU A CD2  5  
ATOM 9407  H H    . LEU A 1 106 ? -18.227 -15.828 -12.030 1.00 0.00 ? 106 LEU A H    5  
ATOM 9408  H HA   . LEU A 1 106 ? -18.900 -15.612 -14.750 1.00 0.00 ? 106 LEU A HA   5  
ATOM 9409  H HB2  . LEU A 1 106 ? -20.040 -15.011 -12.311 1.00 0.00 ? 106 LEU A HB2  5  
ATOM 9410  H HB3  . LEU A 1 106 ? -19.581 -13.375 -12.859 1.00 0.00 ? 106 LEU A HB3  5  
ATOM 9411  H HG   . LEU A 1 106 ? -21.861 -13.748 -13.460 1.00 0.00 ? 106 LEU A HG   5  
ATOM 9412  H HD11 . LEU A 1 106 ? -20.608 -12.791 -15.417 1.00 0.00 ? 106 LEU A HD11 5  
ATOM 9413  H HD12 . LEU A 1 106 ? -20.374 -14.450 -16.080 1.00 0.00 ? 106 LEU A HD12 5  
ATOM 9414  H HD13 . LEU A 1 106 ? -22.030 -13.770 -15.932 1.00 0.00 ? 106 LEU A HD13 5  
ATOM 9415  H HD21 . LEU A 1 106 ? -21.904 -16.198 -13.014 1.00 0.00 ? 106 LEU A HD21 5  
ATOM 9416  H HD22 . LEU A 1 106 ? -22.761 -15.801 -14.548 1.00 0.00 ? 106 LEU A HD22 5  
ATOM 9417  H HD23 . LEU A 1 106 ? -21.110 -16.520 -14.599 1.00 0.00 ? 106 LEU A HD23 5  
ATOM 9418  N N    . GLU A 1 107 ? -16.971 -13.178 -13.574 1.00 0.00 ? 107 GLU A N    5  
ATOM 9419  C CA   . GLU A 1 107 ? -16.057 -12.043 -13.799 1.00 0.00 ? 107 GLU A CA   5  
ATOM 9420  C C    . GLU A 1 107 ? -14.867 -12.337 -14.737 1.00 0.00 ? 107 GLU A C    5  
ATOM 9421  O O    . GLU A 1 107 ? -13.972 -11.530 -14.968 1.00 0.00 ? 107 GLU A O    5  
ATOM 9422  C CB   . GLU A 1 107 ? -15.608 -11.500 -12.409 1.00 0.00 ? 107 GLU A CB   5  
ATOM 9423  C CG   . GLU A 1 107 ? -14.916 -10.125 -12.403 1.00 0.00 ? 107 GLU A CG   5  
ATOM 9424  C CD   . GLU A 1 107 ? -14.750 -9.641  -10.965 1.00 0.00 ? 107 GLU A CD   5  
ATOM 9425  O OE1  . GLU A 1 107 ? -15.369 -8.604  -10.607 1.00 0.00 ? 107 GLU A OE1  5  
ATOM 9426  O OE2  . GLU A 1 107 ? -13.996 -10.305 -10.205 1.00 0.00 ? 107 GLU A OE2  5  
ATOM 9427  H H    . GLU A 1 107 ? -17.014 -13.448 -12.608 1.00 0.00 ? 107 GLU A H    5  
ATOM 9428  H HA   . GLU A 1 107 ? -16.627 -11.263 -14.279 1.00 0.00 ? 107 GLU A HA   5  
ATOM 9429  H HB2  . GLU A 1 107 ? -16.525 -11.405 -11.779 1.00 0.00 ? 107 GLU A HB2  5  
ATOM 9430  H HB3  . GLU A 1 107 ? -14.954 -12.245 -11.906 1.00 0.00 ? 107 GLU A HB3  5  
ATOM 9431  H HG2  . GLU A 1 107 ? -13.909 -10.210 -12.861 1.00 0.00 ? 107 GLU A HG2  5  
ATOM 9432  H HG3  . GLU A 1 107 ? -15.523 -9.396  -12.981 1.00 0.00 ? 107 GLU A HG3  5  
ATOM 9433  N N    . LYS A 1 108 ? -14.916 -13.544 -15.333 1.00 0.00 ? 108 LYS A N    5  
ATOM 9434  C CA   . LYS A 1 108 ? -14.015 -14.119 -16.318 1.00 0.00 ? 108 LYS A CA   5  
ATOM 9435  C C    . LYS A 1 108 ? -14.657 -14.233 -17.702 1.00 0.00 ? 108 LYS A C    5  
ATOM 9436  O O    . LYS A 1 108 ? -13.972 -14.458 -18.693 1.00 0.00 ? 108 LYS A O    5  
ATOM 9437  C CB   . LYS A 1 108 ? -13.575 -15.553 -15.911 1.00 0.00 ? 108 LYS A CB   5  
ATOM 9438  C CG   . LYS A 1 108 ? -12.830 -15.633 -14.569 1.00 0.00 ? 108 LYS A CG   5  
ATOM 9439  C CD   . LYS A 1 108 ? -12.177 -17.005 -14.324 1.00 0.00 ? 108 LYS A CD   5  
ATOM 9440  C CE   . LYS A 1 108 ? -10.977 -17.302 -15.237 1.00 0.00 ? 108 LYS A CE   5  
ATOM 9441  N NZ   . LYS A 1 108 ? -10.343 -18.591 -14.874 1.00 0.00 ? 108 LYS A NZ   5  
ATOM 9442  H H    . LYS A 1 108 ? -15.720 -14.076 -15.024 1.00 0.00 ? 108 LYS A H    5  
ATOM 9443  H HA   . LYS A 1 108 ? -13.130 -13.501 -16.423 1.00 0.00 ? 108 LYS A HA   5  
ATOM 9444  H HB2  . LYS A 1 108 ? -14.464 -16.222 -15.836 1.00 0.00 ? 108 LYS A HB2  5  
ATOM 9445  H HB3  . LYS A 1 108 ? -12.912 -15.964 -16.702 1.00 0.00 ? 108 LYS A HB3  5  
ATOM 9446  H HG2  . LYS A 1 108 ? -12.051 -14.847 -14.511 1.00 0.00 ? 108 LYS A HG2  5  
ATOM 9447  H HG3  . LYS A 1 108 ? -13.560 -15.435 -13.750 1.00 0.00 ? 108 LYS A HG3  5  
ATOM 9448  H HD2  . LYS A 1 108 ? -11.830 -17.028 -13.265 1.00 0.00 ? 108 LYS A HD2  5  
ATOM 9449  H HD3  . LYS A 1 108 ? -12.953 -17.795 -14.436 1.00 0.00 ? 108 LYS A HD3  5  
ATOM 9450  H HE2  . LYS A 1 108 ? -11.287 -17.372 -16.301 1.00 0.00 ? 108 LYS A HE2  5  
ATOM 9451  H HE3  . LYS A 1 108 ? -10.204 -16.509 -15.138 1.00 0.00 ? 108 LYS A HE3  5  
ATOM 9452  H HZ1  . LYS A 1 108 ? -11.040 -19.357 -14.962 1.00 0.00 ? 108 LYS A HZ1  5  
ATOM 9453  H HZ2  . LYS A 1 108 ? -9.543  -18.775 -15.514 1.00 0.00 ? 108 LYS A HZ2  5  
ATOM 9454  H HZ3  . LYS A 1 108 ? -10.000 -18.543 -13.894 1.00 0.00 ? 108 LYS A HZ3  5  
ATOM 9455  N N    . LYS A 1 109 ? -16.008 -14.129 -17.798 1.00 0.00 ? 109 LYS A N    5  
ATOM 9456  C CA   . LYS A 1 109 ? -16.812 -14.371 -18.993 1.00 0.00 ? 109 LYS A CA   5  
ATOM 9457  C C    . LYS A 1 109 ? -17.263 -13.117 -19.735 1.00 0.00 ? 109 LYS A C    5  
ATOM 9458  O O    . LYS A 1 109 ? -18.023 -13.185 -20.701 1.00 0.00 ? 109 LYS A O    5  
ATOM 9459  C CB   . LYS A 1 109 ? -18.061 -15.204 -18.614 1.00 0.00 ? 109 LYS A CB   5  
ATOM 9460  C CG   . LYS A 1 109 ? -17.700 -16.501 -17.876 1.00 0.00 ? 109 LYS A CG   5  
ATOM 9461  C CD   . LYS A 1 109 ? -18.921 -17.405 -17.720 1.00 0.00 ? 109 LYS A CD   5  
ATOM 9462  C CE   . LYS A 1 109 ? -18.660 -18.616 -16.812 1.00 0.00 ? 109 LYS A CE   5  
ATOM 9463  N NZ   . LYS A 1 109 ? -19.879 -19.447 -16.675 1.00 0.00 ? 109 LYS A NZ   5  
ATOM 9464  H H    . LYS A 1 109 ? -16.539 -13.960 -16.961 1.00 0.00 ? 109 LYS A H    5  
ATOM 9465  H HA   . LYS A 1 109 ? -16.274 -14.994 -19.695 1.00 0.00 ? 109 LYS A HA   5  
ATOM 9466  H HB2  . LYS A 1 109 ? -18.738 -14.611 -17.956 1.00 0.00 ? 109 LYS A HB2  5  
ATOM 9467  H HB3  . LYS A 1 109 ? -18.626 -15.483 -19.535 1.00 0.00 ? 109 LYS A HB3  5  
ATOM 9468  H HG2  . LYS A 1 109 ? -16.909 -17.045 -18.438 1.00 0.00 ? 109 LYS A HG2  5  
ATOM 9469  H HG3  . LYS A 1 109 ? -17.297 -16.260 -16.866 1.00 0.00 ? 109 LYS A HG3  5  
ATOM 9470  H HD2  . LYS A 1 109 ? -19.761 -16.802 -17.310 1.00 0.00 ? 109 LYS A HD2  5  
ATOM 9471  H HD3  . LYS A 1 109 ? -19.207 -17.736 -18.744 1.00 0.00 ? 109 LYS A HD3  5  
ATOM 9472  H HE2  . LYS A 1 109 ? -17.857 -19.258 -17.230 1.00 0.00 ? 109 LYS A HE2  5  
ATOM 9473  H HE3  . LYS A 1 109 ? -18.366 -18.285 -15.794 1.00 0.00 ? 109 LYS A HE3  5  
ATOM 9474  H HZ1  . LYS A 1 109 ? -20.643 -18.873 -16.265 1.00 0.00 ? 109 LYS A HZ1  5  
ATOM 9475  H HZ2  . LYS A 1 109 ? -20.169 -19.795 -17.610 1.00 0.00 ? 109 LYS A HZ2  5  
ATOM 9476  H HZ3  . LYS A 1 109 ? -19.678 -20.254 -16.051 1.00 0.00 ? 109 LYS A HZ3  5  
ATOM 9477  N N    . LYS A 1 110 ? -16.815 -11.910 -19.308 1.00 0.00 ? 110 LYS A N    5  
ATOM 9478  C CA   . LYS A 1 110 ? -17.212 -10.599 -19.827 1.00 0.00 ? 110 LYS A CA   5  
ATOM 9479  C C    . LYS A 1 110 ? -16.591 -10.168 -21.166 1.00 0.00 ? 110 LYS A C    5  
ATOM 9480  O O    . LYS A 1 110 ? -16.008 -9.093  -21.297 1.00 0.00 ? 110 LYS A O    5  
ATOM 9481  C CB   . LYS A 1 110 ? -17.001 -9.527  -18.723 1.00 0.00 ? 110 LYS A CB   5  
ATOM 9482  C CG   . LYS A 1 110 ? -17.909 -9.767  -17.503 1.00 0.00 ? 110 LYS A CG   5  
ATOM 9483  C CD   . LYS A 1 110 ? -17.721 -8.722  -16.390 1.00 0.00 ? 110 LYS A CD   5  
ATOM 9484  C CE   . LYS A 1 110 ? -18.844 -8.742  -15.336 1.00 0.00 ? 110 LYS A CE   5  
ATOM 9485  N NZ   . LYS A 1 110 ? -18.952 -10.065 -14.675 1.00 0.00 ? 110 LYS A NZ   5  
ATOM 9486  H H    . LYS A 1 110 ? -16.193 -11.889 -18.532 1.00 0.00 ? 110 LYS A H    5  
ATOM 9487  H HA   . LYS A 1 110 ? -18.281 -10.624 -20.005 1.00 0.00 ? 110 LYS A HA   5  
ATOM 9488  H HB2  . LYS A 1 110 ? -15.936 -9.527  -18.404 1.00 0.00 ? 110 LYS A HB2  5  
ATOM 9489  H HB3  . LYS A 1 110 ? -17.237 -8.511  -19.114 1.00 0.00 ? 110 LYS A HB3  5  
ATOM 9490  H HG2  . LYS A 1 110 ? -18.967 -9.729  -17.848 1.00 0.00 ? 110 LYS A HG2  5  
ATOM 9491  H HG3  . LYS A 1 110 ? -17.734 -10.780 -17.075 1.00 0.00 ? 110 LYS A HG3  5  
ATOM 9492  H HD2  . LYS A 1 110 ? -16.736 -8.898  -15.900 1.00 0.00 ? 110 LYS A HD2  5  
ATOM 9493  H HD3  . LYS A 1 110 ? -17.693 -7.710  -16.857 1.00 0.00 ? 110 LYS A HD3  5  
ATOM 9494  H HE2  . LYS A 1 110 ? -18.657 -7.987  -14.543 1.00 0.00 ? 110 LYS A HE2  5  
ATOM 9495  H HE3  . LYS A 1 110 ? -19.825 -8.530  -15.812 1.00 0.00 ? 110 LYS A HE3  5  
ATOM 9496  H HZ1  . LYS A 1 110 ? -19.139 -10.794 -15.392 1.00 0.00 ? 110 LYS A HZ1  5  
ATOM 9497  H HZ2  . LYS A 1 110 ? -18.060 -10.281 -14.186 1.00 0.00 ? 110 LYS A HZ2  5  
ATOM 9498  H HZ3  . LYS A 1 110 ? -19.731 -10.045 -13.986 1.00 0.00 ? 110 LYS A HZ3  5  
ATOM 9499  N N    . LYS A 1 111 ? -16.752 -11.027 -22.211 1.00 0.00 ? 111 LYS A N    5  
ATOM 9500  C CA   . LYS A 1 111 ? -16.348 -10.876 -23.611 1.00 0.00 ? 111 LYS A CA   5  
ATOM 9501  C C    . LYS A 1 111 ? -14.848 -10.756 -23.882 1.00 0.00 ? 111 LYS A C    5  
ATOM 9502  O O    . LYS A 1 111 ? -14.350 -11.207 -24.914 1.00 0.00 ? 111 LYS A O    5  
ATOM 9503  C CB   . LYS A 1 111 ? -17.166 -9.767  -24.334 1.00 0.00 ? 111 LYS A CB   5  
ATOM 9504  C CG   . LYS A 1 111 ? -17.154 -9.855  -25.871 1.00 0.00 ? 111 LYS A CG   5  
ATOM 9505  C CD   . LYS A 1 111 ? -18.114 -8.855  -26.534 1.00 0.00 ? 111 LYS A CD   5  
ATOM 9506  C CE   . LYS A 1 111 ? -18.151 -9.000  -28.063 1.00 0.00 ? 111 LYS A CE   5  
ATOM 9507  N NZ   . LYS A 1 111 ? -19.109 -8.043  -28.665 1.00 0.00 ? 111 LYS A NZ   5  
ATOM 9508  H H    . LYS A 1 111 ? -17.245 -11.876 -21.993 1.00 0.00 ? 111 LYS A H    5  
ATOM 9509  H HA   . LYS A 1 111 ? -16.637 -11.806 -24.079 1.00 0.00 ? 111 LYS A HA   5  
ATOM 9510  H HB2  . LYS A 1 111 ? -18.227 -9.873  -24.009 1.00 0.00 ? 111 LYS A HB2  5  
ATOM 9511  H HB3  . LYS A 1 111 ? -16.831 -8.759  -24.006 1.00 0.00 ? 111 LYS A HB3  5  
ATOM 9512  H HG2  . LYS A 1 111 ? -16.126 -9.676  -26.256 1.00 0.00 ? 111 LYS A HG2  5  
ATOM 9513  H HG3  . LYS A 1 111 ? -17.452 -10.885 -26.174 1.00 0.00 ? 111 LYS A HG3  5  
ATOM 9514  H HD2  . LYS A 1 111 ? -19.135 -9.021  -26.121 1.00 0.00 ? 111 LYS A HD2  5  
ATOM 9515  H HD3  . LYS A 1 111 ? -17.803 -7.821  -26.263 1.00 0.00 ? 111 LYS A HD3  5  
ATOM 9516  H HE2  . LYS A 1 111 ? -17.150 -8.798  -28.503 1.00 0.00 ? 111 LYS A HE2  5  
ATOM 9517  H HE3  . LYS A 1 111 ? -18.471 -10.023 -28.353 1.00 0.00 ? 111 LYS A HE3  5  
ATOM 9518  H HZ1  . LYS A 1 111 ? -18.824 -7.071  -28.427 1.00 0.00 ? 111 LYS A HZ1  5  
ATOM 9519  H HZ2  . LYS A 1 111 ? -19.114 -8.161  -29.698 1.00 0.00 ? 111 LYS A HZ2  5  
ATOM 9520  H HZ3  . LYS A 1 111 ? -20.061 -8.227  -28.290 1.00 0.00 ? 111 LYS A HZ3  5  
ATOM 9521  N N    . GLY A 1 1   ? 21.024  21.052  13.919  1.00 0.00 ? 1   GLY A N    6  
ATOM 9522  C CA   . GLY A 1 1   ? 19.967  20.136  14.296  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9523  C C    . GLY A 1 1   ? 18.951  20.867  15.115  1.00 0.00 ? 1   GLY A C    6  
ATOM 9524  O O    . GLY A 1 1   ? 18.070  20.283  15.743  1.00 0.00 ? 1   GLY A O    6  
ATOM 9525  H H    . GLY A 1 1   ? 21.879  20.682  13.554  1.00 0.00 ? 1   GLY A H    6  
ATOM 9526  H HA2  . GLY A 1 1   ? 19.488  19.782  13.397  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9527  H HA3  . GLY A 1 1   ? 20.395  19.357  14.910  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9528  N N    . GLN A 1 2   ? 19.042  22.210  15.126  1.00 0.00 ? 2   GLN A N    6  
ATOM 9529  C CA   . GLN A 1 2   ? 18.169  23.108  15.862  1.00 0.00 ? 2   GLN A CA   6  
ATOM 9530  C C    . GLN A 1 2   ? 17.478  24.050  14.909  1.00 0.00 ? 2   GLN A C    6  
ATOM 9531  O O    . GLN A 1 2   ? 17.959  24.317  13.811  1.00 0.00 ? 2   GLN A O    6  
ATOM 9532  C CB   . GLN A 1 2   ? 18.933  23.901  16.966  1.00 0.00 ? 2   GLN A CB   6  
ATOM 9533  C CG   . GLN A 1 2   ? 18.442  23.577  18.400  1.00 0.00 ? 2   GLN A CG   6  
ATOM 9534  C CD   . GLN A 1 2   ? 17.074  24.200  18.699  1.00 0.00 ? 2   GLN A CD   6  
ATOM 9535  O OE1  . GLN A 1 2   ? 16.073  23.941  18.025  1.00 0.00 ? 2   GLN A OE1  6  
ATOM 9536  N NE2  . GLN A 1 2   ? 17.005  25.048  19.754  1.00 0.00 ? 2   GLN A NE2  6  
ATOM 9537  H H    . GLN A 1 2   ? 19.768  22.617  14.573  1.00 0.00 ? 2   GLN A H    6  
ATOM 9538  H HA   . GLN A 1 2   ? 17.380  22.545  16.346  1.00 0.00 ? 2   GLN A HA   6  
ATOM 9539  H HB2  . GLN A 1 2   ? 20.003  23.596  16.908  1.00 0.00 ? 2   GLN A HB2  6  
ATOM 9540  H HB3  . GLN A 1 2   ? 18.915  25.010  16.814  1.00 0.00 ? 2   GLN A HB3  6  
ATOM 9541  H HG2  . GLN A 1 2   ? 18.366  22.476  18.532  1.00 0.00 ? 2   GLN A HG2  6  
ATOM 9542  H HG3  . GLN A 1 2   ? 19.190  23.956  19.130  1.00 0.00 ? 2   GLN A HG3  6  
ATOM 9543  H HE21 . GLN A 1 2   ? 17.811  25.247  20.304  1.00 0.00 ? 2   GLN A HE21 6  
ATOM 9544  H HE22 . GLN A 1 2   ? 16.110  25.430  19.974  1.00 0.00 ? 2   GLN A HE22 6  
ATOM 9545  N N    . ARG A 1 3   ? 16.322  24.591  15.381  1.00 0.00 ? 3   ARG A N    6  
ATOM 9546  C CA   . ARG A 1 3   ? 15.469  25.585  14.734  1.00 0.00 ? 3   ARG A CA   6  
ATOM 9547  C C    . ARG A 1 3   ? 14.544  25.008  13.671  1.00 0.00 ? 3   ARG A C    6  
ATOM 9548  O O    . ARG A 1 3   ? 14.099  25.677  12.746  1.00 0.00 ? 3   ARG A O    6  
ATOM 9549  C CB   . ARG A 1 3   ? 16.294  26.826  14.301  1.00 0.00 ? 3   ARG A CB   6  
ATOM 9550  C CG   . ARG A 1 3   ? 15.584  28.172  14.418  1.00 0.00 ? 3   ARG A CG   6  
ATOM 9551  C CD   . ARG A 1 3   ? 16.600  29.320  14.346  1.00 0.00 ? 3   ARG A CD   6  
ATOM 9552  N NE   . ARG A 1 3   ? 15.878  30.616  14.595  1.00 0.00 ? 3   ARG A NE   6  
ATOM 9553  C CZ   . ARG A 1 3   ? 16.519  31.822  14.703  1.00 0.00 ? 3   ARG A CZ   6  
ATOM 9554  N NH1  . ARG A 1 3   ? 17.877  31.908  14.590  1.00 0.00 ? 3   ARG A NH1  6  
ATOM 9555  N NH2  . ARG A 1 3   ? 15.787  32.952  14.930  1.00 0.00 ? 3   ARG A NH2  6  
ATOM 9556  H H    . ARG A 1 3   ? 16.051  24.326  16.322  1.00 0.00 ? 3   ARG A H    6  
ATOM 9557  H HA   . ARG A 1 3   ? 14.787  25.924  15.504  1.00 0.00 ? 3   ARG A HA   6  
ATOM 9558  H HB2  . ARG A 1 3   ? 17.114  26.924  15.049  1.00 0.00 ? 3   ARG A HB2  6  
ATOM 9559  H HB3  . ARG A 1 3   ? 16.758  26.686  13.304  1.00 0.00 ? 3   ARG A HB3  6  
ATOM 9560  H HG2  . ARG A 1 3   ? 14.789  28.274  13.650  1.00 0.00 ? 3   ARG A HG2  6  
ATOM 9561  H HG3  . ARG A 1 3   ? 15.133  28.177  15.431  1.00 0.00 ? 3   ARG A HG3  6  
ATOM 9562  H HD2  . ARG A 1 3   ? 17.375  29.155  15.136  1.00 0.00 ? 3   ARG A HD2  6  
ATOM 9563  H HD3  . ARG A 1 3   ? 17.082  29.348  13.346  1.00 0.00 ? 3   ARG A HD3  6  
ATOM 9564  H HE   . ARG A 1 3   ? 14.882  30.595  14.685  1.00 0.00 ? 3   ARG A HE   6  
ATOM 9565  H HH11 . ARG A 1 3   ? 18.416  31.082  14.425  1.00 0.00 ? 3   ARG A HH11 6  
ATOM 9566  H HH12 . ARG A 1 3   ? 18.330  32.794  14.671  1.00 0.00 ? 3   ARG A HH12 6  
ATOM 9567  H HH21 . ARG A 1 3   ? 14.793  32.895  15.016  1.00 0.00 ? 3   ARG A HH21 6  
ATOM 9568  H HH22 . ARG A 1 3   ? 16.248  33.837  15.012  1.00 0.00 ? 3   ARG A HH22 6  
ATOM 9569  N N    . GLN A 1 4   ? 14.234  23.701  13.858  1.00 0.00 ? 4   GLN A N    6  
ATOM 9570  C CA   . GLN A 1 4   ? 13.373  22.845  13.060  1.00 0.00 ? 4   GLN A CA   6  
ATOM 9571  C C    . GLN A 1 4   ? 11.947  22.841  13.538  1.00 0.00 ? 4   GLN A C    6  
ATOM 9572  O O    . GLN A 1 4   ? 11.045  22.644  12.728  1.00 0.00 ? 4   GLN A O    6  
ATOM 9573  C CB   . GLN A 1 4   ? 13.831  21.349  13.068  1.00 0.00 ? 4   GLN A CB   6  
ATOM 9574  C CG   . GLN A 1 4   ? 14.182  20.754  14.456  1.00 0.00 ? 4   GLN A CG   6  
ATOM 9575  C CD   . GLN A 1 4   ? 14.642  19.298  14.333  1.00 0.00 ? 4   GLN A CD   6  
ATOM 9576  O OE1  . GLN A 1 4   ? 14.018  18.455  13.685  1.00 0.00 ? 4   GLN A OE1  6  
ATOM 9577  N NE2  . GLN A 1 4   ? 15.772  18.969  15.005  1.00 0.00 ? 4   GLN A NE2  6  
ATOM 9578  H H    . GLN A 1 4   ? 14.678  23.261  14.627  1.00 0.00 ? 4   GLN A H    6  
ATOM 9579  H HA   . GLN A 1 4   ? 13.354  23.198  12.036  1.00 0.00 ? 4   GLN A HA   6  
ATOM 9580  H HB2  . GLN A 1 4   ? 13.027  20.704  12.627  1.00 0.00 ? 4   GLN A HB2  6  
ATOM 9581  H HB3  . GLN A 1 4   ? 14.721  21.273  12.410  1.00 0.00 ? 4   GLN A HB3  6  
ATOM 9582  H HG2  . GLN A 1 4   ? 14.987  21.337  14.945  1.00 0.00 ? 4   GLN A HG2  6  
ATOM 9583  H HG3  . GLN A 1 4   ? 13.289  20.752  15.114  1.00 0.00 ? 4   GLN A HG3  6  
ATOM 9584  H HE21 . GLN A 1 4   ? 16.398  19.669  15.380  1.00 0.00 ? 4   GLN A HE21 6  
ATOM 9585  H HE22 . GLN A 1 4   ? 16.060  18.018  14.970  1.00 0.00 ? 4   GLN A HE22 6  
ATOM 9586  N N    . LEU A 1 5   ? 11.717  22.987  14.882  1.00 0.00 ? 5   LEU A N    6  
ATOM 9587  C CA   . LEU A 1 5   ? 10.448  22.915  15.618  1.00 0.00 ? 5   LEU A CA   6  
ATOM 9588  C C    . LEU A 1 5   ? 9.563   21.699  15.298  1.00 0.00 ? 5   LEU A C    6  
ATOM 9589  O O    . LEU A 1 5   ? 8.369   21.823  15.044  1.00 0.00 ? 5   LEU A O    6  
ATOM 9590  C CB   . LEU A 1 5   ? 9.670   24.270  15.715  1.00 0.00 ? 5   LEU A CB   6  
ATOM 9591  C CG   . LEU A 1 5   ? 9.443   25.064  14.407  1.00 0.00 ? 5   LEU A CG   6  
ATOM 9592  C CD1  . LEU A 1 5   ? 8.096   25.799  14.455  1.00 0.00 ? 5   LEU A CD1  6  
ATOM 9593  C CD2  . LEU A 1 5   ? 10.582  26.068  14.127  1.00 0.00 ? 5   LEU A CD2  6  
ATOM 9594  H H    . LEU A 1 5   ? 12.505  23.150  15.464  1.00 0.00 ? 5   LEU A H    6  
ATOM 9595  H HA   . LEU A 1 5   ? 10.739  22.725  16.640  1.00 0.00 ? 5   LEU A HA   6  
ATOM 9596  H HB2  . LEU A 1 5   ? 8.682   24.098  16.198  1.00 0.00 ? 5   LEU A HB2  6  
ATOM 9597  H HB3  . LEU A 1 5   ? 10.228  24.941  16.406  1.00 0.00 ? 5   LEU A HB3  6  
ATOM 9598  H HG   . LEU A 1 5   ? 9.384   24.338  13.564  1.00 0.00 ? 5   LEU A HG   6  
ATOM 9599  H HD11 . LEU A 1 5   ? 7.273   25.072  14.614  1.00 0.00 ? 5   LEU A HD11 6  
ATOM 9600  H HD12 . LEU A 1 5   ? 8.084   26.540  15.281  1.00 0.00 ? 5   LEU A HD12 6  
ATOM 9601  H HD13 . LEU A 1 5   ? 7.914   26.335  13.499  1.00 0.00 ? 5   LEU A HD13 6  
ATOM 9602  H HD21 . LEU A 1 5   ? 11.572  25.570  14.076  1.00 0.00 ? 5   LEU A HD21 6  
ATOM 9603  H HD22 . LEU A 1 5   ? 10.406  26.587  13.162  1.00 0.00 ? 5   LEU A HD22 6  
ATOM 9604  H HD23 . LEU A 1 5   ? 10.632  26.827  14.936  1.00 0.00 ? 5   LEU A HD23 6  
ATOM 9605  N N    . LEU A 1 6   ? 10.177  20.473  15.291  1.00 0.00 ? 6   LEU A N    6  
ATOM 9606  C CA   . LEU A 1 6   ? 9.530   19.205  14.952  1.00 0.00 ? 6   LEU A CA   6  
ATOM 9607  C C    . LEU A 1 6   ? 8.604   18.659  16.053  1.00 0.00 ? 6   LEU A C    6  
ATOM 9608  O O    . LEU A 1 6   ? 8.771   18.920  17.242  1.00 0.00 ? 6   LEU A O    6  
ATOM 9609  C CB   . LEU A 1 6   ? 10.511  18.082  14.489  1.00 0.00 ? 6   LEU A CB   6  
ATOM 9610  C CG   . LEU A 1 6   ? 10.432  17.699  12.983  1.00 0.00 ? 6   LEU A CG   6  
ATOM 9611  C CD1  . LEU A 1 6   ? 9.085   17.075  12.584  1.00 0.00 ? 6   LEU A CD1  6  
ATOM 9612  C CD2  . LEU A 1 6   ? 10.785  18.855  12.039  1.00 0.00 ? 6   LEU A CD2  6  
ATOM 9613  H H    . LEU A 1 6   ? 11.151  20.419  15.493  1.00 0.00 ? 6   LEU A H    6  
ATOM 9614  H HA   . LEU A 1 6   ? 8.954   19.414  14.068  1.00 0.00 ? 6   LEU A HA   6  
ATOM 9615  H HB2  . LEU A 1 6   ? 11.550  18.394  14.721  1.00 0.00 ? 6   LEU A HB2  6  
ATOM 9616  H HB3  . LEU A 1 6   ? 10.323  17.128  15.030  1.00 0.00 ? 6   LEU A HB3  6  
ATOM 9617  H HG   . LEU A 1 6   ? 11.206  16.907  12.827  1.00 0.00 ? 6   LEU A HG   6  
ATOM 9618  H HD11 . LEU A 1 6   ? 8.831   16.230  13.254  1.00 0.00 ? 6   LEU A HD11 6  
ATOM 9619  H HD12 . LEU A 1 6   ? 8.275   17.832  12.618  1.00 0.00 ? 6   LEU A HD12 6  
ATOM 9620  H HD13 . LEU A 1 6   ? 9.143   16.692  11.542  1.00 0.00 ? 6   LEU A HD13 6  
ATOM 9621  H HD21 . LEU A 1 6   ? 11.822  19.189  12.233  1.00 0.00 ? 6   LEU A HD21 6  
ATOM 9622  H HD22 . LEU A 1 6   ? 10.723  18.513  10.982  1.00 0.00 ? 6   LEU A HD22 6  
ATOM 9623  H HD23 . LEU A 1 6   ? 10.096  19.717  12.164  1.00 0.00 ? 6   LEU A HD23 6  
ATOM 9624  N N    . LEU A 1 7   ? 7.602   17.844  15.646  1.00 0.00 ? 7   LEU A N    6  
ATOM 9625  C CA   . LEU A 1 7   ? 6.608   17.244  16.538  1.00 0.00 ? 7   LEU A CA   6  
ATOM 9626  C C    . LEU A 1 7   ? 6.559   15.752  16.360  1.00 0.00 ? 7   LEU A C    6  
ATOM 9627  O O    . LEU A 1 7   ? 5.593   15.101  16.752  1.00 0.00 ? 7   LEU A O    6  
ATOM 9628  C CB   . LEU A 1 7   ? 5.187   17.857  16.337  1.00 0.00 ? 7   LEU A CB   6  
ATOM 9629  C CG   . LEU A 1 7   ? 5.078   19.374  16.618  1.00 0.00 ? 7   LEU A CG   6  
ATOM 9630  C CD1  . LEU A 1 7   ? 3.677   19.890  16.243  1.00 0.00 ? 7   LEU A CD1  6  
ATOM 9631  C CD2  . LEU A 1 7   ? 5.401   19.726  18.079  1.00 0.00 ? 7   LEU A CD2  6  
ATOM 9632  H H    . LEU A 1 7   ? 7.522   17.647  14.673  1.00 0.00 ? 7   LEU A H    6  
ATOM 9633  H HA   . LEU A 1 7   ? 6.920   17.316  17.573  1.00 0.00 ? 7   LEU A HA   6  
ATOM 9634  H HB2  . LEU A 1 7   ? 4.858   17.686  15.287  1.00 0.00 ? 7   LEU A HB2  6  
ATOM 9635  H HB3  . LEU A 1 7   ? 4.452   17.352  17.006  1.00 0.00 ? 7   LEU A HB3  6  
ATOM 9636  H HG   . LEU A 1 7   ? 5.811   19.904  15.965  1.00 0.00 ? 7   LEU A HG   6  
ATOM 9637  H HD11 . LEU A 1 7   ? 3.456   19.651  15.181  1.00 0.00 ? 7   LEU A HD11 6  
ATOM 9638  H HD12 . LEU A 1 7   ? 2.900   19.419  16.884  1.00 0.00 ? 7   LEU A HD12 6  
ATOM 9639  H HD13 . LEU A 1 7   ? 3.627   20.991  16.376  1.00 0.00 ? 7   LEU A HD13 6  
ATOM 9640  H HD21 . LEU A 1 7   ? 4.716   19.189  18.768  1.00 0.00 ? 7   LEU A HD21 6  
ATOM 9641  H HD22 . LEU A 1 7   ? 6.447   19.456  18.333  1.00 0.00 ? 7   LEU A HD22 6  
ATOM 9642  H HD23 . LEU A 1 7   ? 5.281   20.818  18.242  1.00 0.00 ? 7   LEU A HD23 6  
ATOM 9643  N N    . ALA A 1 8   ? 7.658   15.191  15.786  1.00 0.00 ? 8   ALA A N    6  
ATOM 9644  C CA   . ALA A 1 8   ? 7.929   13.772  15.602  1.00 0.00 ? 8   ALA A CA   6  
ATOM 9645  C C    . ALA A 1 8   ? 7.011   13.062  14.600  1.00 0.00 ? 8   ALA A C    6  
ATOM 9646  O O    . ALA A 1 8   ? 6.538   11.947  14.804  1.00 0.00 ? 8   ALA A O    6  
ATOM 9647  C CB   . ALA A 1 8   ? 7.970   13.113  16.998  1.00 0.00 ? 8   ALA A CB   6  
ATOM 9648  H H    . ALA A 1 8   ? 8.397   15.802  15.533  1.00 0.00 ? 8   ALA A H    6  
ATOM 9649  H HA   . ALA A 1 8   ? 8.926   13.712  15.189  1.00 0.00 ? 8   ALA A HA   6  
ATOM 9650  H HB1  . ALA A 1 8   ? 6.946   13.030  17.420  1.00 0.00 ? 8   ALA A HB1  6  
ATOM 9651  H HB2  . ALA A 1 8   ? 8.542   13.787  17.678  1.00 0.00 ? 8   ALA A HB2  6  
ATOM 9652  H HB3  . ALA A 1 8   ? 8.442   12.111  16.968  1.00 0.00 ? 8   ALA A HB3  6  
ATOM 9653  N N    . SER A 1 9   ? 6.717   13.760  13.473  1.00 0.00 ? 9   SER A N    6  
ATOM 9654  C CA   . SER A 1 9   ? 5.787   13.388  12.416  1.00 0.00 ? 9   SER A CA   6  
ATOM 9655  C C    . SER A 1 9   ? 6.277   12.345  11.411  1.00 0.00 ? 9   SER A C    6  
ATOM 9656  O O    . SER A 1 9   ? 6.832   12.674  10.363  1.00 0.00 ? 9   SER A O    6  
ATOM 9657  C CB   . SER A 1 9   ? 5.337   14.673  11.665  1.00 0.00 ? 9   SER A CB   6  
ATOM 9658  O OG   . SER A 1 9   ? 6.451   15.345  11.077  1.00 0.00 ? 9   SER A OG   6  
ATOM 9659  H H    . SER A 1 9   ? 7.109   14.669  13.345  1.00 0.00 ? 9   SER A H    6  
ATOM 9660  H HA   . SER A 1 9   ? 4.901   12.976  12.881  1.00 0.00 ? 9   SER A HA   6  
ATOM 9661  H HB2  . SER A 1 9   ? 4.573   14.448  10.888  1.00 0.00 ? 9   SER A HB2  6  
ATOM 9662  H HB3  . SER A 1 9   ? 4.875   15.368  12.403  1.00 0.00 ? 9   SER A HB3  6  
ATOM 9663  H HG   . SER A 1 9   ? 6.848   14.674  10.493  1.00 0.00 ? 9   SER A HG   6  
ATOM 9664  N N    . GLU A 1 10  ? 6.018   11.061  11.722  1.00 0.00 ? 10  GLU A N    6  
ATOM 9665  C CA   . GLU A 1 10  ? 6.277   9.902   10.914  1.00 0.00 ? 10  GLU A CA   6  
ATOM 9666  C C    . GLU A 1 10  ? 5.214   8.956   11.390  1.00 0.00 ? 10  GLU A C    6  
ATOM 9667  O O    . GLU A 1 10  ? 4.435   9.339   12.260  1.00 0.00 ? 10  GLU A O    6  
ATOM 9668  C CB   . GLU A 1 10  ? 7.680   9.279   11.136  1.00 0.00 ? 10  GLU A CB   6  
ATOM 9669  C CG   . GLU A 1 10  ? 8.079   9.037   12.610  1.00 0.00 ? 10  GLU A CG   6  
ATOM 9670  C CD   . GLU A 1 10  ? 9.492   8.455   12.668  1.00 0.00 ? 10  GLU A CD   6  
ATOM 9671  O OE1  . GLU A 1 10  ? 9.638   7.297   13.142  1.00 0.00 ? 10  GLU A OE1  6  
ATOM 9672  O OE2  . GLU A 1 10  ? 10.442  9.164   12.241  1.00 0.00 ? 10  GLU A OE2  6  
ATOM 9673  H H    . GLU A 1 10  ? 5.570   10.787  12.576  1.00 0.00 ? 10  GLU A H    6  
ATOM 9674  H HA   . GLU A 1 10  ? 6.094   10.113  9.867   1.00 0.00 ? 10  GLU A HA   6  
ATOM 9675  H HB2  . GLU A 1 10  ? 7.730   8.323   10.571  1.00 0.00 ? 10  GLU A HB2  6  
ATOM 9676  H HB3  . GLU A 1 10  ? 8.418   9.978   10.694  1.00 0.00 ? 10  GLU A HB3  6  
ATOM 9677  H HG2  . GLU A 1 10  ? 8.061   9.994   13.174  1.00 0.00 ? 10  GLU A HG2  6  
ATOM 9678  H HG3  . GLU A 1 10  ? 7.373   8.329   13.094  1.00 0.00 ? 10  GLU A HG3  6  
ATOM 9679  N N    . ASN A 1 11  ? 5.178   7.709   10.849  1.00 0.00 ? 11  ASN A N    6  
ATOM 9680  C CA   . ASN A 1 11  ? 4.264   6.625   11.198  1.00 0.00 ? 11  ASN A CA   6  
ATOM 9681  C C    . ASN A 1 11  ? 2.925   6.756   10.435  1.00 0.00 ? 11  ASN A C    6  
ATOM 9682  O O    . ASN A 1 11  ? 2.025   7.395   10.982  1.00 0.00 ? 11  ASN A O    6  
ATOM 9683  C CB   . ASN A 1 11  ? 4.097   6.465   12.755  1.00 0.00 ? 11  ASN A CB   6  
ATOM 9684  C CG   . ASN A 1 11  ? 3.917   5.017   13.200  1.00 0.00 ? 11  ASN A CG   6  
ATOM 9685  O OD1  . ASN A 1 11  ? 4.290   4.083   12.490  1.00 0.00 ? 11  ASN A OD1  6  
ATOM 9686  N ND2  . ASN A 1 11  ? 3.343   4.791   14.406  1.00 0.00 ? 11  ASN A ND2  6  
ATOM 9687  H H    . ASN A 1 11  ? 5.841   7.458   10.154  1.00 0.00 ? 11  ASN A H    6  
ATOM 9688  H HA   . ASN A 1 11  ? 4.769   5.738   10.842  1.00 0.00 ? 11  ASN A HA   6  
ATOM 9689  H HB2  . ASN A 1 11  ? 5.046   6.825   13.220  1.00 0.00 ? 11  ASN A HB2  6  
ATOM 9690  H HB3  . ASN A 1 11  ? 3.267   7.094   13.141  1.00 0.00 ? 11  ASN A HB3  6  
ATOM 9691  H HD21 . ASN A 1 11  ? 2.865   5.549   14.865  1.00 0.00 ? 11  ASN A HD21 6  
ATOM 9692  H HD22 . ASN A 1 11  ? 3.233   3.843   14.696  1.00 0.00 ? 11  ASN A HD22 6  
ATOM 9693  N N    . PRO A 1 12  ? 2.727   6.226   9.199   1.00 0.00 ? 12  PRO A N    6  
ATOM 9694  C CA   . PRO A 1 12  ? 1.538   6.447   8.342   1.00 0.00 ? 12  PRO A CA   6  
ATOM 9695  C C    . PRO A 1 12  ? 0.140   5.995   8.845   1.00 0.00 ? 12  PRO A C    6  
ATOM 9696  O O    . PRO A 1 12  ? -0.587  5.336   8.099   1.00 0.00 ? 12  PRO A O    6  
ATOM 9697  C CB   . PRO A 1 12  ? 1.922   5.734   7.027   1.00 0.00 ? 12  PRO A CB   6  
ATOM 9698  C CG   . PRO A 1 12  ? 3.450   5.829   6.967   1.00 0.00 ? 12  PRO A CG   6  
ATOM 9699  C CD   . PRO A 1 12  ? 3.847   5.663   8.432   1.00 0.00 ? 12  PRO A CD   6  
ATOM 9700  H HA   . PRO A 1 12  ? 1.459   7.510   8.173   1.00 0.00 ? 12  PRO A HA   6  
ATOM 9701  H HB2  . PRO A 1 12  ? 1.669   4.640   7.074   1.00 0.00 ? 12  PRO A HB2  6  
ATOM 9702  H HB3  . PRO A 1 12  ? 1.444   6.222   6.144   1.00 0.00 ? 12  PRO A HB3  6  
ATOM 9703  H HG2  . PRO A 1 12  ? 3.901   5.048   6.318   1.00 0.00 ? 12  PRO A HG2  6  
ATOM 9704  H HG3  . PRO A 1 12  ? 3.754   6.837   6.609   1.00 0.00 ? 12  PRO A HG3  6  
ATOM 9705  H HD2  . PRO A 1 12  ? 3.951   4.584   8.679   1.00 0.00 ? 12  PRO A HD2  6  
ATOM 9706  H HD3  . PRO A 1 12  ? 4.823   6.190   8.611   1.00 0.00 ? 12  PRO A HD3  6  
ATOM 9707  N N    . GLN A 1 13  ? -0.257  6.404   10.088  1.00 0.00 ? 13  GLN A N    6  
ATOM 9708  C CA   . GLN A 1 13  ? -1.494  6.158   10.815  1.00 0.00 ? 13  GLN A CA   6  
ATOM 9709  C C    . GLN A 1 13  ? -2.682  6.930   10.248  1.00 0.00 ? 13  GLN A C    6  
ATOM 9710  O O    . GLN A 1 13  ? -3.697  6.368   9.833   1.00 0.00 ? 13  GLN A O    6  
ATOM 9711  C CB   . GLN A 1 13  ? -1.297  6.482   12.333  1.00 0.00 ? 13  GLN A CB   6  
ATOM 9712  C CG   . GLN A 1 13  ? -0.206  5.624   13.037  1.00 0.00 ? 13  GLN A CG   6  
ATOM 9713  C CD   . GLN A 1 13  ? 0.016   6.026   14.509  1.00 0.00 ? 13  GLN A CD   6  
ATOM 9714  O OE1  . GLN A 1 13  ? 1.122   6.383   14.926  1.00 0.00 ? 13  GLN A OE1  6  
ATOM 9715  N NE2  . GLN A 1 13  ? -1.057  5.924   15.336  1.00 0.00 ? 13  GLN A NE2  6  
ATOM 9716  H H    . GLN A 1 13  ? 0.426   6.940   10.611  1.00 0.00 ? 13  GLN A H    6  
ATOM 9717  H HA   . GLN A 1 13  ? -1.735  5.119   10.707  1.00 0.00 ? 13  GLN A HA   6  
ATOM 9718  H HB2  . GLN A 1 13  ? -1.011  7.556   12.444  1.00 0.00 ? 13  GLN A HB2  6  
ATOM 9719  H HB3  . GLN A 1 13  ? -2.255  6.326   12.877  1.00 0.00 ? 13  GLN A HB3  6  
ATOM 9720  H HG2  . GLN A 1 13  ? -0.475  4.549   12.994  1.00 0.00 ? 13  GLN A HG2  6  
ATOM 9721  H HG3  . GLN A 1 13  ? 0.768   5.756   12.523  1.00 0.00 ? 13  GLN A HG3  6  
ATOM 9722  H HE21 . GLN A 1 13  ? -1.882  5.466   15.019  1.00 0.00 ? 13  GLN A HE21 6  
ATOM 9723  H HE22 . GLN A 1 13  ? -0.937  6.218   16.282  1.00 0.00 ? 13  GLN A HE22 6  
ATOM 9724  N N    . GLN A 1 14  ? -2.544  8.281   10.160  1.00 0.00 ? 14  GLN A N    6  
ATOM 9725  C CA   . GLN A 1 14  ? -3.518  9.244   9.655   1.00 0.00 ? 14  GLN A CA   6  
ATOM 9726  C C    . GLN A 1 14  ? -3.678  9.293   8.134   1.00 0.00 ? 14  GLN A C    6  
ATOM 9727  O O    . GLN A 1 14  ? -4.362  10.152  7.587   1.00 0.00 ? 14  GLN A O    6  
ATOM 9728  C CB   . GLN A 1 14  ? -3.254  10.659  10.221  1.00 0.00 ? 14  GLN A CB   6  
ATOM 9729  C CG   . GLN A 1 14  ? -1.941  11.327  9.765   1.00 0.00 ? 14  GLN A CG   6  
ATOM 9730  C CD   . GLN A 1 14  ? -0.777  11.007  10.707  1.00 0.00 ? 14  GLN A CD   6  
ATOM 9731  O OE1  . GLN A 1 14  ? -0.286  9.877   10.791  1.00 0.00 ? 14  GLN A OE1  6  
ATOM 9732  N NE2  . GLN A 1 14  ? -0.342  12.060  11.447  1.00 0.00 ? 14  GLN A NE2  6  
ATOM 9733  H H    . GLN A 1 14  ? -1.687  8.717   10.473  1.00 0.00 ? 14  GLN A H    6  
ATOM 9734  H HA   . GLN A 1 14  ? -4.490  8.981   10.043  1.00 0.00 ? 14  GLN A HA   6  
ATOM 9735  H HB2  . GLN A 1 14  ? -4.099  11.323  9.919   1.00 0.00 ? 14  GLN A HB2  6  
ATOM 9736  H HB3  . GLN A 1 14  ? -3.287  10.609  11.333  1.00 0.00 ? 14  GLN A HB3  6  
ATOM 9737  H HG2  . GLN A 1 14  ? -1.646  11.041  8.735   1.00 0.00 ? 14  GLN A HG2  6  
ATOM 9738  H HG3  . GLN A 1 14  ? -2.136  12.417  9.762   1.00 0.00 ? 14  GLN A HG3  6  
ATOM 9739  H HE21 . GLN A 1 14  ? -0.844  12.922  11.420  1.00 0.00 ? 14  GLN A HE21 6  
ATOM 9740  H HE22 . GLN A 1 14  ? 0.430   11.900  12.056  1.00 0.00 ? 14  GLN A HE22 6  
ATOM 9741  N N    . PHE A 1 15  ? -3.070  8.314   7.422   1.00 0.00 ? 15  PHE A N    6  
ATOM 9742  C CA   . PHE A 1 15  ? -3.161  8.068   5.999   1.00 0.00 ? 15  PHE A CA   6  
ATOM 9743  C C    . PHE A 1 15  ? -4.013  6.812   5.787   1.00 0.00 ? 15  PHE A C    6  
ATOM 9744  O O    . PHE A 1 15  ? -4.132  6.309   4.669   1.00 0.00 ? 15  PHE A O    6  
ATOM 9745  C CB   . PHE A 1 15  ? -1.756  7.926   5.347   1.00 0.00 ? 15  PHE A CB   6  
ATOM 9746  C CG   . PHE A 1 15  ? -1.071  9.270   5.259   1.00 0.00 ? 15  PHE A CG   6  
ATOM 9747  C CD1  . PHE A 1 15  ? -1.248  10.062  4.135   1.00 0.00 ? 15  PHE A CD1  6  
ATOM 9748  C CD2  . PHE A 1 15  ? -0.247  9.739   6.272   1.00 0.00 ? 15  PHE A CD2  6  
ATOM 9749  C CE1  . PHE A 1 15  ? -0.621  11.290  4.026   1.00 0.00 ? 15  PHE A CE1  6  
ATOM 9750  C CE2  . PHE A 1 15  ? 0.386   10.965  6.164   1.00 0.00 ? 15  PHE A CE2  6  
ATOM 9751  C CZ   . PHE A 1 15  ? 0.197   11.744  5.040   1.00 0.00 ? 15  PHE A CZ   6  
ATOM 9752  H H    . PHE A 1 15  ? -2.524  7.647   7.921   1.00 0.00 ? 15  PHE A H    6  
ATOM 9753  H HA   . PHE A 1 15  ? -3.693  8.873   5.503   1.00 0.00 ? 15  PHE A HA   6  
ATOM 9754  H HB2  . PHE A 1 15  ? -1.116  7.231   5.934   1.00 0.00 ? 15  PHE A HB2  6  
ATOM 9755  H HB3  . PHE A 1 15  ? -1.834  7.541   4.305   1.00 0.00 ? 15  PHE A HB3  6  
ATOM 9756  H HD1  . PHE A 1 15  ? -1.878  9.717   3.324   1.00 0.00 ? 15  PHE A HD1  6  
ATOM 9757  H HD2  . PHE A 1 15  ? -0.092  9.145   7.162   1.00 0.00 ? 15  PHE A HD2  6  
ATOM 9758  H HE1  . PHE A 1 15  ? -0.768  11.895  3.139   1.00 0.00 ? 15  PHE A HE1  6  
ATOM 9759  H HE2  . PHE A 1 15  ? 1.032   11.319  6.958   1.00 0.00 ? 15  PHE A HE2  6  
ATOM 9760  H HZ   . PHE A 1 15  ? 0.689   12.704  4.952   1.00 0.00 ? 15  PHE A HZ   6  
ATOM 9761  N N    . MET A 1 16  ? -4.689  6.303   6.875   1.00 0.00 ? 16  MET A N    6  
ATOM 9762  C CA   . MET A 1 16  ? -5.620  5.155   6.894   1.00 0.00 ? 16  MET A CA   6  
ATOM 9763  C C    . MET A 1 16  ? -6.848  5.344   6.009   1.00 0.00 ? 16  MET A C    6  
ATOM 9764  O O    . MET A 1 16  ? -7.322  4.410   5.380   1.00 0.00 ? 16  MET A O    6  
ATOM 9765  C CB   . MET A 1 16  ? -6.025  4.717   8.332   1.00 0.00 ? 16  MET A CB   6  
ATOM 9766  C CG   . MET A 1 16  ? -6.685  3.315   8.489   1.00 0.00 ? 16  MET A CG   6  
ATOM 9767  S SD   . MET A 1 16  ? -8.503  3.223   8.365   1.00 0.00 ? 16  MET A SD   6  
ATOM 9768  C CE   . MET A 1 16  ? -8.754  1.435   8.648   1.00 0.00 ? 16  MET A CE   6  
ATOM 9769  H H    . MET A 1 16  ? -4.545  6.730   7.773   1.00 0.00 ? 16  MET A H    6  
ATOM 9770  H HA   . MET A 1 16  ? -5.084  4.315   6.468   1.00 0.00 ? 16  MET A HA   6  
ATOM 9771  H HB2  . MET A 1 16  ? -5.069  4.644   8.903   1.00 0.00 ? 16  MET A HB2  6  
ATOM 9772  H HB3  . MET A 1 16  ? -6.625  5.499   8.845   1.00 0.00 ? 16  MET A HB3  6  
ATOM 9773  H HG2  . MET A 1 16  ? -6.205  2.610   7.777   1.00 0.00 ? 16  MET A HG2  6  
ATOM 9774  H HG3  . MET A 1 16  ? -6.417  2.961   9.505   1.00 0.00 ? 16  MET A HG3  6  
ATOM 9775  H HE1  . MET A 1 16  ? -8.117  1.021   9.458   1.00 0.00 ? 16  MET A HE1  6  
ATOM 9776  H HE2  . MET A 1 16  ? -9.803  1.236   8.938   1.00 0.00 ? 16  MET A HE2  6  
ATOM 9777  H HE3  . MET A 1 16  ? -8.582  0.811   7.740   1.00 0.00 ? 16  MET A HE3  6  
ATOM 9778  N N    . ASP A 1 17  ? -7.356  6.598   5.832   1.00 0.00 ? 17  ASP A N    6  
ATOM 9779  C CA   . ASP A 1 17  ? -8.435  6.954   4.899   1.00 0.00 ? 17  ASP A CA   6  
ATOM 9780  C C    . ASP A 1 17  ? -8.067  6.760   3.411   1.00 0.00 ? 17  ASP A C    6  
ATOM 9781  O O    . ASP A 1 17  ? -8.797  6.135   2.649   1.00 0.00 ? 17  ASP A O    6  
ATOM 9782  C CB   . ASP A 1 17  ? -9.004  8.387   5.177   1.00 0.00 ? 17  ASP A CB   6  
ATOM 9783  C CG   . ASP A 1 17  ? -7.962  9.517   5.093   1.00 0.00 ? 17  ASP A CG   6  
ATOM 9784  O OD1  . ASP A 1 17  ? -7.062  9.569   5.972   1.00 0.00 ? 17  ASP A OD1  6  
ATOM 9785  O OD2  . ASP A 1 17  ? -8.068  10.344  4.149   1.00 0.00 ? 17  ASP A OD2  6  
ATOM 9786  H H    . ASP A 1 17  ? -6.951  7.354   6.340   1.00 0.00 ? 17  ASP A H    6  
ATOM 9787  H HA   . ASP A 1 17  ? -9.254  6.271   5.083   1.00 0.00 ? 17  ASP A HA   6  
ATOM 9788  H HB2  . ASP A 1 17  ? -9.845  8.605   4.484   1.00 0.00 ? 17  ASP A HB2  6  
ATOM 9789  H HB3  . ASP A 1 17  ? -9.420  8.393   6.209   1.00 0.00 ? 17  ASP A HB3  6  
ATOM 9790  N N    . TYR A 1 18  ? -6.868  7.263   2.999   1.00 0.00 ? 18  TYR A N    6  
ATOM 9791  C CA   . TYR A 1 18  ? -6.263  7.134   1.675   1.00 0.00 ? 18  TYR A CA   6  
ATOM 9792  C C    . TYR A 1 18  ? -5.770  5.715   1.329   1.00 0.00 ? 18  TYR A C    6  
ATOM 9793  O O    . TYR A 1 18  ? -6.139  5.160   0.291   1.00 0.00 ? 18  TYR A O    6  
ATOM 9794  C CB   . TYR A 1 18  ? -5.102  8.185   1.583   1.00 0.00 ? 18  TYR A CB   6  
ATOM 9795  C CG   . TYR A 1 18  ? -4.398  8.279   0.238   1.00 0.00 ? 18  TYR A CG   6  
ATOM 9796  C CD1  . TYR A 1 18  ? -3.034  8.051   0.158   1.00 0.00 ? 18  TYR A CD1  6  
ATOM 9797  C CD2  . TYR A 1 18  ? -5.085  8.579   -0.928  1.00 0.00 ? 18  TYR A CD2  6  
ATOM 9798  C CE1  . TYR A 1 18  ? -2.370  8.137   -1.047  1.00 0.00 ? 18  TYR A CE1  6  
ATOM 9799  C CE2  . TYR A 1 18  ? -4.419  8.663   -2.141  1.00 0.00 ? 18  TYR A CE2  6  
ATOM 9800  C CZ   . TYR A 1 18  ? -3.056  8.454   -2.199  1.00 0.00 ? 18  TYR A CZ   6  
ATOM 9801  O OH   . TYR A 1 18  ? -2.344  8.570   -3.414  1.00 0.00 ? 18  TYR A OH   6  
ATOM 9802  H H    . TYR A 1 18  ? -6.303  7.734   3.672   1.00 0.00 ? 18  TYR A H    6  
ATOM 9803  H HA   . TYR A 1 18  ? -7.016  7.383   0.936   1.00 0.00 ? 18  TYR A HA   6  
ATOM 9804  H HB2  . TYR A 1 18  ? -5.543  9.195   1.768   1.00 0.00 ? 18  TYR A HB2  6  
ATOM 9805  H HB3  . TYR A 1 18  ? -4.339  7.962   2.372   1.00 0.00 ? 18  TYR A HB3  6  
ATOM 9806  H HD1  . TYR A 1 18  ? -2.480  7.797   1.053   1.00 0.00 ? 18  TYR A HD1  6  
ATOM 9807  H HD2  . TYR A 1 18  ? -6.153  8.749   -0.895  1.00 0.00 ? 18  TYR A HD2  6  
ATOM 9808  H HE1  . TYR A 1 18  ? -1.302  7.970   -1.091  1.00 0.00 ? 18  TYR A HE1  6  
ATOM 9809  H HE2  . TYR A 1 18  ? -4.974  8.894   -3.042  1.00 0.00 ? 18  TYR A HE2  6  
ATOM 9810  H HH   . TYR A 1 18  ? -2.939  8.914   -4.085  1.00 0.00 ? 18  TYR A HH   6  
ATOM 9811  N N    . PHE A 1 19  ? -4.931  5.102   2.212   1.00 0.00 ? 19  PHE A N    6  
ATOM 9812  C CA   . PHE A 1 19  ? -4.321  3.781   2.079   1.00 0.00 ? 19  PHE A CA   6  
ATOM 9813  C C    . PHE A 1 19  ? -5.269  2.608   2.300   1.00 0.00 ? 19  PHE A C    6  
ATOM 9814  O O    . PHE A 1 19  ? -5.311  1.671   1.500   1.00 0.00 ? 19  PHE A O    6  
ATOM 9815  C CB   . PHE A 1 19  ? -3.045  3.688   2.958   1.00 0.00 ? 19  PHE A CB   6  
ATOM 9816  C CG   . PHE A 1 19  ? -1.898  4.579   2.476   1.00 0.00 ? 19  PHE A CG   6  
ATOM 9817  C CD1  . PHE A 1 19  ? -0.977  5.050   3.399   1.00 0.00 ? 19  PHE A CD1  6  
ATOM 9818  C CD2  . PHE A 1 19  ? -1.653  4.867   1.136   1.00 0.00 ? 19  PHE A CD2  6  
ATOM 9819  C CE1  . PHE A 1 19  ? 0.172   5.715   3.010   1.00 0.00 ? 19  PHE A CE1  6  
ATOM 9820  C CE2  . PHE A 1 19  ? -0.509  5.533   0.741   1.00 0.00 ? 19  PHE A CE2  6  
ATOM 9821  C CZ   . PHE A 1 19  ? 0.416   5.946   1.675   1.00 0.00 ? 19  PHE A CZ   6  
ATOM 9822  H H    . PHE A 1 19  ? -4.648  5.587   3.053   1.00 0.00 ? 19  PHE A H    6  
ATOM 9823  H HA   . PHE A 1 19  ? -4.027  3.651   1.046   1.00 0.00 ? 19  PHE A HA   6  
ATOM 9824  H HB2  . PHE A 1 19  ? -3.282  3.969   4.008   1.00 0.00 ? 19  PHE A HB2  6  
ATOM 9825  H HB3  . PHE A 1 19  ? -2.641  2.648   2.992   1.00 0.00 ? 19  PHE A HB3  6  
ATOM 9826  H HD1  . PHE A 1 19  ? -1.136  4.846   4.451   1.00 0.00 ? 19  PHE A HD1  6  
ATOM 9827  H HD2  . PHE A 1 19  ? -2.324  4.531   0.363   1.00 0.00 ? 19  PHE A HD2  6  
ATOM 9828  H HE1  . PHE A 1 19  ? 0.900   6.032   3.746   1.00 0.00 ? 19  PHE A HE1  6  
ATOM 9829  H HE2  . PHE A 1 19  ? -0.333  5.718   -0.312  1.00 0.00 ? 19  PHE A HE2  6  
ATOM 9830  H HZ   . PHE A 1 19  ? 1.327   6.440   1.361   1.00 0.00 ? 19  PHE A HZ   6  
ATOM 9831  N N    . SER A 1 20  ? -6.127  2.677   3.370   1.00 0.00 ? 20  SER A N    6  
ATOM 9832  C CA   . SER A 1 20  ? -7.175  1.685   3.670   1.00 0.00 ? 20  SER A CA   6  
ATOM 9833  C C    . SER A 1 20  ? -8.300  1.623   2.663   1.00 0.00 ? 20  SER A C    6  
ATOM 9834  O O    . SER A 1 20  ? -8.886  0.557   2.540   1.00 0.00 ? 20  SER A O    6  
ATOM 9835  C CB   . SER A 1 20  ? -7.762  1.580   5.108   1.00 0.00 ? 20  SER A CB   6  
ATOM 9836  O OG   . SER A 1 20  ? -8.457  0.344   5.305   1.00 0.00 ? 20  SER A OG   6  
ATOM 9837  H H    . SER A 1 20  ? -6.095  3.468   3.992   1.00 0.00 ? 20  SER A H    6  
ATOM 9838  H HA   . SER A 1 20  ? -6.685  0.726   3.565   1.00 0.00 ? 20  SER A HA   6  
ATOM 9839  H HB2  . SER A 1 20  ? -6.916  1.624   5.838   1.00 0.00 ? 20  SER A HB2  6  
ATOM 9840  H HB3  . SER A 1 20  ? -8.480  2.413   5.314   1.00 0.00 ? 20  SER A HB3  6  
ATOM 9841  H HG   . SER A 1 20  ? -8.982  0.207   4.495   1.00 0.00 ? 20  SER A HG   6  
ATOM 9842  N N    . GLU A 1 21  ? -8.675  2.717   1.938   1.00 0.00 ? 21  GLU A N    6  
ATOM 9843  C CA   . GLU A 1 21  ? -9.701  2.673   0.884   1.00 0.00 ? 21  GLU A CA   6  
ATOM 9844  C C    . GLU A 1 21  ? -9.237  1.895   -0.353  1.00 0.00 ? 21  GLU A C    6  
ATOM 9845  O O    . GLU A 1 21  ? -9.911  0.976   -0.804  1.00 0.00 ? 21  GLU A O    6  
ATOM 9846  C CB   . GLU A 1 21  ? -10.177 4.102   0.527   1.00 0.00 ? 21  GLU A CB   6  
ATOM 9847  C CG   . GLU A 1 21  ? -11.382 4.232   -0.435  1.00 0.00 ? 21  GLU A CG   6  
ATOM 9848  C CD   . GLU A 1 21  ? -10.959 4.214   -1.907  1.00 0.00 ? 21  GLU A CD   6  
ATOM 9849  O OE1  . GLU A 1 21  ? -10.131 5.081   -2.297  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 9850  O OE2  . GLU A 1 21  ? -11.460 3.336   -2.659  1.00 0.00 ? 21  GLU A OE2  6  
ATOM 9851  H H    . GLU A 1 21  ? -8.216  3.596   2.076   1.00 0.00 ? 21  GLU A H    6  
ATOM 9852  H HA   . GLU A 1 21  ? -10.553 2.118   1.271   1.00 0.00 ? 21  GLU A HA   6  
ATOM 9853  H HB2  . GLU A 1 21  ? -10.515 4.552   1.490   1.00 0.00 ? 21  GLU A HB2  6  
ATOM 9854  H HB3  . GLU A 1 21  ? -9.324  4.725   0.182   1.00 0.00 ? 21  GLU A HB3  6  
ATOM 9855  H HG2  . GLU A 1 21  ? -12.115 3.426   -0.230  1.00 0.00 ? 21  GLU A HG2  6  
ATOM 9856  H HG3  . GLU A 1 21  ? -11.879 5.210   -0.240  1.00 0.00 ? 21  GLU A HG3  6  
ATOM 9857  N N    . GLU A 1 22  ? -8.007  2.179   -0.880  1.00 0.00 ? 22  GLU A N    6  
ATOM 9858  C CA   . GLU A 1 22  ? -7.356  1.465   -1.986  1.00 0.00 ? 22  GLU A CA   6  
ATOM 9859  C C    . GLU A 1 22  ? -7.018  0.017   -1.622  1.00 0.00 ? 22  GLU A C    6  
ATOM 9860  O O    . GLU A 1 22  ? -7.379  -0.909  -2.360  1.00 0.00 ? 22  GLU A O    6  
ATOM 9861  C CB   . GLU A 1 22  ? -6.095  2.258   -2.443  1.00 0.00 ? 22  GLU A CB   6  
ATOM 9862  C CG   . GLU A 1 22  ? -5.774  2.223   -3.954  1.00 0.00 ? 22  GLU A CG   6  
ATOM 9863  C CD   . GLU A 1 22  ? -4.968  1.004   -4.413  1.00 0.00 ? 22  GLU A CD   6  
ATOM 9864  O OE1  . GLU A 1 22  ? -4.806  0.863   -5.655  1.00 0.00 ? 22  GLU A OE1  6  
ATOM 9865  O OE2  . GLU A 1 22  ? -4.493  0.215   -3.556  1.00 0.00 ? 22  GLU A OE2  6  
ATOM 9866  H H    . GLU A 1 22  ? -7.475  2.923   -0.478  1.00 0.00 ? 22  GLU A H    6  
ATOM 9867  H HA   . GLU A 1 22  ? -8.081  1.402   -2.800  1.00 0.00 ? 22  GLU A HA   6  
ATOM 9868  H HB2  . GLU A 1 22  ? -6.347  3.331   -2.257  1.00 0.00 ? 22  GLU A HB2  6  
ATOM 9869  H HB3  . GLU A 1 22  ? -5.195  2.043   -1.823  1.00 0.00 ? 22  GLU A HB3  6  
ATOM 9870  H HG2  . GLU A 1 22  ? -6.725  2.274   -4.527  1.00 0.00 ? 22  GLU A HG2  6  
ATOM 9871  H HG3  . GLU A 1 22  ? -5.180  3.132   -4.198  1.00 0.00 ? 22  GLU A HG3  6  
ATOM 9872  N N    . PHE A 1 23  ? -6.422  -0.201  -0.396  1.00 0.00 ? 23  PHE A N    6  
ATOM 9873  C CA   . PHE A 1 23  ? -6.165  -1.518  0.199   1.00 0.00 ? 23  PHE A CA   6  
ATOM 9874  C C    . PHE A 1 23  ? -7.434  -2.333  0.401   1.00 0.00 ? 23  PHE A C    6  
ATOM 9875  O O    . PHE A 1 23  ? -7.511  -3.451  -0.066  1.00 0.00 ? 23  PHE A O    6  
ATOM 9876  C CB   . PHE A 1 23  ? -5.384  -1.429  1.551   1.00 0.00 ? 23  PHE A CB   6  
ATOM 9877  C CG   . PHE A 1 23  ? -4.936  -2.751  2.161   1.00 0.00 ? 23  PHE A CG   6  
ATOM 9878  C CD1  . PHE A 1 23  ? -4.423  -3.776  1.396   1.00 0.00 ? 23  PHE A CD1  6  
ATOM 9879  C CD2  . PHE A 1 23  ? -5.050  -2.968  3.519   1.00 0.00 ? 23  PHE A CD2  6  
ATOM 9880  C CE1  . PHE A 1 23  ? -4.040  -4.970  1.962   1.00 0.00 ? 23  PHE A CE1  6  
ATOM 9881  C CE2  . PHE A 1 23  ? -4.615  -4.139  4.101   1.00 0.00 ? 23  PHE A CE2  6  
ATOM 9882  C CZ   . PHE A 1 23  ? -4.126  -5.161  3.321   1.00 0.00 ? 23  PHE A CZ   6  
ATOM 9883  H H    . PHE A 1 23  ? -6.148  0.566   0.206   1.00 0.00 ? 23  PHE A H    6  
ATOM 9884  H HA   . PHE A 1 23  ? -5.566  -2.068  -0.513  1.00 0.00 ? 23  PHE A HA   6  
ATOM 9885  H HB2  . PHE A 1 23  ? -4.438  -0.855  1.357   1.00 0.00 ? 23  PHE A HB2  6  
ATOM 9886  H HB3  . PHE A 1 23  ? -6.029  -0.906  2.308   1.00 0.00 ? 23  PHE A HB3  6  
ATOM 9887  H HD1  . PHE A 1 23  ? -4.362  -3.663  0.327   1.00 0.00 ? 23  PHE A HD1  6  
ATOM 9888  H HD2  . PHE A 1 23  ? -5.545  -2.229  4.129   1.00 0.00 ? 23  PHE A HD2  6  
ATOM 9889  H HE1  . PHE A 1 23  ? -3.590  -5.733  1.344   1.00 0.00 ? 23  PHE A HE1  6  
ATOM 9890  H HE2  . PHE A 1 23  ? -4.637  -4.250  5.177   1.00 0.00 ? 23  PHE A HE2  6  
ATOM 9891  H HZ   . PHE A 1 23  ? -3.776  -6.083  3.762   1.00 0.00 ? 23  PHE A HZ   6  
ATOM 9892  N N    . ARG A 1 24  ? -8.502  -1.791  1.040   1.00 0.00 ? 24  ARG A N    6  
ATOM 9893  C CA   . ARG A 1 24  ? -9.767  -2.492  1.247   1.00 0.00 ? 24  ARG A CA   6  
ATOM 9894  C C    . ARG A 1 24  ? -10.604 -2.748  0.007   1.00 0.00 ? 24  ARG A C    6  
ATOM 9895  O O    . ARG A 1 24  ? -11.183 -3.822  -0.114  1.00 0.00 ? 24  ARG A O    6  
ATOM 9896  C CB   . ARG A 1 24  ? -10.505 -1.974  2.522   1.00 0.00 ? 24  ARG A CB   6  
ATOM 9897  C CG   . ARG A 1 24  ? -11.544 -2.952  3.123   1.00 0.00 ? 24  ARG A CG   6  
ATOM 9898  C CD   . ARG A 1 24  ? -10.954 -3.904  4.182   1.00 0.00 ? 24  ARG A CD   6  
ATOM 9899  N NE   . ARG A 1 24  ? -9.779  -4.665  3.637   1.00 0.00 ? 24  ARG A NE   6  
ATOM 9900  C CZ   . ARG A 1 24  ? -8.462  -4.311  3.764   1.00 0.00 ? 24  ARG A CZ   6  
ATOM 9901  N NH1  . ARG A 1 24  ? -8.080  -3.231  4.501   1.00 0.00 ? 24  ARG A NH1  6  
ATOM 9902  N NH2  . ARG A 1 24  ? -7.525  -5.034  3.090   1.00 0.00 ? 24  ARG A NH2  6  
ATOM 9903  H H    . ARG A 1 24  ? -8.497  -0.860  1.422   1.00 0.00 ? 24  ARG A H    6  
ATOM 9904  H HA   . ARG A 1 24  ? -9.502  -3.505  1.481   1.00 0.00 ? 24  ARG A HA   6  
ATOM 9905  H HB2  . ARG A 1 24  ? -9.711  -1.832  3.305   1.00 0.00 ? 24  ARG A HB2  6  
ATOM 9906  H HB3  . ARG A 1 24  ? -10.921 -0.958  2.392   1.00 0.00 ? 24  ARG A HB3  6  
ATOM 9907  H HG2  . ARG A 1 24  ? -12.333 -2.358  3.645   1.00 0.00 ? 24  ARG A HG2  6  
ATOM 9908  H HG3  . ARG A 1 24  ? -12.032 -3.536  2.315   1.00 0.00 ? 24  ARG A HG3  6  
ATOM 9909  H HD2  . ARG A 1 24  ? -10.687 -3.305  5.060   1.00 0.00 ? 24  ARG A HD2  6  
ATOM 9910  H HD3  . ARG A 1 24  ? -11.666 -4.668  4.540   1.00 0.00 ? 24  ARG A HD3  6  
ATOM 9911  H HE   . ARG A 1 24  ? -9.984  -5.467  3.075   1.00 0.00 ? 24  ARG A HE   6  
ATOM 9912  H HH11 . ARG A 1 24  ? -8.768  -2.687  4.982   1.00 0.00 ? 24  ARG A HH11 6  
ATOM 9913  H HH12 . ARG A 1 24  ? -7.113  -2.984  4.560   1.00 0.00 ? 24  ARG A HH12 6  
ATOM 9914  H HH21 . ARG A 1 24  ? -7.804  -5.816  2.531   1.00 0.00 ? 24  ARG A HH21 6  
ATOM 9915  H HH22 . ARG A 1 24  ? -6.560  -4.782  3.151   1.00 0.00 ? 24  ARG A HH22 6  
ATOM 9916  N N    . ASN A 1 25  ? -10.614 -1.847  -1.008  1.00 0.00 ? 25  ASN A N    6  
ATOM 9917  C CA   . ASN A 1 25  ? -11.269 -2.075  -2.297  1.00 0.00 ? 25  ASN A CA   6  
ATOM 9918  C C    . ASN A 1 25  ? -10.568 -3.108  -3.196  1.00 0.00 ? 25  ASN A C    6  
ATOM 9919  O O    . ASN A 1 25  ? -11.197 -4.059  -3.654  1.00 0.00 ? 25  ASN A O    6  
ATOM 9920  C CB   . ASN A 1 25  ? -11.343 -0.717  -3.056  1.00 0.00 ? 25  ASN A CB   6  
ATOM 9921  C CG   . ASN A 1 25  ? -12.543 0.081   -2.547  1.00 0.00 ? 25  ASN A CG   6  
ATOM 9922  O OD1  . ASN A 1 25  ? -12.773 0.208   -1.343  1.00 0.00 ? 25  ASN A OD1  6  
ATOM 9923  N ND2  . ASN A 1 25  ? -13.339 0.653   -3.483  1.00 0.00 ? 25  ASN A ND2  6  
ATOM 9924  H H    . ASN A 1 25  ? -10.136 -0.966  -0.906  1.00 0.00 ? 25  ASN A H    6  
ATOM 9925  H HA   . ASN A 1 25  ? -12.258 -2.499  -2.100  1.00 0.00 ? 25  ASN A HA   6  
ATOM 9926  H HB2  . ASN A 1 25  ? -10.421 -0.139  -2.840  1.00 0.00 ? 25  ASN A HB2  6  
ATOM 9927  H HB3  . ASN A 1 25  ? -11.389 -0.803  -4.156  1.00 0.00 ? 25  ASN A HB3  6  
ATOM 9928  H HD21 . ASN A 1 25  ? -13.155 0.552   -4.457  1.00 0.00 ? 25  ASN A HD21 6  
ATOM 9929  H HD22 . ASN A 1 25  ? -14.124 1.169   -3.151  1.00 0.00 ? 25  ASN A HD22 6  
ATOM 9930  N N    . ASP A 1 26  ? -9.232  -2.965  -3.438  1.00 0.00 ? 26  ASP A N    6  
ATOM 9931  C CA   . ASP A 1 26  ? -8.420  -3.879  -4.255  1.00 0.00 ? 26  ASP A CA   6  
ATOM 9932  C C    . ASP A 1 26  ? -8.043  -5.187  -3.576  1.00 0.00 ? 26  ASP A C    6  
ATOM 9933  O O    . ASP A 1 26  ? -8.113  -6.214  -4.237  1.00 0.00 ? 26  ASP A O    6  
ATOM 9934  C CB   . ASP A 1 26  ? -7.181  -3.177  -4.861  1.00 0.00 ? 26  ASP A CB   6  
ATOM 9935  C CG   . ASP A 1 26  ? -7.643  -2.076  -5.822  1.00 0.00 ? 26  ASP A CG   6  
ATOM 9936  O OD1  . ASP A 1 26  ? -7.416  -0.878  -5.510  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 9937  O OD2  . ASP A 1 26  ? -8.232  -2.428  -6.880  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 9938  H H    . ASP A 1 26  ? -8.726  -2.189  -3.035  1.00 0.00 ? 26  ASP A H    6  
ATOM 9939  H HA   . ASP A 1 26  ? -8.993  -4.241  -5.110  1.00 0.00 ? 26  ASP A HA   6  
ATOM 9940  H HB2  . ASP A 1 26  ? -6.590  -2.717  -4.044  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 9941  H HB3  . ASP A 1 26  ? -6.534  -3.881  -5.427  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 9942  N N    . PHE A 1 27  ? -7.715  -5.223  -2.243  1.00 0.00 ? 27  PHE A N    6  
ATOM 9943  C CA   . PHE A 1 27  ? -7.423  -6.441  -1.447  1.00 0.00 ? 27  PHE A CA   6  
ATOM 9944  C C    . PHE A 1 27  ? -8.677  -7.241  -1.223  1.00 0.00 ? 27  PHE A C    6  
ATOM 9945  O O    . PHE A 1 27  ? -8.595  -8.455  -1.355  1.00 0.00 ? 27  PHE A O    6  
ATOM 9946  C CB   . PHE A 1 27  ? -6.666  -6.220  -0.086  1.00 0.00 ? 27  PHE A CB   6  
ATOM 9947  C CG   . PHE A 1 27  ? -6.310  -7.412  0.816   1.00 0.00 ? 27  PHE A CG   6  
ATOM 9948  C CD1  . PHE A 1 27  ? -7.209  -7.903  1.763   1.00 0.00 ? 27  PHE A CD1  6  
ATOM 9949  C CD2  . PHE A 1 27  ? -5.011  -7.875  0.874   1.00 0.00 ? 27  PHE A CD2  6  
ATOM 9950  C CE1  . PHE A 1 27  ? -6.815  -8.786  2.751   1.00 0.00 ? 27  PHE A CE1  6  
ATOM 9951  C CE2  . PHE A 1 27  ? -4.602  -8.714  1.893   1.00 0.00 ? 27  PHE A CE2  6  
ATOM 9952  C CZ   . PHE A 1 27  ? -5.506  -9.193  2.814   1.00 0.00 ? 27  PHE A CZ   6  
ATOM 9953  H H    . PHE A 1 27  ? -7.694  -4.373  -1.702  1.00 0.00 ? 27  PHE A H    6  
ATOM 9954  H HA   . PHE A 1 27  ? -6.777  -7.068  -2.047  1.00 0.00 ? 27  PHE A HA   6  
ATOM 9955  H HB2  . PHE A 1 27  ? -5.714  -5.682  -0.317  1.00 0.00 ? 27  PHE A HB2  6  
ATOM 9956  H HB3  . PHE A 1 27  ? -7.291  -5.573  0.564   1.00 0.00 ? 27  PHE A HB3  6  
ATOM 9957  H HD1  . PHE A 1 27  ? -8.223  -7.529  1.771   1.00 0.00 ? 27  PHE A HD1  6  
ATOM 9958  H HD2  . PHE A 1 27  ? -4.276  -7.492  0.178   1.00 0.00 ? 27  PHE A HD2  6  
ATOM 9959  H HE1  . PHE A 1 27  ? -7.492  -9.139  3.524   1.00 0.00 ? 27  PHE A HE1  6  
ATOM 9960  H HE2  . PHE A 1 27  ? -3.564  -9.003  1.978   1.00 0.00 ? 27  PHE A HE2  6  
ATOM 9961  H HZ   . PHE A 1 27  ? -5.193  -9.873  3.593   1.00 0.00 ? 27  PHE A HZ   6  
ATOM 9962  N N    . LEU A 1 28  ? -9.885  -6.618  -0.970  1.00 0.00 ? 28  LEU A N    6  
ATOM 9963  C CA   . LEU A 1 28  ? -11.158 -7.362  -0.906  1.00 0.00 ? 28  LEU A CA   6  
ATOM 9964  C C    . LEU A 1 28  ? -11.533 -7.939  -2.254  1.00 0.00 ? 28  LEU A C    6  
ATOM 9965  O O    . LEU A 1 28  ? -11.939 -9.084  -2.312  1.00 0.00 ? 28  LEU A O    6  
ATOM 9966  C CB   . LEU A 1 28  ? -12.379 -6.628  -0.308  1.00 0.00 ? 28  LEU A CB   6  
ATOM 9967  C CG   . LEU A 1 28  ? -12.438 -6.531  1.230   1.00 0.00 ? 28  LEU A CG   6  
ATOM 9968  C CD1  . LEU A 1 28  ? -13.669 -7.312  1.679   1.00 0.00 ? 28  LEU A CD1  6  
ATOM 9969  C CD2  . LEU A 1 28  ? -11.205 -7.021  2.000   1.00 0.00 ? 28  LEU A CD2  6  
ATOM 9970  H H    . LEU A 1 28  ? -9.966  -5.621  -0.876  1.00 0.00 ? 28  LEU A H    6  
ATOM 9971  H HA   . LEU A 1 28  ? -11.004 -8.237  -0.291  1.00 0.00 ? 28  LEU A HA   6  
ATOM 9972  H HB2  . LEU A 1 28  ? -12.478 -5.618  -0.744  1.00 0.00 ? 28  LEU A HB2  6  
ATOM 9973  H HB3  . LEU A 1 28  ? -13.321 -7.174  -0.574  1.00 0.00 ? 28  LEU A HB3  6  
ATOM 9974  H HG   . LEU A 1 28  ? -12.601 -5.457  1.498   1.00 0.00 ? 28  LEU A HG   6  
ATOM 9975  H HD11 . LEU A 1 28  ? -14.572 -6.868  1.204   1.00 0.00 ? 28  LEU A HD11 6  
ATOM 9976  H HD12 . LEU A 1 28  ? -13.584 -8.376  1.373   1.00 0.00 ? 28  LEU A HD12 6  
ATOM 9977  H HD13 . LEU A 1 28  ? -13.771 -7.254  2.777   1.00 0.00 ? 28  LEU A HD13 6  
ATOM 9978  H HD21 . LEU A 1 28  ? -10.304 -6.446  1.704   1.00 0.00 ? 28  LEU A HD21 6  
ATOM 9979  H HD22 . LEU A 1 28  ? -11.374 -6.891  3.088   1.00 0.00 ? 28  LEU A HD22 6  
ATOM 9980  H HD23 . LEU A 1 28  ? -11.028 -8.099  1.820   1.00 0.00 ? 28  LEU A HD23 6  
ATOM 9981  N N    . GLU A 1 29  ? -11.285 -7.215  -3.377  1.00 0.00 ? 29  GLU A N    6  
ATOM 9982  C CA   . GLU A 1 29  ? -11.428 -7.733  -4.743  1.00 0.00 ? 29  GLU A CA   6  
ATOM 9983  C C    . GLU A 1 29  ? -10.529 -8.929  -5.064  1.00 0.00 ? 29  GLU A C    6  
ATOM 9984  O O    . GLU A 1 29  ? -11.026 -9.986  -5.425  1.00 0.00 ? 29  GLU A O    6  
ATOM 9985  C CB   . GLU A 1 29  ? -11.115 -6.602  -5.757  1.00 0.00 ? 29  GLU A CB   6  
ATOM 9986  C CG   . GLU A 1 29  ? -12.404 -6.052  -6.356  1.00 0.00 ? 29  GLU A CG   6  
ATOM 9987  C CD   . GLU A 1 29  ? -12.104 -4.908  -7.319  1.00 0.00 ? 29  GLU A CD   6  
ATOM 9988  O OE1  . GLU A 1 29  ? -11.552 -3.872  -6.857  1.00 0.00 ? 29  GLU A OE1  6  
ATOM 9989  O OE2  . GLU A 1 29  ? -12.421 -5.052  -8.529  1.00 0.00 ? 29  GLU A OE2  6  
ATOM 9990  H H    . GLU A 1 29  ? -10.938 -6.279  -3.301  1.00 0.00 ? 29  GLU A H    6  
ATOM 9991  H HA   . GLU A 1 29  ? -12.458 -8.104  -4.821  1.00 0.00 ? 29  GLU A HA   6  
ATOM 9992  H HB2  . GLU A 1 29  ? -10.601 -5.789  -5.207  1.00 0.00 ? 29  GLU A HB2  6  
ATOM 9993  H HB3  . GLU A 1 29  ? -10.417 -6.862  -6.584  1.00 0.00 ? 29  GLU A HB3  6  
ATOM 9994  H HG2  . GLU A 1 29  ? -12.900 -6.892  -6.885  1.00 0.00 ? 29  GLU A HG2  6  
ATOM 9995  H HG3  . GLU A 1 29  ? -13.035 -5.699  -5.515  1.00 0.00 ? 29  GLU A HG3  6  
ATOM 9996  N N    . LEU A 1 30  ? -9.188  -8.803  -4.842  1.00 0.00 ? 30  LEU A N    6  
ATOM 9997  C CA   . LEU A 1 30  ? -8.147  -9.819  -4.986  1.00 0.00 ? 30  LEU A CA   6  
ATOM 9998  C C    . LEU A 1 30  ? -8.380  -11.071 -4.143  1.00 0.00 ? 30  LEU A C    6  
ATOM 9999  O O    . LEU A 1 30  ? -8.298  -12.192 -4.639  1.00 0.00 ? 30  LEU A O    6  
ATOM 10000 C CB   . LEU A 1 30  ? -6.836  -9.131  -4.532  1.00 0.00 ? 30  LEU A CB   6  
ATOM 10001 C CG   . LEU A 1 30  ? -5.522  -9.524  -5.220  1.00 0.00 ? 30  LEU A CG   6  
ATOM 10002 C CD1  . LEU A 1 30  ? -5.151  -11.010 -5.195  1.00 0.00 ? 30  LEU A CD1  6  
ATOM 10003 C CD2  . LEU A 1 30  ? -5.517  -8.947  -6.634  1.00 0.00 ? 30  LEU A CD2  6  
ATOM 10004 H H    . LEU A 1 30  ? -8.829  -7.919  -4.519  1.00 0.00 ? 30  LEU A H    6  
ATOM 10005 H HA   . LEU A 1 30  ? -8.097  -10.114 -6.027  1.00 0.00 ? 30  LEU A HA   6  
ATOM 10006 H HB2  . LEU A 1 30  ? -6.987  -8.065  -4.816  1.00 0.00 ? 30  LEU A HB2  6  
ATOM 10007 H HB3  . LEU A 1 30  ? -6.719  -9.127  -3.429  1.00 0.00 ? 30  LEU A HB3  6  
ATOM 10008 H HG   . LEU A 1 30  ? -4.697  -9.004  -4.678  1.00 0.00 ? 30  LEU A HG   6  
ATOM 10009 H HD11 . LEU A 1 30  ? -5.944  -11.654 -5.623  1.00 0.00 ? 30  LEU A HD11 6  
ATOM 10010 H HD12 . LEU A 1 30  ? -4.239  -11.154 -5.806  1.00 0.00 ? 30  LEU A HD12 6  
ATOM 10011 H HD13 . LEU A 1 30  ? -4.935  -11.332 -4.148  1.00 0.00 ? 30  LEU A HD13 6  
ATOM 10012 H HD21 . LEU A 1 30  ? -5.854  -7.882  -6.611  1.00 0.00 ? 30  LEU A HD21 6  
ATOM 10013 H HD22 . LEU A 1 30  ? -4.490  -9.005  -7.049  1.00 0.00 ? 30  LEU A HD22 6  
ATOM 10014 H HD23 . LEU A 1 30  ? -6.198  -9.544  -7.274  1.00 0.00 ? 30  LEU A HD23 6  
ATOM 10015 N N    . LEU A 1 31  ? -8.803  -10.852 -2.861  1.00 0.00 ? 31  LEU A N    6  
ATOM 10016 C CA   . LEU A 1 31  ? -9.222  -11.811 -1.842  1.00 0.00 ? 31  LEU A CA   6  
ATOM 10017 C C    . LEU A 1 31  ? -10.478 -12.562 -2.229  1.00 0.00 ? 31  LEU A C    6  
ATOM 10018 O O    . LEU A 1 31  ? -10.532 -13.781 -2.132  1.00 0.00 ? 31  LEU A O    6  
ATOM 10019 C CB   . LEU A 1 31  ? -9.462  -11.072 -0.492  1.00 0.00 ? 31  LEU A CB   6  
ATOM 10020 C CG   . LEU A 1 31  ? -9.863  -11.879 0.760   1.00 0.00 ? 31  LEU A CG   6  
ATOM 10021 C CD1  . LEU A 1 31  ? -8.755  -12.893 1.106   1.00 0.00 ? 31  LEU A CD1  6  
ATOM 10022 C CD2  . LEU A 1 31  ? -10.185 -10.906 1.922   1.00 0.00 ? 31  LEU A CD2  6  
ATOM 10023 H H    . LEU A 1 31  ? -8.881  -9.898  -2.532  1.00 0.00 ? 31  LEU A H    6  
ATOM 10024 H HA   . LEU A 1 31  ? -8.433  -12.538 -1.724  1.00 0.00 ? 31  LEU A HA   6  
ATOM 10025 H HB2  . LEU A 1 31  ? -8.487  -10.576 -0.235  1.00 0.00 ? 31  LEU A HB2  6  
ATOM 10026 H HB3  . LEU A 1 31  ? -10.250 -10.289 -0.654  1.00 0.00 ? 31  LEU A HB3  6  
ATOM 10027 H HG   . LEU A 1 31  ? -10.797 -12.454 0.550   1.00 0.00 ? 31  LEU A HG   6  
ATOM 10028 H HD11 . LEU A 1 31  ? -8.539  -13.558 0.241   1.00 0.00 ? 31  LEU A HD11 6  
ATOM 10029 H HD12 . LEU A 1 31  ? -7.817  -12.356 1.362   1.00 0.00 ? 31  LEU A HD12 6  
ATOM 10030 H HD13 . LEU A 1 31  ? -9.054  -13.516 1.976   1.00 0.00 ? 31  LEU A HD13 6  
ATOM 10031 H HD21 . LEU A 1 31  ? -9.335  -10.218 2.102   1.00 0.00 ? 31  LEU A HD21 6  
ATOM 10032 H HD22 . LEU A 1 31  ? -11.086 -10.285 1.712   1.00 0.00 ? 31  LEU A HD22 6  
ATOM 10033 H HD23 . LEU A 1 31  ? -10.398 -11.446 2.871   1.00 0.00 ? 31  LEU A HD23 6  
ATOM 10034 N N    . ARG A 1 32  ? -11.528 -11.869 -2.738  1.00 0.00 ? 32  ARG A N    6  
ATOM 10035 C CA   . ARG A 1 32  ? -12.768 -12.482 -3.167  1.00 0.00 ? 32  ARG A CA   6  
ATOM 10036 C C    . ARG A 1 32  ? -12.698 -13.232 -4.475  1.00 0.00 ? 32  ARG A C    6  
ATOM 10037 O O    . ARG A 1 32  ? -13.189 -14.353 -4.540  1.00 0.00 ? 32  ARG A O    6  
ATOM 10038 C CB   . ARG A 1 32  ? -13.863 -11.417 -3.196  1.00 0.00 ? 32  ARG A CB   6  
ATOM 10039 C CG   . ARG A 1 32  ? -14.168 -11.000 -1.758  1.00 0.00 ? 32  ARG A CG   6  
ATOM 10040 C CD   . ARG A 1 32  ? -15.175 -9.850  -1.646  1.00 0.00 ? 32  ARG A CD   6  
ATOM 10041 N NE   . ARG A 1 32  ? -14.855 -8.730  -2.600  1.00 0.00 ? 32  ARG A NE   6  
ATOM 10042 C CZ   . ARG A 1 32  ? -15.451 -7.499  -2.557  1.00 0.00 ? 32  ARG A CZ   6  
ATOM 10043 N NH1  . ARG A 1 32  ? -16.380 -7.200  -1.603  1.00 0.00 ? 32  ARG A NH1  6  
ATOM 10044 N NH2  . ARG A 1 32  ? -15.098 -6.553  -3.476  1.00 0.00 ? 32  ARG A NH2  6  
ATOM 10045 H H    . ARG A 1 32  ? -11.534 -10.860 -2.844  1.00 0.00 ? 32  ARG A H    6  
ATOM 10046 H HA   . ARG A 1 32  ? -13.065 -13.220 -2.426  1.00 0.00 ? 32  ARG A HA   6  
ATOM 10047 H HB2  . ARG A 1 32  ? -13.501 -10.540 -3.780  1.00 0.00 ? 32  ARG A HB2  6  
ATOM 10048 H HB3  . ARG A 1 32  ? -14.812 -11.792 -3.646  1.00 0.00 ? 32  ARG A HB3  6  
ATOM 10049 H HG2  . ARG A 1 32  ? -14.549 -11.936 -1.283  1.00 0.00 ? 32  ARG A HG2  6  
ATOM 10050 H HG3  . ARG A 1 32  ? -13.255 -10.711 -1.195  1.00 0.00 ? 32  ARG A HG3  6  
ATOM 10051 H HD2  . ARG A 1 32  ? -16.136 -10.275 -1.955  1.00 0.00 ? 32  ARG A HD2  6  
ATOM 10052 H HD3  . ARG A 1 32  ? -15.226 -9.470  -0.604  1.00 0.00 ? 32  ARG A HD3  6  
ATOM 10053 H HE   . ARG A 1 32  ? -14.172 -8.902  -3.310  1.00 0.00 ? 32  ARG A HE   6  
ATOM 10054 H HH11 . ARG A 1 32  ? -16.638 -7.889  -0.926  1.00 0.00 ? 32  ARG A HH11 6  
ATOM 10055 H HH12 . ARG A 1 32  ? -16.802 -6.294  -1.582  1.00 0.00 ? 32  ARG A HH12 6  
ATOM 10056 H HH21 . ARG A 1 32  ? -14.411 -6.767  -4.173  1.00 0.00 ? 32  ARG A HH21 6  
ATOM 10057 H HH22 . ARG A 1 32  ? -15.521 -5.648  -3.453  1.00 0.00 ? 32  ARG A HH22 6  
ATOM 10058 N N    . ARG A 1 33  ? -12.068 -12.678 -5.555  1.00 0.00 ? 33  ARG A N    6  
ATOM 10059 C CA   . ARG A 1 33  ? -11.881 -13.387 -6.830  1.00 0.00 ? 33  ARG A CA   6  
ATOM 10060 C C    . ARG A 1 33  ? -10.909 -14.503 -6.856  1.00 0.00 ? 33  ARG A C    6  
ATOM 10061 O O    . ARG A 1 33  ? -11.197 -15.575 -7.378  1.00 0.00 ? 33  ARG A O    6  
ATOM 10062 C CB   . ARG A 1 33  ? -11.613 -12.492 -8.052  1.00 0.00 ? 33  ARG A CB   6  
ATOM 10063 C CG   . ARG A 1 33  ? -10.556 -11.384 -7.955  1.00 0.00 ? 33  ARG A CG   6  
ATOM 10064 C CD   . ARG A 1 33  ? -9.723  -11.165 -9.216  1.00 0.00 ? 33  ARG A CD   6  
ATOM 10065 N NE   . ARG A 1 33  ? -8.887  -9.935  -8.998  1.00 0.00 ? 33  ARG A NE   6  
ATOM 10066 C CZ   . ARG A 1 33  ? -8.140  -9.357  -9.989  1.00 0.00 ? 33  ARG A CZ   6  
ATOM 10067 N NH1  . ARG A 1 33  ? -8.078  -9.917  -11.232 1.00 0.00 ? 33  ARG A NH1  6  
ATOM 10068 N NH2  . ARG A 1 33  ? -7.441  -8.214  -9.725  1.00 0.00 ? 33  ARG A NH2  6  
ATOM 10069 H H    . ARG A 1 33  ? -11.651 -11.761 -5.491  1.00 0.00 ? 33  ARG A H    6  
ATOM 10070 H HA   . ARG A 1 33  ? -12.815 -13.875 -7.065  1.00 0.00 ? 33  ARG A HA   6  
ATOM 10071 H HB2  . ARG A 1 33  ? -11.732 -12.956 -9.043  1.00 0.00 ? 33  ARG A HB2  6  
ATOM 10072 H HB3  . ARG A 1 33  ? -12.552 -11.984 -8.080  1.00 0.00 ? 33  ARG A HB3  6  
ATOM 10073 H HG2  . ARG A 1 33  ? -11.111 -10.435 -7.755  1.00 0.00 ? 33  ARG A HG2  6  
ATOM 10074 H HG3  . ARG A 1 33  ? -9.898  -11.573 -7.081  1.00 0.00 ? 33  ARG A HG3  6  
ATOM 10075 H HD2  . ARG A 1 33  ? -9.055  -12.031 -9.400  1.00 0.00 ? 33  ARG A HD2  6  
ATOM 10076 H HD3  . ARG A 1 33  ? -10.395 -11.003 -10.088 1.00 0.00 ? 33  ARG A HD3  6  
ATOM 10077 H HE   . ARG A 1 33  ? -8.903  -9.502  -8.097  1.00 0.00 ? 33  ARG A HE   6  
ATOM 10078 H HH11 . ARG A 1 33  ? -8.585  -10.757 -11.426 1.00 0.00 ? 33  ARG A HH11 6  
ATOM 10079 H HH12 . ARG A 1 33  ? -7.528  -9.487  -11.946 1.00 0.00 ? 33  ARG A HH12 6  
ATOM 10080 H HH21 . ARG A 1 33  ? -7.482  -7.805  -8.814  1.00 0.00 ? 33  ARG A HH21 6  
ATOM 10081 H HH22 . ARG A 1 33  ? -6.892  -7.788  -10.443 1.00 0.00 ? 33  ARG A HH22 6  
ATOM 10082 N N    . ARG A 1 34  ? -9.700  -14.268 -6.315  1.00 0.00 ? 34  ARG A N    6  
ATOM 10083 C CA   . ARG A 1 34  ? -8.657  -15.252 -6.369  1.00 0.00 ? 34  ARG A CA   6  
ATOM 10084 C C    . ARG A 1 34  ? -8.730  -16.320 -5.271  1.00 0.00 ? 34  ARG A C    6  
ATOM 10085 O O    . ARG A 1 34  ? -8.302  -17.459 -5.457  1.00 0.00 ? 34  ARG A O    6  
ATOM 10086 C CB   . ARG A 1 34  ? -7.297  -14.561 -6.466  1.00 0.00 ? 34  ARG A CB   6  
ATOM 10087 C CG   . ARG A 1 34  ? -7.310  -13.503 -7.583  1.00 0.00 ? 34  ARG A CG   6  
ATOM 10088 C CD   . ARG A 1 34  ? -5.932  -13.432 -8.232  1.00 0.00 ? 34  ARG A CD   6  
ATOM 10089 N NE   . ARG A 1 34  ? -5.863  -12.261 -9.175  1.00 0.00 ? 34  ARG A NE   6  
ATOM 10090 C CZ   . ARG A 1 34  ? -4.709  -11.562 -9.425  1.00 0.00 ? 34  ARG A CZ   6  
ATOM 10091 N NH1  . ARG A 1 34  ? -3.541  -11.879 -8.795  1.00 0.00 ? 34  ARG A NH1  6  
ATOM 10092 N NH2  . ARG A 1 34  ? -4.730  -10.526 -10.313 1.00 0.00 ? 34  ARG A NH2  6  
ATOM 10093 H H    . ARG A 1 34  ? -9.444  -13.397 -5.887  1.00 0.00 ? 34  ARG A H    6  
ATOM 10094 H HA   . ARG A 1 34  ? -8.725  -15.708 -7.347  1.00 0.00 ? 34  ARG A HA   6  
ATOM 10095 H HB2  . ARG A 1 34  ? -7.014  -14.071 -5.514  1.00 0.00 ? 34  ARG A HB2  6  
ATOM 10096 H HB3  . ARG A 1 34  ? -6.521  -15.326 -6.702  1.00 0.00 ? 34  ARG A HB3  6  
ATOM 10097 H HG2  . ARG A 1 34  ? -8.064  -13.779 -8.362  1.00 0.00 ? 34  ARG A HG2  6  
ATOM 10098 H HG3  . ARG A 1 34  ? -7.630  -12.519 -7.168  1.00 0.00 ? 34  ARG A HG3  6  
ATOM 10099 H HD2  . ARG A 1 34  ? -5.168  -13.349 -7.429  1.00 0.00 ? 34  ARG A HD2  6  
ATOM 10100 H HD3  . ARG A 1 34  ? -5.793  -14.383 -8.799  1.00 0.00 ? 34  ARG A HD3  6  
ATOM 10101 H HE   . ARG A 1 34  ? -6.698  -11.987 -9.653  1.00 0.00 ? 34  ARG A HE   6  
ATOM 10102 H HH11 . ARG A 1 34  ? -3.517  -12.631 -8.137  1.00 0.00 ? 34  ARG A HH11 6  
ATOM 10103 H HH12 . ARG A 1 34  ? -2.712  -11.355 -8.986  1.00 0.00 ? 34  ARG A HH12 6  
ATOM 10104 H HH21 . ARG A 1 34  ? -5.583  -10.280 -10.774 1.00 0.00 ? 34  ARG A HH21 6  
ATOM 10105 H HH22 . ARG A 1 34  ? -3.895  -10.007 -10.496 1.00 0.00 ? 34  ARG A HH22 6  
ATOM 10106 N N    . PHE A 1 35  ? -9.257  -15.939 -4.074  1.00 0.00 ? 35  PHE A N    6  
ATOM 10107 C CA   . PHE A 1 35  ? -9.286  -16.791 -2.897  1.00 0.00 ? 35  PHE A CA   6  
ATOM 10108 C C    . PHE A 1 35  ? -10.714 -17.234 -2.492  1.00 0.00 ? 35  PHE A C    6  
ATOM 10109 O O    . PHE A 1 35  ? -10.833 -18.289 -1.861  1.00 0.00 ? 35  PHE A O    6  
ATOM 10110 C CB   . PHE A 1 35  ? -8.456  -16.177 -1.694  1.00 0.00 ? 35  PHE A CB   6  
ATOM 10111 C CG   . PHE A 1 35  ? -7.044  -15.714 -2.023  1.00 0.00 ? 35  PHE A CG   6  
ATOM 10112 C CD1  . PHE A 1 35  ? -5.960  -16.314 -1.404  1.00 0.00 ? 35  PHE A CD1  6  
ATOM 10113 C CD2  . PHE A 1 35  ? -6.768  -14.630 -2.843  1.00 0.00 ? 35  PHE A CD2  6  
ATOM 10114 C CE1  . PHE A 1 35  ? -4.677  -15.886 -1.629  1.00 0.00 ? 35  PHE A CE1  6  
ATOM 10115 C CE2  . PHE A 1 35  ? -5.475  -14.227 -3.117  1.00 0.00 ? 35  PHE A CE2  6  
ATOM 10116 C CZ   . PHE A 1 35  ? -4.418  -14.854 -2.498  1.00 0.00 ? 35  PHE A CZ   6  
ATOM 10117 H H    . PHE A 1 35  ? -9.591  -15.006 -3.934  1.00 0.00 ? 35  PHE A H    6  
ATOM 10118 H HA   . PHE A 1 35  ? -8.781  -17.730 -3.107  1.00 0.00 ? 35  PHE A HA   6  
ATOM 10119 H HB2  . PHE A 1 35  ? -8.991  -15.292 -1.271  1.00 0.00 ? 35  PHE A HB2  6  
ATOM 10120 H HB3  . PHE A 1 35  ? -8.292  -16.965 -0.917  1.00 0.00 ? 35  PHE A HB3  6  
ATOM 10121 H HD1  . PHE A 1 35  ? -6.086  -17.120 -0.699  1.00 0.00 ? 35  PHE A HD1  6  
ATOM 10122 H HD2  . PHE A 1 35  ? -7.581  -14.096 -3.300  1.00 0.00 ? 35  PHE A HD2  6  
ATOM 10123 H HE1  . PHE A 1 35  ? -3.893  -16.378 -1.083  1.00 0.00 ? 35  PHE A HE1  6  
ATOM 10124 H HE2  . PHE A 1 35  ? -5.292  -13.424 -3.824  1.00 0.00 ? 35  PHE A HE2  6  
ATOM 10125 H HZ   . PHE A 1 35  ? -3.402  -14.529 -2.673  1.00 0.00 ? 35  PHE A HZ   6  
ATOM 10126 N N    . GLY A 1 36  ? -11.856 -16.480 -2.772  1.00 0.00 ? 36  GLY A N    6  
ATOM 10127 C CA   . GLY A 1 36  ? -13.214 -16.816 -2.323  1.00 0.00 ? 36  GLY A CA   6  
ATOM 10128 C C    . GLY A 1 36  ? -13.401 -16.643 -0.867  1.00 0.00 ? 36  GLY A C    6  
ATOM 10129 O O    . GLY A 1 36  ? -13.391 -15.522 -0.391  1.00 0.00 ? 36  GLY A O    6  
ATOM 10130 H H    . GLY A 1 36  ? -11.928 -15.603 -3.274  1.00 0.00 ? 36  GLY A H    6  
ATOM 10131 H HA2  . GLY A 1 36  ? -13.862 -16.046 -2.727  1.00 0.00 ? 36  GLY A HA2  6  
ATOM 10132 H HA3  . GLY A 1 36  ? -13.433 -17.850 -2.542  1.00 0.00 ? 36  GLY A HA3  6  
ATOM 10133 N N    . THR A 1 37  ? -13.515 -17.747 -0.102  1.00 0.00 ? 37  THR A N    6  
ATOM 10134 C CA   . THR A 1 37  ? -13.450 -17.644 1.339   1.00 0.00 ? 37  THR A CA   6  
ATOM 10135 C C    . THR A 1 37  ? -12.519 -18.811 1.659   1.00 0.00 ? 37  THR A C    6  
ATOM 10136 O O    . THR A 1 37  ? -12.918 -19.972 1.592   1.00 0.00 ? 37  THR A O    6  
ATOM 10137 C CB   . THR A 1 37  ? -14.848 -17.765 1.982   1.00 0.00 ? 37  THR A CB   6  
ATOM 10138 O OG1  . THR A 1 37  ? -15.587 -18.852 1.437   1.00 0.00 ? 37  THR A OG1  6  
ATOM 10139 C CG2  . THR A 1 37  ? -15.713 -16.510 1.753   1.00 0.00 ? 37  THR A CG2  6  
ATOM 10140 H H    . THR A 1 37  ? -13.527 -18.668 -0.492  1.00 0.00 ? 37  THR A H    6  
ATOM 10141 H HA   . THR A 1 37  ? -12.974 -16.735 1.685   1.00 0.00 ? 37  THR A HA   6  
ATOM 10142 H HB   . THR A 1 37  ? -14.774 -17.900 3.083   1.00 0.00 ? 37  THR A HB   6  
ATOM 10143 H HG1  . THR A 1 37  ? -14.975 -19.602 1.448   1.00 0.00 ? 37  THR A HG1  6  
ATOM 10144 H HG21 . THR A 1 37  ? -15.869 -16.293 0.680   1.00 0.00 ? 37  THR A HG21 6  
ATOM 10145 H HG22 . THR A 1 37  ? -16.698 -16.673 2.226   1.00 0.00 ? 37  THR A HG22 6  
ATOM 10146 H HG23 . THR A 1 37  ? -15.354 -15.574 2.223   1.00 0.00 ? 37  THR A HG23 6  
ATOM 10147 N N    . LYS A 1 38  ? -11.277 -18.501 2.062   1.00 0.00 ? 38  LYS A N    6  
ATOM 10148 C CA   . LYS A 1 38  ? -10.234 -19.462 2.372   1.00 0.00 ? 38  LYS A CA   6  
ATOM 10149 C C    . LYS A 1 38  ? -9.450  -18.989 3.566   1.00 0.00 ? 38  LYS A C    6  
ATOM 10150 O O    . LYS A 1 38  ? -9.076  -17.824 3.635   1.00 0.00 ? 38  LYS A O    6  
ATOM 10151 C CB   . LYS A 1 38  ? -9.210  -19.587 1.208   1.00 0.00 ? 38  LYS A CB   6  
ATOM 10152 C CG   . LYS A 1 38  ? -8.091  -20.598 1.525   1.00 0.00 ? 38  LYS A CG   6  
ATOM 10153 C CD   . LYS A 1 38  ? -7.241  -21.059 0.348   1.00 0.00 ? 38  LYS A CD   6  
ATOM 10154 C CE   . LYS A 1 38  ? -6.606  -19.923 -0.461  1.00 0.00 ? 38  LYS A CE   6  
ATOM 10155 N NZ   . LYS A 1 38  ? -5.748  -20.456 -1.545  1.00 0.00 ? 38  LYS A NZ   6  
ATOM 10156 H H    . LYS A 1 38  ? -11.005 -17.550 2.011   1.00 0.00 ? 38  LYS A H    6  
ATOM 10157 H HA   . LYS A 1 38  ? -10.607 -20.463 2.551   1.00 0.00 ? 38  LYS A HA   6  
ATOM 10158 H HB2  . LYS A 1 38  ? -9.759  -19.920 0.303   1.00 0.00 ? 38  LYS A HB2  6  
ATOM 10159 H HB3  . LYS A 1 38  ? -8.764  -18.595 0.964   1.00 0.00 ? 38  LYS A HB3  6  
ATOM 10160 H HG2  . LYS A 1 38  ? -7.381  -20.156 2.258   1.00 0.00 ? 38  LYS A HG2  6  
ATOM 10161 H HG3  . LYS A 1 38  ? -8.553  -21.497 1.995   1.00 0.00 ? 38  LYS A HG3  6  
ATOM 10162 H HD2  . LYS A 1 38  ? -6.430  -21.689 0.786   1.00 0.00 ? 38  LYS A HD2  6  
ATOM 10163 H HD3  . LYS A 1 38  ? -7.905  -21.671 -0.299  1.00 0.00 ? 38  LYS A HD3  6  
ATOM 10164 H HE2  . LYS A 1 38  ? -7.382  -19.286 -0.934  1.00 0.00 ? 38  LYS A HE2  6  
ATOM 10165 H HE3  . LYS A 1 38  ? -5.963  -19.296 0.195   1.00 0.00 ? 38  LYS A HE3  6  
ATOM 10166 H HZ1  . LYS A 1 38  ? -4.996  -21.046 -1.134  1.00 0.00 ? 38  LYS A HZ1  6  
ATOM 10167 H HZ2  . LYS A 1 38  ? -6.325  -21.030 -2.193  1.00 0.00 ? 38  LYS A HZ2  6  
ATOM 10168 H HZ3  . LYS A 1 38  ? -5.322  -19.665 -2.069  1.00 0.00 ? 38  LYS A HZ3  6  
ATOM 10169 N N    . ARG A 1 39  ? -9.058  -19.901 4.511   1.00 0.00 ? 39  ARG A N    6  
ATOM 10170 C CA   . ARG A 1 39  ? -8.092  -19.606 5.578   1.00 0.00 ? 39  ARG A CA   6  
ATOM 10171 C C    . ARG A 1 39  ? -6.669  -19.467 4.968   1.00 0.00 ? 39  ARG A C    6  
ATOM 10172 O O    . ARG A 1 39  ? -6.106  -20.392 4.391   1.00 0.00 ? 39  ARG A O    6  
ATOM 10173 C CB   . ARG A 1 39  ? -8.132  -20.584 6.783   1.00 0.00 ? 39  ARG A CB   6  
ATOM 10174 C CG   . ARG A 1 39  ? -7.410  -21.937 6.657   1.00 0.00 ? 39  ARG A CG   6  
ATOM 10175 C CD   . ARG A 1 39  ? -8.016  -22.919 5.639   1.00 0.00 ? 39  ARG A CD   6  
ATOM 10176 N NE   . ARG A 1 39  ? -9.440  -23.224 6.029   1.00 0.00 ? 39  ARG A NE   6  
ATOM 10177 C CZ   . ARG A 1 39  ? -10.429 -23.522 5.129   1.00 0.00 ? 39  ARG A CZ   6  
ATOM 10178 N NH1  . ARG A 1 39  ? -10.189 -23.512 3.786   1.00 0.00 ? 39  ARG A NH1  6  
ATOM 10179 N NH2  . ARG A 1 39  ? -11.680 -23.826 5.585   1.00 0.00 ? 39  ARG A NH2  6  
ATOM 10180 H H    . ARG A 1 39  ? -9.351  -20.847 4.442   1.00 0.00 ? 39  ARG A H    6  
ATOM 10181 H HA   . ARG A 1 39  ? -8.427  -18.672 6.024   1.00 0.00 ? 39  ARG A HA   6  
ATOM 10182 H HB2  . ARG A 1 39  ? -7.670  -20.061 7.652   1.00 0.00 ? 39  ARG A HB2  6  
ATOM 10183 H HB3  . ARG A 1 39  ? -9.195  -20.763 7.054   1.00 0.00 ? 39  ARG A HB3  6  
ATOM 10184 H HG2  . ARG A 1 39  ? -6.336  -21.784 6.407   1.00 0.00 ? 39  ARG A HG2  6  
ATOM 10185 H HG3  . ARG A 1 39  ? -7.411  -22.363 7.675   1.00 0.00 ? 39  ARG A HG3  6  
ATOM 10186 H HD2  . ARG A 1 39  ? -7.967  -22.476 4.622   1.00 0.00 ? 39  ARG A HD2  6  
ATOM 10187 H HD3  . ARG A 1 39  ? -7.445  -23.868 5.653   1.00 0.00 ? 39  ARG A HD3  6  
ATOM 10188 H HE   . ARG A 1 39  ? -9.668  -23.236 7.002   1.00 0.00 ? 39  ARG A HE   6  
ATOM 10189 H HH11 . ARG A 1 39  ? -9.277  -23.287 3.445   1.00 0.00 ? 39  ARG A HH11 6  
ATOM 10190 H HH12 . ARG A 1 39  ? -10.925 -23.726 3.144   1.00 0.00 ? 39  ARG A HH12 6  
ATOM 10191 H HH21 . ARG A 1 39  ? -11.865 -23.832 6.568   1.00 0.00 ? 39  ARG A HH21 6  
ATOM 10192 H HH22 . ARG A 1 39  ? -12.412 -24.038 4.937   1.00 0.00 ? 39  ARG A HH22 6  
ATOM 10193 N N    . VAL A 1 40  ? -6.110  -18.253 4.958   1.00 0.00 ? 40  VAL A N    6  
ATOM 10194 C CA   . VAL A 1 40  ? -4.920  -17.903 4.183   1.00 0.00 ? 40  VAL A CA   6  
ATOM 10195 C C    . VAL A 1 40  ? -4.163  -16.864 4.982   1.00 0.00 ? 40  VAL A C    6  
ATOM 10196 O O    . VAL A 1 40  ? -4.770  -16.187 5.812   1.00 0.00 ? 40  VAL A O    6  
ATOM 10197 C CB   . VAL A 1 40  ? -5.263  -17.426 2.753   1.00 0.00 ? 40  VAL A CB   6  
ATOM 10198 C CG1  . VAL A 1 40  ? -6.009  -16.075 2.697   1.00 0.00 ? 40  VAL A CG1  6  
ATOM 10199 C CG2  . VAL A 1 40  ? -4.027  -17.385 1.829   1.00 0.00 ? 40  VAL A CG2  6  
ATOM 10200 H H    . VAL A 1 40  ? -6.618  -17.515 5.419   1.00 0.00 ? 40  VAL A H    6  
ATOM 10201 H HA   . VAL A 1 40  ? -4.292  -18.783 4.073   1.00 0.00 ? 40  VAL A HA   6  
ATOM 10202 H HB   . VAL A 1 40  ? -5.949  -18.195 2.327   1.00 0.00 ? 40  VAL A HB   6  
ATOM 10203 H HG11 . VAL A 1 40  ? -6.885  -16.076 3.381   1.00 0.00 ? 40  VAL A HG11 6  
ATOM 10204 H HG12 . VAL A 1 40  ? -5.314  -15.242 2.951   1.00 0.00 ? 40  VAL A HG12 6  
ATOM 10205 H HG13 . VAL A 1 40  ? -6.373  -15.899 1.657   1.00 0.00 ? 40  VAL A HG13 6  
ATOM 10206 H HG21 . VAL A 1 40  ? -3.463  -18.339 1.860   1.00 0.00 ? 40  VAL A HG21 6  
ATOM 10207 H HG22 . VAL A 1 40  ? -4.364  -17.225 0.783   1.00 0.00 ? 40  VAL A HG22 6  
ATOM 10208 H HG23 . VAL A 1 40  ? -3.352  -16.544 2.090   1.00 0.00 ? 40  VAL A HG23 6  
ATOM 10209 N N    . HIS A 1 41  ? -2.820  -16.696 4.789   1.00 0.00 ? 41  HIS A N    6  
ATOM 10210 C CA   . HIS A 1 41  ? -2.026  -15.670 5.468   1.00 0.00 ? 41  HIS A CA   6  
ATOM 10211 C C    . HIS A 1 41  ? -2.117  -14.378 4.675   1.00 0.00 ? 41  HIS A C    6  
ATOM 10212 O O    . HIS A 1 41  ? -1.724  -14.272 3.517   1.00 0.00 ? 41  HIS A O    6  
ATOM 10213 C CB   . HIS A 1 41  ? -0.530  -16.051 5.717   1.00 0.00 ? 41  HIS A CB   6  
ATOM 10214 C CG   . HIS A 1 41  ? 0.218   -15.088 6.627   1.00 0.00 ? 41  HIS A CG   6  
ATOM 10215 N ND1  . HIS A 1 41  ? 0.778   -13.878 6.265   1.00 0.00 ? 41  HIS A ND1  6  
ATOM 10216 C CD2  . HIS A 1 41  ? 0.310   -15.133 7.978   1.00 0.00 ? 41  HIS A CD2  6  
ATOM 10217 C CE1  . HIS A 1 41  ? 1.131   -13.234 7.412   1.00 0.00 ? 41  HIS A CE1  6  
ATOM 10218 N NE2  . HIS A 1 41  ? 0.847   -13.955 8.481   1.00 0.00 ? 41  HIS A NE2  6  
ATOM 10219 H H    . HIS A 1 41  ? -2.355  -17.249 4.100   1.00 0.00 ? 41  HIS A H    6  
ATOM 10220 H HA   . HIS A 1 41  ? -2.447  -15.487 6.453   1.00 0.00 ? 41  HIS A HA   6  
ATOM 10221 H HB2  . HIS A 1 41  ? -0.514  -17.040 6.223   1.00 0.00 ? 41  HIS A HB2  6  
ATOM 10222 H HB3  . HIS A 1 41  ? 0.012   -16.182 4.765   1.00 0.00 ? 41  HIS A HB3  6  
ATOM 10223 H HD1  . HIS A 1 41  ? 1.040   -13.632 5.334   1.00 0.00 ? 41  HIS A HD1  6  
ATOM 10224 H HD2  . HIS A 1 41  ? 0.051   -15.972 8.601   1.00 0.00 ? 41  HIS A HD2  6  
ATOM 10225 H HE1  . HIS A 1 41  ? 1.602   -12.236 7.429   1.00 0.00 ? 41  HIS A HE1  6  
ATOM 10226 N N    . ASN A 1 42  ? -2.638  -13.311 5.315   1.00 0.00 ? 42  ASN A N    6  
ATOM 10227 C CA   . ASN A 1 42  ? -2.882  -11.950 4.837   1.00 0.00 ? 42  ASN A CA   6  
ATOM 10228 C C    . ASN A 1 42  ? -1.694  -11.239 4.187   1.00 0.00 ? 42  ASN A C    6  
ATOM 10229 O O    . ASN A 1 42  ? -1.839  -10.457 3.254   1.00 0.00 ? 42  ASN A O    6  
ATOM 10230 C CB   . ASN A 1 42  ? -3.329  -11.221 6.121   1.00 0.00 ? 42  ASN A CB   6  
ATOM 10231 C CG   . ASN A 1 42  ? -3.919  -9.803  6.066   1.00 0.00 ? 42  ASN A CG   6  
ATOM 10232 O OD1  . ASN A 1 42  ? -4.934  -9.616  6.742   1.00 0.00 ? 42  ASN A OD1  6  
ATOM 10233 N ND2  . ASN A 1 42  ? -3.300  -8.835  5.348   1.00 0.00 ? 42  ASN A ND2  6  
ATOM 10234 H H    . ASN A 1 42  ? -2.949  -13.457 6.250   1.00 0.00 ? 42  ASN A H    6  
ATOM 10235 H HA   . ASN A 1 42  ? -3.690  -11.982 4.114   1.00 0.00 ? 42  ASN A HA   6  
ATOM 10236 H HB2  . ASN A 1 42  ? -4.172  -11.837 6.544   1.00 0.00 ? 42  ASN A HB2  6  
ATOM 10237 H HB3  . ASN A 1 42  ? -2.474  -11.212 6.841   1.00 0.00 ? 42  ASN A HB3  6  
ATOM 10238 H HD21 . ASN A 1 42  ? -2.469  -9.053  4.839   1.00 0.00 ? 42  ASN A HD21 6  
ATOM 10239 H HD22 . ASN A 1 42  ? -3.787  -7.975  5.210   1.00 0.00 ? 42  ASN A HD22 6  
ATOM 10240 N N    . ASN A 1 43  ? -0.448  -11.527 4.658   1.00 0.00 ? 43  ASN A N    6  
ATOM 10241 C CA   . ASN A 1 43  ? 0.786   -10.979 4.075   1.00 0.00 ? 43  ASN A CA   6  
ATOM 10242 C C    . ASN A 1 43  ? 1.086   -11.604 2.697   1.00 0.00 ? 43  ASN A C    6  
ATOM 10243 O O    . ASN A 1 43  ? 1.577   -10.911 1.816   1.00 0.00 ? 43  ASN A O    6  
ATOM 10244 C CB   . ASN A 1 43  ? 1.975   -10.920 5.088   1.00 0.00 ? 43  ASN A CB   6  
ATOM 10245 C CG   . ASN A 1 43  ? 3.066   -9.882  4.753   1.00 0.00 ? 43  ASN A CG   6  
ATOM 10246 O OD1  . ASN A 1 43  ? 4.153   -10.287 4.343   1.00 0.00 ? 43  ASN A OD1  6  
ATOM 10247 N ND2  . ASN A 1 43  ? 2.797   -8.566  4.971   1.00 0.00 ? 43  ASN A ND2  6  
ATOM 10248 H H    . ASN A 1 43  ? -0.384  -12.167 5.426   1.00 0.00 ? 43  ASN A H    6  
ATOM 10249 H HA   . ASN A 1 43  ? 0.586   -9.945  3.831   1.00 0.00 ? 43  ASN A HA   6  
ATOM 10250 H HB2  . ASN A 1 43  ? 1.575   -10.652 6.088   1.00 0.00 ? 43  ASN A HB2  6  
ATOM 10251 H HB3  . ASN A 1 43  ? 2.473   -11.910 5.175   1.00 0.00 ? 43  ASN A HB3  6  
ATOM 10252 H HD21 . ASN A 1 43  ? 2.002   -8.237  5.472   1.00 0.00 ? 43  ASN A HD21 6  
ATOM 10253 H HD22 . ASN A 1 43  ? 3.519   -7.937  4.717   1.00 0.00 ? 43  ASN A HD22 6  
ATOM 10254 N N    . ILE A 1 44  ? 0.633   -12.879 2.449   1.00 0.00 ? 44  ILE A N    6  
ATOM 10255 C CA   . ILE A 1 44  ? 0.616   -13.611 1.162   1.00 0.00 ? 44  ILE A CA   6  
ATOM 10256 C C    . ILE A 1 44  ? -0.346  -12.941 0.198   1.00 0.00 ? 44  ILE A C    6  
ATOM 10257 O O    . ILE A 1 44  ? -0.061  -12.760 -0.980  1.00 0.00 ? 44  ILE A O    6  
ATOM 10258 C CB   . ILE A 1 44  ? 0.220   -15.087 1.307   1.00 0.00 ? 44  ILE A CB   6  
ATOM 10259 C CG1  . ILE A 1 44  ? 1.211   -15.731 2.307   1.00 0.00 ? 44  ILE A CG1  6  
ATOM 10260 C CG2  . ILE A 1 44  ? 0.126   -15.824 -0.067  1.00 0.00 ? 44  ILE A CG2  6  
ATOM 10261 C CD1  . ILE A 1 44  ? 1.062   -17.246 2.362   1.00 0.00 ? 44  ILE A CD1  6  
ATOM 10262 H H    . ILE A 1 44  ? 0.161   -13.380 3.171   1.00 0.00 ? 44  ILE A H    6  
ATOM 10263 H HA   . ILE A 1 44  ? 1.606   -13.616 0.733   1.00 0.00 ? 44  ILE A HA   6  
ATOM 10264 H HB   . ILE A 1 44  ? -0.807  -15.195 1.733   1.00 0.00 ? 44  ILE A HB   6  
ATOM 10265 H HG12 . ILE A 1 44  ? 2.255   -15.483 2.028   1.00 0.00 ? 44  ILE A HG12 6  
ATOM 10266 H HG13 . ILE A 1 44  ? 1.049   -15.319 3.335   1.00 0.00 ? 44  ILE A HG13 6  
ATOM 10267 H HG21 . ILE A 1 44  ? 1.042   -15.656 -0.665  1.00 0.00 ? 44  ILE A HG21 6  
ATOM 10268 H HG22 . ILE A 1 44  ? -0.038  -16.913 0.062   1.00 0.00 ? 44  ILE A HG22 6  
ATOM 10269 H HG23 . ILE A 1 44  ? -0.762  -15.484 -0.650  1.00 0.00 ? 44  ILE A HG23 6  
ATOM 10270 H HD11 . ILE A 1 44  ? -0.014  -17.513 2.470   1.00 0.00 ? 44  ILE A HD11 6  
ATOM 10271 H HD12 . ILE A 1 44  ? 1.442   -17.692 1.417   1.00 0.00 ? 44  ILE A HD12 6  
ATOM 10272 H HD13 . ILE A 1 44  ? 1.636   -17.669 3.211   1.00 0.00 ? 44  ILE A HD13 6  
ATOM 10273 N N    . VAL A 1 45  ? -1.514  -12.514 0.745   1.00 0.00 ? 45  VAL A N    6  
ATOM 10274 C CA   . VAL A 1 45  ? -2.585  -11.812 0.016   1.00 0.00 ? 45  VAL A CA   6  
ATOM 10275 C C    . VAL A 1 45  ? -2.208  -10.357 -0.314  1.00 0.00 ? 45  VAL A C    6  
ATOM 10276 O O    . VAL A 1 45  ? -2.457  -9.877  -1.419  1.00 0.00 ? 45  VAL A O    6  
ATOM 10277 C CB   . VAL A 1 45  ? -3.943  -11.923 0.715   1.00 0.00 ? 45  VAL A CB   6  
ATOM 10278 C CG1  . VAL A 1 45  ? -5.076  -11.424 -0.205  1.00 0.00 ? 45  VAL A CG1  6  
ATOM 10279 C CG2  . VAL A 1 45  ? -4.234  -13.391 1.079   1.00 0.00 ? 45  VAL A CG2  6  
ATOM 10280 H H    . VAL A 1 45  ? -1.605  -12.682 1.735   1.00 0.00 ? 45  VAL A H    6  
ATOM 10281 H HA   . VAL A 1 45  ? -2.709  -12.303 -0.946  1.00 0.00 ? 45  VAL A HA   6  
ATOM 10282 H HB   . VAL A 1 45  ? -3.943  -11.339 1.664   1.00 0.00 ? 45  VAL A HB   6  
ATOM 10283 H HG11 . VAL A 1 45  ? -5.030  -11.924 -1.196  1.00 0.00 ? 45  VAL A HG11 6  
ATOM 10284 H HG12 . VAL A 1 45  ? -6.065  -11.636 0.248   1.00 0.00 ? 45  VAL A HG12 6  
ATOM 10285 H HG13 . VAL A 1 45  ? -5.018  -10.330 -0.367  1.00 0.00 ? 45  VAL A HG13 6  
ATOM 10286 H HG21 . VAL A 1 45  ? -4.160  -14.039 0.185   1.00 0.00 ? 45  VAL A HG21 6  
ATOM 10287 H HG22 . VAL A 1 45  ? -3.547  -13.773 1.858   1.00 0.00 ? 45  VAL A HG22 6  
ATOM 10288 H HG23 . VAL A 1 45  ? -5.272  -13.473 1.467   1.00 0.00 ? 45  VAL A HG23 6  
ATOM 10289 N N    . TYR A 1 46  ? -1.526  -9.651  0.650   1.00 0.00 ? 46  TYR A N    6  
ATOM 10290 C CA   . TYR A 1 46  ? -0.983  -8.284  0.610   1.00 0.00 ? 46  TYR A CA   6  
ATOM 10291 C C    . TYR A 1 46  ? 0.106   -8.192  -0.398  1.00 0.00 ? 46  TYR A C    6  
ATOM 10292 O O    . TYR A 1 46  ? -0.024  -7.370  -1.289  1.00 0.00 ? 46  TYR A O    6  
ATOM 10293 C CB   . TYR A 1 46  ? -0.416  -7.845  2.005   1.00 0.00 ? 46  TYR A CB   6  
ATOM 10294 C CG   . TYR A 1 46  ? -0.421  -6.395  2.464   1.00 0.00 ? 46  TYR A CG   6  
ATOM 10295 C CD1  . TYR A 1 46  ? -0.230  -6.284  3.836   1.00 0.00 ? 46  TYR A CD1  6  
ATOM 10296 C CD2  . TYR A 1 46  ? -0.765  -5.234  1.768   1.00 0.00 ? 46  TYR A CD2  6  
ATOM 10297 C CE1  . TYR A 1 46  ? -0.701  -5.212  4.548   1.00 0.00 ? 46  TYR A CE1  6  
ATOM 10298 C CE2  . TYR A 1 46  ? -1.159  -4.134  2.501   1.00 0.00 ? 46  TYR A CE2  6  
ATOM 10299 C CZ   . TYR A 1 46  ? -1.209  -4.140  3.871   1.00 0.00 ? 46  TYR A CZ   6  
ATOM 10300 O OH   . TYR A 1 46  ? -1.860  -3.093  4.539   1.00 0.00 ? 46  TYR A OH   6  
ATOM 10301 H H    . TYR A 1 46  ? -1.367  -10.105 1.533   1.00 0.00 ? 46  TYR A H    6  
ATOM 10302 H HA   . TYR A 1 46  ? -1.787  -7.644  0.252   1.00 0.00 ? 46  TYR A HA   6  
ATOM 10303 H HB2  . TYR A 1 46  ? -1.182  -8.269  2.696   1.00 0.00 ? 46  TYR A HB2  6  
ATOM 10304 H HB3  . TYR A 1 46  ? 0.573   -8.302  2.273   1.00 0.00 ? 46  TYR A HB3  6  
ATOM 10305 H HD1  . TYR A 1 46  ? 0.164   -7.118  4.397   1.00 0.00 ? 46  TYR A HD1  6  
ATOM 10306 H HD2  . TYR A 1 46  ? -0.868  -5.097  0.694   1.00 0.00 ? 46  TYR A HD2  6  
ATOM 10307 H HE1  . TYR A 1 46  ? -0.719  -5.236  5.628   1.00 0.00 ? 46  TYR A HE1  6  
ATOM 10308 H HE2  . TYR A 1 46  ? -1.551  -3.283  1.977   1.00 0.00 ? 46  TYR A HE2  6  
ATOM 10309 H HH   . TYR A 1 46  ? -2.586  -2.839  3.954   1.00 0.00 ? 46  TYR A HH   6  
ATOM 10310 N N    . ASN A 1 47  ? 1.122   -9.114  -0.357  1.00 0.00 ? 47  ASN A N    6  
ATOM 10311 C CA   . ASN A 1 47  ? 2.199   -9.290  -1.339  1.00 0.00 ? 47  ASN A CA   6  
ATOM 10312 C C    . ASN A 1 47  ? 1.703   -9.661  -2.719  1.00 0.00 ? 47  ASN A C    6  
ATOM 10313 O O    . ASN A 1 47  ? 2.265   -9.226  -3.717  1.00 0.00 ? 47  ASN A O    6  
ATOM 10314 C CB   . ASN A 1 47  ? 3.180   -10.380 -0.892  1.00 0.00 ? 47  ASN A CB   6  
ATOM 10315 C CG   . ASN A 1 47  ? 4.058   -9.775  0.190   1.00 0.00 ? 47  ASN A CG   6  
ATOM 10316 O OD1  . ASN A 1 47  ? 4.569   -8.658  0.082   1.00 0.00 ? 47  ASN A OD1  6  
ATOM 10317 N ND2  . ASN A 1 47  ? 4.222   -10.603 1.250   1.00 0.00 ? 47  ASN A ND2  6  
ATOM 10318 H H    . ASN A 1 47  ? 1.150   -9.790  0.392   1.00 0.00 ? 47  ASN A H    6  
ATOM 10319 H HA   . ASN A 1 47  ? 2.720   -8.352  -1.463  1.00 0.00 ? 47  ASN A HA   6  
ATOM 10320 H HB2  . ASN A 1 47  ? 2.592   -11.227 -0.464  1.00 0.00 ? 47  ASN A HB2  6  
ATOM 10321 H HB3  . ASN A 1 47  ? 3.860   -10.753 -1.690  1.00 0.00 ? 47  ASN A HB3  6  
ATOM 10322 H HD21 . ASN A 1 47  ? 4.548   -11.504 0.997   1.00 0.00 ? 47  ASN A HD21 6  
ATOM 10323 H HD22 . ASN A 1 47  ? 3.418   -10.671 1.861   1.00 0.00 ? 47  ASN A HD22 6  
ATOM 10324 N N    . GLU A 1 48  ? 0.565   -10.412 -2.781  1.00 0.00 ? 48  GLU A N    6  
ATOM 10325 C CA   . GLU A 1 48  ? -0.156  -10.722 -4.029  1.00 0.00 ? 48  GLU A CA   6  
ATOM 10326 C C    . GLU A 1 48  ? -0.843  -9.495  -4.653  1.00 0.00 ? 48  GLU A C    6  
ATOM 10327 O O    . GLU A 1 48  ? -0.727  -9.248  -5.849  1.00 0.00 ? 48  GLU A O    6  
ATOM 10328 C CB   . GLU A 1 48  ? -1.184  -11.876 -3.879  1.00 0.00 ? 48  GLU A CB   6  
ATOM 10329 C CG   . GLU A 1 48  ? -1.691  -12.399 -5.237  1.00 0.00 ? 48  GLU A CG   6  
ATOM 10330 C CD   . GLU A 1 48  ? -2.284  -13.804 -5.148  1.00 0.00 ? 48  GLU A CD   6  
ATOM 10331 O OE1  . GLU A 1 48  ? -1.574  -14.718 -4.648  1.00 0.00 ? 48  GLU A OE1  6  
ATOM 10332 O OE2  . GLU A 1 48  ? -3.443  -13.987 -5.604  1.00 0.00 ? 48  GLU A OE2  6  
ATOM 10333 H H    . GLU A 1 48  ? 0.171   -10.728 -1.905  1.00 0.00 ? 48  GLU A H    6  
ATOM 10334 H HA   . GLU A 1 48  ? 0.580   -11.051 -4.754  1.00 0.00 ? 48  GLU A HA   6  
ATOM 10335 H HB2  . GLU A 1 48  ? -0.672  -12.709 -3.356  1.00 0.00 ? 48  GLU A HB2  6  
ATOM 10336 H HB3  . GLU A 1 48  ? -2.049  -11.571 -3.254  1.00 0.00 ? 48  GLU A HB3  6  
ATOM 10337 H HG2  . GLU A 1 48  ? -2.419  -11.694 -5.670  1.00 0.00 ? 48  GLU A HG2  6  
ATOM 10338 H HG3  . GLU A 1 48  ? -0.841  -12.420 -5.933  1.00 0.00 ? 48  GLU A HG3  6  
ATOM 10339 N N    . TYR A 1 49  ? -1.519  -8.670  -3.806  1.00 0.00 ? 49  TYR A N    6  
ATOM 10340 C CA   . TYR A 1 49  ? -2.170  -7.398  -4.113  1.00 0.00 ? 49  TYR A CA   6  
ATOM 10341 C C    . TYR A 1 49  ? -1.172  -6.267  -4.479  1.00 0.00 ? 49  TYR A C    6  
ATOM 10342 O O    . TYR A 1 49  ? -1.298  -5.646  -5.528  1.00 0.00 ? 49  TYR A O    6  
ATOM 10343 C CB   . TYR A 1 49  ? -3.317  -7.128  -3.069  1.00 0.00 ? 49  TYR A CB   6  
ATOM 10344 C CG   . TYR A 1 49  ? -3.450  -5.723  -2.599  1.00 0.00 ? 49  TYR A CG   6  
ATOM 10345 C CD1  . TYR A 1 49  ? -4.204  -4.778  -3.259  1.00 0.00 ? 49  TYR A CD1  6  
ATOM 10346 C CD2  . TYR A 1 49  ? -2.595  -5.332  -1.605  1.00 0.00 ? 49  TYR A CD2  6  
ATOM 10347 C CE1  . TYR A 1 49  ? -4.096  -3.463  -2.869  1.00 0.00 ? 49  TYR A CE1  6  
ATOM 10348 C CE2  . TYR A 1 49  ? -2.397  -4.011  -1.319  1.00 0.00 ? 49  TYR A CE2  6  
ATOM 10349 C CZ   . TYR A 1 49  ? -3.193  -3.069  -1.913  1.00 0.00 ? 49  TYR A CZ   6  
ATOM 10350 O OH   . TYR A 1 49  ? -3.104  -1.720  -1.549  1.00 0.00 ? 49  TYR A OH   6  
ATOM 10351 H H    . TYR A 1 49  ? -1.590  -8.929  -2.837  1.00 0.00 ? 49  TYR A H    6  
ATOM 10352 H HA   . TYR A 1 49  ? -2.737  -7.513  -5.012  1.00 0.00 ? 49  TYR A HA   6  
ATOM 10353 H HB2  . TYR A 1 49  ? -4.298  -7.417  -3.504  1.00 0.00 ? 49  TYR A HB2  6  
ATOM 10354 H HB3  . TYR A 1 49  ? -3.136  -7.761  -2.170  1.00 0.00 ? 49  TYR A HB3  6  
ATOM 10355 H HD1  . TYR A 1 49  ? -4.806  -5.030  -4.124  1.00 0.00 ? 49  TYR A HD1  6  
ATOM 10356 H HD2  . TYR A 1 49  ? -1.971  -6.069  -1.141  1.00 0.00 ? 49  TYR A HD2  6  
ATOM 10357 H HE1  . TYR A 1 49  ? -4.678  -2.730  -3.383  1.00 0.00 ? 49  TYR A HE1  6  
ATOM 10358 H HE2  . TYR A 1 49  ? -1.593  -3.762  -0.650  1.00 0.00 ? 49  TYR A HE2  6  
ATOM 10359 H HH   . TYR A 1 49  ? -2.466  -1.633  -0.834  1.00 0.00 ? 49  TYR A HH   6  
ATOM 10360 N N    . ILE A 1 50  ? -0.129  -5.986  -3.654  1.00 0.00 ? 50  ILE A N    6  
ATOM 10361 C CA   . ILE A 1 50  ? 0.881   -4.929  -3.887  1.00 0.00 ? 50  ILE A CA   6  
ATOM 10362 C C    . ILE A 1 50  ? 1.901   -5.143  -4.984  1.00 0.00 ? 50  ILE A C    6  
ATOM 10363 O O    . ILE A 1 50  ? 2.506   -4.176  -5.446  1.00 0.00 ? 50  ILE A O    6  
ATOM 10364 C CB   . ILE A 1 50  ? 1.697   -4.517  -2.677  1.00 0.00 ? 50  ILE A CB   6  
ATOM 10365 C CG1  . ILE A 1 50  ? 2.429   -5.686  -1.995  1.00 0.00 ? 50  ILE A CG1  6  
ATOM 10366 C CG2  . ILE A 1 50  ? 0.779   -3.795  -1.712  1.00 0.00 ? 50  ILE A CG2  6  
ATOM 10367 C CD1  . ILE A 1 50  ? 2.619   -5.584  -0.482  1.00 0.00 ? 50  ILE A CD1  6  
ATOM 10368 H H    . ILE A 1 50  ? -0.056  -6.512  -2.794  1.00 0.00 ? 50  ILE A H    6  
ATOM 10369 H HA   . ILE A 1 50  ? 0.340   -4.045  -4.200  1.00 0.00 ? 50  ILE A HA   6  
ATOM 10370 H HB   . ILE A 1 50  ? 2.461   -3.777  -2.991  1.00 0.00 ? 50  ILE A HB   6  
ATOM 10371 H HG12 . ILE A 1 50  ? 1.769   -6.535  -2.145  1.00 0.00 ? 50  ILE A HG12 6  
ATOM 10372 H HG13 . ILE A 1 50  ? 3.395   -5.901  -2.502  1.00 0.00 ? 50  ILE A HG13 6  
ATOM 10373 H HG21 . ILE A 1 50  ? 0.137   -3.042  -2.218  1.00 0.00 ? 50  ILE A HG21 6  
ATOM 10374 H HG22 . ILE A 1 50  ? 0.159   -4.573  -1.227  1.00 0.00 ? 50  ILE A HG22 6  
ATOM 10375 H HG23 . ILE A 1 50  ? 1.374   -3.288  -0.929  1.00 0.00 ? 50  ILE A HG23 6  
ATOM 10376 H HD11 . ILE A 1 50  ? 3.144   -4.646  -0.233  1.00 0.00 ? 50  ILE A HD11 6  
ATOM 10377 H HD12 . ILE A 1 50  ? 1.646   -5.610  0.067   1.00 0.00 ? 50  ILE A HD12 6  
ATOM 10378 H HD13 . ILE A 1 50  ? 3.225   -6.444  -0.124  1.00 0.00 ? 50  ILE A HD13 6  
ATOM 10379 N N    . SER A 1 51  ? 2.095   -6.407  -5.432  1.00 0.00 ? 51  SER A N    6  
ATOM 10380 C CA   . SER A 1 51  ? 2.965   -6.817  -6.555  1.00 0.00 ? 51  SER A CA   6  
ATOM 10381 C C    . SER A 1 51  ? 2.523   -6.323  -7.949  1.00 0.00 ? 51  SER A C    6  
ATOM 10382 O O    . SER A 1 51  ? 3.179   -6.585  -8.949  1.00 0.00 ? 51  SER A O    6  
ATOM 10383 C CB   . SER A 1 51  ? 3.186   -8.348  -6.687  1.00 0.00 ? 51  SER A CB   6  
ATOM 10384 O OG   . SER A 1 51  ? 3.942   -8.834  -5.588  1.00 0.00 ? 51  SER A OG   6  
ATOM 10385 H H    . SER A 1 51  ? 1.617   -7.114  -4.922  1.00 0.00 ? 51  SER A H    6  
ATOM 10386 H HA   . SER A 1 51  ? 3.935   -6.383  -6.341  1.00 0.00 ? 51  SER A HA   6  
ATOM 10387 H HB2  . SER A 1 51  ? 2.210   -8.883  -6.733  1.00 0.00 ? 51  SER A HB2  6  
ATOM 10388 H HB3  . SER A 1 51  ? 3.775   -8.610  -7.597  1.00 0.00 ? 51  SER A HB3  6  
ATOM 10389 H HG   . SER A 1 51  ? 3.301   -8.961  -4.850  1.00 0.00 ? 51  SER A HG   6  
ATOM 10390 N N    . HIS A 1 52  ? 1.400   -5.562  -8.010  1.00 0.00 ? 52  HIS A N    6  
ATOM 10391 C CA   . HIS A 1 52  ? 0.830   -4.835  -9.131  1.00 0.00 ? 52  HIS A CA   6  
ATOM 10392 C C    . HIS A 1 52  ? 1.415   -3.402  -9.093  1.00 0.00 ? 52  HIS A C    6  
ATOM 10393 O O    . HIS A 1 52  ? 2.599   -3.192  -8.847  1.00 0.00 ? 52  HIS A O    6  
ATOM 10394 C CB   . HIS A 1 52  ? -0.727  -4.793  -8.970  1.00 0.00 ? 52  HIS A CB   6  
ATOM 10395 C CG   . HIS A 1 52  ? -1.469  -6.109  -9.153  1.00 0.00 ? 52  HIS A CG   6  
ATOM 10396 N ND1  . HIS A 1 52  ? -2.197  -6.431  -10.287 1.00 0.00 ? 52  HIS A ND1  6  
ATOM 10397 C CD2  . HIS A 1 52  ? -1.719  -7.119  -8.270  1.00 0.00 ? 52  HIS A CD2  6  
ATOM 10398 C CE1  . HIS A 1 52  ? -2.856  -7.590  -10.023 1.00 0.00 ? 52  HIS A CE1  6  
ATOM 10399 N NE2  . HIS A 1 52  ? -2.601  -8.038  -8.817  1.00 0.00 ? 52  HIS A NE2  6  
ATOM 10400 H H    . HIS A 1 52  ? 0.930   -5.413  -7.147  1.00 0.00 ? 52  HIS A H    6  
ATOM 10401 H HA   . HIS A 1 52  ? 1.111   -5.295  -10.070 1.00 0.00 ? 52  HIS A HA   6  
ATOM 10402 H HB2  . HIS A 1 52  ? -0.937  -4.407  -7.937  1.00 0.00 ? 52  HIS A HB2  6  
ATOM 10403 H HB3  . HIS A 1 52  ? -1.201  -4.108  -9.701  1.00 0.00 ? 52  HIS A HB3  6  
ATOM 10404 H HD1  . HIS A 1 52  ? -2.240  -5.907  -11.138 1.00 0.00 ? 52  HIS A HD1  6  
ATOM 10405 H HD2  . HIS A 1 52  ? -1.330  -7.296  -7.278  1.00 0.00 ? 52  HIS A HD2  6  
ATOM 10406 H HE1  . HIS A 1 52  ? -3.533  -8.095  -10.713 1.00 0.00 ? 52  HIS A HE1  6  
ATOM 10407 N N    . ARG A 1 53  ? 0.586   -2.354  -9.331  1.00 0.00 ? 53  ARG A N    6  
ATOM 10408 C CA   . ARG A 1 53  ? 0.941   -0.938  -9.280  1.00 0.00 ? 53  ARG A CA   6  
ATOM 10409 C C    . ARG A 1 53  ? 1.066   -0.296  -7.888  1.00 0.00 ? 53  ARG A C    6  
ATOM 10410 O O    . ARG A 1 53  ? 1.815   0.646   -7.646  1.00 0.00 ? 53  ARG A O    6  
ATOM 10411 C CB   . ARG A 1 53  ? 0.000   -0.142  -10.226 1.00 0.00 ? 53  ARG A CB   6  
ATOM 10412 C CG   . ARG A 1 53  ? -1.329  0.382   -9.641  1.00 0.00 ? 53  ARG A CG   6  
ATOM 10413 C CD   . ARG A 1 53  ? -2.404  -0.632  -9.189  1.00 0.00 ? 53  ARG A CD   6  
ATOM 10414 N NE   . ARG A 1 53  ? -2.828  -1.459  -10.370 1.00 0.00 ? 53  ARG A NE   6  
ATOM 10415 C CZ   . ARG A 1 53  ? -3.808  -2.414  -10.305 1.00 0.00 ? 53  ARG A CZ   6  
ATOM 10416 N NH1  . ARG A 1 53  ? -4.526  -2.607  -9.162  1.00 0.00 ? 53  ARG A NH1  6  
ATOM 10417 N NH2  . ARG A 1 53  ? -4.065  -3.187  -11.401 1.00 0.00 ? 53  ARG A NH2  6  
ATOM 10418 H H    . ARG A 1 53  ? -0.370  -2.513  -9.552  1.00 0.00 ? 53  ARG A H    6  
ATOM 10419 H HA   . ARG A 1 53  ? 1.879   -0.767  -9.745  1.00 0.00 ? 53  ARG A HA   6  
ATOM 10420 H HB2  . ARG A 1 53  ? 0.562   0.760   -10.568 1.00 0.00 ? 53  ARG A HB2  6  
ATOM 10421 H HB3  . ARG A 1 53  ? -0.197  -0.750  -11.136 1.00 0.00 ? 53  ARG A HB3  6  
ATOM 10422 H HG2  . ARG A 1 53  ? -1.017  0.989   -8.773  1.00 0.00 ? 53  ARG A HG2  6  
ATOM 10423 H HG3  . ARG A 1 53  ? -1.766  1.072   -10.388 1.00 0.00 ? 53  ARG A HG3  6  
ATOM 10424 H HD2  . ARG A 1 53  ? -2.039  -1.310  -8.390  1.00 0.00 ? 53  ARG A HD2  6  
ATOM 10425 H HD3  . ARG A 1 53  ? -3.276  -0.083  -8.761  1.00 0.00 ? 53  ARG A HD3  6  
ATOM 10426 H HE   . ARG A 1 53  ? -2.327  -1.348  -11.229 1.00 0.00 ? 53  ARG A HE   6  
ATOM 10427 H HH11 . ARG A 1 53  ? -4.338  -2.049  -8.353  1.00 0.00 ? 53  ARG A HH11 6  
ATOM 10428 H HH12 . ARG A 1 53  ? -5.234  -3.313  -9.130  1.00 0.00 ? 53  ARG A HH12 6  
ATOM 10429 H HH21 . ARG A 1 53  ? -3.538  -3.053  -12.240 1.00 0.00 ? 53  ARG A HH21 6  
ATOM 10430 H HH22 . ARG A 1 53  ? -4.775  -3.890  -11.363 1.00 0.00 ? 53  ARG A HH22 6  
ATOM 10431 N N    . GLU A 1 54  ? 0.159   -0.759  -7.014  1.00 0.00 ? 54  GLU A N    6  
ATOM 10432 C CA   . GLU A 1 54  ? -0.333  -0.200  -5.774  1.00 0.00 ? 54  GLU A CA   6  
ATOM 10433 C C    . GLU A 1 54  ? 0.420   -0.259  -4.476  1.00 0.00 ? 54  GLU A C    6  
ATOM 10434 O O    . GLU A 1 54  ? -0.235  0.003   -3.473  1.00 0.00 ? 54  GLU A O    6  
ATOM 10435 C CB   . GLU A 1 54  ? -1.745  -0.790  -5.560  1.00 0.00 ? 54  GLU A CB   6  
ATOM 10436 C CG   . GLU A 1 54  ? -1.770  -2.323  -5.410  1.00 0.00 ? 54  GLU A CG   6  
ATOM 10437 C CD   . GLU A 1 54  ? -3.114  -2.829  -5.942  1.00 0.00 ? 54  GLU A CD   6  
ATOM 10438 O OE1  . GLU A 1 54  ? -3.136  -3.898  -6.606  1.00 0.00 ? 54  GLU A OE1  6  
ATOM 10439 O OE2  . GLU A 1 54  ? -4.142  -2.135  -5.724  1.00 0.00 ? 54  GLU A OE2  6  
ATOM 10440 H H    . GLU A 1 54  ? -0.378  -1.524  -7.338  1.00 0.00 ? 54  GLU A H    6  
ATOM 10441 H HA   . GLU A 1 54  ? -0.480  0.857   -5.949  1.00 0.00 ? 54  GLU A HA   6  
ATOM 10442 H HB2  . GLU A 1 54  ? -2.272  -0.325  -4.696  1.00 0.00 ? 54  GLU A HB2  6  
ATOM 10443 H HB3  . GLU A 1 54  ? -2.333  -0.488  -6.453  1.00 0.00 ? 54  GLU A HB3  6  
ATOM 10444 H HG2  . GLU A 1 54  ? -0.944  -2.799  -5.978  1.00 0.00 ? 54  GLU A HG2  6  
ATOM 10445 H HG3  . GLU A 1 54  ? -1.606  -2.603  -4.345  1.00 0.00 ? 54  GLU A HG3  6  
ATOM 10446 N N    . HIS A 1 55  ? 1.726   -0.639  -4.426  1.00 0.00 ? 55  HIS A N    6  
ATOM 10447 C CA   . HIS A 1 55  ? 2.587   -0.912  -3.247  1.00 0.00 ? 55  HIS A CA   6  
ATOM 10448 C C    . HIS A 1 55  ? 2.446   -0.265  -1.838  1.00 0.00 ? 55  HIS A C    6  
ATOM 10449 O O    . HIS A 1 55  ? 3.425   0.082   -1.179  1.00 0.00 ? 55  HIS A O    6  
ATOM 10450 C CB   . HIS A 1 55  ? 4.102   -0.993  -3.641  1.00 0.00 ? 55  HIS A CB   6  
ATOM 10451 C CG   . HIS A 1 55  ? 4.986   -1.814  -2.709  1.00 0.00 ? 55  HIS A CG   6  
ATOM 10452 N ND1  . HIS A 1 55  ? 6.356   -1.674  -2.587  1.00 0.00 ? 55  HIS A ND1  6  
ATOM 10453 C CD2  . HIS A 1 55  ? 4.648   -2.830  -1.867  1.00 0.00 ? 55  HIS A CD2  6  
ATOM 10454 C CE1  . HIS A 1 55  ? 6.771   -2.601  -1.684  1.00 0.00 ? 55  HIS A CE1  6  
ATOM 10455 N NE2  . HIS A 1 55  ? 5.770   -3.320  -1.210  1.00 0.00 ? 55  HIS A NE2  6  
ATOM 10456 H H    . HIS A 1 55  ? 2.125   -0.874  -5.315  1.00 0.00 ? 55  HIS A H    6  
ATOM 10457 H HA   . HIS A 1 55  ? 2.319   -1.918  -3.036  1.00 0.00 ? 55  HIS A HA   6  
ATOM 10458 H HB2  . HIS A 1 55  ? 4.169   -1.496  -4.638  1.00 0.00 ? 55  HIS A HB2  6  
ATOM 10459 H HB3  . HIS A 1 55  ? 4.516   0.043   -3.715  1.00 0.00 ? 55  HIS A HB3  6  
ATOM 10460 H HD1  . HIS A 1 55  ? 6.919   -0.998  -3.066  1.00 0.00 ? 55  HIS A HD1  6  
ATOM 10461 H HD2  . HIS A 1 55  ? 3.666   -3.263  -1.715  1.00 0.00 ? 55  HIS A HD2  6  
ATOM 10462 H HE1  . HIS A 1 55  ? 7.812   -2.723  -1.390  1.00 0.00 ? 55  HIS A HE1  6  
ATOM 10463 N N    . ILE A 1 56  ? 1.189   -0.253  -1.302  1.00 0.00 ? 56  ILE A N    6  
ATOM 10464 C CA   . ILE A 1 56  ? 0.717   0.062   0.034   1.00 0.00 ? 56  ILE A CA   6  
ATOM 10465 C C    . ILE A 1 56  ? 0.787   -1.233  0.776   1.00 0.00 ? 56  ILE A C    6  
ATOM 10466 O O    . ILE A 1 56  ? -0.139  -2.036  0.701   1.00 0.00 ? 56  ILE A O    6  
ATOM 10467 C CB   . ILE A 1 56  ? -0.728  0.480   0.128   1.00 0.00 ? 56  ILE A CB   6  
ATOM 10468 C CG1  . ILE A 1 56  ? -0.933  1.733   -0.715  1.00 0.00 ? 56  ILE A CG1  6  
ATOM 10469 C CG2  . ILE A 1 56  ? -1.340  0.684   1.551   1.00 0.00 ? 56  ILE A CG2  6  
ATOM 10470 C CD1  . ILE A 1 56  ? -2.271  1.448   -1.322  1.00 0.00 ? 56  ILE A CD1  6  
ATOM 10471 H H    . ILE A 1 56  ? 0.436   -0.516  -1.917  1.00 0.00 ? 56  ILE A H    6  
ATOM 10472 H HA   . ILE A 1 56  ? 1.279   0.864   0.446   1.00 0.00 ? 56  ILE A HA   6  
ATOM 10473 H HB   . ILE A 1 56  ? -1.341  -0.336  -0.327  1.00 0.00 ? 56  ILE A HB   6  
ATOM 10474 H HG12 . ILE A 1 56  ? -0.948  2.652   -0.095  1.00 0.00 ? 56  ILE A HG12 6  
ATOM 10475 H HG13 . ILE A 1 56  ? -0.179  1.859   -1.520  1.00 0.00 ? 56  ILE A HG13 6  
ATOM 10476 H HG21 . ILE A 1 56  ? -1.080  -0.108  2.280   1.00 0.00 ? 56  ILE A HG21 6  
ATOM 10477 H HG22 . ILE A 1 56  ? -0.991  1.655   1.952   1.00 0.00 ? 56  ILE A HG22 6  
ATOM 10478 H HG23 . ILE A 1 56  ? -2.449  0.729   1.498   1.00 0.00 ? 56  ILE A HG23 6  
ATOM 10479 H HD11 . ILE A 1 56  ? -2.930  1.228   -0.455  1.00 0.00 ? 56  ILE A HD11 6  
ATOM 10480 H HD12 . ILE A 1 56  ? -2.611  2.275   -1.961  1.00 0.00 ? 56  ILE A HD12 6  
ATOM 10481 H HD13 . ILE A 1 56  ? -2.132  0.505   -1.912  1.00 0.00 ? 56  ILE A HD13 6  
ATOM 10482 N N    . HIS A 1 57  ? 1.893   -1.476  1.475   1.00 0.00 ? 57  HIS A N    6  
ATOM 10483 C CA   . HIS A 1 57  ? 2.158   -2.668  2.242   1.00 0.00 ? 57  HIS A CA   6  
ATOM 10484 C C    . HIS A 1 57  ? 1.692   -2.412  3.668   1.00 0.00 ? 57  HIS A C    6  
ATOM 10485 O O    . HIS A 1 57  ? 1.197   -1.341  4.003   1.00 0.00 ? 57  HIS A O    6  
ATOM 10486 C CB   . HIS A 1 57  ? 3.685   -2.927  2.126   1.00 0.00 ? 57  HIS A CB   6  
ATOM 10487 C CG   . HIS A 1 57  ? 4.146   -4.355  2.185   1.00 0.00 ? 57  HIS A CG   6  
ATOM 10488 N ND1  . HIS A 1 57  ? 5.173   -4.826  1.393   1.00 0.00 ? 57  HIS A ND1  6  
ATOM 10489 C CD2  . HIS A 1 57  ? 3.774   -5.405  2.968   1.00 0.00 ? 57  HIS A CD2  6  
ATOM 10490 C CE1  . HIS A 1 57  ? 5.369   -6.123  1.738   1.00 0.00 ? 57  HIS A CE1  6  
ATOM 10491 N NE2  . HIS A 1 57  ? 4.545   -6.508  2.698   1.00 0.00 ? 57  HIS A NE2  6  
ATOM 10492 H H    . HIS A 1 57  ? 2.611   -0.780  1.485   1.00 0.00 ? 57  HIS A H    6  
ATOM 10493 H HA   . HIS A 1 57  ? 1.613   -3.511  1.837   1.00 0.00 ? 57  HIS A HA   6  
ATOM 10494 H HB2  . HIS A 1 57  ? 3.972   -2.573  1.106   1.00 0.00 ? 57  HIS A HB2  6  
ATOM 10495 H HB3  . HIS A 1 57  ? 4.275   -2.313  2.837   1.00 0.00 ? 57  HIS A HB3  6  
ATOM 10496 H HD1  . HIS A 1 57  ? 5.577   -4.360  0.587   1.00 0.00 ? 57  HIS A HD1  6  
ATOM 10497 H HD2  . HIS A 1 57  ? 2.988   -5.528  3.699   1.00 0.00 ? 57  HIS A HD2  6  
ATOM 10498 H HE1  . HIS A 1 57  ? 6.085   -6.780  1.241   1.00 0.00 ? 57  HIS A HE1  6  
ATOM 10499 N N    . MET A 1 58  ? 1.900   -3.350  4.625   1.00 0.00 ? 58  MET A N    6  
ATOM 10500 C CA   . MET A 1 58  ? 1.699   -3.198  6.080   1.00 0.00 ? 58  MET A CA   6  
ATOM 10501 C C    . MET A 1 58  ? 2.506   -2.034  6.708   1.00 0.00 ? 58  MET A C    6  
ATOM 10502 O O    . MET A 1 58  ? 2.290   -1.562  7.810   1.00 0.00 ? 58  MET A O    6  
ATOM 10503 C CB   . MET A 1 58  ? 2.150   -4.532  6.715   1.00 0.00 ? 58  MET A CB   6  
ATOM 10504 C CG   . MET A 1 58  ? 2.026   -4.637  8.242   1.00 0.00 ? 58  MET A CG   6  
ATOM 10505 S SD   . MET A 1 58  ? 1.278   -6.188  8.776   1.00 0.00 ? 58  MET A SD   6  
ATOM 10506 C CE   . MET A 1 58  ? -0.405  -5.516  8.637   1.00 0.00 ? 58  MET A CE   6  
ATOM 10507 H H    . MET A 1 58  ? 2.279   -4.222  4.353   1.00 0.00 ? 58  MET A H    6  
ATOM 10508 H HA   . MET A 1 58  ? 0.642   -3.033  6.271   1.00 0.00 ? 58  MET A HA   6  
ATOM 10509 H HB2  . MET A 1 58  ? 1.542   -5.339  6.253   1.00 0.00 ? 58  MET A HB2  6  
ATOM 10510 H HB3  . MET A 1 58  ? 3.210   -4.736  6.447   1.00 0.00 ? 58  MET A HB3  6  
ATOM 10511 H HG2  . MET A 1 58  ? 3.036   -4.509  8.696   1.00 0.00 ? 58  MET A HG2  6  
ATOM 10512 H HG3  . MET A 1 58  ? 1.407   -3.801  8.633   1.00 0.00 ? 58  MET A HG3  6  
ATOM 10513 H HE1  . MET A 1 58  ? -0.555  -4.969  7.687   1.00 0.00 ? 58  MET A HE1  6  
ATOM 10514 H HE2  . MET A 1 58  ? -1.158  -6.331  8.691   1.00 0.00 ? 58  MET A HE2  6  
ATOM 10515 H HE3  . MET A 1 58  ? -0.626  -4.815  9.474   1.00 0.00 ? 58  MET A HE3  6  
ATOM 10516 N N    . ASN A 1 59  ? 3.445   -1.537  5.883   1.00 0.00 ? 59  ASN A N    6  
ATOM 10517 C CA   . ASN A 1 59  ? 4.350   -0.439  5.959   1.00 0.00 ? 59  ASN A CA   6  
ATOM 10518 C C    . ASN A 1 59  ? 3.699   0.911   5.477   1.00 0.00 ? 59  ASN A C    6  
ATOM 10519 O O    . ASN A 1 59  ? 4.290   1.975   5.652   1.00 0.00 ? 59  ASN A O    6  
ATOM 10520 C CB   . ASN A 1 59  ? 5.571   -0.891  5.073   1.00 0.00 ? 59  ASN A CB   6  
ATOM 10521 C CG   . ASN A 1 59  ? 6.183   -2.278  5.421   1.00 0.00 ? 59  ASN A CG   6  
ATOM 10522 O OD1  . ASN A 1 59  ? 7.273   -2.293  5.995   1.00 0.00 ? 59  ASN A OD1  6  
ATOM 10523 N ND2  . ASN A 1 59  ? 5.589   -3.452  5.038   1.00 0.00 ? 59  ASN A ND2  6  
ATOM 10524 H H    . ASN A 1 59  ? 3.504   -1.993  5.004   1.00 0.00 ? 59  ASN A H    6  
ATOM 10525 H HA   . ASN A 1 59  ? 4.650   -0.313  6.998   1.00 0.00 ? 59  ASN A HA   6  
ATOM 10526 H HB2  . ASN A 1 59  ? 5.283   -0.906  4.003   1.00 0.00 ? 59  ASN A HB2  6  
ATOM 10527 H HB3  . ASN A 1 59  ? 6.392   -0.152  5.191   1.00 0.00 ? 59  ASN A HB3  6  
ATOM 10528 H HD21 . ASN A 1 59  ? 4.623   -3.600  4.807   1.00 0.00 ? 59  ASN A HD21 6  
ATOM 10529 H HD22 . ASN A 1 59  ? 6.141   -4.272  5.187   1.00 0.00 ? 59  ASN A HD22 6  
ATOM 10530 N N    . ALA A 1 60  ? 2.470   0.905   4.869   1.00 0.00 ? 60  ALA A N    6  
ATOM 10531 C CA   . ALA A 1 60  ? 1.728   2.074   4.360   1.00 0.00 ? 60  ALA A CA   6  
ATOM 10532 C C    . ALA A 1 60  ? 0.330   2.143   4.984   1.00 0.00 ? 60  ALA A C    6  
ATOM 10533 O O    . ALA A 1 60  ? -0.664  2.150   4.262   1.00 0.00 ? 60  ALA A O    6  
ATOM 10534 C CB   . ALA A 1 60  ? 1.535   1.967   2.816   1.00 0.00 ? 60  ALA A CB   6  
ATOM 10535 H H    . ALA A 1 60  ? 2.001   0.025   4.718   1.00 0.00 ? 60  ALA A H    6  
ATOM 10536 H HA   . ALA A 1 60  ? 2.241   2.999   4.595   1.00 0.00 ? 60  ALA A HA   6  
ATOM 10537 H HB1  . ALA A 1 60  ? 0.995   1.029   2.560   1.00 0.00 ? 60  ALA A HB1  6  
ATOM 10538 H HB2  . ALA A 1 60  ? 0.890   2.759   2.358   1.00 0.00 ? 60  ALA A HB2  6  
ATOM 10539 H HB3  . ALA A 1 60  ? 2.507   1.950   2.285   1.00 0.00 ? 60  ALA A HB3  6  
ATOM 10540 N N    . THR A 1 61  ? 0.200   2.160   6.341   1.00 0.00 ? 61  THR A N    6  
ATOM 10541 C CA   . THR A 1 61  ? -1.084  2.077   7.068   1.00 0.00 ? 61  THR A CA   6  
ATOM 10542 C C    . THR A 1 61  ? -0.798  2.132   8.572   1.00 0.00 ? 61  THR A C    6  
ATOM 10543 O O    . THR A 1 61  ? 0.355   2.182   8.997   1.00 0.00 ? 61  THR A O    6  
ATOM 10544 C CB   . THR A 1 61  ? -2.014  0.936   6.631   1.00 0.00 ? 61  THR A CB   6  
ATOM 10545 O OG1  . THR A 1 61  ? -3.253  0.890   7.344   1.00 0.00 ? 61  THR A OG1  6  
ATOM 10546 C CG2  . THR A 1 61  ? -1.283  -0.414  6.649   1.00 0.00 ? 61  THR A CG2  6  
ATOM 10547 H H    . THR A 1 61  ? 0.986   2.190   6.960   1.00 0.00 ? 61  THR A H    6  
ATOM 10548 H HA   . THR A 1 61  ? -1.683  2.935   6.861   1.00 0.00 ? 61  THR A HA   6  
ATOM 10549 H HB   . THR A 1 61  ? -2.308  1.130   5.574   1.00 0.00 ? 61  THR A HB   6  
ATOM 10550 H HG1  . THR A 1 61  ? -3.580  -0.015  7.238   1.00 0.00 ? 61  THR A HG1  6  
ATOM 10551 H HG21 . THR A 1 61  ? -0.385  -0.375  6.001   1.00 0.00 ? 61  THR A HG21 6  
ATOM 10552 H HG22 . THR A 1 61  ? -0.978  -0.734  7.666   1.00 0.00 ? 61  THR A HG22 6  
ATOM 10553 H HG23 . THR A 1 61  ? -1.938  -1.174  6.182   1.00 0.00 ? 61  THR A HG23 6  
ATOM 10554 N N    . GLN A 1 62  ? -1.870  2.153   9.418   1.00 0.00 ? 62  GLN A N    6  
ATOM 10555 C CA   . GLN A 1 62  ? -1.857  2.330   10.874  1.00 0.00 ? 62  GLN A CA   6  
ATOM 10556 C C    . GLN A 1 62  ? -1.591  1.074   11.690  1.00 0.00 ? 62  GLN A C    6  
ATOM 10557 O O    . GLN A 1 62  ? -1.396  1.103   12.906  1.00 0.00 ? 62  GLN A O    6  
ATOM 10558 C CB   . GLN A 1 62  ? -3.207  2.948   11.342  1.00 0.00 ? 62  GLN A CB   6  
ATOM 10559 C CG   . GLN A 1 62  ? -4.437  2.010   11.311  1.00 0.00 ? 62  GLN A CG   6  
ATOM 10560 C CD   . GLN A 1 62  ? -5.637  2.685   11.975  1.00 0.00 ? 62  GLN A CD   6  
ATOM 10561 O OE1  . GLN A 1 62  ? -5.606  3.869   12.318  1.00 0.00 ? 62  GLN A OE1  6  
ATOM 10562 N NE2  . GLN A 1 62  ? -6.725  1.893   12.174  1.00 0.00 ? 62  GLN A NE2  6  
ATOM 10563 H H    . GLN A 1 62  ? -2.772  2.073   8.983   1.00 0.00 ? 62  GLN A H    6  
ATOM 10564 H HA   . GLN A 1 62  ? -1.063  3.025   11.120  1.00 0.00 ? 62  GLN A HA   6  
ATOM 10565 H HB2  . GLN A 1 62  ? -3.078  3.330   12.382  1.00 0.00 ? 62  GLN A HB2  6  
ATOM 10566 H HB3  . GLN A 1 62  ? -3.431  3.834   10.704  1.00 0.00 ? 62  GLN A HB3  6  
ATOM 10567 H HG2  . GLN A 1 62  ? -4.701  1.751   10.255  1.00 0.00 ? 62  GLN A HG2  6  
ATOM 10568 H HG3  . GLN A 1 62  ? -4.240  1.089   11.915  1.00 0.00 ? 62  GLN A HG3  6  
ATOM 10569 H HE21 . GLN A 1 62  ? -6.784  0.979   11.776  1.00 0.00 ? 62  GLN A HE21 6  
ATOM 10570 H HE22 . GLN A 1 62  ? -7.493  2.270   12.685  1.00 0.00 ? 62  GLN A HE22 6  
ATOM 10571 N N    . TRP A 1 63  ? -1.632  -0.072  10.977  1.00 0.00 ? 63  TRP A N    6  
ATOM 10572 C CA   . TRP A 1 63  ? -1.480  -1.423  11.454  1.00 0.00 ? 63  TRP A CA   6  
ATOM 10573 C C    . TRP A 1 63  ? -0.072  -1.886  11.089  1.00 0.00 ? 63  TRP A C    6  
ATOM 10574 O O    . TRP A 1 63  ? 0.192   -2.281  9.956   1.00 0.00 ? 63  TRP A O    6  
ATOM 10575 C CB   . TRP A 1 63  ? -2.577  -2.378  10.866  1.00 0.00 ? 63  TRP A CB   6  
ATOM 10576 C CG   . TRP A 1 63  ? -3.966  -1.785  10.526  1.00 0.00 ? 63  TRP A CG   6  
ATOM 10577 C CD1  . TRP A 1 63  ? -4.994  -1.491  11.379  1.00 0.00 ? 63  TRP A CD1  6  
ATOM 10578 C CD2  . TRP A 1 63  ? -4.525  -1.638  9.191   1.00 0.00 ? 63  TRP A CD2  6  
ATOM 10579 N NE1  . TRP A 1 63  ? -6.139  -1.177  10.670  1.00 0.00 ? 63  TRP A NE1  6  
ATOM 10580 C CE2  . TRP A 1 63  ? -5.860  -1.278  9.325   1.00 0.00 ? 63  TRP A CE2  6  
ATOM 10581 C CE3  . TRP A 1 63  ? -3.992  -1.818  7.947   1.00 0.00 ? 63  TRP A CE3  6  
ATOM 10582 C CZ2  . TRP A 1 63  ? -6.670  -1.146  8.225   1.00 0.00 ? 63  TRP A CZ2  6  
ATOM 10583 C CZ3  . TRP A 1 63  ? -4.812  -1.668  6.835   1.00 0.00 ? 63  TRP A CZ3  6  
ATOM 10584 C CH2  . TRP A 1 63  ? -6.158  -1.359  6.958   1.00 0.00 ? 63  TRP A CH2  6  
ATOM 10585 H H    . TRP A 1 63  ? -1.785  0.004   9.995   1.00 0.00 ? 63  TRP A H    6  
ATOM 10586 H HA   . TRP A 1 63  ? -1.569  -1.437  12.536  1.00 0.00 ? 63  TRP A HA   6  
ATOM 10587 H HB2  . TRP A 1 63  ? -2.204  -2.870  9.935   1.00 0.00 ? 63  TRP A HB2  6  
ATOM 10588 H HB3  . TRP A 1 63  ? -2.746  -3.159  11.661  1.00 0.00 ? 63  TRP A HB3  6  
ATOM 10589 H HD1  . TRP A 1 63  ? -4.937  -1.562  12.457  1.00 0.00 ? 63  TRP A HD1  6  
ATOM 10590 H HE1  . TRP A 1 63  ? -7.041  -1.231  11.046  1.00 0.00 ? 63  TRP A HE1  6  
ATOM 10591 H HE3  . TRP A 1 63  ? -2.937  -1.988  7.820   1.00 0.00 ? 63  TRP A HE3  6  
ATOM 10592 H HZ2  . TRP A 1 63  ? -7.719  -0.954  8.337   1.00 0.00 ? 63  TRP A HZ2  6  
ATOM 10593 H HZ3  . TRP A 1 63  ? -4.381  -1.795  5.855   1.00 0.00 ? 63  TRP A HZ3  6  
ATOM 10594 H HH2  . TRP A 1 63  ? -6.828  -1.292  6.081   1.00 0.00 ? 63  TRP A HH2  6  
ATOM 10595 N N    . GLU A 1 64  ? 0.868   -1.789  12.068  1.00 0.00 ? 64  GLU A N    6  
ATOM 10596 C CA   . GLU A 1 64  ? 2.292   -2.104  11.966  1.00 0.00 ? 64  GLU A CA   6  
ATOM 10597 C C    . GLU A 1 64  ? 2.556   -3.602  11.966  1.00 0.00 ? 64  GLU A C    6  
ATOM 10598 O O    . GLU A 1 64  ? 3.360   -4.137  11.209  1.00 0.00 ? 64  GLU A O    6  
ATOM 10599 C CB   . GLU A 1 64  ? 3.007   -1.426  13.173  1.00 0.00 ? 64  GLU A CB   6  
ATOM 10600 C CG   . GLU A 1 64  ? 4.501   -1.760  13.357  1.00 0.00 ? 64  GLU A CG   6  
ATOM 10601 C CD   . GLU A 1 64  ? 5.110   -0.839  14.415  1.00 0.00 ? 64  GLU A CD   6  
ATOM 10602 O OE1  . GLU A 1 64  ? 4.662   -0.911  15.590  1.00 0.00 ? 64  GLU A OE1  6  
ATOM 10603 O OE2  . GLU A 1 64  ? 6.032   -0.056  14.062  1.00 0.00 ? 64  GLU A OE2  6  
ATOM 10604 H H    . GLU A 1 64  ? 0.577   -1.395  12.939  1.00 0.00 ? 64  GLU A H    6  
ATOM 10605 H HA   . GLU A 1 64  ? 2.698   -1.714  11.034  1.00 0.00 ? 64  GLU A HA   6  
ATOM 10606 H HB2  . GLU A 1 64  ? 2.906   -0.325  13.033  1.00 0.00 ? 64  GLU A HB2  6  
ATOM 10607 H HB3  . GLU A 1 64  ? 2.470   -1.689  14.112  1.00 0.00 ? 64  GLU A HB3  6  
ATOM 10608 H HG2  . GLU A 1 64  ? 4.626   -2.813  13.687  1.00 0.00 ? 64  GLU A HG2  6  
ATOM 10609 H HG3  . GLU A 1 64  ? 5.028   -1.638  12.392  1.00 0.00 ? 64  GLU A HG3  6  
ATOM 10610 N N    . THR A 1 65  ? 1.844   -4.315  12.856  1.00 0.00 ? 65  THR A N    6  
ATOM 10611 C CA   . THR A 1 65  ? 1.899   -5.750  13.055  1.00 0.00 ? 65  THR A CA   6  
ATOM 10612 C C    . THR A 1 65  ? 0.555   -6.227  12.535  1.00 0.00 ? 65  THR A C    6  
ATOM 10613 O O    . THR A 1 65  ? -0.454  -5.540  12.719  1.00 0.00 ? 65  THR A O    6  
ATOM 10614 C CB   . THR A 1 65  ? 2.262   -6.096  14.521  1.00 0.00 ? 65  THR A CB   6  
ATOM 10615 O OG1  . THR A 1 65  ? 1.705   -7.314  15.004  1.00 0.00 ? 65  THR A OG1  6  
ATOM 10616 C CG2  . THR A 1 65  ? 1.894   -4.966  15.509  1.00 0.00 ? 65  THR A CG2  6  
ATOM 10617 H H    . THR A 1 65  ? 1.181   -3.854  13.441  1.00 0.00 ? 65  THR A H    6  
ATOM 10618 H HA   . THR A 1 65  ? 2.650   -6.206  12.422  1.00 0.00 ? 65  THR A HA   6  
ATOM 10619 H HB   . THR A 1 65  ? 3.374   -6.195  14.554  1.00 0.00 ? 65  THR A HB   6  
ATOM 10620 H HG1  . THR A 1 65  ? 1.857   -7.322  15.953  1.00 0.00 ? 65  THR A HG1  6  
ATOM 10621 H HG21 . THR A 1 65  ? 0.804   -4.749  15.468  1.00 0.00 ? 65  THR A HG21 6  
ATOM 10622 H HG22 . THR A 1 65  ? 2.163   -5.255  16.548  1.00 0.00 ? 65  THR A HG22 6  
ATOM 10623 H HG23 . THR A 1 65  ? 2.465   -4.037  15.275  1.00 0.00 ? 65  THR A HG23 6  
ATOM 10624 N N    . LEU A 1 66  ? 0.504   -7.421  11.849  1.00 0.00 ? 66  LEU A N    6  
ATOM 10625 C CA   . LEU A 1 66  ? -0.643  -8.033  11.153  1.00 0.00 ? 66  LEU A CA   6  
ATOM 10626 C C    . LEU A 1 66  ? -1.895  -8.166  11.994  1.00 0.00 ? 66  LEU A C    6  
ATOM 10627 O O    . LEU A 1 66  ? -3.002  -7.947  11.517  1.00 0.00 ? 66  LEU A O    6  
ATOM 10628 C CB   . LEU A 1 66  ? -0.226  -9.361  10.440  1.00 0.00 ? 66  LEU A CB   6  
ATOM 10629 C CG   . LEU A 1 66  ? -1.014  -9.869  9.189   1.00 0.00 ? 66  LEU A CG   6  
ATOM 10630 C CD1  . LEU A 1 66  ? -2.545  -9.758  9.290   1.00 0.00 ? 66  LEU A CD1  6  
ATOM 10631 C CD2  . LEU A 1 66  ? -0.513  -9.239  7.876   1.00 0.00 ? 66  LEU A CD2  6  
ATOM 10632 H H    . LEU A 1 66  ? 1.348   -7.940  11.731  1.00 0.00 ? 66  LEU A H    6  
ATOM 10633 H HA   . LEU A 1 66  ? -0.919  -7.348  10.377  1.00 0.00 ? 66  LEU A HA   6  
ATOM 10634 H HB2  . LEU A 1 66  ? 0.825   -9.209  10.093  1.00 0.00 ? 66  LEU A HB2  6  
ATOM 10635 H HB3  . LEU A 1 66  ? -0.214  -10.174 11.192  1.00 0.00 ? 66  LEU A HB3  6  
ATOM 10636 H HG   . LEU A 1 66  ? -0.765  -10.958 9.112   1.00 0.00 ? 66  LEU A HG   6  
ATOM 10637 H HD11 . LEU A 1 66  ? -2.932  -10.182 10.247  1.00 0.00 ? 66  LEU A HD11 6  
ATOM 10638 H HD12 . LEU A 1 66  ? -2.865  -8.687  9.210   1.00 0.00 ? 66  LEU A HD12 6  
ATOM 10639 H HD13 . LEU A 1 66  ? -3.057  -10.290 8.480   1.00 0.00 ? 66  LEU A HD13 6  
ATOM 10640 H HD21 . LEU A 1 66  ? 0.597   -9.237  7.828   1.00 0.00 ? 66  LEU A HD21 6  
ATOM 10641 H HD22 . LEU A 1 66  ? -0.900  -9.783  6.991   1.00 0.00 ? 66  LEU A HD22 6  
ATOM 10642 H HD23 . LEU A 1 66  ? -0.857  -8.192  7.779   1.00 0.00 ? 66  LEU A HD23 6  
ATOM 10643 N N    . THR A 1 67  ? -1.707  -8.370  13.323  1.00 0.00 ? 67  THR A N    6  
ATOM 10644 C CA   . THR A 1 67  ? -2.589  -8.558  14.446  1.00 0.00 ? 67  THR A CA   6  
ATOM 10645 C C    . THR A 1 67  ? -3.543  -7.411  14.566  1.00 0.00 ? 67  THR A C    6  
ATOM 10646 O O    . THR A 1 67  ? -4.726  -7.681  14.652  1.00 0.00 ? 67  THR A O    6  
ATOM 10647 C CB   . THR A 1 67  ? -1.750  -8.677  15.724  1.00 0.00 ? 67  THR A CB   6  
ATOM 10648 O OG1  . THR A 1 67  ? -0.759  -9.678  15.542  1.00 0.00 ? 67  THR A OG1  6  
ATOM 10649 C CG2  . THR A 1 67  ? -2.628  -9.081  16.910  1.00 0.00 ? 67  THR A CG2  6  
ATOM 10650 H H    . THR A 1 67  ? -0.792  -8.454  13.655  1.00 0.00 ? 67  THR A H    6  
ATOM 10651 H HA   . THR A 1 67  ? -3.192  -9.457  14.291  1.00 0.00 ? 67  THR A HA   6  
ATOM 10652 H HB   . THR A 1 67  ? -1.202  -7.736  15.958  1.00 0.00 ? 67  THR A HB   6  
ATOM 10653 H HG1  . THR A 1 67  ? -1.256  -10.481 15.321  1.00 0.00 ? 67  THR A HG1  6  
ATOM 10654 H HG21 . THR A 1 67  ? -3.384  -9.811  16.555  1.00 0.00 ? 67  THR A HG21 6  
ATOM 10655 H HG22 . THR A 1 67  ? -2.029  -9.534  17.727  1.00 0.00 ? 67  THR A HG22 6  
ATOM 10656 H HG23 . THR A 1 67  ? -3.175  -8.208  17.321  1.00 0.00 ? 67  THR A HG23 6  
ATOM 10657 N N    . ASP A 1 68  ? -3.108  -6.129  14.432  1.00 0.00 ? 68  ASP A N    6  
ATOM 10658 C CA   . ASP A 1 68  ? -3.982  -4.950  14.400  1.00 0.00 ? 68  ASP A CA   6  
ATOM 10659 C C    . ASP A 1 68  ? -4.824  -4.738  13.154  1.00 0.00 ? 68  ASP A C    6  
ATOM 10660 O O    . ASP A 1 68  ? -5.908  -4.165  13.224  1.00 0.00 ? 68  ASP A O    6  
ATOM 10661 C CB   . ASP A 1 68  ? -3.198  -3.644  14.719  1.00 0.00 ? 68  ASP A CB   6  
ATOM 10662 C CG   . ASP A 1 68  ? -3.946  -2.772  15.730  1.00 0.00 ? 68  ASP A CG   6  
ATOM 10663 O OD1  . ASP A 1 68  ? -4.189  -3.257  16.868  1.00 0.00 ? 68  ASP A OD1  6  
ATOM 10664 O OD2  . ASP A 1 68  ? -4.282  -1.608  15.377  1.00 0.00 ? 68  ASP A OD2  6  
ATOM 10665 H H    . ASP A 1 68  ? -2.140  -5.923  14.275  1.00 0.00 ? 68  ASP A H    6  
ATOM 10666 H HA   . ASP A 1 68  ? -4.758  -5.194  15.125  1.00 0.00 ? 68  ASP A HA   6  
ATOM 10667 H HB2  . ASP A 1 68  ? -2.222  -3.945  15.136  1.00 0.00 ? 68  ASP A HB2  6  
ATOM 10668 H HB3  . ASP A 1 68  ? -2.954  -3.045  13.817  1.00 0.00 ? 68  ASP A HB3  6  
ATOM 10669 N N    . PHE A 1 69  ? -4.363  -5.247  11.974  1.00 0.00 ? 69  PHE A N    6  
ATOM 10670 C CA   . PHE A 1 69  ? -5.109  -5.287  10.718  1.00 0.00 ? 69  PHE A CA   6  
ATOM 10671 C C    . PHE A 1 69  ? -6.220  -6.347  10.795  1.00 0.00 ? 69  PHE A C    6  
ATOM 10672 O O    . PHE A 1 69  ? -7.358  -6.140  10.371  1.00 0.00 ? 69  PHE A O    6  
ATOM 10673 C CB   . PHE A 1 69  ? -4.163  -5.460  9.491   1.00 0.00 ? 69  PHE A CB   6  
ATOM 10674 C CG   . PHE A 1 69  ? -4.914  -5.459  8.182   1.00 0.00 ? 69  PHE A CG   6  
ATOM 10675 C CD1  . PHE A 1 69  ? -4.695  -6.470  7.271   1.00 0.00 ? 69  PHE A CD1  6  
ATOM 10676 C CD2  . PHE A 1 69  ? -5.975  -4.594  7.982   1.00 0.00 ? 69  PHE A CD2  6  
ATOM 10677 C CE1  . PHE A 1 69  ? -5.596  -6.681  6.254   1.00 0.00 ? 69  PHE A CE1  6  
ATOM 10678 C CE2  . PHE A 1 69  ? -6.886  -4.825  6.985   1.00 0.00 ? 69  PHE A CE2  6  
ATOM 10679 C CZ   . PHE A 1 69  ? -6.703  -5.890  6.145   1.00 0.00 ? 69  PHE A CZ   6  
ATOM 10680 H H    . PHE A 1 69  ? -3.482  -5.720  11.957  1.00 0.00 ? 69  PHE A H    6  
ATOM 10681 H HA   . PHE A 1 69  ? -5.600  -4.347  10.595  1.00 0.00 ? 69  PHE A HA   6  
ATOM 10682 H HB2  . PHE A 1 69  ? -3.446  -4.618  9.450   1.00 0.00 ? 69  PHE A HB2  6  
ATOM 10683 H HB3  . PHE A 1 69  ? -3.591  -6.407  9.584   1.00 0.00 ? 69  PHE A HB3  6  
ATOM 10684 H HD1  . PHE A 1 69  ? -3.881  -7.162  7.430   1.00 0.00 ? 69  PHE A HD1  6  
ATOM 10685 H HD2  . PHE A 1 69  ? -6.190  -3.809  8.688   1.00 0.00 ? 69  PHE A HD2  6  
ATOM 10686 H HE1  . PHE A 1 69  ? -5.513  -7.507  5.566   1.00 0.00 ? 69  PHE A HE1  6  
ATOM 10687 H HE2  . PHE A 1 69  ? -7.762  -4.202  6.902   1.00 0.00 ? 69  PHE A HE2  6  
ATOM 10688 H HZ   . PHE A 1 69  ? -7.444  -6.178  5.424   1.00 0.00 ? 69  PHE A HZ   6  
ATOM 10689 N N    . THR A 1 70  ? -5.896  -7.481  11.460  1.00 0.00 ? 70  THR A N    6  
ATOM 10690 C CA   . THR A 1 70  ? -6.783  -8.610  11.750  1.00 0.00 ? 70  THR A CA   6  
ATOM 10691 C C    . THR A 1 70  ? -7.825  -8.267  12.803  1.00 0.00 ? 70  THR A C    6  
ATOM 10692 O O    . THR A 1 70  ? -8.995  -8.631  12.664  1.00 0.00 ? 70  THR A O    6  
ATOM 10693 C CB   . THR A 1 70  ? -6.010  -9.873  12.056  1.00 0.00 ? 70  THR A CB   6  
ATOM 10694 O OG1  . THR A 1 70  ? -4.800  -9.616  12.706  1.00 0.00 ? 70  THR A OG1  6  
ATOM 10695 C CG2  . THR A 1 70  ? -5.685  -10.550 10.714  1.00 0.00 ? 70  THR A CG2  6  
ATOM 10696 H H    . THR A 1 70  ? -4.956  -7.566  11.821  1.00 0.00 ? 70  THR A H    6  
ATOM 10697 H HA   . THR A 1 70  ? -7.361  -8.818  10.857  1.00 0.00 ? 70  THR A HA   6  
ATOM 10698 H HB   . THR A 1 70  ? -6.496  -10.536 12.781  1.00 0.00 ? 70  THR A HB   6  
ATOM 10699 H HG1  . THR A 1 70  ? -4.973  -8.956  13.400  1.00 0.00 ? 70  THR A HG1  6  
ATOM 10700 H HG21 . THR A 1 70  ? -5.136  -9.835  10.065  1.00 0.00 ? 70  THR A HG21 6  
ATOM 10701 H HG22 . THR A 1 70  ? -5.040  -11.438 10.872  1.00 0.00 ? 70  THR A HG22 6  
ATOM 10702 H HG23 . THR A 1 70  ? -6.604  -10.852 10.177  1.00 0.00 ? 70  THR A HG23 6  
ATOM 10703 N N    . LYS A 1 71  ? -7.414  -7.439  13.832  1.00 0.00 ? 71  LYS A N    6  
ATOM 10704 C CA   . LYS A 1 71  ? -8.338  -6.813  14.804  1.00 0.00 ? 71  LYS A CA   6  
ATOM 10705 C C    . LYS A 1 71  ? -9.373  -5.839  14.189  1.00 0.00 ? 71  LYS A C    6  
ATOM 10706 O O    . LYS A 1 71  ? -10.519 -5.803  14.627  1.00 0.00 ? 71  LYS A O    6  
ATOM 10707 C CB   . LYS A 1 71  ? -7.662  -5.997  15.968  1.00 0.00 ? 71  LYS A CB   6  
ATOM 10708 C CG   . LYS A 1 71  ? -6.634  -6.716  16.863  1.00 0.00 ? 71  LYS A CG   6  
ATOM 10709 C CD   . LYS A 1 71  ? -7.025  -8.165  17.164  1.00 0.00 ? 71  LYS A CD   6  
ATOM 10710 C CE   . LYS A 1 71  ? -6.015  -9.013  17.947  1.00 0.00 ? 71  LYS A CE   6  
ATOM 10711 N NZ   . LYS A 1 71  ? -6.692  -10.097 18.696  1.00 0.00 ? 71  LYS A NZ   6  
ATOM 10712 H H    . LYS A 1 71  ? -6.413  -7.226  13.951  1.00 0.00 ? 71  LYS A H    6  
ATOM 10713 H HA   . LYS A 1 71  ? -8.905  -7.628  15.243  1.00 0.00 ? 71  LYS A HA   6  
ATOM 10714 H HB2  . LYS A 1 71  ? -7.152  -5.090  15.561  1.00 0.00 ? 71  LYS A HB2  6  
ATOM 10715 H HB3  . LYS A 1 71  ? -8.486  -5.674  16.656  1.00 0.00 ? 71  LYS A HB3  6  
ATOM 10716 H HG2  . LYS A 1 71  ? -5.621  -6.654  16.422  1.00 0.00 ? 71  LYS A HG2  6  
ATOM 10717 H HG3  . LYS A 1 71  ? -6.556  -6.156  17.813  1.00 0.00 ? 71  LYS A HG3  6  
ATOM 10718 H HD2  . LYS A 1 71  ? -8.011  -8.144  17.674  1.00 0.00 ? 71  LYS A HD2  6  
ATOM 10719 H HD3  . LYS A 1 71  ? -7.118  -8.662  16.173  1.00 0.00 ? 71  LYS A HD3  6  
ATOM 10720 H HE2  . LYS A 1 71  ? -5.325  -9.488  17.222  1.00 0.00 ? 71  LYS A HE2  6  
ATOM 10721 H HE3  . LYS A 1 71  ? -5.408  -8.443  18.670  1.00 0.00 ? 71  LYS A HE3  6  
ATOM 10722 H HZ1  . LYS A 1 71  ? -7.226  -10.695 18.034  1.00 0.00 ? 71  LYS A HZ1  6  
ATOM 10723 H HZ2  . LYS A 1 71  ? -5.981  -10.675 19.189  1.00 0.00 ? 71  LYS A HZ2  6  
ATOM 10724 H HZ3  . LYS A 1 71  ? -7.346  -9.682  19.392  1.00 0.00 ? 71  LYS A HZ3  6  
ATOM 10725 N N    . TRP A 1 72  ? -8.977  -5.032  13.163  1.00 0.00 ? 72  TRP A N    6  
ATOM 10726 C CA   . TRP A 1 72  ? -9.857  -4.089  12.459  1.00 0.00 ? 72  TRP A CA   6  
ATOM 10727 C C    . TRP A 1 72  ? -10.740 -4.739  11.383  1.00 0.00 ? 72  TRP A C    6  
ATOM 10728 O O    . TRP A 1 72  ? -11.959 -4.610  11.421  1.00 0.00 ? 72  TRP A O    6  
ATOM 10729 C CB   . TRP A 1 72  ? -9.066  -2.867  11.882  1.00 0.00 ? 72  TRP A CB   6  
ATOM 10730 C CG   . TRP A 1 72  ? -9.903  -1.811  11.140  1.00 0.00 ? 72  TRP A CG   6  
ATOM 10731 C CD1  . TRP A 1 72  ? -10.688 -0.808  11.631  1.00 0.00 ? 72  TRP A CD1  6  
ATOM 10732 C CD2  . TRP A 1 72  ? -10.125 -1.838  9.717   1.00 0.00 ? 72  TRP A CD2  6  
ATOM 10733 N NE1  . TRP A 1 72  ? -11.386 -0.211  10.600  1.00 0.00 ? 72  TRP A NE1  6  
ATOM 10734 C CE2  . TRP A 1 72  ? -11.047 -0.838  9.416   1.00 0.00 ? 72  TRP A CE2  6  
ATOM 10735 C CE3  . TRP A 1 72  ? -9.621  -2.647  8.743   1.00 0.00 ? 72  TRP A CE3  6  
ATOM 10736 C CZ2  . TRP A 1 72  ? -11.425 -0.588  8.121   1.00 0.00 ? 72  TRP A CZ2  6  
ATOM 10737 C CZ3  . TRP A 1 72  ? -10.007 -2.403  7.448   1.00 0.00 ? 72  TRP A CZ3  6  
ATOM 10738 C CH2  . TRP A 1 72  ? -10.864 -1.370  7.124   1.00 0.00 ? 72  TRP A CH2  6  
ATOM 10739 H H    . TRP A 1 72  ? -8.023  -5.097  12.853  1.00 0.00 ? 72  TRP A H    6  
ATOM 10740 H HA   . TRP A 1 72  ? -10.558 -3.676  13.179  1.00 0.00 ? 72  TRP A HA   6  
ATOM 10741 H HB2  . TRP A 1 72  ? -8.562  -2.370  12.741  1.00 0.00 ? 72  TRP A HB2  6  
ATOM 10742 H HB3  . TRP A 1 72  ? -8.278  -3.250  11.193  1.00 0.00 ? 72  TRP A HB3  6  
ATOM 10743 H HD1  . TRP A 1 72  ? -10.758 -0.538  12.675  1.00 0.00 ? 72  TRP A HD1  6  
ATOM 10744 H HE1  . TRP A 1 72  ? -11.998 0.543   10.710  1.00 0.00 ? 72  TRP A HE1  6  
ATOM 10745 H HE3  . TRP A 1 72  ? -8.930  -3.450  8.953   1.00 0.00 ? 72  TRP A HE3  6  
ATOM 10746 H HZ2  . TRP A 1 72  ? -12.094 0.222   7.870   1.00 0.00 ? 72  TRP A HZ2  6  
ATOM 10747 H HZ3  . TRP A 1 72  ? -9.629  -3.052  6.678   1.00 0.00 ? 72  TRP A HZ3  6  
ATOM 10748 H HH2  . TRP A 1 72  ? -11.092 -1.178  6.080   1.00 0.00 ? 72  TRP A HH2  6  
ATOM 10749 N N    . LEU A 1 73  ? -10.157 -5.451  10.376  1.00 0.00 ? 73  LEU A N    6  
ATOM 10750 C CA   . LEU A 1 73  ? -10.844 -6.110  9.244   1.00 0.00 ? 73  LEU A CA   6  
ATOM 10751 C C    . LEU A 1 73  ? -11.767 -7.255  9.580   1.00 0.00 ? 73  LEU A C    6  
ATOM 10752 O O    . LEU A 1 73  ? -12.841 -7.445  9.004   1.00 0.00 ? 73  LEU A O    6  
ATOM 10753 C CB   . LEU A 1 73  ? -9.806  -6.471  8.170   1.00 0.00 ? 73  LEU A CB   6  
ATOM 10754 C CG   . LEU A 1 73  ? -10.013 -7.641  7.152   1.00 0.00 ? 73  LEU A CG   6  
ATOM 10755 C CD1  . LEU A 1 73  ? -10.310 -7.054  5.775   1.00 0.00 ? 73  LEU A CD1  6  
ATOM 10756 C CD2  . LEU A 1 73  ? -8.732  -8.494  7.091   1.00 0.00 ? 73  LEU A CD2  6  
ATOM 10757 H H    . LEU A 1 73  ? -9.154  -5.570  10.364  1.00 0.00 ? 73  LEU A H    6  
ATOM 10758 H HA   . LEU A 1 73  ? -11.494 -5.368  8.800   1.00 0.00 ? 73  LEU A HA   6  
ATOM 10759 H HB2  . LEU A 1 73  ? -9.672  -5.449  7.698   1.00 0.00 ? 73  LEU A HB2  6  
ATOM 10760 H HB3  . LEU A 1 73  ? -8.857  -6.727  8.684   1.00 0.00 ? 73  LEU A HB3  6  
ATOM 10761 H HG   . LEU A 1 73  ? -10.807 -8.414  7.405   1.00 0.00 ? 73  LEU A HG   6  
ATOM 10762 H HD11 . LEU A 1 73  ? -9.519  -6.312  5.537   1.00 0.00 ? 73  LEU A HD11 6  
ATOM 10763 H HD12 . LEU A 1 73  ? -10.301 -7.832  4.985   1.00 0.00 ? 73  LEU A HD12 6  
ATOM 10764 H HD13 . LEU A 1 73  ? -11.287 -6.537  5.767   1.00 0.00 ? 73  LEU A HD13 6  
ATOM 10765 H HD21 . LEU A 1 73  ? -7.829  -7.861  7.172   1.00 0.00 ? 73  LEU A HD21 6  
ATOM 10766 H HD22 . LEU A 1 73  ? -8.717  -9.211  7.941   1.00 0.00 ? 73  LEU A HD22 6  
ATOM 10767 H HD23 . LEU A 1 73  ? -8.674  -9.057  6.137   1.00 0.00 ? 73  LEU A HD23 6  
ATOM 10768 N N    . GLY A 1 74  ? -11.351 -8.025  10.622  1.00 0.00 ? 74  GLY A N    6  
ATOM 10769 C CA   . GLY A 1 74  ? -12.101 -9.076  11.314  1.00 0.00 ? 74  GLY A CA   6  
ATOM 10770 C C    . GLY A 1 74  ? -13.390 -8.614  11.957  1.00 0.00 ? 74  GLY A C    6  
ATOM 10771 O O    . GLY A 1 74  ? -14.350 -9.347  12.168  1.00 0.00 ? 74  GLY A O    6  
ATOM 10772 H H    . GLY A 1 74  ? -10.450 -7.822  11.023  1.00 0.00 ? 74  GLY A H    6  
ATOM 10773 H HA2  . GLY A 1 74  ? -12.347 -9.810  10.577  1.00 0.00 ? 74  GLY A HA2  6  
ATOM 10774 H HA3  . GLY A 1 74  ? -11.469 -9.462  12.102  1.00 0.00 ? 74  GLY A HA3  6  
ATOM 10775 N N    . ARG A 1 75  ? -13.400 -7.313  12.323  1.00 0.00 ? 75  ARG A N    6  
ATOM 10776 C CA   . ARG A 1 75  ? -14.486 -6.618  13.010  1.00 0.00 ? 75  ARG A CA   6  
ATOM 10777 C C    . ARG A 1 75  ? -15.602 -6.098  12.143  1.00 0.00 ? 75  ARG A C    6  
ATOM 10778 O O    . ARG A 1 75  ? -16.691 -5.785  12.621  1.00 0.00 ? 75  ARG A O    6  
ATOM 10779 C CB   . ARG A 1 75  ? -13.843 -5.441  13.745  1.00 0.00 ? 75  ARG A CB   6  
ATOM 10780 C CG   . ARG A 1 75  ? -14.505 -5.011  15.060  1.00 0.00 ? 75  ARG A CG   6  
ATOM 10781 C CD   . ARG A 1 75  ? -13.679 -3.936  15.779  1.00 0.00 ? 75  ARG A CD   6  
ATOM 10782 N NE   . ARG A 1 75  ? -14.389 -3.552  17.048  1.00 0.00 ? 75  ARG A NE   6  
ATOM 10783 C CZ   . ARG A 1 75  ? -13.891 -2.635  17.936  1.00 0.00 ? 75  ARG A CZ   6  
ATOM 10784 N NH1  . ARG A 1 75  ? -12.699 -2.012  17.701  1.00 0.00 ? 75  ARG A NH1  6  
ATOM 10785 N NH2  . ARG A 1 75  ? -14.597 -2.341  19.066  1.00 0.00 ? 75  ARG A NH2  6  
ATOM 10786 H H    . ARG A 1 75  ? -12.584 -6.747  12.099  1.00 0.00 ? 75  ARG A H    6  
ATOM 10787 H HA   . ARG A 1 75  ? -14.927 -7.280  13.745  1.00 0.00 ? 75  ARG A HA   6  
ATOM 10788 H HB2  . ARG A 1 75  ? -12.846 -5.867  13.931  1.00 0.00 ? 75  ARG A HB2  6  
ATOM 10789 H HB3  . ARG A 1 75  ? -13.678 -4.549  13.100  1.00 0.00 ? 75  ARG A HB3  6  
ATOM 10790 H HG2  . ARG A 1 75  ? -15.516 -4.609  14.831  1.00 0.00 ? 75  ARG A HG2  6  
ATOM 10791 H HG3  . ARG A 1 75  ? -14.616 -5.901  15.719  1.00 0.00 ? 75  ARG A HG3  6  
ATOM 10792 H HD2  . ARG A 1 75  ? -12.670 -4.335  16.029  1.00 0.00 ? 75  ARG A HD2  6  
ATOM 10793 H HD3  . ARG A 1 75  ? -13.580 -3.039  15.127  1.00 0.00 ? 75  ARG A HD3  6  
ATOM 10794 H HE   . ARG A 1 75  ? -15.266 -3.988  17.253  1.00 0.00 ? 75  ARG A HE   6  
ATOM 10795 H HH11 . ARG A 1 75  ? -12.179 -2.224  16.874  1.00 0.00 ? 75  ARG A HH11 6  
ATOM 10796 H HH12 . ARG A 1 75  ? -12.347 -1.344  18.357  1.00 0.00 ? 75  ARG A HH12 6  
ATOM 10797 H HH21 . ARG A 1 75  ? -15.471 -2.796  19.240  1.00 0.00 ? 75  ARG A HH21 6  
ATOM 10798 H HH22 . ARG A 1 75  ? -14.240 -1.673  19.718  1.00 0.00 ? 75  ARG A HH22 6  
ATOM 10799 N N    . GLU A 1 76  ? -15.338 -5.961  10.823  1.00 0.00 ? 76  GLU A N    6  
ATOM 10800 C CA   . GLU A 1 76  ? -16.256 -5.399  9.849   1.00 0.00 ? 76  GLU A CA   6  
ATOM 10801 C C    . GLU A 1 76  ? -17.230 -6.418  9.309   1.00 0.00 ? 76  GLU A C    6  
ATOM 10802 O O    . GLU A 1 76  ? -18.248 -6.059  8.721   1.00 0.00 ? 76  GLU A O    6  
ATOM 10803 C CB   . GLU A 1 76  ? -15.457 -4.775  8.678   1.00 0.00 ? 76  GLU A CB   6  
ATOM 10804 C CG   . GLU A 1 76  ? -14.612 -3.572  9.131   1.00 0.00 ? 76  GLU A CG   6  
ATOM 10805 C CD   . GLU A 1 76  ? -13.889 -2.995  7.920   1.00 0.00 ? 76  GLU A CD   6  
ATOM 10806 O OE1  . GLU A 1 76  ? -14.281 -1.888  7.464   1.00 0.00 ? 76  GLU A OE1  6  
ATOM 10807 O OE2  . GLU A 1 76  ? -12.936 -3.658  7.434   1.00 0.00 ? 76  GLU A OE2  6  
ATOM 10808 H H    . GLU A 1 76  ? -14.436 -6.210  10.475  1.00 0.00 ? 76  GLU A H    6  
ATOM 10809 H HA   . GLU A 1 76  ? -16.847 -4.613  10.304  1.00 0.00 ? 76  GLU A HA   6  
ATOM 10810 H HB2  . GLU A 1 76  ? -14.793 -5.548  8.226   1.00 0.00 ? 76  GLU A HB2  6  
ATOM 10811 H HB3  . GLU A 1 76  ? -16.150 -4.409  7.885   1.00 0.00 ? 76  GLU A HB3  6  
ATOM 10812 H HG2  . GLU A 1 76  ? -15.278 -2.802  9.576   1.00 0.00 ? 76  GLU A HG2  6  
ATOM 10813 H HG3  . GLU A 1 76  ? -13.869 -3.880  9.896   1.00 0.00 ? 76  GLU A HG3  6  
ATOM 10814 N N    . GLY A 1 77  ? -16.904 -7.739  9.469   1.00 0.00 ? 77  GLY A N    6  
ATOM 10815 C CA   . GLY A 1 77  ? -17.756 -8.786  8.905   1.00 0.00 ? 77  GLY A CA   6  
ATOM 10816 C C    . GLY A 1 77  ? -17.326 -9.145  7.513   1.00 0.00 ? 77  GLY A C    6  
ATOM 10817 O O    . GLY A 1 77  ? -18.096 -9.671  6.721   1.00 0.00 ? 77  GLY A O    6  
ATOM 10818 H H    . GLY A 1 77  ? -16.065 -8.035  9.971   1.00 0.00 ? 77  GLY A H    6  
ATOM 10819 H HA2  . GLY A 1 77  ? -17.617 -9.667  9.515   1.00 0.00 ? 77  GLY A HA2  6  
ATOM 10820 H HA3  . GLY A 1 77  ? -18.798 -8.481  8.860   1.00 0.00 ? 77  GLY A HA3  6  
ATOM 10821 N N    . LEU A 1 78  ? -16.025 -8.900  7.208   1.00 0.00 ? 78  LEU A N    6  
ATOM 10822 C CA   . LEU A 1 78  ? -15.398 -9.286  5.945   1.00 0.00 ? 78  LEU A CA   6  
ATOM 10823 C C    . LEU A 1 78  ? -14.531 -10.466 6.158   1.00 0.00 ? 78  LEU A C    6  
ATOM 10824 O O    . LEU A 1 78  ? -14.459 -11.308 5.287   1.00 0.00 ? 78  LEU A O    6  
ATOM 10825 C CB   . LEU A 1 78  ? -14.508 -8.244  5.223   1.00 0.00 ? 78  LEU A CB   6  
ATOM 10826 C CG   . LEU A 1 78  ? -15.101 -6.835  5.291   1.00 0.00 ? 78  LEU A CG   6  
ATOM 10827 C CD1  . LEU A 1 78  ? -13.975 -5.806  5.354   1.00 0.00 ? 78  LEU A CD1  6  
ATOM 10828 C CD2  . LEU A 1 78  ? -16.089 -6.610  4.138   1.00 0.00 ? 78  LEU A CD2  6  
ATOM 10829 H H    . LEU A 1 78  ? -15.467 -8.428  7.886   1.00 0.00 ? 78  LEU A H    6  
ATOM 10830 H HA   . LEU A 1 78  ? -16.157 -9.623  5.244   1.00 0.00 ? 78  LEU A HA   6  
ATOM 10831 H HB2  . LEU A 1 78  ? -13.429 -8.234  5.548   1.00 0.00 ? 78  LEU A HB2  6  
ATOM 10832 H HB3  . LEU A 1 78  ? -14.478 -8.541  4.145   1.00 0.00 ? 78  LEU A HB3  6  
ATOM 10833 H HG   . LEU A 1 78  ? -15.675 -6.717  6.232   1.00 0.00 ? 78  LEU A HG   6  
ATOM 10834 H HD11 . LEU A 1 78  ? -13.309 -5.916  4.478   1.00 0.00 ? 78  LEU A HD11 6  
ATOM 10835 H HD12 . LEU A 1 78  ? -14.393 -4.778  5.363   1.00 0.00 ? 78  LEU A HD12 6  
ATOM 10836 H HD13 . LEU A 1 78  ? -13.373 -5.959  6.277   1.00 0.00 ? 78  LEU A HD13 6  
ATOM 10837 H HD21 . LEU A 1 78  ? -16.629 -7.563  3.879   1.00 0.00 ? 78  LEU A HD21 6  
ATOM 10838 H HD22 . LEU A 1 78  ? -16.822 -5.827  4.421   1.00 0.00 ? 78  LEU A HD22 6  
ATOM 10839 H HD23 . LEU A 1 78  ? -15.539 -6.236  3.251   1.00 0.00 ? 78  LEU A HD23 6  
ATOM 10840 N N    . CYS A 1 79  ? -13.847 -10.575 7.309   1.00 0.00 ? 79  CYS A N    6  
ATOM 10841 C CA   . CYS A 1 79  ? -12.947 -11.692 7.609   1.00 0.00 ? 79  CYS A CA   6  
ATOM 10842 C C    . CYS A 1 79  ? -13.073 -12.326 8.996   1.00 0.00 ? 79  CYS A C    6  
ATOM 10843 O O    . CYS A 1 79  ? -13.394 -11.683 9.984   1.00 0.00 ? 79  CYS A O    6  
ATOM 10844 C CB   . CYS A 1 79  ? -11.473 -11.308 7.357   1.00 0.00 ? 79  CYS A CB   6  
ATOM 10845 S SG   . CYS A 1 79  ? -11.160 -10.506 5.743   1.00 0.00 ? 79  CYS A SG   6  
ATOM 10846 H H    . CYS A 1 79  ? -13.925 -9.816  7.929   1.00 0.00 ? 79  CYS A H    6  
ATOM 10847 H HA   . CYS A 1 79  ? -13.144 -12.497 6.952   1.00 0.00 ? 79  CYS A HA   6  
ATOM 10848 H HB2  . CYS A 1 79  ? -11.173 -10.720 8.255   1.00 0.00 ? 79  CYS A HB2  6  
ATOM 10849 H HB3  . CYS A 1 79  ? -10.838 -12.198 7.285   1.00 0.00 ? 79  CYS A HB3  6  
ATOM 10850 H HG   . CYS A 1 79  ? -9.875  -10.270 5.964   1.00 0.00 ? 79  CYS A HG   6  
ATOM 10851 N N    . LYS A 1 80  ? -12.751 -13.636 9.112   1.00 0.00 ? 80  LYS A N    6  
ATOM 10852 C CA   . LYS A 1 80  ? -12.621 -14.410 10.336  1.00 0.00 ? 80  LYS A CA   6  
ATOM 10853 C C    . LYS A 1 80  ? -11.133 -14.595 10.595  1.00 0.00 ? 80  LYS A C    6  
ATOM 10854 O O    . LYS A 1 80  ? -10.355 -14.705 9.662   1.00 0.00 ? 80  LYS A O    6  
ATOM 10855 C CB   . LYS A 1 80  ? -13.324 -15.790 10.218  1.00 0.00 ? 80  LYS A CB   6  
ATOM 10856 C CG   . LYS A 1 80  ? -14.855 -15.698 10.242  1.00 0.00 ? 80  LYS A CG   6  
ATOM 10857 C CD   . LYS A 1 80  ? -15.395 -14.988 11.500  1.00 0.00 ? 80  LYS A CD   6  
ATOM 10858 C CE   . LYS A 1 80  ? -16.884 -15.241 11.784  1.00 0.00 ? 80  LYS A CE   6  
ATOM 10859 N NZ   . LYS A 1 80  ? -17.145 -16.670 12.086  1.00 0.00 ? 80  LYS A NZ   6  
ATOM 10860 H H    . LYS A 1 80  ? -12.503 -14.199 8.303   1.00 0.00 ? 80  LYS A H    6  
ATOM 10861 H HA   . LYS A 1 80  ? -12.990 -13.808 11.149  1.00 0.00 ? 80  LYS A HA   6  
ATOM 10862 H HB2  . LYS A 1 80  ? -13.007 -16.285 9.269   1.00 0.00 ? 80  LYS A HB2  6  
ATOM 10863 H HB3  . LYS A 1 80  ? -13.021 -16.486 11.028  1.00 0.00 ? 80  LYS A HB3  6  
ATOM 10864 H HG2  . LYS A 1 80  ? -15.224 -15.186 9.328   1.00 0.00 ? 80  LYS A HG2  6  
ATOM 10865 H HG3  . LYS A 1 80  ? -15.241 -16.740 10.220  1.00 0.00 ? 80  LYS A HG3  6  
ATOM 10866 H HD2  . LYS A 1 80  ? -14.808 -15.331 12.383  1.00 0.00 ? 80  LYS A HD2  6  
ATOM 10867 H HD3  . LYS A 1 80  ? -15.236 -13.891 11.387  1.00 0.00 ? 80  LYS A HD3  6  
ATOM 10868 H HE2  . LYS A 1 80  ? -17.211 -14.650 12.664  1.00 0.00 ? 80  LYS A HE2  6  
ATOM 10869 H HE3  . LYS A 1 80  ? -17.507 -14.967 10.908  1.00 0.00 ? 80  LYS A HE3  6  
ATOM 10870 H HZ1  . LYS A 1 80  ? -16.594 -16.952 12.922  1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 10871 H HZ2  . LYS A 1 80  ? -18.160 -16.805 12.278  1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 10872 H HZ3  . LYS A 1 80  ? -16.865 -17.252 11.273  1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 10873 N N    . VAL A 1 81  ? -10.644 -14.585 11.852  1.00 0.00 ? 81  VAL A N    6  
ATOM 10874 C CA   . VAL A 1 81  ? -9.224  -14.658 12.137  1.00 0.00 ? 81  VAL A CA   6  
ATOM 10875 C C    . VAL A 1 81  ? -8.904  -15.735 13.145  1.00 0.00 ? 81  VAL A C    6  
ATOM 10876 O O    . VAL A 1 81  ? -9.621  -15.943 14.123  1.00 0.00 ? 81  VAL A O    6  
ATOM 10877 C CB   . VAL A 1 81  ? -8.695  -13.318 12.631  1.00 0.00 ? 81  VAL A CB   6  
ATOM 10878 C CG1  . VAL A 1 81  ? -8.152  -12.539 11.441  1.00 0.00 ? 81  VAL A CG1  6  
ATOM 10879 C CG2  . VAL A 1 81  ? -9.764  -12.482 13.367  1.00 0.00 ? 81  VAL A CG2  6  
ATOM 10880 H H    . VAL A 1 81  ? -11.202 -14.513 12.667  1.00 0.00 ? 81  VAL A H    6  
ATOM 10881 H HA   . VAL A 1 81  ? -8.650  -14.932 11.257  1.00 0.00 ? 81  VAL A HA   6  
ATOM 10882 H HB   . VAL A 1 81  ? -7.815  -13.457 13.286  1.00 0.00 ? 81  VAL A HB   6  
ATOM 10883 H HG11 . VAL A 1 81  ? -8.769  -12.661 10.529  1.00 0.00 ? 81  VAL A HG11 6  
ATOM 10884 H HG12 . VAL A 1 81  ? -8.124  -11.466 11.724  1.00 0.00 ? 81  VAL A HG12 6  
ATOM 10885 H HG13 . VAL A 1 81  ? -7.100  -12.873 11.258  1.00 0.00 ? 81  VAL A HG13 6  
ATOM 10886 H HG21 . VAL A 1 81  ? -10.240 -13.065 14.181  1.00 0.00 ? 81  VAL A HG21 6  
ATOM 10887 H HG22 . VAL A 1 81  ? -9.309  -11.566 13.805  1.00 0.00 ? 81  VAL A HG22 6  
ATOM 10888 H HG23 . VAL A 1 81  ? -10.537 -12.144 12.643  1.00 0.00 ? 81  VAL A HG23 6  
ATOM 10889 N N    . ASP A 1 82  ? -7.744  -16.413 12.908  1.00 0.00 ? 82  ASP A N    6  
ATOM 10890 C CA   . ASP A 1 82  ? -7.163  -17.448 13.775  1.00 0.00 ? 82  ASP A CA   6  
ATOM 10891 C C    . ASP A 1 82  ? -5.644  -17.267 13.829  1.00 0.00 ? 82  ASP A C    6  
ATOM 10892 O O    . ASP A 1 82  ? -5.045  -16.779 12.870  1.00 0.00 ? 82  ASP A O    6  
ATOM 10893 C CB   . ASP A 1 82  ? -7.460  -18.896 13.279  1.00 0.00 ? 82  ASP A CB   6  
ATOM 10894 C CG   . ASP A 1 82  ? -8.963  -19.185 13.317  1.00 0.00 ? 82  ASP A CG   6  
ATOM 10895 O OD1  . ASP A 1 82  ? -9.534  -19.200 14.441  1.00 0.00 ? 82  ASP A OD1  6  
ATOM 10896 O OD2  . ASP A 1 82  ? -9.557  -19.393 12.226  1.00 0.00 ? 82  ASP A OD2  6  
ATOM 10897 H H    . ASP A 1 82  ? -7.210  -16.190 12.064  1.00 0.00 ? 82  ASP A H    6  
ATOM 10898 H HA   . ASP A 1 82  ? -7.521  -17.309 14.789  1.00 0.00 ? 82  ASP A HA   6  
ATOM 10899 H HB2  . ASP A 1 82  ? -7.096  -19.023 12.236  1.00 0.00 ? 82  ASP A HB2  6  
ATOM 10900 H HB3  . ASP A 1 82  ? -6.955  -19.650 13.923  1.00 0.00 ? 82  ASP A HB3  6  
ATOM 10901 N N    . GLU A 1 83  ? -4.961  -17.658 14.949  1.00 0.00 ? 83  GLU A N    6  
ATOM 10902 C CA   . GLU A 1 83  ? -3.512  -17.515 15.107  1.00 0.00 ? 83  GLU A CA   6  
ATOM 10903 C C    . GLU A 1 83  ? -2.827  -18.848 15.409  1.00 0.00 ? 83  GLU A C    6  
ATOM 10904 O O    . GLU A 1 83  ? -3.315  -19.689 16.165  1.00 0.00 ? 83  GLU A O    6  
ATOM 10905 C CB   . GLU A 1 83  ? -3.128  -16.435 16.151  1.00 0.00 ? 83  GLU A CB   6  
ATOM 10906 C CG   . GLU A 1 83  ? -1.621  -16.090 16.162  1.00 0.00 ? 83  GLU A CG   6  
ATOM 10907 C CD   . GLU A 1 83  ? -1.306  -14.894 17.060  1.00 0.00 ? 83  GLU A CD   6  
ATOM 10908 O OE1  . GLU A 1 83  ? -0.121  -14.463 17.055  1.00 0.00 ? 83  GLU A OE1  6  
ATOM 10909 O OE2  . GLU A 1 83  ? -2.225  -14.398 17.765  1.00 0.00 ? 83  GLU A OE2  6  
ATOM 10910 H H    . GLU A 1 83  ? -5.429  -18.064 15.734  1.00 0.00 ? 83  GLU A H    6  
ATOM 10911 H HA   . GLU A 1 83  ? -3.081  -17.165 14.171  1.00 0.00 ? 83  GLU A HA   6  
ATOM 10912 H HB2  . GLU A 1 83  ? -3.683  -15.508 15.876  1.00 0.00 ? 83  GLU A HB2  6  
ATOM 10913 H HB3  . GLU A 1 83  ? -3.461  -16.741 17.166  1.00 0.00 ? 83  GLU A HB3  6  
ATOM 10914 H HG2  . GLU A 1 83  ? -1.039  -16.957 16.544  1.00 0.00 ? 83  GLU A HG2  6  
ATOM 10915 H HG3  . GLU A 1 83  ? -1.287  -15.888 15.115  1.00 0.00 ? 83  GLU A HG3  6  
ATOM 10916 N N    . THR A 1 84  ? -1.644  -19.016 14.763  1.00 0.00 ? 84  THR A N    6  
ATOM 10917 C CA   . THR A 1 84  ? -0.706  -20.129 14.756  1.00 0.00 ? 84  THR A CA   6  
ATOM 10918 C C    . THR A 1 84  ? 0.635   -19.654 15.241  1.00 0.00 ? 84  THR A C    6  
ATOM 10919 O O    . THR A 1 84  ? 0.829   -18.459 15.449  1.00 0.00 ? 84  THR A O    6  
ATOM 10920 C CB   . THR A 1 84  ? -0.448  -20.640 13.302  1.00 0.00 ? 84  THR A CB   6  
ATOM 10921 O OG1  . THR A 1 84  ? 0.176   -19.714 12.420  1.00 0.00 ? 84  THR A OG1  6  
ATOM 10922 C CG2  . THR A 1 84  ? -1.751  -20.996 12.591  1.00 0.00 ? 84  THR A CG2  6  
ATOM 10923 H H    . THR A 1 84  ? -1.321  -18.263 14.188  1.00 0.00 ? 84  THR A H    6  
ATOM 10924 H HA   . THR A 1 84  ? -0.984  -20.912 15.446  1.00 0.00 ? 84  THR A HA   6  
ATOM 10925 H HB   . THR A 1 84  ? 0.266   -21.486 13.365  1.00 0.00 ? 84  THR A HB   6  
ATOM 10926 H HG1  . THR A 1 84  ? -0.323  -19.758 11.595  1.00 0.00 ? 84  THR A HG1  6  
ATOM 10927 H HG21 . THR A 1 84  ? -2.349  -21.721 13.180  1.00 0.00 ? 84  THR A HG21 6  
ATOM 10928 H HG22 . THR A 1 84  ? -2.348  -20.068 12.426  1.00 0.00 ? 84  THR A HG22 6  
ATOM 10929 H HG23 . THR A 1 84  ? -1.532  -21.425 11.589  1.00 0.00 ? 84  THR A HG23 6  
ATOM 10930 N N    . PRO A 1 85  ? 1.626   -20.557 15.372  1.00 0.00 ? 85  PRO A N    6  
ATOM 10931 C CA   . PRO A 1 85  ? 3.004   -20.161 15.532  1.00 0.00 ? 85  PRO A CA   6  
ATOM 10932 C C    . PRO A 1 85  ? 3.723   -19.544 14.311  1.00 0.00 ? 85  PRO A C    6  
ATOM 10933 O O    . PRO A 1 85  ? 4.896   -19.201 14.451  1.00 0.00 ? 85  PRO A O    6  
ATOM 10934 C CB   . PRO A 1 85  ? 3.692   -21.455 15.999  1.00 0.00 ? 85  PRO A CB   6  
ATOM 10935 C CG   . PRO A 1 85  ? 2.586   -22.425 16.411  1.00 0.00 ? 85  PRO A CG   6  
ATOM 10936 C CD   . PRO A 1 85  ? 1.473   -22.015 15.469  1.00 0.00 ? 85  PRO A CD   6  
ATOM 10937 H HA   . PRO A 1 85  ? 2.996   -19.417 16.287  1.00 0.00 ? 85  PRO A HA   6  
ATOM 10938 H HB2  . PRO A 1 85  ? 4.339   -21.930 15.229  1.00 0.00 ? 85  PRO A HB2  6  
ATOM 10939 H HB3  . PRO A 1 85  ? 4.278   -21.167 16.868  1.00 0.00 ? 85  PRO A HB3  6  
ATOM 10940 H HG2  . PRO A 1 85  ? 2.885   -23.487 16.304  1.00 0.00 ? 85  PRO A HG2  6  
ATOM 10941 H HG3  . PRO A 1 85  ? 2.286   -22.232 17.466  1.00 0.00 ? 85  PRO A HG3  6  
ATOM 10942 H HD2  . PRO A 1 85  ? 1.670   -22.467 14.468  1.00 0.00 ? 85  PRO A HD2  6  
ATOM 10943 H HD3  . PRO A 1 85  ? 0.484   -22.342 15.860  1.00 0.00 ? 85  PRO A HD3  6  
ATOM 10944 N N    . LYS A 1 86  ? 3.073   -19.414 13.122  1.00 0.00 ? 86  LYS A N    6  
ATOM 10945 C CA   . LYS A 1 86  ? 3.683   -18.915 11.908  1.00 0.00 ? 86  LYS A CA   6  
ATOM 10946 C C    . LYS A 1 86  ? 3.165   -17.548 11.464  1.00 0.00 ? 86  LYS A C    6  
ATOM 10947 O O    . LYS A 1 86  ? 3.655   -16.978 10.489  1.00 0.00 ? 86  LYS A O    6  
ATOM 10948 C CB   . LYS A 1 86  ? 3.393   -19.920 10.769  1.00 0.00 ? 86  LYS A CB   6  
ATOM 10949 C CG   . LYS A 1 86  ? 3.989   -21.303 11.057  1.00 0.00 ? 86  LYS A CG   6  
ATOM 10950 C CD   . LYS A 1 86  ? 3.983   -22.198 9.818   1.00 0.00 ? 86  LYS A CD   6  
ATOM 10951 C CE   . LYS A 1 86  ? 2.579   -22.626 9.365   1.00 0.00 ? 86  LYS A CE   6  
ATOM 10952 N NZ   . LYS A 1 86  ? 2.653   -23.497 8.168   1.00 0.00 ? 86  LYS A NZ   6  
ATOM 10953 H H    . LYS A 1 86  ? 2.119   -19.707 13.019  1.00 0.00 ? 86  LYS A H    6  
ATOM 10954 H HA   . LYS A 1 86  ? 4.759   -18.876 12.020  1.00 0.00 ? 86  LYS A HA   6  
ATOM 10955 H HB2  . LYS A 1 86  ? 2.294   -20.029 10.620  1.00 0.00 ? 86  LYS A HB2  6  
ATOM 10956 H HB3  . LYS A 1 86  ? 3.816   -19.542 9.811   1.00 0.00 ? 86  LYS A HB3  6  
ATOM 10957 H HG2  . LYS A 1 86  ? 5.047   -21.168 11.383  1.00 0.00 ? 86  LYS A HG2  6  
ATOM 10958 H HG3  . LYS A 1 86  ? 3.442   -21.802 11.885  1.00 0.00 ? 86  LYS A HG3  6  
ATOM 10959 H HD2  . LYS A 1 86  ? 4.495   -21.627 9.011   1.00 0.00 ? 86  LYS A HD2  6  
ATOM 10960 H HD3  . LYS A 1 86  ? 4.595   -23.101 10.038  1.00 0.00 ? 86  LYS A HD3  6  
ATOM 10961 H HE2  . LYS A 1 86  ? 2.066   -23.200 10.167  1.00 0.00 ? 86  LYS A HE2  6  
ATOM 10962 H HE3  . LYS A 1 86  ? 1.954   -21.747 9.096   1.00 0.00 ? 86  LYS A HE3  6  
ATOM 10963 H HZ1  . LYS A 1 86  ? 3.208   -24.348 8.394   1.00 0.00 ? 86  LYS A HZ1  6  
ATOM 10964 H HZ2  . LYS A 1 86  ? 1.693   -23.775 7.882   1.00 0.00 ? 86  LYS A HZ2  6  
ATOM 10965 H HZ3  . LYS A 1 86  ? 3.112   -22.978 7.392   1.00 0.00 ? 86  LYS A HZ3  6  
ATOM 10966 N N    . GLY A 1 87  ? 2.120   -16.997 12.135  1.00 0.00 ? 87  GLY A N    6  
ATOM 10967 C CA   . GLY A 1 87  ? 1.480   -15.781 11.654  1.00 0.00 ? 87  GLY A CA   6  
ATOM 10968 C C    . GLY A 1 87  ? 0.039   -15.695 12.029  1.00 0.00 ? 87  GLY A C    6  
ATOM 10969 O O    . GLY A 1 87  ? -0.486  -16.475 12.822  1.00 0.00 ? 87  GLY A O    6  
ATOM 10970 H H    . GLY A 1 87  ? 1.685   -17.447 12.919  1.00 0.00 ? 87  GLY A H    6  
ATOM 10971 H HA2  . GLY A 1 87  ? 2.004   -14.908 12.016  1.00 0.00 ? 87  GLY A HA2  6  
ATOM 10972 H HA3  . GLY A 1 87  ? 1.415   -15.858 10.578  1.00 0.00 ? 87  GLY A HA3  6  
ATOM 10973 N N    . TRP A 1 88  ? -0.668  -14.763 11.338  1.00 0.00 ? 88  TRP A N    6  
ATOM 10974 C CA   . TRP A 1 88  ? -2.117  -14.607 11.383  1.00 0.00 ? 88  TRP A CA   6  
ATOM 10975 C C    . TRP A 1 88  ? -2.678  -15.155 10.068  1.00 0.00 ? 88  TRP A C    6  
ATOM 10976 O O    . TRP A 1 88  ? -2.237  -14.869 8.952   1.00 0.00 ? 88  TRP A O    6  
ATOM 10977 C CB   . TRP A 1 88  ? -2.602  -13.144 11.645  1.00 0.00 ? 88  TRP A CB   6  
ATOM 10978 C CG   . TRP A 1 88  ? -2.557  -12.731 13.115  1.00 0.00 ? 88  TRP A CG   6  
ATOM 10979 C CD1  . TRP A 1 88  ? -1.467  -12.534 13.905  1.00 0.00 ? 88  TRP A CD1  6  
ATOM 10980 C CD2  . TRP A 1 88  ? -3.702  -12.555 13.972  1.00 0.00 ? 88  TRP A CD2  6  
ATOM 10981 N NE1  . TRP A 1 88  ? -1.857  -12.264 15.204  1.00 0.00 ? 88  TRP A NE1  6  
ATOM 10982 C CE2  . TRP A 1 88  ? -3.233  -12.298 15.254  1.00 0.00 ? 88  TRP A CE2  6  
ATOM 10983 C CE3  . TRP A 1 88  ? -5.037  -12.589 13.715  1.00 0.00 ? 88  TRP A CE3  6  
ATOM 10984 C CZ2  . TRP A 1 88  ? -4.101  -12.114 16.290  1.00 0.00 ? 88  TRP A CZ2  6  
ATOM 10985 C CZ3  . TRP A 1 88  ? -5.909  -12.345 14.759  1.00 0.00 ? 88  TRP A CZ3  6  
ATOM 10986 C CH2  . TRP A 1 88  ? -5.449  -12.117 16.031  1.00 0.00 ? 88  TRP A CH2  6  
ATOM 10987 H H    . TRP A 1 88  ? -0.220  -14.165 10.666  1.00 0.00 ? 88  TRP A H    6  
ATOM 10988 H HA   . TRP A 1 88  ? -2.534  -15.232 12.170  1.00 0.00 ? 88  TRP A HA   6  
ATOM 10989 H HB2  . TRP A 1 88  ? -1.974  -12.442 11.054  1.00 0.00 ? 88  TRP A HB2  6  
ATOM 10990 H HB3  . TRP A 1 88  ? -3.661  -13.022 11.328  1.00 0.00 ? 88  TRP A HB3  6  
ATOM 10991 H HD1  . TRP A 1 88  ? -0.461  -12.617 13.537  1.00 0.00 ? 88  TRP A HD1  6  
ATOM 10992 H HE1  . TRP A 1 88  ? -1.282  -12.381 15.992  1.00 0.00 ? 88  TRP A HE1  6  
ATOM 10993 H HE3  . TRP A 1 88  ? -5.383  -12.660 12.701  1.00 0.00 ? 88  TRP A HE3  6  
ATOM 10994 H HZ2  . TRP A 1 88  ? -3.800  -11.837 17.278  1.00 0.00 ? 88  TRP A HZ2  6  
ATOM 10995 H HZ3  . TRP A 1 88  ? -6.973  -12.285 14.614  1.00 0.00 ? 88  TRP A HZ3  6  
ATOM 10996 H HH2  . TRP A 1 88  ? -6.149  -11.884 16.823  1.00 0.00 ? 88  TRP A HH2  6  
ATOM 10997 N N    . TYR A 1 89  ? -3.714  -16.007 10.227  1.00 0.00 ? 89  TYR A N    6  
ATOM 10998 C CA   . TYR A 1 89  ? -4.428  -16.683 9.172   1.00 0.00 ? 89  TYR A CA   6  
ATOM 10999 C C    . TYR A 1 89  ? -5.816  -16.124 9.280   1.00 0.00 ? 89  TYR A C    6  
ATOM 11000 O O    . TYR A 1 89  ? -6.436  -16.145 10.344  1.00 0.00 ? 89  TYR A O    6  
ATOM 11001 C CB   . TYR A 1 89  ? -4.415  -18.232 9.338   1.00 0.00 ? 89  TYR A CB   6  
ATOM 11002 C CG   . TYR A 1 89  ? -2.999  -18.680 9.092   1.00 0.00 ? 89  TYR A CG   6  
ATOM 11003 C CD1  . TYR A 1 89  ? -2.622  -19.120 7.837   1.00 0.00 ? 89  TYR A CD1  6  
ATOM 11004 C CD2  . TYR A 1 89  ? -2.019  -18.487 10.051  1.00 0.00 ? 89  TYR A CD2  6  
ATOM 11005 C CE1  . TYR A 1 89  ? -1.290  -19.321 7.530   1.00 0.00 ? 89  TYR A CE1  6  
ATOM 11006 C CE2  . TYR A 1 89  ? -0.688  -18.578 9.718   1.00 0.00 ? 89  TYR A CE2  6  
ATOM 11007 C CZ   . TYR A 1 89  ? -0.320  -19.009 8.463   1.00 0.00 ? 89  TYR A CZ   6  
ATOM 11008 O OH   . TYR A 1 89  ? 1.049   -19.109 8.150   1.00 0.00 ? 89  TYR A OH   6  
ATOM 11009 H H    . TYR A 1 89  ? -4.093  -16.197 11.140  1.00 0.00 ? 89  TYR A H    6  
ATOM 11010 H HA   . TYR A 1 89  ? -4.031  -16.424 8.200   1.00 0.00 ? 89  TYR A HA   6  
ATOM 11011 H HB2  . TYR A 1 89  ? -4.735  -18.534 10.358  1.00 0.00 ? 89  TYR A HB2  6  
ATOM 11012 H HB3  . TYR A 1 89  ? -5.070  -18.726 8.584   1.00 0.00 ? 89  TYR A HB3  6  
ATOM 11013 H HD1  . TYR A 1 89  ? -3.376  -19.263 7.074   1.00 0.00 ? 89  TYR A HD1  6  
ATOM 11014 H HD2  . TYR A 1 89  ? -2.291  -18.123 11.035  1.00 0.00 ? 89  TYR A HD2  6  
ATOM 11015 H HE1  . TYR A 1 89  ? -1.028  -19.661 6.538   1.00 0.00 ? 89  TYR A HE1  6  
ATOM 11016 H HE2  . TYR A 1 89  ? 0.050   -18.276 10.453  1.00 0.00 ? 89  TYR A HE2  6  
ATOM 11017 H HH   . TYR A 1 89  ? 1.120   -19.391 7.236   1.00 0.00 ? 89  TYR A HH   6  
ATOM 11018 N N    . ILE A 1 90  ? -6.309  -15.594 8.155   1.00 0.00 ? 90  ILE A N    6  
ATOM 11019 C CA   . ILE A 1 90  ? -7.605  -14.983 7.990   1.00 0.00 ? 90  ILE A CA   6  
ATOM 11020 C C    . ILE A 1 90  ? -8.359  -15.856 7.011   1.00 0.00 ? 90  ILE A C    6  
ATOM 11021 O O    . ILE A 1 90  ? -7.844  -16.303 5.988   1.00 0.00 ? 90  ILE A O    6  
ATOM 11022 C CB   . ILE A 1 90  ? -7.567  -13.499 7.540   1.00 0.00 ? 90  ILE A CB   6  
ATOM 11023 C CG1  . ILE A 1 90  ? -7.574  -13.231 6.006   1.00 0.00 ? 90  ILE A CG1  6  
ATOM 11024 C CG2  . ILE A 1 90  ? -6.355  -12.813 8.187   1.00 0.00 ? 90  ILE A CG2  6  
ATOM 11025 C CD1  . ILE A 1 90  ? -7.509  -11.747 5.623   1.00 0.00 ? 90  ILE A CD1  6  
ATOM 11026 H H    . ILE A 1 90  ? -5.736  -15.628 7.342   1.00 0.00 ? 90  ILE A H    6  
ATOM 11027 H HA   . ILE A 1 90  ? -8.133  -14.986 8.940   1.00 0.00 ? 90  ILE A HA   6  
ATOM 11028 H HB   . ILE A 1 90  ? -8.465  -13.009 7.993   1.00 0.00 ? 90  ILE A HB   6  
ATOM 11029 H HG12 . ILE A 1 90  ? -6.718  -13.768 5.539   1.00 0.00 ? 90  ILE A HG12 6  
ATOM 11030 H HG13 . ILE A 1 90  ? -8.516  -13.628 5.562   1.00 0.00 ? 90  ILE A HG13 6  
ATOM 11031 H HG21 . ILE A 1 90  ? -6.326  -13.008 9.277   1.00 0.00 ? 90  ILE A HG21 6  
ATOM 11032 H HG22 . ILE A 1 90  ? -5.414  -13.181 7.730   1.00 0.00 ? 90  ILE A HG22 6  
ATOM 11033 H HG23 . ILE A 1 90  ? -6.385  -11.715 8.006   1.00 0.00 ? 90  ILE A HG23 6  
ATOM 11034 H HD11 . ILE A 1 90  ? -8.277  -11.178 6.182   1.00 0.00 ? 90  ILE A HD11 6  
ATOM 11035 H HD12 . ILE A 1 90  ? -6.509  -11.324 5.857   1.00 0.00 ? 90  ILE A HD12 6  
ATOM 11036 H HD13 . ILE A 1 90  ? -7.686  -11.620 4.534   1.00 0.00 ? 90  ILE A HD13 6  
ATOM 11037 N N    . GLN A 1 91  ? -9.639  -16.097 7.277   1.00 0.00 ? 91  GLN A N    6  
ATOM 11038 C CA   . GLN A 1 91  ? -10.566 -16.747 6.395   1.00 0.00 ? 91  GLN A CA   6  
ATOM 11039 C C    . GLN A 1 91  ? -11.628 -15.716 6.223   1.00 0.00 ? 91  GLN A C    6  
ATOM 11040 O O    . GLN A 1 91  ? -12.226 -15.293 7.192   1.00 0.00 ? 91  GLN A O    6  
ATOM 11041 C CB   . GLN A 1 91  ? -11.107 -18.068 6.984   1.00 0.00 ? 91  GLN A CB   6  
ATOM 11042 C CG   . GLN A 1 91  ? -12.485 -18.513 6.444   1.00 0.00 ? 91  GLN A CG   6  
ATOM 11043 C CD   . GLN A 1 91  ? -12.573 -20.029 6.342   1.00 0.00 ? 91  GLN A CD   6  
ATOM 11044 O OE1  . GLN A 1 91  ? -12.645 -20.734 7.350   1.00 0.00 ? 91  GLN A OE1  6  
ATOM 11045 N NE2  . GLN A 1 91  ? -12.560 -20.555 5.088   1.00 0.00 ? 91  GLN A NE2  6  
ATOM 11046 H H    . GLN A 1 91  ? -10.037 -15.728 8.122   1.00 0.00 ? 91  GLN A H    6  
ATOM 11047 H HA   . GLN A 1 91  ? -10.150 -16.918 5.419   1.00 0.00 ? 91  GLN A HA   6  
ATOM 11048 H HB2  . GLN A 1 91  ? -10.365 -18.860 6.765   1.00 0.00 ? 91  GLN A HB2  6  
ATOM 11049 H HB3  . GLN A 1 91  ? -11.148 -17.981 8.092   1.00 0.00 ? 91  GLN A HB3  6  
ATOM 11050 H HG2  . GLN A 1 91  ? -13.206 -18.152 7.204   1.00 0.00 ? 91  GLN A HG2  6  
ATOM 11051 H HG3  . GLN A 1 91  ? -12.729 -18.068 5.456   1.00 0.00 ? 91  GLN A HG3  6  
ATOM 11052 H HE21 . GLN A 1 91  ? -12.548 -19.967 4.282   1.00 0.00 ? 91  GLN A HE21 6  
ATOM 11053 H HE22 . GLN A 1 91  ? -12.572 -21.549 5.010   1.00 0.00 ? 91  GLN A HE22 6  
ATOM 11054 N N    . TYR A 1 92  ? -11.882 -15.267 4.987   1.00 0.00 ? 92  TYR A N    6  
ATOM 11055 C CA   . TYR A 1 92  ? -12.884 -14.278 4.628   1.00 0.00 ? 92  TYR A CA   6  
ATOM 11056 C C    . TYR A 1 92  ? -14.321 -14.847 4.692   1.00 0.00 ? 92  TYR A C    6  
ATOM 11057 O O    . TYR A 1 92  ? -14.554 -16.036 4.513   1.00 0.00 ? 92  TYR A O    6  
ATOM 11058 C CB   . TYR A 1 92  ? -12.319 -13.399 3.459   1.00 0.00 ? 92  TYR A CB   6  
ATOM 11059 C CG   . TYR A 1 92  ? -13.303 -12.720 2.546   1.00 0.00 ? 92  TYR A CG   6  
ATOM 11060 C CD1  . TYR A 1 92  ? -14.049 -13.463 1.672   1.00 0.00 ? 92  TYR A CD1  6  
ATOM 11061 C CD2  . TYR A 1 92  ? -13.575 -11.375 2.659   1.00 0.00 ? 92  TYR A CD2  6  
ATOM 11062 C CE1  . TYR A 1 92  ? -15.156 -12.953 1.035   1.00 0.00 ? 92  TYR A CE1  6  
ATOM 11063 C CE2  . TYR A 1 92  ? -14.724 -10.857 2.121   1.00 0.00 ? 92  TYR A CE2  6  
ATOM 11064 C CZ   . TYR A 1 92  ? -15.495 -11.648 1.289   1.00 0.00 ? 92  TYR A CZ   6  
ATOM 11065 O OH   . TYR A 1 92  ? -16.708 -11.186 0.791   1.00 0.00 ? 92  TYR A OH   6  
ATOM 11066 H H    . TYR A 1 92  ? -11.357 -15.635 4.229   1.00 0.00 ? 92  TYR A H    6  
ATOM 11067 H HA   . TYR A 1 92  ? -12.931 -13.532 5.410   1.00 0.00 ? 92  TYR A HA   6  
ATOM 11068 H HB2  . TYR A 1 92  ? -11.731 -12.587 3.939   1.00 0.00 ? 92  TYR A HB2  6  
ATOM 11069 H HB3  . TYR A 1 92  ? -11.571 -13.967 2.888   1.00 0.00 ? 92  TYR A HB3  6  
ATOM 11070 H HD1  . TYR A 1 92  ? -13.815 -14.500 1.577   1.00 0.00 ? 92  TYR A HD1  6  
ATOM 11071 H HD2  . TYR A 1 92  ? -12.997 -10.740 3.314   1.00 0.00 ? 92  TYR A HD2  6  
ATOM 11072 H HE1  . TYR A 1 92  ? -15.820 -13.597 0.458   1.00 0.00 ? 92  TYR A HE1  6  
ATOM 11073 H HE2  . TYR A 1 92  ? -14.985 -9.856  2.463   1.00 0.00 ? 92  TYR A HE2  6  
ATOM 11074 H HH   . TYR A 1 92  ? -17.019 -10.597 1.482   1.00 0.00 ? 92  TYR A HH   6  
ATOM 11075 N N    . ILE A 1 93  ? -15.292 -13.975 5.055   1.00 0.00 ? 93  ILE A N    6  
ATOM 11076 C CA   . ILE A 1 93  ? -16.718 -14.094 5.292   1.00 0.00 ? 93  ILE A CA   6  
ATOM 11077 C C    . ILE A 1 93  ? -17.344 -13.919 3.928   1.00 0.00 ? 93  ILE A C    6  
ATOM 11078 O O    . ILE A 1 93  ? -17.150 -12.859 3.344   1.00 0.00 ? 93  ILE A O    6  
ATOM 11079 C CB   . ILE A 1 93  ? -17.164 -12.854 6.116   1.00 0.00 ? 93  ILE A CB   6  
ATOM 11080 C CG1  . ILE A 1 93  ? -16.486 -12.702 7.507   1.00 0.00 ? 93  ILE A CG1  6  
ATOM 11081 C CG2  . ILE A 1 93  ? -18.704 -12.647 6.145   1.00 0.00 ? 93  ILE A CG2  6  
ATOM 11082 C CD1  . ILE A 1 93  ? -17.170 -13.252 8.734   1.00 0.00 ? 93  ILE A CD1  6  
ATOM 11083 H H    . ILE A 1 93  ? -15.032 -13.018 5.156   1.00 0.00 ? 93  ILE A H    6  
ATOM 11084 H HA   . ILE A 1 93  ? -16.982 -15.038 5.743   1.00 0.00 ? 93  ILE A HA   6  
ATOM 11085 H HB   . ILE A 1 93  ? -16.782 -11.923 5.596   1.00 0.00 ? 93  ILE A HB   6  
ATOM 11086 H HG12 . ILE A 1 93  ? -15.411 -12.953 7.526   1.00 0.00 ? 93  ILE A HG12 6  
ATOM 11087 H HG13 . ILE A 1 93  ? -16.453 -11.608 7.667   1.00 0.00 ? 93  ILE A HG13 6  
ATOM 11088 H HG21 . ILE A 1 93  ? -19.239 -13.592 6.353   1.00 0.00 ? 93  ILE A HG21 6  
ATOM 11089 H HG22 . ILE A 1 93  ? -18.959 -11.902 6.925   1.00 0.00 ? 93  ILE A HG22 6  
ATOM 11090 H HG23 . ILE A 1 93  ? -19.040 -12.201 5.177   1.00 0.00 ? 93  ILE A HG23 6  
ATOM 11091 H HD11 . ILE A 1 93  ? -18.179 -12.805 8.847   1.00 0.00 ? 93  ILE A HD11 6  
ATOM 11092 H HD12 . ILE A 1 93  ? -17.224 -14.358 8.698   1.00 0.00 ? 93  ILE A HD12 6  
ATOM 11093 H HD13 . ILE A 1 93  ? -16.534 -12.936 9.598   1.00 0.00 ? 93  ILE A HD13 6  
ATOM 11094 N N    . ASP A 1 94  ? -18.121 -14.876 3.339   1.00 0.00 ? 94  ASP A N    6  
ATOM 11095 C CA   . ASP A 1 94  ? -18.724 -14.642 2.015   1.00 0.00 ? 94  ASP A CA   6  
ATOM 11096 C C    . ASP A 1 94  ? -20.012 -13.879 2.123   1.00 0.00 ? 94  ASP A C    6  
ATOM 11097 O O    . ASP A 1 94  ? -21.112 -14.426 2.135   1.00 0.00 ? 94  ASP A O    6  
ATOM 11098 C CB   . ASP A 1 94  ? -18.856 -15.783 0.957   1.00 0.00 ? 94  ASP A CB   6  
ATOM 11099 C CG   . ASP A 1 94  ? -19.302 -17.143 1.508   1.00 0.00 ? 94  ASP A CG   6  
ATOM 11100 O OD1  . ASP A 1 94  ? -20.371 -17.207 2.170   1.00 0.00 ? 94  ASP A OD1  6  
ATOM 11101 O OD2  . ASP A 1 94  ? -18.583 -18.144 1.252   1.00 0.00 ? 94  ASP A OD2  6  
ATOM 11102 H H    . ASP A 1 94  ? -18.357 -15.730 3.786   1.00 0.00 ? 94  ASP A H    6  
ATOM 11103 H HA   . ASP A 1 94  ? -18.050 -14.000 1.462   1.00 0.00 ? 94  ASP A HA   6  
ATOM 11104 H HB2  . ASP A 1 94  ? -19.529 -15.468 0.130   1.00 0.00 ? 94  ASP A HB2  6  
ATOM 11105 H HB3  . ASP A 1 94  ? -17.863 -15.863 0.451   1.00 0.00 ? 94  ASP A HB3  6  
ATOM 11106 N N    . ARG A 1 95  ? -19.814 -12.540 2.164   1.00 0.00 ? 95  ARG A N    6  
ATOM 11107 C CA   . ARG A 1 95  ? -20.682 -11.372 2.175   1.00 0.00 ? 95  ARG A CA   6  
ATOM 11108 C C    . ARG A 1 95  ? -22.056 -11.557 1.505   1.00 0.00 ? 95  ARG A C    6  
ATOM 11109 O O    . ARG A 1 95  ? -22.960 -12.181 2.057   1.00 0.00 ? 95  ARG A O    6  
ATOM 11110 C CB   . ARG A 1 95  ? -19.787 -10.287 1.559   1.00 0.00 ? 95  ARG A CB   6  
ATOM 11111 C CG   . ARG A 1 95  ? -18.701 -9.846  2.568   1.00 0.00 ? 95  ARG A CG   6  
ATOM 11112 C CD   . ARG A 1 95  ? -19.202 -8.842  3.605   1.00 0.00 ? 95  ARG A CD   6  
ATOM 11113 N NE   . ARG A 1 95  ? -19.575 -7.550  2.931   1.00 0.00 ? 95  ARG A NE   6  
ATOM 11114 C CZ   . ARG A 1 95  ? -19.891 -6.414  3.628   1.00 0.00 ? 95  ARG A CZ   6  
ATOM 11115 N NH1  . ARG A 1 95  ? -19.881 -6.404  4.992   1.00 0.00 ? 95  ARG A NH1  6  
ATOM 11116 N NH2  . ARG A 1 95  ? -20.213 -5.276  2.945   1.00 0.00 ? 95  ARG A NH2  6  
ATOM 11117 H H    . ARG A 1 95  ? -18.846 -12.281 2.172   1.00 0.00 ? 95  ARG A H    6  
ATOM 11118 H HA   . ARG A 1 95  ? -20.818 -11.048 3.182   1.00 0.00 ? 95  ARG A HA   6  
ATOM 11119 H HB2  . ARG A 1 95  ? -19.286 -10.745 0.674   1.00 0.00 ? 95  ARG A HB2  6  
ATOM 11120 H HB3  . ARG A 1 95  ? -20.356 -9.388  1.234   1.00 0.00 ? 95  ARG A HB3  6  
ATOM 11121 H HG2  . ARG A 1 95  ? -18.168 -10.684 3.086   1.00 0.00 ? 95  ARG A HG2  6  
ATOM 11122 H HG3  . ARG A 1 95  ? -17.890 -9.353  2.035   1.00 0.00 ? 95  ARG A HG3  6  
ATOM 11123 H HD2  . ARG A 1 95  ? -20.090 -9.252  4.119   1.00 0.00 ? 95  ARG A HD2  6  
ATOM 11124 H HD3  . ARG A 1 95  ? -18.368 -8.655  4.305   1.00 0.00 ? 95  ARG A HD3  6  
ATOM 11125 H HE   . ARG A 1 95  ? -19.590 -7.521  1.931   1.00 0.00 ? 95  ARG A HE   6  
ATOM 11126 H HH11 . ARG A 1 95  ? -19.642 -7.236  5.495   1.00 0.00 ? 95  ARG A HH11 6  
ATOM 11127 H HH12 . ARG A 1 95  ? -20.110 -5.567  5.487   1.00 0.00 ? 95  ARG A HH12 6  
ATOM 11128 H HH21 . ARG A 1 95  ? -20.218 -5.278  1.945   1.00 0.00 ? 95  ARG A HH21 6  
ATOM 11129 H HH22 . ARG A 1 95  ? -20.442 -4.442  3.446   1.00 0.00 ? 95  ARG A HH22 6  
ATOM 11130 N N    . ASP A 1 96  ? -22.232 -11.079 0.255   1.00 0.00 ? 96  ASP A N    6  
ATOM 11131 C CA   . ASP A 1 96  ? -23.339 -11.493 -0.610  1.00 0.00 ? 96  ASP A CA   6  
ATOM 11132 C C    . ASP A 1 96  ? -22.729 -12.484 -1.605  1.00 0.00 ? 96  ASP A C    6  
ATOM 11133 O O    . ASP A 1 96  ? -21.826 -12.009 -2.289  1.00 0.00 ? 96  ASP A O    6  
ATOM 11134 C CB   . ASP A 1 96  ? -24.004 -10.298 -1.348  1.00 0.00 ? 96  ASP A CB   6  
ATOM 11135 C CG   . ASP A 1 96  ? -25.485 -10.560 -1.666  1.00 0.00 ? 96  ASP A CG   6  
ATOM 11136 O OD1  . ASP A 1 96  ? -25.765 -11.463 -2.494  1.00 0.00 ? 96  ASP A OD1  6  
ATOM 11137 O OD2  . ASP A 1 96  ? -26.347 -9.852  -1.081  1.00 0.00 ? 96  ASP A OD2  6  
ATOM 11138 H H    . ASP A 1 96  ? -21.506 -10.571 -0.195  1.00 0.00 ? 96  ASP A H    6  
ATOM 11139 H HA   . ASP A 1 96  ? -24.112 -11.982 -0.027  1.00 0.00 ? 96  ASP A HA   6  
ATOM 11140 H HB2  . ASP A 1 96  ? -23.947 -9.428  -0.662  1.00 0.00 ? 96  ASP A HB2  6  
ATOM 11141 H HB3  . ASP A 1 96  ? -23.474 -10.034 -2.282  1.00 0.00 ? 96  ASP A HB3  6  
ATOM 11142 N N    . PRO A 1 97  ? -23.078 -13.778 -1.826  1.00 0.00 ? 97  PRO A N    6  
ATOM 11143 C CA   . PRO A 1 97  ? -22.419 -14.736 -2.750  1.00 0.00 ? 97  PRO A CA   6  
ATOM 11144 C C    . PRO A 1 97  ? -22.287 -14.312 -4.209  1.00 0.00 ? 97  PRO A C    6  
ATOM 11145 O O    . PRO A 1 97  ? -21.310 -14.677 -4.861  1.00 0.00 ? 97  PRO A O    6  
ATOM 11146 C CB   . PRO A 1 97  ? -23.247 -16.011 -2.615  1.00 0.00 ? 97  PRO A CB   6  
ATOM 11147 C CG   . PRO A 1 97  ? -23.739 -15.947 -1.171  1.00 0.00 ? 97  PRO A CG   6  
ATOM 11148 C CD   . PRO A 1 97  ? -24.018 -14.457 -0.952  1.00 0.00 ? 97  PRO A CD   6  
ATOM 11149 H HA   . PRO A 1 97  ? -21.403 -14.883 -2.402  1.00 0.00 ? 97  PRO A HA   6  
ATOM 11150 H HB2  . PRO A 1 97  ? -24.161 -15.996 -3.271  1.00 0.00 ? 97  PRO A HB2  6  
ATOM 11151 H HB3  . PRO A 1 97  ? -22.611 -16.907 -2.819  1.00 0.00 ? 97  PRO A HB3  6  
ATOM 11152 H HG2  . PRO A 1 97  ? -24.619 -16.589 -1.005  1.00 0.00 ? 97  PRO A HG2  6  
ATOM 11153 H HG3  . PRO A 1 97  ? -22.919 -16.268 -0.488  1.00 0.00 ? 97  PRO A HG3  6  
ATOM 11154 H HD2  . PRO A 1 97  ? -25.037 -14.132 -1.249  1.00 0.00 ? 97  PRO A HD2  6  
ATOM 11155 H HD3  . PRO A 1 97  ? -23.830 -14.221 0.121   1.00 0.00 ? 97  PRO A HD3  6  
ATOM 11156 N N    . GLU A 1 98  ? -23.192 -13.405 -4.678  1.00 0.00 ? 98  GLU A N    6  
ATOM 11157 C CA   . GLU A 1 98  ? -23.175 -12.644 -5.925  1.00 0.00 ? 98  GLU A CA   6  
ATOM 11158 C C    . GLU A 1 98  ? -21.866 -11.876 -6.072  1.00 0.00 ? 98  GLU A C    6  
ATOM 11159 O O    . GLU A 1 98  ? -21.221 -11.985 -7.096  1.00 0.00 ? 98  GLU A O    6  
ATOM 11160 C CB   . GLU A 1 98  ? -24.368 -11.654 -5.944  1.00 0.00 ? 98  GLU A CB   6  
ATOM 11161 C CG   . GLU A 1 98  ? -25.682 -12.216 -6.531  1.00 0.00 ? 98  GLU A CG   6  
ATOM 11162 C CD   . GLU A 1 98  ? -26.170 -13.476 -5.817  1.00 0.00 ? 98  GLU A CD   6  
ATOM 11163 O OE1  . GLU A 1 98  ? -26.326 -14.517 -6.512  1.00 0.00 ? 98  GLU A OE1  6  
ATOM 11164 O OE2  . GLU A 1 98  ? -26.410 -13.416 -4.582  1.00 0.00 ? 98  GLU A OE2  6  
ATOM 11165 H H    . GLU A 1 98  ? -23.937 -13.158 -4.064  1.00 0.00 ? 98  GLU A H    6  
ATOM 11166 H HA   . GLU A 1 98  ? -23.239 -13.304 -6.779  1.00 0.00 ? 98  GLU A HA   6  
ATOM 11167 H HB2  . GLU A 1 98  ? -24.527 -11.301 -4.903  1.00 0.00 ? 98  GLU A HB2  6  
ATOM 11168 H HB3  . GLU A 1 98  ? -24.152 -10.754 -6.564  1.00 0.00 ? 98  GLU A HB3  6  
ATOM 11169 H HG2  . GLU A 1 98  ? -26.470 -11.436 -6.459  1.00 0.00 ? 98  GLU A HG2  6  
ATOM 11170 H HG3  . GLU A 1 98  ? -25.520 -12.444 -7.608  1.00 0.00 ? 98  GLU A HG3  6  
ATOM 11171 N N    . THR A 1 99  ? -21.359 -11.191 -5.001  1.00 0.00 ? 99  THR A N    6  
ATOM 11172 C CA   . THR A 1 99  ? -20.068 -10.472 -4.941  1.00 0.00 ? 99  THR A CA   6  
ATOM 11173 C C    . THR A 1 99  ? -18.846 -11.348 -5.254  1.00 0.00 ? 99  THR A C    6  
ATOM 11174 O O    . THR A 1 99  ? -18.035 -10.961 -6.081  1.00 0.00 ? 99  THR A O    6  
ATOM 11175 C CB   . THR A 1 99  ? -19.901 -9.712  -3.591  1.00 0.00 ? 99  THR A CB   6  
ATOM 11176 O OG1  . THR A 1 99  ? -20.352 -8.364  -3.684  1.00 0.00 ? 99  THR A OG1  6  
ATOM 11177 C CG2  . THR A 1 99  ? -18.505 -9.737  -2.915  1.00 0.00 ? 99  THR A CG2  6  
ATOM 11178 H H    . THR A 1 99  ? -21.873 -11.193 -4.138  1.00 0.00 ? 99  THR A H    6  
ATOM 11179 H HA   . THR A 1 99  ? -20.097 -9.756  -5.760  1.00 0.00 ? 99  THR A HA   6  
ATOM 11180 H HB   . THR A 1 99  ? -20.589 -10.191 -2.865  1.00 0.00 ? 99  THR A HB   6  
ATOM 11181 H HG1  . THR A 1 99  ? -19.630 -7.848  -4.059  1.00 0.00 ? 99  THR A HG1  6  
ATOM 11182 H HG21 . THR A 1 99  ? -17.697 -9.368  -3.592  1.00 0.00 ? 99  THR A HG21 6  
ATOM 11183 H HG22 . THR A 1 99  ? -18.534 -9.157  -1.958  1.00 0.00 ? 99  THR A HG22 6  
ATOM 11184 H HG23 . THR A 1 99  ? -18.236 -10.770 -2.588  1.00 0.00 ? 99  THR A HG23 6  
ATOM 11185 N N    . ILE A 1 100 ? -18.737 -12.566 -4.648  1.00 0.00 ? 100 ILE A N    6  
ATOM 11186 C CA   . ILE A 1 100 ? -17.756 -13.647 -4.794  1.00 0.00 ? 100 ILE A CA   6  
ATOM 11187 C C    . ILE A 1 100 ? -17.850 -14.283 -6.187  1.00 0.00 ? 100 ILE A C    6  
ATOM 11188 O O    . ILE A 1 100 ? -16.866 -14.349 -6.909  1.00 0.00 ? 100 ILE A O    6  
ATOM 11189 C CB   . ILE A 1 100 ? -18.144 -14.622 -3.684  1.00 0.00 ? 100 ILE A CB   6  
ATOM 11190 C CG1  . ILE A 1 100 ? -17.854 -13.952 -2.313  1.00 0.00 ? 100 ILE A CG1  6  
ATOM 11191 C CG2  . ILE A 1 100 ? -17.343 -15.942 -3.790  1.00 0.00 ? 100 ILE A CG2  6  
ATOM 11192 C CD1  . ILE A 1 100 ? -19.004 -13.266 -1.565  1.00 0.00 ? 100 ILE A CD1  6  
ATOM 11193 H H    . ILE A 1 100 ? -19.439 -12.862 -4.011  1.00 0.00 ? 100 ILE A H    6  
ATOM 11194 H HA   . ILE A 1 100 ? -16.686 -13.378 -4.628  1.00 0.00 ? 100 ILE A HA   6  
ATOM 11195 H HB   . ILE A 1 100 ? -19.242 -14.855 -3.709  1.00 0.00 ? 100 ILE A HB   6  
ATOM 11196 H HG12 . ILE A 1 100 ? -17.527 -14.766 -1.649  1.00 0.00 ? 100 ILE A HG12 6  
ATOM 11197 H HG13 . ILE A 1 100 ? -17.004 -13.246 -2.417  1.00 0.00 ? 100 ILE A HG13 6  
ATOM 11198 H HG21 . ILE A 1 100 ? -16.261 -15.723 -3.896  1.00 0.00 ? 100 ILE A HG21 6  
ATOM 11199 H HG22 . ILE A 1 100 ? -17.485 -16.553 -2.873  1.00 0.00 ? 100 ILE A HG22 6  
ATOM 11200 H HG23 . ILE A 1 100 ? -17.666 -16.567 -4.648  1.00 0.00 ? 100 ILE A HG23 6  
ATOM 11201 H HD11 . ILE A 1 100 ? -19.822 -13.984 -1.354  1.00 0.00 ? 100 ILE A HD11 6  
ATOM 11202 H HD12 . ILE A 1 100 ? -18.625 -12.886 -0.592  1.00 0.00 ? 100 ILE A HD12 6  
ATOM 11203 H HD13 . ILE A 1 100 ? -19.423 -12.401 -2.106  1.00 0.00 ? 100 ILE A HD13 6  
ATOM 11204 N N    . ARG A 1 101 ? -19.058 -14.679 -6.672  1.00 0.00 ? 101 ARG A N    6  
ATOM 11205 C CA   . ARG A 1 101 ? -19.277 -15.253 -8.011  1.00 0.00 ? 101 ARG A CA   6  
ATOM 11206 C C    . ARG A 1 101 ? -19.075 -14.235 -9.149  1.00 0.00 ? 101 ARG A C    6  
ATOM 11207 O O    . ARG A 1 101 ? -18.476 -14.548 -10.177 1.00 0.00 ? 101 ARG A O    6  
ATOM 11208 C CB   . ARG A 1 101 ? -20.639 -15.994 -8.102  1.00 0.00 ? 101 ARG A CB   6  
ATOM 11209 C CG   . ARG A 1 101 ? -20.756 -17.180 -7.113  1.00 0.00 ? 101 ARG A CG   6  
ATOM 11210 C CD   . ARG A 1 101 ? -21.894 -18.156 -7.454  1.00 0.00 ? 101 ARG A CD   6  
ATOM 11211 N NE   . ARG A 1 101 ? -23.221 -17.530 -7.108  1.00 0.00 ? 101 ARG A NE   6  
ATOM 11212 C CZ   . ARG A 1 101 ? -23.924 -17.816 -5.966  1.00 0.00 ? 101 ARG A CZ   6  
ATOM 11213 N NH1  . ARG A 1 101 ? -23.443 -18.694 -5.038  1.00 0.00 ? 101 ARG A NH1  6  
ATOM 11214 N NH2  . ARG A 1 101 ? -25.129 -17.212 -5.749  1.00 0.00 ? 101 ARG A NH2  6  
ATOM 11215 H H    . ARG A 1 101 ? -19.878 -14.607 -6.094  1.00 0.00 ? 101 ARG A H    6  
ATOM 11216 H HA   . ARG A 1 101 ? -18.507 -16.010 -8.179  1.00 0.00 ? 101 ARG A HA   6  
ATOM 11217 H HB2  . ARG A 1 101 ? -21.474 -15.290 -7.897  1.00 0.00 ? 101 ARG A HB2  6  
ATOM 11218 H HB3  . ARG A 1 101 ? -20.776 -16.408 -9.129  1.00 0.00 ? 101 ARG A HB3  6  
ATOM 11219 H HG2  . ARG A 1 101 ? -19.805 -17.759 -7.159  1.00 0.00 ? 101 ARG A HG2  6  
ATOM 11220 H HG3  . ARG A 1 101 ? -20.882 -16.817 -6.063  1.00 0.00 ? 101 ARG A HG3  6  
ATOM 11221 H HD2  . ARG A 1 101 ? -21.895 -18.372 -8.543  1.00 0.00 ? 101 ARG A HD2  6  
ATOM 11222 H HD3  . ARG A 1 101 ? -21.750 -19.116 -6.912  1.00 0.00 ? 101 ARG A HD3  6  
ATOM 11223 H HE   . ARG A 1 101 ? -23.614 -16.877 -7.754  1.00 0.00 ? 101 ARG A HE   6  
ATOM 11224 H HH11 . ARG A 1 101 ? -22.560 -19.141 -5.187  1.00 0.00 ? 101 ARG A HH11 6  
ATOM 11225 H HH12 . ARG A 1 101 ? -23.971 -18.888 -4.212  1.00 0.00 ? 101 ARG A HH12 6  
ATOM 11226 H HH21 . ARG A 1 101 ? -25.491 -16.563 -6.419  1.00 0.00 ? 101 ARG A HH21 6  
ATOM 11227 H HH22 . ARG A 1 101 ? -25.647 -17.414 -4.918  1.00 0.00 ? 101 ARG A HH22 6  
ATOM 11228 N N    . ARG A 1 102 ? -19.445 -12.932 -8.905  1.00 0.00 ? 102 ARG A N    6  
ATOM 11229 C CA   . ARG A 1 102 ? -19.131 -11.767 -9.752  1.00 0.00 ? 102 ARG A CA   6  
ATOM 11230 C C    . ARG A 1 102 ? -17.633 -11.484 -9.770  1.00 0.00 ? 102 ARG A C    6  
ATOM 11231 O O    . ARG A 1 102 ? -17.063 -11.147 -10.798 1.00 0.00 ? 102 ARG A O    6  
ATOM 11232 C CB   . ARG A 1 102 ? -19.907 -10.491 -9.385  1.00 0.00 ? 102 ARG A CB   6  
ATOM 11233 C CG   . ARG A 1 102 ? -21.389 -10.650 -9.755  1.00 0.00 ? 102 ARG A CG   6  
ATOM 11234 C CD   . ARG A 1 102 ? -22.234 -9.409  -9.493  1.00 0.00 ? 102 ARG A CD   6  
ATOM 11235 N NE   . ARG A 1 102 ? -22.113 -9.013  -8.047  1.00 0.00 ? 102 ARG A NE   6  
ATOM 11236 C CZ   . ARG A 1 102 ? -22.874 -8.033  -7.465  1.00 0.00 ? 102 ARG A CZ   6  
ATOM 11237 N NH1  . ARG A 1 102 ? -23.784 -7.326  -8.195  1.00 0.00 ? 102 ARG A NH1  6  
ATOM 11238 N NH2  . ARG A 1 102 ? -22.721 -7.770  -6.133  1.00 0.00 ? 102 ARG A NH2  6  
ATOM 11239 H H    . ARG A 1 102 ? -19.936 -12.698 -8.044  1.00 0.00 ? 102 ARG A H    6  
ATOM 11240 H HA   . ARG A 1 102 ? -19.447 -11.976 -10.759 1.00 0.00 ? 102 ARG A HA   6  
ATOM 11241 H HB2  . ARG A 1 102 ? -19.790 -10.279 -8.301  1.00 0.00 ? 102 ARG A HB2  6  
ATOM 11242 H HB3  . ARG A 1 102 ? -19.534 -9.607  -9.954  1.00 0.00 ? 102 ARG A HB3  6  
ATOM 11243 H HG2  . ARG A 1 102 ? -21.437 -10.857 -10.842 1.00 0.00 ? 102 ARG A HG2  6  
ATOM 11244 H HG3  . ARG A 1 102 ? -21.839 -11.525 -9.241  1.00 0.00 ? 102 ARG A HG3  6  
ATOM 11245 H HD2  . ARG A 1 102 ? -21.845 -8.596  -10.140 1.00 0.00 ? 102 ARG A HD2  6  
ATOM 11246 H HD3  . ARG A 1 102 ? -23.291 -9.662  -9.726  1.00 0.00 ? 102 ARG A HD3  6  
ATOM 11247 H HE   . ARG A 1 102 ? -21.460 -9.510  -7.475  1.00 0.00 ? 102 ARG A HE   6  
ATOM 11248 H HH11 . ARG A 1 102 ? -23.900 -7.519  -9.170  1.00 0.00 ? 102 ARG A HH11 6  
ATOM 11249 H HH12 . ARG A 1 102 ? -24.335 -6.617  -7.755  1.00 0.00 ? 102 ARG A HH12 6  
ATOM 11250 H HH21 . ARG A 1 102 ? -22.057 -8.289  -5.595  1.00 0.00 ? 102 ARG A HH21 6  
ATOM 11251 H HH22 . ARG A 1 102 ? -23.276 -7.061  -5.698  1.00 0.00 ? 102 ARG A HH22 6  
ATOM 11252 N N    . GLN A 1 103 ? -16.957 -11.756 -8.623  1.00 0.00 ? 103 GLN A N    6  
ATOM 11253 C CA   . GLN A 1 103 ? -15.502 -11.796 -8.477  1.00 0.00 ? 103 GLN A CA   6  
ATOM 11254 C C    . GLN A 1 103 ? -14.789 -12.858 -9.268  1.00 0.00 ? 103 GLN A C    6  
ATOM 11255 O O    . GLN A 1 103 ? -13.936 -12.531 -10.086 1.00 0.00 ? 103 GLN A O    6  
ATOM 11256 C CB   . GLN A 1 103 ? -15.056 -11.660 -7.018  1.00 0.00 ? 103 GLN A CB   6  
ATOM 11257 C CG   . GLN A 1 103 ? -14.369 -10.296 -6.799  1.00 0.00 ? 103 GLN A CG   6  
ATOM 11258 C CD   . GLN A 1 103 ? -15.312 -9.109  -6.997  1.00 0.00 ? 103 GLN A CD   6  
ATOM 11259 O OE1  . GLN A 1 103 ? -15.194 -8.357  -7.965  1.00 0.00 ? 103 GLN A OE1  6  
ATOM 11260 N NE2  . GLN A 1 103 ? -16.224 -8.968  -6.013  1.00 0.00 ? 103 GLN A NE2  6  
ATOM 11261 H H    . GLN A 1 103 ? -17.473 -12.019 -7.795  1.00 0.00 ? 103 GLN A H    6  
ATOM 11262 H HA   . GLN A 1 103 ? -14.988 -10.959 -8.861  1.00 0.00 ? 103 GLN A HA   6  
ATOM 11263 H HB2  . GLN A 1 103 ? -15.913 -11.780 -6.332  1.00 0.00 ? 103 GLN A HB2  6  
ATOM 11264 H HB3  . GLN A 1 103 ? -14.355 -12.460 -6.722  1.00 0.00 ? 103 GLN A HB3  6  
ATOM 11265 H HG2  . GLN A 1 103 ? -13.946 -10.258 -5.795  1.00 0.00 ? 103 GLN A HG2  6  
ATOM 11266 H HG3  . GLN A 1 103 ? -13.536 -10.174 -7.500  1.00 0.00 ? 103 GLN A HG3  6  
ATOM 11267 H HE21 . GLN A 1 103 ? -15.843 -8.619  -5.162  1.00 0.00 ? 103 GLN A HE21 6  
ATOM 11268 H HE22 . GLN A 1 103 ? -16.861 -9.753  -5.928  1.00 0.00 ? 103 GLN A HE22 6  
ATOM 11269 N N    . LEU A 1 104 ? -15.093 -14.151 -9.057  1.00 0.00 ? 104 LEU A N    6  
ATOM 11270 C CA   . LEU A 1 104 ? -14.406 -15.253 -9.708  1.00 0.00 ? 104 LEU A CA   6  
ATOM 11271 C C    . LEU A 1 104 ? -14.680 -15.409 -11.210 1.00 0.00 ? 104 LEU A C    6  
ATOM 11272 O O    . LEU A 1 104 ? -13.791 -15.730 -11.991 1.00 0.00 ? 104 LEU A O    6  
ATOM 11273 C CB   . LEU A 1 104 ? -14.554 -16.635 -9.003  1.00 0.00 ? 104 LEU A CB   6  
ATOM 11274 C CG   . LEU A 1 104 ? -15.181 -16.807 -7.602  1.00 0.00 ? 104 LEU A CG   6  
ATOM 11275 C CD1  . LEU A 1 104 ? -15.298 -18.308 -7.249  1.00 0.00 ? 104 LEU A CD1  6  
ATOM 11276 C CD2  . LEU A 1 104 ? -14.427 -16.095 -6.481  1.00 0.00 ? 104 LEU A CD2  6  
ATOM 11277 H H    . LEU A 1 104 ? -15.791 -14.366 -8.375  1.00 0.00 ? 104 LEU A H    6  
ATOM 11278 H HA   . LEU A 1 104 ? -13.344 -15.035 -9.642  1.00 0.00 ? 104 LEU A HA   6  
ATOM 11279 H HB2  . LEU A 1 104 ? -15.206 -17.291 -9.614  1.00 0.00 ? 104 LEU A HB2  6  
ATOM 11280 H HB3  . LEU A 1 104 ? -13.502 -16.997 -8.944  1.00 0.00 ? 104 LEU A HB3  6  
ATOM 11281 H HG   . LEU A 1 104 ? -16.222 -16.417 -7.657  1.00 0.00 ? 104 LEU A HG   6  
ATOM 11282 H HD11 . LEU A 1 104 ? -14.293 -18.781 -7.270  1.00 0.00 ? 104 LEU A HD11 6  
ATOM 11283 H HD12 . LEU A 1 104 ? -15.725 -18.421 -6.231  1.00 0.00 ? 104 LEU A HD12 6  
ATOM 11284 H HD13 . LEU A 1 104 ? -15.959 -18.834 -7.971  1.00 0.00 ? 104 LEU A HD13 6  
ATOM 11285 H HD21 . LEU A 1 104 ? -13.352 -16.368 -6.486  1.00 0.00 ? 104 LEU A HD21 6  
ATOM 11286 H HD22 . LEU A 1 104 ? -14.518 -14.990 -6.561  1.00 0.00 ? 104 LEU A HD22 6  
ATOM 11287 H HD23 . LEU A 1 104 ? -14.844 -16.385 -5.495  1.00 0.00 ? 104 LEU A HD23 6  
ATOM 11288 N N    . GLU A 1 105 ? -15.950 -15.185 -11.648 1.00 0.00 ? 105 GLU A N    6  
ATOM 11289 C CA   . GLU A 1 105 ? -16.382 -15.311 -13.036 1.00 0.00 ? 105 GLU A CA   6  
ATOM 11290 C C    . GLU A 1 105 ? -16.085 -14.091 -13.911 1.00 0.00 ? 105 GLU A C    6  
ATOM 11291 O O    . GLU A 1 105 ? -15.590 -14.233 -15.019 1.00 0.00 ? 105 GLU A O    6  
ATOM 11292 C CB   . GLU A 1 105 ? -17.895 -15.661 -13.128 1.00 0.00 ? 105 GLU A CB   6  
ATOM 11293 C CG   . GLU A 1 105 ? -18.250 -16.963 -12.385 1.00 0.00 ? 105 GLU A CG   6  
ATOM 11294 C CD   . GLU A 1 105 ? -19.750 -17.236 -12.508 1.00 0.00 ? 105 GLU A CD   6  
ATOM 11295 O OE1  . GLU A 1 105 ? -20.547 -16.402 -11.999 1.00 0.00 ? 105 GLU A OE1  6  
ATOM 11296 O OE2  . GLU A 1 105 ? -20.116 -18.281 -13.108 1.00 0.00 ? 105 GLU A OE2  6  
ATOM 11297 H H    . GLU A 1 105 ? -16.686 -14.952 -11.003 1.00 0.00 ? 105 GLU A H    6  
ATOM 11298 H HA   . GLU A 1 105 ? -15.848 -16.138 -13.489 1.00 0.00 ? 105 GLU A HA   6  
ATOM 11299 H HB2  . GLU A 1 105 ? -18.495 -14.829 -12.699 1.00 0.00 ? 105 GLU A HB2  6  
ATOM 11300 H HB3  . GLU A 1 105 ? -18.191 -15.790 -14.195 1.00 0.00 ? 105 GLU A HB3  6  
ATOM 11301 H HG2  . GLU A 1 105 ? -17.674 -17.806 -12.819 1.00 0.00 ? 105 GLU A HG2  6  
ATOM 11302 H HG3  . GLU A 1 105 ? -17.991 -16.876 -11.307 1.00 0.00 ? 105 GLU A HG3  6  
ATOM 11303 N N    . LEU A 1 106 ? -16.406 -12.852 -13.454 1.00 0.00 ? 106 LEU A N    6  
ATOM 11304 C CA   . LEU A 1 106 ? -16.229 -11.625 -14.234 1.00 0.00 ? 106 LEU A CA   6  
ATOM 11305 C C    . LEU A 1 106 ? -14.829 -11.019 -14.207 1.00 0.00 ? 106 LEU A C    6  
ATOM 11306 O O    . LEU A 1 106 ? -14.205 -10.841 -15.251 1.00 0.00 ? 106 LEU A O    6  
ATOM 11307 C CB   . LEU A 1 106 ? -17.187 -10.525 -13.793 1.00 0.00 ? 106 LEU A CB   6  
ATOM 11308 C CG   . LEU A 1 106 ? -18.672 -10.948 -13.683 1.00 0.00 ? 106 LEU A CG   6  
ATOM 11309 C CD1  . LEU A 1 106 ? -19.498 -9.669  -13.616 1.00 0.00 ? 106 LEU A CD1  6  
ATOM 11310 C CD2  . LEU A 1 106 ? -19.214 -11.796 -14.849 1.00 0.00 ? 106 LEU A CD2  6  
ATOM 11311 H H    . LEU A 1 106 ? -16.819 -12.727 -12.549 1.00 0.00 ? 106 LEU A H    6  
ATOM 11312 H HA   . LEU A 1 106 ? -16.520 -11.783 -15.264 1.00 0.00 ? 106 LEU A HA   6  
ATOM 11313 H HB2  . LEU A 1 106 ? -16.820 -10.152 -12.809 1.00 0.00 ? 106 LEU A HB2  6  
ATOM 11314 H HB3  . LEU A 1 106 ? -17.139 -9.672  -14.512 1.00 0.00 ? 106 LEU A HB3  6  
ATOM 11315 H HG   . LEU A 1 106 ? -18.799 -11.538 -12.746 1.00 0.00 ? 106 LEU A HG   6  
ATOM 11316 H HD11 . LEU A 1 106 ? -19.178 -9.044  -12.757 1.00 0.00 ? 106 LEU A HD11 6  
ATOM 11317 H HD12 . LEU A 1 106 ? -19.311 -9.114  -14.561 1.00 0.00 ? 106 LEU A HD12 6  
ATOM 11318 H HD13 . LEU A 1 106 ? -20.579 -9.896  -13.533 1.00 0.00 ? 106 LEU A HD13 6  
ATOM 11319 H HD21 . LEU A 1 106 ? -19.096 -11.250 -15.809 1.00 0.00 ? 106 LEU A HD21 6  
ATOM 11320 H HD22 . LEU A 1 106 ? -18.691 -12.771 -14.930 1.00 0.00 ? 106 LEU A HD22 6  
ATOM 11321 H HD23 . LEU A 1 106 ? -20.296 -11.999 -14.698 1.00 0.00 ? 106 LEU A HD23 6  
ATOM 11322 N N    . GLU A 1 107 ? -14.308 -10.689 -12.984 1.00 0.00 ? 107 GLU A N    6  
ATOM 11323 C CA   . GLU A 1 107 ? -13.029 -10.030 -12.675 1.00 0.00 ? 107 GLU A CA   6  
ATOM 11324 C C    . GLU A 1 107 ? -11.758 -10.764 -13.127 1.00 0.00 ? 107 GLU A C    6  
ATOM 11325 O O    . GLU A 1 107 ? -10.656 -10.232 -13.218 1.00 0.00 ? 107 GLU A O    6  
ATOM 11326 C CB   . GLU A 1 107 ? -12.990 -9.695  -11.179 1.00 0.00 ? 107 GLU A CB   6  
ATOM 11327 C CG   . GLU A 1 107 ? -12.247 -8.381  -10.913 1.00 0.00 ? 107 GLU A CG   6  
ATOM 11328 C CD   . GLU A 1 107 ? -13.074 -7.166  -11.340 1.00 0.00 ? 107 GLU A CD   6  
ATOM 11329 O OE1  . GLU A 1 107 ? -14.187 -6.982  -10.779 1.00 0.00 ? 107 GLU A OE1  6  
ATOM 11330 O OE2  . GLU A 1 107 ? -12.604 -6.405  -12.226 1.00 0.00 ? 107 GLU A OE2  6  
ATOM 11331 H H    . GLU A 1 107 ? -14.862 -10.869 -12.171 1.00 0.00 ? 107 GLU A H    6  
ATOM 11332 H HA   . GLU A 1 107 ? -13.005 -9.044  -13.100 1.00 0.00 ? 107 GLU A HA   6  
ATOM 11333 H HB2  . GLU A 1 107 ? -14.037 -9.576  -10.811 1.00 0.00 ? 107 GLU A HB2  6  
ATOM 11334 H HB3  . GLU A 1 107 ? -12.546 -10.522 -10.582 1.00 0.00 ? 107 GLU A HB3  6  
ATOM 11335 H HG2  . GLU A 1 107 ? -12.099 -8.347  -9.837  1.00 0.00 ? 107 GLU A HG2  6  
ATOM 11336 H HG3  . GLU A 1 107 ? -11.252 -8.376  -11.397 1.00 0.00 ? 107 GLU A HG3  6  
ATOM 11337 N N    . LYS A 1 108 ? -11.960 -12.062 -13.422 1.00 0.00 ? 108 LYS A N    6  
ATOM 11338 C CA   . LYS A 1 108 ? -10.930 -12.998 -13.891 1.00 0.00 ? 108 LYS A CA   6  
ATOM 11339 C C    . LYS A 1 108 ? -11.019 -13.348 -15.374 1.00 0.00 ? 108 LYS A C    6  
ATOM 11340 O O    . LYS A 1 108 ? -10.042 -13.792 -15.973 1.00 0.00 ? 108 LYS A O    6  
ATOM 11341 C CB   . LYS A 1 108 ? -10.884 -14.301 -13.052 1.00 0.00 ? 108 LYS A CB   6  
ATOM 11342 C CG   . LYS A 1 108 ? -10.701 -14.020 -11.553 1.00 0.00 ? 108 LYS A CG   6  
ATOM 11343 C CD   . LYS A 1 108 ? -9.979  -15.136 -10.787 1.00 0.00 ? 108 LYS A CD   6  
ATOM 11344 C CE   . LYS A 1 108 ? -10.697 -16.495 -10.800 1.00 0.00 ? 108 LYS A CE   6  
ATOM 11345 N NZ   . LYS A 1 108 ? -9.960  -17.482 -9.976  1.00 0.00 ? 108 LYS A NZ   6  
ATOM 11346 H H    . LYS A 1 108 ? -12.927 -12.329 -13.274 1.00 0.00 ? 108 LYS A H    6  
ATOM 11347 H HA   . LYS A 1 108 ? -9.952  -12.546 -13.774 1.00 0.00 ? 108 LYS A HA   6  
ATOM 11348 H HB2  . LYS A 1 108 ? -11.814 -14.896 -13.188 1.00 0.00 ? 108 LYS A HB2  6  
ATOM 11349 H HB3  . LYS A 1 108 ? -10.030 -14.924 -13.400 1.00 0.00 ? 108 LYS A HB3  6  
ATOM 11350 H HG2  . LYS A 1 108 ? -10.100 -13.087 -11.435 1.00 0.00 ? 108 LYS A HG2  6  
ATOM 11351 H HG3  . LYS A 1 108 ? -11.704 -13.833 -11.107 1.00 0.00 ? 108 LYS A HG3  6  
ATOM 11352 H HD2  . LYS A 1 108 ? -8.956  -15.254 -11.208 1.00 0.00 ? 108 LYS A HD2  6  
ATOM 11353 H HD3  . LYS A 1 108 ? -9.863  -14.803 -9.732  1.00 0.00 ? 108 LYS A HD3  6  
ATOM 11354 H HE2  . LYS A 1 108 ? -11.715 -16.404 -10.372 1.00 0.00 ? 108 LYS A HE2  6  
ATOM 11355 H HE3  . LYS A 1 108 ? -10.770 -16.906 -11.829 1.00 0.00 ? 108 LYS A HE3  6  
ATOM 11356 H HZ1  . LYS A 1 108 ? -9.897  -17.137 -8.998  1.00 0.00 ? 108 LYS A HZ1  6  
ATOM 11357 H HZ2  . LYS A 1 108 ? -10.464 -18.392 -9.991  1.00 0.00 ? 108 LYS A HZ2  6  
ATOM 11358 H HZ3  . LYS A 1 108 ? -9.002  -17.609 -10.361 1.00 0.00 ? 108 LYS A HZ3  6  
ATOM 11359 N N    . LYS A 1 109 ? -12.212 -13.185 -15.990 1.00 0.00 ? 109 LYS A N    6  
ATOM 11360 C CA   . LYS A 1 109 ? -12.470 -13.498 -17.397 1.00 0.00 ? 109 LYS A CA   6  
ATOM 11361 C C    . LYS A 1 109 ? -12.630 -12.266 -18.287 1.00 0.00 ? 109 LYS A C    6  
ATOM 11362 O O    . LYS A 1 109 ? -12.257 -12.288 -19.458 1.00 0.00 ? 109 LYS A O    6  
ATOM 11363 C CB   . LYS A 1 109 ? -13.720 -14.402 -17.519 1.00 0.00 ? 109 LYS A CB   6  
ATOM 11364 C CG   . LYS A 1 109 ? -14.015 -14.925 -18.938 1.00 0.00 ? 109 LYS A CG   6  
ATOM 11365 C CD   . LYS A 1 109 ? -14.954 -16.139 -18.941 1.00 0.00 ? 109 LYS A CD   6  
ATOM 11366 C CE   . LYS A 1 109 ? -16.376 -15.827 -18.447 1.00 0.00 ? 109 LYS A CE   6  
ATOM 11367 N NZ   . LYS A 1 109 ? -17.231 -17.036 -18.506 1.00 0.00 ? 109 LYS A NZ   6  
ATOM 11368 H H    . LYS A 1 109 ? -12.983 -12.858 -15.451 1.00 0.00 ? 109 LYS A H    6  
ATOM 11369 H HA   . LYS A 1 109 ? -11.660 -14.078 -17.823 1.00 0.00 ? 109 LYS A HA   6  
ATOM 11370 H HB2  . LYS A 1 109 ? -13.554 -15.279 -16.852 1.00 0.00 ? 109 LYS A HB2  6  
ATOM 11371 H HB3  . LYS A 1 109 ? -14.615 -13.868 -17.134 1.00 0.00 ? 109 LYS A HB3  6  
ATOM 11372 H HG2  . LYS A 1 109 ? -14.464 -14.106 -19.544 1.00 0.00 ? 109 LYS A HG2  6  
ATOM 11373 H HG3  . LYS A 1 109 ? -13.055 -15.225 -19.415 1.00 0.00 ? 109 LYS A HG3  6  
ATOM 11374 H HD2  . LYS A 1 109 ? -15.001 -16.539 -19.981 1.00 0.00 ? 109 LYS A HD2  6  
ATOM 11375 H HD3  . LYS A 1 109 ? -14.492 -16.921 -18.297 1.00 0.00 ? 109 LYS A HD3  6  
ATOM 11376 H HE2  . LYS A 1 109 ? -16.371 -15.479 -17.394 1.00 0.00 ? 109 LYS A HE2  6  
ATOM 11377 H HE3  . LYS A 1 109 ? -16.852 -15.049 -19.082 1.00 0.00 ? 109 LYS A HE3  6  
ATOM 11378 H HZ1  . LYS A 1 109 ? -16.820 -17.781 -17.906 1.00 0.00 ? 109 LYS A HZ1  6  
ATOM 11379 H HZ2  . LYS A 1 109 ? -18.186 -16.805 -18.168 1.00 0.00 ? 109 LYS A HZ2  6  
ATOM 11380 H HZ3  . LYS A 1 109 ? -17.284 -17.375 -19.489 1.00 0.00 ? 109 LYS A HZ3  6  
ATOM 11381 N N    . LYS A 1 110 ? -13.238 -11.170 -17.763 1.00 0.00 ? 110 LYS A N    6  
ATOM 11382 C CA   . LYS A 1 110 ? -13.570 -9.965  -18.517 1.00 0.00 ? 110 LYS A CA   6  
ATOM 11383 C C    . LYS A 1 110 ? -12.899 -8.729  -17.915 1.00 0.00 ? 110 LYS A C    6  
ATOM 11384 O O    . LYS A 1 110 ? -13.512 -7.687  -17.691 1.00 0.00 ? 110 LYS A O    6  
ATOM 11385 C CB   . LYS A 1 110 ? -15.119 -9.841  -18.608 1.00 0.00 ? 110 LYS A CB   6  
ATOM 11386 C CG   . LYS A 1 110 ? -15.650 -8.860  -19.671 1.00 0.00 ? 110 LYS A CG   6  
ATOM 11387 C CD   . LYS A 1 110 ? -17.184 -8.869  -19.731 1.00 0.00 ? 110 LYS A CD   6  
ATOM 11388 C CE   . LYS A 1 110 ? -17.744 -7.904  -20.787 1.00 0.00 ? 110 LYS A CE   6  
ATOM 11389 N NZ   . LYS A 1 110 ? -19.224 -7.958  -20.821 1.00 0.00 ? 110 LYS A NZ   6  
ATOM 11390 H H    . LYS A 1 110 ? -13.556 -11.156 -16.797 1.00 0.00 ? 110 LYS A H    6  
ATOM 11391 H HA   . LYS A 1 110 ? -13.200 -10.037 -19.532 1.00 0.00 ? 110 LYS A HA   6  
ATOM 11392 H HB2  . LYS A 1 110 ? -15.513 -10.848 -18.880 1.00 0.00 ? 110 LYS A HB2  6  
ATOM 11393 H HB3  . LYS A 1 110 ? -15.538 -9.591  -17.609 1.00 0.00 ? 110 LYS A HB3  6  
ATOM 11394 H HG2  . LYS A 1 110 ? -15.304 -7.830  -19.432 1.00 0.00 ? 110 LYS A HG2  6  
ATOM 11395 H HG3  . LYS A 1 110 ? -15.242 -9.137  -20.668 1.00 0.00 ? 110 LYS A HG3  6  
ATOM 11396 H HD2  . LYS A 1 110 ? -17.525 -9.906  -19.956 1.00 0.00 ? 110 LYS A HD2  6  
ATOM 11397 H HD3  . LYS A 1 110 ? -17.580 -8.601  -18.725 1.00 0.00 ? 110 LYS A HD3  6  
ATOM 11398 H HE2  . LYS A 1 110 ? -17.451 -6.856  -20.559 1.00 0.00 ? 110 LYS A HE2  6  
ATOM 11399 H HE3  . LYS A 1 110 ? -17.375 -8.171  -21.798 1.00 0.00 ? 110 LYS A HE3  6  
ATOM 11400 H HZ1  . LYS A 1 110 ? -19.531 -8.925  -21.044 1.00 0.00 ? 110 LYS A HZ1  6  
ATOM 11401 H HZ2  . LYS A 1 110 ? -19.604 -7.680  -19.892 1.00 0.00 ? 110 LYS A HZ2  6  
ATOM 11402 H HZ3  . LYS A 1 110 ? -19.578 -7.305  -21.549 1.00 0.00 ? 110 LYS A HZ3  6  
ATOM 11403 N N    . LYS A 1 111 ? -11.573 -8.819  -17.657 1.00 0.00 ? 111 LYS A N    6  
ATOM 11404 C CA   . LYS A 1 111 ? -10.769 -7.733  -17.108 1.00 0.00 ? 111 LYS A CA   6  
ATOM 11405 C C    . LYS A 1 111 ? -9.484  -7.597  -17.915 1.00 0.00 ? 111 LYS A C    6  
ATOM 11406 O O    . LYS A 1 111 ? -8.563  -6.859  -17.570 1.00 0.00 ? 111 LYS A O    6  
ATOM 11407 C CB   . LYS A 1 111 ? -10.491 -7.954  -15.596 1.00 0.00 ? 111 LYS A CB   6  
ATOM 11408 C CG   . LYS A 1 111 ? -10.127 -6.668  -14.827 1.00 0.00 ? 111 LYS A CG   6  
ATOM 11409 C CD   . LYS A 1 111 ? -9.522  -6.911  -13.432 1.00 0.00 ? 111 LYS A CD   6  
ATOM 11410 C CE   . LYS A 1 111 ? -7.982  -6.988  -13.414 1.00 0.00 ? 111 LYS A CE   6  
ATOM 11411 N NZ   . LYS A 1 111 ? -7.470  -8.193  -14.108 1.00 0.00 ? 111 LYS A NZ   6  
ATOM 11412 H H    . LYS A 1 111 ? -11.111 -9.685  -17.839 1.00 0.00 ? 111 LYS A H    6  
ATOM 11413 H HA   . LYS A 1 111 ? -11.288 -6.784  -17.212 1.00 0.00 ? 111 LYS A HA   6  
ATOM 11414 H HB2  . LYS A 1 111 ? -11.419 -8.360  -15.128 1.00 0.00 ? 111 LYS A HB2  6  
ATOM 11415 H HB3  . LYS A 1 111 ? -9.708  -8.730  -15.449 1.00 0.00 ? 111 LYS A HB3  6  
ATOM 11416 H HG2  . LYS A 1 111 ? -9.400  -6.056  -15.406 1.00 0.00 ? 111 LYS A HG2  6  
ATOM 11417 H HG3  . LYS A 1 111 ? -11.051 -6.057  -14.723 1.00 0.00 ? 111 LYS A HG3  6  
ATOM 11418 H HD2  . LYS A 1 111 ? -9.816  -6.050  -12.786 1.00 0.00 ? 111 LYS A HD2  6  
ATOM 11419 H HD3  . LYS A 1 111 ? -9.965  -7.829  -12.989 1.00 0.00 ? 111 LYS A HD3  6  
ATOM 11420 H HE2  . LYS A 1 111 ? -7.544  -6.100  -13.917 1.00 0.00 ? 111 LYS A HE2  6  
ATOM 11421 H HE3  . LYS A 1 111 ? -7.606  -7.028  -12.369 1.00 0.00 ? 111 LYS A HE3  6  
ATOM 11422 H HZ1  . LYS A 1 111 ? -7.796  -8.187  -15.095 1.00 0.00 ? 111 LYS A HZ1  6  
ATOM 11423 H HZ2  . LYS A 1 111 ? -6.430  -8.190  -14.085 1.00 0.00 ? 111 LYS A HZ2  6  
ATOM 11424 H HZ3  . LYS A 1 111 ? -7.826  -9.045  -13.628 1.00 0.00 ? 111 LYS A HZ3  6  
ATOM 11425 N N    . GLY A 1 1   ? 23.035  5.416   10.514  1.00 0.00 ? 1   GLY A N    7  
ATOM 11426 C CA   . GLY A 1 1   ? 23.310  5.476   11.933  1.00 0.00 ? 1   GLY A CA   7  
ATOM 11427 C C    . GLY A 1 1   ? 24.535  6.298   12.137  1.00 0.00 ? 1   GLY A C    7  
ATOM 11428 O O    . GLY A 1 1   ? 25.141  6.311   13.203  1.00 0.00 ? 1   GLY A O    7  
ATOM 11429 H H    . GLY A 1 1   ? 22.072  5.559   10.218  1.00 0.00 ? 1   GLY A H    7  
ATOM 11430 H HA2  . GLY A 1 1   ? 22.483  5.963   12.426  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11431 H HA3  . GLY A 1 1   ? 23.515  4.475   12.284  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11432 N N    . GLN A 1 2   ? 24.933  7.017   11.071  1.00 0.00 ? 2   GLN A N    7  
ATOM 11433 C CA   . GLN A 1 2   ? 26.126  7.840   11.045  1.00 0.00 ? 2   GLN A CA   7  
ATOM 11434 C C    . GLN A 1 2   ? 25.936  8.935   10.024  1.00 0.00 ? 2   GLN A C    7  
ATOM 11435 O O    . GLN A 1 2   ? 25.903  10.126  10.320  1.00 0.00 ? 2   GLN A O    7  
ATOM 11436 C CB   . GLN A 1 2   ? 27.383  6.990   10.675  1.00 0.00 ? 2   GLN A CB   7  
ATOM 11437 C CG   . GLN A 1 2   ? 28.725  7.678   11.011  1.00 0.00 ? 2   GLN A CG   7  
ATOM 11438 C CD   . GLN A 1 2   ? 29.897  6.873   10.449  1.00 0.00 ? 2   GLN A CD   7  
ATOM 11439 O OE1  . GLN A 1 2   ? 30.421  7.194   9.381   1.00 0.00 ? 2   GLN A OE1  7  
ATOM 11440 N NE2  . GLN A 1 2   ? 30.315  5.807   11.170  1.00 0.00 ? 2   GLN A NE2  7  
ATOM 11441 H H    . GLN A 1 2   ? 24.362  6.932   10.255  1.00 0.00 ? 2   GLN A H    7  
ATOM 11442 H HA   . GLN A 1 2   ? 26.275  8.320   12.007  1.00 0.00 ? 2   GLN A HA   7  
ATOM 11443 H HB2  . GLN A 1 2   ? 27.333  6.046   11.264  1.00 0.00 ? 2   GLN A HB2  7  
ATOM 11444 H HB3  . GLN A 1 2   ? 27.369  6.691   9.596   1.00 0.00 ? 2   GLN A HB3  7  
ATOM 11445 H HG2  . GLN A 1 2   ? 28.775  8.685   10.543  1.00 0.00 ? 2   GLN A HG2  7  
ATOM 11446 H HG3  . GLN A 1 2   ? 28.841  7.796   12.108  1.00 0.00 ? 2   GLN A HG3  7  
ATOM 11447 H HE21 . GLN A 1 2   ? 29.817  5.538   11.989  1.00 0.00 ? 2   GLN A HE21 7  
ATOM 11448 H HE22 . GLN A 1 2   ? 31.105  5.306   10.824  1.00 0.00 ? 2   GLN A HE22 7  
ATOM 11449 N N    . ARG A 1 3   ? 25.831  8.507   8.749   1.00 0.00 ? 3   ARG A N    7  
ATOM 11450 C CA   . ARG A 1 3   ? 25.763  9.315   7.556   1.00 0.00 ? 3   ARG A CA   7  
ATOM 11451 C C    . ARG A 1 3   ? 24.354  9.319   6.980   1.00 0.00 ? 3   ARG A C    7  
ATOM 11452 O O    . ARG A 1 3   ? 24.033  8.606   6.034   1.00 0.00 ? 3   ARG A O    7  
ATOM 11453 C CB   . ARG A 1 3   ? 26.795  8.735   6.563   1.00 0.00 ? 3   ARG A CB   7  
ATOM 11454 C CG   . ARG A 1 3   ? 28.250  9.006   6.972   1.00 0.00 ? 3   ARG A CG   7  
ATOM 11455 C CD   . ARG A 1 3   ? 29.266  8.510   5.936   1.00 0.00 ? 3   ARG A CD   7  
ATOM 11456 N NE   . ARG A 1 3   ? 30.649  8.758   6.472   1.00 0.00 ? 3   ARG A NE   7  
ATOM 11457 C CZ   . ARG A 1 3   ? 31.789  8.512   5.754   1.00 0.00 ? 3   ARG A CZ   7  
ATOM 11458 N NH1  . ARG A 1 3   ? 31.724  8.058   4.469   1.00 0.00 ? 3   ARG A NH1  7  
ATOM 11459 N NH2  . ARG A 1 3   ? 33.005  8.725   6.334   1.00 0.00 ? 3   ARG A NH2  7  
ATOM 11460 H H    . ARG A 1 3   ? 25.877  7.530   8.563   1.00 0.00 ? 3   ARG A H    7  
ATOM 11461 H HA   . ARG A 1 3   ? 26.033  10.343  7.766   1.00 0.00 ? 3   ARG A HA   7  
ATOM 11462 H HB2  . ARG A 1 3   ? 26.693  7.625   6.572   1.00 0.00 ? 3   ARG A HB2  7  
ATOM 11463 H HB3  . ARG A 1 3   ? 26.647  9.139   5.539   1.00 0.00 ? 3   ARG A HB3  7  
ATOM 11464 H HG2  . ARG A 1 3   ? 28.397  10.094  7.145   1.00 0.00 ? 3   ARG A HG2  7  
ATOM 11465 H HG3  . ARG A 1 3   ? 28.423  8.454   7.920   1.00 0.00 ? 3   ARG A HG3  7  
ATOM 11466 H HD2  . ARG A 1 3   ? 29.134  7.417   5.779   1.00 0.00 ? 3   ARG A HD2  7  
ATOM 11467 H HD3  . ARG A 1 3   ? 29.132  9.057   4.977   1.00 0.00 ? 3   ARG A HD3  7  
ATOM 11468 H HE   . ARG A 1 3   ? 30.739  9.090   7.411   1.00 0.00 ? 3   ARG A HE   7  
ATOM 11469 H HH11 . ARG A 1 3   ? 30.833  7.904   4.040   1.00 0.00 ? 3   ARG A HH11 7  
ATOM 11470 H HH12 . ARG A 1 3   ? 32.564  7.885   3.956   1.00 0.00 ? 3   ARG A HH12 7  
ATOM 11471 H HH21 . ARG A 1 3   ? 33.058  9.056   7.276   1.00 0.00 ? 3   ARG A HH21 7  
ATOM 11472 H HH22 . ARG A 1 3   ? 33.843  8.548   5.817   1.00 0.00 ? 3   ARG A HH22 7  
ATOM 11473 N N    . GLN A 1 4   ? 23.479  10.156  7.576   1.00 0.00 ? 4   GLN A N    7  
ATOM 11474 C CA   . GLN A 1 4   ? 22.100  10.328  7.155   1.00 0.00 ? 4   GLN A CA   7  
ATOM 11475 C C    . GLN A 1 4   ? 21.532  11.520  7.869   1.00 0.00 ? 4   GLN A C    7  
ATOM 11476 O O    . GLN A 1 4   ? 21.105  12.468  7.221   1.00 0.00 ? 4   GLN A O    7  
ATOM 11477 C CB   . GLN A 1 4   ? 21.165  9.086   7.332   1.00 0.00 ? 4   GLN A CB   7  
ATOM 11478 C CG   . GLN A 1 4   ? 21.290  8.309   8.670   1.00 0.00 ? 4   GLN A CG   7  
ATOM 11479 C CD   . GLN A 1 4   ? 20.533  6.975   8.691   1.00 0.00 ? 4   GLN A CD   7  
ATOM 11480 O OE1  . GLN A 1 4   ? 20.559  6.261   9.698   1.00 0.00 ? 4   GLN A OE1  7  
ATOM 11481 N NE2  . GLN A 1 4   ? 19.869  6.600   7.573   1.00 0.00 ? 4   GLN A NE2  7  
ATOM 11482 H H    . GLN A 1 4   ? 23.799  10.712  8.340   1.00 0.00 ? 4   GLN A H    7  
ATOM 11483 H HA   . GLN A 1 4   ? 22.099  10.602  6.107   1.00 0.00 ? 4   GLN A HA   7  
ATOM 11484 H HB2  . GLN A 1 4   ? 20.097  9.392   7.190   1.00 0.00 ? 4   GLN A HB2  7  
ATOM 11485 H HB3  . GLN A 1 4   ? 21.433  8.395   6.500   1.00 0.00 ? 4   GLN A HB3  7  
ATOM 11486 H HG2  . GLN A 1 4   ? 22.355  8.079   8.880   1.00 0.00 ? 4   GLN A HG2  7  
ATOM 11487 H HG3  . GLN A 1 4   ? 20.891  8.915   9.509   1.00 0.00 ? 4   GLN A HG3  7  
ATOM 11488 H HE21 . GLN A 1 4   ? 19.847  7.188   6.769   1.00 0.00 ? 4   GLN A HE21 7  
ATOM 11489 H HE22 . GLN A 1 4   ? 19.416  5.712   7.579   1.00 0.00 ? 4   GLN A HE22 7  
ATOM 11490 N N    . LEU A 1 5   ? 21.508  11.464  9.232   1.00 0.00 ? 5   LEU A N    7  
ATOM 11491 C CA   . LEU A 1 5   ? 20.986  12.458  10.176  1.00 0.00 ? 5   LEU A CA   7  
ATOM 11492 C C    . LEU A 1 5   ? 19.454  12.457  10.181  1.00 0.00 ? 5   LEU A C    7  
ATOM 11493 O O    . LEU A 1 5   ? 18.792  13.467  9.966   1.00 0.00 ? 5   LEU A O    7  
ATOM 11494 C CB   . LEU A 1 5   ? 21.604  13.886  10.025  1.00 0.00 ? 5   LEU A CB   7  
ATOM 11495 C CG   . LEU A 1 5   ? 23.061  14.057  10.540  1.00 0.00 ? 5   LEU A CG   7  
ATOM 11496 C CD1  . LEU A 1 5   ? 23.120  14.063  12.077  1.00 0.00 ? 5   LEU A CD1  7  
ATOM 11497 C CD2  . LEU A 1 5   ? 24.089  13.065  9.955   1.00 0.00 ? 5   LEU A CD2  7  
ATOM 11498 H H    . LEU A 1 5   ? 21.885  10.652  9.661   1.00 0.00 ? 5   LEU A H    7  
ATOM 11499 H HA   . LEU A 1 5   ? 21.263  12.106  11.157  1.00 0.00 ? 5   LEU A HA   7  
ATOM 11500 H HB2  . LEU A 1 5   ? 21.563  14.185  8.957   1.00 0.00 ? 5   LEU A HB2  7  
ATOM 11501 H HB3  . LEU A 1 5   ? 20.994  14.628  10.589  1.00 0.00 ? 5   LEU A HB3  7  
ATOM 11502 H HG   . LEU A 1 5   ? 23.382  15.077  10.207  1.00 0.00 ? 5   LEU A HG   7  
ATOM 11503 H HD11 . LEU A 1 5   ? 22.434  14.833  12.488  1.00 0.00 ? 5   LEU A HD11 7  
ATOM 11504 H HD12 . LEU A 1 5   ? 22.836  13.075  12.492  1.00 0.00 ? 5   LEU A HD12 7  
ATOM 11505 H HD13 . LEU A 1 5   ? 24.152  14.298  12.418  1.00 0.00 ? 5   LEU A HD13 7  
ATOM 11506 H HD21 . LEU A 1 5   ? 24.067  13.088  8.846   1.00 0.00 ? 5   LEU A HD21 7  
ATOM 11507 H HD22 . LEU A 1 5   ? 25.113  13.341  10.285  1.00 0.00 ? 5   LEU A HD22 7  
ATOM 11508 H HD23 . LEU A 1 5   ? 23.890  12.030  10.305  1.00 0.00 ? 5   LEU A HD23 7  
ATOM 11509 N N    . LEU A 1 6   ? 18.853  11.259  10.405  1.00 0.00 ? 6   LEU A N    7  
ATOM 11510 C CA   . LEU A 1 6   ? 17.416  11.026  10.371  1.00 0.00 ? 6   LEU A CA   7  
ATOM 11511 C C    . LEU A 1 6   ? 16.646  11.323  11.663  1.00 0.00 ? 6   LEU A C    7  
ATOM 11512 O O    . LEU A 1 6   ? 17.058  10.997  12.776  1.00 0.00 ? 6   LEU A O    7  
ATOM 11513 C CB   . LEU A 1 6   ? 17.042  9.606   9.914   1.00 0.00 ? 6   LEU A CB   7  
ATOM 11514 C CG   . LEU A 1 6   ? 17.460  9.246   8.473   1.00 0.00 ? 6   LEU A CG   7  
ATOM 11515 C CD1  . LEU A 1 6   ? 16.538  8.121   8.017   1.00 0.00 ? 6   LEU A CD1  7  
ATOM 11516 C CD2  . LEU A 1 6   ? 17.361  10.376  7.431   1.00 0.00 ? 6   LEU A CD2  7  
ATOM 11517 H H    . LEU A 1 6   ? 19.404  10.451  10.567  1.00 0.00 ? 6   LEU A H    7  
ATOM 11518 H HA   . LEU A 1 6   ? 16.990  11.584  9.557   1.00 0.00 ? 6   LEU A HA   7  
ATOM 11519 H HB2  . LEU A 1 6   ? 17.458  8.851   10.613  1.00 0.00 ? 6   LEU A HB2  7  
ATOM 11520 H HB3  . LEU A 1 6   ? 15.930  9.507   9.935   1.00 0.00 ? 6   LEU A HB3  7  
ATOM 11521 H HG   . LEU A 1 6   ? 18.509  8.883   8.498   1.00 0.00 ? 6   LEU A HG   7  
ATOM 11522 H HD11 . LEU A 1 6   ? 16.581  7.274   8.730   1.00 0.00 ? 6   LEU A HD11 7  
ATOM 11523 H HD12 . LEU A 1 6   ? 15.508  8.541   7.997   1.00 0.00 ? 6   LEU A HD12 7  
ATOM 11524 H HD13 . LEU A 1 6   ? 16.820  7.774   7.002   1.00 0.00 ? 6   LEU A HD13 7  
ATOM 11525 H HD21 . LEU A 1 6   ? 16.344  10.822  7.444   1.00 0.00 ? 6   LEU A HD21 7  
ATOM 11526 H HD22 . LEU A 1 6   ? 18.108  11.176  7.625   1.00 0.00 ? 6   LEU A HD22 7  
ATOM 11527 H HD23 . LEU A 1 6   ? 17.548  9.976   6.411   1.00 0.00 ? 6   LEU A HD23 7  
ATOM 11528 N N    . LEU A 1 7   ? 15.434  11.913  11.487  1.00 0.00 ? 7   LEU A N    7  
ATOM 11529 C CA   . LEU A 1 7   ? 14.458  12.226  12.535  1.00 0.00 ? 7   LEU A CA   7  
ATOM 11530 C C    . LEU A 1 7   ? 13.165  11.517  12.260  1.00 0.00 ? 7   LEU A C    7  
ATOM 11531 O O    . LEU A 1 7   ? 12.129  11.795  12.867  1.00 0.00 ? 7   LEU A O    7  
ATOM 11532 C CB   . LEU A 1 7   ? 14.153  13.749  12.613  1.00 0.00 ? 7   LEU A CB   7  
ATOM 11533 C CG   . LEU A 1 7   ? 15.377  14.666  12.773  1.00 0.00 ? 7   LEU A CG   7  
ATOM 11534 C CD1  . LEU A 1 7   ? 14.936  16.110  12.486  1.00 0.00 ? 7   LEU A CD1  7  
ATOM 11535 C CD2  . LEU A 1 7   ? 16.029  14.527  14.157  1.00 0.00 ? 7   LEU A CD2  7  
ATOM 11536 H H    . LEU A 1 7   ? 15.152  12.168  10.566  1.00 0.00 ? 7   LEU A H    7  
ATOM 11537 H HA   . LEU A 1 7   ? 14.737  11.782  13.480  1.00 0.00 ? 7   LEU A HA   7  
ATOM 11538 H HB2  . LEU A 1 7   ? 13.645  14.071  11.674  1.00 0.00 ? 7   LEU A HB2  7  
ATOM 11539 H HB3  . LEU A 1 7   ? 13.460  13.963  13.460  1.00 0.00 ? 7   LEU A HB3  7  
ATOM 11540 H HG   . LEU A 1 7   ? 16.138  14.391  12.003  1.00 0.00 ? 7   LEU A HG   7  
ATOM 11541 H HD11 . LEU A 1 7   ? 14.497  16.170  11.465  1.00 0.00 ? 7   LEU A HD11 7  
ATOM 11542 H HD12 . LEU A 1 7   ? 14.158  16.427  13.212  1.00 0.00 ? 7   LEU A HD12 7  
ATOM 11543 H HD13 . LEU A 1 7   ? 15.800  16.803  12.548  1.00 0.00 ? 7   LEU A HD13 7  
ATOM 11544 H HD21 . LEU A 1 7   ? 15.305  14.790  14.958  1.00 0.00 ? 7   LEU A HD21 7  
ATOM 11545 H HD22 . LEU A 1 7   ? 16.385  13.488  14.322  1.00 0.00 ? 7   LEU A HD22 7  
ATOM 11546 H HD23 . LEU A 1 7   ? 16.903  15.208  14.237  1.00 0.00 ? 7   LEU A HD23 7  
ATOM 11547 N N    . ALA A 1 8   ? 13.223  10.561  11.299  1.00 0.00 ? 8   ALA A N    7  
ATOM 11548 C CA   . ALA A 1 8   ? 12.157  9.688   10.866  1.00 0.00 ? 8   ALA A CA   7  
ATOM 11549 C C    . ALA A 1 8   ? 11.128  10.408  10.001  1.00 0.00 ? 8   ALA A C    7  
ATOM 11550 O O    . ALA A 1 8   ? 11.196  10.373  8.774   1.00 0.00 ? 8   ALA A O    7  
ATOM 11551 C CB   . ALA A 1 8   ? 11.598  8.938   12.097  1.00 0.00 ? 8   ALA A CB   7  
ATOM 11552 H H    . ALA A 1 8   ? 14.095  10.405  10.859  1.00 0.00 ? 8   ALA A H    7  
ATOM 11553 H HA   . ALA A 1 8   ? 12.620  8.956   10.221  1.00 0.00 ? 8   ALA A HA   7  
ATOM 11554 H HB1  . ALA A 1 8   ? 12.483  8.638   12.713  1.00 0.00 ? 8   ALA A HB1  7  
ATOM 11555 H HB2  . ALA A 1 8   ? 10.999  8.049   11.816  1.00 0.00 ? 8   ALA A HB2  7  
ATOM 11556 H HB3  . ALA A 1 8   ? 11.002  9.601   12.758  1.00 0.00 ? 8   ALA A HB3  7  
ATOM 11557 N N    . SER A 1 9   ? 10.187  11.124  10.683  1.00 0.00 ? 9   SER A N    7  
ATOM 11558 C CA   . SER A 1 9   ? 9.132   12.002  10.173  1.00 0.00 ? 9   SER A CA   7  
ATOM 11559 C C    . SER A 1 9   ? 8.070   11.326  9.296   1.00 0.00 ? 9   SER A C    7  
ATOM 11560 O O    . SER A 1 9   ? 7.645   11.883  8.288   1.00 0.00 ? 9   SER A O    7  
ATOM 11561 C CB   . SER A 1 9   ? 9.741   13.310  9.560   1.00 0.00 ? 9