data_2V5P
# 
_entry.id   2V5P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2V5P         
PDBE  EBI-33120    
WWPDB D_1290033120 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GF2 unspecified 'INSULIN-LIKE GROWTH FACTOR II (IGF II) ( SOMATOMEDIN) (THEORETICAL MODEL)'                              
PDB 1IGL unspecified 'INSULIN-LIKE GROWTH FACTOR II (IGF-II, IGF -2) (NMR, 20 STRUCTURES)'                                    
PDB 1E6F unspecified 'HUMAN MIR-RECEPTOR, REPEAT 11'                                                                          
PDB 1GP0 unspecified 'STRUCTURE OF A FUNCTIONAL IGF2R FRAGMENT DETERMINED FROM ANOMALOUS SCATTERING OF SULPHUR'               
PDB 1GP3 unspecified 'STRUCTURE OF A FUNCTIONAL IGF2R FRAGMENT DETERMINED FROM ANOMALOUS SCATTERING OF SULPHUR'               
PDB 1GQB unspecified 'HUMAN MIR-RECEPTOR, REPEAT 11'                                                                          
PDB 1JPL unspecified 'GGA3 VHS DOMAIN COMPLEXED WITH C-TERMINAL PEPTIDE FROMCATION-INDEPENDENT MANNOSE 6- PHOSPHATE RECEPTOR' 
PDB 1JWG unspecified 'VHS DOMAIN OF HUMAN GGA1 COMPLEXED WITH CATION-INDEPENDENTM6PR C-TERMINAL PEPTIDE'                      
PDB 1LF8 unspecified 'COMPLEX OF GGA3-VHS DOMAIN AND CI-MPR C -TERMINALPHOSPHOPEPTIDE'                                        
PDB 2CNJ unspecified 'NMR STUDIES ON THE INTERACTION OF INSULIN- GROWTH FACTOR II (IGF-II) WITH IGF2R DOMAIN 11'              
PDB 2V5N unspecified .                                                                                                        
PDB 2V5O unspecified .                                                                                                        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2V5P 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-07-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brown, J.'     1  
'Delaine, C.'   2  
'Zaccheo, O.J.' 3  
'Siebold, C.'   4  
'Gilbert, R.J.' 5  
'van Boxel, G.' 6  
'Denley, A.'    7  
'Wallace, J.C.' 8  
'Hassan, A.B.'  9  
'Forbes, B.E.'  10 
'Jones, E.Y.'   11 
# 
_citation.id                        primary 
_citation.title                     'Structure and Functional Analysis of the Igf-II/Igf2R Interaction' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                265 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18046459 
_citation.pdbx_database_id_DOI      10.1038/SJ.EMBOJ.7601938 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Brown, J.'     1  ? 
primary 'Delaine, C.'   2  ? 
primary 'Zaccheo, O.J.' 3  ? 
primary 'Siebold, C.'   4  ? 
primary 'Gilbert, R.J.' 5  ? 
primary 'Van Boxel, G.' 6  ? 
primary 'Denley, A.'    7  ? 
primary 'Wallace, J.C.' 8  ? 
primary 'Hassan, A.B.'  9  ? 
primary 'Forbes, B.E.'  10 ? 
primary 'Jones, E.Y.'   11 ? 
# 
_cell.entry_id           2V5P 
_cell.length_a           165.979 
_cell.length_b           117.312 
_cell.length_c           116.668 
_cell.angle_alpha        90.00 
_cell.angle_beta         123.41 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2V5P 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR' 54414.172 2 ? ? 'DOMAINS 11-13, RESIDUES 1508-1992' ? 
2 polymer     man 'INSULIN-LIKE GROWTH FACTOR II' 7484.472  2 ? ? ?                                   ? 
3 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1 ? 
? ?                                   ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   5 ? ? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;INSULIN-LIKE GROWTH FACTOR II RECEPTOR, CI MAN-6-P RECEPTOR, CI-MPR, M6PR, INSULIN-LIKE GROWTH FACTOR 2 RECEPTOR, IGF-II RECEPTOR, M6P/IGF2 RECEPTOR, M6P/IGF2R, 300 KDA MANNOSE 6-PHOSPHATE RECEPTOR, MPR 300, MPR300, CD222 ANTIGEN
;
2 'IGF-II, SOMATOMEDIN A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV
LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLI
HRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHAVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESS
TPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVRMDGCTLTDEQLLYSFNLSSLSTSTFKV
TRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPF
IFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVC
PPKKLKHHHHHH
;
;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV
LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLI
HRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHAVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESS
TPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVRMDGCTLTDEQLLYSFNLSSLSTSTFKV
TRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPF
IFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVC
PPKKLKHHHHHH
;
A,B ? 
2 'polypeptide(L)' no no AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE 
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   SER n 
1 4   ASN n 
1 5   GLU n 
1 6   HIS n 
1 7   ASP n 
1 8   ASP n 
1 9   CYS n 
1 10  GLN n 
1 11  VAL n 
1 12  THR n 
1 13  ASN n 
1 14  PRO n 
1 15  SER n 
1 16  THR n 
1 17  GLY n 
1 18  HIS n 
1 19  LEU n 
1 20  PHE n 
1 21  ASP n 
1 22  LEU n 
1 23  SER n 
1 24  SER n 
1 25  LEU n 
1 26  SER n 
1 27  GLY n 
1 28  ARG n 
1 29  ALA n 
1 30  GLY n 
1 31  PHE n 
1 32  THR n 
1 33  ALA n 
1 34  ALA n 
1 35  TYR n 
1 36  SER n 
1 37  GLU n 
1 38  LYS n 
1 39  GLY n 
1 40  LEU n 
1 41  VAL n 
1 42  TYR n 
1 43  MET n 
1 44  SER n 
1 45  ILE n 
1 46  CYS n 
1 47  GLY n 
1 48  GLU n 
1 49  ASN n 
1 50  GLU n 
1 51  ASN n 
1 52  CYS n 
1 53  PRO n 
1 54  PRO n 
1 55  GLY n 
1 56  VAL n 
1 57  GLY n 
1 58  ALA n 
1 59  CYS n 
1 60  PHE n 
1 61  GLY n 
1 62  GLN n 
1 63  THR n 
1 64  ARG n 
1 65  ILE n 
1 66  SER n 
1 67  VAL n 
1 68  GLY n 
1 69  LYS n 
1 70  ALA n 
1 71  ASN n 
1 72  LYS n 
1 73  ARG n 
1 74  LEU n 
1 75  ARG n 
1 76  TYR n 
1 77  VAL n 
1 78  ASP n 
1 79  GLN n 
1 80  VAL n 
1 81  LEU n 
1 82  GLN n 
1 83  LEU n 
1 84  VAL n 
1 85  TYR n 
1 86  LYS n 
1 87  ASP n 
1 88  GLY n 
1 89  SER n 
1 90  PRO n 
1 91  CYS n 
1 92  PRO n 
1 93  SER n 
1 94  LYS n 
1 95  SER n 
1 96  GLY n 
1 97  LEU n 
1 98  SER n 
1 99  TYR n 
1 100 LYS n 
1 101 SER n 
1 102 VAL n 
1 103 ILE n 
1 104 SER n 
1 105 PHE n 
1 106 VAL n 
1 107 CYS n 
1 108 ARG n 
1 109 PRO n 
1 110 GLU n 
1 111 ALA n 
1 112 GLY n 
1 113 PRO n 
1 114 THR n 
1 115 ASN n 
1 116 ARG n 
1 117 PRO n 
1 118 MET n 
1 119 LEU n 
1 120 ILE n 
1 121 SER n 
1 122 LEU n 
1 123 ASP n 
1 124 LYS n 
1 125 GLN n 
1 126 THR n 
1 127 CYS n 
1 128 THR n 
1 129 LEU n 
1 130 PHE n 
1 131 PHE n 
1 132 SER n 
1 133 TRP n 
1 134 HIS n 
1 135 THR n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 CYS n 
1 140 GLU n 
1 141 GLN n 
1 142 ALA n 
1 143 THR n 
1 144 GLU n 
1 145 CYS n 
1 146 SER n 
1 147 VAL n 
1 148 ARG n 
1 149 ASN n 
1 150 GLY n 
1 151 SER n 
1 152 SER n 
1 153 ILE n 
1 154 VAL n 
1 155 ASP n 
1 156 LEU n 
1 157 SER n 
1 158 PRO n 
1 159 LEU n 
1 160 ILE n 
1 161 HIS n 
1 162 ARG n 
1 163 THR n 
1 164 GLY n 
1 165 GLY n 
1 166 TYR n 
1 167 GLU n 
1 168 ALA n 
1 169 TYR n 
1 170 ASP n 
1 171 GLU n 
1 172 SER n 
1 173 GLU n 
1 174 ASP n 
1 175 ASP n 
1 176 ALA n 
1 177 SER n 
1 178 ASP n 
1 179 THR n 
1 180 ASN n 
1 181 PRO n 
1 182 ASP n 
1 183 PHE n 
1 184 TYR n 
1 185 ILE n 
1 186 ASN n 
1 187 ILE n 
1 188 CYS n 
1 189 GLN n 
1 190 PRO n 
1 191 LEU n 
1 192 ASN n 
1 193 PRO n 
1 194 MET n 
1 195 HIS n 
1 196 ALA n 
1 197 VAL n 
1 198 PRO n 
1 199 CYS n 
1 200 PRO n 
1 201 ALA n 
1 202 GLY n 
1 203 ALA n 
1 204 ALA n 
1 205 VAL n 
1 206 CYS n 
1 207 LYS n 
1 208 VAL n 
1 209 PRO n 
1 210 ILE n 
1 211 ASP n 
1 212 GLY n 
1 213 PRO n 
1 214 PRO n 
1 215 ILE n 
1 216 ASP n 
1 217 ILE n 
1 218 GLY n 
1 219 ARG n 
1 220 VAL n 
1 221 ALA n 
1 222 GLY n 
1 223 PRO n 
1 224 PRO n 
1 225 ILE n 
1 226 LEU n 
1 227 ASN n 
1 228 PRO n 
1 229 ILE n 
1 230 ALA n 
1 231 ASN n 
1 232 GLU n 
1 233 ILE n 
1 234 TYR n 
1 235 LEU n 
1 236 ASN n 
1 237 PHE n 
1 238 GLU n 
1 239 SER n 
1 240 SER n 
1 241 THR n 
1 242 PRO n 
1 243 CYS n 
1 244 LEU n 
1 245 ALA n 
1 246 ASP n 
1 247 LYS n 
1 248 HIS n 
1 249 PHE n 
1 250 ASN n 
1 251 TYR n 
1 252 THR n 
1 253 SER n 
1 254 LEU n 
1 255 ILE n 
1 256 ALA n 
1 257 PHE n 
1 258 HIS n 
1 259 CYS n 
1 260 LYS n 
1 261 ARG n 
1 262 GLY n 
1 263 VAL n 
1 264 SER n 
1 265 MET n 
1 266 GLY n 
1 267 THR n 
1 268 PRO n 
1 269 LYS n 
1 270 LEU n 
1 271 LEU n 
1 272 ARG n 
1 273 THR n 
1 274 SER n 
1 275 GLU n 
1 276 CYS n 
1 277 ASP n 
1 278 PHE n 
1 279 VAL n 
1 280 PHE n 
1 281 GLU n 
1 282 TRP n 
1 283 GLU n 
1 284 THR n 
1 285 PRO n 
1 286 VAL n 
1 287 VAL n 
1 288 CYS n 
1 289 PRO n 
1 290 ASP n 
1 291 GLU n 
1 292 VAL n 
1 293 ARG n 
1 294 MET n 
1 295 ASP n 
1 296 GLY n 
1 297 CYS n 
1 298 THR n 
1 299 LEU n 
1 300 THR n 
1 301 ASP n 
1 302 GLU n 
1 303 GLN n 
1 304 LEU n 
1 305 LEU n 
1 306 TYR n 
1 307 SER n 
1 308 PHE n 
1 309 ASN n 
1 310 LEU n 
1 311 SER n 
1 312 SER n 
1 313 LEU n 
1 314 SER n 
1 315 THR n 
1 316 SER n 
1 317 THR n 
1 318 PHE n 
1 319 LYS n 
1 320 VAL n 
1 321 THR n 
1 322 ARG n 
1 323 ASP n 
1 324 SER n 
1 325 ARG n 
1 326 THR n 
1 327 TYR n 
1 328 SER n 
1 329 VAL n 
1 330 GLY n 
1 331 VAL n 
1 332 CYS n 
1 333 THR n 
1 334 PHE n 
1 335 ALA n 
1 336 VAL n 
1 337 GLY n 
1 338 PRO n 
1 339 GLU n 
1 340 GLN n 
1 341 GLY n 
1 342 GLY n 
1 343 CYS n 
1 344 LYS n 
1 345 ASP n 
1 346 GLY n 
1 347 GLY n 
1 348 VAL n 
1 349 CYS n 
1 350 LEU n 
1 351 LEU n 
1 352 SER n 
1 353 GLY n 
1 354 THR n 
1 355 LYS n 
1 356 GLY n 
1 357 ALA n 
1 358 SER n 
1 359 PHE n 
1 360 GLY n 
1 361 ARG n 
1 362 LEU n 
1 363 GLN n 
1 364 SER n 
1 365 MET n 
1 366 LYS n 
1 367 LEU n 
1 368 ASP n 
1 369 TYR n 
1 370 ARG n 
1 371 HIS n 
1 372 GLN n 
1 373 ASP n 
1 374 GLU n 
1 375 ALA n 
1 376 VAL n 
1 377 VAL n 
1 378 LEU n 
1 379 SER n 
1 380 TYR n 
1 381 VAL n 
1 382 ASN n 
1 383 GLY n 
1 384 ASP n 
1 385 ARG n 
1 386 CYS n 
1 387 PRO n 
1 388 PRO n 
1 389 GLU n 
1 390 THR n 
1 391 ASP n 
1 392 ASP n 
1 393 GLY n 
1 394 VAL n 
1 395 PRO n 
1 396 CYS n 
1 397 VAL n 
1 398 PHE n 
1 399 PRO n 
1 400 PHE n 
1 401 ILE n 
1 402 PHE n 
1 403 ASN n 
1 404 GLY n 
1 405 LYS n 
1 406 SER n 
1 407 TYR n 
1 408 GLU n 
1 409 GLU n 
1 410 CYS n 
1 411 ILE n 
1 412 ILE n 
1 413 GLU n 
1 414 SER n 
1 415 ARG n 
1 416 ALA n 
1 417 LYS n 
1 418 LEU n 
1 419 TRP n 
1 420 CYS n 
1 421 SER n 
1 422 THR n 
1 423 THR n 
1 424 ALA n 
1 425 ASP n 
1 426 TYR n 
1 427 ASP n 
1 428 ARG n 
1 429 ASP n 
1 430 HIS n 
1 431 GLU n 
1 432 TRP n 
1 433 GLY n 
1 434 PHE n 
1 435 CYS n 
1 436 ARG n 
1 437 HIS n 
1 438 SER n 
1 439 ASN n 
1 440 SER n 
1 441 TYR n 
1 442 ARG n 
1 443 THR n 
1 444 SER n 
1 445 SER n 
1 446 ILE n 
1 447 ILE n 
1 448 PHE n 
1 449 LYS n 
1 450 CYS n 
1 451 ASP n 
1 452 GLU n 
1 453 ASP n 
1 454 GLU n 
1 455 ASP n 
1 456 ILE n 
1 457 GLY n 
1 458 ARG n 
1 459 PRO n 
1 460 GLN n 
1 461 VAL n 
1 462 PHE n 
1 463 SER n 
1 464 GLU n 
1 465 VAL n 
1 466 ARG n 
1 467 GLY n 
1 468 CYS n 
1 469 ASP n 
1 470 VAL n 
1 471 THR n 
1 472 PHE n 
1 473 GLU n 
1 474 TRP n 
1 475 LYS n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 VAL n 
1 480 CYS n 
1 481 PRO n 
1 482 PRO n 
1 483 LYS n 
1 484 LYS n 
1 485 LEU n 
1 486 LYS n 
1 487 HIS n 
1 488 HIS n 
1 489 HIS n 
1 490 HIS n 
1 491 HIS n 
1 492 HIS n 
2 1   ALA n 
2 2   TYR n 
2 3   ARG n 
2 4   PRO n 
2 5   SER n 
2 6   GLU n 
2 7   THR n 
2 8   LEU n 
2 9   CYS n 
2 10  GLY n 
2 11  GLY n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ASP n 
2 16  THR n 
2 17  LEU n 
2 18  GLN n 
2 19  PHE n 
2 20  VAL n 
2 21  CYS n 
2 22  GLY n 
2 23  ASP n 
2 24  ARG n 
2 25  GLY n 
2 26  PHE n 
2 27  TYR n 
2 28  PHE n 
2 29  SER n 
2 30  ARG n 
2 31  PRO n 
2 32  ALA n 
2 33  SER n 
2 34  ARG n 
2 35  VAL n 
2 36  SER n 
2 37  ARG n 
2 38  ARG n 
2 39  SER n 
2 40  ARG n 
2 41  GLY n 
2 42  ILE n 
2 43  VAL n 
2 44  GLU n 
2 45  GLU n 
2 46  CYS n 
2 47  CYS n 
2 48  PHE n 
2 49  ARG n 
2 50  SER n 
2 51  CYS n 
2 52  ASP n 
2 53  LEU n 
2 54  ALA n 
2 55  LEU n 
2 56  LEU n 
2 57  GLU n 
2 58  THR n 
2 59  TYR n 
2 60  CYS n 
2 61  ALA n 
2 62  THR n 
2 63  PRO n 
2 64  ALA n 
2 65  LYS n 
2 66  SER n 
2 67  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? 95661 PLACENTA ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? ? ? ? ?     
'LECR 3.2.8.1' CHO ? ? ? ? ? ? ? ? ? PEE14      ? ? 
2 1 sample ? ? ? Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ?     ?        ? ? ? ? 'Escherichia coli'   562   ? ? ? ? ? ? JM101 
?              ?   ? ? ? ? ? ? ? ? ? PGEM-TEASY ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MPRI_HUMAN 1 ? ? P11717 ? 
2 PDB 2V5P       1 ? ? 2V5P   ? 
3 UNP IGF2_HUMAN 2 ? ? P01344 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2V5P A 1   ? 485 ? P11717 1508 ? 1992 ? 1508 1992 
2 2 2V5P A 486 ? 492 ? 2V5P   1993 ? 1999 ? 1993 1999 
3 1 2V5P B 1   ? 485 ? P11717 1508 ? 1992 ? 1508 1992 
4 2 2V5P B 486 ? 492 ? 2V5P   1993 ? 1999 ? 1993 1999 
5 3 2V5P C 1   ? 67  ? P01344 25   ? 91   ? 1    67   
6 3 2V5P D 1   ? 67  ? P01344 25   ? 91   ? 1    67   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2V5P ALA A 196 ? UNP P11717 GLY 1703 conflict 1703 1 
3 2V5P ALA B 196 ? UNP P11717 GLY 1703 conflict 1703 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2V5P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M TRIS-HCL PH 9.0, 15% (V/V) MPD' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2003-09-13 
_diffrn_detector.details                'TOROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2V5P 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            4.10 
_reflns.number_obs                   14662 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.29 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             4.10 
_reflns_shell.d_res_low              4.20 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.55 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.50 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2V5P 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13919 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.51 
_refine.ls_d_res_high                            4.10 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.293 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.291 
_refine.ls_R_factor_R_free                       0.327 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  741 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.791 
_refine.correlation_coeff_Fo_to_Fc_free          0.746 
_refine.B_iso_mean                               90.39 
_refine.aniso_B[1][1]                            0.24000 
_refine.aniso_B[2][2]                            -0.44000 
_refine.aniso_B[3][3]                            0.31000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.09000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2V5O' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  1.035 
_refine.overall_SU_ML                            1.024 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             175.868 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7880 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         109 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7989 
_refine_hist.d_res_high                       4.10 
_refine_hist.d_res_low                        47.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 8215  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.906  1.981  ? 11186 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.586  5.000  ? 1018  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.250 23.678 ? 348   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.843 15.000 ? 1278  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.537 15.000 ? 52    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.060  0.200  ? 1240  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 6300  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.174  0.200  ? 3047  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.300  0.200  ? 5424  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.105  0.200  ? 182   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.176  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.115  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       4.10 
_refine_ls_shell.d_res_low                        4.21 
_refine_ls_shell.number_reflns_R_work             1030 
_refine_ls_shell.R_factor_R_work                  0.3470 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3880 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.956580 0.030120 0.289920 -0.041000 0.998660 0.031520  -0.288580 0.042040 0.956530 -12.63700 -51.03441 16.99037 
2 given ? 0.947850 0.060430 0.312930 -0.047750 0.997700 -0.048040 -0.315120 0.030590 0.948560 -12.73361 -48.40027 18.56183 
# 
_struct.entry_id                  2V5P 
_struct.title                     'COMPLEX STRUCTURE OF HUMAN IGF2R DOMAINS 11-13 BOUND TO IGF-II' 
_struct.pdbx_descriptor           'CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR, INSULIN-LIKE GROWTH FACTOR II' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2V5P 
_struct_keywords.pdbx_keywords   RECEPTOR/GLYCOPROTEIN 
_struct_keywords.text            
;RECEPTOR/GLYCOPROTEIN, CATION INDEPENDENT MANNOSE 6-PHOSPHATE, MEMBRANE, RECEPTOR, LYSOSOME, TRANSPORT, BETA BARREL, PHOSPHORYLATION, FIBRONECTIN TYPE II, INSULIN-LIKE GROWTH FACTOR, RECEPTOR-GLYCOPROTEIN COMPLEX, POLYMORPHISM, GLYCOPROTEIN, TRANSMEMBRANE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23  ? SER A 26  ? SER A 1530 SER A 1533 5 ? 4  
HELX_P HELX_P2  2  PRO A 136 ? CYS A 139 ? PRO A 1643 CYS A 1646 5 ? 4  
HELX_P HELX_P3  3  SER A 157 ? LEU A 159 ? SER A 1664 LEU A 1666 5 ? 3  
HELX_P HELX_P4  4  PRO A 285 ? CYS A 288 ? PRO A 1792 CYS A 1795 5 ? 4  
HELX_P HELX_P5  5  SER A 312 ? THR A 315 ? SER A 1819 THR A 1822 5 ? 4  
HELX_P HELX_P6  6  ASP A 425 ? HIS A 430 ? ASP A 1932 HIS A 1937 1 ? 6  
HELX_P HELX_P7  7  VAL A 478 ? CYS A 480 ? VAL A 1985 CYS A 1987 5 ? 3  
HELX_P HELX_P8  8  SER B 23  ? SER B 26  ? SER B 1530 SER B 1533 5 ? 4  
HELX_P HELX_P9  9  PRO B 136 ? CYS B 139 ? PRO B 1643 CYS B 1646 5 ? 4  
HELX_P HELX_P10 10 SER B 157 ? LEU B 159 ? SER B 1664 LEU B 1666 5 ? 3  
HELX_P HELX_P11 11 PRO B 285 ? CYS B 288 ? PRO B 1792 CYS B 1795 5 ? 4  
HELX_P HELX_P12 12 SER B 312 ? THR B 315 ? SER B 1819 THR B 1822 5 ? 4  
HELX_P HELX_P13 13 ASP B 425 ? HIS B 430 ? ASP B 1932 HIS B 1937 1 ? 6  
HELX_P HELX_P14 14 VAL B 478 ? CYS B 480 ? VAL B 1985 CYS B 1987 5 ? 3  
HELX_P HELX_P15 15 GLY C 10  ? CYS C 21  ? GLY C 10   CYS C 21   1 ? 12 
HELX_P HELX_P16 16 GLY C 41  ? CYS C 47  ? GLY C 41   CYS C 47   1 ? 7  
HELX_P HELX_P17 17 ASP C 52  ? THR C 58  ? ASP C 52   THR C 58   1 ? 7  
HELX_P HELX_P18 18 GLY D 10  ? CYS D 21  ? GLY D 10   CYS D 21   1 ? 12 
HELX_P HELX_P19 19 GLY D 41  ? CYS D 47  ? GLY D 41   CYS D 47   1 ? 7  
HELX_P HELX_P20 20 LEU D 53  ? THR D 58  ? LEU D 53   THR D 58   1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 9   SG  ? ? ? 1_555 A CYS 46  SG ? ? A CYS 1516 A CYS 1553 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf2  disulf ?    ? A CYS 52  SG  ? ? ? 1_555 A CYS 59  SG ? ? A CYS 1559 A CYS 1566 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3  disulf ?    ? A CYS 91  SG  ? ? ? 1_555 A CYS 127 SG ? ? A CYS 1598 A CYS 1634 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf4  disulf ?    ? A CYS 107 SG  ? ? ? 1_555 A CYS 139 SG ? ? A CYS 1614 A CYS 1646 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf5  disulf ?    ? A CYS 145 SG  ? ? ? 1_555 A CYS 188 SG ? ? A CYS 1652 A CYS 1695 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf6  disulf ?    ? A CYS 199 SG  ? ? ? 1_555 A CYS 206 SG ? ? A CYS 1706 A CYS 1713 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf7  disulf ?    ? A CYS 243 SG  ? ? ? 1_555 A CYS 276 SG ? ? A CYS 1750 A CYS 1783 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf8  disulf ?    ? A CYS 259 SG  ? ? ? 1_555 A CYS 288 SG ? ? A CYS 1766 A CYS 1795 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf9  disulf ?    ? A CYS 297 SG  ? ? ? 1_555 A CYS 332 SG ? ? A CYS 1804 A CYS 1839 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf10 disulf ?    ? A CYS 343 SG  ? ? ? 1_555 A CYS 349 SG ? ? A CYS 1850 A CYS 1856 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf11 disulf ?    ? A CYS 386 SG  ? ? ? 1_555 A CYS 468 SG ? ? A CYS 1893 A CYS 1975 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf12 disulf ?    ? A CYS 396 SG  ? ? ? 1_555 A CYS 420 SG ? ? A CYS 1903 A CYS 1927 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf13 disulf ?    ? A CYS 410 SG  ? ? ? 1_555 A CYS 435 SG ? ? A CYS 1917 A CYS 1942 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf14 disulf ?    ? A CYS 450 SG  ? ? ? 1_555 A CYS 480 SG ? ? A CYS 1957 A CYS 1987 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf15 disulf ?    ? B CYS 9   SG  ? ? ? 1_555 B CYS 46  SG ? ? B CYS 1516 B CYS 1553 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf16 disulf ?    ? B CYS 52  SG  ? ? ? 1_555 B CYS 59  SG ? ? B CYS 1559 B CYS 1566 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf17 disulf ?    ? B CYS 91  SG  ? ? ? 1_555 B CYS 127 SG ? ? B CYS 1598 B CYS 1634 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf18 disulf ?    ? B CYS 107 SG  ? ? ? 1_555 B CYS 139 SG ? ? B CYS 1614 B CYS 1646 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf19 disulf ?    ? B CYS 145 SG  ? ? ? 1_555 B CYS 188 SG ? ? B CYS 1652 B CYS 1695 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf20 disulf ?    ? B CYS 199 SG  ? ? ? 1_555 B CYS 206 SG ? ? B CYS 1706 B CYS 1713 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf21 disulf ?    ? B CYS 243 SG  ? ? ? 1_555 B CYS 276 SG ? ? B CYS 1750 B CYS 1783 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf22 disulf ?    ? B CYS 259 SG  ? ? ? 1_555 B CYS 288 SG ? ? B CYS 1766 B CYS 1795 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf23 disulf ?    ? B CYS 297 SG  ? ? ? 1_555 B CYS 332 SG ? ? B CYS 1804 B CYS 1839 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf24 disulf ?    ? B CYS 343 SG  ? ? ? 1_555 B CYS 349 SG ? ? B CYS 1850 B CYS 1856 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf25 disulf ?    ? B CYS 386 SG  ? ? ? 1_555 B CYS 468 SG ? ? B CYS 1893 B CYS 1975 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf26 disulf ?    ? B CYS 396 SG  ? ? ? 1_555 B CYS 420 SG ? ? B CYS 1903 B CYS 1927 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf27 disulf ?    ? B CYS 410 SG  ? ? ? 1_555 B CYS 435 SG ? ? B CYS 1917 B CYS 1942 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf28 disulf ?    ? B CYS 450 SG  ? ? ? 1_555 B CYS 480 SG ? ? B CYS 1957 B CYS 1987 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf29 disulf ?    ? C CYS 9   SG  ? ? ? 1_555 C CYS 47  SG ? ? C CYS 9    C CYS 47   1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf30 disulf ?    ? C CYS 21  SG  ? ? ? 1_555 C CYS 60  SG ? ? C CYS 21   C CYS 60   1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf31 disulf ?    ? C CYS 46  SG  ? ? ? 1_555 C CYS 51  SG ? ? C CYS 46   C CYS 51   1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf32 disulf ?    ? D CYS 9   SG  ? ? ? 1_555 D CYS 47  SG ? ? D CYS 9    D CYS 47   1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf33 disulf ?    ? D CYS 21  SG  ? ? ? 1_555 D CYS 60  SG ? ? D CYS 21   D CYS 60   1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf34 disulf ?    ? D CYS 46  SG  ? ? ? 1_555 D CYS 51  SG ? ? D CYS 46   D CYS 51   1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale1  covale one  ? A ASN 149 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 1656 A NAG 2991 1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale2  covale one  ? A ASN 250 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 1757 A NAG 2992 1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale3  covale one  ? A ASN 309 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 1816 E NAG 1    1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale4  covale one  ? B ASN 149 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 1656 B NAG 2991 1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale5  covale one  ? B ASN 250 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 1757 B NAG 2992 1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale6  covale one  ? B ASN 309 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 1816 B NAG 2993 1_555 ? ? ? ? ? ? ? 1.445 ? 
N-Glycosylation 
covale7  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale8  covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2    E BMA 3    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 398 A . ? PHE 1905 A PRO 399 A ? PRO 1906 A 1 -6.03 
2 PHE 398 B . ? PHE 1905 B PRO 399 B ? PRO 1906 B 1 -2.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 4 ? 
AC ? 5 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 5 ? 
AG ? 2 ? 
AH ? 4 ? 
AI ? 5 ? 
AJ ? 3 ? 
AK ? 2 ? 
BA ? 2 ? 
BB ? 4 ? 
BC ? 5 ? 
BD ? 2 ? 
BE ? 4 ? 
BF ? 5 ? 
BG ? 2 ? 
BH ? 4 ? 
BI ? 5 ? 
BJ ? 3 ? 
BK ? 2 ? 
CA ? 2 ? 
DA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? parallel      
AI 4 5 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? parallel      
BC 4 5 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? parallel      
BF 4 5 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? parallel      
BI 4 5 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 10  ? THR A 12  ? GLN A 1517 THR A 1519 
AA 2 LEU A 19  ? ASP A 21  ? LEU A 1526 ASP A 1528 
AB 1 PHE A 31  ? TYR A 35  ? PHE A 1538 TYR A 1542 
AB 2 GLY A 39  ? MET A 43  ? GLY A 1546 MET A 1550 
AB 3 VAL A 56  ? PHE A 60  ? VAL A 1563 PHE A 1567 
AB 4 ILE A 65  ? LYS A 69  ? ILE A 1572 LYS A 1576 
AC 1 LEU A 74  ? VAL A 77  ? LEU A 1581 VAL A 1584 
AC 2 VAL A 80  ? TYR A 85  ? VAL A 1587 TYR A 1592 
AC 3 LYS A 100 ? CYS A 107 ? LYS A 1607 CYS A 1614 
AC 4 THR A 128 ? THR A 135 ? THR A 1635 THR A 1642 
AC 5 PRO A 117 ? ASP A 123 ? PRO A 1624 ASP A 1630 
AD 1 SER A 146 ? ASN A 149 ? SER A 1653 ASN A 1656 
AD 2 SER A 152 ? ASP A 155 ? SER A 1659 ASP A 1662 
AE 1 TYR A 166 ? ALA A 168 ? TYR A 1673 ALA A 1675 
AE 2 PHE A 183 ? ILE A 185 ? PHE A 1690 ILE A 1692 
AE 3 VAL A 205 ? LYS A 207 ? VAL A 1712 LYS A 1714 
AE 4 ILE A 215 ? GLY A 218 ? ILE A 1722 GLY A 1725 
AF 1 ILE A 225 ? ASN A 227 ? ILE A 1732 ASN A 1734 
AF 2 GLU A 232 ? PHE A 237 ? GLU A 1739 PHE A 1744 
AF 3 SER A 253 ? CYS A 259 ? SER A 1760 CYS A 1766 
AF 4 PHE A 278 ? THR A 284 ? PHE A 1785 THR A 1791 
AF 5 PRO A 268 ? ARG A 272 ? PRO A 1775 ARG A 1779 
AG 1 CYS A 297 ? ASP A 301 ? CYS A 1804 ASP A 1808 
AG 2 TYR A 306 ? LEU A 310 ? TYR A 1813 LEU A 1817 
AH 1 THR A 317 ? ARG A 322 ? THR A 1824 ARG A 1829 
AH 2 ARG A 325 ? GLY A 330 ? ARG A 1832 GLY A 1837 
AH 3 VAL A 348 ? LEU A 351 ? VAL A 1855 LEU A 1858 
AH 4 GLY A 356 ? SER A 358 ? GLY A 1863 SER A 1865 
AI 1 ARG A 361 ? ARG A 370 ? ARG A 1868 ARG A 1877 
AI 2 ALA A 375 ? VAL A 381 ? ALA A 1882 VAL A 1888 
AI 3 THR A 443 ? CYS A 450 ? THR A 1950 CYS A 1957 
AI 4 ASP A 469 ? THR A 476 ? ASP A 1976 THR A 1983 
AI 5 GLN A 460 ? VAL A 465 ? GLN A 1967 VAL A 1972 
AJ 1 GLU A 389 ? ASP A 391 ? GLU A 1896 ASP A 1898 
AJ 2 TRP A 432 ? ARG A 436 ? TRP A 1939 ARG A 1943 
AJ 3 LEU A 418 ? THR A 422 ? LEU A 1925 THR A 1929 
AK 1 PHE A 400 ? PHE A 402 ? PHE A 1907 PHE A 1909 
AK 2 LYS A 405 ? TYR A 407 ? LYS A 1912 TYR A 1914 
BA 1 GLN B 10  ? THR B 12  ? GLN B 1517 THR B 1519 
BA 2 LEU B 19  ? ASP B 21  ? LEU B 1526 ASP B 1528 
BB 1 PHE B 31  ? TYR B 35  ? PHE B 1538 TYR B 1542 
BB 2 GLY B 39  ? MET B 43  ? GLY B 1546 MET B 1550 
BB 3 VAL B 56  ? PHE B 60  ? VAL B 1563 PHE B 1567 
BB 4 ILE B 65  ? LYS B 69  ? ILE B 1572 LYS B 1576 
BC 1 LEU B 74  ? VAL B 77  ? LEU B 1581 VAL B 1584 
BC 2 VAL B 80  ? TYR B 85  ? VAL B 1587 TYR B 1592 
BC 3 LYS B 100 ? CYS B 107 ? LYS B 1607 CYS B 1614 
BC 4 THR B 128 ? THR B 135 ? THR B 1635 THR B 1642 
BC 5 PRO B 117 ? ASP B 123 ? PRO B 1624 ASP B 1630 
BD 1 SER B 146 ? ASN B 149 ? SER B 1653 ASN B 1656 
BD 2 SER B 152 ? ASP B 155 ? SER B 1659 ASP B 1662 
BE 1 TYR B 166 ? ALA B 168 ? TYR B 1673 ALA B 1675 
BE 2 PHE B 183 ? ILE B 185 ? PHE B 1690 ILE B 1692 
BE 3 VAL B 205 ? LYS B 207 ? VAL B 1712 LYS B 1714 
BE 4 ILE B 215 ? GLY B 218 ? ILE B 1722 GLY B 1725 
BF 1 ILE B 225 ? ASN B 227 ? ILE B 1732 ASN B 1734 
BF 2 GLU B 232 ? PHE B 237 ? GLU B 1739 PHE B 1744 
BF 3 SER B 253 ? CYS B 259 ? SER B 1760 CYS B 1766 
BF 4 PHE B 278 ? THR B 284 ? PHE B 1785 THR B 1791 
BF 5 PRO B 268 ? ARG B 272 ? PRO B 1775 ARG B 1779 
BG 1 CYS B 297 ? ASP B 301 ? CYS B 1804 ASP B 1808 
BG 2 TYR B 306 ? LEU B 310 ? TYR B 1813 LEU B 1817 
BH 1 THR B 317 ? ARG B 322 ? THR B 1824 ARG B 1829 
BH 2 ARG B 325 ? GLY B 330 ? ARG B 1832 GLY B 1837 
BH 3 VAL B 348 ? LEU B 351 ? VAL B 1855 LEU B 1858 
BH 4 GLY B 356 ? SER B 358 ? GLY B 1863 SER B 1865 
BI 1 ARG B 361 ? ARG B 370 ? ARG B 1868 ARG B 1877 
BI 2 ALA B 375 ? VAL B 381 ? ALA B 1882 VAL B 1888 
BI 3 THR B 443 ? CYS B 450 ? THR B 1950 CYS B 1957 
BI 4 ASP B 469 ? THR B 476 ? ASP B 1976 THR B 1983 
BI 5 GLN B 460 ? VAL B 465 ? GLN B 1967 VAL B 1972 
BJ 1 GLU B 389 ? ASP B 391 ? GLU B 1896 ASP B 1898 
BJ 2 TRP B 432 ? ARG B 436 ? TRP B 1939 ARG B 1943 
BJ 3 LEU B 418 ? THR B 422 ? LEU B 1925 THR B 1929 
BK 1 PHE B 400 ? PHE B 402 ? PHE B 1907 PHE B 1909 
BK 2 LYS B 405 ? TYR B 407 ? LYS B 1912 TYR B 1914 
CA 1 GLY C 25  ? TYR C 27  ? GLY C 25   TYR C 27   
CA 2 CYS C 60  ? ALA C 61  ? CYS C 60   ALA C 61   
DA 1 GLY D 25  ? TYR D 27  ? GLY D 25   TYR D 27   
DA 2 CYS D 60  ? ALA D 61  ? CYS D 60   ALA D 61   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 11  ? N VAL A 1518 O PHE A 20  ? O PHE A 1527 
AB 1 2 N TYR A 35  ? N TYR A 1542 O GLY A 39  ? O GLY A 1546 
AB 2 3 N TYR A 42  ? N TYR A 1549 O CYS A 59  ? O CYS A 1566 
AB 3 4 O ALA A 58  ? O ALA A 1565 N VAL A 67  ? N VAL A 1574 
AC 1 2 N VAL A 77  ? N VAL A 1584 O VAL A 80  ? O VAL A 1587 
AC 2 3 N LEU A 83  ? N LEU A 1590 O ILE A 103 ? O ILE A 1610 
AC 3 4 N VAL A 102 ? N VAL A 1609 O LEU A 129 ? O LEU A 1636 
AC 4 5 N SER A 132 ? N SER A 1639 O MET A 118 ? O MET A 1625 
AD 1 2 N ASN A 149 ? N ASN A 1656 O SER A 152 ? O SER A 1659 
AE 1 2 N ALA A 168 ? N ALA A 1675 O PHE A 183 ? O PHE A 1690 
AE 2 3 N TYR A 184 ? N TYR A 1691 O CYS A 206 ? O CYS A 1713 
AE 3 4 N LYS A 207 ? N LYS A 1714 O ILE A 215 ? O ILE A 1722 
AF 1 2 N ILE A 225 ? N ILE A 1732 O TYR A 234 ? O TYR A 1741 
AF 2 3 N PHE A 237 ? N PHE A 1744 O SER A 253 ? O SER A 1760 
AF 3 4 N LEU A 254 ? N LEU A 1761 O PHE A 278 ? O PHE A 1785 
AF 4 5 N GLU A 281 ? N GLU A 1788 O LYS A 269 ? O LYS A 1776 
AG 1 2 N LEU A 299 ? N LEU A 1806 O PHE A 308 ? O PHE A 1815 
AH 1 2 N ARG A 322 ? N ARG A 1829 O ARG A 325 ? O ARG A 1832 
AH 2 3 N SER A 328 ? N SER A 1835 O CYS A 349 ? O CYS A 1856 
AH 3 4 N LEU A 350 ? N LEU A 1857 O ALA A 357 ? O ALA A 1864 
AI 1 2 N ARG A 370 ? N ARG A 1877 O ALA A 375 ? O ALA A 1882 
AI 2 3 N TYR A 380 ? N TYR A 1887 O SER A 444 ? O SER A 1951 
AI 3 4 N SER A 445 ? N SER A 1952 O VAL A 470 ? O VAL A 1977 
AI 4 5 N GLU A 473 ? N GLU A 1980 O GLN A 460 ? O GLN A 1967 
AJ 1 2 N GLU A 389 ? N GLU A 1896 O ARG A 436 ? O ARG A 1943 
AJ 2 3 N GLY A 433 ? N GLY A 1940 O CYS A 420 ? O CYS A 1927 
AK 1 2 N PHE A 402 ? N PHE A 1909 O LYS A 405 ? O LYS A 1912 
BA 1 2 N VAL B 11  ? N VAL B 1518 O PHE B 20  ? O PHE B 1527 
BB 1 2 N TYR B 35  ? N TYR B 1542 O GLY B 39  ? O GLY B 1546 
BB 2 3 N TYR B 42  ? N TYR B 1549 O CYS B 59  ? O CYS B 1566 
BB 3 4 O ALA B 58  ? O ALA B 1565 N VAL B 67  ? N VAL B 1574 
BC 1 2 N VAL B 77  ? N VAL B 1584 O VAL B 80  ? O VAL B 1587 
BC 2 3 N LEU B 83  ? N LEU B 1590 O ILE B 103 ? O ILE B 1610 
BC 3 4 N VAL B 102 ? N VAL B 1609 O LEU B 129 ? O LEU B 1636 
BC 4 5 N SER B 132 ? N SER B 1639 O MET B 118 ? O MET B 1625 
BD 1 2 N ASN B 149 ? N ASN B 1656 O SER B 152 ? O SER B 1659 
BE 1 2 N ALA B 168 ? N ALA B 1675 O PHE B 183 ? O PHE B 1690 
BE 2 3 N TYR B 184 ? N TYR B 1691 O CYS B 206 ? O CYS B 1713 
BE 3 4 N LYS B 207 ? N LYS B 1714 O ILE B 215 ? O ILE B 1722 
BF 1 2 N ILE B 225 ? N ILE B 1732 O TYR B 234 ? O TYR B 1741 
BF 2 3 N PHE B 237 ? N PHE B 1744 O SER B 253 ? O SER B 1760 
BF 3 4 N LEU B 254 ? N LEU B 1761 O PHE B 278 ? O PHE B 1785 
BF 4 5 N GLU B 281 ? N GLU B 1788 O LYS B 269 ? O LYS B 1776 
BG 1 2 N LEU B 299 ? N LEU B 1806 O PHE B 308 ? O PHE B 1815 
BH 1 2 N ARG B 322 ? N ARG B 1829 O ARG B 325 ? O ARG B 1832 
BH 2 3 N SER B 328 ? N SER B 1835 O CYS B 349 ? O CYS B 1856 
BH 3 4 N LEU B 350 ? N LEU B 1857 O ALA B 357 ? O ALA B 1864 
BI 1 2 N ARG B 370 ? N ARG B 1877 O ALA B 375 ? O ALA B 1882 
BI 2 3 N TYR B 380 ? N TYR B 1887 O SER B 444 ? O SER B 1951 
BI 3 4 N SER B 445 ? N SER B 1952 O VAL B 470 ? O VAL B 1977 
BI 4 5 N GLU B 473 ? N GLU B 1980 O GLN B 460 ? O GLN B 1967 
BJ 1 2 N GLU B 389 ? N GLU B 1896 O ARG B 436 ? O ARG B 1943 
BJ 2 3 N GLY B 433 ? N GLY B 1940 O CYS B 420 ? O CYS B 1927 
BK 1 2 N PHE B 402 ? N PHE B 1909 O LYS B 405 ? O LYS B 1912 
CA 1 2 O GLY C 25  ? O GLY C 25   N ALA C 61  ? N ALA C 61   
DA 1 2 O GLY D 25  ? O GLY D 25   N ALA D 61  ? N ALA D 61   
# 
_database_PDB_matrix.entry_id          2V5P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2V5P 
_atom_sites.fract_transf_matrix[1][1]   0.006025 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003974 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008524 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010268 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 9   ? 30.022  -27.247 18.492 1.00 99.62  ? 1516 CYS A N   1 
ATOM   2    C CA  . CYS A 1 9   ? 30.998  -26.547 19.379 1.00 99.41  ? 1516 CYS A CA  1 
ATOM   3    C C   . CYS A 1 9   ? 32.318  -26.300 18.641 1.00 99.54  ? 1516 CYS A C   1 
ATOM   4    O O   . CYS A 1 9   ? 33.358  -26.054 19.260 1.00 99.40  ? 1516 CYS A O   1 
ATOM   5    C CB  . CYS A 1 9   ? 31.226  -27.360 20.660 1.00 99.15  ? 1516 CYS A CB  1 
ATOM   6    S SG  . CYS A 1 9   ? 31.614  -26.384 22.139 1.00 98.87  ? 1516 CYS A SG  1 
ATOM   7    N N   . GLN A 1 10  ? 32.254  -26.359 17.312 1.00 112.23 ? 1517 GLN A N   1 
ATOM   8    C CA  . GLN A 1 10  ? 33.421  -26.174 16.452 1.00 112.42 ? 1517 GLN A CA  1 
ATOM   9    C C   . GLN A 1 10  ? 33.024  -25.537 15.121 1.00 112.73 ? 1517 GLN A C   1 
ATOM   10   O O   . GLN A 1 10  ? 32.113  -26.015 14.441 1.00 112.93 ? 1517 GLN A O   1 
ATOM   11   C CB  . GLN A 1 10  ? 34.142  -27.509 16.223 1.00 112.50 ? 1517 GLN A CB  1 
ATOM   12   C CG  . GLN A 1 10  ? 33.227  -28.673 15.839 1.00 112.60 ? 1517 GLN A CG  1 
ATOM   13   C CD  . GLN A 1 10  ? 33.969  -29.987 15.690 1.00 112.69 ? 1517 GLN A CD  1 
ATOM   14   O OE1 . GLN A 1 10  ? 34.749  -30.379 16.559 1.00 112.51 ? 1517 GLN A OE1 1 
ATOM   15   N NE2 . GLN A 1 10  ? 33.720  -30.682 14.586 1.00 112.98 ? 1517 GLN A NE2 1 
ATOM   16   N N   . VAL A 1 11  ? 33.705  -24.450 14.764 1.00 112.89 ? 1518 VAL A N   1 
ATOM   17   C CA  . VAL A 1 11  ? 33.440  -23.746 13.508 1.00 113.20 ? 1518 VAL A CA  1 
ATOM   18   C C   . VAL A 1 11  ? 34.740  -23.454 12.746 1.00 113.40 ? 1518 VAL A C   1 
ATOM   19   O O   . VAL A 1 11  ? 35.785  -23.200 13.352 1.00 113.24 ? 1518 VAL A O   1 
ATOM   20   C CB  . VAL A 1 11  ? 32.586  -22.456 13.734 1.00 113.15 ? 1518 VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 11  ? 33.400  -21.352 14.403 1.00 112.97 ? 1518 VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 11  ? 31.970  -21.965 12.425 1.00 113.50 ? 1518 VAL A CG2 1 
ATOM   23   N N   . THR A 1 12  ? 34.664  -23.511 11.417 1.00 124.04 ? 1519 THR A N   1 
ATOM   24   C CA  . THR A 1 12  ? 35.815  -23.246 10.555 1.00 124.29 ? 1519 THR A CA  1 
ATOM   25   C C   . THR A 1 12  ? 35.541  -22.106 9.580  1.00 124.55 ? 1519 THR A C   1 
ATOM   26   O O   . THR A 1 12  ? 34.436  -21.984 9.045  1.00 124.70 ? 1519 THR A O   1 
ATOM   27   C CB  . THR A 1 12  ? 36.234  -24.497 9.746  1.00 124.57 ? 1519 THR A CB  1 
ATOM   28   O OG1 . THR A 1 12  ? 35.109  -24.998 9.013  1.00 124.80 ? 1519 THR A OG1 1 
ATOM   29   C CG2 . THR A 1 12  ? 36.770  -25.588 10.666 1.00 124.34 ? 1519 THR A CG2 1 
ATOM   30   N N   . ASN A 1 13  ? 36.557  -21.275 9.362  1.00 123.93 ? 1520 ASN A N   1 
ATOM   31   C CA  . ASN A 1 13  ? 36.504  -20.223 8.356  1.00 124.22 ? 1520 ASN A CA  1 
ATOM   32   C C   . ASN A 1 13  ? 36.666  -20.843 6.966  1.00 124.67 ? 1520 ASN A C   1 
ATOM   33   O O   . ASN A 1 13  ? 37.699  -21.449 6.682  1.00 124.79 ? 1520 ASN A O   1 
ATOM   34   C CB  . ASN A 1 13  ? 37.597  -19.182 8.625  1.00 124.15 ? 1520 ASN A CB  1 
ATOM   35   C CG  . ASN A 1 13  ? 37.509  -17.971 7.704  1.00 124.40 ? 1520 ASN A CG  1 
ATOM   36   O OD1 . ASN A 1 13  ? 36.456  -17.669 7.139  1.00 124.57 ? 1520 ASN A OD1 1 
ATOM   37   N ND2 . ASN A 1 13  ? 38.623  -17.264 7.561  1.00 124.43 ? 1520 ASN A ND2 1 
ATOM   38   N N   . PRO A 1 14  ? 35.637  -20.708 6.102  1.00 137.85 ? 1521 PRO A N   1 
ATOM   39   C CA  . PRO A 1 14  ? 35.645  -21.307 4.759  1.00 138.31 ? 1521 PRO A CA  1 
ATOM   40   C C   . PRO A 1 14  ? 36.835  -20.903 3.882  1.00 138.63 ? 1521 PRO A C   1 
ATOM   41   O O   . PRO A 1 14  ? 37.210  -21.651 2.977  1.00 138.98 ? 1521 PRO A O   1 
ATOM   42   C CB  . PRO A 1 14  ? 34.339  -20.797 4.141  1.00 138.50 ? 1521 PRO A CB  1 
ATOM   43   C CG  . PRO A 1 14  ? 33.462  -20.507 5.303  1.00 138.10 ? 1521 PRO A CG  1 
ATOM   44   C CD  . PRO A 1 14  ? 34.380  -19.982 6.361  1.00 137.74 ? 1521 PRO A CD  1 
ATOM   45   N N   . SER A 1 15  ? 37.415  -19.735 4.154  1.00 141.18 ? 1522 SER A N   1 
ATOM   46   C CA  . SER A 1 15  ? 38.531  -19.213 3.364  1.00 141.47 ? 1522 SER A CA  1 
ATOM   47   C C   . SER A 1 15  ? 39.886  -19.796 3.775  1.00 141.40 ? 1522 SER A C   1 
ATOM   48   O O   . SER A 1 15  ? 40.705  -20.131 2.914  1.00 141.75 ? 1522 SER A O   1 
ATOM   49   C CB  . SER A 1 15  ? 38.572  -17.683 3.434  1.00 141.42 ? 1522 SER A CB  1 
ATOM   50   O OG  . SER A 1 15  ? 38.784  -17.237 4.762  1.00 140.96 ? 1522 SER A OG  1 
ATOM   51   N N   . THR A 1 16  ? 40.114  -19.915 5.083  1.00 138.46 ? 1523 THR A N   1 
ATOM   52   C CA  . THR A 1 16  ? 41.409  -20.358 5.615  1.00 138.36 ? 1523 THR A CA  1 
ATOM   53   C C   . THR A 1 16  ? 41.412  -21.799 6.130  1.00 138.22 ? 1523 THR A C   1 
ATOM   54   O O   . THR A 1 16  ? 42.457  -22.452 6.147  1.00 138.30 ? 1523 THR A O   1 
ATOM   55   C CB  . THR A 1 16  ? 41.920  -19.425 6.738  1.00 137.99 ? 1523 THR A CB  1 
ATOM   56   O OG1 . THR A 1 16  ? 40.917  -19.298 7.754  1.00 137.60 ? 1523 THR A OG1 1 
ATOM   57   C CG2 . THR A 1 16  ? 42.260  -18.047 6.184  1.00 138.16 ? 1523 THR A CG2 1 
ATOM   58   N N   . GLY A 1 17  ? 40.247  -22.286 6.551  1.00 139.99 ? 1524 GLY A N   1 
ATOM   59   C CA  . GLY A 1 17  ? 40.122  -23.633 7.108  1.00 139.84 ? 1524 GLY A CA  1 
ATOM   60   C C   . GLY A 1 17  ? 40.646  -23.717 8.528  1.00 139.42 ? 1524 GLY A C   1 
ATOM   61   O O   . GLY A 1 17  ? 41.036  -24.790 8.993  1.00 139.33 ? 1524 GLY A O   1 
ATOM   62   N N   . HIS A 1 18  ? 40.645  -22.576 9.213  1.00 124.24 ? 1525 HIS A N   1 
ATOM   63   C CA  . HIS A 1 18  ? 41.160  -22.462 10.574 1.00 123.86 ? 1525 HIS A CA  1 
ATOM   64   C C   . HIS A 1 18  ? 40.216  -23.114 11.581 1.00 123.54 ? 1525 HIS A C   1 
ATOM   65   O O   . HIS A 1 18  ? 39.021  -22.808 11.614 1.00 123.46 ? 1525 HIS A O   1 
ATOM   66   C CB  . HIS A 1 18  ? 41.386  -20.988 10.928 1.00 123.74 ? 1525 HIS A CB  1 
ATOM   67   C CG  . HIS A 1 18  ? 42.017  -20.773 12.269 1.00 123.39 ? 1525 HIS A CG  1 
ATOM   68   N ND1 . HIS A 1 18  ? 43.382  -20.733 12.452 1.00 123.43 ? 1525 HIS A ND1 1 
ATOM   69   C CD2 . HIS A 1 18  ? 41.468  -20.576 13.491 1.00 123.03 ? 1525 HIS A CD2 1 
ATOM   70   C CE1 . HIS A 1 18  ? 43.647  -20.526 13.730 1.00 123.10 ? 1525 HIS A CE1 1 
ATOM   71   N NE2 . HIS A 1 18  ? 42.503  -20.427 14.381 1.00 122.85 ? 1525 HIS A NE2 1 
ATOM   72   N N   . LEU A 1 19  ? 40.764  -24.012 12.397 1.00 120.26 ? 1526 LEU A N   1 
ATOM   73   C CA  . LEU A 1 19  ? 39.989  -24.708 13.421 1.00 119.96 ? 1526 LEU A CA  1 
ATOM   74   C C   . LEU A 1 19  ? 39.816  -23.839 14.663 1.00 119.61 ? 1526 LEU A C   1 
ATOM   75   O O   . LEU A 1 19  ? 40.790  -23.312 15.208 1.00 119.52 ? 1526 LEU A O   1 
ATOM   76   C CB  . LEU A 1 19  ? 40.650  -26.046 13.785 1.00 119.93 ? 1526 LEU A CB  1 
ATOM   77   C CG  . LEU A 1 19  ? 39.874  -27.052 14.647 1.00 119.68 ? 1526 LEU A CG  1 
ATOM   78   C CD1 . LEU A 1 19  ? 40.226  -28.479 14.251 1.00 119.84 ? 1526 LEU A CD1 1 
ATOM   79   C CD2 . LEU A 1 19  ? 40.102  -26.837 16.142 1.00 119.33 ? 1526 LEU A CD2 1 
ATOM   80   N N   . PHE A 1 20  ? 38.567  -23.695 15.097 1.00 112.21 ? 1527 PHE A N   1 
ATOM   81   C CA  . PHE A 1 20  ? 38.246  -22.996 16.336 1.00 111.88 ? 1527 PHE A CA  1 
ATOM   82   C C   . PHE A 1 20  ? 37.721  -23.977 17.381 1.00 111.64 ? 1527 PHE A C   1 
ATOM   83   O O   . PHE A 1 20  ? 36.764  -24.715 17.129 1.00 111.69 ? 1527 PHE A O   1 
ATOM   84   C CB  . PHE A 1 20  ? 37.220  -21.884 16.091 1.00 111.89 ? 1527 PHE A CB  1 
ATOM   85   C CG  . PHE A 1 20  ? 37.789  -20.666 15.418 1.00 112.03 ? 1527 PHE A CG  1 
ATOM   86   C CD1 . PHE A 1 20  ? 38.452  -19.691 16.159 1.00 111.86 ? 1527 PHE A CD1 1 
ATOM   87   C CD2 . PHE A 1 20  ? 37.649  -20.484 14.046 1.00 112.36 ? 1527 PHE A CD2 1 
ATOM   88   C CE1 . PHE A 1 20  ? 38.975  -18.558 15.543 1.00 111.99 ? 1527 PHE A CE1 1 
ATOM   89   C CE2 . PHE A 1 20  ? 38.168  -19.353 13.420 1.00 112.51 ? 1527 PHE A CE2 1 
ATOM   90   C CZ  . PHE A 1 20  ? 38.832  -18.388 14.171 1.00 112.32 ? 1527 PHE A CZ  1 
ATOM   91   N N   . ASP A 1 21  ? 38.358  -23.979 18.549 1.00 111.82 ? 1528 ASP A N   1 
ATOM   92   C CA  . ASP A 1 21  ? 37.973  -24.859 19.647 1.00 111.60 ? 1528 ASP A CA  1 
ATOM   93   C C   . ASP A 1 21  ? 37.544  -24.040 20.861 1.00 111.32 ? 1528 ASP A C   1 
ATOM   94   O O   . ASP A 1 21  ? 38.355  -23.329 21.460 1.00 111.22 ? 1528 ASP A O   1 
ATOM   95   C CB  . ASP A 1 21  ? 39.126  -25.805 20.007 1.00 111.59 ? 1528 ASP A CB  1 
ATOM   96   C CG  . ASP A 1 21  ? 38.742  -26.828 21.066 1.00 111.40 ? 1528 ASP A CG  1 
ATOM   97   O OD1 . ASP A 1 21  ? 37.637  -27.407 20.979 1.00 111.40 ? 1528 ASP A OD1 1 
ATOM   98   O OD2 . ASP A 1 21  ? 39.555  -27.060 21.985 1.00 111.26 ? 1528 ASP A OD2 1 
ATOM   99   N N   . LEU A 1 22  ? 36.263  -24.143 21.208 1.00 100.43 ? 1529 LEU A N   1 
ATOM   100  C CA  . LEU A 1 22  ? 35.702  -23.424 22.352 1.00 100.20 ? 1529 LEU A CA  1 
ATOM   101  C C   . LEU A 1 22  ? 35.286  -24.378 23.474 1.00 100.02 ? 1529 LEU A C   1 
ATOM   102  O O   . LEU A 1 22  ? 34.470  -24.028 24.332 1.00 99.88  ? 1529 LEU A O   1 
ATOM   103  C CB  . LEU A 1 22  ? 34.511  -22.563 21.911 1.00 100.26 ? 1529 LEU A CB  1 
ATOM   104  C CG  . LEU A 1 22  ? 34.771  -21.377 20.976 1.00 100.44 ? 1529 LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 22  ? 33.475  -20.933 20.320 1.00 100.56 ? 1529 LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 22  ? 35.428  -20.214 21.713 1.00 100.31 ? 1529 LEU A CD2 1 
ATOM   107  N N   . SER A 1 23  ? 35.871  -25.575 23.469 1.00 105.84 ? 1530 SER A N   1 
ATOM   108  C CA  . SER A 1 23  ? 35.522  -26.632 24.422 1.00 105.69 ? 1530 SER A CA  1 
ATOM   109  C C   . SER A 1 23  ? 36.124  -26.436 25.819 1.00 105.49 ? 1530 SER A C   1 
ATOM   110  O O   . SER A 1 23  ? 35.828  -27.202 26.739 1.00 105.37 ? 1530 SER A O   1 
ATOM   111  C CB  . SER A 1 23  ? 35.914  -28.003 23.861 1.00 105.82 ? 1530 SER A CB  1 
ATOM   112  O OG  . SER A 1 23  ? 37.308  -28.077 23.615 1.00 105.90 ? 1530 SER A OG  1 
ATOM   113  N N   . SER A 1 24  ? 36.960  -25.409 25.971 1.00 104.81 ? 1531 SER A N   1 
ATOM   114  C CA  . SER A 1 24  ? 37.555  -25.069 27.266 1.00 104.64 ? 1531 SER A CA  1 
ATOM   115  C C   . SER A 1 24  ? 36.606  -24.233 28.135 1.00 104.49 ? 1531 SER A C   1 
ATOM   116  O O   . SER A 1 24  ? 36.987  -23.756 29.208 1.00 104.37 ? 1531 SER A O   1 
ATOM   117  C CB  . SER A 1 24  ? 38.892  -24.345 27.069 1.00 104.69 ? 1531 SER A CB  1 
ATOM   118  O OG  . SER A 1 24  ? 38.722  -23.140 26.342 1.00 104.75 ? 1531 SER A OG  1 
ATOM   119  N N   . LEU A 1 25  ? 35.373  -24.065 27.661 1.00 93.79  ? 1532 LEU A N   1 
ATOM   120  C CA  . LEU A 1 25  ? 34.340  -23.316 28.377 1.00 93.69  ? 1532 LEU A CA  1 
ATOM   121  C C   . LEU A 1 25  ? 33.068  -24.153 28.552 1.00 93.69  ? 1532 LEU A C   1 
ATOM   122  O O   . LEU A 1 25  ? 32.034  -23.642 28.993 1.00 93.65  ? 1532 LEU A O   1 
ATOM   123  C CB  . LEU A 1 25  ? 34.014  -22.011 27.635 1.00 93.78  ? 1532 LEU A CB  1 
ATOM   124  C CG  . LEU A 1 25  ? 35.145  -21.053 27.239 1.00 93.84  ? 1532 LEU A CG  1 
ATOM   125  C CD1 . LEU A 1 25  ? 34.653  -20.040 26.215 1.00 93.97  ? 1532 LEU A CD1 1 
ATOM   126  C CD2 . LEU A 1 25  ? 35.744  -20.348 28.453 1.00 93.69  ? 1532 LEU A CD2 1 
ATOM   127  N N   . SER A 1 26  ? 33.158  -25.441 28.222 1.00 97.75  ? 1533 SER A N   1 
ATOM   128  C CA  . SER A 1 26  ? 32.000  -26.343 28.211 1.00 97.77  ? 1533 SER A CA  1 
ATOM   129  C C   . SER A 1 26  ? 31.547  -26.807 29.602 1.00 97.63  ? 1533 SER A C   1 
ATOM   130  O O   . SER A 1 26  ? 30.845  -27.816 29.727 1.00 97.64  ? 1533 SER A O   1 
ATOM   131  C CB  . SER A 1 26  ? 32.275  -27.552 27.307 1.00 97.88  ? 1533 SER A CB  1 
ATOM   132  O OG  . SER A 1 26  ? 33.359  -28.321 27.795 1.00 97.80  ? 1533 SER A OG  1 
ATOM   133  N N   . GLY A 1 27  ? 31.943  -26.067 30.637 1.00 95.28  ? 1534 GLY A N   1 
ATOM   134  C CA  . GLY A 1 27  ? 31.547  -26.368 32.011 1.00 95.16  ? 1534 GLY A CA  1 
ATOM   135  C C   . GLY A 1 27  ? 30.049  -26.239 32.204 1.00 95.19  ? 1534 GLY A C   1 
ATOM   136  O O   . GLY A 1 27  ? 29.463  -25.204 31.877 1.00 95.25  ? 1534 GLY A O   1 
ATOM   137  N N   . ARG A 1 28  ? 29.434  -27.299 32.727 1.00 93.58  ? 1535 ARG A N   1 
ATOM   138  C CA  . ARG A 1 28  ? 27.988  -27.339 32.954 1.00 93.63  ? 1535 ARG A CA  1 
ATOM   139  C C   . ARG A 1 28  ? 27.554  -26.362 34.048 1.00 93.58  ? 1535 ARG A C   1 
ATOM   140  O O   . ARG A 1 28  ? 26.434  -25.845 34.019 1.00 93.65  ? 1535 ARG A O   1 
ATOM   141  C CB  . ARG A 1 28  ? 27.533  -28.761 33.295 1.00 93.63  ? 1535 ARG A CB  1 
ATOM   142  C CG  . ARG A 1 28  ? 26.030  -28.959 33.203 1.00 93.72  ? 1535 ARG A CG  1 
ATOM   143  C CD  . ARG A 1 28  ? 25.605  -30.314 33.727 1.00 93.71  ? 1535 ARG A CD  1 
ATOM   144  N NE  . ARG A 1 28  ? 24.162  -30.360 33.952 1.00 93.80  ? 1535 ARG A NE  1 
ATOM   145  C CZ  . ARG A 1 28  ? 23.572  -30.118 35.120 1.00 93.78  ? 1535 ARG A CZ  1 
ATOM   146  N NH1 . ARG A 1 28  ? 24.295  -29.819 36.191 1.00 93.67  ? 1535 ARG A NH1 1 
ATOM   147  N NH2 . ARG A 1 28  ? 22.251  -30.181 35.218 1.00 93.89  ? 1535 ARG A NH2 1 
ATOM   148  N N   . ALA A 1 29  ? 28.450  -26.119 35.006 1.00 90.71  ? 1536 ALA A N   1 
ATOM   149  C CA  . ALA A 1 29  ? 28.250  -25.099 36.034 1.00 90.67  ? 1536 ALA A CA  1 
ATOM   150  C C   . ALA A 1 29  ? 28.125  -23.719 35.397 1.00 90.71  ? 1536 ALA A C   1 
ATOM   151  O O   . ALA A 1 29  ? 27.373  -22.868 35.876 1.00 90.75  ? 1536 ALA A O   1 
ATOM   152  C CB  . ALA A 1 29  ? 29.393  -25.124 37.037 1.00 90.57  ? 1536 ALA A CB  1 
ATOM   153  N N   . GLY A 1 30  ? 28.872  -23.512 34.315 1.00 85.32  ? 1537 GLY A N   1 
ATOM   154  C CA  . GLY A 1 30  ? 28.753  -22.315 33.496 1.00 85.39  ? 1537 GLY A CA  1 
ATOM   155  C C   . GLY A 1 30  ? 29.374  -21.069 34.088 1.00 85.33  ? 1537 GLY A C   1 
ATOM   156  O O   . GLY A 1 30  ? 30.261  -21.142 34.939 1.00 85.24  ? 1537 GLY A O   1 
ATOM   157  N N   . PHE A 1 31  ? 28.893  -19.920 33.620 1.00 78.69  ? 1538 PHE A N   1 
ATOM   158  C CA  . PHE A 1 31  ? 29.433  -18.618 33.996 1.00 78.66  ? 1538 PHE A CA  1 
ATOM   159  C C   . PHE A 1 31  ? 28.283  -17.637 34.210 1.00 78.73  ? 1538 PHE A C   1 
ATOM   160  O O   . PHE A 1 31  ? 27.166  -17.873 33.750 1.00 78.83  ? 1538 PHE A O   1 
ATOM   161  C CB  . PHE A 1 31  ? 30.388  -18.102 32.910 1.00 78.68  ? 1538 PHE A CB  1 
ATOM   162  C CG  . PHE A 1 31  ? 31.235  -19.180 32.281 1.00 78.68  ? 1538 PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 31  ? 30.855  -19.766 31.076 1.00 78.79  ? 1538 PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 31  ? 32.401  -19.620 32.899 1.00 78.59  ? 1538 PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 31  ? 31.627  -20.767 30.492 1.00 78.81  ? 1538 PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 31  ? 33.180  -20.621 32.322 1.00 78.62  ? 1538 PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 31  ? 32.791  -21.195 31.116 1.00 78.72  ? 1538 PHE A CZ  1 
ATOM   168  N N   . THR A 1 32  ? 28.557  -16.539 34.908 1.00 72.20  ? 1539 THR A N   1 
ATOM   169  C CA  . THR A 1 32  ? 27.511  -15.576 35.248 1.00 72.27  ? 1539 THR A CA  1 
ATOM   170  C C   . THR A 1 32  ? 27.703  -14.224 34.560 1.00 72.33  ? 1539 THR A C   1 
ATOM   171  O O   . THR A 1 32  ? 28.590  -13.449 34.923 1.00 72.26  ? 1539 THR A O   1 
ATOM   172  C CB  . THR A 1 32  ? 27.381  -15.383 36.782 1.00 72.23  ? 1539 THR A CB  1 
ATOM   173  O OG1 . THR A 1 32  ? 28.668  -15.106 37.347 1.00 72.13  ? 1539 THR A OG1 1 
ATOM   174  C CG2 . THR A 1 32  ? 26.805  -16.632 37.437 1.00 72.22  ? 1539 THR A CG2 1 
ATOM   175  N N   . ALA A 1 33  ? 26.866  -13.956 33.561 1.00 69.58  ? 1540 ALA A N   1 
ATOM   176  C CA  . ALA A 1 33  ? 26.858  -12.666 32.874 1.00 69.66  ? 1540 ALA A CA  1 
ATOM   177  C C   . ALA A 1 33  ? 26.178  -11.613 33.739 1.00 69.71  ? 1540 ALA A C   1 
ATOM   178  O O   . ALA A 1 33  ? 25.237  -11.917 34.474 1.00 69.75  ? 1540 ALA A O   1 
ATOM   179  C CB  . ALA A 1 33  ? 26.163  -12.778 31.532 1.00 69.82  ? 1540 ALA A CB  1 
ATOM   180  N N   . ALA A 1 34  ? 26.652  -10.375 33.632 1.00 63.95  ? 1541 ALA A N   1 
ATOM   181  C CA  . ALA A 1 34  ? 26.224  -9.307  34.529 1.00 63.98  ? 1541 ALA A CA  1 
ATOM   182  C C   . ALA A 1 34  ? 25.316  -8.271  33.869 1.00 64.15  ? 1541 ALA A C   1 
ATOM   183  O O   . ALA A 1 34  ? 25.651  -7.715  32.821 1.00 64.20  ? 1541 ALA A O   1 
ATOM   184  C CB  . ALA A 1 34  ? 27.435  -8.632  35.139 1.00 63.88  ? 1541 ALA A CB  1 
ATOM   185  N N   . TYR A 1 35  ? 24.167  -8.024  34.498 1.00 61.17  ? 1542 TYR A N   1 
ATOM   186  C CA  . TYR A 1 35  ? 23.267  -6.934  34.112 1.00 61.35  ? 1542 TYR A CA  1 
ATOM   187  C C   . TYR A 1 35  ? 22.833  -6.129  35.338 1.00 61.39  ? 1542 TYR A C   1 
ATOM   188  O O   . TYR A 1 35  ? 22.982  -6.592  36.472 1.00 61.32  ? 1542 TYR A O   1 
ATOM   189  C CB  . TYR A 1 35  ? 22.051  -7.459  33.331 1.00 61.52  ? 1542 TYR A CB  1 
ATOM   190  C CG  . TYR A 1 35  ? 20.998  -8.175  34.155 1.00 61.59  ? 1542 TYR A CG  1 
ATOM   191  C CD1 . TYR A 1 35  ? 19.918  -7.479  34.700 1.00 61.76  ? 1542 TYR A CD1 1 
ATOM   192  C CD2 . TYR A 1 35  ? 21.068  -9.549  34.370 1.00 61.51  ? 1542 TYR A CD2 1 
ATOM   193  C CE1 . TYR A 1 35  ? 18.943  -8.132  35.453 1.00 61.85  ? 1542 TYR A CE1 1 
ATOM   194  C CE2 . TYR A 1 35  ? 20.095  -10.214 35.114 1.00 61.59  ? 1542 TYR A CE2 1 
ATOM   195  C CZ  . TYR A 1 35  ? 19.038  -9.500  35.655 1.00 61.76  ? 1542 TYR A CZ  1 
ATOM   196  O OH  . TYR A 1 35  ? 18.079  -10.153 36.397 1.00 61.86  ? 1542 TYR A OH  1 
ATOM   197  N N   . SER A 1 36  ? 22.299  -4.929  35.099 1.00 57.27  ? 1543 SER A N   1 
ATOM   198  C CA  . SER A 1 36  ? 21.819  -4.022  36.157 1.00 57.36  ? 1543 SER A CA  1 
ATOM   199  C C   . SER A 1 36  ? 22.843  -3.801  37.283 1.00 57.21  ? 1543 SER A C   1 
ATOM   200  O O   . SER A 1 36  ? 24.028  -3.599  37.010 1.00 57.08  ? 1543 SER A O   1 
ATOM   201  C CB  . SER A 1 36  ? 20.463  -4.486  36.712 1.00 57.52  ? 1543 SER A CB  1 
ATOM   202  O OG  . SER A 1 36  ? 20.593  -5.667  37.486 1.00 57.41  ? 1543 SER A OG  1 
ATOM   203  N N   . GLU A 1 37  ? 22.384  -3.842  38.535 1.00 54.72  ? 1544 GLU A N   1 
ATOM   204  C CA  . GLU A 1 37  ? 23.261  -3.657  39.692 1.00 54.61  ? 1544 GLU A CA  1 
ATOM   205  C C   . GLU A 1 37  ? 23.593  -4.984  40.374 1.00 54.50  ? 1544 GLU A C   1 
ATOM   206  O O   . GLU A 1 37  ? 24.758  -5.264  40.660 1.00 54.35  ? 1544 GLU A O   1 
ATOM   207  C CB  . GLU A 1 37  ? 22.641  -2.686  40.700 1.00 54.77  ? 1544 GLU A CB  1 
ATOM   208  C CG  . GLU A 1 37  ? 23.640  -1.719  41.351 1.00 54.71  ? 1544 GLU A CG  1 
ATOM   209  C CD  . GLU A 1 37  ? 24.626  -2.391  42.303 1.00 54.56  ? 1544 GLU A CD  1 
ATOM   210  O OE1 . GLU A 1 37  ? 24.236  -3.336  43.021 1.00 54.59  ? 1544 GLU A OE1 1 
ATOM   211  O OE2 . GLU A 1 37  ? 25.797  -1.958  42.340 1.00 54.45  ? 1544 GLU A OE2 1 
ATOM   212  N N   . LYS A 1 38  ? 22.567  -5.788  40.644 1.00 55.51  ? 1545 LYS A N   1 
ATOM   213  C CA  . LYS A 1 38  ? 22.757  -7.110  41.244 1.00 55.43  ? 1545 LYS A CA  1 
ATOM   214  C C   . LYS A 1 38  ? 22.141  -8.211  40.387 1.00 55.44  ? 1545 LYS A C   1 
ATOM   215  O O   . LYS A 1 38  ? 21.853  -9.306  40.879 1.00 55.44  ? 1545 LYS A O   1 
ATOM   216  C CB  . LYS A 1 38  ? 22.183  -7.158  42.662 1.00 55.54  ? 1545 LYS A CB  1 
ATOM   217  C CG  . LYS A 1 38  ? 23.014  -6.421  43.704 1.00 55.50  ? 1545 LYS A CG  1 
ATOM   218  C CD  . LYS A 1 38  ? 22.870  -7.040  45.093 1.00 55.56  ? 1545 LYS A CD  1 
ATOM   219  C CE  . LYS A 1 38  ? 21.484  -6.822  45.688 1.00 55.80  ? 1545 LYS A CE  1 
ATOM   220  N NZ  . LYS A 1 38  ? 21.413  -7.280  47.102 1.00 55.88  ? 1545 LYS A NZ  1 
ATOM   221  N N   . GLY A 1 39  ? 21.948  -7.912  39.105 1.00 57.49  ? 1546 GLY A N   1 
ATOM   222  C CA  . GLY A 1 39  ? 21.358  -8.857  38.165 1.00 57.54  ? 1546 GLY A CA  1 
ATOM   223  C C   . GLY A 1 39  ? 22.289  -10.000 37.815 1.00 57.37  ? 1546 GLY A C   1 
ATOM   224  O O   . GLY A 1 39  ? 23.498  -9.806  37.664 1.00 57.23  ? 1546 GLY A O   1 
ATOM   225  N N   . LEU A 1 40  ? 21.717  -11.195 37.688 1.00 63.20  ? 1547 LEU A N   1 
ATOM   226  C CA  . LEU A 1 40  ? 22.486  -12.402 37.405 1.00 63.06  ? 1547 LEU A CA  1 
ATOM   227  C C   . LEU A 1 40  ? 21.900  -13.196 36.243 1.00 63.13  ? 1547 LEU A C   1 
ATOM   228  O O   . LEU A 1 40  ? 20.778  -13.703 36.330 1.00 63.26  ? 1547 LEU A O   1 
ATOM   229  C CB  . LEU A 1 40  ? 22.568  -13.289 38.654 1.00 63.00  ? 1547 LEU A CB  1 
ATOM   230  C CG  . LEU A 1 40  ? 23.288  -12.740 39.890 1.00 62.95  ? 1547 LEU A CG  1 
ATOM   231  C CD1 . LEU A 1 40  ? 22.843  -13.479 41.143 1.00 62.98  ? 1547 LEU A CD1 1 
ATOM   232  C CD2 . LEU A 1 40  ? 24.805  -12.801 39.726 1.00 62.78  ? 1547 LEU A CD2 1 
ATOM   233  N N   . VAL A 1 41  ? 22.660  -13.288 35.154 1.00 67.93  ? 1548 VAL A N   1 
ATOM   234  C CA  . VAL A 1 41  ? 22.327  -14.185 34.054 1.00 67.99  ? 1548 VAL A CA  1 
ATOM   235  C C   . VAL A 1 41  ? 23.203  -15.428 34.175 1.00 67.85  ? 1548 VAL A C   1 
ATOM   236  O O   . VAL A 1 41  ? 24.363  -15.423 33.754 1.00 67.75  ? 1548 VAL A O   1 
ATOM   237  C CB  . VAL A 1 41  ? 22.534  -13.531 32.660 1.00 68.07  ? 1548 VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 41  ? 22.070  -14.472 31.550 1.00 68.18  ? 1548 VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 41  ? 21.796  -12.213 32.561 1.00 68.21  ? 1548 VAL A CG2 1 
ATOM   240  N N   . TYR A 1 42  ? 22.652  -16.481 34.775 1.00 74.51  ? 1549 TYR A N   1 
ATOM   241  C CA  . TYR A 1 42  ? 23.350  -17.760 34.861 1.00 74.39  ? 1549 TYR A CA  1 
ATOM   242  C C   . TYR A 1 42  ? 23.361  -18.377 33.464 1.00 74.45  ? 1549 TYR A C   1 
ATOM   243  O O   . TYR A 1 42  ? 22.306  -18.708 32.923 1.00 74.59  ? 1549 TYR A O   1 
ATOM   244  C CB  . TYR A 1 42  ? 22.669  -18.711 35.855 1.00 74.40  ? 1549 TYR A CB  1 
ATOM   245  C CG  . TYR A 1 42  ? 22.134  -18.078 37.128 1.00 74.44  ? 1549 TYR A CG  1 
ATOM   246  C CD1 . TYR A 1 42  ? 22.993  -17.530 38.082 1.00 74.33  ? 1549 TYR A CD1 1 
ATOM   247  C CD2 . TYR A 1 42  ? 20.763  -18.057 37.388 1.00 74.60  ? 1549 TYR A CD2 1 
ATOM   248  C CE1 . TYR A 1 42  ? 22.496  -16.957 39.254 1.00 74.39  ? 1549 TYR A CE1 1 
ATOM   249  C CE2 . TYR A 1 42  ? 20.258  -17.490 38.556 1.00 74.66  ? 1549 TYR A CE2 1 
ATOM   250  C CZ  . TYR A 1 42  ? 21.127  -16.942 39.483 1.00 74.56  ? 1549 TYR A CZ  1 
ATOM   251  O OH  . TYR A 1 42  ? 20.624  -16.382 40.635 1.00 74.65  ? 1549 TYR A OH  1 
ATOM   252  N N   . MET A 1 43  ? 24.547  -18.512 32.875 1.00 77.80  ? 1550 MET A N   1 
ATOM   253  C CA  . MET A 1 43  ? 24.659  -18.991 31.495 1.00 77.89  ? 1550 MET A CA  1 
ATOM   254  C C   . MET A 1 43  ? 25.780  -20.007 31.263 1.00 77.79  ? 1550 MET A C   1 
ATOM   255  O O   . MET A 1 43  ? 26.715  -20.110 32.055 1.00 77.65  ? 1550 MET A O   1 
ATOM   256  C CB  . MET A 1 43  ? 24.780  -17.817 30.513 1.00 77.99  ? 1550 MET A CB  1 
ATOM   257  C CG  . MET A 1 43  ? 25.990  -16.915 30.717 1.00 77.89  ? 1550 MET A CG  1 
ATOM   258  S SD  . MET A 1 43  ? 26.155  -15.687 29.405 1.00 78.03  ? 1550 MET A SD  1 
ATOM   259  C CE  . MET A 1 43  ? 26.816  -16.683 28.072 1.00 78.09  ? 1550 MET A CE  1 
ATOM   260  N N   . SER A 1 44  ? 25.666  -20.752 30.166 1.00 83.89  ? 1551 SER A N   1 
ATOM   261  C CA  . SER A 1 44  ? 26.678  -21.725 29.765 1.00 83.84  ? 1551 SER A CA  1 
ATOM   262  C C   . SER A 1 44  ? 26.939  -21.659 28.261 1.00 83.98  ? 1551 SER A C   1 
ATOM   263  O O   . SER A 1 44  ? 26.200  -21.003 27.523 1.00 84.13  ? 1551 SER A O   1 
ATOM   264  C CB  . SER A 1 44  ? 26.253  -23.138 30.169 1.00 83.81  ? 1551 SER A CB  1 
ATOM   265  O OG  . SER A 1 44  ? 26.291  -23.303 31.574 1.00 83.68  ? 1551 SER A OG  1 
ATOM   266  N N   . ILE A 1 45  ? 27.999  -22.335 27.819 1.00 85.03  ? 1552 ILE A N   1 
ATOM   267  C CA  . ILE A 1 45  ? 28.366  -22.393 26.403 1.00 85.19  ? 1552 ILE A CA  1 
ATOM   268  C C   . ILE A 1 45  ? 28.354  -23.843 25.919 1.00 85.25  ? 1552 ILE A C   1 
ATOM   269  O O   . ILE A 1 45  ? 28.829  -24.740 26.622 1.00 85.14  ? 1552 ILE A O   1 
ATOM   270  C CB  . ILE A 1 45  ? 29.768  -21.761 26.141 1.00 85.16  ? 1552 ILE A CB  1 
ATOM   271  C CG1 . ILE A 1 45  ? 29.908  -20.388 26.822 1.00 85.07  ? 1552 ILE A CG1 1 
ATOM   272  C CG2 . ILE A 1 45  ? 30.070  -21.677 24.638 1.00 85.36  ? 1552 ILE A CG2 1 
ATOM   273  C CD1 . ILE A 1 45  ? 28.958  -19.300 26.315 1.00 85.18  ? 1552 ILE A CD1 1 
ATOM   274  N N   . CYS A 1 46  ? 27.799  -24.057 24.724 1.00 88.43  ? 1553 CYS A N   1 
ATOM   275  C CA  . CYS A 1 46  ? 27.703  -25.383 24.081 1.00 88.55  ? 1553 CYS A CA  1 
ATOM   276  C C   . CYS A 1 46  ? 26.830  -26.394 24.833 1.00 88.47  ? 1553 CYS A C   1 
ATOM   277  O O   . CYS A 1 46  ? 26.359  -27.371 24.243 1.00 88.59  ? 1553 CYS A O   1 
ATOM   278  C CB  . CYS A 1 46  ? 29.093  -25.976 23.793 1.00 88.54  ? 1553 CYS A CB  1 
ATOM   279  S SG  . CYS A 1 46  ? 29.970  -25.213 22.403 1.00 88.73  ? 1553 CYS A SG  1 
ATOM   280  N N   . GLY A 1 47  ? 26.621  -26.157 26.126 1.00 88.53  ? 1554 GLY A N   1 
ATOM   281  C CA  . GLY A 1 47  ? 25.806  -27.034 26.961 1.00 88.47  ? 1554 GLY A CA  1 
ATOM   282  C C   . GLY A 1 47  ? 24.799  -26.271 27.800 1.00 88.43  ? 1554 GLY A C   1 
ATOM   283  O O   . GLY A 1 47  ? 24.827  -25.038 27.856 1.00 88.43  ? 1554 GLY A O   1 
ATOM   284  N N   . GLU A 1 48  ? 23.902  -27.013 28.445 1.00 84.76  ? 1555 GLU A N   1 
ATOM   285  C CA  . GLU A 1 48  ? 22.889  -26.433 29.327 1.00 84.75  ? 1555 GLU A CA  1 
ATOM   286  C C   . GLU A 1 48  ? 23.494  -25.974 30.651 1.00 84.57  ? 1555 GLU A C   1 
ATOM   287  O O   . GLU A 1 48  ? 24.423  -26.597 31.171 1.00 84.44  ? 1555 GLU A O   1 
ATOM   288  C CB  . GLU A 1 48  ? 21.754  -27.435 29.587 1.00 84.83  ? 1555 GLU A CB  1 
ATOM   289  C CG  . GLU A 1 48  ? 22.201  -28.763 30.204 1.00 84.71  ? 1555 GLU A CG  1 
ATOM   290  C CD  . GLU A 1 48  ? 21.078  -29.495 30.915 1.00 84.74  ? 1555 GLU A CD  1 
ATOM   291  O OE1 . GLU A 1 48  ? 20.103  -29.900 30.246 1.00 84.91  ? 1555 GLU A OE1 1 
ATOM   292  O OE2 . GLU A 1 48  ? 21.180  -29.675 32.147 1.00 84.62  ? 1555 GLU A OE2 1 
ATOM   293  N N   . ASN A 1 49  ? 22.965  -24.880 31.187 1.00 83.82  ? 1556 ASN A N   1 
ATOM   294  C CA  . ASN A 1 49  ? 23.360  -24.410 32.510 1.00 83.68  ? 1556 ASN A CA  1 
ATOM   295  C C   . ASN A 1 49  ? 22.715  -25.267 33.600 1.00 83.66  ? 1556 ASN A C   1 
ATOM   296  O O   . ASN A 1 49  ? 21.703  -25.932 33.356 1.00 83.77  ? 1556 ASN A O   1 
ATOM   297  C CB  . ASN A 1 49  ? 22.995  -22.934 32.688 1.00 83.72  ? 1556 ASN A CB  1 
ATOM   298  C CG  . ASN A 1 49  ? 23.738  -22.283 33.839 1.00 83.58  ? 1556 ASN A CG  1 
ATOM   299  O OD1 . ASN A 1 49  ? 24.966  -22.192 33.833 1.00 83.47  ? 1556 ASN A OD1 1 
ATOM   300  N ND2 . ASN A 1 49  ? 22.993  -21.820 34.831 1.00 83.60  ? 1556 ASN A ND2 1 
ATOM   301  N N   . GLU A 1 50  ? 23.306  -25.255 34.794 1.00 86.95  ? 1557 GLU A N   1 
ATOM   302  C CA  . GLU A 1 50  ? 22.797  -26.045 35.920 1.00 86.94  ? 1557 GLU A CA  1 
ATOM   303  C C   . GLU A 1 50  ? 21.774  -25.298 36.781 1.00 87.02  ? 1557 GLU A C   1 
ATOM   304  O O   . GLU A 1 50  ? 20.864  -25.910 37.346 1.00 87.10  ? 1557 GLU A O   1 
ATOM   305  C CB  . GLU A 1 50  ? 23.945  -26.587 36.782 1.00 86.79  ? 1557 GLU A CB  1 
ATOM   306  C CG  . GLU A 1 50  ? 24.797  -25.531 37.481 1.00 86.71  ? 1557 GLU A CG  1 
ATOM   307  C CD  . GLU A 1 50  ? 25.805  -26.129 38.450 1.00 86.60  ? 1557 GLU A CD  1 
ATOM   308  O OE1 . GLU A 1 50  ? 25.901  -27.373 38.537 1.00 86.58  ? 1557 GLU A OE1 1 
ATOM   309  O OE2 . GLU A 1 50  ? 26.506  -25.348 39.127 1.00 86.55  ? 1557 GLU A OE2 1 
ATOM   310  N N   . ASN A 1 51  ? 21.935  -23.979 36.878 1.00 83.09  ? 1558 ASN A N   1 
ATOM   311  C CA  . ASN A 1 51  ? 21.000  -23.131 37.615 1.00 83.19  ? 1558 ASN A CA  1 
ATOM   312  C C   . ASN A 1 51  ? 19.679  -22.996 36.865 1.00 83.38  ? 1558 ASN A C   1 
ATOM   313  O O   . ASN A 1 51  ? 18.611  -22.919 37.475 1.00 83.50  ? 1558 ASN A O   1 
ATOM   314  C CB  . ASN A 1 51  ? 21.609  -21.749 37.868 1.00 83.15  ? 1558 ASN A CB  1 
ATOM   315  C CG  . ASN A 1 51  ? 23.004  -21.822 38.465 1.00 82.98  ? 1558 ASN A CG  1 
ATOM   316  O OD1 . ASN A 1 51  ? 23.214  -22.434 39.513 1.00 82.94  ? 1558 ASN A OD1 1 
ATOM   317  N ND2 . ASN A 1 51  ? 23.964  -21.192 37.800 1.00 82.91  ? 1558 ASN A ND2 1 
ATOM   318  N N   . CYS A 1 52  ? 19.772  -22.973 35.538 1.00 81.89  ? 1559 CYS A N   1 
ATOM   319  C CA  . CYS A 1 52  ? 18.610  -22.898 34.661 1.00 82.09  ? 1559 CYS A CA  1 
ATOM   320  C C   . CYS A 1 52  ? 17.958  -24.273 34.515 1.00 82.15  ? 1559 CYS A C   1 
ATOM   321  O O   . CYS A 1 52  ? 18.603  -25.289 34.786 1.00 82.03  ? 1559 CYS A O   1 
ATOM   322  C CB  . CYS A 1 52  ? 19.030  -22.371 33.287 1.00 82.13  ? 1559 CYS A CB  1 
ATOM   323  S SG  . CYS A 1 52  ? 19.963  -20.825 33.323 1.00 82.05  ? 1559 CYS A SG  1 
ATOM   324  N N   . PRO A 1 53  ? 16.674  -24.313 34.096 1.00 86.66  ? 1560 PRO A N   1 
ATOM   325  C CA  . PRO A 1 53  ? 15.994  -25.585 33.828 1.00 86.74  ? 1560 PRO A CA  1 
ATOM   326  C C   . PRO A 1 53  ? 16.699  -26.405 32.741 1.00 86.69  ? 1560 PRO A C   1 
ATOM   327  O O   . PRO A 1 53  ? 17.397  -25.830 31.904 1.00 86.67  ? 1560 PRO A O   1 
ATOM   328  C CB  . PRO A 1 53  ? 14.608  -25.143 33.341 1.00 87.01  ? 1560 PRO A CB  1 
ATOM   329  C CG  . PRO A 1 53  ? 14.419  -23.786 33.910 1.00 87.04  ? 1560 PRO A CG  1 
ATOM   330  C CD  . PRO A 1 53  ? 15.777  -23.164 33.870 1.00 86.84  ? 1560 PRO A CD  1 
ATOM   331  N N   . PRO A 1 54  ? 16.531  -27.744 32.760 1.00 91.02  ? 1561 PRO A N   1 
ATOM   332  C CA  . PRO A 1 54  ? 17.150  -28.617 31.756 1.00 90.99  ? 1561 PRO A CA  1 
ATOM   333  C C   . PRO A 1 54  ? 16.902  -28.143 30.324 1.00 91.16  ? 1561 PRO A C   1 
ATOM   334  O O   . PRO A 1 54  ? 15.779  -27.764 29.980 1.00 91.36  ? 1561 PRO A O   1 
ATOM   335  C CB  . PRO A 1 54  ? 16.467  -29.965 31.998 1.00 91.05  ? 1561 PRO A CB  1 
ATOM   336  C CG  . PRO A 1 54  ? 16.114  -29.943 33.437 1.00 91.00  ? 1561 PRO A CG  1 
ATOM   337  C CD  . PRO A 1 54  ? 15.752  -28.518 33.747 1.00 91.05  ? 1561 PRO A CD  1 
ATOM   338  N N   . GLY A 1 55  ? 17.954  -28.151 29.510 1.00 89.96  ? 1562 GLY A N   1 
ATOM   339  C CA  . GLY A 1 55  ? 17.872  -27.693 28.124 1.00 90.13  ? 1562 GLY A CA  1 
ATOM   340  C C   . GLY A 1 55  ? 18.177  -26.215 27.957 1.00 90.13  ? 1562 GLY A C   1 
ATOM   341  O O   . GLY A 1 55  ? 18.672  -25.792 26.910 1.00 90.19  ? 1562 GLY A O   1 
ATOM   342  N N   . VAL A 1 56  ? 17.878  -25.433 28.992 1.00 84.41  ? 1563 VAL A N   1 
ATOM   343  C CA  . VAL A 1 56  ? 18.099  -23.988 28.975 1.00 84.41  ? 1563 VAL A CA  1 
ATOM   344  C C   . VAL A 1 56  ? 19.566  -23.655 29.251 1.00 84.19  ? 1563 VAL A C   1 
ATOM   345  O O   . VAL A 1 56  ? 20.121  -24.044 30.283 1.00 84.02  ? 1563 VAL A O   1 
ATOM   346  C CB  . VAL A 1 56  ? 17.179  -23.263 29.992 1.00 84.44  ? 1563 VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 56  ? 17.481  -21.776 30.035 1.00 84.45  ? 1563 VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 56  ? 15.712  -23.503 29.655 1.00 84.68  ? 1563 VAL A CG2 1 
ATOM   349  N N   . GLY A 1 57  ? 20.183  -22.937 28.317 1.00 84.22  ? 1564 GLY A N   1 
ATOM   350  C CA  . GLY A 1 57  ? 21.576  -22.525 28.443 1.00 84.05  ? 1564 GLY A CA  1 
ATOM   351  C C   . GLY A 1 57  ? 21.759  -21.261 29.262 1.00 83.96  ? 1564 GLY A C   1 
ATOM   352  O O   . GLY A 1 57  ? 22.785  -21.092 29.920 1.00 83.79  ? 1564 GLY A O   1 
ATOM   353  N N   . ALA A 1 58  ? 20.762  -20.376 29.219 1.00 77.34  ? 1565 ALA A N   1 
ATOM   354  C CA  . ALA A 1 58  ? 20.820  -19.090 29.919 1.00 77.29  ? 1565 ALA A CA  1 
ATOM   355  C C   . ALA A 1 58  ? 19.450  -18.658 30.448 1.00 77.43  ? 1565 ALA A C   1 
ATOM   356  O O   . ALA A 1 58  ? 18.443  -18.789 29.748 1.00 77.63  ? 1565 ALA A O   1 
ATOM   357  C CB  . ALA A 1 58  ? 21.400  -18.020 29.006 1.00 77.33  ? 1565 ALA A CB  1 
ATOM   358  N N   . CYS A 1 59  ? 19.424  -18.134 31.675 1.00 73.04  ? 1566 CYS A N   1 
ATOM   359  C CA  . CYS A 1 59  ? 18.170  -17.754 32.341 1.00 73.18  ? 1566 CYS A CA  1 
ATOM   360  C C   . CYS A 1 59  ? 18.270  -16.489 33.206 1.00 73.16  ? 1566 CYS A C   1 
ATOM   361  O O   . CYS A 1 59  ? 19.289  -15.795 33.188 1.00 73.04  ? 1566 CYS A O   1 
ATOM   362  C CB  . CYS A 1 59  ? 17.632  -18.924 33.172 1.00 73.17  ? 1566 CYS A CB  1 
ATOM   363  S SG  . CYS A 1 59  ? 18.792  -19.558 34.396 1.00 72.91  ? 1566 CYS A SG  1 
ATOM   364  N N   . PHE A 1 60  ? 17.201  -16.204 33.956 1.00 66.55  ? 1567 PHE A N   1 
ATOM   365  C CA  . PHE A 1 60  ? 17.107  -15.007 34.803 1.00 66.57  ? 1567 PHE A CA  1 
ATOM   366  C C   . PHE A 1 60  ? 17.243  -15.278 36.306 1.00 66.49  ? 1567 PHE A C   1 
ATOM   367  O O   . PHE A 1 60  ? 17.541  -16.402 36.714 1.00 66.38  ? 1567 PHE A O   1 
ATOM   368  C CB  . PHE A 1 60  ? 15.810  -14.242 34.518 1.00 66.84  ? 1567 PHE A CB  1 
ATOM   369  C CG  . PHE A 1 60  ? 15.894  -13.333 33.330 1.00 66.93  ? 1567 PHE A CG  1 
ATOM   370  C CD1 . PHE A 1 60  ? 16.769  -12.254 33.326 1.00 66.84  ? 1567 PHE A CD1 1 
ATOM   371  C CD2 . PHE A 1 60  ? 15.097  -13.551 32.215 1.00 67.13  ? 1567 PHE A CD2 1 
ATOM   372  C CE1 . PHE A 1 60  ? 16.853  -11.416 32.230 1.00 66.94  ? 1567 PHE A CE1 1 
ATOM   373  C CE2 . PHE A 1 60  ? 15.170  -12.712 31.114 1.00 67.24  ? 1567 PHE A CE2 1 
ATOM   374  C CZ  . PHE A 1 60  ? 16.051  -11.642 31.120 1.00 67.14  ? 1567 PHE A CZ  1 
ATOM   375  N N   . GLY A 1 61  ? 17.010  -14.239 37.112 1.00 62.79  ? 1568 GLY A N   1 
ATOM   376  C CA  . GLY A 1 61  ? 17.272  -14.256 38.556 1.00 62.73  ? 1568 GLY A CA  1 
ATOM   377  C C   . GLY A 1 61  ? 16.449  -15.212 39.403 1.00 62.81  ? 1568 GLY A C   1 
ATOM   378  O O   . GLY A 1 61  ? 16.557  -16.432 39.255 1.00 62.73  ? 1568 GLY A O   1 
ATOM   379  N N   . GLN A 1 62  ? 15.642  -14.652 40.307 1.00 64.59  ? 1569 GLN A N   1 
ATOM   380  C CA  . GLN A 1 62  ? 14.805  -15.437 41.227 1.00 64.71  ? 1569 GLN A CA  1 
ATOM   381  C C   . GLN A 1 62  ? 13.955  -16.471 40.499 1.00 64.80  ? 1569 GLN A C   1 
ATOM   382  O O   . GLN A 1 62  ? 13.883  -17.629 40.913 1.00 64.76  ? 1569 GLN A O   1 
ATOM   383  C CB  . GLN A 1 62  ? 13.909  -14.524 42.075 1.00 64.94  ? 1569 GLN A CB  1 
ATOM   384  C CG  . GLN A 1 62  ? 14.370  -14.337 43.522 1.00 64.91  ? 1569 GLN A CG  1 
ATOM   385  C CD  . GLN A 1 62  ? 15.658  -13.536 43.654 1.00 64.72  ? 1569 GLN A CD  1 
ATOM   386  O OE1 . GLN A 1 62  ? 15.888  -12.571 42.922 1.00 64.69  ? 1569 GLN A OE1 1 
ATOM   387  N NE2 . GLN A 1 62  ? 16.501  -13.929 44.602 1.00 64.60  ? 1569 GLN A NE2 1 
ATOM   388  N N   . THR A 1 63  ? 13.318  -16.040 39.416 1.00 68.23  ? 1570 THR A N   1 
ATOM   389  C CA  . THR A 1 63  ? 12.571  -16.940 38.549 1.00 68.33  ? 1570 THR A CA  1 
ATOM   390  C C   . THR A 1 63  ? 13.456  -17.401 37.388 1.00 68.15  ? 1570 THR A C   1 
ATOM   391  O O   . THR A 1 63  ? 14.297  -16.641 36.896 1.00 68.02  ? 1570 THR A O   1 
ATOM   392  C CB  . THR A 1 63  ? 11.273  -16.284 38.029 1.00 68.63  ? 1570 THR A CB  1 
ATOM   393  O OG1 . THR A 1 63  ? 11.562  -14.976 37.523 1.00 68.65  ? 1570 THR A OG1 1 
ATOM   394  C CG2 . THR A 1 63  ? 10.248  -16.168 39.152 1.00 68.85  ? 1570 THR A CG2 1 
ATOM   395  N N   . ARG A 1 64  ? 13.265  -18.649 36.965 1.00 75.23  ? 1571 ARG A N   1 
ATOM   396  C CA  . ARG A 1 64  ? 14.090  -19.267 35.924 1.00 75.08  ? 1571 ARG A CA  1 
ATOM   397  C C   . ARG A 1 64  ? 13.582  -18.955 34.513 1.00 75.25  ? 1571 ARG A C   1 
ATOM   398  O O   . ARG A 1 64  ? 13.259  -19.865 33.742 1.00 75.31  ? 1571 ARG A O   1 
ATOM   399  C CB  . ARG A 1 64  ? 14.177  -20.781 36.149 1.00 75.00  ? 1571 ARG A CB  1 
ATOM   400  C CG  . ARG A 1 64  ? 15.100  -21.193 37.287 1.00 74.79  ? 1571 ARG A CG  1 
ATOM   401  C CD  . ARG A 1 64  ? 14.851  -22.633 37.721 1.00 74.77  ? 1571 ARG A CD  1 
ATOM   402  N NE  . ARG A 1 64  ? 15.778  -23.056 38.772 1.00 74.58  ? 1571 ARG A NE  1 
ATOM   403  C CZ  . ARG A 1 64  ? 15.625  -24.139 39.532 1.00 74.56  ? 1571 ARG A CZ  1 
ATOM   404  N NH1 . ARG A 1 64  ? 14.570  -24.931 39.374 1.00 74.72  ? 1571 ARG A NH1 1 
ATOM   405  N NH2 . ARG A 1 64  ? 16.530  -24.431 40.457 1.00 74.41  ? 1571 ARG A NH2 1 
ATOM   406  N N   . ILE A 1 65  ? 13.524  -17.666 34.183 1.00 73.19  ? 1572 ILE A N   1 
ATOM   407  C CA  . ILE A 1 65  ? 13.040  -17.211 32.877 1.00 73.37  ? 1572 ILE A CA  1 
ATOM   408  C C   . ILE A 1 65  ? 14.117  -17.413 31.809 1.00 73.23  ? 1572 ILE A C   1 
ATOM   409  O O   . ILE A 1 65  ? 15.148  -16.738 31.816 1.00 73.08  ? 1572 ILE A O   1 
ATOM   410  C CB  . ILE A 1 65  ? 12.585  -15.724 32.903 1.00 73.53  ? 1572 ILE A CB  1 
ATOM   411  C CG1 . ILE A 1 65  ? 11.646  -15.448 34.086 1.00 73.65  ? 1572 ILE A CG1 1 
ATOM   412  C CG2 . ILE A 1 65  ? 11.925  -15.338 31.576 1.00 73.78  ? 1572 ILE A CG2 1 
ATOM   413  C CD1 . ILE A 1 65  ? 11.415  -13.963 34.374 1.00 73.75  ? 1572 ILE A CD1 1 
ATOM   414  N N   . SER A 1 66  ? 13.857  -18.346 30.896 1.00 79.37  ? 1573 SER A N   1 
ATOM   415  C CA  . SER A 1 66  ? 14.804  -18.728 29.848 1.00 79.28  ? 1573 SER A CA  1 
ATOM   416  C C   . SER A 1 66  ? 14.973  -17.654 28.776 1.00 79.39  ? 1573 SER A C   1 
ATOM   417  O O   . SER A 1 66  ? 14.002  -17.010 28.372 1.00 79.63  ? 1573 SER A O   1 
ATOM   418  C CB  . SER A 1 66  ? 14.357  -20.039 29.193 1.00 79.38  ? 1573 SER A CB  1 
ATOM   419  O OG  . SER A 1 66  ? 15.213  -20.404 28.124 1.00 79.33  ? 1573 SER A OG  1 
ATOM   420  N N   . VAL A 1 67  ? 16.211  -17.470 28.323 1.00 77.48  ? 1574 VAL A N   1 
ATOM   421  C CA  . VAL A 1 67  ? 16.496  -16.599 27.179 1.00 77.59  ? 1574 VAL A CA  1 
ATOM   422  C C   . VAL A 1 67  ? 17.108  -17.383 26.011 1.00 77.63  ? 1574 VAL A C   1 
ATOM   423  O O   . VAL A 1 67  ? 17.842  -16.828 25.188 1.00 77.67  ? 1574 VAL A O   1 
ATOM   424  C CB  . VAL A 1 67  ? 17.372  -15.367 27.556 1.00 77.45  ? 1574 VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 67  ? 16.562  -14.358 28.347 1.00 77.52  ? 1574 VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 67  ? 18.620  -15.782 28.322 1.00 77.17  ? 1574 VAL A CG2 1 
ATOM   427  N N   . GLY A 1 68  ? 16.789  -18.675 25.948 1.00 84.82  ? 1575 GLY A N   1 
ATOM   428  C CA  . GLY A 1 68  ? 17.236  -19.537 24.857 1.00 84.88  ? 1575 GLY A CA  1 
ATOM   429  C C   . GLY A 1 68  ? 17.695  -20.913 25.301 1.00 84.71  ? 1575 GLY A C   1 
ATOM   430  O O   . GLY A 1 68  ? 18.269  -21.070 26.382 1.00 84.48  ? 1575 GLY A O   1 
ATOM   431  N N   . LYS A 1 69  ? 17.434  -21.909 24.457 1.00 91.90  ? 1576 LYS A N   1 
ATOM   432  C CA  . LYS A 1 69  ? 17.868  -23.285 24.697 1.00 91.77  ? 1576 LYS A CA  1 
ATOM   433  C C   . LYS A 1 69  ? 19.290  -23.502 24.188 1.00 91.66  ? 1576 LYS A C   1 
ATOM   434  O O   . LYS A 1 69  ? 19.715  -22.868 23.220 1.00 91.77  ? 1576 LYS A O   1 
ATOM   435  C CB  . LYS A 1 69  ? 16.918  -24.279 24.024 1.00 91.99  ? 1576 LYS A CB  1 
ATOM   436  C CG  . LYS A 1 69  ? 15.559  -24.411 24.695 1.00 92.09  ? 1576 LYS A CG  1 
ATOM   437  C CD  . LYS A 1 69  ? 14.638  -25.307 23.883 1.00 92.36  ? 1576 LYS A CD  1 
ATOM   438  C CE  . LYS A 1 69  ? 13.253  -25.387 24.500 1.00 92.49  ? 1576 LYS A CE  1 
ATOM   439  N NZ  . LYS A 1 69  ? 12.299  -26.104 23.610 1.00 92.81  ? 1576 LYS A NZ  1 
ATOM   440  N N   . ALA A 1 70  ? 20.012  -24.411 24.840 1.00 86.34  ? 1577 ALA A N   1 
ATOM   441  C CA  . ALA A 1 70  ? 21.416  -24.672 24.527 1.00 86.23  ? 1577 ALA A CA  1 
ATOM   442  C C   . ALA A 1 70  ? 21.608  -25.603 23.329 1.00 86.39  ? 1577 ALA A C   1 
ATOM   443  O O   . ALA A 1 70  ? 20.978  -26.662 23.243 1.00 86.47  ? 1577 ALA A O   1 
ATOM   444  C CB  . ALA A 1 70  ? 22.133  -25.222 25.749 1.00 85.97  ? 1577 ALA A CB  1 
ATOM   445  N N   . ASN A 1 71  ? 22.487  -25.195 22.415 1.00 89.68  ? 1578 ASN A N   1 
ATOM   446  C CA  . ASN A 1 71  ? 22.827  -25.984 21.226 1.00 89.86  ? 1578 ASN A CA  1 
ATOM   447  C C   . ASN A 1 71  ? 24.313  -25.888 20.857 1.00 89.80  ? 1578 ASN A C   1 
ATOM   448  O O   . ASN A 1 71  ? 25.084  -25.199 21.530 1.00 89.59  ? 1578 ASN A O   1 
ATOM   449  C CB  . ASN A 1 71  ? 21.934  -25.594 20.035 1.00 90.16  ? 1578 ASN A CB  1 
ATOM   450  C CG  . ASN A 1 71  ? 21.931  -24.095 19.759 1.00 90.23  ? 1578 ASN A CG  1 
ATOM   451  O OD1 . ASN A 1 71  ? 22.960  -23.503 19.431 1.00 90.26  ? 1578 ASN A OD1 1 
ATOM   452  N ND2 . ASN A 1 71  ? 20.759  -23.480 19.872 1.00 90.27  ? 1578 ASN A ND2 1 
ATOM   453  N N   . LYS A 1 72  ? 24.707  -26.587 19.793 1.00 87.85  ? 1579 LYS A N   1 
ATOM   454  C CA  . LYS A 1 72  ? 26.085  -26.548 19.297 1.00 87.86  ? 1579 LYS A CA  1 
ATOM   455  C C   . LYS A 1 72  ? 26.228  -25.666 18.053 1.00 88.11  ? 1579 LYS A C   1 
ATOM   456  O O   . LYS A 1 72  ? 27.336  -25.493 17.535 1.00 88.16  ? 1579 LYS A O   1 
ATOM   457  C CB  . LYS A 1 72  ? 26.593  -27.964 18.998 1.00 87.88  ? 1579 LYS A CB  1 
ATOM   458  C CG  . LYS A 1 72  ? 26.847  -28.827 20.231 1.00 87.63  ? 1579 LYS A CG  1 
ATOM   459  C CD  . LYS A 1 72  ? 27.313  -30.233 19.847 1.00 87.68  ? 1579 LYS A CD  1 
ATOM   460  C CE  . LYS A 1 72  ? 28.829  -30.322 19.669 1.00 87.62  ? 1579 LYS A CE  1 
ATOM   461  N NZ  . LYS A 1 72  ? 29.557  -30.370 20.971 1.00 87.33  ? 1579 LYS A NZ  1 
ATOM   462  N N   . ARG A 1 73  ? 25.104  -25.114 17.591 1.00 94.30  ? 1580 ARG A N   1 
ATOM   463  C CA  . ARG A 1 73  ? 25.046  -24.288 16.377 1.00 94.58  ? 1580 ARG A CA  1 
ATOM   464  C C   . ARG A 1 73  ? 26.034  -23.119 16.438 1.00 94.51  ? 1580 ARG A C   1 
ATOM   465  O O   . ARG A 1 73  ? 25.758  -22.085 17.056 1.00 94.41  ? 1580 ARG A O   1 
ATOM   466  C CB  . ARG A 1 73  ? 23.617  -23.776 16.135 1.00 94.76  ? 1580 ARG A CB  1 
ATOM   467  C CG  . ARG A 1 73  ? 22.555  -24.867 16.021 1.00 94.85  ? 1580 ARG A CG  1 
ATOM   468  C CD  . ARG A 1 73  ? 21.159  -24.298 16.235 1.00 94.94  ? 1580 ARG A CD  1 
ATOM   469  N NE  . ARG A 1 73  ? 20.164  -25.344 16.483 1.00 94.99  ? 1580 ARG A NE  1 
ATOM   470  C CZ  . ARG A 1 73  ? 19.212  -25.709 15.626 1.00 95.29  ? 1580 ARG A CZ  1 
ATOM   471  N NH1 . ARG A 1 73  ? 19.101  -25.114 14.444 1.00 95.60  ? 1580 ARG A NH1 1 
ATOM   472  N NH2 . ARG A 1 73  ? 18.360  -26.671 15.957 1.00 95.31  ? 1580 ARG A NH2 1 
ATOM   473  N N   . LEU A 1 74  ? 27.189  -23.305 15.800 1.00 96.02  ? 1581 LEU A N   1 
ATOM   474  C CA  . LEU A 1 74  ? 28.263  -22.316 15.823 1.00 95.95  ? 1581 LEU A CA  1 
ATOM   475  C C   . LEU A 1 74  ? 28.563  -21.790 14.421 1.00 96.27  ? 1581 LEU A C   1 
ATOM   476  O O   . LEU A 1 74  ? 28.771  -22.565 13.484 1.00 96.51  ? 1581 LEU A O   1 
ATOM   477  C CB  . LEU A 1 74  ? 29.522  -22.912 16.465 1.00 95.75  ? 1581 LEU A CB  1 
ATOM   478  C CG  . LEU A 1 74  ? 30.583  -21.971 17.046 1.00 95.57  ? 1581 LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 74  ? 30.036  -21.136 18.201 1.00 95.34  ? 1581 LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 74  ? 31.789  -22.778 17.501 1.00 95.45  ? 1581 LEU A CD2 1 
ATOM   481  N N   . ARG A 1 75  ? 28.582  -20.465 14.297 1.00 97.79  ? 1582 ARG A N   1 
ATOM   482  C CA  . ARG A 1 75  ? 28.736  -19.795 13.009 1.00 98.11  ? 1582 ARG A CA  1 
ATOM   483  C C   . ARG A 1 75  ? 29.969  -18.900 12.975 1.00 98.06  ? 1582 ARG A C   1 
ATOM   484  O O   . ARG A 1 75  ? 30.310  -18.267 13.974 1.00 97.79  ? 1582 ARG A O   1 
ATOM   485  C CB  . ARG A 1 75  ? 27.500  -18.943 12.708 1.00 98.25  ? 1582 ARG A CB  1 
ATOM   486  C CG  . ARG A 1 75  ? 26.219  -19.727 12.458 1.00 98.40  ? 1582 ARG A CG  1 
ATOM   487  C CD  . ARG A 1 75  ? 25.059  -18.798 12.102 1.00 98.59  ? 1582 ARG A CD  1 
ATOM   488  N NE  . ARG A 1 75  ? 25.360  -17.942 10.952 1.00 98.88  ? 1582 ARG A NE  1 
ATOM   489  C CZ  . ARG A 1 75  ? 25.169  -18.281 9.678  1.00 99.26  ? 1582 ARG A CZ  1 
ATOM   490  N NH1 . ARG A 1 75  ? 24.668  -19.470 9.360  1.00 99.39  ? 1582 ARG A NH1 1 
ATOM   491  N NH2 . ARG A 1 75  ? 25.482  -17.425 8.714  1.00 99.53  ? 1582 ARG A NH2 1 
ATOM   492  N N   . TYR A 1 76  ? 30.630  -18.851 11.822 1.00 103.38 ? 1583 TYR A N   1 
ATOM   493  C CA  . TYR A 1 76  ? 31.705  -17.893 11.591 1.00 103.41 ? 1583 TYR A CA  1 
ATOM   494  C C   . TYR A 1 76  ? 31.156  -16.714 10.790 1.00 103.65 ? 1583 TYR A C   1 
ATOM   495  O O   . TYR A 1 76  ? 30.867  -16.844 9.597  1.00 104.00 ? 1583 TYR A O   1 
ATOM   496  C CB  . TYR A 1 76  ? 32.888  -18.547 10.862 1.00 103.59 ? 1583 TYR A CB  1 
ATOM   497  C CG  . TYR A 1 76  ? 34.111  -17.656 10.742 1.00 103.61 ? 1583 TYR A CG  1 
ATOM   498  C CD1 . TYR A 1 76  ? 34.244  -16.755 9.684  1.00 103.90 ? 1583 TYR A CD1 1 
ATOM   499  C CD2 . TYR A 1 76  ? 35.137  -17.717 11.684 1.00 103.34 ? 1583 TYR A CD2 1 
ATOM   500  C CE1 . TYR A 1 76  ? 35.360  -15.933 9.573  1.00 103.93 ? 1583 TYR A CE1 1 
ATOM   501  C CE2 . TYR A 1 76  ? 36.260  -16.901 11.580 1.00 103.37 ? 1583 TYR A CE2 1 
ATOM   502  C CZ  . TYR A 1 76  ? 36.365  -16.013 10.521 1.00 103.66 ? 1583 TYR A CZ  1 
ATOM   503  O OH  . TYR A 1 76  ? 37.472  -15.205 10.410 1.00 103.71 ? 1583 TYR A OH  1 
ATOM   504  N N   . VAL A 1 77  ? 31.001  -15.571 11.455 1.00 99.71  ? 1584 VAL A N   1 
ATOM   505  C CA  . VAL A 1 77  ? 30.489  -14.361 10.806 1.00 99.92  ? 1584 VAL A CA  1 
ATOM   506  C C   . VAL A 1 77  ? 31.480  -13.192 10.908 1.00 99.86  ? 1584 VAL A C   1 
ATOM   507  O O   . VAL A 1 77  ? 31.528  -12.477 11.914 1.00 99.59  ? 1584 VAL A O   1 
ATOM   508  C CB  . VAL A 1 77  ? 29.048  -13.989 11.298 1.00 99.86  ? 1584 VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 77  ? 28.992  -13.839 12.817 1.00 99.46  ? 1584 VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 77  ? 28.525  -12.736 10.591 1.00 100.10 ? 1584 VAL A CG2 1 
ATOM   511  N N   . ASP A 1 78  ? 32.271  -13.027 9.847  1.00 102.68 ? 1585 ASP A N   1 
ATOM   512  C CA  . ASP A 1 78  ? 33.270  -11.955 9.720  1.00 102.70 ? 1585 ASP A CA  1 
ATOM   513  C C   . ASP A 1 78  ? 34.164  -11.815 10.958 1.00 102.33 ? 1585 ASP A C   1 
ATOM   514  O O   . ASP A 1 78  ? 34.011  -10.874 11.744 1.00 102.13 ? 1585 ASP A O   1 
ATOM   515  C CB  . ASP A 1 78  ? 32.603  -10.616 9.366  1.00 102.84 ? 1585 ASP A CB  1 
ATOM   516  C CG  . ASP A 1 78  ? 31.702  -10.710 8.143  1.00 103.23 ? 1585 ASP A CG  1 
ATOM   517  O OD1 . ASP A 1 78  ? 30.620  -11.330 8.240  1.00 103.24 ? 1585 ASP A OD1 1 
ATOM   518  O OD2 . ASP A 1 78  ? 32.069  -10.150 7.088  1.00 103.55 ? 1585 ASP A OD2 1 
ATOM   519  N N   . GLN A 1 79  ? 35.085  -12.767 11.117 1.00 103.16 ? 1586 GLN A N   1 
ATOM   520  C CA  . GLN A 1 79  ? 36.044  -12.813 12.238 1.00 102.85 ? 1586 GLN A CA  1 
ATOM   521  C C   . GLN A 1 79  ? 35.427  -13.193 13.593 1.00 102.50 ? 1586 GLN A C   1 
ATOM   522  O O   . GLN A 1 79  ? 36.146  -13.323 14.588 1.00 102.25 ? 1586 GLN A O   1 
ATOM   523  C CB  . GLN A 1 79  ? 36.827  -11.495 12.367 1.00 102.82 ? 1586 GLN A CB  1 
ATOM   524  C CG  . GLN A 1 79  ? 37.676  -11.118 11.159 1.00 103.15 ? 1586 GLN A CG  1 
ATOM   525  C CD  . GLN A 1 79  ? 38.259  -9.718  11.268 1.00 103.13 ? 1586 GLN A CD  1 
ATOM   526  O OE1 . GLN A 1 79  ? 38.506  -9.215  12.365 1.00 102.83 ? 1586 GLN A OE1 1 
ATOM   527  N NE2 . GLN A 1 79  ? 38.484  -9.082  10.124 1.00 103.45 ? 1586 GLN A NE2 1 
ATOM   528  N N   . VAL A 1 80  ? 34.108  -13.381 13.628 1.00 95.65  ? 1587 VAL A N   1 
ATOM   529  C CA  . VAL A 1 80  ? 33.386  -13.647 14.877 1.00 95.35  ? 1587 VAL A CA  1 
ATOM   530  C C   . VAL A 1 80  ? 32.774  -15.051 14.875 1.00 95.36  ? 1587 VAL A C   1 
ATOM   531  O O   . VAL A 1 80  ? 32.397  -15.566 13.822 1.00 95.63  ? 1587 VAL A O   1 
ATOM   532  C CB  . VAL A 1 80  ? 32.272  -12.593 15.125 1.00 95.33  ? 1587 VAL A CB  1 
ATOM   533  C CG1 . VAL A 1 80  ? 31.792  -12.636 16.568 1.00 95.00  ? 1587 VAL A CG1 1 
ATOM   534  C CG2 . VAL A 1 80  ? 32.765  -11.195 14.788 1.00 95.41  ? 1587 VAL A CG2 1 
ATOM   535  N N   . LEU A 1 81  ? 32.682  -15.660 16.057 1.00 96.72  ? 1588 LEU A N   1 
ATOM   536  C CA  . LEU A 1 81  ? 32.056  -16.974 16.213 1.00 96.69  ? 1588 LEU A CA  1 
ATOM   537  C C   . LEU A 1 81  ? 30.750  -16.860 17.003 1.00 96.56  ? 1588 LEU A C   1 
ATOM   538  O O   . LEU A 1 81  ? 30.759  -16.860 18.235 1.00 96.30  ? 1588 LEU A O   1 
ATOM   539  C CB  . LEU A 1 81  ? 33.004  -17.965 16.904 1.00 96.51  ? 1588 LEU A CB  1 
ATOM   540  C CG  . LEU A 1 81  ? 34.523  -17.891 16.703 1.00 96.54  ? 1588 LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 81  ? 35.207  -18.897 17.615 1.00 96.33  ? 1588 LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 81  ? 34.936  -18.115 15.254 1.00 96.88  ? 1588 LEU A CD2 1 
ATOM   543  N N   . GLN A 1 82  ? 29.631  -16.763 16.288 1.00 90.78  ? 1589 GLN A N   1 
ATOM   544  C CA  . GLN A 1 82  ? 28.322  -16.585 16.923 1.00 90.72  ? 1589 GLN A CA  1 
ATOM   545  C C   . GLN A 1 82  ? 27.705  -17.886 17.428 1.00 90.63  ? 1589 GLN A C   1 
ATOM   546  O O   . GLN A 1 82  ? 27.820  -18.935 16.789 1.00 90.75  ? 1589 GLN A O   1 
ATOM   547  C CB  . GLN A 1 82  ? 27.343  -15.874 15.982 1.00 91.00  ? 1589 GLN A CB  1 
ATOM   548  C CG  . GLN A 1 82  ? 27.353  -14.351 16.098 1.00 90.99  ? 1589 GLN A CG  1 
ATOM   549  C CD  . GLN A 1 82  ? 26.207  -13.682 15.346 1.00 91.27  ? 1589 GLN A CD  1 
ATOM   550  O OE1 . GLN A 1 82  ? 25.712  -12.633 15.760 1.00 91.25  ? 1589 GLN A OE1 1 
ATOM   551  N NE2 . GLN A 1 82  ? 25.784  -14.285 14.239 1.00 91.55  ? 1589 GLN A NE2 1 
ATOM   552  N N   . LEU A 1 83  ? 27.053  -17.794 18.584 1.00 89.23  ? 1590 LEU A N   1 
ATOM   553  C CA  . LEU A 1 83  ? 26.296  -18.900 19.161 1.00 89.16  ? 1590 LEU A CA  1 
ATOM   554  C C   . LEU A 1 83  ? 24.860  -18.440 19.402 1.00 89.23  ? 1590 LEU A C   1 
ATOM   555  O O   . LEU A 1 83  ? 24.624  -17.444 20.092 1.00 89.14  ? 1590 LEU A O   1 
ATOM   556  C CB  . LEU A 1 83  ? 26.942  -19.374 20.468 1.00 88.85  ? 1590 LEU A CB  1 
ATOM   557  C CG  . LEU A 1 83  ? 26.451  -20.676 21.112 1.00 88.75  ? 1590 LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 83  ? 26.874  -21.898 20.303 1.00 88.85  ? 1590 LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 83  ? 26.963  -20.782 22.539 1.00 88.46  ? 1590 LEU A CD2 1 
ATOM   560  N N   . VAL A 1 84  ? 23.907  -19.167 18.825 1.00 90.15  ? 1591 VAL A N   1 
ATOM   561  C CA  . VAL A 1 84  ? 22.502  -18.769 18.865 1.00 90.28  ? 1591 VAL A CA  1 
ATOM   562  C C   . VAL A 1 84  ? 21.677  -19.674 19.782 1.00 90.18  ? 1591 VAL A C   1 
ATOM   563  O O   . VAL A 1 84  ? 21.512  -20.866 19.510 1.00 90.23  ? 1591 VAL A O   1 
ATOM   564  C CB  . VAL A 1 84  ? 21.877  -18.737 17.442 1.00 90.65  ? 1591 VAL A CB  1 
ATOM   565  C CG1 . VAL A 1 84  ? 20.428  -18.266 17.497 1.00 90.81  ? 1591 VAL A CG1 1 
ATOM   566  C CG2 . VAL A 1 84  ? 22.692  -17.838 16.515 1.00 90.78  ? 1591 VAL A CG2 1 
ATOM   567  N N   . TYR A 1 85  ? 21.171  -19.094 20.870 1.00 87.50  ? 1592 TYR A N   1 
ATOM   568  C CA  . TYR A 1 85  ? 20.248  -19.786 21.767 1.00 87.42  ? 1592 TYR A CA  1 
ATOM   569  C C   . TYR A 1 85  ? 18.807  -19.404 21.433 1.00 87.67  ? 1592 TYR A C   1 
ATOM   570  O O   . TYR A 1 85  ? 18.387  -18.270 21.671 1.00 87.71  ? 1592 TYR A O   1 
ATOM   571  C CB  . TYR A 1 85  ? 20.558  -19.474 23.238 1.00 87.15  ? 1592 TYR A CB  1 
ATOM   572  C CG  . TYR A 1 85  ? 21.746  -20.216 23.824 1.00 86.90  ? 1592 TYR A CG  1 
ATOM   573  C CD1 . TYR A 1 85  ? 22.349  -21.275 23.141 1.00 86.93  ? 1592 TYR A CD1 1 
ATOM   574  C CD2 . TYR A 1 85  ? 22.246  -19.878 25.082 1.00 86.67  ? 1592 TYR A CD2 1 
ATOM   575  C CE1 . TYR A 1 85  ? 23.433  -21.959 23.682 1.00 86.73  ? 1592 TYR A CE1 1 
ATOM   576  C CE2 . TYR A 1 85  ? 23.328  -20.561 25.635 1.00 86.47  ? 1592 TYR A CE2 1 
ATOM   577  C CZ  . TYR A 1 85  ? 23.915  -21.601 24.929 1.00 86.50  ? 1592 TYR A CZ  1 
ATOM   578  O OH  . TYR A 1 85  ? 24.984  -22.283 25.463 1.00 86.32  ? 1592 TYR A OH  1 
ATOM   579  N N   . LYS A 1 86  ? 18.061  -20.357 20.879 1.00 93.61  ? 1593 LYS A N   1 
ATOM   580  C CA  . LYS A 1 86  ? 16.697  -20.110 20.402 1.00 93.90  ? 1593 LYS A CA  1 
ATOM   581  C C   . LYS A 1 86  ? 15.623  -20.767 21.278 1.00 93.89  ? 1593 LYS A C   1 
ATOM   582  O O   . LYS A 1 86  ? 15.937  -21.546 22.182 1.00 93.66  ? 1593 LYS A O   1 
ATOM   583  C CB  . LYS A 1 86  ? 16.549  -20.568 18.941 1.00 94.19  ? 1593 LYS A CB  1 
ATOM   584  C CG  . LYS A 1 86  ? 16.757  -22.068 18.714 1.00 94.16  ? 1593 LYS A CG  1 
ATOM   585  C CD  . LYS A 1 86  ? 16.240  -22.508 17.351 1.00 94.51  ? 1593 LYS A CD  1 
ATOM   586  C CE  . LYS A 1 86  ? 16.241  -24.024 17.226 1.00 94.50  ? 1593 LYS A CE  1 
ATOM   587  N NZ  . LYS A 1 86  ? 15.603  -24.480 15.961 1.00 94.87  ? 1593 LYS A NZ  1 
ATOM   588  N N   . ASP A 1 87  ? 14.362  -20.432 20.995 1.00 97.51  ? 1594 ASP A N   1 
ATOM   589  C CA  . ASP A 1 87  ? 13.180  -21.051 21.618 1.00 97.60  ? 1594 ASP A CA  1 
ATOM   590  C C   . ASP A 1 87  ? 13.181  -21.037 23.152 1.00 97.35  ? 1594 ASP A C   1 
ATOM   591  O O   . ASP A 1 87  ? 13.185  -22.089 23.797 1.00 97.24  ? 1594 ASP A O   1 
ATOM   592  C CB  . ASP A 1 87  ? 12.959  -22.479 21.085 1.00 97.68  ? 1594 ASP A CB  1 
ATOM   593  C CG  . ASP A 1 87  ? 12.657  -22.514 19.593 1.00 98.01  ? 1594 ASP A CG  1 
ATOM   594  O OD1 . ASP A 1 87  ? 11.910  -21.638 19.106 1.00 98.27  ? 1594 ASP A OD1 1 
ATOM   595  O OD2 . ASP A 1 87  ? 13.161  -23.429 18.907 1.00 98.03  ? 1594 ASP A OD2 1 
ATOM   596  N N   . GLY A 1 88  ? 13.175  -19.836 23.724 1.00 90.13  ? 1595 GLY A N   1 
ATOM   597  C CA  . GLY A 1 88  ? 13.077  -19.673 25.172 1.00 89.95  ? 1595 GLY A CA  1 
ATOM   598  C C   . GLY A 1 88  ? 11.632  -19.563 25.622 1.00 90.17  ? 1595 GLY A C   1 
ATOM   599  O O   . GLY A 1 88  ? 10.724  -20.061 24.952 1.00 90.42  ? 1595 GLY A O   1 
ATOM   600  N N   . SER A 1 89  ? 11.421  -18.915 26.765 1.00 90.61  ? 1596 SER A N   1 
ATOM   601  C CA  . SER A 1 89  ? 10.075  -18.652 27.265 1.00 90.83  ? 1596 SER A CA  1 
ATOM   602  C C   . SER A 1 89  ? 9.469   -17.461 26.520 1.00 91.11  ? 1596 SER A C   1 
ATOM   603  O O   . SER A 1 89  ? 10.195  -16.537 26.147 1.00 91.04  ? 1596 SER A O   1 
ATOM   604  C CB  . SER A 1 89  ? 10.100  -18.389 28.773 1.00 90.68  ? 1596 SER A CB  1 
ATOM   605  O OG  . SER A 1 89  ? 10.733  -17.158 29.067 1.00 90.58  ? 1596 SER A OG  1 
ATOM   606  N N   . PRO A 1 90  ? 8.141   -17.486 26.286 1.00 93.86  ? 1597 PRO A N   1 
ATOM   607  C CA  . PRO A 1 90  ? 7.450   -16.403 25.576 1.00 94.16  ? 1597 PRO A CA  1 
ATOM   608  C C   . PRO A 1 90  ? 7.669   -15.016 26.187 1.00 94.10  ? 1597 PRO A C   1 
ATOM   609  O O   . PRO A 1 90  ? 7.620   -14.858 27.410 1.00 93.97  ? 1597 PRO A O   1 
ATOM   610  C CB  . PRO A 1 90  ? 5.974   -16.804 25.679 1.00 94.48  ? 1597 PRO A CB  1 
ATOM   611  C CG  . PRO A 1 90  ? 6.000   -18.282 25.826 1.00 94.39  ? 1597 PRO A CG  1 
ATOM   612  C CD  . PRO A 1 90  ? 7.208   -18.565 26.665 1.00 93.98  ? 1597 PRO A CD  1 
ATOM   613  N N   . CYS A 1 91  ? 7.916   -14.031 25.326 1.00 83.66  ? 1598 CYS A N   1 
ATOM   614  C CA  . CYS A 1 91  ? 8.116   -12.646 25.749 1.00 83.64  ? 1598 CYS A CA  1 
ATOM   615  C C   . CYS A 1 91  ? 6.880   -11.784 25.462 1.00 84.03  ? 1598 CYS A C   1 
ATOM   616  O O   . CYS A 1 91  ? 6.198   -12.002 24.458 1.00 84.32  ? 1598 CYS A O   1 
ATOM   617  C CB  . CYS A 1 91  ? 9.364   -12.047 25.086 1.00 83.48  ? 1598 CYS A CB  1 
ATOM   618  S SG  . CYS A 1 91  ? 9.273   -11.799 23.295 1.00 83.77  ? 1598 CYS A SG  1 
ATOM   619  N N   . PRO A 1 92  ? 6.586   -10.815 26.356 1.00 80.60  ? 1599 PRO A N   1 
ATOM   620  C CA  . PRO A 1 92  ? 5.472   -9.865  26.289 1.00 80.96  ? 1599 PRO A CA  1 
ATOM   621  C C   . PRO A 1 92  ? 5.021   -9.482  24.872 1.00 81.28  ? 1599 PRO A C   1 
ATOM   622  O O   . PRO A 1 92  ? 4.010   -9.999  24.393 1.00 81.57  ? 1599 PRO A O   1 
ATOM   623  C CB  . PRO A 1 92  ? 6.030   -8.637  27.018 1.00 80.82  ? 1599 PRO A CB  1 
ATOM   624  C CG  . PRO A 1 92  ? 7.098   -9.167  27.934 1.00 80.39  ? 1599 PRO A CG  1 
ATOM   625  C CD  . PRO A 1 92  ? 7.377   -10.603 27.581 1.00 80.28  ? 1599 PRO A CD  1 
ATOM   626  N N   . SER A 1 93  ? 5.774   -8.584  24.233 1.00 91.34  ? 1600 SER A N   1 
ATOM   627  C CA  . SER A 1 93  ? 5.502   -8.052  22.882 1.00 91.64  ? 1600 SER A CA  1 
ATOM   628  C C   . SER A 1 93  ? 4.180   -8.459  22.203 1.00 92.07  ? 1600 SER A C   1 
ATOM   629  O O   . SER A 1 93  ? 3.160   -7.779  22.351 1.00 92.39  ? 1600 SER A O   1 
ATOM   630  C CB  . SER A 1 93  ? 6.700   -8.312  21.957 1.00 91.45  ? 1600 SER A CB  1 
ATOM   631  O OG  . SER A 1 93  ? 7.126   -9.661  22.040 1.00 91.19  ? 1600 SER A OG  1 
ATOM   632  N N   . LYS A 1 94  ? 4.220   -9.564  21.459 1.00 111.52 ? 1601 LYS A N   1 
ATOM   633  C CA  . LYS A 1 94  ? 3.066   -10.077 20.718 1.00 111.93 ? 1601 LYS A CA  1 
ATOM   634  C C   . LYS A 1 94  ? 3.017   -11.604 20.787 1.00 111.83 ? 1601 LYS A C   1 
ATOM   635  O O   . LYS A 1 94  ? 3.919   -12.236 21.345 1.00 111.45 ? 1601 LYS A O   1 
ATOM   636  C CB  . LYS A 1 94  ? 3.112   -9.600  19.262 1.00 112.20 ? 1601 LYS A CB  1 
ATOM   637  C CG  . LYS A 1 94  ? 2.738   -8.139  19.082 1.00 112.45 ? 1601 LYS A CG  1 
ATOM   638  C CD  . LYS A 1 94  ? 3.502   -7.507  17.937 1.00 112.49 ? 1601 LYS A CD  1 
ATOM   639  C CE  . LYS A 1 94  ? 3.393   -5.992  17.987 1.00 112.65 ? 1601 LYS A CE  1 
ATOM   640  N NZ  . LYS A 1 94  ? 4.260   -5.338  16.970 1.00 112.71 ? 1601 LYS A NZ  1 
ATOM   641  N N   . SER A 1 95  ? 1.964   -12.188 20.218 1.00 129.01 ? 1602 SER A N   1 
ATOM   642  C CA  . SER A 1 95  ? 1.738   -13.636 20.270 1.00 128.97 ? 1602 SER A CA  1 
ATOM   643  C C   . SER A 1 95  ? 2.807   -14.444 19.529 1.00 128.75 ? 1602 SER A C   1 
ATOM   644  O O   . SER A 1 95  ? 3.216   -14.087 18.421 1.00 128.87 ? 1602 SER A O   1 
ATOM   645  C CB  . SER A 1 95  ? 0.346   -13.983 19.727 1.00 129.45 ? 1602 SER A CB  1 
ATOM   646  O OG  . SER A 1 95  ? -0.678  -13.443 20.545 1.00 129.63 ? 1602 SER A OG  1 
ATOM   647  N N   . GLY A 1 96  ? 3.256   -15.527 20.161 1.00 133.35 ? 1603 GLY A N   1 
ATOM   648  C CA  . GLY A 1 96  ? 4.205   -16.459 19.553 1.00 133.15 ? 1603 GLY A CA  1 
ATOM   649  C C   . GLY A 1 96  ? 5.673   -16.150 19.793 1.00 132.75 ? 1603 GLY A C   1 
ATOM   650  O O   . GLY A 1 96  ? 6.526   -17.028 19.643 1.00 132.52 ? 1603 GLY A O   1 
ATOM   651  N N   . LEU A 1 97  ? 5.967   -14.905 20.166 1.00 111.33 ? 1604 LEU A N   1 
ATOM   652  C CA  . LEU A 1 97  ? 7.346   -14.446 20.332 1.00 110.99 ? 1604 LEU A CA  1 
ATOM   653  C C   . LEU A 1 97  ? 7.973   -14.913 21.644 1.00 110.59 ? 1604 LEU A C   1 
ATOM   654  O O   . LEU A 1 97  ? 7.418   -14.693 22.721 1.00 110.56 ? 1604 LEU A O   1 
ATOM   655  C CB  . LEU A 1 97  ? 7.429   -12.919 20.211 1.00 111.08 ? 1604 LEU A CB  1 
ATOM   656  C CG  . LEU A 1 97  ? 7.294   -12.312 18.809 1.00 111.41 ? 1604 LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 97  ? 6.970   -10.828 18.886 1.00 111.56 ? 1604 LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 97  ? 8.549   -12.550 17.970 1.00 111.26 ? 1604 LEU A CD2 1 
ATOM   659  N N   . SER A 1 98  ? 9.130   -15.562 21.530 1.00 98.08  ? 1605 SER A N   1 
ATOM   660  C CA  . SER A 1 98  ? 9.889   -16.043 22.682 1.00 97.70  ? 1605 SER A CA  1 
ATOM   661  C C   . SER A 1 98  ? 11.246  -15.346 22.774 1.00 97.44  ? 1605 SER A C   1 
ATOM   662  O O   . SER A 1 98  ? 11.676  -14.679 21.830 1.00 97.54  ? 1605 SER A O   1 
ATOM   663  C CB  . SER A 1 98  ? 10.082  -17.560 22.597 1.00 97.60  ? 1605 SER A CB  1 
ATOM   664  O OG  . SER A 1 98  ? 8.838   -18.236 22.617 1.00 97.80  ? 1605 SER A OG  1 
ATOM   665  N N   . TYR A 1 99  ? 11.913  -15.504 23.915 1.00 84.87  ? 1606 TYR A N   1 
ATOM   666  C CA  . TYR A 1 99  ? 13.243  -14.936 24.121 1.00 84.61  ? 1606 TYR A CA  1 
ATOM   667  C C   . TYR A 1 99  ? 14.316  -15.724 23.376 1.00 84.49  ? 1606 TYR A C   1 
ATOM   668  O O   . TYR A 1 99  ? 14.222  -16.946 23.238 1.00 84.48  ? 1606 TYR A O   1 
ATOM   669  C CB  . TYR A 1 99  ? 13.589  -14.880 25.612 1.00 84.34  ? 1606 TYR A CB  1 
ATOM   670  C CG  . TYR A 1 99  ? 12.893  -13.782 26.388 1.00 84.42  ? 1606 TYR A CG  1 
ATOM   671  C CD1 . TYR A 1 99  ? 11.878  -14.082 27.296 1.00 84.50  ? 1606 TYR A CD1 1 
ATOM   672  C CD2 . TYR A 1 99  ? 13.257  -12.443 26.225 1.00 84.44  ? 1606 TYR A CD2 1 
ATOM   673  C CE1 . TYR A 1 99  ? 11.236  -13.078 28.019 1.00 84.61  ? 1606 TYR A CE1 1 
ATOM   674  C CE2 . TYR A 1 99  ? 12.620  -11.431 26.940 1.00 84.54  ? 1606 TYR A CE2 1 
ATOM   675  C CZ  . TYR A 1 99  ? 11.612  -11.756 27.836 1.00 84.63  ? 1606 TYR A CZ  1 
ATOM   676  O OH  . TYR A 1 99  ? 10.980  -10.759 28.545 1.00 84.75  ? 1606 TYR A OH  1 
ATOM   677  N N   . LYS A 1 100 ? 15.332  -15.009 22.898 1.00 87.21  ? 1607 LYS A N   1 
ATOM   678  C CA  . LYS A 1 100 ? 16.492  -15.620 22.249 1.00 87.09  ? 1607 LYS A CA  1 
ATOM   679  C C   . LYS A 1 100 ? 17.769  -14.825 22.526 1.00 86.87  ? 1607 LYS A C   1 
ATOM   680  O O   . LYS A 1 100 ? 17.715  -13.619 22.775 1.00 86.88  ? 1607 LYS A O   1 
ATOM   681  C CB  . LYS A 1 100 ? 16.261  -15.801 20.740 1.00 87.38  ? 1607 LYS A CB  1 
ATOM   682  C CG  . LYS A 1 100 ? 15.689  -14.589 20.016 1.00 87.65  ? 1607 LYS A CG  1 
ATOM   683  C CD  . LYS A 1 100 ? 15.423  -14.910 18.555 1.00 87.95  ? 1607 LYS A CD  1 
ATOM   684  C CE  . LYS A 1 100 ? 14.643  -13.797 17.878 1.00 88.27  ? 1607 LYS A CE  1 
ATOM   685  N NZ  . LYS A 1 100 ? 14.407  -14.084 16.437 1.00 88.59  ? 1607 LYS A NZ  1 
ATOM   686  N N   . SER A 1 101 ? 18.911  -15.510 22.492 1.00 81.93  ? 1608 SER A N   1 
ATOM   687  C CA  . SER A 1 101 ? 20.198  -14.887 22.798 1.00 81.72  ? 1608 SER A CA  1 
ATOM   688  C C   . SER A 1 101 ? 21.278  -15.219 21.773 1.00 81.74  ? 1608 SER A C   1 
ATOM   689  O O   . SER A 1 101 ? 21.509  -16.389 21.453 1.00 81.73  ? 1608 SER A O   1 
ATOM   690  C CB  . SER A 1 101 ? 20.667  -15.290 24.198 1.00 81.44  ? 1608 SER A CB  1 
ATOM   691  O OG  . SER A 1 101 ? 19.744  -14.870 25.186 1.00 81.44  ? 1608 SER A OG  1 
ATOM   692  N N   . VAL A 1 102 ? 21.932  -14.178 21.263 1.00 85.63  ? 1609 VAL A N   1 
ATOM   693  C CA  . VAL A 1 102 ? 23.076  -14.339 20.368 1.00 85.66  ? 1609 VAL A CA  1 
ATOM   694  C C   . VAL A 1 102 ? 24.386  -14.037 21.100 1.00 85.39  ? 1609 VAL A C   1 
ATOM   695  O O   . VAL A 1 102 ? 24.707  -12.878 21.383 1.00 85.35  ? 1609 VAL A O   1 
ATOM   696  C CB  . VAL A 1 102 ? 22.949  -13.492 19.068 1.00 85.94  ? 1609 VAL A CB  1 
ATOM   697  C CG1 . VAL A 1 102 ? 22.138  -14.243 18.021 1.00 86.22  ? 1609 VAL A CG1 1 
ATOM   698  C CG2 . VAL A 1 102 ? 22.345  -12.114 19.352 1.00 85.99  ? 1609 VAL A CG2 1 
ATOM   699  N N   . ILE A 1 103 ? 25.124  -15.097 21.418 1.00 82.62  ? 1610 ILE A N   1 
ATOM   700  C CA  . ILE A 1 103 ? 26.382  -14.982 22.151 1.00 82.39  ? 1610 ILE A CA  1 
ATOM   701  C C   . ILE A 1 103 ? 27.563  -15.048 21.186 1.00 82.47  ? 1610 ILE A C   1 
ATOM   702  O O   . ILE A 1 103 ? 27.896  -16.113 20.662 1.00 82.52  ? 1610 ILE A O   1 
ATOM   703  C CB  . ILE A 1 103 ? 26.513  -16.064 23.254 1.00 82.18  ? 1610 ILE A CB  1 
ATOM   704  C CG1 . ILE A 1 103 ? 25.259  -16.088 24.138 1.00 82.14  ? 1610 ILE A CG1 1 
ATOM   705  C CG2 . ILE A 1 103 ? 27.761  -15.815 24.099 1.00 81.96  ? 1610 ILE A CG2 1 
ATOM   706  C CD1 . ILE A 1 103 ? 25.026  -17.399 24.869 1.00 82.03  ? 1610 ILE A CD1 1 
ATOM   707  N N   . SER A 1 104 ? 28.185  -13.895 20.960 1.00 86.49  ? 1611 SER A N   1 
ATOM   708  C CA  . SER A 1 104 ? 29.289  -13.775 20.012 1.00 86.60  ? 1611 SER A CA  1 
ATOM   709  C C   . SER A 1 104 ? 30.649  -13.962 20.684 1.00 86.40  ? 1611 SER A C   1 
ATOM   710  O O   . SER A 1 104 ? 30.809  -13.684 21.875 1.00 86.18  ? 1611 SER A O   1 
ATOM   711  C CB  . SER A 1 104 ? 29.234  -12.418 19.307 1.00 86.76  ? 1611 SER A CB  1 
ATOM   712  O OG  . SER A 1 104 ? 28.001  -12.238 18.635 1.00 86.97  ? 1611 SER A OG  1 
ATOM   713  N N   . PHE A 1 105 ? 31.621  -14.437 19.908 1.00 90.46  ? 1612 PHE A N   1 
ATOM   714  C CA  . PHE A 1 105 ? 32.995  -14.593 20.379 1.00 90.33  ? 1612 PHE A CA  1 
ATOM   715  C C   . PHE A 1 105 ? 33.964  -13.796 19.509 1.00 90.48  ? 1612 PHE A C   1 
ATOM   716  O O   . PHE A 1 105 ? 34.279  -14.187 18.382 1.00 90.70  ? 1612 PHE A O   1 
ATOM   717  C CB  . PHE A 1 105 ? 33.390  -16.072 20.435 1.00 90.30  ? 1612 PHE A CB  1 
ATOM   718  C CG  . PHE A 1 105 ? 32.708  -16.841 21.533 1.00 90.11  ? 1612 PHE A CG  1 
ATOM   719  C CD1 . PHE A 1 105 ? 33.254  -16.883 22.812 1.00 89.87  ? 1612 PHE A CD1 1 
ATOM   720  C CD2 . PHE A 1 105 ? 31.522  -17.527 21.289 1.00 90.18  ? 1612 PHE A CD2 1 
ATOM   721  C CE1 . PHE A 1 105 ? 32.628  -17.594 23.833 1.00 89.72  ? 1612 PHE A CE1 1 
ATOM   722  C CE2 . PHE A 1 105 ? 30.888  -18.240 22.303 1.00 90.03  ? 1612 PHE A CE2 1 
ATOM   723  C CZ  . PHE A 1 105 ? 31.442  -18.274 23.578 1.00 89.79  ? 1612 PHE A CZ  1 
ATOM   724  N N   . VAL A 1 106 ? 34.426  -12.672 20.050 1.00 90.18  ? 1613 VAL A N   1 
ATOM   725  C CA  . VAL A 1 106 ? 35.285  -11.739 19.325 1.00 90.32  ? 1613 VAL A CA  1 
ATOM   726  C C   . VAL A 1 106 ? 36.753  -11.985 19.668 1.00 90.24  ? 1613 VAL A C   1 
ATOM   727  O O   . VAL A 1 106 ? 37.080  -12.336 20.804 1.00 90.03  ? 1613 VAL A O   1 
ATOM   728  C CB  . VAL A 1 106 ? 34.910  -10.272 19.646 1.00 90.27  ? 1613 VAL A CB  1 
ATOM   729  C CG1 . VAL A 1 106 ? 35.582  -9.313  18.679 1.00 90.47  ? 1613 VAL A CG1 1 
ATOM   730  C CG2 . VAL A 1 106 ? 33.404  -10.080 19.602 1.00 90.32  ? 1613 VAL A CG2 1 
ATOM   731  N N   . CYS A 1 107 ? 37.629  -11.802 18.680 1.00 95.72  ? 1614 CYS A N   1 
ATOM   732  C CA  . CYS A 1 107 ? 39.066  -12.006 18.857 1.00 95.70  ? 1614 CYS A CA  1 
ATOM   733  C C   . CYS A 1 107 ? 39.702  -10.942 19.751 1.00 95.53  ? 1614 CYS A C   1 
ATOM   734  O O   . CYS A 1 107 ? 39.467  -9.743  19.576 1.00 95.57  ? 1614 CYS A O   1 
ATOM   735  C CB  . CYS A 1 107 ? 39.780  -12.052 17.502 1.00 96.00  ? 1614 CYS A CB  1 
ATOM   736  S SG  . CYS A 1 107 ? 41.592  -12.120 17.591 1.00 96.04  ? 1614 CYS A SG  1 
ATOM   737  N N   . ARG A 1 108 ? 40.506  -11.406 20.706 1.00 92.91  ? 1615 ARG A N   1 
ATOM   738  C CA  . ARG A 1 108 ? 41.243  -10.539 21.620 1.00 92.77  ? 1615 ARG A CA  1 
ATOM   739  C C   . ARG A 1 108 ? 42.516  -11.248 22.096 1.00 92.74  ? 1615 ARG A C   1 
ATOM   740  O O   . ARG A 1 108 ? 42.471  -12.029 23.051 1.00 92.58  ? 1615 ARG A O   1 
ATOM   741  C CB  . ARG A 1 108 ? 40.367  -10.144 22.811 1.00 92.54  ? 1615 ARG A CB  1 
ATOM   742  C CG  . ARG A 1 108 ? 40.894  -8.968  23.608 1.00 92.44  ? 1615 ARG A CG  1 
ATOM   743  C CD  . ARG A 1 108 ? 40.094  -8.790  24.875 1.00 92.22  ? 1615 ARG A CD  1 
ATOM   744  N NE  . ARG A 1 108 ? 40.333  -7.492  25.496 1.00 92.15  ? 1615 ARG A NE  1 
ATOM   745  C CZ  . ARG A 1 108 ? 39.638  -7.014  26.523 1.00 92.01  ? 1615 ARG A CZ  1 
ATOM   746  N NH1 . ARG A 1 108 ? 38.651  -7.722  27.057 1.00 91.92  ? 1615 ARG A NH1 1 
ATOM   747  N NH2 . ARG A 1 108 ? 39.930  -5.820  27.019 1.00 91.97  ? 1615 ARG A NH2 1 
ATOM   748  N N   . PRO A 1 109 ? 43.655  -10.980 21.425 1.00 99.36  ? 1616 PRO A N   1 
ATOM   749  C CA  . PRO A 1 109 ? 44.945  -11.616 21.728 1.00 99.39  ? 1616 PRO A CA  1 
ATOM   750  C C   . PRO A 1 109 ? 45.463  -11.336 23.141 1.00 99.18  ? 1616 PRO A C   1 
ATOM   751  O O   . PRO A 1 109 ? 46.116  -12.195 23.736 1.00 99.14  ? 1616 PRO A O   1 
ATOM   752  C CB  . PRO A 1 109 ? 45.892  -11.010 20.683 1.00 99.64  ? 1616 PRO A CB  1 
ATOM   753  C CG  . PRO A 1 109 ? 45.229  -9.749  20.245 1.00 99.67  ? 1616 PRO A CG  1 
ATOM   754  C CD  . PRO A 1 109 ? 43.766  -10.033 20.301 1.00 99.57  ? 1616 PRO A CD  1 
ATOM   755  N N   . GLU A 1 110 ? 45.173  -10.146 23.663 1.00 93.52  ? 1617 GLU A N   1 
ATOM   756  C CA  . GLU A 1 110 ? 45.585  -9.764  25.010 1.00 93.34  ? 1617 GLU A CA  1 
ATOM   757  C C   . GLU A 1 110 ? 44.724  -10.458 26.066 1.00 93.14  ? 1617 GLU A C   1 
ATOM   758  O O   . GLU A 1 110 ? 43.538  -10.153 26.216 1.00 93.06  ? 1617 GLU A O   1 
ATOM   759  C CB  . GLU A 1 110 ? 45.545  -8.236  25.171 1.00 93.31  ? 1617 GLU A CB  1 
ATOM   760  C CG  . GLU A 1 110 ? 45.821  -7.712  26.589 1.00 93.13  ? 1617 GLU A CG  1 
ATOM   761  C CD  . GLU A 1 110 ? 47.238  -7.988  27.090 1.00 93.16  ? 1617 GLU A CD  1 
ATOM   762  O OE1 . GLU A 1 110 ? 48.158  -8.179  26.263 1.00 93.35  ? 1617 GLU A OE1 1 
ATOM   763  O OE2 . GLU A 1 110 ? 47.431  -8.003  28.324 1.00 93.03  ? 1617 GLU A OE2 1 
ATOM   764  N N   . ALA A 1 111 ? 45.335  -11.398 26.785 1.00 90.04  ? 1618 ALA A N   1 
ATOM   765  C CA  . ALA A 1 111 ? 44.660  -12.133 27.854 1.00 89.87  ? 1618 ALA A CA  1 
ATOM   766  C C   . ALA A 1 111 ? 44.553  -11.292 29.126 1.00 89.71  ? 1618 ALA A C   1 
ATOM   767  O O   . ALA A 1 111 ? 45.393  -10.425 29.381 1.00 89.74  ? 1618 ALA A O   1 
ATOM   768  C CB  . ALA A 1 111 ? 45.381  -13.446 28.135 1.00 89.89  ? 1618 ALA A CB  1 
ATOM   769  N N   . GLY A 1 112 ? 43.515  -11.552 29.917 1.00 82.19  ? 1619 GLY A N   1 
ATOM   770  C CA  . GLY A 1 112 ? 43.284  -10.812 31.154 1.00 82.06  ? 1619 GLY A CA  1 
ATOM   771  C C   . GLY A 1 112 ? 41.942  -11.102 31.804 1.00 81.95  ? 1619 GLY A C   1 
ATOM   772  O O   . GLY A 1 112 ? 41.268  -12.068 31.437 1.00 81.95  ? 1619 GLY A O   1 
ATOM   773  N N   . PRO A 1 113 ? 41.543  -10.260 32.777 1.00 76.03  ? 1620 PRO A N   1 
ATOM   774  C CA  . PRO A 1 113 ? 40.313  -10.470 33.540 1.00 75.94  ? 1620 PRO A CA  1 
ATOM   775  C C   . PRO A 1 113 ? 39.030  -10.142 32.772 1.00 75.98  ? 1620 PRO A C   1 
ATOM   776  O O   . PRO A 1 113 ? 38.003  -10.772 33.021 1.00 75.95  ? 1620 PRO A O   1 
ATOM   777  C CB  . PRO A 1 113 ? 40.479  -9.533  34.737 1.00 75.89  ? 1620 PRO A CB  1 
ATOM   778  C CG  . PRO A 1 113 ? 41.358  -8.447  34.248 1.00 75.95  ? 1620 PRO A CG  1 
ATOM   779  C CD  . PRO A 1 113 ? 42.264  -9.049  33.213 1.00 76.04  ? 1620 PRO A CD  1 
ATOM   780  N N   . THR A 1 114 ? 39.087  -9.181  31.850 1.00 75.73  ? 1621 THR A N   1 
ATOM   781  C CA  . THR A 1 114 ? 37.905  -8.790  31.067 1.00 75.79  ? 1621 THR A CA  1 
ATOM   782  C C   . THR A 1 114 ? 37.533  -9.819  29.988 1.00 75.87  ? 1621 THR A C   1 
ATOM   783  O O   . THR A 1 114 ? 36.748  -9.527  29.082 1.00 75.98  ? 1621 THR A O   1 
ATOM   784  C CB  . THR A 1 114 ? 38.051  -7.379  30.443 1.00 75.87  ? 1621 THR A CB  1 
ATOM   785  O OG1 . THR A 1 114 ? 39.303  -7.280  29.756 1.00 75.94  ? 1621 THR A OG1 1 
ATOM   786  C CG2 . THR A 1 114 ? 37.978  -6.304  31.516 1.00 75.80  ? 1621 THR A CG2 1 
ATOM   787  N N   . ASN A 1 115 ? 38.098  -11.021 30.105 1.00 81.23  ? 1622 ASN A N   1 
ATOM   788  C CA  . ASN A 1 115 ? 37.765  -12.144 29.231 1.00 81.30  ? 1622 ASN A CA  1 
ATOM   789  C C   . ASN A 1 115 ? 36.570  -12.934 29.769 1.00 81.23  ? 1622 ASN A C   1 
ATOM   790  O O   . ASN A 1 115 ? 36.690  -14.109 30.131 1.00 81.18  ? 1622 ASN A O   1 
ATOM   791  C CB  . ASN A 1 115 ? 38.983  -13.057 29.038 1.00 81.32  ? 1622 ASN A CB  1 
ATOM   792  C CG  . ASN A 1 115 ? 40.078  -12.415 28.200 1.00 81.44  ? 1622 ASN A CG  1 
ATOM   793  O OD1 . ASN A 1 115 ? 40.145  -11.193 28.059 1.00 81.47  ? 1622 ASN A OD1 1 
ATOM   794  N ND2 . ASN A 1 115 ? 40.949  -13.246 27.640 1.00 81.53  ? 1622 ASN A ND2 1 
ATOM   795  N N   . ARG A 1 116 ? 35.419  -12.268 29.818 1.00 78.14  ? 1623 ARG A N   1 
ATOM   796  C CA  . ARG A 1 116 ? 34.182  -12.849 30.337 1.00 78.10  ? 1623 ARG A CA  1 
ATOM   797  C C   . ARG A 1 116 ? 32.981  -12.448 29.477 1.00 78.22  ? 1623 ARG A C   1 
ATOM   798  O O   . ARG A 1 116 ? 33.046  -11.441 28.766 1.00 78.31  ? 1623 ARG A O   1 
ATOM   799  C CB  . ARG A 1 116 ? 33.957  -12.410 31.789 1.00 77.99  ? 1623 ARG A CB  1 
ATOM   800  C CG  . ARG A 1 116 ? 34.594  -13.319 32.830 1.00 77.88  ? 1623 ARG A CG  1 
ATOM   801  C CD  . ARG A 1 116 ? 34.176  -12.928 34.242 1.00 77.81  ? 1623 ARG A CD  1 
ATOM   802  N NE  . ARG A 1 116 ? 34.667  -11.600 34.609 1.00 77.80  ? 1623 ARG A NE  1 
ATOM   803  C CZ  . ARG A 1 116 ? 35.855  -11.355 35.159 1.00 77.76  ? 1623 ARG A CZ  1 
ATOM   804  N NH1 . ARG A 1 116 ? 36.698  -12.347 35.423 1.00 77.72  ? 1623 ARG A NH1 1 
ATOM   805  N NH2 . ARG A 1 116 ? 36.204  -10.107 35.448 1.00 77.76  ? 1623 ARG A NH2 1 
ATOM   806  N N   . PRO A 1 117 ? 31.881  -13.233 29.534 1.00 77.45  ? 1624 PRO A N   1 
ATOM   807  C CA  . PRO A 1 117 ? 30.676  -12.858 28.794 1.00 77.59  ? 1624 PRO A CA  1 
ATOM   808  C C   . PRO A 1 117 ? 30.004  -11.606 29.365 1.00 77.59  ? 1624 PRO A C   1 
ATOM   809  O O   . PRO A 1 117 ? 29.619  -11.581 30.536 1.00 77.50  ? 1624 PRO A O   1 
ATOM   810  C CB  . PRO A 1 117 ? 29.769  -14.084 28.946 1.00 77.60  ? 1624 PRO A CB  1 
ATOM   811  C CG  . PRO A 1 117 ? 30.238  -14.764 30.173 1.00 77.44  ? 1624 PRO A CG  1 
ATOM   812  C CD  . PRO A 1 117 ? 31.705  -14.501 30.267 1.00 77.37  ? 1624 PRO A CD  1 
ATOM   813  N N   . MET A 1 118 ? 29.886  -10.577 28.530 1.00 72.91  ? 1625 MET A N   1 
ATOM   814  C CA  . MET A 1 118 ? 29.256  -9.314  28.911 1.00 72.94  ? 1625 MET A CA  1 
ATOM   815  C C   . MET A 1 118 ? 27.924  -9.135  28.190 1.00 73.12  ? 1625 MET A C   1 
ATOM   816  O O   . MET A 1 118 ? 27.724  -9.675  27.098 1.00 73.25  ? 1625 MET A O   1 
ATOM   817  C CB  . MET A 1 118 ? 30.173  -8.137  28.566 1.00 72.95  ? 1625 MET A CB  1 
ATOM   818  C CG  . MET A 1 118 ? 31.451  -8.049  29.384 1.00 72.80  ? 1625 MET A CG  1 
ATOM   819  S SD  . MET A 1 118 ? 32.653  -6.911  28.661 1.00 72.84  ? 1625 MET A SD  1 
ATOM   820  C CE  . MET A 1 118 ? 31.825  -5.330  28.834 1.00 72.92  ? 1625 MET A CE  1 
ATOM   821  N N   . LEU A 1 119 ? 27.016  -8.378  28.801 1.00 72.24  ? 1626 LEU A N   1 
ATOM   822  C CA  . LEU A 1 119 ? 25.782  -7.984  28.131 1.00 72.44  ? 1626 LEU A CA  1 
ATOM   823  C C   . LEU A 1 119 ? 25.937  -6.575  27.563 1.00 72.54  ? 1626 LEU A C   1 
ATOM   824  O O   . LEU A 1 119 ? 25.872  -5.582  28.295 1.00 72.51  ? 1626 LEU A O   1 
ATOM   825  C CB  . LEU A 1 119 ? 24.576  -8.077  29.075 1.00 72.47  ? 1626 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 119 ? 23.187  -7.801  28.481 1.00 72.70  ? 1626 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 119 ? 22.804  -8.823  27.413 1.00 72.82  ? 1626 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 119 ? 22.129  -7.757  29.574 1.00 72.74  ? 1626 LEU A CD2 1 
ATOM   829  N N   . ILE A 1 120 ? 26.152  -6.508  26.251 1.00 74.81  ? 1627 ILE A N   1 
ATOM   830  C CA  . ILE A 1 120 ? 26.392  -5.244  25.552 1.00 74.93  ? 1627 ILE A CA  1 
ATOM   831  C C   . ILE A 1 120 ? 25.111  -4.403  25.416 1.00 75.12  ? 1627 ILE A C   1 
ATOM   832  O O   . ILE A 1 120 ? 25.100  -3.227  25.794 1.00 75.12  ? 1627 ILE A O   1 
ATOM   833  C CB  . ILE A 1 120 ? 27.126  -5.469  24.182 1.00 75.04  ? 1627 ILE A CB  1 
ATOM   834  C CG1 . ILE A 1 120 ? 27.351  -4.141  23.441 1.00 75.18  ? 1627 ILE A CG1 1 
ATOM   835  C CG2 . ILE A 1 120 ? 26.389  -6.497  23.311 1.00 75.20  ? 1627 ILE A CG2 1 
ATOM   836  C CD1 . ILE A 1 120 ? 28.355  -4.220  22.290 1.00 75.27  ? 1627 ILE A CD1 1 
ATOM   837  N N   . SER A 1 121 ? 24.046  -5.017  24.892 1.00 75.43  ? 1628 SER A N   1 
ATOM   838  C CA  . SER A 1 121 ? 22.727  -4.379  24.758 1.00 75.64  ? 1628 SER A CA  1 
ATOM   839  C C   . SER A 1 121 ? 21.615  -5.382  24.407 1.00 75.79  ? 1628 SER A C   1 
ATOM   840  O O   . SER A 1 121 ? 21.871  -6.577  24.233 1.00 75.74  ? 1628 SER A O   1 
ATOM   841  C CB  . SER A 1 121 ? 22.763  -3.246  23.725 1.00 75.83  ? 1628 SER A CB  1 
ATOM   842  O OG  . SER A 1 121 ? 21.602  -2.436  23.814 1.00 76.02  ? 1628 SER A OG  1 
ATOM   843  N N   . LEU A 1 122 ? 20.386  -4.875  24.305 1.00 76.91  ? 1629 LEU A N   1 
ATOM   844  C CA  . LEU A 1 122 ? 19.198  -5.685  24.028 1.00 77.09  ? 1629 LEU A CA  1 
ATOM   845  C C   . LEU A 1 122 ? 18.250  -4.966  23.068 1.00 77.42  ? 1629 LEU A C   1 
ATOM   846  O O   . LEU A 1 122 ? 18.060  -3.751  23.166 1.00 77.50  ? 1629 LEU A O   1 
ATOM   847  C CB  . LEU A 1 122 ? 18.467  -6.006  25.342 1.00 77.01  ? 1629 LEU A CB  1 
ATOM   848  C CG  . LEU A 1 122 ? 17.002  -6.469  25.335 1.00 77.24  ? 1629 LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 122 ? 16.891  -7.977  25.188 1.00 77.20  ? 1629 LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 122 ? 16.289  -6.009  26.597 1.00 77.24  ? 1629 LEU A CD2 1 
ATOM   851  N N   . ASP A 1 123 ? 17.665  -5.722  22.142 1.00 85.25  ? 1630 ASP A N   1 
ATOM   852  C CA  . ASP A 1 123 ? 16.586  -5.216  21.297 1.00 85.60  ? 1630 ASP A CA  1 
ATOM   853  C C   . ASP A 1 123 ? 15.248  -5.602  21.920 1.00 85.72  ? 1630 ASP A C   1 
ATOM   854  O O   . ASP A 1 123 ? 14.993  -6.781  22.180 1.00 85.66  ? 1630 ASP A O   1 
ATOM   855  C CB  . ASP A 1 123 ? 16.697  -5.767  19.870 1.00 85.81  ? 1630 ASP A CB  1 
ATOM   856  C CG  . ASP A 1 123 ? 15.687  -5.142  18.912 1.00 86.20  ? 1630 ASP A CG  1 
ATOM   857  O OD1 . ASP A 1 123 ? 14.463  -5.274  19.140 1.00 86.37  ? 1630 ASP A OD1 1 
ATOM   858  O OD2 . ASP A 1 123 ? 16.120  -4.532  17.912 1.00 86.36  ? 1630 ASP A OD2 1 
ATOM   859  N N   . LYS A 1 124 ? 14.401  -4.601  22.152 1.00 81.04  ? 1631 LYS A N   1 
ATOM   860  C CA  . LYS A 1 124 ? 13.105  -4.800  22.807 1.00 81.19  ? 1631 LYS A CA  1 
ATOM   861  C C   . LYS A 1 124 ? 12.116  -5.562  21.927 1.00 81.48  ? 1631 LYS A C   1 
ATOM   862  O O   . LYS A 1 124 ? 11.484  -6.519  22.380 1.00 81.47  ? 1631 LYS A O   1 
ATOM   863  C CB  . LYS A 1 124 ? 12.497  -3.458  23.234 1.00 81.35  ? 1631 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 124 ? 13.278  -2.717  24.305 1.00 81.09  ? 1631 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 124 ? 12.898  -1.249  24.335 1.00 81.28  ? 1631 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 124 ? 14.039  -0.407  24.877 1.00 81.03  ? 1631 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 124 ? 13.846  1.043   24.602 1.00 81.22  ? 1631 LYS A NZ  1 
ATOM   868  N N   . GLN A 1 125 ? 11.998  -5.137  20.671 1.00 93.72  ? 1632 GLN A N   1 
ATOM   869  C CA  . GLN A 1 125 ? 11.000  -5.681  19.750 1.00 94.06  ? 1632 GLN A CA  1 
ATOM   870  C C   . GLN A 1 125 ? 11.160  -7.182  19.491 1.00 93.97  ? 1632 GLN A C   1 
ATOM   871  O O   . GLN A 1 125 ? 10.242  -7.962  19.753 1.00 94.05  ? 1632 GLN A O   1 
ATOM   872  C CB  . GLN A 1 125 ? 11.012  -4.911  18.426 1.00 94.35  ? 1632 GLN A CB  1 
ATOM   873  C CG  . GLN A 1 125 ? 10.468  -3.490  18.513 1.00 94.55  ? 1632 GLN A CG  1 
ATOM   874  C CD  . GLN A 1 125 ? 10.388  -2.809  17.156 1.00 94.89  ? 1632 GLN A CD  1 
ATOM   875  O OE1 . GLN A 1 125 ? 11.356  -2.794  16.393 1.00 94.83  ? 1632 GLN A OE1 1 
ATOM   876  N NE2 . GLN A 1 125 ? 9.229   -2.235  16.853 1.00 95.26  ? 1632 GLN A NE2 1 
ATOM   877  N N   . THR A 1 126 ? 12.328  -7.577  18.990 1.00 100.89 ? 1633 THR A N   1 
ATOM   878  C CA  . THR A 1 126 ? 12.566  -8.960  18.562 1.00 100.84 ? 1633 THR A CA  1 
ATOM   879  C C   . THR A 1 126 ? 12.895  -9.920  19.714 1.00 100.52 ? 1633 THR A C   1 
ATOM   880  O O   . THR A 1 126 ? 13.090  -11.119 19.490 1.00 100.46 ? 1633 THR A O   1 
ATOM   881  C CB  . THR A 1 126 ? 13.643  -9.037  17.434 1.00 100.84 ? 1633 THR A CB  1 
ATOM   882  O OG1 . THR A 1 126 ? 13.897  -10.405 17.091 1.00 100.79 ? 1633 THR A OG1 1 
ATOM   883  C CG2 . THR A 1 126 ? 14.945  -8.376  17.860 1.00 100.55 ? 1633 THR A CG2 1 
ATOM   884  N N   . CYS A 1 127 ? 12.933  -9.390  20.937 1.00 84.03  ? 1634 CYS A N   1 
ATOM   885  C CA  . CYS A 1 127 ? 13.271  -10.164 22.137 1.00 83.72  ? 1634 CYS A CA  1 
ATOM   886  C C   . CYS A 1 127 ? 14.588  -10.929 21.968 1.00 83.47  ? 1634 CYS A C   1 
ATOM   887  O O   . CYS A 1 127 ? 14.665  -12.132 22.232 1.00 83.37  ? 1634 CYS A O   1 
ATOM   888  C CB  . CYS A 1 127 ? 12.124  -11.108 22.526 1.00 83.84  ? 1634 CYS A CB  1 
ATOM   889  S SG  . CYS A 1 127 ? 10.575  -10.273 22.950 1.00 84.18  ? 1634 CYS A SG  1 
ATOM   890  N N   . THR A 1 128 ? 15.617  -10.210 21.521 1.00 85.57  ? 1635 THR A N   1 
ATOM   891  C CA  . THR A 1 128 ? 16.929  -10.794 21.257 1.00 85.37  ? 1635 THR A CA  1 
ATOM   892  C C   . THR A 1 128 ? 17.997  -10.151 22.140 1.00 85.08  ? 1635 THR A C   1 
ATOM   893  O O   . THR A 1 128 ? 18.118  -8.924  22.195 1.00 85.11  ? 1635 THR A O   1 
ATOM   894  C CB  . THR A 1 128 ? 17.319  -10.654 19.765 1.00 85.58  ? 1635 THR A CB  1 
ATOM   895  O OG1 . THR A 1 128 ? 16.243  -11.116 18.941 1.00 85.90  ? 1635 THR A OG1 1 
ATOM   896  C CG2 . THR A 1 128 ? 18.570  -11.463 19.447 1.00 85.42  ? 1635 THR A CG2 1 
ATOM   897  N N   . LEU A 1 129 ? 18.764  -10.994 22.829 1.00 76.98  ? 1636 LEU A N   1 
ATOM   898  C CA  . LEU A 1 129 ? 19.840  -10.537 23.706 1.00 76.71  ? 1636 LEU A CA  1 
ATOM   899  C C   . LEU A 1 129 ? 21.193  -10.629 23.005 1.00 76.63  ? 1636 LEU A C   1 
ATOM   900  O O   . LEU A 1 129 ? 21.626  -11.716 22.609 1.00 76.59  ? 1636 LEU A O   1 
ATOM   901  C CB  . LEU A 1 129 ? 19.863  -11.352 25.006 1.00 76.49  ? 1636 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 129 ? 18.789  -11.123 26.077 1.00 76.51  ? 1636 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 129 ? 17.465  -11.793 25.718 1.00 76.74  ? 1636 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 129 ? 19.285  -11.626 27.425 1.00 76.25  ? 1636 LEU A CD2 1 
ATOM   905  N N   . PHE A 1 130 ? 21.851  -9.482  22.847 1.00 81.33  ? 1637 PHE A N   1 
ATOM   906  C CA  . PHE A 1 130 ? 23.191  -9.433  22.267 1.00 81.25  ? 1637 PHE A CA  1 
ATOM   907  C C   . PHE A 1 130 ? 24.241  -9.709  23.339 1.00 80.96  ? 1637 PHE A C   1 
ATOM   908  O O   . PHE A 1 130 ? 24.273  -9.041  24.378 1.00 80.82  ? 1637 PHE A O   1 
ATOM   909  C CB  . PHE A 1 130 ? 23.466  -8.074  21.608 1.00 81.38  ? 1637 PHE A CB  1 
ATOM   910  C CG  . PHE A 1 130 ? 22.529  -7.732  20.479 1.00 81.70  ? 1637 PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 130 ? 22.601  -8.406  19.262 1.00 81.89  ? 1637 PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 130 ? 21.590  -6.715  20.626 1.00 81.83  ? 1637 PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 130 ? 21.738  -8.085  18.215 1.00 82.22  ? 1637 PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 130 ? 20.724  -6.384  19.585 1.00 82.15  ? 1637 PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 130 ? 20.799  -7.071  18.377 1.00 82.35  ? 1637 PHE A CZ  1 
ATOM   916  N N   . PHE A 1 131 ? 25.093  -10.697 23.084 1.00 80.32  ? 1638 PHE A N   1 
ATOM   917  C CA  . PHE A 1 131 ? 26.193  -11.026 23.988 1.00 80.07  ? 1638 PHE A CA  1 
ATOM   918  C C   . PHE A 1 131 ? 27.543  -10.973 23.283 1.00 80.06  ? 1638 PHE A C   1 
ATOM   919  O O   . PHE A 1 131 ? 27.663  -11.342 22.111 1.00 80.23  ? 1638 PHE A O   1 
ATOM   920  C CB  . PHE A 1 131 ? 25.990  -12.403 24.624 1.00 79.96  ? 1638 PHE A CB  1 
ATOM   921  C CG  . PHE A 1 131 ? 25.029  -12.408 25.777 1.00 79.89  ? 1638 PHE A CG  1 
ATOM   922  C CD1 . PHE A 1 131 ? 25.462  -12.087 27.061 1.00 79.70  ? 1638 PHE A CD1 1 
ATOM   923  C CD2 . PHE A 1 131 ? 23.693  -12.746 25.586 1.00 80.04  ? 1638 PHE A CD2 1 
ATOM   924  C CE1 . PHE A 1 131 ? 24.576  -12.094 28.137 1.00 79.67  ? 1638 PHE A CE1 1 
ATOM   925  C CE2 . PHE A 1 131 ? 22.798  -12.758 26.656 1.00 80.00  ? 1638 PHE A CE2 1 
ATOM   926  C CZ  . PHE A 1 131 ? 23.241  -12.431 27.933 1.00 79.82  ? 1638 PHE A CZ  1 
ATOM   927  N N   . SER A 1 132 ? 28.552  -10.511 24.015 1.00 82.42  ? 1639 SER A N   1 
ATOM   928  C CA  . SER A 1 132 ? 29.908  -10.403 23.498 1.00 82.40  ? 1639 SER A CA  1 
ATOM   929  C C   . SER A 1 132 ? 30.902  -11.015 24.479 1.00 82.19  ? 1639 SER A C   1 
ATOM   930  O O   . SER A 1 132 ? 30.882  -10.704 25.671 1.00 82.03  ? 1639 SER A O   1 
ATOM   931  C CB  . SER A 1 132 ? 30.261  -8.938  23.227 1.00 82.46  ? 1639 SER A CB  1 
ATOM   932  O OG  . SER A 1 132 ? 29.335  -8.345  22.333 1.00 82.68  ? 1639 SER A OG  1 
ATOM   933  N N   . TRP A 1 133 ? 31.759  -11.895 23.967 1.00 84.17  ? 1640 TRP A N   1 
ATOM   934  C CA  . TRP A 1 133 ? 32.819  -12.513 24.760 1.00 84.00  ? 1640 TRP A CA  1 
ATOM   935  C C   . TRP A 1 133 ? 34.144  -12.381 24.011 1.00 84.08  ? 1640 TRP A C   1 
ATOM   936  O O   . TRP A 1 133 ? 34.294  -12.897 22.902 1.00 84.23  ? 1640 TRP A O   1 
ATOM   937  C CB  . TRP A 1 133 ? 32.500  -13.988 25.031 1.00 83.95  ? 1640 TRP A CB  1 
ATOM   938  C CG  . TRP A 1 133 ? 33.285  -14.606 26.165 1.00 83.77  ? 1640 TRP A CG  1 
ATOM   939  C CD1 . TRP A 1 133 ? 34.546  -14.269 26.578 1.00 83.69  ? 1640 TRP A CD1 1 
ATOM   940  C CD2 . TRP A 1 133 ? 32.868  -15.690 27.008 1.00 83.66  ? 1640 TRP A CD2 1 
ATOM   941  N NE1 . TRP A 1 133 ? 34.929  -15.061 27.631 1.00 83.55  ? 1640 TRP A NE1 1 
ATOM   942  C CE2 . TRP A 1 133 ? 33.922  -15.945 27.914 1.00 83.52  ? 1640 TRP A CE2 1 
ATOM   943  C CE3 . TRP A 1 133 ? 31.704  -16.467 27.089 1.00 83.68  ? 1640 TRP A CE3 1 
ATOM   944  C CZ2 . TRP A 1 133 ? 33.847  -16.944 28.891 1.00 83.41  ? 1640 TRP A CZ2 1 
ATOM   945  C CZ3 . TRP A 1 133 ? 31.631  -17.459 28.063 1.00 83.56  ? 1640 TRP A CZ3 1 
ATOM   946  C CH2 . TRP A 1 133 ? 32.697  -17.688 28.949 1.00 83.42  ? 1640 TRP A CH2 1 
ATOM   947  N N   . HIS A 1 134 ? 35.098  -11.685 24.622 1.00 85.93  ? 1641 HIS A N   1 
ATOM   948  C CA  . HIS A 1 134 ? 36.383  -11.417 23.981 1.00 86.02  ? 1641 HIS A CA  1 
ATOM   949  C C   . HIS A 1 134 ? 37.498  -12.300 24.545 1.00 85.93  ? 1641 HIS A C   1 
ATOM   950  O O   . HIS A 1 134 ? 37.974  -12.083 25.662 1.00 85.77  ? 1641 HIS A O   1 
ATOM   951  C CB  . HIS A 1 134 ? 36.734  -9.927  24.093 1.00 86.02  ? 1641 HIS A CB  1 
ATOM   952  C CG  . HIS A 1 134 ? 35.891  -9.038  23.229 1.00 86.17  ? 1641 HIS A CG  1 
ATOM   953  N ND1 . HIS A 1 134 ? 34.528  -8.914  23.392 1.00 86.17  ? 1641 HIS A ND1 1 
ATOM   954  C CD2 . HIS A 1 134 ? 36.222  -8.220  22.202 1.00 86.35  ? 1641 HIS A CD2 1 
ATOM   955  C CE1 . HIS A 1 134 ? 34.054  -8.071  22.493 1.00 86.34  ? 1641 HIS A CE1 1 
ATOM   956  N NE2 . HIS A 1 134 ? 35.061  -7.630  21.763 1.00 86.46  ? 1641 HIS A NE2 1 
ATOM   957  N N   . THR A 1 135 ? 37.900  -13.300 23.762 1.00 91.91  ? 1642 THR A N   1 
ATOM   958  C CA  . THR A 1 135 ? 38.945  -14.249 24.158 1.00 91.87  ? 1642 THR A CA  1 
ATOM   959  C C   . THR A 1 135 ? 39.977  -14.470 23.054 1.00 92.07  ? 1642 THR A C   1 
ATOM   960  O O   . THR A 1 135 ? 39.665  -14.301 21.873 1.00 92.26  ? 1642 THR A O   1 
ATOM   961  C CB  . THR A 1 135 ? 38.361  -15.632 24.537 1.00 91.80  ? 1642 THR A CB  1 
ATOM   962  O OG1 . THR A 1 135 ? 37.352  -16.009 23.592 1.00 91.95  ? 1642 THR A OG1 1 
ATOM   963  C CG2 . THR A 1 135 ? 37.772  -15.609 25.936 1.00 91.60  ? 1642 THR A CG2 1 
ATOM   964  N N   . PRO A 1 136 ? 41.214  -14.852 23.434 1.00 98.11  ? 1643 PRO A N   1 
ATOM   965  C CA  . PRO A 1 136 ? 42.208  -15.286 22.451 1.00 98.31  ? 1643 PRO A CA  1 
ATOM   966  C C   . PRO A 1 136 ? 41.842  -16.625 21.804 1.00 98.43  ? 1643 PRO A C   1 
ATOM   967  O O   . PRO A 1 136 ? 42.446  -17.010 20.801 1.00 98.65  ? 1643 PRO A O   1 
ATOM   968  C CB  . PRO A 1 136 ? 43.487  -15.425 23.284 1.00 98.24  ? 1643 PRO A CB  1 
ATOM   969  C CG  . PRO A 1 136 ? 43.013  -15.668 24.669 1.00 98.00  ? 1643 PRO A CG  1 
ATOM   970  C CD  . PRO A 1 136 ? 41.756  -14.872 24.806 1.00 97.91  ? 1643 PRO A CD  1 
ATOM   971  N N   . LEU A 1 137 ? 40.857  -17.315 22.380 1.00 102.29 ? 1644 LEU A N   1 
ATOM   972  C CA  . LEU A 1 137 ? 40.347  -18.576 21.839 1.00 102.38 ? 1644 LEU A CA  1 
ATOM   973  C C   . LEU A 1 137 ? 39.691  -18.396 20.470 1.00 102.60 ? 1644 LEU A C   1 
ATOM   974  O O   . LEU A 1 137 ? 39.641  -19.334 19.671 1.00 102.78 ? 1644 LEU A O   1 
ATOM   975  C CB  . LEU A 1 137 ? 39.346  -19.206 22.813 1.00 102.18 ? 1644 LEU A CB  1 
ATOM   976  C CG  . LEU A 1 137 ? 39.884  -19.839 24.100 1.00 101.99 ? 1644 LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 137 ? 38.814  -19.847 25.180 1.00 101.79 ? 1644 LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 137 ? 40.411  -21.249 23.849 1.00 102.08 ? 1644 LEU A CD2 1 
ATOM   979  N N   . ALA A 1 138 ? 39.195  -17.187 20.211 1.00 100.05 ? 1645 ALA A N   1 
ATOM   980  C CA  . ALA A 1 138 ? 38.517  -16.865 18.957 1.00 100.28 ? 1645 ALA A CA  1 
ATOM   981  C C   . ALA A 1 138 ? 39.411  -16.079 17.990 1.00 100.50 ? 1645 ALA A C   1 
ATOM   982  O O   . ALA A 1 138 ? 38.925  -15.243 17.223 1.00 100.65 ? 1645 ALA A O   1 
ATOM   983  C CB  . ALA A 1 138 ? 37.224  -16.102 19.242 1.00 100.19 ? 1645 ALA A CB  1 
ATOM   984  N N   . CYS A 1 139 ? 40.712  -16.361 18.020 1.00 103.80 ? 1646 CYS A N   1 
ATOM   985  C CA  . CYS A 1 139 ? 41.676  -15.652 17.178 1.00 104.02 ? 1646 CYS A CA  1 
ATOM   986  C C   . CYS A 1 139 ? 42.383  -16.561 16.175 1.00 104.30 ? 1646 CYS A C   1 
ATOM   987  O O   . CYS A 1 139 ? 42.954  -17.591 16.545 1.00 104.27 ? 1646 CYS A O   1 
ATOM   988  C CB  . CYS A 1 139 ? 42.696  -14.903 18.038 1.00 103.87 ? 1646 CYS A CB  1 
ATOM   989  S SG  . CYS A 1 139 ? 41.984  -13.544 18.989 1.00 103.63 ? 1646 CYS A SG  1 
ATOM   990  N N   . GLU A 1 140 ? 42.336  -16.159 14.907 1.00 112.02 ? 1647 GLU A N   1 
ATOM   991  C CA  . GLU A 1 140 ? 42.938  -16.910 13.807 1.00 112.34 ? 1647 GLU A CA  1 
ATOM   992  C C   . GLU A 1 140 ? 44.354  -16.414 13.502 1.00 112.51 ? 1647 GLU A C   1 
ATOM   993  O O   . GLU A 1 140 ? 45.321  -17.170 13.619 1.00 112.58 ? 1647 GLU A O   1 
ATOM   994  C CB  . GLU A 1 140 ? 42.048  -16.823 12.560 1.00 112.62 ? 1647 GLU A CB  1 
ATOM   995  C CG  . GLU A 1 140 ? 42.647  -17.440 11.300 1.00 113.01 ? 1647 GLU A CG  1 
ATOM   996  C CD  . GLU A 1 140 ? 41.826  -17.154 10.057 1.00 113.32 ? 1647 GLU A CD  1 
ATOM   997  O OE1 . GLU A 1 140 ? 40.666  -17.613 9.985  1.00 113.29 ? 1647 GLU A OE1 1 
ATOM   998  O OE2 . GLU A 1 140 ? 42.346  -16.476 9.147  1.00 113.60 ? 1647 GLU A OE2 1 
ATOM   999  N N   . GLN A 1 141 ? 44.463  -15.146 13.108 1.00 113.48 ? 1648 GLN A N   1 
ATOM   1000 C CA  . GLN A 1 141 ? 45.749  -14.534 12.777 1.00 113.66 ? 1648 GLN A CA  1 
ATOM   1001 C C   . GLN A 1 141 ? 46.426  -13.956 14.016 1.00 113.39 ? 1648 GLN A C   1 
ATOM   1002 O O   . GLN A 1 141 ? 45.904  -14.056 15.129 1.00 113.07 ? 1648 GLN A O   1 
ATOM   1003 C CB  . GLN A 1 141 ? 45.566  -13.432 11.726 1.00 113.91 ? 1648 GLN A CB  1 
ATOM   1004 C CG  . GLN A 1 141 ? 45.332  -13.930 10.303 1.00 114.30 ? 1648 GLN A CG  1 
ATOM   1005 C CD  . GLN A 1 141 ? 45.243  -12.802 9.281  1.00 114.57 ? 1648 GLN A CD  1 
ATOM   1006 O OE1 . GLN A 1 141 ? 44.939  -11.655 9.619  1.00 114.45 ? 1648 GLN A OE1 1 
ATOM   1007 N NE2 . GLN A 1 141 ? 45.504  -13.129 8.021  1.00 114.96 ? 1648 GLN A NE2 1 
ATOM   1008 N N   . ALA A 1 142 ? 47.596  -13.357 13.811 1.00 112.94 ? 1649 ALA A N   1 
ATOM   1009 C CA  . ALA A 1 142 ? 48.291  -12.631 14.865 1.00 112.73 ? 1649 ALA A CA  1 
ATOM   1010 C C   . ALA A 1 142 ? 47.814  -11.178 14.895 1.00 112.64 ? 1649 ALA A C   1 
ATOM   1011 O O   . ALA A 1 142 ? 46.855  -10.817 14.209 1.00 112.71 ? 1649 ALA A O   1 
ATOM   1012 C CB  . ALA A 1 142 ? 49.797  -12.706 14.652 1.00 112.95 ? 1649 ALA A CB  1 
ATOM   1013 N N   . THR A 1 143 ? 48.484  -10.353 15.695 1.00 107.08 ? 1650 THR A N   1 
ATOM   1014 C CA  . THR A 1 143 ? 48.142  -8.940  15.808 1.00 107.00 ? 1650 THR A CA  1 
ATOM   1015 C C   . THR A 1 143 ? 49.035  -8.101  14.888 1.00 107.29 ? 1650 THR A C   1 
ATOM   1016 O O   . THR A 1 143 ? 49.967  -7.433  15.346 1.00 107.25 ? 1650 THR A O   1 
ATOM   1017 C CB  . THR A 1 143 ? 48.253  -8.447  17.271 1.00 106.67 ? 1650 THR A CB  1 
ATOM   1018 O OG1 . THR A 1 143 ? 47.826  -9.482  18.165 1.00 106.46 ? 1650 THR A OG1 1 
ATOM   1019 C CG2 . THR A 1 143 ? 47.398  -7.205  17.490 1.00 106.52 ? 1650 THR A CG2 1 
ATOM   1020 N N   . GLU A 1 144 ? 48.750  -8.157  13.587 1.00 111.43 ? 1651 GLU A N   1 
ATOM   1021 C CA  . GLU A 1 144 ? 49.467  -7.349  12.600 1.00 111.75 ? 1651 GLU A CA  1 
ATOM   1022 C C   . GLU A 1 144 ? 49.136  -5.876  12.800 1.00 111.63 ? 1651 GLU A C   1 
ATOM   1023 O O   . GLU A 1 144 ? 48.017  -5.437  12.524 1.00 111.57 ? 1651 GLU A O   1 
ATOM   1024 C CB  . GLU A 1 144 ? 49.119  -7.784  11.175 1.00 112.10 ? 1651 GLU A CB  1 
ATOM   1025 C CG  . GLU A 1 144 ? 49.855  -9.027  10.695 1.00 112.35 ? 1651 GLU A CG  1 
ATOM   1026 C CD  . GLU A 1 144 ? 49.597  -9.335  9.228  1.00 112.75 ? 1651 GLU A CD  1 
ATOM   1027 O OE1 . GLU A 1 144 ? 50.581  -9.558  8.490  1.00 113.10 ? 1651 GLU A OE1 1 
ATOM   1028 O OE2 . GLU A 1 144 ? 48.417  -9.353  8.811  1.00 112.74 ? 1651 GLU A OE2 1 
ATOM   1029 N N   . CYS A 1 145 ? 50.116  -5.121  13.290 1.00 108.79 ? 1652 CYS A N   1 
ATOM   1030 C CA  . CYS A 1 145 ? 49.904  -3.723  13.650 1.00 108.67 ? 1652 CYS A CA  1 
ATOM   1031 C C   . CYS A 1 145 ? 51.121  -2.852  13.338 1.00 108.86 ? 1652 CYS A C   1 
ATOM   1032 O O   . CYS A 1 145 ? 51.069  -1.629  13.489 1.00 108.81 ? 1652 CYS A O   1 
ATOM   1033 C CB  . CYS A 1 145 ? 49.536  -3.619  15.134 1.00 108.27 ? 1652 CYS A CB  1 
ATOM   1034 S SG  . CYS A 1 145 ? 48.271  -2.384  15.525 1.00 108.08 ? 1652 CYS A SG  1 
ATOM   1035 N N   . SER A 1 146 ? 52.207  -3.484  12.895 1.00 116.36 ? 1653 SER A N   1 
ATOM   1036 C CA  . SER A 1 146 ? 53.452  -2.776  12.593 1.00 116.58 ? 1653 SER A CA  1 
ATOM   1037 C C   . SER A 1 146 ? 53.849  -2.848  11.116 1.00 117.03 ? 1653 SER A C   1 
ATOM   1038 O O   . SER A 1 146 ? 53.728  -3.896  10.476 1.00 117.21 ? 1653 SER A O   1 
ATOM   1039 C CB  . SER A 1 146 ? 54.594  -3.290  13.475 1.00 116.49 ? 1653 SER A CB  1 
ATOM   1040 O OG  . SER A 1 146 ? 54.758  -4.691  13.343 1.00 116.56 ? 1653 SER A OG  1 
ATOM   1041 N N   . VAL A 1 147 ? 54.320  -1.719  10.589 1.00 125.83 ? 1654 VAL A N   1 
ATOM   1042 C CA  . VAL A 1 147 ? 54.808  -1.626  9.212  1.00 126.29 ? 1654 VAL A CA  1 
ATOM   1043 C C   . VAL A 1 147 ? 56.232  -1.051  9.198  1.00 126.49 ? 1654 VAL A C   1 
ATOM   1044 O O   . VAL A 1 147 ? 56.669  -0.442  10.177 1.00 126.26 ? 1654 VAL A O   1 
ATOM   1045 C CB  . VAL A 1 147 ? 53.843  -0.793  8.318  1.00 126.43 ? 1654 VAL A CB  1 
ATOM   1046 C CG1 . VAL A 1 147 ? 53.943  0.703   8.626  1.00 126.35 ? 1654 VAL A CG1 1 
ATOM   1047 C CG2 . VAL A 1 147 ? 54.094  -1.068  6.836  1.00 126.93 ? 1654 VAL A CG2 1 
ATOM   1048 N N   . ARG A 1 148 ? 56.946  -1.249  8.092  1.00 140.29 ? 1655 ARG A N   1 
ATOM   1049 C CA  . ARG A 1 148 ? 58.351  -0.860  7.997  1.00 140.54 ? 1655 ARG A CA  1 
ATOM   1050 C C   . ARG A 1 148 ? 58.561  0.423   7.187  1.00 140.81 ? 1655 ARG A C   1 
ATOM   1051 O O   . ARG A 1 148 ? 58.136  0.518   6.033  1.00 141.15 ? 1655 ARG A O   1 
ATOM   1052 C CB  . ARG A 1 148 ? 59.169  -2.008  7.401  1.00 140.87 ? 1655 ARG A CB  1 
ATOM   1053 C CG  . ARG A 1 148 ? 60.615  -2.057  7.860  1.00 141.00 ? 1655 ARG A CG  1 
ATOM   1054 C CD  . ARG A 1 148 ? 61.328  -3.267  7.275  1.00 141.36 ? 1655 ARG A CD  1 
ATOM   1055 N NE  . ARG A 1 148 ? 62.563  -3.578  7.991  1.00 141.39 ? 1655 ARG A NE  1 
ATOM   1056 C CZ  . ARG A 1 148 ? 62.639  -4.371  9.057  1.00 141.09 ? 1655 ARG A CZ  1 
ATOM   1057 N NH1 . ARG A 1 148 ? 61.548  -4.946  9.550  1.00 140.73 ? 1655 ARG A NH1 1 
ATOM   1058 N NH2 . ARG A 1 148 ? 63.813  -4.589  9.636  1.00 141.17 ? 1655 ARG A NH2 1 
ATOM   1059 N N   . ASN A 1 149 ? 59.213  1.405   7.811  1.00 144.39 ? 1656 ASN A N   1 
ATOM   1060 C CA  . ASN A 1 149 ? 59.611  2.647   7.146  1.00 144.65 ? 1656 ASN A CA  1 
ATOM   1061 C C   . ASN A 1 149 ? 61.132  2.685   6.984  1.00 144.97 ? 1656 ASN A C   1 
ATOM   1062 O O   . ASN A 1 149 ? 61.838  3.374   7.726  1.00 144.85 ? 1656 ASN A O   1 
ATOM   1063 C CB  . ASN A 1 149 ? 59.096  3.871   7.923  1.00 144.31 ? 1656 ASN A CB  1 
ATOM   1064 C CG  . ASN A 1 149 ? 59.425  5.200   7.238  1.00 144.57 ? 1656 ASN A CG  1 
ATOM   1065 O OD1 . ASN A 1 149 ? 59.409  5.306   6.009  1.00 144.97 ? 1656 ASN A OD1 1 
ATOM   1066 N ND2 . ASN A 1 149 ? 59.713  6.222   8.052  1.00 144.35 ? 1656 ASN A ND2 1 
ATOM   1067 N N   . GLY A 1 150 ? 61.625  1.919   6.014  1.00 165.50 ? 1657 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 150 ? 63.060  1.788   5.776  1.00 165.86 ? 1657 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 150 ? 63.665  0.683   6.619  1.00 165.73 ? 1657 GLY A C   1 
ATOM   1070 O O   . GLY A 1 150 ? 63.300  -0.487  6.478  1.00 165.72 ? 1657 GLY A O   1 
ATOM   1071 N N   . SER A 1 151 ? 64.592  1.058   7.495  1.00 167.26 ? 1658 SER A N   1 
ATOM   1072 C CA  . SER A 1 151 ? 65.232  0.113   8.408  1.00 167.13 ? 1658 SER A CA  1 
ATOM   1073 C C   . SER A 1 151 ? 64.543  0.089   9.773  1.00 166.57 ? 1658 SER A C   1 
ATOM   1074 O O   . SER A 1 151 ? 64.549  -0.934  10.460 1.00 166.39 ? 1658 SER A O   1 
ATOM   1075 C CB  . SER A 1 151 ? 66.722  0.434   8.565  1.00 167.39 ? 1658 SER A CB  1 
ATOM   1076 O OG  . SER A 1 151 ? 66.920  1.769   8.997  1.00 167.26 ? 1658 SER A OG  1 
ATOM   1077 N N   . SER A 1 152 ? 63.953  1.221   10.153 1.00 143.12 ? 1659 SER A N   1 
ATOM   1078 C CA  . SER A 1 152 ? 63.227  1.342   11.415 1.00 142.61 ? 1659 SER A CA  1 
ATOM   1079 C C   . SER A 1 152 ? 61.757  0.956   11.254 1.00 142.39 ? 1659 SER A C   1 
ATOM   1080 O O   . SER A 1 152 ? 61.079  1.419   10.332 1.00 142.54 ? 1659 SER A O   1 
ATOM   1081 C CB  . SER A 1 152 ? 63.358  2.760   11.983 1.00 142.45 ? 1659 SER A CB  1 
ATOM   1082 O OG  . SER A 1 152 ? 63.035  3.740   11.012 1.00 142.63 ? 1659 SER A OG  1 
ATOM   1083 N N   . ILE A 1 153 ? 61.280  0.100   12.156 1.00 131.54 ? 1660 ILE A N   1 
ATOM   1084 C CA  . ILE A 1 153 ? 59.902  -0.392  12.126 1.00 131.32 ? 1660 ILE A CA  1 
ATOM   1085 C C   . ILE A 1 153 ? 58.976  0.480   12.984 1.00 130.91 ? 1660 ILE A C   1 
ATOM   1086 O O   . ILE A 1 153 ? 59.294  0.799   14.132 1.00 130.65 ? 1660 ILE A O   1 
ATOM   1087 C CB  . ILE A 1 153 ? 59.817  -1.906  12.525 1.00 131.25 ? 1660 ILE A CB  1 
ATOM   1088 C CG1 . ILE A 1 153 ? 58.382  -2.437  12.385 1.00 131.05 ? 1660 ILE A CG1 1 
ATOM   1089 C CG2 . ILE A 1 153 ? 60.397  -2.154  13.930 1.00 131.00 ? 1660 ILE A CG2 1 
ATOM   1090 C CD1 . ILE A 1 153 ? 58.279  -3.952  12.273 1.00 131.12 ? 1660 ILE A CD1 1 
ATOM   1091 N N   . VAL A 1 154 ? 57.844  0.874   12.404 1.00 116.45 ? 1661 VAL A N   1 
ATOM   1092 C CA  . VAL A 1 154 ? 56.852  1.698   13.095 1.00 116.11 ? 1661 VAL A CA  1 
ATOM   1093 C C   . VAL A 1 154 ? 55.658  0.836   13.505 1.00 115.85 ? 1661 VAL A C   1 
ATOM   1094 O O   . VAL A 1 154 ? 55.118  0.085   12.691 1.00 115.99 ? 1661 VAL A O   1 
ATOM   1095 C CB  . VAL A 1 154 ? 56.388  2.897   12.224 1.00 116.26 ? 1661 VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 154 ? 55.379  3.761   12.972 1.00 115.92 ? 1661 VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 154 ? 57.582  3.744   11.792 1.00 116.53 ? 1661 VAL A CG2 1 
ATOM   1098 N N   . ASP A 1 155 ? 55.263  0.949   14.771 1.00 108.15 ? 1662 ASP A N   1 
ATOM   1099 C CA  . ASP A 1 155 ? 54.167  0.159   15.326 1.00 107.88 ? 1662 ASP A CA  1 
ATOM   1100 C C   . ASP A 1 155 ? 53.030  1.053   15.824 1.00 107.63 ? 1662 ASP A C   1 
ATOM   1101 O O   . ASP A 1 155 ? 53.257  2.194   16.234 1.00 107.56 ? 1662 ASP A O   1 
ATOM   1102 C CB  . ASP A 1 155 ? 54.682  -0.733  16.463 1.00 107.68 ? 1662 ASP A CB  1 
ATOM   1103 C CG  . ASP A 1 155 ? 53.758  -1.909  16.763 1.00 107.51 ? 1662 ASP A CG  1 
ATOM   1104 O OD1 . ASP A 1 155 ? 52.748  -2.098  16.051 1.00 107.55 ? 1662 ASP A OD1 1 
ATOM   1105 O OD2 . ASP A 1 155 ? 54.053  -2.654  17.721 1.00 107.34 ? 1662 ASP A OD2 1 
ATOM   1106 N N   . LEU A 1 156 ? 51.809  0.522   15.779 1.00 100.60 ? 1663 LEU A N   1 
ATOM   1107 C CA  . LEU A 1 156 ? 50.616  1.240   16.230 1.00 100.39 ? 1663 LEU A CA  1 
ATOM   1108 C C   . LEU A 1 156 ? 49.986  0.584   17.464 1.00 100.05 ? 1663 LEU A C   1 
ATOM   1109 O O   . LEU A 1 156 ? 48.881  0.948   17.877 1.00 99.88  ? 1663 LEU A O   1 
ATOM   1110 C CB  . LEU A 1 156 ? 49.588  1.332   15.094 1.00 100.56 ? 1663 LEU A CB  1 
ATOM   1111 C CG  . LEU A 1 156 ? 49.942  2.133   13.836 1.00 100.91 ? 1663 LEU A CG  1 
ATOM   1112 C CD1 . LEU A 1 156 ? 49.015  1.756   12.693 1.00 101.10 ? 1663 LEU A CD1 1 
ATOM   1113 C CD2 . LEU A 1 156 ? 49.895  3.635   14.090 1.00 100.88 ? 1663 LEU A CD2 1 
ATOM   1114 N N   . SER A 1 157 ? 50.710  -0.366  18.056 1.00 97.36  ? 1664 SER A N   1 
ATOM   1115 C CA  . SER A 1 157 ? 50.223  -1.155  19.194 1.00 97.08  ? 1664 SER A CA  1 
ATOM   1116 C C   . SER A 1 157 ? 49.811  -0.372  20.448 1.00 96.80  ? 1664 SER A C   1 
ATOM   1117 O O   . SER A 1 157 ? 48.881  -0.789  21.140 1.00 96.59  ? 1664 SER A O   1 
ATOM   1118 C CB  . SER A 1 157 ? 51.228  -2.250  19.565 1.00 97.10  ? 1664 SER A CB  1 
ATOM   1119 O OG  . SER A 1 157 ? 51.255  -3.268  18.581 1.00 97.29  ? 1664 SER A OG  1 
ATOM   1120 N N   . PRO A 1 158 ? 50.501  0.750   20.759 1.00 91.90  ? 1665 PRO A N   1 
ATOM   1121 C CA  . PRO A 1 158 ? 50.058  1.562   21.899 1.00 91.66  ? 1665 PRO A CA  1 
ATOM   1122 C C   . PRO A 1 158 ? 48.693  2.230   21.699 1.00 91.60  ? 1665 PRO A C   1 
ATOM   1123 O O   . PRO A 1 158 ? 48.000  2.512   22.680 1.00 91.38  ? 1665 PRO A O   1 
ATOM   1124 C CB  . PRO A 1 158 ? 51.151  2.630   22.012 1.00 91.75  ? 1665 PRO A CB  1 
ATOM   1125 C CG  . PRO A 1 158 ? 51.733  2.720   20.649 1.00 92.05  ? 1665 PRO A CG  1 
ATOM   1126 C CD  . PRO A 1 158 ? 51.714  1.316   20.139 1.00 92.13  ? 1665 PRO A CD  1 
ATOM   1127 N N   . LEU A 1 159 ? 48.313  2.471   20.446 1.00 91.10  ? 1666 LEU A N   1 
ATOM   1128 C CA  . LEU A 1 159 ? 47.057  3.155   20.138 1.00 91.08  ? 1666 LEU A CA  1 
ATOM   1129 C C   . LEU A 1 159 ? 45.817  2.263   20.237 1.00 90.98  ? 1666 LEU A C   1 
ATOM   1130 O O   . LEU A 1 159 ? 44.693  2.743   20.070 1.00 90.98  ? 1666 LEU A O   1 
ATOM   1131 C CB  . LEU A 1 159 ? 47.122  3.815   18.756 1.00 91.36  ? 1666 LEU A CB  1 
ATOM   1132 C CG  . LEU A 1 159 ? 47.948  5.090   18.561 1.00 91.47  ? 1666 LEU A CG  1 
ATOM   1133 C CD1 . LEU A 1 159 ? 47.790  5.578   17.133 1.00 91.76  ? 1666 LEU A CD1 1 
ATOM   1134 C CD2 . LEU A 1 159 ? 47.545  6.188   19.536 1.00 91.27  ? 1666 LEU A CD2 1 
ATOM   1135 N N   . ILE A 1 160 ? 46.020  0.975   20.511 1.00 89.22  ? 1667 ILE A N   1 
ATOM   1136 C CA  . ILE A 1 160 ? 44.910  0.031   20.651 1.00 89.13  ? 1667 ILE A CA  1 
ATOM   1137 C C   . ILE A 1 160 ? 44.086  0.335   21.903 1.00 88.88  ? 1667 ILE A C   1 
ATOM   1138 O O   . ILE A 1 160 ? 44.586  0.243   23.029 1.00 88.71  ? 1667 ILE A O   1 
ATOM   1139 C CB  . ILE A 1 160 ? 45.392  -1.447  20.676 1.00 89.12  ? 1667 ILE A CB  1 
ATOM   1140 C CG1 . ILE A 1 160 ? 46.162  -1.788  19.396 1.00 89.41  ? 1667 ILE A CG1 1 
ATOM   1141 C CG2 . ILE A 1 160 ? 44.206  -2.399  20.856 1.00 89.02  ? 1667 ILE A CG2 1 
ATOM   1142 C CD1 . ILE A 1 160 ? 46.950  -3.091  19.464 1.00 89.43  ? 1667 ILE A CD1 1 
ATOM   1143 N N   . HIS A 1 161 ? 42.827  0.714   21.688 1.00 83.83  ? 1668 HIS A N   1 
ATOM   1144 C CA  . HIS A 1 161 ? 41.875  0.920   22.773 1.00 83.64  ? 1668 HIS A CA  1 
ATOM   1145 C C   . HIS A 1 161 ? 41.450  -0.453  23.292 1.00 83.52  ? 1668 HIS A C   1 
ATOM   1146 O O   . HIS A 1 161 ? 40.899  -1.261  22.541 1.00 83.61  ? 1668 HIS A O   1 
ATOM   1147 C CB  . HIS A 1 161 ? 40.660  1.709   22.277 1.00 83.72  ? 1668 HIS A CB  1 
ATOM   1148 C CG  . HIS A 1 161 ? 40.017  2.563   23.327 1.00 83.58  ? 1668 HIS A CG  1 
ATOM   1149 N ND1 . HIS A 1 161 ? 39.275  2.041   24.364 1.00 83.41  ? 1668 HIS A ND1 1 
ATOM   1150 C CD2 . HIS A 1 161 ? 39.998  3.907   23.493 1.00 83.59  ? 1668 HIS A CD2 1 
ATOM   1151 C CE1 . HIS A 1 161 ? 38.829  3.024   25.125 1.00 83.34  ? 1668 HIS A CE1 1 
ATOM   1152 N NE2 . HIS A 1 161 ? 39.255  4.168   24.619 1.00 83.44  ? 1668 HIS A NE2 1 
ATOM   1153 N N   . ARG A 1 162 ? 41.723  -0.714  24.570 1.00 82.09  ? 1669 ARG A N   1 
ATOM   1154 C CA  . ARG A 1 162 ? 41.486  -2.036  25.161 1.00 81.98  ? 1669 ARG A CA  1 
ATOM   1155 C C   . ARG A 1 162 ? 40.387  -2.062  26.228 1.00 81.82  ? 1669 ARG A C   1 
ATOM   1156 O O   . ARG A 1 162 ? 40.202  -3.071  26.912 1.00 81.71  ? 1669 ARG A O   1 
ATOM   1157 C CB  . ARG A 1 162 ? 42.788  -2.617  25.722 1.00 81.92  ? 1669 ARG A CB  1 
ATOM   1158 C CG  . ARG A 1 162 ? 43.791  -3.030  24.661 1.00 82.10  ? 1669 ARG A CG  1 
ATOM   1159 C CD  . ARG A 1 162 ? 45.089  -3.478  25.293 1.00 82.06  ? 1669 ARG A CD  1 
ATOM   1160 N NE  . ARG A 1 162 ? 46.149  -3.634  24.302 1.00 82.26  ? 1669 ARG A NE  1 
ATOM   1161 C CZ  . ARG A 1 162 ? 47.435  -3.802  24.596 1.00 82.29  ? 1669 ARG A CZ  1 
ATOM   1162 N NH1 . ARG A 1 162 ? 47.839  -3.835  25.861 1.00 82.14  ? 1669 ARG A NH1 1 
ATOM   1163 N NH2 . ARG A 1 162 ? 48.322  -3.934  23.620 1.00 82.51  ? 1669 ARG A NH2 1 
ATOM   1164 N N   . THR A 1 163 ? 39.661  -0.955  26.360 1.00 78.29  ? 1670 THR A N   1 
ATOM   1165 C CA  . THR A 1 163 ? 38.552  -0.861  27.310 1.00 78.18  ? 1670 THR A CA  1 
ATOM   1166 C C   . THR A 1 163 ? 37.227  -0.574  26.609 1.00 78.29  ? 1670 THR A C   1 
ATOM   1167 O O   . THR A 1 163 ? 36.166  -1.003  27.068 1.00 78.24  ? 1670 THR A O   1 
ATOM   1168 C CB  . THR A 1 163 ? 38.805  0.215   28.387 1.00 78.09  ? 1670 THR A CB  1 
ATOM   1169 O OG1 . THR A 1 163 ? 39.213  1.438   27.761 1.00 78.19  ? 1670 THR A OG1 1 
ATOM   1170 C CG2 . THR A 1 163 ? 39.886  -0.241  29.358 1.00 77.97  ? 1670 THR A CG2 1 
ATOM   1171 N N   . GLY A 1 164 ? 37.303  0.151   25.496 1.00 80.74  ? 1671 GLY A N   1 
ATOM   1172 C CA  . GLY A 1 164 ? 36.133  0.512   24.702 1.00 80.89  ? 1671 GLY A CA  1 
ATOM   1173 C C   . GLY A 1 164 ? 36.539  0.942   23.308 1.00 81.10  ? 1671 GLY A C   1 
ATOM   1174 O O   . GLY A 1 164 ? 36.967  0.119   22.497 1.00 81.19  ? 1671 GLY A O   1 
ATOM   1175 N N   . GLY A 1 165 ? 36.417  2.238   23.039 1.00 84.05  ? 1672 GLY A N   1 
ATOM   1176 C CA  . GLY A 1 165 ? 36.795  2.800   21.746 1.00 84.27  ? 1672 GLY A CA  1 
ATOM   1177 C C   . GLY A 1 165 ? 37.014  4.301   21.776 1.00 84.31  ? 1672 GLY A C   1 
ATOM   1178 O O   . GLY A 1 165 ? 36.912  4.934   22.830 1.00 84.17  ? 1672 GLY A O   1 
ATOM   1179 N N   . TYR A 1 166 ? 37.322  4.861   20.608 1.00 86.13  ? 1673 TYR A N   1 
ATOM   1180 C CA  . TYR A 1 166 ? 37.511  6.299   20.444 1.00 86.21  ? 1673 TYR A CA  1 
ATOM   1181 C C   . TYR A 1 166 ? 36.226  6.941   19.932 1.00 86.36  ? 1673 TYR A C   1 
ATOM   1182 O O   . TYR A 1 166 ? 35.726  6.575   18.865 1.00 86.57  ? 1673 TYR A O   1 
ATOM   1183 C CB  . TYR A 1 166 ? 38.655  6.586   19.465 1.00 86.38  ? 1673 TYR A CB  1 
ATOM   1184 C CG  . TYR A 1 166 ? 40.028  6.157   19.938 1.00 86.26  ? 1673 TYR A CG  1 
ATOM   1185 C CD1 . TYR A 1 166 ? 40.882  7.061   20.567 1.00 86.18  ? 1673 TYR A CD1 1 
ATOM   1186 C CD2 . TYR A 1 166 ? 40.481  4.851   19.741 1.00 86.25  ? 1673 TYR A CD2 1 
ATOM   1187 C CE1 . TYR A 1 166 ? 42.150  6.675   20.997 1.00 86.10  ? 1673 TYR A CE1 1 
ATOM   1188 C CE2 . TYR A 1 166 ? 41.745  4.455   20.168 1.00 86.17  ? 1673 TYR A CE2 1 
ATOM   1189 C CZ  . TYR A 1 166 ? 42.573  5.371   20.794 1.00 86.10  ? 1673 TYR A CZ  1 
ATOM   1190 O OH  . TYR A 1 166 ? 43.822  4.984   21.218 1.00 86.04  ? 1673 TYR A OH  1 
ATOM   1191 N N   . GLU A 1 167 ? 35.694  7.891   20.697 1.00 91.12  ? 1674 GLU A N   1 
ATOM   1192 C CA  . GLU A 1 167 ? 34.492  8.624   20.302 1.00 91.28  ? 1674 GLU A CA  1 
ATOM   1193 C C   . GLU A 1 167 ? 34.831  9.680   19.256 1.00 91.51  ? 1674 GLU A C   1 
ATOM   1194 O O   . GLU A 1 167 ? 35.790  10.438  19.418 1.00 91.47  ? 1674 GLU A O   1 
ATOM   1195 C CB  . GLU A 1 167 ? 33.826  9.279   21.515 1.00 91.15  ? 1674 GLU A CB  1 
ATOM   1196 C CG  . GLU A 1 167 ? 33.177  8.297   22.483 1.00 90.98  ? 1674 GLU A CG  1 
ATOM   1197 C CD  . GLU A 1 167 ? 32.412  8.979   23.607 1.00 90.91  ? 1674 GLU A CD  1 
ATOM   1198 O OE1 . GLU A 1 167 ? 32.238  10.216  23.563 1.00 91.01  ? 1674 GLU A OE1 1 
ATOM   1199 O OE2 . GLU A 1 167 ? 31.980  8.269   24.540 1.00 90.77  ? 1674 GLU A OE2 1 
ATOM   1200 N N   . ALA A 1 168 ? 34.042  9.723   18.187 1.00 96.64  ? 1675 ALA A N   1 
ATOM   1201 C CA  . ALA A 1 168 ? 34.291  10.650  17.085 1.00 96.90  ? 1675 ALA A CA  1 
ATOM   1202 C C   . ALA A 1 168 ? 33.612  12.002  17.282 1.00 96.97  ? 1675 ALA A C   1 
ATOM   1203 O O   . ALA A 1 168 ? 32.598  12.112  17.977 1.00 96.92  ? 1675 ALA A O   1 
ATOM   1204 C CB  . ALA A 1 168 ? 33.875  10.033  15.767 1.00 97.16  ? 1675 ALA A CB  1 
ATOM   1205 N N   . TYR A 1 169 ? 34.190  13.020  16.650 1.00 106.12 ? 1676 TYR A N   1 
ATOM   1206 C CA  . TYR A 1 169 ? 33.727  14.402  16.744 1.00 106.21 ? 1676 TYR A CA  1 
ATOM   1207 C C   . TYR A 1 169 ? 32.369  14.606  16.066 1.00 106.47 ? 1676 TYR A C   1 
ATOM   1208 O O   . TYR A 1 169 ? 32.116  14.064  14.985 1.00 106.70 ? 1676 TYR A O   1 
ATOM   1209 C CB  . TYR A 1 169 ? 34.785  15.333  16.134 1.00 106.32 ? 1676 TYR A CB  1 
ATOM   1210 C CG  . TYR A 1 169 ? 34.463  16.813  16.179 1.00 106.43 ? 1676 TYR A CG  1 
ATOM   1211 C CD1 . TYR A 1 169 ? 34.053  17.491  15.028 1.00 106.74 ? 1676 TYR A CD1 1 
ATOM   1212 C CD2 . TYR A 1 169 ? 34.582  17.541  17.365 1.00 106.22 ? 1676 TYR A CD2 1 
ATOM   1213 C CE1 . TYR A 1 169 ? 33.760  18.854  15.058 1.00 106.85 ? 1676 TYR A CE1 1 
ATOM   1214 C CE2 . TYR A 1 169 ? 34.290  18.904  17.407 1.00 106.33 ? 1676 TYR A CE2 1 
ATOM   1215 C CZ  . TYR A 1 169 ? 33.881  19.553  16.251 1.00 106.64 ? 1676 TYR A CZ  1 
ATOM   1216 O OH  . TYR A 1 169 ? 33.592  20.898  16.286 1.00 106.75 ? 1676 TYR A OH  1 
ATOM   1217 N N   . ASP A 1 170 ? 31.506  15.384  16.720 1.00 115.45 ? 1677 ASP A N   1 
ATOM   1218 C CA  . ASP A 1 170 ? 30.213  15.781  16.162 1.00 115.72 ? 1677 ASP A CA  1 
ATOM   1219 C C   . ASP A 1 170 ? 30.454  16.777  15.022 1.00 116.01 ? 1677 ASP A C   1 
ATOM   1220 O O   . ASP A 1 170 ? 30.496  17.994  15.236 1.00 116.05 ? 1677 ASP A O   1 
ATOM   1221 C CB  . ASP A 1 170 ? 29.327  16.392  17.260 1.00 115.63 ? 1677 ASP A CB  1 
ATOM   1222 C CG  . ASP A 1 170 ? 27.834  16.281  16.957 1.00 115.85 ? 1677 ASP A CG  1 
ATOM   1223 O OD1 . ASP A 1 170 ? 27.455  16.086  15.781 1.00 116.12 ? 1677 ASP A OD1 1 
ATOM   1224 O OD2 . ASP A 1 170 ? 27.034  16.396  17.910 1.00 115.76 ? 1677 ASP A OD2 1 
ATOM   1225 N N   . GLU A 1 171 ? 30.616  16.237  13.814 1.00 118.77 ? 1678 GLU A N   1 
ATOM   1226 C CA  . GLU A 1 171 ? 31.051  16.997  12.634 1.00 119.07 ? 1678 GLU A CA  1 
ATOM   1227 C C   . GLU A 1 171 ? 30.178  18.210  12.280 1.00 119.32 ? 1678 GLU A C   1 
ATOM   1228 O O   . GLU A 1 171 ? 30.700  19.287  11.983 1.00 119.41 ? 1678 GLU A O   1 
ATOM   1229 C CB  . GLU A 1 171 ? 31.230  16.070  11.417 1.00 119.29 ? 1678 GLU A CB  1 
ATOM   1230 C CG  . GLU A 1 171 ? 29.968  15.325  10.942 1.00 119.48 ? 1678 GLU A CG  1 
ATOM   1231 C CD  . GLU A 1 171 ? 29.546  14.184  11.862 1.00 119.19 ? 1678 GLU A CD  1 
ATOM   1232 O OE1 . GLU A 1 171 ? 30.422  13.560  12.499 1.00 118.93 ? 1678 GLU A OE1 1 
ATOM   1233 O OE2 . GLU A 1 171 ? 28.329  13.910  11.941 1.00 119.26 ? 1678 GLU A OE2 1 
ATOM   1234 N N   . SER A 1 172 ? 28.859  18.026  12.318 1.00 129.51 ? 1679 SER A N   1 
ATOM   1235 C CA  . SER A 1 172 ? 27.911  19.082  11.969 1.00 129.79 ? 1679 SER A CA  1 
ATOM   1236 C C   . SER A 1 172 ? 26.586  18.889  12.699 1.00 129.77 ? 1679 SER A C   1 
ATOM   1237 O O   . SER A 1 172 ? 26.187  19.723  13.513 1.00 129.76 ? 1679 SER A O   1 
ATOM   1238 C CB  . SER A 1 172 ? 27.681  19.118  10.455 1.00 130.20 ? 1679 SER A CB  1 
ATOM   1239 O OG  . SER A 1 172 ? 26.919  20.251  10.076 1.00 130.49 ? 1679 SER A OG  1 
ATOM   1240 N N   . THR A 1 179 ? 26.722  12.861  26.763 1.00 121.26 ? 1686 THR A N   1 
ATOM   1241 C CA  . THR A 1 179 ? 27.342  13.215  25.490 1.00 121.34 ? 1686 THR A CA  1 
ATOM   1242 C C   . THR A 1 179 ? 26.769  12.395  24.334 1.00 121.50 ? 1686 THR A C   1 
ATOM   1243 O O   . THR A 1 179 ? 26.620  11.174  24.442 1.00 121.41 ? 1686 THR A O   1 
ATOM   1244 C CB  . THR A 1 179 ? 28.853  13.042  25.573 1.00 121.13 ? 1686 THR A CB  1 
ATOM   1245 N N   . ASN A 1 180 ? 26.450  13.076  23.234 1.00 117.56 ? 1687 ASN A N   1 
ATOM   1246 C CA  . ASN A 1 180 ? 25.916  12.431  22.034 1.00 117.77 ? 1687 ASN A CA  1 
ATOM   1247 C C   . ASN A 1 180 ? 27.019  12.187  20.997 1.00 117.77 ? 1687 ASN A C   1 
ATOM   1248 O O   . ASN A 1 180 ? 27.551  13.140  20.421 1.00 117.88 ? 1687 ASN A O   1 
ATOM   1249 C CB  . ASN A 1 180 ? 24.785  13.262  21.439 1.00 118.08 ? 1687 ASN A CB  1 
ATOM   1250 N N   . PRO A 1 181 ? 27.368  10.906  20.762 1.00 105.23 ? 1688 PRO A N   1 
ATOM   1251 C CA  . PRO A 1 181 ? 28.447  10.529  19.850 1.00 105.24 ? 1688 PRO A CA  1 
ATOM   1252 C C   . PRO A 1 181 ? 27.977  10.342  18.406 1.00 105.55 ? 1688 PRO A C   1 
ATOM   1253 O O   . PRO A 1 181 ? 26.794  10.527  18.108 1.00 105.76 ? 1688 PRO A O   1 
ATOM   1254 C CB  . PRO A 1 181 ? 28.911  9.191   20.420 1.00 105.02 ? 1688 PRO A CB  1 
ATOM   1255 C CG  . PRO A 1 181 ? 27.661  8.584   20.972 1.00 105.03 ? 1688 PRO A CG  1 
ATOM   1256 C CD  . PRO A 1 181 ? 26.743  9.718   21.375 1.00 105.13 ? 1688 PRO A CD  1 
ATOM   1257 N N   . ASP A 1 182 ? 28.908  9.978   17.526 1.00 102.73 ? 1689 ASP A N   1 
ATOM   1258 C CA  . ASP A 1 182 ? 28.593  9.673   16.130 1.00 103.03 ? 1689 ASP A CA  1 
ATOM   1259 C C   . ASP A 1 182 ? 29.288  8.403   15.632 1.00 103.00 ? 1689 ASP A C   1 
ATOM   1260 O O   . ASP A 1 182 ? 28.665  7.576   14.964 1.00 103.17 ? 1689 ASP A O   1 
ATOM   1261 C CB  . ASP A 1 182 ? 28.919  10.863  15.219 1.00 103.27 ? 1689 ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 182 ? 27.780  11.871  15.133 1.00 103.48 ? 1689 ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 182 ? 26.603  11.474  15.278 1.00 103.58 ? 1689 ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 182 ? 28.064  13.066  14.906 1.00 103.56 ? 1689 ASP A OD2 1 
ATOM   1265 N N   . PHE A 1 183 ? 30.573  8.254   15.958 1.00 95.52  ? 1690 PHE A N   1 
ATOM   1266 C CA  . PHE A 1 183 ? 31.347  7.079   15.545 1.00 95.49  ? 1690 PHE A CA  1 
ATOM   1267 C C   . PHE A 1 183 ? 32.181  6.481   16.685 1.00 95.16  ? 1690 PHE A C   1 
ATOM   1268 O O   . PHE A 1 183 ? 32.534  7.176   17.641 1.00 94.96  ? 1690 PHE A O   1 
ATOM   1269 C CB  . PHE A 1 183 ? 32.263  7.407   14.356 1.00 95.71  ? 1690 PHE A CB  1 
ATOM   1270 C CG  . PHE A 1 183 ? 31.555  8.025   13.179 1.00 96.07  ? 1690 PHE A CG  1 
ATOM   1271 C CD1 . PHE A 1 183 ? 30.977  7.224   12.197 1.00 96.32  ? 1690 PHE A CD1 1 
ATOM   1272 C CD2 . PHE A 1 183 ? 31.487  9.409   13.039 1.00 96.18  ? 1690 PHE A CD2 1 
ATOM   1273 C CE1 . PHE A 1 183 ? 30.327  7.793   11.100 1.00 96.69  ? 1690 PHE A CE1 1 
ATOM   1274 C CE2 . PHE A 1 183 ? 30.840  9.988   11.948 1.00 96.53  ? 1690 PHE A CE2 1 
ATOM   1275 C CZ  . PHE A 1 183 ? 30.259  9.178   10.976 1.00 96.79  ? 1690 PHE A CZ  1 
ATOM   1276 N N   . TYR A 1 184 ? 32.488  5.188   16.566 1.00 90.37  ? 1691 TYR A N   1 
ATOM   1277 C CA  . TYR A 1 184 ? 33.375  4.481   17.498 1.00 90.10  ? 1691 TYR A CA  1 
ATOM   1278 C C   . TYR A 1 184 ? 34.463  3.720   16.734 1.00 90.17  ? 1691 TYR A C   1 
ATOM   1279 O O   . TYR A 1 184 ? 34.163  2.992   15.786 1.00 90.36  ? 1691 TYR A O   1 
ATOM   1280 C CB  . TYR A 1 184 ? 32.580  3.515   18.379 1.00 89.93  ? 1691 TYR A CB  1 
ATOM   1281 C CG  . TYR A 1 184 ? 31.637  4.181   19.357 1.00 89.82  ? 1691 TYR A CG  1 
ATOM   1282 C CD1 . TYR A 1 184 ? 32.123  4.849   20.483 1.00 89.62  ? 1691 TYR A CD1 1 
ATOM   1283 C CD2 . TYR A 1 184 ? 30.257  4.126   19.170 1.00 89.96  ? 1691 TYR A CD2 1 
ATOM   1284 C CE1 . TYR A 1 184 ? 31.258  5.454   21.389 1.00 89.55  ? 1691 TYR A CE1 1 
ATOM   1285 C CE2 . TYR A 1 184 ? 29.383  4.727   20.072 1.00 89.89  ? 1691 TYR A CE2 1 
ATOM   1286 C CZ  . TYR A 1 184 ? 29.892  5.388   21.177 1.00 89.69  ? 1691 TYR A CZ  1 
ATOM   1287 O OH  . TYR A 1 184 ? 29.034  5.982   22.071 1.00 89.66  ? 1691 TYR A OH  1 
ATOM   1288 N N   . ILE A 1 185 ? 35.718  3.880   17.155 1.00 89.94  ? 1692 ILE A N   1 
ATOM   1289 C CA  . ILE A 1 185 ? 36.865  3.410   16.365 1.00 90.05  ? 1692 ILE A CA  1 
ATOM   1290 C C   . ILE A 1 185 ? 37.882  2.591   17.175 1.00 89.83  ? 1692 ILE A C   1 
ATOM   1291 O O   . ILE A 1 185 ? 38.200  2.932   18.315 1.00 89.60  ? 1692 ILE A O   1 
ATOM   1292 C CB  . ILE A 1 185 ? 37.576  4.604   15.659 1.00 90.24  ? 1692 ILE A CB  1 
ATOM   1293 C CG1 . ILE A 1 185 ? 36.580  5.389   14.798 1.00 90.48  ? 1692 ILE A CG1 1 
ATOM   1294 C CG2 . ILE A 1 185 ? 38.739  4.123   14.794 1.00 90.41  ? 1692 ILE A CG2 1 
ATOM   1295 C CD1 . ILE A 1 185 ? 36.868  6.871   14.691 1.00 90.56  ? 1692 ILE A CD1 1 
ATOM   1296 N N   . ASN A 1 186 ? 38.374  1.509   16.566 1.00 89.28  ? 1693 ASN A N   1 
ATOM   1297 C CA  . ASN A 1 186 ? 39.447  0.677   17.120 1.00 89.13  ? 1693 ASN A CA  1 
ATOM   1298 C C   . ASN A 1 186 ? 40.369  0.218   15.987 1.00 89.37  ? 1693 ASN A C   1 
ATOM   1299 O O   . ASN A 1 186 ? 39.911  -0.431  15.045 1.00 89.56  ? 1693 ASN A O   1 
ATOM   1300 C CB  . ASN A 1 186 ? 38.860  -0.530  17.857 1.00 88.95  ? 1693 ASN A CB  1 
ATOM   1301 C CG  . ASN A 1 186 ? 39.783  -1.069  18.936 1.00 88.72  ? 1693 ASN A CG  1 
ATOM   1302 O OD1 . ASN A 1 186 ? 40.486  -0.315  19.610 1.00 88.61  ? 1693 ASN A OD1 1 
ATOM   1303 N ND2 . ASN A 1 186 ? 39.771  -2.383  19.116 1.00 88.68  ? 1693 ASN A ND2 1 
ATOM   1304 N N   . ILE A 1 187 ? 41.661  0.540   16.083 1.00 93.78  ? 1694 ILE A N   1 
ATOM   1305 C CA  . ILE A 1 187 ? 42.561  0.487   14.911 1.00 94.07  ? 1694 ILE A CA  1 
ATOM   1306 C C   . ILE A 1 187 ? 43.543  -0.697  14.773 1.00 94.12  ? 1694 ILE A C   1 
ATOM   1307 O O   . ILE A 1 187 ? 44.617  -0.540  14.190 1.00 94.31  ? 1694 ILE A O   1 
ATOM   1308 C CB  . ILE A 1 187 ? 43.335  1.827   14.706 1.00 94.16  ? 1694 ILE A CB  1 
ATOM   1309 C CG1 . ILE A 1 187 ? 44.238  2.136   15.906 1.00 93.93  ? 1694 ILE A CG1 1 
ATOM   1310 C CG2 . ILE A 1 187 ? 42.366  2.970   14.419 1.00 94.22  ? 1694 ILE A CG2 1 
ATOM   1311 C CD1 . ILE A 1 187 ? 45.490  2.904   15.541 1.00 94.08  ? 1694 ILE A CD1 1 
ATOM   1312 N N   . CYS A 1 188 ? 43.174  -1.866  15.292 1.00 96.63  ? 1695 CYS A N   1 
ATOM   1313 C CA  . CYS A 1 188 ? 43.905  -3.117  15.020 1.00 96.71  ? 1695 CYS A CA  1 
ATOM   1314 C C   . CYS A 1 188 ? 43.098  -4.342  15.434 1.00 96.58  ? 1695 CYS A C   1 
ATOM   1315 O O   . CYS A 1 188 ? 42.860  -5.242  14.628 1.00 96.75  ? 1695 CYS A O   1 
ATOM   1316 C CB  . CYS A 1 188 ? 45.302  -3.129  15.663 1.00 96.65  ? 1695 CYS A CB  1 
ATOM   1317 S SG  . CYS A 1 188 ? 46.652  -2.988  14.451 1.00 97.03  ? 1695 CYS A SG  1 
ATOM   1318 N N   . GLN A 1 189 ? 42.689  -4.366  16.698 1.00 93.55  ? 1696 GLN A N   1 
ATOM   1319 C CA  . GLN A 1 189 ? 41.775  -5.379  17.205 1.00 93.40  ? 1696 GLN A CA  1 
ATOM   1320 C C   . GLN A 1 189 ? 40.343  -4.873  17.015 1.00 93.41  ? 1696 GLN A C   1 
ATOM   1321 O O   . GLN A 1 189 ? 40.133  -3.663  16.891 1.00 93.45  ? 1696 GLN A O   1 
ATOM   1322 C CB  . GLN A 1 189 ? 42.061  -5.654  18.684 1.00 93.09  ? 1696 GLN A CB  1 
ATOM   1323 C CG  . GLN A 1 189 ? 43.426  -6.284  18.949 1.00 93.09  ? 1696 GLN A CG  1 
ATOM   1324 C CD  . GLN A 1 189 ? 43.804  -6.284  20.420 1.00 92.82  ? 1696 GLN A CD  1 
ATOM   1325 O OE1 . GLN A 1 189 ? 44.868  -5.791  20.796 1.00 92.81  ? 1696 GLN A OE1 1 
ATOM   1326 N NE2 . GLN A 1 189 ? 42.934  -6.834  21.260 1.00 92.62  ? 1696 GLN A NE2 1 
ATOM   1327 N N   . PRO A 1 190 ? 39.353  -5.789  16.966 1.00 91.33  ? 1697 PRO A N   1 
ATOM   1328 C CA  . PRO A 1 190 ? 37.956  -5.352  16.859 1.00 91.35  ? 1697 PRO A CA  1 
ATOM   1329 C C   . PRO A 1 190 ? 37.511  -4.515  18.059 1.00 91.11  ? 1697 PRO A C   1 
ATOM   1330 O O   . PRO A 1 190 ? 38.084  -4.639  19.144 1.00 90.88  ? 1697 PRO A O   1 
ATOM   1331 C CB  . PRO A 1 190 ? 37.176  -6.670  16.815 1.00 91.35  ? 1697 PRO A CB  1 
ATOM   1332 C CG  . PRO A 1 190 ? 38.167  -7.693  16.381 1.00 91.43  ? 1697 PRO A CG  1 
ATOM   1333 C CD  . PRO A 1 190 ? 39.462  -7.259  16.980 1.00 91.31  ? 1697 PRO A CD  1 
ATOM   1334 N N   . LEU A 1 191 ? 36.501  -3.672  17.850 1.00 86.15  ? 1698 LEU A N   1 
ATOM   1335 C CA  . LEU A 1 191 ? 35.992  -2.750  18.872 1.00 85.97  ? 1698 LEU A CA  1 
ATOM   1336 C C   . LEU A 1 191 ? 35.550  -3.475  20.145 1.00 85.72  ? 1698 LEU A C   1 
ATOM   1337 O O   . LEU A 1 191 ? 34.841  -4.482  20.082 1.00 85.73  ? 1698 LEU A O   1 
ATOM   1338 C CB  . LEU A 1 191 ? 34.832  -1.922  18.302 1.00 86.14  ? 1698 LEU A CB  1 
ATOM   1339 C CG  . LEU A 1 191 ? 34.373  -0.626  18.974 1.00 86.07  ? 1698 LEU A CG  1 
ATOM   1340 C CD1 . LEU A 1 191 ? 35.293  0.533   18.626 1.00 86.16  ? 1698 LEU A CD1 1 
ATOM   1341 C CD2 . LEU A 1 191 ? 32.949  -0.309  18.552 1.00 86.20  ? 1698 LEU A CD2 1 
ATOM   1342 N N   . ASN A 1 192 ? 35.986  -2.958  21.292 1.00 81.63  ? 1699 ASN A N   1 
ATOM   1343 C CA  . ASN A 1 192 ? 35.638  -3.524  22.596 1.00 81.41  ? 1699 ASN A CA  1 
ATOM   1344 C C   . ASN A 1 192 ? 34.195  -3.222  22.999 1.00 81.40  ? 1699 ASN A C   1 
ATOM   1345 O O   . ASN A 1 192 ? 33.690  -2.131  22.718 1.00 81.50  ? 1699 ASN A O   1 
ATOM   1346 C CB  . ASN A 1 192 ? 36.606  -3.029  23.672 1.00 81.23  ? 1699 ASN A CB  1 
ATOM   1347 C CG  . ASN A 1 192 ? 37.955  -3.707  23.597 1.00 81.22  ? 1699 ASN A CG  1 
ATOM   1348 O OD1 . ASN A 1 192 ? 38.088  -4.894  23.897 1.00 81.16  ? 1699 ASN A OD1 1 
ATOM   1349 N ND2 . ASN A 1 192 ? 38.968  -2.952  23.202 1.00 81.30  ? 1699 ASN A ND2 1 
ATOM   1350 N N   . PRO A 1 193 ? 33.533  -4.179  23.680 1.00 79.59  ? 1700 PRO A N   1 
ATOM   1351 C CA  . PRO A 1 193 ? 32.107  -4.041  23.957 1.00 79.63  ? 1700 PRO A CA  1 
ATOM   1352 C C   . PRO A 1 193 ? 31.816  -2.966  24.999 1.00 79.53  ? 1700 PRO A C   1 
ATOM   1353 O O   . PRO A 1 193 ? 32.243  -3.073  26.153 1.00 79.35  ? 1700 PRO A O   1 
ATOM   1354 C CB  . PRO A 1 193 ? 31.710  -5.429  24.470 1.00 79.53  ? 1700 PRO A CB  1 
ATOM   1355 C CG  . PRO A 1 193 ? 32.951  -5.990  25.046 1.00 79.37  ? 1700 PRO A CG  1 
ATOM   1356 C CD  . PRO A 1 193 ? 34.087  -5.424  24.246 1.00 79.45  ? 1700 PRO A CD  1 
ATOM   1357 N N   . MET A 1 194 ? 31.106  -1.928  24.570 1.00 76.17  ? 1701 MET A N   1 
ATOM   1358 C CA  . MET A 1 194 ? 30.659  -0.867  25.464 1.00 76.12  ? 1701 MET A CA  1 
ATOM   1359 C C   . MET A 1 194 ? 29.294  -1.228  26.049 1.00 76.13  ? 1701 MET A C   1 
ATOM   1360 O O   . MET A 1 194 ? 28.799  -2.342  25.854 1.00 76.13  ? 1701 MET A O   1 
ATOM   1361 C CB  . MET A 1 194 ? 30.576  0.462   24.714 1.00 76.29  ? 1701 MET A CB  1 
ATOM   1362 C CG  . MET A 1 194 ? 31.829  0.833   23.946 1.00 76.33  ? 1701 MET A CG  1 
ATOM   1363 S SD  . MET A 1 194 ? 31.516  2.205   22.828 1.00 76.59  ? 1701 MET A SD  1 
ATOM   1364 C CE  . MET A 1 194 ? 30.378  1.454   21.662 1.00 76.82  ? 1701 MET A CE  1 
ATOM   1365 N N   . HIS A 1 195 ? 28.688  -0.283  26.764 1.00 72.60  ? 1702 HIS A N   1 
ATOM   1366 C CA  . HIS A 1 195 ? 27.377  -0.500  27.367 1.00 72.64  ? 1702 HIS A CA  1 
ATOM   1367 C C   . HIS A 1 195 ? 26.264  0.251   26.635 1.00 72.88  ? 1702 HIS A C   1 
ATOM   1368 O O   . HIS A 1 195 ? 26.436  1.409   26.243 1.00 72.97  ? 1702 HIS A O   1 
ATOM   1369 C CB  . HIS A 1 195 ? 27.396  -0.117  28.850 1.00 72.51  ? 1702 HIS A CB  1 
ATOM   1370 C CG  . HIS A 1 195 ? 26.055  -0.193  29.509 1.00 72.59  ? 1702 HIS A CG  1 
ATOM   1371 N ND1 . HIS A 1 195 ? 25.324  0.928   29.838 1.00 72.70  ? 1702 HIS A ND1 1 
ATOM   1372 C CD2 . HIS A 1 195 ? 25.300  -1.256  29.876 1.00 72.58  ? 1702 HIS A CD2 1 
ATOM   1373 C CE1 . HIS A 1 195 ? 24.182  0.559   30.391 1.00 72.77  ? 1702 HIS A CE1 1 
ATOM   1374 N NE2 . HIS A 1 195 ? 24.143  -0.761  30.426 1.00 72.70  ? 1702 HIS A NE2 1 
ATOM   1375 N N   . ALA A 1 196 ? 25.132  -0.431  26.457 1.00 74.96  ? 1703 ALA A N   1 
ATOM   1376 C CA  . ALA A 1 196 ? 23.908  0.141   25.870 1.00 75.22  ? 1703 ALA A CA  1 
ATOM   1377 C C   . ALA A 1 196 ? 24.010  0.538   24.391 1.00 75.42  ? 1703 ALA A C   1 
ATOM   1378 O O   . ALA A 1 196 ? 23.000  0.878   23.765 1.00 75.65  ? 1703 ALA A O   1 
ATOM   1379 C CB  . ALA A 1 196 ? 23.380  1.311   26.722 1.00 75.25  ? 1703 ALA A CB  1 
ATOM   1380 N N   . VAL A 1 197 ? 25.221  0.493   23.838 1.00 81.60  ? 1704 VAL A N   1 
ATOM   1381 C CA  . VAL A 1 197 ? 25.440  0.790   22.424 1.00 81.80  ? 1704 VAL A CA  1 
ATOM   1382 C C   . VAL A 1 197 ? 25.755  -0.511  21.680 1.00 81.82  ? 1704 VAL A C   1 
ATOM   1383 O O   . VAL A 1 197 ? 26.859  -1.048  21.806 1.00 81.67  ? 1704 VAL A O   1 
ATOM   1384 C CB  . VAL A 1 197 ? 26.569  1.835   22.216 1.00 81.75  ? 1704 VAL A CB  1 
ATOM   1385 C CG1 . VAL A 1 197 ? 26.656  2.246   20.752 1.00 82.01  ? 1704 VAL A CG1 1 
ATOM   1386 C CG2 . VAL A 1 197 ? 26.340  3.061   23.094 1.00 81.70  ? 1704 VAL A CG2 1 
ATOM   1387 N N   . PRO A 1 198 ? 24.780  -1.026  20.905 1.00 86.30  ? 1705 PRO A N   1 
ATOM   1388 C CA  . PRO A 1 198 ? 24.942  -2.318  20.248 1.00 86.34  ? 1705 PRO A CA  1 
ATOM   1389 C C   . PRO A 1 198 ? 25.663  -2.226  18.901 1.00 86.51  ? 1705 PRO A C   1 
ATOM   1390 O O   . PRO A 1 198 ? 25.063  -2.472  17.851 1.00 86.77  ? 1705 PRO A O   1 
ATOM   1391 C CB  . PRO A 1 198 ? 23.498  -2.813  20.072 1.00 86.52  ? 1705 PRO A CB  1 
ATOM   1392 C CG  . PRO A 1 198 ? 22.609  -1.614  20.316 1.00 86.62  ? 1705 PRO A CG  1 
ATOM   1393 C CD  . PRO A 1 198 ? 23.473  -0.423  20.598 1.00 86.54  ? 1705 PRO A CD  1 
ATOM   1394 N N   . CYS A 1 199 ? 26.943  -1.859  18.946 1.00 88.22  ? 1706 CYS A N   1 
ATOM   1395 C CA  . CYS A 1 199 ? 27.819  -1.950  17.782 1.00 88.36  ? 1706 CYS A CA  1 
ATOM   1396 C C   . CYS A 1 199 ? 28.110  -3.428  17.534 1.00 88.33  ? 1706 CYS A C   1 
ATOM   1397 O O   . CYS A 1 199 ? 28.682  -4.094  18.402 1.00 88.08  ? 1706 CYS A O   1 
ATOM   1398 C CB  . CYS A 1 199 ? 29.125  -1.181  18.010 1.00 88.22  ? 1706 CYS A CB  1 
ATOM   1399 S SG  . CYS A 1 199 ? 28.997  0.620   17.863 1.00 88.33  ? 1706 CYS A SG  1 
ATOM   1400 N N   . PRO A 1 200 ? 27.702  -3.947  16.357 1.00 92.94  ? 1707 PRO A N   1 
ATOM   1401 C CA  . PRO A 1 200 ? 27.827  -5.369  16.031 1.00 92.95  ? 1707 PRO A CA  1 
ATOM   1402 C C   . PRO A 1 200 ? 29.200  -5.922  16.395 1.00 92.74  ? 1707 PRO A C   1 
ATOM   1403 O O   . PRO A 1 200 ? 30.220  -5.373  15.972 1.00 92.78  ? 1707 PRO A O   1 
ATOM   1404 C CB  . PRO A 1 200 ? 27.620  -5.395  14.517 1.00 93.31  ? 1707 PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 200 ? 26.712  -4.254  14.261 1.00 93.49  ? 1707 PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 200 ? 27.096  -3.187  15.248 1.00 93.26  ? 1707 PRO A CD  1 
ATOM   1407 N N   . ALA A 1 201 ? 29.210  -6.987  17.193 1.00 90.28  ? 1708 ALA A N   1 
ATOM   1408 C CA  . ALA A 1 201 ? 30.443  -7.587  17.700 1.00 90.08  ? 1708 ALA A CA  1 
ATOM   1409 C C   . ALA A 1 201 ? 31.409  -7.932  16.570 1.00 90.26  ? 1708 ALA A C   1 
ATOM   1410 O O   . ALA A 1 201 ? 31.034  -8.597  15.602 1.00 90.49  ? 1708 ALA A O   1 
ATOM   1411 C CB  . ALA A 1 201 ? 30.127  -8.819  18.535 1.00 89.90  ? 1708 ALA A CB  1 
ATOM   1412 N N   . GLY A 1 202 ? 32.644  -7.453  16.696 1.00 93.38  ? 1709 GLY A N   1 
ATOM   1413 C CA  . GLY A 1 202 ? 33.670  -7.673  15.680 1.00 93.57  ? 1709 GLY A CA  1 
ATOM   1414 C C   . GLY A 1 202 ? 33.964  -6.453  14.825 1.00 93.79  ? 1709 GLY A C   1 
ATOM   1415 O O   . GLY A 1 202 ? 35.009  -6.388  14.172 1.00 93.93  ? 1709 GLY A O   1 
ATOM   1416 N N   . ALA A 1 203 ? 33.042  -5.490  14.829 1.00 93.57  ? 1710 ALA A N   1 
ATOM   1417 C CA  . ALA A 1 203 ? 33.195  -4.248  14.069 1.00 93.78  ? 1710 ALA A CA  1 
ATOM   1418 C C   . ALA A 1 203 ? 34.389  -3.433  14.555 1.00 93.64  ? 1710 ALA A C   1 
ATOM   1419 O O   . ALA A 1 203 ? 34.736  -3.472  15.735 1.00 93.35  ? 1710 ALA A O   1 
ATOM   1420 C CB  . ALA A 1 203 ? 31.923  -3.415  14.146 1.00 93.86  ? 1710 ALA A CB  1 
ATOM   1421 N N   . ALA A 1 204 ? 35.018  -2.710  13.634 1.00 92.94  ? 1711 ALA A N   1 
ATOM   1422 C CA  . ALA A 1 204 ? 36.134  -1.830  13.959 1.00 92.85  ? 1711 ALA A CA  1 
ATOM   1423 C C   . ALA A 1 204 ? 35.675  -0.375  13.984 1.00 92.89  ? 1711 ALA A C   1 
ATOM   1424 O O   . ALA A 1 204 ? 35.903  0.338   14.964 1.00 92.67  ? 1711 ALA A O   1 
ATOM   1425 C CB  . ALA A 1 204 ? 37.267  -2.024  12.968 1.00 93.08  ? 1711 ALA A CB  1 
ATOM   1426 N N   . VAL A 1 205 ? 35.028  0.055   12.901 1.00 94.68  ? 1712 VAL A N   1 
ATOM   1427 C CA  . VAL A 1 205 ? 34.428  1.386   12.823 1.00 94.76  ? 1712 VAL A CA  1 
ATOM   1428 C C   . VAL A 1 205 ? 32.907  1.246   12.887 1.00 94.81  ? 1712 VAL A C   1 
ATOM   1429 O O   . VAL A 1 205 ? 32.318  0.432   12.171 1.00 94.99  ? 1712 VAL A O   1 
ATOM   1430 C CB  . VAL A 1 205 ? 34.857  2.152   11.543 1.00 95.10  ? 1712 VAL A CB  1 
ATOM   1431 C CG1 . VAL A 1 205 ? 34.368  3.594   11.584 1.00 95.14  ? 1712 VAL A CG1 1 
ATOM   1432 C CG2 . VAL A 1 205 ? 36.370  2.126   11.381 1.00 95.10  ? 1712 VAL A CG2 1 
ATOM   1433 N N   . CYS A 1 206 ? 32.284  2.041   13.753 1.00 95.29  ? 1713 CYS A N   1 
ATOM   1434 C CA  . CYS A 1 206 ? 30.850  1.951   14.013 1.00 95.31  ? 1713 CYS A CA  1 
ATOM   1435 C C   . CYS A 1 206 ? 30.174  3.299   13.781 1.00 95.47  ? 1713 CYS A C   1 
ATOM   1436 O O   . CYS A 1 206 ? 30.673  4.332   14.225 1.00 95.37  ? 1713 CYS A O   1 
ATOM   1437 C CB  . CYS A 1 206 ? 30.617  1.478   15.452 1.00 94.97  ? 1713 CYS A CB  1 
ATOM   1438 S SG  . CYS A 1 206 ? 28.931  0.949   15.854 1.00 94.99  ? 1713 CYS A SG  1 
ATOM   1439 N N   . LYS A 1 207 ? 29.047  3.280   13.073 1.00 100.11 ? 1714 LYS A N   1 
ATOM   1440 C CA  . LYS A 1 207 ? 28.262  4.486   12.825 1.00 100.30 ? 1714 LYS A CA  1 
ATOM   1441 C C   . LYS A 1 207 ? 26.957  4.424   13.608 1.00 100.24 ? 1714 LYS A C   1 
ATOM   1442 O O   . LYS A 1 207 ? 26.176  3.486   13.449 1.00 100.32 ? 1714 LYS A O   1 
ATOM   1443 C CB  . LYS A 1 207 ? 27.978  4.651   11.328 1.00 100.71 ? 1714 LYS A CB  1 
ATOM   1444 C CG  . LYS A 1 207 ? 27.056  5.818   10.976 1.00 100.96 ? 1714 LYS A CG  1 
ATOM   1445 C CD  . LYS A 1 207 ? 26.541  5.703   9.547  1.00 101.40 ? 1714 LYS A CD  1 
ATOM   1446 C CE  . LYS A 1 207 ? 25.377  6.648   9.290  1.00 101.67 ? 1714 LYS A CE  1 
ATOM   1447 N NZ  . LYS A 1 207 ? 24.812  6.473   7.921  1.00 102.11 ? 1714 LYS A NZ  1 
ATOM   1448 N N   . VAL A 1 208 ? 26.730  5.426   14.453 1.00 101.99 ? 1715 VAL A N   1 
ATOM   1449 C CA  . VAL A 1 208 ? 25.505  5.504   15.247 1.00 101.96 ? 1715 VAL A CA  1 
ATOM   1450 C C   . VAL A 1 208 ? 24.675  6.724   14.831 1.00 102.23 ? 1715 VAL A C   1 
ATOM   1451 O O   . VAL A 1 208 ? 25.037  7.861   15.150 1.00 102.18 ? 1715 VAL A O   1 
ATOM   1452 C CB  . VAL A 1 208 ? 25.802  5.523   16.775 1.00 101.59 ? 1715 VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 208 ? 24.511  5.642   17.584 1.00 101.60 ? 1715 VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 208 ? 26.568  4.270   17.190 1.00 101.36 ? 1715 VAL A CG2 1 
ATOM   1455 N N   . PRO A 1 209 ? 23.568  6.490   14.099 1.00 110.83 ? 1716 PRO A N   1 
ATOM   1456 C CA  . PRO A 1 209 ? 22.664  7.572   13.710 1.00 111.12 ? 1716 PRO A CA  1 
ATOM   1457 C C   . PRO A 1 209 ? 21.637  7.887   14.799 1.00 111.06 ? 1716 PRO A C   1 
ATOM   1458 O O   . PRO A 1 209 ? 21.379  7.047   15.666 1.00 110.88 ? 1716 PRO A O   1 
ATOM   1459 C CB  . PRO A 1 209 ? 21.975  7.017   12.463 1.00 111.49 ? 1716 PRO A CB  1 
ATOM   1460 C CG  . PRO A 1 209 ? 22.000  5.532   12.637 1.00 111.35 ? 1716 PRO A CG  1 
ATOM   1461 C CD  . PRO A 1 209 ? 23.117  5.182   13.586 1.00 110.93 ? 1716 PRO A CD  1 
ATOM   1462 N N   . ILE A 1 210 ? 21.066  9.092   14.750 1.00 120.25 ? 1717 ILE A N   1 
ATOM   1463 C CA  . ILE A 1 210 ? 20.060  9.535   15.724 1.00 120.24 ? 1717 ILE A CA  1 
ATOM   1464 C C   . ILE A 1 210 ? 18.802  8.664   15.644 1.00 120.41 ? 1717 ILE A C   1 
ATOM   1465 O O   . ILE A 1 210 ? 18.249  8.258   16.671 1.00 120.27 ? 1717 ILE A O   1 
ATOM   1466 C CB  . ILE A 1 210 ? 19.699  11.045  15.542 1.00 120.46 ? 1717 ILE A CB  1 
ATOM   1467 C CG1 . ILE A 1 210 ? 20.944  11.941  15.688 1.00 120.26 ? 1717 ILE A CG1 1 
ATOM   1468 C CG2 . ILE A 1 210 ? 18.577  11.478  16.501 1.00 120.53 ? 1717 ILE A CG2 1 
ATOM   1469 C CD1 . ILE A 1 210 ? 21.607  11.939  17.075 1.00 119.88 ? 1717 ILE A CD1 1 
ATOM   1470 N N   . ASP A 1 211 ? 18.369  8.377   14.420 1.00 124.39 ? 1718 ASP A N   1 
ATOM   1471 C CA  . ASP A 1 211 ? 17.234  7.492   14.185 1.00 124.59 ? 1718 ASP A CA  1 
ATOM   1472 C C   . ASP A 1 211 ? 17.690  6.239   13.439 1.00 124.60 ? 1718 ASP A C   1 
ATOM   1473 O O   . ASP A 1 211 ? 17.959  6.279   12.234 1.00 124.87 ? 1718 ASP A O   1 
ATOM   1474 C CB  . ASP A 1 211 ? 16.125  8.223   13.418 1.00 125.04 ? 1718 ASP A CB  1 
ATOM   1475 C CG  . ASP A 1 211 ? 15.569  9.416   14.184 1.00 125.07 ? 1718 ASP A CG  1 
ATOM   1476 O OD1 . ASP A 1 211 ? 15.183  9.253   15.364 1.00 124.87 ? 1718 ASP A OD1 1 
ATOM   1477 O OD2 . ASP A 1 211 ? 15.511  10.519  13.600 1.00 125.30 ? 1718 ASP A OD2 1 
ATOM   1478 N N   . GLY A 1 212 ? 17.786  5.133   14.174 1.00 117.63 ? 1719 GLY A N   1 
ATOM   1479 C CA  . GLY A 1 212 ? 18.247  3.863   13.621 1.00 117.60 ? 1719 GLY A CA  1 
ATOM   1480 C C   . GLY A 1 212 ? 19.382  3.250   14.424 1.00 117.18 ? 1719 GLY A C   1 
ATOM   1481 O O   . GLY A 1 212 ? 20.183  3.977   15.019 1.00 116.95 ? 1719 GLY A O   1 
ATOM   1482 N N   . PRO A 1 213 ? 19.460  1.905   14.447 1.00 107.64 ? 1720 PRO A N   1 
ATOM   1483 C CA  . PRO A 1 213 ? 20.505  1.171   15.170 1.00 107.27 ? 1720 PRO A CA  1 
ATOM   1484 C C   . PRO A 1 213 ? 21.903  1.402   14.581 1.00 107.20 ? 1720 PRO A C   1 
ATOM   1485 O O   . PRO A 1 213 ? 22.013  1.852   13.438 1.00 107.48 ? 1720 PRO A O   1 
ATOM   1486 C CB  . PRO A 1 213 ? 20.086  -0.294  14.997 1.00 107.30 ? 1720 PRO A CB  1 
ATOM   1487 C CG  . PRO A 1 213 ? 19.253  -0.312  13.768 1.00 107.71 ? 1720 PRO A CG  1 
ATOM   1488 C CD  . PRO A 1 213 ? 18.524  0.992   13.765 1.00 107.91 ? 1720 PRO A CD  1 
ATOM   1489 N N   . PRO A 1 214 ? 22.967  1.114   15.360 1.00 99.56  ? 1721 PRO A N   1 
ATOM   1490 C CA  . PRO A 1 214 ? 24.331  1.223   14.840 1.00 99.50  ? 1721 PRO A CA  1 
ATOM   1491 C C   . PRO A 1 214 ? 24.562  0.327   13.623 1.00 99.72  ? 1721 PRO A C   1 
ATOM   1492 O O   . PRO A 1 214 ? 24.017  -0.778  13.554 1.00 99.76  ? 1721 PRO A O   1 
ATOM   1493 C CB  . PRO A 1 214 ? 25.196  0.754   16.016 1.00 99.12  ? 1721 PRO A CB  1 
ATOM   1494 C CG  . PRO A 1 214 ? 24.361  0.989   17.216 1.00 98.98  ? 1721 PRO A CG  1 
ATOM   1495 C CD  . PRO A 1 214 ? 22.962  0.695   16.774 1.00 99.23  ? 1721 PRO A CD  1 
ATOM   1496 N N   . ILE A 1 215 ? 25.361  0.812   12.675 1.00 104.72 ? 1722 ILE A N   1 
ATOM   1497 C CA  . ILE A 1 215 ? 25.649  0.070   11.449 1.00 104.97 ? 1722 ILE A CA  1 
ATOM   1498 C C   . ILE A 1 215 ? 27.153  -0.163  11.260 1.00 104.86 ? 1722 ILE A C   1 
ATOM   1499 O O   . ILE A 1 215 ? 27.972  0.706   11.572 1.00 104.75 ? 1722 ILE A O   1 
ATOM   1500 C CB  . ILE A 1 215 ? 25.001  0.748   10.199 1.00 105.40 ? 1722 ILE A CB  1 
ATOM   1501 C CG1 . ILE A 1 215 ? 24.888  -0.235  9.027  1.00 105.70 ? 1722 ILE A CG1 1 
ATOM   1502 C CG2 . ILE A 1 215 ? 25.741  2.021   9.795  1.00 105.50 ? 1722 ILE A CG2 1 
ATOM   1503 C CD1 . ILE A 1 215 ? 23.696  -1.177  9.114  1.00 105.76 ? 1722 ILE A CD1 1 
ATOM   1504 N N   . ASP A 1 216 ? 27.499  -1.346  10.760 1.00 104.52 ? 1723 ASP A N   1 
ATOM   1505 C CA  . ASP A 1 216 ? 28.891  -1.741  10.554 1.00 104.44 ? 1723 ASP A CA  1 
ATOM   1506 C C   . ASP A 1 216 ? 29.491  -1.047  9.333  1.00 104.76 ? 1723 ASP A C   1 
ATOM   1507 O O   . ASP A 1 216 ? 29.269  -1.472  8.197  1.00 105.08 ? 1723 ASP A O   1 
ATOM   1508 C CB  . ASP A 1 216 ? 28.988  -3.268  10.410 1.00 104.44 ? 1723 ASP A CB  1 
ATOM   1509 C CG  . ASP A 1 216 ? 30.423  -3.773  10.382 1.00 104.33 ? 1723 ASP A CG  1 
ATOM   1510 O OD1 . ASP A 1 216 ? 31.178  -3.426  9.448  1.00 104.54 ? 1723 ASP A OD1 1 
ATOM   1511 O OD2 . ASP A 1 216 ? 30.792  -4.542  11.291 1.00 104.05 ? 1723 ASP A OD2 1 
ATOM   1512 N N   . ILE A 1 217 ? 30.247  0.022   9.572  1.00 104.99 ? 1724 ILE A N   1 
ATOM   1513 C CA  . ILE A 1 217 ? 30.959  0.716   8.494  1.00 105.27 ? 1724 ILE A CA  1 
ATOM   1514 C C   . ILE A 1 217 ? 32.469  0.453   8.539  1.00 105.17 ? 1724 ILE A C   1 
ATOM   1515 O O   . ILE A 1 217 ? 33.238  1.098   7.824  1.00 105.37 ? 1724 ILE A O   1 
ATOM   1516 C CB  . ILE A 1 217 ? 30.657  2.249   8.455  1.00 105.35 ? 1724 ILE A CB  1 
ATOM   1517 C CG1 . ILE A 1 217 ? 31.084  2.939   9.757  1.00 104.97 ? 1724 ILE A CG1 1 
ATOM   1518 C CG2 . ILE A 1 217 ? 29.182  2.500   8.143  1.00 105.58 ? 1724 ILE A CG2 1 
ATOM   1519 C CD1 . ILE A 1 217 ? 31.285  4.443   9.625  1.00 105.04 ? 1724 ILE A CD1 1 
ATOM   1520 N N   . GLY A 1 218 ? 32.884  -0.504  9.368  1.00 101.79 ? 1725 GLY A N   1 
ATOM   1521 C CA  . GLY A 1 218 ? 34.302  -0.821  9.522  1.00 101.69 ? 1725 GLY A CA  1 
ATOM   1522 C C   . GLY A 1 218 ? 34.609  -2.160  10.165 1.00 101.46 ? 1725 GLY A C   1 
ATOM   1523 O O   . GLY A 1 218 ? 34.130  -2.458  11.260 1.00 101.16 ? 1725 GLY A O   1 
ATOM   1524 N N   . ARG A 1 219 ? 35.404  -2.967  9.464  1.00 102.53 ? 1726 ARG A N   1 
ATOM   1525 C CA  . ARG A 1 219 ? 35.970  -4.209  9.996  1.00 102.35 ? 1726 ARG A CA  1 
ATOM   1526 C C   . ARG A 1 219 ? 37.432  -4.290  9.570  1.00 102.45 ? 1726 ARG A C   1 
ATOM   1527 O O   . ARG A 1 219 ? 37.756  -4.039  8.405  1.00 102.80 ? 1726 ARG A O   1 
ATOM   1528 C CB  . ARG A 1 219 ? 35.210  -5.436  9.482  1.00 102.48 ? 1726 ARG A CB  1 
ATOM   1529 C CG  . ARG A 1 219 ? 33.826  -5.640  10.083 1.00 102.35 ? 1726 ARG A CG  1 
ATOM   1530 C CD  . ARG A 1 219 ? 33.201  -6.926  9.569  1.00 102.50 ? 1726 ARG A CD  1 
ATOM   1531 N NE  . ARG A 1 219 ? 31.767  -7.000  9.843  1.00 102.48 ? 1726 ARG A NE  1 
ATOM   1532 C CZ  . ARG A 1 219 ? 31.221  -7.617  10.888 1.00 102.20 ? 1726 ARG A CZ  1 
ATOM   1533 N NH1 . ARG A 1 219 ? 31.982  -8.226  11.791 1.00 101.91 ? 1726 ARG A NH1 1 
ATOM   1534 N NH2 . ARG A 1 219 ? 29.903  -7.621  11.034 1.00 102.24 ? 1726 ARG A NH2 1 
ATOM   1535 N N   . VAL A 1 220 ? 38.307  -4.643  10.511 1.00 102.53 ? 1727 VAL A N   1 
ATOM   1536 C CA  . VAL A 1 220 ? 39.759  -4.655  10.272 1.00 102.61 ? 1727 VAL A CA  1 
ATOM   1537 C C   . VAL A 1 220 ? 40.169  -5.539  9.085  1.00 102.96 ? 1727 VAL A C   1 
ATOM   1538 O O   . VAL A 1 220 ? 39.873  -6.736  9.050  1.00 102.96 ? 1727 VAL A O   1 
ATOM   1539 C CB  . VAL A 1 220 ? 40.568  -4.996  11.568 1.00 102.26 ? 1727 VAL A CB  1 
ATOM   1540 C CG1 . VAL A 1 220 ? 40.124  -6.326  12.179 1.00 102.11 ? 1727 VAL A CG1 1 
ATOM   1541 C CG2 . VAL A 1 220 ? 42.074  -4.984  11.302 1.00 102.37 ? 1727 VAL A CG2 1 
ATOM   1542 N N   . ALA A 1 221 ? 40.841  -4.924  8.113  1.00 110.99 ? 1728 ALA A N   1 
ATOM   1543 C CA  . ALA A 1 221 ? 41.248  -5.611  6.890  1.00 111.38 ? 1728 ALA A CA  1 
ATOM   1544 C C   . ALA A 1 221 ? 42.641  -6.229  7.011  1.00 111.39 ? 1728 ALA A C   1 
ATOM   1545 O O   . ALA A 1 221 ? 42.769  -7.431  7.246  1.00 111.27 ? 1728 ALA A O   1 
ATOM   1546 C CB  . ALA A 1 221 ? 41.167  -4.667  5.694  1.00 111.76 ? 1728 ALA A CB  1 
ATOM   1547 N N   . GLY A 1 222 ? 43.676  -5.407  6.852  1.00 116.51 ? 1729 GLY A N   1 
ATOM   1548 C CA  . GLY A 1 222 ? 45.056  -5.874  6.951  1.00 116.56 ? 1729 GLY A CA  1 
ATOM   1549 C C   . GLY A 1 222 ? 45.917  -4.960  7.802  1.00 116.34 ? 1729 GLY A C   1 
ATOM   1550 O O   . GLY A 1 222 ? 45.398  -4.048  8.449  1.00 116.11 ? 1729 GLY A O   1 
ATOM   1551 N N   . PRO A 1 223 ? 47.241  -5.207  7.821  1.00 117.71 ? 1730 PRO A N   1 
ATOM   1552 C CA  . PRO A 1 223 ? 48.183  -4.317  8.501  1.00 117.57 ? 1730 PRO A CA  1 
ATOM   1553 C C   . PRO A 1 223 ? 48.310  -2.979  7.764  1.00 117.81 ? 1730 PRO A C   1 
ATOM   1554 O O   . PRO A 1 223 ? 48.048  -2.923  6.560  1.00 118.18 ? 1730 PRO A O   1 
ATOM   1555 C CB  . PRO A 1 223 ? 49.502  -5.095  8.443  1.00 117.70 ? 1730 PRO A CB  1 
ATOM   1556 C CG  . PRO A 1 223 ? 49.366  -5.987  7.265  1.00 118.06 ? 1730 PRO A CG  1 
ATOM   1557 C CD  . PRO A 1 223 ? 47.919  -6.362  7.204  1.00 117.96 ? 1730 PRO A CD  1 
ATOM   1558 N N   . PRO A 1 224 ? 48.703  -1.906  8.480  1.00 116.66 ? 1731 PRO A N   1 
ATOM   1559 C CA  . PRO A 1 224 ? 48.806  -0.561  7.900  1.00 116.85 ? 1731 PRO A CA  1 
ATOM   1560 C C   . PRO A 1 224 ? 49.700  -0.492  6.661  1.00 117.31 ? 1731 PRO A C   1 
ATOM   1561 O O   . PRO A 1 224 ? 50.741  -1.148  6.612  1.00 117.44 ? 1731 PRO A O   1 
ATOM   1562 C CB  . PRO A 1 224 ? 49.415  0.268   9.039  1.00 116.55 ? 1731 PRO A CB  1 
ATOM   1563 C CG  . PRO A 1 224 ? 49.991  -0.729  9.992  1.00 116.31 ? 1731 PRO A CG  1 
ATOM   1564 C CD  . PRO A 1 224 ? 49.082  -1.903  9.903  1.00 116.26 ? 1731 PRO A CD  1 
ATOM   1565 N N   . ILE A 1 225 ? 49.281  0.293   5.671  1.00 130.02 ? 1732 ILE A N   1 
ATOM   1566 C CA  . ILE A 1 225 ? 50.063  0.491   4.446  1.00 130.51 ? 1732 ILE A CA  1 
ATOM   1567 C C   . ILE A 1 225 ? 50.836  1.811   4.491  1.00 130.56 ? 1732 ILE A C   1 
ATOM   1568 O O   . ILE A 1 225 ? 50.464  2.729   5.226  1.00 130.28 ? 1732 ILE A O   1 
ATOM   1569 C CB  . ILE A 1 225 ? 49.186  0.406   3.163  1.00 130.86 ? 1732 ILE A CB  1 
ATOM   1570 C CG1 . ILE A 1 225 ? 48.016  1.398   3.223  1.00 130.76 ? 1732 ILE A CG1 1 
ATOM   1571 C CG2 . ILE A 1 225 ? 48.695  -1.028  2.950  1.00 130.88 ? 1732 ILE A CG2 1 
ATOM   1572 C CD1 . ILE A 1 225 ? 47.394  1.725   1.870  1.00 131.21 ? 1732 ILE A CD1 1 
ATOM   1573 N N   . LEU A 1 226 ? 51.908  1.899   3.704  1.00 141.36 ? 1733 LEU A N   1 
ATOM   1574 C CA  . LEU A 1 226 ? 52.800  3.057   3.737  1.00 141.45 ? 1733 LEU A CA  1 
ATOM   1575 C C   . LEU A 1 226 ? 52.832  3.821   2.412  1.00 141.91 ? 1733 LEU A C   1 
ATOM   1576 O O   . LEU A 1 226 ? 52.929  3.222   1.339  1.00 142.33 ? 1733 LEU A O   1 
ATOM   1577 C CB  . LEU A 1 226 ? 54.211  2.619   4.150  1.00 141.48 ? 1733 LEU A CB  1 
ATOM   1578 C CG  . LEU A 1 226 ? 55.264  3.684   4.474  1.00 141.51 ? 1733 LEU A CG  1 
ATOM   1579 C CD1 . LEU A 1 226 ? 56.073  3.284   5.700  1.00 141.21 ? 1733 LEU A CD1 1 
ATOM   1580 C CD2 . LEU A 1 226 ? 56.177  3.951   3.278  1.00 142.05 ? 1733 LEU A CD2 1 
ATOM   1581 N N   . ASN A 1 227 ? 52.747  5.147   2.508  1.00 154.92 ? 1734 ASN A N   1 
ATOM   1582 C CA  . ASN A 1 227 ? 52.850  6.034   1.351  1.00 155.34 ? 1734 ASN A CA  1 
ATOM   1583 C C   . ASN A 1 227 ? 54.307  6.407   1.073  1.00 155.61 ? 1734 ASN A C   1 
ATOM   1584 O O   . ASN A 1 227 ? 54.999  6.902   1.965  1.00 155.36 ? 1734 ASN A O   1 
ATOM   1585 C CB  . ASN A 1 227 ? 52.004  7.296   1.566  1.00 155.18 ? 1734 ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 227 ? 52.175  8.320   0.457  1.00 155.61 ? 1734 ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 227 ? 51.915  8.040   -0.714 1.00 156.02 ? 1734 ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 227 ? 52.602  9.521   0.826  1.00 155.52 ? 1734 ASN A ND2 1 
ATOM   1589 N N   . PRO A 1 228 ? 54.779  6.161   -0.165 1.00 179.16 ? 1735 PRO A N   1 
ATOM   1590 C CA  . PRO A 1 228 ? 56.173  6.426   -0.529 1.00 179.48 ? 1735 PRO A CA  1 
ATOM   1591 C C   . PRO A 1 228 ? 56.580  7.905   -0.487 1.00 179.52 ? 1735 PRO A C   1 
ATOM   1592 O O   . PRO A 1 228 ? 57.692  8.216   -0.053 1.00 179.55 ? 1735 PRO A O   1 
ATOM   1593 C CB  . PRO A 1 228 ? 56.273  5.884   -1.962 1.00 180.06 ? 1735 PRO A CB  1 
ATOM   1594 C CG  . PRO A 1 228 ? 54.879  5.883   -2.474 1.00 180.08 ? 1735 PRO A CG  1 
ATOM   1595 C CD  . PRO A 1 228 ? 54.015  5.592   -1.291 1.00 179.51 ? 1735 PRO A CD  1 
ATOM   1596 N N   . ILE A 1 229 ? 55.689  8.798   -0.916 1.00 189.08 ? 1736 ILE A N   1 
ATOM   1597 C CA  . ILE A 1 229 ? 56.029  10.217  -1.095 1.00 189.19 ? 1736 ILE A CA  1 
ATOM   1598 C C   . ILE A 1 229 ? 56.112  10.995  0.228  1.00 188.70 ? 1736 ILE A C   1 
ATOM   1599 O O   . ILE A 1 229 ? 57.185  11.082  0.831  1.00 188.58 ? 1736 ILE A O   1 
ATOM   1600 C CB  . ILE A 1 229 ? 55.080  10.939  -2.109 1.00 189.47 ? 1736 ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 229 ? 54.850  10.091  -3.365 1.00 189.96 ? 1736 ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 229 ? 55.639  12.305  -2.504 1.00 189.67 ? 1736 ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 229 ? 53.543  9.318   -3.368 1.00 189.83 ? 1736 ILE A CD1 1 
ATOM   1604 N N   . ALA A 1 230 ? 54.983  11.549  0.672  1.00 172.07 ? 1737 ALA A N   1 
ATOM   1605 C CA  . ALA A 1 230 ? 54.936  12.417  1.854  1.00 171.63 ? 1737 ALA A CA  1 
ATOM   1606 C C   . ALA A 1 230 ? 54.907  11.644  3.176  1.00 171.15 ? 1737 ALA A C   1 
ATOM   1607 O O   . ALA A 1 230 ? 54.564  12.199  4.225  1.00 170.77 ? 1737 ALA A O   1 
ATOM   1608 C CB  . ALA A 1 230 ? 53.747  13.373  1.759  1.00 171.58 ? 1737 ALA A CB  1 
ATOM   1609 N N   . ASN A 1 231 ? 55.286  10.368  3.107  1.00 150.20 ? 1738 ASN A N   1 
ATOM   1610 C CA  . ASN A 1 231 ? 55.327  9.459   4.258  1.00 149.82 ? 1738 ASN A CA  1 
ATOM   1611 C C   . ASN A 1 231 ? 54.103  9.478   5.178  1.00 149.37 ? 1738 ASN A C   1 
ATOM   1612 O O   . ASN A 1 231 ? 54.189  9.857   6.351  1.00 149.02 ? 1738 ASN A O   1 
ATOM   1613 C CB  . ASN A 1 231 ? 56.633  9.617   5.047  1.00 149.69 ? 1738 ASN A CB  1 
ATOM   1614 C CG  . ASN A 1 231 ? 57.654  8.545   4.706  1.00 150.02 ? 1738 ASN A CG  1 
ATOM   1615 O OD1 . ASN A 1 231 ? 57.385  7.348   4.833  1.00 150.05 ? 1738 ASN A OD1 1 
ATOM   1616 N ND2 . ASN A 1 231 ? 58.839  8.970   4.289  1.00 150.27 ? 1738 ASN A ND2 1 
ATOM   1617 N N   . GLU A 1 232 ? 52.966  9.074   4.619  1.00 134.83 ? 1739 GLU A N   1 
ATOM   1618 C CA  . GLU A 1 232 ? 51.736  8.901   5.381  1.00 134.46 ? 1739 GLU A CA  1 
ATOM   1619 C C   . GLU A 1 232 ? 51.433  7.414   5.508  1.00 134.37 ? 1739 GLU A C   1 
ATOM   1620 O O   . GLU A 1 232 ? 51.800  6.620   4.641  1.00 134.69 ? 1739 GLU A O   1 
ATOM   1621 C CB  . GLU A 1 232 ? 50.569  9.614   4.696  1.00 134.60 ? 1739 GLU A CB  1 
ATOM   1622 C CG  . GLU A 1 232 ? 50.670  11.134  4.691  1.00 134.65 ? 1739 GLU A CG  1 
ATOM   1623 C CD  . GLU A 1 232 ? 49.706  11.784  3.713  1.00 134.89 ? 1739 GLU A CD  1 
ATOM   1624 O OE1 . GLU A 1 232 ? 48.512  11.412  3.700  1.00 134.79 ? 1739 GLU A OE1 1 
ATOM   1625 O OE2 . GLU A 1 232 ? 50.143  12.676  2.955  1.00 135.21 ? 1739 GLU A OE2 1 
ATOM   1626 N N   . ILE A 1 233 ? 50.773  7.039   6.597  1.00 123.25 ? 1740 ILE A N   1 
ATOM   1627 C CA  . ILE A 1 233 ? 50.364  5.655   6.795  1.00 123.14 ? 1740 ILE A CA  1 
ATOM   1628 C C   . ILE A 1 233 ? 48.841  5.567   6.751  1.00 123.03 ? 1740 ILE A C   1 
ATOM   1629 O O   . ILE A 1 233 ? 48.149  6.370   7.377  1.00 122.81 ? 1740 ILE A O   1 
ATOM   1630 C CB  . ILE A 1 233 ? 50.957  5.056   8.103  1.00 122.78 ? 1740 ILE A CB  1 
ATOM   1631 C CG1 . ILE A 1 233 ? 52.412  4.622   7.890  1.00 122.99 ? 1740 ILE A CG1 1 
ATOM   1632 C CG2 . ILE A 1 233 ? 50.168  3.839   8.569  1.00 122.57 ? 1740 ILE A CG2 1 
ATOM   1633 C CD1 . ILE A 1 233 ? 53.445  5.731   8.013  1.00 123.07 ? 1740 ILE A CD1 1 
ATOM   1634 N N   . TYR A 1 234 ? 48.330  4.610   5.982  1.00 118.95 ? 1741 TYR A N   1 
ATOM   1635 C CA  . TYR A 1 234 ? 46.890  4.393   5.875  1.00 118.89 ? 1741 TYR A CA  1 
ATOM   1636 C C   . TYR A 1 234 ? 46.494  3.036   6.450  1.00 118.68 ? 1741 TYR A C   1 
ATOM   1637 O O   . TYR A 1 234 ? 47.309  2.111   6.499  1.00 118.72 ? 1741 TYR A O   1 
ATOM   1638 C CB  . TYR A 1 234 ? 46.421  4.496   4.418  1.00 119.34 ? 1741 TYR A CB  1 
ATOM   1639 C CG  . TYR A 1 234 ? 46.875  5.735   3.671  1.00 119.63 ? 1741 TYR A CG  1 
ATOM   1640 C CD1 . TYR A 1 234 ? 46.514  7.013   4.103  1.00 119.48 ? 1741 TYR A CD1 1 
ATOM   1641 C CD2 . TYR A 1 234 ? 47.644  5.626   2.512  1.00 120.09 ? 1741 TYR A CD2 1 
ATOM   1642 C CE1 . TYR A 1 234 ? 46.924  8.151   3.409  1.00 119.75 ? 1741 TYR A CE1 1 
ATOM   1643 C CE2 . TYR A 1 234 ? 48.057  6.756   1.811  1.00 120.38 ? 1741 TYR A CE2 1 
ATOM   1644 C CZ  . TYR A 1 234 ? 47.694  8.014   2.265  1.00 120.20 ? 1741 TYR A CZ  1 
ATOM   1645 O OH  . TYR A 1 234 ? 48.099  9.135   1.576  1.00 120.50 ? 1741 TYR A OH  1 
ATOM   1646 N N   . LEU A 1 235 ? 45.240  2.929   6.883  1.00 111.77 ? 1742 LEU A N   1 
ATOM   1647 C CA  . LEU A 1 235 ? 44.702  1.677   7.406  1.00 111.58 ? 1742 LEU A CA  1 
ATOM   1648 C C   . LEU A 1 235 ? 43.254  1.483   6.958  1.00 111.66 ? 1742 LEU A C   1 
ATOM   1649 O O   . LEU A 1 235 ? 42.395  2.335   7.201  1.00 111.56 ? 1742 LEU A O   1 
ATOM   1650 C CB  . LEU A 1 235 ? 44.830  1.628   8.934  1.00 111.13 ? 1742 LEU A CB  1 
ATOM   1651 C CG  . LEU A 1 235 ? 44.575  0.314   9.682  1.00 110.91 ? 1742 LEU A CG  1 
ATOM   1652 C CD1 . LEU A 1 235 ? 45.293  -0.869  9.051  1.00 111.14 ? 1742 LEU A CD1 1 
ATOM   1653 C CD2 . LEU A 1 235 ? 44.986  0.467   11.134 1.00 110.52 ? 1742 LEU A CD2 1 
ATOM   1654 N N   . ASN A 1 236 ? 43.003  0.355   6.300  1.00 111.22 ? 1743 ASN A N   1 
ATOM   1655 C CA  . ASN A 1 236 ? 41.706  0.065   5.684  1.00 111.37 ? 1743 ASN A CA  1 
ATOM   1656 C C   . ASN A 1 236 ? 40.745  -0.707  6.582  1.00 111.05 ? 1743 ASN A C   1 
ATOM   1657 O O   . ASN A 1 236 ? 41.154  -1.601  7.326  1.00 110.82 ? 1743 ASN A O   1 
ATOM   1658 C CB  . ASN A 1 236 ? 41.896  -0.672  4.351  1.00 111.81 ? 1743 ASN A CB  1 
ATOM   1659 C CG  . ASN A 1 236 ? 42.999  -1.728  4.404  1.00 111.82 ? 1743 ASN A CG  1 
ATOM   1660 O OD1 . ASN A 1 236 ? 43.410  -2.175  5.479  1.00 111.48 ? 1743 ASN A OD1 1 
ATOM   1661 N ND2 . ASN A 1 236 ? 43.481  -2.130  3.233  1.00 112.25 ? 1743 ASN A ND2 1 
ATOM   1662 N N   . PHE A 1 237 ? 39.465  -0.346  6.500  1.00 107.14 ? 1744 PHE A N   1 
ATOM   1663 C CA  . PHE A 1 237 ? 38.410  -1.002  7.269  1.00 106.89 ? 1744 PHE A CA  1 
ATOM   1664 C C   . PHE A 1 237 ? 37.162  -1.189  6.412  1.00 107.16 ? 1744 PHE A C   1 
ATOM   1665 O O   . PHE A 1 237 ? 36.390  -0.248  6.213  1.00 107.24 ? 1744 PHE A O   1 
ATOM   1666 C CB  . PHE A 1 237 ? 38.073  -0.195  8.527  1.00 106.52 ? 1744 PHE A CB  1 
ATOM   1667 C CG  . PHE A 1 237 ? 39.217  -0.064  9.494  1.00 106.24 ? 1744 PHE A CG  1 
ATOM   1668 C CD1 . PHE A 1 237 ? 39.506  -1.086  10.390 1.00 105.97 ? 1744 PHE A CD1 1 
ATOM   1669 C CD2 . PHE A 1 237 ? 40.002  1.084   9.514  1.00 106.26 ? 1744 PHE A CD2 1 
ATOM   1670 C CE1 . PHE A 1 237 ? 40.561  -0.973  11.288 1.00 105.74 ? 1744 PHE A CE1 1 
ATOM   1671 C CE2 . PHE A 1 237 ? 41.060  1.206   10.408 1.00 106.03 ? 1744 PHE A CE2 1 
ATOM   1672 C CZ  . PHE A 1 237 ? 41.337  0.177   11.298 1.00 105.78 ? 1744 PHE A CZ  1 
ATOM   1673 N N   . GLU A 1 238 ? 36.973  -2.408  5.911  1.00 110.49 ? 1745 GLU A N   1 
ATOM   1674 C CA  . GLU A 1 238 ? 35.853  -2.724  5.015  1.00 110.80 ? 1745 GLU A CA  1 
ATOM   1675 C C   . GLU A 1 238 ? 34.530  -2.955  5.761  1.00 110.60 ? 1745 GLU A C   1 
ATOM   1676 O O   . GLU A 1 238 ? 34.288  -2.332  6.794  1.00 110.32 ? 1745 GLU A O   1 
ATOM   1677 C CB  . GLU A 1 238 ? 36.203  -3.888  4.072  1.00 111.09 ? 1745 GLU A CB  1 
ATOM   1678 C CG  . GLU A 1 238 ? 36.934  -5.059  4.722  1.00 110.85 ? 1745 GLU A CG  1 
ATOM   1679 C CD  . GLU A 1 238 ? 37.663  -5.931  3.710  1.00 111.18 ? 1745 GLU A CD  1 
ATOM   1680 O OE1 . GLU A 1 238 ? 38.207  -5.389  2.723  1.00 111.53 ? 1745 GLU A OE1 1 
ATOM   1681 O OE2 . GLU A 1 238 ? 37.700  -7.164  3.907  1.00 111.12 ? 1745 GLU A OE2 1 
ATOM   1682 N N   . SER A 1 239 ? 33.678  -3.838  5.240  1.00 111.83 ? 1746 SER A N   1 
ATOM   1683 C CA  . SER A 1 239 ? 32.331  -4.011  5.790  1.00 111.71 ? 1746 SER A CA  1 
ATOM   1684 C C   . SER A 1 239 ? 31.726  -5.398  5.567  1.00 111.76 ? 1746 SER A C   1 
ATOM   1685 O O   . SER A 1 239 ? 32.310  -6.250  4.894  1.00 111.91 ? 1746 SER A O   1 
ATOM   1686 C CB  . SER A 1 239 ? 31.395  -2.942  5.215  1.00 111.99 ? 1746 SER A CB  1 
ATOM   1687 O OG  . SER A 1 239 ? 30.113  -2.988  5.815  1.00 111.87 ? 1746 SER A OG  1 
ATOM   1688 N N   . SER A 1 240 ? 30.546  -5.599  6.154  1.00 116.82 ? 1747 SER A N   1 
ATOM   1689 C CA  . SER A 1 240 ? 29.743  -6.806  5.971  1.00 116.91 ? 1747 SER A CA  1 
ATOM   1690 C C   . SER A 1 240 ? 28.296  -6.446  5.609  1.00 117.13 ? 1747 SER A C   1 
ATOM   1691 O O   . SER A 1 240 ? 27.441  -7.325  5.478  1.00 117.22 ? 1747 SER A O   1 
ATOM   1692 C CB  . SER A 1 240 ? 29.779  -7.662  7.242  1.00 116.49 ? 1747 SER A CB  1 
ATOM   1693 O OG  . SER A 1 240 ? 29.082  -8.884  7.067  1.00 116.57 ? 1747 SER A OG  1 
ATOM   1694 N N   . THR A 1 241 ? 28.035  -5.147  5.453  1.00 121.66 ? 1748 THR A N   1 
ATOM   1695 C CA  . THR A 1 241 ? 26.708  -4.632  5.097  1.00 121.90 ? 1748 THR A CA  1 
ATOM   1696 C C   . THR A 1 241 ? 26.797  -3.646  3.919  1.00 122.29 ? 1748 THR A C   1 
ATOM   1697 O O   . THR A 1 241 ? 27.753  -2.869  3.841  1.00 122.24 ? 1748 THR A O   1 
ATOM   1698 C CB  . THR A 1 241 ? 26.008  -3.960  6.305  1.00 121.59 ? 1748 THR A CB  1 
ATOM   1699 O OG1 . THR A 1 241 ? 26.937  -3.119  6.998  1.00 121.29 ? 1748 THR A OG1 1 
ATOM   1700 C CG2 . THR A 1 241 ? 25.464  -5.010  7.268  1.00 121.33 ? 1748 THR A CG2 1 
ATOM   1701 N N   . PRO A 1 242 ? 25.799  -3.670  3.007  1.00 127.18 ? 1749 PRO A N   1 
ATOM   1702 C CA  . PRO A 1 242 ? 25.887  -2.926  1.744  1.00 127.64 ? 1749 PRO A CA  1 
ATOM   1703 C C   . PRO A 1 242 ? 25.556  -1.435  1.839  1.00 127.68 ? 1749 PRO A C   1 
ATOM   1704 O O   . PRO A 1 242 ? 24.836  -1.009  2.743  1.00 127.44 ? 1749 PRO A O   1 
ATOM   1705 C CB  . PRO A 1 242 ? 24.858  -3.632  0.861  1.00 128.04 ? 1749 PRO A CB  1 
ATOM   1706 C CG  . PRO A 1 242 ? 23.829  -4.122  1.811  1.00 127.79 ? 1749 PRO A CG  1 
ATOM   1707 C CD  . PRO A 1 242 ? 24.522  -4.403  3.118  1.00 127.26 ? 1749 PRO A CD  1 
ATOM   1708 N N   . CYS A 1 243 ? 26.080  -0.666  0.885  1.00 127.26 ? 1750 CYS A N   1 
ATOM   1709 C CA  . CYS A 1 243 ? 25.856  0.777   0.795  1.00 127.37 ? 1750 CYS A CA  1 
ATOM   1710 C C   . CYS A 1 243 ? 24.504  1.087   0.141  1.00 127.77 ? 1750 CYS A C   1 
ATOM   1711 O O   . CYS A 1 243 ? 23.762  0.173   -0.225 1.00 127.97 ? 1750 CYS A O   1 
ATOM   1712 C CB  . CYS A 1 243 ? 26.998  1.430   0.004  1.00 127.55 ? 1750 CYS A CB  1 
ATOM   1713 S SG  . CYS A 1 243 ? 27.161  3.220   0.224  1.00 127.52 ? 1750 CYS A SG  1 
ATOM   1714 N N   . LEU A 1 244 ? 24.189  2.375   0.001  1.00 137.32 ? 1751 LEU A N   1 
ATOM   1715 C CA  . LEU A 1 244 ? 22.945  2.810   -0.643 1.00 137.74 ? 1751 LEU A CA  1 
ATOM   1716 C C   . LEU A 1 244 ? 23.144  3.171   -2.121 1.00 138.29 ? 1751 LEU A C   1 
ATOM   1717 O O   . LEU A 1 244 ? 22.455  4.040   -2.662 1.00 138.62 ? 1751 LEU A O   1 
ATOM   1718 C CB  . LEU A 1 244 ? 22.317  3.978   0.130  1.00 137.59 ? 1751 LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 244 ? 21.672  3.661   1.484  1.00 137.16 ? 1751 LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 244 ? 21.560  4.918   2.332  1.00 137.02 ? 1751 LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 244 ? 20.307  2.997   1.316  1.00 137.33 ? 1751 LEU A CD2 1 
ATOM   1722 N N   . ALA A 1 245 ? 24.089  2.486   -2.763 1.00 140.62 ? 1752 ALA A N   1 
ATOM   1723 C CA  . ALA A 1 245 ? 24.385  2.667   -4.184 1.00 141.17 ? 1752 ALA A CA  1 
ATOM   1724 C C   . ALA A 1 245 ? 24.908  1.366   -4.793 1.00 141.32 ? 1752 ALA A C   1 
ATOM   1725 O O   . ALA A 1 245 ? 25.194  1.297   -5.991 1.00 141.79 ? 1752 ALA A O   1 
ATOM   1726 C CB  . ALA A 1 245 ? 25.392  3.796   -4.381 1.00 141.17 ? 1752 ALA A CB  1 
ATOM   1727 N N   . ASP A 1 246 ? 25.029  0.339   -3.952 1.00 141.24 ? 1753 ASP A N   1 
ATOM   1728 C CA  . ASP A 1 246 ? 25.500  -0.979  -4.367 1.00 141.33 ? 1753 ASP A CA  1 
ATOM   1729 C C   . ASP A 1 246 ? 24.836  -2.066  -3.528 1.00 141.01 ? 1753 ASP A C   1 
ATOM   1730 O O   . ASP A 1 246 ? 24.851  -3.243  -3.888 1.00 141.08 ? 1753 ASP A O   1 
ATOM   1731 C CB  . ASP A 1 246 ? 27.017  -1.063  -4.249 1.00 141.14 ? 1753 ASP A CB  1 
ATOM   1732 N N   . ASN A 1 250 ? 28.871  -2.579  -0.865 1.00 124.95 ? 1757 ASN A N   1 
ATOM   1733 C CA  . ASN A 1 250 ? 29.645  -2.724  0.363  1.00 124.42 ? 1757 ASN A CA  1 
ATOM   1734 C C   . ASN A 1 250 ? 30.228  -1.409  0.872  1.00 124.23 ? 1757 ASN A C   1 
ATOM   1735 O O   . ASN A 1 250 ? 30.822  -0.645  0.107  1.00 124.49 ? 1757 ASN A O   1 
ATOM   1736 C CB  . ASN A 1 250 ? 30.753  -3.772  0.185  1.00 124.39 ? 1757 ASN A CB  1 
ATOM   1737 C CG  . ASN A 1 250 ? 30.415  -5.098  0.846  1.00 124.15 ? 1757 ASN A CG  1 
ATOM   1738 O OD1 . ASN A 1 250 ? 30.417  -5.205  2.076  1.00 123.70 ? 1757 ASN A OD1 1 
ATOM   1739 N ND2 . ASN A 1 250 ? 30.115  -6.115  0.031  1.00 124.45 ? 1757 ASN A ND2 1 
ATOM   1740 N N   . TYR A 1 251 ? 30.040  -1.155  2.168  1.00 117.42 ? 1758 TYR A N   1 
ATOM   1741 C CA  . TYR A 1 251 ? 30.597  0.020   2.844  1.00 117.17 ? 1758 TYR A CA  1 
ATOM   1742 C C   . TYR A 1 251 ? 32.113  -0.085  2.991  1.00 117.02 ? 1758 TYR A C   1 
ATOM   1743 O O   . TYR A 1 251 ? 32.684  -1.174  2.887  1.00 117.00 ? 1758 TYR A O   1 
ATOM   1744 C CB  . TYR A 1 251 ? 29.970  0.192   4.233  1.00 116.75 ? 1758 TYR A CB  1 
ATOM   1745 C CG  . TYR A 1 251 ? 28.766  1.107   4.297  1.00 116.85 ? 1758 TYR A CG  1 
ATOM   1746 C CD1 . TYR A 1 251 ? 28.916  2.494   4.264  1.00 116.90 ? 1758 TYR A CD1 1 
ATOM   1747 C CD2 . TYR A 1 251 ? 27.478  0.588   4.425  1.00 116.89 ? 1758 TYR A CD2 1 
ATOM   1748 C CE1 . TYR A 1 251 ? 27.811  3.342   4.336  1.00 117.01 ? 1758 TYR A CE1 1 
ATOM   1749 C CE2 . TYR A 1 251 ? 26.365  1.427   4.499  1.00 117.00 ? 1758 TYR A CE2 1 
ATOM   1750 C CZ  . TYR A 1 251 ? 26.540  2.801   4.454  1.00 117.06 ? 1758 TYR A CZ  1 
ATOM   1751 O OH  . TYR A 1 251 ? 25.445  3.634   4.526  1.00 117.20 ? 1758 TYR A OH  1 
ATOM   1752 N N   . THR A 1 252 ? 32.757  1.054   3.235  1.00 113.67 ? 1759 THR A N   1 
ATOM   1753 C CA  . THR A 1 252 ? 34.203  1.105   3.463  1.00 113.53 ? 1759 THR A CA  1 
ATOM   1754 C C   . THR A 1 252 ? 34.603  2.324   4.297  1.00 113.27 ? 1759 THR A C   1 
ATOM   1755 O O   . THR A 1 252 ? 33.927  3.356   4.272  1.00 113.33 ? 1759 THR A O   1 
ATOM   1756 C CB  . THR A 1 252 ? 35.017  1.048   2.132  1.00 113.96 ? 1759 THR A CB  1 
ATOM   1757 O OG1 . THR A 1 252 ? 36.417  1.176   2.409  1.00 113.82 ? 1759 THR A OG1 1 
ATOM   1758 C CG2 . THR A 1 252 ? 34.586  2.146   1.161  1.00 114.35 ? 1759 THR A CG2 1 
ATOM   1759 N N   . SER A 1 253 ? 35.699  2.183   5.041  1.00 109.65 ? 1760 SER A N   1 
ATOM   1760 C CA  . SER A 1 253 ? 36.240  3.262   5.866  1.00 109.40 ? 1760 SER A CA  1 
ATOM   1761 C C   . SER A 1 253 ? 37.766  3.223   5.883  1.00 109.37 ? 1760 SER A C   1 
ATOM   1762 O O   . SER A 1 253 ? 38.368  2.188   6.174  1.00 109.24 ? 1760 SER A O   1 
ATOM   1763 C CB  . SER A 1 253 ? 35.694  3.180   7.292  1.00 108.97 ? 1760 SER A CB  1 
ATOM   1764 O OG  . SER A 1 253 ? 36.176  4.248   8.086  1.00 108.74 ? 1760 SER A OG  1 
ATOM   1765 N N   . LEU A 1 254 ? 38.380  4.358   5.564  1.00 110.75 ? 1761 LEU A N   1 
ATOM   1766 C CA  . LEU A 1 254 ? 39.834  4.478   5.544  1.00 110.75 ? 1761 LEU A CA  1 
ATOM   1767 C C   . LEU A 1 254 ? 40.317  5.540   6.525  1.00 110.47 ? 1761 LEU A C   1 
ATOM   1768 O O   . LEU A 1 254 ? 39.701  6.601   6.660  1.00 110.45 ? 1761 LEU A O   1 
ATOM   1769 C CB  . LEU A 1 254 ? 40.330  4.798   4.131  1.00 111.22 ? 1761 LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 254 ? 40.453  3.635   3.141  1.00 111.53 ? 1761 LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 254 ? 40.204  4.109   1.717  1.00 112.05 ? 1761 LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 254 ? 41.812  2.953   3.254  1.00 111.50 ? 1761 LEU A CD2 1 
ATOM   1773 N N   . ILE A 1 255 ? 41.420  5.241   7.208  1.00 108.88 ? 1762 ILE A N   1 
ATOM   1774 C CA  . ILE A 1 255 ? 42.017  6.163   8.173  1.00 108.62 ? 1762 ILE A CA  1 
ATOM   1775 C C   . ILE A 1 255 ? 43.425  6.577   7.737  1.00 108.80 ? 1762 ILE A C   1 
ATOM   1776 O O   . ILE A 1 255 ? 44.301  5.730   7.548  1.00 108.89 ? 1762 ILE A O   1 
ATOM   1777 C CB  . ILE A 1 255 ? 42.038  5.569   9.610  1.00 108.19 ? 1762 ILE A CB  1 
ATOM   1778 C CG1 . ILE A 1 255 ? 40.619  5.186   10.052 1.00 108.03 ? 1762 ILE A CG1 1 
ATOM   1779 C CG2 . ILE A 1 255 ? 42.676  6.556   10.595 1.00 107.95 ? 1762 ILE A CG2 1 
ATOM   1780 C CD1 . ILE A 1 255 ? 40.532  4.505   11.407 1.00 107.65 ? 1762 ILE A CD1 1 
ATOM   1781 N N   . ALA A 1 256 ? 43.622  7.884   7.573  1.00 115.59 ? 1763 ALA A N   1 
ATOM   1782 C CA  . ALA A 1 256 ? 44.919  8.449   7.204  1.00 115.76 ? 1763 ALA A CA  1 
ATOM   1783 C C   . ALA A 1 256 ? 45.638  8.996   8.431  1.00 115.44 ? 1763 ALA A C   1 
ATOM   1784 O O   . ALA A 1 256 ? 45.005  9.547   9.335  1.00 115.16 ? 1763 ALA A O   1 
ATOM   1785 C CB  . ALA A 1 256 ? 44.743  9.541   6.163  1.00 116.10 ? 1763 ALA A CB  1 
ATOM   1786 N N   . PHE A 1 257 ? 46.960  8.847   8.451  1.00 114.77 ? 1764 PHE A N   1 
ATOM   1787 C CA  . PHE A 1 257 ? 47.769  9.249   9.601  1.00 114.50 ? 1764 PHE A CA  1 
ATOM   1788 C C   . PHE A 1 257 ? 48.777  10.350  9.273  1.00 114.69 ? 1764 PHE A C   1 
ATOM   1789 O O   . PHE A 1 257 ? 49.387  10.353  8.199  1.00 115.03 ? 1764 PHE A O   1 
ATOM   1790 C CB  . PHE A 1 257 ? 48.491  8.037   10.203 1.00 114.35 ? 1764 PHE A CB  1 
ATOM   1791 C CG  . PHE A 1 257 ? 47.577  7.060   10.899 1.00 114.09 ? 1764 PHE A CG  1 
ATOM   1792 C CD1 . PHE A 1 257 ? 47.288  7.202   12.252 1.00 113.71 ? 1764 PHE A CD1 1 
ATOM   1793 C CD2 . PHE A 1 257 ? 47.016  5.991   10.207 1.00 114.23 ? 1764 PHE A CD2 1 
ATOM   1794 C CE1 . PHE A 1 257 ? 46.448  6.299   12.900 1.00 113.49 ? 1764 PHE A CE1 1 
ATOM   1795 C CE2 . PHE A 1 257 ? 46.175  5.084   10.847 1.00 113.99 ? 1764 PHE A CE2 1 
ATOM   1796 C CZ  . PHE A 1 257 ? 45.891  5.239   12.195 1.00 113.62 ? 1764 PHE A CZ  1 
ATOM   1797 N N   . HIS A 1 258 ? 48.934  11.281  10.213 1.00 119.68 ? 1765 HIS A N   1 
ATOM   1798 C CA  . HIS A 1 258 ? 49.917  12.358  10.116 1.00 119.80 ? 1765 HIS A CA  1 
ATOM   1799 C C   . HIS A 1 258 ? 50.987  12.229  11.195 1.00 119.58 ? 1765 HIS A C   1 
ATOM   1800 O O   . HIS A 1 258 ? 50.930  11.333  12.040 1.00 119.31 ? 1765 HIS A O   1 
ATOM   1801 C CB  . HIS A 1 258 ? 49.243  13.727  10.253 1.00 119.75 ? 1765 HIS A CB  1 
ATOM   1802 C CG  . HIS A 1 258 ? 48.496  14.167  9.034  1.00 120.05 ? 1765 HIS A CG  1 
ATOM   1803 N ND1 . HIS A 1 258 ? 47.275  14.802  9.105  1.00 119.98 ? 1765 HIS A ND1 1 
ATOM   1804 C CD2 . HIS A 1 258 ? 48.794  14.070  7.717  1.00 120.45 ? 1765 HIS A CD2 1 
ATOM   1805 C CE1 . HIS A 1 258 ? 46.856  15.080  7.884  1.00 120.32 ? 1765 HIS A CE1 1 
ATOM   1806 N NE2 . HIS A 1 258 ? 47.757  14.642  7.023  1.00 120.61 ? 1765 HIS A NE2 1 
ATOM   1807 N N   . CYS A 1 259 ? 51.958  13.139  11.156 1.00 117.87 ? 1766 CYS A N   1 
ATOM   1808 C CA  . CYS A 1 259 ? 52.981  13.235  12.188 1.00 117.68 ? 1766 CYS A CA  1 
ATOM   1809 C C   . CYS A 1 259 ? 52.819  14.534  12.978 1.00 117.49 ? 1766 CYS A C   1 
ATOM   1810 O O   . CYS A 1 259 ? 53.231  15.606  12.525 1.00 117.67 ? 1766 CYS A O   1 
ATOM   1811 C CB  . CYS A 1 259 ? 54.379  13.144  11.572 1.00 117.97 ? 1766 CYS A CB  1 
ATOM   1812 S SG  . CYS A 1 259 ? 55.735  13.370  12.747 1.00 117.80 ? 1766 CYS A SG  1 
ATOM   1813 N N   . LYS A 1 260 ? 52.207  14.427  14.156 1.00 111.72 ? 1767 LYS A N   1 
ATOM   1814 C CA  . LYS A 1 260 ? 52.002  15.577  15.035 1.00 111.53 ? 1767 LYS A CA  1 
ATOM   1815 C C   . LYS A 1 260 ? 52.624  15.337  16.410 1.00 111.27 ? 1767 LYS A C   1 
ATOM   1816 O O   . LYS A 1 260 ? 52.028  14.687  17.272 1.00 111.02 ? 1767 LYS A O   1 
ATOM   1817 C CB  . LYS A 1 260 ? 50.511  15.915  15.159 1.00 111.40 ? 1767 LYS A CB  1 
ATOM   1818 C CG  . LYS A 1 260 ? 50.229  17.266  15.805 1.00 111.27 ? 1767 LYS A CG  1 
ATOM   1819 C CD  . LYS A 1 260 ? 48.754  17.617  15.744 1.00 111.23 ? 1767 LYS A CD  1 
ATOM   1820 C CE  . LYS A 1 260 ? 48.506  19.025  16.253 1.00 111.16 ? 1767 LYS A CE  1 
ATOM   1821 N NZ  . LYS A 1 260 ? 47.073  19.406  16.135 1.00 111.17 ? 1767 LYS A NZ  1 
ATOM   1822 N N   . ARG A 1 261 ? 53.830  15.868  16.595 1.00 105.76 ? 1768 ARG A N   1 
ATOM   1823 C CA  . ARG A 1 261 ? 54.562  15.737  17.852 1.00 105.56 ? 1768 ARG A CA  1 
ATOM   1824 C C   . ARG A 1 261 ? 53.946  16.615  18.938 1.00 105.31 ? 1768 ARG A C   1 
ATOM   1825 O O   . ARG A 1 261 ? 53.592  17.770  18.689 1.00 105.36 ? 1768 ARG A O   1 
ATOM   1826 C CB  . ARG A 1 261 ? 56.039  16.092  17.651 1.00 105.77 ? 1768 ARG A CB  1 
ATOM   1827 C CG  . ARG A 1 261 ? 56.816  15.085  16.811 1.00 106.02 ? 1768 ARG A CG  1 
ATOM   1828 C CD  . ARG A 1 261 ? 58.288  15.455  16.713 1.00 106.23 ? 1768 ARG A CD  1 
ATOM   1829 N NE  . ARG A 1 261 ? 59.113  14.302  16.352 1.00 106.39 ? 1768 ARG A NE  1 
ATOM   1830 C CZ  . ARG A 1 261 ? 59.545  14.031  15.123 1.00 106.73 ? 1768 ARG A CZ  1 
ATOM   1831 N NH1 . ARG A 1 261 ? 59.243  14.832  14.110 1.00 106.95 ? 1768 ARG A NH1 1 
ATOM   1832 N NH2 . ARG A 1 261 ? 60.287  12.954  14.908 1.00 106.87 ? 1768 ARG A NH2 1 
ATOM   1833 N N   . GLY A 1 262 ? 53.817  16.054  20.138 1.00 100.66 ? 1769 GLY A N   1 
ATOM   1834 C CA  . GLY A 1 262 ? 53.246  16.775  21.273 1.00 100.43 ? 1769 GLY A CA  1 
ATOM   1835 C C   . GLY A 1 262 ? 52.848  15.879  22.429 1.00 100.18 ? 1769 GLY A C   1 
ATOM   1836 O O   . GLY A 1 262 ? 53.101  14.671  22.411 1.00 100.16 ? 1769 GLY A O   1 
ATOM   1837 N N   . VAL A 1 263 ? 52.223  16.483  23.437 1.00 93.61  ? 1770 VAL A N   1 
ATOM   1838 C CA  . VAL A 1 263 ? 51.767  15.763  24.627 1.00 93.37  ? 1770 VAL A CA  1 
ATOM   1839 C C   . VAL A 1 263 ? 50.615  14.804  24.326 1.00 93.31  ? 1770 VAL A C   1 
ATOM   1840 O O   . VAL A 1 263 ? 50.601  13.673  24.818 1.00 93.21  ? 1770 VAL A O   1 
ATOM   1841 C CB  . VAL A 1 263 ? 51.389  16.724  25.793 1.00 93.23  ? 1770 VAL A CB  1 
ATOM   1842 C CG1 . VAL A 1 263 ? 52.635  17.191  26.527 1.00 93.24  ? 1770 VAL A CG1 1 
ATOM   1843 C CG2 . VAL A 1 263 ? 50.576  17.919  25.293 1.00 93.30  ? 1770 VAL A CG2 1 
ATOM   1844 N N   . SER A 1 264 ? 49.665  15.259  23.510 1.00 92.78  ? 1771 SER A N   1 
ATOM   1845 C CA  . SER A 1 264 ? 48.516  14.454  23.107 1.00 92.75  ? 1771 SER A CA  1 
ATOM   1846 C C   . SER A 1 264 ? 48.933  13.331  22.169 1.00 92.88  ? 1771 SER A C   1 
ATOM   1847 O O   . SER A 1 264 ? 49.856  13.492  21.370 1.00 93.07  ? 1771 SER A O   1 
ATOM   1848 C CB  . SER A 1 264 ? 47.470  15.335  22.425 1.00 92.85  ? 1771 SER A CB  1 
ATOM   1849 O OG  . SER A 1 264 ? 46.511  14.550  21.737 1.00 92.91  ? 1771 SER A OG  1 
ATOM   1850 N N   . MET A 1 265 ? 48.248  12.196  22.273 1.00 92.21  ? 1772 MET A N   1 
ATOM   1851 C CA  . MET A 1 265 ? 48.469  11.077  21.361 1.00 92.34  ? 1772 MET A CA  1 
ATOM   1852 C C   . MET A 1 265 ? 47.493  11.116  20.186 1.00 92.50  ? 1772 MET A C   1 
ATOM   1853 O O   . MET A 1 265 ? 47.516  10.244  19.316 1.00 92.64  ? 1772 MET A O   1 
ATOM   1854 C CB  . MET A 1 265 ? 48.384  9.744   22.107 1.00 92.18  ? 1772 MET A CB  1 
ATOM   1855 C CG  . MET A 1 265 ? 49.658  9.390   22.856 1.00 92.14  ? 1772 MET A CG  1 
ATOM   1856 S SD  . MET A 1 265 ? 50.934  8.643   21.824 1.00 92.39  ? 1772 MET A SD  1 
ATOM   1857 C CE  . MET A 1 265 ? 50.405  6.932   21.801 1.00 92.30  ? 1772 MET A CE  1 
ATOM   1858 N N   . GLY A 1 266 ? 46.642  12.140  20.170 1.00 94.93  ? 1773 GLY A N   1 
ATOM   1859 C CA  . GLY A 1 266 ? 45.682  12.342  19.091 1.00 95.10  ? 1773 GLY A CA  1 
ATOM   1860 C C   . GLY A 1 266 ? 44.468  11.436  19.167 1.00 95.01  ? 1773 GLY A C   1 
ATOM   1861 O O   . GLY A 1 266 ? 44.451  10.456  19.915 1.00 94.83  ? 1773 GLY A O   1 
ATOM   1862 N N   . THR A 1 267 ? 43.451  11.775  18.381 1.00 93.86  ? 1774 THR A N   1 
ATOM   1863 C CA  . THR A 1 267 ? 42.212  11.001  18.314 1.00 93.83  ? 1774 THR A CA  1 
ATOM   1864 C C   . THR A 1 267 ? 41.637  11.053  16.893 1.00 94.12  ? 1774 THR A C   1 
ATOM   1865 O O   . THR A 1 267 ? 41.631  12.118  16.270 1.00 94.30  ? 1774 THR A O   1 
ATOM   1866 C CB  . THR A 1 267 ? 41.171  11.470  19.382 1.00 93.65  ? 1774 THR A CB  1 
ATOM   1867 O OG1 . THR A 1 267 ? 39.956  10.720  19.248 1.00 93.65  ? 1774 THR A OG1 1 
ATOM   1868 C CG2 . THR A 1 267 ? 40.865  12.965  19.261 1.00 93.74  ? 1774 THR A CG2 1 
ATOM   1869 N N   . PRO A 1 268 ? 41.172  9.898   16.371 1.00 97.99  ? 1775 PRO A N   1 
ATOM   1870 C CA  . PRO A 1 268 ? 40.677  9.831   14.993 1.00 98.30  ? 1775 PRO A CA  1 
ATOM   1871 C C   . PRO A 1 268 ? 39.482  10.753  14.737 1.00 98.40  ? 1775 PRO A C   1 
ATOM   1872 O O   . PRO A 1 268 ? 38.389  10.527  15.264 1.00 98.30  ? 1775 PRO A O   1 
ATOM   1873 C CB  . PRO A 1 268 ? 40.289  8.356   14.824 1.00 98.28  ? 1775 PRO A CB  1 
ATOM   1874 C CG  . PRO A 1 268 ? 40.121  7.835   16.201 1.00 97.96  ? 1775 PRO A CG  1 
ATOM   1875 C CD  . PRO A 1 268 ? 41.092  8.589   17.042 1.00 97.80  ? 1775 PRO A CD  1 
ATOM   1876 N N   . LYS A 1 269 ? 39.716  11.792  13.939 1.00 104.11 ? 1776 LYS A N   1 
ATOM   1877 C CA  . LYS A 1 269 ? 38.686  12.763  13.574 1.00 104.27 ? 1776 LYS A CA  1 
ATOM   1878 C C   . LYS A 1 269 ? 38.214  12.528  12.142 1.00 104.62 ? 1776 LYS A C   1 
ATOM   1879 O O   . LYS A 1 269 ? 38.965  12.020  11.308 1.00 104.78 ? 1776 LYS A O   1 
ATOM   1880 C CB  . LYS A 1 269 ? 39.218  14.195  13.712 1.00 104.29 ? 1776 LYS A CB  1 
ATOM   1881 C CG  . LYS A 1 269 ? 39.675  14.594  15.117 1.00 103.97 ? 1776 LYS A CG  1 
ATOM   1882 C CD  . LYS A 1 269 ? 38.521  15.084  15.978 1.00 103.84 ? 1776 LYS A CD  1 
ATOM   1883 C CE  . LYS A 1 269 ? 39.020  15.662  17.292 1.00 103.58 ? 1776 LYS A CE  1 
ATOM   1884 N NZ  . LYS A 1 269 ? 37.903  16.191  18.121 1.00 103.50 ? 1776 LYS A NZ  1 
ATOM   1885 N N   . LEU A 1 270 ? 36.970  12.909  11.867 1.00 109.45 ? 1777 LEU A N   1 
ATOM   1886 C CA  . LEU A 1 270 ? 36.358  12.742  10.548 1.00 109.81 ? 1777 LEU A CA  1 
ATOM   1887 C C   . LEU A 1 270 ? 36.593  13.974  9.672  1.00 110.10 ? 1777 LEU A C   1 
ATOM   1888 O O   . LEU A 1 270 ? 36.472  15.106  10.145 1.00 110.04 ? 1777 LEU A O   1 
ATOM   1889 C CB  . LEU A 1 270 ? 34.857  12.480  10.712 1.00 109.82 ? 1777 LEU A CB  1 
ATOM   1890 C CG  . LEU A 1 270 ? 33.920  12.460  9.503  1.00 110.21 ? 1777 LEU A CG  1 
ATOM   1891 C CD1 . LEU A 1 270 ? 34.111  11.197  8.679  1.00 110.38 ? 1777 LEU A CD1 1 
ATOM   1892 C CD2 . LEU A 1 270 ? 32.484  12.579  9.976  1.00 110.17 ? 1777 LEU A CD2 1 
ATOM   1893 N N   . LEU A 1 271 ? 36.924  13.754  8.401  1.00 119.66 ? 1778 LEU A N   1 
ATOM   1894 C CA  . LEU A 1 271 ? 37.169  14.868  7.483  1.00 119.98 ? 1778 LEU A CA  1 
ATOM   1895 C C   . LEU A 1 271 ? 36.301  14.843  6.221  1.00 120.39 ? 1778 LEU A C   1 
ATOM   1896 O O   . LEU A 1 271 ? 35.748  15.874  5.831  1.00 120.59 ? 1778 LEU A O   1 
ATOM   1897 C CB  . LEU A 1 271 ? 38.657  14.976  7.127  1.00 120.04 ? 1778 LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 271 ? 39.140  16.373  6.714  1.00 120.21 ? 1778 LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 271 ? 40.514  16.666  7.294  1.00 120.03 ? 1778 LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 271 ? 39.134  16.566  5.198  1.00 120.69 ? 1778 LEU A CD2 1 
ATOM   1901 N N   . ARG A 1 272 ? 36.190  13.679  5.584  1.00 124.70 ? 1779 ARG A N   1 
ATOM   1902 C CA  . ARG A 1 272 ? 35.364  13.542  4.382  1.00 125.12 ? 1779 ARG A CA  1 
ATOM   1903 C C   . ARG A 1 272 ? 34.354  12.406  4.483  1.00 125.08 ? 1779 ARG A C   1 
ATOM   1904 O O   . ARG A 1 272 ? 34.711  11.263  4.776  1.00 124.92 ? 1779 ARG A O   1 
ATOM   1905 C CB  . ARG A 1 272 ? 36.226  13.382  3.126  1.00 125.49 ? 1779 ARG A CB  1 
ATOM   1906 C CG  . ARG A 1 272 ? 36.955  14.649  2.714  1.00 125.65 ? 1779 ARG A CG  1 
ATOM   1907 C CD  . ARG A 1 272 ? 37.366  14.609  1.251  1.00 126.15 ? 1779 ARG A CD  1 
ATOM   1908 N NE  . ARG A 1 272 ? 38.314  15.675  0.928  1.00 126.28 ? 1779 ARG A NE  1 
ATOM   1909 C CZ  . ARG A 1 272 ? 37.978  16.924  0.611  1.00 126.47 ? 1779 ARG A CZ  1 
ATOM   1910 N NH1 . ARG A 1 272 ? 36.703  17.293  0.569  1.00 126.56 ? 1779 ARG A NH1 1 
ATOM   1911 N NH2 . ARG A 1 272 ? 38.924  17.811  0.336  1.00 126.58 ? 1779 ARG A NH2 1 
ATOM   1912 N N   . THR A 1 273 ? 33.091  12.742  4.236  1.00 123.86 ? 1780 THR A N   1 
ATOM   1913 C CA  . THR A 1 273 ? 32.001  11.771  4.252  1.00 123.86 ? 1780 THR A CA  1 
ATOM   1914 C C   . THR A 1 273 ? 31.547  11.438  2.831  1.00 124.34 ? 1780 THR A C   1 
ATOM   1915 O O   . THR A 1 273 ? 30.442  11.802  2.416  1.00 124.55 ? 1780 THR A O   1 
ATOM   1916 C CB  . THR A 1 273 ? 30.798  12.269  5.087  1.00 123.72 ? 1780 THR A CB  1 
ATOM   1917 O OG1 . THR A 1 273 ? 30.490  13.622  4.731  1.00 123.98 ? 1780 THR A OG1 1 
ATOM   1918 C CG2 . THR A 1 273 ? 31.105  12.199  6.570  1.00 123.24 ? 1780 THR A CG2 1 
ATOM   1919 N N   . SER A 1 274 ? 32.418  10.756  2.089  1.00 128.47 ? 1781 SER A N   1 
ATOM   1920 C CA  . SER A 1 274 ? 32.092  10.256  0.755  1.00 128.94 ? 1781 SER A CA  1 
ATOM   1921 C C   . SER A 1 274 ? 30.919  9.282   0.858  1.00 128.94 ? 1781 SER A C   1 
ATOM   1922 O O   . SER A 1 274 ? 30.887  8.433   1.746  1.00 128.60 ? 1781 SER A O   1 
ATOM   1923 C CB  . SER A 1 274 ? 33.313  9.582   0.123  1.00 129.08 ? 1781 SER A CB  1 
ATOM   1924 O OG  . SER A 1 274 ? 33.006  9.022   -1.142 1.00 129.56 ? 1781 SER A OG  1 
ATOM   1925 N N   . GLU A 1 275 ? 29.959  9.416   -0.053 1.00 131.91 ? 1782 GLU A N   1 
ATOM   1926 C CA  . GLU A 1 275 ? 28.654  8.745   0.058  1.00 131.94 ? 1782 GLU A CA  1 
ATOM   1927 C C   . GLU A 1 275 ? 28.689  7.247   0.394  1.00 131.75 ? 1782 GLU A C   1 
ATOM   1928 O O   . GLU A 1 275 ? 27.802  6.750   1.091  1.00 131.56 ? 1782 GLU A O   1 
ATOM   1929 C CB  . GLU A 1 275 ? 27.804  9.004   -1.193 1.00 132.50 ? 1782 GLU A CB  1 
ATOM   1930 C CG  . GLU A 1 275 ? 27.588  10.488  -1.515 1.00 132.72 ? 1782 GLU A CG  1 
ATOM   1931 C CD  . GLU A 1 275 ? 27.105  11.300  -0.318 1.00 132.36 ? 1782 GLU A CD  1 
ATOM   1932 O OE1 . GLU A 1 275 ? 26.019  10.994  0.221  1.00 132.26 ? 1782 GLU A OE1 1 
ATOM   1933 O OE2 . GLU A 1 275 ? 27.813  12.251  0.077  1.00 132.21 ? 1782 GLU A OE2 1 
ATOM   1934 N N   . CYS A 1 276 ? 29.705  6.540   -0.097 1.00 124.82 ? 1783 CYS A N   1 
ATOM   1935 C CA  . CYS A 1 276 ? 29.897  5.122   0.228  1.00 124.63 ? 1783 CYS A CA  1 
ATOM   1936 C C   . CYS A 1 276 ? 31.246  4.847   0.903  1.00 124.29 ? 1783 CYS A C   1 
ATOM   1937 O O   . CYS A 1 276 ? 31.610  3.691   1.132  1.00 124.19 ? 1783 CYS A O   1 
ATOM   1938 C CB  . CYS A 1 276 ? 29.740  4.246   -1.021 1.00 125.08 ? 1783 CYS A CB  1 
ATOM   1939 S SG  . CYS A 1 276 ? 28.033  3.859   -1.497 1.00 125.37 ? 1783 CYS A SG  1 
ATOM   1940 N N   . ASP A 1 277 ? 31.971  5.915   1.225  1.00 118.55 ? 1784 ASP A N   1 
ATOM   1941 C CA  . ASP A 1 277 ? 33.293  5.809   1.838  1.00 118.27 ? 1784 ASP A CA  1 
ATOM   1942 C C   . ASP A 1 277 ? 33.366  6.651   3.120  1.00 117.85 ? 1784 ASP A C   1 
ATOM   1943 O O   . ASP A 1 277 ? 32.483  7.468   3.384  1.00 117.85 ? 1784 ASP A O   1 
ATOM   1944 C CB  . ASP A 1 277 ? 34.365  6.253   0.834  1.00 118.61 ? 1784 ASP A CB  1 
ATOM   1945 C CG  . ASP A 1 277 ? 35.688  5.517   1.007  1.00 118.47 ? 1784 ASP A CG  1 
ATOM   1946 O OD1 . ASP A 1 277 ? 36.031  5.123   2.142  1.00 118.05 ? 1784 ASP A OD1 1 
ATOM   1947 O OD2 . ASP A 1 277 ? 36.396  5.336   -0.006 1.00 118.81 ? 1784 ASP A OD2 1 
ATOM   1948 N N   . PHE A 1 278 ? 34.408  6.436   3.919  1.00 112.57 ? 1785 PHE A N   1 
ATOM   1949 C CA  . PHE A 1 278 ? 34.628  7.224   5.134  1.00 112.20 ? 1785 PHE A CA  1 
ATOM   1950 C C   . PHE A 1 278 ? 36.109  7.533   5.344  1.00 112.08 ? 1785 PHE A C   1 
ATOM   1951 O O   . PHE A 1 278 ? 36.940  6.626   5.414  1.00 112.01 ? 1785 PHE A O   1 
ATOM   1952 C CB  . PHE A 1 278 ? 34.047  6.514   6.363  1.00 111.81 ? 1785 PHE A CB  1 
ATOM   1953 C CG  . PHE A 1 278 ? 32.547  6.605   6.470  1.00 111.86 ? 1785 PHE A CG  1 
ATOM   1954 C CD1 . PHE A 1 278 ? 31.938  7.760   6.954  1.00 111.81 ? 1785 PHE A CD1 1 
ATOM   1955 C CD2 . PHE A 1 278 ? 31.745  5.532   6.098  1.00 111.96 ? 1785 PHE A CD2 1 
ATOM   1956 C CE1 . PHE A 1 278 ? 30.553  7.847   7.058  1.00 111.89 ? 1785 PHE A CE1 1 
ATOM   1957 C CE2 . PHE A 1 278 ? 30.358  5.609   6.199  1.00 112.03 ? 1785 PHE A CE2 1 
ATOM   1958 C CZ  . PHE A 1 278 ? 29.763  6.769   6.681  1.00 112.00 ? 1785 PHE A CZ  1 
ATOM   1959 N N   . VAL A 1 279 ? 36.426  8.822   5.441  1.00 113.54 ? 1786 VAL A N   1 
ATOM   1960 C CA  . VAL A 1 279 ? 37.806  9.270   5.615  1.00 113.47 ? 1786 VAL A CA  1 
ATOM   1961 C C   . VAL A 1 279 ? 38.030  9.808   7.028  1.00 113.04 ? 1786 VAL A C   1 
ATOM   1962 O O   . VAL A 1 279 ? 37.369  10.759  7.456  1.00 112.96 ? 1786 VAL A O   1 
ATOM   1963 C CB  . VAL A 1 279 ? 38.203  10.342  4.568  1.00 113.83 ? 1786 VAL A CB  1 
ATOM   1964 C CG1 . VAL A 1 279 ? 39.686  10.681  4.676  1.00 113.78 ? 1786 VAL A CG1 1 
ATOM   1965 C CG2 . VAL A 1 279 ? 37.875  9.865   3.159  1.00 114.29 ? 1786 VAL A CG2 1 
ATOM   1966 N N   . PHE A 1 280 ? 38.963  9.185   7.744  1.00 108.06 ? 1787 PHE A N   1 
ATOM   1967 C CA  . PHE A 1 280 ? 39.328  9.618   9.088  1.00 107.67 ? 1787 PHE A CA  1 
ATOM   1968 C C   . PHE A 1 280 ? 40.795  10.030  9.153  1.00 107.65 ? 1787 PHE A C   1 
ATOM   1969 O O   . PHE A 1 280 ? 41.684  9.260   8.793  1.00 107.70 ? 1787 PHE A O   1 
ATOM   1970 C CB  . PHE A 1 280 ? 39.023  8.525   10.117 1.00 107.36 ? 1787 PHE A CB  1 
ATOM   1971 C CG  . PHE A 1 280 ? 37.556  8.232   10.278 1.00 107.33 ? 1787 PHE A CG  1 
ATOM   1972 C CD1 . PHE A 1 280 ? 36.734  9.094   10.997 1.00 107.22 ? 1787 PHE A CD1 1 
ATOM   1973 C CD2 . PHE A 1 280 ? 36.997  7.088   9.718  1.00 107.45 ? 1787 PHE A CD2 1 
ATOM   1974 C CE1 . PHE A 1 280 ? 35.377  8.827   11.151 1.00 107.22 ? 1787 PHE A CE1 1 
ATOM   1975 C CE2 . PHE A 1 280 ? 35.639  6.812   9.869  1.00 107.44 ? 1787 PHE A CE2 1 
ATOM   1976 C CZ  . PHE A 1 280 ? 34.829  7.683   10.586 1.00 107.34 ? 1787 PHE A CZ  1 
ATOM   1977 N N   . GLU A 1 281 ? 41.035  11.255  9.610  1.00 111.98 ? 1788 GLU A N   1 
ATOM   1978 C CA  . GLU A 1 281 ? 42.379  11.815  9.671  1.00 111.99 ? 1788 GLU A CA  1 
ATOM   1979 C C   . GLU A 1 281 ? 42.879  11.854  11.112 1.00 111.60 ? 1788 GLU A C   1 
ATOM   1980 O O   . GLU A 1 281 ? 42.320  12.562  11.952 1.00 111.40 ? 1788 GLU A O   1 
ATOM   1981 C CB  . GLU A 1 281 ? 42.387  13.217  9.062  1.00 112.21 ? 1788 GLU A CB  1 
ATOM   1982 C CG  . GLU A 1 281 ? 43.719  13.633  8.471  1.00 112.43 ? 1788 GLU A CG  1 
ATOM   1983 C CD  . GLU A 1 281 ? 43.697  15.048  7.925  1.00 112.65 ? 1788 GLU A CD  1 
ATOM   1984 O OE1 . GLU A 1 281 ? 43.468  15.989  8.716  1.00 112.44 ? 1788 GLU A OE1 1 
ATOM   1985 O OE2 . GLU A 1 281 ? 43.923  15.222  6.707  1.00 113.02 ? 1788 GLU A OE2 1 
ATOM   1986 N N   . TRP A 1 282 ? 43.931  11.088  11.389 1.00 106.06 ? 1789 TRP A N   1 
ATOM   1987 C CA  . TRP A 1 282 ? 44.479  10.968  12.739 1.00 105.72 ? 1789 TRP A CA  1 
ATOM   1988 C C   . TRP A 1 282 ? 45.865  11.606  12.840 1.00 105.75 ? 1789 TRP A C   1 
ATOM   1989 O O   . TRP A 1 282 ? 46.808  11.175  12.174 1.00 105.92 ? 1789 TRP A O   1 
ATOM   1990 C CB  . TRP A 1 282 ? 44.548  9.492   13.150 1.00 105.57 ? 1789 TRP A CB  1 
ATOM   1991 C CG  . TRP A 1 282 ? 44.754  9.247   14.627 1.00 105.21 ? 1789 TRP A CG  1 
ATOM   1992 C CD1 . TRP A 1 282 ? 45.382  10.069  15.523 1.00 105.05 ? 1789 TRP A CD1 1 
ATOM   1993 C CD2 . TRP A 1 282 ? 44.356  8.085   15.365 1.00 105.00 ? 1789 TRP A CD2 1 
ATOM   1994 N NE1 . TRP A 1 282 ? 45.384  9.499   16.772 1.00 104.76 ? 1789 TRP A NE1 1 
ATOM   1995 C CE2 . TRP A 1 282 ? 44.763  8.281   16.705 1.00 104.72 ? 1789 TRP A CE2 1 
ATOM   1996 C CE3 . TRP A 1 282 ? 43.690  6.900   15.026 1.00 105.02 ? 1789 TRP A CE3 1 
ATOM   1997 C CZ2 . TRP A 1 282 ? 44.526  7.336   17.707 1.00 104.47 ? 1789 TRP A CZ2 1 
ATOM   1998 C CZ3 . TRP A 1 282 ? 43.454  5.960   16.024 1.00 104.77 ? 1789 TRP A CZ3 1 
ATOM   1999 C CH2 . TRP A 1 282 ? 43.872  6.185   17.349 1.00 104.50 ? 1789 TRP A CH2 1 
ATOM   2000 N N   . GLU A 1 283 ? 45.979  12.631  13.681 1.00 108.92 ? 1790 GLU A N   1 
ATOM   2001 C CA  . GLU A 1 283 ? 47.260  13.286  13.940 1.00 108.93 ? 1790 GLU A CA  1 
ATOM   2002 C C   . GLU A 1 283 ? 47.881  12.741  15.226 1.00 108.64 ? 1790 GLU A C   1 
ATOM   2003 O O   . GLU A 1 283 ? 47.360  12.967  16.320 1.00 108.37 ? 1790 GLU A O   1 
ATOM   2004 C CB  . GLU A 1 283 ? 47.076  14.803  14.019 1.00 108.94 ? 1790 GLU A CB  1 
ATOM   2005 C CG  . GLU A 1 283 ? 46.757  15.460  12.682 1.00 109.28 ? 1790 GLU A CG  1 
ATOM   2006 C CD  . GLU A 1 283 ? 46.128  16.831  12.835 1.00 109.27 ? 1790 GLU A CD  1 
ATOM   2007 O OE1 . GLU A 1 283 ? 45.039  16.924  13.441 1.00 109.12 ? 1790 GLU A OE1 1 
ATOM   2008 O OE2 . GLU A 1 283 ? 46.714  17.815  12.337 1.00 109.43 ? 1790 GLU A OE2 1 
ATOM   2009 N N   . THR A 1 284 ? 48.995  12.024  15.084 1.00 101.92 ? 1791 THR A N   1 
ATOM   2010 C CA  . THR A 1 284 ? 49.606  11.292  16.202 1.00 101.69 ? 1791 THR A CA  1 
ATOM   2011 C C   . THR A 1 284 ? 51.143  11.240  16.120 1.00 101.82 ? 1791 THR A C   1 
ATOM   2012 O O   . THR A 1 284 ? 51.698  11.107  15.027 1.00 102.11 ? 1791 THR A O   1 
ATOM   2013 C CB  . THR A 1 284 ? 49.006  9.855   16.330 1.00 101.59 ? 1791 THR A CB  1 
ATOM   2014 O OG1 . THR A 1 284 ? 49.763  9.083   17.272 1.00 101.43 ? 1791 THR A OG1 1 
ATOM   2015 C CG2 . THR A 1 284 ? 48.988  9.136   14.984 1.00 101.88 ? 1791 THR A CG2 1 
ATOM   2016 N N   . PRO A 1 285 ? 51.833  11.347  17.279 1.00 102.70 ? 1792 PRO A N   1 
ATOM   2017 C CA  . PRO A 1 285 ? 53.299  11.302  17.294 1.00 102.83 ? 1792 PRO A CA  1 
ATOM   2018 C C   . PRO A 1 285 ? 53.886  9.895   17.143 1.00 102.90 ? 1792 PRO A C   1 
ATOM   2019 O O   . PRO A 1 285 ? 55.105  9.753   17.040 1.00 103.08 ? 1792 PRO A O   1 
ATOM   2020 C CB  . PRO A 1 285 ? 53.666  11.881  18.671 1.00 102.60 ? 1792 PRO A CB  1 
ATOM   2021 C CG  . PRO A 1 285 ? 52.378  12.257  19.336 1.00 102.35 ? 1792 PRO A CG  1 
ATOM   2022 C CD  . PRO A 1 285 ? 51.288  11.528  18.634 1.00 102.38 ? 1792 PRO A CD  1 
ATOM   2023 N N   . VAL A 1 286 ? 53.034  8.871   17.137 1.00 101.88 ? 1793 VAL A N   1 
ATOM   2024 C CA  . VAL A 1 286 ? 53.492  7.494   16.933 1.00 101.95 ? 1793 VAL A CA  1 
ATOM   2025 C C   . VAL A 1 286 ? 53.768  7.220   15.447 1.00 102.31 ? 1793 VAL A C   1 
ATOM   2026 O O   . VAL A 1 286 ? 54.533  6.315   15.106 1.00 102.47 ? 1793 VAL A O   1 
ATOM   2027 C CB  . VAL A 1 286 ? 52.510  6.451   17.545 1.00 101.70 ? 1793 VAL A CB  1 
ATOM   2028 C CG1 . VAL A 1 286 ? 51.330  6.186   16.620 1.00 101.78 ? 1793 VAL A CG1 1 
ATOM   2029 C CG2 . VAL A 1 286 ? 53.237  5.153   17.872 1.00 101.69 ? 1793 VAL A CG2 1 
ATOM   2030 N N   . VAL A 1 287 ? 53.140  8.012   14.578 1.00 110.38 ? 1794 VAL A N   1 
ATOM   2031 C CA  . VAL A 1 287 ? 53.424  7.990   13.142 1.00 110.76 ? 1794 VAL A CA  1 
ATOM   2032 C C   . VAL A 1 287 ? 54.470  9.074   12.848 1.00 110.96 ? 1794 VAL A C   1 
ATOM   2033 O O   . VAL A 1 287 ? 54.335  9.879   11.923 1.00 111.21 ? 1794 VAL A O   1 
ATOM   2034 C CB  . VAL A 1 287 ? 52.133  8.153   12.287 1.00 110.85 ? 1794 VAL A CB  1 
ATOM   2035 C CG1 . VAL A 1 287 ? 52.432  7.994   10.802 1.00 111.27 ? 1794 VAL A CG1 1 
ATOM   2036 C CG2 . VAL A 1 287 ? 51.087  7.132   12.707 1.00 110.63 ? 1794 VAL A CG2 1 
ATOM   2037 N N   . CYS A 1 288 ? 55.506  9.084   13.683 1.00 113.90 ? 1795 CYS A N   1 
ATOM   2038 C CA  . CYS A 1 288 ? 56.665  9.949   13.527 1.00 114.10 ? 1795 CYS A CA  1 
ATOM   2039 C C   . CYS A 1 288 ? 57.917  9.107   13.757 1.00 114.21 ? 1795 CYS A C   1 
ATOM   2040 O O   . CYS A 1 288 ? 57.881  8.154   14.538 1.00 114.02 ? 1795 CYS A O   1 
ATOM   2041 C CB  . CYS A 1 288 ? 56.619  11.101  14.533 1.00 113.86 ? 1795 CYS A CB  1 
ATOM   2042 S SG  . CYS A 1 288 ? 55.216  12.219  14.339 1.00 113.75 ? 1795 CYS A SG  1 
ATOM   2043 N N   . PRO A 1 289 ? 59.027  9.443   13.074 1.00 116.52 ? 1796 PRO A N   1 
ATOM   2044 C CA  . PRO A 1 289 ? 60.246  8.666   13.280 1.00 116.65 ? 1796 PRO A CA  1 
ATOM   2045 C C   . PRO A 1 289 ? 60.962  9.031   14.581 1.00 116.45 ? 1796 PRO A C   1 
ATOM   2046 O O   . PRO A 1 289 ? 60.701  10.090  15.158 1.00 116.26 ? 1796 PRO A O   1 
ATOM   2047 C CB  . PRO A 1 289 ? 61.106  9.045   12.072 1.00 117.11 ? 1796 PRO A CB  1 
ATOM   2048 C CG  . PRO A 1 289 ? 60.674  10.424  11.725 1.00 117.14 ? 1796 PRO A CG  1 
ATOM   2049 C CD  . PRO A 1 289 ? 59.217  10.525  12.089 1.00 116.80 ? 1796 PRO A CD  1 
ATOM   2050 N N   . ASP A 1 290 ? 61.850  8.147   15.031 1.00 114.86 ? 1797 ASP A N   1 
ATOM   2051 C CA  . ASP A 1 290 ? 62.681  8.403   16.202 1.00 114.74 ? 1797 ASP A CA  1 
ATOM   2052 C C   . ASP A 1 290 ? 63.781  9.404   15.851 1.00 115.02 ? 1797 ASP A C   1 
ATOM   2053 O O   . ASP A 1 290 ? 64.798  9.045   15.250 1.00 115.36 ? 1797 ASP A O   1 
ATOM   2054 C CB  . ASP A 1 290 ? 63.282  7.097   16.733 1.00 114.75 ? 1797 ASP A CB  1 
ATOM   2055 C CG  . ASP A 1 290 ? 62.229  6.141   17.265 1.00 114.45 ? 1797 ASP A CG  1 
ATOM   2056 O OD1 . ASP A 1 290 ? 61.536  6.497   18.242 1.00 114.12 ? 1797 ASP A OD1 1 
ATOM   2057 O OD2 . ASP A 1 290 ? 62.103  5.029   16.711 1.00 114.56 ? 1797 ASP A OD2 1 
ATOM   2058 N N   . GLU A 1 291 ? 63.558  10.662  16.221 1.00 114.71 ? 1798 GLU A N   1 
ATOM   2059 C CA  . GLU A 1 291 ? 64.480  11.746  15.893 1.00 114.96 ? 1798 GLU A CA  1 
ATOM   2060 C C   . GLU A 1 291 ? 65.665  11.773  16.855 1.00 114.97 ? 1798 GLU A C   1 
ATOM   2061 O O   . GLU A 1 291 ? 65.486  11.863  18.072 1.00 114.68 ? 1798 GLU A O   1 
ATOM   2062 C CB  . GLU A 1 291 ? 63.745  13.091  15.903 1.00 114.82 ? 1798 GLU A CB  1 
ATOM   2063 C CG  . GLU A 1 291 ? 64.508  14.240  15.239 1.00 115.11 ? 1798 GLU A CG  1 
ATOM   2064 C CD  . GLU A 1 291 ? 63.712  15.539  15.188 1.00 114.99 ? 1798 GLU A CD  1 
ATOM   2065 O OE1 . GLU A 1 291 ? 62.859  15.765  16.077 1.00 114.64 ? 1798 GLU A OE1 1 
ATOM   2066 O OE2 . GLU A 1 291 ? 63.947  16.341  14.258 1.00 115.25 ? 1798 GLU A OE2 1 
ATOM   2067 N N   . VAL A 1 292 ? 66.872  11.687  16.298 1.00 110.88 ? 1799 VAL A N   1 
ATOM   2068 C CA  . VAL A 1 292 ? 68.105  11.770  17.083 1.00 110.97 ? 1799 VAL A CA  1 
ATOM   2069 C C   . VAL A 1 292 ? 68.323  13.220  17.520 1.00 110.92 ? 1799 VAL A C   1 
ATOM   2070 O O   . VAL A 1 292 ? 68.160  14.146  16.722 1.00 111.07 ? 1799 VAL A O   1 
ATOM   2071 C CB  . VAL A 1 292 ? 69.336  11.246  16.293 1.00 111.43 ? 1799 VAL A CB  1 
ATOM   2072 C CG1 . VAL A 1 292 ? 70.570  11.181  17.187 1.00 111.53 ? 1799 VAL A CG1 1 
ATOM   2073 C CG2 . VAL A 1 292 ? 69.052  9.872   15.694 1.00 111.50 ? 1799 VAL A CG2 1 
ATOM   2074 N N   . ARG A 1 293 ? 68.682  13.401  18.789 1.00 106.17 ? 1800 ARG A N   1 
ATOM   2075 C CA  . ARG A 1 293 ? 68.831  14.727  19.393 1.00 106.08 ? 1800 ARG A CA  1 
ATOM   2076 C C   . ARG A 1 293 ? 69.909  15.575  18.712 1.00 106.46 ? 1800 ARG A C   1 
ATOM   2077 O O   . ARG A 1 293 ? 70.940  15.056  18.277 1.00 106.78 ? 1800 ARG A O   1 
ATOM   2078 C CB  . ARG A 1 293 ? 69.110  14.599  20.899 1.00 105.84 ? 1800 ARG A CB  1 
ATOM   2079 C CG  . ARG A 1 293 ? 69.124  15.919  21.670 1.00 105.73 ? 1800 ARG A CG  1 
ATOM   2080 C CD  . ARG A 1 293 ? 67.722  16.493  21.873 1.00 105.38 ? 1800 ARG A CD  1 
ATOM   2081 N NE  . ARG A 1 293 ? 67.734  17.955  21.935 1.00 105.40 ? 1800 ARG A NE  1 
ATOM   2082 C CZ  . ARG A 1 293 ? 68.031  18.669  23.019 1.00 105.33 ? 1800 ARG A CZ  1 
ATOM   2083 N NH1 . ARG A 1 293 ? 68.347  18.068  24.158 1.00 105.27 ? 1800 ARG A NH1 1 
ATOM   2084 N NH2 . ARG A 1 293 ? 68.012  19.994  22.963 1.00 105.36 ? 1800 ARG A NH2 1 
ATOM   2085 N N   . MET A 1 294 ? 69.644  16.879  18.631 1.00 111.88 ? 1801 MET A N   1 
ATOM   2086 C CA  . MET A 1 294 ? 70.534  17.859  18.002 1.00 112.21 ? 1801 MET A CA  1 
ATOM   2087 C C   . MET A 1 294 ? 71.965  17.792  18.530 1.00 112.43 ? 1801 MET A C   1 
ATOM   2088 O O   . MET A 1 294 ? 72.884  17.412  17.803 1.00 112.79 ? 1801 MET A O   1 
ATOM   2089 C CB  . MET A 1 294 ? 69.976  19.275  18.193 1.00 112.06 ? 1801 MET A CB  1 
ATOM   2090 C CG  . MET A 1 294 ? 68.847  19.650  17.245 1.00 112.05 ? 1801 MET A CG  1 
ATOM   2091 S SD  . MET A 1 294 ? 69.430  20.439  15.731 1.00 112.52 ? 1801 MET A SD  1 
ATOM   2092 C CE  . MET A 1 294 ? 69.776  22.098  16.318 1.00 112.45 ? 1801 MET A CE  1 
ATOM   2093 N N   . ASP A 1 295 ? 72.138  18.156  19.798 1.00 103.78 ? 1802 ASP A N   1 
ATOM   2094 C CA  . ASP A 1 295 ? 73.457  18.217  20.422 1.00 103.99 ? 1802 ASP A CA  1 
ATOM   2095 C C   . ASP A 1 295 ? 73.599  17.214  21.570 1.00 103.82 ? 1802 ASP A C   1 
ATOM   2096 O O   . ASP A 1 295 ? 73.826  17.589  22.726 1.00 103.69 ? 1802 ASP A O   1 
ATOM   2097 C CB  . ASP A 1 295 ? 73.781  19.651  20.870 1.00 103.98 ? 1802 ASP A CB  1 
ATOM   2098 C CG  . ASP A 1 295 ? 72.546  20.424  21.316 1.00 103.62 ? 1802 ASP A CG  1 
ATOM   2099 O OD1 . ASP A 1 295 ? 71.814  19.937  22.205 1.00 103.29 ? 1802 ASP A OD1 1 
ATOM   2100 O OD2 . ASP A 1 295 ? 72.313  21.525  20.775 1.00 103.68 ? 1802 ASP A OD2 1 
ATOM   2101 N N   . GLY A 1 296 ? 73.455  15.934  21.228 1.00 97.79  ? 1803 GLY A N   1 
ATOM   2102 C CA  . GLY A 1 296 ? 73.652  14.823  22.162 1.00 97.68  ? 1803 GLY A CA  1 
ATOM   2103 C C   . GLY A 1 296 ? 72.759  14.836  23.388 1.00 97.26  ? 1803 GLY A C   1 
ATOM   2104 O O   . GLY A 1 296 ? 71.634  14.333  23.360 1.00 96.99  ? 1803 GLY A O   1 
ATOM   2105 N N   . CYS A 1 297 ? 73.279  15.409  24.470 1.00 92.64  ? 1804 CYS A N   1 
ATOM   2106 C CA  . CYS A 1 297 ? 72.566  15.485  25.738 1.00 92.29  ? 1804 CYS A CA  1 
ATOM   2107 C C   . CYS A 1 297 ? 72.905  16.811  26.430 1.00 92.28  ? 1804 CYS A C   1 
ATOM   2108 O O   . CYS A 1 297 ? 73.223  16.843  27.622 1.00 92.21  ? 1804 CYS A O   1 
ATOM   2109 C CB  . CYS A 1 297 ? 72.926  14.275  26.615 1.00 92.26  ? 1804 CYS A CB  1 
ATOM   2110 S SG  . CYS A 1 297 ? 71.889  13.999  28.089 1.00 91.84  ? 1804 CYS A SG  1 
ATOM   2111 N N   . THR A 1 298 ? 72.838  17.903  25.669 1.00 95.49  ? 1805 THR A N   1 
ATOM   2112 C CA  . THR A 1 298 ? 73.185  19.235  26.179 1.00 95.51  ? 1805 THR A CA  1 
ATOM   2113 C C   . THR A 1 298 ? 72.093  20.280  25.920 1.00 95.30  ? 1805 THR A C   1 
ATOM   2114 O O   . THR A 1 298 ? 71.226  20.087  25.065 1.00 95.21  ? 1805 THR A O   1 
ATOM   2115 C CB  . THR A 1 298 ? 74.526  19.745  25.595 1.00 95.92  ? 1805 THR A CB  1 
ATOM   2116 O OG1 . THR A 1 298 ? 74.467  19.724  24.166 1.00 96.11  ? 1805 THR A OG1 1 
ATOM   2117 C CG2 . THR A 1 298 ? 75.695  18.884  26.064 1.00 96.16  ? 1805 THR A CG2 1 
ATOM   2118 N N   . LEU A 1 299 ? 72.152  21.384  26.666 1.00 105.04 ? 1806 LEU A N   1 
ATOM   2119 C CA  . LEU A 1 299 ? 71.184  22.479  26.557 1.00 104.86 ? 1806 LEU A CA  1 
ATOM   2120 C C   . LEU A 1 299 ? 71.844  23.750  26.020 1.00 105.09 ? 1806 LEU A C   1 
ATOM   2121 O O   . LEU A 1 299 ? 72.906  24.148  26.497 1.00 105.28 ? 1806 LEU A O   1 
ATOM   2122 C CB  . LEU A 1 299 ? 70.535  22.746  27.927 1.00 104.56 ? 1806 LEU A CB  1 
ATOM   2123 C CG  . LEU A 1 299 ? 69.492  23.850  28.194 1.00 104.34 ? 1806 LEU A CG  1 
ATOM   2124 C CD1 . LEU A 1 299 ? 70.133  25.225  28.419 1.00 104.48 ? 1806 LEU A CD1 1 
ATOM   2125 C CD2 . LEU A 1 299 ? 68.397  23.920  27.123 1.00 104.24 ? 1806 LEU A CD2 1 
ATOM   2126 N N   . THR A 1 300 ? 71.206  24.383  25.036 1.00 117.95 ? 1807 THR A N   1 
ATOM   2127 C CA  . THR A 1 300 ? 71.707  25.642  24.467 1.00 118.16 ? 1807 THR A CA  1 
ATOM   2128 C C   . THR A 1 300 ? 70.597  26.659  24.147 1.00 117.99 ? 1807 THR A C   1 
ATOM   2129 O O   . THR A 1 300 ? 69.815  26.479  23.209 1.00 117.98 ? 1807 THR A O   1 
ATOM   2130 C CB  . THR A 1 300 ? 72.643  25.413  23.236 1.00 118.55 ? 1807 THR A CB  1 
ATOM   2131 O OG1 . THR A 1 300 ? 72.945  26.668  22.611 1.00 118.74 ? 1807 THR A OG1 1 
ATOM   2132 C CG2 . THR A 1 300 ? 72.006  24.478  22.210 1.00 118.56 ? 1807 THR A CG2 1 
ATOM   2133 N N   . ASP A 1 301 ? 70.541  27.717  24.953 1.00 135.04 ? 1808 ASP A N   1 
ATOM   2134 C CA  . ASP A 1 301 ? 69.622  28.835  24.745 1.00 134.92 ? 1808 ASP A CA  1 
ATOM   2135 C C   . ASP A 1 301 ? 70.459  30.099  24.559 1.00 135.15 ? 1808 ASP A C   1 
ATOM   2136 O O   . ASP A 1 301 ? 71.438  30.301  25.280 1.00 135.27 ? 1808 ASP A O   1 
ATOM   2137 C CB  . ASP A 1 301 ? 68.683  28.980  25.951 1.00 134.58 ? 1808 ASP A CB  1 
ATOM   2138 C CG  . ASP A 1 301 ? 67.409  29.755  25.626 1.00 134.42 ? 1808 ASP A CG  1 
ATOM   2139 O OD1 . ASP A 1 301 ? 67.499  30.899  25.133 1.00 134.56 ? 1808 ASP A OD1 1 
ATOM   2140 O OD2 . ASP A 1 301 ? 66.310  29.221  25.886 1.00 134.17 ? 1808 ASP A OD2 1 
ATOM   2141 N N   . GLU A 1 302 ? 70.078  30.945  23.601 1.00 152.93 ? 1809 GLU A N   1 
ATOM   2142 C CA  . GLU A 1 302 ? 70.871  32.139  23.268 1.00 153.18 ? 1809 GLU A CA  1 
ATOM   2143 C C   . GLU A 1 302 ? 70.789  33.262  24.316 1.00 153.05 ? 1809 GLU A C   1 
ATOM   2144 O O   . GLU A 1 302 ? 71.546  34.235  24.248 1.00 153.25 ? 1809 GLU A O   1 
ATOM   2145 C CB  . GLU A 1 302 ? 70.549  32.658  21.853 1.00 153.35 ? 1809 GLU A CB  1 
ATOM   2146 C CG  . GLU A 1 302 ? 69.439  33.712  21.756 1.00 153.19 ? 1809 GLU A CG  1 
ATOM   2147 C CD  . GLU A 1 302 ? 68.062  33.126  21.499 1.00 152.96 ? 1809 GLU A CD  1 
ATOM   2148 O OE1 . GLU A 1 302 ? 67.950  32.168  20.704 1.00 153.04 ? 1809 GLU A OE1 1 
ATOM   2149 O OE2 . GLU A 1 302 ? 67.083  33.639  22.080 1.00 152.71 ? 1809 GLU A OE2 1 
ATOM   2150 N N   . GLN A 1 303 ? 69.876  33.114  25.278 1.00 155.47 ? 1810 GLN A N   1 
ATOM   2151 C CA  . GLN A 1 303 ? 69.736  34.057  26.393 1.00 155.35 ? 1810 GLN A CA  1 
ATOM   2152 C C   . GLN A 1 303 ? 70.976  34.048  27.290 1.00 155.48 ? 1810 GLN A C   1 
ATOM   2153 O O   . GLN A 1 303 ? 71.386  35.089  27.808 1.00 155.56 ? 1810 GLN A O   1 
ATOM   2154 C CB  . GLN A 1 303 ? 68.484  33.739  27.220 1.00 155.01 ? 1810 GLN A CB  1 
ATOM   2155 C CG  . GLN A 1 303 ? 67.160  33.970  26.491 1.00 154.87 ? 1810 GLN A CG  1 
ATOM   2156 C CD  . GLN A 1 303 ? 66.843  35.441  26.269 1.00 154.92 ? 1810 GLN A CD  1 
ATOM   2157 O OE1 . GLN A 1 303 ? 67.119  36.288  27.121 1.00 154.92 ? 1810 GLN A OE1 1 
ATOM   2158 N NE2 . GLN A 1 303 ? 66.252  35.749  25.122 1.00 154.99 ? 1810 GLN A NE2 1 
ATOM   2159 N N   . LEU A 1 304 ? 71.557  32.863  27.464 1.00 140.33 ? 1811 LEU A N   1 
ATOM   2160 C CA  . LEU A 1 304 ? 72.809  32.684  28.201 1.00 140.51 ? 1811 LEU A CA  1 
ATOM   2161 C C   . LEU A 1 304 ? 73.962  32.355  27.249 1.00 140.86 ? 1811 LEU A C   1 
ATOM   2162 O O   . LEU A 1 304 ? 75.121  32.655  27.542 1.00 141.10 ? 1811 LEU A O   1 
ATOM   2163 C CB  . LEU A 1 304 ? 72.667  31.595  29.273 1.00 140.34 ? 1811 LEU A CB  1 
ATOM   2164 C CG  . LEU A 1 304 ? 72.072  30.234  28.889 1.00 140.21 ? 1811 LEU A CG  1 
ATOM   2165 C CD1 . LEU A 1 304 ? 72.761  29.117  29.645 1.00 140.24 ? 1811 LEU A CD1 1 
ATOM   2166 C CD2 . LEU A 1 304 ? 70.562  30.195  29.115 1.00 139.88 ? 1811 LEU A CD2 1 
ATOM   2167 N N   . LEU A 1 305 ? 73.621  31.727  26.122 1.00 141.59 ? 1812 LEU A N   1 
ATOM   2168 C CA  . LEU A 1 305 ? 74.541  31.438  25.004 1.00 141.93 ? 1812 LEU A CA  1 
ATOM   2169 C C   . LEU A 1 305 ? 75.457  30.218  25.197 1.00 142.09 ? 1812 LEU A C   1 
ATOM   2170 O O   . LEU A 1 305 ? 75.878  29.602  24.214 1.00 142.31 ? 1812 LEU A O   1 
ATOM   2171 C CB  . LEU A 1 305 ? 75.346  32.685  24.593 1.00 142.21 ? 1812 LEU A CB  1 
ATOM   2172 C CG  . LEU A 1 305 ? 75.824  32.818  23.142 1.00 142.54 ? 1812 LEU A CG  1 
ATOM   2173 C CD1 . LEU A 1 305 ? 74.654  32.964  22.174 1.00 142.41 ? 1812 LEU A CD1 1 
ATOM   2174 C CD2 . LEU A 1 305 ? 76.770  34.001  23.007 1.00 142.81 ? 1812 LEU A CD2 1 
ATOM   2175 N N   . TYR A 1 306 ? 75.758  29.871  26.448 1.00 123.50 ? 1813 TYR A N   1 
ATOM   2176 C CA  . TYR A 1 306 ? 76.606  28.709  26.745 1.00 123.65 ? 1813 TYR A CA  1 
ATOM   2177 C C   . TYR A 1 306 ? 75.793  27.432  27.009 1.00 123.40 ? 1813 TYR A C   1 
ATOM   2178 O O   . TYR A 1 306 ? 74.565  27.484  27.134 1.00 123.10 ? 1813 TYR A O   1 
ATOM   2179 C CB  . TYR A 1 306 ? 77.578  29.007  27.898 1.00 123.78 ? 1813 TYR A CB  1 
ATOM   2180 C CG  . TYR A 1 306 ? 76.923  29.397  29.207 1.00 123.49 ? 1813 TYR A CG  1 
ATOM   2181 C CD1 . TYR A 1 306 ? 76.662  30.734  29.506 1.00 123.44 ? 1813 TYR A CD1 1 
ATOM   2182 C CD2 . TYR A 1 306 ? 76.583  28.432  30.156 1.00 123.30 ? 1813 TYR A CD2 1 
ATOM   2183 C CE1 . TYR A 1 306 ? 76.065  31.100  30.708 1.00 123.20 ? 1813 TYR A CE1 1 
ATOM   2184 C CE2 . TYR A 1 306 ? 75.988  28.787  31.363 1.00 123.07 ? 1813 TYR A CE2 1 
ATOM   2185 C CZ  . TYR A 1 306 ? 75.732  30.122  31.631 1.00 123.02 ? 1813 TYR A CZ  1 
ATOM   2186 O OH  . TYR A 1 306 ? 75.145  30.481  32.821 1.00 122.82 ? 1813 TYR A OH  1 
ATOM   2187 N N   . SER A 1 307 ? 76.487  26.296  27.097 1.00 107.90 ? 1814 SER A N   1 
ATOM   2188 C CA  . SER A 1 307 ? 75.838  24.983  27.170 1.00 107.71 ? 1814 SER A CA  1 
ATOM   2189 C C   . SER A 1 307 ? 75.984  24.265  28.515 1.00 107.59 ? 1814 SER A C   1 
ATOM   2190 O O   . SER A 1 307 ? 76.995  24.414  29.205 1.00 107.79 ? 1814 SER A O   1 
ATOM   2191 C CB  . SER A 1 307 ? 76.347  24.078  26.042 1.00 107.98 ? 1814 SER A CB  1 
ATOM   2192 O OG  . SER A 1 307 ? 77.735  23.825  26.176 1.00 108.32 ? 1814 SER A OG  1 
ATOM   2193 N N   . PHE A 1 308 ? 74.960  23.486  28.868 1.00 98.25  ? 1815 PHE A N   1 
ATOM   2194 C CA  . PHE A 1 308 ? 74.972  22.639  30.061 1.00 98.12  ? 1815 PHE A CA  1 
ATOM   2195 C C   . PHE A 1 308 ? 75.134  21.168  29.682 1.00 98.18  ? 1815 PHE A C   1 
ATOM   2196 O O   . PHE A 1 308 ? 74.271  20.593  29.014 1.00 98.02  ? 1815 PHE A O   1 
ATOM   2197 C CB  . PHE A 1 308 ? 73.690  22.825  30.880 1.00 97.74  ? 1815 PHE A CB  1 
ATOM   2198 C CG  . PHE A 1 308 ? 73.613  24.138  31.608 1.00 97.69  ? 1815 PHE A CG  1 
ATOM   2199 C CD1 . PHE A 1 308 ? 74.378  24.364  32.749 1.00 97.80  ? 1815 PHE A CD1 1 
ATOM   2200 C CD2 . PHE A 1 308 ? 72.762  25.143  31.164 1.00 97.54  ? 1815 PHE A CD2 1 
ATOM   2201 C CE1 . PHE A 1 308 ? 74.305  25.577  33.429 1.00 97.76  ? 1815 PHE A CE1 1 
ATOM   2202 C CE2 . PHE A 1 308 ? 72.680  26.358  31.839 1.00 97.50  ? 1815 PHE A CE2 1 
ATOM   2203 C CZ  . PHE A 1 308 ? 73.454  26.575  32.973 1.00 97.61  ? 1815 PHE A CZ  1 
ATOM   2204 N N   . ASN A 1 309 ? 76.237  20.568  30.119 1.00 90.63  ? 1816 ASN A N   1 
ATOM   2205 C CA  . ASN A 1 309 ? 76.571  19.188  29.768 1.00 90.75  ? 1816 ASN A CA  1 
ATOM   2206 C C   . ASN A 1 309 ? 75.962  18.170  30.732 1.00 90.49  ? 1816 ASN A C   1 
ATOM   2207 O O   . ASN A 1 309 ? 76.552  17.842  31.764 1.00 90.56  ? 1816 ASN A O   1 
ATOM   2208 C CB  . ASN A 1 309 ? 78.095  19.016  29.678 1.00 91.17  ? 1816 ASN A CB  1 
ATOM   2209 C CG  . ASN A 1 309 ? 78.508  17.716  28.999 1.00 91.36  ? 1816 ASN A CG  1 
ATOM   2210 O OD1 . ASN A 1 309 ? 77.686  17.020  28.395 1.00 91.17  ? 1816 ASN A OD1 1 
ATOM   2211 N ND2 . ASN A 1 309 ? 79.801  17.393  29.091 1.00 91.74  ? 1816 ASN A ND2 1 
ATOM   2212 N N   . LEU A 1 310 ? 74.784  17.665  30.375 1.00 87.51  ? 1817 LEU A N   1 
ATOM   2213 C CA  . LEU A 1 310 ? 74.060  16.701  31.206 1.00 87.25  ? 1817 LEU A CA  1 
ATOM   2214 C C   . LEU A 1 310 ? 74.501  15.252  30.972 1.00 87.38  ? 1817 LEU A C   1 
ATOM   2215 O O   . LEU A 1 310 ? 73.954  14.327  31.581 1.00 87.19  ? 1817 LEU A O   1 
ATOM   2216 C CB  . LEU A 1 310 ? 72.546  16.844  30.998 1.00 86.89  ? 1817 LEU A CB  1 
ATOM   2217 C CG  . LEU A 1 310 ? 71.880  18.165  31.403 1.00 86.70  ? 1817 LEU A CG  1 
ATOM   2218 C CD1 . LEU A 1 310 ? 70.506  18.289  30.768 1.00 86.45  ? 1817 LEU A CD1 1 
ATOM   2219 C CD2 . LEU A 1 310 ? 71.783  18.315  32.918 1.00 86.56  ? 1817 LEU A CD2 1 
ATOM   2220 N N   . SER A 1 311 ? 75.496  15.063  30.103 1.00 86.91  ? 1818 SER A N   1 
ATOM   2221 C CA  . SER A 1 311 ? 76.030  13.734  29.779 1.00 87.08  ? 1818 SER A CA  1 
ATOM   2222 C C   . SER A 1 311 ? 76.775  13.085  30.946 1.00 87.19  ? 1818 SER A C   1 
ATOM   2223 O O   . SER A 1 311 ? 76.979  11.869  30.958 1.00 87.27  ? 1818 SER A O   1 
ATOM   2224 C CB  . SER A 1 311 ? 76.947  13.803  28.554 1.00 87.47  ? 1818 SER A CB  1 
ATOM   2225 O OG  . SER A 1 311 ? 76.215  14.121  27.384 1.00 87.39  ? 1818 SER A OG  1 
ATOM   2226 N N   . SER A 1 312 ? 77.181  13.902  31.916 1.00 86.97  ? 1819 SER A N   1 
ATOM   2227 C CA  . SER A 1 312 ? 77.824  13.416  33.137 1.00 87.07  ? 1819 SER A CA  1 
ATOM   2228 C C   . SER A 1 312 ? 76.854  12.611  34.003 1.00 86.76  ? 1819 SER A C   1 
ATOM   2229 O O   . SER A 1 312 ? 77.267  11.718  34.745 1.00 86.84  ? 1819 SER A O   1 
ATOM   2230 C CB  . SER A 1 312 ? 78.401  14.585  33.938 1.00 87.17  ? 1819 SER A CB  1 
ATOM   2231 O OG  . SER A 1 312 ? 77.405  15.552  34.221 1.00 86.87  ? 1819 SER A OG  1 
ATOM   2232 N N   . LEU A 1 313 ? 75.568  12.938  33.894 1.00 86.16  ? 1820 LEU A N   1 
ATOM   2233 C CA  . LEU A 1 313 ? 74.511  12.255  34.635 1.00 85.85  ? 1820 LEU A CA  1 
ATOM   2234 C C   . LEU A 1 313 ? 74.017  11.014  33.897 1.00 85.77  ? 1820 LEU A C   1 
ATOM   2235 O O   . LEU A 1 313 ? 73.357  10.155  34.485 1.00 85.57  ? 1820 LEU A O   1 
ATOM   2236 C CB  . LEU A 1 313 ? 73.346  13.216  34.895 1.00 85.53  ? 1820 LEU A CB  1 
ATOM   2237 C CG  . LEU A 1 313 ? 73.387  14.150  36.113 1.00 85.49  ? 1820 LEU A CG  1 
ATOM   2238 C CD1 . LEU A 1 313 ? 74.629  15.037  36.157 1.00 85.81  ? 1820 LEU A CD1 1 
ATOM   2239 C CD2 . LEU A 1 313 ? 72.138  15.008  36.138 1.00 85.19  ? 1820 LEU A CD2 1 
ATOM   2240 N N   . SER A 1 314 ? 74.357  10.922  32.613 1.00 86.59  ? 1821 SER A N   1 
ATOM   2241 C CA  . SER A 1 314 ? 73.928  9.811   31.764 1.00 86.56  ? 1821 SER A CA  1 
ATOM   2242 C C   . SER A 1 314 ? 74.717  8.527   32.031 1.00 86.76  ? 1821 SER A C   1 
ATOM   2243 O O   . SER A 1 314 ? 74.888  7.693   31.137 1.00 86.88  ? 1821 SER A O   1 
ATOM   2244 C CB  . SER A 1 314 ? 74.022  10.202  30.282 1.00 86.73  ? 1821 SER A CB  1 
ATOM   2245 O OG  . SER A 1 314 ? 75.368  10.264  29.839 1.00 87.13  ? 1821 SER A OG  1 
ATOM   2246 N N   . THR A 1 315 ? 75.180  8.368   33.267 1.00 88.61  ? 1822 THR A N   1 
ATOM   2247 C CA  . THR A 1 315 ? 76.029  7.237   33.632 1.00 88.83  ? 1822 THR A CA  1 
ATOM   2248 C C   . THR A 1 315 ? 75.248  5.937   33.862 1.00 88.62  ? 1822 THR A C   1 
ATOM   2249 O O   . THR A 1 315 ? 75.618  4.892   33.318 1.00 88.78  ? 1822 THR A O   1 
ATOM   2250 C CB  . THR A 1 315 ? 76.966  7.568   34.838 1.00 89.02  ? 1822 THR A CB  1 
ATOM   2251 O OG1 . THR A 1 315 ? 77.761  6.422   35.168 1.00 89.25  ? 1822 THR A OG1 1 
ATOM   2252 C CG2 . THR A 1 315 ? 76.172  8.021   36.070 1.00 88.71  ? 1822 THR A CG2 1 
ATOM   2253 N N   . SER A 1 316 ? 74.169  6.007   34.646 1.00 89.93  ? 1823 SER A N   1 
ATOM   2254 C CA  . SER A 1 316 ? 73.421  4.809   35.048 1.00 89.72  ? 1823 SER A CA  1 
ATOM   2255 C C   . SER A 1 316 ? 71.992  5.073   35.546 1.00 89.32  ? 1823 SER A C   1 
ATOM   2256 O O   . SER A 1 316 ? 71.465  6.182   35.425 1.00 89.18  ? 1823 SER A O   1 
ATOM   2257 C CB  . SER A 1 316 ? 74.209  4.023   36.108 1.00 89.90  ? 1823 SER A CB  1 
ATOM   2258 O OG  . SER A 1 316 ? 74.479  4.825   37.245 1.00 89.93  ? 1823 SER A OG  1 
ATOM   2259 N N   . THR A 1 317 ? 71.387  4.026   36.106 1.00 91.49  ? 1824 THR A N   1 
ATOM   2260 C CA  . THR A 1 317 ? 70.018  4.042   36.617 1.00 91.13  ? 1824 THR A CA  1 
ATOM   2261 C C   . THR A 1 317 ? 69.949  4.655   38.019 1.00 91.07  ? 1824 THR A C   1 
ATOM   2262 O O   . THR A 1 317 ? 70.907  4.569   38.789 1.00 91.29  ? 1824 THR A O   1 
ATOM   2263 C CB  . THR A 1 317 ? 69.450  2.600   36.660 1.00 91.02  ? 1824 THR A CB  1 
ATOM   2264 O OG1 . THR A 1 317 ? 69.615  1.979   35.380 1.00 91.13  ? 1824 THR A OG1 1 
ATOM   2265 C CG2 . THR A 1 317 ? 67.976  2.588   37.030 1.00 90.67  ? 1824 THR A CG2 1 
ATOM   2266 N N   . PHE A 1 318 ? 68.811  5.272   38.335 1.00 90.73  ? 1825 PHE A N   1 
ATOM   2267 C CA  . PHE A 1 318 ? 68.547  5.827   39.665 1.00 90.65  ? 1825 PHE A CA  1 
ATOM   2268 C C   . PHE A 1 318 ? 67.226  5.296   40.223 1.00 90.36  ? 1825 PHE A C   1 
ATOM   2269 O O   . PHE A 1 318 ? 66.301  4.998   39.465 1.00 90.18  ? 1825 PHE A O   1 
ATOM   2270 C CB  . PHE A 1 318 ? 68.517  7.358   39.613 1.00 90.63  ? 1825 PHE A CB  1 
ATOM   2271 C CG  . PHE A 1 318 ? 69.849  7.982   39.309 1.00 90.93  ? 1825 PHE A CG  1 
ATOM   2272 C CD1 . PHE A 1 318 ? 70.657  8.454   40.337 1.00 91.11  ? 1825 PHE A CD1 1 
ATOM   2273 C CD2 . PHE A 1 318 ? 70.298  8.097   37.995 1.00 91.05  ? 1825 PHE A CD2 1 
ATOM   2274 C CE1 . PHE A 1 318 ? 71.895  9.032   40.063 1.00 91.40  ? 1825 PHE A CE1 1 
ATOM   2275 C CE2 . PHE A 1 318 ? 71.534  8.668   37.710 1.00 91.35  ? 1825 PHE A CE2 1 
ATOM   2276 C CZ  . PHE A 1 318 ? 72.334  9.139   38.746 1.00 91.52  ? 1825 PHE A CZ  1 
ATOM   2277 N N   . LYS A 1 319 ? 67.143  5.179   41.547 1.00 92.57  ? 1826 LYS A N   1 
ATOM   2278 C CA  . LYS A 1 319 ? 65.927  4.696   42.198 1.00 92.33  ? 1826 LYS A CA  1 
ATOM   2279 C C   . LYS A 1 319 ? 65.357  5.728   43.168 1.00 92.24  ? 1826 LYS A C   1 
ATOM   2280 O O   . LYS A 1 319 ? 65.710  5.748   44.350 1.00 92.33  ? 1826 LYS A O   1 
ATOM   2281 C CB  . LYS A 1 319 ? 66.173  3.353   42.904 1.00 92.41  ? 1826 LYS A CB  1 
ATOM   2282 C CG  . LYS A 1 319 ? 66.605  2.210   41.985 1.00 92.49  ? 1826 LYS A CG  1 
ATOM   2283 C CD  . LYS A 1 319 ? 65.499  1.800   41.018 1.00 92.25  ? 1826 LYS A CD  1 
ATOM   2284 C CE  . LYS A 1 319 ? 66.011  0.849   39.945 1.00 92.37  ? 1826 LYS A CE  1 
ATOM   2285 N NZ  . LYS A 1 319 ? 66.383  -0.489  40.486 1.00 92.51  ? 1826 LYS A NZ  1 
ATOM   2286 N N   . VAL A 1 320 ? 64.487  6.591   42.651 1.00 90.93  ? 1827 VAL A N   1 
ATOM   2287 C CA  . VAL A 1 320 ? 63.786  7.578   43.470 1.00 90.83  ? 1827 VAL A CA  1 
ATOM   2288 C C   . VAL A 1 320 ? 62.479  6.962   43.951 1.00 90.61  ? 1827 VAL A C   1 
ATOM   2289 O O   . VAL A 1 320 ? 61.697  6.448   43.149 1.00 90.45  ? 1827 VAL A O   1 
ATOM   2290 C CB  . VAL A 1 320 ? 63.485  8.877   42.693 1.00 90.77  ? 1827 VAL A CB  1 
ATOM   2291 C CG1 . VAL A 1 320 ? 63.144  9.999   43.658 1.00 90.76  ? 1827 VAL A CG1 1 
ATOM   2292 C CG2 . VAL A 1 320 ? 64.668  9.274   41.827 1.00 90.97  ? 1827 VAL A CG2 1 
ATOM   2293 N N   . THR A 1 321 ? 62.246  7.016   45.258 1.00 92.57  ? 1828 THR A N   1 
ATOM   2294 C CA  . THR A 1 321 ? 61.097  6.343   45.851 1.00 92.41  ? 1828 THR A CA  1 
ATOM   2295 C C   . THR A 1 321 ? 60.375  7.223   46.863 1.00 92.37  ? 1828 THR A C   1 
ATOM   2296 O O   . THR A 1 321 ? 61.003  7.854   47.716 1.00 92.54  ? 1828 THR A O   1 
ATOM   2297 C CB  . THR A 1 321 ? 61.511  5.004   46.509 1.00 92.49  ? 1828 THR A CB  1 
ATOM   2298 O OG1 . THR A 1 321 ? 62.264  4.227   45.571 1.00 92.55  ? 1828 THR A OG1 1 
ATOM   2299 C CG2 . THR A 1 321 ? 60.294  4.201   46.943 1.00 92.32  ? 1828 THR A CG2 1 
ATOM   2300 N N   . ARG A 1 322 ? 59.050  7.260   46.741 1.00 92.89  ? 1829 ARG A N   1 
ATOM   2301 C CA  . ARG A 1 322 ? 58.178  7.929   47.703 1.00 92.85  ? 1829 ARG A CA  1 
ATOM   2302 C C   . ARG A 1 322 ? 56.838  7.207   47.814 1.00 92.67  ? 1829 ARG A C   1 
ATOM   2303 O O   . ARG A 1 322 ? 56.183  6.944   46.802 1.00 92.51  ? 1829 ARG A O   1 
ATOM   2304 C CB  . ARG A 1 322 ? 57.959  9.392   47.316 1.00 92.83  ? 1829 ARG A CB  1 
ATOM   2305 C CG  . ARG A 1 322 ? 58.811  10.383  48.100 1.00 93.03  ? 1829 ARG A CG  1 
ATOM   2306 C CD  . ARG A 1 322 ? 58.388  11.814  47.808 1.00 93.00  ? 1829 ARG A CD  1 
ATOM   2307 N NE  . ARG A 1 322 ? 56.939  11.986  47.915 1.00 92.83  ? 1829 ARG A NE  1 
ATOM   2308 C CZ  . ARG A 1 322 ? 56.247  12.970  47.347 1.00 92.74  ? 1829 ARG A CZ  1 
ATOM   2309 N NH1 . ARG A 1 322 ? 56.861  13.894  46.618 1.00 92.78  ? 1829 ARG A NH1 1 
ATOM   2310 N NH2 . ARG A 1 322 ? 54.932  13.030  47.506 1.00 92.63  ? 1829 ARG A NH2 1 
ATOM   2311 N N   . ASP A 1 323 ? 56.449  6.891   49.049 1.00 95.21  ? 1830 ASP A N   1 
ATOM   2312 C CA  . ASP A 1 323 ? 55.187  6.204   49.357 1.00 95.07  ? 1830 ASP A CA  1 
ATOM   2313 C C   . ASP A 1 323 ? 55.045  4.885   48.593 1.00 94.96  ? 1830 ASP A C   1 
ATOM   2314 O O   . ASP A 1 323 ? 54.143  4.732   47.766 1.00 94.79  ? 1830 ASP A O   1 
ATOM   2315 C CB  . ASP A 1 323 ? 53.974  7.116   49.092 1.00 94.95  ? 1830 ASP A CB  1 
ATOM   2316 C CG  . ASP A 1 323 ? 54.122  8.502   49.706 1.00 95.06  ? 1830 ASP A CG  1 
ATOM   2317 O OD1 . ASP A 1 323 ? 55.046  8.715   50.522 1.00 95.25  ? 1830 ASP A OD1 1 
ATOM   2318 O OD2 . ASP A 1 323 ? 53.304  9.384   49.368 1.00 94.99  ? 1830 ASP A OD2 1 
ATOM   2319 N N   . SER A 1 324 ? 55.948  3.947   48.873 1.00 95.19  ? 1831 SER A N   1 
ATOM   2320 C CA  . SER A 1 324 ? 55.983  2.626   48.221 1.00 95.11  ? 1831 SER A CA  1 
ATOM   2321 C C   . SER A 1 324 ? 56.333  2.669   46.728 1.00 95.05  ? 1831 SER A C   1 
ATOM   2322 O O   . SER A 1 324 ? 56.821  1.681   46.175 1.00 95.06  ? 1831 SER A O   1 
ATOM   2323 C CB  . SER A 1 324 ? 54.670  1.856   48.436 1.00 94.96  ? 1831 SER A CB  1 
ATOM   2324 O OG  . SER A 1 324 ? 54.385  1.695   49.814 1.00 95.05  ? 1831 SER A OG  1 
ATOM   2325 N N   . ARG A 1 325 ? 56.089  3.811   46.087 1.00 91.66  ? 1832 ARG A N   1 
ATOM   2326 C CA  . ARG A 1 325 ? 56.304  3.962   44.648 1.00 91.61  ? 1832 ARG A CA  1 
ATOM   2327 C C   . ARG A 1 325 ? 57.783  4.109   44.296 1.00 91.79  ? 1832 ARG A C   1 
ATOM   2328 O O   . ARG A 1 325 ? 58.379  5.171   44.488 1.00 91.90  ? 1832 ARG A O   1 
ATOM   2329 C CB  . ARG A 1 325 ? 55.488  5.135   44.095 1.00 91.51  ? 1832 ARG A CB  1 
ATOM   2330 C CG  . ARG A 1 325 ? 53.985  4.887   44.067 1.00 91.34  ? 1832 ARG A CG  1 
ATOM   2331 C CD  . ARG A 1 325 ? 53.226  6.086   43.521 1.00 91.27  ? 1832 ARG A CD  1 
ATOM   2332 N NE  . ARG A 1 325 ? 53.215  7.212   44.454 1.00 91.34  ? 1832 ARG A NE  1 
ATOM   2333 C CZ  . ARG A 1 325 ? 52.258  7.443   45.351 1.00 91.31  ? 1832 ARG A CZ  1 
ATOM   2334 N NH1 . ARG A 1 325 ? 51.214  6.628   45.453 1.00 91.21  ? 1832 ARG A NH1 1 
ATOM   2335 N NH2 . ARG A 1 325 ? 52.346  8.497   46.151 1.00 91.40  ? 1832 ARG A NH2 1 
ATOM   2336 N N   . THR A 1 326 ? 58.360  3.028   43.776 1.00 91.86  ? 1833 THR A N   1 
ATOM   2337 C CA  . THR A 1 326 ? 59.770  2.986   43.400 1.00 92.06  ? 1833 THR A CA  1 
ATOM   2338 C C   . THR A 1 326 ? 59.952  3.321   41.917 1.00 92.05  ? 1833 THR A C   1 
ATOM   2339 O O   . THR A 1 326 ? 59.800  2.457   41.049 1.00 92.00  ? 1833 THR A O   1 
ATOM   2340 C CB  . THR A 1 326 ? 60.386  1.602   43.722 1.00 92.16  ? 1833 THR A CB  1 
ATOM   2341 O OG1 . THR A 1 326 ? 60.076  1.242   45.073 1.00 92.17  ? 1833 THR A OG1 1 
ATOM   2342 C CG2 . THR A 1 326 ? 61.898  1.618   43.541 1.00 92.40  ? 1833 THR A CG2 1 
ATOM   2343 N N   . TYR A 1 327 ? 60.269  4.583   41.636 1.00 89.30  ? 1834 TYR A N   1 
ATOM   2344 C CA  . TYR A 1 327 ? 60.522  5.033   40.267 1.00 89.33  ? 1834 TYR A CA  1 
ATOM   2345 C C   . TYR A 1 327 ? 61.929  4.677   39.803 1.00 89.55  ? 1834 TYR A C   1 
ATOM   2346 O O   . TYR A 1 327 ? 62.803  4.355   40.611 1.00 89.70  ? 1834 TYR A O   1 
ATOM   2347 C CB  . TYR A 1 327 ? 60.323  6.547   40.143 1.00 89.31  ? 1834 TYR A CB  1 
ATOM   2348 C CG  . TYR A 1 327 ? 58.890  7.009   40.244 1.00 89.11  ? 1834 TYR A CG  1 
ATOM   2349 C CD1 . TYR A 1 327 ? 58.445  7.706   41.362 1.00 89.07  ? 1834 TYR A CD1 1 
ATOM   2350 C CD2 . TYR A 1 327 ? 57.981  6.759   39.216 1.00 88.97  ? 1834 TYR A CD2 1 
ATOM   2351 C CE1 . TYR A 1 327 ? 57.130  8.140   41.460 1.00 88.91  ? 1834 TYR A CE1 1 
ATOM   2352 C CE2 . TYR A 1 327 ? 56.663  7.188   39.306 1.00 88.82  ? 1834 TYR A CE2 1 
ATOM   2353 C CZ  . TYR A 1 327 ? 56.245  7.877   40.430 1.00 88.78  ? 1834 TYR A CZ  1 
ATOM   2354 O OH  . TYR A 1 327 ? 54.942  8.303   40.525 1.00 88.65  ? 1834 TYR A OH  1 
ATOM   2355 N N   . SER A 1 328 ? 62.135  4.743   38.491 1.00 90.60  ? 1835 SER A N   1 
ATOM   2356 C CA  . SER A 1 328 ? 63.448  4.559   37.894 1.00 90.84  ? 1835 SER A CA  1 
ATOM   2357 C C   . SER A 1 328 ? 63.693  5.690   36.904 1.00 90.92  ? 1835 SER A C   1 
ATOM   2358 O O   . SER A 1 328 ? 62.974  5.821   35.915 1.00 90.82  ? 1835 SER A O   1 
ATOM   2359 C CB  . SER A 1 328 ? 63.533  3.199   37.201 1.00 90.88  ? 1835 SER A CB  1 
ATOM   2360 O OG  . SER A 1 328 ? 64.799  3.006   36.601 1.00 91.13  ? 1835 SER A OG  1 
ATOM   2361 N N   . VAL A 1 329 ? 64.694  6.519   37.187 1.00 89.18  ? 1836 VAL A N   1 
ATOM   2362 C CA  . VAL A 1 329 ? 64.993  7.674   36.343 1.00 89.27  ? 1836 VAL A CA  1 
ATOM   2363 C C   . VAL A 1 329 ? 66.380  7.554   35.715 1.00 89.57  ? 1836 VAL A C   1 
ATOM   2364 O O   . VAL A 1 329 ? 67.365  7.263   36.400 1.00 89.74  ? 1836 VAL A O   1 
ATOM   2365 C CB  . VAL A 1 329 ? 64.867  9.011   37.123 1.00 89.22  ? 1836 VAL A CB  1 
ATOM   2366 C CG1 . VAL A 1 329 ? 65.107  10.199  36.204 1.00 89.30  ? 1836 VAL A CG1 1 
ATOM   2367 C CG2 . VAL A 1 329 ? 63.497  9.128   37.774 1.00 88.95  ? 1836 VAL A CG2 1 
ATOM   2368 N N   . GLY A 1 330 ? 66.440  7.770   34.405 1.00 89.83  ? 1837 GLY A N   1 
ATOM   2369 C CA  . GLY A 1 330 ? 67.700  7.774   33.674 1.00 90.15  ? 1837 GLY A CA  1 
ATOM   2370 C C   . GLY A 1 330 ? 67.762  8.940   32.711 1.00 90.22  ? 1837 GLY A C   1 
ATOM   2371 O O   . GLY A 1 330 ? 67.069  8.948   31.692 1.00 90.15  ? 1837 GLY A O   1 
ATOM   2372 N N   . VAL A 1 331 ? 68.581  9.936   33.043 1.00 90.13  ? 1838 VAL A N   1 
ATOM   2373 C CA  . VAL A 1 331 ? 68.787  11.088  32.168 1.00 90.23  ? 1838 VAL A CA  1 
ATOM   2374 C C   . VAL A 1 331 ? 69.558  10.630  30.934 1.00 90.51  ? 1838 VAL A C   1 
ATOM   2375 O O   . VAL A 1 331 ? 70.679  10.133  31.047 1.00 90.76  ? 1838 VAL A O   1 
ATOM   2376 C CB  . VAL A 1 331 ? 69.529  12.243  32.890 1.00 90.34  ? 1838 VAL A CB  1 
ATOM   2377 C CG1 . VAL A 1 331 ? 69.869  13.367  31.916 1.00 90.49  ? 1838 VAL A CG1 1 
ATOM   2378 C CG2 . VAL A 1 331 ? 68.689  12.779  34.034 1.00 90.08  ? 1838 VAL A CG2 1 
ATOM   2379 N N   . CYS A 1 332 ? 68.930  10.777  29.768 1.00 94.21  ? 1839 CYS A N   1 
ATOM   2380 C CA  . CYS A 1 332 ? 69.495  10.347  28.480 1.00 94.47  ? 1839 CYS A CA  1 
ATOM   2381 C C   . CYS A 1 332 ? 69.764  8.836   28.378 1.00 94.55  ? 1839 CYS A C   1 
ATOM   2382 O O   . CYS A 1 332 ? 70.500  8.388   27.496 1.00 94.84  ? 1839 CYS A O   1 
ATOM   2383 C CB  . CYS A 1 332 ? 70.748  11.166  28.124 1.00 94.79  ? 1839 CYS A CB  1 
ATOM   2384 S SG  . CYS A 1 332 ? 70.387  12.799  27.430 1.00 94.77  ? 1839 CYS A SG  1 
ATOM   2385 N N   . THR A 1 333 ? 69.154  8.059   29.273 1.00 95.31  ? 1840 THR A N   1 
ATOM   2386 C CA  . THR A 1 333 ? 69.300  6.601   29.289 1.00 95.36  ? 1840 THR A CA  1 
ATOM   2387 C C   . THR A 1 333 ? 67.986  5.943   29.699 1.00 95.02  ? 1840 THR A C   1 
ATOM   2388 O O   . THR A 1 333 ? 67.255  6.482   30.530 1.00 94.78  ? 1840 THR A O   1 
ATOM   2389 C CB  . THR A 1 333 ? 70.412  6.148   30.266 1.00 95.52  ? 1840 THR A CB  1 
ATOM   2390 O OG1 . THR A 1 333 ? 71.571  6.971   30.098 1.00 95.81  ? 1840 THR A OG1 1 
ATOM   2391 C CG2 . THR A 1 333 ? 70.797  4.690   30.025 1.00 95.67  ? 1840 THR A CG2 1 
ATOM   2392 N N   . PHE A 1 334 ? 67.695  4.779   29.118 1.00 97.04  ? 1841 PHE A N   1 
ATOM   2393 C CA  . PHE A 1 334 ? 66.481  4.021   29.437 1.00 96.75  ? 1841 PHE A CA  1 
ATOM   2394 C C   . PHE A 1 334 ? 66.350  3.772   30.937 1.00 96.58  ? 1841 PHE A C   1 
ATOM   2395 O O   . PHE A 1 334 ? 67.321  3.394   31.594 1.00 96.74  ? 1841 PHE A O   1 
ATOM   2396 C CB  . PHE A 1 334 ? 66.453  2.690   28.679 1.00 96.84  ? 1841 PHE A CB  1 
ATOM   2397 C CG  . PHE A 1 334 ? 66.371  2.841   27.185 1.00 97.00  ? 1841 PHE A CG  1 
ATOM   2398 C CD1 . PHE A 1 334 ? 65.159  3.136   26.567 1.00 96.82  ? 1841 PHE A CD1 1 
ATOM   2399 C CD2 . PHE A 1 334 ? 67.504  2.678   26.394 1.00 97.35  ? 1841 PHE A CD2 1 
ATOM   2400 C CE1 . PHE A 1 334 ? 65.079  3.276   25.183 1.00 96.99  ? 1841 PHE A CE1 1 
ATOM   2401 C CE2 . PHE A 1 334 ? 67.434  2.814   25.009 1.00 97.52  ? 1841 PHE A CE2 1 
ATOM   2402 C CZ  . PHE A 1 334 ? 66.218  3.113   24.403 1.00 97.34  ? 1841 PHE A CZ  1 
ATOM   2403 N N   . ALA A 1 335 ? 65.146  3.996   31.463 1.00 93.51  ? 1842 ALA A N   1 
ATOM   2404 C CA  . ALA A 1 335 ? 64.856  3.865   32.893 1.00 93.35  ? 1842 ALA A CA  1 
ATOM   2405 C C   . ALA A 1 335 ? 65.272  2.508   33.441 1.00 93.40  ? 1842 ALA A C   1 
ATOM   2406 O O   . ALA A 1 335 ? 66.113  2.422   34.335 1.00 93.52  ? 1842 ALA A O   1 
ATOM   2407 C CB  . ALA A 1 335 ? 63.380  4.103   33.157 1.00 93.05  ? 1842 ALA A CB  1 
ATOM   2408 N N   . VAL A 1 336 ? 64.671  1.453   32.901 1.00 99.17  ? 1843 VAL A N   1 
ATOM   2409 C CA  . VAL A 1 336 ? 65.029  0.093   33.268 1.00 99.23  ? 1843 VAL A CA  1 
ATOM   2410 C C   . VAL A 1 336 ? 65.815  -0.516  32.115 1.00 99.49  ? 1843 VAL A C   1 
ATOM   2411 O O   . VAL A 1 336 ? 65.368  -0.486  30.965 1.00 99.49  ? 1843 VAL A O   1 
ATOM   2412 C CB  . VAL A 1 336 ? 63.788  -0.767  33.589 1.00 98.97  ? 1843 VAL A CB  1 
ATOM   2413 C CG1 . VAL A 1 336 ? 64.208  -2.089  34.191 1.00 99.04  ? 1843 VAL A CG1 1 
ATOM   2414 C CG2 . VAL A 1 336 ? 62.862  -0.036  34.547 1.00 98.73  ? 1843 VAL A CG2 1 
ATOM   2415 N N   . GLY A 1 337 ? 66.989  -1.058  32.432 1.00 107.03 ? 1844 GLY A N   1 
ATOM   2416 C CA  . GLY A 1 337 ? 67.893  -1.617  31.428 1.00 107.33 ? 1844 GLY A CA  1 
ATOM   2417 C C   . GLY A 1 337 ? 67.408  -2.915  30.803 1.00 107.30 ? 1844 GLY A C   1 
ATOM   2418 O O   . GLY A 1 337 ? 66.279  -3.344  31.057 1.00 107.04 ? 1844 GLY A O   1 
ATOM   2419 N N   . PRO A 1 338 ? 68.265  -3.557  29.984 1.00 119.21 ? 1845 PRO A N   1 
ATOM   2420 C CA  . PRO A 1 338 ? 67.922  -4.803  29.285 1.00 119.23 ? 1845 PRO A CA  1 
ATOM   2421 C C   . PRO A 1 338 ? 67.643  -5.996  30.211 1.00 119.09 ? 1845 PRO A C   1 
ATOM   2422 O O   . PRO A 1 338 ? 67.106  -7.010  29.756 1.00 119.03 ? 1845 PRO A O   1 
ATOM   2423 C CB  . PRO A 1 338 ? 69.162  -5.076  28.424 1.00 119.65 ? 1845 PRO A CB  1 
ATOM   2424 C CG  . PRO A 1 338 ? 70.270  -4.346  29.102 1.00 119.83 ? 1845 PRO A CG  1 
ATOM   2425 C CD  . PRO A 1 338 ? 69.638  -3.116  29.672 1.00 119.56 ? 1845 PRO A CD  1 
ATOM   2426 N N   . GLU A 1 339 ? 68.001  -5.869  31.490 1.00 123.20 ? 1846 GLU A N   1 
ATOM   2427 C CA  . GLU A 1 339 ? 67.826  -6.947  32.467 1.00 123.10 ? 1846 GLU A CA  1 
ATOM   2428 C C   . GLU A 1 339 ? 66.353  -7.162  32.827 1.00 122.73 ? 1846 GLU A C   1 
ATOM   2429 O O   . GLU A 1 339 ? 65.778  -8.201  32.493 1.00 122.65 ? 1846 GLU A O   1 
ATOM   2430 C CB  . GLU A 1 339 ? 68.670  -6.686  33.723 1.00 123.20 ? 1846 GLU A CB  1 
ATOM   2431 C CG  . GLU A 1 339 ? 68.881  -7.917  34.608 1.00 123.23 ? 1846 GLU A CG  1 
ATOM   2432 C CD  . GLU A 1 339 ? 69.850  -7.679  35.762 1.00 123.41 ? 1846 GLU A CD  1 
ATOM   2433 O OE1 . GLU A 1 339 ? 70.464  -6.593  35.832 1.00 123.56 ? 1846 GLU A OE1 1 
ATOM   2434 O OE2 . GLU A 1 339 ? 70.000  -8.589  36.606 1.00 123.41 ? 1846 GLU A OE2 1 
ATOM   2435 N N   . GLN A 1 340 ? 65.749  -6.184  33.500 1.00 116.19 ? 1847 GLN A N   1 
ATOM   2436 C CA  . GLN A 1 340 ? 64.333  -6.254  33.858 1.00 115.86 ? 1847 GLN A CA  1 
ATOM   2437 C C   . GLN A 1 340 ? 63.451  -5.864  32.670 1.00 115.76 ? 1847 GLN A C   1 
ATOM   2438 O O   . GLN A 1 340 ? 62.477  -6.555  32.364 1.00 115.60 ? 1847 GLN A O   1 
ATOM   2439 C CB  . GLN A 1 340 ? 64.036  -5.386  35.087 1.00 115.71 ? 1847 GLN A CB  1 
ATOM   2440 C CG  . GLN A 1 340 ? 62.598  -5.469  35.603 1.00 115.39 ? 1847 GLN A CG  1 
ATOM   2441 C CD  . GLN A 1 340 ? 62.233  -6.846  36.133 1.00 115.33 ? 1847 GLN A CD  1 
ATOM   2442 O OE1 . GLN A 1 340 ? 63.049  -7.524  36.761 1.00 115.47 ? 1847 GLN A OE1 1 
ATOM   2443 N NE2 . GLN A 1 340 ? 60.996  -7.264  35.885 1.00 115.11 ? 1847 GLN A NE2 1 
ATOM   2444 N N   . GLY A 1 341 ? 63.800  -4.753  32.019 1.00 112.47 ? 1848 GLY A N   1 
ATOM   2445 C CA  . GLY A 1 341 ? 63.182  -4.315  30.762 1.00 112.45 ? 1848 GLY A CA  1 
ATOM   2446 C C   . GLY A 1 341 ? 61.666  -4.290  30.689 1.00 112.17 ? 1848 GLY A C   1 
ATOM   2447 O O   . GLY A 1 341 ? 61.087  -4.607  29.647 1.00 112.18 ? 1848 GLY A O   1 
ATOM   2448 N N   . GLY A 1 342 ? 61.024  -3.909  31.792 1.00 108.07 ? 1849 GLY A N   1 
ATOM   2449 C CA  . GLY A 1 342 ? 59.566  -3.825  31.858 1.00 107.81 ? 1849 GLY A CA  1 
ATOM   2450 C C   . GLY A 1 342 ? 59.009  -2.677  31.037 1.00 107.78 ? 1849 GLY A C   1 
ATOM   2451 O O   . GLY A 1 342 ? 58.042  -2.849  30.293 1.00 107.71 ? 1849 GLY A O   1 
ATOM   2452 N N   . CYS A 1 343 ? 59.628  -1.507  31.174 1.00 101.13 ? 1850 CYS A N   1 
ATOM   2453 C CA  . CYS A 1 343 ? 59.207  -0.305  30.462 1.00 101.11 ? 1850 CYS A CA  1 
ATOM   2454 C C   . CYS A 1 343 ? 60.135  -0.002  29.287 1.00 101.38 ? 1850 CYS A C   1 
ATOM   2455 O O   . CYS A 1 343 ? 61.092  0.767   29.422 1.00 101.52 ? 1850 CYS A O   1 
ATOM   2456 C CB  . CYS A 1 343 ? 59.162  0.890   31.420 1.00 101.02 ? 1850 CYS A CB  1 
ATOM   2457 S SG  . CYS A 1 343 ? 58.050  0.686   32.829 1.00 100.74 ? 1850 CYS A SG  1 
ATOM   2458 N N   . LYS A 1 344 ? 59.853  -0.617  28.139 1.00 107.33 ? 1851 LYS A N   1 
ATOM   2459 C CA  . LYS A 1 344 ? 60.626  -0.365  26.925 1.00 107.61 ? 1851 LYS A CA  1 
ATOM   2460 C C   . LYS A 1 344 ? 60.380  1.063   26.445 1.00 107.62 ? 1851 LYS A C   1 
ATOM   2461 O O   . LYS A 1 344 ? 59.261  1.574   26.549 1.00 107.42 ? 1851 LYS A O   1 
ATOM   2462 C CB  . LYS A 1 344 ? 60.273  -1.371  25.825 1.00 107.71 ? 1851 LYS A CB  1 
ATOM   2463 C CG  . LYS A 1 344 ? 61.322  -1.467  24.721 1.00 108.06 ? 1851 LYS A CG  1 
ATOM   2464 C CD  . LYS A 1 344 ? 60.832  -2.270  23.526 1.00 108.17 ? 1851 LYS A CD  1 
ATOM   2465 C CE  . LYS A 1 344 ? 61.868  -2.266  22.409 1.00 108.55 ? 1851 LYS A CE  1 
ATOM   2466 N NZ  . LYS A 1 344 ? 61.404  -2.997  21.197 1.00 108.71 ? 1851 LYS A NZ  1 
ATOM   2467 N N   . ASP A 1 345 ? 61.439  1.698   25.939 1.00 104.21 ? 1852 ASP A N   1 
ATOM   2468 C CA  . ASP A 1 345 ? 61.420  3.099   25.489 1.00 104.25 ? 1852 ASP A CA  1 
ATOM   2469 C C   . ASP A 1 345 ? 61.235  4.113   26.622 1.00 104.06 ? 1852 ASP A C   1 
ATOM   2470 O O   . ASP A 1 345 ? 61.632  5.269   26.487 1.00 104.14 ? 1852 ASP A O   1 
ATOM   2471 C CB  . ASP A 1 345 ? 60.377  3.332   24.383 1.00 104.23 ? 1852 ASP A CB  1 
ATOM   2472 C CG  . ASP A 1 345 ? 60.728  2.630   23.079 1.00 104.50 ? 1852 ASP A CG  1 
ATOM   2473 O OD1 . ASP A 1 345 ? 61.929  2.404   22.812 1.00 104.76 ? 1852 ASP A OD1 1 
ATOM   2474 O OD2 . ASP A 1 345 ? 59.795  2.313   22.312 1.00 104.49 ? 1852 ASP A OD2 1 
ATOM   2475 N N   . GLY A 1 346 ? 60.644  3.676   27.732 1.00 97.26  ? 1853 GLY A N   1 
ATOM   2476 C CA  . GLY A 1 346 ? 60.350  4.553   28.863 1.00 97.08  ? 1853 GLY A CA  1 
ATOM   2477 C C   . GLY A 1 346 ? 61.575  5.137   29.541 1.00 97.21  ? 1853 GLY A C   1 
ATOM   2478 O O   . GLY A 1 346 ? 62.438  4.401   30.021 1.00 97.31  ? 1853 GLY A O   1 
ATOM   2479 N N   . GLY A 1 347 ? 61.646  6.467   29.568 1.00 94.01  ? 1854 GLY A N   1 
ATOM   2480 C CA  . GLY A 1 347 ? 62.716  7.192   30.256 1.00 94.12  ? 1854 GLY A CA  1 
ATOM   2481 C C   . GLY A 1 347 ? 62.530  7.206   31.764 1.00 93.96  ? 1854 GLY A C   1 
ATOM   2482 O O   . GLY A 1 347 ? 63.507  7.265   32.515 1.00 94.08  ? 1854 GLY A O   1 
ATOM   2483 N N   . VAL A 1 348 ? 61.269  7.175   32.196 1.00 89.97  ? 1855 VAL A N   1 
ATOM   2484 C CA  . VAL A 1 348 ? 60.896  7.005   33.604 1.00 89.81  ? 1855 VAL A CA  1 
ATOM   2485 C C   . VAL A 1 348 ? 59.914  5.834   33.696 1.00 89.64  ? 1855 VAL A C   1 
ATOM   2486 O O   . VAL A 1 348 ? 58.972  5.746   32.904 1.00 89.56  ? 1855 VAL A O   1 
ATOM   2487 C CB  . VAL A 1 348 ? 60.259  8.288   34.214 1.00 89.69  ? 1855 VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 348 ? 59.948  8.091   35.695 1.00 89.56  ? 1855 VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 348 ? 61.172  9.492   34.034 1.00 89.86  ? 1855 VAL A CG2 1 
ATOM   2490 N N   . CYS A 1 349 ? 60.137  4.940   34.656 1.00 90.97  ? 1856 CYS A N   1 
ATOM   2491 C CA  . CYS A 1 349 ? 59.313  3.741   34.799 1.00 90.83  ? 1856 CYS A CA  1 
ATOM   2492 C C   . CYS A 1 349 ? 58.889  3.500   36.249 1.00 90.70  ? 1856 CYS A C   1 
ATOM   2493 O O   . CYS A 1 349 ? 59.729  3.297   37.129 1.00 90.80  ? 1856 CYS A O   1 
ATOM   2494 C CB  . CYS A 1 349 ? 60.050  2.522   34.225 1.00 90.97  ? 1856 CYS A CB  1 
ATOM   2495 S SG  . CYS A 1 349 ? 59.244  0.910   34.460 1.00 90.83  ? 1856 CYS A SG  1 
ATOM   2496 N N   . LEU A 1 350 ? 57.578  3.537   36.485 1.00 87.90  ? 1857 LEU A N   1 
ATOM   2497 C CA  . LEU A 1 350 ? 57.009  3.232   37.796 1.00 87.78  ? 1857 LEU A CA  1 
ATOM   2498 C C   . LEU A 1 350 ? 56.991  1.720   38.003 1.00 87.76  ? 1857 LEU A C   1 
ATOM   2499 O O   . LEU A 1 350 ? 56.173  1.007   37.414 1.00 87.66  ? 1857 LEU A O   1 
ATOM   2500 C CB  . LEU A 1 350 ? 55.600  3.825   37.930 1.00 87.61  ? 1857 LEU A CB  1 
ATOM   2501 C CG  . LEU A 1 350 ? 54.742  3.511   39.163 1.00 87.48  ? 1857 LEU A CG  1 
ATOM   2502 C CD1 . LEU A 1 350 ? 55.396  3.990   40.454 1.00 87.56  ? 1857 LEU A CD1 1 
ATOM   2503 C CD2 . LEU A 1 350 ? 53.354  4.116   39.009 1.00 87.34  ? 1857 LEU A CD2 1 
ATOM   2504 N N   . LEU A 1 351 ? 57.908  1.242   38.838 1.00 92.60  ? 1858 LEU A N   1 
ATOM   2505 C CA  . LEU A 1 351 ? 58.078  -0.190  39.059 1.00 92.62  ? 1858 LEU A CA  1 
ATOM   2506 C C   . LEU A 1 351 ? 57.004  -0.792  39.960 1.00 92.46  ? 1858 LEU A C   1 
ATOM   2507 O O   . LEU A 1 351 ? 56.495  -0.140  40.875 1.00 92.39  ? 1858 LEU A O   1 
ATOM   2508 C CB  . LEU A 1 351 ? 59.470  -0.491  39.632 1.00 92.82  ? 1858 LEU A CB  1 
ATOM   2509 C CG  . LEU A 1 351 ? 60.672  -0.490  38.683 1.00 93.04  ? 1858 LEU A CG  1 
ATOM   2510 C CD1 . LEU A 1 351 ? 61.957  -0.265  39.459 1.00 93.25  ? 1858 LEU A CD1 1 
ATOM   2511 C CD2 . LEU A 1 351 ? 60.750  -1.782  37.872 1.00 93.06  ? 1858 LEU A CD2 1 
ATOM   2512 N N   . SER A 1 352 ? 56.662  -2.041  39.667 1.00 94.14  ? 1859 SER A N   1 
ATOM   2513 C CA  . SER A 1 352 ? 55.842  -2.867  40.541 1.00 94.03  ? 1859 SER A CA  1 
ATOM   2514 C C   . SER A 1 352 ? 56.495  -4.240  40.669 1.00 94.12  ? 1859 SER A C   1 
ATOM   2515 O O   . SER A 1 352 ? 56.034  -5.092  41.432 1.00 94.07  ? 1859 SER A O   1 
ATOM   2516 C CB  . SER A 1 352 ? 54.424  -2.999  39.987 1.00 93.85  ? 1859 SER A CB  1 
ATOM   2517 O OG  . SER A 1 352 ? 53.739  -1.760  40.037 1.00 93.78  ? 1859 SER A OG  1 
ATOM   2518 N N   . GLY A 1 353 ? 57.574  -4.439  39.913 1.00 104.41 ? 1860 GLY A N   1 
ATOM   2519 C CA  . GLY A 1 353 ? 58.290  -5.713  39.870 1.00 104.53 ? 1860 GLY A CA  1 
ATOM   2520 C C   . GLY A 1 353 ? 57.613  -6.718  38.958 1.00 104.44 ? 1860 GLY A C   1 
ATOM   2521 O O   . GLY A 1 353 ? 58.266  -7.597  38.391 1.00 104.57 ? 1860 GLY A O   1 
ATOM   2522 N N   . THR A 1 354 ? 56.296  -6.573  38.819 1.00 104.30 ? 1861 THR A N   1 
ATOM   2523 C CA  . THR A 1 354 ? 55.469  -7.483  38.030 1.00 104.21 ? 1861 THR A CA  1 
ATOM   2524 C C   . THR A 1 354 ? 55.009  -6.876  36.696 1.00 104.19 ? 1861 THR A C   1 
ATOM   2525 O O   . THR A 1 354 ? 54.975  -7.570  35.677 1.00 104.24 ? 1861 THR A O   1 
ATOM   2526 C CB  . THR A 1 354 ? 54.251  -8.013  38.853 1.00 104.03 ? 1861 THR A CB  1 
ATOM   2527 O OG1 . THR A 1 354 ? 53.376  -8.768  38.005 1.00 103.94 ? 1861 THR A OG1 1 
ATOM   2528 C CG2 . THR A 1 354 ? 53.465  -6.870  39.505 1.00 103.92 ? 1861 THR A CG2 1 
ATOM   2529 N N   . LYS A 1 355 ? 54.668  -5.587  36.708 1.00 98.00  ? 1862 LYS A N   1 
ATOM   2530 C CA  . LYS A 1 355 ? 54.137  -4.909  35.522 1.00 97.98  ? 1862 LYS A CA  1 
ATOM   2531 C C   . LYS A 1 355 ? 55.089  -3.836  34.986 1.00 98.13  ? 1862 LYS A C   1 
ATOM   2532 O O   . LYS A 1 355 ? 55.871  -4.095  34.068 1.00 98.28  ? 1862 LYS A O   1 
ATOM   2533 C CB  . LYS A 1 355 ? 52.748  -4.314  35.808 1.00 97.81  ? 1862 LYS A CB  1 
ATOM   2534 C CG  . LYS A 1 355 ? 51.678  -5.331  36.203 1.00 97.67  ? 1862 LYS A CG  1 
ATOM   2535 C CD  . LYS A 1 355 ? 51.142  -6.099  35.001 1.00 97.66  ? 1862 LYS A CD  1 
ATOM   2536 C CE  . LYS A 1 355 ? 50.172  -7.187  35.433 1.00 97.55  ? 1862 LYS A CE  1 
ATOM   2537 N NZ  . LYS A 1 355 ? 49.580  -7.905  34.272 1.00 97.55  ? 1862 LYS A NZ  1 
ATOM   2538 N N   . GLY A 1 356 ? 55.021  -2.640  35.569 1.00 94.70  ? 1863 GLY A N   1 
ATOM   2539 C CA  . GLY A 1 356 ? 55.810  -1.499  35.110 1.00 94.83  ? 1863 GLY A CA  1 
ATOM   2540 C C   . GLY A 1 356 ? 55.024  -0.625  34.151 1.00 94.77  ? 1863 GLY A C   1 
ATOM   2541 O O   . GLY A 1 356 ? 54.328  -1.131  33.267 1.00 94.73  ? 1863 GLY A O   1 
ATOM   2542 N N   . ALA A 1 357 ? 55.137  0.690   34.328 1.00 90.80  ? 1864 ALA A N   1 
ATOM   2543 C CA  . ALA A 1 357 ? 54.423  1.654   33.491 1.00 90.76  ? 1864 ALA A CA  1 
ATOM   2544 C C   . ALA A 1 357 ? 55.284  2.870   33.152 1.00 90.90  ? 1864 ALA A C   1 
ATOM   2545 O O   . ALA A 1 357 ? 55.767  3.571   34.045 1.00 90.90  ? 1864 ALA A O   1 
ATOM   2546 C CB  . ALA A 1 357 ? 53.126  2.082   34.161 1.00 90.58  ? 1864 ALA A CB  1 
ATOM   2547 N N   . SER A 1 358 ? 55.462  3.108   31.854 1.00 91.78  ? 1865 SER A N   1 
ATOM   2548 C CA  . SER A 1 358 ? 56.304  4.192   31.350 1.00 91.93  ? 1865 SER A CA  1 
ATOM   2549 C C   . SER A 1 358 ? 55.677  5.568   31.554 1.00 91.85  ? 1865 SER A C   1 
ATOM   2550 O O   . SER A 1 358 ? 54.457  5.723   31.470 1.00 91.71  ? 1865 SER A O   1 
ATOM   2551 C CB  . SER A 1 358 ? 56.613  3.975   29.866 1.00 92.10  ? 1865 SER A CB  1 
ATOM   2552 O OG  . SER A 1 358 ? 57.246  5.110   29.300 1.00 92.25  ? 1865 SER A OG  1 
ATOM   2553 N N   . PHE A 1 359 ? 56.527  6.558   31.813 1.00 88.30  ? 1866 PHE A N   1 
ATOM   2554 C CA  . PHE A 1 359 ? 56.091  7.943   31.985 1.00 88.26  ? 1866 PHE A CA  1 
ATOM   2555 C C   . PHE A 1 359 ? 56.637  8.868   30.897 1.00 88.43  ? 1866 PHE A C   1 
ATOM   2556 O O   . PHE A 1 359 ? 56.710  10.084  31.079 1.00 88.44  ? 1866 PHE A O   1 
ATOM   2557 C CB  . PHE A 1 359 ? 56.474  8.456   33.376 1.00 88.22  ? 1866 PHE A CB  1 
ATOM   2558 C CG  . PHE A 1 359 ? 55.436  8.186   34.427 1.00 88.04  ? 1866 PHE A CG  1 
ATOM   2559 C CD1 . PHE A 1 359 ? 55.455  7.003   35.157 1.00 87.98  ? 1866 PHE A CD1 1 
ATOM   2560 C CD2 . PHE A 1 359 ? 54.434  9.116   34.686 1.00 87.93  ? 1866 PHE A CD2 1 
ATOM   2561 C CE1 . PHE A 1 359 ? 54.493  6.753   36.129 1.00 87.83  ? 1866 PHE A CE1 1 
ATOM   2562 C CE2 . PHE A 1 359 ? 53.466  8.873   35.653 1.00 87.80  ? 1866 PHE A CE2 1 
ATOM   2563 C CZ  . PHE A 1 359 ? 53.497  7.690   36.378 1.00 87.74  ? 1866 PHE A CZ  1 
ATOM   2564 N N   . GLY A 1 360 ? 57.007  8.282   29.762 1.00 92.75  ? 1867 GLY A N   1 
ATOM   2565 C CA  . GLY A 1 360 ? 57.499  9.044   28.621 1.00 92.94  ? 1867 GLY A CA  1 
ATOM   2566 C C   . GLY A 1 360 ? 58.601  8.326   27.873 1.00 93.16  ? 1867 GLY A C   1 
ATOM   2567 O O   . GLY A 1 360 ? 59.581  7.883   28.470 1.00 93.24  ? 1867 GLY A O   1 
ATOM   2568 N N   . ARG A 1 361 ? 58.429  8.208   26.560 1.00 98.51  ? 1868 ARG A N   1 
ATOM   2569 C CA  . ARG A 1 361 ? 59.430  7.592   25.695 1.00 98.76  ? 1868 ARG A CA  1 
ATOM   2570 C C   . ARG A 1 361 ? 60.700  8.438   25.656 1.00 98.97  ? 1868 ARG A C   1 
ATOM   2571 O O   . ARG A 1 361 ? 60.653  9.629   25.338 1.00 99.02  ? 1868 ARG A O   1 
ATOM   2572 C CB  . ARG A 1 361 ? 58.871  7.385   24.282 1.00 98.88  ? 1868 ARG A CB  1 
ATOM   2573 C CG  . ARG A 1 361 ? 57.892  6.218   24.158 1.00 98.74  ? 1868 ARG A CG  1 
ATOM   2574 C CD  . ARG A 1 361 ? 57.061  6.283   22.878 1.00 98.83  ? 1868 ARG A CD  1 
ATOM   2575 N NE  . ARG A 1 361 ? 57.863  6.093   21.669 1.00 99.15  ? 1868 ARG A NE  1 
ATOM   2576 C CZ  . ARG A 1 361 ? 58.214  7.068   20.834 1.00 99.35  ? 1868 ARG A CZ  1 
ATOM   2577 N NH1 . ARG A 1 361 ? 57.837  8.320   21.062 1.00 99.27  ? 1868 ARG A NH1 1 
ATOM   2578 N NH2 . ARG A 1 361 ? 58.945  6.789   19.765 1.00 99.66  ? 1868 ARG A NH2 1 
ATOM   2579 N N   . LEU A 1 362 ? 61.825  7.807   25.990 1.00 99.15  ? 1869 LEU A N   1 
ATOM   2580 C CA  . LEU A 1 362 ? 63.142  8.454   26.038 1.00 99.37  ? 1869 LEU A CA  1 
ATOM   2581 C C   . LEU A 1 362 ? 63.458  9.263   24.779 1.00 99.60  ? 1869 LEU A C   1 
ATOM   2582 O O   . LEU A 1 362 ? 64.170  10.268  24.839 1.00 99.71  ? 1869 LEU A O   1 
ATOM   2583 C CB  . LEU A 1 362 ? 64.231  7.398   26.279 1.00 99.54  ? 1869 LEU A CB  1 
ATOM   2584 C CG  . LEU A 1 362 ? 65.711  7.793   26.330 1.00 99.83  ? 1869 LEU A CG  1 
ATOM   2585 C CD1 . LEU A 1 362 ? 66.026  8.633   27.559 1.00 99.75  ? 1869 LEU A CD1 1 
ATOM   2586 C CD2 . LEU A 1 362 ? 66.582  6.550   26.299 1.00 100.01 ? 1869 LEU A CD2 1 
ATOM   2587 N N   . GLN A 1 363 ? 62.912  8.817   23.649 1.00 105.04 ? 1870 GLN A N   1 
ATOM   2588 C CA  . GLN A 1 363 ? 63.121  9.459   22.353 1.00 105.28 ? 1870 GLN A CA  1 
ATOM   2589 C C   . GLN A 1 363 ? 62.470  10.839  22.252 1.00 105.19 ? 1870 GLN A C   1 
ATOM   2590 O O   . GLN A 1 363 ? 62.942  11.694  21.502 1.00 105.40 ? 1870 GLN A O   1 
ATOM   2591 C CB  . GLN A 1 363 ? 62.608  8.560   21.222 1.00 105.39 ? 1870 GLN A CB  1 
ATOM   2592 C CG  . GLN A 1 363 ? 63.470  7.328   20.940 1.00 105.60 ? 1870 GLN A CG  1 
ATOM   2593 C CD  . GLN A 1 363 ? 63.125  6.126   21.811 1.00 105.38 ? 1870 GLN A CD  1 
ATOM   2594 O OE1 . GLN A 1 363 ? 62.539  6.258   22.888 1.00 105.09 ? 1870 GLN A OE1 1 
ATOM   2595 N NE2 . GLN A 1 363 ? 63.496  4.940   21.343 1.00 105.53 ? 1870 GLN A NE2 1 
ATOM   2596 N N   . SER A 1 364 ? 61.397  11.051  23.009 1.00 104.24 ? 1871 SER A N   1 
ATOM   2597 C CA  . SER A 1 364 ? 60.640  12.301  22.952 1.00 104.14 ? 1871 SER A CA  1 
ATOM   2598 C C   . SER A 1 364 ? 61.231  13.409  23.829 1.00 104.13 ? 1871 SER A C   1 
ATOM   2599 O O   . SER A 1 364 ? 60.602  14.452  24.030 1.00 104.07 ? 1871 SER A O   1 
ATOM   2600 C CB  . SER A 1 364 ? 59.182  12.046  23.330 1.00 103.85 ? 1871 SER A CB  1 
ATOM   2601 O OG  . SER A 1 364 ? 59.073  11.619  24.675 1.00 103.64 ? 1871 SER A OG  1 
ATOM   2602 N N   . MET A 1 365 ? 62.443  13.179  24.331 1.00 100.79 ? 1872 MET A N   1 
ATOM   2603 C CA  . MET A 1 365 ? 63.127  14.102  25.241 1.00 100.80 ? 1872 MET A CA  1 
ATOM   2604 C C   . MET A 1 365 ? 63.283  15.517  24.682 1.00 100.92 ? 1872 MET A C   1 
ATOM   2605 O O   . MET A 1 365 ? 63.733  15.709  23.551 1.00 101.16 ? 1872 MET A O   1 
ATOM   2606 C CB  . MET A 1 365 ? 64.493  13.534  25.645 1.00 100.99 ? 1872 MET A CB  1 
ATOM   2607 C CG  . MET A 1 365 ? 65.389  14.512  26.390 1.00 101.07 ? 1872 MET A CG  1 
ATOM   2608 S SD  . MET A 1 365 ? 66.857  13.749  27.096 1.00 101.27 ? 1872 MET A SD  1 
ATOM   2609 C CE  . MET A 1 365 ? 67.709  15.195  27.723 1.00 101.41 ? 1872 MET A CE  1 
ATOM   2610 N N   . LYS A 1 366 ? 62.904  16.497  25.500 1.00 104.07 ? 1873 LYS A N   1 
ATOM   2611 C CA  . LYS A 1 366 ? 63.043  17.912  25.166 1.00 104.17 ? 1873 LYS A CA  1 
ATOM   2612 C C   . LYS A 1 366 ? 63.770  18.656  26.281 1.00 104.15 ? 1873 LYS A C   1 
ATOM   2613 O O   . LYS A 1 366 ? 63.535  18.399  27.464 1.00 103.96 ? 1873 LYS A O   1 
ATOM   2614 C CB  . LYS A 1 366 ? 61.670  18.547  24.941 1.00 104.00 ? 1873 LYS A CB  1 
ATOM   2615 C CG  . LYS A 1 366 ? 60.979  18.136  23.647 1.00 104.10 ? 1873 LYS A CG  1 
ATOM   2616 C CD  . LYS A 1 366 ? 59.607  18.790  23.510 1.00 103.96 ? 1873 LYS A CD  1 
ATOM   2617 C CE  . LYS A 1 366 ? 59.712  20.273  23.173 1.00 104.07 ? 1873 LYS A CE  1 
ATOM   2618 N NZ  . LYS A 1 366 ? 58.375  20.925  23.132 1.00 103.93 ? 1873 LYS A NZ  1 
ATOM   2619 N N   . LEU A 1 367 ? 64.652  19.575  25.897 1.00 100.04 ? 1874 LEU A N   1 
ATOM   2620 C CA  . LEU A 1 367 ? 65.360  20.415  26.861 1.00 100.07 ? 1874 LEU A CA  1 
ATOM   2621 C C   . LEU A 1 367 ? 65.044  21.892  26.670 1.00 100.07 ? 1874 LEU A C   1 
ATOM   2622 O O   . LEU A 1 367 ? 65.179  22.431  25.571 1.00 100.25 ? 1874 LEU A O   1 
ATOM   2623 C CB  . LEU A 1 367 ? 66.873  20.180  26.801 1.00 100.34 ? 1874 LEU A CB  1 
ATOM   2624 C CG  . LEU A 1 367 ? 67.453  19.011  27.604 1.00 100.34 ? 1874 LEU A CG  1 
ATOM   2625 C CD1 . LEU A 1 367 ? 68.943  18.878  27.341 1.00 100.68 ? 1874 LEU A CD1 1 
ATOM   2626 C CD2 . LEU A 1 367 ? 67.197  19.173  29.098 1.00 100.14 ? 1874 LEU A CD2 1 
ATOM   2627 N N   . ASP A 1 368 ? 64.619  22.534  27.754 1.00 110.61 ? 1875 ASP A N   1 
ATOM   2628 C CA  . ASP A 1 368 ? 64.282  23.953  27.744 1.00 110.61 ? 1875 ASP A CA  1 
ATOM   2629 C C   . ASP A 1 368 ? 64.854  24.661  28.967 1.00 110.59 ? 1875 ASP A C   1 
ATOM   2630 O O   . ASP A 1 368 ? 65.229  24.018  29.950 1.00 110.53 ? 1875 ASP A O   1 
ATOM   2631 C CB  . ASP A 1 368 ? 62.763  24.143  27.682 1.00 110.39 ? 1875 ASP A CB  1 
ATOM   2632 C CG  . ASP A 1 368 ? 62.165  23.673  26.366 1.00 110.45 ? 1875 ASP A CG  1 
ATOM   2633 O OD1 . ASP A 1 368 ? 62.685  24.057  25.294 1.00 110.67 ? 1875 ASP A OD1 1 
ATOM   2634 O OD2 . ASP A 1 368 ? 61.166  22.924  26.406 1.00 110.28 ? 1875 ASP A OD2 1 
ATOM   2635 N N   . TYR A 1 369 ? 64.917  25.988  28.897 1.00 112.06 ? 1876 TYR A N   1 
ATOM   2636 C CA  . TYR A 1 369 ? 65.465  26.796  29.978 1.00 112.08 ? 1876 TYR A CA  1 
ATOM   2637 C C   . TYR A 1 369 ? 64.371  27.611  30.658 1.00 111.88 ? 1876 TYR A C   1 
ATOM   2638 O O   . TYR A 1 369 ? 63.666  28.382  30.004 1.00 111.85 ? 1876 TYR A O   1 
ATOM   2639 C CB  . TYR A 1 369 ? 66.560  27.723  29.439 1.00 112.34 ? 1876 TYR A CB  1 
ATOM   2640 C CG  . TYR A 1 369 ? 67.387  28.401  30.508 1.00 112.42 ? 1876 TYR A CG  1 
ATOM   2641 C CD1 . TYR A 1 369 ? 67.068  29.683  30.957 1.00 112.37 ? 1876 TYR A CD1 1 
ATOM   2642 C CD2 . TYR A 1 369 ? 68.495  27.763  31.067 1.00 112.56 ? 1876 TYR A CD2 1 
ATOM   2643 C CE1 . TYR A 1 369 ? 67.828  30.311  31.941 1.00 112.47 ? 1876 TYR A CE1 1 
ATOM   2644 C CE2 . TYR A 1 369 ? 69.262  28.381  32.051 1.00 112.65 ? 1876 TYR A CE2 1 
ATOM   2645 C CZ  . TYR A 1 369 ? 68.923  29.654  32.482 1.00 112.61 ? 1876 TYR A CZ  1 
ATOM   2646 O OH  . TYR A 1 369 ? 69.679  30.269  33.453 1.00 112.72 ? 1876 TYR A OH  1 
ATOM   2647 N N   . ARG A 1 370 ? 64.229  27.427  31.968 1.00 120.03 ? 1877 ARG A N   1 
ATOM   2648 C CA  . ARG A 1 370 ? 63.321  28.248  32.759 1.00 119.88 ? 1877 ARG A CA  1 
ATOM   2649 C C   . ARG A 1 370 ? 64.063  29.510  33.185 1.00 120.03 ? 1877 ARG A C   1 
ATOM   2650 O O   . ARG A 1 370 ? 65.129  29.436  33.796 1.00 120.15 ? 1877 ARG A O   1 
ATOM   2651 C CB  . ARG A 1 370 ? 62.800  27.489  33.984 1.00 119.71 ? 1877 ARG A CB  1 
ATOM   2652 C CG  . ARG A 1 370 ? 61.381  27.884  34.387 1.00 119.52 ? 1877 ARG A CG  1 
ATOM   2653 C CD  . ARG A 1 370 ? 61.141  27.782  35.890 1.00 119.43 ? 1877 ARG A CD  1 
ATOM   2654 N NE  . ARG A 1 370 ? 61.134  26.405  36.384 1.00 119.35 ? 1877 ARG A NE  1 
ATOM   2655 C CZ  . ARG A 1 370 ? 60.724  26.042  37.598 1.00 119.26 ? 1877 ARG A CZ  1 
ATOM   2656 N NH1 . ARG A 1 370 ? 60.273  26.947  38.459 1.00 119.25 ? 1877 ARG A NH1 1 
ATOM   2657 N NH2 . ARG A 1 370 ? 60.758  24.765  37.952 1.00 119.21 ? 1877 ARG A NH2 1 
ATOM   2658 N N   . HIS A 1 371 ? 63.499  30.664  32.842 1.00 131.47 ? 1878 HIS A N   1 
ATOM   2659 C CA  . HIS A 1 371 ? 64.129  31.953  33.125 1.00 131.61 ? 1878 HIS A CA  1 
ATOM   2660 C C   . HIS A 1 371 ? 63.691  32.509  34.479 1.00 131.52 ? 1878 HIS A C   1 
ATOM   2661 O O   . HIS A 1 371 ? 64.378  33.349  35.065 1.00 131.65 ? 1878 HIS A O   1 
ATOM   2662 C CB  . HIS A 1 371 ? 63.824  32.950  32.004 1.00 131.68 ? 1878 HIS A CB  1 
ATOM   2663 C CG  . HIS A 1 371 ? 64.299  32.503  30.656 1.00 131.82 ? 1878 HIS A CG  1 
ATOM   2664 N ND1 . HIS A 1 371 ? 63.615  31.579  29.895 1.00 131.74 ? 1878 HIS A ND1 1 
ATOM   2665 C CD2 . HIS A 1 371 ? 65.391  32.849  29.934 1.00 132.05 ? 1878 HIS A CD2 1 
ATOM   2666 C CE1 . HIS A 1 371 ? 64.265  31.376  28.763 1.00 131.92 ? 1878 HIS A CE1 1 
ATOM   2667 N NE2 . HIS A 1 371 ? 65.345  32.135  28.761 1.00 132.12 ? 1878 HIS A NE2 1 
ATOM   2668 N N   . GLN A 1 372 ? 62.547  32.029  34.962 1.00 139.61 ? 1879 GLN A N   1 
ATOM   2669 C CA  . GLN A 1 372 ? 62.008  32.401  36.269 1.00 139.53 ? 1879 GLN A CA  1 
ATOM   2670 C C   . GLN A 1 372 ? 62.899  31.899  37.410 1.00 139.60 ? 1879 GLN A C   1 
ATOM   2671 O O   . GLN A 1 372 ? 63.299  32.674  38.281 1.00 139.70 ? 1879 GLN A O   1 
ATOM   2672 C CB  . GLN A 1 372 ? 60.581  31.850  36.418 1.00 139.32 ? 1879 GLN A CB  1 
ATOM   2673 C CG  . GLN A 1 372 ? 59.976  31.940  37.820 1.00 139.25 ? 1879 GLN A CG  1 
ATOM   2674 C CD  . GLN A 1 372 ? 59.333  33.284  38.108 1.00 139.26 ? 1879 GLN A CD  1 
ATOM   2675 O OE1 . GLN A 1 372 ? 59.998  34.320  38.117 1.00 139.39 ? 1879 GLN A OE1 1 
ATOM   2676 N NE2 . GLN A 1 372 ? 58.029  33.270  38.356 1.00 139.13 ? 1879 GLN A NE2 1 
ATOM   2677 N N   . ASP A 1 373 ? 63.206  30.604  37.385 1.00 121.05 ? 1880 ASP A N   1 
ATOM   2678 C CA  . ASP A 1 373 ? 63.954  29.949  38.456 1.00 121.11 ? 1880 ASP A CA  1 
ATOM   2679 C C   . ASP A 1 373 ? 65.400  29.650  38.048 1.00 121.32 ? 1880 ASP A C   1 
ATOM   2680 O O   . ASP A 1 373 ? 66.162  29.064  38.823 1.00 121.41 ? 1880 ASP A O   1 
ATOM   2681 C CB  . ASP A 1 373 ? 63.233  28.658  38.870 1.00 120.95 ? 1880 ASP A CB  1 
ATOM   2682 C CG  . ASP A 1 373 ? 63.688  28.126  40.224 1.00 120.99 ? 1880 ASP A CG  1 
ATOM   2683 O OD1 . ASP A 1 373 ? 64.251  28.896  41.034 1.00 121.13 ? 1880 ASP A OD1 1 
ATOM   2684 O OD2 . ASP A 1 373 ? 63.473  26.923  40.479 1.00 120.88 ? 1880 ASP A OD2 1 
ATOM   2685 N N   . GLU A 1 374 ? 65.770  30.072  36.837 1.00 112.08 ? 1881 GLU A N   1 
ATOM   2686 C CA  . GLU A 1 374 ? 67.092  29.793  36.257 1.00 112.30 ? 1881 GLU A CA  1 
ATOM   2687 C C   . GLU A 1 374 ? 67.403  28.294  36.279 1.00 112.29 ? 1881 GLU A C   1 
ATOM   2688 O O   . GLU A 1 374 ? 68.459  27.869  36.753 1.00 112.45 ? 1881 GLU A O   1 
ATOM   2689 C CB  . GLU A 1 374 ? 68.195  30.597  36.959 1.00 112.50 ? 1881 GLU A CB  1 
ATOM   2690 C CG  . GLU A 1 374 ? 68.099  32.106  36.773 1.00 112.56 ? 1881 GLU A CG  1 
ATOM   2691 C CD  . GLU A 1 374 ? 69.266  32.857  37.399 1.00 112.79 ? 1881 GLU A CD  1 
ATOM   2692 O OE1 . GLU A 1 374 ? 69.912  32.316  38.322 1.00 112.87 ? 1881 GLU A OE1 1 
ATOM   2693 O OE2 . GLU A 1 374 ? 69.535  33.996  36.966 1.00 112.91 ? 1881 GLU A OE2 1 
ATOM   2694 N N   . ALA A 1 375 ? 66.466  27.503  35.762 1.00 101.12 ? 1882 ALA A N   1 
ATOM   2695 C CA  . ALA A 1 375 ? 66.566  26.048  35.805 1.00 101.08 ? 1882 ALA A CA  1 
ATOM   2696 C C   . ALA A 1 375 ? 66.525  25.423  34.413 1.00 101.11 ? 1882 ALA A C   1 
ATOM   2697 O O   . ALA A 1 375 ? 66.152  26.076  33.436 1.00 101.13 ? 1882 ALA A O   1 
ATOM   2698 C CB  . ALA A 1 375 ? 65.462  25.474  36.684 1.00 100.85 ? 1882 ALA A CB  1 
ATOM   2699 N N   . VAL A 1 376 ? 66.917  24.153  34.339 1.00 94.83  ? 1883 VAL A N   1 
ATOM   2700 C CA  . VAL A 1 376 ? 66.905  23.393  33.093 1.00 94.87  ? 1883 VAL A CA  1 
ATOM   2701 C C   . VAL A 1 376 ? 65.815  22.322  33.161 1.00 94.64  ? 1883 VAL A C   1 
ATOM   2702 O O   . VAL A 1 376 ? 65.816  21.481  34.063 1.00 94.56  ? 1883 VAL A O   1 
ATOM   2703 C CB  . VAL A 1 376 ? 68.290  22.752  32.807 1.00 95.13  ? 1883 VAL A CB  1 
ATOM   2704 C CG1 . VAL A 1 376 ? 68.242  21.859  31.572 1.00 95.17  ? 1883 VAL A CG1 1 
ATOM   2705 C CG2 . VAL A 1 376 ? 69.354  23.831  32.638 1.00 95.37  ? 1883 VAL A CG2 1 
ATOM   2706 N N   . VAL A 1 377 ? 64.886  22.367  32.207 1.00 97.88  ? 1884 VAL A N   1 
ATOM   2707 C CA  . VAL A 1 377 ? 63.748  21.448  32.185 1.00 97.67  ? 1884 VAL A CA  1 
ATOM   2708 C C   . VAL A 1 377 ? 63.944  20.327  31.163 1.00 97.74  ? 1884 VAL A C   1 
ATOM   2709 O O   . VAL A 1 377 ? 64.056  20.575  29.961 1.00 97.85  ? 1884 VAL A O   1 
ATOM   2710 C CB  . VAL A 1 377 ? 62.405  22.184  31.913 1.00 97.51  ? 1884 VAL A CB  1 
ATOM   2711 C CG1 . VAL A 1 377 ? 61.224  21.230  32.069 1.00 97.29  ? 1884 VAL A CG1 1 
ATOM   2712 C CG2 . VAL A 1 377 ? 62.241  23.379  32.843 1.00 97.48  ? 1884 VAL A CG2 1 
ATOM   2713 N N   . LEU A 1 378 ? 63.999  19.098  31.666 1.00 93.40  ? 1885 LEU A N   1 
ATOM   2714 C CA  . LEU A 1 378 ? 64.011  17.898  30.837 1.00 93.43  ? 1885 LEU A CA  1 
ATOM   2715 C C   . LEU A 1 378 ? 62.649  17.226  30.946 1.00 93.18  ? 1885 LEU A C   1 
ATOM   2716 O O   . LEU A 1 378 ? 62.125  17.069  32.045 1.00 93.01  ? 1885 LEU A O   1 
ATOM   2717 C CB  . LEU A 1 378 ? 65.134  16.949  31.288 1.00 93.55  ? 1885 LEU A CB  1 
ATOM   2718 C CG  . LEU A 1 378 ? 65.018  15.416  31.241 1.00 93.53  ? 1885 LEU A CG  1 
ATOM   2719 C CD1 . LEU A 1 378 ? 64.711  14.882  29.853 1.00 93.63  ? 1885 LEU A CD1 1 
ATOM   2720 C CD2 . LEU A 1 378 ? 66.296  14.784  31.772 1.00 93.69  ? 1885 LEU A CD2 1 
ATOM   2721 N N   . SER A 1 379 ? 62.077  16.840  29.808 1.00 95.86  ? 1886 SER A N   1 
ATOM   2722 C CA  . SER A 1 379 ? 60.761  16.205  29.797 1.00 95.65  ? 1886 SER A CA  1 
ATOM   2723 C C   . SER A 1 379 ? 60.623  15.128  28.728 1.00 95.71  ? 1886 SER A C   1 
ATOM   2724 O O   . SER A 1 379 ? 60.942  15.356  27.562 1.00 95.89  ? 1886 SER A O   1 
ATOM   2725 C CB  . SER A 1 379 ? 59.658  17.255  29.627 1.00 95.55  ? 1886 SER A CB  1 
ATOM   2726 O OG  . SER A 1 379 ? 59.777  17.926  28.385 1.00 95.71  ? 1886 SER A OG  1 
ATOM   2727 N N   . TYR A 1 380 ? 60.154  13.953  29.144 1.00 96.90  ? 1887 TYR A N   1 
ATOM   2728 C CA  . TYR A 1 380 ? 59.748  12.902  28.215 1.00 96.91  ? 1887 TYR A CA  1 
ATOM   2729 C C   . TYR A 1 380 ? 58.227  12.907  28.101 1.00 96.72  ? 1887 TYR A C   1 
ATOM   2730 O O   . TYR A 1 380 ? 57.535  13.417  28.985 1.00 96.56  ? 1887 TYR A O   1 
ATOM   2731 C CB  . TYR A 1 380 ? 60.218  11.520  28.682 1.00 96.91  ? 1887 TYR A CB  1 
ATOM   2732 C CG  . TYR A 1 380 ? 61.651  11.437  29.165 1.00 97.08  ? 1887 TYR A CG  1 
ATOM   2733 C CD1 . TYR A 1 380 ? 62.721  11.592  28.285 1.00 97.34  ? 1887 TYR A CD1 1 
ATOM   2734 C CD2 . TYR A 1 380 ? 61.933  11.173  30.505 1.00 96.99  ? 1887 TYR A CD2 1 
ATOM   2735 C CE1 . TYR A 1 380 ? 64.037  11.505  28.733 1.00 97.52  ? 1887 TYR A CE1 1 
ATOM   2736 C CE2 . TYR A 1 380 ? 63.243  11.082  30.962 1.00 97.16  ? 1887 TYR A CE2 1 
ATOM   2737 C CZ  . TYR A 1 380 ? 64.288  11.250  30.073 1.00 97.43  ? 1887 TYR A CZ  1 
ATOM   2738 O OH  . TYR A 1 380 ? 65.583  11.161  30.528 1.00 97.63  ? 1887 TYR A OH  1 
ATOM   2739 N N   . VAL A 1 381 ? 57.710  12.337  27.015 1.00 95.56  ? 1888 VAL A N   1 
ATOM   2740 C CA  . VAL A 1 381 ? 56.266  12.292  26.774 1.00 95.41  ? 1888 VAL A CA  1 
ATOM   2741 C C   . VAL A 1 381 ? 55.856  11.005  26.041 1.00 95.43  ? 1888 VAL A C   1 
ATOM   2742 O O   . VAL A 1 381 ? 56.709  10.285  25.518 1.00 95.59  ? 1888 VAL A O   1 
ATOM   2743 C CB  . VAL A 1 381 ? 55.774  13.569  26.020 1.00 95.48  ? 1888 VAL A CB  1 
ATOM   2744 C CG1 . VAL A 1 381 ? 56.138  13.521  24.540 1.00 95.72  ? 1888 VAL A CG1 1 
ATOM   2745 C CG2 . VAL A 1 381 ? 54.278  13.764  26.197 1.00 95.31  ? 1888 VAL A CG2 1 
ATOM   2746 N N   . ASN A 1 382 ? 54.552  10.728  26.026 1.00 97.10  ? 1889 ASN A N   1 
ATOM   2747 C CA  . ASN A 1 382 ? 53.968  9.568   25.340 1.00 97.10  ? 1889 ASN A CA  1 
ATOM   2748 C C   . ASN A 1 382 ? 54.378  8.224   25.953 1.00 97.04  ? 1889 ASN A C   1 
ATOM   2749 O O   . ASN A 1 382 ? 54.904  7.345   25.265 1.00 97.18  ? 1889 ASN A O   1 
ATOM   2750 C CB  . ASN A 1 382 ? 54.257  9.602   23.826 1.00 97.35  ? 1889 ASN A CB  1 
ATOM   2751 C CG  . ASN A 1 382 ? 53.838  10.914  23.169 1.00 97.44  ? 1889 ASN A CG  1 
ATOM   2752 O OD1 . ASN A 1 382 ? 54.515  11.406  22.265 1.00 97.66  ? 1889 ASN A OD1 1 
ATOM   2753 N ND2 . ASN A 1 382 ? 52.720  11.481  23.615 1.00 97.28  ? 1889 ASN A ND2 1 
ATOM   2754 N N   . GLY A 1 383 ? 54.125  8.078   27.252 1.00 92.66  ? 1890 GLY A N   1 
ATOM   2755 C CA  . GLY A 1 383 ? 54.422  6.842   27.973 1.00 92.59  ? 1890 GLY A CA  1 
ATOM   2756 C C   . GLY A 1 383 ? 53.296  5.833   27.857 1.00 92.47  ? 1890 GLY A C   1 
ATOM   2757 O O   . GLY A 1 383 ? 53.031  5.312   26.773 1.00 92.57  ? 1890 GLY A O   1 
ATOM   2758 N N   . ASP A 1 384 ? 52.641  5.554   28.982 1.00 90.69  ? 1891 ASP A N   1 
ATOM   2759 C CA  . ASP A 1 384 ? 51.469  4.680   29.013 1.00 90.57  ? 1891 ASP A CA  1 
ATOM   2760 C C   . ASP A 1 384 ? 50.195  5.495   29.221 1.00 90.46  ? 1891 ASP A C   1 
ATOM   2761 O O   . ASP A 1 384 ? 50.263  6.689   29.511 1.00 90.46  ? 1891 ASP A O   1 
ATOM   2762 C CB  . ASP A 1 384 ? 51.614  3.622   30.111 1.00 90.45  ? 1891 ASP A CB  1 
ATOM   2763 C CG  . ASP A 1 384 ? 52.398  2.406   29.652 1.00 90.55  ? 1891 ASP A CG  1 
ATOM   2764 O OD1 . ASP A 1 384 ? 51.929  1.699   28.736 1.00 90.59  ? 1891 ASP A OD1 1 
ATOM   2765 O OD2 . ASP A 1 384 ? 53.479  2.148   30.219 1.00 90.61  ? 1891 ASP A OD2 1 
ATOM   2766 N N   . ARG A 1 385 ? 49.039  4.850   29.062 1.00 85.84  ? 1892 ARG A N   1 
ATOM   2767 C CA  . ARG A 1 385 ? 47.747  5.506   29.276 1.00 85.76  ? 1892 ARG A CA  1 
ATOM   2768 C C   . ARG A 1 385 ? 47.571  5.892   30.741 1.00 85.63  ? 1892 ARG A C   1 
ATOM   2769 O O   . ARG A 1 385 ? 47.840  5.089   31.637 1.00 85.54  ? 1892 ARG A O   1 
ATOM   2770 C CB  . ARG A 1 385 ? 46.592  4.609   28.817 1.00 85.72  ? 1892 ARG A CB  1 
ATOM   2771 C CG  . ARG A 1 385 ? 46.506  4.434   27.308 1.00 85.87  ? 1892 ARG A CG  1 
ATOM   2772 C CD  . ARG A 1 385 ? 45.153  3.897   26.856 1.00 85.85  ? 1892 ARG A CD  1 
ATOM   2773 N NE  . ARG A 1 385 ? 45.006  2.462   27.095 1.00 85.77  ? 1892 ARG A NE  1 
ATOM   2774 C CZ  . ARG A 1 385 ? 44.052  1.700   26.562 1.00 85.78  ? 1892 ARG A CZ  1 
ATOM   2775 N NH1 . ARG A 1 385 ? 43.146  2.226   25.746 1.00 85.87  ? 1892 ARG A NH1 1 
ATOM   2776 N NH2 . ARG A 1 385 ? 44.004  0.405   26.843 1.00 85.70  ? 1892 ARG A NH2 1 
ATOM   2777 N N   . CYS A 1 386 ? 47.129  7.126   30.972 1.00 77.56  ? 1893 CYS A N   1 
ATOM   2778 C CA  . CYS A 1 386 ? 46.927  7.650   32.325 1.00 77.47  ? 1893 CYS A CA  1 
ATOM   2779 C C   . CYS A 1 386 ? 45.857  6.871   33.093 1.00 77.35  ? 1893 CYS A C   1 
ATOM   2780 O O   . CYS A 1 386 ? 44.925  6.342   32.485 1.00 77.34  ? 1893 CYS A O   1 
ATOM   2781 C CB  . CYS A 1 386 ? 46.588  9.143   32.280 1.00 77.50  ? 1893 CYS A CB  1 
ATOM   2782 S SG  . CYS A 1 386 ? 47.997  10.176  31.821 1.00 77.63  ? 1893 CYS A SG  1 
ATOM   2783 N N   . PRO A 1 387 ? 45.994  6.792   34.432 1.00 69.95  ? 1894 PRO A N   1 
ATOM   2784 C CA  . PRO A 1 387 ? 45.105  5.972   35.259 1.00 69.85  ? 1894 PRO A CA  1 
ATOM   2785 C C   . PRO A 1 387 ? 43.623  6.356   35.154 1.00 69.84  ? 1894 PRO A C   1 
ATOM   2786 O O   . PRO A 1 387 ? 43.303  7.544   35.062 1.00 69.88  ? 1894 PRO A O   1 
ATOM   2787 C CB  . PRO A 1 387 ? 45.619  6.226   36.682 1.00 69.84  ? 1894 PRO A CB  1 
ATOM   2788 C CG  . PRO A 1 387 ? 47.027  6.665   36.504 1.00 69.91  ? 1894 PRO A CG  1 
ATOM   2789 C CD  . PRO A 1 387 ? 47.013  7.474   35.251 1.00 69.98  ? 1894 PRO A CD  1 
ATOM   2790 N N   . PRO A 1 388 ? 42.726  5.350   35.157 1.00 67.68  ? 1895 PRO A N   1 
ATOM   2791 C CA  . PRO A 1 388 ? 41.283  5.590   35.127 1.00 67.68  ? 1895 PRO A CA  1 
ATOM   2792 C C   . PRO A 1 388 ? 40.743  6.128   36.452 1.00 67.66  ? 1895 PRO A C   1 
ATOM   2793 O O   . PRO A 1 388 ? 41.314  5.862   37.510 1.00 67.63  ? 1895 PRO A O   1 
ATOM   2794 C CB  . PRO A 1 388 ? 40.706  4.199   34.854 1.00 67.63  ? 1895 PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 388 ? 41.713  3.260   35.405 1.00 67.58  ? 1895 PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 388 ? 43.043  3.909   35.171 1.00 67.63  ? 1895 PRO A CD  1 
ATOM   2797 N N   . GLU A 1 389 ? 39.650  6.882   36.378 1.00 63.05  ? 1896 GLU A N   1 
ATOM   2798 C CA  . GLU A 1 389 ? 38.966  7.407   37.561 1.00 63.07  ? 1896 GLU A CA  1 
ATOM   2799 C C   . GLU A 1 389 ? 37.494  6.998   37.540 1.00 63.09  ? 1896 GLU A C   1 
ATOM   2800 O O   . GLU A 1 389 ? 36.979  6.579   36.501 1.00 63.10  ? 1896 GLU A O   1 
ATOM   2801 C CB  . GLU A 1 389 ? 39.073  8.934   37.611 1.00 63.14  ? 1896 GLU A CB  1 
ATOM   2802 C CG  . GLU A 1 389 ? 40.491  9.473   37.752 1.00 63.14  ? 1896 GLU A CG  1 
ATOM   2803 C CD  . GLU A 1 389 ? 40.545  10.992  37.791 1.00 63.22  ? 1896 GLU A CD  1 
ATOM   2804 O OE1 . GLU A 1 389 ? 39.546  11.645  37.417 1.00 63.28  ? 1896 GLU A OE1 1 
ATOM   2805 O OE2 . GLU A 1 389 ? 41.594  11.534  38.196 1.00 63.23  ? 1896 GLU A OE2 1 
ATOM   2806 N N   . THR A 1 390 ? 36.821  7.118   38.683 1.00 60.99  ? 1897 THR A N   1 
ATOM   2807 C CA  . THR A 1 390 ? 35.372  6.916   38.736 1.00 61.05  ? 1897 THR A CA  1 
ATOM   2808 C C   . THR A 1 390 ? 34.668  8.177   38.236 1.00 61.16  ? 1897 THR A C   1 
ATOM   2809 O O   . THR A 1 390 ? 35.286  9.242   38.151 1.00 61.19  ? 1897 THR A O   1 
ATOM   2810 C CB  . THR A 1 390 ? 34.864  6.551   40.153 1.00 61.06  ? 1897 THR A CB  1 
ATOM   2811 O OG1 . THR A 1 390 ? 34.991  7.682   41.022 1.00 61.14  ? 1897 THR A OG1 1 
ATOM   2812 C CG2 . THR A 1 390 ? 35.640  5.369   40.727 1.00 60.97  ? 1897 THR A CG2 1 
ATOM   2813 N N   . ASP A 1 391 ? 33.382  8.054   37.912 1.00 68.43  ? 1898 ASP A N   1 
ATOM   2814 C CA  . ASP A 1 391 ? 32.602  9.168   37.360 1.00 68.57  ? 1898 ASP A CA  1 
ATOM   2815 C C   . ASP A 1 391 ? 32.443  10.349  38.320 1.00 68.65  ? 1898 ASP A C   1 
ATOM   2816 O O   . ASP A 1 391 ? 32.213  11.480  37.884 1.00 68.75  ? 1898 ASP A O   1 
ATOM   2817 C CB  . ASP A 1 391 ? 31.229  8.679   36.893 1.00 68.66  ? 1898 ASP A CB  1 
ATOM   2818 C CG  . ASP A 1 391 ? 31.314  7.753   35.693 1.00 68.61  ? 1898 ASP A CG  1 
ATOM   2819 O OD1 . ASP A 1 391 ? 32.112  8.031   34.772 1.00 68.59  ? 1898 ASP A OD1 1 
ATOM   2820 O OD2 . ASP A 1 391 ? 30.573  6.748   35.667 1.00 68.62  ? 1898 ASP A OD2 1 
ATOM   2821 N N   . ASP A 1 392 ? 32.569  10.077  39.619 1.00 66.26  ? 1899 ASP A N   1 
ATOM   2822 C CA  . ASP A 1 392 ? 32.480  11.106  40.657 1.00 66.36  ? 1899 ASP A CA  1 
ATOM   2823 C C   . ASP A 1 392 ? 33.737  11.978  40.709 1.00 66.32  ? 1899 ASP A C   1 
ATOM   2824 O O   . ASP A 1 392 ? 33.647  13.199  40.866 1.00 66.42  ? 1899 ASP A O   1 
ATOM   2825 C CB  . ASP A 1 392 ? 32.224  10.464  42.026 1.00 66.38  ? 1899 ASP A CB  1 
ATOM   2826 C CG  . ASP A 1 392 ? 31.001  9.561   42.030 1.00 66.43  ? 1899 ASP A CG  1 
ATOM   2827 O OD1 . ASP A 1 392 ? 29.904  10.027  41.653 1.00 66.56  ? 1899 ASP A OD1 1 
ATOM   2828 O OD2 . ASP A 1 392 ? 31.138  8.381   42.419 1.00 66.36  ? 1899 ASP A OD2 1 
ATOM   2829 N N   . GLY A 1 393 ? 34.901  11.343  40.577 1.00 65.11  ? 1900 GLY A N   1 
ATOM   2830 C CA  . GLY A 1 393 ? 36.181  12.049  40.572 1.00 65.08  ? 1900 GLY A CA  1 
ATOM   2831 C C   . GLY A 1 393 ? 37.253  11.405  41.432 1.00 65.02  ? 1900 GLY A C   1 
ATOM   2832 O O   . GLY A 1 393 ? 38.397  11.865  41.449 1.00 65.01  ? 1900 GLY A O   1 
ATOM   2833 N N   . VAL A 1 394 ? 36.885  10.342  42.146 1.00 57.28  ? 1901 VAL A N   1 
ATOM   2834 C CA  . VAL A 1 394 ? 37.820  9.626   43.020 1.00 57.23  ? 1901 VAL A CA  1 
ATOM   2835 C C   . VAL A 1 394 ? 38.610  8.554   42.249 1.00 57.11  ? 1901 VAL A C   1 
ATOM   2836 O O   . VAL A 1 394 ? 38.016  7.649   41.657 1.00 57.06  ? 1901 VAL A O   1 
ATOM   2837 C CB  . VAL A 1 394 ? 37.117  9.051   44.301 1.00 57.28  ? 1901 VAL A CB  1 
ATOM   2838 C CG1 . VAL A 1 394 ? 35.867  8.240   43.955 1.00 57.28  ? 1901 VAL A CG1 1 
ATOM   2839 C CG2 . VAL A 1 394 ? 38.091  8.234   45.153 1.00 57.25  ? 1901 VAL A CG2 1 
ATOM   2840 N N   . PRO A 1 395 ? 39.955  8.668   42.246 1.00 56.52  ? 1902 PRO A N   1 
ATOM   2841 C CA  . PRO A 1 395 ? 40.817  7.745   41.502 1.00 56.44  ? 1902 PRO A CA  1 
ATOM   2842 C C   . PRO A 1 395 ? 40.737  6.301   41.996 1.00 56.39  ? 1902 PRO A C   1 
ATOM   2843 O O   . PRO A 1 395 ? 40.495  6.054   43.180 1.00 56.41  ? 1902 PRO A O   1 
ATOM   2844 C CB  . PRO A 1 395 ? 42.224  8.310   41.732 1.00 56.47  ? 1902 PRO A CB  1 
ATOM   2845 C CG  . PRO A 1 395 ? 42.116  9.116   42.975 1.00 56.55  ? 1902 PRO A CG  1 
ATOM   2846 C CD  . PRO A 1 395 ? 40.742  9.699   42.948 1.00 56.59  ? 1902 PRO A CD  1 
ATOM   2847 N N   . CYS A 1 396 ? 40.938  5.367   41.072 1.00 54.61  ? 1903 CYS A N   1 
ATOM   2848 C CA  . CYS A 1 396 ? 40.928  3.942   41.377 1.00 54.56  ? 1903 CYS A CA  1 
ATOM   2849 C C   . CYS A 1 396 ? 42.228  3.527   42.059 1.00 54.57  ? 1903 CYS A C   1 
ATOM   2850 O O   . CYS A 1 396 ? 43.246  4.213   41.945 1.00 54.60  ? 1903 CYS A O   1 
ATOM   2851 C CB  . CYS A 1 396 ? 40.715  3.128   40.099 1.00 54.51  ? 1903 CYS A CB  1 
ATOM   2852 S SG  . CYS A 1 396 ? 39.228  3.574   39.164 1.00 54.54  ? 1903 CYS A SG  1 
ATOM   2853 N N   . VAL A 1 397 ? 42.184  2.403   42.769 1.00 53.07  ? 1904 VAL A N   1 
ATOM   2854 C CA  . VAL A 1 397 ? 43.344  1.908   43.507 1.00 53.10  ? 1904 VAL A CA  1 
ATOM   2855 C C   . VAL A 1 397 ? 43.752  0.512   43.035 1.00 53.04  ? 1904 VAL A C   1 
ATOM   2856 O O   . VAL A 1 397 ? 42.998  -0.456  43.178 1.00 53.00  ? 1904 VAL A O   1 
ATOM   2857 C CB  . VAL A 1 397 ? 43.099  1.923   45.040 1.00 53.16  ? 1904 VAL A CB  1 
ATOM   2858 C CG1 . VAL A 1 397 ? 44.254  1.264   45.784 1.00 53.21  ? 1904 VAL A CG1 1 
ATOM   2859 C CG2 . VAL A 1 397 ? 42.890  3.351   45.537 1.00 53.24  ? 1904 VAL A CG2 1 
ATOM   2860 N N   . PHE A 1 398 ? 44.952  0.432   42.465 1.00 56.63  ? 1905 PHE A N   1 
ATOM   2861 C CA  . PHE A 1 398 ? 45.522  -0.830  42.008 1.00 56.60  ? 1905 PHE A CA  1 
ATOM   2862 C C   . PHE A 1 398 ? 46.738  -1.207  42.856 1.00 56.68  ? 1905 PHE A C   1 
ATOM   2863 O O   . PHE A 1 398 ? 47.545  -0.339  43.197 1.00 56.75  ? 1905 PHE A O   1 
ATOM   2864 C CB  . PHE A 1 398 ? 45.928  -0.747  40.528 1.00 56.60  ? 1905 PHE A CB  1 
ATOM   2865 C CG  . PHE A 1 398 ? 44.810  -0.347  39.598 1.00 56.57  ? 1905 PHE A CG  1 
ATOM   2866 C CD1 . PHE A 1 398 ? 43.605  -1.049  39.580 1.00 56.51  ? 1905 PHE A CD1 1 
ATOM   2867 C CD2 . PHE A 1 398 ? 44.974  0.720   38.720 1.00 56.61  ? 1905 PHE A CD2 1 
ATOM   2868 C CE1 . PHE A 1 398 ? 42.577  -0.680  38.713 1.00 56.50  ? 1905 PHE A CE1 1 
ATOM   2869 C CE2 . PHE A 1 398 ? 43.952  1.094   37.847 1.00 56.60  ? 1905 PHE A CE2 1 
ATOM   2870 C CZ  . PHE A 1 398 ? 42.752  0.392   37.844 1.00 56.55  ? 1905 PHE A CZ  1 
ATOM   2871 N N   . PRO A 1 399 ? 46.867  -2.500  43.210 1.00 57.09  ? 1906 PRO A N   1 
ATOM   2872 C CA  . PRO A 1 399 ? 45.890  -3.559  42.965 1.00 57.01  ? 1906 PRO A CA  1 
ATOM   2873 C C   . PRO A 1 399 ? 44.888  -3.727  44.110 1.00 57.00  ? 1906 PRO A C   1 
ATOM   2874 O O   . PRO A 1 399 ? 45.167  -3.328  45.243 1.00 57.07  ? 1906 PRO A O   1 
ATOM   2875 C CB  . PRO A 1 399 ? 46.761  -4.814  42.826 1.00 57.04  ? 1906 PRO A CB  1 
ATOM   2876 C CG  . PRO A 1 399 ? 48.123  -4.447  43.393 1.00 57.15  ? 1906 PRO A CG  1 
ATOM   2877 C CD  . PRO A 1 399 ? 48.069  -3.028  43.875 1.00 57.18  ? 1906 PRO A CD  1 
ATOM   2878 N N   . PHE A 1 400 ? 43.729  -4.307  43.805 1.00 52.18  ? 1907 PHE A N   1 
ATOM   2879 C CA  . PHE A 1 400 ? 42.696  -4.562  44.813 1.00 52.18  ? 1907 PHE A CA  1 
ATOM   2880 C C   . PHE A 1 400 ? 42.224  -6.015  44.804 1.00 52.14  ? 1907 PHE A C   1 
ATOM   2881 O O   . PHE A 1 400 ? 42.259  -6.685  43.766 1.00 52.08  ? 1907 PHE A O   1 
ATOM   2882 C CB  . PHE A 1 400 ? 41.509  -3.598  44.650 1.00 52.18  ? 1907 PHE A CB  1 
ATOM   2883 C CG  . PHE A 1 400 ? 40.719  -3.803  43.383 1.00 52.11  ? 1907 PHE A CG  1 
ATOM   2884 C CD1 . PHE A 1 400 ? 39.633  -4.674  43.356 1.00 52.08  ? 1907 PHE A CD1 1 
ATOM   2885 C CD2 . PHE A 1 400 ? 41.050  -3.112  42.222 1.00 52.10  ? 1907 PHE A CD2 1 
ATOM   2886 C CE1 . PHE A 1 400 ? 38.900  -4.864  42.190 1.00 52.04  ? 1907 PHE A CE1 1 
ATOM   2887 C CE2 . PHE A 1 400 ? 40.322  -3.296  41.051 1.00 52.07  ? 1907 PHE A CE2 1 
ATOM   2888 C CZ  . PHE A 1 400 ? 39.244  -4.173  41.036 1.00 52.04  ? 1907 PHE A CZ  1 
ATOM   2889 N N   . ILE A 1 401 ? 41.776  -6.490  45.963 1.00 53.69  ? 1908 ILE A N   1 
ATOM   2890 C CA  . ILE A 1 401 ? 41.331  -7.875  46.112 1.00 53.66  ? 1908 ILE A CA  1 
ATOM   2891 C C   . ILE A 1 401 ? 39.830  -8.007  45.844 1.00 53.62  ? 1908 ILE A C   1 
ATOM   2892 O O   . ILE A 1 401 ? 39.049  -7.115  46.182 1.00 53.66  ? 1908 ILE A O   1 
ATOM   2893 C CB  . ILE A 1 401 ? 41.682  -8.454  47.510 1.00 53.75  ? 1908 ILE A CB  1 
ATOM   2894 C CG1 . ILE A 1 401 ? 43.057  -7.952  47.976 1.00 53.83  ? 1908 ILE A CG1 1 
ATOM   2895 C CG2 . ILE A 1 401 ? 41.630  -9.990  47.489 1.00 53.72  ? 1908 ILE A CG2 1 
ATOM   2896 C CD1 . ILE A 1 401 ? 43.311  -8.089  49.473 1.00 53.96  ? 1908 ILE A CD1 1 
ATOM   2897 N N   . PHE A 1 402 ? 39.441  -9.121  45.227 1.00 54.66  ? 1909 PHE A N   1 
ATOM   2898 C CA  . PHE A 1 402 ? 38.040  -9.403  44.927 1.00 54.64  ? 1909 PHE A CA  1 
ATOM   2899 C C   . PHE A 1 402 ? 37.790  -10.910 44.962 1.00 54.61  ? 1909 PHE A C   1 
ATOM   2900 O O   . PHE A 1 402 ? 38.316  -11.654 44.130 1.00 54.56  ? 1909 PHE A O   1 
ATOM   2901 C CB  . PHE A 1 402 ? 37.655  -8.808  43.568 1.00 54.60  ? 1909 PHE A CB  1 
ATOM   2902 C CG  . PHE A 1 402 ? 36.199  -8.937  43.233 1.00 54.61  ? 1909 PHE A CG  1 
ATOM   2903 C CD1 . PHE A 1 402 ? 35.275  -8.029  43.737 1.00 54.67  ? 1909 PHE A CD1 1 
ATOM   2904 C CD2 . PHE A 1 402 ? 35.751  -9.956  42.399 1.00 54.56  ? 1909 PHE A CD2 1 
ATOM   2905 C CE1 . PHE A 1 402 ? 33.924  -8.139  43.426 1.00 54.71  ? 1909 PHE A CE1 1 
ATOM   2906 C CE2 . PHE A 1 402 ? 34.404  -10.076 42.082 1.00 54.59  ? 1909 PHE A CE2 1 
ATOM   2907 C CZ  . PHE A 1 402 ? 33.487  -9.166  42.596 1.00 54.67  ? 1909 PHE A CZ  1 
ATOM   2908 N N   . ASN A 1 403 ? 36.994  -11.345 45.940 1.00 60.65  ? 1910 ASN A N   1 
ATOM   2909 C CA  . ASN A 1 403 ? 36.718  -12.768 46.206 1.00 60.64  ? 1910 ASN A CA  1 
ATOM   2910 C C   . ASN A 1 403 ? 37.948  -13.626 46.536 1.00 60.65  ? 1910 ASN A C   1 
ATOM   2911 O O   . ASN A 1 403 ? 37.816  -14.794 46.912 1.00 60.66  ? 1910 ASN A O   1 
ATOM   2912 C CB  . ASN A 1 403 ? 35.905  -13.403 45.066 1.00 60.58  ? 1910 ASN A CB  1 
ATOM   2913 C CG  . ASN A 1 403 ? 34.457  -12.947 45.053 1.00 60.62  ? 1910 ASN A CG  1 
ATOM   2914 O OD1 . ASN A 1 403 ? 33.924  -12.574 44.008 1.00 60.60  ? 1910 ASN A OD1 1 
ATOM   2915 N ND2 . ASN A 1 403 ? 33.810  -12.977 46.216 1.00 60.70  ? 1910 ASN A ND2 1 
ATOM   2916 N N   . GLY A 1 404 ? 39.135  -13.038 46.402 1.00 64.41  ? 1911 GLY A N   1 
ATOM   2917 C CA  . GLY A 1 404 ? 40.393  -13.742 46.642 1.00 64.44  ? 1911 GLY A CA  1 
ATOM   2918 C C   . GLY A 1 404 ? 41.377  -13.621 45.491 1.00 64.41  ? 1911 GLY A C   1 
ATOM   2919 O O   . GLY A 1 404 ? 42.280  -14.448 45.348 1.00 64.43  ? 1911 GLY A O   1 
ATOM   2920 N N   . LYS A 1 405 ? 41.196  -12.586 44.671 1.00 65.68  ? 1912 LYS A N   1 
ATOM   2921 C CA  . LYS A 1 405 ? 42.058  -12.323 43.517 1.00 65.66  ? 1912 LYS A CA  1 
ATOM   2922 C C   . LYS A 1 405 ? 42.526  -10.870 43.514 1.00 65.70  ? 1912 LYS A C   1 
ATOM   2923 O O   . LYS A 1 405 ? 41.811  -9.983  43.978 1.00 65.71  ? 1912 LYS A O   1 
ATOM   2924 C CB  . LYS A 1 405 ? 41.315  -12.613 42.207 1.00 65.61  ? 1912 LYS A CB  1 
ATOM   2925 C CG  . LYS A 1 405 ? 41.006  -14.077 41.922 1.00 65.58  ? 1912 LYS A CG  1 
ATOM   2926 C CD  . LYS A 1 405 ? 42.176  -14.786 41.248 1.00 65.61  ? 1912 LYS A CD  1 
ATOM   2927 C CE  . LYS A 1 405 ? 41.698  -15.886 40.304 1.00 65.57  ? 1912 LYS A CE  1 
ATOM   2928 N NZ  . LYS A 1 405 ? 40.841  -16.911 40.970 1.00 65.55  ? 1912 LYS A NZ  1 
ATOM   2929 N N   . SER A 1 406 ? 43.721  -10.637 42.979 1.00 62.46  ? 1913 SER A N   1 
ATOM   2930 C CA  . SER A 1 406 ? 44.269  -9.288  42.844 1.00 62.49  ? 1913 SER A CA  1 
ATOM   2931 C C   . SER A 1 406 ? 44.064  -8.777  41.417 1.00 62.46  ? 1913 SER A C   1 
ATOM   2932 O O   . SER A 1 406 ? 44.244  -9.528  40.454 1.00 62.46  ? 1913 SER A O   1 
ATOM   2933 C CB  . SER A 1 406 ? 45.754  -9.280  43.211 1.00 62.58  ? 1913 SER A CB  1 
ATOM   2934 O OG  . SER A 1 406 ? 46.218  -7.963  43.439 1.00 62.63  ? 1913 SER A OG  1 
ATOM   2935 N N   . TYR A 1 407 ? 43.691  -7.503  41.285 1.00 62.52  ? 1914 TYR A N   1 
ATOM   2936 C CA  . TYR A 1 407 ? 43.328  -6.935  39.979 1.00 62.51  ? 1914 TYR A CA  1 
ATOM   2937 C C   . TYR A 1 407 ? 44.097  -5.673  39.600 1.00 62.56  ? 1914 TYR A C   1 
ATOM   2938 O O   . TYR A 1 407 ? 44.354  -4.814  40.443 1.00 62.59  ? 1914 TYR A O   1 
ATOM   2939 C CB  . TYR A 1 407 ? 41.817  -6.697  39.901 1.00 62.46  ? 1914 TYR A CB  1 
ATOM   2940 C CG  . TYR A 1 407 ? 41.019  -7.981  39.895 1.00 62.42  ? 1914 TYR A CG  1 
ATOM   2941 C CD1 . TYR A 1 407 ? 40.497  -8.505  41.075 1.00 62.41  ? 1914 TYR A CD1 1 
ATOM   2942 C CD2 . TYR A 1 407 ? 40.805  -8.686  38.711 1.00 62.42  ? 1914 TYR A CD2 1 
ATOM   2943 C CE1 . TYR A 1 407 ? 39.773  -9.690  41.073 1.00 62.38  ? 1914 TYR A CE1 1 
ATOM   2944 C CE2 . TYR A 1 407 ? 40.080  -9.872  38.700 1.00 62.38  ? 1914 TYR A CE2 1 
ATOM   2945 C CZ  . TYR A 1 407 ? 39.568  -10.368 39.884 1.00 62.36  ? 1914 TYR A CZ  1 
ATOM   2946 O OH  . TYR A 1 407 ? 38.850  -11.542 39.881 1.00 62.33  ? 1914 TYR A OH  1 
ATOM   2947 N N   . GLU A 1 408 ? 44.438  -5.565  38.316 1.00 67.25  ? 1915 GLU A N   1 
ATOM   2948 C CA  . GLU A 1 408 ? 45.304  -4.493  37.815 1.00 67.31  ? 1915 GLU A CA  1 
ATOM   2949 C C   . GLU A 1 408 ? 44.579  -3.367  37.071 1.00 67.32  ? 1915 GLU A C   1 
ATOM   2950 O O   . GLU A 1 408 ? 45.049  -2.227  37.068 1.00 67.36  ? 1915 GLU A O   1 
ATOM   2951 C CB  . GLU A 1 408 ? 46.410  -5.073  36.926 1.00 67.39  ? 1915 GLU A CB  1 
ATOM   2952 C CG  . GLU A 1 408 ? 47.539  -5.764  37.689 1.00 67.43  ? 1915 GLU A CG  1 
ATOM   2953 C CD  . GLU A 1 408 ? 48.552  -4.794  38.288 1.00 67.51  ? 1915 GLU A CD  1 
ATOM   2954 O OE1 . GLU A 1 408 ? 48.459  -3.571  38.034 1.00 67.52  ? 1915 GLU A OE1 1 
ATOM   2955 O OE2 . GLU A 1 408 ? 49.452  -5.264  39.015 1.00 67.58  ? 1915 GLU A OE2 1 
ATOM   2956 N N   . GLU A 1 409 ? 43.455  -3.689  36.431 1.00 67.74  ? 1916 GLU A N   1 
ATOM   2957 C CA  . GLU A 1 409 ? 42.665  -2.690  35.702 1.00 67.76  ? 1916 GLU A CA  1 
ATOM   2958 C C   . GLU A 1 409 ? 41.166  -2.796  36.017 1.00 67.71  ? 1916 GLU A C   1 
ATOM   2959 O O   . GLU A 1 409 ? 40.737  -3.715  36.720 1.00 67.66  ? 1916 GLU A O   1 
ATOM   2960 C CB  . GLU A 1 409 ? 42.936  -2.768  34.185 1.00 67.84  ? 1916 GLU A CB  1 
ATOM   2961 C CG  . GLU A 1 409 ? 42.033  -3.720  33.382 1.00 67.84  ? 1916 GLU A CG  1 
ATOM   2962 C CD  . GLU A 1 409 ? 42.548  -5.149  33.307 1.00 67.83  ? 1916 GLU A CD  1 
ATOM   2963 O OE1 . GLU A 1 409 ? 43.228  -5.611  34.249 1.00 67.79  ? 1916 GLU A OE1 1 
ATOM   2964 O OE2 . GLU A 1 409 ? 42.258  -5.819  32.293 1.00 67.89  ? 1916 GLU A OE2 1 
ATOM   2965 N N   . CYS A 1 410 ? 40.386  -1.842  35.506 1.00 64.47  ? 1917 CYS A N   1 
ATOM   2966 C CA  . CYS A 1 410 ? 38.931  -1.869  35.628 1.00 64.46  ? 1917 CYS A CA  1 
ATOM   2967 C C   . CYS A 1 410 ? 38.376  -3.203  35.137 1.00 64.44  ? 1917 CYS A C   1 
ATOM   2968 O O   . CYS A 1 410 ? 38.702  -3.650  34.036 1.00 64.48  ? 1917 CYS A O   1 
ATOM   2969 C CB  . CYS A 1 410 ? 38.309  -0.722  34.832 1.00 64.54  ? 1917 CYS A CB  1 
ATOM   2970 S SG  . CYS A 1 410 ? 38.721  0.924   35.444 1.00 64.57  ? 1917 CYS A SG  1 
ATOM   2971 N N   . ILE A 1 411 ? 37.549  -3.835  35.965 1.00 65.21  ? 1918 ILE A N   1 
ATOM   2972 C CA  . ILE A 1 411 ? 37.000  -5.159  35.654 1.00 65.19  ? 1918 ILE A CA  1 
ATOM   2973 C C   . ILE A 1 411 ? 35.472  -5.157  35.515 1.00 65.23  ? 1918 ILE A C   1 
ATOM   2974 O O   . ILE A 1 411 ? 34.827  -4.120  35.697 1.00 65.28  ? 1918 ILE A O   1 
ATOM   2975 C CB  . ILE A 1 411 ? 37.465  -6.233  36.678 1.00 65.12  ? 1918 ILE A CB  1 
ATOM   2976 C CG1 . ILE A 1 411 ? 37.248  -5.754  38.120 1.00 65.10  ? 1918 ILE A CG1 1 
ATOM   2977 C CG2 . ILE A 1 411 ? 38.925  -6.585  36.434 1.00 65.11  ? 1918 ILE A CG2 1 
ATOM   2978 C CD1 . ILE A 1 411 ? 37.400  -6.841  39.176 1.00 65.06  ? 1918 ILE A CD1 1 
ATOM   2979 N N   . ILE A 1 412 ? 34.910  -6.317  35.174 1.00 65.78  ? 1919 ILE A N   1 
ATOM   2980 C CA  . ILE A 1 412 ? 33.461  -6.475  35.005 1.00 65.84  ? 1919 ILE A CA  1 
ATOM   2981 C C   . ILE A 1 412 ? 32.918  -7.778  35.604 1.00 65.80  ? 1919 ILE A C   1 
ATOM   2982 O O   . ILE A 1 412 ? 32.463  -8.673  34.885 1.00 65.82  ? 1919 ILE A O   1 
ATOM   2983 C CB  . ILE A 1 412 ? 33.006  -6.321  33.521 1.00 65.93  ? 1919 ILE A CB  1 
ATOM   2984 C CG1 . ILE A 1 412 ? 34.114  -6.736  32.543 1.00 65.94  ? 1919 ILE A CG1 1 
ATOM   2985 C CG2 . ILE A 1 412 ? 32.571  -4.892  33.245 1.00 66.02  ? 1919 ILE A CG2 1 
ATOM   2986 C CD1 . ILE A 1 412 ? 34.159  -8.222  32.222 1.00 65.92  ? 1919 ILE A CD1 1 
ATOM   2987 N N   . GLU A 1 413 ? 32.980  -7.872  36.928 1.00 63.79  ? 1920 GLU A N   1 
ATOM   2988 C CA  . GLU A 1 413 ? 32.339  -8.958  37.657 1.00 63.78  ? 1920 GLU A CA  1 
ATOM   2989 C C   . GLU A 1 413 ? 31.068  -8.435  38.306 1.00 63.85  ? 1920 GLU A C   1 
ATOM   2990 O O   . GLU A 1 413 ? 31.075  -7.376  38.938 1.00 63.88  ? 1920 GLU A O   1 
ATOM   2991 C CB  . GLU A 1 413 ? 33.272  -9.540  38.722 1.00 63.70  ? 1920 GLU A CB  1 
ATOM   2992 C CG  . GLU A 1 413 ? 34.323  -10.519 38.199 1.00 63.64  ? 1920 GLU A CG  1 
ATOM   2993 C CD  . GLU A 1 413 ? 33.838  -11.965 38.140 1.00 63.62  ? 1920 GLU A CD  1 
ATOM   2994 O OE1 . GLU A 1 413 ? 32.711  -12.215 37.661 1.00 63.67  ? 1920 GLU A OE1 1 
ATOM   2995 O OE2 . GLU A 1 413 ? 34.601  -12.859 38.565 1.00 63.58  ? 1920 GLU A OE2 1 
ATOM   2996 N N   . SER A 1 414 ? 29.980  -9.182  38.127 1.00 60.78  ? 1921 SER A N   1 
ATOM   2997 C CA  . SER A 1 414 ? 28.662  -8.862  38.695 1.00 60.89  ? 1921 SER A CA  1 
ATOM   2998 C C   . SER A 1 414 ? 28.198  -7.405  38.510 1.00 60.98  ? 1921 SER A C   1 
ATOM   2999 O O   . SER A 1 414 ? 27.354  -6.918  39.266 1.00 61.07  ? 1921 SER A O   1 
ATOM   3000 C CB  . SER A 1 414 ? 28.575  -9.298  40.169 1.00 60.87  ? 1921 SER A CB  1 
ATOM   3001 O OG  . SER A 1 414 ? 29.596  -8.708  40.956 1.00 60.82  ? 1921 SER A OG  1 
ATOM   3002 N N   . ARG A 1 415 ? 28.745  -6.727  37.500 1.00 60.21  ? 1922 ARG A N   1 
ATOM   3003 C CA  . ARG A 1 415 ? 28.345  -5.357  37.157 1.00 60.30  ? 1922 ARG A CA  1 
ATOM   3004 C C   . ARG A 1 415 ? 28.304  -5.106  35.646 1.00 60.36  ? 1922 ARG A C   1 
ATOM   3005 O O   . ARG A 1 415 ? 29.020  -5.754  34.879 1.00 60.30  ? 1922 ARG A O   1 
ATOM   3006 C CB  . ARG A 1 415 ? 29.250  -4.337  37.850 1.00 60.26  ? 1922 ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 415 ? 28.802  -3.998  39.257 1.00 60.31  ? 1922 ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 415 ? 29.887  -3.299  40.037 1.00 60.25  ? 1922 ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 415 ? 29.478  -3.056  41.418 1.00 60.32  ? 1922 ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 415 ? 29.839  -3.801  42.459 1.00 60.28  ? 1922 ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 415 ? 30.630  -4.854  42.298 1.00 60.17  ? 1922 ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 415 ? 29.406  -3.489  43.671 1.00 60.37  ? 1922 ARG A NH2 1 
ATOM   3013 N N   . ALA A 1 416 ? 27.464  -4.157  35.233 1.00 65.15  ? 1923 ALA A N   1 
ATOM   3014 C CA  . ALA A 1 416 ? 27.250  -3.848  33.818 1.00 65.25  ? 1923 ALA A CA  1 
ATOM   3015 C C   . ALA A 1 416 ? 28.451  -3.155  33.172 1.00 65.21  ? 1923 ALA A C   1 
ATOM   3016 O O   . ALA A 1 416 ? 29.172  -3.765  32.379 1.00 65.17  ? 1923 ALA A O   1 
ATOM   3017 C CB  . ALA A 1 416 ? 25.981  -3.017  33.640 1.00 65.43  ? 1923 ALA A CB  1 
ATOM   3018 N N   . LYS A 1 417 ? 28.657  -1.885  33.513 1.00 66.23  ? 1924 LYS A N   1 
ATOM   3019 C CA  . LYS A 1 417 ? 29.782  -1.110  32.993 1.00 66.20  ? 1924 LYS A CA  1 
ATOM   3020 C C   . LYS A 1 417 ? 31.073  -1.435  33.762 1.00 66.04  ? 1924 LYS A C   1 
ATOM   3021 O O   . LYS A 1 417 ? 31.027  -2.057  34.827 1.00 65.97  ? 1924 LYS A O   1 
ATOM   3022 C CB  . LYS A 1 417 ? 29.458  0.395   33.029 1.00 66.30  ? 1924 LYS A CB  1 
ATOM   3023 C CG  . LYS A 1 417 ? 30.408  1.299   32.225 1.00 66.31  ? 1924 LYS A CG  1 
ATOM   3024 C CD  . LYS A 1 417 ? 30.401  0.972   30.730 1.00 66.41  ? 1924 LYS A CD  1 
ATOM   3025 C CE  . LYS A 1 417 ? 31.597  1.591   30.012 1.00 66.41  ? 1924 LYS A CE  1 
ATOM   3026 N NZ  . LYS A 1 417 ? 31.679  1.165   28.584 1.00 66.52  ? 1924 LYS A NZ  1 
ATOM   3027 N N   . LEU A 1 418 ? 32.213  -1.022  33.207 1.00 66.44  ? 1925 LEU A N   1 
ATOM   3028 C CA  . LEU A 1 418 ? 33.536  -1.307  33.771 1.00 66.32  ? 1925 LEU A CA  1 
ATOM   3029 C C   . LEU A 1 418 ? 33.786  -0.551  35.075 1.00 66.28  ? 1925 LEU A C   1 
ATOM   3030 O O   . LEU A 1 418 ? 33.678  0.676   35.122 1.00 66.34  ? 1925 LEU A O   1 
ATOM   3031 C CB  . LEU A 1 418 ? 34.626  -0.978  32.746 1.00 66.34  ? 1925 LEU A CB  1 
ATOM   3032 C CG  . LEU A 1 418 ? 34.556  -1.709  31.399 1.00 66.40  ? 1925 LEU A CG  1 
ATOM   3033 C CD1 . LEU A 1 418 ? 35.038  -0.815  30.264 1.00 66.52  ? 1925 LEU A CD1 1 
ATOM   3034 C CD2 . LEU A 1 418 ? 35.332  -3.022  31.431 1.00 66.32  ? 1925 LEU A CD2 1 
ATOM   3035 N N   . TRP A 1 419 ? 34.126  -1.296  36.126 1.00 58.08  ? 1926 TRP A N   1 
ATOM   3036 C CA  . TRP A 1 419 ? 34.259  -0.739  37.474 1.00 58.06  ? 1926 TRP A CA  1 
ATOM   3037 C C   . TRP A 1 419 ? 35.612  -1.038  38.118 1.00 57.98  ? 1926 TRP A C   1 
ATOM   3038 O O   . TRP A 1 419 ? 36.281  -2.012  37.763 1.00 57.93  ? 1926 TRP A O   1 
ATOM   3039 C CB  . TRP A 1 419 ? 33.140  -1.267  38.375 1.00 58.09  ? 1926 TRP A CB  1 
ATOM   3040 C CG  . TRP A 1 419 ? 33.273  -2.729  38.698 1.00 58.01  ? 1926 TRP A CG  1 
ATOM   3041 C CD1 . TRP A 1 419 ? 32.859  -3.780  37.931 1.00 58.00  ? 1926 TRP A CD1 1 
ATOM   3042 C CD2 . TRP A 1 419 ? 33.860  -3.299  39.875 1.00 57.96  ? 1926 TRP A CD2 1 
ATOM   3043 N NE1 . TRP A 1 419 ? 33.153  -4.969  38.554 1.00 57.93  ? 1926 TRP A NE1 1 
ATOM   3044 C CE2 . TRP A 1 419 ? 33.767  -4.704  39.749 1.00 57.91  ? 1926 TRP A CE2 1 
ATOM   3045 C CE3 . TRP A 1 419 ? 34.455  -2.761  41.023 1.00 57.97  ? 1926 TRP A CE3 1 
ATOM   3046 C CZ2 . TRP A 1 419 ? 34.246  -5.578  40.730 1.00 57.86  ? 1926 TRP A CZ2 1 
ATOM   3047 C CZ3 . TRP A 1 419 ? 34.933  -3.631  41.997 1.00 57.93  ? 1926 TRP A CZ3 1 
ATOM   3048 C CH2 . TRP A 1 419 ? 34.824  -5.024  41.843 1.00 57.88  ? 1926 TRP A CH2 1 
ATOM   3049 N N   . CYS A 1 420 ? 35.992  -0.193  39.075 1.00 55.01  ? 1927 CYS A N   1 
ATOM   3050 C CA  . CYS A 1 420 ? 37.226  -0.352  39.844 1.00 54.96  ? 1927 CYS A CA  1 
ATOM   3051 C C   . CYS A 1 420 ? 36.922  -0.222  41.331 1.00 54.99  ? 1927 CYS A C   1 
ATOM   3052 O O   . CYS A 1 420 ? 35.791  0.086   41.710 1.00 55.05  ? 1927 CYS A O   1 
ATOM   3053 C CB  . CYS A 1 420 ? 38.240  0.720   39.443 1.00 54.98  ? 1927 CYS A CB  1 
ATOM   3054 S SG  . CYS A 1 420 ? 37.782  2.395   39.966 1.00 55.06  ? 1927 CYS A SG  1 
ATOM   3055 N N   . SER A 1 421 ? 37.931  -0.450  42.168 1.00 49.49  ? 1928 SER A N   1 
ATOM   3056 C CA  . SER A 1 421 ? 37.812  -0.190  43.600 1.00 49.55  ? 1928 SER A CA  1 
ATOM   3057 C C   . SER A 1 421 ? 38.488  1.132   43.946 1.00 49.61  ? 1928 SER A C   1 
ATOM   3058 O O   . SER A 1 421 ? 39.389  1.578   43.235 1.00 49.59  ? 1928 SER A O   1 
ATOM   3059 C CB  . SER A 1 421 ? 38.424  -1.328  44.416 1.00 49.53  ? 1928 SER A CB  1 
ATOM   3060 O OG  . SER A 1 421 ? 38.185  -1.146  45.801 1.00 49.62  ? 1928 SER A OG  1 
ATOM   3061 N N   . THR A 1 422 ? 38.043  1.755   45.034 1.00 48.61  ? 1929 THR A N   1 
ATOM   3062 C CA  . THR A 1 422 ? 38.644  3.002   45.513 1.00 48.69  ? 1929 THR A CA  1 
ATOM   3063 C C   . THR A 1 422 ? 39.470  2.784   46.788 1.00 48.74  ? 1929 THR A C   1 
ATOM   3064 O O   . THR A 1 422 ? 40.041  3.728   47.341 1.00 48.82  ? 1929 THR A O   1 
ATOM   3065 C CB  . THR A 1 422 ? 37.584  4.109   45.723 1.00 48.78  ? 1929 THR A CB  1 
ATOM   3066 O OG1 . THR A 1 422 ? 36.457  3.573   46.428 1.00 48.84  ? 1929 THR A OG1 1 
ATOM   3067 C CG2 . THR A 1 422 ? 37.119  4.662   44.383 1.00 48.75  ? 1929 THR A CG2 1 
ATOM   3068 N N   . THR A 1 423 ? 39.523  1.529   47.234 1.00 47.16  ? 1930 THR A N   1 
ATOM   3069 C CA  . THR A 1 423 ? 40.351  1.108   48.365 1.00 47.22  ? 1930 THR A CA  1 
ATOM   3070 C C   . THR A 1 423 ? 41.354  0.045   47.915 1.00 47.14  ? 1930 THR A C   1 
ATOM   3071 O O   . THR A 1 423 ? 41.361  -0.358  46.749 1.00 47.04  ? 1930 THR A O   1 
ATOM   3072 C CB  . THR A 1 423 ? 39.497  0.513   49.509 1.00 47.31  ? 1930 THR A CB  1 
ATOM   3073 O OG1 . THR A 1 423 ? 38.742  -0.600  49.017 1.00 47.22  ? 1930 THR A OG1 1 
ATOM   3074 C CG2 . THR A 1 423 ? 38.548  1.552   50.079 1.00 47.42  ? 1930 THR A CG2 1 
ATOM   3075 N N   . ALA A 1 424 ? 42.191  -0.411  48.843 1.00 48.50  ? 1931 ALA A N   1 
ATOM   3076 C CA  . ALA A 1 424 ? 43.123  -1.505  48.575 1.00 48.45  ? 1931 ALA A CA  1 
ATOM   3077 C C   . ALA A 1 424 ? 42.399  -2.852  48.518 1.00 48.39  ? 1931 ALA A C   1 
ATOM   3078 O O   . ALA A 1 424 ? 42.927  -3.829  47.983 1.00 48.33  ? 1931 ALA A O   1 
ATOM   3079 C CB  . ALA A 1 424 ? 44.222  -1.534  49.625 1.00 48.58  ? 1931 ALA A CB  1 
ATOM   3080 N N   . ASP A 1 425 ? 41.189  -2.891  49.072 1.00 48.74  ? 1932 ASP A N   1 
ATOM   3081 C CA  . ASP A 1 425 ? 40.394  -4.110  49.117 1.00 48.70  ? 1932 ASP A CA  1 
ATOM   3082 C C   . ASP A 1 425 ? 38.910  -3.777  49.006 1.00 48.71  ? 1932 ASP A C   1 
ATOM   3083 O O   . ASP A 1 425 ? 38.396  -2.933  49.743 1.00 48.81  ? 1932 ASP A O   1 
ATOM   3084 C CB  . ASP A 1 425 ? 40.678  -4.878  50.416 1.00 48.80  ? 1932 ASP A CB  1 
ATOM   3085 C CG  . ASP A 1 425 ? 40.224  -6.335  50.364 1.00 48.75  ? 1932 ASP A CG  1 
ATOM   3086 O OD1 . ASP A 1 425 ? 39.522  -6.732  49.409 1.00 48.65  ? 1932 ASP A OD1 1 
ATOM   3087 O OD2 . ASP A 1 425 ? 40.573  -7.092  51.295 1.00 48.83  ? 1932 ASP A OD2 1 
ATOM   3088 N N   . TYR A 1 426 ? 38.237  -4.442  48.070 1.00 48.02  ? 1933 TYR A N   1 
ATOM   3089 C CA  . TYR A 1 426 ? 36.789  -4.330  47.908 1.00 48.04  ? 1933 TYR A CA  1 
ATOM   3090 C C   . TYR A 1 426 ? 36.073  -5.276  48.869 1.00 48.10  ? 1933 TYR A C   1 
ATOM   3091 O O   . TYR A 1 426 ? 35.130  -4.876  49.550 1.00 48.21  ? 1933 TYR A O   1 
ATOM   3092 C CB  . TYR A 1 426 ? 36.379  -4.621  46.457 1.00 47.93  ? 1933 TYR A CB  1 
ATOM   3093 C CG  . TYR A 1 426 ? 34.883  -4.700  46.233 1.00 47.96  ? 1933 TYR A CG  1 
ATOM   3094 C CD1 . TYR A 1 426 ? 34.141  -3.557  45.931 1.00 48.02  ? 1933 TYR A CD1 1 
ATOM   3095 C CD2 . TYR A 1 426 ? 34.209  -5.920  46.322 1.00 47.96  ? 1933 TYR A CD2 1 
ATOM   3096 C CE1 . TYR A 1 426 ? 32.762  -3.628  45.725 1.00 48.07  ? 1933 TYR A CE1 1 
ATOM   3097 C CE2 . TYR A 1 426 ? 32.832  -6.002  46.121 1.00 48.00  ? 1933 TYR A CE2 1 
ATOM   3098 C CZ  . TYR A 1 426 ? 32.116  -4.855  45.822 1.00 48.07  ? 1933 TYR A CZ  1 
ATOM   3099 O OH  . TYR A 1 426 ? 30.756  -4.938  45.622 1.00 48.14  ? 1933 TYR A OH  1 
ATOM   3100 N N   . ASP A 1 427 ? 36.531  -6.526  48.920 1.00 52.69  ? 1934 ASP A N   1 
ATOM   3101 C CA  . ASP A 1 427 ? 35.964  -7.544  49.809 1.00 52.75  ? 1934 ASP A CA  1 
ATOM   3102 C C   . ASP A 1 427 ? 35.834  -7.054  51.248 1.00 52.92  ? 1934 ASP A C   1 
ATOM   3103 O O   . ASP A 1 427 ? 34.981  -7.525  52.000 1.00 53.01  ? 1934 ASP A O   1 
ATOM   3104 C CB  . ASP A 1 427 ? 36.827  -8.810  49.791 1.00 52.69  ? 1934 ASP A CB  1 
ATOM   3105 C CG  . ASP A 1 427 ? 36.902  -9.460  48.420 1.00 52.55  ? 1934 ASP A CG  1 
ATOM   3106 O OD1 . ASP A 1 427 ? 36.025  -9.199  47.567 1.00 52.51  ? 1934 ASP A OD1 1 
ATOM   3107 O OD2 . ASP A 1 427 ? 37.846  -10.248 48.201 1.00 52.50  ? 1934 ASP A OD2 1 
ATOM   3108 N N   . ARG A 1 428 ? 36.684  -6.098  51.611 1.00 51.92  ? 1935 ARG A N   1 
ATOM   3109 C CA  . ARG A 1 428 ? 36.806  -5.619  52.982 1.00 52.10  ? 1935 ARG A CA  1 
ATOM   3110 C C   . ARG A 1 428 ? 36.018  -4.334  53.232 1.00 52.21  ? 1935 ARG A C   1 
ATOM   3111 O O   . ARG A 1 428 ? 35.583  -4.082  54.356 1.00 52.39  ? 1935 ARG A O   1 
ATOM   3112 C CB  . ARG A 1 428 ? 38.286  -5.392  53.309 1.00 52.13  ? 1935 ARG A CB  1 
ATOM   3113 C CG  . ARG A 1 428 ? 38.643  -5.423  54.787 1.00 52.33  ? 1935 ARG A CG  1 
ATOM   3114 C CD  . ARG A 1 428 ? 40.134  -5.201  54.977 1.00 52.36  ? 1935 ARG A CD  1 
ATOM   3115 N NE  . ARG A 1 428 ? 40.533  -3.839  54.625 1.00 52.35  ? 1935 ARG A NE  1 
ATOM   3116 C CZ  . ARG A 1 428 ? 41.751  -3.484  54.222 1.00 52.31  ? 1935 ARG A CZ  1 
ATOM   3117 N NH1 . ARG A 1 428 ? 42.713  -4.391  54.101 1.00 52.29  ? 1935 ARG A NH1 1 
ATOM   3118 N NH2 . ARG A 1 428 ? 42.005  -2.215  53.929 1.00 52.32  ? 1935 ARG A NH2 1 
ATOM   3119 N N   . ASP A 1 429 ? 35.835  -3.529  52.188 1.00 48.73  ? 1936 ASP A N   1 
ATOM   3120 C CA  . ASP A 1 429 ? 35.265  -2.188  52.346 1.00 48.84  ? 1936 ASP A CA  1 
ATOM   3121 C C   . ASP A 1 429 ? 34.111  -1.858  51.391 1.00 48.79  ? 1936 ASP A C   1 
ATOM   3122 O O   . ASP A 1 429 ? 33.421  -0.851  51.578 1.00 48.90  ? 1936 ASP A O   1 
ATOM   3123 C CB  . ASP A 1 429 ? 36.370  -1.134  52.223 1.00 48.84  ? 1936 ASP A CB  1 
ATOM   3124 C CG  . ASP A 1 429 ? 37.409  -1.251  53.317 1.00 48.93  ? 1936 ASP A CG  1 
ATOM   3125 O OD1 . ASP A 1 429 ? 37.155  -0.753  54.433 1.00 49.12  ? 1936 ASP A OD1 1 
ATOM   3126 O OD2 . ASP A 1 429 ? 38.479  -1.841  53.061 1.00 48.84  ? 1936 ASP A OD2 1 
ATOM   3127 N N   . HIS A 1 430 ? 33.911  -2.704  50.380 1.00 48.05  ? 1937 HIS A N   1 
ATOM   3128 C CA  . HIS A 1 430 ? 32.863  -2.520  49.363 1.00 48.02  ? 1937 HIS A CA  1 
ATOM   3129 C C   . HIS A 1 430 ? 32.732  -1.066  48.889 1.00 48.05  ? 1937 HIS A C   1 
ATOM   3130 O O   . HIS A 1 430 ? 31.645  -0.482  48.899 1.00 48.16  ? 1937 HIS A O   1 
ATOM   3131 C CB  . HIS A 1 430 ? 31.521  -3.091  49.845 1.00 48.13  ? 1937 HIS A CB  1 
ATOM   3132 C CG  . HIS A 1 430 ? 31.518  -4.584  49.990 1.00 48.07  ? 1937 HIS A CG  1 
ATOM   3133 N ND1 . HIS A 1 430 ? 31.027  -5.426  49.015 1.00 47.97  ? 1937 HIS A ND1 1 
ATOM   3134 C CD2 . HIS A 1 430 ? 31.952  -5.383  50.994 1.00 48.12  ? 1937 HIS A CD2 1 
ATOM   3135 C CE1 . HIS A 1 430 ? 31.157  -6.680  49.413 1.00 47.94  ? 1937 HIS A CE1 1 
ATOM   3136 N NE2 . HIS A 1 430 ? 31.715  -6.682  50.610 1.00 48.03  ? 1937 HIS A NE2 1 
ATOM   3137 N N   . GLU A 1 431 ? 33.866  -0.501  48.484 1.00 45.82  ? 1938 GLU A N   1 
ATOM   3138 C CA  . GLU A 1 431 ? 33.949  0.863   47.972 1.00 45.84  ? 1938 GLU A CA  1 
ATOM   3139 C C   . GLU A 1 431 ? 34.337  0.832   46.497 1.00 45.70  ? 1938 GLU A C   1 
ATOM   3140 O O   . GLU A 1 431 ? 35.380  0.274   46.136 1.00 45.60  ? 1938 GLU A O   1 
ATOM   3141 C CB  . GLU A 1 431 ? 34.984  1.657   48.767 1.00 45.90  ? 1938 GLU A CB  1 
ATOM   3142 C CG  . GLU A 1 431 ? 34.472  2.217   50.081 1.00 46.09  ? 1938 GLU A CG  1 
ATOM   3143 C CD  . GLU A 1 431 ? 33.788  3.561   49.918 1.00 46.19  ? 1938 GLU A CD  1 
ATOM   3144 O OE1 . GLU A 1 431 ? 34.122  4.298   48.963 1.00 46.11  ? 1938 GLU A OE1 1 
ATOM   3145 O OE2 . GLU A 1 431 ? 32.920  3.885   50.754 1.00 46.36  ? 1938 GLU A OE2 1 
ATOM   3146 N N   . TRP A 1 432 ? 33.500  1.432   45.650 1.00 48.70  ? 1939 TRP A N   1 
ATOM   3147 C CA  . TRP A 1 432 ? 33.667  1.331   44.196 1.00 48.60  ? 1939 TRP A CA  1 
ATOM   3148 C C   . TRP A 1 432 ? 32.969  2.450   43.405 1.00 48.67  ? 1939 TRP A C   1 
ATOM   3149 O O   . TRP A 1 432 ? 32.226  3.260   43.969 1.00 48.79  ? 1939 TRP A O   1 
ATOM   3150 C CB  . TRP A 1 432 ? 33.179  -0.042  43.712 1.00 48.54  ? 1939 TRP A CB  1 
ATOM   3151 C CG  . TRP A 1 432 ? 31.694  -0.164  43.690 1.00 48.63  ? 1939 TRP A CG  1 
ATOM   3152 C CD1 . TRP A 1 432 ? 30.873  -0.407  44.751 1.00 48.73  ? 1939 TRP A CD1 1 
ATOM   3153 C CD2 . TRP A 1 432 ? 30.846  -0.034  42.547 1.00 48.66  ? 1939 TRP A CD2 1 
ATOM   3154 N NE1 . TRP A 1 432 ? 29.564  -0.439  44.340 1.00 48.82  ? 1939 TRP A NE1 1 
ATOM   3155 C CE2 . TRP A 1 432 ? 29.520  -0.213  42.990 1.00 48.78  ? 1939 TRP A CE2 1 
ATOM   3156 C CE3 . TRP A 1 432 ? 31.079  0.213   41.188 1.00 48.62  ? 1939 TRP A CE3 1 
ATOM   3157 C CZ2 . TRP A 1 432 ? 28.430  -0.155  42.124 1.00 48.86  ? 1939 TRP A CZ2 1 
ATOM   3158 C CZ3 . TRP A 1 432 ? 29.996  0.277   40.328 1.00 48.70  ? 1939 TRP A CZ3 1 
ATOM   3159 C CH2 . TRP A 1 432 ? 28.688  0.090   40.798 1.00 48.81  ? 1939 TRP A CH2 1 
ATOM   3160 N N   . GLY A 1 433 ? 33.224  2.472   42.095 1.00 53.67  ? 1940 GLY A N   1 
ATOM   3161 C CA  . GLY A 1 433 ? 32.594  3.403   41.154 1.00 53.74  ? 1940 GLY A CA  1 
ATOM   3162 C C   . GLY A 1 433 ? 32.882  3.004   39.713 1.00 53.68  ? 1940 GLY A C   1 
ATOM   3163 O O   . GLY A 1 433 ? 33.827  2.256   39.450 1.00 53.58  ? 1940 GLY A O   1 
ATOM   3164 N N   . PHE A 1 434 ? 32.066  3.499   38.781 1.00 60.73  ? 1941 PHE A N   1 
ATOM   3165 C CA  . PHE A 1 434 ? 32.237  3.199   37.353 1.00 60.71  ? 1941 PHE A CA  1 
ATOM   3166 C C   . PHE A 1 434 ? 33.418  3.958   36.745 1.00 60.69  ? 1941 PHE A C   1 
ATOM   3167 O O   . PHE A 1 434 ? 33.581  5.155   36.985 1.00 60.73  ? 1941 PHE A O   1 
ATOM   3168 C CB  . PHE A 1 434 ? 30.959  3.515   36.562 1.00 60.84  ? 1941 PHE A CB  1 
ATOM   3169 C CG  . PHE A 1 434 ? 29.849  2.510   36.747 1.00 60.88  ? 1941 PHE A CG  1 
ATOM   3170 C CD1 . PHE A 1 434 ? 30.101  1.140   36.688 1.00 60.78  ? 1941 PHE A CD1 1 
ATOM   3171 C CD2 . PHE A 1 434 ? 28.539  2.939   36.944 1.00 61.02  ? 1941 PHE A CD2 1 
ATOM   3172 C CE1 . PHE A 1 434 ? 29.070  0.215   36.848 1.00 60.82  ? 1941 PHE A CE1 1 
ATOM   3173 C CE2 . PHE A 1 434 ? 27.501  2.021   37.101 1.00 61.08  ? 1941 PHE A CE2 1 
ATOM   3174 C CZ  . PHE A 1 434 ? 27.769  0.657   37.054 1.00 60.97  ? 1941 PHE A CZ  1 
ATOM   3175 N N   . CYS A 1 435 ? 34.222  3.256   35.948 1.00 64.71  ? 1942 CYS A N   1 
ATOM   3176 C CA  . CYS A 1 435 ? 35.426  3.827   35.338 1.00 64.70  ? 1942 CYS A CA  1 
ATOM   3177 C C   . CYS A 1 435 ? 35.136  4.751   34.159 1.00 64.81  ? 1942 CYS A C   1 
ATOM   3178 O O   . CYS A 1 435 ? 34.321  4.428   33.293 1.00 64.87  ? 1942 CYS A O   1 
ATOM   3179 C CB  . CYS A 1 435 ? 36.364  2.716   34.864 1.00 64.63  ? 1942 CYS A CB  1 
ATOM   3180 S SG  . CYS A 1 435 ? 36.950  1.623   36.157 1.00 64.52  ? 1942 CYS A SG  1 
ATOM   3181 N N   . ARG A 1 436 ? 35.813  5.897   34.135 1.00 71.05  ? 1943 ARG A N   1 
ATOM   3182 C CA  . ARG A 1 436 ? 35.856  6.758   32.951 1.00 71.15  ? 1943 ARG A CA  1 
ATOM   3183 C C   . ARG A 1 436 ? 37.313  7.039   32.575 1.00 71.13  ? 1943 ARG A C   1 
ATOM   3184 O O   . ARG A 1 436 ? 38.008  7.805   33.248 1.00 71.11  ? 1943 ARG A O   1 
ATOM   3185 C CB  . ARG A 1 436 ? 35.045  8.052   33.139 1.00 71.25  ? 1943 ARG A CB  1 
ATOM   3186 C CG  . ARG A 1 436 ? 35.335  8.841   34.411 1.00 71.22  ? 1943 ARG A CG  1 
ATOM   3187 C CD  . ARG A 1 436 ? 34.961  10.313  34.250 1.00 71.34  ? 1943 ARG A CD  1 
ATOM   3188 N NE  . ARG A 1 436 ? 35.462  11.131  35.356 1.00 71.32  ? 1943 ARG A NE  1 
ATOM   3189 C CZ  . ARG A 1 436 ? 36.697  11.629  35.440 1.00 71.29  ? 1943 ARG A CZ  1 
ATOM   3190 N NH1 . ARG A 1 436 ? 37.590  11.402  34.481 1.00 71.27  ? 1943 ARG A NH1 1 
ATOM   3191 N NH2 . ARG A 1 436 ? 37.043  12.357  36.494 1.00 71.29  ? 1943 ARG A NH2 1 
ATOM   3192 N N   . HIS A 1 437 ? 37.764  6.399   31.499 1.00 75.17  ? 1944 HIS A N   1 
ATOM   3193 C CA  . HIS A 1 437 ? 39.176  6.416   31.110 1.00 75.17  ? 1944 HIS A CA  1 
ATOM   3194 C C   . HIS A 1 437 ? 39.613  7.722   30.452 1.00 75.27  ? 1944 HIS A C   1 
ATOM   3195 O O   . HIS A 1 437 ? 38.838  8.365   29.741 1.00 75.38  ? 1944 HIS A O   1 
ATOM   3196 C CB  . HIS A 1 437 ? 39.497  5.225   30.202 1.00 75.19  ? 1944 HIS A CB  1 
ATOM   3197 C CG  . HIS A 1 437 ? 39.322  3.897   30.871 1.00 75.08  ? 1944 HIS A CG  1 
ATOM   3198 N ND1 . HIS A 1 437 ? 38.098  3.273   30.979 1.00 75.07  ? 1944 HIS A ND1 1 
ATOM   3199 C CD2 . HIS A 1 437 ? 40.215  3.078   31.475 1.00 75.00  ? 1944 HIS A CD2 1 
ATOM   3200 C CE1 . HIS A 1 437 ? 38.245  2.126   31.617 1.00 74.98  ? 1944 HIS A CE1 1 
ATOM   3201 N NE2 . HIS A 1 437 ? 39.520  1.984   31.930 1.00 74.93  ? 1944 HIS A NE2 1 
ATOM   3202 N N   . SER A 1 438 ? 40.864  8.098   30.703 1.00 75.89  ? 1945 SER A N   1 
ATOM   3203 C CA  . SER A 1 438 ? 41.444  9.316   30.152 1.00 75.99  ? 1945 SER A CA  1 
ATOM   3204 C C   . SER A 1 438 ? 42.081  9.041   28.797 1.00 76.10  ? 1945 SER A C   1 
ATOM   3205 O O   . SER A 1 438 ? 42.727  8.009   28.600 1.00 76.08  ? 1945 SER A O   1 
ATOM   3206 C CB  . SER A 1 438 ? 42.483  9.896   31.116 1.00 75.94  ? 1945 SER A CB  1 
ATOM   3207 O OG  . SER A 1 438 ? 42.991  11.133  30.646 1.00 76.04  ? 1945 SER A OG  1 
ATOM   3208 N N   . ASN A 1 439 ? 41.893  9.975   27.868 1.00 82.61  ? 1946 ASN A N   1 
ATOM   3209 C CA  . ASN A 1 439 ? 42.459  9.861   26.527 1.00 82.76  ? 1946 ASN A CA  1 
ATOM   3210 C C   . ASN A 1 439 ? 43.806  10.574  26.402 1.00 82.82  ? 1946 ASN A C   1 
ATOM   3211 O O   . ASN A 1 439 ? 44.214  10.982  25.311 1.00 82.98  ? 1946 ASN A O   1 
ATOM   3212 C CB  . ASN A 1 439 ? 41.461  10.364  25.481 1.00 82.91  ? 1946 ASN A CB  1 
ATOM   3213 C CG  . ASN A 1 439 ? 40.133  9.638   25.551 1.00 82.88  ? 1946 ASN A CG  1 
ATOM   3214 O OD1 . ASN A 1 439 ? 39.361  9.821   26.491 1.00 82.78  ? 1946 ASN A OD1 1 
ATOM   3215 N ND2 . ASN A 1 439 ? 39.859  8.809   24.551 1.00 82.97  ? 1946 ASN A ND2 1 
ATOM   3216 N N   . SER A 1 440 ? 44.488  10.715  27.536 1.00 82.69  ? 1947 SER A N   1 
ATOM   3217 C CA  . SER A 1 440 ? 45.824  11.297  27.586 1.00 82.75  ? 1947 SER A CA  1 
ATOM   3218 C C   . SER A 1 440 ? 46.827  10.268  28.096 1.00 82.69  ? 1947 SER A C   1 
ATOM   3219 O O   . SER A 1 440 ? 46.465  9.339   28.822 1.00 82.56  ? 1947 SER A O   1 
ATOM   3220 C CB  . SER A 1 440 ? 45.837  12.538  28.478 1.00 82.71  ? 1947 SER A CB  1 
ATOM   3221 O OG  . SER A 1 440 ? 45.419  12.223  29.795 1.00 82.56  ? 1947 SER A OG  1 
ATOM   3222 N N   . TYR A 1 441 ? 48.087  10.442  27.707 1.00 85.93  ? 1948 TYR A N   1 
ATOM   3223 C CA  . TYR A 1 441 ? 49.149  9.508   28.066 1.00 85.92  ? 1948 TYR A CA  1 
ATOM   3224 C C   . TYR A 1 441 ? 50.125  10.130  29.063 1.00 85.90  ? 1948 TYR A C   1 
ATOM   3225 O O   . TYR A 1 441 ? 50.211  11.355  29.179 1.00 85.93  ? 1948 TYR A O   1 
ATOM   3226 C CB  . TYR A 1 441 ? 49.880  9.020   26.810 1.00 86.09  ? 1948 TYR A CB  1 
ATOM   3227 C CG  . TYR A 1 441 ? 49.125  7.979   25.999 1.00 86.12  ? 1948 TYR A CG  1 
ATOM   3228 C CD1 . TYR A 1 441 ? 49.666  6.713   25.781 1.00 86.16  ? 1948 TYR A CD1 1 
ATOM   3229 C CD2 . TYR A 1 441 ? 47.875  8.263   25.443 1.00 86.13  ? 1948 TYR A CD2 1 
ATOM   3230 C CE1 . TYR A 1 441 ? 48.983  5.756   25.033 1.00 86.19  ? 1948 TYR A CE1 1 
ATOM   3231 C CE2 . TYR A 1 441 ? 47.184  7.313   24.695 1.00 86.17  ? 1948 TYR A CE2 1 
ATOM   3232 C CZ  . TYR A 1 441 ? 47.744  6.064   24.493 1.00 86.20  ? 1948 TYR A CZ  1 
ATOM   3233 O OH  . TYR A 1 441 ? 47.059  5.124   23.757 1.00 86.24  ? 1948 TYR A OH  1 
ATOM   3234 N N   . ARG A 1 442 ? 50.853  9.271   29.775 1.00 88.55  ? 1949 ARG A N   1 
ATOM   3235 C CA  . ARG A 1 442 ? 51.704  9.682   30.893 1.00 88.53  ? 1949 ARG A CA  1 
ATOM   3236 C C   . ARG A 1 442 ? 52.903  10.525  30.476 1.00 88.69  ? 1949 ARG A C   1 
ATOM   3237 O O   . ARG A 1 442 ? 53.570  10.231  29.483 1.00 88.84  ? 1949 ARG A O   1 
ATOM   3238 C CB  . ARG A 1 442 ? 52.179  8.458   31.681 1.00 88.48  ? 1949 ARG A CB  1 
ATOM   3239 C CG  . ARG A 1 442 ? 51.072  7.713   32.412 1.00 88.32  ? 1949 ARG A CG  1 
ATOM   3240 C CD  . ARG A 1 442 ? 51.635  6.626   33.312 1.00 88.28  ? 1949 ARG A CD  1 
ATOM   3241 N NE  . ARG A 1 442 ? 50.588  5.748   33.829 1.00 88.15  ? 1949 ARG A NE  1 
ATOM   3242 C CZ  . ARG A 1 442 ? 50.728  4.935   34.873 1.00 88.09  ? 1949 ARG A CZ  1 
ATOM   3243 N NH1 . ARG A 1 442 ? 51.874  4.881   35.540 1.00 88.15  ? 1949 ARG A NH1 1 
ATOM   3244 N NH2 . ARG A 1 442 ? 49.711  4.177   35.260 1.00 87.98  ? 1949 ARG A NH2 1 
ATOM   3245 N N   . THR A 1 443 ? 53.160  11.573  31.256 1.00 88.74  ? 1950 THR A N   1 
ATOM   3246 C CA  . THR A 1 443 ? 54.280  12.486  31.031 1.00 88.88  ? 1950 THR A CA  1 
ATOM   3247 C C   . THR A 1 443 ? 55.184  12.532  32.265 1.00 88.89  ? 1950 THR A C   1 
ATOM   3248 O O   . THR A 1 443 ? 54.736  12.248  33.377 1.00 88.77  ? 1950 THR A O   1 
ATOM   3249 C CB  . THR A 1 443 ? 53.787  13.922  30.730 1.00 88.91  ? 1950 THR A CB  1 
ATOM   3250 O OG1 . THR A 1 443 ? 53.035  14.417  31.845 1.00 88.77  ? 1950 THR A OG1 1 
ATOM   3251 C CG2 . THR A 1 443 ? 52.909  13.952  29.488 1.00 88.94  ? 1950 THR A CG2 1 
ATOM   3252 N N   . SER A 1 444 ? 56.453  12.879  32.067 1.00 92.13  ? 1951 SER A N   1 
ATOM   3253 C CA  . SER A 1 444 ? 57.381  13.072  33.184 1.00 92.17  ? 1951 SER A CA  1 
ATOM   3254 C C   . SER A 1 444 ? 58.423  14.133  32.871 1.00 92.35  ? 1951 SER A C   1 
ATOM   3255 O O   . SER A 1 444 ? 58.968  14.172  31.769 1.00 92.49  ? 1951 SER A O   1 
ATOM   3256 C CB  . SER A 1 444 ? 58.066  11.759  33.572 1.00 92.20  ? 1951 SER A CB  1 
ATOM   3257 O OG  . SER A 1 444 ? 58.728  11.181  32.464 1.00 92.34  ? 1951 SER A OG  1 
ATOM   3258 N N   . SER A 1 445 ? 58.696  14.987  33.852 1.00 91.06  ? 1952 SER A N   1 
ATOM   3259 C CA  . SER A 1 445 ? 59.638  16.090  33.682 1.00 91.22  ? 1952 SER A CA  1 
ATOM   3260 C C   . SER A 1 445 ? 60.616  16.210  34.853 1.00 91.30  ? 1952 SER A C   1 
ATOM   3261 O O   . SER A 1 445 ? 60.276  15.883  35.991 1.00 91.20  ? 1952 SER A O   1 
ATOM   3262 C CB  . SER A 1 445 ? 58.886  17.408  33.474 1.00 91.17  ? 1952 SER A CB  1 
ATOM   3263 O OG  . SER A 1 445 ? 57.936  17.629  34.503 1.00 91.01  ? 1952 SER A OG  1 
ATOM   3264 N N   . ILE A 1 446 ? 61.832  16.673  34.559 1.00 90.98  ? 1953 ILE A N   1 
ATOM   3265 C CA  . ILE A 1 446 ? 62.868  16.876  35.574 1.00 91.11  ? 1953 ILE A CA  1 
ATOM   3266 C C   . ILE A 1 446 ? 63.383  18.314  35.532 1.00 91.23  ? 1953 ILE A C   1 
ATOM   3267 O O   . ILE A 1 446 ? 63.975  18.740  34.540 1.00 91.38  ? 1953 ILE A O   1 
ATOM   3268 C CB  . ILE A 1 446 ? 64.056  15.898  35.394 1.00 91.29  ? 1953 ILE A CB  1 
ATOM   3269 C CG1 . ILE A 1 446 ? 63.576  14.444  35.423 1.00 91.18  ? 1953 ILE A CG1 1 
ATOM   3270 C CG2 . ILE A 1 446 ? 65.108  16.134  36.473 1.00 91.44  ? 1953 ILE A CG2 1 
ATOM   3271 C CD1 . ILE A 1 446 ? 64.528  13.463  34.768 1.00 91.36  ? 1953 ILE A CD1 1 
ATOM   3272 N N   . ILE A 1 447 ? 63.152  19.054  36.612 1.00 92.02  ? 1954 ILE A N   1 
ATOM   3273 C CA  . ILE A 1 447 ? 63.639  20.429  36.722 1.00 92.13  ? 1954 ILE A CA  1 
ATOM   3274 C C   . ILE A 1 447 ? 64.968  20.494  37.476 1.00 92.34  ? 1954 ILE A C   1 
ATOM   3275 O O   . ILE A 1 447 ? 65.012  20.359  38.703 1.00 92.33  ? 1954 ILE A O   1 
ATOM   3276 C CB  . ILE A 1 447 ? 62.592  21.389  37.353 1.00 91.99  ? 1954 ILE A CB  1 
ATOM   3277 C CG1 . ILE A 1 447 ? 61.869  20.722  38.533 1.00 91.86  ? 1954 ILE A CG1 1 
ATOM   3278 C CG2 . ILE A 1 447 ? 61.598  21.847  36.295 1.00 91.89  ? 1954 ILE A CG2 1 
ATOM   3279 C CD1 . ILE A 1 447 ? 61.215  21.696  39.504 1.00 91.80  ? 1954 ILE A CD1 1 
ATOM   3280 N N   . PHE A 1 448 ? 66.050  20.697  36.727 1.00 87.44  ? 1955 PHE A N   1 
ATOM   3281 C CA  . PHE A 1 448 ? 67.398  20.706  37.291 1.00 87.68  ? 1955 PHE A CA  1 
ATOM   3282 C C   . PHE A 1 448 ? 67.725  22.009  38.015 1.00 87.76  ? 1955 PHE A C   1 
ATOM   3283 O O   . PHE A 1 448 ? 67.747  23.085  37.412 1.00 87.81  ? 1955 PHE A O   1 
ATOM   3284 C CB  . PHE A 1 448 ? 68.439  20.403  36.212 1.00 87.90  ? 1955 PHE A CB  1 
ATOM   3285 C CG  . PHE A 1 448 ? 68.412  18.981  35.726 1.00 87.88  ? 1955 PHE A CG  1 
ATOM   3286 C CD1 . PHE A 1 448 ? 68.979  17.962  36.484 1.00 87.95  ? 1955 PHE A CD1 1 
ATOM   3287 C CD2 . PHE A 1 448 ? 67.826  18.660  34.507 1.00 87.82  ? 1955 PHE A CD2 1 
ATOM   3288 C CE1 . PHE A 1 448 ? 68.956  16.644  36.038 1.00 87.93  ? 1955 PHE A CE1 1 
ATOM   3289 C CE2 . PHE A 1 448 ? 67.802  17.345  34.052 1.00 87.81  ? 1955 PHE A CE2 1 
ATOM   3290 C CZ  . PHE A 1 448 ? 68.369  16.336  34.819 1.00 87.86  ? 1955 PHE A CZ  1 
ATOM   3291 N N   . LYS A 1 449 ? 67.979  21.890  39.315 1.00 91.62  ? 1956 LYS A N   1 
ATOM   3292 C CA  . LYS A 1 449 ? 68.231  23.035  40.184 1.00 91.71  ? 1956 LYS A CA  1 
ATOM   3293 C C   . LYS A 1 449 ? 69.683  23.033  40.669 1.00 91.99  ? 1956 LYS A C   1 
ATOM   3294 O O   . LYS A 1 449 ? 70.289  21.972  40.838 1.00 92.09  ? 1956 LYS A O   1 
ATOM   3295 C CB  . LYS A 1 449 ? 67.259  23.005  41.366 1.00 91.54  ? 1956 LYS A CB  1 
ATOM   3296 C CG  . LYS A 1 449 ? 66.774  24.369  41.831 1.00 91.51  ? 1956 LYS A CG  1 
ATOM   3297 C CD  . LYS A 1 449 ? 65.311  24.295  42.255 1.00 91.27  ? 1956 LYS A CD  1 
ATOM   3298 C CE  . LYS A 1 449 ? 64.875  25.519  43.049 1.00 91.28  ? 1956 LYS A CE  1 
ATOM   3299 N NZ  . LYS A 1 449 ? 65.211  25.408  44.496 1.00 91.40  ? 1956 LYS A NZ  1 
ATOM   3300 N N   . CYS A 1 450 ? 70.231  24.225  40.893 1.00 93.99  ? 1957 CYS A N   1 
ATOM   3301 C CA  . CYS A 1 450 ? 71.656  24.384  41.182 1.00 94.29  ? 1957 CYS A CA  1 
ATOM   3302 C C   . CYS A 1 450 ? 72.025  24.143  42.646 1.00 94.39  ? 1957 CYS A C   1 
ATOM   3303 O O   . CYS A 1 450 ? 71.304  24.557  43.557 1.00 94.28  ? 1957 CYS A O   1 
ATOM   3304 C CB  . CYS A 1 450 ? 72.134  25.771  40.740 1.00 94.42  ? 1957 CYS A CB  1 
ATOM   3305 S SG  . CYS A 1 450 ? 73.877  26.123  41.084 1.00 94.83  ? 1957 CYS A SG  1 
ATOM   3306 N N   . ASP A 1 451 ? 73.155  23.463  42.843 1.00 97.19  ? 1958 ASP A N   1 
ATOM   3307 C CA  . ASP A 1 451 ? 73.781  23.273  44.155 1.00 97.38  ? 1958 ASP A CA  1 
ATOM   3308 C C   . ASP A 1 451 ? 75.263  22.970  43.942 1.00 97.72  ? 1958 ASP A C   1 
ATOM   3309 O O   . ASP A 1 451 ? 75.615  22.044  43.209 1.00 97.76  ? 1958 ASP A O   1 
ATOM   3310 C CB  . ASP A 1 451 ? 73.105  22.141  44.938 1.00 97.24  ? 1958 ASP A CB  1 
ATOM   3311 C CG  . ASP A 1 451 ? 73.367  22.221  46.438 1.00 97.40  ? 1958 ASP A CG  1 
ATOM   3312 O OD1 . ASP A 1 451 ? 74.515  22.498  46.846 1.00 97.71  ? 1958 ASP A OD1 1 
ATOM   3313 O OD2 . ASP A 1 451 ? 72.416  21.989  47.214 1.00 97.24  ? 1958 ASP A OD2 1 
ATOM   3314 N N   . GLU A 1 452 ? 76.123  23.749  44.592 1.00 101.70 ? 1959 GLU A N   1 
ATOM   3315 C CA  . GLU A 1 452 ? 77.563  23.729  44.312 1.00 102.05 ? 1959 GLU A CA  1 
ATOM   3316 C C   . GLU A 1 452 ? 78.319  22.538  44.916 1.00 102.27 ? 1959 GLU A C   1 
ATOM   3317 O O   . GLU A 1 452 ? 79.250  22.019  44.297 1.00 102.51 ? 1959 GLU A O   1 
ATOM   3318 C CB  . GLU A 1 452 ? 78.222  25.051  44.738 1.00 102.28 ? 1959 GLU A CB  1 
ATOM   3319 C CG  . GLU A 1 452 ? 77.494  26.328  44.274 1.00 102.08 ? 1959 GLU A CG  1 
ATOM   3320 C CD  . GLU A 1 452 ? 77.542  26.569  42.764 1.00 102.04 ? 1959 GLU A CD  1 
ATOM   3321 O OE1 . GLU A 1 452 ? 78.315  25.893  42.051 1.00 102.20 ? 1959 GLU A OE1 1 
ATOM   3322 O OE2 . GLU A 1 452 ? 76.799  27.454  42.290 1.00 101.85 ? 1959 GLU A OE2 1 
ATOM   3323 N N   . ASP A 1 453 ? 77.922  22.114  46.114 1.00 102.16 ? 1960 ASP A N   1 
ATOM   3324 C CA  . ASP A 1 453 ? 78.594  21.004  46.802 1.00 102.38 ? 1960 ASP A CA  1 
ATOM   3325 C C   . ASP A 1 453 ? 78.120  19.618  46.343 1.00 102.20 ? 1960 ASP A C   1 
ATOM   3326 O O   . ASP A 1 453 ? 78.752  18.605  46.656 1.00 102.38 ? 1960 ASP A O   1 
ATOM   3327 C CB  . ASP A 1 453 ? 78.494  21.153  48.331 1.00 102.47 ? 1960 ASP A CB  1 
ATOM   3328 C CG  . ASP A 1 453 ? 77.059  21.281  48.826 1.00 102.14 ? 1960 ASP A CG  1 
ATOM   3329 O OD1 . ASP A 1 453 ? 76.299  20.293  48.748 1.00 101.90 ? 1960 ASP A OD1 1 
ATOM   3330 O OD2 . ASP A 1 453 ? 76.698  22.371  49.318 1.00 102.14 ? 1960 ASP A OD2 1 
ATOM   3331 N N   . GLU A 1 454 ? 77.016  19.584  45.602 1.00 91.77  ? 1961 GLU A N   1 
ATOM   3332 C CA  . GLU A 1 454 ? 76.473  18.337  45.071 1.00 91.58  ? 1961 GLU A CA  1 
ATOM   3333 C C   . GLU A 1 454 ? 77.135  18.008  43.736 1.00 91.70  ? 1961 GLU A C   1 
ATOM   3334 O O   . GLU A 1 454 ? 76.609  18.354  42.674 1.00 91.52  ? 1961 GLU A O   1 
ATOM   3335 C CB  . GLU A 1 454 ? 74.951  18.434  44.899 1.00 91.18  ? 1961 GLU A CB  1 
ATOM   3336 C CG  . GLU A 1 454 ? 74.172  18.809  46.161 1.00 91.06  ? 1961 GLU A CG  1 
ATOM   3337 C CD  . GLU A 1 454 ? 74.030  17.667  47.153 1.00 91.06  ? 1961 GLU A CD  1 
ATOM   3338 O OE1 . GLU A 1 454 ? 74.018  16.491  46.730 1.00 90.94  ? 1961 GLU A OE1 1 
ATOM   3339 O OE2 . GLU A 1 454 ? 73.919  17.952  48.364 1.00 91.19  ? 1961 GLU A OE2 1 
ATOM   3340 N N   . ASP A 1 455 ? 78.289  17.344  43.800 1.00 88.22  ? 1962 ASP A N   1 
ATOM   3341 C CA  . ASP A 1 455 ? 79.050  16.963  42.607 1.00 88.40  ? 1962 ASP A CA  1 
ATOM   3342 C C   . ASP A 1 455 ? 78.174  16.140  41.661 1.00 88.13  ? 1962 ASP A C   1 
ATOM   3343 O O   . ASP A 1 455 ? 77.777  16.622  40.597 1.00 88.02  ? 1962 ASP A O   1 
ATOM   3344 C CB  . ASP A 1 455 ? 80.316  16.190  43.003 1.00 88.78  ? 1962 ASP A CB  1 
ATOM   3345 C CG  . ASP A 1 455 ? 81.463  16.386  42.020 1.00 89.11  ? 1962 ASP A CG  1 
ATOM   3346 O OD1 . ASP A 1 455 ? 81.209  16.680  40.830 1.00 89.02  ? 1962 ASP A OD1 1 
ATOM   3347 O OD2 . ASP A 1 455 ? 82.629  16.242  42.443 1.00 89.48  ? 1962 ASP A OD2 1 
ATOM   3348 N N   . ILE A 1 456 ? 77.870  14.906  42.057 1.00 83.37  ? 1963 ILE A N   1 
ATOM   3349 C CA  . ILE A 1 456 ? 76.859  14.101  41.379 1.00 83.07  ? 1963 ILE A CA  1 
ATOM   3350 C C   . ILE A 1 456 ? 75.701  13.915  42.360 1.00 82.78  ? 1963 ILE A C   1 
ATOM   3351 O O   . ILE A 1 456 ? 75.783  13.109  43.292 1.00 82.83  ? 1963 ILE A O   1 
ATOM   3352 C CB  . ILE A 1 456 ? 77.409  12.729  40.895 1.00 83.22  ? 1963 ILE A CB  1 
ATOM   3353 C CG1 . ILE A 1 456 ? 78.723  12.907  40.121 1.00 83.57  ? 1963 ILE A CG1 1 
ATOM   3354 C CG2 . ILE A 1 456 ? 76.367  12.010  40.033 1.00 82.92  ? 1963 ILE A CG2 1 
ATOM   3355 C CD1 . ILE A 1 456 ? 79.580  11.649  40.028 1.00 83.83  ? 1963 ILE A CD1 1 
ATOM   3356 N N   . GLY A 1 457 ? 74.635  14.685  42.150 1.00 87.46  ? 1964 GLY A N   1 
ATOM   3357 C CA  . GLY A 1 457 ? 73.504  14.731  43.077 1.00 87.21  ? 1964 GLY A CA  1 
ATOM   3358 C C   . GLY A 1 457 ? 72.484  13.621  42.908 1.00 86.94  ? 1964 GLY A C   1 
ATOM   3359 O O   . GLY A 1 457 ? 72.707  12.662  42.167 1.00 86.98  ? 1964 GLY A O   1 
ATOM   3360 N N   . ARG A 1 458 ? 71.361  13.758  43.608 1.00 89.23  ? 1965 ARG A N   1 
ATOM   3361 C CA  . ARG A 1 458 ? 70.282  12.778  43.550 1.00 88.98  ? 1965 ARG A CA  1 
ATOM   3362 C C   . ARG A 1 458 ? 68.936  13.461  43.297 1.00 88.69  ? 1965 ARG A C   1 
ATOM   3363 O O   . ARG A 1 458 ? 68.612  14.453  43.956 1.00 88.65  ? 1965 ARG A O   1 
ATOM   3364 C CB  . ARG A 1 458 ? 70.229  11.959  44.843 1.00 89.01  ? 1965 ARG A CB  1 
ATOM   3365 C CG  . ARG A 1 458 ? 69.287  10.758  44.789 1.00 88.80  ? 1965 ARG A CG  1 
ATOM   3366 C CD  . ARG A 1 458 ? 69.118  10.096  46.151 1.00 88.83  ? 1965 ARG A CD  1 
ATOM   3367 N NE  . ARG A 1 458 ? 70.326  9.395   46.589 1.00 89.12  ? 1965 ARG A NE  1 
ATOM   3368 C CZ  . ARG A 1 458 ? 70.639  8.143   46.261 1.00 89.17  ? 1965 ARG A CZ  1 
ATOM   3369 N NH1 . ARG A 1 458 ? 69.838  7.428   45.478 1.00 88.94  ? 1965 ARG A NH1 1 
ATOM   3370 N NH2 . ARG A 1 458 ? 71.762  7.603   46.718 1.00 89.46  ? 1965 ARG A NH2 1 
ATOM   3371 N N   . PRO A 1 459 ? 68.155  12.936  42.331 1.00 88.33  ? 1966 PRO A N   1 
ATOM   3372 C CA  . PRO A 1 459 ? 66.811  13.449  42.070 1.00 88.06  ? 1966 PRO A CA  1 
ATOM   3373 C C   . PRO A 1 459 ? 65.820  13.040  43.157 1.00 87.89  ? 1966 PRO A C   1 
ATOM   3374 O O   . PRO A 1 459 ? 65.992  11.996  43.792 1.00 87.93  ? 1966 PRO A O   1 
ATOM   3375 C CB  . PRO A 1 459 ? 66.435  12.785  40.744 1.00 87.96  ? 1966 PRO A CB  1 
ATOM   3376 C CG  . PRO A 1 459 ? 67.228  11.534  40.708 1.00 88.10  ? 1966 PRO A CG  1 
ATOM   3377 C CD  . PRO A 1 459 ? 68.510  11.831  41.418 1.00 88.37  ? 1966 PRO A CD  1 
ATOM   3378 N N   . GLN A 1 460 ? 64.799  13.869  43.367 1.00 92.28  ? 1967 GLN A N   1 
ATOM   3379 C CA  . GLN A 1 460 ? 63.735  13.576  44.328 1.00 92.13  ? 1967 GLN A CA  1 
ATOM   3380 C C   . GLN A 1 460 ? 62.361  13.903  43.747 1.00 91.89  ? 1967 GLN A C   1 
ATOM   3381 O O   . GLN A 1 460 ? 62.229  14.814  42.927 1.00 91.86  ? 1967 GLN A O   1 
ATOM   3382 C CB  . GLN A 1 460 ? 63.951  14.336  45.643 1.00 92.25  ? 1967 GLN A CB  1 
ATOM   3383 C CG  . GLN A 1 460 ? 65.230  13.970  46.407 1.00 92.50  ? 1967 GLN A CG  1 
ATOM   3384 C CD  . GLN A 1 460 ? 65.206  12.570  47.015 1.00 92.50  ? 1967 GLN A CD  1 
ATOM   3385 O OE1 . GLN A 1 460 ? 64.702  11.618  46.414 1.00 92.35  ? 1967 GLN A OE1 1 
ATOM   3386 N NE2 . GLN A 1 460 ? 65.767  12.442  48.213 1.00 92.68  ? 1967 GLN A NE2 1 
ATOM   3387 N N   . VAL A 1 461 ? 61.348  13.152  44.176 1.00 91.35  ? 1968 VAL A N   1 
ATOM   3388 C CA  . VAL A 1 461 ? 59.973  13.357  43.718 1.00 91.14  ? 1968 VAL A CA  1 
ATOM   3389 C C   . VAL A 1 461 ? 59.451  14.709  44.199 1.00 91.13  ? 1968 VAL A C   1 
ATOM   3390 O O   . VAL A 1 461 ? 59.384  14.965  45.404 1.00 91.18  ? 1968 VAL A O   1 
ATOM   3391 C CB  . VAL A 1 461 ? 59.019  12.239  44.212 1.00 91.01  ? 1968 VAL A CB  1 
ATOM   3392 C CG1 . VAL A 1 461 ? 57.657  12.362  43.544 1.00 90.81  ? 1968 VAL A CG1 1 
ATOM   3393 C CG2 . VAL A 1 461 ? 59.608  10.861  43.956 1.00 91.03  ? 1968 VAL A CG2 1 
ATOM   3394 N N   . PHE A 1 462 ? 59.088  15.569  43.250 1.00 92.28  ? 1969 PHE A N   1 
ATOM   3395 C CA  . PHE A 1 462 ? 58.581  16.903  43.564 1.00 92.27  ? 1969 PHE A CA  1 
ATOM   3396 C C   . PHE A 1 462 ? 57.055  16.956  43.548 1.00 92.10  ? 1969 PHE A C   1 
ATOM   3397 O O   . PHE A 1 462 ? 56.445  17.502  44.469 1.00 92.10  ? 1969 PHE A O   1 
ATOM   3398 C CB  . PHE A 1 462 ? 59.182  17.953  42.619 1.00 92.35  ? 1969 PHE A CB  1 
ATOM   3399 C CG  . PHE A 1 462 ? 58.625  19.339  42.808 1.00 92.34  ? 1969 PHE A CG  1 
ATOM   3400 C CD1 . PHE A 1 462 ? 58.930  20.081  43.946 1.00 92.44  ? 1969 PHE A CD1 1 
ATOM   3401 C CD2 . PHE A 1 462 ? 57.806  19.908  41.839 1.00 92.24  ? 1969 PHE A CD2 1 
ATOM   3402 C CE1 . PHE A 1 462 ? 58.417  21.364  44.120 1.00 92.45  ? 1969 PHE A CE1 1 
ATOM   3403 C CE2 . PHE A 1 462 ? 57.290  21.191  42.003 1.00 92.25  ? 1969 PHE A CE2 1 
ATOM   3404 C CZ  . PHE A 1 462 ? 57.597  21.920  43.145 1.00 92.35  ? 1969 PHE A CZ  1 
ATOM   3405 N N   . SER A 1 463 ? 56.446  16.390  42.506 1.00 86.12  ? 1970 SER A N   1 
ATOM   3406 C CA  . SER A 1 463 ? 54.986  16.371  42.381 1.00 85.97  ? 1970 SER A CA  1 
ATOM   3407 C C   . SER A 1 463 ? 54.460  15.210  41.538 1.00 85.85  ? 1970 SER A C   1 
ATOM   3408 O O   . SER A 1 463 ? 54.877  15.016  40.396 1.00 85.86  ? 1970 SER A O   1 
ATOM   3409 C CB  . SER A 1 463 ? 54.469  17.700  41.819 1.00 85.97  ? 1970 SER A CB  1 
ATOM   3410 O OG  . SER A 1 463 ? 54.927  17.912  40.495 1.00 85.99  ? 1970 SER A OG  1 
ATOM   3411 N N   . GLU A 1 464 ? 53.540  14.447  42.121 1.00 81.64  ? 1971 GLU A N   1 
ATOM   3412 C CA  . GLU A 1 464 ? 52.809  13.407  41.405 1.00 81.52  ? 1971 GLU A CA  1 
ATOM   3413 C C   . GLU A 1 464 ? 51.369  13.868  41.208 1.00 81.43  ? 1971 GLU A C   1 
ATOM   3414 O O   . GLU A 1 464 ? 50.653  14.119  42.183 1.00 81.42  ? 1971 GLU A O   1 
ATOM   3415 C CB  . GLU A 1 464 ? 52.818  12.095  42.191 1.00 81.49  ? 1971 GLU A CB  1 
ATOM   3416 C CG  . GLU A 1 464 ? 54.172  11.423  42.324 1.00 81.59  ? 1971 GLU A CG  1 
ATOM   3417 C CD  . GLU A 1 464 ? 54.152  10.284  43.328 1.00 81.59  ? 1971 GLU A CD  1 
ATOM   3418 O OE1 . GLU A 1 464 ? 53.801  10.522  44.503 1.00 81.60  ? 1971 GLU A OE1 1 
ATOM   3419 O OE2 . GLU A 1 464 ? 54.492  9.148   42.943 1.00 81.59  ? 1971 GLU A OE2 1 
ATOM   3420 N N   . VAL A 1 465 ? 50.951  13.988  39.951 1.00 74.42  ? 1972 VAL A N   1 
ATOM   3421 C CA  . VAL A 1 465 ? 49.587  14.414  39.633 1.00 74.36  ? 1972 VAL A CA  1 
ATOM   3422 C C   . VAL A 1 465 ? 48.806  13.280  38.969 1.00 74.27  ? 1972 VAL A C   1 
ATOM   3423 O O   . VAL A 1 465 ? 49.100  12.890  37.837 1.00 74.27  ? 1972 VAL A O   1 
ATOM   3424 C CB  . VAL A 1 465 ? 49.560  15.694  38.748 1.00 74.41  ? 1972 VAL A CB  1 
ATOM   3425 C CG1 . VAL A 1 465 ? 48.128  16.068  38.369 1.00 74.37  ? 1972 VAL A CG1 1 
ATOM   3426 C CG2 . VAL A 1 465 ? 50.236  16.860  39.463 1.00 74.51  ? 1972 VAL A CG2 1 
ATOM   3427 N N   . ARG A 1 466 ? 47.826  12.752  39.703 1.00 72.50  ? 1973 ARG A N   1 
ATOM   3428 C CA  . ARG A 1 466 ? 46.903  11.701  39.232 1.00 72.42  ? 1973 ARG A CA  1 
ATOM   3429 C C   . ARG A 1 466 ? 47.578  10.437  38.672 1.00 72.39  ? 1973 ARG A C   1 
ATOM   3430 O O   . ARG A 1 466 ? 46.900  9.549   38.147 1.00 72.33  ? 1973 ARG A O   1 
ATOM   3431 C CB  . ARG A 1 466 ? 45.903  12.263  38.209 1.00 72.42  ? 1973 ARG A CB  1 
ATOM   3432 C CG  . ARG A 1 466 ? 45.224  13.563  38.618 1.00 72.47  ? 1973 ARG A CG  1 
ATOM   3433 C CD  . ARG A 1 466 ? 44.137  13.944  37.627 1.00 72.48  ? 1973 ARG A CD  1 
ATOM   3434 N NE  . ARG A 1 466 ? 43.953  15.392  37.544 1.00 72.56  ? 1973 ARG A NE  1 
ATOM   3435 C CZ  . ARG A 1 466 ? 44.373  16.153  36.535 1.00 72.62  ? 1973 ARG A CZ  1 
ATOM   3436 N NH1 . ARG A 1 466 ? 45.004  15.615  35.498 1.00 72.62  ? 1973 ARG A NH1 1 
ATOM   3437 N NH2 . ARG A 1 466 ? 44.155  17.461  36.561 1.00 72.69  ? 1973 ARG A NH2 1 
ATOM   3438 N N   . GLY A 1 467 ? 48.903  10.360  38.796 1.00 74.64  ? 1974 GLY A N   1 
ATOM   3439 C CA  . GLY A 1 467 ? 49.691  9.290   38.179 1.00 74.65  ? 1974 GLY A CA  1 
ATOM   3440 C C   . GLY A 1 467 ? 49.797  9.464   36.673 1.00 74.69  ? 1974 GLY A C   1 
ATOM   3441 O O   . GLY A 1 467 ? 50.223  8.556   35.957 1.00 74.72  ? 1974 GLY A O   1 
ATOM   3442 N N   . CYS A 1 468 ? 49.404  10.647  36.207 1.00 80.19  ? 1975 CYS A N   1 
ATOM   3443 C CA  . CYS A 1 468 ? 49.368  10.991  34.791 1.00 80.25  ? 1975 CYS A CA  1 
ATOM   3444 C C   . CYS A 1 468 ? 50.540  11.918  34.452 1.00 80.37  ? 1975 CYS A C   1 
ATOM   3445 O O   . CYS A 1 468 ? 50.855  12.141  33.279 1.00 80.46  ? 1975 CYS A O   1 
ATOM   3446 C CB  . CYS A 1 468 ? 48.027  11.664  34.476 1.00 80.23  ? 1975 CYS A CB  1 
ATOM   3447 S SG  . CYS A 1 468 ? 47.648  11.959  32.734 1.00 80.31  ? 1975 CYS A SG  1 
ATOM   3448 N N   . ASP A 1 469 ? 51.180  12.438  35.498 1.00 81.29  ? 1976 ASP A N   1 
ATOM   3449 C CA  . ASP A 1 469 ? 52.351  13.307  35.381 1.00 81.42  ? 1976 ASP A CA  1 
ATOM   3450 C C   . ASP A 1 469 ? 53.185  13.259  36.662 1.00 81.44  ? 1976 ASP A C   1 
ATOM   3451 O O   . ASP A 1 469 ? 52.644  13.361  37.768 1.00 81.38  ? 1976 ASP A O   1 
ATOM   3452 C CB  . ASP A 1 469 ? 51.927  14.752  35.082 1.00 81.45  ? 1976 ASP A CB  1 
ATOM   3453 C CG  . ASP A 1 469 ? 53.104  15.716  35.038 1.00 81.58  ? 1976 ASP A CG  1 
ATOM   3454 O OD1 . ASP A 1 469 ? 53.969  15.569  34.149 1.00 81.68  ? 1976 ASP A OD1 1 
ATOM   3455 O OD2 . ASP A 1 469 ? 53.156  16.629  35.889 1.00 81.59  ? 1976 ASP A OD2 1 
ATOM   3456 N N   . VAL A 1 470 ? 54.497  13.093  36.507 1.00 86.47  ? 1977 VAL A N   1 
ATOM   3457 C CA  . VAL A 1 470 ? 55.424  13.128  37.640 1.00 86.54  ? 1977 VAL A CA  1 
ATOM   3458 C C   . VAL A 1 470 ? 56.585  14.076  37.345 1.00 86.69  ? 1977 VAL A C   1 
ATOM   3459 O O   . VAL A 1 470 ? 57.259  13.945  36.323 1.00 86.79  ? 1977 VAL A O   1 
ATOM   3460 C CB  . VAL A 1 470 ? 55.973  11.719  38.008 1.00 86.55  ? 1977 VAL A CB  1 
ATOM   3461 C CG1 . VAL A 1 470 ? 56.812  11.784  39.277 1.00 86.64  ? 1977 VAL A CG1 1 
ATOM   3462 C CG2 . VAL A 1 470 ? 54.841  10.729  38.202 1.00 86.41  ? 1977 VAL A CG2 1 
ATOM   3463 N N   . THR A 1 471 ? 56.803  15.032  38.244 1.00 87.10  ? 1978 THR A N   1 
ATOM   3464 C CA  . THR A 1 471 ? 57.910  15.978  38.120 1.00 87.26  ? 1978 THR A CA  1 
ATOM   3465 C C   . THR A 1 471 ? 58.953  15.716  39.206 1.00 87.37  ? 1978 THR A C   1 
ATOM   3466 O O   . THR A 1 471 ? 58.621  15.641  40.391 1.00 87.33  ? 1978 THR A O   1 
ATOM   3467 C CB  . THR A 1 471 ? 57.420  17.444  38.187 1.00 87.25  ? 1978 THR A CB  1 
ATOM   3468 O OG1 . THR A 1 471 ? 56.311  17.621  37.297 1.00 87.14  ? 1978 THR A OG1 1 
ATOM   3469 C CG2 . THR A 1 471 ? 58.532  18.411  37.796 1.00 87.41  ? 1978 THR A CG2 1 
ATOM   3470 N N   . PHE A 1 472 ? 60.209  15.565  38.787 1.00 90.09  ? 1979 PHE A N   1 
ATOM   3471 C CA  . PHE A 1 472 ? 61.321  15.328  39.707 1.00 90.23  ? 1979 PHE A CA  1 
ATOM   3472 C C   . PHE A 1 472 ? 62.208  16.561  39.849 1.00 90.40  ? 1979 PHE A C   1 
ATOM   3473 O O   . PHE A 1 472 ? 62.435  17.286  38.877 1.00 90.46  ? 1979 PHE A O   1 
ATOM   3474 C CB  . PHE A 1 472 ? 62.175  14.149  39.231 1.00 90.33  ? 1979 PHE A CB  1 
ATOM   3475 C CG  . PHE A 1 472 ? 61.479  12.819  39.300 1.00 90.20  ? 1979 PHE A CG  1 
ATOM   3476 C CD1 . PHE A 1 472 ? 60.864  12.283  38.172 1.00 90.11  ? 1979 PHE A CD1 1 
ATOM   3477 C CD2 . PHE A 1 472 ? 61.452  12.092  40.488 1.00 90.18  ? 1979 PHE A CD2 1 
ATOM   3478 C CE1 . PHE A 1 472 ? 60.226  11.047  38.226 1.00 89.98  ? 1979 PHE A CE1 1 
ATOM   3479 C CE2 . PHE A 1 472 ? 60.815  10.855  40.553 1.00 90.06  ? 1979 PHE A CE2 1 
ATOM   3480 C CZ  . PHE A 1 472 ? 60.200  10.332  39.420 1.00 89.95  ? 1979 PHE A CZ  1 
ATOM   3481 N N   . GLU A 1 473 ? 62.708  16.792  41.061 1.00 90.16  ? 1980 GLU A N   1 
ATOM   3482 C CA  . GLU A 1 473 ? 63.679  17.856  41.298 1.00 90.35  ? 1980 GLU A CA  1 
ATOM   3483 C C   . GLU A 1 473 ? 65.060  17.262  41.561 1.00 90.57  ? 1980 GLU A C   1 
ATOM   3484 O O   . GLU A 1 473 ? 65.270  16.556  42.550 1.00 90.61  ? 1980 GLU A O   1 
ATOM   3485 C CB  . GLU A 1 473 ? 63.243  18.768  42.447 1.00 90.34  ? 1980 GLU A CB  1 
ATOM   3486 C CG  . GLU A 1 473 ? 63.948  20.119  42.451 1.00 90.50  ? 1980 GLU A CG  1 
ATOM   3487 C CD  . GLU A 1 473 ? 63.443  21.051  43.535 1.00 90.48  ? 1980 GLU A CD  1 
ATOM   3488 O OE1 . GLU A 1 473 ? 63.629  20.742  44.732 1.00 90.55  ? 1980 GLU A OE1 1 
ATOM   3489 O OE2 . GLU A 1 473 ? 62.870  22.105  43.187 1.00 90.43  ? 1980 GLU A OE2 1 
ATOM   3490 N N   . TRP A 1 474 ? 65.989  17.549  40.655 1.00 88.24  ? 1981 TRP A N   1 
ATOM   3491 C CA  . TRP A 1 474 ? 67.344  17.022  40.721 1.00 88.48  ? 1981 TRP A CA  1 
ATOM   3492 C C   . TRP A 1 474 ? 68.320  18.165  40.972 1.00 88.70  ? 1981 TRP A C   1 
ATOM   3493 O O   . TRP A 1 474 ? 68.457  19.068  40.141 1.00 88.74  ? 1981 TRP A O   1 
ATOM   3494 C CB  . TRP A 1 474 ? 67.691  16.307  39.410 1.00 88.52  ? 1981 TRP A CB  1 
ATOM   3495 C CG  . TRP A 1 474 ? 68.932  15.450  39.453 1.00 88.77  ? 1981 TRP A CG  1 
ATOM   3496 C CD1 . TRP A 1 474 ? 70.095  15.715  40.120 1.00 89.02  ? 1981 TRP A CD1 1 
ATOM   3497 C CD2 . TRP A 1 474 ? 69.140  14.206  38.769 1.00 88.80  ? 1981 TRP A CD2 1 
ATOM   3498 N NE1 . TRP A 1 474 ? 71.004  14.707  39.913 1.00 89.22  ? 1981 TRP A NE1 1 
ATOM   3499 C CE2 . TRP A 1 474 ? 70.446  13.769  39.085 1.00 89.09  ? 1981 TRP A CE2 1 
ATOM   3500 C CE3 . TRP A 1 474 ? 68.350  13.416  37.924 1.00 88.64  ? 1981 TRP A CE3 1 
ATOM   3501 C CZ2 . TRP A 1 474 ? 70.978  12.574  38.590 1.00 89.21  ? 1981 TRP A CZ2 1 
ATOM   3502 C CZ3 . TRP A 1 474 ? 68.879  12.226  37.436 1.00 88.76  ? 1981 TRP A CZ3 1 
ATOM   3503 C CH2 . TRP A 1 474 ? 70.182  11.821  37.767 1.00 89.04  ? 1981 TRP A CH2 1 
ATOM   3504 N N   . LYS A 1 475 ? 68.991  18.121  42.120 1.00 88.60  ? 1982 LYS A N   1 
ATOM   3505 C CA  . LYS A 1 475 ? 69.995  19.124  42.472 1.00 88.83  ? 1982 LYS A CA  1 
ATOM   3506 C C   . LYS A 1 475 ? 71.411  18.644  42.147 1.00 89.12  ? 1982 LYS A C   1 
ATOM   3507 O O   . LYS A 1 475 ? 71.919  17.706  42.768 1.00 89.23  ? 1982 LYS A O   1 
ATOM   3508 C CB  . LYS A 1 475 ? 69.881  19.518  43.947 1.00 88.87  ? 1982 LYS A CB  1 
ATOM   3509 C CG  . LYS A 1 475 ? 68.723  20.451  44.257 1.00 88.67  ? 1982 LYS A CG  1 
ATOM   3510 C CD  . LYS A 1 475 ? 68.749  20.881  45.713 1.00 88.74  ? 1982 LYS A CD  1 
ATOM   3511 C CE  . LYS A 1 475 ? 67.630  21.860  46.025 1.00 88.56  ? 1982 LYS A CE  1 
ATOM   3512 N NZ  . LYS A 1 475 ? 67.661  22.301  47.447 1.00 88.64  ? 1982 LYS A NZ  1 
ATOM   3513 N N   . THR A 1 476 ? 72.033  19.294  41.166 1.00 85.85  ? 1983 THR A N   1 
ATOM   3514 C CA  . THR A 1 476 ? 73.385  18.948  40.717 1.00 86.15  ? 1983 THR A CA  1 
ATOM   3515 C C   . THR A 1 476 ? 74.301  20.164  40.594 1.00 86.39  ? 1983 THR A C   1 
ATOM   3516 O O   . THR A 1 476 ? 73.842  21.308  40.603 1.00 86.29  ? 1983 THR A O   1 
ATOM   3517 C CB  . THR A 1 476 ? 73.373  18.198  39.361 1.00 86.14  ? 1983 THR A CB  1 
ATOM   3518 O OG1 . THR A 1 476 ? 72.131  18.431  38.684 1.00 85.85  ? 1983 THR A OG1 1 
ATOM   3519 C CG2 . THR A 1 476 ? 73.558  16.709  39.574 1.00 86.18  ? 1983 THR A CG2 1 
ATOM   3520 N N   . LYS A 1 477 ? 75.600  19.896  40.481 1.00 87.60  ? 1984 LYS A N   1 
ATOM   3521 C CA  . LYS A 1 477 ? 76.605  20.933  40.269 1.00 87.87  ? 1984 LYS A CA  1 
ATOM   3522 C C   . LYS A 1 477 ? 76.624  21.374  38.807 1.00 87.88  ? 1984 LYS A C   1 
ATOM   3523 O O   . LYS A 1 477 ? 76.964  22.518  38.501 1.00 87.99  ? 1984 LYS A O   1 
ATOM   3524 C CB  . LYS A 1 477 ? 77.988  20.414  40.677 1.00 88.23  ? 1984 LYS A CB  1 
ATOM   3525 C CG  . LYS A 1 477 ? 79.045  21.491  40.885 1.00 88.54  ? 1984 LYS A CG  1 
ATOM   3526 C CD  . LYS A 1 477 ? 80.366  20.881  41.321 1.00 88.92  ? 1984 LYS A CD  1 
ATOM   3527 C CE  . LYS A 1 477 ? 81.387  21.955  41.645 1.00 89.24  ? 1984 LYS A CE  1 
ATOM   3528 N NZ  . LYS A 1 477 ? 82.613  21.373  42.253 1.00 89.62  ? 1984 LYS A NZ  1 
ATOM   3529 N N   . VAL A 1 478 ? 76.245  20.455  37.919 1.00 86.92  ? 1985 VAL A N   1 
ATOM   3530 C CA  . VAL A 1 478 ? 76.321  20.646  36.466 1.00 86.98  ? 1985 VAL A CA  1 
ATOM   3531 C C   . VAL A 1 478 ? 75.557  21.878  35.967 1.00 86.82  ? 1985 VAL A C   1 
ATOM   3532 O O   . VAL A 1 478 ? 76.063  22.635  35.135 1.00 86.98  ? 1985 VAL A O   1 
ATOM   3533 C CB  . VAL A 1 478 ? 75.837  19.379  35.708 1.00 86.88  ? 1985 VAL A CB  1 
ATOM   3534 C CG1 . VAL A 1 478 ? 75.866  19.595  34.203 1.00 87.01  ? 1985 VAL A CG1 1 
ATOM   3535 C CG2 . VAL A 1 478 ? 76.690  18.178  36.083 1.00 87.07  ? 1985 VAL A CG2 1 
ATOM   3536 N N   . VAL A 1 479 ? 74.349  22.075  36.486 1.00 94.25  ? 1986 VAL A N   1 
ATOM   3537 C CA  . VAL A 1 479 ? 73.479  23.161  36.033 1.00 94.07  ? 1986 VAL A CA  1 
ATOM   3538 C C   . VAL A 1 479 ? 73.713  24.472  36.795 1.00 94.13  ? 1986 VAL A C   1 
ATOM   3539 O O   . VAL A 1 479 ? 72.778  25.071  37.333 1.00 93.92  ? 1986 VAL A O   1 
ATOM   3540 C CB  . VAL A 1 479 ? 71.984  22.745  36.064 1.00 93.72  ? 1986 VAL A CB  1 
ATOM   3541 C CG1 . VAL A 1 479 ? 71.663  21.851  34.875 1.00 93.68  ? 1986 VAL A CG1 1 
ATOM   3542 C CG2 . VAL A 1 479 ? 71.628  22.053  37.384 1.00 93.60  ? 1986 VAL A CG2 1 
ATOM   3543 N N   . CYS A 1 480 ? 74.967  24.918  36.820 1.00 99.82  ? 1987 CYS A N   1 
ATOM   3544 C CA  . CYS A 1 480 ? 75.350  26.105  37.588 1.00 99.92  ? 1987 CYS A CA  1 
ATOM   3545 C C   . CYS A 1 480 ? 76.272  27.103  36.864 1.00 100.19 ? 1987 CYS A C   1 
ATOM   3546 O O   . CYS A 1 480 ? 75.847  28.228  36.602 1.00 100.12 ? 1987 CYS A O   1 
ATOM   3547 C CB  . CYS A 1 480 ? 75.966  25.705  38.939 1.00 100.05 ? 1987 CYS A CB  1 
ATOM   3548 S SG  . CYS A 1 480 ? 74.894  24.724  40.015 1.00 99.78  ? 1987 CYS A SG  1 
ATOM   3549 N N   . PRO A 1 481 ? 77.508  26.681  36.501 1.00 103.49 ? 1988 PRO A N   1 
ATOM   3550 C CA  . PRO A 1 481 ? 78.687  27.561  36.360 1.00 103.83 ? 1988 PRO A CA  1 
ATOM   3551 C C   . PRO A 1 481 ? 78.580  28.798  35.450 1.00 103.86 ? 1988 PRO A C   1 
ATOM   3552 O O   . PRO A 1 481 ? 78.713  28.675  34.228 1.00 103.95 ? 1988 PRO A O   1 
ATOM   3553 C CB  . PRO A 1 481 ? 79.772  26.612  35.830 1.00 104.12 ? 1988 PRO A CB  1 
ATOM   3554 C CG  . PRO A 1 481 ? 79.334  25.265  36.250 1.00 103.96 ? 1988 PRO A CG  1 
ATOM   3555 C CD  . PRO A 1 481 ? 77.846  25.292  36.135 1.00 103.56 ? 1988 PRO A CD  1 
ATOM   3556 N N   . PRO A 1 482 ? 78.332  29.985  36.047 1.00 125.73 ? 1989 PRO A N   1 
ATOM   3557 C CA  . PRO A 1 482 ? 78.542  31.272  35.399 1.00 125.85 ? 1989 PRO A CA  1 
ATOM   3558 C C   . PRO A 1 482 ? 79.790  31.980  35.953 1.00 126.18 ? 1989 PRO A C   1 
ATOM   3559 O O   . PRO A 1 482 ? 80.010  33.162  35.675 1.00 126.29 ? 1989 PRO A O   1 
ATOM   3560 C CB  . PRO A 1 482 ? 77.290  32.048  35.814 1.00 125.54 ? 1989 PRO A CB  1 
ATOM   3561 C CG  . PRO A 1 482 ? 76.892  31.434  37.180 1.00 125.37 ? 1989 PRO A CG  1 
ATOM   3562 C CD  . PRO A 1 482 ? 77.738  30.186  37.381 1.00 125.54 ? 1989 PRO A CD  1 
ATOM   3563 N N   . LYS A 1 483 ? 80.588  31.242  36.726 1.00 129.87 ? 1990 LYS A N   1 
ATOM   3564 C CA  . LYS A 1 483 ? 81.712  31.782  37.495 1.00 130.17 ? 1990 LYS A CA  1 
ATOM   3565 C C   . LYS A 1 483 ? 82.791  32.414  36.613 1.00 130.52 ? 1990 LYS A C   1 
ATOM   3566 O O   . LYS A 1 483 ? 83.191  31.847  35.597 1.00 130.64 ? 1990 LYS A O   1 
ATOM   3567 C CB  . LYS A 1 483 ? 82.318  30.676  38.369 1.00 130.31 ? 1990 LYS A CB  1 
ATOM   3568 C CG  . LYS A 1 483 ? 83.251  31.160  39.472 1.00 130.59 ? 1990 LYS A CG  1 
ATOM   3569 C CD  . LYS A 1 483 ? 83.836  29.983  40.245 1.00 130.77 ? 1990 LYS A CD  1 
ATOM   3570 C CE  . LYS A 1 483 ? 84.768  30.444  41.358 1.00 131.08 ? 1990 LYS A CE  1 
ATOM   3571 N NZ  . LYS A 1 483 ? 84.038  31.094  42.485 1.00 130.89 ? 1990 LYS A NZ  1 
ATOM   3572 N N   . CYS B 1 9   ? 21.157  -80.162 27.663 1.00 99.61  ? 1516 CYS B N   1 
ATOM   3573 C CA  . CYS B 1 9   ? 21.485  -78.708 27.729 1.00 99.46  ? 1516 CYS B CA  1 
ATOM   3574 C C   . CYS B 1 9   ? 22.407  -78.324 26.570 1.00 99.61  ? 1516 CYS B C   1 
ATOM   3575 O O   . CYS B 1 9   ? 23.620  -78.173 26.745 1.00 99.57  ? 1516 CYS B O   1 
ATOM   3576 C CB  . CYS B 1 9   ? 22.121  -78.367 29.082 1.00 99.23  ? 1516 CYS B CB  1 
ATOM   3577 S SG  . CYS B 1 9   ? 22.136  -76.606 29.496 1.00 99.02  ? 1516 CYS B SG  1 
ATOM   3578 N N   . GLN B 1 10  ? 21.812  -78.173 25.386 1.00 97.57  ? 1517 GLN B N   1 
ATOM   3579 C CA  . GLN B 1 10  ? 22.560  -77.921 24.148 1.00 97.77  ? 1517 GLN B CA  1 
ATOM   3580 C C   . GLN B 1 10  ? 21.740  -77.184 23.084 1.00 97.91  ? 1517 GLN B C   1 
ATOM   3581 O O   . GLN B 1 10  ? 20.535  -77.413 22.944 1.00 97.98  ? 1517 GLN B O   1 
ATOM   3582 C CB  . GLN B 1 10  ? 23.104  -79.238 23.571 1.00 98.00  ? 1517 GLN B CB  1 
ATOM   3583 C CG  . GLN B 1 10  ? 22.055  -80.342 23.397 1.00 98.14  ? 1517 GLN B CG  1 
ATOM   3584 C CD  . GLN B 1 10  ? 22.650  -81.675 22.969 1.00 98.34  ? 1517 GLN B CD  1 
ATOM   3585 O OE1 . GLN B 1 10  ? 23.799  -81.993 23.284 1.00 98.30  ? 1517 GLN B OE1 1 
ATOM   3586 N NE2 . GLN B 1 10  ? 21.860  -82.466 22.252 1.00 98.58  ? 1517 GLN B NE2 1 
ATOM   3587 N N   . VAL B 1 11  ? 22.408  -76.298 22.346 1.00 93.62  ? 1518 VAL B N   1 
ATOM   3588 C CA  . VAL B 1 11  ? 21.821  -75.620 21.186 1.00 93.81  ? 1518 VAL B CA  1 
ATOM   3589 C C   . VAL B 1 11  ? 22.886  -75.406 20.105 1.00 94.02  ? 1518 VAL B C   1 
ATOM   3590 O O   . VAL B 1 11  ? 24.083  -75.361 20.403 1.00 93.94  ? 1518 VAL B O   1 
ATOM   3591 C CB  . VAL B 1 11  ? 21.135  -74.274 21.571 1.00 93.63  ? 1518 VAL B CB  1 
ATOM   3592 C CG1 . VAL B 1 11  ? 22.160  -73.159 21.757 1.00 93.48  ? 1518 VAL B CG1 1 
ATOM   3593 C CG2 . VAL B 1 11  ? 20.093  -73.877 20.531 1.00 93.85  ? 1518 VAL B CG2 1 
ATOM   3594 N N   . THR B 1 12  ? 22.443  -75.290 18.855 1.00 94.74  ? 1519 THR B N   1 
ATOM   3595 C CA  . THR B 1 12  ? 23.341  -75.064 17.724 1.00 94.99  ? 1519 THR B CA  1 
ATOM   3596 C C   . THR B 1 12  ? 22.900  -73.872 16.876 1.00 95.09  ? 1519 THR B C   1 
ATOM   3597 O O   . THR B 1 12  ? 21.718  -73.522 16.844 1.00 95.07  ? 1519 THR B O   1 
ATOM   3598 C CB  . THR B 1 12  ? 23.456  -76.317 16.818 1.00 95.34  ? 1519 THR B CB  1 
ATOM   3599 O OG1 . THR B 1 12  ? 22.153  -76.863 16.577 1.00 95.46  ? 1519 THR B OG1 1 
ATOM   3600 C CG2 . THR B 1 12  ? 24.332  -77.380 17.467 1.00 95.29  ? 1519 THR B CG2 1 
ATOM   3601 N N   . ASN B 1 13  ? 23.866  -73.248 16.206 1.00 92.46  ? 1520 ASN B N   1 
ATOM   3602 C CA  . ASN B 1 13  ? 23.592  -72.210 15.220 1.00 92.62  ? 1520 ASN B CA  1 
ATOM   3603 C C   . ASN B 1 13  ? 23.296  -72.874 13.875 1.00 93.06  ? 1520 ASN B C   1 
ATOM   3604 O O   . ASN B 1 13  ? 24.180  -73.505 13.293 1.00 93.29  ? 1520 ASN B O   1 
ATOM   3605 C CB  . ASN B 1 13  ? 24.784  -71.252 15.108 1.00 92.57  ? 1520 ASN B CB  1 
ATOM   3606 C CG  . ASN B 1 13  ? 24.479  -70.011 14.277 1.00 92.68  ? 1520 ASN B CG  1 
ATOM   3607 O OD1 . ASN B 1 13  ? 23.341  -69.770 13.873 1.00 92.80  ? 1520 ASN B OD1 1 
ATOM   3608 N ND2 . ASN B 1 13  ? 25.508  -69.210 14.027 1.00 92.65  ? 1520 ASN B ND2 1 
ATOM   3609 N N   . PRO B 1 14  ? 22.047  -72.745 13.383 1.00 98.17  ? 1521 PRO B N   1 
ATOM   3610 C CA  . PRO B 1 14  ? 21.606  -73.411 12.150 1.00 98.60  ? 1521 PRO B CA  1 
ATOM   3611 C C   . PRO B 1 14  ? 22.440  -73.072 10.911 1.00 98.93  ? 1521 PRO B C   1 
ATOM   3612 O O   . PRO B 1 14  ? 22.488  -73.865 9.967  1.00 99.31  ? 1521 PRO B O   1 
ATOM   3613 C CB  . PRO B 1 14  ? 20.171  -72.903 11.971 1.00 98.63  ? 1521 PRO B CB  1 
ATOM   3614 C CG  . PRO B 1 14  ? 19.736  -72.510 13.336 1.00 98.21  ? 1521 PRO B CG  1 
ATOM   3615 C CD  . PRO B 1 14  ? 20.960  -71.953 13.987 1.00 97.95  ? 1521 PRO B CD  1 
ATOM   3616 N N   . SER B 1 15  ? 23.090  -71.910 10.924 1.00 99.69  ? 1522 SER B N   1 
ATOM   3617 C CA  . SER B 1 15  ? 23.881  -71.439 9.785  1.00 100.00 ? 1522 SER B CA  1 
ATOM   3618 C C   . SER B 1 15  ? 25.279  -72.063 9.709  1.00 100.09 ? 1522 SER B C   1 
ATOM   3619 O O   . SER B 1 15  ? 25.817  -72.246 8.615  1.00 100.47 ? 1522 SER B O   1 
ATOM   3620 C CB  . SER B 1 15  ? 23.982  -69.910 9.796  1.00 99.85  ? 1522 SER B CB  1 
ATOM   3621 O OG  . SER B 1 15  ? 24.556  -69.441 11.004 1.00 99.42  ? 1522 SER B OG  1 
ATOM   3622 N N   . THR B 1 16  ? 25.858  -72.385 10.864 1.00 101.90 ? 1523 THR B N   1 
ATOM   3623 C CA  . THR B 1 16  ? 27.225  -72.916 10.925 1.00 101.98 ? 1523 THR B CA  1 
ATOM   3624 C C   . THR B 1 16  ? 27.300  -74.356 11.439 1.00 101.96 ? 1523 THR B C   1 
ATOM   3625 O O   . THR B 1 16  ? 28.130  -75.142 10.976 1.00 102.22 ? 1523 THR B O   1 
ATOM   3626 C CB  . THR B 1 16  ? 28.153  -72.017 11.778 1.00 101.66 ? 1523 THR B CB  1 
ATOM   3627 O OG1 . THR B 1 16  ? 27.537  -71.747 13.044 1.00 101.24 ? 1523 THR B OG1 1 
ATOM   3628 C CG2 . THR B 1 16  ? 28.434  -70.702 11.062 1.00 101.78 ? 1523 THR B CG2 1 
ATOM   3629 N N   . GLY B 1 17  ? 26.433  -74.691 12.391 1.00 103.97 ? 1524 GLY B N   1 
ATOM   3630 C CA  . GLY B 1 17  ? 26.428  -76.014 13.014 1.00 103.92 ? 1524 GLY B CA  1 
ATOM   3631 C C   . GLY B 1 17  ? 27.325  -76.081 14.237 1.00 103.60 ? 1524 GLY B C   1 
ATOM   3632 O O   . GLY B 1 17  ? 27.716  -77.166 14.670 1.00 103.59 ? 1524 GLY B O   1 
ATOM   3633 N N   . HIS B 1 18  ? 27.646  -74.911 14.787 1.00 98.98  ? 1525 HIS B N   1 
ATOM   3634 C CA  . HIS B 1 18  ? 28.508  -74.794 15.960 1.00 98.68  ? 1525 HIS B CA  1 
ATOM   3635 C C   . HIS B 1 18  ? 27.775  -75.256 17.217 1.00 98.37  ? 1525 HIS B C   1 
ATOM   3636 O O   . HIS B 1 18  ? 26.719  -74.720 17.563 1.00 98.20  ? 1525 HIS B O   1 
ATOM   3637 C CB  . HIS B 1 18  ? 28.987  -73.347 16.117 1.00 98.51  ? 1525 HIS B CB  1 
ATOM   3638 C CG  . HIS B 1 18  ? 29.990  -73.153 17.211 1.00 98.26  ? 1525 HIS B CG  1 
ATOM   3639 N ND1 . HIS B 1 18  ? 31.346  -73.289 17.009 1.00 98.41  ? 1525 HIS B ND1 1 
ATOM   3640 C CD2 . HIS B 1 18  ? 29.836  -72.820 18.515 1.00 97.90  ? 1525 HIS B CD2 1 
ATOM   3641 C CE1 . HIS B 1 18  ? 31.984  -73.054 18.142 1.00 98.14  ? 1525 HIS B CE1 1 
ATOM   3642 N NE2 . HIS B 1 18  ? 31.090  -72.767 19.071 1.00 97.83  ? 1525 HIS B NE2 1 
ATOM   3643 N N   . LEU B 1 19  ? 28.341  -76.255 17.890 1.00 99.57  ? 1526 LEU B N   1 
ATOM   3644 C CA  . LEU B 1 19  ? 27.739  -76.818 19.095 1.00 99.31  ? 1526 LEU B CA  1 
ATOM   3645 C C   . LEU B 1 19  ? 28.170  -76.039 20.333 1.00 98.96  ? 1526 LEU B C   1 
ATOM   3646 O O   . LEU B 1 19  ? 29.363  -75.829 20.562 1.00 98.95  ? 1526 LEU B O   1 
ATOM   3647 C CB  . LEU B 1 19  ? 28.101  -78.303 19.235 1.00 99.45  ? 1526 LEU B CB  1 
ATOM   3648 C CG  . LEU B 1 19  ? 27.198  -79.211 20.082 1.00 99.30  ? 1526 LEU B CG  1 
ATOM   3649 C CD1 . LEU B 1 19  ? 27.208  -80.631 19.533 1.00 99.59  ? 1526 LEU B CD1 1 
ATOM   3650 C CD2 . LEU B 1 19  ? 27.580  -79.203 21.560 1.00 99.01  ? 1526 LEU B CD2 1 
ATOM   3651 N N   . PHE B 1 20  ? 27.186  -75.607 21.118 1.00 93.98  ? 1527 PHE B N   1 
ATOM   3652 C CA  . PHE B 1 20  ? 27.439  -74.949 22.396 1.00 93.66  ? 1527 PHE B CA  1 
ATOM   3653 C C   . PHE B 1 20  ? 27.182  -75.917 23.542 1.00 93.51  ? 1527 PHE B C   1 
ATOM   3654 O O   . PHE B 1 20  ? 26.227  -76.696 23.505 1.00 93.56  ? 1527 PHE B O   1 
ATOM   3655 C CB  . PHE B 1 20  ? 26.566  -73.702 22.552 1.00 93.49  ? 1527 PHE B CB  1 
ATOM   3656 C CG  . PHE B 1 20  ? 27.020  -72.535 21.722 1.00 93.55  ? 1527 PHE B CG  1 
ATOM   3657 C CD1 . PHE B 1 20  ? 27.982  -71.654 22.206 1.00 93.40  ? 1527 PHE B CD1 1 
ATOM   3658 C CD2 . PHE B 1 20  ? 26.483  -72.312 20.458 1.00 93.79  ? 1527 PHE B CD2 1 
ATOM   3659 C CE1 . PHE B 1 20  ? 28.406  -70.571 21.442 1.00 93.46  ? 1527 PHE B CE1 1 
ATOM   3660 C CE2 . PHE B 1 20  ? 26.900  -71.230 19.685 1.00 93.86  ? 1527 PHE B CE2 1 
ATOM   3661 C CZ  . PHE B 1 20  ? 27.863  -70.358 20.179 1.00 93.70  ? 1527 PHE B CZ  1 
ATOM   3662 N N   . ASP B 1 21  ? 28.041  -75.863 24.555 1.00 97.13  ? 1528 ASP B N   1 
ATOM   3663 C CA  . ASP B 1 21  ? 27.920  -76.746 25.708 1.00 97.01  ? 1528 ASP B CA  1 
ATOM   3664 C C   . ASP B 1 21  ? 27.970  -75.962 27.017 1.00 96.72  ? 1528 ASP B C   1 
ATOM   3665 O O   . ASP B 1 21  ? 28.999  -75.380 27.372 1.00 96.65  ? 1528 ASP B O   1 
ATOM   3666 C CB  . ASP B 1 21  ? 29.005  -77.829 25.673 1.00 97.18  ? 1528 ASP B CB  1 
ATOM   3667 C CG  . ASP B 1 21  ? 28.682  -79.015 26.568 1.00 97.14  ? 1528 ASP B CG  1 
ATOM   3668 O OD1 . ASP B 1 21  ? 27.485  -79.314 26.777 1.00 97.13  ? 1528 ASP B OD1 1 
ATOM   3669 O OD2 . ASP B 1 21  ? 29.633  -79.659 27.058 1.00 97.14  ? 1528 ASP B OD2 1 
ATOM   3670 N N   . LEU B 1 22  ? 26.840  -75.944 27.720 1.00 94.72  ? 1529 LEU B N   1 
ATOM   3671 C CA  . LEU B 1 22  ? 26.726  -75.253 29.002 1.00 94.46  ? 1529 LEU B CA  1 
ATOM   3672 C C   . LEU B 1 22  ? 26.662  -76.253 30.160 1.00 94.40  ? 1529 LEU B C   1 
ATOM   3673 O O   . LEU B 1 22  ? 26.099  -75.961 31.219 1.00 94.22  ? 1529 LEU B O   1 
ATOM   3674 C CB  . LEU B 1 22  ? 25.497  -74.335 29.007 1.00 94.35  ? 1529 LEU B CB  1 
ATOM   3675 C CG  . LEU B 1 22  ? 25.460  -73.178 28.001 1.00 94.39  ? 1529 LEU B CG  1 
ATOM   3676 C CD1 . LEU B 1 22  ? 24.043  -72.665 27.837 1.00 94.36  ? 1529 LEU B CD1 1 
ATOM   3677 C CD2 . LEU B 1 22  ? 26.395  -72.047 28.407 1.00 94.24  ? 1529 LEU B CD2 1 
ATOM   3678 N N   . SER B 1 23  ? 27.257  -77.427 29.946 1.00 102.44 ? 1530 SER B N   1 
ATOM   3679 C CA  . SER B 1 23  ? 27.250  -78.513 30.930 1.00 102.43 ? 1530 SER B CA  1 
ATOM   3680 C C   . SER B 1 23  ? 28.196  -78.269 32.110 1.00 102.30 ? 1530 SER B C   1 
ATOM   3681 O O   . SER B 1 23  ? 28.149  -78.993 33.109 1.00 102.27 ? 1530 SER B O   1 
ATOM   3682 C CB  . SER B 1 23  ? 27.572  -79.850 30.254 1.00 102.66 ? 1530 SER B CB  1 
ATOM   3683 O OG  . SER B 1 23  ? 28.875  -79.841 29.697 1.00 102.79 ? 1530 SER B OG  1 
ATOM   3684 N N   . SER B 1 24  ? 29.049  -77.253 31.988 1.00 103.88 ? 1531 SER B N   1 
ATOM   3685 C CA  . SER B 1 24  ? 29.921  -76.825 33.083 1.00 103.76 ? 1531 SER B CA  1 
ATOM   3686 C C   . SER B 1 24  ? 29.194  -75.865 34.031 1.00 103.54 ? 1531 SER B C   1 
ATOM   3687 O O   . SER B 1 24  ? 29.786  -75.354 34.985 1.00 103.43 ? 1531 SER B O   1 
ATOM   3688 C CB  . SER B 1 24  ? 31.201  -76.183 32.537 1.00 103.83 ? 1531 SER B CB  1 
ATOM   3689 O OG  . SER B 1 24  ? 30.912  -75.030 31.765 1.00 103.77 ? 1531 SER B OG  1 
ATOM   3690 N N   . LEU B 1 25  ? 27.910  -75.632 33.757 1.00 100.34 ? 1532 LEU B N   1 
ATOM   3691 C CA  . LEU B 1 25  ? 27.060  -74.779 34.590 1.00 100.16 ? 1532 LEU B CA  1 
ATOM   3692 C C   . LEU B 1 25  ? 25.784  -75.509 35.025 1.00 100.16 ? 1532 LEU B C   1 
ATOM   3693 O O   . LEU B 1 25  ? 24.781  -74.873 35.360 1.00 100.07 ? 1532 LEU B O   1 
ATOM   3694 C CB  . LEU B 1 25  ? 26.694  -73.487 33.843 1.00 100.11 ? 1532 LEU B CB  1 
ATOM   3695 C CG  . LEU B 1 25  ? 27.783  -72.567 33.279 1.00 100.10 ? 1532 LEU B CG  1 
ATOM   3696 C CD1 . LEU B 1 25  ? 27.148  -71.469 32.444 1.00 100.07 ? 1532 LEU B CD1 1 
ATOM   3697 C CD2 . LEU B 1 25  ? 28.655  -71.967 34.376 1.00 99.98  ? 1532 LEU B CD2 1 
ATOM   3698 N N   . SER B 1 26  ? 25.832  -76.840 35.029 1.00 103.82 ? 1533 SER B N   1 
ATOM   3699 C CA  . SER B 1 26  ? 24.655  -77.664 35.326 1.00 103.85 ? 1533 SER B CA  1 
ATOM   3700 C C   . SER B 1 26  ? 24.522  -78.048 36.805 1.00 103.78 ? 1533 SER B C   1 
ATOM   3701 O O   . SER B 1 26  ? 23.776  -78.970 37.151 1.00 103.82 ? 1533 SER B O   1 
ATOM   3702 C CB  . SER B 1 26  ? 24.640  -78.916 34.438 1.00 104.04 ? 1533 SER B CB  1 
ATOM   3703 O OG  . SER B 1 26  ? 25.823  -79.678 34.600 1.00 104.11 ? 1533 SER B OG  1 
ATOM   3704 N N   . GLY B 1 27  ? 25.236  -77.326 37.669 1.00 110.73 ? 1534 GLY B N   1 
ATOM   3705 C CA  . GLY B 1 27  ? 25.214  -77.572 39.110 1.00 110.68 ? 1534 GLY B CA  1 
ATOM   3706 C C   . GLY B 1 27  ? 23.862  -77.323 39.752 1.00 110.62 ? 1534 GLY B C   1 
ATOM   3707 O O   . GLY B 1 27  ? 23.279  -76.245 39.600 1.00 110.53 ? 1534 GLY B O   1 
ATOM   3708 N N   . ARG B 1 28  ? 23.367  -78.331 40.467 1.00 111.37 ? 1535 ARG B N   1 
ATOM   3709 C CA  . ARG B 1 28  ? 22.098  -78.243 41.188 1.00 111.35 ? 1535 ARG B CA  1 
ATOM   3710 C C   . ARG B 1 28  ? 22.187  -77.231 42.331 1.00 111.25 ? 1535 ARG B C   1 
ATOM   3711 O O   . ARG B 1 28  ? 21.198  -76.572 42.663 1.00 111.21 ? 1535 ARG B O   1 
ATOM   3712 C CB  . ARG B 1 28  ? 21.685  -79.620 41.721 1.00 111.46 ? 1535 ARG B CB  1 
ATOM   3713 C CG  . ARG B 1 28  ? 20.260  -79.685 42.257 1.00 111.48 ? 1535 ARG B CG  1 
ATOM   3714 C CD  . ARG B 1 28  ? 19.940  -81.052 42.835 1.00 111.60 ? 1535 ARG B CD  1 
ATOM   3715 N NE  . ARG B 1 28  ? 18.633  -81.067 43.492 1.00 111.64 ? 1535 ARG B NE  1 
ATOM   3716 C CZ  . ARG B 1 28  ? 18.441  -80.915 44.800 1.00 111.64 ? 1535 ARG B CZ  1 
ATOM   3717 N NH1 . ARG B 1 28  ? 19.471  -80.740 45.619 1.00 111.61 ? 1535 ARG B NH1 1 
ATOM   3718 N NH2 . ARG B 1 28  ? 17.211  -80.943 45.295 1.00 111.70 ? 1535 ARG B NH2 1 
ATOM   3719 N N   . ALA B 1 29  ? 23.378  -77.114 42.919 1.00 115.29 ? 1536 ALA B N   1 
ATOM   3720 C CA  . ALA B 1 29  ? 23.664  -76.104 43.937 1.00 115.20 ? 1536 ALA B CA  1 
ATOM   3721 C C   . ALA B 1 29  ? 23.400  -74.701 43.400 1.00 115.10 ? 1536 ALA B C   1 
ATOM   3722 O O   . ALA B 1 29  ? 23.040  -73.794 44.154 1.00 115.03 ? 1536 ALA B O   1 
ATOM   3723 C CB  . ALA B 1 29  ? 25.098  -76.229 44.423 1.00 115.22 ? 1536 ALA B CB  1 
ATOM   3724 N N   . GLY B 1 30  ? 23.587  -74.542 42.092 1.00 105.46 ? 1537 GLY B N   1 
ATOM   3725 C CA  . GLY B 1 30  ? 23.247  -73.315 41.388 1.00 105.38 ? 1537 GLY B CA  1 
ATOM   3726 C C   . GLY B 1 30  ? 24.135  -72.134 41.710 1.00 105.28 ? 1537 GLY B C   1 
ATOM   3727 O O   . GLY B 1 30  ? 25.232  -72.291 42.249 1.00 105.28 ? 1537 GLY B O   1 
ATOM   3728 N N   . PHE B 1 31  ? 23.645  -70.946 41.373 1.00 103.42 ? 1538 PHE B N   1 
ATOM   3729 C CA  . PHE B 1 31  ? 24.394  -69.709 41.546 1.00 103.33 ? 1538 PHE B CA  1 
ATOM   3730 C C   . PHE B 1 31  ? 23.505  -68.648 42.182 1.00 103.26 ? 1538 PHE B C   1 
ATOM   3731 O O   . PHE B 1 31  ? 22.278  -68.745 42.130 1.00 103.29 ? 1538 PHE B O   1 
ATOM   3732 C CB  . PHE B 1 31  ? 24.933  -69.221 40.196 1.00 103.32 ? 1538 PHE B CB  1 
ATOM   3733 C CG  . PHE B 1 31  ? 25.687  -70.272 39.425 1.00 103.42 ? 1538 PHE B CG  1 
ATOM   3734 C CD1 . PHE B 1 31  ? 25.030  -71.083 38.502 1.00 103.52 ? 1538 PHE B CD1 1 
ATOM   3735 C CD2 . PHE B 1 31  ? 27.051  -70.458 39.626 1.00 103.44 ? 1538 PHE B CD2 1 
ATOM   3736 C CE1 . PHE B 1 31  ? 25.720  -72.062 37.792 1.00 103.63 ? 1538 PHE B CE1 1 
ATOM   3737 C CE2 . PHE B 1 31  ? 27.751  -71.434 38.918 1.00 103.56 ? 1538 PHE B CE2 1 
ATOM   3738 C CZ  . PHE B 1 31  ? 27.083  -72.236 37.999 1.00 103.65 ? 1538 PHE B CZ  1 
ATOM   3739 N N   . THR B 1 32  ? 24.128  -67.641 42.785 1.00 102.02 ? 1539 THR B N   1 
ATOM   3740 C CA  . THR B 1 32  ? 23.390  -66.557 43.423 1.00 101.96 ? 1539 THR B CA  1 
ATOM   3741 C C   . THR B 1 32  ? 23.490  -65.265 42.615 1.00 101.88 ? 1539 THR B C   1 
ATOM   3742 O O   . THR B 1 32  ? 24.564  -64.670 42.495 1.00 101.82 ? 1539 THR B O   1 
ATOM   3743 C CB  . THR B 1 32  ? 23.852  -66.316 44.880 1.00 101.95 ? 1539 THR B CB  1 
ATOM   3744 O OG1 . THR B 1 32  ? 25.273  -66.143 44.914 1.00 101.91 ? 1539 THR B OG1 1 
ATOM   3745 C CG2 . THR B 1 32  ? 23.468  -67.491 45.770 1.00 102.05 ? 1539 THR B CG2 1 
ATOM   3746 N N   . ALA B 1 33  ? 22.360  -64.856 42.046 1.00 96.61  ? 1540 ALA B N   1 
ATOM   3747 C CA  . ALA B 1 33  ? 22.254  -63.579 41.352 1.00 96.55  ? 1540 ALA B CA  1 
ATOM   3748 C C   . ALA B 1 33  ? 21.786  -62.519 42.338 1.00 96.51  ? 1540 ALA B C   1 
ATOM   3749 O O   . ALA B 1 33  ? 20.875  -62.758 43.134 1.00 96.56  ? 1540 ALA B O   1 
ATOM   3750 C CB  . ALA B 1 33  ? 21.293  -63.687 40.185 1.00 96.62  ? 1540 ALA B CB  1 
ATOM   3751 N N   . ALA B 1 34  ? 22.411  -61.349 42.282 1.00 98.48  ? 1541 ALA B N   1 
ATOM   3752 C CA  . ALA B 1 34  ? 22.164  -60.305 43.269 1.00 98.44  ? 1541 ALA B CA  1 
ATOM   3753 C C   . ALA B 1 34  ? 21.185  -59.245 42.784 1.00 98.44  ? 1541 ALA B C   1 
ATOM   3754 O O   . ALA B 1 34  ? 21.411  -58.597 41.760 1.00 98.40  ? 1541 ALA B O   1 
ATOM   3755 C CB  . ALA B 1 34  ? 23.473  -59.663 43.692 1.00 98.36  ? 1541 ALA B CB  1 
ATOM   3756 N N   . TYR B 1 35  ? 20.093  -59.085 43.528 1.00 97.00  ? 1542 TYR B N   1 
ATOM   3757 C CA  . TYR B 1 35  ? 19.156  -57.989 43.308 1.00 97.02  ? 1542 TYR B CA  1 
ATOM   3758 C C   . TYR B 1 35  ? 19.151  -57.062 44.519 1.00 97.00  ? 1542 TYR B C   1 
ATOM   3759 O O   . TYR B 1 35  ? 19.517  -57.475 45.621 1.00 97.02  ? 1542 TYR B O   1 
ATOM   3760 C CB  . TYR B 1 35  ? 17.743  -58.513 43.004 1.00 97.14  ? 1542 TYR B CB  1 
ATOM   3761 C CG  . TYR B 1 35  ? 16.971  -59.072 44.188 1.00 97.24  ? 1542 TYR B CG  1 
ATOM   3762 C CD1 . TYR B 1 35  ? 16.254  -58.232 45.040 1.00 97.31  ? 1542 TYR B CD1 1 
ATOM   3763 C CD2 . TYR B 1 35  ? 16.933  -60.441 44.437 1.00 97.31  ? 1542 TYR B CD2 1 
ATOM   3764 C CE1 . TYR B 1 35  ? 15.539  -58.740 46.123 1.00 97.43  ? 1542 TYR B CE1 1 
ATOM   3765 C CE2 . TYR B 1 35  ? 16.213  -60.960 45.511 1.00 97.43  ? 1542 TYR B CE2 1 
ATOM   3766 C CZ  . TYR B 1 35  ? 15.521  -60.105 46.350 1.00 97.49  ? 1542 TYR B CZ  1 
ATOM   3767 O OH  . TYR B 1 35  ? 14.813  -60.611 47.417 1.00 97.63  ? 1542 TYR B OH  1 
ATOM   3768 N N   . SER B 1 36  ? 18.743  -55.813 44.302 1.00 100.11 ? 1543 SER B N   1 
ATOM   3769 C CA  . SER B 1 36  ? 18.601  -54.812 45.369 1.00 100.12 ? 1543 SER B CA  1 
ATOM   3770 C C   . SER B 1 36  ? 19.860  -54.620 46.227 1.00 100.05 ? 1543 SER B C   1 
ATOM   3771 O O   . SER B 1 36  ? 20.983  -54.781 45.744 1.00 99.96  ? 1543 SER B O   1 
ATOM   3772 C CB  . SER B 1 36  ? 17.391  -55.131 46.257 1.00 100.27 ? 1543 SER B CB  1 
ATOM   3773 O OG  . SER B 1 36  ? 17.673  -56.188 47.160 1.00 100.32 ? 1543 SER B OG  1 
ATOM   3774 N N   . GLU B 1 37  ? 19.653  -54.273 47.498 1.00 105.82 ? 1544 GLU B N   1 
ATOM   3775 C CA  . GLU B 1 37  ? 20.741  -53.985 48.425 1.00 105.79 ? 1544 GLU B CA  1 
ATOM   3776 C C   . GLU B 1 37  ? 21.377  -55.273 48.942 1.00 105.82 ? 1544 GLU B C   1 
ATOM   3777 O O   . GLU B 1 37  ? 22.593  -55.446 48.855 1.00 105.75 ? 1544 GLU B O   1 
ATOM   3778 C CB  . GLU B 1 37  ? 20.232  -53.127 49.588 1.00 105.88 ? 1544 GLU B CB  1 
ATOM   3779 C CG  . GLU B 1 37  ? 21.151  -51.967 49.980 1.00 105.81 ? 1544 GLU B CG  1 
ATOM   3780 C CD  . GLU B 1 37  ? 22.414  -52.403 50.713 1.00 105.79 ? 1544 GLU B CD  1 
ATOM   3781 O OE1 . GLU B 1 37  ? 22.381  -53.434 51.419 1.00 105.88 ? 1544 GLU B OE1 1 
ATOM   3782 O OE2 . GLU B 1 37  ? 23.441  -51.701 50.591 1.00 105.71 ? 1544 GLU B OE2 1 
ATOM   3783 N N   . LYS B 1 38  ? 20.551  -56.170 49.477 1.00 108.33 ? 1545 LYS B N   1 
ATOM   3784 C CA  . LYS B 1 38  ? 21.024  -57.454 49.994 1.00 108.38 ? 1545 LYS B CA  1 
ATOM   3785 C C   . LYS B 1 38  ? 20.123  -58.615 49.576 1.00 108.44 ? 1545 LYS B C   1 
ATOM   3786 O O   . LYS B 1 38  ? 20.034  -59.630 50.273 1.00 108.53 ? 1545 LYS B O   1 
ATOM   3787 C CB  . LYS B 1 38  ? 21.171  -57.407 51.520 1.00 108.50 ? 1545 LYS B CB  1 
ATOM   3788 C CG  . LYS B 1 38  ? 22.490  -56.809 52.000 1.00 108.45 ? 1545 LYS B CG  1 
ATOM   3789 C CD  . LYS B 1 38  ? 22.756  -57.104 53.473 1.00 108.60 ? 1545 LYS B CD  1 
ATOM   3790 C CE  . LYS B 1 38  ? 22.028  -56.131 54.390 1.00 108.72 ? 1545 LYS B CE  1 
ATOM   3791 N NZ  . LYS B 1 38  ? 22.426  -56.323 55.811 1.00 108.88 ? 1545 LYS B NZ  1 
ATOM   3792 N N   . GLY B 1 39  ? 19.463  -58.462 48.432 1.00 102.65 ? 1546 GLY B N   1 
ATOM   3793 C CA  . GLY B 1 39  ? 18.566  -59.489 47.916 1.00 102.73 ? 1546 GLY B CA  1 
ATOM   3794 C C   . GLY B 1 39  ? 19.288  -60.581 47.151 1.00 102.68 ? 1546 GLY B C   1 
ATOM   3795 O O   . GLY B 1 39  ? 20.325  -60.336 46.527 1.00 102.58 ? 1546 GLY B O   1 
ATOM   3796 N N   . LEU B 1 40  ? 18.732  -61.790 47.198 1.00 102.06 ? 1547 LEU B N   1 
ATOM   3797 C CA  . LEU B 1 40  ? 19.328  -62.947 46.535 1.00 102.05 ? 1547 LEU B CA  1 
ATOM   3798 C C   . LEU B 1 40  ? 18.338  -63.698 45.654 1.00 102.11 ? 1547 LEU B C   1 
ATOM   3799 O O   . LEU B 1 40  ? 17.231  -64.027 46.085 1.00 102.23 ? 1547 LEU B O   1 
ATOM   3800 C CB  . LEU B 1 40  ? 19.928  -63.907 47.567 1.00 102.10 ? 1547 LEU B CB  1 
ATOM   3801 C CG  . LEU B 1 40  ? 21.240  -63.507 48.249 1.00 102.05 ? 1547 LEU B CG  1 
ATOM   3802 C CD1 . LEU B 1 40  ? 21.428  -64.282 49.547 1.00 102.17 ? 1547 LEU B CD1 1 
ATOM   3803 C CD2 . LEU B 1 40  ? 22.435  -63.705 47.320 1.00 101.97 ? 1547 LEU B CD2 1 
ATOM   3804 N N   . VAL B 1 41  ? 18.749  -63.954 44.415 1.00 96.23  ? 1548 VAL B N   1 
ATOM   3805 C CA  . VAL B 1 41  ? 18.020  -64.838 43.513 1.00 96.31  ? 1548 VAL B CA  1 
ATOM   3806 C C   . VAL B 1 41  ? 18.811  -66.134 43.404 1.00 96.32  ? 1548 VAL B C   1 
ATOM   3807 O O   . VAL B 1 41  ? 19.755  -66.229 42.615 1.00 96.28  ? 1548 VAL B O   1 
ATOM   3808 C CB  . VAL B 1 41  ? 17.827  -64.217 42.100 1.00 96.29  ? 1548 VAL B CB  1 
ATOM   3809 C CG1 . VAL B 1 41  ? 17.111  -65.192 41.168 1.00 96.40  ? 1548 VAL B CG1 1 
ATOM   3810 C CG2 . VAL B 1 41  ? 17.053  -62.917 42.180 1.00 96.29  ? 1548 VAL B CG2 1 
ATOM   3811 N N   . TYR B 1 42  ? 18.445  -67.120 44.218 1.00 100.82 ? 1549 TYR B N   1 
ATOM   3812 C CA  . TYR B 1 42  ? 19.047  -68.442 44.114 1.00 100.85 ? 1549 TYR B CA  1 
ATOM   3813 C C   . TYR B 1 42  ? 18.518  -69.091 42.838 1.00 100.91 ? 1549 TYR B C   1 
ATOM   3814 O O   . TYR B 1 42  ? 17.330  -69.403 42.742 1.00 101.00 ? 1549 TYR B O   1 
ATOM   3815 C CB  . TYR B 1 42  ? 18.717  -69.317 45.329 1.00 100.94 ? 1549 TYR B CB  1 
ATOM   3816 C CG  . TYR B 1 42  ? 18.706  -68.618 46.673 1.00 100.95 ? 1549 TYR B CG  1 
ATOM   3817 C CD1 . TYR B 1 42  ? 19.880  -68.123 47.240 1.00 100.88 ? 1549 TYR B CD1 1 
ATOM   3818 C CD2 . TYR B 1 42  ? 17.520  -68.482 47.393 1.00 101.05 ? 1549 TYR B CD2 1 
ATOM   3819 C CE1 . TYR B 1 42  ? 19.867  -67.490 48.482 1.00 100.90 ? 1549 TYR B CE1 1 
ATOM   3820 C CE2 . TYR B 1 42  ? 17.495  -67.853 48.633 1.00 101.09 ? 1549 TYR B CE2 1 
ATOM   3821 C CZ  . TYR B 1 42  ? 18.670  -67.359 49.171 1.00 101.01 ? 1549 TYR B CZ  1 
ATOM   3822 O OH  . TYR B 1 42  ? 18.645  -66.737 50.396 1.00 101.07 ? 1549 TYR B OH  1 
ATOM   3823 N N   . MET B 1 43  ? 19.396  -69.265 41.853 1.00 95.85  ? 1550 MET B N   1 
ATOM   3824 C CA  . MET B 1 43  ? 18.999  -69.825 40.558 1.00 95.92  ? 1550 MET B CA  1 
ATOM   3825 C C   . MET B 1 43  ? 19.965  -70.891 40.031 1.00 95.96  ? 1550 MET B C   1 
ATOM   3826 O O   . MET B 1 43  ? 21.078  -71.037 40.536 1.00 95.92  ? 1550 MET B O   1 
ATOM   3827 C CB  . MET B 1 43  ? 18.800  -68.718 39.513 1.00 95.90  ? 1550 MET B CB  1 
ATOM   3828 C CG  . MET B 1 43  ? 20.010  -67.831 39.261 1.00 95.79  ? 1550 MET B CG  1 
ATOM   3829 S SD  . MET B 1 43  ? 20.094  -67.259 37.552 1.00 95.83  ? 1550 MET B SD  1 
ATOM   3830 C CE  . MET B 1 43  ? 20.844  -68.682 36.768 1.00 95.93  ? 1550 MET B CE  1 
ATOM   3831 N N   . SER B 1 44  ? 19.522  -71.627 39.013 1.00 97.36  ? 1551 SER B N   1 
ATOM   3832 C CA  . SER B 1 44  ? 20.341  -72.650 38.362 1.00 97.43  ? 1551 SER B CA  1 
ATOM   3833 C C   . SER B 1 44  ? 20.172  -72.623 36.838 1.00 97.52  ? 1551 SER B C   1 
ATOM   3834 O O   . SER B 1 44  ? 19.372  -71.848 36.310 1.00 97.53  ? 1551 SER B O   1 
ATOM   3835 C CB  . SER B 1 44  ? 20.006  -74.037 38.917 1.00 97.52  ? 1551 SER B CB  1 
ATOM   3836 O OG  . SER B 1 44  ? 20.354  -74.140 40.286 1.00 97.46  ? 1551 SER B OG  1 
ATOM   3837 N N   . ILE B 1 45  ? 20.934  -73.468 36.142 1.00 95.76  ? 1552 ILE B N   1 
ATOM   3838 C CA  . ILE B 1 45  ? 20.888  -73.554 34.679 1.00 95.88  ? 1552 ILE B CA  1 
ATOM   3839 C C   . ILE B 1 45  ? 20.617  -74.988 34.212 1.00 96.04  ? 1552 ILE B C   1 
ATOM   3840 O O   . ILE B 1 45  ? 21.302  -75.923 34.634 1.00 96.05  ? 1552 ILE B O   1 
ATOM   3841 C CB  . ILE B 1 45  ? 22.191  -72.995 34.030 1.00 95.86  ? 1552 ILE B CB  1 
ATOM   3842 C CG1 . ILE B 1 45  ? 22.305  -71.478 34.243 1.00 95.72  ? 1552 ILE B CG1 1 
ATOM   3843 C CG2 . ILE B 1 45  ? 22.279  -73.349 32.540 1.00 96.03  ? 1552 ILE B CG2 1 
ATOM   3844 C CD1 . ILE B 1 45  ? 21.150  -70.651 33.674 1.00 95.74  ? 1552 ILE B CD1 1 
ATOM   3845 N N   . CYS B 1 46  ? 19.610  -75.142 33.348 1.00 97.38  ? 1553 CYS B N   1 
ATOM   3846 C CA  . CYS B 1 46  ? 19.190  -76.443 32.798 1.00 97.55  ? 1553 CYS B CA  1 
ATOM   3847 C C   . CYS B 1 46  ? 18.808  -77.475 33.865 1.00 97.55  ? 1553 CYS B C   1 
ATOM   3848 O O   . CYS B 1 46  ? 18.768  -78.678 33.594 1.00 97.68  ? 1553 CYS B O   1 
ATOM   3849 C CB  . CYS B 1 46  ? 20.248  -77.010 31.839 1.00 97.67  ? 1553 CYS B CB  1 
ATOM   3850 S SG  . CYS B 1 46  ? 20.261  -76.246 30.200 1.00 97.81  ? 1553 CYS B SG  1 
ATOM   3851 N N   . GLY B 1 47  ? 18.516  -76.991 35.069 1.00 100.93 ? 1554 GLY B N   1 
ATOM   3852 C CA  . GLY B 1 47  ? 18.167  -77.847 36.199 1.00 100.93 ? 1554 GLY B CA  1 
ATOM   3853 C C   . GLY B 1 47  ? 17.619  -77.059 37.374 1.00 100.82 ? 1554 GLY B C   1 
ATOM   3854 O O   . GLY B 1 47  ? 17.774  -75.838 37.441 1.00 100.72 ? 1554 GLY B O   1 
ATOM   3855 N N   . GLU B 1 48  ? 16.969  -77.765 38.295 1.00 101.46 ? 1555 GLU B N   1 
ATOM   3856 C CA  . GLU B 1 48  ? 16.354  -77.145 39.469 1.00 101.40 ? 1555 GLU B CA  1 
ATOM   3857 C C   . GLU B 1 48  ? 17.388  -76.704 40.507 1.00 101.27 ? 1555 GLU B C   1 
ATOM   3858 O O   . GLU B 1 48  ? 18.453  -77.312 40.636 1.00 101.26 ? 1555 GLU B O   1 
ATOM   3859 C CB  . GLU B 1 48  ? 15.323  -78.092 40.100 1.00 101.51 ? 1555 GLU B CB  1 
ATOM   3860 C CG  . GLU B 1 48  ? 15.871  -79.463 40.506 1.00 101.57 ? 1555 GLU B CG  1 
ATOM   3861 C CD  . GLU B 1 48  ? 14.805  -80.388 41.070 1.00 101.68 ? 1555 GLU B CD  1 
ATOM   3862 O OE1 . GLU B 1 48  ? 13.772  -80.596 40.398 1.00 101.80 ? 1555 GLU B OE1 1 
ATOM   3863 O OE2 . GLU B 1 48  ? 15.006  -80.919 42.183 1.00 101.68 ? 1555 GLU B OE2 1 
ATOM   3864 N N   . ASN B 1 49  ? 17.065  -75.638 41.234 1.00 103.69 ? 1556 ASN B N   1 
ATOM   3865 C CA  . ASN B 1 49  ? 17.913  -75.148 42.316 1.00 103.59 ? 1556 ASN B CA  1 
ATOM   3866 C C   . ASN B 1 49  ? 17.535  -75.777 43.656 1.00 103.66 ? 1556 ASN B C   1 
ATOM   3867 O O   . ASN B 1 49  ? 16.353  -75.991 43.938 1.00 103.75 ? 1556 ASN B O   1 
ATOM   3868 C CB  . ASN B 1 49  ? 17.844  -73.621 42.401 1.00 103.49 ? 1556 ASN B CB  1 
ATOM   3869 C CG  . ASN B 1 49  ? 18.714  -73.055 43.508 1.00 103.41 ? 1556 ASN B CG  1 
ATOM   3870 O OD1 . ASN B 1 49  ? 19.911  -73.336 43.587 1.00 103.37 ? 1556 ASN B OD1 1 
ATOM   3871 N ND2 . ASN B 1 49  ? 18.112  -72.252 44.372 1.00 103.40 ? 1556 ASN B ND2 1 
ATOM   3872 N N   . GLU B 1 50  ? 18.543  -76.063 44.477 1.00 110.69 ? 1557 GLU B N   1 
ATOM   3873 C CA  . GLU B 1 50  ? 18.334  -76.725 45.767 1.00 110.77 ? 1557 GLU B CA  1 
ATOM   3874 C C   . GLU B 1 50  ? 17.767  -75.812 46.855 1.00 110.77 ? 1557 GLU B C   1 
ATOM   3875 O O   . GLU B 1 50  ? 17.220  -76.293 47.848 1.00 110.87 ? 1557 GLU B O   1 
ATOM   3876 C CB  . GLU B 1 50  ? 19.617  -77.413 46.247 1.00 110.78 ? 1557 GLU B CB  1 
ATOM   3877 C CG  . GLU B 1 50  ? 20.817  -76.494 46.439 1.00 110.68 ? 1557 GLU B CG  1 
ATOM   3878 C CD  . GLU B 1 50  ? 22.100  -77.254 46.747 1.00 110.72 ? 1557 GLU B CD  1 
ATOM   3879 O OE1 . GLU B 1 50  ? 22.167  -78.472 46.471 1.00 110.81 ? 1557 GLU B OE1 1 
ATOM   3880 O OE2 . GLU B 1 50  ? 23.053  -76.626 47.256 1.00 110.67 ? 1557 GLU B OE2 1 
ATOM   3881 N N   . ASN B 1 51  ? 17.906  -74.501 46.665 1.00 108.98 ? 1558 ASN B N   1 
ATOM   3882 C CA  . ASN B 1 51  ? 17.307  -73.519 47.569 1.00 108.99 ? 1558 ASN B CA  1 
ATOM   3883 C C   . ASN B 1 51  ? 15.861  -73.221 47.179 1.00 109.05 ? 1558 ASN B C   1 
ATOM   3884 O O   . ASN B 1 51  ? 15.078  -72.719 47.990 1.00 109.11 ? 1558 ASN B O   1 
ATOM   3885 C CB  . ASN B 1 51  ? 18.126  -72.228 47.584 1.00 108.86 ? 1558 ASN B CB  1 
ATOM   3886 C CG  . ASN B 1 51  ? 19.614  -72.484 47.676 1.00 108.81 ? 1558 ASN B CG  1 
ATOM   3887 O OD1 . ASN B 1 51  ? 20.105  -73.014 48.673 1.00 108.87 ? 1558 ASN B OD1 1 
ATOM   3888 N ND2 . ASN B 1 51  ? 20.342  -72.108 46.634 1.00 108.72 ? 1558 ASN B ND2 1 
ATOM   3889 N N   . CYS B 1 52  ? 15.528  -73.536 45.929 1.00 101.67 ? 1559 CYS B N   1 
ATOM   3890 C CA  . CYS B 1 52  ? 14.178  -73.384 45.395 1.00 101.76 ? 1559 CYS B CA  1 
ATOM   3891 C C   . CYS B 1 52  ? 13.385  -74.680 45.559 1.00 101.90 ? 1559 CYS B C   1 
ATOM   3892 O O   . CYS B 1 52  ? 13.981  -75.746 45.737 1.00 101.92 ? 1559 CYS B O   1 
ATOM   3893 C CB  . CYS B 1 52  ? 14.241  -73.011 43.911 1.00 101.70 ? 1559 CYS B CB  1 
ATOM   3894 S SG  . CYS B 1 52  ? 14.981  -71.407 43.537 1.00 101.54 ? 1559 CYS B SG  1 
ATOM   3895 N N   . PRO B 1 53  ? 12.037  -74.597 45.503 1.00 102.22 ? 1560 PRO B N   1 
ATOM   3896 C CA  . PRO B 1 53  ? 11.208  -75.803 45.478 1.00 102.37 ? 1560 PRO B CA  1 
ATOM   3897 C C   . PRO B 1 53  ? 11.584  -76.714 44.307 1.00 102.36 ? 1560 PRO B C   1 
ATOM   3898 O O   . PRO B 1 53  ? 12.033  -76.216 43.273 1.00 102.28 ? 1560 PRO B O   1 
ATOM   3899 C CB  . PRO B 1 53  ? 9.794   -75.250 45.281 1.00 102.50 ? 1560 PRO B CB  1 
ATOM   3900 C CG  . PRO B 1 53  ? 9.850   -73.878 45.831 1.00 102.44 ? 1560 PRO B CG  1 
ATOM   3901 C CD  . PRO B 1 53  ? 11.213  -73.374 45.481 1.00 102.25 ? 1560 PRO B CD  1 
ATOM   3902 N N   . PRO B 1 54  ? 11.413  -78.042 44.468 1.00 104.03 ? 1561 PRO B N   1 
ATOM   3903 C CA  . PRO B 1 54  ? 11.789  -78.988 43.414 1.00 104.05 ? 1561 PRO B CA  1 
ATOM   3904 C C   . PRO B 1 54  ? 11.120  -78.658 42.080 1.00 104.10 ? 1561 PRO B C   1 
ATOM   3905 O O   . PRO B 1 54  ? 9.902   -78.477 42.027 1.00 104.23 ? 1561 PRO B O   1 
ATOM   3906 C CB  . PRO B 1 54  ? 11.276  -80.330 43.948 1.00 104.19 ? 1561 PRO B CB  1 
ATOM   3907 C CG  . PRO B 1 54  ? 11.236  -80.160 45.418 1.00 104.19 ? 1561 PRO B CG  1 
ATOM   3908 C CD  . PRO B 1 54  ? 10.856  -78.731 45.647 1.00 104.15 ? 1561 PRO B CD  1 
ATOM   3909 N N   . GLY B 1 55  ? 11.922  -78.566 41.022 1.00 99.26  ? 1562 GLY B N   1 
ATOM   3910 C CA  . GLY B 1 55  ? 11.419  -78.236 39.688 1.00 99.32  ? 1562 GLY B CA  1 
ATOM   3911 C C   . GLY B 1 55  ? 11.576  -76.771 39.325 1.00 99.23  ? 1562 GLY B C   1 
ATOM   3912 O O   . GLY B 1 55  ? 11.534  -76.409 38.147 1.00 99.25  ? 1562 GLY B O   1 
ATOM   3913 N N   . VAL B 1 56  ? 11.757  -75.931 40.342 1.00 95.78  ? 1563 VAL B N   1 
ATOM   3914 C CA  . VAL B 1 56  ? 11.925  -74.490 40.158 1.00 95.68  ? 1563 VAL B CA  1 
ATOM   3915 C C   . VAL B 1 56  ? 13.388  -74.154 39.850 1.00 95.53  ? 1563 VAL B C   1 
ATOM   3916 O O   . VAL B 1 56  ? 14.299  -74.589 40.562 1.00 95.45  ? 1563 VAL B O   1 
ATOM   3917 C CB  . VAL B 1 56  ? 11.430  -73.702 41.402 1.00 95.66  ? 1563 VAL B CB  1 
ATOM   3918 C CG1 . VAL B 1 56  ? 11.692  -72.215 41.251 1.00 95.55  ? 1563 VAL B CG1 1 
ATOM   3919 C CG2 . VAL B 1 56  ? 9.948   -73.961 41.650 1.00 95.84  ? 1563 VAL B CG2 1 
ATOM   3920 N N   . GLY B 1 57  ? 13.600  -73.384 38.783 1.00 94.85  ? 1564 GLY B N   1 
ATOM   3921 C CA  . GLY B 1 57  ? 14.942  -72.991 38.350 1.00 94.73  ? 1564 GLY B CA  1 
ATOM   3922 C C   . GLY B 1 57  ? 15.514  -71.795 39.090 1.00 94.58  ? 1564 GLY B C   1 
ATOM   3923 O O   . GLY B 1 57  ? 16.718  -71.735 39.339 1.00 94.47  ? 1564 GLY B O   1 
ATOM   3924 N N   . ALA B 1 58  ? 14.647  -70.843 39.435 1.00 93.31  ? 1565 ALA B N   1 
ATOM   3925 C CA  . ALA B 1 58  ? 15.046  -69.618 40.130 1.00 93.18  ? 1565 ALA B CA  1 
ATOM   3926 C C   . ALA B 1 58  ? 13.949  -69.141 41.082 1.00 93.24  ? 1565 ALA B C   1 
ATOM   3927 O O   . ALA B 1 58  ? 12.763  -69.243 40.764 1.00 93.37  ? 1565 ALA B O   1 
ATOM   3928 C CB  . ALA B 1 58  ? 15.379  -68.530 39.122 1.00 93.13  ? 1565 ALA B CB  1 
ATOM   3929 N N   . CYS B 1 59  ? 14.347  -68.618 42.243 1.00 93.83  ? 1566 CYS B N   1 
ATOM   3930 C CA  . CYS B 1 59  ? 13.388  -68.131 43.245 1.00 93.90  ? 1566 CYS B CA  1 
ATOM   3931 C C   . CYS B 1 59  ? 13.901  -66.946 44.077 1.00 93.80  ? 1566 CYS B C   1 
ATOM   3932 O O   . CYS B 1 59  ? 14.983  -66.417 43.815 1.00 93.67  ? 1566 CYS B O   1 
ATOM   3933 C CB  . CYS B 1 59  ? 12.927  -69.277 44.154 1.00 94.01  ? 1566 CYS B CB  1 
ATOM   3934 S SG  . CYS B 1 59  ? 14.258  -70.171 44.979 1.00 93.94  ? 1566 CYS B SG  1 
ATOM   3935 N N   . PHE B 1 60  ? 13.111  -66.537 45.072 1.00 95.24  ? 1567 PHE B N   1 
ATOM   3936 C CA  . PHE B 1 60  ? 13.427  -65.373 45.906 1.00 95.18  ? 1567 PHE B CA  1 
ATOM   3937 C C   . PHE B 1 60  ? 14.010  -65.715 47.277 1.00 95.19  ? 1567 PHE B C   1 
ATOM   3938 O O   . PHE B 1 60  ? 14.135  -66.889 47.632 1.00 95.24  ? 1567 PHE B O   1 
ATOM   3939 C CB  . PHE B 1 60  ? 12.197  -64.477 46.070 1.00 95.29  ? 1567 PHE B CB  1 
ATOM   3940 C CG  . PHE B 1 60  ? 11.902  -63.634 44.870 1.00 95.27  ? 1567 PHE B CG  1 
ATOM   3941 C CD1 . PHE B 1 60  ? 12.769  -62.622 44.486 1.00 95.12  ? 1567 PHE B CD1 1 
ATOM   3942 C CD2 . PHE B 1 60  ? 10.753  -63.847 44.126 1.00 95.40  ? 1567 PHE B CD2 1 
ATOM   3943 C CE1 . PHE B 1 60  ? 12.496  -61.847 43.377 1.00 95.11  ? 1567 PHE B CE1 1 
ATOM   3944 C CE2 . PHE B 1 60  ? 10.468  -63.071 43.019 1.00 95.40  ? 1567 PHE B CE2 1 
ATOM   3945 C CZ  . PHE B 1 60  ? 11.344  -62.070 42.641 1.00 95.25  ? 1567 PHE B CZ  1 
ATOM   3946 N N   . GLY B 1 61  ? 14.342  -64.670 48.038 1.00 100.20 ? 1568 GLY B N   1 
ATOM   3947 C CA  . GLY B 1 61  ? 15.098  -64.775 49.290 1.00 100.20 ? 1568 GLY B CA  1 
ATOM   3948 C C   . GLY B 1 61  ? 14.540  -65.662 50.389 1.00 100.37 ? 1568 GLY B C   1 
ATOM   3949 O O   . GLY B 1 61  ? 14.761  -66.876 50.386 1.00 100.40 ? 1568 GLY B O   1 
ATOM   3950 N N   . GLN B 1 62  ? 13.838  -65.050 51.341 1.00 102.18 ? 1569 GLN B N   1 
ATOM   3951 C CA  . GLN B 1 62  ? 13.303  -65.770 52.498 1.00 102.36 ? 1569 GLN B CA  1 
ATOM   3952 C C   . GLN B 1 62  ? 12.176  -66.720 52.101 1.00 102.49 ? 1569 GLN B C   1 
ATOM   3953 O O   . GLN B 1 62  ? 12.268  -67.926 52.337 1.00 102.54 ? 1569 GLN B O   1 
ATOM   3954 C CB  . GLN B 1 62  ? 12.857  -64.794 53.594 1.00 102.49 ? 1569 GLN B CB  1 
ATOM   3955 C CG  . GLN B 1 62  ? 13.971  -64.389 54.566 1.00 102.45 ? 1569 GLN B CG  1 
ATOM   3956 C CD  . GLN B 1 62  ? 15.116  -63.631 53.902 1.00 102.23 ? 1569 GLN B CD  1 
ATOM   3957 O OE1 . GLN B 1 62  ? 14.898  -62.737 53.083 1.00 102.14 ? 1569 GLN B OE1 1 
ATOM   3958 N NE2 . GLN B 1 62  ? 16.345  -63.987 54.261 1.00 102.15 ? 1569 GLN B NE2 1 
ATOM   3959 N N   . THR B 1 63  ? 11.122  -66.181 51.494 1.00 96.63  ? 1570 THR B N   1 
ATOM   3960 C CA  . THR B 1 63  ? 10.087  -67.018 50.900 1.00 96.74  ? 1570 THR B CA  1 
ATOM   3961 C C   . THR B 1 63  ? 10.586  -67.519 49.555 1.00 96.59  ? 1570 THR B C   1 
ATOM   3962 O O   . THR B 1 63  ? 11.378  -66.847 48.891 1.00 96.41  ? 1570 THR B O   1 
ATOM   3963 C CB  . THR B 1 63  ? 8.757   -66.265 50.715 1.00 96.89  ? 1570 THR B CB  1 
ATOM   3964 O OG1 . THR B 1 63  ? 8.999   -65.009 50.071 1.00 96.76  ? 1570 THR B OG1 1 
ATOM   3965 C CG2 . THR B 1 63  ? 8.089   -66.024 52.060 1.00 97.10  ? 1570 THR B CG2 1 
ATOM   3966 N N   . ARG B 1 64  ? 10.129  -68.703 49.162 1.00 95.97  ? 1571 ARG B N   1 
ATOM   3967 C CA  . ARG B 1 64  ? 10.576  -69.321 47.916 1.00 95.87  ? 1571 ARG B CA  1 
ATOM   3968 C C   . ARG B 1 64  ? 9.635   -69.009 46.747 1.00 95.92  ? 1571 ARG B C   1 
ATOM   3969 O O   . ARG B 1 64  ? 9.012   -69.906 46.168 1.00 96.03  ? 1571 ARG B O   1 
ATOM   3970 C CB  . ARG B 1 64  ? 10.778  -70.828 48.107 1.00 95.92  ? 1571 ARG B CB  1 
ATOM   3971 C CG  . ARG B 1 64  ? 12.047  -71.173 48.870 1.00 95.84  ? 1571 ARG B CG  1 
ATOM   3972 C CD  . ARG B 1 64  ? 12.017  -72.592 49.408 1.00 95.94  ? 1571 ARG B CD  1 
ATOM   3973 N NE  . ARG B 1 64  ? 13.215  -72.891 50.192 1.00 95.88  ? 1571 ARG B NE  1 
ATOM   3974 C CZ  . ARG B 1 64  ? 13.413  -74.015 50.876 1.00 95.97  ? 1571 ARG B CZ  1 
ATOM   3975 N NH1 . ARG B 1 64  ? 12.493  -74.972 50.886 1.00 96.11  ? 1571 ARG B NH1 1 
ATOM   3976 N NH2 . ARG B 1 64  ? 14.539  -74.182 51.555 1.00 95.94  ? 1571 ARG B NH2 1 
ATOM   3977 N N   . ILE B 1 65  ? 9.549   -67.724 46.408 1.00 90.82  ? 1572 ILE B N   1 
ATOM   3978 C CA  . ILE B 1 65  ? 8.702   -67.254 45.316 1.00 90.88  ? 1572 ILE B CA  1 
ATOM   3979 C C   . ILE B 1 65  ? 9.327   -67.632 43.975 1.00 90.78  ? 1572 ILE B C   1 
ATOM   3980 O O   . ILE B 1 65  ? 10.304  -67.023 43.538 1.00 90.62  ? 1572 ILE B O   1 
ATOM   3981 C CB  . ILE B 1 65  ? 8.467   -65.722 45.385 1.00 90.86  ? 1572 ILE B CB  1 
ATOM   3982 C CG1 . ILE B 1 65  ? 8.044   -65.292 46.796 1.00 90.94  ? 1572 ILE B CG1 1 
ATOM   3983 C CG2 . ILE B 1 65  ? 7.436   -65.284 44.344 1.00 91.00  ? 1572 ILE B CG2 1 
ATOM   3984 C CD1 . ILE B 1 65  ? 8.183   -63.798 47.062 1.00 90.88  ? 1572 ILE B CD1 1 
ATOM   3985 N N   . SER B 1 66  ? 8.752   -68.650 43.340 1.00 90.71  ? 1573 SER B N   1 
ATOM   3986 C CA  . SER B 1 66  ? 9.232   -69.169 42.062 1.00 90.66  ? 1573 SER B CA  1 
ATOM   3987 C C   . SER B 1 66  ? 9.085   -68.153 40.929 1.00 90.65  ? 1573 SER B C   1 
ATOM   3988 O O   . SER B 1 66  ? 8.027   -67.540 40.767 1.00 90.78  ? 1573 SER B O   1 
ATOM   3989 C CB  . SER B 1 66  ? 8.479   -70.457 41.711 1.00 90.82  ? 1573 SER B CB  1 
ATOM   3990 O OG  . SER B 1 66  ? 8.798   -70.914 40.407 1.00 90.81  ? 1573 SER B OG  1 
ATOM   3991 N N   . VAL B 1 67  ? 10.153  -67.977 40.154 1.00 88.68  ? 1574 VAL B N   1 
ATOM   3992 C CA  . VAL B 1 67  ? 10.098  -67.143 38.951 1.00 88.68  ? 1574 VAL B CA  1 
ATOM   3993 C C   . VAL B 1 67  ? 10.329  -67.958 37.675 1.00 88.75  ? 1574 VAL B C   1 
ATOM   3994 O O   . VAL B 1 67  ? 10.767  -67.425 36.652 1.00 88.72  ? 1574 VAL B O   1 
ATOM   3995 C CB  . VAL B 1 67  ? 11.048  -65.911 39.018 1.00 88.51  ? 1574 VAL B CB  1 
ATOM   3996 C CG1 . VAL B 1 67  ? 10.529  -64.894 40.015 1.00 88.50  ? 1574 VAL B CG1 1 
ATOM   3997 C CG2 . VAL B 1 67  ? 12.474  -66.321 39.350 1.00 88.35  ? 1574 VAL B CG2 1 
ATOM   3998 N N   . GLY B 1 68  ? 10.020  -69.252 37.745 1.00 89.05  ? 1575 GLY B N   1 
ATOM   3999 C CA  . GLY B 1 68  ? 10.112  -70.132 36.584 1.00 89.14  ? 1575 GLY B CA  1 
ATOM   4000 C C   . GLY B 1 68  ? 10.507  -71.564 36.890 1.00 89.15  ? 1575 GLY B C   1 
ATOM   4001 O O   . GLY B 1 68  ? 11.174  -71.839 37.890 1.00 89.04  ? 1575 GLY B O   1 
ATOM   4002 N N   . LYS B 1 69  ? 10.085  -72.474 36.016 1.00 92.00  ? 1576 LYS B N   1 
ATOM   4003 C CA  . LYS B 1 69  ? 10.423  -73.891 36.118 1.00 92.04  ? 1576 LYS B CA  1 
ATOM   4004 C C   . LYS B 1 69  ? 11.660  -74.196 35.285 1.00 91.98  ? 1576 LYS B C   1 
ATOM   4005 O O   . LYS B 1 69  ? 11.828  -73.655 34.190 1.00 92.02  ? 1576 LYS B O   1 
ATOM   4006 C CB  . LYS B 1 69  ? 9.259   -74.765 35.644 1.00 92.26  ? 1576 LYS B CB  1 
ATOM   4007 C CG  . LYS B 1 69  ? 8.032   -74.744 36.545 1.00 92.35  ? 1576 LYS B CG  1 
ATOM   4008 C CD  . LYS B 1 69  ? 6.895   -75.553 35.936 1.00 92.59  ? 1576 LYS B CD  1 
ATOM   4009 C CE  . LYS B 1 69  ? 5.684   -75.587 36.852 1.00 92.71  ? 1576 LYS B CE  1 
ATOM   4010 N NZ  . LYS B 1 69  ? 4.551   -76.331 36.236 1.00 92.96  ? 1576 LYS B NZ  1 
ATOM   4011 N N   . ALA B 1 70  ? 12.512  -75.074 35.806 1.00 94.86  ? 1577 ALA B N   1 
ATOM   4012 C CA  . ALA B 1 70  ? 13.762  -75.443 35.147 1.00 94.82  ? 1577 ALA B CA  1 
ATOM   4013 C C   . ALA B 1 70  ? 13.529  -76.334 33.930 1.00 95.00  ? 1577 ALA B C   1 
ATOM   4014 O O   . ALA B 1 70  ? 12.744  -77.283 33.988 1.00 95.12  ? 1577 ALA B O   1 
ATOM   4015 C CB  . ALA B 1 70  ? 14.683  -76.127 36.130 1.00 94.72  ? 1577 ALA B CB  1 
ATOM   4016 N N   . ASN B 1 71  ? 14.222  -76.025 32.836 1.00 94.12  ? 1578 ASN B N   1 
ATOM   4017 C CA  . ASN B 1 71  ? 14.075  -76.765 31.580 1.00 94.31  ? 1578 ASN B CA  1 
ATOM   4018 C C   . ASN B 1 71  ? 15.358  -76.842 30.748 1.00 94.32  ? 1578 ASN B C   1 
ATOM   4019 O O   . ASN B 1 71  ? 16.335  -76.143 31.027 1.00 94.17  ? 1578 ASN B O   1 
ATOM   4020 C CB  . ASN B 1 71  ? 12.927  -76.185 30.741 1.00 94.46  ? 1578 ASN B CB  1 
ATOM   4021 C CG  . ASN B 1 71  ? 13.055  -74.688 30.524 1.00 94.37  ? 1578 ASN B CG  1 
ATOM   4022 O OD1 . ASN B 1 71  ? 13.855  -74.229 29.706 1.00 94.40  ? 1578 ASN B OD1 1 
ATOM   4023 N ND2 . ASN B 1 71  ? 12.255  -73.918 31.251 1.00 94.27  ? 1578 ASN B ND2 1 
ATOM   4024 N N   . LYS B 1 72  ? 15.340  -77.697 29.727 1.00 96.18  ? 1579 LYS B N   1 
ATOM   4025 C CA  . LYS B 1 72  ? 16.469  -77.864 28.811 1.00 96.25  ? 1579 LYS B CA  1 
ATOM   4026 C C   . LYS B 1 72  ? 16.278  -77.048 27.527 1.00 96.38  ? 1579 LYS B C   1 
ATOM   4027 O O   . LYS B 1 72  ? 17.112  -77.101 26.617 1.00 96.49  ? 1579 LYS B O   1 
ATOM   4028 C CB  . LYS B 1 72  ? 16.662  -79.348 28.469 1.00 96.41  ? 1579 LYS B CB  1 
ATOM   4029 C CG  . LYS B 1 72  ? 16.925  -80.255 29.671 1.00 96.31  ? 1579 LYS B CG  1 
ATOM   4030 C CD  . LYS B 1 72  ? 16.824  -81.736 29.304 1.00 96.50  ? 1579 LYS B CD  1 
ATOM   4031 C CE  . LYS B 1 72  ? 18.098  -82.262 28.646 1.00 96.58  ? 1579 LYS B CE  1 
ATOM   4032 N NZ  . LYS B 1 72  ? 19.231  -82.392 29.608 1.00 96.42  ? 1579 LYS B NZ  1 
ATOM   4033 N N   . ARG B 1 73  ? 15.180  -76.291 27.472 1.00 91.55  ? 1580 ARG B N   1 
ATOM   4034 C CA  . ARG B 1 73  ? 14.792  -75.517 26.286 1.00 91.71  ? 1580 ARG B CA  1 
ATOM   4035 C C   . ARG B 1 73  ? 15.748  -74.360 26.003 1.00 91.60  ? 1580 ARG B C   1 
ATOM   4036 O O   . ARG B 1 73  ? 15.586  -73.257 26.535 1.00 91.44  ? 1580 ARG B O   1 
ATOM   4037 C CB  . ARG B 1 73  ? 13.358  -74.992 26.429 1.00 91.76  ? 1580 ARG B CB  1 
ATOM   4038 C CG  . ARG B 1 73  ? 12.281  -76.066 26.454 1.00 91.92  ? 1580 ARG B CG  1 
ATOM   4039 C CD  . ARG B 1 73  ? 11.001  -75.523 27.066 1.00 91.91  ? 1580 ARG B CD  1 
ATOM   4040 N NE  . ARG B 1 73  ? 9.936   -76.523 27.101 1.00 92.08  ? 1580 ARG B NE  1 
ATOM   4041 C CZ  . ARG B 1 73  ? 8.912   -76.566 26.254 1.00 92.34  ? 1580 ARG B CZ  1 
ATOM   4042 N NH1 . ARG B 1 73  ? 8.797   -75.659 25.291 1.00 92.45  ? 1580 ARG B NH1 1 
ATOM   4043 N NH2 . ARG B 1 73  ? 7.995   -77.517 26.372 1.00 92.49  ? 1580 ARG B NH2 1 
ATOM   4044 N N   . LEU B 1 74  ? 16.739  -74.623 25.156 1.00 89.73  ? 1581 LEU B N   1 
ATOM   4045 C CA  . LEU B 1 74  ? 17.751  -73.633 24.808 1.00 89.66  ? 1581 LEU B CA  1 
ATOM   4046 C C   . LEU B 1 74  ? 17.605  -73.199 23.351 1.00 89.90  ? 1581 LEU B C   1 
ATOM   4047 O O   . LEU B 1 74  ? 17.360  -74.026 22.470 1.00 90.14  ? 1581 LEU B O   1 
ATOM   4048 C CB  . LEU B 1 74  ? 19.151  -74.193 25.083 1.00 89.60  ? 1581 LEU B CB  1 
ATOM   4049 C CG  . LEU B 1 74  ? 20.381  -73.278 25.052 1.00 89.48  ? 1581 LEU B CG  1 
ATOM   4050 C CD1 . LEU B 1 74  ? 20.261  -72.092 26.001 1.00 89.22  ? 1581 LEU B CD1 1 
ATOM   4051 C CD2 . LEU B 1 74  ? 21.628  -74.090 25.368 1.00 89.47  ? 1581 LEU B CD2 1 
ATOM   4052 N N   . ARG B 1 75  ? 17.752  -71.898 23.112 1.00 86.23  ? 1582 ARG B N   1 
ATOM   4053 C CA  . ARG B 1 75  ? 17.568  -71.314 21.783 1.00 86.45  ? 1582 ARG B CA  1 
ATOM   4054 C C   . ARG B 1 75  ? 18.755  -70.443 21.380 1.00 86.41  ? 1582 ARG B C   1 
ATOM   4055 O O   . ARG B 1 75  ? 19.343  -69.761 22.220 1.00 86.17  ? 1582 ARG B O   1 
ATOM   4056 C CB  . ARG B 1 75  ? 16.292  -70.466 21.743 1.00 86.47  ? 1582 ARG B CB  1 
ATOM   4057 C CG  . ARG B 1 75  ? 14.988  -71.248 21.852 1.00 86.61  ? 1582 ARG B CG  1 
ATOM   4058 C CD  . ARG B 1 75  ? 13.793  -70.314 22.018 1.00 86.61  ? 1582 ARG B CD  1 
ATOM   4059 N NE  . ARG B 1 75  ? 13.564  -69.480 20.836 1.00 86.82  ? 1582 ARG B NE  1 
ATOM   4060 C CZ  . ARG B 1 75  ? 12.701  -69.763 19.862 1.00 87.12  ? 1582 ARG B CZ  1 
ATOM   4061 N NH1 . ARG B 1 75  ? 11.964  -70.867 19.911 1.00 87.26  ? 1582 ARG B NH1 1 
ATOM   4062 N NH2 . ARG B 1 75  ? 12.572  -68.937 18.832 1.00 87.31  ? 1582 ARG B NH2 1 
ATOM   4063 N N   . TYR B 1 76  ? 19.098  -70.472 20.095 1.00 84.15  ? 1583 TYR B N   1 
ATOM   4064 C CA  . TYR B 1 76  ? 20.095  -69.560 19.541 1.00 84.17  ? 1583 TYR B CA  1 
ATOM   4065 C C   . TYR B 1 76  ? 19.386  -68.403 18.844 1.00 84.27  ? 1583 TYR B C   1 
ATOM   4066 O O   . TYR B 1 76  ? 18.784  -68.581 17.783 1.00 84.56  ? 1583 TYR B O   1 
ATOM   4067 C CB  . TYR B 1 76  ? 21.032  -70.287 18.565 1.00 84.42  ? 1583 TYR B CB  1 
ATOM   4068 C CG  . TYR B 1 76  ? 22.174  -69.430 18.045 1.00 84.45  ? 1583 TYR B CG  1 
ATOM   4069 C CD1 . TYR B 1 76  ? 21.994  -68.576 16.954 1.00 84.64  ? 1583 TYR B CD1 1 
ATOM   4070 C CD2 . TYR B 1 76  ? 23.434  -69.476 18.642 1.00 84.31  ? 1583 TYR B CD2 1 
ATOM   4071 C CE1 . TYR B 1 76  ? 23.037  -67.785 16.477 1.00 84.69  ? 1583 TYR B CE1 1 
ATOM   4072 C CE2 . TYR B 1 76  ? 24.486  -68.691 18.169 1.00 84.35  ? 1583 TYR B CE2 1 
ATOM   4073 C CZ  . TYR B 1 76  ? 24.279  -67.850 17.087 1.00 84.54  ? 1583 TYR B CZ  1 
ATOM   4074 O OH  . TYR B 1 76  ? 25.310  -67.073 16.614 1.00 84.60  ? 1583 TYR B OH  1 
ATOM   4075 N N   . VAL B 1 77  ? 19.455  -67.220 19.449 1.00 81.02  ? 1584 VAL B N   1 
ATOM   4076 C CA  . VAL B 1 77  ? 18.840  -66.024 18.872 1.00 81.10  ? 1584 VAL B CA  1 
ATOM   4077 C C   . VAL B 1 77  ? 19.851  -64.879 18.728 1.00 81.00  ? 1584 VAL B C   1 
ATOM   4078 O O   . VAL B 1 77  ? 20.093  -64.115 19.667 1.00 80.73  ? 1584 VAL B O   1 
ATOM   4079 C CB  . VAL B 1 77  ? 17.537  -65.600 19.633 1.00 80.98  ? 1584 VAL B CB  1 
ATOM   4080 C CG1 . VAL B 1 77  ? 17.790  -65.415 21.129 1.00 80.63  ? 1584 VAL B CG1 1 
ATOM   4081 C CG2 . VAL B 1 77  ? 16.911  -64.350 19.013 1.00 81.08  ? 1584 VAL B CG2 1 
ATOM   4082 N N   . ASP B 1 78  ? 20.440  -64.792 17.535 1.00 78.69  ? 1585 ASP B N   1 
ATOM   4083 C CA  . ASP B 1 78  ? 21.394  -63.737 17.165 1.00 78.67  ? 1585 ASP B CA  1 
ATOM   4084 C C   . ASP B 1 78  ? 22.556  -63.581 18.153 1.00 78.39  ? 1585 ASP B C   1 
ATOM   4085 O O   . ASP B 1 78  ? 22.577  -62.645 18.959 1.00 78.14  ? 1585 ASP B O   1 
ATOM   4086 C CB  . ASP B 1 78  ? 20.676  -62.394 16.956 1.00 78.66  ? 1585 ASP B CB  1 
ATOM   4087 C CG  . ASP B 1 78  ? 19.629  -62.449 15.856 1.00 78.98  ? 1585 ASP B CG  1 
ATOM   4088 O OD1 . ASP B 1 78  ? 18.711  -63.291 15.940 1.00 79.05  ? 1585 ASP B OD1 1 
ATOM   4089 O OD2 . ASP B 1 78  ? 19.718  -61.634 14.913 1.00 79.18  ? 1585 ASP B OD2 1 
ATOM   4090 N N   . GLN B 1 79  ? 23.513  -64.509 18.076 1.00 78.27  ? 1586 GLN B N   1 
ATOM   4091 C CA  . GLN B 1 79  ? 24.729  -64.505 18.912 1.00 78.07  ? 1586 GLN B CA  1 
ATOM   4092 C C   . GLN B 1 79  ? 24.476  -64.792 20.401 1.00 77.76  ? 1586 GLN B C   1 
ATOM   4093 O O   . GLN B 1 79  ? 25.413  -64.785 21.205 1.00 77.59  ? 1586 GLN B O   1 
ATOM   4094 C CB  . GLN B 1 79  ? 25.519  -63.192 18.751 1.00 78.00  ? 1586 GLN B CB  1 
ATOM   4095 C CG  . GLN B 1 79  ? 25.928  -62.845 17.319 1.00 78.31  ? 1586 GLN B CG  1 
ATOM   4096 C CD  . GLN B 1 79  ? 26.933  -63.821 16.730 1.00 78.54  ? 1586 GLN B CD  1 
ATOM   4097 O OE1 . GLN B 1 79  ? 26.737  -64.337 15.630 1.00 78.85  ? 1586 GLN B OE1 1 
ATOM   4098 N NE2 . GLN B 1 79  ? 28.013  -64.079 17.460 1.00 78.39  ? 1586 GLN B NE2 1 
ATOM   4099 N N   . VAL B 1 80  ? 23.220  -65.049 20.759 1.00 79.16  ? 1587 VAL B N   1 
ATOM   4100 C CA  . VAL B 1 80  ? 22.826  -65.246 22.155 1.00 78.89  ? 1587 VAL B CA  1 
ATOM   4101 C C   . VAL B 1 80  ? 22.215  -66.636 22.357 1.00 78.97  ? 1587 VAL B C   1 
ATOM   4102 O O   . VAL B 1 80  ? 21.565  -67.172 21.458 1.00 79.21  ? 1587 VAL B O   1 
ATOM   4103 C CB  . VAL B 1 80  ? 21.821  -64.153 22.619 1.00 78.75  ? 1587 VAL B CB  1 
ATOM   4104 C CG1 . VAL B 1 80  ? 21.601  -64.212 24.121 1.00 78.48  ? 1587 VAL B CG1 1 
ATOM   4105 C CG2 . VAL B 1 80  ? 22.310  -62.767 22.227 1.00 78.75  ? 1587 VAL B CG2 1 
ATOM   4106 N N   . LEU B 1 81  ? 22.437  -67.212 23.536 1.00 82.42  ? 1588 LEU B N   1 
ATOM   4107 C CA  . LEU B 1 81  ? 21.837  -68.492 23.904 1.00 82.47  ? 1588 LEU B CA  1 
ATOM   4108 C C   . LEU B 1 81  ? 20.785  -68.270 24.991 1.00 82.30  ? 1588 LEU B C   1 
ATOM   4109 O O   . LEU B 1 81  ? 21.110  -68.192 26.176 1.00 82.12  ? 1588 LEU B O   1 
ATOM   4110 C CB  . LEU B 1 81  ? 22.908  -69.486 24.377 1.00 82.44  ? 1588 LEU B CB  1 
ATOM   4111 C CG  . LEU B 1 81  ? 24.265  -69.550 23.663 1.00 82.57  ? 1588 LEU B CG  1 
ATOM   4112 C CD1 . LEU B 1 81  ? 25.208  -70.484 24.405 1.00 82.50  ? 1588 LEU B CD1 1 
ATOM   4113 C CD2 . LEU B 1 81  ? 24.136  -69.969 22.205 1.00 82.89  ? 1588 LEU B CD2 1 
ATOM   4114 N N   . GLN B 1 82  ? 19.524  -68.157 24.578 1.00 82.76  ? 1589 GLN B N   1 
ATOM   4115 C CA  . GLN B 1 82  ? 18.430  -67.848 25.501 1.00 82.64  ? 1589 GLN B CA  1 
ATOM   4116 C C   . GLN B 1 82  ? 17.827  -69.076 26.173 1.00 82.65  ? 1589 GLN B C   1 
ATOM   4117 O O   . GLN B 1 82  ? 17.534  -70.080 25.518 1.00 82.84  ? 1589 GLN B O   1 
ATOM   4118 C CB  . GLN B 1 82  ? 17.321  -67.059 24.794 1.00 82.77  ? 1589 GLN B CB  1 
ATOM   4119 C CG  . GLN B 1 82  ? 17.475  -65.544 24.854 1.00 82.68  ? 1589 GLN B CG  1 
ATOM   4120 C CD  . GLN B 1 82  ? 16.224  -64.800 24.404 1.00 82.81  ? 1589 GLN B CD  1 
ATOM   4121 O OE1 . GLN B 1 82  ? 15.413  -65.322 23.635 1.00 83.04  ? 1589 GLN B OE1 1 
ATOM   4122 N NE2 . GLN B 1 82  ? 16.065  -63.572 24.882 1.00 82.68  ? 1589 GLN B NE2 1 
ATOM   4123 N N   . LEU B 1 83  ? 17.654  -68.980 27.488 1.00 85.92  ? 1590 LEU B N   1 
ATOM   4124 C CA  . LEU B 1 83  ? 16.868  -69.938 28.257 1.00 85.93  ? 1590 LEU B CA  1 
ATOM   4125 C C   . LEU B 1 83  ? 15.609  -69.247 28.757 1.00 85.91  ? 1590 LEU B C   1 
ATOM   4126 O O   . LEU B 1 83  ? 15.637  -68.061 29.089 1.00 85.79  ? 1590 LEU B O   1 
ATOM   4127 C CB  . LEU B 1 83  ? 17.666  -70.480 29.445 1.00 85.76  ? 1590 LEU B CB  1 
ATOM   4128 C CG  . LEU B 1 83  ? 18.553  -71.710 29.239 1.00 85.82  ? 1590 LEU B CG  1 
ATOM   4129 C CD1 . LEU B 1 83  ? 19.490  -71.887 30.419 1.00 85.64  ? 1590 LEU B CD1 1 
ATOM   4130 C CD2 . LEU B 1 83  ? 17.722  -72.970 29.026 1.00 85.99  ? 1590 LEU B CD2 1 
ATOM   4131 N N   . VAL B 1 84  ? 14.507  -69.990 28.802 1.00 86.18  ? 1591 VAL B N   1 
ATOM   4132 C CA  . VAL B 1 84  ? 13.233  -69.453 29.280 1.00 86.21  ? 1591 VAL B CA  1 
ATOM   4133 C C   . VAL B 1 84  ? 12.666  -70.336 30.390 1.00 86.17  ? 1591 VAL B C   1 
ATOM   4134 O O   . VAL B 1 84  ? 12.393  -71.519 30.173 1.00 86.28  ? 1591 VAL B O   1 
ATOM   4135 C CB  . VAL B 1 84  ? 12.194  -69.299 28.133 1.00 86.46  ? 1591 VAL B CB  1 
ATOM   4136 C CG1 . VAL B 1 84  ? 10.877  -68.739 28.662 1.00 86.51  ? 1591 VAL B CG1 1 
ATOM   4137 C CG2 . VAL B 1 84  ? 12.735  -68.402 27.024 1.00 86.52  ? 1591 VAL B CG2 1 
ATOM   4138 N N   . TYR B 1 85  ? 12.501  -69.754 31.575 1.00 88.12  ? 1592 TYR B N   1 
ATOM   4139 C CA  . TYR B 1 85  ? 11.907  -70.463 32.705 1.00 88.11  ? 1592 TYR B CA  1 
ATOM   4140 C C   . TYR B 1 85  ? 10.425  -70.128 32.852 1.00 88.24  ? 1592 TYR B C   1 
ATOM   4141 O O   . TYR B 1 85  ? 10.056  -69.042 33.305 1.00 88.19  ? 1592 TYR B O   1 
ATOM   4142 C CB  . TYR B 1 85  ? 12.682  -70.196 33.999 1.00 87.89  ? 1592 TYR B CB  1 
ATOM   4143 C CG  . TYR B 1 85  ? 14.035  -70.878 34.060 1.00 87.80  ? 1592 TYR B CG  1 
ATOM   4144 C CD1 . TYR B 1 85  ? 14.296  -72.028 33.310 1.00 87.91  ? 1592 TYR B CD1 1 
ATOM   4145 C CD2 . TYR B 1 85  ? 15.045  -70.391 34.886 1.00 87.62  ? 1592 TYR B CD2 1 
ATOM   4146 C CE1 . TYR B 1 85  ? 15.529  -72.660 33.366 1.00 87.85  ? 1592 TYR B CE1 1 
ATOM   4147 C CE2 . TYR B 1 85  ? 16.283  -71.021 34.952 1.00 87.56  ? 1592 TYR B CE2 1 
ATOM   4148 C CZ  . TYR B 1 85  ? 16.516  -72.152 34.188 1.00 87.68  ? 1592 TYR B CZ  1 
ATOM   4149 O OH  . TYR B 1 85  ? 17.736  -72.782 34.244 1.00 87.64  ? 1592 TYR B OH  1 
ATOM   4150 N N   . LYS B 1 86  ? 9.591   -71.087 32.459 1.00 88.61  ? 1593 LYS B N   1 
ATOM   4151 C CA  . LYS B 1 86  ? 8.141   -70.917 32.355 1.00 88.80  ? 1593 LYS B CA  1 
ATOM   4152 C C   . LYS B 1 86  ? 7.407   -71.230 33.656 1.00 88.81  ? 1593 LYS B C   1 
ATOM   4153 O O   . LYS B 1 86  ? 7.978   -71.827 34.569 1.00 88.68  ? 1593 LYS B O   1 
ATOM   4154 C CB  . LYS B 1 86  ? 7.599   -71.828 31.249 1.00 89.03  ? 1593 LYS B CB  1 
ATOM   4155 C CG  . LYS B 1 86  ? 7.930   -73.307 31.457 1.00 89.05  ? 1593 LYS B CG  1 
ATOM   4156 C CD  . LYS B 1 86  ? 7.076   -74.213 30.594 1.00 89.32  ? 1593 LYS B CD  1 
ATOM   4157 C CE  . LYS B 1 86  ? 7.346   -75.674 30.916 1.00 89.34  ? 1593 LYS B CE  1 
ATOM   4158 N NZ  . LYS B 1 86  ? 6.439   -76.587 30.167 1.00 89.61  ? 1593 LYS B NZ  1 
ATOM   4159 N N   . ASP B 1 87  ? 6.136   -70.831 33.716 1.00 89.30  ? 1594 ASP B N   1 
ATOM   4160 C CA  . ASP B 1 87  ? 5.217   -71.200 34.800 1.00 89.38  ? 1594 ASP B CA  1 
ATOM   4161 C C   . ASP B 1 87  ? 5.783   -70.990 36.206 1.00 89.20  ? 1594 ASP B C   1 
ATOM   4162 O O   . ASP B 1 87  ? 6.064   -71.951 36.928 1.00 89.16  ? 1594 ASP B O   1 
ATOM   4163 C CB  . ASP B 1 87  ? 4.737   -72.651 34.636 1.00 89.53  ? 1594 ASP B CB  1 
ATOM   4164 C CG  . ASP B 1 87  ? 3.913   -72.858 33.382 1.00 89.79  ? 1594 ASP B CG  1 
ATOM   4165 O OD1 . ASP B 1 87  ? 3.004   -72.042 33.118 1.00 89.92  ? 1594 ASP B OD1 1 
ATOM   4166 O OD2 . ASP B 1 87  ? 4.170   -73.849 32.665 1.00 89.87  ? 1594 ASP B OD2 1 
ATOM   4167 N N   . GLY B 1 88  ? 5.950   -69.726 36.584 1.00 88.24  ? 1595 GLY B N   1 
ATOM   4168 C CA  . GLY B 1 88  ? 6.363   -69.380 37.939 1.00 88.10  ? 1595 GLY B CA  1 
ATOM   4169 C C   . GLY B 1 88  ? 5.168   -69.307 38.868 1.00 88.25  ? 1595 GLY B C   1 
ATOM   4170 O O   . GLY B 1 88  ? 4.072   -69.758 38.525 1.00 88.47  ? 1595 GLY B O   1 
ATOM   4171 N N   . SER B 1 89  ? 5.380   -68.744 40.053 1.00 86.78  ? 1596 SER B N   1 
ATOM   4172 C CA  . SER B 1 89  ? 4.295   -68.528 41.002 1.00 86.94  ? 1596 SER B CA  1 
ATOM   4173 C C   . SER B 1 89  ? 3.439   -67.346 40.543 1.00 87.06  ? 1596 SER B C   1 
ATOM   4174 O O   . SER B 1 89  ? 3.940   -66.460 39.849 1.00 86.95  ? 1596 SER B O   1 
ATOM   4175 C CB  . SER B 1 89  ? 4.852   -68.273 42.404 1.00 86.83  ? 1596 SER B CB  1 
ATOM   4176 O OG  . SER B 1 89  ? 5.437   -66.988 42.492 1.00 86.69  ? 1596 SER B OG  1 
ATOM   4177 N N   . PRO B 1 90  ? 2.142   -67.340 40.910 1.00 86.86  ? 1597 PRO B N   1 
ATOM   4178 C CA  . PRO B 1 90  ? 1.243   -66.231 40.583 1.00 87.01  ? 1597 PRO B CA  1 
ATOM   4179 C C   . PRO B 1 90  ? 1.819   -64.853 40.916 1.00 86.86  ? 1597 PRO B C   1 
ATOM   4180 O O   . PRO B 1 90  ? 2.360   -64.647 42.005 1.00 86.74  ? 1597 PRO B O   1 
ATOM   4181 C CB  . PRO B 1 90  ? 0.021   -66.513 41.456 1.00 87.27  ? 1597 PRO B CB  1 
ATOM   4182 C CG  . PRO B 1 90  ? -0.002  -67.987 41.582 1.00 87.32  ? 1597 PRO B CG  1 
ATOM   4183 C CD  . PRO B 1 90  ? 1.437   -68.412 41.641 1.00 87.03  ? 1597 PRO B CD  1 
ATOM   4184 N N   . CYS B 1 91  ? 1.703   -63.930 39.966 1.00 86.06  ? 1598 CYS B N   1 
ATOM   4185 C CA  . CYS B 1 91  ? 2.163   -62.558 40.144 1.00 85.94  ? 1598 CYS B CA  1 
ATOM   4186 C C   . CYS B 1 91  ? 0.995   -61.575 40.035 1.00 86.17  ? 1598 CYS B C   1 
ATOM   4187 O O   . CYS B 1 91  ? 0.051   -61.828 39.284 1.00 86.39  ? 1598 CYS B O   1 
ATOM   4188 C CB  . CYS B 1 91  ? 3.256   -62.216 39.124 1.00 85.73  ? 1598 CYS B CB  1 
ATOM   4189 S SG  . CYS B 1 91  ? 2.700   -61.911 37.425 1.00 85.89  ? 1598 CYS B SG  1 
ATOM   4190 N N   . PRO B 1 92  ? 1.059   -60.459 40.791 1.00 86.69  ? 1599 PRO B N   1 
ATOM   4191 C CA  . PRO B 1 92  ? 0.108   -59.348 40.871 1.00 86.89  ? 1599 PRO B CA  1 
ATOM   4192 C C   . PRO B 1 92  ? -0.775  -59.107 39.629 1.00 87.11  ? 1599 PRO B C   1 
ATOM   4193 O O   . PRO B 1 92  ? -1.725  -59.857 39.395 1.00 87.36  ? 1599 PRO B O   1 
ATOM   4194 C CB  . PRO B 1 92  ? 1.028   -58.149 41.121 1.00 86.68  ? 1599 PRO B CB  1 
ATOM   4195 C CG  . PRO B 1 92  ? 2.249   -58.722 41.794 1.00 86.41  ? 1599 PRO B CG  1 
ATOM   4196 C CD  . PRO B 1 92  ? 2.190   -60.223 41.705 1.00 86.44  ? 1599 PRO B CD  1 
ATOM   4197 N N   . SER B 1 93  ? -0.464  -58.051 38.874 1.00 90.89  ? 1600 SER B N   1 
ATOM   4198 C CA  . SER B 1 93  ? -1.175  -57.645 37.644 1.00 91.10  ? 1600 SER B CA  1 
ATOM   4199 C C   . SER B 1 93  ? -2.606  -58.169 37.423 1.00 91.46  ? 1600 SER B C   1 
ATOM   4200 O O   . SER B 1 93  ? -3.578  -57.508 37.799 1.00 91.70  ? 1600 SER B O   1 
ATOM   4201 C CB  . SER B 1 93  ? -0.301  -57.902 36.410 1.00 90.94  ? 1600 SER B CB  1 
ATOM   4202 O OG  . SER B 1 93  ? 0.245   -59.208 36.441 1.00 90.80  ? 1600 SER B OG  1 
ATOM   4203 N N   . LYS B 1 94  ? -2.722  -59.348 36.809 1.00 95.85  ? 1601 LYS B N   1 
ATOM   4204 C CA  . LYS B 1 94  ? -4.019  -59.905 36.408 1.00 96.20  ? 1601 LYS B CA  1 
ATOM   4205 C C   . LYS B 1 94  ? -4.158  -61.400 36.715 1.00 96.23  ? 1601 LYS B C   1 
ATOM   4206 O O   . LYS B 1 94  ? -3.291  -61.997 37.359 1.00 95.99  ? 1601 LYS B O   1 
ATOM   4207 C CB  . LYS B 1 94  ? -4.272  -59.648 34.917 1.00 96.35  ? 1601 LYS B CB  1 
ATOM   4208 C CG  . LYS B 1 94  ? -4.596  -58.205 34.569 1.00 96.47  ? 1601 LYS B CG  1 
ATOM   4209 C CD  . LYS B 1 94  ? -4.437  -57.957 33.079 1.00 96.56  ? 1601 LYS B CD  1 
ATOM   4210 C CE  . LYS B 1 94  ? -4.649  -56.492 32.737 1.00 96.69  ? 1601 LYS B CE  1 
ATOM   4211 N NZ  . LYS B 1 94  ? -4.298  -56.203 31.318 1.00 96.76  ? 1601 LYS B NZ  1 
ATOM   4212 N N   . SER B 1 95  ? -5.257  -61.988 36.242 1.00 98.54  ? 1602 SER B N   1 
ATOM   4213 C CA  . SER B 1 95  ? -5.592  -63.391 36.499 1.00 98.63  ? 1602 SER B CA  1 
ATOM   4214 C C   . SER B 1 95  ? -4.759  -64.360 35.662 1.00 98.48  ? 1602 SER B C   1 
ATOM   4215 O O   . SER B 1 95  ? -4.601  -64.176 34.452 1.00 98.54  ? 1602 SER B O   1 
ATOM   4216 C CB  . SER B 1 95  ? -7.084  -63.642 36.249 1.00 99.05  ? 1602 SER B CB  1 
ATOM   4217 O OG  . SER B 1 95  ? -7.893  -62.873 37.123 1.00 99.22  ? 1602 SER B OG  1 
ATOM   4218 N N   . GLY B 1 96  ? -4.233  -65.389 36.324 1.00 96.61  ? 1603 GLY B N   1 
ATOM   4219 C CA  . GLY B 1 96  ? -3.491  -66.463 35.662 1.00 96.49  ? 1603 GLY B CA  1 
ATOM   4220 C C   . GLY B 1 96  ? -2.092  -66.103 35.192 1.00 96.18  ? 1603 GLY B C   1 
ATOM   4221 O O   . GLY B 1 96  ? -1.499  -66.830 34.390 1.00 96.11  ? 1603 GLY B O   1 
ATOM   4222 N N   . LEU B 1 97  ? -1.562  -64.987 35.688 1.00 93.17  ? 1604 LEU B N   1 
ATOM   4223 C CA  . LEU B 1 97  ? -0.235  -64.528 35.288 1.00 92.89  ? 1604 LEU B CA  1 
ATOM   4224 C C   . LEU B 1 97  ? 0.863   -65.056 36.203 1.00 92.61  ? 1604 LEU B C   1 
ATOM   4225 O O   . LEU B 1 97  ? 0.889   -64.768 37.402 1.00 92.54  ? 1604 LEU B O   1 
ATOM   4226 C CB  . LEU B 1 97  ? -0.182  -62.999 35.180 1.00 92.85  ? 1604 LEU B CB  1 
ATOM   4227 C CG  . LEU B 1 97  ? -0.768  -62.400 33.894 1.00 93.05  ? 1604 LEU B CG  1 
ATOM   4228 C CD1 . LEU B 1 97  ? -0.872  -60.889 33.993 1.00 93.05  ? 1604 LEU B CD1 1 
ATOM   4229 C CD2 . LEU B 1 97  ? 0.040   -62.800 32.657 1.00 92.97  ? 1604 LEU B CD2 1 
ATOM   4230 N N   . SER B 1 98  ? 1.760   -65.841 35.614 1.00 90.26  ? 1605 SER B N   1 
ATOM   4231 C CA  . SER B 1 98  ? 2.894   -66.420 36.323 1.00 90.02  ? 1605 SER B CA  1 
ATOM   4232 C C   . SER B 1 98  ? 4.172   -65.661 35.993 1.00 89.78  ? 1605 SER B C   1 
ATOM   4233 O O   . SER B 1 98  ? 4.281   -65.041 34.931 1.00 89.81  ? 1605 SER B O   1 
ATOM   4234 C CB  . SER B 1 98  ? 3.059   -67.893 35.942 1.00 90.06  ? 1605 SER B CB  1 
ATOM   4235 O OG  . SER B 1 98  ? 1.882   -68.631 36.221 1.00 90.30  ? 1605 SER B OG  1 
ATOM   4236 N N   . TYR B 1 99  ? 5.134   -65.710 36.911 1.00 88.31  ? 1606 TYR B N   1 
ATOM   4237 C CA  . TYR B 1 99  ? 6.462   -65.164 36.659 1.00 88.08  ? 1606 TYR B CA  1 
ATOM   4238 C C   . TYR B 1 99  ? 7.167   -65.993 35.590 1.00 88.06  ? 1606 TYR B C   1 
ATOM   4239 O O   . TYR B 1 99  ? 6.947   -67.203 35.484 1.00 88.15  ? 1606 TYR B O   1 
ATOM   4240 C CB  . TYR B 1 99  ? 7.302   -65.153 37.939 1.00 87.89  ? 1606 TYR B CB  1 
ATOM   4241 C CG  . TYR B 1 99  ? 6.940   -64.080 38.945 1.00 87.87  ? 1606 TYR B CG  1 
ATOM   4242 C CD1 . TYR B 1 99  ? 6.363   -64.413 40.169 1.00 87.95  ? 1606 TYR B CD1 1 
ATOM   4243 C CD2 . TYR B 1 99  ? 7.192   -62.733 38.681 1.00 87.80  ? 1606 TYR B CD2 1 
ATOM   4244 C CE1 . TYR B 1 99  ? 6.034   -63.434 41.102 1.00 87.96  ? 1606 TYR B CE1 1 
ATOM   4245 C CE2 . TYR B 1 99  ? 6.867   -61.745 39.607 1.00 87.80  ? 1606 TYR B CE2 1 
ATOM   4246 C CZ  . TYR B 1 99  ? 6.290   -62.104 40.814 1.00 87.89  ? 1606 TYR B CZ  1 
ATOM   4247 O OH  . TYR B 1 99  ? 5.965   -61.132 41.731 1.00 87.91  ? 1606 TYR B OH  1 
ATOM   4248 N N   . LYS B 1 100 ? 8.001   -65.334 34.793 1.00 87.17  ? 1607 LYS B N   1 
ATOM   4249 C CA  . LYS B 1 100 ? 8.818   -66.018 33.793 1.00 87.16  ? 1607 LYS B CA  1 
ATOM   4250 C C   . LYS B 1 100 ? 10.182  -65.356 33.658 1.00 86.95  ? 1607 LYS B C   1 
ATOM   4251 O O   . LYS B 1 100 ? 10.290  -64.131 33.671 1.00 86.88  ? 1607 LYS B O   1 
ATOM   4252 C CB  . LYS B 1 100 ? 8.101   -66.103 32.439 1.00 87.38  ? 1607 LYS B CB  1 
ATOM   4253 C CG  . LYS B 1 100 ? 7.435   -64.818 31.971 1.00 87.47  ? 1607 LYS B CG  1 
ATOM   4254 C CD  . LYS B 1 100 ? 6.566   -65.079 30.753 1.00 87.74  ? 1607 LYS B CD  1 
ATOM   4255 C CE  . LYS B 1 100 ? 5.729   -63.863 30.394 1.00 87.88  ? 1607 LYS B CE  1 
ATOM   4256 N NZ  . LYS B 1 100 ? 4.865   -64.103 29.203 1.00 88.18  ? 1607 LYS B NZ  1 
ATOM   4257 N N   . SER B 1 101 ? 11.220  -66.178 33.541 1.00 86.11  ? 1608 SER B N   1 
ATOM   4258 C CA  . SER B 1 101 ? 12.590  -65.683 33.483 1.00 85.93  ? 1608 SER B CA  1 
ATOM   4259 C C   . SER B 1 101 ? 13.245  -66.004 32.148 1.00 86.00  ? 1608 SER B C   1 
ATOM   4260 O O   . SER B 1 101 ? 13.164  -67.133 31.663 1.00 86.11  ? 1608 SER B O   1 
ATOM   4261 C CB  . SER B 1 101 ? 13.414  -66.270 34.629 1.00 85.78  ? 1608 SER B CB  1 
ATOM   4262 O OG  . SER B 1 101 ? 12.854  -65.926 35.885 1.00 85.74  ? 1608 SER B OG  1 
ATOM   4263 N N   . VAL B 1 102 ? 13.891  -65.000 31.560 1.00 83.77  ? 1609 VAL B N   1 
ATOM   4264 C CA  . VAL B 1 102 ? 14.599  -65.168 30.290 1.00 83.85  ? 1609 VAL B CA  1 
ATOM   4265 C C   . VAL B 1 102 ? 16.107  -64.938 30.436 1.00 83.69  ? 1609 VAL B C   1 
ATOM   4266 O O   . VAL B 1 102 ? 16.619  -63.850 30.156 1.00 83.63  ? 1609 VAL B O   1 
ATOM   4267 C CB  . VAL B 1 102 ? 14.000  -64.292 29.152 1.00 84.01  ? 1609 VAL B CB  1 
ATOM   4268 C CG1 . VAL B 1 102 ? 12.764  -64.954 28.565 1.00 84.24  ? 1609 VAL B CG1 1 
ATOM   4269 C CG2 . VAL B 1 102 ? 13.680  -62.885 29.644 1.00 83.91  ? 1609 VAL B CG2 1 
ATOM   4270 N N   . ILE B 1 103 ? 16.809  -65.974 30.888 1.00 83.69  ? 1610 ILE B N   1 
ATOM   4271 C CA  . ILE B 1 103 ? 18.260  -65.914 31.033 1.00 83.57  ? 1610 ILE B CA  1 
ATOM   4272 C C   . ILE B 1 103 ? 18.911  -66.032 29.658 1.00 83.71  ? 1610 ILE B C   1 
ATOM   4273 O O   . ILE B 1 103 ? 18.609  -66.951 28.895 1.00 83.88  ? 1610 ILE B O   1 
ATOM   4274 C CB  . ILE B 1 103 ? 18.800  -67.003 31.993 1.00 83.50  ? 1610 ILE B CB  1 
ATOM   4275 C CG1 . ILE B 1 103 ? 18.009  -66.999 33.306 1.00 83.42  ? 1610 ILE B CG1 1 
ATOM   4276 C CG2 . ILE B 1 103 ? 20.291  -66.791 32.264 1.00 83.39  ? 1610 ILE B CG2 1 
ATOM   4277 C CD1 . ILE B 1 103 ? 18.211  -68.228 34.159 1.00 83.41  ? 1610 ILE B CD1 1 
ATOM   4278 N N   . SER B 1 104 ? 19.791  -65.084 29.350 1.00 79.90  ? 1611 SER B N   1 
ATOM   4279 C CA  . SER B 1 104 ? 20.441  -65.017 28.045 1.00 80.04  ? 1611 SER B CA  1 
ATOM   4280 C C   . SER B 1 104 ? 21.964  -65.055 28.173 1.00 79.97  ? 1611 SER B C   1 
ATOM   4281 O O   . SER B 1 104 ? 22.559  -64.250 28.894 1.00 79.80  ? 1611 SER B O   1 
ATOM   4282 C CB  . SER B 1 104 ? 20.001  -63.754 27.302 1.00 80.09  ? 1611 SER B CB  1 
ATOM   4283 O OG  . SER B 1 104 ? 18.591  -63.620 27.299 1.00 80.16  ? 1611 SER B OG  1 
ATOM   4284 N N   . PHE B 1 105 ? 22.586  -65.998 27.471 1.00 79.81  ? 1612 PHE B N   1 
ATOM   4285 C CA  . PHE B 1 105 ? 24.038  -66.144 27.493 1.00 79.79  ? 1612 PHE B CA  1 
ATOM   4286 C C   . PHE B 1 105 ? 24.695  -65.350 26.365 1.00 79.90  ? 1612 PHE B C   1 
ATOM   4287 O O   . PHE B 1 105 ? 24.489  -65.636 25.182 1.00 80.12  ? 1612 PHE B O   1 
ATOM   4288 C CB  . PHE B 1 105 ? 24.436  -67.621 27.425 1.00 79.90  ? 1612 PHE B CB  1 
ATOM   4289 C CG  . PHE B 1 105 ? 24.011  -68.418 28.623 1.00 79.79  ? 1612 PHE B CG  1 
ATOM   4290 C CD1 . PHE B 1 105 ? 24.754  -68.384 29.797 1.00 79.63  ? 1612 PHE B CD1 1 
ATOM   4291 C CD2 . PHE B 1 105 ? 22.869  -69.207 28.579 1.00 79.88  ? 1612 PHE B CD2 1 
ATOM   4292 C CE1 . PHE B 1 105 ? 24.365  -69.121 30.907 1.00 79.55  ? 1612 PHE B CE1 1 
ATOM   4293 C CE2 . PHE B 1 105 ? 22.472  -69.946 29.685 1.00 79.79  ? 1612 PHE B CE2 1 
ATOM   4294 C CZ  . PHE B 1 105 ? 23.222  -69.905 30.850 1.00 79.63  ? 1612 PHE B CZ  1 
ATOM   4295 N N   . VAL B 1 106 ? 25.484  -64.351 26.750 1.00 76.17  ? 1613 VAL B N   1 
ATOM   4296 C CA  . VAL B 1 106 ? 26.145  -63.459 25.801 1.00 76.26  ? 1613 VAL B CA  1 
ATOM   4297 C C   . VAL B 1 106 ? 27.636  -63.798 25.701 1.00 76.31  ? 1613 VAL B C   1 
ATOM   4298 O O   . VAL B 1 106 ? 28.250  -64.226 26.680 1.00 76.20  ? 1613 VAL B O   1 
ATOM   4299 C CB  . VAL B 1 106 ? 25.960  -61.971 26.200 1.00 76.10  ? 1613 VAL B CB  1 
ATOM   4300 C CG1 . VAL B 1 106 ? 26.249  -61.058 25.025 1.00 76.23  ? 1613 VAL B CG1 1 
ATOM   4301 C CG2 . VAL B 1 106 ? 24.548  -61.716 26.717 1.00 76.01  ? 1613 VAL B CG2 1 
ATOM   4302 N N   . CYS B 1 107 ? 28.203  -63.611 24.511 1.00 75.59  ? 1614 CYS B N   1 
ATOM   4303 C CA  . CYS B 1 107 ? 29.608  -63.926 24.247 1.00 75.69  ? 1614 CYS B CA  1 
ATOM   4304 C C   . CYS B 1 107 ? 30.566  -62.911 24.872 1.00 75.53  ? 1614 CYS B C   1 
ATOM   4305 O O   . CYS B 1 107 ? 30.373  -61.698 24.751 1.00 75.45  ? 1614 CYS B O   1 
ATOM   4306 C CB  . CYS B 1 107 ? 29.855  -64.038 22.738 1.00 75.99  ? 1614 CYS B CB  1 
ATOM   4307 S SG  . CYS B 1 107 ? 31.586  -64.250 22.231 1.00 76.17  ? 1614 CYS B SG  1 
ATOM   4308 N N   . ARG B 1 108 ? 31.597  -63.429 25.538 1.00 74.61  ? 1615 ARG B N   1 
ATOM   4309 C CA  . ARG B 1 108 ? 32.642  -62.612 26.150 1.00 74.49  ? 1615 ARG B CA  1 
ATOM   4310 C C   . ARG B 1 108 ? 33.949  -63.407 26.232 1.00 74.62  ? 1615 ARG B C   1 
ATOM   4311 O O   . ARG B 1 108 ? 34.124  -64.218 27.145 1.00 74.55  ? 1615 ARG B O   1 
ATOM   4312 C CB  . ARG B 1 108 ? 32.213  -62.146 27.543 1.00 74.22  ? 1615 ARG B CB  1 
ATOM   4313 C CG  . ARG B 1 108 ? 32.987  -60.953 28.080 1.00 74.08  ? 1615 ARG B CG  1 
ATOM   4314 C CD  . ARG B 1 108 ? 32.671  -60.736 29.545 1.00 73.86  ? 1615 ARG B CD  1 
ATOM   4315 N NE  . ARG B 1 108 ? 32.677  -59.322 29.907 1.00 73.70  ? 1615 ARG B NE  1 
ATOM   4316 C CZ  . ARG B 1 108 ? 32.027  -58.809 30.949 1.00 73.51  ? 1615 ARG B CZ  1 
ATOM   4317 N NH1 . ARG B 1 108 ? 31.303  -59.588 31.745 1.00 73.46  ? 1615 ARG B NH1 1 
ATOM   4318 N NH2 . ARG B 1 108 ? 32.095  -57.507 31.193 1.00 73.40  ? 1615 ARG B NH2 1 
ATOM   4319 N N   . PRO B 1 109 ? 34.871  -63.178 25.275 1.00 75.32  ? 1616 PRO B N   1 
ATOM   4320 C CA  . PRO B 1 109 ? 36.162  -63.878 25.224 1.00 75.50  ? 1616 PRO B CA  1 
ATOM   4321 C C   . PRO B 1 109 ? 37.030  -63.596 26.451 1.00 75.34  ? 1616 PRO B C   1 
ATOM   4322 O O   . PRO B 1 109 ? 37.743  -64.484 26.924 1.00 75.41  ? 1616 PRO B O   1 
ATOM   4323 C CB  . PRO B 1 109 ? 36.823  -63.308 23.963 1.00 75.73  ? 1616 PRO B CB  1 
ATOM   4324 C CG  . PRO B 1 109 ? 36.135  -62.004 23.722 1.00 75.60  ? 1616 PRO B CG  1 
ATOM   4325 C CD  . PRO B 1 109 ? 34.728  -62.217 24.166 1.00 75.43  ? 1616 PRO B CD  1 
ATOM   4326 N N   . GLU B 1 110 ? 36.956  -62.363 26.946 1.00 74.16  ? 1617 GLU B N   1 
ATOM   4327 C CA  . GLU B 1 110 ? 37.651  -61.950 28.156 1.00 74.01  ? 1617 GLU B CA  1 
ATOM   4328 C C   . GLU B 1 110 ? 36.963  -62.551 29.387 1.00 73.83  ? 1617 GLU B C   1 
ATOM   4329 O O   . GLU B 1 110 ? 35.955  -62.024 29.873 1.00 73.64  ? 1617 GLU B O   1 
ATOM   4330 C CB  . GLU B 1 110 ? 37.705  -60.414 28.230 1.00 73.88  ? 1617 GLU B CB  1 
ATOM   4331 C CG  . GLU B 1 110 ? 38.343  -59.827 29.496 1.00 73.72  ? 1617 GLU B CG  1 
ATOM   4332 C CD  . GLU B 1 110 ? 39.822  -60.154 29.645 1.00 73.88  ? 1617 GLU B CD  1 
ATOM   4333 O OE1 . GLU B 1 110 ? 40.550  -60.171 28.627 1.00 74.10  ? 1617 GLU B OE1 1 
ATOM   4334 O OE2 . GLU B 1 110 ? 40.257  -60.383 30.793 1.00 73.80  ? 1617 GLU B OE2 1 
ATOM   4335 N N   . ALA B 1 111 ? 37.507  -63.666 29.871 1.00 73.60  ? 1618 ALA B N   1 
ATOM   4336 C CA  . ALA B 1 111 ? 37.002  -64.322 31.075 1.00 73.45  ? 1618 ALA B CA  1 
ATOM   4337 C C   . ALA B 1 111 ? 37.465  -63.581 32.330 1.00 73.29  ? 1618 ALA B C   1 
ATOM   4338 O O   . ALA B 1 111 ? 38.304  -62.680 32.253 1.00 73.29  ? 1618 ALA B O   1 
ATOM   4339 C CB  . ALA B 1 111 ? 37.446  -65.780 31.111 1.00 73.62  ? 1618 ALA B CB  1 
ATOM   4340 N N   . GLY B 1 112 ? 36.910  -63.954 33.480 1.00 72.60  ? 1619 GLY B N   1 
ATOM   4341 C CA  . GLY B 1 112 ? 37.309  -63.353 34.748 1.00 72.46  ? 1619 GLY B CA  1 
ATOM   4342 C C   . GLY B 1 112 ? 36.225  -63.328 35.809 1.00 72.29  ? 1619 GLY B C   1 
ATOM   4343 O O   . GLY B 1 112 ? 35.467  -64.291 35.946 1.00 72.30  ? 1619 GLY B O   1 
ATOM   4344 N N   . PRO B 1 113 ? 36.142  -62.218 36.567 1.00 73.87  ? 1620 PRO B N   1 
ATOM   4345 C CA  . PRO B 1 113 ? 35.225  -62.123 37.702 1.00 73.72  ? 1620 PRO B CA  1 
ATOM   4346 C C   . PRO B 1 113 ? 33.783  -61.788 37.314 1.00 73.64  ? 1620 PRO B C   1 
ATOM   4347 O O   . PRO B 1 113 ? 32.850  -62.308 37.928 1.00 73.59  ? 1620 PRO B O   1 
ATOM   4348 C CB  . PRO B 1 113 ? 35.832  -61.002 38.546 1.00 73.64  ? 1620 PRO B CB  1 
ATOM   4349 C CG  . PRO B 1 113 ? 36.554  -60.139 37.577 1.00 73.68  ? 1620 PRO B CG  1 
ATOM   4350 C CD  . PRO B 1 113 ? 36.926  -60.981 36.385 1.00 73.84  ? 1620 PRO B CD  1 
ATOM   4351 N N   . THR B 1 114 ? 33.606  -60.937 36.305 1.00 76.94  ? 1621 THR B N   1 
ATOM   4352 C CA  . THR B 1 114 ? 32.273  -60.529 35.857 1.00 76.88  ? 1621 THR B CA  1 
ATOM   4353 C C   . THR B 1 114 ? 31.589  -61.604 35.009 1.00 76.99  ? 1621 THR B C   1 
ATOM   4354 O O   . THR B 1 114 ? 30.651  -61.316 34.262 1.00 77.00  ? 1621 THR B O   1 
ATOM   4355 C CB  . THR B 1 114 ? 32.307  -59.187 35.090 1.00 76.84  ? 1621 THR B CB  1 
ATOM   4356 O OG1 . THR B 1 114 ? 33.380  -59.203 34.142 1.00 76.96  ? 1621 THR B OG1 1 
ATOM   4357 C CG2 . THR B 1 114 ? 32.505  -58.026 36.050 1.00 76.70  ? 1621 THR B CG2 1 
ATOM   4358 N N   . ASN B 1 115 ? 32.066  -62.841 35.136 1.00 78.33  ? 1622 ASN B N   1 
ATOM   4359 C CA  . ASN B 1 115 ? 31.452  -63.992 34.484 1.00 78.44  ? 1622 ASN B CA  1 
ATOM   4360 C C   . ASN B 1 115 ? 30.417  -64.658 35.388 1.00 78.38  ? 1622 ASN B C   1 
ATOM   4361 O O   . ASN B 1 115 ? 30.538  -65.838 35.728 1.00 78.44  ? 1622 ASN B O   1 
ATOM   4362 C CB  . ASN B 1 115 ? 32.521  -65.001 34.052 1.00 78.60  ? 1622 ASN B CB  1 
ATOM   4363 C CG  . ASN B 1 115 ? 33.229  -64.599 32.766 1.00 78.73  ? 1622 ASN B CG  1 
ATOM   4364 O OD1 . ASN B 1 115 ? 33.116  -63.464 32.300 1.00 78.68  ? 1622 ASN B OD1 1 
ATOM   4365 N ND2 . ASN B 1 115 ? 33.966  -65.538 32.188 1.00 78.92  ? 1622 ASN B ND2 1 
ATOM   4366 N N   . ARG B 1 116 ? 29.405  -63.883 35.776 1.00 83.61  ? 1623 ARG B N   1 
ATOM   4367 C CA  . ARG B 1 116 ? 28.319  -64.356 36.641 1.00 83.57  ? 1623 ARG B CA  1 
ATOM   4368 C C   . ARG B 1 116 ? 26.950  -63.861 36.157 1.00 83.55  ? 1623 ARG B C   1 
ATOM   4369 O O   . ARG B 1 116 ? 26.869  -62.832 35.480 1.00 83.53  ? 1623 ARG B O   1 
ATOM   4370 C CB  . ARG B 1 116 ? 28.555  -63.923 38.093 1.00 83.46  ? 1623 ARG B CB  1 
ATOM   4371 C CG  . ARG B 1 116 ? 29.611  -64.739 38.814 1.00 83.51  ? 1623 ARG B CG  1 
ATOM   4372 C CD  . ARG B 1 116 ? 29.480  -64.618 40.320 1.00 83.45  ? 1623 ARG B CD  1 
ATOM   4373 N NE  . ARG B 1 116 ? 30.566  -65.315 41.010 1.00 83.52  ? 1623 ARG B NE  1 
ATOM   4374 C CZ  . ARG B 1 116 ? 30.534  -66.594 41.382 1.00 83.61  ? 1623 ARG B CZ  1 
ATOM   4375 N NH1 . ARG B 1 116 ? 29.462  -67.342 41.140 1.00 83.64  ? 1623 ARG B NH1 1 
ATOM   4376 N NH2 . ARG B 1 116 ? 31.580  -67.125 42.003 1.00 83.68  ? 1623 ARG B NH2 1 
ATOM   4377 N N   . PRO B 1 117 ? 25.868  -64.595 36.496 1.00 85.56  ? 1624 PRO B N   1 
ATOM   4378 C CA  . PRO B 1 117 ? 24.524  -64.143 36.132 1.00 85.56  ? 1624 PRO B CA  1 
ATOM   4379 C C   . PRO B 1 117 ? 24.142  -62.844 36.844 1.00 85.44  ? 1624 PRO B C   1 
ATOM   4380 O O   . PRO B 1 117 ? 24.392  -62.695 38.043 1.00 85.37  ? 1624 PRO B O   1 
ATOM   4381 C CB  . PRO B 1 117 ? 23.625  -65.296 36.595 1.00 85.63  ? 1624 PRO B CB  1 
ATOM   4382 C CG  . PRO B 1 117 ? 24.409  -66.003 37.640 1.00 85.60  ? 1624 PRO B CG  1 
ATOM   4383 C CD  . PRO B 1 117 ? 25.836  -65.880 37.222 1.00 85.60  ? 1624 PRO B CD  1 
ATOM   4384 N N   . MET B 1 118 ? 23.550  -61.916 36.098 1.00 85.54  ? 1625 MET B N   1 
ATOM   4385 C CA  . MET B 1 118 ? 23.180  -60.606 36.628 1.00 85.45  ? 1625 MET B CA  1 
ATOM   4386 C C   . MET B 1 118 ? 21.736  -60.245 36.303 1.00 85.51  ? 1625 MET B C   1 
ATOM   4387 O O   . MET B 1 118 ? 21.200  -60.659 35.274 1.00 85.62  ? 1625 MET B O   1 
ATOM   4388 C CB  . MET B 1 118 ? 24.100  -59.524 36.062 1.00 85.40  ? 1625 MET B CB  1 
ATOM   4389 C CG  . MET B 1 118 ? 25.508  -59.523 36.624 1.00 85.34  ? 1625 MET B CG  1 
ATOM   4390 S SD  . MET B 1 118 ? 26.530  -58.257 35.849 1.00 85.32  ? 1625 MET B SD  1 
ATOM   4391 C CE  . MET B 1 118 ? 25.821  -56.757 36.527 1.00 85.21  ? 1625 MET B CE  1 
ATOM   4392 N N   . LEU B 1 119 ? 21.116  -59.466 37.184 1.00 85.71  ? 1626 LEU B N   1 
ATOM   4393 C CA  . LEU B 1 119 ? 19.786  -58.928 36.930 1.00 85.77  ? 1626 LEU B CA  1 
ATOM   4394 C C   . LEU B 1 119 ? 19.916  -57.603 36.186 1.00 85.75  ? 1626 LEU B C   1 
ATOM   4395 O O   . LEU B 1 119 ? 20.444  -56.625 36.723 1.00 85.64  ? 1626 LEU B O   1 
ATOM   4396 C CB  . LEU B 1 119 ? 19.010  -58.739 38.238 1.00 85.76  ? 1626 LEU B CB  1 
ATOM   4397 C CG  . LEU B 1 119 ? 17.515  -58.415 38.135 1.00 85.86  ? 1626 LEU B CG  1 
ATOM   4398 C CD1 . LEU B 1 119 ? 16.695  -59.680 37.915 1.00 85.99  ? 1626 LEU B CD1 1 
ATOM   4399 C CD2 . LEU B 1 119 ? 17.037  -57.683 39.379 1.00 85.84  ? 1626 LEU B CD2 1 
ATOM   4400 N N   . ILE B 1 120 ? 19.444  -57.589 34.943 1.00 82.52  ? 1627 ILE B N   1 
ATOM   4401 C CA  . ILE B 1 120 ? 19.471  -56.388 34.112 1.00 82.52  ? 1627 ILE B CA  1 
ATOM   4402 C C   . ILE B 1 120 ? 18.374  -55.434 34.568 1.00 82.54  ? 1627 ILE B C   1 
ATOM   4403 O O   . ILE B 1 120 ? 18.654  -54.318 35.011 1.00 82.45  ? 1627 ILE B O   1 
ATOM   4404 C CB  . ILE B 1 120 ? 19.290  -56.729 32.605 1.00 82.67  ? 1627 ILE B CB  1 
ATOM   4405 C CG1 . ILE B 1 120 ? 20.302  -57.794 32.150 1.00 82.70  ? 1627 ILE B CG1 1 
ATOM   4406 C CG2 . ILE B 1 120 ? 19.364  -55.470 31.737 1.00 82.69  ? 1627 ILE B CG2 1 
ATOM   4407 C CD1 . ILE B 1 120 ? 21.766  -57.417 32.346 1.00 82.58  ? 1627 ILE B CD1 1 
ATOM   4408 N N   . SER B 1 121 ? 17.131  -55.897 34.453 1.00 83.62  ? 1628 SER B N   1 
ATOM   4409 C CA  . SER B 1 121 ? 15.945  -55.163 34.886 1.00 83.68  ? 1628 SER B CA  1 
ATOM   4410 C C   . SER B 1 121 ? 14.712  -56.040 34.699 1.00 83.86  ? 1628 SER B C   1 
ATOM   4411 O O   . SER B 1 121 ? 14.795  -57.121 34.110 1.00 83.92  ? 1628 SER B O   1 
ATOM   4412 C CB  . SER B 1 121 ? 15.784  -53.859 34.098 1.00 83.72  ? 1628 SER B CB  1 
ATOM   4413 O OG  . SER B 1 121 ? 14.763  -53.053 34.659 1.00 83.78  ? 1628 SER B OG  1 
ATOM   4414 N N   . LEU B 1 122 ? 13.573  -55.570 35.208 1.00 85.36  ? 1629 LEU B N   1 
ATOM   4415 C CA  . LEU B 1 122 ? 12.297  -56.265 35.041 1.00 85.55  ? 1629 LEU B CA  1 
ATOM   4416 C C   . LEU B 1 122 ? 11.284  -55.443 34.263 1.00 85.71  ? 1629 LEU B C   1 
ATOM   4417 O O   . LEU B 1 122 ? 11.240  -54.216 34.378 1.00 85.67  ? 1629 LEU B O   1 
ATOM   4418 C CB  . LEU B 1 122 ? 11.671  -56.615 36.395 1.00 85.57  ? 1629 LEU B CB  1 
ATOM   4419 C CG  . LEU B 1 122 ? 12.129  -57.780 37.274 1.00 85.47  ? 1629 LEU B CG  1 
ATOM   4420 C CD1 . LEU B 1 122 ? 10.905  -58.618 37.599 1.00 85.63  ? 1629 LEU B CD1 1 
ATOM   4421 C CD2 . LEU B 1 122 ? 13.196  -58.647 36.629 1.00 85.40  ? 1629 LEU B CD2 1 
ATOM   4422 N N   . ASP B 1 123 ? 10.467  -56.136 33.475 1.00 87.16  ? 1630 ASP B N   1 
ATOM   4423 C CA  . ASP B 1 123 ? 9.252   -55.553 32.934 1.00 87.36  ? 1630 ASP B CA  1 
ATOM   4424 C C   . ASP B 1 123 ? 8.136   -55.926 33.902 1.00 87.47  ? 1630 ASP B C   1 
ATOM   4425 O O   . ASP B 1 123 ? 7.798   -57.105 34.050 1.00 87.52  ? 1630 ASP B O   1 
ATOM   4426 C CB  . ASP B 1 123 ? 8.970   -56.083 31.525 1.00 87.56  ? 1630 ASP B CB  1 
ATOM   4427 C CG  . ASP B 1 123 ? 7.981   -55.219 30.760 1.00 87.77  ? 1630 ASP B CG  1 
ATOM   4428 O OD1 . ASP B 1 123 ? 6.767   -55.282 31.052 1.00 87.95  ? 1630 ASP B OD1 1 
ATOM   4429 O OD2 . ASP B 1 123 ? 8.421   -54.483 29.853 1.00 87.77  ? 1630 ASP B OD2 1 
ATOM   4430 N N   . LYS B 1 124 ? 7.592   -54.918 34.580 1.00 88.17  ? 1631 LYS B N   1 
ATOM   4431 C CA  . LYS B 1 124 ? 6.567   -55.116 35.607 1.00 88.28  ? 1631 LYS B CA  1 
ATOM   4432 C C   . LYS B 1 124 ? 5.296   -55.736 35.033 1.00 88.56  ? 1631 LYS B C   1 
ATOM   4433 O O   . LYS B 1 124 ? 4.690   -56.612 35.650 1.00 88.64  ? 1631 LYS B O   1 
ATOM   4434 C CB  . LYS B 1 124 ? 6.214   -53.788 36.284 1.00 88.30  ? 1631 LYS B CB  1 
ATOM   4435 C CG  . LYS B 1 124 ? 7.391   -53.007 36.839 1.00 88.05  ? 1631 LYS B CG  1 
ATOM   4436 C CD  . LYS B 1 124 ? 6.944   -51.620 37.260 1.00 88.10  ? 1631 LYS B CD  1 
ATOM   4437 C CE  . LYS B 1 124 ? 8.120   -50.675 37.399 1.00 87.87  ? 1631 LYS B CE  1 
ATOM   4438 N NZ  . LYS B 1 124 ? 7.663   -49.264 37.527 1.00 87.93  ? 1631 LYS B NZ  1 
ATOM   4439 N N   . GLN B 1 125 ? 4.913   -55.274 33.846 1.00 92.38  ? 1632 GLN B N   1 
ATOM   4440 C CA  . GLN B 1 125 ? 3.655   -55.655 33.214 1.00 92.67  ? 1632 GLN B CA  1 
ATOM   4441 C C   . GLN B 1 125 ? 3.569   -57.147 32.894 1.00 92.73  ? 1632 GLN B C   1 
ATOM   4442 O O   . GLN B 1 125 ? 2.635   -57.823 33.325 1.00 92.88  ? 1632 GLN B O   1 
ATOM   4443 C CB  . GLN B 1 125 ? 3.424   -54.822 31.947 1.00 92.82  ? 1632 GLN B CB  1 
ATOM   4444 C CG  . GLN B 1 125 ? 3.436   -53.310 32.169 1.00 92.79  ? 1632 GLN B CG  1 
ATOM   4445 C CD  . GLN B 1 125 ? 2.248   -52.816 32.980 1.00 92.99  ? 1632 GLN B CD  1 
ATOM   4446 O OE1 . GLN B 1 125 ? 1.094   -52.991 32.587 1.00 93.27  ? 1632 GLN B OE1 1 
ATOM   4447 N NE2 . GLN B 1 125 ? 2.530   -52.185 34.115 1.00 92.85  ? 1632 GLN B NE2 1 
ATOM   4448 N N   . THR B 1 126 ? 4.550   -57.654 32.153 1.00 93.94  ? 1633 THR B N   1 
ATOM   4449 C CA  . THR B 1 126 ? 4.528   -59.042 31.682 1.00 94.01  ? 1633 THR B CA  1 
ATOM   4450 C C   . THR B 1 126 ? 5.167   -60.039 32.664 1.00 93.83  ? 1633 THR B C   1 
ATOM   4451 O O   . THR B 1 126 ? 5.358   -61.210 32.328 1.00 93.85  ? 1633 THR B O   1 
ATOM   4452 C CB  . THR B 1 126 ? 5.124   -59.171 30.243 1.00 94.05  ? 1633 THR B CB  1 
ATOM   4453 O OG1 . THR B 1 126 ? 5.265   -60.553 29.888 1.00 94.10  ? 1633 THR B OG1 1 
ATOM   4454 C CG2 . THR B 1 126 ? 6.475   -58.476 30.131 1.00 93.82  ? 1633 THR B CG2 1 
ATOM   4455 N N   . CYS B 1 127 ? 5.464   -59.570 33.877 1.00 88.17  ? 1634 CYS B N   1 
ATOM   4456 C CA  . CYS B 1 127 ? 6.075   -60.392 34.934 1.00 88.01  ? 1634 CYS B CA  1 
ATOM   4457 C C   . CYS B 1 127 ? 7.270   -61.208 34.436 1.00 87.86  ? 1634 CYS B C   1 
ATOM   4458 O O   . CYS B 1 127 ? 7.348   -62.422 34.646 1.00 87.87  ? 1634 CYS B O   1 
ATOM   4459 C CB  . CYS B 1 127 ? 5.031   -61.298 35.599 1.00 88.17  ? 1634 CYS B CB  1 
ATOM   4460 S SG  . CYS B 1 127 ? 3.953   -60.450 36.769 1.00 88.30  ? 1634 CYS B SG  1 
ATOM   4461 N N   . THR B 1 128 ? 8.197   -60.521 33.777 1.00 86.45  ? 1635 THR B N   1 
ATOM   4462 C CA  . THR B 1 128 ? 9.343   -61.168 33.155 1.00 86.35  ? 1635 THR B CA  1 
ATOM   4463 C C   . THR B 1 128 ? 10.639  -60.763 33.852 1.00 86.10  ? 1635 THR B C   1 
ATOM   4464 O O   . THR B 1 128 ? 10.777  -59.631 34.322 1.00 86.01  ? 1635 THR B O   1 
ATOM   4465 C CB  . THR B 1 128 ? 9.417   -60.846 31.644 1.00 86.47  ? 1635 THR B CB  1 
ATOM   4466 O OG1 . THR B 1 128 ? 8.105   -60.917 31.078 1.00 86.72  ? 1635 THR B OG1 1 
ATOM   4467 C CG2 . THR B 1 128 ? 10.313  -61.837 30.916 1.00 86.46  ? 1635 THR B CG2 1 
ATOM   4468 N N   . LEU B 1 129 ? 11.575  -61.706 33.920 1.00 84.03  ? 1636 LEU B N   1 
ATOM   4469 C CA  . LEU B 1 129 ? 12.888  -61.470 34.509 1.00 83.81  ? 1636 LEU B CA  1 
ATOM   4470 C C   . LEU B 1 129 ? 13.991  -61.599 33.461 1.00 83.78  ? 1636 LEU B C   1 
ATOM   4471 O O   . LEU B 1 129 ? 14.310  -62.703 33.009 1.00 83.83  ? 1636 LEU B O   1 
ATOM   4472 C CB  . LEU B 1 129 ? 13.137  -62.423 35.685 1.00 83.74  ? 1636 LEU B CB  1 
ATOM   4473 C CG  . LEU B 1 129 ? 12.406  -62.168 37.009 1.00 83.74  ? 1636 LEU B CG  1 
ATOM   4474 C CD1 . LEU B 1 129 ? 10.975  -62.697 36.981 1.00 83.93  ? 1636 LEU B CD1 1 
ATOM   4475 C CD2 . LEU B 1 129 ? 13.176  -62.781 38.170 1.00 83.62  ? 1636 LEU B CD2 1 
ATOM   4476 N N   . PHE B 1 130 ? 14.558  -60.460 33.073 1.00 80.93  ? 1637 PHE B N   1 
ATOM   4477 C CA  . PHE B 1 130 ? 15.627  -60.424 32.081 1.00 80.92  ? 1637 PHE B CA  1 
ATOM   4478 C C   . PHE B 1 130 ? 16.984  -60.645 32.746 1.00 80.74  ? 1637 PHE B C   1 
ATOM   4479 O O   . PHE B 1 130 ? 17.376  -59.894 33.645 1.00 80.60  ? 1637 PHE B O   1 
ATOM   4480 C CB  . PHE B 1 130 ? 15.617  -59.098 31.308 1.00 80.94  ? 1637 PHE B CB  1 
ATOM   4481 C CG  . PHE B 1 130 ? 14.292  -58.768 30.672 1.00 81.12  ? 1637 PHE B CG  1 
ATOM   4482 C CD1 . PHE B 1 130 ? 13.849  -59.458 29.547 1.00 81.33  ? 1637 PHE B CD1 1 
ATOM   4483 C CD2 . PHE B 1 130 ? 13.495  -57.753 31.190 1.00 81.12  ? 1637 PHE B CD2 1 
ATOM   4484 C CE1 . PHE B 1 130 ? 12.626  -59.153 28.957 1.00 81.53  ? 1637 PHE B CE1 1 
ATOM   4485 C CE2 . PHE B 1 130 ? 12.271  -57.438 30.606 1.00 81.32  ? 1637 PHE B CE2 1 
ATOM   4486 C CZ  . PHE B 1 130 ? 11.835  -58.140 29.488 1.00 81.53  ? 1637 PHE B CZ  1 
ATOM   4487 N N   . PHE B 1 131 ? 17.684  -61.687 32.303 1.00 81.43  ? 1638 PHE B N   1 
ATOM   4488 C CA  . PHE B 1 131 ? 19.009  -62.019 32.819 1.00 81.31  ? 1638 PHE B CA  1 
ATOM   4489 C C   . PHE B 1 131 ? 20.062  -62.023 31.715 1.00 81.35  ? 1638 PHE B C   1 
ATOM   4490 O O   . PHE B 1 131 ? 19.752  -62.275 30.548 1.00 81.51  ? 1638 PHE B O   1 
ATOM   4491 C CB  . PHE B 1 131 ? 18.995  -63.383 33.517 1.00 81.31  ? 1638 PHE B CB  1 
ATOM   4492 C CG  . PHE B 1 131 ? 18.329  -63.376 34.864 1.00 81.25  ? 1638 PHE B CG  1 
ATOM   4493 C CD1 . PHE B 1 131 ? 19.027  -62.973 35.998 1.00 81.10  ? 1638 PHE B CD1 1 
ATOM   4494 C CD2 . PHE B 1 131 ? 17.009  -63.789 35.003 1.00 81.35  ? 1638 PHE B CD2 1 
ATOM   4495 C CE1 . PHE B 1 131 ? 18.418  -62.969 37.249 1.00 81.08  ? 1638 PHE B CE1 1 
ATOM   4496 C CE2 . PHE B 1 131 ? 16.392  -63.791 36.251 1.00 81.33  ? 1638 PHE B CE2 1 
ATOM   4497 C CZ  . PHE B 1 131 ? 17.097  -63.380 37.375 1.00 81.19  ? 1638 PHE B CZ  1 
ATOM   4498 N N   . SER B 1 132 ? 21.303  -61.738 32.099 1.00 78.61  ? 1639 SER B N   1 
ATOM   4499 C CA  . SER B 1 132 ? 22.443  -61.803 31.190 1.00 78.67  ? 1639 SER B CA  1 
ATOM   4500 C C   . SER B 1 132 ? 23.658  -62.413 31.879 1.00 78.59  ? 1639 SER B C   1 
ATOM   4501 O O   . SER B 1 132 ? 23.980  -62.067 33.019 1.00 78.45  ? 1639 SER B O   1 
ATOM   4502 C CB  . SER B 1 132 ? 22.789  -60.419 30.642 1.00 78.63  ? 1639 SER B CB  1 
ATOM   4503 O OG  . SER B 1 132 ? 21.713  -59.884 29.895 1.00 78.73  ? 1639 SER B OG  1 
ATOM   4504 N N   . TRP B 1 133 ? 24.322  -63.324 31.173 1.00 79.98  ? 1640 TRP B N   1 
ATOM   4505 C CA  . TRP B 1 133 ? 25.511  -63.998 31.680 1.00 79.95  ? 1640 TRP B CA  1 
ATOM   4506 C C   . TRP B 1 133 ? 26.580  -64.032 30.587 1.00 80.08  ? 1640 TRP B C   1 
ATOM   4507 O O   . TRP B 1 133 ? 26.521  -64.856 29.669 1.00 80.24  ? 1640 TRP B O   1 
ATOM   4508 C CB  . TRP B 1 133 ? 25.159  -65.419 32.138 1.00 80.00  ? 1640 TRP B CB  1 
ATOM   4509 C CG  . TRP B 1 133 ? 26.193  -66.081 33.014 1.00 79.96  ? 1640 TRP B CG  1 
ATOM   4510 C CD1 . TRP B 1 133 ? 27.509  -65.736 33.145 1.00 79.93  ? 1640 TRP B CD1 1 
ATOM   4511 C CD2 . TRP B 1 133 ? 25.998  -67.227 33.854 1.00 79.97  ? 1640 TRP B CD2 1 
ATOM   4512 N NE1 . TRP B 1 133 ? 28.138  -66.584 34.021 1.00 79.93  ? 1640 TRP B NE1 1 
ATOM   4513 C CE2 . TRP B 1 133 ? 27.235  -67.510 34.470 1.00 79.95  ? 1640 TRP B CE2 1 
ATOM   4514 C CE3 . TRP B 1 133 ? 24.895  -68.038 34.150 1.00 80.00  ? 1640 TRP B CE3 1 
ATOM   4515 C CZ2 . TRP B 1 133 ? 27.402  -68.569 35.367 1.00 79.97  ? 1640 TRP B CZ2 1 
ATOM   4516 C CZ3 . TRP B 1 133 ? 25.062  -69.093 35.041 1.00 80.01  ? 1640 TRP B CZ3 1 
ATOM   4517 C CH2 . TRP B 1 133 ? 26.307  -69.346 35.638 1.00 79.99  ? 1640 TRP B CH2 1 
ATOM   4518 N N   . HIS B 1 134 ? 27.551  -63.129 30.689 1.00 77.10  ? 1641 HIS B N   1 
ATOM   4519 C CA  . HIS B 1 134 ? 28.611  -63.013 29.692 1.00 77.23  ? 1641 HIS B CA  1 
ATOM   4520 C C   . HIS B 1 134 ? 29.717  -64.046 29.918 1.00 77.31  ? 1641 HIS B C   1 
ATOM   4521 O O   . HIS B 1 134 ? 30.548  -63.898 30.818 1.00 77.21  ? 1641 HIS B O   1 
ATOM   4522 C CB  . HIS B 1 134 ? 29.177  -61.590 29.676 1.00 77.14  ? 1641 HIS B CB  1 
ATOM   4523 C CG  . HIS B 1 134 ? 28.246  -60.577 29.088 1.00 77.13  ? 1641 HIS B CG  1 
ATOM   4524 N ND1 . HIS B 1 134 ? 27.120  -60.130 29.746 1.00 77.00  ? 1641 HIS B ND1 1 
ATOM   4525 C CD2 . HIS B 1 134 ? 28.275  -59.920 27.904 1.00 77.25  ? 1641 HIS B CD2 1 
ATOM   4526 C CE1 . HIS B 1 134 ? 26.492  -59.247 28.990 1.00 77.05  ? 1641 HIS B CE1 1 
ATOM   4527 N NE2 . HIS B 1 134 ? 27.173  -59.100 27.868 1.00 77.20  ? 1641 HIS B NE2 1 
ATOM   4528 N N   . THR B 1 135 ? 29.711  -65.095 29.096 1.00 80.37  ? 1642 THR B N   1 
ATOM   4529 C CA  . THR B 1 135 ? 30.686  -66.184 29.205 1.00 80.48  ? 1642 THR B CA  1 
ATOM   4530 C C   . THR B 1 135 ? 31.461  -66.415 27.909 1.00 80.71  ? 1642 THR B C   1 
ATOM   4531 O O   . THR B 1 135 ? 30.931  -66.178 26.819 1.00 80.83  ? 1642 THR B O   1 
ATOM   4532 C CB  . THR B 1 135 ? 30.016  -67.526 29.585 1.00 80.51  ? 1642 THR B CB  1 
ATOM   4533 O OG1 . THR B 1 135 ? 28.877  -67.753 28.745 1.00 80.61  ? 1642 THR B OG1 1 
ATOM   4534 C CG2 . THR B 1 135 ? 29.591  -67.530 31.040 1.00 80.32  ? 1642 THR B CG2 1 
ATOM   4535 N N   . PRO B 1 136 ? 32.723  -66.883 28.024 1.00 82.74  ? 1643 PRO B N   1 
ATOM   4536 C CA  . PRO B 1 136 ? 33.451  -67.403 26.863 1.00 83.01  ? 1643 PRO B CA  1 
ATOM   4537 C C   . PRO B 1 136 ? 32.868  -68.737 26.386 1.00 83.17  ? 1643 PRO B C   1 
ATOM   4538 O O   . PRO B 1 136 ? 33.252  -69.238 25.326 1.00 83.42  ? 1643 PRO B O   1 
ATOM   4539 C CB  . PRO B 1 136 ? 34.875  -67.595 27.397 1.00 83.05  ? 1643 PRO B CB  1 
ATOM   4540 C CG  . PRO B 1 136 ? 34.710  -67.780 28.863 1.00 82.83  ? 1643 PRO B CG  1 
ATOM   4541 C CD  . PRO B 1 136 ? 33.542  -66.925 29.251 1.00 82.62  ? 1643 PRO B CD  1 
ATOM   4542 N N   . LEU B 1 137 ? 31.951  -69.295 27.176 1.00 85.74  ? 1644 LEU B N   1 
ATOM   4543 C CA  . LEU B 1 137 ? 31.223  -70.512 26.821 1.00 85.87  ? 1644 LEU B CA  1 
ATOM   4544 C C   . LEU B 1 137 ? 30.140  -70.227 25.781 1.00 85.96  ? 1644 LEU B C   1 
ATOM   4545 O O   . LEU B 1 137 ? 29.686  -71.134 25.080 1.00 86.14  ? 1644 LEU B O   1 
ATOM   4546 C CB  . LEU B 1 137 ? 30.601  -71.144 28.070 1.00 85.70  ? 1644 LEU B CB  1 
ATOM   4547 C CG  . LEU B 1 137 ? 31.548  -71.735 29.120 1.00 85.66  ? 1644 LEU B CG  1 
ATOM   4548 C CD1 . LEU B 1 137 ? 30.900  -71.727 30.495 1.00 85.45  ? 1644 LEU B CD1 1 
ATOM   4549 C CD2 . LEU B 1 137 ? 31.996  -73.142 28.741 1.00 85.88  ? 1644 LEU B CD2 1 
ATOM   4550 N N   . ALA B 1 138 ? 29.734  -68.962 25.689 1.00 82.84  ? 1645 ALA B N   1 
ATOM   4551 C CA  . ALA B 1 138 ? 28.716  -68.530 24.735 1.00 82.93  ? 1645 ALA B CA  1 
ATOM   4552 C C   . ALA B 1 138 ? 29.327  -67.926 23.465 1.00 83.14  ? 1645 ALA B C   1 
ATOM   4553 O O   . ALA B 1 138 ? 28.677  -67.144 22.767 1.00 83.21  ? 1645 ALA B O   1 
ATOM   4554 C CB  . ALA B 1 138 ? 27.762  -67.543 25.399 1.00 82.71  ? 1645 ALA B CB  1 
ATOM   4555 N N   . CYS B 1 139 ? 30.567  -68.306 23.161 1.00 82.55  ? 1646 CYS B N   1 
ATOM   4556 C CA  . CYS B 1 139 ? 31.285  -67.749 22.014 1.00 82.77  ? 1646 CYS B CA  1 
ATOM   4557 C C   . CYS B 1 139 ? 31.552  -68.762 20.904 1.00 83.11  ? 1646 CYS B C   1 
ATOM   4558 O O   . CYS B 1 139 ? 32.071  -69.854 21.147 1.00 83.19  ? 1646 CYS B O   1 
ATOM   4559 C CB  . CYS B 1 139 ? 32.590  -67.091 22.463 1.00 82.69  ? 1646 CYS B CB  1 
ATOM   4560 S SG  . CYS B 1 139 ? 32.333  -65.645 23.508 1.00 82.35  ? 1646 CYS B SG  1 
ATOM   4561 N N   . GLU B 1 140 ? 31.189  -68.372 19.684 1.00 85.84  ? 1647 GLU B N   1 
ATOM   4562 C CA  . GLU B 1 140 ? 31.354  -69.200 18.492 1.00 86.21  ? 1647 GLU B CA  1 
ATOM   4563 C C   . GLU B 1 140 ? 32.664  -68.868 17.777 1.00 86.42  ? 1647 GLU B C   1 
ATOM   4564 O O   . GLU B 1 140 ? 33.490  -69.751 17.536 1.00 86.61  ? 1647 GLU B O   1 
ATOM   4565 C CB  . GLU B 1 140 ? 30.158  -69.000 17.550 1.00 86.35  ? 1647 GLU B CB  1 
ATOM   4566 C CG  . GLU B 1 140 ? 30.243  -69.746 16.221 1.00 86.75  ? 1647 GLU B CG  1 
ATOM   4567 C CD  . GLU B 1 140 ? 29.107  -69.399 15.269 1.00 86.92  ? 1647 GLU B CD  1 
ATOM   4568 O OE1 . GLU B 1 140 ? 27.970  -69.173 15.737 1.00 86.74  ? 1647 GLU B OE1 1 
ATOM   4569 O OE2 . GLU B 1 140 ? 29.352  -69.361 14.046 1.00 87.25  ? 1647 GLU B OE2 1 
ATOM   4570 N N   . GLN B 1 141 ? 32.841  -67.590 17.447 1.00 84.70  ? 1648 GLN B N   1 
ATOM   4571 C CA  . GLN B 1 141 ? 34.019  -67.118 16.724 1.00 84.92  ? 1648 GLN B CA  1 
ATOM   4572 C C   . GLN B 1 141 ? 35.058  -66.536 17.677 1.00 84.71  ? 1648 GLN B C   1 
ATOM   4573 O O   . GLN B 1 141 ? 34.892  -66.580 18.900 1.00 84.42  ? 1648 GLN B O   1 
ATOM   4574 C CB  . GLN B 1 141 ? 33.620  -66.049 15.702 1.00 85.06  ? 1648 GLN B CB  1 
ATOM   4575 C CG  . GLN B 1 141 ? 32.659  -66.513 14.617 1.00 85.32  ? 1648 GLN B CG  1 
ATOM   4576 C CD  . GLN B 1 141 ? 32.321  -65.414 13.621 1.00 85.47  ? 1648 GLN B CD  1 
ATOM   4577 O OE1 . GLN B 1 141 ? 32.788  -64.279 13.739 1.00 85.34  ? 1648 GLN B OE1 1 
ATOM   4578 N NE2 . GLN B 1 141 ? 31.504  -65.751 12.629 1.00 85.76  ? 1648 GLN B NE2 1 
ATOM   4579 N N   . ALA B 1 142 ? 36.129  -65.993 17.102 1.00 82.96  ? 1649 ALA B N   1 
ATOM   4580 C CA  . ALA B 1 142 ? 37.111  -65.218 17.850 1.00 82.78  ? 1649 ALA B CA  1 
ATOM   4581 C C   . ALA B 1 142 ? 36.609  -63.779 18.012 1.00 82.54  ? 1649 ALA B C   1 
ATOM   4582 O O   . ALA B 1 142 ? 35.405  -63.523 17.920 1.00 82.39  ? 1649 ALA B O   1 
ATOM   4583 C CB  . ALA B 1 142 ? 38.460  -65.252 17.144 1.00 83.11  ? 1649 ALA B CB  1 
ATOM   4584 N N   . THR B 1 143 ? 37.526  -62.845 18.251 1.00 78.53  ? 1650 THR B N   1 
ATOM   4585 C CA  . THR B 1 143 ? 37.162  -61.441 18.428 1.00 78.31  ? 1650 THR B CA  1 
ATOM   4586 C C   . THR B 1 143 ? 37.794  -60.581 17.334 1.00 78.55  ? 1650 THR B C   1 
ATOM   4587 O O   . THR B 1 143 ? 38.722  -59.807 17.590 1.00 78.51  ? 1650 THR B O   1 
ATOM   4588 C CB  . THR B 1 143 ? 37.565  -60.920 19.827 1.00 77.99  ? 1650 THR B CB  1 
ATOM   4589 O OG1 . THR B 1 143 ? 37.437  -61.974 20.789 1.00 77.87  ? 1650 THR B OG1 1 
ATOM   4590 C CG2 . THR B 1 143 ? 36.683  -59.747 20.240 1.00 77.70  ? 1650 THR B CG2 1 
ATOM   4591 N N   . GLU B 1 144 ? 37.278  -60.732 16.114 1.00 80.92  ? 1651 GLU B N   1 
ATOM   4592 C CA  . GLU B 1 144 ? 37.780  -60.011 14.941 1.00 81.20  ? 1651 GLU B CA  1 
ATOM   4593 C C   . GLU B 1 144 ? 37.679  -58.500 15.136 1.00 81.00  ? 1651 GLU B C   1 
ATOM   4594 O O   . GLU B 1 144 ? 36.581  -57.936 15.161 1.00 80.85  ? 1651 GLU B O   1 
ATOM   4595 C CB  . GLU B 1 144 ? 37.028  -60.446 13.680 1.00 81.52  ? 1651 GLU B CB  1 
ATOM   4596 C CG  . GLU B 1 144 ? 37.301  -61.883 13.256 1.00 81.81  ? 1651 GLU B CG  1 
ATOM   4597 C CD  . GLU B 1 144 ? 36.310  -62.390 12.227 1.00 82.08  ? 1651 GLU B CD  1 
ATOM   4598 O OE1 . GLU B 1 144 ? 36.754  -62.835 11.148 1.00 82.49  ? 1651 GLU B OE1 1 
ATOM   4599 O OE2 . GLU B 1 144 ? 35.089  -62.344 12.493 1.00 81.90  ? 1651 GLU B OE2 1 
ATOM   4600 N N   . CYS B 1 145 ? 38.835  -57.857 15.280 1.00 79.29  ? 1652 CYS B N   1 
ATOM   4601 C CA  . CYS B 1 145 ? 38.895  -56.445 15.646 1.00 79.08  ? 1652 CYS B CA  1 
ATOM   4602 C C   . CYS B 1 145 ? 40.056  -55.704 14.978 1.00 79.31  ? 1652 CYS B C   1 
ATOM   4603 O O   . CYS B 1 145 ? 40.178  -54.482 15.111 1.00 79.17  ? 1652 CYS B O   1 
ATOM   4604 C CB  . CYS B 1 145 ? 38.990  -56.313 17.169 1.00 78.68  ? 1652 CYS B CB  1 
ATOM   4605 S SG  . CYS B 1 145 ? 38.044  -54.944 17.862 1.00 78.33  ? 1652 CYS B SG  1 
ATOM   4606 N N   . SER B 1 146 ? 40.897  -56.444 14.258 1.00 84.33  ? 1653 SER B N   1 
ATOM   4607 C CA  . SER B 1 146 ? 42.075  -55.874 13.601 1.00 84.60  ? 1653 SER B CA  1 
ATOM   4608 C C   . SER B 1 146 ? 41.989  -55.909 12.072 1.00 85.05  ? 1653 SER B C   1 
ATOM   4609 O O   . SER B 1 146 ? 41.503  -56.881 11.486 1.00 85.26  ? 1653 SER B O   1 
ATOM   4610 C CB  . SER B 1 146 ? 43.354  -56.566 14.087 1.00 84.69  ? 1653 SER B CB  1 
ATOM   4611 O OG  . SER B 1 146 ? 43.240  -57.977 14.015 1.00 84.86  ? 1653 SER B OG  1 
ATOM   4612 N N   . VAL B 1 147 ? 42.466  -54.836 11.443 1.00 91.70  ? 1654 VAL B N   1 
ATOM   4613 C CA  . VAL B 1 147 ? 42.462  -54.695 9.984  1.00 92.15  ? 1654 VAL B CA  1 
ATOM   4614 C C   . VAL B 1 147 ? 43.849  -54.275 9.478  1.00 92.45  ? 1654 VAL B C   1 
ATOM   4615 O O   . VAL B 1 147 ? 44.600  -53.609 10.194 1.00 92.26  ? 1654 VAL B O   1 
ATOM   4616 C CB  . VAL B 1 147 ? 41.355  -53.704 9.508  1.00 92.09  ? 1654 VAL B CB  1 
ATOM   4617 C CG1 . VAL B 1 147 ? 41.629  -52.277 9.999  1.00 91.87  ? 1654 VAL B CG1 1 
ATOM   4618 C CG2 . VAL B 1 147 ? 41.189  -53.745 7.987  1.00 92.58  ? 1654 VAL B CG2 1 
ATOM   4619 N N   . ARG B 1 148 ? 44.176  -54.663 8.247  1.00 100.56 ? 1655 ARG B N   1 
ATOM   4620 C CA  . ARG B 1 148 ? 45.515  -54.469 7.691  1.00 100.92 ? 1655 ARG B CA  1 
ATOM   4621 C C   . ARG B 1 148 ? 45.643  -53.192 6.853  1.00 101.10 ? 1655 ARG B C   1 
ATOM   4622 O O   . ARG B 1 148 ? 45.032  -53.074 5.789  1.00 101.37 ? 1655 ARG B O   1 
ATOM   4623 C CB  . ARG B 1 148 ? 45.906  -55.695 6.861  1.00 101.39 ? 1655 ARG B CB  1 
ATOM   4624 C CG  . ARG B 1 148 ? 47.395  -55.902 6.708  1.00 101.71 ? 1655 ARG B CG  1 
ATOM   4625 C CD  . ARG B 1 148 ? 47.689  -57.294 6.181  1.00 102.10 ? 1655 ARG B CD  1 
ATOM   4626 N NE  . ARG B 1 148 ? 49.117  -57.602 6.204  1.00 102.37 ? 1655 ARG B NE  1 
ATOM   4627 C CZ  . ARG B 1 148 ? 49.777  -58.062 7.266  1.00 102.16 ? 1655 ARG B CZ  1 
ATOM   4628 N NH1 . ARG B 1 148 ? 49.147  -58.270 8.417  1.00 101.67 ? 1655 ARG B NH1 1 
ATOM   4629 N NH2 . ARG B 1 148 ? 51.076  -58.311 7.176  1.00 102.47 ? 1655 ARG B NH2 1 
ATOM   4630 N N   . ASN B 1 149 ? 46.438  -52.241 7.344  1.00 101.36 ? 1656 ASN B N   1 
ATOM   4631 C CA  . ASN B 1 149 ? 46.733  -51.012 6.605  1.00 101.54 ? 1656 ASN B CA  1 
ATOM   4632 C C   . ASN B 1 149 ? 48.096  -51.110 5.928  1.00 102.00 ? 1656 ASN B C   1 
ATOM   4633 O O   . ASN B 1 149 ? 49.058  -50.452 6.334  1.00 101.96 ? 1656 ASN B O   1 
ATOM   4634 C CB  . ASN B 1 149 ? 46.661  -49.778 7.519  1.00 101.10 ? 1656 ASN B CB  1 
ATOM   4635 C CG  . ASN B 1 149 ? 46.547  -48.467 6.738  1.00 101.23 ? 1656 ASN B CG  1 
ATOM   4636 O OD1 . ASN B 1 149 ? 46.052  -48.445 5.609  1.00 101.53 ? 1656 ASN B OD1 1 
ATOM   4637 N ND2 . ASN B 1 149 ? 46.988  -47.366 7.356  1.00 101.00 ? 1656 ASN B ND2 1 
ATOM   4638 N N   . GLY B 1 150 ? 48.167  -51.946 4.895  1.00 111.88 ? 1657 GLY B N   1 
ATOM   4639 C CA  . GLY B 1 150 ? 49.409  -52.186 4.166  1.00 112.39 ? 1657 GLY B CA  1 
ATOM   4640 C C   . GLY B 1 150 ? 50.232  -53.282 4.813  1.00 112.42 ? 1657 GLY B C   1 
ATOM   4641 O O   . GLY B 1 150 ? 49.754  -54.405 4.985  1.00 112.40 ? 1657 GLY B O   1 
ATOM   4642 N N   . SER B 1 151 ? 51.472  -52.952 5.167  1.00 111.86 ? 1658 SER B N   1 
ATOM   4643 C CA  . SER B 1 151 ? 52.361  -53.881 5.866  1.00 111.88 ? 1658 SER B CA  1 
ATOM   4644 C C   . SER B 1 151 ? 52.044  -53.928 7.361  1.00 111.30 ? 1658 SER B C   1 
ATOM   4645 O O   . SER B 1 151 ? 52.161  -54.979 7.996  1.00 111.21 ? 1658 SER B O   1 
ATOM   4646 C CB  . SER B 1 151 ? 53.825  -53.493 5.646  1.00 112.23 ? 1658 SER B CB  1 
ATOM   4647 O OG  . SER B 1 151 ? 54.085  -52.180 6.113  1.00 111.96 ? 1658 SER B OG  1 
ATOM   4648 N N   . SER B 1 152 ? 51.644  -52.782 7.908  1.00 98.93  ? 1659 SER B N   1 
ATOM   4649 C CA  . SER B 1 152 ? 51.267  -52.667 9.314  1.00 98.37  ? 1659 SER B CA  1 
ATOM   4650 C C   . SER B 1 152 ? 49.798  -53.028 9.534  1.00 98.07  ? 1659 SER B C   1 
ATOM   4651 O O   . SER B 1 152 ? 48.981  -52.951 8.610  1.00 98.23  ? 1659 SER B O   1 
ATOM   4652 C CB  . SER B 1 152 ? 51.547  -51.251 9.826  1.00 98.11  ? 1659 SER B CB  1 
ATOM   4653 O OG  . SER B 1 152 ? 50.831  -50.283 9.077  1.00 98.14  ? 1659 SER B OG  1 
ATOM   4654 N N   . ILE B 1 153 ? 49.476  -53.421 10.764 1.00 92.64  ? 1660 ILE B N   1 
ATOM   4655 C CA  . ILE B 1 153 ? 48.114  -53.802 11.138 1.00 92.33  ? 1660 ILE B CA  1 
ATOM   4656 C C   . ILE B 1 153 ? 47.549  -52.861 12.213 1.00 91.81  ? 1660 ILE B C   1 
ATOM   4657 O O   . ILE B 1 153 ? 48.216  -52.564 13.208 1.00 91.60  ? 1660 ILE B O   1 
ATOM   4658 C CB  . ILE B 1 153 ? 48.030  -55.312 11.553 1.00 92.35  ? 1660 ILE B CB  1 
ATOM   4659 C CG1 . ILE B 1 153 ? 46.580  -55.736 11.827 1.00 92.07  ? 1660 ILE B CG1 1 
ATOM   4660 C CG2 . ILE B 1 153 ? 48.961  -55.627 12.739 1.00 92.20  ? 1660 ILE B CG2 1 
ATOM   4661 C CD1 . ILE B 1 153 ? 46.324  -57.228 11.675 1.00 92.24  ? 1660 ILE B CD1 1 
ATOM   4662 N N   . VAL B 1 154 ? 46.328  -52.378 11.985 1.00 84.36  ? 1661 VAL B N   1 
ATOM   4663 C CA  . VAL B 1 154 ? 45.650  -51.473 12.915 1.00 83.90  ? 1661 VAL B CA  1 
ATOM   4664 C C   . VAL B 1 154 ? 44.565  -52.224 13.689 1.00 83.59  ? 1661 VAL B C   1 
ATOM   4665 O O   . VAL B 1 154 ? 43.701  -52.878 13.096 1.00 83.70  ? 1661 VAL B O   1 
ATOM   4666 C CB  . VAL B 1 154 ? 45.063  -50.227 12.186 1.00 83.92  ? 1661 VAL B CB  1 
ATOM   4667 C CG1 . VAL B 1 154 ? 44.190  -49.394 13.120 1.00 83.46  ? 1661 VAL B CG1 1 
ATOM   4668 C CG2 . VAL B 1 154 ? 46.182  -49.367 11.610 1.00 84.17  ? 1661 VAL B CG2 1 
ATOM   4669 N N   . ASP B 1 155 ? 44.628  -52.123 15.016 1.00 78.97  ? 1662 ASP B N   1 
ATOM   4670 C CA  . ASP B 1 155 ? 43.711  -52.827 15.912 1.00 78.67  ? 1662 ASP B CA  1 
ATOM   4671 C C   . ASP B 1 155 ? 42.807  -51.852 16.666 1.00 78.28  ? 1662 ASP B C   1 
ATOM   4672 O O   . ASP B 1 155 ? 43.235  -50.760 17.049 1.00 78.15  ? 1662 ASP B O   1 
ATOM   4673 C CB  . ASP B 1 155 ? 44.504  -53.689 16.902 1.00 78.60  ? 1662 ASP B CB  1 
ATOM   4674 C CG  . ASP B 1 155 ? 43.665  -54.792 17.538 1.00 78.42  ? 1662 ASP B CG  1 
ATOM   4675 O OD1 . ASP B 1 155 ? 42.504  -55.002 17.122 1.00 78.38  ? 1662 ASP B OD1 1 
ATOM   4676 O OD2 . ASP B 1 155 ? 44.179  -55.459 18.460 1.00 78.33  ? 1662 ASP B OD2 1 
ATOM   4677 N N   . LEU B 1 156 ? 41.556  -52.260 16.872 1.00 75.35  ? 1663 LEU B N   1 
ATOM   4678 C CA  . LEU B 1 156 ? 40.573  -51.457 17.598 1.00 75.00  ? 1663 LEU B CA  1 
ATOM   4679 C C   . LEU B 1 156 ? 40.281  -52.024 18.992 1.00 74.69  ? 1663 LEU B C   1 
ATOM   4680 O O   . LEU B 1 156 ? 39.377  -51.553 19.687 1.00 74.41  ? 1663 LEU B O   1 
ATOM   4681 C CB  . LEU B 1 156 ? 39.271  -51.346 16.793 1.00 75.06  ? 1663 LEU B CB  1 
ATOM   4682 C CG  . LEU B 1 156 ? 39.232  -50.519 15.503 1.00 75.35  ? 1663 LEU B CG  1 
ATOM   4683 C CD1 . LEU B 1 156 ? 37.923  -50.762 14.767 1.00 75.42  ? 1663 LEU B CD1 1 
ATOM   4684 C CD2 . LEU B 1 156 ? 39.418  -49.030 15.775 1.00 75.22  ? 1663 LEU B CD2 1 
ATOM   4685 N N   . SER B 1 157 ? 41.071  -53.018 19.397 1.00 72.36  ? 1664 SER B N   1 
ATOM   4686 C CA  . SER B 1 157 ? 40.854  -53.754 20.648 1.00 72.12  ? 1664 SER B CA  1 
ATOM   4687 C C   . SER B 1 157 ? 40.927  -52.958 21.963 1.00 71.80  ? 1664 SER B C   1 
ATOM   4688 O O   . SER B 1 157 ? 40.226  -53.305 22.917 1.00 71.56  ? 1664 SER B O   1 
ATOM   4689 C CB  . SER B 1 157 ? 41.778  -54.974 20.721 1.00 72.31  ? 1664 SER B CB  1 
ATOM   4690 O OG  . SER B 1 157 ? 41.442  -55.919 19.722 1.00 72.55  ? 1664 SER B OG  1 
ATOM   4691 N N   . PRO B 1 158 ? 41.776  -51.905 22.034 1.00 70.76  ? 1665 PRO B N   1 
ATOM   4692 C CA  . PRO B 1 158 ? 41.786  -51.087 23.254 1.00 70.47  ? 1665 PRO B CA  1 
ATOM   4693 C C   . PRO B 1 158 ? 40.496  -50.301 23.500 1.00 70.23  ? 1665 PRO B C   1 
ATOM   4694 O O   . PRO B 1 158 ? 40.223  -49.922 24.640 1.00 69.97  ? 1665 PRO B O   1 
ATOM   4695 C CB  . PRO B 1 158 ? 42.950  -50.117 23.017 1.00 70.57  ? 1665 PRO B CB  1 
ATOM   4696 C CG  . PRO B 1 158 ? 43.088  -50.046 21.545 1.00 70.87  ? 1665 PRO B CG  1 
ATOM   4697 C CD  . PRO B 1 158 ? 42.779  -51.427 21.063 1.00 71.04  ? 1665 PRO B CD  1 
ATOM   4698 N N   . LEU B 1 159 ? 39.716  -50.061 22.447 1.00 70.67  ? 1666 LEU B N   1 
ATOM   4699 C CA  . LEU B 1 159 ? 38.476  -49.295 22.567 1.00 70.48  ? 1666 LEU B CA  1 
ATOM   4700 C C   . LEU B 1 159 ? 37.264  -50.119 23.013 1.00 70.35  ? 1666 LEU B C   1 
ATOM   4701 O O   . LEU B 1 159 ? 36.188  -49.561 23.241 1.00 70.19  ? 1666 LEU B O   1 
ATOM   4702 C CB  . LEU B 1 159 ? 38.161  -48.557 21.262 1.00 70.67  ? 1666 LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 159 ? 38.860  -47.226 20.970 1.00 70.70  ? 1666 LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 159 ? 38.382  -46.686 19.635 1.00 70.91  ? 1666 LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 159 ? 38.618  -46.199 22.071 1.00 70.39  ? 1666 LEU B CD2 1 
ATOM   4706 N N   . ILE B 1 160 ? 37.438  -51.434 23.136 1.00 68.83  ? 1667 ILE B N   1 
ATOM   4707 C CA  . ILE B 1 160 ? 36.365  -52.317 23.601 1.00 68.73  ? 1667 ILE B CA  1 
ATOM   4708 C C   . ILE B 1 160 ? 35.948  -51.953 25.026 1.00 68.43  ? 1667 ILE B C   1 
ATOM   4709 O O   . ILE B 1 160 ? 36.756  -52.018 25.956 1.00 68.33  ? 1667 ILE B O   1 
ATOM   4710 C CB  . ILE B 1 160 ? 36.764  -53.817 23.540 1.00 68.87  ? 1667 ILE B CB  1 
ATOM   4711 C CG1 . ILE B 1 160 ? 37.055  -54.243 22.099 1.00 69.20  ? 1667 ILE B CG1 1 
ATOM   4712 C CG2 . ILE B 1 160 ? 35.663  -54.697 24.141 1.00 68.74  ? 1667 ILE B CG2 1 
ATOM   4713 C CD1 . ILE B 1 160 ? 37.735  -55.599 21.976 1.00 69.37  ? 1667 ILE B CD1 1 
ATOM   4714 N N   . HIS B 1 161 ? 34.687  -51.554 25.179 1.00 69.97  ? 1668 HIS B N   1 
ATOM   4715 C CA  . HIS B 1 161 ? 34.112  -51.295 26.492 1.00 69.71  ? 1668 HIS B CA  1 
ATOM   4716 C C   . HIS B 1 161 ? 33.882  -52.647 27.170 1.00 69.69  ? 1668 HIS B C   1 
ATOM   4717 O O   . HIS B 1 161 ? 33.115  -53.474 26.669 1.00 69.78  ? 1668 HIS B O   1 
ATOM   4718 C CB  . HIS B 1 161 ? 32.796  -50.523 26.356 1.00 69.64  ? 1668 HIS B CB  1 
ATOM   4719 C CG  . HIS B 1 161 ? 32.563  -49.522 27.446 1.00 69.41  ? 1668 HIS B CG  1 
ATOM   4720 N ND1 . HIS B 1 161 ? 32.320  -49.886 28.752 1.00 69.25  ? 1668 HIS B ND1 1 
ATOM   4721 C CD2 . HIS B 1 161 ? 32.527  -48.169 27.420 1.00 69.34  ? 1668 HIS B CD2 1 
ATOM   4722 C CE1 . HIS B 1 161 ? 32.148  -48.800 29.485 1.00 69.09  ? 1668 HIS B CE1 1 
ATOM   4723 N NE2 . HIS B 1 161 ? 32.269  -47.745 28.701 1.00 69.13  ? 1668 HIS B NE2 1 
ATOM   4724 N N   . ARG B 1 162 ? 34.569  -52.870 28.290 1.00 68.95  ? 1669 ARG B N   1 
ATOM   4725 C CA  . ARG B 1 162 ? 34.516  -54.153 29.001 1.00 68.93  ? 1669 ARG B CA  1 
ATOM   4726 C C   . ARG B 1 162 ? 33.791  -54.080 30.348 1.00 68.73  ? 1669 ARG B C   1 
ATOM   4727 O O   . ARG B 1 162 ? 33.844  -55.023 31.142 1.00 68.70  ? 1669 ARG B O   1 
ATOM   4728 C CB  . ARG B 1 162 ? 35.924  -54.725 29.194 1.00 69.02  ? 1669 ARG B CB  1 
ATOM   4729 C CG  . ARG B 1 162 ? 36.551  -55.299 27.936 1.00 69.28  ? 1669 ARG B CG  1 
ATOM   4730 C CD  . ARG B 1 162 ? 37.889  -55.932 28.257 1.00 69.37  ? 1669 ARG B CD  1 
ATOM   4731 N NE  . ARG B 1 162 ? 38.739  -56.059 27.076 1.00 69.63  ? 1669 ARG B NE  1 
ATOM   4732 C CZ  . ARG B 1 162 ? 40.052  -56.280 27.112 1.00 69.77  ? 1669 ARG B CZ  1 
ATOM   4733 N NH1 . ARG B 1 162 ? 40.687  -56.399 28.274 1.00 69.67  ? 1669 ARG B NH1 1 
ATOM   4734 N NH2 . ARG B 1 162 ? 40.735  -56.378 25.980 1.00 70.03  ? 1669 ARG B NH2 1 
ATOM   4735 N N   . THR B 1 163 ? 33.115  -52.960 30.595 1.00 69.18  ? 1670 THR B N   1 
ATOM   4736 C CA  . THR B 1 163 ? 32.366  -52.759 31.835 1.00 69.01  ? 1670 THR B CA  1 
ATOM   4737 C C   . THR B 1 163 ? 30.898  -52.430 31.565 1.00 68.98  ? 1670 THR B C   1 
ATOM   4738 O O   . THR B 1 163 ? 30.000  -53.020 32.172 1.00 68.95  ? 1670 THR B O   1 
ATOM   4739 C CB  . THR B 1 163 ? 32.988  -51.647 32.709 1.00 68.88  ? 1670 THR B CB  1 
ATOM   4740 O OG1 . THR B 1 163 ? 33.216  -50.478 31.913 1.00 68.90  ? 1670 THR B OG1 1 
ATOM   4741 C CG2 . THR B 1 163 ? 34.307  -52.108 33.310 1.00 68.91  ? 1670 THR B CG2 1 
ATOM   4742 N N   . GLY B 1 164 ? 30.669  -51.487 30.655 1.00 66.53  ? 1671 GLY B N   1 
ATOM   4743 C CA  . GLY B 1 164 ? 29.326  -51.061 30.277 1.00 66.54  ? 1671 GLY B CA  1 
ATOM   4744 C C   . GLY B 1 164 ? 29.273  -50.718 28.804 1.00 66.70  ? 1671 GLY B C   1 
ATOM   4745 O O   . GLY B 1 164 ? 29.563  -51.561 27.954 1.00 66.86  ? 1671 GLY B O   1 
ATOM   4746 N N   . GLY B 1 165 ? 28.916  -49.472 28.506 1.00 66.40  ? 1672 GLY B N   1 
ATOM   4747 C CA  . GLY B 1 165 ? 28.828  -48.994 27.128 1.00 66.57  ? 1672 GLY B CA  1 
ATOM   4748 C C   . GLY B 1 165 ? 29.049  -47.499 26.994 1.00 66.52  ? 1672 GLY B C   1 
ATOM   4749 O O   . GLY B 1 165 ? 28.910  -46.751 27.966 1.00 66.35  ? 1672 GLY B O   1 
ATOM   4750 N N   . TYR B 1 166 ? 29.396  -47.070 25.783 1.00 69.85  ? 1673 TYR B N   1 
ATOM   4751 C CA  . TYR B 1 166 ? 29.603  -45.657 25.482 1.00 69.83  ? 1673 TYR B CA  1 
ATOM   4752 C C   . TYR B 1 166 ? 28.263  -44.938 25.366 1.00 69.83  ? 1673 TYR B C   1 
ATOM   4753 O O   . TYR B 1 166 ? 27.375  -45.377 24.630 1.00 69.98  ? 1673 TYR B O   1 
ATOM   4754 C CB  . TYR B 1 166 ? 30.395  -45.491 24.181 1.00 70.04  ? 1673 TYR B CB  1 
ATOM   4755 C CG  . TYR B 1 166 ? 31.834  -45.961 24.243 1.00 70.07  ? 1673 TYR B CG  1 
ATOM   4756 C CD1 . TYR B 1 166 ? 32.866  -45.067 24.528 1.00 70.00  ? 1673 TYR B CD1 1 
ATOM   4757 C CD2 . TYR B 1 166 ? 32.165  -47.295 23.997 1.00 70.19  ? 1673 TYR B CD2 1 
ATOM   4758 C CE1 . TYR B 1 166 ? 34.190  -45.492 24.577 1.00 70.05  ? 1673 TYR B CE1 1 
ATOM   4759 C CE2 . TYR B 1 166 ? 33.486  -47.729 24.044 1.00 70.25  ? 1673 TYR B CE2 1 
ATOM   4760 C CZ  . TYR B 1 166 ? 34.492  -46.823 24.333 1.00 70.19  ? 1673 TYR B CZ  1 
ATOM   4761 O OH  . TYR B 1 166 ? 35.799  -47.248 24.380 1.00 70.26  ? 1673 TYR B OH  1 
ATOM   4762 N N   . GLU B 1 167 ? 28.123  -43.836 26.097 1.00 61.66  ? 1674 GLU B N   1 
ATOM   4763 C CA  . GLU B 1 167 ? 26.896  -43.042 26.072 1.00 61.66  ? 1674 GLU B CA  1 
ATOM   4764 C C   . GLU B 1 167 ? 26.928  -42.018 24.941 1.00 61.81  ? 1674 GLU B C   1 
ATOM   4765 O O   . GLU B 1 167 ? 27.915  -41.297 24.771 1.00 61.79  ? 1674 GLU B O   1 
ATOM   4766 C CB  . GLU B 1 167 ? 26.663  -42.357 27.422 1.00 61.46  ? 1674 GLU B CB  1 
ATOM   4767 C CG  . GLU B 1 167 ? 26.308  -43.325 28.549 1.00 61.35  ? 1674 GLU B CG  1 
ATOM   4768 C CD  . GLU B 1 167 ? 26.067  -42.641 29.886 1.00 61.19  ? 1674 GLU B CD  1 
ATOM   4769 O OE1 . GLU B 1 167 ? 26.426  -41.453 30.039 1.00 61.15  ? 1674 GLU B OE1 1 
ATOM   4770 O OE2 . GLU B 1 167 ? 25.521  -43.306 30.793 1.00 61.12  ? 1674 GLU B OE2 1 
ATOM   4771 N N   . ALA B 1 168 ? 25.841  -41.965 24.173 1.00 56.58  ? 1675 ALA B N   1 
ATOM   4772 C CA  . ALA B 1 168 ? 25.760  -41.100 22.994 1.00 56.76  ? 1675 ALA B CA  1 
ATOM   4773 C C   . ALA B 1 168 ? 25.100  -39.748 23.268 1.00 56.71  ? 1675 ALA B C   1 
ATOM   4774 O O   . ALA B 1 168 ? 24.217  -39.627 24.122 1.00 56.60  ? 1675 ALA B O   1 
ATOM   4775 C CB  . ALA B 1 168 ? 25.056  -41.816 21.859 1.00 57.02  ? 1675 ALA B CB  1 
ATOM   4776 N N   . TYR B 1 169 ? 25.539  -38.744 22.511 1.00 60.35  ? 1676 TYR B N   1 
ATOM   4777 C CA  . TYR B 1 169 ? 25.115  -37.354 22.675 1.00 60.31  ? 1676 TYR B CA  1 
ATOM   4778 C C   . TYR B 1 169 ? 23.638  -37.133 22.339 1.00 60.45  ? 1676 TYR B C   1 
ATOM   4779 O O   . TYR B 1 169 ? 23.052  -37.874 21.543 1.00 60.66  ? 1676 TYR B O   1 
ATOM   4780 C CB  . TYR B 1 169 ? 26.006  -36.446 21.813 1.00 60.39  ? 1676 TYR B CB  1 
ATOM   4781 C CG  . TYR B 1 169 ? 25.747  -34.958 21.950 1.00 60.35  ? 1676 TYR B CG  1 
ATOM   4782 C CD1 . TYR B 1 169 ? 25.227  -34.222 20.883 1.00 60.57  ? 1676 TYR B CD1 1 
ATOM   4783 C CD2 . TYR B 1 169 ? 26.028  -34.284 23.142 1.00 60.11  ? 1676 TYR B CD2 1 
ATOM   4784 C CE1 . TYR B 1 169 ? 24.991  -32.851 20.998 1.00 60.54  ? 1676 TYR B CE1 1 
ATOM   4785 C CE2 . TYR B 1 169 ? 25.793  -32.914 23.269 1.00 60.08  ? 1676 TYR B CE2 1 
ATOM   4786 C CZ  . TYR B 1 169 ? 25.275  -32.205 22.194 1.00 60.29  ? 1676 TYR B CZ  1 
ATOM   4787 O OH  . TYR B 1 169 ? 25.043  -30.851 22.314 1.00 60.27  ? 1676 TYR B OH  1 
ATOM   4788 N N   . ASP B 1 170 ? 23.049  -36.116 22.969 1.00 55.00  ? 1677 ASP B N   1 
ATOM   4789 C CA  . ASP B 1 170 ? 21.685  -35.681 22.667 1.00 55.15  ? 1677 ASP B CA  1 
ATOM   4790 C C   . ASP B 1 170 ? 21.704  -34.773 21.431 1.00 55.36  ? 1677 ASP B C   1 
ATOM   4791 O O   . ASP B 1 170 ? 21.932  -33.562 21.530 1.00 55.31  ? 1677 ASP B O   1 
ATOM   4792 C CB  . ASP B 1 170 ? 21.056  -34.967 23.877 1.00 54.99  ? 1677 ASP B CB  1 
ATOM   4793 C CG  . ASP B 1 170 ? 19.539  -35.158 23.963 1.00 55.12  ? 1677 ASP B CG  1 
ATOM   4794 O OD1 . ASP B 1 170 ? 18.874  -35.308 22.912 1.00 55.36  ? 1677 ASP B OD1 1 
ATOM   4795 O OD2 . ASP B 1 170 ? 19.009  -35.150 25.096 1.00 54.99  ? 1677 ASP B OD2 1 
ATOM   4796 N N   . GLU B 1 171 ? 21.466  -35.386 20.271 1.00 60.12  ? 1678 GLU B N   1 
ATOM   4797 C CA  . GLU B 1 171 ? 21.532  -34.726 18.960 1.00 60.37  ? 1678 GLU B CA  1 
ATOM   4798 C C   . GLU B 1 171 ? 20.583  -33.533 18.795 1.00 60.47  ? 1678 GLU B C   1 
ATOM   4799 O O   . GLU B 1 171 ? 20.895  -32.581 18.074 1.00 60.58  ? 1678 GLU B O   1 
ATOM   4800 C CB  . GLU B 1 171 ? 21.298  -35.749 17.835 1.00 60.64  ? 1678 GLU B CB  1 
ATOM   4801 C CG  . GLU B 1 171 ? 19.914  -36.424 17.829 1.00 60.77  ? 1678 GLU B CG  1 
ATOM   4802 C CD  . GLU B 1 171 ? 19.680  -37.336 19.027 1.00 60.54  ? 1678 GLU B CD  1 
ATOM   4803 O OE1 . GLU B 1 171 ? 20.537  -38.205 19.302 1.00 60.40  ? 1678 GLU B OE1 1 
ATOM   4804 O OE2 . GLU B 1 171 ? 18.634  -37.182 19.695 1.00 60.53  ? 1678 GLU B OE2 1 
ATOM   4805 N N   . SER B 1 172 ? 19.430  -33.601 19.459 1.00 62.42  ? 1679 SER B N   1 
ATOM   4806 C CA  . SER B 1 172 ? 18.418  -32.550 19.395 1.00 62.53  ? 1679 SER B CA  1 
ATOM   4807 C C   . SER B 1 172 ? 17.595  -32.501 20.682 1.00 62.38  ? 1679 SER B C   1 
ATOM   4808 O O   . SER B 1 172 ? 18.118  -32.205 21.759 1.00 62.14  ? 1679 SER B O   1 
ATOM   4809 C CB  . SER B 1 172 ? 17.500  -32.765 18.187 1.00 62.89  ? 1679 SER B CB  1 
ATOM   4810 O OG  . SER B 1 172 ? 16.632  -31.661 17.994 1.00 63.03  ? 1679 SER B OG  1 
ATOM   4811 N N   . THR B 1 179 ? 21.736  -38.454 34.255 1.00 55.60  ? 1686 THR B N   1 
ATOM   4812 C CA  . THR B 1 179 ? 21.661  -37.757 32.974 1.00 55.67  ? 1686 THR B CA  1 
ATOM   4813 C C   . THR B 1 179 ? 20.844  -38.543 31.947 1.00 55.83  ? 1686 THR B C   1 
ATOM   4814 O O   . THR B 1 179 ? 20.679  -39.760 32.072 1.00 55.85  ? 1686 THR B O   1 
ATOM   4815 C CB  . THR B 1 179 ? 23.062  -37.465 32.442 1.00 55.59  ? 1686 THR B CB  1 
ATOM   4816 N N   . ASN B 1 180 ? 20.341  -37.832 30.938 1.00 51.19  ? 1687 ASN B N   1 
ATOM   4817 C CA  . ASN B 1 180 ? 19.505  -38.424 29.892 1.00 51.38  ? 1687 ASN B CA  1 
ATOM   4818 C C   . ASN B 1 180 ? 20.330  -38.922 28.696 1.00 51.45  ? 1687 ASN B C   1 
ATOM   4819 O O   . ASN B 1 180 ? 20.903  -38.114 27.955 1.00 51.49  ? 1687 ASN B O   1 
ATOM   4820 C CB  . ASN B 1 180 ? 18.435  -37.428 29.436 1.00 51.53  ? 1687 ASN B CB  1 
ATOM   4821 N N   . PRO B 1 181 ? 20.399  -40.257 28.512 1.00 53.32  ? 1688 PRO B N   1 
ATOM   4822 C CA  . PRO B 1 181 ? 21.121  -40.859 27.391 1.00 53.42  ? 1688 PRO B CA  1 
ATOM   4823 C C   . PRO B 1 181 ? 20.240  -41.055 26.153 1.00 53.67  ? 1688 PRO B C   1 
ATOM   4824 O O   . PRO B 1 181 ? 19.012  -40.966 26.245 1.00 53.76  ? 1688 PRO B O   1 
ATOM   4825 C CB  . PRO B 1 181 ? 21.544  -42.216 27.954 1.00 53.34  ? 1688 PRO B CB  1 
ATOM   4826 C CG  . PRO B 1 181 ? 20.456  -42.570 28.925 1.00 53.30  ? 1688 PRO B CG  1 
ATOM   4827 C CD  . PRO B 1 181 ? 19.799  -41.287 29.383 1.00 53.28  ? 1688 PRO B CD  1 
ATOM   4828 N N   . ASP B 1 182 ? 20.872  -41.325 25.011 1.00 59.22  ? 1689 ASP B N   1 
ATOM   4829 C CA  . ASP B 1 182 ? 20.155  -41.574 23.759 1.00 59.49  ? 1689 ASP B CA  1 
ATOM   4830 C C   . ASP B 1 182 ? 20.526  -42.918 23.118 1.00 59.60  ? 1689 ASP B C   1 
ATOM   4831 O O   . ASP B 1 182 ? 19.642  -43.673 22.704 1.00 59.78  ? 1689 ASP B O   1 
ATOM   4832 C CB  . ASP B 1 182 ? 20.366  -40.419 22.767 1.00 59.62  ? 1689 ASP B CB  1 
ATOM   4833 C CG  . ASP B 1 182 ? 19.433  -39.235 23.022 1.00 59.66  ? 1689 ASP B CG  1 
ATOM   4834 O OD1 . ASP B 1 182 ? 18.492  -39.349 23.838 1.00 59.65  ? 1689 ASP B OD1 1 
ATOM   4835 O OD2 . ASP B 1 182 ? 19.640  -38.181 22.388 1.00 59.73  ? 1689 ASP B OD2 1 
ATOM   4836 N N   . PHE B 1 183 ? 21.826  -43.207 23.039 1.00 63.49  ? 1690 PHE B N   1 
ATOM   4837 C CA  . PHE B 1 183 ? 22.310  -44.456 22.439 1.00 63.60  ? 1690 PHE B CA  1 
ATOM   4838 C C   . PHE B 1 183 ? 23.419  -45.119 23.258 1.00 63.42  ? 1690 PHE B C   1 
ATOM   4839 O O   . PHE B 1 183 ? 24.199  -44.441 23.930 1.00 63.23  ? 1690 PHE B O   1 
ATOM   4840 C CB  . PHE B 1 183 ? 22.816  -44.230 21.006 1.00 63.83  ? 1690 PHE B CB  1 
ATOM   4841 C CG  . PHE B 1 183 ? 21.855  -43.485 20.118 1.00 64.05  ? 1690 PHE B CG  1 
ATOM   4842 C CD1 . PHE B 1 183 ? 20.901  -44.171 19.372 1.00 64.29  ? 1690 PHE B CD1 1 
ATOM   4843 C CD2 . PHE B 1 183 ? 21.921  -42.097 20.006 1.00 64.03  ? 1690 PHE B CD2 1 
ATOM   4844 C CE1 . PHE B 1 183 ? 20.016  -43.483 18.541 1.00 64.52  ? 1690 PHE B CE1 1 
ATOM   4845 C CE2 . PHE B 1 183 ? 21.042  -41.401 19.182 1.00 64.24  ? 1690 PHE B CE2 1 
ATOM   4846 C CZ  . PHE B 1 183 ? 20.088  -42.095 18.447 1.00 64.50  ? 1690 PHE B CZ  1 
ATOM   4847 N N   . TYR B 1 184 ? 23.481  -46.448 23.180 1.00 62.94  ? 1691 TYR B N   1 
ATOM   4848 C CA  . TYR B 1 184 ? 24.529  -47.237 23.830 1.00 62.81  ? 1691 TYR B CA  1 
ATOM   4849 C C   . TYR B 1 184 ? 25.294  -48.077 22.809 1.00 62.99  ? 1691 TYR B C   1 
ATOM   4850 O O   . TYR B 1 184 ? 24.685  -48.737 21.966 1.00 63.20  ? 1691 TYR B O   1 
ATOM   4851 C CB  . TYR B 1 184 ? 23.933  -48.132 24.918 1.00 62.69  ? 1691 TYR B CB  1 
ATOM   4852 C CG  . TYR B 1 184 ? 23.433  -47.376 26.128 1.00 62.49  ? 1691 TYR B CG  1 
ATOM   4853 C CD1 . TYR B 1 184 ? 24.326  -46.770 27.013 1.00 62.30  ? 1691 TYR B CD1 1 
ATOM   4854 C CD2 . TYR B 1 184 ? 22.069  -47.273 26.395 1.00 62.52  ? 1691 TYR B CD2 1 
ATOM   4855 C CE1 . TYR B 1 184 ? 23.874  -46.074 28.129 1.00 62.14  ? 1691 TYR B CE1 1 
ATOM   4856 C CE2 . TYR B 1 184 ? 21.607  -46.578 27.511 1.00 62.37  ? 1691 TYR B CE2 1 
ATOM   4857 C CZ  . TYR B 1 184 ? 22.515  -45.983 28.372 1.00 62.18  ? 1691 TYR B CZ  1 
ATOM   4858 O OH  . TYR B 1 184 ? 22.068  -45.298 29.477 1.00 62.06  ? 1691 TYR B OH  1 
ATOM   4859 N N   . ILE B 1 185 ? 26.625  -48.054 22.892 1.00 66.63  ? 1692 ILE B N   1 
ATOM   4860 C CA  . ILE B 1 185 ? 27.483  -48.637 21.851 1.00 66.83  ? 1692 ILE B CA  1 
ATOM   4861 C C   . ILE B 1 185 ? 28.661  -49.458 22.406 1.00 66.76  ? 1692 ILE B C   1 
ATOM   4862 O O   . ILE B 1 185 ? 29.284  -49.076 23.399 1.00 66.56  ? 1692 ILE B O   1 
ATOM   4863 C CB  . ILE B 1 185 ? 28.019  -47.534 20.889 1.00 66.96  ? 1692 ILE B CB  1 
ATOM   4864 C CG1 . ILE B 1 185 ? 26.871  -46.659 20.370 1.00 67.04  ? 1692 ILE B CG1 1 
ATOM   4865 C CG2 . ILE B 1 185 ? 28.771  -48.153 19.714 1.00 67.24  ? 1692 ILE B CG2 1 
ATOM   4866 C CD1 . ILE B 1 185 ? 27.253  -45.223 20.084 1.00 67.01  ? 1692 ILE B CD1 1 
ATOM   4867 N N   . ASN B 1 186 ? 28.944  -50.586 21.750 1.00 67.96  ? 1693 ASN B N   1 
ATOM   4868 C CA  . ASN B 1 186 ? 30.135  -51.408 22.008 1.00 67.96  ? 1693 ASN B CA  1 
ATOM   4869 C C   . ASN B 1 186 ? 30.676  -51.934 20.673 1.00 68.27  ? 1693 ASN B C   1 
ATOM   4870 O O   . ASN B 1 186 ? 29.919  -52.498 19.880 1.00 68.46  ? 1693 ASN B O   1 
ATOM   4871 C CB  . ASN B 1 186 ? 29.798  -52.564 22.958 1.00 67.85  ? 1693 ASN B CB  1 
ATOM   4872 C CG  . ASN B 1 186 ? 31.023  -53.115 23.682 1.00 67.77  ? 1693 ASN B CG  1 
ATOM   4873 O OD1 . ASN B 1 186 ? 32.089  -52.497 23.697 1.00 67.75  ? 1693 ASN B OD1 1 
ATOM   4874 N ND2 . ASN B 1 186 ? 30.868  -54.284 24.295 1.00 67.73  ? 1693 ASN B ND2 1 
ATOM   4875 N N   . ILE B 1 187 ? 31.977  -51.762 20.429 1.00 72.36  ? 1694 ILE B N   1 
ATOM   4876 C CA  . ILE B 1 187 ? 32.512  -51.841 19.053 1.00 72.68  ? 1694 ILE B CA  1 
ATOM   4877 C C   . ILE B 1 187 ? 33.362  -53.062 18.640 1.00 72.89  ? 1694 ILE B C   1 
ATOM   4878 O O   . ILE B 1 187 ? 34.190  -52.958 17.733 1.00 73.13  ? 1694 ILE B O   1 
ATOM   4879 C CB  . ILE B 1 187 ? 33.244  -50.527 18.640 1.00 72.72  ? 1694 ILE B CB  1 
ATOM   4880 C CG1 . ILE B 1 187 ? 34.497  -50.296 19.493 1.00 72.58  ? 1694 ILE B CG1 1 
ATOM   4881 C CG2 . ILE B 1 187 ? 32.285  -49.340 18.706 1.00 72.59  ? 1694 ILE B CG2 1 
ATOM   4882 C CD1 . ILE B 1 187 ? 35.603  -49.559 18.763 1.00 72.77  ? 1694 ILE B CD1 1 
ATOM   4883 N N   . CYS B 1 188 ? 33.147  -54.204 19.289 1.00 72.62  ? 1695 CYS B N   1 
ATOM   4884 C CA  . CYS B 1 188 ? 33.723  -55.486 18.850 1.00 72.84  ? 1695 CYS B CA  1 
ATOM   4885 C C   . CYS B 1 188 ? 33.101  -56.657 19.596 1.00 72.72  ? 1695 CYS B C   1 
ATOM   4886 O O   . CYS B 1 188 ? 32.762  -57.680 18.998 1.00 72.92  ? 1695 CYS B O   1 
ATOM   4887 C CB  . CYS B 1 188 ? 35.253  -55.511 18.977 1.00 72.90  ? 1695 CYS B CB  1 
ATOM   4888 S SG  . CYS B 1 188 ? 36.117  -55.392 17.381 1.00 73.32  ? 1695 CYS B SG  1 
ATOM   4889 N N   . GLN B 1 189 ? 32.963  -56.495 20.907 1.00 72.01  ? 1696 GLN B N   1 
ATOM   4890 C CA  . GLN B 1 189 ? 32.261  -57.453 21.750 1.00 71.88  ? 1696 GLN B CA  1 
ATOM   4891 C C   . GLN B 1 189 ? 30.847  -56.925 22.013 1.00 71.73  ? 1696 GLN B C   1 
ATOM   4892 O O   . GLN B 1 189 ? 30.623  -55.714 21.943 1.00 71.66  ? 1696 GLN B O   1 
ATOM   4893 C CB  . GLN B 1 189 ? 33.026  -57.666 23.061 1.00 71.67  ? 1696 GLN B CB  1 
ATOM   4894 C CG  . GLN B 1 189 ? 34.387  -58.343 22.880 1.00 71.83  ? 1696 GLN B CG  1 
ATOM   4895 C CD  . GLN B 1 189 ? 35.223  -58.365 24.151 1.00 71.65  ? 1696 GLN B CD  1 
ATOM   4896 O OE1 . GLN B 1 189 ? 36.402  -58.010 24.134 1.00 71.71  ? 1696 GLN B OE1 1 
ATOM   4897 N NE2 . GLN B 1 189 ? 34.618  -58.786 25.258 1.00 71.45  ? 1696 GLN B NE2 1 
ATOM   4898 N N   . PRO B 1 190 ? 29.882  -57.826 22.293 1.00 71.54  ? 1697 PRO B N   1 
ATOM   4899 C CA  . PRO B 1 190 ? 28.511  -57.381 22.562 1.00 71.43  ? 1697 PRO B CA  1 
ATOM   4900 C C   . PRO B 1 190 ? 28.416  -56.505 23.810 1.00 71.15  ? 1697 PRO B C   1 
ATOM   4901 O O   . PRO B 1 190 ? 29.243  -56.631 24.717 1.00 71.01  ? 1697 PRO B O   1 
ATOM   4902 C CB  . PRO B 1 190 ? 27.748  -58.692 22.776 1.00 71.46  ? 1697 PRO B CB  1 
ATOM   4903 C CG  . PRO B 1 190 ? 28.595  -59.746 22.143 1.00 71.67  ? 1697 PRO B CG  1 
ATOM   4904 C CD  . PRO B 1 190 ? 29.998  -59.294 22.360 1.00 71.63  ? 1697 PRO B CD  1 
ATOM   4905 N N   . LEU B 1 191 ? 27.410  -55.632 23.840 1.00 70.30  ? 1698 LEU B N   1 
ATOM   4906 C CA  . LEU B 1 191 ? 27.229  -54.661 24.922 1.00 70.06  ? 1698 LEU B CA  1 
ATOM   4907 C C   . LEU B 1 191 ? 27.152  -55.318 26.297 1.00 69.88  ? 1698 LEU B C   1 
ATOM   4908 O O   . LEU B 1 191 ? 26.477  -56.335 26.477 1.00 69.91  ? 1698 LEU B O   1 
ATOM   4909 C CB  . LEU B 1 191 ? 25.980  -53.810 24.677 1.00 70.07  ? 1698 LEU B CB  1 
ATOM   4910 C CG  . LEU B 1 191 ? 25.761  -52.532 25.492 1.00 69.87  ? 1698 LEU B CG  1 
ATOM   4911 C CD1 . LEU B 1 191 ? 26.631  -51.394 24.974 1.00 69.86  ? 1698 LEU B CD1 1 
ATOM   4912 C CD2 . LEU B 1 191 ? 24.293  -52.138 25.456 1.00 69.91  ? 1698 LEU B CD2 1 
ATOM   4913 N N   . ASN B 1 192 ? 27.854  -54.720 27.255 1.00 71.76  ? 1699 ASN B N   1 
ATOM   4914 C CA  . ASN B 1 192 ? 27.938  -55.234 28.620 1.00 71.60  ? 1699 ASN B CA  1 
ATOM   4915 C C   . ASN B 1 192 ? 26.662  -55.014 29.439 1.00 71.49  ? 1699 ASN B C   1 
ATOM   4916 O O   . ASN B 1 192 ? 25.842  -54.159 29.091 1.00 71.51  ? 1699 ASN B O   1 
ATOM   4917 C CB  . ASN B 1 192 ? 29.145  -54.624 29.336 1.00 71.48  ? 1699 ASN B CB  1 
ATOM   4918 C CG  . ASN B 1 192 ? 30.455  -55.203 28.857 1.00 71.60  ? 1699 ASN B CG  1 
ATOM   4919 O OD1 . ASN B 1 192 ? 30.758  -56.373 29.095 1.00 71.64  ? 1699 ASN B OD1 1 
ATOM   4920 N ND2 . ASN B 1 192 ? 31.244  -54.383 28.181 1.00 71.67  ? 1699 ASN B ND2 1 
ATOM   4921 N N   . PRO B 1 193 ? 26.497  -55.780 30.537 1.00 74.27  ? 1700 PRO B N   1 
ATOM   4922 C CA  . PRO B 1 193 ? 25.265  -55.706 31.314 1.00 74.21  ? 1700 PRO B CA  1 
ATOM   4923 C C   . PRO B 1 193 ? 25.209  -54.475 32.218 1.00 74.05  ? 1700 PRO B C   1 
ATOM   4924 O O   . PRO B 1 193 ? 25.749  -54.483 33.327 1.00 73.94  ? 1700 PRO B O   1 
ATOM   4925 C CB  . PRO B 1 193 ? 25.294  -56.997 32.139 1.00 74.19  ? 1700 PRO B CB  1 
ATOM   4926 C CG  . PRO B 1 193 ? 26.731  -57.331 32.284 1.00 74.18  ? 1700 PRO B CG  1 
ATOM   4927 C CD  . PRO B 1 193 ? 27.459  -56.744 31.111 1.00 74.25  ? 1700 PRO B CD  1 
ATOM   4928 N N   . MET B 1 194 ? 24.556  -53.424 31.730 1.00 75.93  ? 1701 MET B N   1 
ATOM   4929 C CA  . MET B 1 194 ? 24.335  -52.214 32.517 1.00 75.80  ? 1701 MET B CA  1 
ATOM   4930 C C   . MET B 1 194 ? 23.161  -52.422 33.473 1.00 75.77  ? 1701 MET B C   1 
ATOM   4931 O O   . MET B 1 194 ? 22.613  -53.524 33.561 1.00 75.81  ? 1701 MET B O   1 
ATOM   4932 C CB  . MET B 1 194 ? 24.074  -51.021 31.598 1.00 75.85  ? 1701 MET B CB  1 
ATOM   4933 C CG  . MET B 1 194 ? 25.179  -50.753 30.590 1.00 75.90  ? 1701 MET B CG  1 
ATOM   4934 S SD  . MET B 1 194 ? 24.780  -49.391 29.482 1.00 75.99  ? 1701 MET B SD  1 
ATOM   4935 C CE  . MET B 1 194 ? 23.422  -50.083 28.538 1.00 76.20  ? 1701 MET B CE  1 
ATOM   4936 N N   . HIS B 1 195 ? 22.775  -51.364 34.183 1.00 80.24  ? 1702 HIS B N   1 
ATOM   4937 C CA  . HIS B 1 195 ? 21.676  -51.447 35.144 1.00 80.23  ? 1702 HIS B CA  1 
ATOM   4938 C C   . HIS B 1 195 ? 20.434  -50.666 34.705 1.00 80.32  ? 1702 HIS B C   1 
ATOM   4939 O O   . HIS B 1 195 ? 20.540  -49.559 34.170 1.00 80.31  ? 1702 HIS B O   1 
ATOM   4940 C CB  . HIS B 1 195 ? 22.136  -50.980 36.527 1.00 80.11  ? 1702 HIS B CB  1 
ATOM   4941 C CG  . HIS B 1 195 ? 21.065  -51.037 37.570 1.00 80.13  ? 1702 HIS B CG  1 
ATOM   4942 N ND1 . HIS B 1 195 ? 20.347  -49.927 37.960 1.00 80.13  ? 1702 HIS B ND1 1 
ATOM   4943 C CD2 . HIS B 1 195 ? 20.579  -52.074 38.294 1.00 80.17  ? 1702 HIS B CD2 1 
ATOM   4944 C CE1 . HIS B 1 195 ? 19.470  -50.275 38.885 1.00 80.18  ? 1702 HIS B CE1 1 
ATOM   4945 N NE2 . HIS B 1 195 ? 19.590  -51.572 39.105 1.00 80.20  ? 1702 HIS B NE2 1 
ATOM   4946 N N   . ALA B 1 196 ? 19.266  -51.268 34.936 1.00 78.08  ? 1703 ALA B N   1 
ATOM   4947 C CA  . ALA B 1 196 ? 17.954  -50.641 34.703 1.00 78.19  ? 1703 ALA B CA  1 
ATOM   4948 C C   . ALA B 1 196 ? 17.674  -50.216 33.255 1.00 78.30  ? 1703 ALA B C   1 
ATOM   4949 O O   . ALA B 1 196 ? 16.615  -49.654 32.962 1.00 78.39  ? 1703 ALA B O   1 
ATOM   4950 C CB  . ALA B 1 196 ? 17.723  -49.470 35.678 1.00 78.13  ? 1703 ALA B CB  1 
ATOM   4951 N N   . VAL B 1 197 ? 18.618  -50.483 32.357 1.00 69.73  ? 1704 VAL B N   1 
ATOM   4952 C CA  . VAL B 1 197 ? 18.424  -50.230 30.933 1.00 69.87  ? 1704 VAL B CA  1 
ATOM   4953 C C   . VAL B 1 197 ? 18.411  -51.577 30.201 1.00 70.00  ? 1704 VAL B C   1 
ATOM   4954 O O   . VAL B 1 197 ? 19.472  -52.118 29.874 1.00 69.97  ? 1704 VAL B O   1 
ATOM   4955 C CB  . VAL B 1 197 ? 19.508  -49.285 30.349 1.00 69.81  ? 1704 VAL B CB  1 
ATOM   4956 C CG1 . VAL B 1 197 ? 19.173  -48.912 28.909 1.00 69.99  ? 1704 VAL B CG1 1 
ATOM   4957 C CG2 . VAL B 1 197 ? 19.649  -48.026 31.201 1.00 69.67  ? 1704 VAL B CG2 1 
ATOM   4958 N N   . PRO B 1 198 ? 17.205  -52.129 29.954 1.00 68.57  ? 1705 PRO B N   1 
ATOM   4959 C CA  . PRO B 1 198 ? 17.074  -53.472 29.390 1.00 68.69  ? 1705 PRO B CA  1 
ATOM   4960 C C   . PRO B 1 198 ? 17.352  -53.526 27.887 1.00 68.86  ? 1705 PRO B C   1 
ATOM   4961 O O   . PRO B 1 198 ? 16.484  -53.933 27.109 1.00 69.06  ? 1705 PRO B O   1 
ATOM   4962 C CB  . PRO B 1 198 ? 15.612  -53.848 29.692 1.00 68.81  ? 1705 PRO B CB  1 
ATOM   4963 C CG  . PRO B 1 198 ? 15.042  -52.709 30.502 1.00 68.75  ? 1705 PRO B CG  1 
ATOM   4964 C CD  . PRO B 1 198 ? 15.887  -51.523 30.199 1.00 68.66  ? 1705 PRO B CD  1 
ATOM   4965 N N   . CYS B 1 199 ? 18.556  -53.112 27.495 1.00 67.78  ? 1706 CYS B N   1 
ATOM   4966 C CA  . CYS B 1 199 ? 19.027  -53.271 26.122 1.00 67.95  ? 1706 CYS B CA  1 
ATOM   4967 C C   . CYS B 1 199 ? 19.128  -54.762 25.814 1.00 68.05  ? 1706 CYS B C   1 
ATOM   4968 O O   . CYS B 1 199 ? 19.774  -55.501 26.562 1.00 67.93  ? 1706 CYS B O   1 
ATOM   4969 C CB  . CYS B 1 199 ? 20.385  -52.589 25.927 1.00 67.86  ? 1706 CYS B CB  1 
ATOM   4970 S SG  . CYS B 1 199 ? 20.308  -50.793 25.697 1.00 67.82  ? 1706 CYS B SG  1 
ATOM   4971 N N   . PRO B 1 200 ? 18.478  -55.212 24.722 1.00 68.56  ? 1707 PRO B N   1 
ATOM   4972 C CA  . PRO B 1 200 ? 18.420  -56.634 24.387 1.00 68.68  ? 1707 PRO B CA  1 
ATOM   4973 C C   . PRO B 1 200 ? 19.776  -57.302 24.560 1.00 68.60  ? 1707 PRO B C   1 
ATOM   4974 O O   . PRO B 1 200 ? 20.787  -56.776 24.089 1.00 68.61  ? 1707 PRO B O   1 
ATOM   4975 C CB  . PRO B 1 200 ? 18.012  -56.626 22.914 1.00 68.97  ? 1707 PRO B CB  1 
ATOM   4976 C CG  . PRO B 1 200 ? 17.188  -55.399 22.773 1.00 69.01  ? 1707 PRO B CG  1 
ATOM   4977 C CD  . PRO B 1 200 ? 17.764  -54.385 23.729 1.00 68.74  ? 1707 PRO B CD  1 
ATOM   4978 N N   . ALA B 1 201 ? 19.794  -58.434 25.258 1.00 71.22  ? 1708 ALA B N   1 
ATOM   4979 C CA  . ALA B 1 201 ? 21.029  -59.171 25.498 1.00 71.16  ? 1708 ALA B CA  1 
ATOM   4980 C C   . ALA B 1 201 ? 21.736  -59.465 24.178 1.00 71.36  ? 1708 ALA B C   1 
ATOM   4981 O O   . ALA B 1 201 ? 21.148  -60.049 23.264 1.00 71.59  ? 1708 ALA B O   1 
ATOM   4982 C CB  . ALA B 1 201 ? 20.742  -60.453 26.256 1.00 71.12  ? 1708 ALA B CB  1 
ATOM   4983 N N   . GLY B 1 202 ? 22.989  -59.028 24.081 1.00 70.68  ? 1709 GLY B N   1 
ATOM   4984 C CA  . GLY B 1 202 ? 23.771  -59.174 22.858 1.00 70.89  ? 1709 GLY B CA  1 
ATOM   4985 C C   . GLY B 1 202 ? 23.379  -58.171 21.789 1.00 71.05  ? 1709 GLY B C   1 
ATOM   4986 O O   . GLY B 1 202 ? 23.085  -58.548 20.652 1.00 71.31  ? 1709 GLY B O   1 
ATOM   4987 N N   . ALA B 1 203 ? 23.369  -56.893 22.160 1.00 70.64  ? 1710 ALA B N   1 
ATOM   4988 C CA  . ALA B 1 203 ? 23.079  -55.810 21.223 1.00 70.77  ? 1710 ALA B CA  1 
ATOM   4989 C C   . ALA B 1 203 ? 24.198  -54.777 21.239 1.00 70.68  ? 1710 ALA B C   1 
ATOM   4990 O O   . ALA B 1 203 ? 24.370  -54.054 22.219 1.00 70.44  ? 1710 ALA B O   1 
ATOM   4991 C CB  . ALA B 1 203 ? 21.742  -55.156 21.551 1.00 70.71  ? 1710 ALA B CB  1 
ATOM   4992 N N   . ALA B 1 204 ? 24.953  -54.717 20.144 1.00 69.80  ? 1711 ALA B N   1 
ATOM   4993 C CA  . ALA B 1 204 ? 26.085  -53.800 20.020 1.00 69.76  ? 1711 ALA B CA  1 
ATOM   4994 C C   . ALA B 1 204 ? 25.661  -52.331 20.091 1.00 69.67  ? 1711 ALA B C   1 
ATOM   4995 O O   . ALA B 1 204 ? 26.236  -51.555 20.856 1.00 69.47  ? 1711 ALA B O   1 
ATOM   4996 C CB  . ALA B 1 204 ? 26.853  -54.078 18.739 1.00 70.05  ? 1711 ALA B CB  1 
ATOM   4997 N N   . VAL B 1 205 ? 24.660  -51.959 19.295 1.00 69.22  ? 1712 VAL B N   1 
ATOM   4998 C CA  . VAL B 1 205 ? 24.106  -50.603 19.329 1.00 69.16  ? 1712 VAL B CA  1 
ATOM   4999 C C   . VAL B 1 205 ? 22.666  -50.634 19.848 1.00 69.11  ? 1712 VAL B C   1 
ATOM   5000 O O   . VAL B 1 205 ? 21.861  -51.471 19.429 1.00 69.28  ? 1712 VAL B O   1 
ATOM   5001 C CB  . VAL B 1 205 ? 24.172  -49.891 17.950 1.00 69.43  ? 1712 VAL B CB  1 
ATOM   5002 C CG1 . VAL B 1 205 ? 23.978  -48.389 18.114 1.00 69.34  ? 1712 VAL B CG1 1 
ATOM   5003 C CG2 . VAL B 1 205 ? 25.501  -50.157 17.263 1.00 69.56  ? 1712 VAL B CG2 1 
ATOM   5004 N N   . CYS B 1 206 ? 22.358  -49.714 20.759 1.00 64.46  ? 1713 CYS B N   1 
ATOM   5005 C CA  . CYS B 1 206 ? 21.071  -49.692 21.446 1.00 64.40  ? 1713 CYS B CA  1 
ATOM   5006 C C   . CYS B 1 206 ? 20.478  -48.283 21.480 1.00 64.38  ? 1713 CYS B C   1 
ATOM   5007 O O   . CYS B 1 206 ? 21.097  -47.352 22.000 1.00 64.21  ? 1713 CYS B O   1 
ATOM   5008 C CB  . CYS B 1 206 ? 21.238  -50.239 22.868 1.00 64.14  ? 1713 CYS B CB  1 
ATOM   5009 S SG  . CYS B 1 206 ? 19.704  -50.581 23.764 1.00 64.09  ? 1713 CYS B SG  1 
ATOM   5010 N N   . LYS B 1 207 ? 19.283  -48.136 20.911 1.00 62.78  ? 1714 LYS B N   1 
ATOM   5011 C CA  . LYS B 1 207 ? 18.553  -46.872 20.947 1.00 62.80  ? 1714 LYS B CA  1 
ATOM   5012 C C   . LYS B 1 207 ? 17.522  -46.893 22.069 1.00 62.69  ? 1714 LYS B C   1 
ATOM   5013 O O   . LYS B 1 207 ? 16.665  -47.780 22.122 1.00 62.78  ? 1714 LYS B O   1 
ATOM   5014 C CB  . LYS B 1 207 ? 17.864  -46.596 19.606 1.00 63.13  ? 1714 LYS B CB  1 
ATOM   5015 C CG  . LYS B 1 207 ? 17.094  -45.279 19.555 1.00 63.18  ? 1714 LYS B CG  1 
ATOM   5016 C CD  . LYS B 1 207 ? 16.108  -45.246 18.399 1.00 63.52  ? 1714 LYS B CD  1 
ATOM   5017 C CE  . LYS B 1 207 ? 15.277  -43.971 18.422 1.00 63.59  ? 1714 LYS B CE  1 
ATOM   5018 N NZ  . LYS B 1 207 ? 14.129  -44.023 17.470 1.00 63.93  ? 1714 LYS B NZ  1 
ATOM   5019 N N   . VAL B 1 208 ? 17.616  -45.911 22.962 1.00 62.55  ? 1715 VAL B N   1 
ATOM   5020 C CA  . VAL B 1 208 ? 16.670  -45.770 24.066 1.00 62.46  ? 1715 VAL B CA  1 
ATOM   5021 C C   . VAL B 1 208 ? 15.830  -44.501 23.875 1.00 62.55  ? 1715 VAL B C   1 
ATOM   5022 O O   . VAL B 1 208 ? 16.330  -43.386 24.061 1.00 62.43  ? 1715 VAL B O   1 
ATOM   5023 C CB  . VAL B 1 208 ? 17.384  -45.766 25.450 1.00 62.16  ? 1715 VAL B CB  1 
ATOM   5024 C CG1 . VAL B 1 208 ? 16.376  -45.622 26.587 1.00 62.11  ? 1715 VAL B CG1 1 
ATOM   5025 C CG2 . VAL B 1 208 ? 18.210  -47.035 25.638 1.00 62.09  ? 1715 VAL B CG2 1 
ATOM   5026 N N   . PRO B 1 209 ? 14.556  -44.669 23.471 1.00 63.30  ? 1716 PRO B N   1 
ATOM   5027 C CA  . PRO B 1 209 ? 13.625  -43.549 23.383 1.00 63.41  ? 1716 PRO B CA  1 
ATOM   5028 C C   . PRO B 1 209 ? 12.869  -43.332 24.694 1.00 63.29  ? 1716 PRO B C   1 
ATOM   5029 O O   . PRO B 1 209 ? 12.650  -44.286 25.450 1.00 63.20  ? 1716 PRO B O   1 
ATOM   5030 C CB  . PRO B 1 209 ? 12.662  -43.989 22.281 1.00 63.74  ? 1716 PRO B CB  1 
ATOM   5031 C CG  . PRO B 1 209 ? 12.678  -45.495 22.329 1.00 63.75  ? 1716 PRO B CG  1 
ATOM   5032 C CD  . PRO B 1 209 ? 13.929  -45.937 23.050 1.00 63.48  ? 1716 PRO B CD  1 
ATOM   5033 N N   . ILE B 1 210 ? 12.478  -42.086 24.955 1.00 68.50  ? 1717 ILE B N   1 
ATOM   5034 C CA  . ILE B 1 210 ? 11.703  -41.748 26.151 1.00 68.44  ? 1717 ILE B CA  1 
ATOM   5035 C C   . ILE B 1 210 ? 10.371  -42.510 26.149 1.00 68.65  ? 1717 ILE B C   1 
ATOM   5036 O O   . ILE B 1 210 ? 9.947   -43.037 27.181 1.00 68.58  ? 1717 ILE B O   1 
ATOM   5037 C CB  . ILE B 1 210 ? 11.485  -40.204 26.289 1.00 68.43  ? 1717 ILE B CB  1 
ATOM   5038 C CG1 . ILE B 1 210 ? 12.825  -39.444 26.256 1.00 68.20  ? 1717 ILE B CG1 1 
ATOM   5039 C CG2 . ILE B 1 210 ? 10.670  -39.857 27.548 1.00 68.43  ? 1717 ILE B CG2 1 
ATOM   5040 C CD1 . ILE B 1 210 ? 13.821  -39.798 27.373 1.00 67.92  ? 1717 ILE B CD1 1 
ATOM   5041 N N   . ASP B 1 211 ? 9.737   -42.585 24.980 1.00 68.63  ? 1718 ASP B N   1 
ATOM   5042 C CA  . ASP B 1 211 ? 8.495   -43.338 24.811 1.00 68.87  ? 1718 ASP B CA  1 
ATOM   5043 C C   . ASP B 1 211 ? 8.755   -44.724 24.214 1.00 68.92  ? 1718 ASP B C   1 
ATOM   5044 O O   . ASP B 1 211 ? 8.754   -44.898 22.991 1.00 69.14  ? 1718 ASP B O   1 
ATOM   5045 C CB  . ASP B 1 211 ? 7.498   -42.561 23.936 1.00 69.19  ? 1718 ASP B CB  1 
ATOM   5046 C CG  . ASP B 1 211 ? 7.127   -41.203 24.519 1.00 69.18  ? 1718 ASP B CG  1 
ATOM   5047 O OD1 . ASP B 1 211 ? 7.440   -40.934 25.700 1.00 68.95  ? 1718 ASP B OD1 1 
ATOM   5048 O OD2 . ASP B 1 211 ? 6.512   -40.399 23.785 1.00 69.41  ? 1718 ASP B OD2 1 
ATOM   5049 N N   . GLY B 1 212 ? 8.986   -45.704 25.084 1.00 64.28  ? 1719 GLY B N   1 
ATOM   5050 C CA  . GLY B 1 212 ? 9.151   -47.088 24.649 1.00 64.34  ? 1719 GLY B CA  1 
ATOM   5051 C C   . GLY B 1 212 ? 10.391  -47.798 25.166 1.00 64.07  ? 1719 GLY B C   1 
ATOM   5052 O O   . GLY B 1 212 ? 11.225  -47.184 25.841 1.00 63.83  ? 1719 GLY B O   1 
ATOM   5053 N N   . PRO B 1 213 ? 10.518  -49.104 24.847 1.00 61.86  ? 1720 PRO B N   1 
ATOM   5054 C CA  . PRO B 1 213 ? 11.640  -49.942 25.273 1.00 61.65  ? 1720 PRO B CA  1 
ATOM   5055 C C   . PRO B 1 213 ? 12.913  -49.671 24.462 1.00 61.60  ? 1720 PRO B C   1 
ATOM   5056 O O   . PRO B 1 213 ? 12.829  -49.098 23.372 1.00 61.77  ? 1720 PRO B O   1 
ATOM   5057 C CB  . PRO B 1 213 ? 11.129  -51.362 25.002 1.00 61.81  ? 1720 PRO B CB  1 
ATOM   5058 C CG  . PRO B 1 213 ? 10.199  -51.209 23.860 1.00 62.12  ? 1720 PRO B CG  1 
ATOM   5059 C CD  . PRO B 1 213 ? 9.550   -49.861 24.029 1.00 62.17  ? 1720 PRO B CD  1 
ATOM   5060 N N   . PRO B 1 214 ? 14.090  -50.063 24.997 1.00 63.13  ? 1721 PRO B N   1 
ATOM   5061 C CA  . PRO B 1 214 ? 15.337  -49.974 24.235 1.00 63.10  ? 1721 PRO B CA  1 
ATOM   5062 C C   . PRO B 1 214 ? 15.343  -50.942 23.049 1.00 63.34  ? 1721 PRO B C   1 
ATOM   5063 O O   . PRO B 1 214 ? 15.169  -52.153 23.231 1.00 63.37  ? 1721 PRO B O   1 
ATOM   5064 C CB  . PRO B 1 214 ? 16.409  -50.368 25.262 1.00 62.84  ? 1721 PRO B CB  1 
ATOM   5065 C CG  . PRO B 1 214 ? 15.753  -50.218 26.595 1.00 62.71  ? 1721 PRO B CG  1 
ATOM   5066 C CD  . PRO B 1 214 ? 14.327  -50.582 26.355 1.00 62.92  ? 1721 PRO B CD  1 
ATOM   5067 N N   . ILE B 1 215 ? 15.536  -50.399 21.849 1.00 66.67  ? 1722 ILE B N   1 
ATOM   5068 C CA  . ILE B 1 215 ? 15.435  -51.177 20.612 1.00 66.95  ? 1722 ILE B CA  1 
ATOM   5069 C C   . ILE B 1 215 ? 16.799  -51.595 20.047 1.00 66.93  ? 1722 ILE B C   1 
ATOM   5070 O O   . ILE B 1 215 ? 17.770  -50.834 20.101 1.00 66.80  ? 1722 ILE B O   1 
ATOM   5071 C CB  . ILE B 1 215 ? 14.557  -50.447 19.536 1.00 67.23  ? 1722 ILE B CB  1 
ATOM   5072 C CG1 . ILE B 1 215 ? 14.353  -51.315 18.285 1.00 67.57  ? 1722 ILE B CG1 1 
ATOM   5073 C CG2 . ILE B 1 215 ? 15.134  -49.079 19.173 1.00 67.20  ? 1722 ILE B CG2 1 
ATOM   5074 C CD1 . ILE B 1 215 ? 13.484  -52.546 18.502 1.00 67.70  ? 1722 ILE B CD1 1 
ATOM   5075 N N   . ASP B 1 216 ? 16.852  -52.816 19.520 1.00 71.49  ? 1723 ASP B N   1 
ATOM   5076 C CA  . ASP B 1 216 ? 18.055  -53.367 18.905 1.00 71.53  ? 1723 ASP B CA  1 
ATOM   5077 C C   . ASP B 1 216 ? 18.310  -52.716 17.546 1.00 71.79  ? 1723 ASP B C   1 
ATOM   5078 O O   . ASP B 1 216 ? 17.700  -53.094 16.542 1.00 72.09  ? 1723 ASP B O   1 
ATOM   5079 C CB  . ASP B 1 216 ? 17.916  -54.889 18.762 1.00 71.63  ? 1723 ASP B CB  1 
ATOM   5080 C CG  . ASP B 1 216 ? 19.169  -55.549 18.212 1.00 71.68  ? 1723 ASP B CG  1 
ATOM   5081 O OD1 . ASP B 1 216 ? 19.414  -55.461 16.989 1.00 71.94  ? 1723 ASP B OD1 1 
ATOM   5082 O OD2 . ASP B 1 216 ? 19.898  -56.178 19.004 1.00 71.49  ? 1723 ASP B OD2 1 
ATOM   5083 N N   . ILE B 1 217 ? 19.206  -51.731 17.524 1.00 73.54  ? 1724 ILE B N   1 
ATOM   5084 C CA  . ILE B 1 217 ? 19.581  -51.060 16.276 1.00 73.78  ? 1724 ILE B CA  1 
ATOM   5085 C C   . ILE B 1 217 ? 20.999  -51.419 15.817 1.00 73.81  ? 1724 ILE B C   1 
ATOM   5086 O O   . ILE B 1 217 ? 21.512  -50.839 14.856 1.00 73.98  ? 1724 ILE B O   1 
ATOM   5087 C CB  . ILE B 1 217 ? 19.401  -49.512 16.346 1.00 73.72  ? 1724 ILE B CB  1 
ATOM   5088 C CG1 . ILE B 1 217 ? 20.267  -48.899 17.453 1.00 73.37  ? 1724 ILE B CG1 1 
ATOM   5089 C CG2 . ILE B 1 217 ? 17.925  -49.151 16.517 1.00 73.81  ? 1724 ILE B CG2 1 
ATOM   5090 C CD1 . ILE B 1 217 ? 20.587  -47.425 17.244 1.00 73.34  ? 1724 ILE B CD1 1 
ATOM   5091 N N   . GLY B 1 218 ? 21.621  -52.381 16.498 1.00 73.58  ? 1725 GLY B N   1 
ATOM   5092 C CA  . GLY B 1 218 ? 22.982  -52.797 16.168 1.00 73.62  ? 1725 GLY B CA  1 
ATOM   5093 C C   . GLY B 1 218 ? 23.411  -54.127 16.756 1.00 73.53  ? 1725 GLY B C   1 
ATOM   5094 O O   . GLY B 1 218 ? 23.390  -54.314 17.972 1.00 73.25  ? 1725 GLY B O   1 
ATOM   5095 N N   . ARG B 1 219 ? 23.799  -55.049 15.878 1.00 73.75  ? 1726 ARG B N   1 
ATOM   5096 C CA  . ARG B 1 219 ? 24.379  -56.331 16.279 1.00 73.71  ? 1726 ARG B CA  1 
ATOM   5097 C C   . ARG B 1 219 ? 25.702  -56.562 15.550 1.00 73.89  ? 1726 ARG B C   1 
ATOM   5098 O O   . ARG B 1 219 ? 25.822  -56.261 14.358 1.00 74.19  ? 1726 ARG B O   1 
ATOM   5099 C CB  . ARG B 1 219 ? 23.407  -57.484 16.011 1.00 73.87  ? 1726 ARG B CB  1 
ATOM   5100 C CG  . ARG B 1 219 ? 22.229  -57.549 16.976 1.00 73.67  ? 1726 ARG B CG  1 
ATOM   5101 C CD  . ARG B 1 219 ? 21.401  -58.805 16.753 1.00 73.84  ? 1726 ARG B CD  1 
ATOM   5102 N NE  . ARG B 1 219 ? 20.191  -58.838 17.576 1.00 73.71  ? 1726 ARG B NE  1 
ATOM   5103 C CZ  . ARG B 1 219 ? 20.103  -59.397 18.783 1.00 73.46  ? 1726 ARG B CZ  1 
ATOM   5104 N NH1 . ARG B 1 219 ? 21.158  -59.984 19.339 1.00 73.31  ? 1726 ARG B NH1 1 
ATOM   5105 N NH2 . ARG B 1 219 ? 18.950  -59.370 19.438 1.00 73.38  ? 1726 ARG B NH2 1 
ATOM   5106 N N   . VAL B 1 220 ? 26.684  -57.096 16.275 1.00 75.21  ? 1727 VAL B N   1 
ATOM   5107 C CA  . VAL B 1 220 ? 28.048  -57.284 15.764 1.00 75.36  ? 1727 VAL B CA  1 
ATOM   5108 C C   . VAL B 1 220 ? 28.103  -58.081 14.454 1.00 75.77  ? 1727 VAL B C   1 
ATOM   5109 O O   . VAL B 1 220 ? 27.638  -59.221 14.385 1.00 75.86  ? 1727 VAL B O   1 
ATOM   5110 C CB  . VAL B 1 220 ? 28.996  -57.890 16.853 1.00 75.15  ? 1727 VAL B CB  1 
ATOM   5111 C CG1 . VAL B 1 220 ? 28.419  -59.179 17.448 1.00 75.09  ? 1727 VAL B CG1 1 
ATOM   5112 C CG2 . VAL B 1 220 ? 30.406  -58.112 16.304 1.00 75.34  ? 1727 VAL B CG2 1 
ATOM   5113 N N   . ALA B 1 221 ? 28.664  -57.457 13.419 1.00 80.14  ? 1728 ALA B N   1 
ATOM   5114 C CA  . ALA B 1 221 ? 28.803  -58.091 12.110 1.00 80.56  ? 1728 ALA B CA  1 
ATOM   5115 C C   . ALA B 1 221 ? 30.212  -58.659 11.913 1.00 80.70  ? 1728 ALA B C   1 
ATOM   5116 O O   . ALA B 1 221 ? 30.605  -59.597 12.612 1.00 80.61  ? 1728 ALA B O   1 
ATOM   5117 C CB  . ALA B 1 221 ? 28.437  -57.113 10.999 1.00 80.82  ? 1728 ALA B CB  1 
ATOM   5118 N N   . GLY B 1 222 ? 30.967  -58.090 10.975 1.00 85.63  ? 1729 GLY B N   1 
ATOM   5119 C CA  . GLY B 1 222 ? 32.315  -58.569 10.668 1.00 85.83  ? 1729 GLY B CA  1 
ATOM   5120 C C   . GLY B 1 222 ? 33.420  -57.615 11.093 1.00 85.68  ? 1729 GLY B C   1 
ATOM   5121 O O   . GLY B 1 222 ? 33.136  -56.534 11.619 1.00 85.41  ? 1729 GLY B O   1 
ATOM   5122 N N   . PRO B 1 223 ? 34.692  -58.015 10.874 1.00 88.04  ? 1730 PRO B N   1 
ATOM   5123 C CA  . PRO B 1 223 ? 35.851  -57.170 11.173 1.00 87.96  ? 1730 PRO B CA  1 
ATOM   5124 C C   . PRO B 1 223 ? 35.854  -55.895 10.327 1.00 88.11  ? 1730 PRO B C   1 
ATOM   5125 O O   . PRO B 1 223 ? 35.500  -55.949 9.145  1.00 88.47  ? 1730 PRO B O   1 
ATOM   5126 C CB  . PRO B 1 223 ? 37.046  -58.061 10.809 1.00 88.25  ? 1730 PRO B CB  1 
ATOM   5127 C CG  . PRO B 1 223 ? 36.502  -59.083 9.881  1.00 88.60  ? 1730 PRO B CG  1 
ATOM   5128 C CD  . PRO B 1 223 ? 35.098  -59.322 10.326 1.00 88.37  ? 1730 PRO B CD  1 
ATOM   5129 N N   . PRO B 1 224 ? 36.250  -54.755 10.928 1.00 88.15  ? 1731 PRO B N   1 
ATOM   5130 C CA  . PRO B 1 224 ? 36.206  -53.435 10.288 1.00 88.23  ? 1731 PRO B CA  1 
ATOM   5131 C C   . PRO B 1 224 ? 36.859  -53.397 8.905  1.00 88.72  ? 1731 PRO B C   1 
ATOM   5132 O O   . PRO B 1 224 ? 37.934  -53.968 8.710  1.00 88.92  ? 1731 PRO B O   1 
ATOM   5133 C CB  . PRO B 1 224 ? 36.975  -52.539 11.271 1.00 87.93  ? 1731 PRO B CB  1 
ATOM   5134 C CG  . PRO B 1 224 ? 37.668  -53.475 12.216 1.00 87.77  ? 1731 PRO B CG  1 
ATOM   5135 C CD  . PRO B 1 224 ? 36.789  -54.668 12.295 1.00 87.77  ? 1731 PRO B CD  1 
ATOM   5136 N N   . ILE B 1 225 ? 36.195  -52.736 7.959  1.00 99.50  ? 1732 ILE B N   1 
ATOM   5137 C CA  . ILE B 1 225 ? 36.696  -52.613 6.586  1.00 99.99  ? 1732 ILE B CA  1 
ATOM   5138 C C   . ILE B 1 225 ? 37.573  -51.371 6.414  1.00 100.02 ? 1732 ILE B C   1 
ATOM   5139 O O   . ILE B 1 225 ? 37.592  -50.495 7.281  1.00 99.66  ? 1732 ILE B O   1 
ATOM   5140 C CB  . ILE B 1 225 ? 35.546  -52.626 5.536  1.00 100.26 ? 1732 ILE B CB  1 
ATOM   5141 C CG1 . ILE B 1 225 ? 34.417  -51.665 5.939  1.00 99.95  ? 1732 ILE B CG1 1 
ATOM   5142 C CG2 . ILE B 1 225 ? 35.024  -54.051 5.341  1.00 100.44 ? 1732 ILE B CG2 1 
ATOM   5143 C CD1 . ILE B 1 225 ? 33.427  -51.343 4.825  1.00 100.24 ? 1732 ILE B CD1 1 
ATOM   5144 N N   . LEU B 1 226 ? 38.296  -51.304 5.298  1.00 107.75 ? 1733 LEU B N   1 
ATOM   5145 C CA  . LEU B 1 226 ? 39.225  -50.206 5.039  1.00 107.84 ? 1733 LEU B CA  1 
ATOM   5146 C C   . LEU B 1 226 ? 38.927  -49.506 3.712  1.00 108.24 ? 1733 LEU B C   1 
ATOM   5147 O O   . LEU B 1 226 ? 38.774  -50.155 2.675  1.00 108.68 ? 1733 LEU B O   1 
ATOM   5148 C CB  . LEU B 1 226 ? 40.671  -50.717 5.072  1.00 108.02 ? 1733 LEU B CB  1 
ATOM   5149 C CG  . LEU B 1 226 ? 41.816  -49.714 5.258  1.00 108.01 ? 1733 LEU B CG  1 
ATOM   5150 C CD1 . LEU B 1 226 ? 42.925  -50.324 6.101  1.00 107.90 ? 1733 LEU B CD1 1 
ATOM   5151 C CD2 . LEU B 1 226 ? 42.366  -49.219 3.925  1.00 108.53 ? 1733 LEU B CD2 1 
ATOM   5152 N N   . ASN B 1 227 ? 38.849  -48.177 3.763  1.00 118.42 ? 1734 ASN B N   1 
ATOM   5153 C CA  . ASN B 1 227 ? 38.611  -47.351 2.581  1.00 118.78 ? 1734 ASN B CA  1 
ATOM   5154 C C   . ASN B 1 227 ? 39.891  -47.163 1.762  1.00 119.19 ? 1734 ASN B C   1 
ATOM   5155 O O   . ASN B 1 227 ? 40.881  -46.638 2.277  1.00 119.05 ? 1734 ASN B O   1 
ATOM   5156 C CB  . ASN B 1 227 ? 38.020  -45.995 2.993  1.00 118.47 ? 1734 ASN B CB  1 
ATOM   5157 C CG  . ASN B 1 227 ? 37.882  -45.024 1.827  1.00 118.83 ? 1734 ASN B CG  1 
ATOM   5158 O OD1 . ASN B 1 227 ? 37.392  -45.380 0.754  1.00 119.25 ? 1734 ASN B OD1 1 
ATOM   5159 N ND2 . ASN B 1 227 ? 38.301  -43.784 2.044  1.00 118.68 ? 1734 ASN B ND2 1 
ATOM   5160 N N   . PRO B 1 228 ? 39.875  -47.601 0.486  1.00 136.03 ? 1735 PRO B N   1 
ATOM   5161 C CA  . PRO B 1 228 ? 41.038  -47.483 -0.401 1.00 136.50 ? 1735 PRO B CA  1 
ATOM   5162 C C   . PRO B 1 228 ? 41.484  -46.041 -0.670 1.00 136.56 ? 1735 PRO B C   1 
ATOM   5163 O O   . PRO B 1 228 ? 42.681  -45.797 -0.830 1.00 136.81 ? 1735 PRO B O   1 
ATOM   5164 C CB  . PRO B 1 228 ? 40.562  -48.148 -1.700 1.00 137.04 ? 1735 PRO B CB  1 
ATOM   5165 C CG  . PRO B 1 228 ? 39.080  -48.111 -1.635 1.00 136.88 ? 1735 PRO B CG  1 
ATOM   5166 C CD  . PRO B 1 228 ? 38.743  -48.261 -0.189 1.00 136.26 ? 1735 PRO B CD  1 
ATOM   5167 N N   . ILE B 1 229 ? 40.537  -45.104 -0.711 1.00 141.55 ? 1736 ILE B N   1 
ATOM   5168 C CA  . ILE B 1 229 ? 40.850  -43.699 -1.000 1.00 141.60 ? 1736 ILE B CA  1 
ATOM   5169 C C   . ILE B 1 229 ? 41.347  -42.964 0.259  1.00 141.08 ? 1736 ILE B C   1 
ATOM   5170 O O   . ILE B 1 229 ? 42.494  -43.155 0.668  1.00 141.04 ? 1736 ILE B O   1 
ATOM   5171 C CB  . ILE B 1 229 ? 39.671  -42.947 -1.703 1.00 141.71 ? 1736 ILE B CB  1 
ATOM   5172 C CG1 . ILE B 1 229 ? 39.108  -43.763 -2.873 1.00 142.26 ? 1736 ILE B CG1 1 
ATOM   5173 C CG2 . ILE B 1 229 ? 40.121  -41.583 -2.221 1.00 141.82 ? 1736 ILE B CG2 1 
ATOM   5174 C CD1 . ILE B 1 229 ? 37.885  -44.596 -2.532 1.00 142.13 ? 1736 ILE B CD1 1 
ATOM   5175 N N   . ALA B 1 230 ? 40.490  -42.145 0.871  1.00 129.67 ? 1737 ALA B N   1 
ATOM   5176 C CA  . ALA B 1 230 ? 40.862  -41.345 2.042  1.00 129.20 ? 1737 ALA B CA  1 
ATOM   5177 C C   . ALA B 1 230 ? 40.940  -42.188 3.320  1.00 128.78 ? 1737 ALA B C   1 
ATOM   5178 O O   . ALA B 1 230 ? 40.237  -41.925 4.297  1.00 128.33 ? 1737 ALA B O   1 
ATOM   5179 C CB  . ALA B 1 230 ? 39.896  -40.173 2.214  1.00 128.98 ? 1737 ALA B CB  1 
ATOM   5180 N N   . ASN B 1 231 ? 41.823  -43.186 3.289  1.00 114.04 ? 1738 ASN B N   1 
ATOM   5181 C CA  . ASN B 1 231 ? 41.993  -44.206 4.337  1.00 113.75 ? 1738 ASN B CA  1 
ATOM   5182 C C   . ASN B 1 231 ? 41.127  -44.109 5.600  1.00 113.20 ? 1738 ASN B C   1 
ATOM   5183 O O   . ASN B 1 231 ? 41.612  -43.774 6.685  1.00 112.85 ? 1738 ASN B O   1 
ATOM   5184 C CB  . ASN B 1 231 ? 43.476  -44.370 4.694  1.00 113.79 ? 1738 ASN B CB  1 
ATOM   5185 C CG  . ASN B 1 231 ? 44.263  -45.097 3.613  1.00 114.34 ? 1738 ASN B CG  1 
ATOM   5186 O OD1 . ASN B 1 231 ? 43.757  -46.015 2.963  1.00 114.57 ? 1738 ASN B OD1 1 
ATOM   5187 N ND2 . ASN B 1 231 ? 45.512  -44.689 3.419  1.00 114.56 ? 1738 ASN B ND2 1 
ATOM   5188 N N   . GLU B 1 232 ? 39.841  -44.403 5.434  1.00 104.05 ? 1739 GLU B N   1 
ATOM   5189 C CA  . GLU B 1 232 ? 38.896  -44.446 6.543  1.00 103.59 ? 1739 GLU B CA  1 
ATOM   5190 C C   . GLU B 1 232 ? 38.563  -45.888 6.896  1.00 103.55 ? 1739 GLU B C   1 
ATOM   5191 O O   . GLU B 1 232 ? 38.714  -46.792 6.073  1.00 103.92 ? 1739 GLU B O   1 
ATOM   5192 C CB  . GLU B 1 232 ? 37.619  -43.681 6.196  1.00 103.58 ? 1739 GLU B CB  1 
ATOM   5193 C CG  . GLU B 1 232 ? 37.743  -42.171 6.318  1.00 103.48 ? 1739 GLU B CG  1 
ATOM   5194 C CD  . GLU B 1 232 ? 36.617  -41.433 5.620  1.00 103.60 ? 1739 GLU B CD  1 
ATOM   5195 O OE1 . GLU B 1 232 ? 35.436  -41.724 5.908  1.00 103.41 ? 1739 GLU B OE1 1 
ATOM   5196 O OE2 . GLU B 1 232 ? 36.915  -40.553 4.786  1.00 103.92 ? 1739 GLU B OE2 1 
ATOM   5197 N N   . ILE B 1 233 ? 38.119  -46.096 8.130  1.00 94.20  ? 1740 ILE B N   1 
ATOM   5198 C CA  . ILE B 1 233 ? 37.722  -47.418 8.591  1.00 94.12  ? 1740 ILE B CA  1 
ATOM   5199 C C   . ILE B 1 233 ? 36.265  -47.386 9.049  1.00 93.86  ? 1740 ILE B C   1 
ATOM   5200 O O   . ILE B 1 233 ? 35.888  -46.581 9.902  1.00 93.51  ? 1740 ILE B O   1 
ATOM   5201 C CB  . ILE B 1 233 ? 38.677  -47.959 9.699  1.00 93.90  ? 1740 ILE B CB  1 
ATOM   5202 C CG1 . ILE B 1 233 ? 39.989  -48.467 9.088  1.00 94.26  ? 1740 ILE B CG1 1 
ATOM   5203 C CG2 . ILE B 1 233 ? 38.038  -49.104 10.476 1.00 93.69  ? 1740 ILE B CG2 1 
ATOM   5204 C CD1 . ILE B 1 233 ? 41.068  -47.411 8.896  1.00 94.33  ? 1740 ILE B CD1 1 
ATOM   5205 N N   . TYR B 1 234 ? 35.449  -48.246 8.446  1.00 91.01  ? 1741 TYR B N   1 
ATOM   5206 C CA  . TYR B 1 234 ? 34.049  -48.378 8.829  1.00 90.82  ? 1741 TYR B CA  1 
ATOM   5207 C C   . TYR B 1 234 ? 33.858  -49.606 9.710  1.00 90.62  ? 1741 TYR B C   1 
ATOM   5208 O O   . TYR B 1 234 ? 34.718  -50.489 9.759  1.00 90.71  ? 1741 TYR B O   1 
ATOM   5209 C CB  . TYR B 1 234 ? 33.138  -48.490 7.596  1.00 91.18  ? 1741 TYR B CB  1 
ATOM   5210 C CG  . TYR B 1 234 ? 33.240  -47.358 6.590  1.00 91.46  ? 1741 TYR B CG  1 
ATOM   5211 C CD1 . TYR B 1 234 ? 33.054  -46.028 6.973  1.00 91.25  ? 1741 TYR B CD1 1 
ATOM   5212 C CD2 . TYR B 1 234 ? 33.492  -47.625 5.243  1.00 91.95  ? 1741 TYR B CD2 1 
ATOM   5213 C CE1 . TYR B 1 234 ? 33.141  -44.991 6.045  1.00 91.51  ? 1741 TYR B CE1 1 
ATOM   5214 C CE2 . TYR B 1 234 ? 33.579  -46.597 4.307  1.00 92.24  ? 1741 TYR B CE2 1 
ATOM   5215 C CZ  . TYR B 1 234 ? 33.402  -45.285 4.715  1.00 92.01  ? 1741 TYR B CZ  1 
ATOM   5216 O OH  . TYR B 1 234 ? 33.486  -44.266 3.795  1.00 92.30  ? 1741 TYR B OH  1 
ATOM   5217 N N   . LEU B 1 235 ? 32.725  -49.648 10.404 1.00 84.46  ? 1742 LEU B N   1 
ATOM   5218 C CA  . LEU B 1 235 ? 32.305  -50.829 11.145 1.00 84.31  ? 1742 LEU B CA  1 
ATOM   5219 C C   . LEU B 1 235 ? 30.784  -50.941 11.090 1.00 84.29  ? 1742 LEU B C   1 
ATOM   5220 O O   . LEU B 1 235 ? 30.069  -50.012 11.470 1.00 84.11  ? 1742 LEU B O   1 
ATOM   5221 C CB  . LEU B 1 235 ? 32.813  -50.777 12.589 1.00 83.91  ? 1742 LEU B CB  1 
ATOM   5222 C CG  . LEU B 1 235 ? 32.739  -52.045 13.448 1.00 83.77  ? 1742 LEU B CG  1 
ATOM   5223 C CD1 . LEU B 1 235 ? 33.270  -53.279 12.719 1.00 84.10  ? 1742 LEU B CD1 1 
ATOM   5224 C CD2 . LEU B 1 235 ? 33.491  -51.827 14.749 1.00 83.44  ? 1742 LEU B CD2 1 
ATOM   5225 N N   . ASN B 1 236 ? 30.302  -52.079 10.599 1.00 83.19  ? 1743 ASN B N   1 
ATOM   5226 C CA  . ASN B 1 236 ? 28.874  -52.281 10.363 1.00 83.25  ? 1743 ASN B CA  1 
ATOM   5227 C C   . ASN B 1 236 ? 28.166  -53.047 11.473 1.00 82.96  ? 1743 ASN B C   1 
ATOM   5228 O O   . ASN B 1 236 ? 28.739  -53.949 12.087 1.00 82.83  ? 1743 ASN B O   1 
ATOM   5229 C CB  . ASN B 1 236 ? 28.639  -52.967 9.010  1.00 83.71  ? 1743 ASN B CB  1 
ATOM   5230 C CG  . ASN B 1 236 ? 29.350  -54.310 8.892  1.00 83.85  ? 1743 ASN B CG  1 
ATOM   5231 O OD1 . ASN B 1 236 ? 30.273  -54.617 9.652  1.00 83.65  ? 1743 ASN B OD1 1 
ATOM   5232 N ND2 . ASN B 1 236 ? 28.921  -55.117 7.928  1.00 84.23  ? 1743 ASN B ND2 1 
ATOM   5233 N N   . PHE B 1 237 ? 26.915  -52.668 11.720 1.00 79.00  ? 1744 PHE B N   1 
ATOM   5234 C CA  . PHE B 1 237 ? 26.074  -53.326 12.709 1.00 78.76  ? 1744 PHE B CA  1 
ATOM   5235 C C   . PHE B 1 237 ? 24.638  -53.406 12.208 1.00 78.93  ? 1744 PHE B C   1 
ATOM   5236 O O   . PHE B 1 237 ? 23.943  -52.390 12.126 1.00 78.92  ? 1744 PHE B O   1 
ATOM   5237 C CB  . PHE B 1 237 ? 26.126  -52.583 14.047 1.00 78.35  ? 1744 PHE B CB  1 
ATOM   5238 C CG  . PHE B 1 237 ? 27.482  -52.587 14.692 1.00 78.17  ? 1744 PHE B CG  1 
ATOM   5239 C CD1 . PHE B 1 237 ? 27.970  -53.733 15.311 1.00 78.06  ? 1744 PHE B CD1 1 
ATOM   5240 C CD2 . PHE B 1 237 ? 28.272  -51.443 14.684 1.00 78.11  ? 1744 PHE B CD2 1 
ATOM   5241 C CE1 . PHE B 1 237 ? 29.225  -53.742 15.912 1.00 77.93  ? 1744 PHE B CE1 1 
ATOM   5242 C CE2 . PHE B 1 237 ? 29.529  -51.442 15.284 1.00 77.96  ? 1744 PHE B CE2 1 
ATOM   5243 C CZ  . PHE B 1 237 ? 30.005  -52.594 15.899 1.00 77.88  ? 1744 PHE B CZ  1 
ATOM   5244 N N   . GLU B 1 238 ? 24.202  -54.617 11.870 1.00 80.34  ? 1745 GLU B N   1 
ATOM   5245 C CA  . GLU B 1 238 ? 22.833  -54.846 11.404 1.00 80.53  ? 1745 GLU B CA  1 
ATOM   5246 C C   . GLU B 1 238 ? 21.842  -54.909 12.574 1.00 80.25  ? 1745 GLU B C   1 
ATOM   5247 O O   . GLU B 1 238 ? 21.923  -54.090 13.490 1.00 79.97  ? 1745 GLU B O   1 
ATOM   5248 C CB  . GLU B 1 238 ? 22.749  -56.084 10.496 1.00 80.89  ? 1745 GLU B CB  1 
ATOM   5249 C CG  . GLU B 1 238 ? 23.547  -57.301 10.962 1.00 80.79  ? 1745 GLU B CG  1 
ATOM   5250 C CD  . GLU B 1 238 ? 23.578  -58.422 9.930  1.00 81.18  ? 1745 GLU B CD  1 
ATOM   5251 O OE1 . GLU B 1 238 ? 23.228  -58.179 8.752  1.00 81.54  ? 1745 GLU B OE1 1 
ATOM   5252 O OE2 . GLU B 1 238 ? 23.961  -59.552 10.299 1.00 81.12  ? 1745 GLU B OE2 1 
ATOM   5253 N N   . SER B 1 239 ? 20.913  -55.863 12.544 1.00 80.04  ? 1746 SER B N   1 
ATOM   5254 C CA  . SER B 1 239 ? 19.885  -55.966 13.581 1.00 79.83  ? 1746 SER B CA  1 
ATOM   5255 C C   . SER B 1 239 ? 19.200  -57.332 13.604 1.00 79.93  ? 1746 SER B C   1 
ATOM   5256 O O   . SER B 1 239 ? 19.706  -58.309 13.048 1.00 80.09  ? 1746 SER B O   1 
ATOM   5257 C CB  . SER B 1 239 ? 18.837  -54.859 13.397 1.00 79.92  ? 1746 SER B CB  1 
ATOM   5258 O OG  . SER B 1 239 ? 17.955  -54.786 14.505 1.00 79.69  ? 1746 SER B OG  1 
ATOM   5259 N N   . SER B 1 240 ? 18.050  -57.380 14.273 1.00 81.99  ? 1747 SER B N   1 
ATOM   5260 C CA  . SER B 1 240 ? 17.181  -58.548 14.307 1.00 82.12  ? 1747 SER B CA  1 
ATOM   5261 C C   . SER B 1 240 ? 15.727  -58.087 14.196 1.00 82.24  ? 1747 SER B C   1 
ATOM   5262 O O   . SER B 1 240 ? 14.843  -58.862 13.826 1.00 82.47  ? 1747 SER B O   1 
ATOM   5263 C CB  . SER B 1 240 ? 17.395  -59.328 15.604 1.00 81.82  ? 1747 SER B CB  1 
ATOM   5264 O OG  . SER B 1 240 ? 16.750  -60.587 15.556 1.00 81.94  ? 1747 SER B OG  1 
ATOM   5265 N N   . THR B 1 241 ? 15.502  -56.814 14.520 1.00 87.73  ? 1748 THR B N   1 
ATOM   5266 C CA  . THR B 1 241 ? 14.179  -56.191 14.470 1.00 87.85  ? 1748 THR B CA  1 
ATOM   5267 C C   . THR B 1 241 ? 14.004  -55.360 13.193 1.00 88.16  ? 1748 THR B C   1 
ATOM   5268 O O   . THR B 1 241 ? 14.952  -54.707 12.747 1.00 88.15  ? 1748 THR B O   1 
ATOM   5269 C CB  . THR B 1 241 ? 13.934  -55.284 15.701 1.00 87.52  ? 1748 THR B CB  1 
ATOM   5270 O OG1 . THR B 1 241 ? 15.022  -54.363 15.847 1.00 87.32  ? 1748 THR B OG1 1 
ATOM   5271 C CG2 . THR B 1 241 ? 13.801  -56.117 16.972 1.00 87.26  ? 1748 THR B CG2 1 
ATOM   5272 N N   . PRO B 1 242 ? 12.791  -55.383 12.600 1.00 94.56  ? 1749 PRO B N   1 
ATOM   5273 C CA  . PRO B 1 242 ? 12.498  -54.636 11.372 1.00 94.92  ? 1749 PRO B CA  1 
ATOM   5274 C C   . PRO B 1 242 ? 12.405  -53.120 11.566 1.00 94.81  ? 1749 PRO B C   1 
ATOM   5275 O O   . PRO B 1 242 ? 12.175  -52.644 12.681 1.00 94.52  ? 1749 PRO B O   1 
ATOM   5276 C CB  . PRO B 1 242 ? 11.135  -55.188 10.950 1.00 95.23  ? 1749 PRO B CB  1 
ATOM   5277 C CG  . PRO B 1 242 ? 10.502  -55.623 12.217 1.00 94.96  ? 1749 PRO B CG  1 
ATOM   5278 C CD  . PRO B 1 242 ? 11.617  -56.148 13.065 1.00 94.62  ? 1749 PRO B CD  1 
ATOM   5279 N N   . CYS B 1 243 ? 12.577  -52.383 10.471 1.00 96.87  ? 1750 CYS B N   1 
ATOM   5280 C CA  . CYS B 1 243 ? 12.477  -50.925 10.466 1.00 96.84  ? 1750 CYS B CA  1 
ATOM   5281 C C   . CYS B 1 243 ? 11.154  -50.471 9.837  1.00 97.19  ? 1750 CYS B C   1 
ATOM   5282 O O   . CYS B 1 243 ? 10.492  -51.248 9.142  1.00 97.51  ? 1750 CYS B O   1 
ATOM   5283 C CB  . CYS B 1 243 ? 13.667  -50.326 9.715  1.00 96.91  ? 1750 CYS B CB  1 
ATOM   5284 S SG  . CYS B 1 243 ? 13.821  -48.533 9.839  1.00 96.81  ? 1750 CYS B SG  1 
ATOM   5285 N N   . LEU B 1 244 ? 10.782  -49.213 10.074 1.00 109.40 ? 1751 LEU B N   1 
ATOM   5286 C CA  . LEU B 1 244 ? 9.488   -48.669 9.633  1.00 109.72 ? 1751 LEU B CA  1 
ATOM   5287 C C   . LEU B 1 244 ? 9.410   -48.339 8.130  1.00 110.18 ? 1751 LEU B C   1 
ATOM   5288 O O   . LEU B 1 244 ? 8.884   -47.291 7.740  1.00 110.34 ? 1751 LEU B O   1 
ATOM   5289 C CB  . LEU B 1 244 ? 9.109   -47.440 10.478 1.00 109.50 ? 1751 LEU B CB  1 
ATOM   5290 C CG  . LEU B 1 244 ? 8.790   -47.626 11.967 1.00 109.11 ? 1751 LEU B CG  1 
ATOM   5291 C CD1 . LEU B 1 244 ? 8.924   -46.305 12.711 1.00 108.89 ? 1751 LEU B CD1 1 
ATOM   5292 C CD2 . LEU B 1 244 ? 7.402   -48.225 12.177 1.00 109.26 ? 1751 LEU B CD2 1 
ATOM   5293 N N   . ALA B 1 245 ? 9.926   -49.242 7.297  1.00 116.31 ? 1752 ALA B N   1 
ATOM   5294 C CA  . ALA B 1 245 ? 9.887   -49.089 5.841  1.00 116.79 ? 1752 ALA B CA  1 
ATOM   5295 C C   . ALA B 1 245 ? 9.811   -50.443 5.137  1.00 117.08 ? 1752 ALA B C   1 
ATOM   5296 O O   . ALA B 1 245 ? 9.227   -50.559 4.057  1.00 117.56 ? 1752 ALA B O   1 
ATOM   5297 C CB  . ALA B 1 245 ? 11.095  -48.300 5.351  1.00 116.75 ? 1752 ALA B CB  1 
ATOM   5298 N N   . ASP B 1 246 ? 10.411  -51.458 5.758  1.00 118.41 ? 1753 ASP B N   1 
ATOM   5299 C CA  . ASP B 1 246 ? 10.410  -52.818 5.227  1.00 118.64 ? 1753 ASP B CA  1 
ATOM   5300 C C   . ASP B 1 246 ? 10.344  -53.837 6.359  1.00 118.29 ? 1753 ASP B C   1 
ATOM   5301 O O   . ASP B 1 246 ? 9.913   -54.972 6.162  1.00 118.45 ? 1753 ASP B O   1 
ATOM   5302 C CB  . ASP B 1 246 ? 11.644  -53.055 4.369  1.00 118.78 ? 1753 ASP B CB  1 
ATOM   5303 N N   . ASN B 1 250 ? 14.472  -54.685 8.160  1.00 93.81  ? 1757 ASN B N   1 
ATOM   5304 C CA  . ASN B 1 250 ? 15.695  -54.792 8.947  1.00 93.44  ? 1757 ASN B CA  1 
ATOM   5305 C C   . ASN B 1 250 ? 16.365  -53.447 9.209  1.00 93.22  ? 1757 ASN B C   1 
ATOM   5306 O O   . ASN B 1 250 ? 16.563  -52.650 8.288  1.00 93.46  ? 1757 ASN B O   1 
ATOM   5307 C CB  . ASN B 1 250 ? 16.686  -55.757 8.285  1.00 93.59  ? 1757 ASN B CB  1 
ATOM   5308 C CG  . ASN B 1 250 ? 16.582  -57.169 8.832  1.00 93.49  ? 1757 ASN B CG  1 
ATOM   5309 O OD1 . ASN B 1 250 ? 16.932  -57.423 9.989  1.00 93.11  ? 1757 ASN B OD1 1 
ATOM   5310 N ND2 . ASN B 1 250 ? 16.096  -58.097 7.997  1.00 93.85  ? 1757 ASN B ND2 1 
ATOM   5311 N N   . TYR B 1 251 ? 16.698  -53.209 10.477 1.00 86.05  ? 1758 TYR B N   1 
ATOM   5312 C CA  . TYR B 1 251 ? 17.454  -52.030 10.903 1.00 85.80  ? 1758 TYR B CA  1 
ATOM   5313 C C   . TYR B 1 251 ? 18.933  -52.182 10.565 1.00 85.79  ? 1758 TYR B C   1 
ATOM   5314 O O   . TYR B 1 251 ? 19.434  -53.302 10.428 1.00 85.83  ? 1758 TYR B O   1 
ATOM   5315 C CB  . TYR B 1 251 ? 17.312  -51.824 12.413 1.00 85.37  ? 1758 TYR B CB  1 
ATOM   5316 C CG  . TYR B 1 251 ? 16.365  -50.726 12.841 1.00 85.31  ? 1758 TYR B CG  1 
ATOM   5317 C CD1 . TYR B 1 251 ? 16.663  -49.386 12.593 1.00 85.32  ? 1758 TYR B CD1 1 
ATOM   5318 C CD2 . TYR B 1 251 ? 15.190  -51.023 13.531 1.00 85.23  ? 1758 TYR B CD2 1 
ATOM   5319 C CE1 . TYR B 1 251 ? 15.804  -48.370 12.998 1.00 85.27  ? 1758 TYR B CE1 1 
ATOM   5320 C CE2 . TYR B 1 251 ? 14.323  -50.014 13.942 1.00 85.19  ? 1758 TYR B CE2 1 
ATOM   5321 C CZ  . TYR B 1 251 ? 14.638  -48.690 13.672 1.00 85.21  ? 1758 TYR B CZ  1 
ATOM   5322 O OH  . TYR B 1 251 ? 13.791  -47.682 14.073 1.00 85.18  ? 1758 TYR B OH  1 
ATOM   5323 N N   . THR B 1 252 ? 19.628  -51.052 10.442 1.00 84.33  ? 1759 THR B N   1 
ATOM   5324 C CA  . THR B 1 252 ? 21.074  -51.047 10.194 1.00 84.31  ? 1759 THR B CA  1 
ATOM   5325 C C   . THR B 1 252 ? 21.780  -49.837 10.823 1.00 84.02  ? 1759 THR B C   1 
ATOM   5326 O O   . THR B 1 252 ? 21.181  -48.772 10.992 1.00 83.95  ? 1759 THR B O   1 
ATOM   5327 C CB  . THR B 1 252 ? 21.420  -51.179 8.675  1.00 84.77  ? 1759 THR B CB  1 
ATOM   5328 O OG1 . THR B 1 252 ? 22.833  -51.040 8.482  1.00 84.75  ? 1759 THR B OG1 1 
ATOM   5329 C CG2 . THR B 1 252 ? 20.687  -50.138 7.835  1.00 85.04  ? 1759 THR B CG2 1 
ATOM   5330 N N   . SER B 1 253 ? 23.051  -50.028 11.174 1.00 81.43  ? 1760 SER B N   1 
ATOM   5331 C CA  . SER B 1 253 ? 23.880  -48.984 11.776 1.00 81.18  ? 1760 SER B CA  1 
ATOM   5332 C C   . SER B 1 253 ? 25.346  -49.135 11.375 1.00 81.26  ? 1760 SER B C   1 
ATOM   5333 O O   . SER B 1 253 ? 25.855  -50.251 11.264 1.00 81.36  ? 1760 SER B O   1 
ATOM   5334 C CB  . SER B 1 253 ? 23.755  -49.011 13.298 1.00 80.75  ? 1760 SER B CB  1 
ATOM   5335 O OG  . SER B 1 253 ? 24.646  -48.088 13.896 1.00 80.52  ? 1760 SER B OG  1 
ATOM   5336 N N   . LEU B 1 254 ? 26.018  -48.003 11.172 1.00 83.58  ? 1761 LEU B N   1 
ATOM   5337 C CA  . LEU B 1 254 ? 27.419  -47.984 10.750 1.00 83.68  ? 1761 LEU B CA  1 
ATOM   5338 C C   . LEU B 1 254 ? 28.243  -46.969 11.533 1.00 83.39  ? 1761 LEU B C   1 
ATOM   5339 O O   . LEU B 1 254 ? 27.767  -45.871 11.835 1.00 83.26  ? 1761 LEU B O   1 
ATOM   5340 C CB  . LEU B 1 254 ? 27.521  -47.691 9.250  1.00 84.13  ? 1761 LEU B CB  1 
ATOM   5341 C CG  . LEU B 1 254 ? 27.451  -48.876 8.283  1.00 84.50  ? 1761 LEU B CG  1 
ATOM   5342 C CD1 . LEU B 1 254 ? 26.700  -48.496 7.017  1.00 84.89  ? 1761 LEU B CD1 1 
ATOM   5343 C CD2 . LEU B 1 254 ? 28.846  -49.388 7.952  1.00 84.64  ? 1761 LEU B CD2 1 
ATOM   5344 N N   . ILE B 1 255 ? 29.479  -47.346 11.857 1.00 82.32  ? 1762 ILE B N   1 
ATOM   5345 C CA  . ILE B 1 255 ? 30.406  -46.463 12.567 1.00 82.08  ? 1762 ILE B CA  1 
ATOM   5346 C C   . ILE B 1 255 ? 31.659  -46.188 11.733 1.00 82.32  ? 1762 ILE B C   1 
ATOM   5347 O O   . ILE B 1 255 ? 32.449  -47.094 11.455 1.00 82.48  ? 1762 ILE B O   1 
ATOM   5348 C CB  . ILE B 1 255 ? 30.806  -47.017 13.965 1.00 81.73  ? 1762 ILE B CB  1 
ATOM   5349 C CG1 . ILE B 1 255 ? 29.562  -47.261 14.829 1.00 81.50  ? 1762 ILE B CG1 1 
ATOM   5350 C CG2 . ILE B 1 255 ? 31.768  -46.054 14.669 1.00 81.51  ? 1762 ILE B CG2 1 
ATOM   5351 C CD1 . ILE B 1 255 ? 29.832  -47.992 16.129 1.00 81.21  ? 1762 ILE B CD1 1 
ATOM   5352 N N   . ALA B 1 256 ? 31.820  -44.926 11.341 1.00 88.23  ? 1763 ALA B N   1 
ATOM   5353 C CA  . ALA B 1 256 ? 32.985  -44.471 10.585 1.00 88.46  ? 1763 ALA B CA  1 
ATOM   5354 C C   . ALA B 1 256 ? 34.049  -43.910 11.523 1.00 88.19  ? 1763 ALA B C   1 
ATOM   5355 O O   . ALA B 1 256 ? 33.752  -43.545 12.663 1.00 87.83  ? 1763 ALA B O   1 
ATOM   5356 C CB  . ALA B 1 256 ? 32.572  -43.424 9.560  1.00 88.70  ? 1763 ALA B CB  1 
ATOM   5357 N N   . PHE B 1 257 ? 35.285  -43.838 11.034 1.00 87.42  ? 1764 PHE B N   1 
ATOM   5358 C CA  . PHE B 1 257 ? 36.408  -43.372 11.843 1.00 87.21  ? 1764 PHE B CA  1 
ATOM   5359 C C   . PHE B 1 257 ? 37.270  -42.339 11.124 1.00 87.42  ? 1764 PHE B C   1 
ATOM   5360 O O   . PHE B 1 257 ? 37.436  -42.391 9.904  1.00 87.80  ? 1764 PHE B O   1 
ATOM   5361 C CB  . PHE B 1 257 ? 37.276  -44.555 12.279 1.00 87.21  ? 1764 PHE B CB  1 
ATOM   5362 C CG  . PHE B 1 257 ? 36.638  -45.431 13.326 1.00 86.93  ? 1764 PHE B CG  1 
ATOM   5363 C CD1 . PHE B 1 257 ? 36.759  -45.123 14.676 1.00 86.55  ? 1764 PHE B CD1 1 
ATOM   5364 C CD2 . PHE B 1 257 ? 35.927  -46.571 12.962 1.00 87.06  ? 1764 PHE B CD2 1 
ATOM   5365 C CE1 . PHE B 1 257 ? 36.179  -45.934 15.649 1.00 86.32  ? 1764 PHE B CE1 1 
ATOM   5366 C CE2 . PHE B 1 257 ? 35.341  -47.387 13.926 1.00 86.82  ? 1764 PHE B CE2 1 
ATOM   5367 C CZ  . PHE B 1 257 ? 35.467  -47.067 15.272 1.00 86.45  ? 1764 PHE B CZ  1 
ATOM   5368 N N   . HIS B 1 258 ? 37.808  -41.400 11.900 1.00 92.94  ? 1765 HIS B N   1 
ATOM   5369 C CA  . HIS B 1 258 ? 38.771  -40.417 11.409 1.00 93.10  ? 1765 HIS B CA  1 
ATOM   5370 C C   . HIS B 1 258 ? 40.095  -40.548 12.156 1.00 92.99  ? 1765 HIS B C   1 
ATOM   5371 O O   . HIS B 1 258 ? 40.294  -41.489 12.930 1.00 92.84  ? 1765 HIS B O   1 
ATOM   5372 C CB  . HIS B 1 258 ? 38.234  -38.994 11.581 1.00 92.93  ? 1765 HIS B CB  1 
ATOM   5373 C CG  . HIS B 1 258 ? 37.123  -38.643 10.644 1.00 93.11  ? 1765 HIS B CG  1 
ATOM   5374 N ND1 . HIS B 1 258 ? 35.870  -38.279 11.085 1.00 92.89  ? 1765 HIS B ND1 1 
ATOM   5375 C CD2 . HIS B 1 258 ? 37.076  -38.593 9.292  1.00 93.51  ? 1765 HIS B CD2 1 
ATOM   5376 C CE1 . HIS B 1 258 ? 35.099  -38.020 10.044 1.00 93.15  ? 1765 HIS B CE1 1 
ATOM   5377 N NE2 . HIS B 1 258 ? 35.806  -38.205 8.944  1.00 93.53  ? 1765 HIS B NE2 1 
ATOM   5378 N N   . CYS B 1 259 ? 40.996  -39.599 11.913 1.00 90.21  ? 1766 CYS B N   1 
ATOM   5379 C CA  . CYS B 1 259 ? 42.250  -39.512 12.652 1.00 90.11  ? 1766 CYS B CA  1 
ATOM   5380 C C   . CYS B 1 259 ? 42.332  -38.190 13.416 1.00 89.82  ? 1766 CYS B C   1 
ATOM   5381 O O   . CYS B 1 259 ? 42.443  -37.115 12.817 1.00 89.93  ? 1766 CYS B O   1 
ATOM   5382 C CB  . CYS B 1 259 ? 43.452  -39.682 11.714 1.00 90.51  ? 1766 CYS B CB  1 
ATOM   5383 S SG  . CYS B 1 259 ? 45.083  -39.552 12.512 1.00 90.46  ? 1766 CYS B SG  1 
ATOM   5384 N N   . LYS B 1 260 ? 42.257  -38.285 14.742 1.00 89.16  ? 1767 LYS B N   1 
ATOM   5385 C CA  . LYS B 1 260 ? 42.378  -37.125 15.620 1.00 88.88  ? 1767 LYS B CA  1 
ATOM   5386 C C   . LYS B 1 260 ? 43.240  -37.467 16.832 1.00 88.68  ? 1767 LYS B C   1 
ATOM   5387 O O   . LYS B 1 260 ? 42.752  -38.031 17.816 1.00 88.42  ? 1767 LYS B O   1 
ATOM   5388 C CB  . LYS B 1 260 ? 40.996  -36.628 16.059 1.00 88.63  ? 1767 LYS B CB  1 
ATOM   5389 C CG  . LYS B 1 260 ? 41.016  -35.310 16.824 1.00 88.39  ? 1767 LYS B CG  1 
ATOM   5390 C CD  . LYS B 1 260 ? 39.661  -35.012 17.443 1.00 88.13  ? 1767 LYS B CD  1 
ATOM   5391 C CE  . LYS B 1 260 ? 39.684  -33.713 18.230 1.00 87.89  ? 1767 LYS B CE  1 
ATOM   5392 N NZ  . LYS B 1 260 ? 38.364  -33.424 18.855 1.00 87.64  ? 1767 LYS B NZ  1 
ATOM   5393 N N   . ARG B 1 261 ? 44.524  -37.129 16.741 1.00 87.56  ? 1768 ARG B N   1 
ATOM   5394 C CA  . ARG B 1 261 ? 45.478  -37.343 17.830 1.00 87.42  ? 1768 ARG B CA  1 
ATOM   5395 C C   . ARG B 1 261 ? 45.217  -36.371 18.977 1.00 87.07  ? 1768 ARG B C   1 
ATOM   5396 O O   . ARG B 1 261 ? 44.755  -35.247 18.760 1.00 87.01  ? 1768 ARG B O   1 
ATOM   5397 C CB  . ARG B 1 261 ? 46.917  -37.179 17.329 1.00 87.70  ? 1768 ARG B CB  1 
ATOM   5398 C CG  . ARG B 1 261 ? 47.425  -38.316 16.448 1.00 88.05  ? 1768 ARG B CG  1 
ATOM   5399 C CD  . ARG B 1 261 ? 48.820  -38.012 15.912 1.00 88.37  ? 1768 ARG B CD  1 
ATOM   5400 N NE  . ARG B 1 261 ? 49.407  -39.147 15.200 1.00 88.71  ? 1768 ARG B NE  1 
ATOM   5401 C CZ  . ARG B 1 261 ? 49.322  -39.346 13.886 1.00 89.07  ? 1768 ARG B CZ  1 
ATOM   5402 N NH1 . ARG B 1 261 ? 48.670  -38.488 13.113 1.00 89.15  ? 1768 ARG B NH1 1 
ATOM   5403 N NH2 . ARG B 1 261 ? 49.894  -40.411 13.341 1.00 89.39  ? 1768 ARG B NH2 1 
ATOM   5404 N N   . GLY B 1 262 ? 45.516  -36.814 20.196 1.00 88.46  ? 1769 GLY B N   1 
ATOM   5405 C CA  . GLY B 1 262 ? 45.331  -35.990 21.387 1.00 88.15  ? 1769 GLY B CA  1 
ATOM   5406 C C   . GLY B 1 262 ? 45.276  -36.795 22.671 1.00 87.95  ? 1769 GLY B C   1 
ATOM   5407 O O   . GLY B 1 262 ? 45.569  -37.994 22.680 1.00 88.05  ? 1769 GLY B O   1 
ATOM   5408 N N   . VAL B 1 263 ? 44.899  -36.125 23.758 1.00 82.90  ? 1770 VAL B N   1 
ATOM   5409 C CA  . VAL B 1 263 ? 44.802  -36.760 25.074 1.00 82.71  ? 1770 VAL B CA  1 
ATOM   5410 C C   . VAL B 1 263 ? 43.588  -37.679 25.201 1.00 82.61  ? 1770 VAL B C   1 
ATOM   5411 O O   . VAL B 1 263 ? 43.644  -38.694 25.899 1.00 82.56  ? 1770 VAL B O   1 
ATOM   5412 C CB  . VAL B 1 263 ? 44.806  -35.724 26.234 1.00 82.47  ? 1770 VAL B CB  1 
ATOM   5413 C CG1 . VAL B 1 263 ? 46.216  -35.213 26.492 1.00 82.56  ? 1770 VAL B CG1 1 
ATOM   5414 C CG2 . VAL B 1 263 ? 43.845  -34.566 25.955 1.00 82.36  ? 1770 VAL B CG2 1 
ATOM   5415 N N   . SER B 1 264 ? 42.502  -37.320 24.518 1.00 78.11  ? 1771 SER B N   1 
ATOM   5416 C CA  . SER B 1 264 ? 41.258  -38.081 24.567 1.00 78.04  ? 1771 SER B CA  1 
ATOM   5417 C C   . SER B 1 264 ? 41.232  -39.182 23.511 1.00 78.28  ? 1771 SER B C   1 
ATOM   5418 O O   . SER B 1 264 ? 41.693  -38.986 22.385 1.00 78.52  ? 1771 SER B O   1 
ATOM   5419 C CB  . SER B 1 264 ? 40.058  -37.149 24.390 1.00 77.94  ? 1771 SER B CB  1 
ATOM   5420 O OG  . SER B 1 264 ? 38.839  -37.828 24.634 1.00 77.85  ? 1771 SER B OG  1 
ATOM   5421 N N   . MET B 1 265 ? 40.687  -40.337 23.886 1.00 73.64  ? 1772 MET B N   1 
ATOM   5422 C CA  . MET B 1 265 ? 40.551  -41.472 22.974 1.00 73.85  ? 1772 MET B CA  1 
ATOM   5423 C C   . MET B 1 265 ? 39.252  -41.414 22.167 1.00 73.90  ? 1772 MET B C   1 
ATOM   5424 O O   . MET B 1 265 ? 38.931  -42.343 21.421 1.00 74.08  ? 1772 MET B O   1 
ATOM   5425 C CB  . MET B 1 265 ? 40.652  -42.788 23.746 1.00 73.79  ? 1772 MET B CB  1 
ATOM   5426 C CG  . MET B 1 265 ? 42.075  -43.177 24.095 1.00 73.86  ? 1772 MET B CG  1 
ATOM   5427 S SD  . MET B 1 265 ? 42.904  -44.088 22.784 1.00 74.24  ? 1772 MET B SD  1 
ATOM   5428 C CE  . MET B 1 265 ? 42.256  -45.738 23.044 1.00 74.23  ? 1772 MET B CE  1 
ATOM   5429 N N   . GLY B 1 266 ? 38.511  -40.319 22.324 1.00 76.75  ? 1773 GLY B N   1 
ATOM   5430 C CA  . GLY B 1 266 ? 37.293  -40.078 21.556 1.00 76.81  ? 1773 GLY B CA  1 
ATOM   5431 C C   . GLY B 1 266 ? 36.089  -40.872 22.020 1.00 76.70  ? 1773 GLY B C   1 
ATOM   5432 O O   . GLY B 1 266 ? 36.210  -41.802 22.819 1.00 76.62  ? 1773 GLY B O   1 
ATOM   5433 N N   . THR B 1 267 ? 34.923  -40.495 21.503 1.00 76.49  ? 1774 THR B N   1 
ATOM   5434 C CA  . THR B 1 267 ? 33.658  -41.156 21.824 1.00 76.42  ? 1774 THR B CA  1 
ATOM   5435 C C   . THR B 1 267 ? 32.727  -41.143 20.605 1.00 76.64  ? 1774 THR B C   1 
ATOM   5436 O O   . THR B 1 267 ? 32.669  -40.138 19.890 1.00 76.74  ? 1774 THR B O   1 
ATOM   5437 C CB  . THR B 1 267 ? 32.964  -40.511 23.062 1.00 76.15  ? 1774 THR B CB  1 
ATOM   5438 O OG1 . THR B 1 267 ? 31.666  -41.089 23.254 1.00 76.12  ? 1774 THR B OG1 1 
ATOM   5439 C CG2 . THR B 1 267 ? 32.828  -38.993 22.905 1.00 76.11  ? 1774 THR B CG2 1 
ATOM   5440 N N   . PRO B 1 268 ? 32.012  -42.261 20.352 1.00 78.20  ? 1775 PRO B N   1 
ATOM   5441 C CA  . PRO B 1 268 ? 31.099  -42.324 19.206 1.00 78.44  ? 1775 PRO B CA  1 
ATOM   5442 C C   . PRO B 1 268 ? 29.945  -41.322 19.303 1.00 78.37  ? 1775 PRO B C   1 
ATOM   5443 O O   . PRO B 1 268 ? 29.245  -41.269 20.318 1.00 78.16  ? 1775 PRO B O   1 
ATOM   5444 C CB  . PRO B 1 268 ? 30.579  -43.766 19.242 1.00 78.49  ? 1775 PRO B CB  1 
ATOM   5445 C CG  . PRO B 1 268 ? 30.794  -44.222 20.637 1.00 78.22  ? 1775 PRO B CG  1 
ATOM   5446 C CD  . PRO B 1 268 ? 32.029  -43.528 21.108 1.00 78.11  ? 1775 PRO B CD  1 
ATOM   5447 N N   . LYS B 1 269 ? 29.772  -40.532 18.246 1.00 77.98  ? 1776 LYS B N   1 
ATOM   5448 C CA  . LYS B 1 269 ? 28.738  -39.499 18.182 1.00 77.97  ? 1776 LYS B CA  1 
ATOM   5449 C C   . LYS B 1 269 ? 27.799  -39.764 17.009 1.00 78.26  ? 1776 LYS B C   1 
ATOM   5450 O O   . LYS B 1 269 ? 28.193  -40.390 16.025 1.00 78.51  ? 1776 LYS B O   1 
ATOM   5451 C CB  . LYS B 1 269 ? 29.372  -38.113 18.016 1.00 77.95  ? 1776 LYS B CB  1 
ATOM   5452 C CG  . LYS B 1 269 ? 30.389  -37.722 19.085 1.00 77.70  ? 1776 LYS B CG  1 
ATOM   5453 C CD  . LYS B 1 269 ? 29.745  -36.985 20.247 1.00 77.44  ? 1776 LYS B CD  1 
ATOM   5454 C CE  . LYS B 1 269 ? 30.800  -36.315 21.113 1.00 77.25  ? 1776 LYS B CE  1 
ATOM   5455 N NZ  . LYS B 1 269 ? 30.194  -35.504 22.204 1.00 77.01  ? 1776 LYS B NZ  1 
ATOM   5456 N N   . LEU B 1 270 ? 26.564  -39.281 17.117 1.00 75.41  ? 1777 LEU B N   1 
ATOM   5457 C CA  . LEU B 1 270 ? 25.588  -39.401 16.032 1.00 75.71  ? 1777 LEU B CA  1 
ATOM   5458 C C   . LEU B 1 270 ? 25.676  -38.207 15.083 1.00 75.91  ? 1777 LEU B C   1 
ATOM   5459 O O   . LEU B 1 270 ? 25.817  -37.061 15.522 1.00 75.76  ? 1777 LEU B O   1 
ATOM   5460 C CB  . LEU B 1 270 ? 24.163  -39.536 16.589 1.00 75.64  ? 1777 LEU B CB  1 
ATOM   5461 C CG  . LEU B 1 270 ? 22.994  -39.679 15.599 1.00 75.95  ? 1777 LEU B CG  1 
ATOM   5462 C CD1 . LEU B 1 270 ? 22.901  -41.090 15.026 1.00 76.15  ? 1777 LEU B CD1 1 
ATOM   5463 C CD2 . LEU B 1 270 ? 21.678  -39.287 16.250 1.00 75.87  ? 1777 LEU B CD2 1 
ATOM   5464 N N   . LEU B 1 271 ? 25.592  -38.487 13.784 1.00 80.67  ? 1778 LEU B N   1 
ATOM   5465 C CA  . LEU B 1 271 ? 25.604  -37.441 12.767 1.00 80.92  ? 1778 LEU B CA  1 
ATOM   5466 C C   . LEU B 1 271 ? 24.359  -37.509 11.880 1.00 81.22  ? 1778 LEU B C   1 
ATOM   5467 O O   . LEU B 1 271 ? 23.485  -36.642 11.966 1.00 81.22  ? 1778 LEU B O   1 
ATOM   5468 C CB  . LEU B 1 271 ? 26.887  -37.511 11.928 1.00 81.11  ? 1778 LEU B CB  1 
ATOM   5469 C CG  . LEU B 1 271 ? 27.397  -36.198 11.320 1.00 81.22  ? 1778 LEU B CG  1 
ATOM   5470 C CD1 . LEU B 1 271 ? 28.905  -36.243 11.146 1.00 81.26  ? 1778 LEU B CD1 1 
ATOM   5471 C CD2 . LEU B 1 271 ? 26.711  -35.855 9.997  1.00 81.61  ? 1778 LEU B CD2 1 
ATOM   5472 N N   . ARG B 1 272 ? 24.281  -38.542 11.041 1.00 86.34  ? 1779 ARG B N   1 
ATOM   5473 C CA  . ARG B 1 272 ? 23.181  -38.686 10.084 1.00 86.68  ? 1779 ARG B CA  1 
ATOM   5474 C C   . ARG B 1 272 ? 22.060  -39.580 10.606 1.00 86.62  ? 1779 ARG B C   1 
ATOM   5475 O O   . ARG B 1 272 ? 22.309  -40.658 11.154 1.00 86.47  ? 1779 ARG B O   1 
ATOM   5476 C CB  . ARG B 1 272 ? 23.691  -39.200 8.733  1.00 87.09  ? 1779 ARG B CB  1 
ATOM   5477 C CG  . ARG B 1 272 ? 24.517  -38.186 7.956  1.00 87.25  ? 1779 ARG B CG  1 
ATOM   5478 C CD  . ARG B 1 272 ? 24.999  -38.753 6.634  1.00 87.68  ? 1779 ARG B CD  1 
ATOM   5479 N NE  . ARG B 1 272 ? 25.831  -37.794 5.909  1.00 87.86  ? 1779 ARG B NE  1 
ATOM   5480 C CZ  . ARG B 1 272 ? 25.375  -36.904 5.031  1.00 88.15  ? 1779 ARG B CZ  1 
ATOM   5481 N NH1 . ARG B 1 272 ? 24.079  -36.834 4.749  1.00 88.31  ? 1779 ARG B NH1 1 
ATOM   5482 N NH2 . ARG B 1 272 ? 26.220  -36.079 4.428  1.00 88.30  ? 1779 ARG B NH2 1 
ATOM   5483 N N   . THR B 1 273 ? 20.827  -39.117 10.422 1.00 85.79  ? 1780 THR B N   1 
ATOM   5484 C CA  . THR B 1 273 ? 19.644  -39.821 10.905 1.00 85.75  ? 1780 THR B CA  1 
ATOM   5485 C C   . THR B 1 273 ? 18.837  -40.400 9.748  1.00 86.16  ? 1780 THR B C   1 
ATOM   5486 O O   . THR B 1 273 ? 17.622  -40.195 9.666  1.00 86.24  ? 1780 THR B O   1 
ATOM   5487 C CB  . THR B 1 273 ? 18.737  -38.894 11.749 1.00 85.60  ? 1780 THR B CB  1 
ATOM   5488 O OG1 . THR B 1 273 ? 18.421  -37.715 10.998 1.00 85.84  ? 1780 THR B OG1 1 
ATOM   5489 C CG2 . THR B 1 273 ? 19.422  -38.497 13.051 1.00 85.18  ? 1780 THR B CG2 1 
ATOM   5490 N N   . SER B 1 274 ? 19.519  -41.115 8.852  1.00 93.86  ? 1781 SER B N   1 
ATOM   5491 C CA  . SER B 1 274 ? 18.863  -41.779 7.726  1.00 94.29  ? 1781 SER B CA  1 
ATOM   5492 C C   . SER B 1 274 ? 17.746  -42.675 8.254  1.00 94.26  ? 1781 SER B C   1 
ATOM   5493 O O   . SER B 1 274 ? 17.963  -43.477 9.163  1.00 94.01  ? 1781 SER B O   1 
ATOM   5494 C CB  . SER B 1 274 ? 19.871  -42.586 6.905  1.00 94.51  ? 1781 SER B CB  1 
ATOM   5495 O OG  . SER B 1 274 ? 19.262  -43.147 5.755  1.00 94.97  ? 1781 SER B OG  1 
ATOM   5496 N N   . GLU B 1 275 ? 16.554  -42.520 7.683  1.00 96.64  ? 1782 GLU B N   1 
ATOM   5497 C CA  . GLU B 1 275 ? 15.315  -43.059 8.263  1.00 96.59  ? 1782 GLU B CA  1 
ATOM   5498 C C   . GLU B 1 275 ? 15.371  -44.509 8.749  1.00 96.46  ? 1782 GLU B C   1 
ATOM   5499 O O   . GLU B 1 275 ? 14.747  -44.849 9.756  1.00 96.19  ? 1782 GLU B O   1 
ATOM   5500 C CB  . GLU B 1 275 ? 14.128  -42.842 7.314  1.00 97.03  ? 1782 GLU B CB  1 
ATOM   5501 C CG  . GLU B 1 275 ? 13.865  -41.373 6.960  1.00 97.15  ? 1782 GLU B CG  1 
ATOM   5502 C CD  . GLU B 1 275 ? 13.918  -40.441 8.168  1.00 96.75  ? 1782 GLU B CD  1 
ATOM   5503 O OE1 . GLU B 1 275 ? 13.102  -40.609 9.099  1.00 96.56  ? 1782 GLU B OE1 1 
ATOM   5504 O OE2 . GLU B 1 275 ? 14.778  -39.534 8.180  1.00 96.63  ? 1782 GLU B OE2 1 
ATOM   5505 N N   . CYS B 1 276 ? 16.114  -45.355 8.040  1.00 93.86  ? 1783 CYS B N   1 
ATOM   5506 C CA  . CYS B 1 276 ? 16.315  -46.742 8.463  1.00 93.75  ? 1783 CYS B CA  1 
ATOM   5507 C C   . CYS B 1 276 ? 17.792  -47.117 8.582  1.00 93.60  ? 1783 CYS B C   1 
ATOM   5508 O O   . CYS B 1 276 ? 18.156  -48.288 8.451  1.00 93.71  ? 1783 CYS B O   1 
ATOM   5509 C CB  . CYS B 1 276 ? 15.587  -47.707 7.524  1.00 94.15  ? 1783 CYS B CB  1 
ATOM   5510 S SG  . CYS B 1 276 ? 13.836  -47.921 7.901  1.00 94.23  ? 1783 CYS B SG  1 
ATOM   5511 N N   . ASP B 1 277 ? 18.632  -46.119 8.852  1.00 89.03  ? 1784 ASP B N   1 
ATOM   5512 C CA  . ASP B 1 277 ? 20.079  -46.313 8.926  1.00 88.90  ? 1784 ASP B CA  1 
ATOM   5513 C C   . ASP B 1 277 ? 20.728  -45.314 9.886  1.00 88.52  ? 1784 ASP B C   1 
ATOM   5514 O O   . ASP B 1 277 ? 20.441  -44.116 9.842  1.00 88.50  ? 1784 ASP B O   1 
ATOM   5515 C CB  . ASP B 1 277 ? 20.697  -46.190 7.527  1.00 89.31  ? 1784 ASP B CB  1 
ATOM   5516 C CG  . ASP B 1 277 ? 22.059  -46.862 7.415  1.00 89.30  ? 1784 ASP B CG  1 
ATOM   5517 O OD1 . ASP B 1 277 ? 22.556  -47.416 8.420  1.00 89.01  ? 1784 ASP B OD1 1 
ATOM   5518 O OD2 . ASP B 1 277 ? 22.636  -46.838 6.307  1.00 89.61  ? 1784 ASP B OD2 1 
ATOM   5519 N N   . PHE B 1 278 ? 21.607  -45.815 10.751 1.00 82.53  ? 1785 PHE B N   1 
ATOM   5520 C CA  . PHE B 1 278 ? 22.302  -44.967 11.717 1.00 82.17  ? 1785 PHE B CA  1 
ATOM   5521 C C   . PHE B 1 278 ? 23.778  -44.781 11.373 1.00 82.17  ? 1785 PHE B C   1 
ATOM   5522 O O   . PHE B 1 278 ? 24.512  -45.753 11.190 1.00 82.22  ? 1785 PHE B O   1 
ATOM   5523 C CB  . PHE B 1 278 ? 22.142  -45.521 13.136 1.00 81.80  ? 1785 PHE B CB  1 
ATOM   5524 C CG  . PHE B 1 278 ? 20.794  -45.251 13.745 1.00 81.71  ? 1785 PHE B CG  1 
ATOM   5525 C CD1 . PHE B 1 278 ? 20.501  -44.004 14.295 1.00 81.55  ? 1785 PHE B CD1 1 
ATOM   5526 C CD2 . PHE B 1 278 ? 19.818  -46.242 13.775 1.00 81.80  ? 1785 PHE B CD2 1 
ATOM   5527 C CE1 . PHE B 1 278 ? 19.254  -43.747 14.861 1.00 81.49  ? 1785 PHE B CE1 1 
ATOM   5528 C CE2 . PHE B 1 278 ? 18.568  -45.995 14.340 1.00 81.74  ? 1785 PHE B CE2 1 
ATOM   5529 C CZ  . PHE B 1 278 ? 18.286  -44.744 14.884 1.00 81.59  ? 1785 PHE B CZ  1 
ATOM   5530 N N   . VAL B 1 279 ? 24.198  -43.521 11.286 1.00 84.81  ? 1786 VAL B N   1 
ATOM   5531 C CA  . VAL B 1 279 ? 25.582  -43.181 10.962 1.00 84.83  ? 1786 VAL B CA  1 
ATOM   5532 C C   . VAL B 1 279 ? 26.277  -42.562 12.172 1.00 84.43  ? 1786 VAL B C   1 
ATOM   5533 O O   . VAL B 1 279 ? 25.854  -41.520 12.681 1.00 84.25  ? 1786 VAL B O   1 
ATOM   5534 C CB  . VAL B 1 279 ? 25.672  -42.223 9.744  1.00 85.14  ? 1786 VAL B CB  1 
ATOM   5535 C CG1 . VAL B 1 279 ? 27.115  -41.801 9.485  1.00 85.16  ? 1786 VAL B CG1 1 
ATOM   5536 C CG2 . VAL B 1 279 ? 25.082  -42.877 8.500  1.00 85.58  ? 1786 VAL B CG2 1 
ATOM   5537 N N   . PHE B 1 280 ? 27.344  -43.217 12.622 1.00 81.50  ? 1787 PHE B N   1 
ATOM   5538 C CA  . PHE B 1 280 ? 28.133  -42.740 13.754 1.00 81.15  ? 1787 PHE B CA  1 
ATOM   5539 C C   . PHE B 1 280 ? 29.564  -42.399 13.343 1.00 81.24  ? 1787 PHE B C   1 
ATOM   5540 O O   . PHE B 1 280 ? 30.204  -43.146 12.601 1.00 81.47  ? 1787 PHE B O   1 
ATOM   5541 C CB  . PHE B 1 280 ? 28.133  -43.769 14.887 1.00 80.91  ? 1787 PHE B CB  1 
ATOM   5542 C CG  . PHE B 1 280 ? 26.780  -44.001 15.497 1.00 80.79  ? 1787 PHE B CG  1 
ATOM   5543 C CD1 . PHE B 1 280 ? 26.270  -43.121 16.448 1.00 80.54  ? 1787 PHE B CD1 1 
ATOM   5544 C CD2 . PHE B 1 280 ? 26.016  -45.103 15.126 1.00 80.95  ? 1787 PHE B CD2 1 
ATOM   5545 C CE1 . PHE B 1 280 ? 25.017  -43.333 17.018 1.00 80.46  ? 1787 PHE B CE1 1 
ATOM   5546 C CE2 . PHE B 1 280 ? 24.762  -45.324 15.692 1.00 80.86  ? 1787 PHE B CE2 1 
ATOM   5547 C CZ  . PHE B 1 280 ? 24.261  -44.437 16.639 1.00 80.62  ? 1787 PHE B CZ  1 
ATOM   5548 N N   . GLU B 1 281 ? 30.055  -41.266 13.839 1.00 85.61  ? 1788 GLU B N   1 
ATOM   5549 C CA  . GLU B 1 281 ? 31.375  -40.762 13.475 1.00 85.69  ? 1788 GLU B CA  1 
ATOM   5550 C C   . GLU B 1 281 ? 32.265  -40.644 14.710 1.00 85.37  ? 1788 GLU B C   1 
ATOM   5551 O O   . GLU B 1 281 ? 31.998  -39.839 15.606 1.00 85.10  ? 1788 GLU B O   1 
ATOM   5552 C CB  . GLU B 1 281 ? 31.242  -39.409 12.779 1.00 85.82  ? 1788 GLU B CB  1 
ATOM   5553 C CG  . GLU B 1 281 ? 32.285  -39.152 11.714 1.00 86.14  ? 1788 GLU B CG  1 
ATOM   5554 C CD  . GLU B 1 281 ? 32.107  -37.803 11.045 1.00 86.27  ? 1788 GLU B CD  1 
ATOM   5555 O OE1 . GLU B 1 281 ? 32.208  -36.773 11.745 1.00 86.02  ? 1788 GLU B OE1 1 
ATOM   5556 O OE2 . GLU B 1 281 ? 31.878  -37.772 9.816  1.00 86.64  ? 1788 GLU B OE2 1 
ATOM   5557 N N   . TRP B 1 282 ? 33.325  -41.449 14.741 1.00 83.12  ? 1789 TRP B N   1 
ATOM   5558 C CA  . TRP B 1 282 ? 34.190  -41.567 15.914 1.00 82.84  ? 1789 TRP B CA  1 
ATOM   5559 C C   . TRP B 1 282 ? 35.612  -41.079 15.630 1.00 82.95  ? 1789 TRP B C   1 
ATOM   5560 O O   . TRP B 1 282 ? 36.390  -41.758 14.955 1.00 83.19  ? 1789 TRP B O   1 
ATOM   5561 C CB  . TRP B 1 282 ? 34.220  -43.023 16.388 1.00 82.80  ? 1789 TRP B CB  1 
ATOM   5562 C CG  . TRP B 1 282 ? 34.797  -43.241 17.762 1.00 82.51  ? 1789 TRP B CG  1 
ATOM   5563 C CD1 . TRP B 1 282 ? 35.667  -42.428 18.432 1.00 82.35  ? 1789 TRP B CD1 1 
ATOM   5564 C CD2 . TRP B 1 282 ? 34.567  -44.368 18.616 1.00 82.37  ? 1789 TRP B CD2 1 
ATOM   5565 N NE1 . TRP B 1 282 ? 35.977  -42.969 19.653 1.00 82.12  ? 1789 TRP B NE1 1 
ATOM   5566 C CE2 . TRP B 1 282 ? 35.318  -44.162 19.792 1.00 82.13  ? 1789 TRP B CE2 1 
ATOM   5567 C CE3 . TRP B 1 282 ? 33.793  -45.530 18.504 1.00 82.43  ? 1789 TRP B CE3 1 
ATOM   5568 C CZ2 . TRP B 1 282 ? 35.319  -45.073 20.851 1.00 81.97  ? 1789 TRP B CZ2 1 
ATOM   5569 C CZ3 . TRP B 1 282 ? 33.795  -46.435 19.557 1.00 82.25  ? 1789 TRP B CZ3 1 
ATOM   5570 C CH2 . TRP B 1 282 ? 34.554  -46.201 20.714 1.00 82.03  ? 1789 TRP B CH2 1 
ATOM   5571 N N   . GLU B 1 283 ? 35.942  -39.904 16.161 1.00 86.51  ? 1790 GLU B N   1 
ATOM   5572 C CA  . GLU B 1 283 ? 37.281  -39.331 16.023 1.00 86.58  ? 1790 GLU B CA  1 
ATOM   5573 C C   . GLU B 1 283 ? 38.199  -39.880 17.114 1.00 86.40  ? 1790 GLU B C   1 
ATOM   5574 O O   . GLU B 1 283 ? 38.019  -39.576 18.295 1.00 86.09  ? 1790 GLU B O   1 
ATOM   5575 C CB  . GLU B 1 283 ? 37.224  -37.803 16.100 1.00 86.48  ? 1790 GLU B CB  1 
ATOM   5576 C CG  . GLU B 1 283 ? 36.386  -37.138 15.013 1.00 86.67  ? 1790 GLU B CG  1 
ATOM   5577 C CD  . GLU B 1 283 ? 36.131  -35.664 15.287 1.00 86.52  ? 1790 GLU B CD  1 
ATOM   5578 O OE1 . GLU B 1 283 ? 35.655  -35.329 16.394 1.00 86.21  ? 1790 GLU B OE1 1 
ATOM   5579 O OE2 . GLU B 1 283 ? 36.399  -34.838 14.389 1.00 86.71  ? 1790 GLU B OE2 1 
ATOM   5580 N N   . THR B 1 284 ? 39.182  -40.685 16.713 1.00 81.74  ? 1791 THR B N   1 
ATOM   5581 C CA  . THR B 1 284 ? 40.070  -41.366 17.665 1.00 81.63  ? 1791 THR B CA  1 
ATOM   5582 C C   . THR B 1 284 ? 41.507  -41.522 17.141 1.00 81.88  ? 1791 THR B C   1 
ATOM   5583 O O   . THR B 1 284 ? 41.709  -41.734 15.943 1.00 82.21  ? 1791 THR B O   1 
ATOM   5584 C CB  . THR B 1 284 ? 39.489  -42.748 18.107 1.00 81.56  ? 1791 THR B CB  1 
ATOM   5585 O OG1 . THR B 1 284 ? 40.458  -43.469 18.879 1.00 81.51  ? 1791 THR B OG1 1 
ATOM   5586 C CG2 . THR B 1 284 ? 39.078  -43.588 16.906 1.00 81.87  ? 1791 THR B CG2 1 
ATOM   5587 N N   . PRO B 1 285 ? 42.507  -41.402 18.039 1.00 80.94  ? 1792 PRO B N   1 
ATOM   5588 C CA  . PRO B 1 285 ? 43.911  -41.600 17.669 1.00 81.18  ? 1792 PRO B CA  1 
ATOM   5589 C C   . PRO B 1 285 ? 44.281  -43.050 17.337 1.00 81.41  ? 1792 PRO B C   1 
ATOM   5590 O O   . PRO B 1 285 ? 45.358  -43.290 16.789 1.00 81.69  ? 1792 PRO B O   1 
ATOM   5591 C CB  . PRO B 1 285 ? 44.679  -41.140 18.918 1.00 80.95  ? 1792 PRO B CB  1 
ATOM   5592 C CG  . PRO B 1 285 ? 43.690  -40.413 19.759 1.00 80.62  ? 1792 PRO B CG  1 
ATOM   5593 C CD  . PRO B 1 285 ? 42.375  -41.033 19.459 1.00 80.58  ? 1792 PRO B CD  1 
ATOM   5594 N N   . VAL B 1 286 ? 43.407  -44.000 17.662 1.00 77.88  ? 1793 VAL B N   1 
ATOM   5595 C CA  . VAL B 1 286 ? 43.674  -45.419 17.395 1.00 78.08  ? 1793 VAL B CA  1 
ATOM   5596 C C   . VAL B 1 286 ? 43.518  -45.780 15.905 1.00 78.45  ? 1793 VAL B C   1 
ATOM   5597 O O   . VAL B 1 286 ? 43.966  -46.843 15.463 1.00 78.70  ? 1793 VAL B O   1 
ATOM   5598 C CB  . VAL B 1 286 ? 42.814  -46.346 18.300 1.00 77.83  ? 1793 VAL B CB  1 
ATOM   5599 C CG1 . VAL B 1 286 ? 41.419  -46.539 17.722 1.00 77.83  ? 1793 VAL B CG1 1 
ATOM   5600 C CG2 . VAL B 1 286 ? 43.506  -47.688 18.511 1.00 77.97  ? 1793 VAL B CG2 1 
ATOM   5601 N N   . VAL B 1 287 ? 42.887  -44.886 15.145 1.00 84.67  ? 1794 VAL B N   1 
ATOM   5602 C CA  . VAL B 1 287 ? 42.748  -45.033 13.693 1.00 85.06  ? 1794 VAL B CA  1 
ATOM   5603 C C   . VAL B 1 287 ? 43.768  -44.118 12.994 1.00 85.31  ? 1794 VAL B C   1 
ATOM   5604 O O   . VAL B 1 287 ? 43.591  -43.711 11.843 1.00 85.59  ? 1794 VAL B O   1 
ATOM   5605 C CB  . VAL B 1 287 ? 41.285  -44.767 13.230 1.00 85.01  ? 1794 VAL B CB  1 
ATOM   5606 C CG1 . VAL B 1 287 ? 41.107  -45.061 11.748 1.00 85.44  ? 1794 VAL B CG1 1 
ATOM   5607 C CG2 . VAL B 1 287 ? 40.318  -45.621 14.032 1.00 84.77  ? 1794 VAL B CG2 1 
ATOM   5608 N N   . CYS B 1 288 ? 44.840  -43.806 13.719 1.00 86.84  ? 1795 CYS B N   1 
ATOM   5609 C CA  . CYS B 1 288 ? 45.968  -43.051 13.188 1.00 87.08  ? 1795 CYS B CA  1 
ATOM   5610 C C   . CYS B 1 288 ? 47.195  -43.956 13.106 1.00 87.35  ? 1795 CYS B C   1 
ATOM   5611 O O   . CYS B 1 288 ? 47.310  -44.910 13.880 1.00 87.24  ? 1795 CYS B O   1 
ATOM   5612 C CB  . CYS B 1 288 ? 46.268  -41.843 14.076 1.00 86.79  ? 1795 CYS B CB  1 
ATOM   5613 S SG  . CYS B 1 288 ? 44.913  -40.665 14.205 1.00 86.51  ? 1795 CYS B SG  1 
ATOM   5614 N N   . PRO B 1 289 ? 48.115  -43.670 12.165 1.00 84.36  ? 1796 PRO B N   1 
ATOM   5615 C CA  . PRO B 1 289 ? 49.317  -44.492 12.057 1.00 84.64  ? 1796 PRO B CA  1 
ATOM   5616 C C   . PRO B 1 289 ? 50.397  -44.082 13.059 1.00 84.49  ? 1796 PRO B C   1 
ATOM   5617 O O   . PRO B 1 289 ? 50.294  -43.024 13.685 1.00 84.18  ? 1796 PRO B O   1 
ATOM   5618 C CB  . PRO B 1 289 ? 49.788  -44.222 10.627 1.00 85.12  ? 1796 PRO B CB  1 
ATOM   5619 C CG  . PRO B 1 289 ? 49.340  -42.830 10.347 1.00 85.01  ? 1796 PRO B CG  1 
ATOM   5620 C CD  . PRO B 1 289 ? 48.092  -42.590 11.158 1.00 84.55  ? 1796 PRO B CD  1 
ATOM   5621 N N   . ASP B 1 290 ? 51.415  -44.927 13.207 1.00 85.66  ? 1797 ASP B N   1 
ATOM   5622 C CA  . ASP B 1 290 ? 52.572  -44.607 14.035 1.00 85.62  ? 1797 ASP B CA  1 
ATOM   5623 C C   . ASP B 1 290 ? 53.419  -43.554 13.327 1.00 85.89  ? 1797 ASP B C   1 
ATOM   5624 O O   . ASP B 1 290 ? 53.928  -43.793 12.227 1.00 86.33  ? 1797 ASP B O   1 
ATOM   5625 C CB  . ASP B 1 290 ? 53.403  -45.865 14.315 1.00 85.81  ? 1797 ASP B CB  1 
ATOM   5626 C CG  . ASP B 1 290 ? 52.644  -46.904 15.123 1.00 85.55  ? 1797 ASP B CG  1 
ATOM   5627 O OD1 . ASP B 1 290 ? 52.059  -46.547 16.168 1.00 85.13  ? 1797 ASP B OD1 1 
ATOM   5628 O OD2 . ASP B 1 290 ? 52.645  -48.085 14.718 1.00 85.77  ? 1797 ASP B OD2 1 
ATOM   5629 N N   . GLU B 1 291 ? 53.552  -42.387 13.952 1.00 92.19  ? 1798 GLU B N   1 
ATOM   5630 C CA  . GLU B 1 291 ? 54.313  -41.285 13.369 1.00 92.41  ? 1798 GLU B CA  1 
ATOM   5631 C C   . GLU B 1 291 ? 55.739  -41.242 13.917 1.00 92.55  ? 1798 GLU B C   1 
ATOM   5632 O O   . GLU B 1 291 ? 55.948  -41.093 15.124 1.00 92.26  ? 1798 GLU B O   1 
ATOM   5633 C CB  . GLU B 1 291 ? 53.601  -39.946 13.599 1.00 92.09  ? 1798 GLU B CB  1 
ATOM   5634 C CG  . GLU B 1 291 ? 54.138  -38.796 12.745 1.00 92.32  ? 1798 GLU B CG  1 
ATOM   5635 C CD  . GLU B 1 291 ? 53.475  -37.460 13.046 1.00 92.02  ? 1798 GLU B CD  1 
ATOM   5636 O OE1 . GLU B 1 291 ? 53.001  -37.260 14.186 1.00 91.60  ? 1798 GLU B OE1 1 
ATOM   5637 O OE2 . GLU B 1 291 ? 53.438  -36.602 12.139 1.00 92.21  ? 1798 GLU B OE2 1 
ATOM   5638 N N   . VAL B 1 292 ? 56.709  -41.385 13.016 1.00 102.15 ? 1799 VAL B N   1 
ATOM   5639 C CA  . VAL B 1 292 ? 58.126  -41.267 13.360 1.00 102.37 ? 1799 VAL B CA  1 
ATOM   5640 C C   . VAL B 1 292 ? 58.456  -39.790 13.584 1.00 102.25 ? 1799 VAL B C   1 
ATOM   5641 O O   . VAL B 1 292 ? 58.139  -38.940 12.748 1.00 102.32 ? 1799 VAL B O   1 
ATOM   5642 C CB  . VAL B 1 292 ? 59.043  -41.873 12.262 1.00 102.96 ? 1799 VAL B CB  1 
ATOM   5643 C CG1 . VAL B 1 292 ? 60.510  -41.799 12.674 1.00 103.20 ? 1799 VAL B CG1 1 
ATOM   5644 C CG2 . VAL B 1 292 ? 58.652  -43.319 11.967 1.00 103.09 ? 1799 VAL B CG2 1 
ATOM   5645 N N   . ARG B 1 293 ? 59.086  -39.502 14.722 1.00 108.82 ? 1800 ARG B N   1 
ATOM   5646 C CA  . ARG B 1 293 ? 59.367  -38.133 15.164 1.00 108.65 ? 1800 ARG B CA  1 
ATOM   5647 C C   . ARG B 1 293 ? 60.146  -37.303 14.135 1.00 109.03 ? 1800 ARG B C   1 
ATOM   5648 O O   . ARG B 1 293 ? 60.993  -37.832 13.409 1.00 109.48 ? 1800 ARG B O   1 
ATOM   5649 C CB  . ARG B 1 293 ? 60.103  -38.161 16.514 1.00 108.47 ? 1800 ARG B CB  1 
ATOM   5650 C CG  . ARG B 1 293 ? 60.333  -36.797 17.160 1.00 108.26 ? 1800 ARG B CG  1 
ATOM   5651 C CD  . ARG B 1 293 ? 59.078  -36.250 17.830 1.00 107.75 ? 1800 ARG B CD  1 
ATOM   5652 N NE  . ARG B 1 293 ? 58.949  -34.805 17.638 1.00 107.66 ? 1800 ARG B NE  1 
ATOM   5653 C CZ  . ARG B 1 293 ? 59.600  -33.879 18.340 1.00 107.59 ? 1800 ARG B CZ  1 
ATOM   5654 N NH1 . ARG B 1 293 ? 60.447  -34.227 19.301 1.00 107.62 ? 1800 ARG B NH1 1 
ATOM   5655 N NH2 . ARG B 1 293 ? 59.404  -32.594 18.077 1.00 107.50 ? 1800 ARG B NH2 1 
ATOM   5656 N N   . MET B 1 294 ? 59.835  -36.005 14.085 1.00 127.45 ? 1801 MET B N   1 
ATOM   5657 C CA  . MET B 1 294 ? 60.497  -35.042 13.197 1.00 127.75 ? 1801 MET B CA  1 
ATOM   5658 C C   . MET B 1 294 ? 62.020  -35.051 13.316 1.00 128.10 ? 1801 MET B C   1 
ATOM   5659 O O   . MET B 1 294 ? 62.727  -35.227 12.322 1.00 128.58 ? 1801 MET B O   1 
ATOM   5660 C CB  . MET B 1 294 ? 59.967  -33.626 13.456 1.00 127.42 ? 1801 MET B CB  1 
ATOM   5661 C CG  . MET B 1 294 ? 59.063  -33.080 12.360 1.00 127.45 ? 1801 MET B CG  1 
ATOM   5662 S SD  . MET B 1 294 ? 59.955  -32.659 10.843 1.00 128.04 ? 1801 MET B SD  1 
ATOM   5663 C CE  . MET B 1 294 ? 60.881  -31.209 11.356 1.00 128.00 ? 1801 MET B CE  1 
ATOM   5664 N N   . ASP B 1 295 ? 62.511  -34.858 14.537 1.00 132.37 ? 1802 ASP B N   1 
ATOM   5665 C CA  . ASP B 1 295 ? 63.946  -34.804 14.800 1.00 132.67 ? 1802 ASP B CA  1 
ATOM   5666 C C   . ASP B 1 295 ? 64.349  -35.759 15.927 1.00 132.56 ? 1802 ASP B C   1 
ATOM   5667 O O   . ASP B 1 295 ? 64.727  -35.332 17.023 1.00 132.30 ? 1802 ASP B O   1 
ATOM   5668 C CB  . ASP B 1 295 ? 64.396  -33.360 15.081 1.00 132.60 ? 1802 ASP B CB  1 
ATOM   5669 C CG  . ASP B 1 295 ? 63.337  -32.539 15.805 1.00 132.06 ? 1802 ASP B CG  1 
ATOM   5670 O OD1 . ASP B 1 295 ? 62.812  -33.003 16.840 1.00 131.70 ? 1802 ASP B OD1 1 
ATOM   5671 O OD2 . ASP B 1 295 ? 63.032  -31.422 15.335 1.00 132.02 ? 1802 ASP B OD2 1 
ATOM   5672 N N   . GLY B 1 296 ? 64.244  -37.056 15.637 1.00 124.87 ? 1803 GLY B N   1 
ATOM   5673 C CA  . GLY B 1 296 ? 64.672  -38.128 16.539 1.00 124.85 ? 1803 GLY B CA  1 
ATOM   5674 C C   . GLY B 1 296 ? 64.161  -38.044 17.964 1.00 124.34 ? 1803 GLY B C   1 
ATOM   5675 O O   . GLY B 1 296 ? 63.063  -38.509 18.273 1.00 124.02 ? 1803 GLY B O   1 
ATOM   5676 N N   . CYS B 1 297 ? 64.975  -37.449 18.831 1.00 111.66 ? 1804 CYS B N   1 
ATOM   5677 C CA  . CYS B 1 297 ? 64.668  -37.323 20.251 1.00 111.23 ? 1804 CYS B CA  1 
ATOM   5678 C C   . CYS B 1 297 ? 65.229  -35.991 20.768 1.00 111.16 ? 1804 CYS B C   1 
ATOM   5679 O O   . CYS B 1 297 ? 65.986  -35.950 21.741 1.00 111.16 ? 1804 CYS B O   1 
ATOM   5680 C CB  . CYS B 1 297 ? 65.234  -38.534 21.014 1.00 111.31 ? 1804 CYS B CB  1 
ATOM   5681 S SG  . CYS B 1 297 ? 65.029  -38.556 22.823 1.00 110.90 ? 1804 CYS B SG  1 
ATOM   5682 N N   . THR B 1 298 ? 64.857  -34.902 20.094 1.00 114.75 ? 1805 THR B N   1 
ATOM   5683 C CA  . THR B 1 298 ? 65.345  -33.558 20.428 1.00 114.69 ? 1805 THR B CA  1 
ATOM   5684 C C   . THR B 1 298 ? 64.235  -32.502 20.371 1.00 114.32 ? 1805 THR B C   1 
ATOM   5685 O O   . THR B 1 298 ? 63.168  -32.740 19.800 1.00 114.19 ? 1805 THR B O   1 
ATOM   5686 C CB  . THR B 1 298 ? 66.498  -33.111 19.494 1.00 115.18 ? 1805 THR B CB  1 
ATOM   5687 O OG1 . THR B 1 298 ? 66.104  -33.281 18.128 1.00 115.39 ? 1805 THR B OG1 1 
ATOM   5688 C CG2 . THR B 1 298 ? 67.769  -33.910 19.759 1.00 115.56 ? 1805 THR B CG2 1 
ATOM   5689 N N   . LEU B 1 299 ? 64.505  -31.338 20.961 1.00 115.71 ? 1806 LEU B N   1 
ATOM   5690 C CA  . LEU B 1 299 ? 63.559  -30.219 20.983 1.00 115.38 ? 1806 LEU B CA  1 
ATOM   5691 C C   . LEU B 1 299 ? 64.140  -28.990 20.282 1.00 115.58 ? 1806 LEU B C   1 
ATOM   5692 O O   . LEU B 1 299 ? 65.316  -28.669 20.454 1.00 115.84 ? 1806 LEU B O   1 
ATOM   5693 C CB  . LEU B 1 299 ? 63.169  -29.881 22.432 1.00 114.97 ? 1806 LEU B CB  1 
ATOM   5694 C CG  . LEU B 1 299 ? 62.100  -28.834 22.803 1.00 114.57 ? 1806 LEU B CG  1 
ATOM   5695 C CD1 . LEU B 1 299 ? 62.663  -27.409 22.848 1.00 114.63 ? 1806 LEU B CD1 1 
ATOM   5696 C CD2 . LEU B 1 299 ? 60.852  -28.906 21.915 1.00 114.44 ? 1806 LEU B CD2 1 
ATOM   5697 N N   . THR B 1 300 ? 63.304  -28.311 19.498 1.00 128.23 ? 1807 THR B N   1 
ATOM   5698 C CA  . THR B 1 300 ? 63.699  -27.076 18.811 1.00 128.39 ? 1807 THR B CA  1 
ATOM   5699 C C   . THR B 1 300 ? 62.553  -26.055 18.726 1.00 128.06 ? 1807 THR B C   1 
ATOM   5700 O O   . THR B 1 300 ? 61.526  -26.302 18.086 1.00 127.99 ? 1807 THR B O   1 
ATOM   5701 C CB  . THR B 1 300 ? 64.333  -27.351 17.407 1.00 128.89 ? 1807 THR B CB  1 
ATOM   5702 O OG1 . THR B 1 300 ? 64.559  -26.112 16.723 1.00 129.02 ? 1807 THR B OG1 1 
ATOM   5703 C CG2 . THR B 1 300 ? 63.443  -28.252 16.549 1.00 128.95 ? 1807 THR B CG2 1 
ATOM   5704 N N   . ASP B 1 301 ? 62.742  -24.918 19.391 1.00 135.99 ? 1808 ASP B N   1 
ATOM   5705 C CA  . ASP B 1 301 ? 61.765  -23.828 19.399 1.00 135.70 ? 1808 ASP B CA  1 
ATOM   5706 C C   . ASP B 1 301 ? 62.422  -22.555 18.870 1.00 135.90 ? 1808 ASP B C   1 
ATOM   5707 O O   . ASP B 1 301 ? 63.606  -22.321 19.117 1.00 136.15 ? 1808 ASP B O   1 
ATOM   5708 C CB  . ASP B 1 301 ? 61.236  -23.603 20.821 1.00 135.27 ? 1808 ASP B CB  1 
ATOM   5709 C CG  . ASP B 1 301 ? 59.844  -22.985 20.846 1.00 134.93 ? 1808 ASP B CG  1 
ATOM   5710 O OD1 . ASP B 1 301 ? 59.523  -22.157 19.966 1.00 135.00 ? 1808 ASP B OD1 1 
ATOM   5711 O OD2 . ASP B 1 301 ? 59.067  -23.325 21.763 1.00 134.61 ? 1808 ASP B OD2 1 
ATOM   5712 N N   . GLU B 1 302 ? 61.655  -21.734 18.154 1.00 156.03 ? 1809 GLU B N   1 
ATOM   5713 C CA  . GLU B 1 302 ? 62.195  -20.526 17.512 1.00 156.23 ? 1809 GLU B CA  1 
ATOM   5714 C C   . GLU B 1 302 ? 62.450  -19.362 18.479 1.00 156.01 ? 1809 GLU B C   1 
ATOM   5715 O O   . GLU B 1 302 ? 63.108  -18.382 18.116 1.00 156.18 ? 1809 GLU B O   1 
ATOM   5716 C CB  . GLU B 1 302 ? 61.310  -20.079 16.336 1.00 156.31 ? 1809 GLU B CB  1 
ATOM   5717 C CG  . GLU B 1 302 ? 60.048  -19.303 16.719 1.00 155.91 ? 1809 GLU B CG  1 
ATOM   5718 C CD  . GLU B 1 302 ? 58.920  -20.193 17.209 1.00 155.60 ? 1809 GLU B CD  1 
ATOM   5719 O OE1 . GLU B 1 302 ? 58.555  -21.151 16.495 1.00 155.73 ? 1809 GLU B OE1 1 
ATOM   5720 O OE2 . GLU B 1 302 ? 58.389  -19.924 18.307 1.00 155.24 ? 1809 GLU B OE2 1 
ATOM   5721 N N   . GLN B 1 303 ? 61.926  -19.476 19.700 1.00 153.95 ? 1810 GLN B N   1 
ATOM   5722 C CA  . GLN B 1 303 ? 62.109  -18.455 20.738 1.00 153.72 ? 1810 GLN B CA  1 
ATOM   5723 C C   . GLN B 1 303 ? 63.554  -18.409 21.237 1.00 153.94 ? 1810 GLN B C   1 
ATOM   5724 O O   . GLN B 1 303 ? 64.060  -17.346 21.602 1.00 153.92 ? 1810 GLN B O   1 
ATOM   5725 C CB  . GLN B 1 303 ? 61.152  -18.698 21.911 1.00 153.30 ? 1810 GLN B CB  1 
ATOM   5726 C CG  . GLN B 1 303 ? 59.664  -18.659 21.547 1.00 153.07 ? 1810 GLN B CG  1 
ATOM   5727 C CD  . GLN B 1 303 ? 59.141  -17.254 21.281 1.00 152.94 ? 1810 GLN B CD  1 
ATOM   5728 O OE1 . GLN B 1 303 ? 59.559  -16.287 21.920 1.00 152.84 ? 1810 GLN B OE1 1 
ATOM   5729 N NE2 . GLN B 1 303 ? 58.211  -17.141 20.340 1.00 152.97 ? 1810 GLN B NE2 1 
ATOM   5730 N N   . LEU B 1 304 ? 64.205  -19.571 21.249 1.00 146.88 ? 1811 LEU B N   1 
ATOM   5731 C CA  . LEU B 1 304 ? 65.616  -19.693 21.622 1.00 147.16 ? 1811 LEU B CA  1 
ATOM   5732 C C   . LEU B 1 304 ? 66.485  -20.058 20.413 1.00 147.64 ? 1811 LEU B C   1 
ATOM   5733 O O   . LEU B 1 304 ? 67.650  -19.659 20.336 1.00 147.94 ? 1811 LEU B O   1 
ATOM   5734 C CB  . LEU B 1 304 ? 65.802  -20.715 22.752 1.00 147.05 ? 1811 LEU B CB  1 
ATOM   5735 C CG  . LEU B 1 304 ? 65.135  -22.091 22.637 1.00 146.99 ? 1811 LEU B CG  1 
ATOM   5736 C CD1 . LEU B 1 304 ? 66.039  -23.169 23.199 1.00 147.17 ? 1811 LEU B CD1 1 
ATOM   5737 C CD2 . LEU B 1 304 ? 63.770  -22.114 23.321 1.00 146.54 ? 1811 LEU B CD2 1 
ATOM   5738 N N   . LEU B 1 305 ? 65.902  -20.830 19.492 1.00 153.73 ? 1812 LEU B N   1 
ATOM   5739 C CA  . LEU B 1 305 ? 66.477  -21.154 18.170 1.00 154.18 ? 1812 LEU B CA  1 
ATOM   5740 C C   . LEU B 1 305 ? 67.454  -22.347 18.119 1.00 154.53 ? 1812 LEU B C   1 
ATOM   5741 O O   . LEU B 1 305 ? 67.693  -22.900 17.042 1.00 154.89 ? 1812 LEU B O   1 
ATOM   5742 C CB  . LEU B 1 305 ? 67.073  -19.908 17.486 1.00 154.41 ? 1812 LEU B CB  1 
ATOM   5743 C CG  . LEU B 1 305 ? 66.969  -19.794 15.961 1.00 154.73 ? 1812 LEU B CG  1 
ATOM   5744 C CD1 . LEU B 1 305 ? 65.525  -19.590 15.509 1.00 154.45 ? 1812 LEU B CD1 1 
ATOM   5745 C CD2 . LEU B 1 305 ? 67.844  -18.658 15.453 1.00 155.01 ? 1812 LEU B CD2 1 
ATOM   5746 N N   . TYR B 1 306 ? 68.004  -22.744 19.267 1.00 143.70 ? 1813 TYR B N   1 
ATOM   5747 C CA  . TYR B 1 306 ? 68.928  -23.888 19.327 1.00 144.03 ? 1813 TYR B CA  1 
ATOM   5748 C C   . TYR B 1 306 ? 68.280  -25.162 19.890 1.00 143.82 ? 1813 TYR B C   1 
ATOM   5749 O O   . TYR B 1 306 ? 67.242  -25.099 20.557 1.00 143.39 ? 1813 TYR B O   1 
ATOM   5750 C CB  . TYR B 1 306 ? 70.213  -23.533 20.092 1.00 144.22 ? 1813 TYR B CB  1 
ATOM   5751 C CG  . TYR B 1 306 ? 69.993  -22.974 21.481 1.00 143.83 ? 1813 TYR B CG  1 
ATOM   5752 C CD1 . TYR B 1 306 ? 69.926  -21.598 21.696 1.00 143.67 ? 1813 TYR B CD1 1 
ATOM   5753 C CD2 . TYR B 1 306 ? 69.863  -23.820 22.583 1.00 143.65 ? 1813 TYR B CD2 1 
ATOM   5754 C CE1 . TYR B 1 306 ? 69.725  -21.078 22.971 1.00 143.34 ? 1813 TYR B CE1 1 
ATOM   5755 C CE2 . TYR B 1 306 ? 69.662  -23.310 23.862 1.00 143.32 ? 1813 TYR B CE2 1 
ATOM   5756 C CZ  . TYR B 1 306 ? 69.595  -21.939 24.047 1.00 143.17 ? 1813 TYR B CZ  1 
ATOM   5757 O OH  . TYR B 1 306 ? 69.398  -21.427 25.309 1.00 142.88 ? 1813 TYR B OH  1 
ATOM   5758 N N   . SER B 1 307 ? 68.907  -26.308 19.621 1.00 131.12 ? 1814 SER B N   1 
ATOM   5759 C CA  . SER B 1 307 ? 68.335  -27.617 19.951 1.00 130.99 ? 1814 SER B CA  1 
ATOM   5760 C C   . SER B 1 307 ? 68.904  -28.247 21.224 1.00 130.93 ? 1814 SER B C   1 
ATOM   5761 O O   . SER B 1 307 ? 70.098  -28.127 21.508 1.00 131.22 ? 1814 SER B O   1 
ATOM   5762 C CB  . SER B 1 307 ? 68.512  -28.582 18.775 1.00 131.39 ? 1814 SER B CB  1 
ATOM   5763 O OG  . SER B 1 307 ? 69.884  -28.786 18.481 1.00 131.88 ? 1814 SER B OG  1 
ATOM   5764 N N   . PHE B 1 308 ? 68.034  -28.922 21.977 1.00 119.89 ? 1815 PHE B N   1 
ATOM   5765 C CA  . PHE B 1 308 ? 68.433  -29.680 23.166 1.00 119.83 ? 1815 PHE B CA  1 
ATOM   5766 C C   . PHE B 1 308 ? 68.464  -31.178 22.871 1.00 120.02 ? 1815 PHE B C   1 
ATOM   5767 O O   . PHE B 1 308 ? 67.458  -31.756 22.452 1.00 119.83 ? 1815 PHE B O   1 
ATOM   5768 C CB  . PHE B 1 308 ? 67.484  -29.405 24.338 1.00 119.33 ? 1815 PHE B CB  1 
ATOM   5769 C CG  . PHE B 1 308 ? 67.645  -28.042 24.951 1.00 119.16 ? 1815 PHE B CG  1 
ATOM   5770 C CD1 . PHE B 1 308 ? 68.786  -27.722 25.685 1.00 119.35 ? 1815 PHE B CD1 1 
ATOM   5771 C CD2 . PHE B 1 308 ? 66.648  -27.083 24.811 1.00 118.84 ? 1815 PHE B CD2 1 
ATOM   5772 C CE1 . PHE B 1 308 ? 68.936  -26.462 26.258 1.00 119.21 ? 1815 PHE B CE1 1 
ATOM   5773 C CE2 . PHE B 1 308 ? 66.787  -25.821 25.383 1.00 118.69 ? 1815 PHE B CE2 1 
ATOM   5774 C CZ  . PHE B 1 308 ? 67.934  -25.510 26.107 1.00 118.88 ? 1815 PHE B CZ  1 
ATOM   5775 N N   . ASN B 1 309 ? 69.620  -31.799 23.094 1.00 120.33 ? 1816 ASN B N   1 
ATOM   5776 C CA  . ASN B 1 309 ? 69.790  -33.228 22.844 1.00 120.56 ? 1816 ASN B CA  1 
ATOM   5777 C C   . ASN B 1 309 ? 69.347  -34.078 24.032 1.00 120.28 ? 1816 ASN B C   1 
ATOM   5778 O O   . ASN B 1 309 ? 69.987  -34.080 25.084 1.00 120.31 ? 1816 ASN B O   1 
ATOM   5779 C CB  . ASN B 1 309 ? 71.240  -33.542 22.457 1.00 121.12 ? 1816 ASN B CB  1 
ATOM   5780 C CG  . ASN B 1 309 ? 71.400  -34.921 21.827 1.00 121.43 ? 1816 ASN B CG  1 
ATOM   5781 O OD1 . ASN B 1 309 ? 70.418  -35.615 21.550 1.00 121.24 ? 1816 ASN B OD1 1 
ATOM   5782 N ND2 . ASN B 1 309 ? 72.655  -35.317 21.593 1.00 121.92 ? 1816 ASN B ND2 1 
ATOM   5783 N N   . LEU B 1 310 ? 68.241  -34.795 23.851 1.00 109.91 ? 1817 LEU B N   1 
ATOM   5784 C CA  . LEU B 1 310 ? 67.697  -35.672 24.887 1.00 109.64 ? 1817 LEU B CA  1 
ATOM   5785 C C   . LEU B 1 310 ? 67.964  -37.145 24.574 1.00 109.91 ? 1817 LEU B C   1 
ATOM   5786 O O   . LEU B 1 310 ? 67.570  -38.032 25.337 1.00 109.75 ? 1817 LEU B O   1 
ATOM   5787 C CB  . LEU B 1 310 ? 66.195  -35.421 25.070 1.00 109.16 ? 1817 LEU B CB  1 
ATOM   5788 C CG  . LEU B 1 310 ? 65.759  -34.028 25.535 1.00 108.84 ? 1817 LEU B CG  1 
ATOM   5789 C CD1 . LEU B 1 310 ? 64.281  -33.811 25.258 1.00 108.50 ? 1817 LEU B CD1 1 
ATOM   5790 C CD2 . LEU B 1 310 ? 66.070  -33.808 27.010 1.00 108.63 ? 1817 LEU B CD2 1 
ATOM   5791 N N   . SER B 1 311 ? 68.644  -37.390 23.454 1.00 117.73 ? 1818 SER B N   1 
ATOM   5792 C CA  . SER B 1 311 ? 69.020  -38.741 23.028 1.00 118.05 ? 1818 SER B CA  1 
ATOM   5793 C C   . SER B 1 311 ? 70.113  -39.339 23.915 1.00 118.30 ? 1818 SER B C   1 
ATOM   5794 O O   . SER B 1 311 ? 70.359  -40.547 23.880 1.00 118.51 ? 1818 SER B O   1 
ATOM   5795 C CB  . SER B 1 311 ? 69.484  -38.738 21.568 1.00 118.48 ? 1818 SER B CB  1 
ATOM   5796 O OG  . SER B 1 311 ? 68.510  -38.164 20.714 1.00 118.29 ? 1818 SER B OG  1 
ATOM   5797 N N   . SER B 1 312 ? 70.772  -38.485 24.696 1.00 122.46 ? 1819 SER B N   1 
ATOM   5798 C CA  . SER B 1 312 ? 71.783  -38.921 25.658 1.00 122.67 ? 1819 SER B CA  1 
ATOM   5799 C C   . SER B 1 312 ? 71.142  -39.635 26.848 1.00 122.35 ? 1819 SER B C   1 
ATOM   5800 O O   . SER B 1 312 ? 71.719  -40.574 27.402 1.00 122.56 ? 1819 SER B O   1 
ATOM   5801 C CB  . SER B 1 312 ? 72.619  -37.731 26.138 1.00 122.74 ? 1819 SER B CB  1 
ATOM   5802 O OG  . SER B 1 312 ? 71.801  -36.717 26.698 1.00 122.28 ? 1819 SER B OG  1 
ATOM   5803 N N   . LEU B 1 313 ? 69.947  -39.186 27.224 1.00 110.21 ? 1820 LEU B N   1 
ATOM   5804 C CA  . LEU B 1 313 ? 69.198  -39.774 28.333 1.00 109.88 ? 1820 LEU B CA  1 
ATOM   5805 C C   . LEU B 1 313 ? 68.456  -41.043 27.918 1.00 109.83 ? 1820 LEU B C   1 
ATOM   5806 O O   . LEU B 1 313 ? 68.001  -41.807 28.772 1.00 109.65 ? 1820 LEU B O   1 
ATOM   5807 C CB  . LEU B 1 313 ? 68.219  -38.752 28.923 1.00 109.39 ? 1820 LEU B CB  1 
ATOM   5808 C CG  . LEU B 1 313 ? 68.742  -37.726 29.937 1.00 109.32 ? 1820 LEU B CG  1 
ATOM   5809 C CD1 . LEU B 1 313 ? 69.623  -36.663 29.292 1.00 109.63 ? 1820 LEU B CD1 1 
ATOM   5810 C CD2 . LEU B 1 313 ? 67.577  -37.065 30.643 1.00 108.83 ? 1820 LEU B CD2 1 
ATOM   5811 N N   . SER B 1 314 ? 68.348  -41.267 26.610 1.00 110.11 ? 1821 SER B N   1 
ATOM   5812 C CA  . SER B 1 314 ? 67.682  -42.452 26.069 1.00 110.11 ? 1821 SER B CA  1 
ATOM   5813 C C   . SER B 1 314 ? 68.583  -43.690 26.130 1.00 110.51 ? 1821 SER B C   1 
ATOM   5814 O O   . SER B 1 314 ? 68.628  -44.489 25.190 1.00 110.75 ? 1821 SER B O   1 
ATOM   5815 C CB  . SER B 1 314 ? 67.205  -42.194 24.634 1.00 110.20 ? 1821 SER B CB  1 
ATOM   5816 O OG  . SER B 1 314 ? 68.294  -42.050 23.741 1.00 110.70 ? 1821 SER B OG  1 
ATOM   5817 N N   . THR B 1 315 ? 69.287  -43.844 27.249 1.00 118.25 ? 1822 THR B N   1 
ATOM   5818 C CA  . THR B 1 315 ? 70.242  -44.936 27.425 1.00 118.65 ? 1822 THR B CA  1 
ATOM   5819 C C   . THR B 1 315 ? 69.583  -46.259 27.838 1.00 118.51 ? 1822 THR B C   1 
ATOM   5820 O O   . THR B 1 315 ? 69.802  -47.285 27.189 1.00 118.80 ? 1822 THR B O   1 
ATOM   5821 C CB  . THR B 1 315 ? 71.400  -44.555 28.399 1.00 118.85 ? 1822 THR B CB  1 
ATOM   5822 O OG1 . THR B 1 315 ? 72.219  -45.704 28.654 1.00 119.22 ? 1822 THR B OG1 1 
ATOM   5823 C CG2 . THR B 1 315 ? 70.869  -43.999 29.727 1.00 118.43 ? 1822 THR B CG2 1 
ATOM   5824 N N   . SER B 1 316 ? 68.777  -46.227 28.901 1.00 111.06 ? 1823 SER B N   1 
ATOM   5825 C CA  . SER B 1 316 ? 68.192  -47.444 29.472 1.00 110.92 ? 1823 SER B CA  1 
ATOM   5826 C C   . SER B 1 316 ? 66.936  -47.196 30.320 1.00 110.40 ? 1823 SER B C   1 
ATOM   5827 O O   . SER B 1 316 ? 66.303  -46.141 30.229 1.00 110.10 ? 1823 SER B O   1 
ATOM   5828 C CB  . SER B 1 316 ? 69.242  -48.192 30.302 1.00 111.25 ? 1823 SER B CB  1 
ATOM   5829 O OG  . SER B 1 316 ? 69.738  -47.372 31.346 1.00 111.21 ? 1823 SER B OG  1 
ATOM   5830 N N   . THR B 1 317 ? 66.595  -48.188 31.140 1.00 101.97 ? 1824 THR B N   1 
ATOM   5831 C CA  . THR B 1 317 ? 65.418  -48.156 32.005 1.00 101.52 ? 1824 THR B CA  1 
ATOM   5832 C C   . THR B 1 317 ? 65.734  -47.466 33.334 1.00 101.40 ? 1824 THR B C   1 
ATOM   5833 O O   . THR B 1 317 ? 66.844  -47.591 33.856 1.00 101.70 ? 1824 THR B O   1 
ATOM   5834 C CB  . THR B 1 317 ? 64.910  -49.591 32.286 1.00 101.49 ? 1824 THR B CB  1 
ATOM   5835 O OG1 . THR B 1 317 ? 64.891  -50.345 31.068 1.00 101.70 ? 1824 THR B OG1 1 
ATOM   5836 C CG2 . THR B 1 317 ? 63.512  -49.575 32.878 1.00 101.03 ? 1824 THR B CG2 1 
ATOM   5837 N N   . PHE B 1 318 ? 64.751  -46.743 33.870 1.00 97.63  ? 1825 PHE B N   1 
ATOM   5838 C CA  . PHE B 1 318 ? 64.873  -46.078 35.171 1.00 97.49  ? 1825 PHE B CA  1 
ATOM   5839 C C   . PHE B 1 318 ? 63.754  -46.513 36.114 1.00 97.16  ? 1825 PHE B C   1 
ATOM   5840 O O   . PHE B 1 318 ? 62.641  -46.803 35.673 1.00 96.93  ? 1825 PHE B O   1 
ATOM   5841 C CB  . PHE B 1 318 ? 64.876  -44.555 35.001 1.00 97.34  ? 1825 PHE B CB  1 
ATOM   5842 C CG  . PHE B 1 318 ? 66.103  -44.027 34.311 1.00 97.69  ? 1825 PHE B CG  1 
ATOM   5843 C CD1 . PHE B 1 318 ? 67.169  -43.524 35.052 1.00 97.90  ? 1825 PHE B CD1 1 
ATOM   5844 C CD2 . PHE B 1 318 ? 66.200  -44.039 32.920 1.00 97.85  ? 1825 PHE B CD2 1 
ATOM   5845 C CE1 . PHE B 1 318 ? 68.314  -43.039 34.419 1.00 98.24  ? 1825 PHE B CE1 1 
ATOM   5846 C CE2 . PHE B 1 318 ? 67.341  -43.560 32.276 1.00 98.20  ? 1825 PHE B CE2 1 
ATOM   5847 C CZ  . PHE B 1 318 ? 68.400  -43.057 33.027 1.00 98.40  ? 1825 PHE B CZ  1 
ATOM   5848 N N   . LYS B 1 319 ? 64.055  -46.557 37.410 1.00 96.33  ? 1826 LYS B N   1 
ATOM   5849 C CA  . LYS B 1 319 ? 63.113  -47.078 38.404 1.00 96.08  ? 1826 LYS B CA  1 
ATOM   5850 C C   . LYS B 1 319 ? 62.736  -46.041 39.466 1.00 95.83  ? 1826 LYS B C   1 
ATOM   5851 O O   . LYS B 1 319 ? 63.238  -46.074 40.593 1.00 95.92  ? 1826 LYS B O   1 
ATOM   5852 C CB  . LYS B 1 319 ? 63.667  -48.352 39.064 1.00 96.33  ? 1826 LYS B CB  1 
ATOM   5853 C CG  . LYS B 1 319 ? 64.179  -49.423 38.098 1.00 96.65  ? 1826 LYS B CG  1 
ATOM   5854 C CD  . LYS B 1 319 ? 63.047  -50.091 37.326 1.00 96.46  ? 1826 LYS B CD  1 
ATOM   5855 C CE  . LYS B 1 319 ? 63.574  -51.130 36.348 1.00 96.80  ? 1826 LYS B CE  1 
ATOM   5856 N NZ  . LYS B 1 319 ? 64.180  -52.307 37.031 1.00 97.11  ? 1826 LYS B NZ  1 
ATOM   5857 N N   . VAL B 1 320 ? 61.848  -45.121 39.095 1.00 92.33  ? 1827 VAL B N   1 
ATOM   5858 C CA  . VAL B 1 320 ? 61.355  -44.104 40.021 1.00 92.08  ? 1827 VAL B CA  1 
ATOM   5859 C C   . VAL B 1 320 ? 60.278  -44.718 40.911 1.00 91.85  ? 1827 VAL B C   1 
ATOM   5860 O O   . VAL B 1 320 ? 59.329  -45.330 40.416 1.00 91.69  ? 1827 VAL B O   1 
ATOM   5861 C CB  . VAL B 1 320 ? 60.790  -42.871 39.284 1.00 91.87  ? 1827 VAL B CB  1 
ATOM   5862 C CG1 . VAL B 1 320 ? 60.665  -41.701 40.238 1.00 91.71  ? 1827 VAL B CG1 1 
ATOM   5863 C CG2 . VAL B 1 320 ? 61.680  -42.490 38.112 1.00 92.10  ? 1827 VAL B CG2 1 
ATOM   5864 N N   . THR B 1 321 ? 60.435  -44.551 42.222 1.00 93.67  ? 1828 THR B N   1 
ATOM   5865 C CA  . THR B 1 321 ? 59.570  -45.216 43.194 1.00 93.51  ? 1828 THR B CA  1 
ATOM   5866 C C   . THR B 1 321 ? 59.107  -44.278 44.304 1.00 93.34  ? 1828 THR B C   1 
ATOM   5867 O O   . THR B 1 321 ? 59.916  -43.582 44.920 1.00 93.48  ? 1828 THR B O   1 
ATOM   5868 C CB  . THR B 1 321 ? 60.279  -46.435 43.829 1.00 93.78  ? 1828 THR B CB  1 
ATOM   5869 O OG1 . THR B 1 321 ? 60.951  -47.183 42.810 1.00 93.99  ? 1828 THR B OG1 1 
ATOM   5870 C CG2 . THR B 1 321 ? 59.280  -47.338 44.537 1.00 93.63  ? 1828 THR B CG2 1 
ATOM   5871 N N   . ARG B 1 322 ? 57.797  -44.271 44.545 1.00 94.52  ? 1829 ARG B N   1 
ATOM   5872 C CA  . ARG B 1 322 ? 57.200  -43.546 45.666 1.00 94.36  ? 1829 ARG B CA  1 
ATOM   5873 C C   . ARG B 1 322 ? 55.966  -44.267 46.198 1.00 94.16  ? 1829 ARG B C   1 
ATOM   5874 O O   . ARG B 1 322 ? 55.050  -44.586 45.436 1.00 93.98  ? 1829 ARG B O   1 
ATOM   5875 C CB  . ARG B 1 322 ? 56.850  -42.110 45.271 1.00 94.17  ? 1829 ARG B CB  1 
ATOM   5876 C CG  . ARG B 1 322 ? 57.925  -41.093 45.627 1.00 94.34  ? 1829 ARG B CG  1 
ATOM   5877 C CD  . ARG B 1 322 ? 57.480  -39.675 45.319 1.00 94.13  ? 1829 ARG B CD  1 
ATOM   5878 N NE  . ARG B 1 322 ? 56.276  -39.297 46.056 1.00 93.89  ? 1829 ARG B NE  1 
ATOM   5879 C CZ  . ARG B 1 322 ? 55.537  -38.222 45.795 1.00 93.66  ? 1829 ARG B CZ  1 
ATOM   5880 N NH1 . ARG B 1 322 ? 55.868  -37.400 44.807 1.00 93.64  ? 1829 ARG B NH1 1 
ATOM   5881 N NH2 . ARG B 1 322 ? 54.460  -37.968 46.524 1.00 93.48  ? 1829 ARG B NH2 1 
ATOM   5882 N N   . ASP B 1 323 ? 55.960  -44.517 47.509 1.00 98.88  ? 1830 ASP B N   1 
ATOM   5883 C CA  . ASP B 1 323 ? 54.871  -45.216 48.208 1.00 98.74  ? 1830 ASP B CA  1 
ATOM   5884 C C   . ASP B 1 323 ? 54.543  -46.575 47.588 1.00 98.75  ? 1830 ASP B C   1 
ATOM   5885 O O   . ASP B 1 323 ? 53.428  -46.796 47.105 1.00 98.54  ? 1830 ASP B O   1 
ATOM   5886 C CB  . ASP B 1 323 ? 53.611  -44.337 48.295 1.00 98.44  ? 1830 ASP B CB  1 
ATOM   5887 C CG  . ASP B 1 323 ? 53.805  -43.110 49.173 1.00 98.44  ? 1830 ASP B CG  1 
ATOM   5888 O OD1 . ASP B 1 323 ? 54.941  -42.593 49.257 1.00 98.62  ? 1830 ASP B OD1 1 
ATOM   5889 O OD2 . ASP B 1 323 ? 52.809  -42.656 49.774 1.00 98.26  ? 1830 ASP B OD2 1 
ATOM   5890 N N   . SER B 1 324 ? 55.529  -47.473 47.605 1.00 97.00  ? 1831 SER B N   1 
ATOM   5891 C CA  . SER B 1 324 ? 55.417  -48.829 47.039 1.00 97.06  ? 1831 SER B CA  1 
ATOM   5892 C C   . SER B 1 324 ? 55.312  -48.857 45.510 1.00 97.00  ? 1831 SER B C   1 
ATOM   5893 O O   . SER B 1 324 ? 55.700  -49.841 44.877 1.00 97.15  ? 1831 SER B O   1 
ATOM   5894 C CB  . SER B 1 324 ? 54.255  -49.611 47.669 1.00 96.92  ? 1831 SER B CB  1 
ATOM   5895 O OG  . SER B 1 324 ? 54.356  -49.631 49.082 1.00 97.00  ? 1831 SER B OG  1 
ATOM   5896 N N   . ARG B 1 325 ? 54.790  -47.777 44.930 1.00 88.43  ? 1832 ARG B N   1 
ATOM   5897 C CA  . ARG B 1 325 ? 54.594  -47.674 43.486 1.00 88.37  ? 1832 ARG B CA  1 
ATOM   5898 C C   . ARG B 1 325 ? 55.918  -47.492 42.751 1.00 88.62  ? 1832 ARG B C   1 
ATOM   5899 O O   . ARG B 1 325 ? 56.538  -46.429 42.820 1.00 88.67  ? 1832 ARG B O   1 
ATOM   5900 C CB  . ARG B 1 325 ? 53.641  -46.521 43.151 1.00 88.09  ? 1832 ARG B CB  1 
ATOM   5901 C CG  . ARG B 1 325 ? 52.207  -46.727 43.618 1.00 87.84  ? 1832 ARG B CG  1 
ATOM   5902 C CD  . ARG B 1 325 ? 51.318  -45.547 43.238 1.00 87.60  ? 1832 ARG B CD  1 
ATOM   5903 N NE  . ARG B 1 325 ? 51.631  -44.337 43.999 1.00 87.57  ? 1832 ARG B NE  1 
ATOM   5904 C CZ  . ARG B 1 325 ? 51.068  -44.003 45.159 1.00 87.47  ? 1832 ARG B CZ  1 
ATOM   5905 N NH1 . ARG B 1 325 ? 50.151  -44.785 45.717 1.00 87.39  ? 1832 ARG B NH1 1 
ATOM   5906 N NH2 . ARG B 1 325 ? 51.425  -42.880 45.766 1.00 87.47  ? 1832 ARG B NH2 1 
ATOM   5907 N N   . THR B 1 326 ? 56.343  -48.543 42.054 1.00 88.52  ? 1833 THR B N   1 
ATOM   5908 C CA  . THR B 1 326 ? 57.564  -48.511 41.256 1.00 88.80  ? 1833 THR B CA  1 
ATOM   5909 C C   . THR B 1 326 ? 57.220  -48.321 39.781 1.00 88.75  ? 1833 THR B C   1 
ATOM   5910 O O   . THR B 1 326 ? 56.641  -49.208 39.147 1.00 88.72  ? 1833 THR B O   1 
ATOM   5911 C CB  . THR B 1 326 ? 58.394  -49.803 41.432 1.00 89.10  ? 1833 THR B CB  1 
ATOM   5912 O OG1 . THR B 1 326 ? 58.516  -50.115 42.825 1.00 89.15  ? 1833 THR B OG1 1 
ATOM   5913 C CG2 . THR B 1 326 ? 59.784  -49.644 40.824 1.00 89.44  ? 1833 THR B CG2 1 
ATOM   5914 N N   . TYR B 1 327 ? 57.573  -47.157 39.245 1.00 84.74  ? 1834 TYR B N   1 
ATOM   5915 C CA  . TYR B 1 327 ? 57.345  -46.859 37.836 1.00 84.72  ? 1834 TYR B CA  1 
ATOM   5916 C C   . TYR B 1 327 ? 58.495  -47.366 36.966 1.00 85.08  ? 1834 TYR B C   1 
ATOM   5917 O O   . TYR B 1 327 ? 59.398  -48.055 37.448 1.00 85.32  ? 1834 TYR B O   1 
ATOM   5918 C CB  . TYR B 1 327 ? 57.141  -45.354 37.623 1.00 84.57  ? 1834 TYR B CB  1 
ATOM   5919 C CG  . TYR B 1 327 ? 55.863  -44.805 38.216 1.00 84.22  ? 1834 TYR B CG  1 
ATOM   5920 C CD1 . TYR B 1 327 ? 55.895  -43.957 39.321 1.00 84.12  ? 1834 TYR B CD1 1 
ATOM   5921 C CD2 . TYR B 1 327 ? 54.620  -45.128 37.671 1.00 84.02  ? 1834 TYR B CD2 1 
ATOM   5922 C CE1 . TYR B 1 327 ? 54.724  -43.445 39.870 1.00 83.83  ? 1834 TYR B CE1 1 
ATOM   5923 C CE2 . TYR B 1 327 ? 53.444  -44.622 38.213 1.00 83.72  ? 1834 TYR B CE2 1 
ATOM   5924 C CZ  . TYR B 1 327 ? 53.505  -43.783 39.312 1.00 83.63  ? 1834 TYR B CZ  1 
ATOM   5925 O OH  . TYR B 1 327 ? 52.345  -43.280 39.850 1.00 83.37  ? 1834 TYR B OH  1 
ATOM   5926 N N   . SER B 1 328 ? 58.444  -47.026 35.681 1.00 87.44  ? 1835 SER B N   1 
ATOM   5927 C CA  . SER B 1 328 ? 59.504  -47.347 34.737 1.00 87.79  ? 1835 SER B CA  1 
ATOM   5928 C C   . SER B 1 328 ? 59.532  -46.267 33.665 1.00 87.79  ? 1835 SER B C   1 
ATOM   5929 O O   . SER B 1 328 ? 58.663  -46.224 32.794 1.00 87.66  ? 1835 SER B O   1 
ATOM   5930 C CB  . SER B 1 328 ? 59.274  -48.728 34.119 1.00 87.92  ? 1835 SER B CB  1 
ATOM   5931 O OG  . SER B 1 328 ? 60.307  -49.063 33.212 1.00 88.30  ? 1835 SER B OG  1 
ATOM   5932 N N   . VAL B 1 329 ? 60.521  -45.382 33.746 1.00 87.88  ? 1836 VAL B N   1 
ATOM   5933 C CA  . VAL B 1 329 ? 60.591  -44.232 32.848 1.00 87.87  ? 1836 VAL B CA  1 
ATOM   5934 C C   . VAL B 1 329 ? 61.777  -44.331 31.889 1.00 88.27  ? 1836 VAL B C   1 
ATOM   5935 O O   . VAL B 1 329 ? 62.936  -44.197 32.290 1.00 88.50  ? 1836 VAL B O   1 
ATOM   5936 C CB  . VAL B 1 329 ? 60.643  -42.892 33.626 1.00 87.68  ? 1836 VAL B CB  1 
ATOM   5937 C CG1 . VAL B 1 329 ? 60.359  -41.733 32.696 1.00 87.57  ? 1836 VAL B CG1 1 
ATOM   5938 C CG2 . VAL B 1 329 ? 59.649  -42.893 34.774 1.00 87.36  ? 1836 VAL B CG2 1 
ATOM   5939 N N   . GLY B 1 330 ? 61.473  -44.576 30.619 1.00 93.40  ? 1837 GLY B N   1 
ATOM   5940 C CA  . GLY B 1 330 ? 62.487  -44.600 29.575 1.00 93.80  ? 1837 GLY B CA  1 
ATOM   5941 C C   . GLY B 1 330 ? 62.229  -43.484 28.586 1.00 93.75  ? 1837 GLY B C   1 
ATOM   5942 O O   . GLY B 1 330 ? 61.259  -43.536 27.829 1.00 93.60  ? 1837 GLY B O   1 
ATOM   5943 N N   . VAL B 1 331 ? 63.085  -42.465 28.609 1.00 95.70  ? 1838 VAL B N   1 
ATOM   5944 C CA  . VAL B 1 331 ? 62.979  -41.344 27.675 1.00 95.69  ? 1838 VAL B CA  1 
ATOM   5945 C C   . VAL B 1 331 ? 63.283  -41.840 26.265 1.00 96.03  ? 1838 VAL B C   1 
ATOM   5946 O O   . VAL B 1 331 ? 64.314  -42.472 26.036 1.00 96.41  ? 1838 VAL B O   1 
ATOM   5947 C CB  . VAL B 1 331 ? 63.926  -40.177 28.062 1.00 95.78  ? 1838 VAL B CB  1 
ATOM   5948 C CG1 . VAL B 1 331 ? 63.922  -39.087 26.993 1.00 95.83  ? 1838 VAL B CG1 1 
ATOM   5949 C CG2 . VAL B 1 331 ? 63.527  -39.592 29.406 1.00 95.44  ? 1838 VAL B CG2 1 
ATOM   5950 N N   . CYS B 1 332 ? 62.362  -41.572 25.338 1.00 101.50 ? 1839 CYS B N   1 
ATOM   5951 C CA  . CYS B 1 332 ? 62.476  -42.009 23.941 1.00 101.82 ? 1839 CYS B CA  1 
ATOM   5952 C C   . CYS B 1 332 ? 62.718  -43.520 23.800 1.00 102.06 ? 1839 CYS B C   1 
ATOM   5953 O O   . CYS B 1 332 ? 63.260  -43.983 22.793 1.00 102.44 ? 1839 CYS B O   1 
ATOM   5954 C CB  . CYS B 1 332 ? 63.555  -41.199 23.204 1.00 102.16 ? 1839 CYS B CB  1 
ATOM   5955 S SG  . CYS B 1 332 ? 63.214  -39.422 23.124 1.00 101.89 ? 1839 CYS B SG  1 
ATOM   5956 N N   . THR B 1 333 ? 62.307  -44.275 24.818 1.00 102.07 ? 1840 THR B N   1 
ATOM   5957 C CA  . THR B 1 333 ? 62.466  -45.729 24.855 1.00 102.25 ? 1840 THR B CA  1 
ATOM   5958 C C   . THR B 1 333 ? 61.217  -46.365 25.468 1.00 101.88 ? 1840 THR B C   1 
ATOM   5959 O O   . THR B 1 333 ? 60.480  -45.707 26.204 1.00 101.50 ? 1840 THR B O   1 
ATOM   5960 C CB  . THR B 1 333 ? 63.707  -46.144 25.686 1.00 102.49 ? 1840 THR B CB  1 
ATOM   5961 O OG1 . THR B 1 333 ? 64.758  -45.187 25.508 1.00 102.72 ? 1840 THR B OG1 1 
ATOM   5962 C CG2 . THR B 1 333 ? 64.210  -47.526 25.272 1.00 102.85 ? 1840 THR B CG2 1 
ATOM   5963 N N   . PHE B 1 334 ? 60.978  -47.637 25.156 1.00 98.41  ? 1841 PHE B N   1 
ATOM   5964 C CA  . PHE B 1 334 ? 59.889  -48.392 25.773 1.00 98.11  ? 1841 PHE B CA  1 
ATOM   5965 C C   . PHE B 1 334 ? 60.173  -48.586 27.260 1.00 97.96  ? 1841 PHE B C   1 
ATOM   5966 O O   . PHE B 1 334 ? 61.278  -48.984 27.636 1.00 98.23  ? 1841 PHE B O   1 
ATOM   5967 C CB  . PHE B 1 334 ? 59.703  -49.748 25.083 1.00 98.32  ? 1841 PHE B CB  1 
ATOM   5968 C CG  . PHE B 1 334 ? 59.287  -49.645 23.639 1.00 98.47  ? 1841 PHE B CG  1 
ATOM   5969 C CD1 . PHE B 1 334 ? 57.948  -49.475 23.297 1.00 98.18  ? 1841 PHE B CD1 1 
ATOM   5970 C CD2 . PHE B 1 334 ? 60.233  -49.726 22.621 1.00 98.92  ? 1841 PHE B CD2 1 
ATOM   5971 C CE1 . PHE B 1 334 ? 57.557  -49.381 21.961 1.00 98.34  ? 1841 PHE B CE1 1 
ATOM   5972 C CE2 . PHE B 1 334 ? 59.853  -49.634 21.282 1.00 99.08  ? 1841 PHE B CE2 1 
ATOM   5973 C CZ  . PHE B 1 334 ? 58.513  -49.461 20.953 1.00 98.79  ? 1841 PHE B CZ  1 
ATOM   5974 N N   . ALA B 1 335 ? 59.175  -48.290 28.093 1.00 91.03  ? 1842 ALA B N   1 
ATOM   5975 C CA  . ALA B 1 335 ? 59.301  -48.354 29.553 1.00 90.87  ? 1842 ALA B CA  1 
ATOM   5976 C C   . ALA B 1 335 ? 59.899  -49.673 30.028 1.00 91.09  ? 1842 ALA B C   1 
ATOM   5977 O O   . ALA B 1 335 ? 60.965  -49.695 30.644 1.00 91.30  ? 1842 ALA B O   1 
ATOM   5978 C CB  . ALA B 1 335 ? 57.952  -48.118 30.209 1.00 90.44  ? 1842 ALA B CB  1 
ATOM   5979 N N   . VAL B 1 336 ? 59.201  -50.767 29.740 1.00 96.05  ? 1843 VAL B N   1 
ATOM   5980 C CA  . VAL B 1 336 ? 59.723  -52.102 29.984 1.00 96.29  ? 1843 VAL B CA  1 
ATOM   5981 C C   . VAL B 1 336 ? 60.260  -52.631 28.658 1.00 96.66  ? 1843 VAL B C   1 
ATOM   5982 O O   . VAL B 1 336 ? 59.669  -52.386 27.602 1.00 96.63  ? 1843 VAL B O   1 
ATOM   5983 C CB  . VAL B 1 336 ? 58.641  -53.061 30.530 1.00 96.06  ? 1843 VAL B CB  1 
ATOM   5984 C CG1 . VAL B 1 336 ? 59.289  -54.248 31.211 1.00 96.27  ? 1843 VAL B CG1 1 
ATOM   5985 C CG2 . VAL B 1 336 ? 57.728  -52.345 31.509 1.00 95.64  ? 1843 VAL B CG2 1 
ATOM   5986 N N   . GLY B 1 337 ? 61.383  -53.344 28.715 1.00 109.41 ? 1844 GLY B N   1 
ATOM   5987 C CA  . GLY B 1 337 ? 62.003  -53.917 27.519 1.00 109.82 ? 1844 GLY B CA  1 
ATOM   5988 C C   . GLY B 1 337 ? 61.236  -55.107 26.964 1.00 109.84 ? 1844 GLY B C   1 
ATOM   5989 O O   . GLY B 1 337 ? 60.055  -55.283 27.269 1.00 109.49 ? 1844 GLY B O   1 
ATOM   5990 N N   . PRO B 1 338 ? 61.900  -55.936 26.137 1.00 120.66 ? 1845 PRO B N   1 
ATOM   5991 C CA  . PRO B 1 338 ? 61.235  -57.121 25.588 1.00 120.71 ? 1845 PRO B CA  1 
ATOM   5992 C C   . PRO B 1 338 ? 61.096  -58.274 26.593 1.00 120.61 ? 1845 PRO B C   1 
ATOM   5993 O O   . PRO B 1 338 ? 60.355  -59.227 26.333 1.00 120.53 ? 1845 PRO B O   1 
ATOM   5994 C CB  . PRO B 1 338 ? 62.152  -57.528 24.430 1.00 121.23 ? 1845 PRO B CB  1 
ATOM   5995 C CG  . PRO B 1 338 ? 63.502  -57.048 24.831 1.00 121.49 ? 1845 PRO B CG  1 
ATOM   5996 C CD  . PRO B 1 338 ? 63.292  -55.809 25.662 1.00 121.13 ? 1845 PRO B CD  1 
ATOM   5997 N N   . GLU B 1 339 ? 61.789  -58.175 27.727 1.00 119.80 ? 1846 GLU B N   1 
ATOM   5998 C CA  . GLU B 1 339 ? 61.876  -59.273 28.697 1.00 119.81 ? 1846 GLU B CA  1 
ATOM   5999 C C   . GLU B 1 339 ? 60.614  -59.457 29.548 1.00 119.35 ? 1846 GLU B C   1 
ATOM   6000 O O   . GLU B 1 339 ? 59.896  -60.446 29.380 1.00 119.30 ? 1846 GLU B O   1 
ATOM   6001 C CB  . GLU B 1 339 ? 63.137  -59.136 29.560 1.00 120.04 ? 1846 GLU B CB  1 
ATOM   6002 C CG  . GLU B 1 339 ? 64.420  -59.493 28.808 1.00 120.58 ? 1846 GLU B CG  1 
ATOM   6003 C CD  . GLU B 1 339 ? 65.678  -58.960 29.468 1.00 120.81 ? 1846 GLU B CD  1 
ATOM   6004 O OE1 . GLU B 1 339 ? 65.804  -59.065 30.708 1.00 120.69 ? 1846 GLU B OE1 1 
ATOM   6005 O OE2 . GLU B 1 339 ? 66.552  -58.445 28.738 1.00 121.13 ? 1846 GLU B OE2 1 
ATOM   6006 N N   . GLN B 1 340 ? 60.349  -58.519 30.457 1.00 107.31 ? 1847 GLN B N   1 
ATOM   6007 C CA  . GLN B 1 340 ? 59.092  -58.514 31.207 1.00 106.88 ? 1847 GLN B CA  1 
ATOM   6008 C C   . GLN B 1 340 ? 57.959  -58.100 30.268 1.00 106.66 ? 1847 GLN B C   1 
ATOM   6009 O O   . GLN B 1 340 ? 56.899  -58.728 30.249 1.00 106.46 ? 1847 GLN B O   1 
ATOM   6010 C CB  . GLN B 1 340 ? 59.179  -57.584 32.425 1.00 106.65 ? 1847 GLN B CB  1 
ATOM   6011 C CG  . GLN B 1 340 ? 57.899  -57.485 33.264 1.00 106.23 ? 1847 GLN B CG  1 
ATOM   6012 C CD  . GLN B 1 340 ? 57.659  -58.700 34.148 1.00 106.23 ? 1847 GLN B CD  1 
ATOM   6013 O OE1 . GLN B 1 340 ? 58.583  -59.231 34.765 1.00 106.47 ? 1847 GLN B OE1 1 
ATOM   6014 N NE2 . GLN B 1 340 ? 56.407  -59.136 34.220 1.00 105.97 ? 1847 GLN B NE2 1 
ATOM   6015 N N   . GLY B 1 341 ? 58.207  -57.040 29.497 1.00 103.85 ? 1848 GLY B N   1 
ATOM   6016 C CA  . GLY B 1 341 ? 57.335  -56.599 28.405 1.00 103.74 ? 1848 GLY B CA  1 
ATOM   6017 C C   . GLY B 1 341 ? 55.851  -56.479 28.691 1.00 103.34 ? 1848 GLY B C   1 
ATOM   6018 O O   . GLY B 1 341 ? 55.026  -56.752 27.816 1.00 103.33 ? 1848 GLY B O   1 
ATOM   6019 N N   . GLY B 1 342 ? 55.512  -56.065 29.910 1.00 94.65  ? 1849 GLY B N   1 
ATOM   6020 C CA  . GLY B 1 342 ? 54.117  -55.920 30.326 1.00 94.28  ? 1849 GLY B CA  1 
ATOM   6021 C C   . GLY B 1 342 ? 53.415  -54.763 29.642 1.00 94.10  ? 1849 GLY B C   1 
ATOM   6022 O O   . GLY B 1 342 ? 52.326  -54.926 29.089 1.00 93.98  ? 1849 GLY B O   1 
ATOM   6023 N N   . CYS B 1 343 ? 54.050  -53.594 29.679 1.00 88.74  ? 1850 CYS B N   1 
ATOM   6024 C CA  . CYS B 1 343 ? 53.494  -52.379 29.089 1.00 88.58  ? 1850 CYS B CA  1 
ATOM   6025 C C   . CYS B 1 343 ? 53.973  -52.175 27.654 1.00 88.87  ? 1850 CYS B C   1 
ATOM   6026 O O   . CYS B 1 343 ? 54.891  -51.390 27.401 1.00 89.01  ? 1850 CYS B O   1 
ATOM   6027 C CB  . CYS B 1 343 ? 53.843  -51.161 29.949 1.00 88.43  ? 1850 CYS B CB  1 
ATOM   6028 S SG  . CYS B 1 343 ? 53.058  -51.152 31.575 1.00 88.08  ? 1850 CYS B SG  1 
ATOM   6029 N N   . LYS B 1 344 ? 53.347  -52.891 26.722 1.00 94.42  ? 1851 LYS B N   1 
ATOM   6030 C CA  . LYS B 1 344 ? 53.641  -52.739 25.299 1.00 94.70  ? 1851 LYS B CA  1 
ATOM   6031 C C   . LYS B 1 344 ? 53.326  -51.310 24.862 1.00 94.57  ? 1851 LYS B C   1 
ATOM   6032 O O   . LYS B 1 344 ? 52.346  -50.718 25.325 1.00 94.24  ? 1851 LYS B O   1 
ATOM   6033 C CB  . LYS B 1 344 ? 52.837  -53.743 24.470 1.00 94.79  ? 1851 LYS B CB  1 
ATOM   6034 C CG  . LYS B 1 344 ? 53.278  -53.852 23.016 1.00 95.17  ? 1851 LYS B CG  1 
ATOM   6035 C CD  . LYS B 1 344 ? 52.190  -54.459 22.149 1.00 95.18  ? 1851 LYS B CD  1 
ATOM   6036 C CE  . LYS B 1 344 ? 52.532  -54.331 20.675 1.00 95.55  ? 1851 LYS B CE  1 
ATOM   6037 N NZ  . LYS B 1 344 ? 51.438  -54.848 19.811 1.00 95.55  ? 1851 LYS B NZ  1 
ATOM   6038 N N   . ASP B 1 345 ? 54.171  -50.767 23.985 1.00 94.20  ? 1852 ASP B N   1 
ATOM   6039 C CA  . ASP B 1 345 ? 54.077  -49.377 23.511 1.00 94.14  ? 1852 ASP B CA  1 
ATOM   6040 C C   . ASP B 1 345 ? 54.321  -48.339 24.608 1.00 93.88  ? 1852 ASP B C   1 
ATOM   6041 O O   . ASP B 1 345 ? 54.667  -47.197 24.311 1.00 93.89  ? 1852 ASP B O   1 
ATOM   6042 C CB  . ASP B 1 345 ? 52.735  -49.102 22.810 1.00 93.97  ? 1852 ASP B CB  1 
ATOM   6043 C CG  . ASP B 1 345 ? 52.701  -49.603 21.374 1.00 94.30  ? 1852 ASP B CG  1 
ATOM   6044 O OD1 . ASP B 1 345 ? 53.737  -49.518 20.678 1.00 94.66  ? 1852 ASP B OD1 1 
ATOM   6045 O OD2 . ASP B 1 345 ? 51.627  -50.069 20.936 1.00 94.23  ? 1852 ASP B OD2 1 
ATOM   6046 N N   . GLY B 1 346 ? 54.148  -48.745 25.864 1.00 87.37  ? 1853 GLY B N   1 
ATOM   6047 C CA  . GLY B 1 346 ? 54.251  -47.843 27.008 1.00 87.13  ? 1853 GLY B CA  1 
ATOM   6048 C C   . GLY B 1 346 ? 55.601  -47.174 27.185 1.00 87.32  ? 1853 GLY B C   1 
ATOM   6049 O O   . GLY B 1 346 ? 56.639  -47.837 27.177 1.00 87.61  ? 1853 GLY B O   1 
ATOM   6050 N N   . GLY B 1 347 ? 55.575  -45.851 27.332 1.00 87.37  ? 1854 GLY B N   1 
ATOM   6051 C CA  . GLY B 1 347 ? 56.768  -45.063 27.638 1.00 87.51  ? 1854 GLY B CA  1 
ATOM   6052 C C   . GLY B 1 347 ? 56.978  -44.946 29.136 1.00 87.34  ? 1854 GLY B C   1 
ATOM   6053 O O   . GLY B 1 347 ? 58.112  -44.825 29.603 1.00 87.53  ? 1854 GLY B O   1 
ATOM   6054 N N   . VAL B 1 348 ? 55.872  -44.974 29.881 1.00 82.51  ? 1855 VAL B N   1 
ATOM   6055 C CA  . VAL B 1 348 ? 55.875  -45.002 31.346 1.00 82.35  ? 1855 VAL B CA  1 
ATOM   6056 C C   . VAL B 1 348 ? 55.017  -46.184 31.803 1.00 82.23  ? 1855 VAL B C   1 
ATOM   6057 O O   . VAL B 1 348 ? 53.890  -46.349 31.337 1.00 82.10  ? 1855 VAL B O   1 
ATOM   6058 C CB  . VAL B 1 348 ? 55.323  -43.683 31.951 1.00 82.05  ? 1855 VAL B CB  1 
ATOM   6059 C CG1 . VAL B 1 348 ? 55.170  -43.792 33.464 1.00 81.88  ? 1855 VAL B CG1 1 
ATOM   6060 C CG2 . VAL B 1 348 ? 56.225  -42.510 31.602 1.00 82.17  ? 1855 VAL B CG2 1 
ATOM   6061 N N   . CYS B 1 349 ? 55.547  -46.998 32.713 1.00 82.07  ? 1856 CYS B N   1 
ATOM   6062 C CA  . CYS B 1 349 ? 54.839  -48.196 33.164 1.00 81.99  ? 1856 CYS B CA  1 
ATOM   6063 C C   . CYS B 1 349 ? 54.878  -48.375 34.682 1.00 81.88  ? 1856 CYS B C   1 
ATOM   6064 O O   . CYS B 1 349 ? 55.949  -48.565 35.266 1.00 82.08  ? 1856 CYS B O   1 
ATOM   6065 C CB  . CYS B 1 349 ? 55.401  -49.437 32.460 1.00 82.29  ? 1856 CYS B CB  1 
ATOM   6066 S SG  . CYS B 1 349 ? 54.606  -51.008 32.885 1.00 82.22  ? 1856 CYS B SG  1 
ATOM   6067 N N   . LEU B 1 350 ? 53.705  -48.308 35.310 1.00 79.75  ? 1857 LEU B N   1 
ATOM   6068 C CA  . LEU B 1 350 ? 53.567  -48.616 36.732 1.00 79.65  ? 1857 LEU B CA  1 
ATOM   6069 C C   . LEU B 1 350 ? 53.604  -50.127 36.919 1.00 79.78  ? 1857 LEU B C   1 
ATOM   6070 O O   . LEU B 1 350 ? 52.759  -50.852 36.386 1.00 79.71  ? 1857 LEU B O   1 
ATOM   6071 C CB  . LEU B 1 350 ? 52.271  -48.034 37.309 1.00 79.33  ? 1857 LEU B CB  1 
ATOM   6072 C CG  . LEU B 1 350 ? 51.898  -48.415 38.748 1.00 79.23  ? 1857 LEU B CG  1 
ATOM   6073 C CD1 . LEU B 1 350 ? 52.908  -47.877 39.754 1.00 79.34  ? 1857 LEU B CD1 1 
ATOM   6074 C CD2 . LEU B 1 350 ? 50.496  -47.936 39.090 1.00 78.93  ? 1857 LEU B CD2 1 
ATOM   6075 N N   . LEU B 1 351 ? 54.589  -50.591 37.681 1.00 84.68  ? 1858 LEU B N   1 
ATOM   6076 C CA  . LEU B 1 351 ? 54.850  -52.019 37.812 1.00 84.85  ? 1858 LEU B CA  1 
ATOM   6077 C C   . LEU B 1 351 ? 54.110  -52.672 38.972 1.00 84.70  ? 1858 LEU B C   1 
ATOM   6078 O O   . LEU B 1 351 ? 53.955  -52.086 40.045 1.00 84.57  ? 1858 LEU B O   1 
ATOM   6079 C CB  . LEU B 1 351 ? 56.355  -52.282 37.926 1.00 85.20  ? 1858 LEU B CB  1 
ATOM   6080 C CG  . LEU B 1 351 ? 57.198  -52.021 36.673 1.00 85.43  ? 1858 LEU B CG  1 
ATOM   6081 C CD1 . LEU B 1 351 ? 58.641  -51.727 37.045 1.00 85.72  ? 1858 LEU B CD1 1 
ATOM   6082 C CD2 . LEU B 1 351 ? 57.115  -53.189 35.694 1.00 85.60  ? 1858 LEU B CD2 1 
ATOM   6083 N N   . SER B 1 352 ? 53.646  -53.892 38.723 1.00 86.21  ? 1859 SER B N   1 
ATOM   6084 C CA  . SER B 1 352 ? 53.060  -54.749 39.743 1.00 86.13  ? 1859 SER B CA  1 
ATOM   6085 C C   . SER B 1 352 ? 53.706  -56.127 39.645 1.00 86.39  ? 1859 SER B C   1 
ATOM   6086 O O   . SER B 1 352 ? 53.586  -56.949 40.556 1.00 86.40  ? 1859 SER B O   1 
ATOM   6087 C CB  . SER B 1 352 ? 51.545  -54.861 39.550 1.00 85.84  ? 1859 SER B CB  1 
ATOM   6088 O OG  . SER B 1 352 ? 50.911  -53.602 39.694 1.00 85.61  ? 1859 SER B OG  1 
ATOM   6089 N N   . GLY B 1 353 ? 54.395  -56.364 38.529 1.00 94.25  ? 1860 GLY B N   1 
ATOM   6090 C CA  . GLY B 1 353 ? 55.023  -57.651 38.246 1.00 94.53  ? 1860 GLY B CA  1 
ATOM   6091 C C   . GLY B 1 353 ? 54.033  -58.699 37.771 1.00 94.45  ? 1860 GLY B C   1 
ATOM   6092 O O   . GLY B 1 353 ? 54.428  -59.792 37.358 1.00 94.69  ? 1860 GLY B O   1 
ATOM   6093 N N   . THR B 1 354 ? 52.745  -58.359 37.824 1.00 91.56  ? 1861 THR B N   1 
ATOM   6094 C CA  . THR B 1 354 ? 51.661  -59.287 37.486 1.00 91.46  ? 1861 THR B CA  1 
ATOM   6095 C C   . THR B 1 354 ? 50.756  -58.796 36.345 1.00 91.32  ? 1861 THR B C   1 
ATOM   6096 O O   . THR B 1 354 ? 50.230  -59.605 35.576 1.00 91.36  ? 1861 THR B O   1 
ATOM   6097 C CB  . THR B 1 354 ? 50.802  -59.655 38.739 1.00 91.27  ? 1861 THR B CB  1 
ATOM   6098 O OG1 . THR B 1 354 ? 49.765  -60.573 38.368 1.00 91.17  ? 1861 THR B OG1 1 
ATOM   6099 C CG2 . THR B 1 354 ? 50.173  -58.412 39.382 1.00 91.00  ? 1861 THR B CG2 1 
ATOM   6100 N N   . LYS B 1 355 ? 50.579  -57.479 36.240 1.00 84.83  ? 1862 LYS B N   1 
ATOM   6101 C CA  . LYS B 1 355 ? 49.674  -56.896 35.247 1.00 84.69  ? 1862 LYS B CA  1 
ATOM   6102 C C   . LYS B 1 355 ? 50.372  -55.894 34.329 1.00 84.80  ? 1862 LYS B C   1 
ATOM   6103 O O   . LYS B 1 355 ? 50.431  -56.098 33.113 1.00 84.94  ? 1862 LYS B O   1 
ATOM   6104 C CB  . LYS B 1 355 ? 48.462  -56.245 35.931 1.00 84.37  ? 1862 LYS B CB  1 
ATOM   6105 C CG  . LYS B 1 355 ? 47.534  -57.219 36.653 1.00 84.26  ? 1862 LYS B CG  1 
ATOM   6106 C CD  . LYS B 1 355 ? 46.683  -58.020 35.676 1.00 84.26  ? 1862 LYS B CD  1 
ATOM   6107 C CE  . LYS B 1 355 ? 45.904  -59.111 36.390 1.00 84.17  ? 1862 LYS B CE  1 
ATOM   6108 N NZ  . LYS B 1 355 ? 45.003  -59.846 35.460 1.00 84.16  ? 1862 LYS B NZ  1 
ATOM   6109 N N   . GLY B 1 356 ? 50.893  -54.818 34.917 1.00 83.39  ? 1863 GLY B N   1 
ATOM   6110 C CA  . GLY B 1 356 ? 51.565  -53.759 34.167 1.00 83.48  ? 1863 GLY B CA  1 
ATOM   6111 C C   . GLY B 1 356 ? 50.586  -52.807 33.508 1.00 83.27  ? 1863 GLY B C   1 
ATOM   6112 O O   . GLY B 1 356 ? 49.801  -53.211 32.646 1.00 83.25  ? 1863 GLY B O   1 
ATOM   6113 N N   . ALA B 1 357 ? 50.638  -51.540 33.911 1.00 78.17  ? 1864 ALA B N   1 
ATOM   6114 C CA  . ALA B 1 357 ? 49.733  -50.519 33.384 1.00 77.97  ? 1864 ALA B CA  1 
ATOM   6115 C C   . ALA B 1 357 ? 50.482  -49.318 32.807 1.00 78.06  ? 1864 ALA B C   1 
ATOM   6116 O O   . ALA B 1 357 ? 51.175  -48.595 33.530 1.00 78.06  ? 1864 ALA B O   1 
ATOM   6117 C CB  . ALA B 1 357 ? 48.746  -50.078 34.457 1.00 77.68  ? 1864 ALA B CB  1 
ATOM   6118 N N   . SER B 1 358 ? 50.334  -49.121 31.498 1.00 79.33  ? 1865 SER B N   1 
ATOM   6119 C CA  . SER B 1 358 ? 50.996  -48.036 30.775 1.00 79.43  ? 1865 SER B CA  1 
ATOM   6120 C C   . SER B 1 358 ? 50.371  -46.674 31.072 1.00 79.18  ? 1865 SER B C   1 
ATOM   6121 O O   . SER B 1 358 ? 49.192  -46.583 31.415 1.00 78.94  ? 1865 SER B O   1 
ATOM   6122 C CB  . SER B 1 358 ? 50.964  -48.311 29.268 1.00 79.63  ? 1865 SER B CB  1 
ATOM   6123 O OG  . SER B 1 358 ? 51.417  -47.190 28.527 1.00 79.72  ? 1865 SER B OG  1 
ATOM   6124 N N   . PHE B 1 359 ? 51.173  -45.622 30.934 1.00 77.40  ? 1866 PHE B N   1 
ATOM   6125 C CA  . PHE B 1 359 ? 50.705  -44.253 31.133 1.00 77.19  ? 1866 PHE B CA  1 
ATOM   6126 C C   . PHE B 1 359 ? 50.831  -43.404 29.873 1.00 77.30  ? 1866 PHE B C   1 
ATOM   6127 O O   . PHE B 1 359 ? 50.663  -42.185 29.918 1.00 77.18  ? 1866 PHE B O   1 
ATOM   6128 C CB  . PHE B 1 359 ? 51.447  -43.596 32.298 1.00 77.14  ? 1866 PHE B CB  1 
ATOM   6129 C CG  . PHE B 1 359 ? 50.819  -43.853 33.634 1.00 76.93  ? 1866 PHE B CG  1 
ATOM   6130 C CD1 . PHE B 1 359 ? 51.223  -44.933 34.411 1.00 77.01  ? 1866 PHE B CD1 1 
ATOM   6131 C CD2 . PHE B 1 359 ? 49.817  -43.017 34.115 1.00 76.67  ? 1866 PHE B CD2 1 
ATOM   6132 C CE1 . PHE B 1 359 ? 50.639  -45.176 35.648 1.00 76.84  ? 1866 PHE B CE1 1 
ATOM   6133 C CE2 . PHE B 1 359 ? 49.225  -43.251 35.350 1.00 76.50  ? 1866 PHE B CE2 1 
ATOM   6134 C CZ  . PHE B 1 359 ? 49.637  -44.333 36.119 1.00 76.59  ? 1866 PHE B CZ  1 
ATOM   6135 N N   . GLY B 1 360 ? 51.121  -44.055 28.750 1.00 80.68  ? 1867 GLY B N   1 
ATOM   6136 C CA  . GLY B 1 360 ? 51.241  -43.367 27.472 1.00 80.83  ? 1867 GLY B CA  1 
ATOM   6137 C C   . GLY B 1 360 ? 52.088  -44.112 26.463 1.00 81.19  ? 1867 GLY B C   1 
ATOM   6138 O O   . GLY B 1 360 ? 53.180  -44.582 26.784 1.00 81.39  ? 1867 GLY B O   1 
ATOM   6139 N N   . ARG B 1 361 ? 51.573  -44.219 25.242 1.00 84.84  ? 1868 ARG B N   1 
ATOM   6140 C CA  . ARG B 1 361 ? 52.299  -44.845 24.140 1.00 85.21  ? 1868 ARG B CA  1 
ATOM   6141 C C   . ARG B 1 361 ? 53.551  -44.047 23.787 1.00 85.44  ? 1868 ARG B C   1 
ATOM   6142 O O   . ARG B 1 361 ? 53.520  -42.815 23.745 1.00 85.36  ? 1868 ARG B O   1 
ATOM   6143 C CB  . ARG B 1 361 ? 51.397  -44.995 22.911 1.00 85.28  ? 1868 ARG B CB  1 
ATOM   6144 C CG  . ARG B 1 361 ? 50.420  -46.163 22.993 1.00 85.20  ? 1868 ARG B CG  1 
ATOM   6145 C CD  . ARG B 1 361 ? 49.388  -46.137 21.870 1.00 85.24  ? 1868 ARG B CD  1 
ATOM   6146 N NE  . ARG B 1 361 ? 49.968  -46.405 20.554 1.00 85.63  ? 1868 ARG B NE  1 
ATOM   6147 C CZ  . ARG B 1 361 ? 50.145  -45.490 19.604 1.00 85.79  ? 1868 ARG B CZ  1 
ATOM   6148 N NH1 . ARG B 1 361 ? 49.789  -44.227 19.808 1.00 85.58  ? 1868 ARG B NH1 1 
ATOM   6149 N NH2 . ARG B 1 361 ? 50.679  -45.840 18.442 1.00 86.17  ? 1868 ARG B NH2 1 
ATOM   6150 N N   . LEU B 1 362 ? 54.647  -44.763 23.545 1.00 90.98  ? 1869 LEU B N   1 
ATOM   6151 C CA  . LEU B 1 362 ? 55.932  -44.155 23.201 1.00 91.25  ? 1869 LEU B CA  1 
ATOM   6152 C C   . LEU B 1 362 ? 55.835  -43.333 21.920 1.00 91.41  ? 1869 LEU B C   1 
ATOM   6153 O O   . LEU B 1 362 ? 56.510  -42.313 21.775 1.00 91.48  ? 1869 LEU B O   1 
ATOM   6154 C CB  . LEU B 1 362 ? 57.012  -45.237 23.060 1.00 91.62  ? 1869 LEU B CB  1 
ATOM   6155 C CG  . LEU B 1 362 ? 58.431  -44.846 22.629 1.00 91.99  ? 1869 LEU B CG  1 
ATOM   6156 C CD1 . LEU B 1 362 ? 59.091  -43.908 23.633 1.00 91.87  ? 1869 LEU B CD1 1 
ATOM   6157 C CD2 . LEU B 1 362 ? 59.278  -46.089 22.416 1.00 92.36  ? 1869 LEU B CD2 1 
ATOM   6158 N N   . GLN B 1 363 ? 54.981  -43.784 21.006 1.00 95.09  ? 1870 GLN B N   1 
ATOM   6159 C CA  . GLN B 1 363 ? 54.787  -43.139 19.710 1.00 95.27  ? 1870 GLN B CA  1 
ATOM   6160 C C   . GLN B 1 363 ? 54.046  -41.808 19.827 1.00 94.99  ? 1870 GLN B C   1 
ATOM   6161 O O   . GLN B 1 363 ? 54.238  -40.912 19.002 1.00 95.14  ? 1870 GLN B O   1 
ATOM   6162 C CB  . GLN B 1 363 ? 54.036  -44.073 18.753 1.00 95.42  ? 1870 GLN B CB  1 
ATOM   6163 C CG  . GLN B 1 363 ? 54.770  -45.372 18.405 1.00 95.77  ? 1870 GLN B CG  1 
ATOM   6164 C CD  . GLN B 1 363 ? 54.617  -46.466 19.460 1.00 95.60  ? 1870 GLN B CD  1 
ATOM   6165 O OE1 . GLN B 1 363 ? 53.985  -46.271 20.501 1.00 95.23  ? 1870 GLN B OE1 1 
ATOM   6166 N NE2 . GLN B 1 363 ? 55.201  -47.626 19.188 1.00 95.90  ? 1870 GLN B NE2 1 
ATOM   6167 N N   . SER B 1 364 ? 53.207  -41.684 20.854 1.00 91.55  ? 1871 SER B N   1 
ATOM   6168 C CA  . SER B 1 364 ? 52.400  -40.481 21.067 1.00 91.27  ? 1871 SER B CA  1 
ATOM   6169 C C   . SER B 1 364 ? 53.215  -39.309 21.621 1.00 91.23  ? 1871 SER B C   1 
ATOM   6170 O O   . SER B 1 364 ? 52.689  -38.207 21.796 1.00 91.04  ? 1871 SER B O   1 
ATOM   6171 C CB  . SER B 1 364 ? 51.230  -40.795 21.999 1.00 90.90  ? 1871 SER B CB  1 
ATOM   6172 O OG  . SER B 1 364 ? 51.684  -41.096 23.307 1.00 90.75  ? 1871 SER B OG  1 
ATOM   6173 N N   . MET B 1 365 ? 54.496  -39.564 21.882 1.00 93.71  ? 1872 MET B N   1 
ATOM   6174 C CA  . MET B 1 365 ? 55.422  -38.598 22.477 1.00 93.72  ? 1872 MET B CA  1 
ATOM   6175 C C   . MET B 1 365 ? 55.391  -37.210 21.830 1.00 93.73  ? 1872 MET B C   1 
ATOM   6176 O O   . MET B 1 365 ? 55.390  -37.084 20.603 1.00 93.98  ? 1872 MET B O   1 
ATOM   6177 C CB  . MET B 1 365 ? 56.844  -39.167 22.450 1.00 94.06  ? 1872 MET B CB  1 
ATOM   6178 C CG  . MET B 1 365 ? 57.928  -38.199 22.871 1.00 94.15  ? 1872 MET B CG  1 
ATOM   6179 S SD  . MET B 1 365 ? 59.570  -38.928 22.816 1.00 94.60  ? 1872 MET B SD  1 
ATOM   6180 C CE  . MET B 1 365 ? 60.535  -37.469 22.445 1.00 94.82  ? 1872 MET B CE  1 
ATOM   6181 N N   . LYS B 1 366 ? 55.360  -36.181 22.675 1.00 97.58  ? 1873 LYS B N   1 
ATOM   6182 C CA  . LYS B 1 366 ? 55.424  -34.789 22.232 1.00 97.58  ? 1873 LYS B CA  1 
ATOM   6183 C C   . LYS B 1 366 ? 56.403  -33.985 23.083 1.00 97.55  ? 1873 LYS B C   1 
ATOM   6184 O O   . LYS B 1 366 ? 56.456  -34.145 24.305 1.00 97.34  ? 1873 LYS B O   1 
ATOM   6185 C CB  . LYS B 1 366 ? 54.040  -34.135 22.269 1.00 97.26  ? 1873 LYS B CB  1 
ATOM   6186 C CG  . LYS B 1 366 ? 53.089  -34.597 21.169 1.00 97.34  ? 1873 LYS B CG  1 
ATOM   6187 C CD  . LYS B 1 366 ? 51.888  -33.668 21.024 1.00 97.10  ? 1873 LYS B CD  1 
ATOM   6188 C CE  . LYS B 1 366 ? 52.241  -32.408 20.239 1.00 97.21  ? 1873 LYS B CE  1 
ATOM   6189 N NZ  . LYS B 1 366 ? 51.053  -31.544 19.999 1.00 97.00  ? 1873 LYS B NZ  1 
ATOM   6190 N N   . LEU B 1 367 ? 57.177  -33.127 22.424 1.00 100.40 ? 1874 LEU B N   1 
ATOM   6191 C CA  . LEU B 1 367 ? 58.123  -32.244 23.100 1.00 100.41 ? 1874 LEU B CA  1 
ATOM   6192 C C   . LEU B 1 367 ? 57.801  -30.778 22.833 1.00 100.30 ? 1874 LEU B C   1 
ATOM   6193 O O   . LEU B 1 367 ? 57.637  -30.368 21.681 1.00 100.47 ? 1874 LEU B O   1 
ATOM   6194 C CB  . LEU B 1 367 ? 59.560  -32.547 22.663 1.00 100.83 ? 1874 LEU B CB  1 
ATOM   6195 C CG  . LEU B 1 367 ? 60.277  -33.777 23.226 1.00 100.99 ? 1874 LEU B CG  1 
ATOM   6196 C CD1 . LEU B 1 367 ? 61.604  -33.969 22.516 1.00 101.45 ? 1874 LEU B CD1 1 
ATOM   6197 C CD2 . LEU B 1 367 ? 60.498  -33.653 24.724 1.00 100.78 ? 1874 LEU B CD2 1 
ATOM   6198 N N   . ASP B 1 368 ? 57.716  -29.996 23.906 1.00 106.05 ? 1875 ASP B N   1 
ATOM   6199 C CA  . ASP B 1 368 ? 57.443  -28.564 23.810 1.00 105.92 ? 1875 ASP B CA  1 
ATOM   6200 C C   . ASP B 1 368 ? 58.421  -27.752 24.662 1.00 105.93 ? 1875 ASP B C   1 
ATOM   6201 O O   . ASP B 1 368 ? 59.499  -28.237 25.016 1.00 106.12 ? 1875 ASP B O   1 
ATOM   6202 C CB  . ASP B 1 368 ? 55.993  -28.266 24.214 1.00 105.56 ? 1875 ASP B CB  1 
ATOM   6203 C CG  . ASP B 1 368 ? 54.981  -28.780 23.203 1.00 105.58 ? 1875 ASP B CG  1 
ATOM   6204 O OD1 . ASP B 1 368 ? 55.223  -28.650 21.982 1.00 105.85 ? 1875 ASP B OD1 1 
ATOM   6205 O OD2 . ASP B 1 368 ? 53.933  -29.307 23.632 1.00 105.36 ? 1875 ASP B OD2 1 
ATOM   6206 N N   . TYR B 1 369 ? 58.040  -26.515 24.976 1.00 109.39 ? 1876 TYR B N   1 
ATOM   6207 C CA  . TYR B 1 369 ? 58.856  -25.633 25.805 1.00 109.37 ? 1876 TYR B CA  1 
ATOM   6208 C C   . TYR B 1 369 ? 57.977  -24.777 26.714 1.00 109.01 ? 1876 TYR B C   1 
ATOM   6209 O O   . TYR B 1 369 ? 57.059  -24.097 26.247 1.00 108.85 ? 1876 TYR B O   1 
ATOM   6210 C CB  . TYR B 1 369 ? 59.741  -24.740 24.927 1.00 109.62 ? 1876 TYR B CB  1 
ATOM   6211 C CG  . TYR B 1 369 ? 60.851  -24.029 25.671 1.00 109.71 ? 1876 TYR B CG  1 
ATOM   6212 C CD1 . TYR B 1 369 ? 60.664  -22.745 26.186 1.00 109.52 ? 1876 TYR B CD1 1 
ATOM   6213 C CD2 . TYR B 1 369 ? 62.093  -24.637 25.852 1.00 110.00 ? 1876 TYR B CD2 1 
ATOM   6214 C CE1 . TYR B 1 369 ? 61.683  -22.088 26.868 1.00 109.61 ? 1876 TYR B CE1 1 
ATOM   6215 C CE2 . TYR B 1 369 ? 63.119  -23.988 26.531 1.00 110.10 ? 1876 TYR B CE2 1 
ATOM   6216 C CZ  . TYR B 1 369 ? 62.908  -22.715 27.036 1.00 109.90 ? 1876 TYR B CZ  1 
ATOM   6217 O OH  . TYR B 1 369 ? 63.920  -22.071 27.709 1.00 110.01 ? 1876 TYR B OH  1 
ATOM   6218 N N   . ARG B 1 370 ? 58.259  -24.829 28.013 1.00 113.60 ? 1877 ARG B N   1 
ATOM   6219 C CA  . ARG B 1 370 ? 57.599  -23.963 28.982 1.00 113.30 ? 1877 ARG B CA  1 
ATOM   6220 C C   . ARG B 1 370 ? 58.380  -22.655 29.065 1.00 113.38 ? 1877 ARG B C   1 
ATOM   6221 O O   . ARG B 1 370 ? 59.568  -22.654 29.393 1.00 113.55 ? 1877 ARG B O   1 
ATOM   6222 C CB  . ARG B 1 370 ? 57.525  -24.637 30.356 1.00 113.17 ? 1877 ARG B CB  1 
ATOM   6223 C CG  . ARG B 1 370 ? 56.494  -24.022 31.297 1.00 112.85 ? 1877 ARG B CG  1 
ATOM   6224 C CD  . ARG B 1 370 ? 56.811  -24.302 32.763 1.00 112.78 ? 1877 ARG B CD  1 
ATOM   6225 N NE  . ARG B 1 370 ? 56.567  -25.692 33.150 1.00 112.76 ? 1877 ARG B NE  1 
ATOM   6226 C CZ  . ARG B 1 370 ? 56.560  -26.137 34.405 1.00 112.65 ? 1877 ARG B CZ  1 
ATOM   6227 N NH1 . ARG B 1 370 ? 56.779  -25.308 35.417 1.00 112.55 ? 1877 ARG B NH1 1 
ATOM   6228 N NH2 . ARG B 1 370 ? 56.327  -27.417 34.652 1.00 112.65 ? 1877 ARG B NH2 1 
ATOM   6229 N N   . HIS B 1 371 ? 57.714  -21.548 28.747 1.00 127.33 ? 1878 HIS B N   1 
ATOM   6230 C CA  . HIS B 1 371 ? 58.343  -20.226 28.778 1.00 127.39 ? 1878 HIS B CA  1 
ATOM   6231 C C   . HIS B 1 371 ? 58.279  -19.606 30.174 1.00 127.19 ? 1878 HIS B C   1 
ATOM   6232 O O   . HIS B 1 371 ? 58.962  -18.618 30.455 1.00 127.27 ? 1878 HIS B O   1 
ATOM   6233 C CB  . HIS B 1 371 ? 57.696  -19.298 27.747 1.00 127.36 ? 1878 HIS B CB  1 
ATOM   6234 C CG  . HIS B 1 371 ? 57.793  -19.799 26.339 1.00 127.59 ? 1878 HIS B CG  1 
ATOM   6235 N ND1 . HIS B 1 371 ? 56.887  -20.688 25.803 1.00 127.54 ? 1878 HIS B ND1 1 
ATOM   6236 C CD2 . HIS B 1 371 ? 58.690  -19.538 25.358 1.00 127.89 ? 1878 HIS B CD2 1 
ATOM   6237 C CE1 . HIS B 1 371 ? 57.220  -20.953 24.552 1.00 127.81 ? 1878 HIS B CE1 1 
ATOM   6238 N NE2 . HIS B 1 371 ? 58.310  -20.268 24.258 1.00 128.03 ? 1878 HIS B NE2 1 
ATOM   6239 N N   . GLN B 1 372 ? 57.458  -20.198 31.039 1.00 134.56 ? 1879 GLN B N   1 
ATOM   6240 C CA  . GLN B 1 372 ? 57.298  -19.748 32.419 1.00 134.39 ? 1879 GLN B CA  1 
ATOM   6241 C C   . GLN B 1 372 ? 58.525  -20.102 33.264 1.00 134.56 ? 1879 GLN B C   1 
ATOM   6242 O O   . GLN B 1 372 ? 59.276  -19.214 33.675 1.00 134.65 ? 1879 GLN B O   1 
ATOM   6243 C CB  . GLN B 1 372 ? 56.015  -20.344 33.023 1.00 134.13 ? 1879 GLN B CB  1 
ATOM   6244 C CG  . GLN B 1 372 ? 55.760  -20.014 34.495 1.00 133.98 ? 1879 GLN B CG  1 
ATOM   6245 C CD  . GLN B 1 372 ? 55.289  -18.589 34.716 1.00 133.84 ? 1879 GLN B CD  1 
ATOM   6246 O OE1 . GLN B 1 372 ? 56.069  -17.640 34.623 1.00 133.94 ? 1879 GLN B OE1 1 
ATOM   6247 N NE2 . GLN B 1 372 ? 54.008  -18.433 35.025 1.00 133.62 ? 1879 GLN B NE2 1 
ATOM   6248 N N   . ASP B 1 373 ? 58.724  -21.396 33.508 1.00 124.00 ? 1880 ASP B N   1 
ATOM   6249 C CA  . ASP B 1 373 ? 59.838  -21.877 34.328 1.00 124.17 ? 1880 ASP B CA  1 
ATOM   6250 C C   . ASP B 1 373 ? 61.064  -22.249 33.492 1.00 124.50 ? 1880 ASP B C   1 
ATOM   6251 O O   . ASP B 1 373 ? 62.036  -22.796 34.020 1.00 124.70 ? 1880 ASP B O   1 
ATOM   6252 C CB  . ASP B 1 373 ? 59.399  -23.074 35.184 1.00 124.08 ? 1880 ASP B CB  1 
ATOM   6253 C CG  . ASP B 1 373 ? 58.496  -22.677 36.347 1.00 123.82 ? 1880 ASP B CG  1 
ATOM   6254 O OD1 . ASP B 1 373 ? 58.142  -21.484 36.471 1.00 123.71 ? 1880 ASP B OD1 1 
ATOM   6255 O OD2 . ASP B 1 373 ? 58.139  -23.570 37.144 1.00 123.74 ? 1880 ASP B OD2 1 
ATOM   6256 N N   . GLU B 1 374 ? 61.009  -21.938 32.196 1.00 116.84 ? 1881 GLU B N   1 
ATOM   6257 C CA  . GLU B 1 374 ? 62.069  -22.272 31.233 1.00 117.18 ? 1881 GLU B CA  1 
ATOM   6258 C C   . GLU B 1 374 ? 62.386  -23.771 31.220 1.00 117.34 ? 1881 GLU B C   1 
ATOM   6259 O O   . GLU B 1 374 ? 63.552  -24.174 31.239 1.00 117.63 ? 1881 GLU B O   1 
ATOM   6260 C CB  . GLU B 1 374 ? 63.334  -21.436 31.479 1.00 117.40 ? 1881 GLU B CB  1 
ATOM   6261 C CG  . GLU B 1 374 ? 63.161  -19.944 31.223 1.00 117.30 ? 1881 GLU B CG  1 
ATOM   6262 C CD  . GLU B 1 374 ? 64.463  -19.169 31.325 1.00 117.56 ? 1881 GLU B CD  1 
ATOM   6263 O OE1 . GLU B 1 374 ? 65.330  -19.544 32.144 1.00 117.72 ? 1881 GLU B OE1 1 
ATOM   6264 O OE2 . GLU B 1 374 ? 64.617  -18.175 30.585 1.00 117.61 ? 1881 GLU B OE2 1 
ATOM   6265 N N   . ALA B 1 375 ? 61.333  -24.584 31.181 1.00 104.50 ? 1882 ALA B N   1 
ATOM   6266 C CA  . ALA B 1 375 ? 61.464  -26.038 31.252 1.00 104.60 ? 1882 ALA B CA  1 
ATOM   6267 C C   . ALA B 1 375 ? 61.110  -26.728 29.934 1.00 104.72 ? 1882 ALA B C   1 
ATOM   6268 O O   . ALA B 1 375 ? 60.358  -26.191 29.119 1.00 104.64 ? 1882 ALA B O   1 
ATOM   6269 C CB  . ALA B 1 375 ? 60.609  -26.586 32.391 1.00 104.32 ? 1882 ALA B CB  1 
ATOM   6270 N N   . VAL B 1 376 ? 61.667  -27.921 29.738 1.00 98.30  ? 1883 VAL B N   1 
ATOM   6271 C CA  . VAL B 1 376 ? 61.371  -28.744 28.569 1.00 98.45  ? 1883 VAL B CA  1 
ATOM   6272 C C   . VAL B 1 376 ? 60.416  -29.863 28.983 1.00 98.25  ? 1883 VAL B C   1 
ATOM   6273 O O   . VAL B 1 376 ? 60.723  -30.651 29.881 1.00 98.26  ? 1883 VAL B O   1 
ATOM   6274 C CB  . VAL B 1 376 ? 62.659  -29.338 27.943 1.00 98.87  ? 1883 VAL B CB  1 
ATOM   6275 C CG1 . VAL B 1 376 ? 62.333  -30.124 26.678 1.00 99.04  ? 1883 VAL B CG1 1 
ATOM   6276 C CG2 . VAL B 1 376 ? 63.667  -28.237 27.636 1.00 99.08  ? 1883 VAL B CG2 1 
ATOM   6277 N N   . VAL B 1 377 ? 59.261  -29.923 28.326 1.00 94.10  ? 1884 VAL B N   1 
ATOM   6278 C CA  . VAL B 1 377 ? 58.195  -30.847 28.716 1.00 93.88  ? 1884 VAL B CA  1 
ATOM   6279 C C   . VAL B 1 377 ? 58.064  -32.041 27.764 1.00 94.06  ? 1884 VAL B C   1 
ATOM   6280 O O   . VAL B 1 377 ? 57.631  -31.898 26.616 1.00 94.12  ? 1884 VAL B O   1 
ATOM   6281 C CB  . VAL B 1 377 ? 56.828  -30.119 28.863 1.00 93.55  ? 1884 VAL B CB  1 
ATOM   6282 C CG1 . VAL B 1 377 ? 55.774  -31.058 29.440 1.00 93.33  ? 1884 VAL B CG1 1 
ATOM   6283 C CG2 . VAL B 1 377 ? 56.966  -28.876 29.739 1.00 93.39  ? 1884 VAL B CG2 1 
ATOM   6284 N N   . LEU B 1 378 ? 58.456  -33.213 28.258 1.00 90.72  ? 1885 LEU B N   1 
ATOM   6285 C CA  . LEU B 1 378 ? 58.238  -34.480 27.567 1.00 90.86  ? 1885 LEU B CA  1 
ATOM   6286 C C   . LEU B 1 378 ? 56.888  -35.035 27.998 1.00 90.55  ? 1885 LEU B C   1 
ATOM   6287 O O   . LEU B 1 378 ? 56.519  -34.910 29.163 1.00 90.31  ? 1885 LEU B O   1 
ATOM   6288 C CB  . LEU B 1 378 ? 59.358  -35.471 27.909 1.00 91.12  ? 1885 LEU B CB  1 
ATOM   6289 C CG  . LEU B 1 378 ? 59.264  -36.935 27.459 1.00 91.25  ? 1885 LEU B CG  1 
ATOM   6290 C CD1 . LEU B 1 378 ? 59.171  -37.044 25.951 1.00 91.49  ? 1885 LEU B CD1 1 
ATOM   6291 C CD2 . LEU B 1 378 ? 60.454  -37.726 27.967 1.00 91.49  ? 1885 LEU B CD2 1 
ATOM   6292 N N   . SER B 1 379 ? 56.151  -35.635 27.064 1.00 87.63  ? 1886 SER B N   1 
ATOM   6293 C CA  . SER B 1 379 ? 54.824  -36.178 27.366 1.00 87.36  ? 1886 SER B CA  1 
ATOM   6294 C C   . SER B 1 379 ? 54.379  -37.273 26.401 1.00 87.50  ? 1886 SER B C   1 
ATOM   6295 O O   . SER B 1 379 ? 54.482  -37.116 25.185 1.00 87.69  ? 1886 SER B O   1 
ATOM   6296 C CB  . SER B 1 379 ? 53.777  -35.057 27.394 1.00 87.09  ? 1886 SER B CB  1 
ATOM   6297 O OG  . SER B 1 379 ? 53.769  -34.333 26.176 1.00 87.22  ? 1886 SER B OG  1 
ATOM   6298 N N   . TYR B 1 380 ? 53.891  -38.380 26.960 1.00 85.84  ? 1887 TYR B N   1 
ATOM   6299 C CA  . TYR B 1 380 ? 53.220  -39.427 26.188 1.00 85.91  ? 1887 TYR B CA  1 
ATOM   6300 C C   . TYR B 1 380 ? 51.730  -39.423 26.532 1.00 85.60  ? 1887 TYR B C   1 
ATOM   6301 O O   . TYR B 1 380 ? 51.301  -38.705 27.439 1.00 85.34  ? 1887 TYR B O   1 
ATOM   6302 C CB  . TYR B 1 380 ? 53.815  -40.812 26.481 1.00 86.08  ? 1887 TYR B CB  1 
ATOM   6303 C CG  . TYR B 1 380 ? 55.313  -40.847 26.702 1.00 86.34  ? 1887 TYR B CG  1 
ATOM   6304 C CD1 . TYR B 1 380 ? 56.202  -40.596 25.658 1.00 86.66  ? 1887 TYR B CD1 1 
ATOM   6305 C CD2 . TYR B 1 380 ? 55.839  -41.154 27.954 1.00 86.29  ? 1887 TYR B CD2 1 
ATOM   6306 C CE1 . TYR B 1 380 ? 57.579  -40.633 25.861 1.00 86.92  ? 1887 TYR B CE1 1 
ATOM   6307 C CE2 . TYR B 1 380 ? 57.212  -41.196 28.168 1.00 86.56  ? 1887 TYR B CE2 1 
ATOM   6308 C CZ  . TYR B 1 380 ? 58.075  -40.935 27.119 1.00 86.87  ? 1887 TYR B CZ  1 
ATOM   6309 O OH  . TYR B 1 380 ? 59.432  -40.976 27.331 1.00 87.15  ? 1887 TYR B OH  1 
ATOM   6310 N N   . VAL B 1 381 ? 50.945  -40.220 25.809 1.00 82.01  ? 1888 VAL B N   1 
ATOM   6311 C CA  . VAL B 1 381 ? 49.500  -40.315 26.045 1.00 81.75  ? 1888 VAL B CA  1 
ATOM   6312 C C   . VAL B 1 381 ? 48.916  -41.610 25.460 1.00 81.84  ? 1888 VAL B C   1 
ATOM   6313 O O   . VAL B 1 381 ? 49.606  -42.340 24.747 1.00 82.12  ? 1888 VAL B O   1 
ATOM   6314 C CB  . VAL B 1 381 ? 48.746  -39.052 25.510 1.00 81.64  ? 1888 VAL B CB  1 
ATOM   6315 C CG1 . VAL B 1 381 ? 48.710  -39.026 23.987 1.00 81.88  ? 1888 VAL B CG1 1 
ATOM   6316 C CG2 . VAL B 1 381 ? 47.341  -38.966 26.085 1.00 81.35  ? 1888 VAL B CG2 1 
ATOM   6317 N N   . ASN B 1 382 ? 47.652  -41.883 25.787 1.00 79.29  ? 1889 ASN B N   1 
ATOM   6318 C CA  . ASN B 1 382 ? 46.898  -43.026 25.259 1.00 79.35  ? 1889 ASN B CA  1 
ATOM   6319 C C   . ASN B 1 382 ? 47.447  -44.375 25.726 1.00 79.45  ? 1889 ASN B C   1 
ATOM   6320 O O   . ASN B 1 382 ? 47.823  -45.224 24.916 1.00 79.70  ? 1889 ASN B O   1 
ATOM   6321 C CB  . ASN B 1 382 ? 46.789  -42.973 23.722 1.00 79.60  ? 1889 ASN B CB  1 
ATOM   6322 C CG  . ASN B 1 382 ? 46.266  -41.636 23.203 1.00 79.54  ? 1889 ASN B CG  1 
ATOM   6323 O OD1 . ASN B 1 382 ? 46.641  -41.198 22.115 1.00 79.77  ? 1889 ASN B OD1 1 
ATOM   6324 N ND2 . ASN B 1 382 ? 45.396  -40.988 23.974 1.00 79.25  ? 1889 ASN B ND2 1 
ATOM   6325 N N   . GLY B 1 383 ? 47.485  -44.559 27.041 1.00 75.98  ? 1890 GLY B N   1 
ATOM   6326 C CA  . GLY B 1 383 ? 47.955  -45.807 27.633 1.00 76.05  ? 1890 GLY B CA  1 
ATOM   6327 C C   . GLY B 1 383 ? 46.813  -46.770 27.874 1.00 75.92  ? 1890 GLY B C   1 
ATOM   6328 O O   . GLY B 1 383 ? 46.329  -47.416 26.943 1.00 76.04  ? 1890 GLY B O   1 
ATOM   6329 N N   . ASP B 1 384 ? 46.391  -46.867 29.132 1.00 73.07  ? 1891 ASP B N   1 
ATOM   6330 C CA  . ASP B 1 384 ? 45.232  -47.666 29.517 1.00 72.92  ? 1891 ASP B CA  1 
ATOM   6331 C C   . ASP B 1 384 ? 44.146  -46.763 30.088 1.00 72.66  ? 1891 ASP B C   1 
ATOM   6332 O O   . ASP B 1 384 ? 44.381  -45.575 30.311 1.00 72.58  ? 1891 ASP B O   1 
ATOM   6333 C CB  . ASP B 1 384 ? 45.626  -48.730 30.546 1.00 72.92  ? 1891 ASP B CB  1 
ATOM   6334 C CG  . ASP B 1 384 ? 46.379  -49.895 29.929 1.00 73.19  ? 1891 ASP B CG  1 
ATOM   6335 O OD1 . ASP B 1 384 ? 46.056  -50.289 28.787 1.00 73.32  ? 1891 ASP B OD1 1 
ATOM   6336 O OD2 . ASP B 1 384 ? 47.289  -50.429 30.597 1.00 73.30  ? 1891 ASP B OD2 1 
ATOM   6337 N N   . ARG B 1 385 ? 42.960  -47.328 30.313 1.00 71.23  ? 1892 ARG B N   1 
ATOM   6338 C CA  . ARG B 1 385 ? 41.856  -46.599 30.939 1.00 71.00  ? 1892 ARG B CA  1 
ATOM   6339 C C   . ARG B 1 385 ? 42.188  -46.232 32.383 1.00 70.86  ? 1892 ARG B C   1 
ATOM   6340 O O   . ARG B 1 385 ? 42.780  -47.029 33.117 1.00 70.90  ? 1892 ARG B O   1 
ATOM   6341 C CB  . ARG B 1 385 ? 40.559  -47.413 30.885 1.00 70.93  ? 1892 ARG B CB  1 
ATOM   6342 C CG  . ARG B 1 385 ? 39.853  -47.371 29.537 1.00 71.03  ? 1892 ARG B CG  1 
ATOM   6343 C CD  . ARG B 1 385 ? 38.582  -48.213 29.510 1.00 70.98  ? 1892 ARG B CD  1 
ATOM   6344 N NE  . ARG B 1 385 ? 38.852  -49.643 29.660 1.00 71.07  ? 1892 ARG B NE  1 
ATOM   6345 C CZ  . ARG B 1 385 ? 38.052  -50.613 29.226 1.00 71.12  ? 1892 ARG B CZ  1 
ATOM   6346 N NH1 . ARG B 1 385 ? 36.921  -50.324 28.593 1.00 71.11  ? 1892 ARG B NH1 1 
ATOM   6347 N NH2 . ARG B 1 385 ? 38.390  -51.882 29.416 1.00 71.21  ? 1892 ARG B NH2 1 
ATOM   6348 N N   . CYS B 1 386 ? 41.803  -45.019 32.776 1.00 70.80  ? 1893 CYS B N   1 
ATOM   6349 C CA  . CYS B 1 386 ? 42.048  -44.507 34.125 1.00 70.68  ? 1893 CYS B CA  1 
ATOM   6350 C C   . CYS B 1 386 ? 41.308  -45.318 35.194 1.00 70.59  ? 1893 CYS B C   1 
ATOM   6351 O O   . CYS B 1 386 ? 40.297  -45.956 34.893 1.00 70.57  ? 1893 CYS B O   1 
ATOM   6352 C CB  . CYS B 1 386 ? 41.675  -43.023 34.203 1.00 70.56  ? 1893 CYS B CB  1 
ATOM   6353 S SG  . CYS B 1 386 ? 42.794  -41.970 33.255 1.00 70.68  ? 1893 CYS B SG  1 
ATOM   6354 N N   . PRO B 1 387 ? 41.818  -45.308 36.443 1.00 68.20  ? 1894 PRO B N   1 
ATOM   6355 C CA  . PRO B 1 387 ? 41.219  -46.125 37.498 1.00 68.14  ? 1894 PRO B CA  1 
ATOM   6356 C C   . PRO B 1 387 ? 39.779  -45.720 37.818 1.00 67.98  ? 1894 PRO B C   1 
ATOM   6357 O O   . PRO B 1 387 ? 39.463  -44.527 37.826 1.00 67.89  ? 1894 PRO B O   1 
ATOM   6358 C CB  . PRO B 1 387 ? 42.125  -45.861 38.709 1.00 68.17  ? 1894 PRO B CB  1 
ATOM   6359 C CG  . PRO B 1 387 ? 43.391  -45.324 38.144 1.00 68.26  ? 1894 PRO B CG  1 
ATOM   6360 C CD  . PRO B 1 387 ? 42.974  -44.544 36.944 1.00 68.21  ? 1894 PRO B CD  1 
ATOM   6361 N N   . PRO B 1 388 ? 38.907  -46.714 38.063 1.00 68.52  ? 1895 PRO B N   1 
ATOM   6362 C CA  . PRO B 1 388 ? 37.516  -46.484 38.457 1.00 68.40  ? 1895 PRO B CA  1 
ATOM   6363 C C   . PRO B 1 388 ? 37.378  -45.859 39.847 1.00 68.32  ? 1895 PRO B C   1 
ATOM   6364 O O   . PRO B 1 388 ? 38.289  -45.964 40.671 1.00 68.37  ? 1895 PRO B O   1 
ATOM   6365 C CB  . PRO B 1 388 ? 36.915  -47.892 38.450 1.00 68.44  ? 1895 PRO B CB  1 
ATOM   6366 C CG  . PRO B 1 388 ? 38.073  -48.800 38.656 1.00 68.56  ? 1895 PRO B CG  1 
ATOM   6367 C CD  . PRO B 1 388 ? 39.214  -48.152 37.949 1.00 68.63  ? 1895 PRO B CD  1 
ATOM   6368 N N   . GLU B 1 389 ? 36.238  -45.217 40.088 1.00 71.43  ? 1896 GLU B N   1 
ATOM   6369 C CA  . GLU B 1 389 ? 35.948  -44.564 41.364 1.00 71.37  ? 1896 GLU B CA  1 
ATOM   6370 C C   . GLU B 1 389 ? 34.577  -44.982 41.885 1.00 71.34  ? 1896 GLU B C   1 
ATOM   6371 O O   . GLU B 1 389 ? 33.767  -45.534 41.141 1.00 71.34  ? 1896 GLU B O   1 
ATOM   6372 C CB  . GLU B 1 389 ? 35.972  -43.043 41.202 1.00 71.31  ? 1896 GLU B CB  1 
ATOM   6373 C CG  . GLU B 1 389 ? 37.332  -42.448 40.876 1.00 71.35  ? 1896 GLU B CG  1 
ATOM   6374 C CD  . GLU B 1 389 ? 37.292  -40.935 40.744 1.00 71.29  ? 1896 GLU B CD  1 
ATOM   6375 O OE1 . GLU B 1 389 ? 36.231  -40.388 40.369 1.00 71.23  ? 1896 GLU B OE1 1 
ATOM   6376 O OE2 . GLU B 1 389 ? 38.328  -40.293 41.014 1.00 71.31  ? 1896 GLU B OE2 1 
ATOM   6377 N N   . THR B 1 390 ? 34.322  -44.709 43.163 1.00 75.33  ? 1897 THR B N   1 
ATOM   6378 C CA  . THR B 1 390 ? 32.984  -44.869 43.731 1.00 75.32  ? 1897 THR B CA  1 
ATOM   6379 C C   . THR B 1 390 ? 32.151  -43.638 43.389 1.00 75.26  ? 1897 THR B C   1 
ATOM   6380 O O   . THR B 1 390 ? 32.697  -42.606 42.989 1.00 75.23  ? 1897 THR B O   1 
ATOM   6381 C CB  . THR B 1 390 ? 33.012  -45.065 45.264 1.00 75.36  ? 1897 THR B CB  1 
ATOM   6382 O OG1 . THR B 1 390 ? 33.441  -43.854 45.899 1.00 75.35  ? 1897 THR B OG1 1 
ATOM   6383 C CG2 . THR B 1 390 ? 33.944  -46.209 45.651 1.00 75.44  ? 1897 THR B CG2 1 
ATOM   6384 N N   . ASP B 1 391 ? 30.834  -43.750 43.552 1.00 84.15  ? 1898 ASP B N   1 
ATOM   6385 C CA  . ASP B 1 391 ? 29.915  -42.652 43.249 1.00 84.12  ? 1898 ASP B CA  1 
ATOM   6386 C C   . ASP B 1 391 ? 30.244  -41.373 44.020 1.00 84.10  ? 1898 ASP B C   1 
ATOM   6387 O O   . ASP B 1 391 ? 30.145  -40.272 43.474 1.00 84.06  ? 1898 ASP B O   1 
ATOM   6388 C CB  . ASP B 1 391 ? 28.466  -43.069 43.526 1.00 84.16  ? 1898 ASP B CB  1 
ATOM   6389 C CG  . ASP B 1 391 ? 27.930  -44.055 42.501 1.00 84.19  ? 1898 ASP B CG  1 
ATOM   6390 O OD1 . ASP B 1 391 ? 28.097  -43.817 41.284 1.00 84.18  ? 1898 ASP B OD1 1 
ATOM   6391 O OD2 . ASP B 1 391 ? 27.326  -45.065 42.917 1.00 84.24  ? 1898 ASP B OD2 1 
ATOM   6392 N N   . ASP B 1 392 ? 30.646  -41.535 45.281 1.00 86.06  ? 1899 ASP B N   1 
ATOM   6393 C CA  . ASP B 1 392 ? 30.901  -40.411 46.188 1.00 86.07  ? 1899 ASP B CA  1 
ATOM   6394 C C   . ASP B 1 392 ? 32.166  -39.620 45.846 1.00 86.03  ? 1899 ASP B C   1 
ATOM   6395 O O   . ASP B 1 392 ? 32.196  -38.397 46.003 1.00 86.01  ? 1899 ASP B O   1 
ATOM   6396 C CB  . ASP B 1 392 ? 30.958  -40.900 47.639 1.00 86.15  ? 1899 ASP B CB  1 
ATOM   6397 C CG  . ASP B 1 392 ? 29.652  -41.527 48.097 1.00 86.21  ? 1899 ASP B CG  1 
ATOM   6398 O OD1 . ASP B 1 392 ? 28.631  -40.809 48.163 1.00 86.22  ? 1899 ASP B OD1 1 
ATOM   6399 O OD2 . ASP B 1 392 ? 29.652  -42.738 48.399 1.00 86.25  ? 1899 ASP B OD2 1 
ATOM   6400 N N   . GLY B 1 393 ? 33.204  -40.320 45.392 1.00 80.23  ? 1900 GLY B N   1 
ATOM   6401 C CA  . GLY B 1 393 ? 34.442  -39.671 44.961 1.00 80.22  ? 1900 GLY B CA  1 
ATOM   6402 C C   . GLY B 1 393 ? 35.723  -40.231 45.555 1.00 80.29  ? 1900 GLY B C   1 
ATOM   6403 O O   . GLY B 1 393 ? 36.807  -39.697 45.311 1.00 80.30  ? 1900 GLY B O   1 
ATOM   6404 N N   . VAL B 1 394 ? 35.602  -41.303 46.334 1.00 72.27  ? 1901 VAL B N   1 
ATOM   6405 C CA  . VAL B 1 394 ? 36.766  -41.964 46.930 1.00 72.36  ? 1901 VAL B CA  1 
ATOM   6406 C C   . VAL B 1 394 ? 37.261  -43.112 46.034 1.00 72.39  ? 1901 VAL B C   1 
ATOM   6407 O O   . VAL B 1 394 ? 36.502  -44.036 45.733 1.00 72.37  ? 1901 VAL B O   1 
ATOM   6408 C CB  . VAL B 1 394 ? 36.498  -42.417 48.407 1.00 72.44  ? 1901 VAL B CB  1 
ATOM   6409 C CG1 . VAL B 1 394 ? 35.144  -43.114 48.553 1.00 72.43  ? 1901 VAL B CG1 1 
ATOM   6410 C CG2 . VAL B 1 394 ? 37.635  -43.288 48.944 1.00 72.56  ? 1901 VAL B CG2 1 
ATOM   6411 N N   . PRO B 1 395 ? 38.537  -43.045 45.600 1.00 67.05  ? 1902 PRO B N   1 
ATOM   6412 C CA  . PRO B 1 395 ? 39.111  -43.977 44.619 1.00 67.10  ? 1902 PRO B CA  1 
ATOM   6413 C C   . PRO B 1 395 ? 39.157  -45.434 45.075 1.00 67.18  ? 1902 PRO B C   1 
ATOM   6414 O O   . PRO B 1 395 ? 39.264  -45.712 46.273 1.00 67.24  ? 1902 PRO B O   1 
ATOM   6415 C CB  . PRO B 1 395 ? 40.534  -43.444 44.417 1.00 67.17  ? 1902 PRO B CB  1 
ATOM   6416 C CG  . PRO B 1 395 ? 40.828  -42.669 45.649 1.00 67.19  ? 1902 PRO B CG  1 
ATOM   6417 C CD  . PRO B 1 395 ? 39.528  -42.043 46.033 1.00 67.09  ? 1902 PRO B CD  1 
ATOM   6418 N N   . CYS B 1 396 ? 39.077  -46.343 44.104 1.00 64.46  ? 1903 CYS B N   1 
ATOM   6419 C CA  . CYS B 1 396 ? 39.126  -47.783 44.352 1.00 64.54  ? 1903 CYS B CA  1 
ATOM   6420 C C   . CYS B 1 396 ? 40.551  -48.244 44.623 1.00 64.69  ? 1903 CYS B C   1 
ATOM   6421 O O   . CYS B 1 396 ? 41.500  -47.753 44.009 1.00 64.73  ? 1903 CYS B O   1 
ATOM   6422 C CB  . CYS B 1 396 ? 38.559  -48.555 43.159 1.00 64.53  ? 1903 CYS B CB  1 
ATOM   6423 S SG  . CYS B 1 396 ? 36.832  -48.195 42.774 1.00 64.40  ? 1903 CYS B SG  1 
ATOM   6424 N N   . VAL B 1 397 ? 40.687  -49.198 45.539 1.00 64.03  ? 1904 VAL B N   1 
ATOM   6425 C CA  . VAL B 1 397 ? 41.992  -49.725 45.926 1.00 64.20  ? 1904 VAL B CA  1 
ATOM   6426 C C   . VAL B 1 397 ? 42.219  -51.107 45.313 1.00 64.29  ? 1904 VAL B C   1 
ATOM   6427 O O   . VAL B 1 397 ? 41.480  -52.055 45.594 1.00 64.28  ? 1904 VAL B O   1 
ATOM   6428 C CB  . VAL B 1 397 ? 42.151  -49.769 47.469 1.00 64.28  ? 1904 VAL B CB  1 
ATOM   6429 C CG1 . VAL B 1 397 ? 43.464  -50.435 47.868 1.00 64.48  ? 1904 VAL B CG1 1 
ATOM   6430 C CG2 . VAL B 1 397 ? 42.069  -48.363 48.054 1.00 64.22  ? 1904 VAL B CG2 1 
ATOM   6431 N N   . PHE B 1 398 ? 43.245  -51.204 44.469 1.00 64.34  ? 1905 PHE B N   1 
ATOM   6432 C CA  . PHE B 1 398 ? 43.599  -52.460 43.812 1.00 64.46  ? 1905 PHE B CA  1 
ATOM   6433 C C   . PHE B 1 398 ? 45.038  -52.882 44.124 1.00 64.67  ? 1905 PHE B C   1 
ATOM   6434 O O   . PHE B 1 398 ? 45.948  -52.052 44.080 1.00 64.73  ? 1905 PHE B O   1 
ATOM   6435 C CB  . PHE B 1 398 ? 43.397  -52.359 42.294 1.00 64.43  ? 1905 PHE B CB  1 
ATOM   6436 C CG  . PHE B 1 398 ? 41.968  -52.111 41.878 1.00 64.26  ? 1905 PHE B CG  1 
ATOM   6437 C CD1 . PHE B 1 398 ? 40.932  -52.915 42.351 1.00 64.20  ? 1905 PHE B CD1 1 
ATOM   6438 C CD2 . PHE B 1 398 ? 41.663  -51.085 40.989 1.00 64.17  ? 1905 PHE B CD2 1 
ATOM   6439 C CE1 . PHE B 1 398 ? 39.617  -52.687 41.957 1.00 64.07  ? 1905 PHE B CE1 1 
ATOM   6440 C CE2 . PHE B 1 398 ? 40.350  -50.852 40.588 1.00 64.04  ? 1905 PHE B CE2 1 
ATOM   6441 C CZ  . PHE B 1 398 ? 39.327  -51.654 41.073 1.00 63.99  ? 1905 PHE B CZ  1 
ATOM   6442 N N   . PRO B 1 399 ? 45.247  -54.175 44.445 1.00 66.14  ? 1906 PRO B N   1 
ATOM   6443 C CA  . PRO B 1 399 ? 44.221  -55.214 44.567 1.00 66.09  ? 1906 PRO B CA  1 
ATOM   6444 C C   . PRO B 1 399 ? 43.594  -55.287 45.965 1.00 66.05  ? 1906 PRO B C   1 
ATOM   6445 O O   . PRO B 1 399 ? 44.158  -54.757 46.927 1.00 66.10  ? 1906 PRO B O   1 
ATOM   6446 C CB  . PRO B 1 399 ? 44.990  -56.509 44.260 1.00 66.28  ? 1906 PRO B CB  1 
ATOM   6447 C CG  . PRO B 1 399 ? 46.464  -56.137 44.243 1.00 66.47  ? 1906 PRO B CG  1 
ATOM   6448 C CD  . PRO B 1 399 ? 46.590  -54.721 44.700 1.00 66.37  ? 1906 PRO B CD  1 
ATOM   6449 N N   . PHE B 1 400 ? 42.432  -55.934 46.063 1.00 65.37  ? 1907 PHE B N   1 
ATOM   6450 C CA  . PHE B 1 400 ? 41.758  -56.136 47.348 1.00 65.35  ? 1907 PHE B CA  1 
ATOM   6451 C C   . PHE B 1 400 ? 41.267  -57.572 47.533 1.00 65.41  ? 1907 PHE B C   1 
ATOM   6452 O O   . PHE B 1 400 ? 41.063  -58.298 46.557 1.00 65.40  ? 1907 PHE B O   1 
ATOM   6453 C CB  . PHE B 1 400 ? 40.613  -55.127 47.539 1.00 65.17  ? 1907 PHE B CB  1 
ATOM   6454 C CG  . PHE B 1 400 ? 39.454  -55.320 46.596 1.00 65.04  ? 1907 PHE B CG  1 
ATOM   6455 C CD1 . PHE B 1 400 ? 38.349  -56.080 46.976 1.00 65.01  ? 1907 PHE B CD1 1 
ATOM   6456 C CD2 . PHE B 1 400 ? 39.456  -54.728 45.336 1.00 64.96  ? 1907 PHE B CD2 1 
ATOM   6457 C CE1 . PHE B 1 400 ? 37.271  -56.258 46.111 1.00 64.91  ? 1907 PHE B CE1 1 
ATOM   6458 C CE2 . PHE B 1 400 ? 38.382  -54.900 44.464 1.00 64.87  ? 1907 PHE B CE2 1 
ATOM   6459 C CZ  . PHE B 1 400 ? 37.288  -55.666 44.853 1.00 64.84  ? 1907 PHE B CZ  1 
ATOM   6460 N N   . ILE B 1 401 ? 41.079  -57.971 48.789 1.00 68.87  ? 1908 ILE B N   1 
ATOM   6461 C CA  . ILE B 1 401 ? 40.677  -59.339 49.122 1.00 68.94  ? 1908 ILE B CA  1 
ATOM   6462 C C   . ILE B 1 401 ? 39.169  -59.450 49.379 1.00 68.82  ? 1908 ILE B C   1 
ATOM   6463 O O   . ILE B 1 401 ? 38.578  -58.606 50.060 1.00 68.75  ? 1908 ILE B O   1 
ATOM   6464 C CB  . ILE B 1 401 ? 41.465  -59.893 50.340 1.00 69.14  ? 1908 ILE B CB  1 
ATOM   6465 C CG1 . ILE B 1 401 ? 42.927  -59.432 50.297 1.00 69.28  ? 1908 ILE B CG1 1 
ATOM   6466 C CG2 . ILE B 1 401 ? 41.377  -61.422 50.391 1.00 69.26  ? 1908 ILE B CG2 1 
ATOM   6467 C CD1 . ILE B 1 401 ? 43.636  -59.474 51.641 1.00 69.47  ? 1908 ILE B CD1 1 
ATOM   6468 N N   . PHE B 1 402 ? 38.560  -60.494 48.820 1.00 71.21  ? 1909 PHE B N   1 
ATOM   6469 C CA  . PHE B 1 402 ? 37.145  -60.786 49.030 1.00 71.13  ? 1909 PHE B CA  1 
ATOM   6470 C C   . PHE B 1 402 ? 36.929  -62.297 49.071 1.00 71.23  ? 1909 PHE B C   1 
ATOM   6471 O O   . PHE B 1 402 ? 37.223  -62.998 48.100 1.00 71.26  ? 1909 PHE B O   1 
ATOM   6472 C CB  . PHE B 1 402 ? 36.290  -60.136 47.936 1.00 70.97  ? 1909 PHE B CB  1 
ATOM   6473 C CG  . PHE B 1 402 ? 34.808  -60.255 48.165 1.00 70.89  ? 1909 PHE B CG  1 
ATOM   6474 C CD1 . PHE B 1 402 ? 34.144  -59.352 48.987 1.00 70.84  ? 1909 PHE B CD1 1 
ATOM   6475 C CD2 . PHE B 1 402 ? 34.075  -61.264 47.549 1.00 70.89  ? 1909 PHE B CD2 1 
ATOM   6476 C CE1 . PHE B 1 402 ? 32.772  -59.456 49.201 1.00 70.79  ? 1909 PHE B CE1 1 
ATOM   6477 C CE2 . PHE B 1 402 ? 32.704  -61.378 47.757 1.00 70.84  ? 1909 PHE B CE2 1 
ATOM   6478 C CZ  . PHE B 1 402 ? 32.051  -60.470 48.584 1.00 70.80  ? 1909 PHE B CZ  1 
ATOM   6479 N N   . ASN B 1 403 ? 36.420  -62.783 50.203 1.00 78.41  ? 1910 ASN B N   1 
ATOM   6480 C CA  . ASN B 1 403 ? 36.237  -64.219 50.460 1.00 78.53  ? 1910 ASN B CA  1 
ATOM   6481 C C   . ASN B 1 403 ? 37.479  -65.068 50.160 1.00 78.68  ? 1910 ASN B C   1 
ATOM   6482 O O   . ASN B 1 403 ? 37.378  -66.177 49.629 1.00 78.73  ? 1910 ASN B O   1 
ATOM   6483 C CB  . ASN B 1 403 ? 35.000  -64.762 49.728 1.00 78.44  ? 1910 ASN B CB  1 
ATOM   6484 C CG  . ASN B 1 403 ? 33.708  -64.483 50.476 1.00 78.39  ? 1910 ASN B CG  1 
ATOM   6485 O OD1 . ASN B 1 403 ? 32.839  -63.764 49.986 1.00 78.26  ? 1910 ASN B OD1 1 
ATOM   6486 N ND2 . ASN B 1 403 ? 33.575  -65.053 51.670 1.00 78.52  ? 1910 ASN B ND2 1 
ATOM   6487 N N   . GLY B 1 404 ? 38.646  -64.531 50.509 1.00 79.56  ? 1911 GLY B N   1 
ATOM   6488 C CA  . GLY B 1 404 ? 39.921  -65.218 50.314 1.00 79.73  ? 1911 GLY B CA  1 
ATOM   6489 C C   . GLY B 1 404 ? 40.439  -65.205 48.886 1.00 79.71  ? 1911 GLY B C   1 
ATOM   6490 O O   . GLY B 1 404 ? 41.185  -66.100 48.486 1.00 79.85  ? 1911 GLY B O   1 
ATOM   6491 N N   . LYS B 1 405 ? 40.043  -64.191 48.118 1.00 76.45  ? 1912 LYS B N   1 
ATOM   6492 C CA  . LYS B 1 405 ? 40.476  -64.042 46.726 1.00 76.44  ? 1912 LYS B CA  1 
ATOM   6493 C C   . LYS B 1 405 ? 40.954  -62.616 46.468 1.00 76.36  ? 1912 LYS B C   1 
ATOM   6494 O O   . LYS B 1 405 ? 40.423  -61.668 47.048 1.00 76.23  ? 1912 LYS B O   1 
ATOM   6495 C CB  . LYS B 1 405 ? 39.332  -64.367 45.755 1.00 76.32  ? 1912 LYS B CB  1 
ATOM   6496 C CG  . LYS B 1 405 ? 38.652  -65.724 45.936 1.00 76.38  ? 1912 LYS B CG  1 
ATOM   6497 C CD  . LYS B 1 405 ? 39.408  -66.848 45.240 1.00 76.54  ? 1912 LYS B CD  1 
ATOM   6498 C CE  . LYS B 1 405 ? 38.469  -67.980 44.836 1.00 76.52  ? 1912 LYS B CE  1 
ATOM   6499 N NZ  . LYS B 1 405 ? 37.765  -68.608 45.991 1.00 76.49  ? 1912 LYS B NZ  1 
ATOM   6500 N N   . SER B 1 406 ? 41.946  -62.467 45.593 1.00 71.37  ? 1913 SER B N   1 
ATOM   6501 C CA  . SER B 1 406 ? 42.441  -61.146 45.199 1.00 71.31  ? 1913 SER B CA  1 
ATOM   6502 C C   . SER B 1 406 ? 41.770  -60.676 43.909 1.00 71.18  ? 1913 SER B C   1 
ATOM   6503 O O   . SER B 1 406 ? 41.665  -61.439 42.945 1.00 71.22  ? 1913 SER B O   1 
ATOM   6504 C CB  . SER B 1 406 ? 43.961  -61.163 45.030 1.00 71.51  ? 1913 SER B CB  1 
ATOM   6505 O OG  . SER B 1 406 ? 44.459  -59.862 44.765 1.00 71.46  ? 1913 SER B OG  1 
ATOM   6506 N N   . TYR B 1 407 ? 41.326  -59.420 43.897 1.00 69.19  ? 1914 TYR B N   1 
ATOM   6507 C CA  . TYR B 1 407 ? 40.596  -58.867 42.753 1.00 69.06  ? 1914 TYR B CA  1 
ATOM   6508 C C   . TYR B 1 407 ? 41.227  -57.599 42.184 1.00 69.03  ? 1914 TYR B C   1 
ATOM   6509 O O   . TYR B 1 407 ? 41.687  -56.733 42.930 1.00 69.02  ? 1914 TYR B O   1 
ATOM   6510 C CB  . TYR B 1 407 ? 39.125  -58.634 43.111 1.00 68.90  ? 1914 TYR B CB  1 
ATOM   6511 C CG  . TYR B 1 407 ? 38.358  -59.916 43.357 1.00 68.93  ? 1914 TYR B CG  1 
ATOM   6512 C CD1 . TYR B 1 407 ? 38.036  -60.320 44.650 1.00 68.95  ? 1914 TYR B CD1 1 
ATOM   6513 C CD2 . TYR B 1 407 ? 37.967  -60.733 42.296 1.00 68.95  ? 1914 TYR B CD2 1 
ATOM   6514 C CE1 . TYR B 1 407 ? 37.336  -61.501 44.879 1.00 68.98  ? 1914 TYR B CE1 1 
ATOM   6515 C CE2 . TYR B 1 407 ? 37.267  -61.916 42.516 1.00 68.98  ? 1914 TYR B CE2 1 
ATOM   6516 C CZ  . TYR B 1 407 ? 36.956  -62.293 43.810 1.00 69.00  ? 1914 TYR B CZ  1 
ATOM   6517 O OH  . TYR B 1 407 ? 36.265  -63.460 44.040 1.00 69.03  ? 1914 TYR B OH  1 
ATOM   6518 N N   . GLU B 1 408 ? 41.224  -57.502 40.855 1.00 68.68  ? 1915 GLU B N   1 
ATOM   6519 C CA  . GLU B 1 408 ? 41.915  -56.430 40.133 1.00 68.69  ? 1915 GLU B CA  1 
ATOM   6520 C C   . GLU B 1 408 ? 41.008  -55.291 39.653 1.00 68.52  ? 1915 GLU B C   1 
ATOM   6521 O O   . GLU B 1 408 ? 41.444  -54.142 39.580 1.00 68.49  ? 1915 GLU B O   1 
ATOM   6522 C CB  . GLU B 1 408 ? 42.701  -57.004 38.947 1.00 68.87  ? 1915 GLU B CB  1 
ATOM   6523 C CG  . GLU B 1 408 ? 43.977  -57.758 39.331 1.00 69.08  ? 1915 GLU B CG  1 
ATOM   6524 C CD  . GLU B 1 408 ? 45.158  -56.844 39.658 1.00 69.15  ? 1915 GLU B CD  1 
ATOM   6525 O OE1 . GLU B 1 408 ? 45.072  -55.619 39.422 1.00 69.06  ? 1915 GLU B OE1 1 
ATOM   6526 O OE2 . GLU B 1 408 ? 46.184  -57.361 40.149 1.00 69.30  ? 1915 GLU B OE2 1 
ATOM   6527 N N   . GLU B 1 409 ? 39.763  -55.612 39.307 1.00 67.93  ? 1916 GLU B N   1 
ATOM   6528 C CA  . GLU B 1 409 ? 38.799  -54.597 38.868 1.00 67.79  ? 1916 GLU B CA  1 
ATOM   6529 C C   . GLU B 1 409 ? 37.504  -54.653 39.682 1.00 67.67  ? 1916 GLU B C   1 
ATOM   6530 O O   . GLU B 1 409 ? 37.341  -55.525 40.538 1.00 67.69  ? 1916 GLU B O   1 
ATOM   6531 C CB  . GLU B 1 409 ? 38.509  -54.718 37.362 1.00 67.85  ? 1916 GLU B CB  1 
ATOM   6532 C CG  . GLU B 1 409 ? 37.498  -55.801 36.967 1.00 67.86  ? 1916 GLU B CG  1 
ATOM   6533 C CD  . GLU B 1 409 ? 38.138  -57.137 36.629 1.00 68.04  ? 1916 GLU B CD  1 
ATOM   6534 O OE1 . GLU B 1 409 ? 39.050  -57.583 37.361 1.00 68.11  ? 1916 GLU B OE1 1 
ATOM   6535 O OE2 . GLU B 1 409 ? 37.711  -57.751 35.627 1.00 68.11  ? 1916 GLU B OE2 1 
ATOM   6536 N N   . CYS B 1 410 ? 36.597  -53.714 39.413 1.00 69.65  ? 1917 CYS B N   1 
ATOM   6537 C CA  . CYS B 1 410 ? 35.281  -53.698 40.044 1.00 69.55  ? 1917 CYS B CA  1 
ATOM   6538 C C   . CYS B 1 410 ? 34.550  -55.004 39.747 1.00 69.61  ? 1917 CYS B C   1 
ATOM   6539 O O   . CYS B 1 410 ? 34.416  -55.399 38.587 1.00 69.66  ? 1917 CYS B O   1 
ATOM   6540 C CB  . CYS B 1 410 ? 34.458  -52.507 39.550 1.00 69.46  ? 1917 CYS B CB  1 
ATOM   6541 S SG  . CYS B 1 410 ? 35.297  -50.914 39.668 1.00 69.40  ? 1917 CYS B SG  1 
ATOM   6542 N N   . ILE B 1 411 ? 34.096  -55.674 40.803 1.00 71.77  ? 1918 ILE B N   1 
ATOM   6543 C CA  . ILE B 1 411 ? 33.448  -56.982 40.675 1.00 71.82  ? 1918 ILE B CA  1 
ATOM   6544 C C   . ILE B 1 411 ? 31.946  -56.918 40.957 1.00 71.76  ? 1918 ILE B C   1 
ATOM   6545 O O   . ILE B 1 411 ? 31.402  -55.843 41.216 1.00 71.68  ? 1918 ILE B O   1 
ATOM   6546 C CB  . ILE B 1 411 ? 34.124  -58.056 41.571 1.00 71.91  ? 1918 ILE B CB  1 
ATOM   6547 C CG1 . ILE B 1 411 ? 34.152  -57.613 43.041 1.00 71.87  ? 1918 ILE B CG1 1 
ATOM   6548 C CG2 . ILE B 1 411 ? 35.525  -58.364 41.057 1.00 72.02  ? 1918 ILE B CG2 1 
ATOM   6549 C CD1 . ILE B 1 411 ? 34.466  -58.729 44.027 1.00 71.97  ? 1918 ILE B CD1 1 
ATOM   6550 N N   . ILE B 1 412 ? 31.288  -58.075 40.889 1.00 80.68  ? 1919 ILE B N   1 
ATOM   6551 C CA  . ILE B 1 412 ? 29.849  -58.179 41.141 1.00 80.65  ? 1919 ILE B CA  1 
ATOM   6552 C C   . ILE B 1 412 ? 29.490  -59.401 41.994 1.00 80.71  ? 1919 ILE B C   1 
ATOM   6553 O O   . ILE B 1 412 ? 28.885  -60.363 41.518 1.00 80.77  ? 1919 ILE B O   1 
ATOM   6554 C CB  . ILE B 1 412 ? 29.010  -58.139 39.828 1.00 80.67  ? 1919 ILE B CB  1 
ATOM   6555 C CG1 . ILE B 1 412 ? 29.776  -58.759 38.651 1.00 80.74  ? 1919 ILE B CG1 1 
ATOM   6556 C CG2 . ILE B 1 412 ? 28.611  -56.709 39.496 1.00 80.59  ? 1919 ILE B CG2 1 
ATOM   6557 C CD1 . ILE B 1 412 ? 29.584  -60.257 38.480 1.00 80.84  ? 1919 ILE B CD1 1 
ATOM   6558 N N   . GLU B 1 413 ? 29.877  -59.346 43.264 1.00 84.41  ? 1920 GLU B N   1 
ATOM   6559 C CA  . GLU B 1 413 ? 29.536  -60.387 44.224 1.00 84.48  ? 1920 GLU B CA  1 
ATOM   6560 C C   . GLU B 1 413 ? 28.566  -59.842 45.265 1.00 84.46  ? 1920 GLU B C   1 
ATOM   6561 O O   . GLU B 1 413 ? 28.866  -58.860 45.949 1.00 84.43  ? 1920 GLU B O   1 
ATOM   6562 C CB  . GLU B 1 413 ? 30.797  -60.937 44.892 1.00 84.55  ? 1920 GLU B CB  1 
ATOM   6563 C CG  . GLU B 1 413 ? 31.481  -62.057 44.118 1.00 84.63  ? 1920 GLU B CG  1 
ATOM   6564 C CD  . GLU B 1 413 ? 30.900  -63.426 44.429 1.00 84.71  ? 1920 GLU B CD  1 
ATOM   6565 O OE1 . GLU B 1 413 ? 31.035  -63.885 45.583 1.00 84.76  ? 1920 GLU B OE1 1 
ATOM   6566 O OE2 . GLU B 1 413 ? 30.317  -64.048 43.518 1.00 84.74  ? 1920 GLU B OE2 1 
ATOM   6567 N N   . SER B 1 414 ? 27.399  -60.480 45.358 1.00 93.38  ? 1921 SER B N   1 
ATOM   6568 C CA  . SER B 1 414 ? 26.319  -60.098 46.285 1.00 93.39  ? 1921 SER B CA  1 
ATOM   6569 C C   . SER B 1 414 ? 25.822  -58.649 46.134 1.00 93.32  ? 1921 SER B C   1 
ATOM   6570 O O   . SER B 1 414 ? 25.152  -58.119 47.024 1.00 93.34  ? 1921 SER B O   1 
ATOM   6571 C CB  . SER B 1 414 ? 26.696  -60.409 47.745 1.00 93.47  ? 1921 SER B CB  1 
ATOM   6572 O OG  . SER B 1 414 ? 27.681  -59.515 48.237 1.00 93.44  ? 1921 SER B OG  1 
ATOM   6573 N N   . ARG B 1 415 ? 26.145  -58.026 45.001 1.00 91.79  ? 1922 ARG B N   1 
ATOM   6574 C CA  . ARG B 1 415 ? 25.705  -56.662 44.697 1.00 91.72  ? 1922 ARG B CA  1 
ATOM   6575 C C   . ARG B 1 415 ? 25.265  -56.516 43.243 1.00 91.71  ? 1922 ARG B C   1 
ATOM   6576 O O   . ARG B 1 415 ? 25.767  -57.218 42.363 1.00 91.72  ? 1922 ARG B O   1 
ATOM   6577 C CB  . ARG B 1 415 ? 26.803  -55.652 45.032 1.00 91.66  ? 1922 ARG B CB  1 
ATOM   6578 C CG  . ARG B 1 415 ? 26.771  -55.188 46.473 1.00 91.69  ? 1922 ARG B CG  1 
ATOM   6579 C CD  . ARG B 1 415 ? 28.104  -54.624 46.926 1.00 91.67  ? 1922 ARG B CD  1 
ATOM   6580 N NE  . ARG B 1 415 ? 28.046  -54.202 48.323 1.00 91.72  ? 1922 ARG B NE  1 
ATOM   6581 C CZ  . ARG B 1 415 ? 28.243  -55.004 49.367 1.00 91.82  ? 1922 ARG B CZ  1 
ATOM   6582 N NH1 . ARG B 1 415 ? 28.523  -56.290 49.191 1.00 91.86  ? 1922 ARG B NH1 1 
ATOM   6583 N NH2 . ARG B 1 415 ? 28.159  -54.516 50.595 1.00 91.89  ? 1922 ARG B NH2 1 
ATOM   6584 N N   . ALA B 1 416 ? 24.331  -55.596 43.005 1.00 92.81  ? 1923 ALA B N   1 
ATOM   6585 C CA  . ALA B 1 416 ? 23.716  -55.411 41.686 1.00 92.83  ? 1923 ALA B CA  1 
ATOM   6586 C C   . ALA B 1 416 ? 24.636  -54.722 40.673 1.00 92.77  ? 1923 ALA B C   1 
ATOM   6587 O O   . ALA B 1 416 ? 25.019  -55.319 39.663 1.00 92.81  ? 1923 ALA B O   1 
ATOM   6588 C CB  . ALA B 1 416 ? 22.394  -54.656 41.819 1.00 92.86  ? 1923 ALA B CB  1 
ATOM   6589 N N   . LYS B 1 417 ? 24.975  -53.464 40.949 1.00 87.51  ? 1924 LYS B N   1 
ATOM   6590 C CA  . LYS B 1 417 ? 25.876  -52.684 40.104 1.00 87.47  ? 1924 LYS B CA  1 
ATOM   6591 C C   . LYS B 1 417 ? 27.329  -53.085 40.389 1.00 87.45  ? 1924 LYS B C   1 
ATOM   6592 O O   . LYS B 1 417 ? 27.606  -53.757 41.385 1.00 87.47  ? 1924 LYS B O   1 
ATOM   6593 C CB  . LYS B 1 417 ? 25.653  -51.185 40.356 1.00 87.41  ? 1924 LYS B CB  1 
ATOM   6594 C CG  . LYS B 1 417 ? 26.233  -50.234 39.306 1.00 87.38  ? 1924 LYS B CG  1 
ATOM   6595 C CD  . LYS B 1 417 ? 25.326  -50.104 38.091 1.00 87.43  ? 1924 LYS B CD  1 
ATOM   6596 C CE  . LYS B 1 417 ? 25.892  -49.126 37.069 1.00 87.42  ? 1924 LYS B CE  1 
ATOM   6597 N NZ  . LYS B 1 417 ? 25.022  -49.010 35.860 1.00 87.51  ? 1924 LYS B NZ  1 
ATOM   6598 N N   . LEU B 1 418 ? 28.245  -52.684 39.508 1.00 78.37  ? 1925 LEU B N   1 
ATOM   6599 C CA  . LEU B 1 418 ? 29.675  -52.971 39.665 1.00 78.38  ? 1925 LEU B CA  1 
ATOM   6600 C C   . LEU B 1 418 ? 30.266  -52.200 40.846 1.00 78.32  ? 1925 LEU B C   1 
ATOM   6601 O O   . LEU B 1 418 ? 30.075  -50.989 40.958 1.00 78.26  ? 1925 LEU B O   1 
ATOM   6602 C CB  . LEU B 1 418 ? 30.431  -52.638 38.373 1.00 78.41  ? 1925 LEU B CB  1 
ATOM   6603 C CG  . LEU B 1 418 ? 30.073  -53.440 37.115 1.00 78.50  ? 1925 LEU B CG  1 
ATOM   6604 C CD1 . LEU B 1 418 ? 30.287  -52.614 35.853 1.00 78.53  ? 1925 LEU B CD1 1 
ATOM   6605 C CD2 . LEU B 1 418 ? 30.851  -54.750 37.047 1.00 78.59  ? 1925 LEU B CD2 1 
ATOM   6606 N N   . TRP B 1 419 ? 30.980  -52.911 41.719 1.00 73.81  ? 1926 TRP B N   1 
ATOM   6607 C CA  . TRP B 1 419 ? 31.495  -52.332 42.963 1.00 73.79  ? 1926 TRP B CA  1 
ATOM   6608 C C   . TRP B 1 419 ? 32.966  -52.674 43.228 1.00 73.84  ? 1926 TRP B C   1 
ATOM   6609 O O   . TRP B 1 419 ? 33.450  -53.737 42.827 1.00 73.91  ? 1926 TRP B O   1 
ATOM   6610 C CB  . TRP B 1 419 ? 30.639  -52.787 44.150 1.00 73.81  ? 1926 TRP B CB  1 
ATOM   6611 C CG  . TRP B 1 419 ? 30.818  -54.242 44.493 1.00 73.89  ? 1926 TRP B CG  1 
ATOM   6612 C CD1 . TRP B 1 419 ? 30.220  -55.307 43.884 1.00 73.92  ? 1926 TRP B CD1 1 
ATOM   6613 C CD2 . TRP B 1 419 ? 31.656  -54.787 45.520 1.00 73.96  ? 1926 TRP B CD2 1 
ATOM   6614 N NE1 . TRP B 1 419 ? 30.634  -56.482 44.466 1.00 74.01  ? 1926 TRP B NE1 1 
ATOM   6615 C CE2 . TRP B 1 419 ? 31.515  -56.191 45.474 1.00 74.03  ? 1926 TRP B CE2 1 
ATOM   6616 C CE3 . TRP B 1 419 ? 32.512  -54.224 46.477 1.00 73.98  ? 1926 TRP B CE3 1 
ATOM   6617 C CZ2 . TRP B 1 419 ? 32.197  -57.043 46.350 1.00 74.13  ? 1926 TRP B CZ2 1 
ATOM   6618 C CZ3 . TRP B 1 419 ? 33.191  -55.072 47.346 1.00 74.09  ? 1926 TRP B CZ3 1 
ATOM   6619 C CH2 . TRP B 1 419 ? 33.028  -56.465 47.275 1.00 74.16  ? 1926 TRP B CH2 1 
ATOM   6620 N N   . CYS B 1 420 ? 33.659  -51.765 43.914 1.00 67.55  ? 1927 CYS B N   1 
ATOM   6621 C CA  . CYS B 1 420 ? 35.049  -51.969 44.333 1.00 67.62  ? 1927 CYS B CA  1 
ATOM   6622 C C   . CYS B 1 420 ? 35.179  -51.779 45.843 1.00 67.65  ? 1927 CYS B C   1 
ATOM   6623 O O   . CYS B 1 420 ? 34.187  -51.519 46.528 1.00 67.62  ? 1927 CYS B O   1 
ATOM   6624 C CB  . CYS B 1 420 ? 35.976  -50.987 43.610 1.00 67.60  ? 1927 CYS B CB  1 
ATOM   6625 S SG  . CYS B 1 420 ? 35.796  -49.265 44.155 1.00 67.51  ? 1927 CYS B SG  1 
ATOM   6626 N N   . SER B 1 421 ? 36.403  -51.900 46.354 1.00 66.29  ? 1928 SER B N   1 
ATOM   6627 C CA  . SER B 1 421 ? 36.685  -51.636 47.764 1.00 66.36  ? 1928 SER B CA  1 
ATOM   6628 C C   . SER B 1 421 ? 37.511  -50.363 47.925 1.00 66.34  ? 1928 SER B C   1 
ATOM   6629 O O   . SER B 1 421 ? 38.407  -50.094 47.122 1.00 66.34  ? 1928 SER B O   1 
ATOM   6630 C CB  . SER B 1 421 ? 37.415  -52.820 48.397 1.00 66.50  ? 1928 SER B CB  1 
ATOM   6631 O OG  . SER B 1 421 ? 37.584  -52.627 49.790 1.00 66.59  ? 1928 SER B OG  1 
ATOM   6632 N N   . THR B 1 422 ? 37.204  -49.585 48.961 1.00 67.46  ? 1929 THR B N   1 
ATOM   6633 C CA  . THR B 1 422 ? 37.947  -48.355 49.257 1.00 67.46  ? 1929 THR B CA  1 
ATOM   6634 C C   . THR B 1 422 ? 39.115  -48.609 50.215 1.00 67.62  ? 1929 THR B C   1 
ATOM   6635 O O   . THR B 1 422 ? 39.882  -47.696 50.535 1.00 67.65  ? 1929 THR B O   1 
ATOM   6636 C CB  . THR B 1 422 ? 37.031  -47.239 49.818 1.00 67.40  ? 1929 THR B CB  1 
ATOM   6637 O OG1 . THR B 1 422 ? 36.335  -47.717 50.974 1.00 67.48  ? 1929 THR B OG1 1 
ATOM   6638 C CG2 . THR B 1 422 ? 36.022  -46.798 48.772 1.00 67.26  ? 1929 THR B CG2 1 
ATOM   6639 N N   . THR B 1 423 ? 39.237  -49.857 50.664 1.00 67.41  ? 1930 THR B N   1 
ATOM   6640 C CA  . THR B 1 423 ? 40.356  -50.303 51.493 1.00 67.59  ? 1930 THR B CA  1 
ATOM   6641 C C   . THR B 1 423 ? 41.138  -51.393 50.766 1.00 67.67  ? 1930 THR B C   1 
ATOM   6642 O O   . THR B 1 423 ? 40.726  -51.857 49.701 1.00 67.58  ? 1930 THR B O   1 
ATOM   6643 C CB  . THR B 1 423 ? 39.878  -50.861 52.852 1.00 67.71  ? 1930 THR B CB  1 
ATOM   6644 O OG1 . THR B 1 423 ? 38.974  -51.952 52.633 1.00 67.68  ? 1930 THR B OG1 1 
ATOM   6645 C CG2 . THR B 1 423 ? 39.182  -49.788 53.667 1.00 67.67  ? 1930 THR B CG2 1 
ATOM   6646 N N   . ALA B 1 424 ? 42.261  -51.804 51.349 1.00 66.90  ? 1931 ALA B N   1 
ATOM   6647 C CA  . ALA B 1 424 ? 43.068  -52.893 50.802 1.00 67.01  ? 1931 ALA B CA  1 
ATOM   6648 C C   . ALA B 1 424 ? 42.401  -54.258 50.994 1.00 67.04  ? 1931 ALA B C   1 
ATOM   6649 O O   . ALA B 1 424 ? 42.798  -55.243 50.369 1.00 67.10  ? 1931 ALA B O   1 
ATOM   6650 C CB  . ALA B 1 424 ? 44.457  -52.885 51.422 1.00 67.22  ? 1931 ALA B CB  1 
ATOM   6651 N N   . ASP B 1 425 ? 41.389  -54.306 51.859 1.00 69.39  ? 1932 ASP B N   1 
ATOM   6652 C CA  . ASP B 1 425 ? 40.653  -55.536 52.143 1.00 69.42  ? 1932 ASP B CA  1 
ATOM   6653 C C   . ASP B 1 425 ? 39.212  -55.234 52.551 1.00 69.31  ? 1932 ASP B C   1 
ATOM   6654 O O   . ASP B 1 425 ? 38.966  -54.451 53.472 1.00 69.34  ? 1932 ASP B O   1 
ATOM   6655 C CB  . ASP B 1 425 ? 41.362  -56.343 53.239 1.00 69.65  ? 1932 ASP B CB  1 
ATOM   6656 C CG  . ASP B 1 425 ? 40.769  -57.735 53.437 1.00 69.70  ? 1932 ASP B CG  1 
ATOM   6657 O OD1 . ASP B 1 425 ? 39.820  -58.116 52.718 1.00 69.56  ? 1932 ASP B OD1 1 
ATOM   6658 O OD2 . ASP B 1 425 ? 41.264  -58.457 54.328 1.00 69.89  ? 1932 ASP B OD2 1 
ATOM   6659 N N   . TYR B 1 426 ? 38.269  -55.866 51.855 1.00 70.21  ? 1933 TYR B N   1 
ATOM   6660 C CA  . TYR B 1 426 ? 36.848  -55.726 52.161 1.00 70.13  ? 1933 TYR B CA  1 
ATOM   6661 C C   . TYR B 1 426 ? 36.430  -56.658 53.296 1.00 70.27  ? 1933 TYR B C   1 
ATOM   6662 O O   . TYR B 1 426 ? 35.683  -56.257 54.186 1.00 70.30  ? 1933 TYR B O   1 
ATOM   6663 C CB  . TYR B 1 426 ? 35.994  -55.980 50.914 1.00 69.99  ? 1933 TYR B CB  1 
ATOM   6664 C CG  . TYR B 1 426 ? 34.503  -55.793 51.130 1.00 69.92  ? 1933 TYR B CG  1 
ATOM   6665 C CD1 . TYR B 1 426 ? 33.916  -54.532 51.030 1.00 69.81  ? 1933 TYR B CD1 1 
ATOM   6666 C CD2 . TYR B 1 426 ? 33.682  -56.880 51.432 1.00 69.97  ? 1933 TYR B CD2 1 
ATOM   6667 C CE1 . TYR B 1 426 ? 32.550  -54.359 51.227 1.00 69.78  ? 1933 TYR B CE1 1 
ATOM   6668 C CE2 . TYR B 1 426 ? 32.317  -56.717 51.630 1.00 69.94  ? 1933 TYR B CE2 1 
ATOM   6669 C CZ  . TYR B 1 426 ? 31.759  -55.455 51.525 1.00 69.85  ? 1933 TYR B CZ  1 
ATOM   6670 O OH  . TYR B 1 426 ? 30.410  -55.290 51.721 1.00 69.83  ? 1933 TYR B OH  1 
ATOM   6671 N N   . ASP B 1 427 ? 36.915  -57.899 53.259 1.00 76.31  ? 1934 ASP B N   1 
ATOM   6672 C CA  . ASP B 1 427 ? 36.604  -58.897 54.286 1.00 76.46  ? 1934 ASP B CA  1 
ATOM   6673 C C   . ASP B 1 427 ? 36.894  -58.387 55.692 1.00 76.61  ? 1934 ASP B C   1 
ATOM   6674 O O   . ASP B 1 427 ? 36.207  -58.750 56.648 1.00 76.70  ? 1934 ASP B O   1 
ATOM   6675 C CB  . ASP B 1 427 ? 37.403  -60.181 54.046 1.00 76.57  ? 1934 ASP B CB  1 
ATOM   6676 C CG  . ASP B 1 427 ? 37.089  -60.831 52.714 1.00 76.47  ? 1934 ASP B CG  1 
ATOM   6677 O OD1 . ASP B 1 427 ? 35.969  -60.643 52.193 1.00 76.33  ? 1934 ASP B OD1 1 
ATOM   6678 O OD2 . ASP B 1 427 ? 37.969  -61.544 52.188 1.00 76.55  ? 1934 ASP B OD2 1 
ATOM   6679 N N   . ARG B 1 428 ? 37.912  -57.537 55.797 1.00 79.16  ? 1935 ARG B N   1 
ATOM   6680 C CA  . ARG B 1 428 ? 38.402  -57.043 57.076 1.00 79.33  ? 1935 ARG B CA  1 
ATOM   6681 C C   . ARG B 1 428 ? 37.702  -55.758 57.524 1.00 79.26  ? 1935 ARG B C   1 
ATOM   6682 O O   . ARG B 1 428 ? 37.331  -55.628 58.692 1.00 79.40  ? 1935 ARG B O   1 
ATOM   6683 C CB  . ARG B 1 428 ? 39.915  -56.825 56.994 1.00 79.43  ? 1935 ARG B CB  1 
ATOM   6684 C CG  . ARG B 1 428 ? 40.586  -56.466 58.310 1.00 79.65  ? 1935 ARG B CG  1 
ATOM   6685 C CD  . ARG B 1 428 ? 42.007  -55.986 58.077 1.00 79.73  ? 1935 ARG B CD  1 
ATOM   6686 N NE  . ARG B 1 428 ? 42.046  -54.787 57.240 1.00 79.54  ? 1935 ARG B NE  1 
ATOM   6687 C CZ  . ARG B 1 428 ? 43.136  -54.326 56.634 1.00 79.54  ? 1935 ARG B CZ  1 
ATOM   6688 N NH1 . ARG B 1 428 ? 44.296  -54.958 56.761 1.00 79.72  ? 1935 ARG B NH1 1 
ATOM   6689 N NH2 . ARG B 1 428 ? 43.065  -53.228 55.895 1.00 79.37  ? 1935 ARG B NH2 1 
ATOM   6690 N N   . ASP B 1 429 ? 37.518  -54.822 56.595 1.00 76.86  ? 1936 ASP B N   1 
ATOM   6691 C CA  . ASP B 1 429 ? 37.033  -53.482 56.939 1.00 76.80  ? 1936 ASP B CA  1 
ATOM   6692 C C   . ASP B 1 429 ? 35.614  -53.171 56.448 1.00 76.65  ? 1936 ASP B C   1 
ATOM   6693 O O   . ASP B 1 429 ? 34.989  -52.214 56.918 1.00 76.64  ? 1936 ASP B O   1 
ATOM   6694 C CB  . ASP B 1 429 ? 38.020  -52.419 56.437 1.00 76.74  ? 1936 ASP B CB  1 
ATOM   6695 C CG  . ASP B 1 429 ? 39.430  -52.631 56.968 1.00 76.93  ? 1936 ASP B CG  1 
ATOM   6696 O OD1 . ASP B 1 429 ? 39.602  -52.745 58.200 1.00 77.12  ? 1936 ASP B OD1 1 
ATOM   6697 O OD2 . ASP B 1 429 ? 40.369  -52.680 56.148 1.00 76.90  ? 1936 ASP B OD2 1 
ATOM   6698 N N   . HIS B 1 430 ? 35.117  -53.987 55.516 1.00 76.09  ? 1937 HIS B N   1 
ATOM   6699 C CA  . HIS B 1 430 ? 33.784  -53.823 54.916 1.00 75.95  ? 1937 HIS B CA  1 
ATOM   6700 C C   . HIS B 1 430 ? 33.535  -52.402 54.406 1.00 75.82  ? 1937 HIS B C   1 
ATOM   6701 O O   . HIS B 1 430 ? 32.625  -51.707 54.866 1.00 75.83  ? 1937 HIS B O   1 
ATOM   6702 C CB  . HIS B 1 430 ? 32.676  -54.275 55.880 1.00 76.06  ? 1937 HIS B CB  1 
ATOM   6703 C CG  . HIS B 1 430 ? 32.620  -55.757 56.085 1.00 76.15  ? 1937 HIS B CG  1 
ATOM   6704 N ND1 . HIS B 1 430 ? 31.867  -56.591 55.285 1.00 76.08  ? 1937 HIS B ND1 1 
ATOM   6705 C CD2 . HIS B 1 430 ? 33.219  -56.554 57.001 1.00 76.34  ? 1937 HIS B CD2 1 
ATOM   6706 C CE1 . HIS B 1 430 ? 32.008  -57.838 55.699 1.00 76.20  ? 1937 HIS B CE1 1 
ATOM   6707 N NE2 . HIS B 1 430 ? 32.823  -57.843 56.738 1.00 76.36  ? 1937 HIS B NE2 1 
ATOM   6708 N N   . GLU B 1 431 ? 34.363  -51.981 53.456 1.00 72.04  ? 1938 GLU B N   1 
ATOM   6709 C CA  . GLU B 1 431 ? 34.251  -50.657 52.859 1.00 71.92  ? 1938 GLU B CA  1 
ATOM   6710 C C   . GLU B 1 431 ? 34.108  -50.780 51.346 1.00 71.78  ? 1938 GLU B C   1 
ATOM   6711 O O   . GLU B 1 431 ? 34.917  -51.446 50.693 1.00 71.79  ? 1938 GLU B O   1 
ATOM   6712 C CB  . GLU B 1 431 ? 35.468  -49.803 53.221 1.00 71.97  ? 1938 GLU B CB  1 
ATOM   6713 C CG  . GLU B 1 431 ? 35.524  -49.365 54.680 1.00 72.11  ? 1938 GLU B CG  1 
ATOM   6714 C CD  . GLU B 1 431 ? 34.610  -48.194 54.983 1.00 72.05  ? 1938 GLU B CD  1 
ATOM   6715 O OE1 . GLU B 1 431 ? 34.604  -47.218 54.202 1.00 71.92  ? 1938 GLU B OE1 1 
ATOM   6716 O OE2 . GLU B 1 431 ? 33.906  -48.245 56.012 1.00 72.16  ? 1938 GLU B OE2 1 
ATOM   6717 N N   . TRP B 1 432 ? 33.075  -50.142 50.797 1.00 72.53  ? 1939 TRP B N   1 
ATOM   6718 C CA  . TRP B 1 432 ? 32.757  -50.265 49.374 1.00 72.42  ? 1939 TRP B CA  1 
ATOM   6719 C C   . TRP B 1 432 ? 32.043  -49.041 48.787 1.00 72.32  ? 1939 TRP B C   1 
ATOM   6720 O O   . TRP B 1 432 ? 31.773  -48.061 49.485 1.00 72.33  ? 1939 TRP B O   1 
ATOM   6721 C CB  . TRP B 1 432 ? 31.929  -51.535 49.124 1.00 72.45  ? 1939 TRP B CB  1 
ATOM   6722 C CG  . TRP B 1 432 ? 30.537  -51.471 49.679 1.00 72.46  ? 1939 TRP B CG  1 
ATOM   6723 C CD1 . TRP B 1 432 ? 30.167  -51.613 50.985 1.00 72.57  ? 1939 TRP B CD1 1 
ATOM   6724 C CD2 . TRP B 1 432 ? 29.329  -51.246 48.942 1.00 72.40  ? 1939 TRP B CD2 1 
ATOM   6725 N NE1 . TRP B 1 432 ? 28.804  -51.489 51.109 1.00 72.58  ? 1939 TRP B NE1 1 
ATOM   6726 C CE2 . TRP B 1 432 ? 28.265  -51.265 49.870 1.00 72.47  ? 1939 TRP B CE2 1 
ATOM   6727 C CE3 . TRP B 1 432 ? 29.042  -51.033 47.587 1.00 72.32  ? 1939 TRP B CE3 1 
ATOM   6728 C CZ2 . TRP B 1 432 ? 26.933  -51.076 49.487 1.00 72.47  ? 1939 TRP B CZ2 1 
ATOM   6729 C CZ3 . TRP B 1 432 ? 27.719  -50.844 47.208 1.00 72.30  ? 1939 TRP B CZ3 1 
ATOM   6730 C CH2 . TRP B 1 432 ? 26.681  -50.868 48.155 1.00 72.38  ? 1939 TRP B CH2 1 
ATOM   6731 N N   . GLY B 1 433 ? 31.757  -49.123 47.489 1.00 75.77  ? 1940 GLY B N   1 
ATOM   6732 C CA  . GLY B 1 433 ? 31.026  -48.099 46.750 1.00 75.69  ? 1940 GLY B CA  1 
ATOM   6733 C C   . GLY B 1 433 ? 30.876  -48.537 45.305 1.00 75.65  ? 1940 GLY B C   1 
ATOM   6734 O O   . GLY B 1 433 ? 31.793  -49.136 44.737 1.00 75.67  ? 1940 GLY B O   1 
ATOM   6735 N N   . PHE B 1 434 ? 29.718  -48.250 44.713 1.00 78.38  ? 1941 PHE B N   1 
ATOM   6736 C CA  . PHE B 1 434 ? 29.450  -48.622 43.324 1.00 78.37  ? 1941 PHE B CA  1 
ATOM   6737 C C   . PHE B 1 434 ? 30.376  -47.882 42.359 1.00 78.33  ? 1941 PHE B C   1 
ATOM   6738 O O   . PHE B 1 434 ? 30.546  -46.666 42.462 1.00 78.29  ? 1941 PHE B O   1 
ATOM   6739 C CB  . PHE B 1 434 ? 27.984  -48.361 42.954 1.00 78.37  ? 1941 PHE B CB  1 
ATOM   6740 C CG  . PHE B 1 434 ? 27.007  -49.348 43.550 1.00 78.43  ? 1941 PHE B CG  1 
ATOM   6741 C CD1 . PHE B 1 434 ? 27.252  -50.721 43.501 1.00 78.48  ? 1941 PHE B CD1 1 
ATOM   6742 C CD2 . PHE B 1 434 ? 25.822  -48.903 44.131 1.00 78.47  ? 1941 PHE B CD2 1 
ATOM   6743 C CE1 . PHE B 1 434 ? 26.340  -51.632 44.041 1.00 78.54  ? 1941 PHE B CE1 1 
ATOM   6744 C CE2 . PHE B 1 434 ? 24.905  -49.806 44.672 1.00 78.54  ? 1941 PHE B CE2 1 
ATOM   6745 C CZ  . PHE B 1 434 ? 25.166  -51.173 44.627 1.00 78.58  ? 1941 PHE B CZ  1 
ATOM   6746 N N   . CYS B 1 435 ? 30.968  -48.628 41.427 1.00 74.03  ? 1942 CYS B N   1 
ATOM   6747 C CA  . CYS B 1 435 ? 31.948  -48.085 40.483 1.00 74.03  ? 1942 CYS B CA  1 
ATOM   6748 C C   . CYS B 1 435 ? 31.334  -47.237 39.369 1.00 74.01  ? 1942 CYS B C   1 
ATOM   6749 O O   . CYS B 1 435 ? 30.393  -47.668 38.697 1.00 74.04  ? 1942 CYS B O   1 
ATOM   6750 C CB  . CYS B 1 435 ? 32.789  -49.210 39.865 1.00 74.11  ? 1942 CYS B CB  1 
ATOM   6751 S SG  . CYS B 1 435 ? 34.125  -49.822 40.916 1.00 74.16  ? 1942 CYS B SG  1 
ATOM   6752 N N   . ARG B 1 436 ? 31.870  -46.030 39.190 1.00 76.24  ? 1943 ARG B N   1 
ATOM   6753 C CA  . ARG B 1 436 ? 31.594  -45.222 38.000 1.00 76.24  ? 1943 ARG B CA  1 
ATOM   6754 C C   . ARG B 1 436 ? 32.896  -44.933 37.248 1.00 76.28  ? 1943 ARG B C   1 
ATOM   6755 O O   . ARG B 1 436 ? 33.707  -44.100 37.664 1.00 76.24  ? 1943 ARG B O   1 
ATOM   6756 C CB  . ARG B 1 436 ? 30.802  -43.941 38.323 1.00 76.18  ? 1943 ARG B CB  1 
ATOM   6757 C CG  . ARG B 1 436 ? 31.414  -43.023 39.370 1.00 76.12  ? 1943 ARG B CG  1 
ATOM   6758 C CD  . ARG B 1 436 ? 30.974  -41.578 39.156 1.00 76.08  ? 1943 ARG B CD  1 
ATOM   6759 N NE  . ARG B 1 436 ? 31.758  -40.645 39.966 1.00 76.04  ? 1943 ARG B NE  1 
ATOM   6760 C CZ  . ARG B 1 436 ? 32.946  -40.148 39.620 1.00 76.03  ? 1943 ARG B CZ  1 
ATOM   6761 N NH1 . ARG B 1 436 ? 33.517  -40.487 38.468 1.00 76.08  ? 1943 ARG B NH1 1 
ATOM   6762 N NH2 . ARG B 1 436 ? 33.571  -39.309 40.437 1.00 76.00  ? 1943 ARG B NH2 1 
ATOM   6763 N N   . HIS B 1 437 ? 33.082  -45.646 36.141 1.00 70.64  ? 1944 HIS B N   1 
ATOM   6764 C CA  . HIS B 1 437 ? 34.330  -45.626 35.380 1.00 70.72  ? 1944 HIS B CA  1 
ATOM   6765 C C   . HIS B 1 437 ? 34.504  -44.349 34.568 1.00 70.72  ? 1944 HIS B C   1 
ATOM   6766 O O   . HIS B 1 437 ? 33.532  -43.784 34.063 1.00 70.69  ? 1944 HIS B O   1 
ATOM   6767 C CB  . HIS B 1 437 ? 34.399  -46.840 34.452 1.00 70.84  ? 1944 HIS B CB  1 
ATOM   6768 C CG  . HIS B 1 437 ? 34.192  -48.146 35.152 1.00 70.85  ? 1944 HIS B CG  1 
ATOM   6769 N ND1 . HIS B 1 437 ? 32.947  -48.592 35.540 1.00 70.80  ? 1944 HIS B ND1 1 
ATOM   6770 C CD2 . HIS B 1 437 ? 35.070  -49.101 35.536 1.00 70.91  ? 1944 HIS B CD2 1 
ATOM   6771 C CE1 . HIS B 1 437 ? 33.068  -49.766 36.133 1.00 70.83  ? 1944 HIS B CE1 1 
ATOM   6772 N NE2 . HIS B 1 437 ? 34.346  -50.098 36.144 1.00 70.90  ? 1944 HIS B NE2 1 
ATOM   6773 N N   . SER B 1 438 ? 35.751  -43.905 34.447 1.00 71.82  ? 1945 SER B N   1 
ATOM   6774 C CA  . SER B 1 438 ? 36.082  -42.741 33.638 1.00 71.84  ? 1945 SER B CA  1 
ATOM   6775 C C   . SER B 1 438 ? 36.337  -43.157 32.194 1.00 72.00  ? 1945 SER B C   1 
ATOM   6776 O O   . SER B 1 438 ? 36.882  -44.234 31.935 1.00 72.10  ? 1945 SER B O   1 
ATOM   6777 C CB  . SER B 1 438 ? 37.303  -42.020 34.208 1.00 71.83  ? 1945 SER B CB  1 
ATOM   6778 O OG  . SER B 1 438 ? 37.539  -40.801 33.525 1.00 71.85  ? 1945 SER B OG  1 
ATOM   6779 N N   . ASN B 1 439 ? 35.937  -42.296 31.261 1.00 70.72  ? 1946 ASN B N   1 
ATOM   6780 C CA  . ASN B 1 439 ? 36.097  -42.568 29.833 1.00 70.90  ? 1946 ASN B CA  1 
ATOM   6781 C C   . ASN B 1 439 ? 37.407  -42.033 29.248 1.00 71.00  ? 1946 ASN B C   1 
ATOM   6782 O O   . ASN B 1 439 ? 37.616  -42.081 28.032 1.00 71.17  ? 1946 ASN B O   1 
ATOM   6783 C CB  . ASN B 1 439 ? 34.893  -42.038 29.044 1.00 70.92  ? 1946 ASN B CB  1 
ATOM   6784 C CG  . ASN B 1 439 ? 33.610  -42.786 29.365 1.00 70.87  ? 1946 ASN B CG  1 
ATOM   6785 O OD1 . ASN B 1 439 ? 33.129  -42.766 30.500 1.00 70.73  ? 1946 ASN B OD1 1 
ATOM   6786 N ND2 . ASN B 1 439 ? 33.043  -43.444 28.359 1.00 71.01  ? 1946 ASN B ND2 1 
ATOM   6787 N N   . SER B 1 440 ? 38.282  -41.532 30.120 1.00 72.43  ? 1947 SER B N   1 
ATOM   6788 C CA  . SER B 1 440 ? 39.592  -41.017 29.716 1.00 72.53  ? 1947 SER B CA  1 
ATOM   6789 C C   . SER B 1 440 ? 40.705  -42.041 29.946 1.00 72.64  ? 1947 SER B C   1 
ATOM   6790 O O   . SER B 1 440 ? 40.564  -42.957 30.761 1.00 72.59  ? 1947 SER B O   1 
ATOM   6791 C CB  . SER B 1 440 ? 39.909  -39.704 30.442 1.00 72.40  ? 1947 SER B CB  1 
ATOM   6792 O OG  . SER B 1 440 ? 39.971  -39.891 31.845 1.00 72.27  ? 1947 SER B OG  1 
ATOM   6793 N N   . TYR B 1 441 ? 41.806  -41.875 29.217 1.00 73.20  ? 1948 TYR B N   1 
ATOM   6794 C CA  . TYR B 1 441 ? 42.948  -42.786 29.294 1.00 73.36  ? 1948 TYR B CA  1 
ATOM   6795 C C   . TYR B 1 441 ? 44.170  -42.105 29.919 1.00 73.37  ? 1948 TYR B C   1 
ATOM   6796 O O   . TYR B 1 441 ? 44.261  -40.875 29.941 1.00 73.30  ? 1948 TYR B O   1 
ATOM   6797 C CB  . TYR B 1 441 ? 43.289  -43.336 27.906 1.00 73.61  ? 1948 TYR B CB  1 
ATOM   6798 C CG  . TYR B 1 441 ? 42.326  -44.382 27.369 1.00 73.65  ? 1948 TYR B CG  1 
ATOM   6799 C CD1 . TYR B 1 441 ? 42.770  -45.668 27.059 1.00 73.82  ? 1948 TYR B CD1 1 
ATOM   6800 C CD2 . TYR B 1 441 ? 40.979  -44.083 27.153 1.00 73.53  ? 1948 TYR B CD2 1 
ATOM   6801 C CE1 . TYR B 1 441 ? 41.898  -46.631 26.554 1.00 73.87  ? 1948 TYR B CE1 1 
ATOM   6802 C CE2 . TYR B 1 441 ? 40.099  -45.038 26.649 1.00 73.59  ? 1948 TYR B CE2 1 
ATOM   6803 C CZ  . TYR B 1 441 ? 40.565  -46.308 26.350 1.00 73.75  ? 1948 TYR B CZ  1 
ATOM   6804 O OH  . TYR B 1 441 ? 39.694  -47.252 25.856 1.00 73.81  ? 1948 TYR B OH  1 
ATOM   6805 N N   . ARG B 1 442 ? 45.107  -42.918 30.406 1.00 75.82  ? 1949 ARG B N   1 
ATOM   6806 C CA  . ARG B 1 442 ? 46.229  -42.443 31.225 1.00 75.84  ? 1949 ARG B CA  1 
ATOM   6807 C C   . ARG B 1 442 ? 47.266  -41.609 30.471 1.00 76.01  ? 1949 ARG B C   1 
ATOM   6808 O O   . ARG B 1 442 ? 47.574  -41.877 29.306 1.00 76.21  ? 1949 ARG B O   1 
ATOM   6809 C CB  . ARG B 1 442 ? 46.918  -43.618 31.926 1.00 75.93  ? 1949 ARG B CB  1 
ATOM   6810 C CG  . ARG B 1 442 ? 46.035  -44.376 32.905 1.00 75.77  ? 1949 ARG B CG  1 
ATOM   6811 C CD  . ARG B 1 442 ? 46.859  -45.328 33.746 1.00 75.87  ? 1949 ARG B CD  1 
ATOM   6812 N NE  . ARG B 1 442 ? 46.052  -46.389 34.343 1.00 75.79  ? 1949 ARG B NE  1 
ATOM   6813 C CZ  . ARG B 1 442 ? 46.477  -47.207 35.303 1.00 75.83  ? 1949 ARG B CZ  1 
ATOM   6814 N NH1 . ARG B 1 442 ? 47.702  -47.086 35.797 1.00 75.96  ? 1949 ARG B NH1 1 
ATOM   6815 N NH2 . ARG B 1 442 ? 45.670  -48.144 35.779 1.00 75.76  ? 1949 ARG B NH2 1 
ATOM   6816 N N   . THR B 1 443 ? 47.795  -40.599 31.162 1.00 78.00  ? 1950 THR B N   1 
ATOM   6817 C CA  . THR B 1 443 ? 48.809  -39.691 30.621 1.00 78.15  ? 1950 THR B CA  1 
ATOM   6818 C C   . THR B 1 443 ? 50.022  -39.628 31.551 1.00 78.23  ? 1950 THR B C   1 
ATOM   6819 O O   . THR B 1 443 ? 49.928  -39.979 32.729 1.00 78.12  ? 1950 THR B O   1 
ATOM   6820 C CB  . THR B 1 443 ? 48.258  -38.254 30.436 1.00 78.01  ? 1950 THR B CB  1 
ATOM   6821 O OG1 . THR B 1 443 ? 47.902  -37.704 31.710 1.00 77.80  ? 1950 THR B OG1 1 
ATOM   6822 C CG2 . THR B 1 443 ? 47.034  -38.242 29.532 1.00 77.94  ? 1950 THR B CG2 1 
ATOM   6823 N N   . SER B 1 444 ? 51.158  -39.185 31.012 1.00 81.47  ? 1951 SER B N   1 
ATOM   6824 C CA  . SER B 1 444 ? 52.376  -38.973 31.799 1.00 81.57  ? 1951 SER B CA  1 
ATOM   6825 C C   . SER B 1 444 ? 53.295  -37.956 31.133 1.00 81.73  ? 1951 SER B C   1 
ATOM   6826 O O   . SER B 1 444 ? 53.482  -37.982 29.917 1.00 81.90  ? 1951 SER B O   1 
ATOM   6827 C CB  . SER B 1 444 ? 53.124  -40.289 32.027 1.00 81.77  ? 1951 SER B CB  1 
ATOM   6828 O OG  . SER B 1 444 ? 53.452  -40.909 30.798 1.00 82.01  ? 1951 SER B OG  1 
ATOM   6829 N N   . SER B 1 445 ? 53.871  -37.065 31.937 1.00 83.75  ? 1952 SER B N   1 
ATOM   6830 C CA  . SER B 1 445 ? 54.734  -36.004 31.420 1.00 83.89  ? 1952 SER B CA  1 
ATOM   6831 C C   . SER B 1 445 ? 55.949  -35.722 32.307 1.00 84.02  ? 1952 SER B C   1 
ATOM   6832 O O   . SER B 1 445 ? 55.835  -35.656 33.533 1.00 83.88  ? 1952 SER B O   1 
ATOM   6833 C CB  . SER B 1 445 ? 53.929  -34.720 31.194 1.00 83.68  ? 1952 SER B CB  1 
ATOM   6834 O OG  . SER B 1 445 ? 53.291  -34.296 32.385 1.00 83.42  ? 1952 SER B OG  1 
ATOM   6835 N N   . ILE B 1 446 ? 57.108  -35.556 31.671 1.00 87.53  ? 1953 ILE B N   1 
ATOM   6836 C CA  . ILE B 1 446 ? 58.352  -35.220 32.363 1.00 87.70  ? 1953 ILE B CA  1 
ATOM   6837 C C   . ILE B 1 446 ? 58.722  -33.761 32.102 1.00 87.69  ? 1953 ILE B C   1 
ATOM   6838 O O   . ILE B 1 446 ? 58.922  -33.359 30.953 1.00 87.82  ? 1953 ILE B O   1 
ATOM   6839 C CB  . ILE B 1 446 ? 59.526  -36.135 31.924 1.00 88.07  ? 1953 ILE B CB  1 
ATOM   6840 C CG1 . ILE B 1 446 ? 59.212  -37.602 32.229 1.00 88.09  ? 1953 ILE B CG1 1 
ATOM   6841 C CG2 . ILE B 1 446 ? 60.830  -35.710 32.603 1.00 88.28  ? 1953 ILE B CG2 1 
ATOM   6842 C CD1 . ILE B 1 446 ? 60.060  -38.583 31.453 1.00 88.46  ? 1953 ILE B CD1 1 
ATOM   6843 N N   . ILE B 1 447 ? 58.806  -32.977 33.173 1.00 91.05  ? 1954 ILE B N   1 
ATOM   6844 C CA  . ILE B 1 447 ? 59.230  -31.581 33.075 1.00 91.05  ? 1954 ILE B CA  1 
ATOM   6845 C C   . ILE B 1 447 ? 60.719  -31.435 33.403 1.00 91.34  ? 1954 ILE B C   1 
ATOM   6846 O O   . ILE B 1 447 ? 61.100  -31.216 34.557 1.00 91.32  ? 1954 ILE B O   1 
ATOM   6847 C CB  . ILE B 1 447 ? 58.349  -30.622 33.931 1.00 90.74  ? 1954 ILE B CB  1 
ATOM   6848 C CG1 . ILE B 1 447 ? 58.189  -31.142 35.367 1.00 90.63  ? 1954 ILE B CG1 1 
ATOM   6849 C CG2 . ILE B 1 447 ? 56.987  -30.431 33.270 1.00 90.51  ? 1954 ILE B CG2 1 
ATOM   6850 C CD1 . ILE B 1 447 ? 57.871  -30.063 36.390 1.00 90.43  ? 1954 ILE B CD1 1 
ATOM   6851 N N   . PHE B 1 448 ? 61.550  -31.577 32.371 1.00 94.41  ? 1955 PHE B N   1 
ATOM   6852 C CA  . PHE B 1 448 ? 63.002  -31.477 32.509 1.00 94.74  ? 1955 PHE B CA  1 
ATOM   6853 C C   . PHE B 1 448 ? 63.423  -30.111 33.038 1.00 94.70  ? 1955 PHE B C   1 
ATOM   6854 O O   . PHE B 1 448 ? 62.969  -29.077 32.544 1.00 94.57  ? 1955 PHE B O   1 
ATOM   6855 C CB  . PHE B 1 448 ? 63.700  -31.763 31.175 1.00 95.07  ? 1955 PHE B CB  1 
ATOM   6856 C CG  . PHE B 1 448 ? 63.654  -33.207 30.758 1.00 95.22  ? 1955 PHE B CG  1 
ATOM   6857 C CD1 . PHE B 1 448 ? 64.355  -34.175 31.471 1.00 95.39  ? 1955 PHE B CD1 1 
ATOM   6858 C CD2 . PHE B 1 448 ? 62.926  -33.598 29.640 1.00 95.21  ? 1955 PHE B CD2 1 
ATOM   6859 C CE1 . PHE B 1 448 ? 64.319  -35.512 31.085 1.00 95.54  ? 1955 PHE B CE1 1 
ATOM   6860 C CE2 . PHE B 1 448 ? 62.886  -34.933 29.245 1.00 95.37  ? 1955 PHE B CE2 1 
ATOM   6861 C CZ  . PHE B 1 448 ? 63.584  -35.891 29.970 1.00 95.52  ? 1955 PHE B CZ  1 
ATOM   6862 N N   . LYS B 1 449 ? 64.290  -30.119 34.048 1.00 102.73 ? 1956 LYS B N   1 
ATOM   6863 C CA  . LYS B 1 449 ? 64.720  -28.888 34.705 1.00 102.71 ? 1956 LYS B CA  1 
ATOM   6864 C C   . LYS B 1 449 ? 66.247  -28.779 34.769 1.00 103.10 ? 1956 LYS B C   1 
ATOM   6865 O O   . LYS B 1 449 ? 66.962  -29.757 34.529 1.00 103.38 ? 1956 LYS B O   1 
ATOM   6866 C CB  . LYS B 1 449 ? 64.095  -28.785 36.099 1.00 102.45 ? 1956 LYS B CB  1 
ATOM   6867 C CG  . LYS B 1 449 ? 63.414  -27.451 36.365 1.00 102.21 ? 1956 LYS B CG  1 
ATOM   6868 C CD  . LYS B 1 449 ? 62.291  -27.603 37.385 1.00 101.89 ? 1956 LYS B CD  1 
ATOM   6869 C CE  . LYS B 1 449 ? 61.265  -26.480 37.271 1.00 101.64 ? 1956 LYS B CE  1 
ATOM   6870 N NZ  . LYS B 1 449 ? 61.804  -25.154 37.684 1.00 101.71 ? 1956 LYS B NZ  1 
ATOM   6871 N N   . CYS B 1 450 ? 66.732  -27.585 35.100 1.00 114.48 ? 1957 CYS B N   1 
ATOM   6872 C CA  . CYS B 1 450 ? 68.151  -27.259 34.986 1.00 114.86 ? 1957 CYS B CA  1 
ATOM   6873 C C   . CYS B 1 450 ? 68.972  -27.565 36.238 1.00 115.03 ? 1957 CYS B C   1 
ATOM   6874 O O   . CYS B 1 450 ? 68.591  -27.192 37.350 1.00 114.83 ? 1957 CYS B O   1 
ATOM   6875 C CB  . CYS B 1 450 ? 68.317  -25.786 34.601 1.00 114.83 ? 1957 CYS B CB  1 
ATOM   6876 S SG  . CYS B 1 450 ? 69.971  -25.350 34.033 1.00 115.31 ? 1957 CYS B SG  1 
ATOM   6877 N N   . ASP B 1 451 ? 70.098  -28.250 36.035 1.00 125.53 ? 1958 ASP B N   1 
ATOM   6878 C CA  . ASP B 1 451 ? 71.094  -28.495 37.082 1.00 125.79 ? 1958 ASP B CA  1 
ATOM   6879 C C   . ASP B 1 451 ? 72.444  -28.807 36.438 1.00 126.27 ? 1958 ASP B C   1 
ATOM   6880 O O   . ASP B 1 451 ? 72.565  -29.758 35.666 1.00 126.43 ? 1958 ASP B O   1 
ATOM   6881 C CB  . ASP B 1 451 ? 70.661  -29.637 38.009 1.00 125.70 ? 1958 ASP B CB  1 
ATOM   6882 C CG  . ASP B 1 451 ? 71.391  -29.619 39.345 1.00 125.87 ? 1958 ASP B CG  1 
ATOM   6883 O OD1 . ASP B 1 451 ? 72.633  -29.764 39.362 1.00 126.27 ? 1958 ASP B OD1 1 
ATOM   6884 O OD2 . ASP B 1 451 ? 70.717  -29.474 40.386 1.00 125.63 ? 1958 ASP B OD2 1 
ATOM   6885 N N   . GLU B 1 452 ? 73.451  -28.004 36.770 1.00 141.10 ? 1959 GLU B N   1 
ATOM   6886 C CA  . GLU B 1 452 ? 74.761  -28.065 36.112 1.00 141.57 ? 1959 GLU B CA  1 
ATOM   6887 C C   . GLU B 1 452 ? 75.605  -29.284 36.493 1.00 141.95 ? 1959 GLU B C   1 
ATOM   6888 O O   . GLU B 1 452 ? 76.331  -29.825 35.656 1.00 142.31 ? 1959 GLU B O   1 
ATOM   6889 C CB  . GLU B 1 452 ? 75.556  -26.780 36.382 1.00 141.71 ? 1959 GLU B CB  1 
ATOM   6890 C CG  . GLU B 1 452 ? 74.852  -25.485 35.969 1.00 141.39 ? 1959 GLU B CG  1 
ATOM   6891 C CD  . GLU B 1 452 ? 74.864  -25.231 34.467 1.00 141.50 ? 1959 GLU B CD  1 
ATOM   6892 O OE1 . GLU B 1 452 ? 75.449  -26.036 33.710 1.00 141.77 ? 1959 GLU B OE1 1 
ATOM   6893 O OE2 . GLU B 1 452 ? 74.283  -24.210 34.042 1.00 141.35 ? 1959 GLU B OE2 1 
ATOM   6894 N N   . ASP B 1 453 ? 75.506  -29.707 37.751 1.00 147.40 ? 1960 ASP B N   1 
ATOM   6895 C CA  . ASP B 1 453 ? 76.342  -30.786 38.285 1.00 147.76 ? 1960 ASP B CA  1 
ATOM   6896 C C   . ASP B 1 453 ? 75.816  -32.184 37.957 1.00 147.72 ? 1960 ASP B C   1 
ATOM   6897 O O   . ASP B 1 453 ? 76.581  -33.151 37.941 1.00 148.08 ? 1960 ASP B O   1 
ATOM   6898 C CB  . ASP B 1 453 ? 76.510  -30.630 39.800 1.00 147.75 ? 1960 ASP B CB  1 
ATOM   6899 C CG  . ASP B 1 453 ? 77.111  -29.288 40.188 1.00 147.86 ? 1960 ASP B CG  1 
ATOM   6900 O OD1 . ASP B 1 453 ? 78.023  -28.805 39.482 1.00 148.15 ? 1960 ASP B OD1 1 
ATOM   6901 O OD2 . ASP B 1 453 ? 76.670  -28.718 41.207 1.00 147.67 ? 1960 ASP B OD2 1 
ATOM   6902 N N   . GLU B 1 454 ? 74.513  -32.280 37.700 1.00 129.52 ? 1961 GLU B N   1 
ATOM   6903 C CA  . GLU B 1 454 ? 73.873  -33.550 37.363 1.00 129.43 ? 1961 GLU B CA  1 
ATOM   6904 C C   . GLU B 1 454 ? 74.226  -33.966 35.933 1.00 129.67 ? 1961 GLU B C   1 
ATOM   6905 O O   . GLU B 1 454 ? 73.467  -33.706 34.995 1.00 129.45 ? 1961 GLU B O   1 
ATOM   6906 C CB  . GLU B 1 454 ? 72.351  -33.454 37.536 1.00 128.91 ? 1961 GLU B CB  1 
ATOM   6907 C CG  . GLU B 1 454 ? 71.882  -33.064 38.937 1.00 128.67 ? 1961 GLU B CG  1 
ATOM   6908 C CD  . GLU B 1 454 ? 71.824  -34.235 39.900 1.00 128.69 ? 1961 GLU B CD  1 
ATOM   6909 O OE1 . GLU B 1 454 ? 71.085  -35.204 39.624 1.00 128.51 ? 1961 GLU B OE1 1 
ATOM   6910 O OE2 . GLU B 1 454 ? 72.505  -34.177 40.945 1.00 128.91 ? 1961 GLU B OE2 1 
ATOM   6911 N N   . ASP B 1 455 ? 75.388  -34.603 35.782 1.00 134.89 ? 1962 ASP B N   1 
ATOM   6912 C CA  . ASP B 1 455 ? 75.871  -35.078 34.484 1.00 135.20 ? 1962 ASP B CA  1 
ATOM   6913 C C   . ASP B 1 455 ? 74.858  -36.042 33.863 1.00 134.99 ? 1962 ASP B C   1 
ATOM   6914 O O   . ASP B 1 455 ? 74.340  -35.792 32.772 1.00 134.88 ? 1962 ASP B O   1 
ATOM   6915 C CB  . ASP B 1 455 ? 77.244  -35.748 34.640 1.00 135.76 ? 1962 ASP B CB  1 
ATOM   6916 C CG  . ASP B 1 455 ? 78.018  -35.829 33.330 1.00 136.17 ? 1962 ASP B CG  1 
ATOM   6917 O OD1 . ASP B 1 455 ? 77.905  -34.904 32.497 1.00 136.11 ? 1962 ASP B OD1 1 
ATOM   6918 O OD2 . ASP B 1 455 ? 78.758  -36.818 33.143 1.00 136.58 ? 1962 ASP B OD2 1 
ATOM   6919 N N   . ILE B 1 456 ? 74.580  -37.135 34.572 1.00 122.11 ? 1963 ILE B N   1 
ATOM   6920 C CA  . ILE B 1 456 ? 73.480  -38.036 34.237 1.00 121.85 ? 1963 ILE B CA  1 
ATOM   6921 C C   . ILE B 1 456 ? 72.569  -38.120 35.464 1.00 121.46 ? 1963 ILE B C   1 
ATOM   6922 O O   . ILE B 1 456 ? 72.804  -38.918 36.376 1.00 121.56 ? 1963 ILE B O   1 
ATOM   6923 C CB  . ILE B 1 456 ? 73.974  -39.447 33.807 1.00 122.20 ? 1963 ILE B CB  1 
ATOM   6924 C CG1 . ILE B 1 456 ? 75.029  -39.342 32.696 1.00 122.65 ? 1963 ILE B CG1 1 
ATOM   6925 C CG2 . ILE B 1 456 ? 72.795  -40.315 33.352 1.00 121.92 ? 1963 ILE B CG2 1 
ATOM   6926 C CD1 . ILE B 1 456 ? 75.933  -40.560 32.565 1.00 123.14 ? 1963 ILE B CD1 1 
ATOM   6927 N N   . GLY B 1 457 ? 71.540  -37.276 35.480 1.00 112.65 ? 1964 GLY B N   1 
ATOM   6928 C CA  . GLY B 1 457 ? 70.672  -37.113 36.648 1.00 112.28 ? 1964 GLY B CA  1 
ATOM   6929 C C   . GLY B 1 457 ? 69.663  -38.222 36.877 1.00 112.06 ? 1964 GLY B C   1 
ATOM   6930 O O   . GLY B 1 457 ? 69.653  -39.228 36.162 1.00 112.21 ? 1964 GLY B O   1 
ATOM   6931 N N   . ARG B 1 458 ? 68.810  -38.029 37.883 1.00 104.23 ? 1965 ARG B N   1 
ATOM   6932 C CA  . ARG B 1 458 ? 67.784  -39.005 38.245 1.00 103.99 ? 1965 ARG B CA  1 
ATOM   6933 C C   . ARG B 1 458 ? 66.382  -38.388 38.255 1.00 103.53 ? 1965 ARG B C   1 
ATOM   6934 O O   . ARG B 1 458 ? 66.172  -37.338 38.870 1.00 103.36 ? 1965 ARG B O   1 
ATOM   6935 C CB  . ARG B 1 458 ? 68.099  -39.641 39.606 1.00 104.08 ? 1965 ARG B CB  1 
ATOM   6936 C CG  . ARG B 1 458 ? 67.074  -40.673 40.083 1.00 103.87 ? 1965 ARG B CG  1 
ATOM   6937 C CD  . ARG B 1 458 ? 67.598  -41.510 41.241 1.00 104.05 ? 1965 ARG B CD  1 
ATOM   6938 N NE  . ARG B 1 458 ? 68.666  -42.417 40.821 1.00 104.49 ? 1965 ARG B NE  1 
ATOM   6939 C CZ  . ARG B 1 458 ? 68.479  -43.664 40.394 1.00 104.59 ? 1965 ARG B CZ  1 
ATOM   6940 N NH1 . ARG B 1 458 ? 67.258  -44.180 40.326 1.00 104.28 ? 1965 ARG B NH1 1 
ATOM   6941 N NH2 . ARG B 1 458 ? 69.520  -44.402 40.034 1.00 105.01 ? 1965 ARG B NH2 1 
ATOM   6942 N N   . PRO B 1 459 ? 65.422  -39.038 37.565 1.00 94.44  ? 1966 PRO B N   1 
ATOM   6943 C CA  . PRO B 1 459 ? 64.016  -38.626 37.589 1.00 94.02  ? 1966 PRO B CA  1 
ATOM   6944 C C   . PRO B 1 459 ? 63.338  -38.932 38.925 1.00 93.82  ? 1966 PRO B C   1 
ATOM   6945 O O   . PRO B 1 459 ? 63.577  -39.988 39.514 1.00 93.95  ? 1966 PRO B O   1 
ATOM   6946 C CB  . PRO B 1 459 ? 63.384  -39.464 36.476 1.00 94.00  ? 1966 PRO B CB  1 
ATOM   6947 C CG  . PRO B 1 459 ? 64.260  -40.657 36.345 1.00 94.34  ? 1966 PRO B CG  1 
ATOM   6948 C CD  . PRO B 1 459 ? 65.642  -40.210 36.694 1.00 94.66  ? 1966 PRO B CD  1 
ATOM   6949 N N   . GLN B 1 460 ? 62.504  -38.003 39.390 1.00 93.35  ? 1967 GLN B N   1 
ATOM   6950 C CA  . GLN B 1 460 ? 61.740  -38.175 40.629 1.00 93.15  ? 1967 GLN B CA  1 
ATOM   6951 C C   . GLN B 1 460 ? 60.265  -37.836 40.401 1.00 92.77  ? 1967 GLN B C   1 
ATOM   6952 O O   . GLN B 1 460 ? 59.943  -36.998 39.556 1.00 92.66  ? 1967 GLN B O   1 
ATOM   6953 C CB  . GLN B 1 460 ? 62.316  -37.305 41.755 1.00 93.21  ? 1967 GLN B CB  1 
ATOM   6954 C CG  . GLN B 1 460 ? 63.772  -37.598 42.136 1.00 93.60  ? 1967 GLN B CG  1 
ATOM   6955 C CD  . GLN B 1 460 ? 63.939  -38.872 42.950 1.00 93.73  ? 1967 GLN B CD  1 
ATOM   6956 O OE1 . GLN B 1 460 ? 63.857  -39.981 42.420 1.00 93.78  ? 1967 GLN B OE1 1 
ATOM   6957 N NE2 . GLN B 1 460 ? 64.192  -38.715 44.244 1.00 93.80  ? 1967 GLN B NE2 1 
ATOM   6958 N N   . VAL B 1 461 ? 59.378  -38.489 41.152 1.00 89.08  ? 1968 VAL B N   1 
ATOM   6959 C CA  . VAL B 1 461 ? 57.935  -38.251 41.037 1.00 88.75  ? 1968 VAL B CA  1 
ATOM   6960 C C   . VAL B 1 461 ? 57.574  -36.878 41.599 1.00 88.57  ? 1968 VAL B C   1 
ATOM   6961 O O   . VAL B 1 461 ? 57.866  -36.579 42.758 1.00 88.61  ? 1968 VAL B O   1 
ATOM   6962 C CB  . VAL B 1 461 ? 57.101  -39.339 41.761 1.00 88.65  ? 1968 VAL B CB  1 
ATOM   6963 C CG1 . VAL B 1 461 ? 55.606  -39.049 41.645 1.00 88.33  ? 1968 VAL B CG1 1 
ATOM   6964 C CG2 . VAL B 1 461 ? 57.411  -40.718 41.210 1.00 88.83  ? 1968 VAL B CG2 1 
ATOM   6965 N N   . PHE B 1 462 ? 56.946  -36.050 40.768 1.00 88.82  ? 1969 PHE B N   1 
ATOM   6966 C CA  . PHE B 1 462 ? 56.532  -34.712 41.181 1.00 88.64  ? 1969 PHE B CA  1 
ATOM   6967 C C   . PHE B 1 462 ? 55.103  -34.706 41.717 1.00 88.37  ? 1969 PHE B C   1 
ATOM   6968 O O   . PHE B 1 462 ? 54.856  -34.203 42.815 1.00 88.30  ? 1969 PHE B O   1 
ATOM   6969 C CB  . PHE B 1 462 ? 56.698  -33.704 40.036 1.00 88.63  ? 1969 PHE B CB  1 
ATOM   6970 C CG  . PHE B 1 462 ? 56.327  -32.291 40.404 1.00 88.47  ? 1969 PHE B CG  1 
ATOM   6971 C CD1 . PHE B 1 462 ? 56.949  -31.644 41.471 1.00 88.54  ? 1969 PHE B CD1 1 
ATOM   6972 C CD2 . PHE B 1 462 ? 55.364  -31.601 39.675 1.00 88.28  ? 1969 PHE B CD2 1 
ATOM   6973 C CE1 . PHE B 1 462 ? 56.608  -30.337 41.813 1.00 88.40  ? 1969 PHE B CE1 1 
ATOM   6974 C CE2 . PHE B 1 462 ? 55.018  -30.293 40.007 1.00 88.15  ? 1969 PHE B CE2 1 
ATOM   6975 C CZ  . PHE B 1 462 ? 55.641  -29.660 41.078 1.00 88.20  ? 1969 PHE B CZ  1 
ATOM   6976 N N   . SER B 1 463 ? 54.173  -35.266 40.944 1.00 86.40  ? 1970 SER B N   1 
ATOM   6977 C CA  . SER B 1 463 ? 52.767  -35.349 41.352 1.00 86.16  ? 1970 SER B CA  1 
ATOM   6978 C C   . SER B 1 463 ? 52.008  -36.489 40.674 1.00 86.11  ? 1970 SER B C   1 
ATOM   6979 O O   . SER B 1 463 ? 52.129  -36.703 39.465 1.00 86.16  ? 1970 SER B O   1 
ATOM   6980 C CB  . SER B 1 463 ? 52.045  -34.018 41.103 1.00 85.97  ? 1970 SER B CB  1 
ATOM   6981 O OG  . SER B 1 463 ? 52.130  -33.633 39.742 1.00 85.99  ? 1970 SER B OG  1 
ATOM   6982 N N   . GLU B 1 464 ? 51.234  -37.219 41.474 1.00 82.96  ? 1971 GLU B N   1 
ATOM   6983 C CA  . GLU B 1 464 ? 50.330  -38.249 40.975 1.00 82.89  ? 1971 GLU B CA  1 
ATOM   6984 C C   . GLU B 1 464 ? 48.898  -37.764 41.160 1.00 82.65  ? 1971 GLU B C   1 
ATOM   6985 O O   . GLU B 1 464 ? 48.497  -37.411 42.272 1.00 82.57  ? 1971 GLU B O   1 
ATOM   6986 C CB  . GLU B 1 464 ? 50.530  -39.565 41.731 1.00 82.98  ? 1971 GLU B CB  1 
ATOM   6987 C CG  . GLU B 1 464 ? 51.874  -40.247 41.508 1.00 83.24  ? 1971 GLU B CG  1 
ATOM   6988 C CD  . GLU B 1 464 ? 52.166  -41.316 42.552 1.00 83.36  ? 1971 GLU B CD  1 
ATOM   6989 O OE1 . GLU B 1 464 ? 51.973  -41.049 43.759 1.00 83.32  ? 1971 GLU B OE1 1 
ATOM   6990 O OE2 . GLU B 1 464 ? 52.598  -42.422 42.170 1.00 83.50  ? 1971 GLU B OE2 1 
ATOM   6991 N N   . VAL B 1 465 ? 48.135  -37.734 40.070 1.00 81.23  ? 1972 VAL B N   1 
ATOM   6992 C CA  . VAL B 1 465 ? 46.748  -37.273 40.116 1.00 81.03  ? 1972 VAL B CA  1 
ATOM   6993 C C   . VAL B 1 465 ? 45.780  -38.398 39.739 1.00 80.98  ? 1972 VAL B C   1 
ATOM   6994 O O   . VAL B 1 465 ? 45.659  -38.761 38.566 1.00 81.02  ? 1972 VAL B O   1 
ATOM   6995 C CB  . VAL B 1 465 ? 46.513  -36.024 39.218 1.00 80.96  ? 1972 VAL B CB  1 
ATOM   6996 C CG1 . VAL B 1 465 ? 45.104  -35.474 39.419 1.00 80.78  ? 1972 VAL B CG1 1 
ATOM   6997 C CG2 . VAL B 1 465 ? 47.546  -34.938 39.508 1.00 81.03  ? 1972 VAL B CG2 1 
ATOM   6998 N N   . ARG B 1 466 ? 45.112  -38.947 40.755 1.00 77.37  ? 1973 ARG B N   1 
ATOM   6999 C CA  . ARG B 1 466 ? 44.068  -39.983 40.609 1.00 77.32  ? 1973 ARG B CA  1 
ATOM   7000 C C   . ARG B 1 466 ? 44.523  -41.296 39.948 1.00 77.44  ? 1973 ARG B C   1 
ATOM   7001 O O   . ARG B 1 466 ? 43.734  -42.238 39.830 1.00 77.41  ? 1973 ARG B O   1 
ATOM   7002 C CB  . ARG B 1 466 ? 42.830  -39.435 39.876 1.00 77.19  ? 1973 ARG B CB  1 
ATOM   7003 C CG  . ARG B 1 466 ? 42.311  -38.092 40.374 1.00 77.07  ? 1973 ARG B CG  1 
ATOM   7004 C CD  . ARG B 1 466 ? 41.052  -37.688 39.623 1.00 76.97  ? 1973 ARG B CD  1 
ATOM   7005 N NE  . ARG B 1 466 ? 41.022  -36.255 39.331 1.00 76.92  ? 1973 ARG B NE  1 
ATOM   7006 C CZ  . ARG B 1 466 ? 41.298  -35.719 38.144 1.00 76.96  ? 1973 ARG B CZ  1 
ATOM   7007 N NH1 . ARG B 1 466 ? 41.622  -36.491 37.113 1.00 77.06  ? 1973 ARG B NH1 1 
ATOM   7008 N NH2 . ARG B 1 466 ? 41.245  -34.404 37.983 1.00 76.91  ? 1973 ARG B NH2 1 
ATOM   7009 N N   . GLY B 1 467 ? 45.784  -41.358 39.527 1.00 74.56  ? 1974 GLY B N   1 
ATOM   7010 C CA  . GLY B 1 467 ? 46.290  -42.495 38.756 1.00 74.71  ? 1974 GLY B CA  1 
ATOM   7011 C C   . GLY B 1 467 ? 45.914  -42.377 37.290 1.00 74.73  ? 1974 GLY B C   1 
ATOM   7012 O O   . GLY B 1 467 ? 46.149  -43.293 36.498 1.00 74.86  ? 1974 GLY B O   1 
ATOM   7013 N N   . CYS B 1 468 ? 45.324  -41.235 36.942 1.00 74.41  ? 1975 CYS B N   1 
ATOM   7014 C CA  . CYS B 1 468 ? 44.904  -40.918 35.583 1.00 74.42  ? 1975 CYS B CA  1 
ATOM   7015 C C   . CYS B 1 468 ? 45.967  -40.050 34.901 1.00 74.55  ? 1975 CYS B C   1 
ATOM   7016 O O   . CYS B 1 468 ? 45.909  -39.814 33.691 1.00 74.61  ? 1975 CYS B O   1 
ATOM   7017 C CB  . CYS B 1 468 ? 43.554  -40.193 35.628 1.00 74.24  ? 1975 CYS B CB  1 
ATOM   7018 S SG  . CYS B 1 468 ? 42.596  -40.123 34.085 1.00 74.25  ? 1975 CYS B SG  1 
ATOM   7019 N N   . ASP B 1 469 ? 46.939  -39.594 35.693 1.00 77.06  ? 1976 ASP B N   1 
ATOM   7020 C CA  . ASP B 1 469 ? 48.055  -38.772 35.218 1.00 77.19  ? 1976 ASP B CA  1 
ATOM   7021 C C   . ASP B 1 469 ? 49.227  -38.799 36.202 1.00 77.29  ? 1976 ASP B C   1 
ATOM   7022 O O   . ASP B 1 469 ? 49.029  -38.711 37.417 1.00 77.20  ? 1976 ASP B O   1 
ATOM   7023 C CB  . ASP B 1 469 ? 47.601  -37.323 34.994 1.00 77.06  ? 1976 ASP B CB  1 
ATOM   7024 C CG  . ASP B 1 469 ? 48.743  -36.401 34.592 1.00 77.19  ? 1976 ASP B CG  1 
ATOM   7025 O OD1 . ASP B 1 469 ? 49.520  -36.760 33.680 1.00 77.39  ? 1976 ASP B OD1 1 
ATOM   7026 O OD2 . ASP B 1 469 ? 48.860  -35.311 35.189 1.00 77.11  ? 1976 ASP B OD2 1 
ATOM   7027 N N   . VAL B 1 470 ? 50.442  -38.924 35.671 1.00 79.79  ? 1977 VAL B N   1 
ATOM   7028 C CA  . VAL B 1 470 ? 51.664  -38.833 36.477 1.00 79.92  ? 1977 VAL B CA  1 
ATOM   7029 C C   . VAL B 1 470 ? 52.568  -37.729 35.924 1.00 80.03  ? 1977 VAL B C   1 
ATOM   7030 O O   . VAL B 1 470 ? 52.633  -37.522 34.713 1.00 80.09  ? 1977 VAL B O   1 
ATOM   7031 C CB  . VAL B 1 470 ? 52.443  -40.178 36.527 1.00 80.14  ? 1977 VAL B CB  1 
ATOM   7032 C CG1 . VAL B 1 470 ? 53.633  -40.085 37.476 1.00 80.28  ? 1977 VAL B CG1 1 
ATOM   7033 C CG2 . VAL B 1 470 ? 51.539  -41.311 36.967 1.00 80.05  ? 1977 VAL B CG2 1 
ATOM   7034 N N   . THR B 1 471 ? 53.255  -37.023 36.819 1.00 82.75  ? 1978 THR B N   1 
ATOM   7035 C CA  . THR B 1 471 ? 54.207  -35.991 36.423 1.00 82.88  ? 1978 THR B CA  1 
ATOM   7036 C C   . THR B 1 471 ? 55.564  -36.238 37.083 1.00 83.11  ? 1978 THR B C   1 
ATOM   7037 O O   . THR B 1 471 ? 55.659  -36.334 38.309 1.00 83.07  ? 1978 THR B O   1 
ATOM   7038 C CB  . THR B 1 471 ? 53.689  -34.574 36.771 1.00 82.68  ? 1978 THR B CB  1 
ATOM   7039 O OG1 . THR B 1 471 ? 52.333  -34.436 36.329 1.00 82.47  ? 1978 THR B OG1 1 
ATOM   7040 C CG2 . THR B 1 471 ? 54.545  -33.501 36.104 1.00 82.80  ? 1978 THR B CG2 1 
ATOM   7041 N N   . PHE B 1 472 ? 56.604  -36.354 36.260 1.00 85.87  ? 1979 PHE B N   1 
ATOM   7042 C CA  . PHE B 1 472 ? 57.967  -36.559 36.750 1.00 86.13  ? 1979 PHE B CA  1 
ATOM   7043 C C   . PHE B 1 472 ? 58.800  -35.286 36.647 1.00 86.23  ? 1979 PHE B C   1 
ATOM   7044 O O   . PHE B 1 472 ? 58.625  -34.493 35.719 1.00 86.19  ? 1979 PHE B O   1 
ATOM   7045 C CB  . PHE B 1 472 ? 58.658  -37.686 35.976 1.00 86.41  ? 1979 PHE B CB  1 
ATOM   7046 C CG  . PHE B 1 472 ? 58.078  -39.046 36.229 1.00 86.37  ? 1979 PHE B CG  1 
ATOM   7047 C CD1 . PHE B 1 472 ? 57.162  -39.599 35.342 1.00 86.28  ? 1979 PHE B CD1 1 
ATOM   7048 C CD2 . PHE B 1 472 ? 58.450  -39.778 37.352 1.00 86.44  ? 1979 PHE B CD2 1 
ATOM   7049 C CE1 . PHE B 1 472 ? 56.622  -40.861 35.569 1.00 86.25  ? 1979 PHE B CE1 1 
ATOM   7050 C CE2 . PHE B 1 472 ? 57.915  -41.042 37.590 1.00 86.41  ? 1979 PHE B CE2 1 
ATOM   7051 C CZ  . PHE B 1 472 ? 56.997  -41.583 36.697 1.00 86.31  ? 1979 PHE B CZ  1 
ATOM   7052 N N   . GLU B 1 473 ? 59.702  -35.099 37.607 1.00 91.62  ? 1980 GLU B N   1 
ATOM   7053 C CA  . GLU B 1 473 ? 60.656  -33.996 37.573 1.00 91.76  ? 1980 GLU B CA  1 
ATOM   7054 C C   . GLU B 1 473 ? 62.079  -34.541 37.471 1.00 92.13  ? 1980 GLU B C   1 
ATOM   7055 O O   . GLU B 1 473 ? 62.656  -34.996 38.462 1.00 92.26  ? 1980 GLU B O   1 
ATOM   7056 C CB  . GLU B 1 473 ? 60.501  -33.095 38.802 1.00 91.61  ? 1980 GLU B CB  1 
ATOM   7057 C CG  . GLU B 1 473 ? 61.243  -31.767 38.694 1.00 91.69  ? 1980 GLU B CG  1 
ATOM   7058 C CD  . GLU B 1 473 ? 61.203  -30.956 39.977 1.00 91.56  ? 1980 GLU B CD  1 
ATOM   7059 O OE1 . GLU B 1 473 ? 61.453  -31.526 41.061 1.00 91.58  ? 1980 GLU B OE1 1 
ATOM   7060 O OE2 . GLU B 1 473 ? 60.933  -29.739 39.897 1.00 91.46  ? 1980 GLU B OE2 1 
ATOM   7061 N N   . TRP B 1 474 ? 62.628  -34.501 36.260 1.00 94.71  ? 1981 TRP B N   1 
ATOM   7062 C CA  . TRP B 1 474 ? 63.979  -34.978 35.992 1.00 95.11  ? 1981 TRP B CA  1 
ATOM   7063 C C   . TRP B 1 474 ? 64.928  -33.791 35.862 1.00 95.27  ? 1981 TRP B C   1 
ATOM   7064 O O   . TRP B 1 474 ? 64.734  -32.925 35.006 1.00 95.23  ? 1981 TRP B O   1 
ATOM   7065 C CB  . TRP B 1 474 ? 64.004  -35.810 34.704 1.00 95.26  ? 1981 TRP B CB  1 
ATOM   7066 C CG  . TRP B 1 474 ? 65.244  -36.649 34.511 1.00 95.68  ? 1981 TRP B CG  1 
ATOM   7067 C CD1 . TRP B 1 474 ? 66.515  -36.352 34.919 1.00 95.98  ? 1981 TRP B CD1 1 
ATOM   7068 C CD2 . TRP B 1 474 ? 65.330  -37.910 33.833 1.00 95.87  ? 1981 TRP B CD2 1 
ATOM   7069 N NE1 . TRP B 1 474 ? 67.379  -37.354 34.555 1.00 96.34  ? 1981 TRP B NE1 1 
ATOM   7070 C CE2 . TRP B 1 474 ? 66.679  -38.321 33.884 1.00 96.28  ? 1981 TRP B CE2 1 
ATOM   7071 C CE3 . TRP B 1 474 ? 64.396  -38.733 33.192 1.00 95.75  ? 1981 TRP B CE3 1 
ATOM   7072 C CZ2 . TRP B 1 474 ? 67.118  -39.523 33.322 1.00 96.58  ? 1981 TRP B CZ2 1 
ATOM   7073 C CZ3 . TRP B 1 474 ? 64.834  -39.929 32.635 1.00 96.03  ? 1981 TRP B CZ3 1 
ATOM   7074 C CH2 . TRP B 1 474 ? 66.183  -40.309 32.701 1.00 96.44  ? 1981 TRP B CH2 1 
ATOM   7075 N N   . LYS B 1 475 ? 65.949  -33.757 36.715 1.00 104.13 ? 1982 LYS B N   1 
ATOM   7076 C CA  . LYS B 1 475 ? 66.957  -32.700 36.672 1.00 104.33 ? 1982 LYS B CA  1 
ATOM   7077 C C   . LYS B 1 475 ? 68.257  -33.195 36.038 1.00 104.78 ? 1982 LYS B C   1 
ATOM   7078 O O   . LYS B 1 475 ? 68.914  -34.097 36.564 1.00 105.01 ? 1982 LYS B O   1 
ATOM   7079 C CB  . LYS B 1 475 ? 67.207  -32.126 38.071 1.00 104.29 ? 1982 LYS B CB  1 
ATOM   7080 C CG  . LYS B 1 475 ? 66.085  -31.228 38.570 1.00 103.90 ? 1982 LYS B CG  1 
ATOM   7081 C CD  . LYS B 1 475 ? 66.280  -30.829 40.020 1.00 103.88 ? 1982 LYS B CD  1 
ATOM   7082 C CE  . LYS B 1 475 ? 65.099  -30.009 40.514 1.00 103.50 ? 1982 LYS B CE  1 
ATOM   7083 N NZ  . LYS B 1 475 ? 65.194  -29.699 41.966 1.00 103.49 ? 1982 LYS B NZ  1 
ATOM   7084 N N   . THR B 1 476 ? 68.608  -32.601 34.899 1.00 109.63 ? 1983 THR B N   1 
ATOM   7085 C CA  . THR B 1 476 ? 69.817  -32.966 34.158 1.00 110.08 ? 1983 THR B CA  1 
ATOM   7086 C C   . THR B 1 476 ? 70.601  -31.749 33.667 1.00 110.26 ? 1983 THR B C   1 
ATOM   7087 O O   . THR B 1 476 ? 70.102  -30.620 33.696 1.00 110.01 ? 1983 THR B O   1 
ATOM   7088 C CB  . THR B 1 476 ? 69.505  -33.891 32.958 1.00 110.18 ? 1983 THR B CB  1 
ATOM   7089 O OG1 . THR B 1 476 ? 68.166  -33.663 32.503 1.00 109.80 ? 1983 THR B OG1 1 
ATOM   7090 C CG2 . THR B 1 476 ? 69.658  -35.345 33.354 1.00 110.33 ? 1983 THR B CG2 1 
ATOM   7091 N N   . LYS B 1 477 ? 71.829  -31.998 33.217 1.00 121.10 ? 1984 LYS B N   1 
ATOM   7092 C CA  . LYS B 1 477 ? 72.728  -30.952 32.735 1.00 121.34 ? 1984 LYS B CA  1 
ATOM   7093 C C   . LYS B 1 477 ? 72.388  -30.491 31.318 1.00 121.34 ? 1984 LYS B C   1 
ATOM   7094 O O   . LYS B 1 477 ? 72.557  -29.315 30.988 1.00 121.34 ? 1984 LYS B O   1 
ATOM   7095 C CB  . LYS B 1 477 ? 74.181  -31.441 32.786 1.00 121.86 ? 1984 LYS B CB  1 
ATOM   7096 C CG  . LYS B 1 477 ? 75.223  -30.379 32.462 1.00 122.15 ? 1984 LYS B CG  1 
ATOM   7097 C CD  . LYS B 1 477 ? 76.513  -31.006 31.965 1.00 122.71 ? 1984 LYS B CD  1 
ATOM   7098 C CE  . LYS B 1 477 ? 77.429  -29.959 31.356 1.00 123.02 ? 1984 LYS B CE  1 
ATOM   7099 N NZ  . LYS B 1 477 ? 78.638  -30.571 30.741 1.00 123.59 ? 1984 LYS B NZ  1 
ATOM   7100 N N   . VAL B 1 478 ? 71.899  -31.418 30.496 1.00 118.34 ? 1985 VAL B N   1 
ATOM   7101 C CA  . VAL B 1 478 ? 71.772  -31.204 29.047 1.00 118.46 ? 1985 VAL B CA  1 
ATOM   7102 C C   . VAL B 1 478 ? 70.738  -30.138 28.643 1.00 118.10 ? 1985 VAL B C   1 
ATOM   7103 O O   . VAL B 1 478 ? 70.853  -29.532 27.574 1.00 118.24 ? 1985 VAL B O   1 
ATOM   7104 C CB  . VAL B 1 478 ? 71.491  -32.530 28.286 1.00 118.60 ? 1985 VAL B CB  1 
ATOM   7105 C CG1 . VAL B 1 478 ? 72.102  -32.477 26.893 1.00 119.00 ? 1985 VAL B CG1 1 
ATOM   7106 C CG2 . VAL B 1 478 ? 72.049  -33.729 29.046 1.00 118.78 ? 1985 VAL B CG2 1 
ATOM   7107 N N   . VAL B 1 479 ? 69.745  -29.907 29.499 1.00 112.16 ? 1986 VAL B N   1 
ATOM   7108 C CA  . VAL B 1 479 ? 68.666  -28.956 29.199 1.00 111.81 ? 1986 VAL B CA  1 
ATOM   7109 C C   . VAL B 1 479 ? 68.948  -27.529 29.693 1.00 111.72 ? 1986 VAL B C   1 
ATOM   7110 O O   . VAL B 1 479 ? 68.057  -26.853 30.217 1.00 111.35 ? 1986 VAL B O   1 
ATOM   7111 C CB  . VAL B 1 479 ? 67.294  -29.454 29.730 1.00 111.39 ? 1986 VAL B CB  1 
ATOM   7112 C CG1 . VAL B 1 479 ? 66.718  -30.514 28.804 1.00 111.43 ? 1986 VAL B CG1 1 
ATOM   7113 C CG2 . VAL B 1 479 ? 67.411  -29.980 31.162 1.00 111.28 ? 1986 VAL B CG2 1 
ATOM   7114 N N   . CYS B 1 480 ? 70.186  -27.073 29.508 1.00 123.81 ? 1987 CYS B N   1 
ATOM   7115 C CA  . CYS B 1 480 ? 70.607  -25.750 29.979 1.00 123.78 ? 1987 CYS B CA  1 
ATOM   7116 C C   . CYS B 1 480 ? 71.507  -24.961 29.008 1.00 124.11 ? 1987 CYS B C   1 
ATOM   7117 O O   . CYS B 1 480 ? 71.131  -23.859 28.607 1.00 123.97 ? 1987 CYS B O   1 
ATOM   7118 C CB  . CYS B 1 480 ? 71.289  -25.844 31.354 1.00 123.85 ? 1987 CYS B CB  1 
ATOM   7119 S SG  . CYS B 1 480 ? 70.375  -26.752 32.620 1.00 123.53 ? 1987 CYS B SG  1 
ATOM   7120 N N   . PRO B 1 481 ? 72.672  -25.534 28.609 1.00 139.65 ? 1988 PRO B N   1 
ATOM   7121 C CA  . PRO B 1 481 ? 73.831  -24.778 28.095 1.00 140.03 ? 1988 PRO B CA  1 
ATOM   7122 C C   . PRO B 1 481 ? 73.557  -23.672 27.063 1.00 140.00 ? 1988 PRO B C   1 
ATOM   7123 O O   . PRO B 1 481 ? 73.319  -23.971 25.889 1.00 140.14 ? 1988 PRO B O   1 
ATOM   7124 C CB  . PRO B 1 481 ? 74.716  -25.871 27.485 1.00 140.49 ? 1988 PRO B CB  1 
ATOM   7125 C CG  . PRO B 1 481 ? 74.417  -27.064 28.291 1.00 140.38 ? 1988 PRO B CG  1 
ATOM   7126 C CD  . PRO B 1 481 ? 72.943  -26.986 28.579 1.00 139.85 ? 1988 PRO B CD  1 
ATOM   7127 N N   . PRO B 1 482 ? 73.584  -22.399 27.508 1.00 153.66 ? 1989 PRO B N   1 
ATOM   7128 C CA  . PRO B 1 482 ? 73.588  -21.252 26.607 1.00 153.72 ? 1989 PRO B CA  1 
ATOM   7129 C C   . PRO B 1 482 ? 75.007  -20.717 26.369 1.00 154.18 ? 1989 PRO B C   1 
ATOM   7130 O O   . PRO B 1 482 ? 75.187  -19.754 25.618 1.00 154.30 ? 1989 PRO B O   1 
ATOM   7131 C CB  . PRO B 1 482 ? 72.755  -20.220 27.372 1.00 153.28 ? 1989 PRO B CB  1 
ATOM   7132 C CG  . PRO B 1 482 ? 72.888  -20.613 28.845 1.00 153.11 ? 1989 PRO B CG  1 
ATOM   7133 C CD  . PRO B 1 482 ? 73.566  -21.961 28.916 1.00 153.41 ? 1989 PRO B CD  1 
ATOM   7134 N N   . LYS B 1 483 ? 75.993  -21.347 27.008 1.00 178.86 ? 1990 LYS B N   1 
ATOM   7135 C CA  . LYS B 1 483 ? 77.393  -20.929 26.932 1.00 179.31 ? 1990 LYS B CA  1 
ATOM   7136 C C   . LYS B 1 483 ? 77.997  -21.222 25.563 1.00 179.76 ? 1990 LYS B C   1 
ATOM   7137 O O   . LYS B 1 483 ? 78.995  -20.615 25.173 1.00 180.14 ? 1990 LYS B O   1 
ATOM   7138 C CB  . LYS B 1 483 ? 78.220  -21.618 28.022 1.00 179.49 ? 1990 LYS B CB  1 
ATOM   7139 C CG  . LYS B 1 483 ? 77.992  -21.079 29.426 1.00 179.20 ? 1990 LYS B CG  1 
ATOM   7140 C CD  . LYS B 1 483 ? 78.941  -21.729 30.419 1.00 179.49 ? 1990 LYS B CD  1 
ATOM   7141 C CE  . LYS B 1 483 ? 78.831  -21.088 31.792 1.00 179.27 ? 1990 LYS B CE  1 
ATOM   7142 N NZ  . LYS B 1 483 ? 79.824  -21.654 32.746 1.00 179.60 ? 1990 LYS B NZ  1 
ATOM   7143 N N   . GLU C 2 6   ? -6.542  -63.547 44.506 1.00 83.97  ? 6    GLU C N   1 
ATOM   7144 C CA  . GLU C 2 6   ? -5.056  -63.686 44.485 1.00 83.57  ? 6    GLU C CA  1 
ATOM   7145 C C   . GLU C 2 6   ? -4.403  -62.663 45.417 1.00 83.44  ? 6    GLU C C   1 
ATOM   7146 O O   . GLU C 2 6   ? -3.981  -61.584 44.989 1.00 83.32  ? 6    GLU C O   1 
ATOM   7147 C CB  . GLU C 2 6   ? -4.523  -63.542 43.053 1.00 83.41  ? 6    GLU C CB  1 
ATOM   7148 C CG  . GLU C 2 6   ? -3.168  -64.200 42.800 1.00 83.06  ? 6    GLU C CG  1 
ATOM   7149 C CD  . GLU C 2 6   ? -3.266  -65.708 42.644 1.00 83.09  ? 6    GLU C CD  1 
ATOM   7150 O OE1 . GLU C 2 6   ? -3.322  -66.417 43.672 1.00 83.12  ? 6    GLU C OE1 1 
ATOM   7151 O OE2 . GLU C 2 6   ? -3.277  -66.185 41.490 1.00 83.11  ? 6    GLU C OE2 1 
ATOM   7152 N N   . THR C 2 7   ? -4.331  -63.017 46.696 1.00 80.57  ? 7    THR C N   1 
ATOM   7153 C CA  . THR C 2 7   ? -3.781  -62.135 47.720 1.00 80.49  ? 7    THR C CA  1 
ATOM   7154 C C   . THR C 2 7   ? -2.313  -62.458 47.984 1.00 80.15  ? 7    THR C C   1 
ATOM   7155 O O   . THR C 2 7   ? -1.936  -63.628 48.093 1.00 80.08  ? 7    THR C O   1 
ATOM   7156 C CB  . THR C 2 7   ? -4.577  -62.239 49.037 1.00 80.80  ? 7    THR C CB  1 
ATOM   7157 O OG1 . THR C 2 7   ? -4.614  -63.603 49.472 1.00 80.83  ? 7    THR C OG1 1 
ATOM   7158 C CG2 . THR C 2 7   ? -6.005  -61.739 48.849 1.00 81.17  ? 7    THR C CG2 1 
ATOM   7159 N N   . LEU C 2 8   ? -1.492  -61.415 48.074 1.00 80.04  ? 8    LEU C N   1 
ATOM   7160 C CA  . LEU C 2 8   ? -0.068  -61.565 48.375 1.00 79.73  ? 8    LEU C CA  1 
ATOM   7161 C C   . LEU C 2 8   ? 0.183   -61.163 49.821 1.00 79.78  ? 8    LEU C C   1 
ATOM   7162 O O   . LEU C 2 8   ? 0.142   -59.977 50.156 1.00 79.83  ? 8    LEU C O   1 
ATOM   7163 C CB  . LEU C 2 8   ? 0.784   -60.709 47.433 1.00 79.48  ? 8    LEU C CB  1 
ATOM   7164 C CG  . LEU C 2 8   ? 0.521   -60.785 45.927 1.00 79.47  ? 8    LEU C CG  1 
ATOM   7165 C CD1 . LEU C 2 8   ? 1.120   -59.570 45.243 1.00 79.33  ? 8    LEU C CD1 1 
ATOM   7166 C CD2 . LEU C 2 8   ? 1.055   -62.079 45.315 1.00 79.32  ? 8    LEU C CD2 1 
ATOM   7167 N N   . CYS C 2 9   ? 0.448   -62.153 50.672 1.00 80.15  ? 9    CYS C N   1 
ATOM   7168 C CA  . CYS C 2 9   ? 0.486   -61.934 52.118 1.00 80.28  ? 9    CYS C CA  1 
ATOM   7169 C C   . CYS C 2 9   ? 1.726   -62.463 52.835 1.00 80.08  ? 9    CYS C C   1 
ATOM   7170 O O   . CYS C 2 9   ? 2.449   -63.317 52.315 1.00 79.88  ? 9    CYS C O   1 
ATOM   7171 C CB  . CYS C 2 9   ? -0.768  -62.523 52.761 1.00 80.63  ? 9    CYS C CB  1 
ATOM   7172 S SG  . CYS C 2 9   ? -2.251  -61.603 52.365 1.00 80.94  ? 9    CYS C SG  1 
ATOM   7173 N N   . GLY C 2 10  ? 1.948   -61.939 54.040 1.00 83.49  ? 10   GLY C N   1 
ATOM   7174 C CA  . GLY C 2 10  ? 3.029   -62.383 54.914 1.00 83.38  ? 10   GLY C CA  1 
ATOM   7175 C C   . GLY C 2 10  ? 4.404   -62.041 54.381 1.00 83.03  ? 10   GLY C C   1 
ATOM   7176 O O   . GLY C 2 10  ? 4.619   -60.953 53.843 1.00 82.91  ? 10   GLY C O   1 
ATOM   7177 N N   . GLY C 2 11  ? 5.330   -62.985 54.529 1.00 87.37  ? 11   GLY C N   1 
ATOM   7178 C CA  . GLY C 2 11  ? 6.703   -62.824 54.054 1.00 87.07  ? 11   GLY C CA  1 
ATOM   7179 C C   . GLY C 2 11  ? 6.794   -62.689 52.548 1.00 86.89  ? 11   GLY C C   1 
ATOM   7180 O O   . GLY C 2 11  ? 7.701   -62.033 52.031 1.00 86.67  ? 11   GLY C O   1 
ATOM   7181 N N   . GLU C 2 12  ? 5.847   -63.311 51.849 1.00 83.76  ? 12   GLU C N   1 
ATOM   7182 C CA  . GLU C 2 12  ? 5.776   -63.235 50.394 1.00 83.64  ? 12   GLU C CA  1 
ATOM   7183 C C   . GLU C 2 12  ? 5.537   -61.801 49.923 1.00 83.62  ? 12   GLU C C   1 
ATOM   7184 O O   . GLU C 2 12  ? 6.062   -61.391 48.886 1.00 83.44  ? 12   GLU C O   1 
ATOM   7185 C CB  . GLU C 2 12  ? 4.700   -64.177 49.852 1.00 83.82  ? 12   GLU C CB  1 
ATOM   7186 C CG  . GLU C 2 12  ? 4.973   -65.650 50.142 1.00 83.83  ? 12   GLU C CG  1 
ATOM   7187 C CD  . GLU C 2 12  ? 4.163   -66.594 49.272 1.00 83.94  ? 12   GLU C CD  1 
ATOM   7188 O OE1 . GLU C 2 12  ? 4.122   -66.394 48.037 1.00 83.88  ? 12   GLU C OE1 1 
ATOM   7189 O OE2 . GLU C 2 12  ? 3.578   -67.549 49.825 1.00 84.12  ? 12   GLU C OE2 1 
ATOM   7190 N N   . LEU C 2 13  ? 4.755   -61.046 50.696 1.00 82.04  ? 13   LEU C N   1 
ATOM   7191 C CA  . LEU C 2 13  ? 4.542   -59.618 50.450 1.00 82.04  ? 13   LEU C CA  1 
ATOM   7192 C C   . LEU C 2 13  ? 5.828   -58.819 50.674 1.00 81.80  ? 13   LEU C C   1 
ATOM   7193 O O   . LEU C 2 13  ? 6.177   -57.952 49.868 1.00 81.66  ? 13   LEU C O   1 
ATOM   7194 C CB  . LEU C 2 13  ? 3.409   -59.076 51.338 1.00 82.34  ? 13   LEU C CB  1 
ATOM   7195 C CG  . LEU C 2 13  ? 3.213   -57.562 51.510 1.00 82.38  ? 13   LEU C CG  1 
ATOM   7196 C CD1 . LEU C 2 13  ? 2.711   -56.896 50.233 1.00 82.36  ? 13   LEU C CD1 1 
ATOM   7197 C CD2 . LEU C 2 13  ? 2.268   -57.276 52.665 1.00 82.70  ? 13   LEU C CD2 1 
ATOM   7198 N N   . VAL C 2 14  ? 6.528   -59.128 51.765 1.00 85.05  ? 14   VAL C N   1 
ATOM   7199 C CA  . VAL C 2 14  ? 7.738   -58.401 52.154 1.00 84.86  ? 14   VAL C CA  1 
ATOM   7200 C C   . VAL C 2 14  ? 8.894   -58.655 51.181 1.00 84.59  ? 14   VAL C C   1 
ATOM   7201 O O   . VAL C 2 14  ? 9.555   -57.712 50.738 1.00 84.44  ? 14   VAL C O   1 
ATOM   7202 C CB  . VAL C 2 14  ? 8.178   -58.738 53.605 1.00 84.94  ? 14   VAL C CB  1 
ATOM   7203 C CG1 . VAL C 2 14  ? 9.266   -57.779 54.070 1.00 84.81  ? 14   VAL C CG1 1 
ATOM   7204 C CG2 . VAL C 2 14  ? 6.993   -58.684 54.558 1.00 85.26  ? 14   VAL C CG2 1 
ATOM   7205 N N   . ASP C 2 15  ? 9.123   -59.927 50.850 1.00 88.17  ? 15   ASP C N   1 
ATOM   7206 C CA  . ASP C 2 15  ? 10.204  -60.327 49.944 1.00 87.94  ? 15   ASP C CA  1 
ATOM   7207 C C   . ASP C 2 15  ? 10.139  -59.605 48.601 1.00 87.85  ? 15   ASP C C   1 
ATOM   7208 O O   . ASP C 2 15  ? 11.168  -59.189 48.062 1.00 87.66  ? 15   ASP C O   1 
ATOM   7209 C CB  . ASP C 2 15  ? 10.193  -61.845 49.723 1.00 87.97  ? 15   ASP C CB  1 
ATOM   7210 C CG  . ASP C 2 15  ? 10.920  -62.608 50.821 1.00 87.98  ? 15   ASP C CG  1 
ATOM   7211 O OD1 . ASP C 2 15  ? 10.808  -62.229 52.006 1.00 88.09  ? 15   ASP C OD1 1 
ATOM   7212 O OD2 . ASP C 2 15  ? 11.599  -63.603 50.494 1.00 87.89  ? 15   ASP C OD2 1 
ATOM   7213 N N   . THR C 2 16  ? 8.923   -59.453 48.078 1.00 84.66  ? 16   THR C N   1 
ATOM   7214 C CA  . THR C 2 16  ? 8.698   -58.817 46.782 1.00 84.62  ? 16   THR C CA  1 
ATOM   7215 C C   . THR C 2 16  ? 8.905   -57.302 46.846 1.00 84.55  ? 16   THR C C   1 
ATOM   7216 O O   . THR C 2 16  ? 9.303   -56.686 45.855 1.00 84.43  ? 16   THR C O   1 
ATOM   7217 C CB  . THR C 2 16  ? 7.290   -59.145 46.233 1.00 84.83  ? 16   THR C CB  1 
ATOM   7218 O OG1 . THR C 2 16  ? 7.023   -60.542 46.409 1.00 84.91  ? 16   THR C OG1 1 
ATOM   7219 C CG2 . THR C 2 16  ? 7.183   -58.805 44.748 1.00 84.80  ? 16   THR C CG2 1 
ATOM   7220 N N   . LEU C 2 17  ? 8.649   -56.714 48.014 1.00 84.21  ? 17   LEU C N   1 
ATOM   7221 C CA  . LEU C 2 17  ? 8.814   -55.273 48.212 1.00 84.17  ? 17   LEU C CA  1 
ATOM   7222 C C   . LEU C 2 17  ? 10.246  -54.782 47.990 1.00 83.92  ? 17   LEU C C   1 
ATOM   7223 O O   . LEU C 2 17  ? 10.464  -53.828 47.241 1.00 83.83  ? 17   LEU C O   1 
ATOM   7224 C CB  . LEU C 2 17  ? 8.307   -54.849 49.592 1.00 84.34  ? 17   LEU C CB  1 
ATOM   7225 C CG  . LEU C 2 17  ? 6.853   -54.381 49.645 1.00 84.61  ? 17   LEU C CG  1 
ATOM   7226 C CD1 . LEU C 2 17  ? 6.312   -54.464 51.062 1.00 84.82  ? 17   LEU C CD1 1 
ATOM   7227 C CD2 . LEU C 2 17  ? 6.725   -52.964 49.096 1.00 84.59  ? 17   LEU C CD2 1 
ATOM   7228 N N   . GLN C 2 18  ? 11.213  -55.436 48.632 1.00 88.82  ? 18   GLN C N   1 
ATOM   7229 C CA  . GLN C 2 18  ? 12.623  -55.089 48.441 1.00 88.60  ? 18   GLN C CA  1 
ATOM   7230 C C   . GLN C 2 18  ? 13.149  -55.528 47.075 1.00 88.46  ? 18   GLN C C   1 
ATOM   7231 O O   . GLN C 2 18  ? 14.182  -55.041 46.622 1.00 88.31  ? 18   GLN C O   1 
ATOM   7232 C CB  . GLN C 2 18  ? 13.501  -55.638 49.573 1.00 88.57  ? 18   GLN C CB  1 
ATOM   7233 C CG  . GLN C 2 18  ? 13.487  -57.151 49.745 1.00 88.63  ? 18   GLN C CG  1 
ATOM   7234 C CD  . GLN C 2 18  ? 14.216  -57.604 51.001 1.00 88.65  ? 18   GLN C CD  1 
ATOM   7235 O OE1 . GLN C 2 18  ? 15.060  -56.887 51.544 1.00 88.58  ? 18   GLN C OE1 1 
ATOM   7236 N NE2 . GLN C 2 18  ? 13.891  -58.804 51.468 1.00 88.77  ? 18   GLN C NE2 1 
ATOM   7237 N N   . PHE C 2 19  ? 12.436  -56.443 46.423 1.00 92.56  ? 19   PHE C N   1 
ATOM   7238 C CA  . PHE C 2 19  ? 12.767  -56.832 45.058 1.00 92.48  ? 19   PHE C CA  1 
ATOM   7239 C C   . PHE C 2 19  ? 12.401  -55.727 44.072 1.00 92.48  ? 19   PHE C C   1 
ATOM   7240 O O   . PHE C 2 19  ? 13.063  -55.551 43.048 1.00 92.37  ? 19   PHE C O   1 
ATOM   7241 C CB  . PHE C 2 19  ? 12.084  -58.144 44.675 1.00 92.59  ? 19   PHE C CB  1 
ATOM   7242 C CG  . PHE C 2 19  ? 12.297  -58.538 43.244 1.00 92.55  ? 19   PHE C CG  1 
ATOM   7243 C CD1 . PHE C 2 19  ? 13.573  -58.829 42.770 1.00 92.39  ? 19   PHE C CD1 1 
ATOM   7244 C CD2 . PHE C 2 19  ? 11.226  -58.608 42.365 1.00 92.68  ? 19   PHE C CD2 1 
ATOM   7245 C CE1 . PHE C 2 19  ? 13.776  -59.191 41.442 1.00 92.39  ? 19   PHE C CE1 1 
ATOM   7246 C CE2 . PHE C 2 19  ? 11.419  -58.971 41.036 1.00 92.67  ? 19   PHE C CE2 1 
ATOM   7247 C CZ  . PHE C 2 19  ? 12.697  -59.264 40.575 1.00 92.52  ? 19   PHE C CZ  1 
ATOM   7248 N N   . VAL C 2 20  ? 11.346  -54.986 44.394 1.00 90.77  ? 20   VAL C N   1 
ATOM   7249 C CA  . VAL C 2 20  ? 10.926  -53.852 43.583 1.00 90.80  ? 20   VAL C CA  1 
ATOM   7250 C C   . VAL C 2 20  ? 11.704  -52.595 43.983 1.00 90.67  ? 20   VAL C C   1 
ATOM   7251 O O   . VAL C 2 20  ? 12.248  -51.898 43.124 1.00 90.56  ? 20   VAL C O   1 
ATOM   7252 C CB  . VAL C 2 20  ? 9.396   -53.614 43.679 1.00 91.03  ? 20   VAL C CB  1 
ATOM   7253 C CG1 . VAL C 2 20  ? 8.975   -52.446 42.807 1.00 91.07  ? 20   VAL C CG1 1 
ATOM   7254 C CG2 . VAL C 2 20  ? 8.635   -54.863 43.267 1.00 91.16  ? 20   VAL C CG2 1 
ATOM   7255 N N   . CYS C 2 21  ? 11.771  -52.327 45.286 1.00 91.38  ? 21   CYS C N   1 
ATOM   7256 C CA  . CYS C 2 21  ? 12.401  -51.112 45.807 1.00 91.30  ? 21   CYS C CA  1 
ATOM   7257 C C   . CYS C 2 21  ? 13.892  -51.293 46.094 1.00 91.11  ? 21   CYS C C   1 
ATOM   7258 O O   . CYS C 2 21  ? 14.736  -50.691 45.428 1.00 90.97  ? 21   CYS C O   1 
ATOM   7259 C CB  . CYS C 2 21  ? 11.682  -50.637 47.073 1.00 91.46  ? 21   CYS C CB  1 
ATOM   7260 S SG  . CYS C 2 21  ? 9.880   -50.619 46.977 1.00 91.74  ? 21   CYS C SG  1 
ATOM   7261 N N   . GLY C 2 22  ? 14.202  -52.110 47.099 1.00 94.38  ? 22   GLY C N   1 
ATOM   7262 C CA  . GLY C 2 22  ? 15.581  -52.428 47.453 1.00 94.24  ? 22   GLY C CA  1 
ATOM   7263 C C   . GLY C 2 22  ? 16.337  -51.293 48.104 1.00 94.17  ? 22   GLY C C   1 
ATOM   7264 O O   . GLY C 2 22  ? 15.987  -50.859 49.202 1.00 94.27  ? 22   GLY C O   1 
ATOM   7265 N N   . ASP C 2 23  ? 17.376  -50.819 47.415 1.00 101.64 ? 23   ASP C N   1 
ATOM   7266 C CA  . ASP C 2 23  ? 18.252  -49.752 47.914 1.00 101.56 ? 23   ASP C CA  1 
ATOM   7267 C C   . ASP C 2 23  ? 17.479  -48.495 48.299 1.00 101.64 ? 23   ASP C C   1 
ATOM   7268 O O   . ASP C 2 23  ? 17.780  -47.862 49.316 1.00 101.68 ? 23   ASP C O   1 
ATOM   7269 C CB  . ASP C 2 23  ? 19.330  -49.400 46.883 1.00 101.40 ? 23   ASP C CB  1 
ATOM   7270 C CG  . ASP C 2 23  ? 20.348  -50.507 46.694 1.00 101.33 ? 23   ASP C CG  1 
ATOM   7271 O OD1 . ASP C 2 23  ? 19.964  -51.593 46.214 1.00 101.37 ? 23   ASP C OD1 1 
ATOM   7272 O OD2 . ASP C 2 23  ? 21.537  -50.286 47.011 1.00 101.25 ? 23   ASP C OD2 1 
ATOM   7273 N N   . ARG C 2 24  ? 16.491  -48.142 47.477 1.00 93.51  ? 24   ARG C N   1 
ATOM   7274 C CA  . ARG C 2 24  ? 15.604  -47.019 47.761 1.00 93.62  ? 24   ARG C CA  1 
ATOM   7275 C C   . ARG C 2 24  ? 14.868  -47.254 49.075 1.00 93.81  ? 24   ARG C C   1 
ATOM   7276 O O   . ARG C 2 24  ? 14.780  -46.356 49.912 1.00 93.88  ? 24   ARG C O   1 
ATOM   7277 C CB  . ARG C 2 24  ? 14.600  -46.817 46.624 1.00 93.69  ? 24   ARG C CB  1 
ATOM   7278 C CG  . ARG C 2 24  ? 15.219  -46.409 45.294 1.00 93.55  ? 24   ARG C CG  1 
ATOM   7279 C CD  . ARG C 2 24  ? 14.154  -46.236 44.223 1.00 93.65  ? 24   ARG C CD  1 
ATOM   7280 N NE  . ARG C 2 24  ? 13.419  -47.477 43.971 1.00 93.75  ? 24   ARG C NE  1 
ATOM   7281 C CZ  . ARG C 2 24  ? 12.383  -47.592 43.144 1.00 93.90  ? 24   ARG C CZ  1 
ATOM   7282 N NH1 . ARG C 2 24  ? 11.936  -46.540 42.467 1.00 93.97  ? 24   ARG C NH1 1 
ATOM   7283 N NH2 . ARG C 2 24  ? 11.789  -48.768 42.990 1.00 93.98  ? 24   ARG C NH2 1 
ATOM   7284 N N   . GLY C 2 25  ? 14.364  -48.473 49.252 1.00 83.61  ? 25   GLY C N   1 
ATOM   7285 C CA  . GLY C 2 25  ? 13.632  -48.845 50.456 1.00 83.81  ? 25   GLY C CA  1 
ATOM   7286 C C   . GLY C 2 25  ? 12.135  -48.793 50.242 1.00 84.01  ? 25   GLY C C   1 
ATOM   7287 O O   . GLY C 2 25  ? 11.663  -48.283 49.226 1.00 83.99  ? 25   GLY C O   1 
ATOM   7288 N N   . PHE C 2 26  ? 11.389  -49.320 51.207 1.00 78.31  ? 26   PHE C N   1 
ATOM   7289 C CA  . PHE C 2 26  ? 9.934   -49.372 51.115 1.00 78.53  ? 26   PHE C CA  1 
ATOM   7290 C C   . PHE C 2 26  ? 9.255   -49.109 52.457 1.00 78.78  ? 26   PHE C C   1 
ATOM   7291 O O   . PHE C 2 26  ? 9.746   -49.531 53.507 1.00 78.82  ? 26   PHE C O   1 
ATOM   7292 C CB  . PHE C 2 26  ? 9.475   -50.718 50.538 1.00 78.57  ? 26   PHE C CB  1 
ATOM   7293 C CG  . PHE C 2 26  ? 9.961   -51.916 51.310 1.00 78.56  ? 26   PHE C CG  1 
ATOM   7294 C CD1 . PHE C 2 26  ? 11.201  -52.483 51.034 1.00 78.34  ? 26   PHE C CD1 1 
ATOM   7295 C CD2 . PHE C 2 26  ? 9.170   -52.487 52.304 1.00 78.79  ? 26   PHE C CD2 1 
ATOM   7296 C CE1 . PHE C 2 26  ? 11.651  -53.589 51.745 1.00 78.35  ? 26   PHE C CE1 1 
ATOM   7297 C CE2 . PHE C 2 26  ? 9.611   -53.596 53.018 1.00 78.80  ? 26   PHE C CE2 1 
ATOM   7298 C CZ  . PHE C 2 26  ? 10.854  -54.149 52.738 1.00 78.58  ? 26   PHE C CZ  1 
ATOM   7299 N N   . TYR C 2 27  ? 8.126   -48.407 52.406 1.00 73.70  ? 27   TYR C N   1 
ATOM   7300 C CA  . TYR C 2 27  ? 7.319   -48.137 53.593 1.00 73.99  ? 27   TYR C CA  1 
ATOM   7301 C C   . TYR C 2 27  ? 6.043   -48.974 53.594 1.00 74.23  ? 27   TYR C C   1 
ATOM   7302 O O   . TYR C 2 27  ? 5.698   -49.602 52.591 1.00 74.18  ? 27   TYR C O   1 
ATOM   7303 C CB  . TYR C 2 27  ? 6.962   -46.649 53.683 1.00 74.08  ? 27   TYR C CB  1 
ATOM   7304 C CG  . TYR C 2 27  ? 8.149   -45.717 53.788 1.00 73.88  ? 27   TYR C CG  1 
ATOM   7305 C CD1 . TYR C 2 27  ? 8.959   -45.709 54.926 1.00 73.85  ? 27   TYR C CD1 1 
ATOM   7306 C CD2 . TYR C 2 27  ? 8.452   -44.830 52.756 1.00 73.72  ? 27   TYR C CD2 1 
ATOM   7307 C CE1 . TYR C 2 27  ? 10.050  -44.848 55.028 1.00 73.68  ? 27   TYR C CE1 1 
ATOM   7308 C CE2 . TYR C 2 27  ? 9.538   -43.963 52.848 1.00 73.55  ? 27   TYR C CE2 1 
ATOM   7309 C CZ  . TYR C 2 27  ? 10.332  -43.978 53.985 1.00 73.52  ? 27   TYR C CZ  1 
ATOM   7310 O OH  . TYR C 2 27  ? 11.406  -43.122 54.079 1.00 73.37  ? 27   TYR C OH  1 
ATOM   7311 N N   . PHE C 2 28  ? 5.352   -48.977 54.730 1.00 73.35  ? 28   PHE C N   1 
ATOM   7312 C CA  . PHE C 2 28  ? 4.067   -49.658 54.865 1.00 73.63  ? 28   PHE C CA  1 
ATOM   7313 C C   . PHE C 2 28  ? 2.932   -48.651 55.068 1.00 73.93  ? 28   PHE C C   1 
ATOM   7314 O O   . PHE C 2 28  ? 1.770   -49.033 55.238 1.00 74.21  ? 28   PHE C O   1 
ATOM   7315 C CB  . PHE C 2 28  ? 4.116   -50.665 56.018 1.00 73.76  ? 28   PHE C CB  1 
ATOM   7316 C CG  . PHE C 2 28  ? 4.759   -51.977 55.655 1.00 73.56  ? 28   PHE C CG  1 
ATOM   7317 C CD1 . PHE C 2 28  ? 3.990   -53.127 55.525 1.00 73.70  ? 28   PHE C CD1 1 
ATOM   7318 C CD2 . PHE C 2 28  ? 6.132   -52.066 55.448 1.00 73.26  ? 28   PHE C CD2 1 
ATOM   7319 C CE1 . PHE C 2 28  ? 4.573   -54.344 55.191 1.00 73.53  ? 28   PHE C CE1 1 
ATOM   7320 C CE2 . PHE C 2 28  ? 6.725   -53.280 55.113 1.00 73.10  ? 28   PHE C CE2 1 
ATOM   7321 C CZ  . PHE C 2 28  ? 5.943   -54.421 54.984 1.00 73.23  ? 28   PHE C CZ  1 
ATOM   7322 N N   . SER C 2 29  ? 3.286   -47.367 55.035 1.00 76.61  ? 29   SER C N   1 
ATOM   7323 C CA  . SER C 2 29  ? 2.334   -46.273 55.210 1.00 76.89  ? 29   SER C CA  1 
ATOM   7324 C C   . SER C 2 29  ? 2.135   -45.509 53.897 1.00 76.78  ? 29   SER C C   1 
ATOM   7325 O O   . SER C 2 29  ? 2.156   -44.270 53.865 1.00 76.98  ? 29   SER C O   1 
ATOM   7326 C CB  . SER C 2 29  ? 2.810   -45.328 56.319 1.00 76.98  ? 29   SER C CB  1 
ATOM   7327 O OG  . SER C 2 29  ? 3.122   -46.043 57.502 1.00 77.05  ? 29   SER C OG  1 
ATOM   7328 N N   . ARG C 2 40  ? -5.226  -45.661 53.990 1.00 86.91  ? 40   ARG C N   1 
ATOM   7329 C CA  . ARG C 2 40  ? -4.974  -47.099 53.994 1.00 86.79  ? 40   ARG C CA  1 
ATOM   7330 C C   . ARG C 2 40  ? -3.490  -47.428 53.827 1.00 86.32  ? 40   ARG C C   1 
ATOM   7331 O O   . ARG C 2 40  ? -2.718  -46.625 53.292 1.00 86.06  ? 40   ARG C O   1 
ATOM   7332 C CB  . ARG C 2 40  ? -5.789  -47.793 52.900 1.00 86.88  ? 40   ARG C CB  1 
ATOM   7333 C CG  . ARG C 2 40  ? -7.264  -47.946 53.219 1.00 87.36  ? 40   ARG C CG  1 
ATOM   7334 C CD  . ARG C 2 40  ? -7.979  -48.700 52.112 1.00 87.42  ? 40   ARG C CD  1 
ATOM   7335 N NE  . ARG C 2 40  ? -9.321  -49.118 52.513 1.00 87.88  ? 40   ARG C NE  1 
ATOM   7336 C CZ  . ARG C 2 40  ? -10.152 -49.829 51.753 1.00 88.04  ? 40   ARG C CZ  1 
ATOM   7337 N NH1 . ARG C 2 40  ? -9.792  -50.211 50.532 1.00 87.78  ? 40   ARG C NH1 1 
ATOM   7338 N NH2 . ARG C 2 40  ? -11.353 -50.156 52.214 1.00 88.49  ? 40   ARG C NH2 1 
ATOM   7339 N N   . GLY C 2 41  ? -3.106  -48.615 54.292 1.00 80.16  ? 41   GLY C N   1 
ATOM   7340 C CA  . GLY C 2 41  ? -1.733  -49.098 54.171 1.00 79.75  ? 41   GLY C CA  1 
ATOM   7341 C C   . GLY C 2 41  ? -1.577  -50.098 53.042 1.00 79.55  ? 41   GLY C C   1 
ATOM   7342 O O   . GLY C 2 41  ? -2.559  -50.473 52.394 1.00 79.72  ? 41   GLY C O   1 
ATOM   7343 N N   . ILE C 2 42  ? -0.338  -50.530 52.809 1.00 78.38  ? 42   ILE C N   1 
ATOM   7344 C CA  . ILE C 2 42  ? -0.027  -51.473 51.729 1.00 78.16  ? 42   ILE C CA  1 
ATOM   7345 C C   . ILE C 2 42  ? -0.641  -52.853 51.957 1.00 78.32  ? 42   ILE C C   1 
ATOM   7346 O O   . ILE C 2 42  ? -1.134  -53.478 51.014 1.00 78.36  ? 42   ILE C O   1 
ATOM   7347 C CB  . ILE C 2 42  ? 1.505   -51.590 51.462 1.00 77.77  ? 42   ILE C CB  1 
ATOM   7348 C CG1 . ILE C 2 42  ? 1.771   -52.486 50.243 1.00 77.59  ? 42   ILE C CG1 1 
ATOM   7349 C CG2 . ILE C 2 42  ? 2.247   -52.084 52.706 1.00 77.73  ? 42   ILE C CG2 1 
ATOM   7350 C CD1 . ILE C 2 42  ? 3.173   -52.403 49.688 1.00 77.23  ? 42   ILE C CD1 1 
ATOM   7351 N N   . VAL C 2 43  ? -0.615  -53.316 53.206 1.00 78.55  ? 43   VAL C N   1 
ATOM   7352 C CA  . VAL C 2 43  ? -1.173  -54.618 53.564 1.00 78.72  ? 43   VAL C CA  1 
ATOM   7353 C C   . VAL C 2 43  ? -2.639  -54.676 53.146 1.00 79.04  ? 43   VAL C C   1 
ATOM   7354 O O   . VAL C 2 43  ? -3.094  -55.675 52.591 1.00 79.09  ? 43   VAL C O   1 
ATOM   7355 C CB  . VAL C 2 43  ? -1.050  -54.910 55.080 1.00 78.88  ? 43   VAL C CB  1 
ATOM   7356 C CG1 . VAL C 2 43  ? -1.150  -56.408 55.344 1.00 78.95  ? 43   VAL C CG1 1 
ATOM   7357 C CG2 . VAL C 2 43  ? 0.260   -54.362 55.636 1.00 78.62  ? 43   VAL C CG2 1 
ATOM   7358 N N   . GLU C 2 44  ? -3.357  -53.580 53.392 1.00 82.96  ? 44   GLU C N   1 
ATOM   7359 C CA  . GLU C 2 44  ? -4.785  -53.473 53.087 1.00 83.31  ? 44   GLU C CA  1 
ATOM   7360 C C   . GLU C 2 44  ? -5.125  -53.539 51.597 1.00 83.24  ? 44   GLU C C   1 
ATOM   7361 O O   . GLU C 2 44  ? -6.259  -53.853 51.230 1.00 83.51  ? 44   GLU C O   1 
ATOM   7362 C CB  . GLU C 2 44  ? -5.371  -52.201 53.707 1.00 83.58  ? 44   GLU C CB  1 
ATOM   7363 C CG  . GLU C 2 44  ? -5.638  -52.311 55.203 1.00 83.86  ? 44   GLU C CG  1 
ATOM   7364 C CD  . GLU C 2 44  ? -6.293  -51.068 55.782 1.00 84.16  ? 44   GLU C CD  1 
ATOM   7365 O OE1 . GLU C 2 44  ? -5.763  -49.955 55.570 1.00 83.99  ? 44   GLU C OE1 1 
ATOM   7366 O OE2 . GLU C 2 44  ? -7.335  -51.208 56.460 1.00 84.58  ? 44   GLU C OE2 1 
ATOM   7367 N N   . GLU C 2 45  ? -4.143  -53.256 50.746 1.00 82.72  ? 45   GLU C N   1 
ATOM   7368 C CA  . GLU C 2 45  ? -4.385  -53.135 49.312 1.00 82.66  ? 45   GLU C CA  1 
ATOM   7369 C C   . GLU C 2 45  ? -3.933  -54.362 48.514 1.00 82.47  ? 45   GLU C C   1 
ATOM   7370 O O   . GLU C 2 45  ? -4.566  -54.723 47.518 1.00 82.57  ? 45   GLU C O   1 
ATOM   7371 C CB  . GLU C 2 45  ? -3.717  -51.867 48.780 1.00 82.46  ? 45   GLU C CB  1 
ATOM   7372 C CG  . GLU C 2 45  ? -4.542  -51.111 47.749 1.00 82.63  ? 45   GLU C CG  1 
ATOM   7373 C CD  . GLU C 2 45  ? -4.219  -49.626 47.708 1.00 82.58  ? 45   GLU C CD  1 
ATOM   7374 O OE1 . GLU C 2 45  ? -3.889  -49.047 48.768 1.00 82.61  ? 45   GLU C OE1 1 
ATOM   7375 O OE2 . GLU C 2 45  ? -4.305  -49.033 46.613 1.00 82.53  ? 45   GLU C OE2 1 
ATOM   7376 N N   . CYS C 2 46  ? -2.852  -54.999 48.963 1.00 79.94  ? 46   CYS C N   1 
ATOM   7377 C CA  . CYS C 2 46  ? -2.226  -56.102 48.223 1.00 79.72  ? 46   CYS C CA  1 
ATOM   7378 C C   . CYS C 2 46  ? -2.294  -57.450 48.945 1.00 79.78  ? 46   CYS C C   1 
ATOM   7379 O O   . CYS C 2 46  ? -2.059  -58.498 48.337 1.00 79.67  ? 46   CYS C O   1 
ATOM   7380 C CB  . CYS C 2 46  ? -0.771  -55.758 47.893 1.00 79.34  ? 46   CYS C CB  1 
ATOM   7381 S SG  . CYS C 2 46  ? -0.555  -54.172 47.055 1.00 79.25  ? 46   CYS C SG  1 
ATOM   7382 N N   . CYS C 2 47  ? -2.609  -57.416 50.237 1.00 79.16  ? 47   CYS C N   1 
ATOM   7383 C CA  . CYS C 2 47  ? -2.749  -58.632 51.033 1.00 79.26  ? 47   CYS C CA  1 
ATOM   7384 C C   . CYS C 2 47  ? -4.207  -58.874 51.426 1.00 79.68  ? 47   CYS C C   1 
ATOM   7385 O O   . CYS C 2 47  ? -4.711  -59.990 51.299 1.00 79.80  ? 47   CYS C O   1 
ATOM   7386 C CB  . CYS C 2 47  ? -1.840  -58.577 52.266 1.00 79.15  ? 47   CYS C CB  1 
ATOM   7387 S SG  . CYS C 2 47  ? -2.054  -59.910 53.474 1.00 79.33  ? 47   CYS C SG  1 
ATOM   7388 N N   . PHE C 2 48  ? -4.878  -57.827 51.901 1.00 82.91  ? 48   PHE C N   1 
ATOM   7389 C CA  . PHE C 2 48  ? -6.312  -57.893 52.173 1.00 83.34  ? 48   PHE C CA  1 
ATOM   7390 C C   . PHE C 2 48  ? -7.077  -58.009 50.855 1.00 83.43  ? 48   PHE C C   1 
ATOM   7391 O O   . PHE C 2 48  ? -8.172  -58.572 50.809 1.00 83.74  ? 48   PHE C O   1 
ATOM   7392 C CB  . PHE C 2 48  ? -6.776  -56.660 52.952 1.00 83.58  ? 48   PHE C CB  1 
ATOM   7393 C CG  . PHE C 2 48  ? -6.332  -56.637 54.395 1.00 83.63  ? 48   PHE C CG  1 
ATOM   7394 C CD1 . PHE C 2 48  ? -7.180  -57.068 55.401 1.00 83.99  ? 48   PHE C CD1 1 
ATOM   7395 C CD2 . PHE C 2 48  ? -5.075  -56.170 54.748 1.00 83.33  ? 48   PHE C CD2 1 
ATOM   7396 C CE1 . PHE C 2 48  ? -6.783  -57.043 56.733 1.00 84.07  ? 48   PHE C CE1 1 
ATOM   7397 C CE2 . PHE C 2 48  ? -4.668  -56.137 56.076 1.00 83.40  ? 48   PHE C CE2 1 
ATOM   7398 C CZ  . PHE C 2 48  ? -5.524  -56.576 57.069 1.00 83.77  ? 48   PHE C CZ  1 
ATOM   7399 N N   . ARG C 2 49  ? -6.478  -57.471 49.792 1.00 84.81  ? 49   ARG C N   1 
ATOM   7400 C CA  . ARG C 2 49  ? -7.021  -57.546 48.435 1.00 84.86  ? 49   ARG C CA  1 
ATOM   7401 C C   . ARG C 2 49  ? -5.931  -57.973 47.448 1.00 84.47  ? 49   ARG C C   1 
ATOM   7402 O O   . ARG C 2 49  ? -5.044  -58.758 47.795 1.00 84.25  ? 49   ARG C O   1 
ATOM   7403 C CB  . ARG C 2 49  ? -7.618  -56.194 48.025 1.00 85.02  ? 49   ARG C CB  1 
ATOM   7404 C CG  . ARG C 2 49  ? -8.911  -55.839 48.741 1.00 85.47  ? 49   ARG C CG  1 
ATOM   7405 C CD  . ARG C 2 49  ? -9.238  -54.359 48.616 1.00 85.60  ? 49   ARG C CD  1 
ATOM   7406 N NE  . ARG C 2 49  ? -10.302 -53.970 49.542 1.00 86.01  ? 49   ARG C NE  1 
ATOM   7407 C CZ  . ARG C 2 49  ? -10.103 -53.493 50.769 1.00 86.07  ? 49   ARG C CZ  1 
ATOM   7408 N NH1 . ARG C 2 49  ? -8.874  -53.327 51.240 1.00 85.72  ? 49   ARG C NH1 1 
ATOM   7409 N NH2 . ARG C 2 49  ? -11.142 -53.176 51.529 1.00 86.49  ? 49   ARG C NH2 1 
ATOM   7410 N N   . SER C 2 50  ? -6.008  -57.462 46.221 1.00 84.94  ? 50   SER C N   1 
ATOM   7411 C CA  . SER C 2 50  ? -4.985  -57.706 45.207 1.00 84.62  ? 50   SER C CA  1 
ATOM   7412 C C   . SER C 2 50  ? -4.566  -56.400 44.537 1.00 84.49  ? 50   SER C C   1 
ATOM   7413 O O   . SER C 2 50  ? -5.373  -55.478 44.391 1.00 84.72  ? 50   SER C O   1 
ATOM   7414 C CB  . SER C 2 50  ? -5.480  -58.709 44.162 1.00 84.71  ? 50   SER C CB  1 
ATOM   7415 O OG  . SER C 2 50  ? -6.612  -58.216 43.466 1.00 85.02  ? 50   SER C OG  1 
ATOM   7416 N N   . CYS C 2 51  ? -3.298  -56.328 44.145 1.00 83.74  ? 51   CYS C N   1 
ATOM   7417 C CA  . CYS C 2 51  ? -2.754  -55.158 43.462 1.00 83.58  ? 51   CYS C CA  1 
ATOM   7418 C C   . CYS C 2 51  ? -1.688  -55.592 42.463 1.00 83.29  ? 51   CYS C C   1 
ATOM   7419 O O   . CYS C 2 51  ? -1.157  -56.698 42.564 1.00 83.16  ? 51   CYS C O   1 
ATOM   7420 C CB  . CYS C 2 51  ? -2.154  -54.179 44.473 1.00 83.47  ? 51   CYS C CB  1 
ATOM   7421 S SG  . CYS C 2 51  ? -0.525  -54.666 45.087 1.00 83.08  ? 51   CYS C SG  1 
ATOM   7422 N N   . ASP C 2 52  ? -1.383  -54.722 41.504 1.00 86.32  ? 52   ASP C N   1 
ATOM   7423 C CA  . ASP C 2 52  ? -0.298  -54.972 40.560 1.00 86.05  ? 52   ASP C CA  1 
ATOM   7424 C C   . ASP C 2 52  ? 1.028   -54.462 41.120 1.00 85.74  ? 52   ASP C C   1 
ATOM   7425 O O   . ASP C 2 52  ? 1.063   -53.866 42.198 1.00 85.74  ? 52   ASP C O   1 
ATOM   7426 C CB  . ASP C 2 52  ? -0.604  -54.360 39.183 1.00 86.13  ? 52   ASP C CB  1 
ATOM   7427 C CG  . ASP C 2 52  ? -0.566  -52.837 39.181 1.00 86.14  ? 52   ASP C CG  1 
ATOM   7428 O OD1 . ASP C 2 52  ? -0.799  -52.211 40.238 1.00 86.14  ? 52   ASP C OD1 1 
ATOM   7429 O OD2 . ASP C 2 52  ? -0.312  -52.265 38.100 1.00 86.18  ? 52   ASP C OD2 1 
ATOM   7430 N N   . LEU C 2 53  ? 2.113   -54.695 40.388 1.00 85.10  ? 53   LEU C N   1 
ATOM   7431 C CA  . LEU C 2 53  ? 3.439   -54.249 40.807 1.00 84.82  ? 53   LEU C CA  1 
ATOM   7432 C C   . LEU C 2 53  ? 3.586   -52.723 40.785 1.00 84.79  ? 53   LEU C C   1 
ATOM   7433 O O   . LEU C 2 53  ? 4.483   -52.176 41.428 1.00 84.61  ? 53   LEU C O   1 
ATOM   7434 C CB  . LEU C 2 53  ? 4.524   -54.919 39.957 1.00 84.60  ? 53   LEU C CB  1 
ATOM   7435 C CG  . LEU C 2 53  ? 4.688   -56.436 40.121 1.00 84.57  ? 53   LEU C CG  1 
ATOM   7436 C CD1 . LEU C 2 53  ? 5.352   -57.052 38.904 1.00 84.46  ? 53   LEU C CD1 1 
ATOM   7437 C CD2 . LEU C 2 53  ? 5.462   -56.786 41.387 1.00 84.43  ? 53   LEU C CD2 1 
ATOM   7438 N N   . ALA C 2 54  ? 2.702   -52.045 40.053 1.00 87.73  ? 54   ALA C N   1 
ATOM   7439 C CA  . ALA C 2 54  ? 2.691   -50.580 39.999 1.00 87.74  ? 54   ALA C CA  1 
ATOM   7440 C C   . ALA C 2 54  ? 2.166   -49.972 41.298 1.00 87.86  ? 54   ALA C C   1 
ATOM   7441 O O   . ALA C 2 54  ? 2.746   -49.015 41.818 1.00 87.73  ? 54   ALA C O   1 
ATOM   7442 C CB  . ALA C 2 54  ? 1.881   -50.088 38.808 1.00 87.95  ? 54   ALA C CB  1 
ATOM   7443 N N   . LEU C 2 55  ? 1.073   -50.533 41.818 1.00 83.30  ? 55   LEU C N   1 
ATOM   7444 C CA  . LEU C 2 55  ? 0.538   -50.141 43.125 1.00 83.45  ? 55   LEU C CA  1 
ATOM   7445 C C   . LEU C 2 55  ? 1.442   -50.609 44.261 1.00 83.26  ? 55   LEU C C   1 
ATOM   7446 O O   . LEU C 2 55  ? 1.224   -50.258 45.422 1.00 83.37  ? 55   LEU C O   1 
ATOM   7447 C CB  . LEU C 2 55  ? -0.885  -50.676 43.328 1.00 83.80  ? 55   LEU C CB  1 
ATOM   7448 C CG  . LEU C 2 55  ? -2.055  -49.811 42.847 1.00 84.09  ? 55   LEU C CG  1 
ATOM   7449 C CD1 . LEU C 2 55  ? -3.349  -50.613 42.851 1.00 84.41  ? 55   LEU C CD1 1 
ATOM   7450 C CD2 . LEU C 2 55  ? -2.202  -48.546 43.692 1.00 84.19  ? 55   LEU C CD2 1 
ATOM   7451 N N   . LEU C 2 56  ? 2.453   -51.402 43.913 1.00 80.85  ? 56   LEU C N   1 
ATOM   7452 C CA  . LEU C 2 56  ? 3.446   -51.873 44.868 1.00 80.67  ? 56   LEU C CA  1 
ATOM   7453 C C   . LEU C 2 56  ? 4.641   -50.924 44.897 1.00 80.41  ? 56   LEU C C   1 
ATOM   7454 O O   . LEU C 2 56  ? 5.181   -50.635 45.966 1.00 80.33  ? 56   LEU C O   1 
ATOM   7455 C CB  . LEU C 2 56  ? 3.893   -53.296 44.517 1.00 80.57  ? 56   LEU C CB  1 
ATOM   7456 C CG  . LEU C 2 56  ? 4.430   -54.189 45.638 1.00 80.50  ? 56   LEU C CG  1 
ATOM   7457 C CD1 . LEU C 2 56  ? 3.314   -54.647 46.568 1.00 80.77  ? 56   LEU C CD1 1 
ATOM   7458 C CD2 . LEU C 2 56  ? 5.143   -55.391 45.048 1.00 80.35  ? 56   LEU C CD2 1 
ATOM   7459 N N   . GLU C 2 57  ? 5.037   -50.432 43.723 1.00 86.50  ? 57   GLU C N   1 
ATOM   7460 C CA  . GLU C 2 57  ? 6.161   -49.498 43.604 1.00 86.27  ? 57   GLU C CA  1 
ATOM   7461 C C   . GLU C 2 57  ? 5.780   -48.072 44.013 1.00 86.35  ? 57   GLU C C   1 
ATOM   7462 O O   . GLU C 2 57  ? 6.640   -47.189 44.101 1.00 86.18  ? 57   GLU C O   1 
ATOM   7463 C CB  . GLU C 2 57  ? 6.745   -49.509 42.187 1.00 86.13  ? 57   GLU C CB  1 
ATOM   7464 C CG  . GLU C 2 57  ? 8.174   -48.980 42.114 1.00 85.87  ? 57   GLU C CG  1 
ATOM   7465 C CD  . GLU C 2 57  ? 8.626   -48.674 40.706 1.00 85.78  ? 57   GLU C CD  1 
ATOM   7466 O OE1 . GLU C 2 57  ? 7.912   -47.934 39.998 1.00 85.91  ? 57   GLU C OE1 1 
ATOM   7467 O OE2 . GLU C 2 57  ? 9.707   -49.161 40.312 1.00 85.60  ? 57   GLU C OE2 1 
ATOM   7468 N N   . THR C 2 58  ? 4.489   -47.853 44.255 1.00 84.14  ? 58   THR C N   1 
ATOM   7469 C CA  . THR C 2 58  ? 4.008   -46.594 44.812 1.00 84.27  ? 58   THR C CA  1 
ATOM   7470 C C   . THR C 2 58  ? 4.505   -46.476 46.252 1.00 84.22  ? 58   THR C C   1 
ATOM   7471 O O   . THR C 2 58  ? 4.715   -45.372 46.761 1.00 84.22  ? 58   THR C O   1 
ATOM   7472 C CB  . THR C 2 58  ? 2.465   -46.507 44.780 1.00 84.62  ? 58   THR C CB  1 
ATOM   7473 O OG1 . THR C 2 58  ? 1.975   -47.061 43.553 1.00 84.69  ? 58   THR C OG1 1 
ATOM   7474 C CG2 . THR C 2 58  ? 1.997   -45.060 44.899 1.00 84.74  ? 58   THR C CG2 1 
ATOM   7475 N N   . TYR C 2 59  ? 4.707   -47.629 46.889 1.00 77.35  ? 59   TYR C N   1 
ATOM   7476 C CA  . TYR C 2 59  ? 5.192   -47.696 48.266 1.00 77.33  ? 59   TYR C CA  1 
ATOM   7477 C C   . TYR C 2 59  ? 6.722   -47.710 48.388 1.00 77.03  ? 59   TYR C C   1 
ATOM   7478 O O   . TYR C 2 59  ? 7.255   -47.716 49.501 1.00 77.01  ? 59   TYR C O   1 
ATOM   7479 C CB  . TYR C 2 59  ? 4.581   -48.903 48.987 1.00 77.50  ? 59   TYR C CB  1 
ATOM   7480 C CG  . TYR C 2 59  ? 3.146   -48.693 49.420 1.00 77.85  ? 59   TYR C CG  1 
ATOM   7481 C CD1 . TYR C 2 59  ? 2.848   -48.030 50.610 1.00 78.03  ? 59   TYR C CD1 1 
ATOM   7482 C CD2 . TYR C 2 59  ? 2.088   -49.157 48.642 1.00 78.03  ? 59   TYR C CD2 1 
ATOM   7483 C CE1 . TYR C 2 59  ? 1.532   -47.834 51.014 1.00 78.38  ? 59   TYR C CE1 1 
ATOM   7484 C CE2 . TYR C 2 59  ? 0.768   -48.968 49.038 1.00 78.37  ? 59   TYR C CE2 1 
ATOM   7485 C CZ  . TYR C 2 59  ? 0.498   -48.305 50.224 1.00 78.55  ? 59   TYR C CZ  1 
ATOM   7486 O OH  . TYR C 2 59  ? -0.805  -48.114 50.623 1.00 78.92  ? 59   TYR C OH  1 
ATOM   7487 N N   . CYS C 2 60  ? 7.420   -47.710 47.251 1.00 84.18  ? 60   CYS C N   1 
ATOM   7488 C CA  . CYS C 2 60  ? 8.880   -47.586 47.240 1.00 83.91  ? 60   CYS C CA  1 
ATOM   7489 C C   . CYS C 2 60  ? 9.297   -46.202 47.716 1.00 83.87  ? 60   CYS C C   1 
ATOM   7490 O O   . CYS C 2 60  ? 8.736   -45.194 47.279 1.00 83.95  ? 60   CYS C O   1 
ATOM   7491 C CB  . CYS C 2 60  ? 9.451   -47.835 45.840 1.00 83.73  ? 60   CYS C CB  1 
ATOM   7492 S SG  . CYS C 2 60  ? 9.490   -49.560 45.292 1.00 83.73  ? 60   CYS C SG  1 
ATOM   7493 N N   . ALA C 2 61  ? 10.281  -46.161 48.612 1.00 87.41  ? 61   ALA C N   1 
ATOM   7494 C CA  . ALA C 2 61  ? 10.783  -44.903 49.159 1.00 87.37  ? 61   ALA C CA  1 
ATOM   7495 C C   . ALA C 2 61  ? 11.415  -44.028 48.079 1.00 87.19  ? 61   ALA C C   1 
ATOM   7496 O O   . ALA C 2 61  ? 11.878  -44.526 47.048 1.00 87.05  ? 61   ALA C O   1 
ATOM   7497 C CB  . ALA C 2 61  ? 11.769  -45.165 50.283 1.00 87.30  ? 61   ALA C CB  1 
ATOM   7498 N N   . THR C 2 62  ? 11.418  -42.722 48.331 1.00 108.04 ? 62   THR C N   1 
ATOM   7499 C CA  . THR C 2 62  ? 11.929  -41.730 47.386 1.00 107.91 ? 62   THR C CA  1 
ATOM   7500 C C   . THR C 2 62  ? 13.446  -41.847 47.163 1.00 107.66 ? 62   THR C C   1 
ATOM   7501 O O   . THR C 2 62  ? 14.211  -41.933 48.128 1.00 107.60 ? 62   THR C O   1 
ATOM   7502 C CB  . THR C 2 62  ? 11.538  -40.284 47.809 1.00 108.02 ? 62   THR C CB  1 
ATOM   7503 O OG1 . THR C 2 62  ? 12.262  -39.332 47.020 1.00 107.86 ? 62   THR C OG1 1 
ATOM   7504 C CG2 . THR C 2 62  ? 11.822  -40.037 49.294 1.00 108.08 ? 62   THR C CG2 1 
ATOM   7505 N N   . PRO C 2 63  ? 13.879  -41.862 45.886 1.00 130.26 ? 63   PRO C N   1 
ATOM   7506 C CA  . PRO C 2 63  ? 15.304  -41.919 45.556 1.00 130.04 ? 63   PRO C CA  1 
ATOM   7507 C C   . PRO C 2 63  ? 16.007  -40.595 45.841 1.00 129.97 ? 63   PRO C C   1 
ATOM   7508 O O   . PRO C 2 63  ? 17.232  -40.561 45.952 1.00 129.82 ? 63   PRO C O   1 
ATOM   7509 C CB  . PRO C 2 63  ? 15.302  -42.205 44.052 1.00 129.99 ? 63   PRO C CB  1 
ATOM   7510 C CG  . PRO C 2 63  ? 14.025  -41.629 43.563 1.00 130.16 ? 63   PRO C CG  1 
ATOM   7511 C CD  . PRO C 2 63  ? 13.036  -41.838 44.674 1.00 130.33 ? 63   PRO C CD  1 
ATOM   7512 N N   . GLU D 2 6   ? -1.609  -13.783 27.152 1.00 102.73 ? 6    GLU D N   1 
ATOM   7513 C CA  . GLU D 2 6   ? -0.235  -14.065 27.655 1.00 102.24 ? 6    GLU D CA  1 
ATOM   7514 C C   . GLU D 2 6   ? 0.126   -13.097 28.782 1.00 102.09 ? 6    GLU D C   1 
ATOM   7515 O O   . GLU D 2 6   ? 0.642   -12.004 28.535 1.00 102.03 ? 6    GLU D O   1 
ATOM   7516 C CB  . GLU D 2 6   ? 0.779   -13.975 26.509 1.00 102.10 ? 6    GLU D CB  1 
ATOM   7517 C CG  . GLU D 2 6   ? 2.144   -14.595 26.803 1.00 101.63 ? 6    GLU D CG  1 
ATOM   7518 C CD  . GLU D 2 6   ? 2.117   -16.116 26.803 1.00 101.51 ? 6    GLU D CD  1 
ATOM   7519 O OE1 . GLU D 2 6   ? 1.670   -16.710 27.808 1.00 101.40 ? 6    GLU D OE1 1 
ATOM   7520 O OE2 . GLU D 2 6   ? 2.555   -16.719 25.799 1.00 101.52 ? 6    GLU D OE2 1 
ATOM   7521 N N   . THR D 2 7   ? -0.149  -13.512 30.018 1.00 85.82  ? 7    THR D N   1 
ATOM   7522 C CA  . THR D 2 7   ? 0.024   -12.647 31.189 1.00 85.74  ? 7    THR D CA  1 
ATOM   7523 C C   . THR D 2 7   ? 1.433   -12.712 31.784 1.00 85.27  ? 7    THR D C   1 
ATOM   7524 O O   . THR D 2 7   ? 2.138   -13.717 31.645 1.00 85.01  ? 7    THR D O   1 
ATOM   7525 C CB  . THR D 2 7   ? -1.027  -12.943 32.290 1.00 85.97  ? 7    THR D CB  1 
ATOM   7526 O OG1 . THR D 2 7   ? -0.952  -14.321 32.673 1.00 85.79  ? 7    THR D OG1 1 
ATOM   7527 C CG2 . THR D 2 7   ? -2.437  -12.629 31.793 1.00 86.47  ? 7    THR D CG2 1 
ATOM   7528 N N   . LEU D 2 8   ? 1.826   -11.624 32.446 1.00 73.64  ? 8    LEU D N   1 
ATOM   7529 C CA  . LEU D 2 8   ? 3.160   -11.477 33.025 1.00 73.23  ? 8    LEU D CA  1 
ATOM   7530 C C   . LEU D 2 8   ? 3.034   -11.068 34.494 1.00 73.23  ? 8    LEU D C   1 
ATOM   7531 O O   . LEU D 2 8   ? 3.141   -9.885  34.829 1.00 73.28  ? 8    LEU D O   1 
ATOM   7532 C CB  . LEU D 2 8   ? 3.963   -10.423 32.248 1.00 73.11  ? 8    LEU D CB  1 
ATOM   7533 C CG  . LEU D 2 8   ? 3.705   -10.246 30.743 1.00 73.29  ? 8    LEU D CG  1 
ATOM   7534 C CD1 . LEU D 2 8   ? 4.098   -8.849  30.283 1.00 73.30  ? 8    LEU D CD1 1 
ATOM   7535 C CD2 . LEU D 2 8   ? 4.401   -11.323 29.906 1.00 73.11  ? 8    LEU D CD2 1 
ATOM   7536 N N   . CYS D 2 9   ? 2.808   -12.053 35.363 1.00 73.14  ? 9    CYS D N   1 
ATOM   7537 C CA  . CYS D 2 9   ? 2.462   -11.795 36.768 1.00 73.22  ? 9    CYS D CA  1 
ATOM   7538 C C   . CYS D 2 9   ? 3.505   -12.274 37.782 1.00 72.88  ? 9    CYS D C   1 
ATOM   7539 O O   . CYS D 2 9   ? 4.452   -12.984 37.430 1.00 72.56  ? 9    CYS D O   1 
ATOM   7540 C CB  . CYS D 2 9   ? 1.101   -12.421 37.097 1.00 73.57  ? 9    CYS D CB  1 
ATOM   7541 S SG  . CYS D 2 9   ? -0.289  -11.727 36.175 1.00 74.06  ? 9    CYS D SG  1 
ATOM   7542 N N   . GLY D 2 10  ? 3.313   -11.871 39.039 1.00 75.24  ? 10   GLY D N   1 
ATOM   7543 C CA  . GLY D 2 10  ? 4.138   -12.322 40.161 1.00 74.98  ? 10   GLY D CA  1 
ATOM   7544 C C   . GLY D 2 10  ? 5.552   -11.777 40.150 1.00 74.63  ? 10   GLY D C   1 
ATOM   7545 O O   . GLY D 2 10  ? 5.780   -10.620 39.786 1.00 74.65  ? 10   GLY D O   1 
ATOM   7546 N N   . GLY D 2 11  ? 6.501   -12.620 40.556 1.00 68.92  ? 11   GLY D N   1 
ATOM   7547 C CA  . GLY D 2 11  ? 7.921   -12.270 40.544 1.00 68.59  ? 11   GLY D CA  1 
ATOM   7548 C C   . GLY D 2 11  ? 8.496   -12.220 39.140 1.00 68.44  ? 11   GLY D C   1 
ATOM   7549 O O   . GLY D 2 11  ? 9.548   -11.617 38.913 1.00 68.22  ? 11   GLY D O   1 
ATOM   7550 N N   . GLU D 2 12  ? 7.792   -12.853 38.202 1.00 66.64  ? 12   GLU D N   1 
ATOM   7551 C CA  . GLU D 2 12  ? 8.185   -12.888 36.793 1.00 66.56  ? 12   GLU D CA  1 
ATOM   7552 C C   . GLU D 2 12  ? 7.999   -11.538 36.091 1.00 66.70  ? 12   GLU D C   1 
ATOM   7553 O O   . GLU D 2 12  ? 8.548   -11.320 35.010 1.00 66.61  ? 12   GLU D O   1 
ATOM   7554 C CB  . GLU D 2 12  ? 7.422   -13.990 36.052 1.00 66.69  ? 12   GLU D CB  1 
ATOM   7555 C CG  . GLU D 2 12  ? 7.735   -15.398 36.549 1.00 66.52  ? 12   GLU D CG  1 
ATOM   7556 C CD  . GLU D 2 12  ? 6.926   -16.475 35.847 1.00 66.67  ? 12   GLU D CD  1 
ATOM   7557 O OE1 . GLU D 2 12  ? 5.693   -16.313 35.711 1.00 66.99  ? 12   GLU D OE1 1 
ATOM   7558 O OE2 . GLU D 2 12  ? 7.526   -17.494 35.443 1.00 66.48  ? 12   GLU D OE2 1 
ATOM   7559 N N   . LEU D 2 13  ? 7.219   -10.649 36.704 1.00 58.40  ? 13   LEU D N   1 
ATOM   7560 C CA  . LEU D 2 13  ? 7.109   -9.259  36.257 1.00 58.53  ? 13   LEU D CA  1 
ATOM   7561 C C   . LEU D 2 13  ? 8.223   -8.413  36.879 1.00 58.30  ? 13   LEU D C   1 
ATOM   7562 O O   . LEU D 2 13  ? 8.772   -7.519  36.230 1.00 58.23  ? 13   LEU D O   1 
ATOM   7563 C CB  . LEU D 2 13  ? 5.734   -8.674  36.617 1.00 58.93  ? 13   LEU D CB  1 
ATOM   7564 C CG  . LEU D 2 13  ? 5.432   -7.212  36.247 1.00 59.13  ? 13   LEU D CG  1 
ATOM   7565 C CD1 . LEU D 2 13  ? 5.106   -7.060  34.766 1.00 59.28  ? 13   LEU D CD1 1 
ATOM   7566 C CD2 . LEU D 2 13  ? 4.300   -6.656  37.095 1.00 59.47  ? 13   LEU D CD2 1 
ATOM   7567 N N   . VAL D 2 14  ? 8.546   -8.713  38.137 1.00 54.99  ? 14   VAL D N   1 
ATOM   7568 C CA  . VAL D 2 14  ? 9.549   -7.971  38.905 1.00 54.80  ? 14   VAL D CA  1 
ATOM   7569 C C   . VAL D 2 14  ? 10.964  -8.187  38.355 1.00 54.46  ? 14   VAL D C   1 
ATOM   7570 O O   . VAL D 2 14  ? 11.731  -7.229  38.209 1.00 54.36  ? 14   VAL D O   1 
ATOM   7571 C CB  . VAL D 2 14  ? 9.489   -8.330  40.418 1.00 54.80  ? 14   VAL D CB  1 
ATOM   7572 C CG1 . VAL D 2 14  ? 10.485  -7.498  41.220 1.00 54.61  ? 14   VAL D CG1 1 
ATOM   7573 C CG2 . VAL D 2 14  ? 8.081   -8.126  40.963 1.00 55.16  ? 14   VAL D CG2 1 
ATOM   7574 N N   . ASP D 2 15  ? 11.294  -9.442  38.047 1.00 55.83  ? 15   ASP D N   1 
ATOM   7575 C CA  . ASP D 2 15  ? 12.594  -9.793  37.467 1.00 55.53  ? 15   ASP D CA  1 
ATOM   7576 C C   . ASP D 2 15  ? 12.801  -9.158  36.092 1.00 55.55  ? 15   ASP D C   1 
ATOM   7577 O O   . ASP D 2 15  ? 13.928  -8.821  35.721 1.00 55.34  ? 15   ASP D O   1 
ATOM   7578 C CB  . ASP D 2 15  ? 12.756  -11.315 37.375 1.00 55.40  ? 15   ASP D CB  1 
ATOM   7579 C CG  . ASP D 2 15  ? 13.141  -11.950 38.705 1.00 55.27  ? 15   ASP D CG  1 
ATOM   7580 O OD1 . ASP D 2 15  ? 13.844  -11.299 39.509 1.00 55.16  ? 15   ASP D OD1 1 
ATOM   7581 O OD2 . ASP D 2 15  ? 12.748  -13.111 38.943 1.00 55.28  ? 15   ASP D OD2 1 
ATOM   7582 N N   . THR D 2 16  ? 11.705  -8.998  35.352 1.00 55.40  ? 16   THR D N   1 
ATOM   7583 C CA  . THR D 2 16  ? 11.723  -8.391  34.020 1.00 55.48  ? 16   THR D CA  1 
ATOM   7584 C C   . THR D 2 16  ? 11.893  -6.869  34.090 1.00 55.54  ? 16   THR D C   1 
ATOM   7585 O O   . THR D 2 16  ? 12.510  -6.270  33.206 1.00 55.48  ? 16   THR D O   1 
ATOM   7586 C CB  . THR D 2 16  ? 10.446  -8.751  33.219 1.00 55.78  ? 16   THR D CB  1 
ATOM   7587 O OG1 . THR D 2 16  ? 10.186  -10.155 33.338 1.00 55.74  ? 16   THR D OG1 1 
ATOM   7588 C CG2 . THR D 2 16  ? 10.605  -8.403  31.742 1.00 55.85  ? 16   THR D CG2 1 
ATOM   7589 N N   . LEU D 2 17  ? 11.350  -6.256  35.143 1.00 50.28  ? 17   LEU D N   1 
ATOM   7590 C CA  . LEU D 2 17  ? 11.459  -4.809  35.360 1.00 50.35  ? 17   LEU D CA  1 
ATOM   7591 C C   . LEU D 2 17  ? 12.909  -4.329  35.448 1.00 50.07  ? 17   LEU D C   1 
ATOM   7592 O O   . LEU D 2 17  ? 13.316  -3.423  34.715 1.00 50.07  ? 17   LEU D O   1 
ATOM   7593 C CB  . LEU D 2 17  ? 10.692  -4.397  36.622 1.00 50.54  ? 17   LEU D CB  1 
ATOM   7594 C CG  . LEU D 2 17  ? 9.193   -4.131  36.482 1.00 50.92  ? 17   LEU D CG  1 
ATOM   7595 C CD1 . LEU D 2 17  ? 8.468   -4.430  37.784 1.00 51.09  ? 17   LEU D CD1 1 
ATOM   7596 C CD2 . LEU D 2 17  ? 8.934   -2.698  36.029 1.00 51.10  ? 17   LEU D CD2 1 
ATOM   7597 N N   . GLN D 2 18  ? 13.677  -4.951  36.341 1.00 51.28  ? 18   GLN D N   1 
ATOM   7598 C CA  . GLN D 2 18  ? 15.082  -4.600  36.564 1.00 51.02  ? 18   GLN D CA  1 
ATOM   7599 C C   . GLN D 2 18  ? 15.981  -5.020  35.404 1.00 50.85  ? 18   GLN D C   1 
ATOM   7600 O O   . GLN D 2 18  ? 17.085  -4.499  35.244 1.00 50.70  ? 18   GLN D O   1 
ATOM   7601 C CB  . GLN D 2 18  ? 15.586  -5.204  37.880 1.00 50.85  ? 18   GLN D CB  1 
ATOM   7602 C CG  . GLN D 2 18  ? 15.317  -6.699  38.043 1.00 50.79  ? 18   GLN D CG  1 
ATOM   7603 C CD  . GLN D 2 18  ? 15.491  -7.175  39.476 1.00 50.73  ? 18   GLN D CD  1 
ATOM   7604 O OE1 . GLN D 2 18  ? 16.387  -6.724  40.195 1.00 50.59  ? 18   GLN D OE1 1 
ATOM   7605 N NE2 . GLN D 2 18  ? 14.631  -8.097  39.899 1.00 50.84  ? 18   GLN D NE2 1 
ATOM   7606 N N   . PHE D 2 19  ? 15.501  -5.969  34.606 1.00 57.59  ? 19   PHE D N   1 
ATOM   7607 C CA  . PHE D 2 19  ? 16.191  -6.381  33.390 1.00 57.49  ? 19   PHE D CA  1 
ATOM   7608 C C   . PHE D 2 19  ? 16.142  -5.272  32.340 1.00 57.63  ? 19   PHE D C   1 
ATOM   7609 O O   . PHE D 2 19  ? 17.075  -5.111  31.551 1.00 57.52  ? 19   PHE D O   1 
ATOM   7610 C CB  . PHE D 2 19  ? 15.587  -7.679  32.845 1.00 57.55  ? 19   PHE D CB  1 
ATOM   7611 C CG  . PHE D 2 19  ? 16.141  -8.099  31.512 1.00 57.51  ? 19   PHE D CG  1 
ATOM   7612 C CD1 . PHE D 2 19  ? 17.497  -8.385  31.360 1.00 57.27  ? 19   PHE D CD1 1 
ATOM   7613 C CD2 . PHE D 2 19  ? 15.304  -8.214  30.409 1.00 57.74  ? 19   PHE D CD2 1 
ATOM   7614 C CE1 . PHE D 2 19  ? 18.011  -8.777  30.125 1.00 57.27  ? 19   PHE D CE1 1 
ATOM   7615 C CE2 . PHE D 2 19  ? 15.807  -8.606  29.169 1.00 57.74  ? 19   PHE D CE2 1 
ATOM   7616 C CZ  . PHE D 2 19  ? 17.163  -8.888  29.027 1.00 57.50  ? 19   PHE D CZ  1 
ATOM   7617 N N   . VAL D 2 20  ? 15.055  -4.506  32.349 1.00 60.30  ? 20   VAL D N   1 
ATOM   7618 C CA  . VAL D 2 20  ? 14.882  -3.397  31.416 1.00 60.47  ? 20   VAL D CA  1 
ATOM   7619 C C   . VAL D 2 20  ? 15.359  -2.079  32.034 1.00 60.43  ? 20   VAL D C   1 
ATOM   7620 O O   . VAL D 2 20  ? 16.111  -1.327  31.408 1.00 60.37  ? 20   VAL D O   1 
ATOM   7621 C CB  . VAL D 2 20  ? 13.410  -3.273  30.936 1.00 60.81  ? 20   VAL D CB  1 
ATOM   7622 C CG1 . VAL D 2 20  ? 13.282  -2.214  29.851 1.00 61.00  ? 20   VAL D CG1 1 
ATOM   7623 C CG2 . VAL D 2 20  ? 12.900  -4.609  30.416 1.00 60.87  ? 20   VAL D CG2 1 
ATOM   7624 N N   . CYS D 2 21  ? 14.929  -1.813  33.265 1.00 57.77  ? 21   CYS D N   1 
ATOM   7625 C CA  . CYS D 2 21  ? 15.235  -0.551  33.932 1.00 57.76  ? 21   CYS D CA  1 
ATOM   7626 C C   . CYS D 2 21  ? 16.630  -0.529  34.551 1.00 57.46  ? 21   CYS D C   1 
ATOM   7627 O O   . CYS D 2 21  ? 17.409  0.394   34.300 1.00 57.39  ? 21   CYS D O   1 
ATOM   7628 C CB  . CYS D 2 21  ? 14.170  -0.228  34.981 1.00 57.97  ? 21   CYS D CB  1 
ATOM   7629 S SG  . CYS D 2 21  ? 12.488  -0.130  34.323 1.00 58.37  ? 21   CYS D SG  1 
ATOM   7630 N N   . GLY D 2 22  ? 16.935  -1.542  35.359 1.00 55.28  ? 22   GLY D N   1 
ATOM   7631 C CA  . GLY D 2 22  ? 18.254  -1.686  35.968 1.00 55.01  ? 22   GLY D CA  1 
ATOM   7632 C C   . GLY D 2 22  ? 18.585  -0.602  36.970 1.00 55.00  ? 22   GLY D C   1 
ATOM   7633 O O   . GLY D 2 22  ? 17.827  -0.365  37.913 1.00 55.15  ? 22   GLY D O   1 
ATOM   7634 N N   . ASP D 2 23  ? 19.718  0.061   36.749 1.00 61.60  ? 23   ASP D N   1 
ATOM   7635 C CA  . ASP D 2 23  ? 20.210  1.116   37.638 1.00 61.58  ? 23   ASP D CA  1 
ATOM   7636 C C   . ASP D 2 23  ? 19.381  2.398   37.579 1.00 61.82  ? 23   ASP D C   1 
ATOM   7637 O O   . ASP D 2 23  ? 19.464  3.232   38.486 1.00 61.87  ? 23   ASP D O   1 
ATOM   7638 C CB  . ASP D 2 23  ? 21.682  1.424   37.343 1.00 61.37  ? 23   ASP D CB  1 
ATOM   7639 C CG  . ASP D 2 23  ? 22.599  0.251   37.646 1.00 61.15  ? 23   ASP D CG  1 
ATOM   7640 O OD1 . ASP D 2 23  ? 22.112  -0.778  38.162 1.00 61.14  ? 23   ASP D OD1 1 
ATOM   7641 O OD2 . ASP D 2 23  ? 23.812  0.362   37.368 1.00 60.99  ? 23   ASP D OD2 1 
ATOM   7642 N N   . ARG D 2 24  ? 18.597  2.554   36.512 1.00 72.09  ? 24   ARG D N   1 
ATOM   7643 C CA  . ARG D 2 24  ? 17.653  3.666   36.397 1.00 72.35  ? 24   ARG D CA  1 
ATOM   7644 C C   . ARG D 2 24  ? 16.543  3.529   37.431 1.00 72.54  ? 24   ARG D C   1 
ATOM   7645 O O   . ARG D 2 24  ? 16.073  4.525   37.981 1.00 72.71  ? 24   ARG D O   1 
ATOM   7646 C CB  . ARG D 2 24  ? 17.043  3.728   34.995 1.00 72.51  ? 24   ARG D CB  1 
ATOM   7647 C CG  . ARG D 2 24  ? 17.932  4.362   33.936 1.00 72.42  ? 24   ARG D CG  1 
ATOM   7648 C CD  . ARG D 2 24  ? 17.195  4.491   32.612 1.00 72.64  ? 24   ARG D CD  1 
ATOM   7649 N NE  . ARG D 2 24  ? 16.796  3.190   32.081 1.00 72.65  ? 24   ARG D NE  1 
ATOM   7650 C CZ  . ARG D 2 24  ? 15.858  3.004   31.158 1.00 72.88  ? 24   ARG D CZ  1 
ATOM   7651 N NH1 . ARG D 2 24  ? 15.201  4.037   30.646 1.00 73.15  ? 24   ARG D NH1 1 
ATOM   7652 N NH2 . ARG D 2 24  ? 15.573  1.776   30.748 1.00 72.87  ? 24   ARG D NH2 1 
ATOM   7653 N N   . GLY D 2 25  ? 16.143  2.286   37.694 1.00 60.35  ? 25   GLY D N   1 
ATOM   7654 C CA  . GLY D 2 25  ? 15.058  1.994   38.622 1.00 60.55  ? 25   GLY D CA  1 
ATOM   7655 C C   . GLY D 2 25  ? 13.713  2.005   37.923 1.00 60.84  ? 25   GLY D C   1 
ATOM   7656 O O   . GLY D 2 25  ? 13.602  2.439   36.775 1.00 60.91  ? 25   GLY D O   1 
ATOM   7657 N N   . PHE D 2 26  ? 12.689  1.525   38.621 1.00 56.19  ? 26   PHE D N   1 
ATOM   7658 C CA  . PHE D 2 26  ? 11.336  1.473   38.074 1.00 56.50  ? 26   PHE D CA  1 
ATOM   7659 C C   . PHE D 2 26  ? 10.275  1.826   39.112 1.00 56.79  ? 26   PHE D C   1 
ATOM   7660 O O   . PHE D 2 26  ? 10.531  1.787   40.316 1.00 56.74  ? 26   PHE D O   1 
ATOM   7661 C CB  . PHE D 2 26  ? 11.043  0.100   37.452 1.00 56.45  ? 26   PHE D CB  1 
ATOM   7662 C CG  . PHE D 2 26  ? 11.428  -1.066  38.323 1.00 56.27  ? 26   PHE D CG  1 
ATOM   7663 C CD1 . PHE D 2 26  ? 12.706  -1.612  38.250 1.00 55.93  ? 26   PHE D CD1 1 
ATOM   7664 C CD2 . PHE D 2 26  ? 10.511  -1.628  39.204 1.00 56.45  ? 26   PHE D CD2 1 
ATOM   7665 C CE1 . PHE D 2 26  ? 13.066  -2.690  39.048 1.00 55.78  ? 26   PHE D CE1 1 
ATOM   7666 C CE2 . PHE D 2 26  ? 10.863  -2.707  40.006 1.00 56.29  ? 26   PHE D CE2 1 
ATOM   7667 C CZ  . PHE D 2 26  ? 12.141  -3.239  39.925 1.00 55.95  ? 26   PHE D CZ  1 
ATOM   7668 N N   . TYR D 2 27  ? 9.089   2.178   38.628 1.00 60.29  ? 27   TYR D N   1 
ATOM   7669 C CA  . TYR D 2 27  ? 7.950   2.461   39.488 1.00 60.63  ? 27   TYR D CA  1 
ATOM   7670 C C   . TYR D 2 27  ? 6.926   1.333   39.391 1.00 60.81  ? 27   TYR D C   1 
ATOM   7671 O O   . TYR D 2 27  ? 7.206   0.262   38.848 1.00 60.62  ? 27   TYR D O   1 
ATOM   7672 C CB  . TYR D 2 27  ? 7.290   3.781   39.080 1.00 60.93  ? 27   TYR D CB  1 
ATOM   7673 C CG  . TYR D 2 27  ? 8.154   5.009   39.243 1.00 60.82  ? 27   TYR D CG  1 
ATOM   7674 C CD1 . TYR D 2 27  ? 8.224   5.678   40.464 1.00 60.91  ? 27   TYR D CD1 1 
ATOM   7675 C CD2 . TYR D 2 27  ? 8.884   5.517   38.171 1.00 60.65  ? 27   TYR D CD2 1 
ATOM   7676 C CE1 . TYR D 2 27  ? 9.012   6.816   40.617 1.00 60.81  ? 27   TYR D CE1 1 
ATOM   7677 C CE2 . TYR D 2 27  ? 9.673   6.654   38.313 1.00 60.56  ? 27   TYR D CE2 1 
ATOM   7678 C CZ  . TYR D 2 27  ? 9.734   7.297   39.538 1.00 60.63  ? 27   TYR D CZ  1 
ATOM   7679 O OH  . TYR D 2 27  ? 10.514  8.424   39.684 1.00 60.55  ? 27   TYR D OH  1 
ATOM   7680 N N   . PHE D 2 28  ? 5.743   1.589   39.942 1.00 57.79  ? 28   PHE D N   1 
ATOM   7681 C CA  . PHE D 2 28  ? 4.567   0.761   39.710 1.00 58.05  ? 28   PHE D CA  1 
ATOM   7682 C C   . PHE D 2 28  ? 3.383   1.659   39.335 1.00 58.49  ? 28   PHE D C   1 
ATOM   7683 O O   . PHE D 2 28  ? 2.243   1.199   39.224 1.00 58.80  ? 28   PHE D O   1 
ATOM   7684 C CB  . PHE D 2 28  ? 4.253   -0.098  40.939 1.00 58.09  ? 28   PHE D CB  1 
ATOM   7685 C CG  . PHE D 2 28  ? 5.263   -1.185  41.198 1.00 57.70  ? 28   PHE D CG  1 
ATOM   7686 C CD1 . PHE D 2 28  ? 5.283   -2.337  40.417 1.00 57.56  ? 28   PHE D CD1 1 
ATOM   7687 C CD2 . PHE D 2 28  ? 6.186   -1.064  42.230 1.00 57.49  ? 28   PHE D CD2 1 
ATOM   7688 C CE1 . PHE D 2 28  ? 6.211   -3.346  40.653 1.00 57.22  ? 28   PHE D CE1 1 
ATOM   7689 C CE2 . PHE D 2 28  ? 7.117   -2.072  42.476 1.00 57.15  ? 28   PHE D CE2 1 
ATOM   7690 C CZ  . PHE D 2 28  ? 7.128   -3.214  41.684 1.00 57.01  ? 28   PHE D CZ  1 
ATOM   7691 N N   . SER D 2 29  ? 3.682   2.943   39.137 1.00 68.55  ? 29   SER D N   1 
ATOM   7692 C CA  . SER D 2 29  ? 2.702   3.951   38.738 1.00 68.96  ? 29   SER D CA  1 
ATOM   7693 C C   . SER D 2 29  ? 3.369   5.009   37.856 1.00 68.86  ? 29   SER D C   1 
ATOM   7694 O O   . SER D 2 29  ? 2.827   6.093   37.634 1.00 69.13  ? 29   SER D O   1 
ATOM   7695 C CB  . SER D 2 29  ? 2.071   4.604   39.971 1.00 69.25  ? 29   SER D CB  1 
ATOM   7696 O OG  . SER D 2 29  ? 1.313   3.665   40.714 1.00 69.41  ? 29   SER D OG  1 
ATOM   7697 N N   . ARG D 2 40  ? -4.370  4.080   35.966 1.00 72.46  ? 40   ARG D N   1 
ATOM   7698 C CA  . ARG D 2 40  ? -4.056  2.664   36.147 1.00 72.16  ? 40   ARG D CA  1 
ATOM   7699 C C   . ARG D 2 40  ? -2.601  2.440   36.567 1.00 71.60  ? 40   ARG D C   1 
ATOM   7700 O O   . ARG D 2 40  ? -1.834  3.396   36.727 1.00 71.44  ? 40   ARG D O   1 
ATOM   7701 C CB  . ARG D 2 40  ? -4.361  1.874   34.868 1.00 72.21  ? 40   ARG D CB  1 
ATOM   7702 C CG  . ARG D 2 40  ? -5.828  1.519   34.671 1.00 72.71  ? 40   ARG D CG  1 
ATOM   7703 C CD  . ARG D 2 40  ? -6.011  0.636   33.443 1.00 72.72  ? 40   ARG D CD  1 
ATOM   7704 N NE  . ARG D 2 40  ? -7.420  0.403   33.126 1.00 73.25  ? 40   ARG D NE  1 
ATOM   7705 C CZ  . ARG D 2 40  ? -7.857  -0.176  32.010 1.00 73.40  ? 40   ARG D CZ  1 
ATOM   7706 N NH1 . ARG D 2 40  ? -6.999  -0.588  31.084 1.00 73.09  ? 40   ARG D NH1 1 
ATOM   7707 N NH2 . ARG D 2 40  ? -9.158  -0.341  31.816 1.00 73.91  ? 40   ARG D NH2 1 
ATOM   7708 N N   . GLY D 2 41  ? -2.238  1.170   36.748 1.00 61.94  ? 41   GLY D N   1 
ATOM   7709 C CA  . GLY D 2 41  ? -0.875  0.780   37.106 1.00 61.42  ? 41   GLY D CA  1 
ATOM   7710 C C   . GLY D 2 41  ? -0.286  -0.252  36.160 1.00 61.13  ? 41   GLY D C   1 
ATOM   7711 O O   . GLY D 2 41  ? -0.962  -0.723  35.242 1.00 61.32  ? 41   GLY D O   1 
ATOM   7712 N N   . ILE D 2 42  ? 0.977   -0.603  36.394 1.00 54.80  ? 42   ILE D N   1 
ATOM   7713 C CA  . ILE D 2 42  ? 1.700   -1.560  35.549 1.00 54.48  ? 42   ILE D CA  1 
ATOM   7714 C C   . ILE D 2 42  ? 1.194   -3.002  35.704 1.00 54.52  ? 42   ILE D C   1 
ATOM   7715 O O   . ILE D 2 42  ? 1.212   -3.776  34.743 1.00 54.50  ? 42   ILE D O   1 
ATOM   7716 C CB  . ILE D 2 42  ? 3.245   -1.483  35.765 1.00 54.01  ? 42   ILE D CB  1 
ATOM   7717 C CG1 . ILE D 2 42  ? 3.984   -2.305  34.699 1.00 53.73  ? 42   ILE D CG1 1 
ATOM   7718 C CG2 . ILE D 2 42  ? 3.628   -1.905  37.187 1.00 53.86  ? 42   ILE D CG2 1 
ATOM   7719 C CD1 . ILE D 2 42  ? 5.481   -2.085  34.649 1.00 53.33  ? 42   ILE D CD1 1 
ATOM   7720 N N   . VAL D 2 43  ? 0.740   -3.352  36.908 1.00 60.55  ? 43   VAL D N   1 
ATOM   7721 C CA  . VAL D 2 43  ? 0.209   -4.690  37.182 1.00 60.60  ? 43   VAL D CA  1 
ATOM   7722 C C   . VAL D 2 43  ? -1.090  -4.908  36.404 1.00 61.01  ? 43   VAL D C   1 
ATOM   7723 O O   . VAL D 2 43  ? -1.394  -6.024  35.982 1.00 61.00  ? 43   VAL D O   1 
ATOM   7724 C CB  . VAL D 2 43  ? -0.031  -4.926  38.698 1.00 60.67  ? 43   VAL D CB  1 
ATOM   7725 C CG1 . VAL D 2 43  ? -0.145  -6.417  39.003 1.00 60.59  ? 43   VAL D CG1 1 
ATOM   7726 C CG2 . VAL D 2 43  ? 1.091   -4.308  39.528 1.00 60.38  ? 43   VAL D CG2 1 
ATOM   7727 N N   . GLU D 2 44  ? -1.843  -3.827  36.209 1.00 64.98  ? 44   GLU D N   1 
ATOM   7728 C CA  . GLU D 2 44  ? -3.073  -3.863  35.421 1.00 65.42  ? 44   GLU D CA  1 
ATOM   7729 C C   . GLU D 2 44  ? -2.801  -3.968  33.920 1.00 65.35  ? 44   GLU D C   1 
ATOM   7730 O O   . GLU D 2 44  ? -3.587  -4.560  33.177 1.00 65.60  ? 44   GLU D O   1 
ATOM   7731 C CB  . GLU D 2 44  ? -3.937  -2.636  35.720 1.00 65.84  ? 44   GLU D CB  1 
ATOM   7732 C CG  . GLU D 2 44  ? -4.626  -2.683  37.077 1.00 66.08  ? 44   GLU D CG  1 
ATOM   7733 C CD  . GLU D 2 44  ? -5.431  -1.433  37.371 1.00 66.52  ? 44   GLU D CD  1 
ATOM   7734 O OE1 . GLU D 2 44  ? -4.845  -0.328  37.369 1.00 66.43  ? 44   GLU D OE1 1 
ATOM   7735 O OE2 . GLU D 2 44  ? -6.650  -1.558  37.618 1.00 66.98  ? 44   GLU D OE2 1 
ATOM   7736 N N   . GLU D 2 45  ? -1.679  -3.399  33.487 1.00 63.95  ? 45   GLU D N   1 
ATOM   7737 C CA  . GLU D 2 45  ? -1.355  -3.305  32.068 1.00 63.92  ? 45   GLU D CA  1 
ATOM   7738 C C   . GLU D 2 45  ? -0.621  -4.537  31.533 1.00 63.58  ? 45   GLU D C   1 
ATOM   7739 O O   . GLU D 2 45  ? -0.788  -4.897  30.365 1.00 63.67  ? 45   GLU D O   1 
ATOM   7740 C CB  . GLU D 2 45  ? -0.540  -2.038  31.801 1.00 63.80  ? 45   GLU D CB  1 
ATOM   7741 C CG  . GLU D 2 45  ? -0.642  -1.517  30.377 1.00 63.98  ? 45   GLU D CG  1 
ATOM   7742 C CD  . GLU D 2 45  ? -0.196  -0.074  30.252 1.00 64.02  ? 45   GLU D CD  1 
ATOM   7743 O OE1 . GLU D 2 45  ? -0.738  0.788   30.978 1.00 64.27  ? 45   GLU D OE1 1 
ATOM   7744 O OE2 . GLU D 2 45  ? 0.692   0.201   29.419 1.00 63.82  ? 45   GLU D OE2 1 
ATOM   7745 N N   . CYS D 2 46  ? 0.175   -5.180  32.387 1.00 64.66  ? 46   CYS D N   1 
ATOM   7746 C CA  . CYS D 2 46  ? 1.032   -6.293  31.962 1.00 64.32  ? 46   CYS D CA  1 
ATOM   7747 C C   . CYS D 2 46  ? 0.704   -7.632  32.627 1.00 64.26  ? 46   CYS D C   1 
ATOM   7748 O O   . CYS D 2 46  ? 1.024   -8.691  32.083 1.00 64.08  ? 46   CYS D O   1 
ATOM   7749 C CB  . CYS D 2 46  ? 2.507   -5.941  32.177 1.00 63.89  ? 46   CYS D CB  1 
ATOM   7750 S SG  . CYS D 2 46  ? 3.060   -4.491  31.243 1.00 63.92  ? 46   CYS D SG  1 
ATOM   7751 N N   . CYS D 2 47  ? 0.073   -7.579  33.797 1.00 71.15  ? 47   CYS D N   1 
ATOM   7752 C CA  . CYS D 2 47  ? -0.322  -8.791  34.514 1.00 71.14  ? 47   CYS D CA  1 
ATOM   7753 C C   . CYS D 2 47  ? -1.812  -9.097  34.335 1.00 71.60  ? 47   CYS D C   1 
ATOM   7754 O O   . CYS D 2 47  ? -2.178  -10.238 34.043 1.00 71.63  ? 47   CYS D O   1 
ATOM   7755 C CB  . CYS D 2 47  ? 0.063   -8.695  35.996 1.00 70.99  ? 47   CYS D CB  1 
ATOM   7756 S SG  . CYS D 2 47  ? -0.655  -9.949  37.098 1.00 71.09  ? 47   CYS D SG  1 
ATOM   7757 N N   . PHE D 2 48  ? -2.663  -8.085  34.504 1.00 78.67  ? 48   PHE D N   1 
ATOM   7758 C CA  . PHE D 2 48  ? -4.101  -8.233  34.248 1.00 79.16  ? 48   PHE D CA  1 
ATOM   7759 C C   . PHE D 2 48  ? -4.379  -8.437  32.758 1.00 79.30  ? 48   PHE D C   1 
ATOM   7760 O O   . PHE D 2 48  ? -5.358  -9.086  32.381 1.00 79.61  ? 48   PHE D O   1 
ATOM   7761 C CB  . PHE D 2 48  ? -4.884  -7.023  34.768 1.00 79.53  ? 48   PHE D CB  1 
ATOM   7762 C CG  . PHE D 2 48  ? -5.268  -7.117  36.222 1.00 79.62  ? 48   PHE D CG  1 
ATOM   7763 C CD1 . PHE D 2 48  ? -6.491  -7.670  36.598 1.00 80.04  ? 48   PHE D CD1 1 
ATOM   7764 C CD2 . PHE D 2 48  ? -4.416  -6.643  37.216 1.00 79.31  ? 48   PHE D CD2 1 
ATOM   7765 C CE1 . PHE D 2 48  ? -6.855  -7.757  37.941 1.00 80.15  ? 48   PHE D CE1 1 
ATOM   7766 C CE2 . PHE D 2 48  ? -4.771  -6.723  38.562 1.00 79.42  ? 48   PHE D CE2 1 
ATOM   7767 C CZ  . PHE D 2 48  ? -5.993  -7.282  38.925 1.00 79.84  ? 48   PHE D CZ  1 
ATOM   7768 N N   . ARG D 2 49  ? -3.507  -7.875  31.924 1.00 82.29  ? 49   ARG D N   1 
ATOM   7769 C CA  . ARG D 2 49  ? -3.595  -8.009  30.472 1.00 82.40  ? 49   ARG D CA  1 
ATOM   7770 C C   . ARG D 2 49  ? -2.248  -8.458  29.903 1.00 81.95  ? 49   ARG D C   1 
ATOM   7771 O O   . ARG D 2 49  ? -1.477  -9.146  30.577 1.00 81.59  ? 49   ARG D O   1 
ATOM   7772 C CB  . ARG D 2 49  ? -4.018  -6.677  29.844 1.00 82.73  ? 49   ARG D CB  1 
ATOM   7773 C CG  . ARG D 2 49  ? -5.409  -6.212  30.232 1.00 83.23  ? 49   ARG D CG  1 
ATOM   7774 C CD  . ARG D 2 49  ? -5.584  -4.726  29.979 1.00 83.46  ? 49   ARG D CD  1 
ATOM   7775 N NE  . ARG D 2 49  ? -6.881  -4.252  30.457 1.00 83.95  ? 49   ARG D NE  1 
ATOM   7776 C CZ  . ARG D 2 49  ? -7.118  -3.795  31.685 1.00 84.01  ? 49   ARG D CZ  1 
ATOM   7777 N NH1 . ARG D 2 49  ? -6.144  -3.734  32.585 1.00 83.59  ? 49   ARG D NH1 1 
ATOM   7778 N NH2 . ARG D 2 49  ? -8.338  -3.393  32.013 1.00 84.50  ? 49   ARG D NH2 1 
ATOM   7779 N N   . SER D 2 50  ? -1.981  -8.073  28.657 1.00 83.54  ? 50   SER D N   1 
ATOM   7780 C CA  . SER D 2 50  ? -0.690  -8.309  28.020 1.00 83.16  ? 50   SER D CA  1 
ATOM   7781 C C   . SER D 2 50  ? -0.148  -7.010  27.429 1.00 83.16  ? 50   SER D C   1 
ATOM   7782 O O   . SER D 2 50  ? -0.881  -6.255  26.783 1.00 83.53  ? 50   SER D O   1 
ATOM   7783 C CB  . SER D 2 50  ? -0.796  -9.396  26.944 1.00 83.21  ? 50   SER D CB  1 
ATOM   7784 O OG  . SER D 2 50  ? -1.837  -9.118  26.023 1.00 83.67  ? 50   SER D OG  1 
ATOM   7785 N N   . CYS D 2 51  ? 1.134   -6.753  27.669 1.00 75.18  ? 51   CYS D N   1 
ATOM   7786 C CA  . CYS D 2 51  ? 1.790   -5.548  27.177 1.00 75.13  ? 51   CYS D CA  1 
ATOM   7787 C C   . CYS D 2 51  ? 3.053   -5.913  26.407 1.00 74.81  ? 51   CYS D C   1 
ATOM   7788 O O   . CYS D 2 51  ? 3.451   -7.079  26.379 1.00 74.60  ? 51   CYS D O   1 
ATOM   7789 C CB  . CYS D 2 51  ? 2.140   -4.622  28.346 1.00 74.99  ? 51   CYS D CB  1 
ATOM   7790 S SG  . CYS D 2 51  ? 3.486   -5.232  29.399 1.00 74.44  ? 51   CYS D SG  1 
ATOM   7791 N N   . ASP D 2 52  ? 3.669   -4.916  25.777 1.00 80.57  ? 52   ASP D N   1 
ATOM   7792 C CA  . ASP D 2 52  ? 4.994   -5.080  25.182 1.00 80.26  ? 52   ASP D CA  1 
ATOM   7793 C C   . ASP D 2 52  ? 6.068   -4.467  26.081 1.00 79.91  ? 52   ASP D C   1 
ATOM   7794 O O   . ASP D 2 52  ? 5.754   -3.784  27.060 1.00 79.95  ? 52   ASP D O   1 
ATOM   7795 C CB  . ASP D 2 52  ? 5.054   -4.512  23.750 1.00 80.48  ? 52   ASP D CB  1 
ATOM   7796 C CG  . ASP D 2 52  ? 4.407   -3.139  23.620 1.00 80.79  ? 52   ASP D CG  1 
ATOM   7797 O OD1 . ASP D 2 52  ? 4.804   -2.205  24.349 1.00 80.66  ? 52   ASP D OD1 1 
ATOM   7798 O OD2 . ASP D 2 52  ? 3.509   -2.991  22.764 1.00 81.17  ? 52   ASP D OD2 1 
ATOM   7799 N N   . LEU D 2 53  ? 7.331   -4.719  25.747 1.00 72.13  ? 53   LEU D N   1 
ATOM   7800 C CA  . LEU D 2 53  ? 8.460   -4.218  26.530 1.00 71.79  ? 53   LEU D CA  1 
ATOM   7801 C C   . LEU D 2 53  ? 8.639   -2.700  26.410 1.00 71.88  ? 53   LEU D C   1 
ATOM   7802 O O   . LEU D 2 53  ? 9.380   -2.094  27.185 1.00 71.67  ? 53   LEU D O   1 
ATOM   7803 C CB  . LEU D 2 53  ? 9.743   -4.963  26.149 1.00 71.47  ? 53   LEU D CB  1 
ATOM   7804 C CG  . LEU D 2 53  ? 9.722   -6.477  26.403 1.00 71.32  ? 53   LEU D CG  1 
ATOM   7805 C CD1 . LEU D 2 53  ? 10.740  -7.197  25.535 1.00 71.14  ? 53   LEU D CD1 1 
ATOM   7806 C CD2 . LEU D 2 53  ? 9.940   -6.804  27.877 1.00 71.08  ? 53   LEU D CD2 1 
ATOM   7807 N N   . ALA D 2 54  ? 7.953   -2.099  25.440 1.00 80.20  ? 54   ALA D N   1 
ATOM   7808 C CA  . ALA D 2 54  ? 7.905   -0.646  25.294 1.00 80.35  ? 54   ALA D CA  1 
ATOM   7809 C C   . ALA D 2 54  ? 6.933   -0.035  26.303 1.00 80.54  ? 54   ALA D C   1 
ATOM   7810 O O   . ALA D 2 54  ? 7.217   1.010   26.891 1.00 80.49  ? 54   ALA D O   1 
ATOM   7811 C CB  . ALA D 2 54  ? 7.517   -0.264  23.874 1.00 80.67  ? 54   ALA D CB  1 
ATOM   7812 N N   . LEU D 2 55  ? 5.791   -0.695  26.496 1.00 69.80  ? 55   LEU D N   1 
ATOM   7813 C CA  . LEU D 2 55  ? 4.829   -0.321  27.536 1.00 69.99  ? 55   LEU D CA  1 
ATOM   7814 C C   . LEU D 2 55  ? 5.325   -0.747  28.918 1.00 69.68  ? 55   LEU D C   1 
ATOM   7815 O O   . LEU D 2 55  ? 4.610   -0.615  29.916 1.00 69.82  ? 55   LEU D O   1 
ATOM   7816 C CB  . LEU D 2 55  ? 3.449   -0.936  27.260 1.00 70.36  ? 55   LEU D CB  1 
ATOM   7817 C CG  . LEU D 2 55  ? 2.550   -0.347  26.165 1.00 70.80  ? 55   LEU D CG  1 
ATOM   7818 C CD1 . LEU D 2 55  ? 1.322   -1.229  25.955 1.00 71.11  ? 55   LEU D CD1 1 
ATOM   7819 C CD2 . LEU D 2 55  ? 2.132   1.091   26.474 1.00 71.05  ? 55   LEU D CD2 1 
ATOM   7820 N N   . LEU D 2 56  ? 6.552   -1.261  28.961 1.00 60.42  ? 56   LEU D N   1 
ATOM   7821 C CA  . LEU D 2 56  ? 7.200   -1.656  30.204 1.00 60.11  ? 56   LEU D CA  1 
ATOM   7822 C C   . LEU D 2 56  ? 8.295   -0.656  30.570 1.00 59.87  ? 56   LEU D C   1 
ATOM   7823 O O   . LEU D 2 56  ? 8.457   -0.310  31.742 1.00 59.77  ? 56   LEU D O   1 
ATOM   7824 C CB  . LEU D 2 56  ? 7.786   -3.064  30.075 1.00 59.85  ? 56   LEU D CB  1 
ATOM   7825 C CG  . LEU D 2 56  ? 8.060   -3.849  31.359 1.00 59.62  ? 56   LEU D CG  1 
ATOM   7826 C CD1 . LEU D 2 56  ? 6.778   -4.457  31.908 1.00 59.86  ? 56   LEU D CD1 1 
ATOM   7827 C CD2 . LEU D 2 56  ? 9.083   -4.935  31.097 1.00 59.31  ? 56   LEU D CD2 1 
ATOM   7828 N N   . GLU D 2 57  ? 9.035   -0.193  29.562 1.00 69.36  ? 57   GLU D N   1 
ATOM   7829 C CA  . GLU D 2 57  ? 10.109  0.780   29.768 1.00 69.16  ? 57   GLU D CA  1 
ATOM   7830 C C   . GLU D 2 57  ? 9.569   2.199   29.956 1.00 69.40  ? 57   GLU D C   1 
ATOM   7831 O O   . GLU D 2 57  ? 10.327  3.128   30.253 1.00 69.26  ? 57   GLU D O   1 
ATOM   7832 C CB  . GLU D 2 57  ? 11.127  0.739   28.624 1.00 69.01  ? 57   GLU D CB  1 
ATOM   7833 C CG  . GLU D 2 57  ? 12.501  1.278   29.019 1.00 68.70  ? 57   GLU D CG  1 
ATOM   7834 C CD  . GLU D 2 57  ? 13.400  1.568   27.835 1.00 68.65  ? 57   GLU D CD  1 
ATOM   7835 O OE1 . GLU D 2 57  ? 12.984  2.330   26.938 1.00 68.91  ? 57   GLU D OE1 1 
ATOM   7836 O OE2 . GLU D 2 57  ? 14.534  1.045   27.812 1.00 68.37  ? 57   GLU D OE2 1 
ATOM   7837 N N   . THR D 2 58  ? 8.260   2.361   29.780 1.00 73.80  ? 58   THR D N   1 
ATOM   7838 C CA  . THR D 2 58  ? 7.590   3.613   30.120 1.00 74.06  ? 58   THR D CA  1 
ATOM   7839 C C   . THR D 2 58  ? 7.522   3.773   31.643 1.00 73.99  ? 58   THR D C   1 
ATOM   7840 O O   . THR D 2 58  ? 7.409   4.890   32.158 1.00 74.11  ? 58   THR D O   1 
ATOM   7841 C CB  . THR D 2 58  ? 6.179   3.722   29.474 1.00 74.51  ? 58   THR D CB  1 
ATOM   7842 O OG1 . THR D 2 58  ? 5.639   5.028   29.709 1.00 74.77  ? 58   THR D OG1 1 
ATOM   7843 C CG2 . THR D 2 58  ? 5.218   2.668   30.025 1.00 74.65  ? 58   THR D CG2 1 
ATOM   7844 N N   . TYR D 2 59  ? 7.612   2.646   32.348 1.00 60.31  ? 59   TYR D N   1 
ATOM   7845 C CA  . TYR D 2 59  ? 7.605   2.619   33.808 1.00 60.24  ? 59   TYR D CA  1 
ATOM   7846 C C   . TYR D 2 59  ? 9.007   2.610   34.426 1.00 59.85  ? 59   TYR D C   1 
ATOM   7847 O O   . TYR D 2 59  ? 9.149   2.494   35.646 1.00 59.77  ? 59   TYR D O   1 
ATOM   7848 C CB  . TYR D 2 59  ? 6.793   1.425   34.314 1.00 60.33  ? 59   TYR D CB  1 
ATOM   7849 C CG  . TYR D 2 59  ? 5.295   1.638   34.287 1.00 60.77  ? 59   TYR D CG  1 
ATOM   7850 C CD1 . TYR D 2 59  ? 4.662   2.394   35.275 1.00 61.01  ? 59   TYR D CD1 1 
ATOM   7851 C CD2 . TYR D 2 59  ? 4.510   1.079   33.281 1.00 60.98  ? 59   TYR D CD2 1 
ATOM   7852 C CE1 . TYR D 2 59  ? 3.288   2.591   35.260 1.00 61.45  ? 59   TYR D CE1 1 
ATOM   7853 C CE2 . TYR D 2 59  ? 3.132   1.269   33.258 1.00 61.41  ? 59   TYR D CE2 1 
ATOM   7854 C CZ  . TYR D 2 59  ? 2.529   2.026   34.251 1.00 61.64  ? 59   TYR D CZ  1 
ATOM   7855 O OH  . TYR D 2 59  ? 1.168   2.221   34.238 1.00 62.09  ? 59   TYR D OH  1 
ATOM   7856 N N   . CYS D 2 60  ? 10.036  2.729   33.587 1.00 68.26  ? 60   CYS D N   1 
ATOM   7857 C CA  . CYS D 2 60  ? 11.410  2.899   34.066 1.00 67.92  ? 60   CYS D CA  1 
ATOM   7858 C C   . CYS D 2 60  ? 11.610  4.320   34.576 1.00 67.98  ? 60   CYS D C   1 
ATOM   7859 O O   . CYS D 2 60  ? 11.154  5.281   33.946 1.00 68.20  ? 60   CYS D O   1 
ATOM   7860 C CB  . CYS D 2 60  ? 12.428  2.604   32.960 1.00 67.70  ? 60   CYS D CB  1 
ATOM   7861 S SG  . CYS D 2 60  ? 12.692  0.856   32.556 1.00 67.53  ? 60   CYS D SG  1 
ATOM   7862 N N   . ALA D 2 61  ? 12.288  4.445   35.715 1.00 90.32  ? 61   ALA D N   1 
ATOM   7863 C CA  . ALA D 2 61  ? 12.558  5.748   36.321 1.00 90.37  ? 61   ALA D CA  1 
ATOM   7864 C C   . ALA D 2 61  ? 13.502  6.572   35.456 1.00 90.25  ? 61   ALA D C   1 
ATOM   7865 O O   . ALA D 2 61  ? 14.509  6.063   34.957 1.00 90.01  ? 61   ALA D O   1 
ATOM   7866 C CB  . ALA D 2 61  ? 13.114  5.588   37.726 1.00 90.20  ? 61   ALA D CB  1 
ATOM   7867 N N   . THR D 2 62  ? 13.152  7.844   35.285 1.00 137.10 ? 62   THR D N   1 
ATOM   7868 C CA  . THR D 2 62  ? 13.881  8.769   34.416 1.00 137.05 ? 62   THR D CA  1 
ATOM   7869 C C   . THR D 2 62  ? 15.393  8.796   34.697 1.00 136.70 ? 62   THR D C   1 
ATOM   7870 O O   . THR D 2 62  ? 15.809  9.013   35.838 1.00 136.59 ? 62   THR D O   1 
ATOM   7871 C CB  . THR D 2 62  ? 13.267  10.202  34.460 1.00 137.32 ? 62   THR D CB  1 
ATOM   7872 O OG1 . THR D 2 62  ? 14.164  11.138  33.849 1.00 137.24 ? 62   THR D OG1 1 
ATOM   7873 C CG2 . THR D 2 62  ? 12.971  10.643  35.896 1.00 137.39 ? 62   THR D CG2 1 
ATOM   7874 N N   . PRO D 2 63  ? 16.213  8.547   33.656 1.00 165.53 ? 63   PRO D N   1 
ATOM   7875 C CA  . PRO D 2 63  ? 17.671  8.642   33.766 1.00 165.23 ? 63   PRO D CA  1 
ATOM   7876 C C   . PRO D 2 63  ? 18.147  10.089  33.866 1.00 165.24 ? 63   PRO D C   1 
ATOM   7877 O O   . PRO D 2 63  ? 18.522  10.543  34.947 1.00 165.12 ? 63   PRO D O   1 
ATOM   7878 C CB  . PRO D 2 63  ? 18.164  8.014   32.460 1.00 165.16 ? 63   PRO D CB  1 
ATOM   7879 C CG  . PRO D 2 63  ? 17.050  8.211   31.501 1.00 165.46 ? 63   PRO D CG  1 
ATOM   7880 C CD  . PRO D 2 63  ? 15.788  8.133   32.305 1.00 165.66 ? 63   PRO D CD  1 
HETATM 7881 C C1  . NAG E 3 .   ? 80.094  16.129  28.459 1.00 60.64  ? 1    NAG E C1  1 
HETATM 7882 C C2  . NAG E 3 .   ? 81.170  16.327  27.387 1.00 60.75  ? 1    NAG E C2  1 
HETATM 7883 C C3  . NAG E 3 .   ? 81.589  14.979  26.790 1.00 60.64  ? 1    NAG E C3  1 
HETATM 7884 C C4  . NAG E 3 .   ? 81.934  13.953  27.868 1.00 60.49  ? 1    NAG E C4  1 
HETATM 7885 C C5  . NAG E 3 .   ? 80.803  13.869  28.912 1.00 60.62  ? 1    NAG E C5  1 
HETATM 7886 C C6  . NAG E 3 .   ? 81.098  12.944  30.097 1.00 60.78  ? 1    NAG E C6  1 
HETATM 7887 C C7  . NAG E 3 .   ? 81.312  17.863  25.454 1.00 60.98  ? 1    NAG E C7  1 
HETATM 7888 C C8  . NAG E 3 .   ? 81.744  19.248  25.842 1.00 60.98  ? 1    NAG E C8  1 
HETATM 7889 N N2  . NAG E 3 .   ? 80.603  17.181  26.354 1.00 60.92  ? 1    NAG E N2  1 
HETATM 7890 O O3  . NAG E 3 .   ? 82.720  15.153  25.966 1.00 60.70  ? 1    NAG E O3  1 
HETATM 7891 O O4  . NAG E 3 .   ? 82.180  12.716  27.221 1.00 60.13  ? 1    NAG E O4  1 
HETATM 7892 O O5  . NAG E 3 .   ? 80.457  15.150  29.417 1.00 60.67  ? 1    NAG E O5  1 
HETATM 7893 O O6  . NAG E 3 .   ? 82.138  13.469  30.893 1.00 61.06  ? 1    NAG E O6  1 
HETATM 7894 O O7  . NAG E 3 .   ? 81.604  17.405  24.348 1.00 61.03  ? 1    NAG E O7  1 
HETATM 7895 C C1  . NAG E 3 .   ? 83.226  11.980  27.898 1.00 59.88  ? 2    NAG E C1  1 
HETATM 7896 C C2  . NAG E 3 .   ? 82.985  10.474  27.781 1.00 59.74  ? 2    NAG E C2  1 
HETATM 7897 C C3  . NAG E 3 .   ? 84.043  9.723   28.592 1.00 59.70  ? 2    NAG E C3  1 
HETATM 7898 C C4  . NAG E 3 .   ? 85.458  10.173  28.227 1.00 59.67  ? 2    NAG E C4  1 
HETATM 7899 C C5  . NAG E 3 .   ? 85.561  11.704  28.315 1.00 59.78  ? 2    NAG E C5  1 
HETATM 7900 C C6  . NAG E 3 .   ? 86.932  12.226  27.891 1.00 59.89  ? 2    NAG E C6  1 
HETATM 7901 C C7  . NAG E 3 .   ? 81.064  8.991   28.298 1.00 59.44  ? 2    NAG E C7  1 
HETATM 7902 C C8  . NAG E 3 .   ? 80.561  8.544   29.639 1.00 59.37  ? 2    NAG E C8  1 
HETATM 7903 N N2  . NAG E 3 .   ? 81.638  10.195  28.261 1.00 59.58  ? 2    NAG E N2  1 
HETATM 7904 O O3  . NAG E 3 .   ? 83.933  8.336   28.358 1.00 59.70  ? 2    NAG E O3  1 
HETATM 7905 O O4  . NAG E 3 .   ? 86.347  9.600   29.165 1.00 59.53  ? 2    NAG E O4  1 
HETATM 7906 O O5  . NAG E 3 .   ? 84.552  12.351  27.551 1.00 59.80  ? 2    NAG E O5  1 
HETATM 7907 O O6  . NAG E 3 .   ? 87.778  12.269  29.020 1.00 59.92  ? 2    NAG E O6  1 
HETATM 7908 O O7  . NAG E 3 .   ? 80.936  8.263   27.314 1.00 59.38  ? 2    NAG E O7  1 
HETATM 7909 C C1  . BMA E 3 .   ? 87.232  8.620   28.581 1.00 59.39  ? 3    BMA E C1  1 
HETATM 7910 C C2  . BMA E 3 .   ? 88.622  8.786   29.206 1.00 59.39  ? 3    BMA E C2  1 
HETATM 7911 C C3  . BMA E 3 .   ? 89.584  7.654   28.819 1.00 59.39  ? 3    BMA E C3  1 
HETATM 7912 C C4  . BMA E 3 .   ? 88.922  6.274   28.866 1.00 59.33  ? 3    BMA E C4  1 
HETATM 7913 C C5  . BMA E 3 .   ? 87.557  6.292   28.173 1.00 59.29  ? 3    BMA E C5  1 
HETATM 7914 C C6  . BMA E 3 .   ? 86.853  4.943   28.291 1.00 59.22  ? 3    BMA E C6  1 
HETATM 7915 O O2  . BMA E 3 .   ? 88.511  8.868   30.612 1.00 59.42  ? 3    BMA E O2  1 
HETATM 7916 O O3  . BMA E 3 .   ? 90.717  7.670   29.665 1.00 59.33  ? 3    BMA E O3  1 
HETATM 7917 O O4  . BMA E 3 .   ? 89.763  5.325   28.245 1.00 59.32  ? 3    BMA E O4  1 
HETATM 7918 O O5  . BMA E 3 .   ? 86.743  7.299   28.748 1.00 59.31  ? 3    BMA E O5  1 
HETATM 7919 O O6  . BMA E 3 .   ? 85.865  4.825   27.290 1.00 59.19  ? 3    BMA E O6  1 
HETATM 7920 C C1  . NAG F 4 .   ? 60.070  7.454   7.380  1.00 59.36  ? 2991 NAG A C1  1 
HETATM 7921 C C2  . NAG F 4 .   ? 59.288  8.587   8.054  1.00 59.37  ? 2991 NAG A C2  1 
HETATM 7922 C C3  . NAG F 4 .   ? 59.738  9.971   7.583  1.00 59.27  ? 2991 NAG A C3  1 
HETATM 7923 C C4  . NAG F 4 .   ? 61.254  10.119  7.674  1.00 59.22  ? 2991 NAG A C4  1 
HETATM 7924 C C5  . NAG F 4 .   ? 61.958  8.933   7.003  1.00 59.24  ? 2991 NAG A C5  1 
HETATM 7925 C C6  . NAG F 4 .   ? 63.467  8.992   7.215  1.00 59.21  ? 2991 NAG A C6  1 
HETATM 7926 C C7  . NAG F 4 .   ? 56.958  8.120   8.641  1.00 59.67  ? 2991 NAG A C7  1 
HETATM 7927 C C8  . NAG F 4 .   ? 56.109  9.253   9.144  1.00 59.74  ? 2991 NAG A C8  1 
HETATM 7928 N N2  . NAG F 4 .   ? 57.882  8.436   7.741  1.00 59.47  ? 2991 NAG A N2  1 
HETATM 7929 O O3  . NAG F 4 .   ? 59.118  10.966  8.371  1.00 59.12  ? 2991 NAG A O3  1 
HETATM 7930 O O4  . NAG F 4 .   ? 61.649  11.336  7.074  1.00 59.06  ? 2991 NAG A O4  1 
HETATM 7931 O O5  . NAG F 4 .   ? 61.470  7.682   7.473  1.00 59.34  ? 2991 NAG A O5  1 
HETATM 7932 O O6  . NAG F 4 .   ? 64.019  9.946   6.335  1.00 59.18  ? 2991 NAG A O6  1 
HETATM 7933 O O7  . NAG F 4 .   ? 56.784  6.969   9.042  1.00 59.81  ? 2991 NAG A O7  1 
HETATM 7934 C C1  . NAG G 4 .   ? 30.728  -7.357  0.455  1.00 60.86  ? 2992 NAG A C1  1 
HETATM 7935 C C2  . NAG G 4 .   ? 29.676  -8.299  1.061  1.00 61.06  ? 2992 NAG A C2  1 
HETATM 7936 C C3  . NAG G 4 .   ? 30.308  -9.627  1.481  1.00 61.02  ? 2992 NAG A C3  1 
HETATM 7937 C C4  . NAG G 4 .   ? 31.045  -10.243 0.296  1.00 61.08  ? 2992 NAG A C4  1 
HETATM 7938 C C5  . NAG G 4 .   ? 32.044  -9.236  -0.289 1.00 61.19  ? 2992 NAG A C5  1 
HETATM 7939 C C6  . NAG G 4 .   ? 32.712  -9.800  -1.542 1.00 61.26  ? 2992 NAG A C6  1 
HETATM 7940 C C7  . NAG G 4 .   ? 27.638  -7.791  2.277  1.00 61.35  ? 2992 NAG A C7  1 
HETATM 7941 C C8  . NAG G 4 .   ? 26.811  -6.784  1.532  1.00 61.36  ? 2992 NAG A C8  1 
HETATM 7942 N N2  . NAG G 4 .   ? 28.963  -7.683  2.170  1.00 61.24  ? 2992 NAG A N2  1 
HETATM 7943 O O3  . NAG G 4 .   ? 29.320  -10.524 1.939  1.00 60.93  ? 2992 NAG A O3  1 
HETATM 7944 O O4  . NAG G 4 .   ? 31.699  -11.419 0.720  1.00 61.05  ? 2992 NAG A O4  1 
HETATM 7945 O O5  . NAG G 4 .   ? 31.396  -8.011  -0.616 1.00 61.09  ? 2992 NAG A O5  1 
HETATM 7946 O O6  . NAG G 4 .   ? 33.477  -8.804  -2.187 1.00 61.24  ? 2992 NAG A O6  1 
HETATM 7947 O O7  . NAG G 4 .   ? 27.090  -8.669  2.943  1.00 61.35  ? 2992 NAG A O7  1 
HETATM 7948 C C1  . NAG H 4 .   ? 47.468  -46.373 6.420  1.00 59.22  ? 2991 NAG B C1  1 
HETATM 7949 C C2  . NAG H 4 .   ? 47.202  -44.959 6.956  1.00 59.36  ? 2991 NAG B C2  1 
HETATM 7950 C C3  . NAG H 4 .   ? 47.773  -43.900 6.009  1.00 59.31  ? 2991 NAG B C3  1 
HETATM 7951 C C4  . NAG H 4 .   ? 49.241  -44.181 5.704  1.00 59.44  ? 2991 NAG B C4  1 
HETATM 7952 C C5  . NAG H 4 .   ? 49.426  -45.624 5.217  1.00 59.55  ? 2991 NAG B C5  1 
HETATM 7953 C C6  . NAG H 4 .   ? 50.905  -45.962 5.040  1.00 59.63  ? 2991 NAG B C6  1 
HETATM 7954 C C7  . NAG H 4 .   ? 45.270  -44.097 8.201  1.00 59.91  ? 2991 NAG B C7  1 
HETATM 7955 C C8  . NAG H 4 .   ? 44.650  -42.751 7.952  1.00 59.95  ? 2991 NAG B C8  1 
HETATM 7956 N N2  . NAG H 4 .   ? 45.778  -44.737 7.143  1.00 59.63  ? 2991 NAG B N2  1 
HETATM 7957 O O3  . NAG H 4 .   ? 47.660  -42.614 6.578  1.00 59.13  ? 2991 NAG B O3  1 
HETATM 7958 O O4  . NAG H 4 .   ? 49.698  -43.256 4.739  1.00 59.40  ? 2991 NAG B O4  1 
HETATM 7959 O O5  . NAG H 4 .   ? 48.846  -46.552 6.126  1.00 59.43  ? 2991 NAG B O5  1 
HETATM 7960 O O6  . NAG H 4 .   ? 51.085  -46.766 3.895  1.00 59.63  ? 2991 NAG B O6  1 
HETATM 7961 O O7  . NAG H 4 .   ? 45.286  -44.564 9.341  1.00 60.15  ? 2991 NAG B O7  1 
HETATM 7962 C C1  . NAG I 4 .   ? 16.367  -59.458 8.411  1.00 61.04  ? 2992 NAG B C1  1 
HETATM 7963 C C2  . NAG I 4 .   ? 15.152  -60.052 9.139  1.00 61.32  ? 2992 NAG B C2  1 
HETATM 7964 C C3  . NAG I 4 .   ? 15.403  -61.510 9.525  1.00 61.28  ? 2992 NAG B C3  1 
HETATM 7965 C C4  . NAG I 4 .   ? 15.842  -62.313 8.305  1.00 61.23  ? 2992 NAG B C4  1 
HETATM 7966 C C5  . NAG I 4 .   ? 17.026  -61.638 7.604  1.00 61.22  ? 2992 NAG B C5  1 
HETATM 7967 C C6  . NAG I 4 .   ? 17.378  -62.347 6.296  1.00 61.18  ? 2992 NAG B C6  1 
HETATM 7968 C C7  . NAG I 4 .   ? 13.617  -58.674 10.485 1.00 62.10  ? 2992 NAG B C7  1 
HETATM 7969 C C8  . NAG I 4 .   ? 13.041  -57.864 9.356  1.00 62.23  ? 2992 NAG B C8  1 
HETATM 7970 N N2  . NAG I 4 .   ? 14.812  -59.250 10.306 1.00 61.76  ? 2992 NAG B N2  1 
HETATM 7971 O O3  . NAG I 4 .   ? 14.226  -62.084 10.045 1.00 61.28  ? 2992 NAG B O3  1 
HETATM 7972 O O4  . NAG I 4 .   ? 16.189  -63.618 8.717  1.00 61.17  ? 2992 NAG B O4  1 
HETATM 7973 O O5  . NAG I 4 .   ? 16.735  -60.277 7.310  1.00 61.13  ? 2992 NAG B O5  1 
HETATM 7974 O O6  . NAG I 4 .   ? 17.921  -63.625 6.551  1.00 61.15  ? 2992 NAG B O6  1 
HETATM 7975 O O7  . NAG I 4 .   ? 12.986  -58.780 11.536 1.00 62.29  ? 2992 NAG B O7  1 
HETATM 7976 C C1  . NAG J 4 .   ? 72.744  -36.372 20.609 1.00 63.27  ? 2993 NAG B C1  1 
HETATM 7977 C C2  . NAG J 4 .   ? 73.191  -35.804 19.254 1.00 63.44  ? 2993 NAG B C2  1 
HETATM 7978 C C3  . NAG J 4 .   ? 73.389  -36.944 18.251 1.00 63.49  ? 2993 NAG B C3  1 
HETATM 7979 C C4  . NAG J 4 .   ? 74.287  -38.046 18.811 1.00 63.40  ? 2993 NAG B C4  1 
HETATM 7980 C C5  . NAG J 4 .   ? 73.782  -38.509 20.180 1.00 63.34  ? 2993 NAG B C5  1 
HETATM 7981 C C6  . NAG J 4 .   ? 74.719  -39.533 20.818 1.00 63.38  ? 2993 NAG B C6  1 
HETATM 7982 C C7  . NAG J 4 .   ? 72.429  -33.735 18.131 1.00 63.38  ? 2993 NAG B C7  1 
HETATM 7983 C C8  . NAG J 4 .   ? 72.430  -32.489 18.970 1.00 63.31  ? 2993 NAG B C8  1 
HETATM 7984 N N2  . NAG J 4 .   ? 72.174  -34.889 18.753 1.00 63.49  ? 2993 NAG B N2  1 
HETATM 7985 O O3  . NAG J 4 .   ? 73.964  -36.434 17.068 1.00 63.61  ? 2993 NAG B O3  1 
HETATM 7986 O O4  . NAG J 4 .   ? 74.306  -39.131 17.909 1.00 63.33  ? 2993 NAG B O4  1 
HETATM 7987 O O5  . NAG J 4 .   ? 73.603  -37.410 21.059 1.00 63.26  ? 2993 NAG B O5  1 
HETATM 7988 O O6  . NAG J 4 .   ? 74.382  -40.826 20.365 1.00 63.46  ? 2993 NAG B O6  1 
HETATM 7989 O O7  . NAG J 4 .   ? 72.639  -33.660 16.921 1.00 63.31  ? 2993 NAG B O7  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . CYS A 9   ? 1.2206 1.5231 1.0413 0.1787  -0.1384 -0.6636 1516 CYS A N   
2    C CA  . CYS A 9   ? 1.2152 1.5223 1.0394 0.1773  -0.1349 -0.6611 1516 CYS A CA  
3    C C   . CYS A 9   ? 1.2200 1.5241 1.0378 0.1781  -0.1312 -0.6593 1516 CYS A C   
4    O O   . CYS A 9   ? 1.2161 1.5237 1.0368 0.1772  -0.1275 -0.6571 1516 CYS A O   
5    C CB  . CYS A 9   ? 1.2069 1.5205 1.0397 0.1757  -0.1332 -0.6608 1516 CYS A CB  
6    S SG  . CYS A 9   ? 1.1991 1.5188 1.0385 0.1735  -0.1316 -0.6590 1516 CYS A SG  
7    N N   . GLN A 10  ? 1.2729 1.9983 0.9929 0.3510  -0.1106 -0.7591 1517 GLN A N   
8    C CA  . GLN A 10  ? 1.2791 2.0003 0.9919 0.3519  -0.1068 -0.7574 1517 GLN A CA  
9    C C   . GLN A 10  ? 1.2891 2.0024 0.9917 0.3531  -0.1089 -0.7580 1517 GLN A C   
10   O O   . GLN A 10  ? 1.2946 2.0032 0.9928 0.3540  -0.1123 -0.7601 1517 GLN A O   
11   C CB  . GLN A 10  ? 1.2802 2.0011 0.9928 0.3524  -0.1037 -0.7577 1517 GLN A CB  
12   C CG  . GLN A 10  ? 1.2824 2.0011 0.9944 0.3531  -0.1067 -0.7602 1517 GLN A CG  
13   C CD  . GLN A 10  ? 1.2840 2.0019 0.9955 0.3537  -0.1035 -0.7603 1517 GLN A CD  
14   O OE1 . GLN A 10  ? 1.2778 2.0009 0.9960 0.3529  -0.1004 -0.7591 1517 GLN A OE1 
15   N NE2 . GLN A 10  ? 1.2926 2.0037 0.9962 0.3551  -0.1044 -0.7620 1517 GLN A NE2 
16   N N   . VAL A 11  ? 1.2052 2.2115 0.8723 0.3303  -0.0940 -0.7418 1518 VAL A N   
17   C CA  . VAL A 11  ? 1.2153 2.2137 0.8720 0.3312  -0.0960 -0.7419 1518 VAL A CA  
18   C C   . VAL A 11  ? 1.2214 2.2159 0.8711 0.3318  -0.0909 -0.7401 1518 VAL A C   
19   O O   . VAL A 11  ? 1.2164 2.2154 0.8706 0.3310  -0.0868 -0.7380 1518 VAL A O   
20   C CB  . VAL A 11  ? 1.2141 2.2128 0.8720 0.3307  -0.1001 -0.7419 1518 VAL A CB  
21   C CG1 . VAL A 11  ? 1.2095 2.2122 0.8706 0.3298  -0.0973 -0.7396 1518 VAL A CG1 
22   C CG2 . VAL A 11  ? 1.2249 2.2149 0.8726 0.3318  -0.1037 -0.7429 1518 VAL A CG2 
23   N N   . THR A 12  ? 1.2676 2.6093 0.8359 0.4460  -0.0634 -0.7695 1519 THR A N   
24   C CA  . THR A 12  ? 1.2751 2.6118 0.8354 0.4465  -0.0586 -0.7680 1519 THR A CA  
25   C C   . THR A 12  ? 1.2839 2.6137 0.8346 0.4467  -0.0608 -0.7675 1519 THR A C   
26   O O   . THR A 12  ? 1.2888 2.6141 0.8350 0.4469  -0.0661 -0.7691 1519 THR A O   
27   C CB  . THR A 12  ? 1.2825 2.6139 0.8365 0.4474  -0.0557 -0.7691 1519 THR A CB  
28   O OG1 . THR A 12  ? 1.2898 2.6148 0.8370 0.4481  -0.0606 -0.7714 1519 THR A OG1 
29   C CG2 . THR A 12  ? 1.2741 2.6123 0.8377 0.4472  -0.0529 -0.7692 1519 THR A CG2 
30   N N   . ASN A 13  ? 1.1704 2.8150 0.7230 0.4133  -0.0461 -0.6898 1520 ASN A N   
31   C CA  . ASN A 13  ? 1.1800 2.8172 0.7222 0.4135  -0.0472 -0.6891 1520 ASN A CA  
32   C C   . ASN A 13  ? 1.1933 2.8205 0.7227 0.4146  -0.0458 -0.6901 1520 ASN A C   
33   O O   . ASN A 13  ? 1.1961 2.8219 0.7234 0.4149  -0.0403 -0.6895 1520 ASN A O   
34   C CB  . ASN A 13  ? 1.1777 2.8175 0.7216 0.4131  -0.0427 -0.6862 1520 ASN A CB  
35   C CG  . ASN A 13  ? 1.1861 2.8194 0.7208 0.4131  -0.0443 -0.6852 1520 ASN A CG  
36   O OD1 . ASN A 13  ? 1.1921 2.8201 0.7207 0.4133  -0.0496 -0.6866 1520 ASN A OD1 
37   N ND2 . ASN A 13  ? 1.1866 2.8204 0.7205 0.4128  -0.0399 -0.6829 1520 ASN A ND2 
38   N N   . PRO A 14  ? 1.3549 3.1162 0.7663 0.4584  -0.0663 -0.8213 1521 PRO A N   
39   C CA  . PRO A 14  ? 1.3688 3.1194 0.7667 0.4591  -0.0659 -0.8226 1521 PRO A CA  
40   C C   . PRO A 14  ? 1.3782 3.1226 0.7663 0.4591  -0.0601 -0.8209 1521 PRO A C   
41   O O   . PRO A 14  ? 1.3881 3.1252 0.7670 0.4596  -0.0571 -0.8217 1521 PRO A O   
42   C CB  . PRO A 14  ? 1.3754 3.1199 0.7670 0.4589  -0.0736 -0.8238 1521 PRO A CB  
43   C CG  . PRO A 14  ? 1.3630 3.1164 0.7676 0.4586  -0.0781 -0.8241 1521 PRO A CG  
44   C CD  . PRO A 14  ? 1.3522 3.1146 0.7665 0.4580  -0.0733 -0.8220 1521 PRO A CD  
45   N N   . SER A 15  ? 1.2963 3.3829 0.6846 0.5037  -0.0281 -0.7009 1522 SER A N   
46   C CA  . SER A 15  ? 1.3048 3.3858 0.6845 0.5037  -0.0225 -0.6991 1522 SER A CA  
47   C C   . SER A 15  ? 1.3004 3.3859 0.6859 0.5040  -0.0146 -0.6980 1522 SER A C   
48   O O   . SER A 15  ? 1.3098 3.3889 0.6871 0.5042  -0.0092 -0.6976 1522 SER A O   
49   C CB  . SER A 15  ? 1.3040 3.3857 0.6835 0.5031  -0.0240 -0.6972 1522 SER A CB  
50   O OG  . SER A 15  ? 1.2899 3.3825 0.6833 0.5026  -0.0236 -0.6959 1522 SER A OG  
51   N N   . THR A 16  ? 1.2943 3.2271 0.7391 0.5641  0.0147  -0.6832 1523 THR A N   
52   C CA  . THR A 16  ? 1.2888 3.2268 0.7411 0.5641  0.0216  -0.6816 1523 THR A CA  
53   C C   . THR A 16  ? 1.2834 3.2255 0.7427 0.5645  0.0227  -0.6830 1523 THR A C   
54   O O   . THR A 16  ? 1.2832 3.2263 0.7452 0.5648  0.0285  -0.6823 1523 THR A O   
55   C CB  . THR A 16  ? 1.2775 3.2245 0.7409 0.5633  0.0223  -0.6791 1523 THR A CB  
56   O OG1 . THR A 16  ? 1.2672 3.2212 0.7395 0.5627  0.0168  -0.6801 1523 THR A OG1 
57   C CG2 . THR A 16  ? 1.2831 3.2261 0.7400 0.5630  0.0228  -0.6773 1523 THR A CG2 
58   N N   . GLY A 17  ? 1.4289 2.9956 0.8942 0.5932  -0.0048 -0.8449 1524 GLY A N   
59   C CA  . GLY A 17  ? 1.4233 2.9941 0.8956 0.5935  -0.0044 -0.8463 1524 GLY A CA  
60   C C   . GLY A 17  ? 1.4095 2.9913 0.8964 0.5928  -0.0027 -0.8447 1524 GLY A C   
61   O O   . GLY A 17  ? 1.4050 2.9905 0.8983 0.5928  -0.0005 -0.8452 1524 GLY A O   
62   N N   . HIS A 18  ? 1.2728 2.6190 0.8286 0.5453  0.0030  -0.6565 1525 HIS A N   
63   C CA  . HIS A 18  ? 1.2604 2.6164 0.8292 0.5443  0.0043  -0.6549 1525 HIS A CA  
64   C C   . HIS A 18  ? 1.2516 2.6135 0.8286 0.5437  0.0000  -0.6564 1525 HIS A C   
65   O O   . HIS A 18  ? 1.2512 2.6125 0.8270 0.5436  -0.0054 -0.6579 1525 HIS A O   
66   C CB  . HIS A 18  ? 1.2575 2.6158 0.8279 0.5435  0.0038  -0.6528 1525 HIS A CB  
67   C CG  . HIS A 18  ? 1.2461 2.6134 0.8286 0.5422  0.0052  -0.6507 1525 HIS A CG  
68   N ND1 . HIS A 18  ? 1.2445 2.6140 0.8311 0.5419  0.0107  -0.6484 1525 HIS A ND1 
69   C CD2 . HIS A 18  ? 1.2362 2.6105 0.8275 0.5411  0.0019  -0.6509 1525 HIS A CD2 
70   C CE1 . HIS A 18  ? 1.2342 2.6116 0.8313 0.5407  0.0102  -0.6470 1525 HIS A CE1 
71   N NE2 . HIS A 18  ? 1.2292 2.6094 0.8290 0.5401  0.0051  -0.6485 1525 HIS A NE2 
72   N N   . LEU A 19  ? 1.3352 2.3034 0.9305 0.5584  -0.0340 -0.6802 1526 LEU A N   
73   C CA  . LEU A 19  ? 1.3266 2.3008 0.9303 0.5579  -0.0375 -0.6815 1526 LEU A CA  
74   C C   . LEU A 19  ? 1.3171 2.2983 0.9290 0.5564  -0.0395 -0.6802 1526 LEU A C   
75   O O   . LEU A 19  ? 1.3133 2.2980 0.9296 0.5555  -0.0366 -0.6777 1526 LEU A O   
76   C CB  . LEU A 19  ? 1.3233 2.3005 0.9329 0.5579  -0.0342 -0.6815 1526 LEU A CB  
77   C CG  . LEU A 19  ? 1.3157 2.2981 0.9331 0.5573  -0.0372 -0.6830 1526 LEU A CG  
78   C CD1 . LEU A 19  ? 1.3185 2.2990 0.9355 0.5582  -0.0351 -0.6841 1526 LEU A CD1 
79   C CD2 . LEU A 19  ? 1.3048 2.2957 0.9333 0.5555  -0.0370 -0.6812 1526 LEU A CD2 
80   N N   . PHE A 20  ? 1.1758 2.2058 0.8815 0.4677  -0.0768 -0.6595 1527 PHE A N   
81   C CA  . PHE A 20  ? 1.1668 2.2033 0.8806 0.4663  -0.0788 -0.6586 1527 PHE A CA  
82   C C   . PHE A 20  ? 1.1593 2.2012 0.8812 0.4654  -0.0804 -0.6599 1527 PHE A C   
83   O O   . PHE A 20  ? 1.1609 2.2011 0.8815 0.4661  -0.0834 -0.6622 1527 PHE A O   
84   C CB  . PHE A 20  ? 1.1688 2.2031 0.8791 0.4663  -0.0830 -0.6595 1527 PHE A CB  
85   C CG  . PHE A 20  ? 1.1737 2.2046 0.8782 0.4665  -0.0816 -0.6577 1527 PHE A CG  
86   C CD1 . PHE A 20  ? 1.1683 2.2037 0.8778 0.4654  -0.0799 -0.6554 1527 PHE A CD1 
87   C CD2 . PHE A 20  ? 1.1840 2.2071 0.8780 0.4677  -0.0820 -0.6582 1527 PHE A CD2 
88   C CE1 . PHE A 20  ? 1.1727 2.2050 0.8772 0.4654  -0.0785 -0.6538 1527 PHE A CE1 
89   C CE2 . PHE A 20  ? 1.1888 2.2085 0.8774 0.4679  -0.0807 -0.6565 1527 PHE A CE2 
90   C CZ  . PHE A 20  ? 1.1829 2.2075 0.8770 0.4668  -0.0789 -0.6542 1527 PHE A CZ  
91   N N   . ASP A 21  ? 1.2141 2.1011 0.9332 0.4977  -0.0914 -0.6353 1528 ASP A N   
92   C CA  . ASP A 21  ? 1.2069 2.0991 0.9339 0.4966  -0.0927 -0.6362 1528 ASP A CA  
93   C C   . ASP A 21  ? 1.1998 2.0970 0.9328 0.4948  -0.0947 -0.6356 1528 ASP A C   
94   O O   . ASP A 21  ? 1.1965 2.0966 0.9326 0.4936  -0.0927 -0.6334 1528 ASP A O   
95   C CB  . ASP A 21  ? 1.2045 2.0992 0.9360 0.4963  -0.0891 -0.6348 1528 ASP A CB  
96   C CG  . ASP A 21  ? 1.1981 2.0974 0.9368 0.4952  -0.0904 -0.6356 1528 ASP A CG  
97   O OD1 . ASP A 21  ? 1.1987 2.0970 0.9366 0.4957  -0.0934 -0.6381 1528 ASP A OD1 
98   O OD2 . ASP A 21  ? 1.1927 2.0965 0.9380 0.4938  -0.0886 -0.6338 1528 ASP A OD2 
99   N N   . LEU A 22  ? 1.0855 1.8530 0.8771 0.3549  -0.1011 -0.5691 1529 LEU A N   
100  C CA  . LEU A 22  ? 1.0794 1.8511 0.8765 0.3533  -0.1030 -0.5691 1529 LEU A CA  
101  C C   . LEU A 22  ? 1.0733 1.8494 0.8773 0.3519  -0.1037 -0.5701 1529 LEU A C   
102  O O   . LEU A 22  ? 1.0694 1.8480 0.8773 0.3506  -0.1058 -0.5710 1529 LEU A O   
103  C CB  . LEU A 22  ? 1.0821 1.8511 0.8761 0.3538  -0.1064 -0.5708 1529 LEU A CB  
104  C CG  . LEU A 22  ? 1.0881 1.8526 0.8753 0.3549  -0.1063 -0.5698 1529 LEU A CG  
105  C CD1 . LEU A 22  ? 1.0918 1.8528 0.8759 0.3558  -0.1106 -0.5719 1529 LEU A CD1 
106  C CD2 . LEU A 22  ? 1.0849 1.8521 0.8742 0.3535  -0.1045 -0.5674 1529 LEU A CD2 
107  N N   . SER A 23  ? 1.2791 1.7334 1.0086 0.4704  -0.1620 -0.6032 1530 SER A N   
108  C CA  . SER A 23  ? 1.2740 1.7321 1.0096 0.4693  -0.1626 -0.6039 1530 SER A CA  
109  C C   . SER A 23  ? 1.2677 1.7307 1.0095 0.4666  -0.1615 -0.6021 1530 SER A C   
110  O O   . SER A 23  ? 1.2635 1.7296 1.0102 0.4652  -0.1621 -0.6026 1530 SER A O   
111  C CB  . SER A 23  ? 1.2764 1.7330 1.0111 0.4704  -0.1615 -0.6044 1530 SER A CB  
112  O OG  . SER A 23  ? 1.2775 1.7340 1.0119 0.4706  -0.1579 -0.6021 1530 SER A OG  
113  N N   . SER A 24  ? 1.1333 1.8835 0.9652 0.4510  -0.1310 -0.5652 1531 SER A N   
114  C CA  . SER A 24  ? 1.1281 1.8823 0.9652 0.4483  -0.1301 -0.5633 1531 SER A CA  
115  C C   . SER A 24  ? 1.1252 1.8810 0.9639 0.4469  -0.1323 -0.5643 1531 SER A C   
116  O O   . SER A 24  ? 1.1219 1.8801 0.9635 0.4447  -0.1317 -0.5627 1531 SER A O   
117  C CB  . SER A 24  ? 1.1290 1.8831 0.9654 0.4483  -0.1275 -0.5602 1531 SER A CB  
118  O OG  . SER A 24  ? 1.1321 1.8838 0.9640 0.4492  -0.1279 -0.5601 1531 SER A OG  
119  N N   . LEU A 25  ? 1.0023 1.6280 0.9331 0.2617  -0.1226 -0.5454 1532 LEU A N   
120  C CA  . LEU A 25  ? 1.0000 1.6269 0.9328 0.2605  -0.1246 -0.5468 1532 LEU A CA  
121  C C   . LEU A 25  ? 0.9990 1.6262 0.9342 0.2606  -0.1266 -0.5496 1532 LEU A C   
122  O O   . LEU A 25  ? 0.9977 1.6254 0.9350 0.2599  -0.1281 -0.5511 1532 LEU A O   
123  C CB  . LEU A 25  ? 1.0034 1.6275 0.9321 0.2617  -0.1255 -0.5471 1532 LEU A CB  
124  C CG  . LEU A 25  ? 1.0057 1.6285 0.9309 0.2621  -0.1237 -0.5446 1532 LEU A CG  
125  C CD1 . LEU A 25  ? 1.0102 1.6293 0.9306 0.2637  -0.1253 -0.5454 1532 LEU A CD1 
126  C CD2 . LEU A 25  ? 1.0018 1.6276 0.9302 0.2597  -0.1224 -0.5424 1532 LEU A CD2 
127  N N   . SER A 26  ? 1.1854 1.4921 1.0362 0.2824  -0.1544 -0.5723 1533 SER A N   
128  C CA  . SER A 26  ? 1.1851 1.4917 1.0379 0.2829  -0.1564 -0.5748 1533 SER A CA  
129  C C   . SER A 26  ? 1.1802 1.4902 1.0388 0.2804  -0.1567 -0.5756 1533 SER A C   
130  O O   . SER A 26  ? 1.1794 1.4899 1.0405 0.2806  -0.1580 -0.5774 1533 SER A O   
131  C CB  . SER A 26  ? 1.1876 1.4925 1.0387 0.2845  -0.1562 -0.5752 1533 SER A CB  
132  O OG  . SER A 26  ? 1.1848 1.4923 1.0388 0.2833  -0.1541 -0.5734 1533 SER A OG  
133  N N   . GLY A 27  ? 1.1598 1.4210 1.0391 0.2368  -0.1466 -0.5149 1534 GLY A N   
134  C CA  . GLY A 27  ? 1.1560 1.4199 1.0397 0.2340  -0.1465 -0.5155 1534 GLY A CA  
135  C C   . GLY A 27  ? 1.1557 1.4193 1.0417 0.2342  -0.1483 -0.5184 1534 GLY A C   
136  O O   . GLY A 27  ? 1.1571 1.4194 1.0422 0.2349  -0.1492 -0.5192 1534 GLY A O   
137  N N   . ARG A 28  ? 1.2232 1.2418 1.0904 0.1409  -0.1439 -0.4819 1535 ARG A N   
138  C CA  . ARG A 28  ? 1.2227 1.2413 1.0932 0.1409  -0.1454 -0.4846 1535 ARG A CA  
139  C C   . ARG A 28  ? 1.2209 1.2406 1.0938 0.1385  -0.1445 -0.4850 1535 ARG A C   
140  O O   . ARG A 28  ? 1.2212 1.2403 1.0964 0.1387  -0.1455 -0.4871 1535 ARG A O   
141  C CB  . ARG A 28  ? 1.2212 1.2410 1.0951 0.1404  -0.1458 -0.4857 1535 ARG A CB  
142  C CG  . ARG A 28  ? 1.2212 1.2406 1.0988 0.1410  -0.1475 -0.4887 1535 ARG A CG  
143  C CD  . ARG A 28  ? 1.2194 1.2403 1.1006 0.1402  -0.1476 -0.4896 1535 ARG A CD  
144  N NE  . ARG A 28  ? 1.2189 1.2399 1.1048 0.1401  -0.1489 -0.4923 1535 ARG A NE  
145  C CZ  . ARG A 28  ? 1.2169 1.2393 1.1067 0.1376  -0.1474 -0.4932 1535 ARG A CZ  
146  N NH1 . ARG A 28  ? 1.2154 1.2391 1.1042 0.1349  -0.1451 -0.4914 1535 ARG A NH1 
147  N NH2 . ARG A 28  ? 1.2167 1.2391 1.1113 0.1377  -0.1484 -0.4957 1535 ARG A NH2 
148  N N   . ALA A 29  ? 1.1298 1.2762 1.0402 0.1306  -0.1388 -0.4598 1536 ALA A N   
149  C CA  . ALA A 29  ? 1.1289 1.2757 1.0401 0.1281  -0.1377 -0.4598 1536 ALA A CA  
150  C C   . ALA A 29  ? 1.1307 1.2759 1.0399 0.1296  -0.1381 -0.4600 1536 ALA A C   
151  O O   . ALA A 29  ? 1.1306 1.2756 1.0416 0.1287  -0.1379 -0.4612 1536 ALA A O   
152  C CB  . ALA A 29  ? 1.1278 1.2756 1.0378 0.1254  -0.1360 -0.4573 1536 ALA A CB  
153  N N   . GLY A 30  ? 0.9700 1.3161 0.9555 0.0912  -0.1248 -0.4900 1537 GLY A N   
154  C CA  . GLY A 30  ? 0.9723 1.3165 0.9553 0.0927  -0.1256 -0.4900 1537 GLY A CA  
155  C C   . GLY A 30  ? 0.9719 1.3163 0.9536 0.0912  -0.1243 -0.4882 1537 GLY A C   
156  O O   . GLY A 30  ? 0.9706 1.3162 0.9517 0.0891  -0.1228 -0.4862 1537 GLY A O   
157  N N   . PHE A 31  ? 0.8193 1.3280 0.8423 0.0520  -0.1130 -0.4562 1538 PHE A N   
158  C CA  . PHE A 31  ? 0.8195 1.3280 0.8409 0.0509  -0.1120 -0.4548 1538 PHE A CA  
159  C C   . PHE A 31  ? 0.8198 1.3276 0.8437 0.0507  -0.1127 -0.4569 1538 PHE A C   
160  O O   . PHE A 31  ? 0.8204 1.3275 0.8469 0.0520  -0.1143 -0.4593 1538 PHE A O   
161  C CB  . PHE A 31  ? 0.8218 1.3288 0.8387 0.0529  -0.1124 -0.4528 1538 PHE A CB  
162  C CG  . PHE A 31  ? 0.8225 1.3295 0.8373 0.0540  -0.1120 -0.4514 1538 PHE A CG  
163  C CD1 . PHE A 31  ? 0.8252 1.3302 0.8382 0.0566  -0.1136 -0.4526 1538 PHE A CD1 
164  C CD2 . PHE A 31  ? 0.8209 1.3294 0.8357 0.0524  -0.1102 -0.4490 1538 PHE A CD2 
165  C CE1 . PHE A 31  ? 0.8262 1.3309 0.8372 0.0577  -0.1129 -0.4514 1538 PHE A CE1 
166  C CE2 . PHE A 31  ? 0.8215 1.3301 0.8352 0.0535  -0.1098 -0.4480 1538 PHE A CE2 
167  C CZ  . PHE A 31  ? 0.8242 1.3308 0.8359 0.0562  -0.1110 -0.4492 1538 PHE A CZ  
168  N N   . THR A 32  ? 0.7195 1.2644 0.7590 -0.0125 -0.1042 -0.4038 1539 THR A N   
169  C CA  . THR A 32  ? 0.7197 1.2640 0.7621 -0.0130 -0.1045 -0.4059 1539 THR A CA  
170  C C   . THR A 32  ? 0.7216 1.2644 0.7619 -0.0118 -0.1053 -0.4050 1539 THR A C   
171  O O   . THR A 32  ? 0.7216 1.2644 0.7594 -0.0130 -0.1040 -0.4031 1539 THR A O   
172  C CB  . THR A 32  ? 0.7182 1.2634 0.7625 -0.0164 -0.1020 -0.4063 1539 THR A CB  
173  O OG1 . THR A 32  ? 0.7180 1.2635 0.7588 -0.0182 -0.1008 -0.4034 1539 THR A OG1 
174  C CG2 . THR A 32  ? 0.7168 1.2631 0.7640 -0.0175 -0.1014 -0.4077 1539 THR A CG2 
175  N N   . ALA A 33  ? 0.6302 1.3431 0.6704 -0.0687 -0.0907 -0.3797 1540 ALA A N   
176  C CA  . ALA A 33  ? 0.6323 1.3435 0.6709 -0.0675 -0.0918 -0.3792 1540 ALA A CA  
177  C C   . ALA A 33  ? 0.6315 1.3429 0.6740 -0.0690 -0.0909 -0.3806 1540 ALA A C   
178  O O   . ALA A 33  ? 0.6302 1.3423 0.6775 -0.0702 -0.0904 -0.3828 1540 ALA A O   
179  C CB  . ALA A 33  ? 0.6351 1.3441 0.6733 -0.0645 -0.0949 -0.3802 1540 ALA A CB  
180  N N   . ALA A 34  ? 0.5577 1.2673 0.6045 -0.1093 -0.0864 -0.2996 1541 ALA A N   
181  C CA  . ALA A 34  ? 0.5572 1.2668 0.6069 -0.1111 -0.0851 -0.3005 1541 ALA A CA  
182  C C   . ALA A 34  ? 0.5589 1.2669 0.6115 -0.1094 -0.0873 -0.3019 1541 ALA A C   
183  O O   . ALA A 34  ? 0.5611 1.2675 0.6106 -0.1075 -0.0894 -0.3009 1541 ALA A O   
184  C CB  . ALA A 34  ? 0.5570 1.2668 0.6030 -0.1128 -0.0834 -0.2980 1541 ALA A CB  
185  N N   . TYR A 35  ? 0.5218 1.2359 0.5663 -0.1543 -0.0819 -0.2412 1542 TYR A N   
186  C CA  . TYR A 35  ? 0.5232 1.2359 0.5717 -0.1532 -0.0834 -0.2425 1542 TYR A CA  
187  C C   . TYR A 35  ? 0.5224 1.2354 0.5747 -0.1555 -0.0807 -0.2440 1542 TYR A C   
188  O O   . TYR A 35  ? 0.5210 1.2351 0.5736 -0.1580 -0.0777 -0.2443 1542 TYR A O   
189  C CB  . TYR A 35  ? 0.5240 1.2360 0.5773 -0.1511 -0.0864 -0.2448 1542 TYR A CB  
190  C CG  . TYR A 35  ? 0.5222 1.2355 0.5823 -0.1524 -0.0848 -0.2475 1542 TYR A CG  
191  C CD1 . TYR A 35  ? 0.5220 1.2352 0.5892 -0.1529 -0.0841 -0.2497 1542 TYR A CD1 
192  C CD2 . TYR A 35  ? 0.5208 1.2354 0.5805 -0.1527 -0.0842 -0.2477 1542 TYR A CD2 
193  C CE1 . TYR A 35  ? 0.5207 1.2348 0.5944 -0.1541 -0.0824 -0.2522 1542 TYR A CE1 
194  C CE2 . TYR A 35  ? 0.5193 1.2351 0.5854 -0.1537 -0.0828 -0.2502 1542 TYR A CE2 
195  C CZ  . TYR A 35  ? 0.5193 1.2348 0.5923 -0.1544 -0.0817 -0.2524 1542 TYR A CZ  
196  O OH  . TYR A 35  ? 0.5182 1.2345 0.5976 -0.1556 -0.0799 -0.2549 1542 TYR A OH  
197  N N   . SER A 36  ? 0.4820 1.1352 0.5586 -0.1735 -0.0861 -0.1719 1543 SER A N   
198  C CA  . SER A 36  ? 0.4819 1.1348 0.5625 -0.1755 -0.0835 -0.1733 1543 SER A CA  
199  C C   . SER A 36  ? 0.4815 1.1347 0.5572 -0.1782 -0.0803 -0.1719 1543 SER A C   
200  O O   . SER A 36  ? 0.4819 1.1349 0.5516 -0.1782 -0.0807 -0.1692 1543 SER A O   
201  C CB  . SER A 36  ? 0.4811 1.1345 0.5695 -0.1761 -0.0824 -0.1766 1543 SER A CB  
202  O OG  . SER A 36  ? 0.4797 1.1344 0.5670 -0.1779 -0.0798 -0.1770 1543 SER A OG  
203  N N   . GLU A 37  ? 0.4723 1.0387 0.5680 -0.1368 -0.0864 -0.1834 1544 GLU A N   
204  C CA  . GLU A 37  ? 0.4726 1.0386 0.5637 -0.1398 -0.0834 -0.1820 1544 GLU A CA  
205  C C   . GLU A 37  ? 0.4717 1.0386 0.5604 -0.1416 -0.0817 -0.1817 1544 GLU A C   
206  O O   . GLU A 37  ? 0.4716 1.0387 0.5546 -0.1430 -0.0812 -0.1793 1544 GLU A O   
207  C CB  . GLU A 37  ? 0.4740 1.0385 0.5683 -0.1420 -0.0804 -0.1842 1544 GLU A CB  
208  C CG  . GLU A 37  ? 0.4755 1.0386 0.5643 -0.1441 -0.0790 -0.1823 1544 GLU A CG  
209  C CD  . GLU A 37  ? 0.4758 1.0387 0.5585 -0.1469 -0.0772 -0.1807 1544 GLU A CD  
210  O OE1 . GLU A 37  ? 0.4757 1.0388 0.5594 -0.1485 -0.0753 -0.1819 1544 GLU A OE1 
211  O OE2 . GLU A 37  ? 0.4763 1.0388 0.5535 -0.1477 -0.0776 -0.1779 1544 GLU A OE2 
212  N N   . LYS A 38  ? 0.5291 0.9968 0.5831 -0.0903 -0.0842 -0.2081 1545 LYS A N   
213  C CA  . LYS A 38  ? 0.5282 0.9968 0.5807 -0.0917 -0.0829 -0.2080 1545 LYS A CA  
214  C C   . LYS A 38  ? 0.5267 0.9968 0.5829 -0.0894 -0.0851 -0.2090 1545 LYS A C   
215  O O   . LYS A 38  ? 0.5259 0.9967 0.5836 -0.0904 -0.0839 -0.2099 1545 LYS A O   
216  C CB  . LYS A 38  ? 0.5294 0.9969 0.5836 -0.0951 -0.0790 -0.2099 1545 LYS A CB  
217  C CG  . LYS A 38  ? 0.5315 0.9971 0.5800 -0.0982 -0.0767 -0.2087 1545 LYS A CG  
218  C CD  . LYS A 38  ? 0.5332 0.9974 0.5801 -0.1018 -0.0732 -0.2097 1545 LYS A CD  
219  C CE  . LYS A 38  ? 0.5347 0.9976 0.5877 -0.1027 -0.0702 -0.2134 1545 LYS A CE  
220  N NZ  . LYS A 38  ? 0.5374 0.9981 0.5875 -0.1067 -0.0665 -0.2143 1545 LYS A NZ  
221  N N   . GLY A 39  ? 0.5630 1.0172 0.6041 -0.1138 -0.0819 -0.2319 1546 GLY A N   
222  C CA  . GLY A 39  ? 0.5623 1.0172 0.6064 -0.1114 -0.0846 -0.2328 1546 GLY A CA  
223  C C   . GLY A 39  ? 0.5615 1.0174 0.6005 -0.1108 -0.0855 -0.2307 1546 GLY A C   
224  O O   . GLY A 39  ? 0.5617 1.0176 0.5948 -0.1110 -0.0857 -0.2281 1546 GLY A O   
225  N N   . LEU A 40  ? 0.6403 1.0597 0.7011 -0.0696 -0.0913 -0.3027 1547 LEU A N   
226  C CA  . LEU A 40  ? 0.6395 1.0599 0.6964 -0.0693 -0.0920 -0.3012 1547 LEU A CA  
227  C C   . LEU A 40  ? 0.6398 1.0600 0.6986 -0.0663 -0.0952 -0.3019 1547 LEU A C   
228  O O   . LEU A 40  ? 0.6393 1.0599 0.7040 -0.0661 -0.0956 -0.3043 1547 LEU A O   
229  C CB  . LEU A 40  ? 0.6383 1.0596 0.6955 -0.0720 -0.0891 -0.3016 1547 LEU A CB  
230  C CG  . LEU A 40  ? 0.6388 1.0596 0.6931 -0.0754 -0.0860 -0.3007 1547 LEU A CG  
231  C CD1 . LEU A 40  ? 0.6385 1.0595 0.6946 -0.0781 -0.0833 -0.3021 1547 LEU A CD1 
232  C CD2 . LEU A 40  ? 0.6389 1.0597 0.6865 -0.0759 -0.0863 -0.2973 1547 LEU A CD2 
233  N N   . VAL A 41  ? 0.6888 1.1442 0.7479 -0.0794 -0.0947 -0.3723 1548 VAL A N   
234  C CA  . VAL A 41  ? 0.6897 1.1446 0.7489 -0.0769 -0.0976 -0.3727 1548 VAL A CA  
235  C C   . VAL A 41  ? 0.6887 1.1447 0.7442 -0.0773 -0.0967 -0.3713 1548 VAL A C   
236  O O   . VAL A 41  ? 0.6895 1.1451 0.7394 -0.0768 -0.0967 -0.3689 1548 VAL A O   
237  C CB  . VAL A 41  ? 0.6927 1.1453 0.7483 -0.0742 -0.1006 -0.3718 1548 VAL A CB  
238  C CG1 . VAL A 41  ? 0.6946 1.1457 0.7501 -0.0719 -0.1040 -0.3725 1548 VAL A CG1 
239  C CG2 . VAL A 41  ? 0.6938 1.1451 0.7526 -0.0741 -0.1015 -0.3727 1548 VAL A CG2 
240  N N   . TYR A 42  ? 0.8171 1.1425 0.8712 -0.0160 -0.1204 -0.4198 1549 TYR A N   
241  C CA  . TYR A 42  ? 0.8161 1.1426 0.8677 -0.0164 -0.1199 -0.4185 1549 TYR A CA  
242  C C   . TYR A 42  ? 0.8180 1.1431 0.8675 -0.0133 -0.1230 -0.4185 1549 TYR A C   
243  O O   . TYR A 42  ? 0.8189 1.1432 0.8719 -0.0119 -0.1252 -0.4205 1549 TYR A O   
244  C CB  . TYR A 42  ? 0.8141 1.1421 0.8703 -0.0182 -0.1185 -0.4203 1549 TYR A CB  
245  C CG  . TYR A 42  ? 0.8134 1.1417 0.8729 -0.0208 -0.1156 -0.4214 1549 TYR A CG  
246  C CD1 . TYR A 42  ? 0.8132 1.1416 0.8693 -0.0233 -0.1132 -0.4199 1549 TYR A CD1 
247  C CD2 . TYR A 42  ? 0.8132 1.1415 0.8794 -0.0209 -0.1155 -0.4244 1549 TYR A CD2 
248  C CE1 . TYR A 42  ? 0.8133 1.1414 0.8717 -0.0260 -0.1105 -0.4212 1549 TYR A CE1 
249  C CE2 . TYR A 42  ? 0.8130 1.1413 0.8822 -0.0234 -0.1125 -0.4257 1549 TYR A CE2 
250  C CZ  . TYR A 42  ? 0.8133 1.1413 0.8782 -0.0261 -0.1099 -0.4241 1549 TYR A CZ  
251  O OH  . TYR A 42  ? 0.8139 1.1412 0.8810 -0.0286 -0.1068 -0.4255 1549 TYR A OH  
252  N N   . MET A 43  ? 0.8427 1.2136 0.8997 -0.0099 -0.1208 -0.4799 1550 MET A N   
253  C CA  . MET A 43  ? 0.8455 1.2144 0.8992 -0.0071 -0.1233 -0.4796 1550 MET A CA  
254  C C   . MET A 43  ? 0.8454 1.2148 0.8952 -0.0070 -0.1222 -0.4778 1550 MET A C   
255  O O   . MET A 43  ? 0.8434 1.2145 0.8923 -0.0088 -0.1199 -0.4762 1550 MET A O   
256  C CB  . MET A 43  ? 0.8488 1.2150 0.8991 -0.0054 -0.1250 -0.4790 1550 MET A CB  
257  C CG  . MET A 43  ? 0.8489 1.2153 0.8949 -0.0063 -0.1230 -0.4765 1550 MET A CG  
258  S SD  . MET A 43  ? 0.8534 1.2162 0.8948 -0.0041 -0.1253 -0.4756 1550 MET A SD  
259  C CE  . MET A 43  ? 0.8572 1.2175 0.8923 -0.0017 -0.1263 -0.4747 1550 MET A CE  
260  N N   . SER A 44  ? 0.9348 1.2834 0.9689 0.0555  -0.1411 -0.5347 1551 SER A N   
261  C CA  . SER A 44  ? 0.9355 1.2839 0.9658 0.0562  -0.1402 -0.5332 1551 SER A CA  
262  C C   . SER A 44  ? 0.9405 1.2852 0.9651 0.0588  -0.1420 -0.5328 1551 SER A C   
263  O O   . SER A 44  ? 0.9435 1.2856 0.9673 0.0601  -0.1445 -0.5339 1551 SER A O   
264  C CB  . SER A 44  ? 0.9335 1.2835 0.9673 0.0557  -0.1402 -0.5345 1551 SER A CB  
265  O OG  . SER A 44  ? 0.9295 1.2826 0.9672 0.0529  -0.1380 -0.5343 1551 SER A OG  
266  N N   . ILE A 45  ? 0.9343 1.3103 0.9859 0.0439  -0.1303 -0.5691 1552 ILE A N   
267  C CA  . ILE A 45  ? 0.9397 1.3118 0.9850 0.0463  -0.1313 -0.5687 1552 ILE A CA  
268  C C   . ILE A 45  ? 0.9412 1.3123 0.9855 0.0474  -0.1317 -0.5695 1552 ILE A C   
269  O O   . ILE A 45  ? 0.9380 1.3118 0.9849 0.0463  -0.1299 -0.5691 1552 ILE A O   
270  C CB  . ILE A 45  ? 0.9411 1.3126 0.9817 0.0463  -0.1288 -0.5659 1552 ILE A CB  
271  C CG1 . ILE A 45  ? 0.9389 1.3119 0.9811 0.0449  -0.1280 -0.5648 1552 ILE A CG1 
272  C CG2 . ILE A 45  ? 0.9477 1.3143 0.9811 0.0487  -0.1296 -0.5655 1552 ILE A CG2 
273  C CD1 . ILE A 45  ? 0.9413 1.3120 0.9830 0.0456  -0.1306 -0.5662 1552 ILE A CD1 
274  N N   . CYS A 46  ? 1.0600 1.2835 1.0164 0.0573  -0.1314 -0.5713 1553 CYS A N   
275  C CA  . CYS A 46  ? 1.0627 1.2842 1.0172 0.0586  -0.1323 -0.5723 1553 CYS A CA  
276  C C   . CYS A 46  ? 1.0587 1.2830 1.0197 0.0577  -0.1332 -0.5741 1553 CYS A C   
277  O O   . CYS A 46  ? 1.0611 1.2835 1.0213 0.0590  -0.1350 -0.5756 1553 CYS A O   
278  C CB  . CYS A 46  ? 1.0642 1.2852 1.0144 0.0590  -0.1290 -0.5705 1553 CYS A CB  
279  S SG  . CYS A 46  ? 1.0715 1.2872 1.0124 0.0606  -0.1282 -0.5690 1553 CYS A SG  
280  N N   . GLY A 47  ? 1.1508 1.1477 1.0650 0.0533  -0.1495 -0.5225 1554 GLY A N   
281  C CA  . GLY A 47  ? 1.1469 1.1467 1.0675 0.0522  -0.1500 -0.5242 1554 GLY A CA  
282  C C   . GLY A 47  ? 1.1440 1.1456 1.0703 0.0509  -0.1508 -0.5254 1554 GLY A C   
283  O O   . GLY A 47  ? 1.1443 1.1456 1.0698 0.0505  -0.1504 -0.5249 1554 GLY A O   
284  N N   . GLU A 48  ? 1.1240 1.0162 1.0800 -0.0237 -0.1316 -0.4661 1555 GLU A N   
285  C CA  . GLU A 48  ? 1.1212 1.0153 1.0835 -0.0251 -0.1316 -0.4675 1555 GLU A CA  
286  C C   . GLU A 48  ? 1.1173 1.0145 1.0812 -0.0277 -0.1281 -0.4661 1555 GLU A C   
287  O O   . GLU A 48  ? 1.1154 1.0144 1.0782 -0.0289 -0.1261 -0.4647 1555 GLU A O   
288  C CB  . GLU A 48  ? 1.1199 1.0148 1.0881 -0.0252 -0.1332 -0.4697 1555 GLU A CB  
289  C CG  . GLU A 48  ? 1.1174 1.0145 1.0866 -0.0262 -0.1315 -0.4693 1555 GLU A CG  
290  C CD  . GLU A 48  ? 1.1147 1.0138 1.0910 -0.0274 -0.1317 -0.4713 1555 GLU A CD  
291  O OE1 . GLU A 48  ? 1.1164 1.0139 1.0956 -0.0260 -0.1347 -0.4733 1555 GLU A OE1 
292  O OE2 . GLU A 48  ? 1.1113 1.0132 1.0903 -0.0297 -0.1290 -0.4708 1555 GLU A OE2 
293  N N   . ASN A 49  ? 1.0531 1.0651 1.0663 -0.0043 -0.1305 -0.4715 1556 ASN A N   
294  C CA  . ASN A 49  ? 1.0500 1.0644 1.0647 -0.0071 -0.1273 -0.4706 1556 ASN A CA  
295  C C   . ASN A 49  ? 1.0472 1.0638 1.0673 -0.0089 -0.1263 -0.4720 1556 ASN A C   
296  O O   . ASN A 49  ? 1.0473 1.0637 1.0715 -0.0082 -0.1280 -0.4740 1556 ASN A O   
297  C CB  . ASN A 49  ? 1.0504 1.0643 1.0659 -0.0076 -0.1272 -0.4708 1556 ASN A CB  
298  C CG  . ASN A 49  ? 1.0483 1.0639 1.0631 -0.0103 -0.1239 -0.4693 1556 ASN A CG  
299  O OD1 . ASN A 49  ? 1.0483 1.0641 1.0587 -0.0107 -0.1228 -0.4668 1556 ASN A OD1 
300  N ND2 . ASN A 49  ? 1.0470 1.0633 1.0660 -0.0120 -0.1226 -0.4706 1556 ASN A ND2 
301  N N   . GLU A 50  ? 1.1523 1.0429 1.1084 0.0403  -0.1099 -0.4237 1557 GLU A N   
302  C CA  . GLU A 50  ? 1.1501 1.0425 1.1105 0.0381  -0.1084 -0.4248 1557 GLU A CA  
303  C C   . GLU A 50  ? 1.1496 1.0421 1.1145 0.0364  -0.1071 -0.4268 1557 GLU A C   
304  O O   . GLU A 50  ? 1.1487 1.0419 1.1185 0.0355  -0.1067 -0.4287 1557 GLU A O   
305  C CB  . GLU A 50  ? 1.1487 1.0424 1.1065 0.0359  -0.1064 -0.4226 1557 GLU A CB  
306  C CG  . GLU A 50  ? 1.1487 1.0423 1.1032 0.0339  -0.1045 -0.4207 1557 GLU A CG  
307  C CD  . GLU A 50  ? 1.1477 1.0423 1.1003 0.0313  -0.1030 -0.4185 1557 GLU A CD  
308  O OE1 . GLU A 50  ? 1.1468 1.0423 1.1004 0.0313  -0.1033 -0.4183 1557 GLU A OE1 
309  O OE2 . GLU A 50  ? 1.1479 1.0423 1.0980 0.0294  -0.1015 -0.4167 1557 GLU A OE2 
310  N N   . ASN A 51  ? 1.0715 1.0188 1.0665 -0.0086 -0.0861 -0.4016 1558 ASN A N   
311  C CA  . ASN A 51  ? 1.0715 1.0186 1.0706 -0.0100 -0.0846 -0.4034 1558 ASN A CA  
312  C C   . ASN A 51  ? 1.0722 1.0186 1.0770 -0.0078 -0.0869 -0.4059 1558 ASN A C   
313  O O   . ASN A 51  ? 1.0717 1.0184 1.0824 -0.0088 -0.0857 -0.4079 1558 ASN A O   
314  C CB  . ASN A 51  ? 1.0723 1.0186 1.0681 -0.0109 -0.0834 -0.4020 1558 ASN A CB  
315  C CG  . ASN A 51  ? 1.0719 1.0187 1.0622 -0.0127 -0.0817 -0.3993 1558 ASN A CG  
316  O OD1 . ASN A 51  ? 1.0711 1.0186 1.0614 -0.0154 -0.0798 -0.3989 1558 ASN A OD1 
317  N ND2 . ASN A 51  ? 1.0727 1.0189 1.0585 -0.0115 -0.0825 -0.3971 1558 ASN A ND2 
318  N N   . CYS A 52  ? 1.0185 0.9907 1.1022 -0.0533 -0.0917 -0.4399 1559 CYS A N   
319  C CA  . CYS A 52  ? 1.0198 0.9908 1.1082 -0.0511 -0.0948 -0.4419 1559 CYS A CA  
320  C C   . CYS A 52  ? 1.0192 0.9908 1.1112 -0.0505 -0.0961 -0.4433 1559 CYS A C   
321  O O   . CYS A 52  ? 1.0181 0.9908 1.1076 -0.0513 -0.0952 -0.4422 1559 CYS A O   
322  C CB  . CYS A 52  ? 1.0227 0.9914 1.1061 -0.0485 -0.0979 -0.4408 1559 CYS A CB  
323  S SG  . CYS A 52  ? 1.0236 0.9915 1.1021 -0.0489 -0.0967 -0.4388 1559 CYS A SG  
324  N N   . PRO A 53  ? 1.1099 0.9656 1.2169 -0.0896 -0.0740 -0.4564 1560 PRO A N   
325  C CA  . PRO A 53  ? 1.1097 0.9656 1.2204 -0.0888 -0.0759 -0.4577 1560 PRO A CA  
326  C C   . PRO A 53  ? 1.1115 0.9661 1.2161 -0.0868 -0.0785 -0.4564 1560 PRO A C   
327  O O   . PRO A 53  ? 1.1139 0.9666 1.2125 -0.0854 -0.0798 -0.4550 1560 PRO A O   
328  C CB  . PRO A 53  ? 1.1109 0.9656 1.2291 -0.0874 -0.0785 -0.4598 1560 PRO A CB  
329  C CG  . PRO A 53  ? 1.1106 0.9654 1.2310 -0.0886 -0.0764 -0.4600 1560 PRO A CG  
330  C CD  . PRO A 53  ? 1.1110 0.9656 1.2228 -0.0891 -0.0751 -0.4577 1560 PRO A CD  
331  N N   . PRO A 54  ? 1.2336 0.9742 1.2502 -0.0362 -0.1057 -0.4688 1561 PRO A N   
332  C CA  . PRO A 54  ? 1.2356 0.9747 1.2467 -0.0344 -0.1079 -0.4679 1561 PRO A CA  
333  C C   . PRO A 54  ? 1.2399 0.9754 1.2480 -0.0317 -0.1120 -0.4681 1561 PRO A C   
334  O O   . PRO A 54  ? 1.2412 0.9754 1.2544 -0.0307 -0.1146 -0.4697 1561 PRO A O   
335  C CB  . PRO A 54  ? 1.2343 0.9745 1.2503 -0.0346 -0.1084 -0.4693 1561 PRO A CB  
336  C CG  . PRO A 54  ? 1.2309 0.9739 1.2524 -0.0373 -0.1049 -0.4700 1561 PRO A CG  
337  C CD  . PRO A 54  ? 1.2311 0.9737 1.2546 -0.0379 -0.1040 -0.4704 1561 PRO A CD  
338  N N   . GLY A 55  ? 1.1810 1.0430 1.1939 -0.0262 -0.1458 -0.5279 1562 GLY A N   
339  C CA  . GLY A 55  ? 1.1861 1.0439 1.1942 -0.0238 -0.1493 -0.5278 1562 GLY A CA  
340  C C   . GLY A 55  ? 1.1873 1.0441 1.1928 -0.0237 -0.1491 -0.5268 1562 GLY A C   
341  O O   . GLY A 55  ? 1.1915 1.0450 1.1902 -0.0221 -0.1507 -0.5257 1562 GLY A O   
342  N N   . VAL A 56  ? 1.0290 1.0494 1.1285 -0.0649 -0.1304 -0.5231 1563 VAL A N   
343  C CA  . VAL A 56  ? 1.0297 1.0495 1.1277 -0.0652 -0.1298 -0.5224 1563 VAL A CA  
344  C C   . VAL A 56  ? 1.0290 1.0496 1.1202 -0.0659 -0.1268 -0.5199 1563 VAL A C   
345  O O   . VAL A 56  ? 1.0256 1.0491 1.1174 -0.0680 -0.1234 -0.5192 1563 VAL A O   
346  C CB  . VAL A 56  ? 1.0267 1.0486 1.1329 -0.0668 -0.1282 -0.5238 1563 VAL A CB  
347  C CG1 . VAL A 56  ? 1.0275 1.0487 1.1322 -0.0671 -0.1278 -0.5230 1563 VAL A CG1 
348  C CG2 . VAL A 56  ? 1.0273 1.0485 1.1415 -0.0659 -0.1314 -0.5261 1563 VAL A CG2 
349  N N   . GLY A 57  ? 0.9731 1.1842 1.0423 -0.0242 -0.1248 -0.5494 1564 GLY A N   
350  C CA  . GLY A 57  ? 0.9729 1.1845 1.0360 -0.0249 -0.1221 -0.5469 1564 GLY A CA  
351  C C   . GLY A 57  ? 0.9707 1.1839 1.0354 -0.0265 -0.1199 -0.5462 1564 GLY A C   
352  O O   . GLY A 57  ? 0.9686 1.1837 1.0311 -0.0281 -0.1169 -0.5446 1564 GLY A O   
353  N N   . ALA A 58  ? 0.8462 1.1476 0.9444 -0.0476 -0.1268 -0.4907 1565 ALA A N   
354  C CA  . ALA A 58  ? 0.8447 1.1472 0.9446 -0.0491 -0.1248 -0.4903 1565 ALA A CA  
355  C C   . ALA A 58  ? 0.8435 1.1466 0.9518 -0.0496 -0.1255 -0.4927 1565 ALA A C   
356  O O   . ALA A 58  ? 0.8455 1.1468 0.9572 -0.0480 -0.1289 -0.4943 1565 ALA A O   
357  C CB  . ALA A 58  ? 0.8480 1.1479 0.9422 -0.0478 -0.1261 -0.4887 1565 ALA A CB  
358  N N   . CYS A 59  ? 0.8067 1.0529 0.9153 -0.0797 -0.1159 -0.4156 1566 CYS A N   
359  C CA  . CYS A 59  ? 0.8055 1.0524 0.9225 -0.0806 -0.1155 -0.4180 1566 CYS A CA  
360  C C   . CYS A 59  ? 0.8045 1.0520 0.9229 -0.0824 -0.1128 -0.4180 1566 CYS A C   
361  O O   . CYS A 59  ? 0.8050 1.0522 0.9177 -0.0826 -0.1119 -0.4160 1566 CYS A O   
362  C CB  . CYS A 59  ? 0.8030 1.0519 0.9250 -0.0819 -0.1140 -0.4196 1566 CYS A CB  
363  S SG  . CYS A 59  ? 0.8004 1.0516 0.9181 -0.0847 -0.1096 -0.4180 1566 CYS A SG  
364  N N   . PHE A 60  ? 0.7270 0.9652 0.8361 -0.1061 -0.0961 -0.3271 1567 PHE A N   
365  C CA  . PHE A 60  ? 0.7266 0.9649 0.8378 -0.1077 -0.0932 -0.3276 1567 PHE A CA  
366  C C   . PHE A 60  ? 0.7246 0.9646 0.8368 -0.1110 -0.0886 -0.3280 1567 PHE A C   
367  O O   . PHE A 60  ? 0.7234 0.9645 0.8341 -0.1119 -0.0874 -0.3278 1567 PHE A O   
368  C CB  . PHE A 60  ? 0.7275 0.9649 0.8470 -0.1067 -0.0951 -0.3298 1567 PHE A CB  
369  C CG  . PHE A 60  ? 0.7301 0.9653 0.8476 -0.1045 -0.0989 -0.3289 1567 PHE A CG  
370  C CD1 . PHE A 60  ? 0.7310 0.9654 0.8431 -0.1048 -0.0982 -0.3271 1567 PHE A CD1 
371  C CD2 . PHE A 60  ? 0.7322 0.9656 0.8528 -0.1022 -0.1036 -0.3296 1567 PHE A CD2 
372  C CE1 . PHE A 60  ? 0.7337 0.9659 0.8435 -0.1027 -0.1018 -0.3262 1567 PHE A CE1 
373  C CE2 . PHE A 60  ? 0.7353 0.9661 0.8533 -0.1002 -0.1074 -0.3287 1567 PHE A CE2 
374  C CZ  . PHE A 60  ? 0.7361 0.9662 0.8486 -0.1005 -0.1063 -0.3269 1567 PHE A CZ  
375  N N   . GLY A 61  ? 0.7260 0.8544 0.8053 -0.0588 -0.0754 -0.2380 1568 GLY A N   
376  C CA  . GLY A 61  ? 0.7253 0.8543 0.8036 -0.0621 -0.0709 -0.2381 1568 GLY A CA  
377  C C   . GLY A 61  ? 0.7244 0.8543 0.8076 -0.0639 -0.0684 -0.2401 1568 GLY A C   
378  O O   . GLY A 61  ? 0.7235 0.8543 0.8055 -0.0636 -0.0693 -0.2398 1568 GLY A O   
379  N N   . GLN A 62  ? 0.8029 0.7521 0.8990 -0.0298 -0.0243 -0.1523 1569 GLN A N   
380  C CA  . GLN A 62  ? 0.8026 0.7522 0.9036 -0.0318 -0.0214 -0.1544 1569 GLN A CA  
381  C C   . GLN A 62  ? 0.8014 0.7521 0.9085 -0.0296 -0.0241 -0.1555 1569 GLN A C   
382  O O   . GLN A 62  ? 0.8006 0.7522 0.9075 -0.0307 -0.0232 -0.1557 1569 GLN A O   
383  C CB  . GLN A 62  ? 0.8039 0.7524 0.9109 -0.0335 -0.0175 -0.1567 1569 GLN A CB  
384  C CG  . GLN A 62  ? 0.8056 0.7528 0.9076 -0.0373 -0.0126 -0.1565 1569 GLN A CG  
385  C CD  . GLN A 62  ? 0.8065 0.7527 0.8996 -0.0383 -0.0126 -0.1541 1569 GLN A CD  
386  O OE1 . GLN A 62  ? 0.8064 0.7525 0.8989 -0.0364 -0.0149 -0.1532 1569 GLN A OE1 
387  N NE2 . GLN A 62  ? 0.8076 0.7530 0.8937 -0.0412 -0.0100 -0.1527 1569 GLN A NE2 
388  N N   . THR A 63  ? 0.8061 0.7586 1.0275 -0.0838 -0.0318 -0.2054 1570 THR A N   
389  C CA  . THR A 63  ? 0.8055 0.7585 1.0319 -0.0816 -0.0355 -0.2063 1570 THR A CA  
390  C C   . THR A 63  ? 0.8058 0.7586 1.0248 -0.0794 -0.0397 -0.2039 1570 THR A C   
391  O O   . THR A 63  ? 0.8066 0.7586 1.0192 -0.0788 -0.0406 -0.2020 1570 THR A O   
392  C CB  . THR A 63  ? 0.8062 0.7585 1.0427 -0.0798 -0.0375 -0.2082 1570 THR A CB  
393  O OG1 . THR A 63  ? 0.8075 0.7585 1.0422 -0.0790 -0.0388 -0.2075 1570 THR A OG1 
394  C CG2 . THR A 63  ? 0.8059 0.7586 1.0513 -0.0819 -0.0333 -0.2109 1570 THR A CG2 
395  N N   . ARG A 64  ? 0.8577 0.8524 1.1481 -0.0864 -0.0582 -0.3404 1571 ARG A N   
396  C CA  . ARG A 64  ? 0.8583 0.8526 1.1417 -0.0844 -0.0617 -0.3384 1571 ARG A CA  
397  C C   . ARG A 64  ? 0.8605 0.8529 1.1455 -0.0815 -0.0668 -0.3386 1571 ARG A C   
398  O O   . ARG A 64  ? 0.8612 0.8530 1.1472 -0.0798 -0.0701 -0.3391 1571 ARG A O   
399  C CB  . ARG A 64  ? 0.8570 0.8526 1.1398 -0.0850 -0.0614 -0.3386 1571 ARG A CB  
400  C CG  . ARG A 64  ? 0.8557 0.8525 1.1331 -0.0878 -0.0573 -0.3371 1571 ARG A CG  
401  C CD  . ARG A 64  ? 0.8543 0.8524 1.1339 -0.0887 -0.0564 -0.3379 1571 ARG A CD  
402  N NE  . ARG A 64  ? 0.8535 0.8524 1.1276 -0.0913 -0.0531 -0.3364 1571 ARG A NE  
403  C CZ  . ARG A 64  ? 0.8525 0.8524 1.1280 -0.0932 -0.0511 -0.3368 1571 ARG A CZ  
404  N NH1 . ARG A 64  ? 0.8520 0.8524 1.1344 -0.0927 -0.0516 -0.3388 1571 ARG A NH1 
405  N NH2 . ARG A 64  ? 0.8523 0.8525 1.1222 -0.0958 -0.0485 -0.3352 1571 ARG A NH2 
406  N N   . ILE A 65  ? 0.7930 0.9409 1.0466 -0.1296 -0.0974 -0.3878 1572 ILE A N   
407  C CA  . ILE A 65  ? 0.7957 0.9413 1.0506 -0.1270 -0.1024 -0.3880 1572 ILE A CA  
408  C C   . ILE A 65  ? 0.7979 0.9418 1.0426 -0.1253 -0.1052 -0.3856 1572 ILE A C   
409  O O   . ILE A 65  ? 0.7983 0.9419 1.0362 -0.1256 -0.1037 -0.3837 1572 ILE A O   
410  C CB  . ILE A 65  ? 0.7966 0.9412 1.0557 -0.1269 -0.1026 -0.3885 1572 ILE A CB  
411  C CG1 . ILE A 65  ? 0.7946 0.9408 1.0627 -0.1289 -0.0986 -0.3907 1572 ILE A CG1 
412  C CG2 . ILE A 65  ? 0.7997 0.9417 1.0617 -0.1243 -0.1084 -0.3889 1572 ILE A CG2 
413  C CD1 . ILE A 65  ? 0.7952 0.9408 1.0660 -0.1295 -0.0971 -0.3910 1572 ILE A CD1 
414  N N   . SER A 66  ? 0.8415 1.0838 1.0902 -0.1090 -0.1326 -0.5027 1573 SER A N   
415  C CA  . SER A 66  ? 0.8443 1.0845 1.0833 -0.1075 -0.1350 -0.5008 1573 SER A CA  
416  C C   . SER A 66  ? 0.8481 1.0851 1.0832 -0.1058 -0.1381 -0.4997 1573 SER A C   
417  O O   . SER A 66  ? 0.8497 1.0851 1.0905 -0.1052 -0.1410 -0.5008 1573 SER A O   
418  C CB  . SER A 66  ? 0.8457 1.0848 1.0852 -0.1061 -0.1380 -0.5016 1573 SER A CB  
419  O OG  . SER A 66  ? 0.8492 1.0856 1.0793 -0.1045 -0.1403 -0.5000 1573 SER A OG  
420  N N   . VAL A 67  ? 0.7990 1.2078 0.9369 -0.0892 -0.1730 -0.5072 1574 VAL A N   
421  C CA  . VAL A 67  ? 0.8035 1.2086 0.9359 -0.0877 -0.1762 -0.5059 1574 VAL A CA  
422  C C   . VAL A 67  ? 0.8078 1.2097 0.9318 -0.0859 -0.1788 -0.5048 1574 VAL A C   
423  O O   . VAL A 67  ? 0.8119 1.2106 0.9284 -0.0848 -0.1800 -0.5033 1574 VAL A O   
424  C CB  . VAL A 67  ? 0.8028 1.2085 0.9313 -0.0886 -0.1733 -0.5042 1574 VAL A CB  
425  C CG1 . VAL A 67  ? 0.8003 1.2078 0.9370 -0.0899 -0.1720 -0.5055 1574 VAL A CG1 
426  C CG2 . VAL A 67  ? 0.8002 1.2083 0.9233 -0.0900 -0.1691 -0.5026 1574 VAL A CG2 
427  N N   . GLY A 68  ? 0.9048 1.2949 1.0227 -0.0705 -0.1852 -0.5960 1575 GLY A N   
428  C CA  . GLY A 68  ? 0.9092 1.2960 1.0195 -0.0688 -0.1876 -0.5953 1575 GLY A CA  
429  C C   . GLY A 68  ? 0.9067 1.2957 1.0160 -0.0693 -0.1852 -0.5953 1575 GLY A C   
430  O O   . GLY A 68  ? 0.9020 1.2949 1.0127 -0.0710 -0.1808 -0.5947 1575 GLY A O   
431  N N   . LYS A 69  ? 1.0378 1.2970 1.1567 -0.0736 -0.1754 -0.6664 1576 LYS A N   
432  C CA  . LYS A 69  ? 1.0362 1.2969 1.1537 -0.0737 -0.1736 -0.6664 1576 LYS A CA  
433  C C   . LYS A 69  ? 1.0385 1.2978 1.1461 -0.0732 -0.1715 -0.6643 1576 LYS A C   
434  O O   . LYS A 69  ? 1.0436 1.2989 1.1442 -0.0720 -0.1730 -0.6632 1576 LYS A O   
435  C CB  . LYS A 69  ? 1.0390 1.2973 1.1586 -0.0724 -0.1776 -0.6682 1576 LYS A CB  
436  C CG  . LYS A 69  ? 1.0359 1.2963 1.1666 -0.0731 -0.1791 -0.6703 1576 LYS A CG  
437  C CD  . LYS A 69  ? 1.0399 1.2969 1.1721 -0.0716 -0.1841 -0.6718 1576 LYS A CD  
438  C CE  . LYS A 69  ? 1.0369 1.2960 1.1812 -0.0722 -0.1854 -0.6739 1576 LYS A CE  
439  N NZ  . LYS A 69  ? 1.0417 1.2967 1.1877 -0.0706 -0.1914 -0.6751 1576 LYS A NZ  
440  N N   . ALA A 70  ? 1.0591 1.0976 1.1237 -0.0798 -0.1385 -0.5615 1577 ALA A N   
441  C CA  . ALA A 70  ? 1.0605 1.0983 1.1173 -0.0795 -0.1360 -0.5594 1577 ALA A CA  
442  C C   . ALA A 70  ? 1.0661 1.0996 1.1166 -0.0776 -0.1379 -0.5597 1577 ALA A C   
443  O O   . ALA A 70  ? 1.0662 1.0995 1.1195 -0.0772 -0.1398 -0.5612 1577 ALA A O   
444  C CB  . ALA A 70  ? 1.0548 1.0974 1.1142 -0.0813 -0.1317 -0.5586 1577 ALA A CB  
445  N N   . ASN A 71  ? 1.1188 1.1454 1.1430 -0.0577 -0.1347 -0.6026 1578 ASN A N   
446  C CA  . ASN A 71  ? 1.1251 1.1470 1.1418 -0.0562 -0.1359 -0.6028 1578 ASN A CA  
447  C C   . ASN A 71  ? 1.1272 1.1480 1.1364 -0.0560 -0.1322 -0.6006 1578 ASN A C   
448  O O   . ASN A 71  ? 1.1229 1.1473 1.1337 -0.0571 -0.1288 -0.5989 1578 ASN A O   
449  C CB  . ASN A 71  ? 1.1323 1.1481 1.1452 -0.0546 -0.1410 -0.6039 1578 ASN A CB  
450  C CG  . ASN A 71  ? 1.1343 1.1484 1.1453 -0.0546 -0.1419 -0.6029 1578 ASN A CG  
451  O OD1 . ASN A 71  ? 1.1381 1.1496 1.1414 -0.0542 -0.1403 -0.6011 1578 ASN A OD1 
452  N ND2 . ASN A 71  ? 1.1320 1.1475 1.1501 -0.0551 -0.1444 -0.6039 1578 ASN A ND2 
453  N N   . LYS A 72  ? 1.1577 1.1056 1.0745 -0.0051 -0.1368 -0.5465 1579 LYS A N   
454  C CA  . LYS A 72  ? 1.1607 1.1069 1.0703 -0.0046 -0.1333 -0.5444 1579 LYS A CA  
455  C C   . LYS A 72  ? 1.1691 1.1088 1.0695 -0.0035 -0.1348 -0.5439 1579 LYS A C   
456  O O   . LYS A 72  ? 1.1726 1.1101 1.0666 -0.0031 -0.1317 -0.5422 1579 LYS A O   
457  C CB  . LYS A 72  ? 1.1619 1.1075 1.0695 -0.0041 -0.1316 -0.5449 1579 LYS A CB  
458  C CG  . LYS A 72  ? 1.1538 1.1058 1.0696 -0.0054 -0.1293 -0.5449 1579 LYS A CG  
459  C CD  . LYS A 72  ? 1.1554 1.1065 1.0692 -0.0049 -0.1277 -0.5450 1579 LYS A CD  
460  C CE  . LYS A 72  ? 1.1555 1.1072 1.0662 -0.0049 -0.1230 -0.5428 1579 LYS A CE  
461  N NZ  . LYS A 72  ? 1.1472 1.1056 1.0652 -0.0068 -0.1200 -0.5414 1579 LYS A NZ  
462  N N   . ARG A 73  ? 1.2186 1.4681 0.8961 0.1190  -0.1803 -0.5964 1580 ARG A N   
463  C CA  . ARG A 73  ? 1.2274 1.4700 0.8961 0.1200  -0.1828 -0.5960 1580 ARG A CA  
464  C C   . ARG A 73  ? 1.2274 1.4704 0.8929 0.1195  -0.1798 -0.5936 1580 ARG A C   
465  O O   . ARG A 73  ? 1.2238 1.4694 0.8938 0.1189  -0.1806 -0.5932 1580 ARG A O   
466  C CB  . ARG A 73  ? 1.2296 1.4697 0.9011 0.1203  -0.1887 -0.5975 1580 ARG A CB  
467  C CG  . ARG A 73  ? 1.2294 1.4692 0.9052 0.1207  -0.1922 -0.5996 1580 ARG A CG  
468  C CD  . ARG A 73  ? 1.2278 1.4682 0.9110 0.1203  -0.1969 -0.6010 1580 ARG A CD  
469  N NE  . ARG A 73  ? 1.2258 1.4674 0.9156 0.1206  -0.1996 -0.6029 1580 ARG A NE  
470  C CZ  . ARG A 73  ? 1.2321 1.4683 0.9201 0.1213  -0.2052 -0.6043 1580 ARG A CZ  
471  N NH1 . ARG A 73  ? 1.2412 1.4701 0.9207 0.1222  -0.2087 -0.6039 1580 ARG A NH1 
472  N NH2 . ARG A 73  ? 1.2295 1.4674 0.9244 0.1213  -0.2073 -0.6061 1580 ARG A NH2 
473  N N   . LEU A 74  ? 1.1123 1.6856 0.8501 0.1530  -0.1458 -0.6241 1581 LEU A N   
474  C CA  . LEU A 74  ? 1.1123 1.6861 0.8471 0.1527  -0.1424 -0.6219 1581 LEU A CA  
475  C C   . LEU A 74  ? 1.1228 1.6886 0.8463 0.1537  -0.1432 -0.6212 1581 LEU A C   
476  O O   . LEU A 74  ? 1.1303 1.6903 0.8461 0.1547  -0.1433 -0.6218 1581 LEU A O   
477  C CB  . LEU A 74  ? 1.1077 1.6857 0.8445 0.1520  -0.1368 -0.6204 1581 LEU A CB  
478  C CG  . LEU A 74  ? 1.1036 1.6853 0.8422 0.1510  -0.1332 -0.6179 1581 LEU A CG  
479  C CD1 . LEU A 74  ? 1.0959 1.6832 0.8430 0.1497  -0.1343 -0.6180 1581 LEU A CD1 
480  C CD2 . LEU A 74  ? 1.1005 1.6853 0.8407 0.1507  -0.1281 -0.6165 1581 LEU A CD2 
481  N N   . ARG A 75  ? 1.0397 1.9725 0.7030 0.1553  -0.1155 -0.5702 1582 ARG A N   
482  C CA  . ARG A 75  ? 1.0499 1.9749 0.7026 0.1561  -0.1169 -0.5695 1582 ARG A CA  
483  C C   . ARG A 75  ? 1.0503 1.9757 0.6996 0.1556  -0.1125 -0.5669 1582 ARG A C   
484  O O   . ARG A 75  ? 1.0426 1.9741 0.6988 0.1546  -0.1106 -0.5658 1582 ARG A O   
485  C CB  . ARG A 75  ? 1.0522 1.9747 0.7058 0.1561  -0.1229 -0.5702 1582 ARG A CB  
486  C CG  . ARG A 75  ? 1.0543 1.9744 0.7097 0.1565  -0.1280 -0.5727 1582 ARG A CG  
487  C CD  . ARG A 75  ? 1.0575 1.9744 0.7137 0.1567  -0.1340 -0.5733 1582 ARG A CD  
488  N NE  . ARG A 75  ? 1.0674 1.9768 0.7127 0.1571  -0.1351 -0.5720 1582 ARG A NE  
489  C CZ  . ARG A 75  ? 1.0786 1.9791 0.7135 0.1579  -0.1383 -0.5724 1582 ARG A CZ  
490  N NH1 . ARG A 75  ? 1.0813 1.9794 0.7153 0.1583  -0.1405 -0.5741 1582 ARG A NH1 
491  N NH2 . ARG A 75  ? 1.0876 1.9813 0.7124 0.1580  -0.1391 -0.5710 1582 ARG A NH2 
492  N N   . TYR A 76  ? 0.9506 2.3153 0.6620 0.1592  -0.0832 -0.5820 1583 TYR A N   
493  C CA  . TYR A 76  ? 0.9526 2.3164 0.6599 0.1590  -0.0794 -0.5796 1583 TYR A CA  
494  C C   . TYR A 76  ? 0.9597 2.3176 0.6607 0.1592  -0.0834 -0.5794 1583 TYR A C   
495  O O   . TYR A 76  ? 0.9702 2.3199 0.6612 0.1599  -0.0857 -0.5799 1583 TYR A O   
496  C CB  . TYR A 76  ? 0.9588 2.3186 0.6583 0.1597  -0.0745 -0.5788 1583 TYR A CB  
497  C CG  . TYR A 76  ? 0.9600 2.3197 0.6567 0.1594  -0.0698 -0.5762 1583 TYR A CG  
498  C CD1 . TYR A 76  ? 0.9694 2.3220 0.6562 0.1597  -0.0706 -0.5752 1583 TYR A CD1 
499  C CD2 . TYR A 76  ? 0.9520 2.3185 0.6559 0.1587  -0.0650 -0.5745 1583 TYR A CD2 
500  C CE1 . TYR A 76  ? 0.9706 2.3230 0.6550 0.1594  -0.0663 -0.5728 1583 TYR A CE1 
501  C CE2 . TYR A 76  ? 0.9531 2.3195 0.6549 0.1583  -0.0610 -0.5720 1583 TYR A CE2 
502  C CZ  . TYR A 76  ? 0.9623 2.3217 0.6545 0.1588  -0.0615 -0.5713 1583 TYR A CZ  
503  O OH  . TYR A 76  ? 0.9635 2.3228 0.6539 0.1585  -0.0575 -0.5688 1583 TYR A OH  
504  N N   . VAL A 77  ? 0.8571 2.3478 0.5836 0.1108  -0.1072 -0.4763 1584 VAL A N   
505  C CA  . VAL A 77  ? 0.8629 2.3488 0.5847 0.1108  -0.1111 -0.4758 1584 VAL A CA  
506  C C   . VAL A 77  ? 0.8622 2.3492 0.5827 0.1103  -0.1077 -0.4733 1584 VAL A C   
507  O O   . VAL A 77  ? 0.8539 2.3473 0.5826 0.1096  -0.1070 -0.4726 1584 VAL A O   
508  C CB  . VAL A 77  ? 0.8587 2.3470 0.5884 0.1106  -0.1169 -0.4774 1584 VAL A CB  
509  C CG1 . VAL A 77  ? 0.8463 2.3441 0.5886 0.1097  -0.1152 -0.4774 1584 VAL A CG1 
510  C CG2 . VAL A 77  ? 0.8651 2.3480 0.5902 0.1106  -0.1212 -0.4769 1584 VAL A CG2 
511  N N   . ASP A 78  ? 0.7740 2.5735 0.5538 0.0916  -0.0842 -0.4460 1585 ASP A N   
512  C CA  . ASP A 78  ? 0.7753 2.5745 0.5521 0.0913  -0.0808 -0.4433 1585 ASP A CA  
513  C C   . ASP A 78  ? 0.7645 2.5725 0.5508 0.0904  -0.0763 -0.4420 1585 ASP A C   
514  O O   . ASP A 78  ? 0.7582 2.5708 0.5511 0.0896  -0.0772 -0.4413 1585 ASP A O   
515  C CB  . ASP A 78  ? 0.7789 2.5748 0.5534 0.0909  -0.0855 -0.4429 1585 ASP A CB  
516  C CG  . ASP A 78  ? 0.7902 2.5768 0.5552 0.0917  -0.0907 -0.4442 1585 ASP A CG  
517  O OD1 . ASP A 78  ? 0.7892 2.5759 0.5575 0.0918  -0.0951 -0.4462 1585 ASP A OD1 
518  O OD2 . ASP A 78  ? 0.8003 2.5794 0.5545 0.0918  -0.0904 -0.4429 1585 ASP A OD2 
519  N N   . GLN A 79  ? 0.7813 2.5519 0.5861 0.1897  -0.0795 -0.4918 1586 GLN A N   
520  C CA  . GLN A 79  ? 0.7720 2.5503 0.5853 0.1888  -0.0751 -0.4903 1586 GLN A CA  
521  C C   . GLN A 79  ? 0.7611 2.5473 0.5858 0.1879  -0.0768 -0.4916 1586 GLN A C   
522  O O   . GLN A 79  ? 0.7535 2.5459 0.5853 0.1870  -0.0736 -0.4903 1586 GLN A O   
523  C CB  . GLN A 79  ? 0.7712 2.5506 0.5846 0.1881  -0.0731 -0.4878 1586 GLN A CB  
524  C CG  . GLN A 79  ? 0.7813 2.5536 0.5841 0.1888  -0.0702 -0.4862 1586 GLN A CG  
525  C CD  . GLN A 79  ? 0.7806 2.5538 0.5837 0.1880  -0.0689 -0.4837 1586 GLN A CD  
526  O OE1 . GLN A 79  ? 0.7717 2.5517 0.5836 0.1871  -0.0683 -0.4828 1586 GLN A OE1 
527  N NE2 . GLN A 79  ? 0.7904 2.5563 0.5836 0.1886  -0.0687 -0.4828 1586 GLN A NE2 
528  N N   . VAL A 80  ? 0.7865 2.2471 0.6004 0.1620  -0.0973 -0.4650 1587 VAL A N   
529  C CA  . VAL A 80  ? 0.7770 2.2444 0.6014 0.1611  -0.0989 -0.4663 1587 VAL A CA  
530  C C   . VAL A 80  ? 0.7766 2.2440 0.6024 0.1615  -0.1002 -0.4686 1587 VAL A C   
531  O O   . VAL A 80  ? 0.7845 2.2457 0.6031 0.1626  -0.1020 -0.4697 1587 VAL A O   
532  C CB  . VAL A 80  ? 0.7753 2.2433 0.6032 0.1606  -0.1035 -0.4672 1587 VAL A CB  
533  C CG1 . VAL A 80  ? 0.7650 2.2405 0.6040 0.1595  -0.1036 -0.4679 1587 VAL A CG1 
534  C CG2 . VAL A 80  ? 0.7784 2.2442 0.6025 0.1606  -0.1030 -0.4652 1587 VAL A CG2 
535  N N   . LEU A 81  ? 0.9037 2.0917 0.6792 0.2198  -0.1235 -0.5449 1588 LEU A N   
536  C CA  . LEU A 81  ? 0.9022 2.0911 0.6803 0.2203  -0.1247 -0.5468 1588 LEU A CA  
537  C C   . LEU A 81  ? 0.8969 2.0891 0.6827 0.2196  -0.1286 -0.5489 1588 LEU A C   
538  O O   . LEU A 81  ? 0.8887 2.0872 0.6828 0.2184  -0.1272 -0.5490 1588 LEU A O   
539  C CB  . LEU A 81  ? 0.8971 2.0905 0.6791 0.2196  -0.1203 -0.5461 1588 LEU A CB  
540  C CG  . LEU A 81  ? 0.8987 2.0918 0.6775 0.2196  -0.1151 -0.5436 1588 LEU A CG  
541  C CD1 . LEU A 81  ? 0.8920 2.0906 0.6774 0.2187  -0.1120 -0.5429 1588 LEU A CD1 
542  C CD2 . LEU A 81  ? 0.9089 2.0945 0.6773 0.2212  -0.1142 -0.5435 1588 LEU A CD2 
543  N N   . GLN A 82  ? 0.8790 1.9059 0.6643 0.1167  -0.1286 -0.5116 1589 GLN A N   
544  C CA  . GLN A 82  ? 0.8747 1.9042 0.6677 0.1162  -0.1324 -0.5135 1589 GLN A CA  
545  C C   . GLN A 82  ? 0.8709 1.9031 0.6694 0.1162  -0.1331 -0.5155 1589 GLN A C   
546  O O   . GLN A 82  ? 0.8749 1.9042 0.6689 0.1169  -0.1330 -0.5160 1589 GLN A O   
547  C CB  . GLN A 82  ? 0.8814 1.9052 0.6708 0.1171  -0.1376 -0.5144 1589 GLN A CB  
548  C CG  . GLN A 82  ? 0.8809 1.9050 0.6712 0.1165  -0.1383 -0.5131 1589 GLN A CG  
549  C CD  . GLN A 82  ? 0.8867 1.9057 0.6753 0.1172  -0.1440 -0.5141 1589 GLN A CD  
550  O OE1 . GLN A 82  ? 0.8844 1.9048 0.6775 0.1167  -0.1456 -0.5139 1589 GLN A OE1 
551  N NE2 . GLN A 82  ? 0.8944 1.9072 0.6767 0.1182  -0.1473 -0.5152 1589 GLN A NE2 
552  N N   . LEU A 83  ? 0.9554 1.6974 0.7374 0.1134  -0.1577 -0.5354 1590 LEU A N   
553  C CA  . LEU A 83  ? 0.9514 1.6962 0.7397 0.1133  -0.1586 -0.5374 1590 LEU A CA  
554  C C   . LEU A 83  ? 0.9502 1.6952 0.7448 0.1130  -0.1629 -0.5393 1590 LEU A C   
555  O O   . LEU A 83  ? 0.9466 1.6942 0.7460 0.1121  -0.1626 -0.5390 1590 LEU A O   
556  C CB  . LEU A 83  ? 0.9434 1.6947 0.7377 0.1116  -0.1544 -0.5368 1590 LEU A CB  
557  C CG  . LEU A 83  ? 0.9390 1.6936 0.7392 0.1111  -0.1544 -0.5383 1590 LEU A CG  
558  C CD1 . LEU A 83  ? 0.9429 1.6948 0.7379 0.1123  -0.1537 -0.5385 1590 LEU A CD1 
559  C CD2 . LEU A 83  ? 0.9312 1.6920 0.7377 0.1092  -0.1509 -0.5375 1590 LEU A CD2 
560  N N   . VAL A 84  ? 0.9523 1.6698 0.8028 0.0474  -0.1841 -0.5958 1591 VAL A N   
561  C CA  . VAL A 84  ? 0.9523 1.6691 0.8088 0.0474  -0.1886 -0.5976 1591 VAL A CA  
562  C C   . VAL A 84  ? 0.9463 1.6676 0.8122 0.0467  -0.1888 -0.5996 1591 VAL A C   
563  O O   . VAL A 84  ? 0.9475 1.6679 0.8126 0.0474  -0.1896 -0.6006 1591 VAL A O   
564  C CB  . VAL A 84  ? 0.9615 1.6709 0.8115 0.0489  -0.1938 -0.5982 1591 VAL A CB  
565  C CG1 . VAL A 84  ? 0.9614 1.6702 0.8187 0.0491  -0.1987 -0.5999 1591 VAL A CG1 
566  C CG2 . VAL A 84  ? 0.9682 1.6726 0.8082 0.0496  -0.1933 -0.5963 1591 VAL A CG2 
567  N N   . TYR A 85  ? 0.9476 1.5096 0.8670 -0.0040 -0.1867 -0.5853 1592 TYR A N   
568  C CA  . TYR A 85  ? 0.9422 1.5082 0.8711 -0.0048 -0.1867 -0.5871 1592 TYR A CA  
569  C C   . TYR A 85  ? 0.9440 1.5080 0.8789 -0.0043 -0.1915 -0.5889 1592 TYR A C   
570  O O   . TYR A 85  ? 0.9427 1.5075 0.8822 -0.0046 -0.1923 -0.5891 1592 TYR A O   
571  C CB  . TYR A 85  ? 0.9348 1.5067 0.8696 -0.0068 -0.1824 -0.5867 1592 TYR A CB  
572  C CG  . TYR A 85  ? 0.9315 1.5064 0.8638 -0.0077 -0.1779 -0.5855 1592 TYR A CG  
573  C CD1 . TYR A 85  ? 0.9346 1.5074 0.8608 -0.0066 -0.1777 -0.5849 1592 TYR A CD1 
574  C CD2 . TYR A 85  ? 0.9257 1.5053 0.8618 -0.0097 -0.1739 -0.5848 1592 TYR A CD2 
575  C CE1 . TYR A 85  ? 0.9315 1.5072 0.8564 -0.0076 -0.1738 -0.5838 1592 TYR A CE1 
576  C CE2 . TYR A 85  ? 0.9230 1.5051 0.8572 -0.0107 -0.1704 -0.5835 1592 TYR A CE2 
577  C CZ  . TYR A 85  ? 0.9257 1.5060 0.8547 -0.0096 -0.1703 -0.5828 1592 TYR A CZ  
578  O OH  . TYR A 85  ? 0.9230 1.5058 0.8509 -0.0104 -0.1669 -0.5814 1592 TYR A OH  
579  N N   . LYS A 86  ? 0.9682 1.5587 1.0295 -0.0230 -0.2324 -0.7091 1593 LYS A N   
580  C CA  . LYS A 86  ? 0.9710 1.5588 1.0376 -0.0223 -0.2378 -0.7106 1593 LYS A CA  
581  C C   . LYS A 86  ? 0.9658 1.5575 1.0439 -0.0230 -0.2380 -0.7128 1593 LYS A C   
582  O O   . LYS A 86  ? 0.9604 1.5566 1.0415 -0.0241 -0.2342 -0.7131 1593 LYS A O   
583  C CB  . LYS A 86  ? 0.9797 1.5605 1.0382 -0.0207 -0.2425 -0.7106 1593 LYS A CB  
584  C CG  . LYS A 86  ? 0.9804 1.5608 1.0362 -0.0203 -0.2421 -0.7113 1593 LYS A CG  
585  C CD  . LYS A 86  ? 0.9893 1.5624 1.0389 -0.0187 -0.2476 -0.7120 1593 LYS A CD  
586  C CE  . LYS A 86  ? 0.9896 1.5626 1.0383 -0.0184 -0.2475 -0.7129 1593 LYS A CE  
587  N NZ  . LYS A 86  ? 0.9986 1.5641 1.0416 -0.0172 -0.2533 -0.7136 1593 LYS A NZ  
588  N N   . ASP A 87  ? 0.9829 1.5005 1.2214 -0.0929 -0.2326 -0.7785 1594 ASP A N   
589  C CA  . ASP A 87  ? 0.9793 1.4995 1.2292 -0.0934 -0.2337 -0.7806 1594 ASP A CA  
590  C C   . ASP A 87  ? 0.9712 1.4979 1.2294 -0.0952 -0.2284 -0.7813 1594 ASP A C   
591  O O   . ASP A 87  ? 0.9676 1.4973 1.2294 -0.0958 -0.2264 -0.7821 1594 ASP A O   
592  C CB  . ASP A 87  ? 0.9817 1.4999 1.2296 -0.0925 -0.2360 -0.7814 1594 ASP A CB  
593  C CG  . ASP A 87  ? 0.9905 1.5015 1.2317 -0.0908 -0.2422 -0.7813 1594 ASP A CG  
594  O OD1 . ASP A 87  ? 0.9938 1.5018 1.2381 -0.0904 -0.2465 -0.7814 1594 ASP A OD1 
595  O OD2 . ASP A 87  ? 0.9946 1.5025 1.2273 -0.0900 -0.2427 -0.7809 1594 ASP A OD2 
596  N N   . GLY A 88  ? 0.9011 1.3471 1.1760 -0.1057 -0.1973 -0.6826 1595 GLY A N   
597  C CA  . GLY A 88  ? 0.8945 1.3458 1.1770 -0.1076 -0.1923 -0.6833 1595 GLY A CA  
598  C C   . GLY A 88  ? 0.8927 1.3452 1.1878 -0.1079 -0.1939 -0.6855 1595 GLY A C   
599  O O   . GLY A 88  ? 0.8955 1.3455 1.1943 -0.1067 -0.1985 -0.6866 1595 GLY A O   
600  N N   . SER A 89  ? 0.8653 1.2780 1.2991 -0.1709 -0.1469 -0.6919 1596 SER A N   
601  C CA  . SER A 89  ? 0.8636 1.2774 1.3101 -0.1712 -0.1476 -0.6940 1596 SER A CA  
602  C C   . SER A 89  ? 0.8670 1.2778 1.3166 -0.1702 -0.1518 -0.6940 1596 SER A C   
603  O O   . SER A 89  ? 0.8691 1.2782 1.3117 -0.1699 -0.1520 -0.6923 1596 SER A O   
604  C CB  . SER A 89  ? 0.8584 1.2765 1.3102 -0.1736 -0.1414 -0.6948 1596 SER A CB  
605  O OG  . SER A 89  ? 0.8581 1.2765 1.3070 -0.1744 -0.1392 -0.6937 1596 SER A OG  
606  N N   . PRO A 90  ? 0.8060 1.4287 1.3313 -0.1617 -0.2220 -0.7371 1597 PRO A N   
607  C CA  . PRO A 90  ? 0.8094 1.4291 1.3391 -0.1607 -0.2265 -0.7371 1597 PRO A CA  
608  C C   . PRO A 90  ? 0.8076 1.4287 1.3390 -0.1617 -0.2232 -0.7368 1597 PRO A C   
609  O O   . PRO A 90  ? 0.8030 1.4279 1.3394 -0.1634 -0.2177 -0.7376 1597 PRO A O   
610  C CB  . PRO A 90  ? 0.8086 1.4288 1.3522 -0.1606 -0.2290 -0.7393 1597 PRO A CB  
611  C CG  . PRO A 90  ? 0.8074 1.4287 1.3499 -0.1606 -0.2284 -0.7398 1597 PRO A CG  
612  C CD  . PRO A 90  ? 0.8039 1.4284 1.3382 -0.1621 -0.2222 -0.7390 1597 PRO A CD  
613  N N   . CYS A 91  ? 0.7210 1.4158 1.0418 -0.1539 -0.2375 -0.5358 1598 CYS A N   
614  C CA  . CYS A 91  ? 0.7200 1.4156 1.0423 -0.1545 -0.2354 -0.5353 1598 CYS A CA  
615  C C   . CYS A 91  ? 0.7217 1.4156 1.0554 -0.1539 -0.2393 -0.5364 1598 CYS A C   
616  O O   . CYS A 91  ? 0.7259 1.4162 1.0616 -0.1526 -0.2457 -0.5365 1598 CYS A O   
617  C CB  . CYS A 91  ? 0.7232 1.4163 1.0323 -0.1541 -0.2360 -0.5328 1598 CYS A CB  
618  S SG  . CYS A 91  ? 0.7315 1.4178 1.0333 -0.1518 -0.2442 -0.5314 1598 CYS A SG  
619  N N   . PRO A 92  ? 0.6761 1.3473 1.0387 -0.1897 -0.2520 -0.4419 1599 PRO A N   
620  C CA  . PRO A 92  ? 0.6769 1.3472 1.0517 -0.1893 -0.2545 -0.4431 1599 PRO A CA  
621  C C   . PRO A 92  ? 0.6829 1.3481 1.0570 -0.1875 -0.2628 -0.4420 1599 PRO A C   
622  O O   . PRO A 92  ? 0.6848 1.3484 1.0659 -0.1865 -0.2675 -0.4429 1599 PRO A O   
623  C CB  . PRO A 92  ? 0.6748 1.3468 1.0490 -0.1905 -0.2500 -0.4427 1599 PRO A CB  
624  C CG  . PRO A 92  ? 0.6719 1.3465 1.0359 -0.1918 -0.2440 -0.4419 1599 PRO A CG  
625  C CD  . PRO A 92  ? 0.6717 1.3467 1.0315 -0.1915 -0.2446 -0.4419 1599 PRO A CD  
626  N N   . SER A 93  ? 0.7195 1.8171 0.9336 -0.1252 -0.3465 -0.4208 1600 SER A N   
627  C CA  . SER A 93  ? 0.7261 1.8181 0.9375 -0.1237 -0.3542 -0.4196 1600 SER A CA  
628  C C   . SER A 93  ? 0.7293 1.8185 0.9502 -0.1225 -0.3610 -0.4205 1600 SER A C   
629  O O   . SER A 93  ? 0.7290 1.8182 0.9628 -0.1225 -0.3630 -0.4217 1600 SER A O   
630  C CB  . SER A 93  ? 0.7305 1.8192 0.9247 -0.1230 -0.3556 -0.4171 1600 SER A CB  
631  O OG  . SER A 93  ? 0.7288 1.8191 0.9167 -0.1231 -0.3529 -0.4172 1600 SER A OG  
632  N N   . LYS A 94  ? 0.8112 2.1758 1.2502 -0.0390 -0.4740 -0.7623 1601 LYS A N   
633  C CA  . LYS A 94  ? 0.8151 2.1763 1.2612 -0.0379 -0.4810 -0.7630 1601 LYS A CA  
634  C C   . LYS A 94  ? 0.8140 2.1762 1.2586 -0.0379 -0.4803 -0.7638 1601 LYS A C   
635  O O   . LYS A 94  ? 0.8104 2.1758 1.2480 -0.0386 -0.4747 -0.7638 1601 LYS A O   
636  C CB  . LYS A 94  ? 0.8237 2.1777 1.2615 -0.0368 -0.4887 -0.7610 1601 LYS A CB  
637  C CG  . LYS A 94  ? 0.8255 2.1779 1.2689 -0.0366 -0.4914 -0.7605 1601 LYS A CG  
638  C CD  . LYS A 94  ? 0.8328 2.1793 1.2619 -0.0362 -0.4954 -0.7580 1601 LYS A CD  
639  C CE  . LYS A 94  ? 0.8334 2.1792 1.2673 -0.0362 -0.4964 -0.7573 1601 LYS A CE  
640  N NZ  . LYS A 94  ? 0.8408 2.1807 1.2607 -0.0357 -0.5004 -0.7548 1601 LYS A NZ  
641  N N   . SER A 95  ? 0.8597 2.2631 1.7789 -0.0296 -0.5315 -1.1749 1602 SER A N   
642  C CA  . SER A 95  ? 0.8587 2.2630 1.7785 -0.0295 -0.5317 -1.1759 1602 SER A CA  
643  C C   . SER A 95  ? 0.8625 2.2639 1.7652 -0.0289 -0.5321 -1.1746 1602 SER A C   
644  O O   . SER A 95  ? 0.8696 2.2651 1.7615 -0.0282 -0.5368 -1.1729 1602 SER A O   
645  C CB  . SER A 95  ? 0.8618 2.2633 1.7933 -0.0286 -0.5386 -1.1770 1602 SER A CB  
646  O OG  . SER A 95  ? 0.8569 2.2623 1.8061 -0.0293 -0.5368 -1.1787 1602 SER A OG  
647  N N   . GLY A 96  ? 0.8982 2.3189 1.8492 -0.0155 -0.4968 -1.3078 1603 GLY A N   
648  C CA  . GLY A 96  ? 0.9012 2.3197 1.8378 -0.0152 -0.4968 -1.3069 1603 GLY A CA  
649  C C   . GLY A 96  ? 0.8999 2.3198 1.8239 -0.0156 -0.4914 -1.3054 1603 GLY A C   
650  O O   . GLY A 96  ? 0.9005 2.3201 1.8144 -0.0155 -0.4893 -1.3048 1603 GLY A O   
651  N N   . LEU A 97  ? 0.8559 2.1169 1.2570 -0.0190 -0.4106 -0.8952 1604 LEU A N   
652  C CA  . LEU A 97  ? 0.8552 2.1171 1.2447 -0.0196 -0.4061 -0.8934 1604 LEU A CA  
653  C C   . LEU A 97  ? 0.8478 2.1159 1.2381 -0.0209 -0.3982 -0.8939 1604 LEU A C   
654  O O   . LEU A 97  ? 0.8423 2.1148 1.2434 -0.0220 -0.3948 -0.8953 1604 LEU A O   
655  C CB  . LEU A 97  ? 0.8566 2.1172 1.2465 -0.0197 -0.4068 -0.8924 1604 LEU A CB  
656  C CG  . LEU A 97  ? 0.8652 2.1187 1.2488 -0.0185 -0.4140 -0.8910 1604 LEU A CG  
657  C CD1 . LEU A 97  ? 0.8654 2.1185 1.2546 -0.0186 -0.4151 -0.8906 1604 LEU A CD1 
658  C CD2 . LEU A 97  ? 0.8704 2.1200 1.2369 -0.0179 -0.4138 -0.8891 1604 LEU A CD2 
659  N N   . SER A 98  ? 0.8180 1.7287 1.1797 -0.1225 -0.2664 -0.7667 1605 SER A N   
660  C CA  . SER A 98  ? 0.8118 1.7278 1.1724 -0.1238 -0.2594 -0.7667 1605 SER A CA  
661  C C   . SER A 98  ? 0.8118 1.7280 1.1624 -0.1243 -0.2558 -0.7648 1605 SER A C   
662  O O   . SER A 98  ? 0.8169 1.7290 1.1601 -0.1234 -0.2587 -0.7633 1605 SER A O   
663  C CB  . SER A 98  ? 0.8116 1.7279 1.1687 -0.1237 -0.2590 -0.7671 1605 SER A CB  
664  O OG  . SER A 98  ? 0.8103 1.7275 1.1780 -0.1235 -0.2612 -0.7692 1605 SER A OG  
665  N N   . TYR A 99  ? 0.7725 1.5485 0.9034 -0.1181 -0.2073 -0.5594 1606 TYR A N   
666  C CA  . TYR A 99  ? 0.7718 1.5486 0.8941 -0.1187 -0.2035 -0.5573 1606 TYR A CA  
667  C C   . TYR A 99  ? 0.7751 1.5496 0.8854 -0.1180 -0.2036 -0.5558 1606 TYR A C   
668  O O   . TYR A 99  ? 0.7751 1.5497 0.8847 -0.1176 -0.2039 -0.5564 1606 TYR A O   
669  C CB  . TYR A 99  ? 0.7654 1.5474 0.8915 -0.1208 -0.1973 -0.5576 1606 TYR A CB  
670  C CG  . TYR A 99  ? 0.7627 1.5467 0.8981 -0.1218 -0.1958 -0.5588 1606 TYR A CG  
671  C CD1 . TYR A 99  ? 0.7591 1.5459 0.9055 -0.1229 -0.1941 -0.5611 1606 TYR A CD1 
672  C CD2 . TYR A 99  ? 0.7640 1.5469 0.8974 -0.1218 -0.1958 -0.5576 1606 TYR A CD2 
673  C CE1 . TYR A 99  ? 0.7571 1.5453 0.9121 -0.1238 -0.1924 -0.5622 1606 TYR A CE1 
674  C CE2 . TYR A 99  ? 0.7619 1.5462 0.9038 -0.1228 -0.1944 -0.5588 1606 TYR A CE2 
675  C CZ  . TYR A 99  ? 0.7585 1.5454 0.9113 -0.1238 -0.1925 -0.5612 1606 TYR A CZ  
676  O OH  . TYR A 99  ? 0.7567 1.5449 0.9182 -0.1247 -0.1907 -0.5625 1606 TYR A OH  
677  N N   . LYS A 100 ? 0.7978 1.6481 0.8673 -0.0807 -0.2075 -0.5960 1607 LYS A N   
678  C CA  . LYS A 100 ? 0.8008 1.6491 0.8590 -0.0802 -0.2066 -0.5943 1607 LYS A CA  
679  C C   . LYS A 100 ? 0.7996 1.6491 0.8518 -0.0808 -0.2026 -0.5922 1607 LYS A C   
680  O O   . LYS A 100 ? 0.7987 1.6488 0.8533 -0.0815 -0.2021 -0.5918 1607 LYS A O   
681  C CB  . LYS A 100 ? 0.8090 1.6507 0.8602 -0.0784 -0.2120 -0.5940 1607 LYS A CB  
682  C CG  . LYS A 100 ? 0.8136 1.6513 0.8653 -0.0776 -0.2164 -0.5938 1607 LYS A CG  
683  C CD  . LYS A 100 ? 0.8225 1.6531 0.8660 -0.0762 -0.2217 -0.5934 1607 LYS A CD  
684  C CE  . LYS A 100 ? 0.8272 1.6537 0.8729 -0.0755 -0.2272 -0.5932 1607 LYS A CE  
685  N NZ  . LYS A 100 ? 0.8371 1.6556 0.8731 -0.0744 -0.2325 -0.5927 1607 LYS A NZ  
686  N N   . SER A 101 ? 0.7750 1.5863 0.7515 -0.0379 -0.1780 -0.5041 1608 SER A N   
687  C CA  . SER A 101 ? 0.7736 1.5864 0.7449 -0.0388 -0.1739 -0.5020 1608 SER A CA  
688  C C   . SER A 101 ? 0.7787 1.5879 0.7390 -0.0377 -0.1737 -0.5001 1608 SER A C   
689  O O   . SER A 101 ? 0.7798 1.5883 0.7370 -0.0372 -0.1732 -0.5004 1608 SER A O   
690  C CB  . SER A 101 ? 0.7667 1.5851 0.7423 -0.0406 -0.1692 -0.5020 1608 SER A CB  
691  O OG  . SER A 101 ? 0.7626 1.5839 0.7477 -0.0417 -0.1687 -0.5037 1608 SER A OG  
692  N N   . VAL A 102 ? 0.7821 1.7602 0.7109 0.0006  -0.1668 -0.5235 1609 VAL A N   
693  C CA  . VAL A 102 ? 0.7871 1.7617 0.7055 0.0015  -0.1657 -0.5217 1609 VAL A CA  
694  C C   . VAL A 102 ? 0.7831 1.7613 0.7000 0.0003  -0.1606 -0.5196 1609 VAL A C   
695  O O   . VAL A 102 ? 0.7823 1.7612 0.6991 -0.0003 -0.1596 -0.5184 1609 VAL A O   
696  C CB  . VAL A 102 ? 0.7950 1.7634 0.7066 0.0027  -0.1694 -0.5210 1609 VAL A CB  
697  C CG1 . VAL A 102 ? 0.8014 1.7645 0.7099 0.0041  -0.1740 -0.5223 1609 VAL A CG1 
698  C CG2 . VAL A 102 ? 0.7938 1.7627 0.7105 0.0021  -0.1712 -0.5210 1609 VAL A CG2 
699  N N   . ILE A 103 ? 0.7849 1.6669 0.6871 0.0237  -0.1369 -0.4706 1610 ILE A N   
700  C CA  . ILE A 103 ? 0.7811 1.6666 0.6825 0.0225  -0.1323 -0.4686 1610 ILE A CA  
701  C C   . ILE A 103 ? 0.7862 1.6683 0.6786 0.0234  -0.1307 -0.4666 1610 ILE A C   
702  O O   . ILE A 103 ? 0.7887 1.6691 0.6774 0.0242  -0.1301 -0.4668 1610 ILE A O   
703  C CB  . ILE A 103 ? 0.7751 1.6653 0.6817 0.0212  -0.1297 -0.4693 1610 ILE A CB  
704  C CG1 . ILE A 103 ? 0.7709 1.6639 0.6861 0.0203  -0.1310 -0.4715 1610 ILE A CG1 
705  C CG2 . ILE A 103 ? 0.7712 1.6649 0.6778 0.0197  -0.1254 -0.4670 1610 ILE A CG2 
706  C CD1 . ILE A 103 ? 0.7671 1.6630 0.6866 0.0196  -0.1300 -0.4726 1610 ILE A CD1 
707  N N   . SER A 104 ? 0.7452 1.9017 0.6392 0.0635  -0.1195 -0.4742 1611 SER A N   
708  C CA  . SER A 104 ? 0.7507 1.9035 0.6361 0.0644  -0.1178 -0.4722 1611 SER A CA  
709  C C   . SER A 104 ? 0.7467 1.9032 0.6328 0.0632  -0.1130 -0.4700 1611 SER A C   
710  O O   . SER A 104 ? 0.7402 1.9016 0.6324 0.0617  -0.1115 -0.4697 1611 SER A O   
711  C CB  . SER A 104 ? 0.7553 1.9044 0.6366 0.0648  -0.1196 -0.4711 1611 SER A CB  
712  O OG  . SER A 104 ? 0.7590 1.9047 0.6404 0.0657  -0.1244 -0.4729 1611 SER A OG  
713  N N   . PHE A 105 ? 0.7829 1.9980 0.6560 0.1464  -0.1173 -0.4873 1612 PHE A N   
714  C CA  . PHE A 105 ? 0.7801 1.9980 0.6537 0.1456  -0.1128 -0.4851 1612 PHE A CA  
715  C C   . PHE A 105 ? 0.7855 1.9998 0.6522 0.1463  -0.1111 -0.4830 1612 PHE A C   
716  O O   . PHE A 105 ? 0.7922 2.0017 0.6519 0.1475  -0.1105 -0.4828 1612 PHE A O   
717  C CB  . PHE A 105 ? 0.7792 1.9981 0.6533 0.1458  -0.1110 -0.4855 1612 PHE A CB  
718  C CG  . PHE A 105 ? 0.7728 1.9963 0.6545 0.1448  -0.1119 -0.4871 1612 PHE A CG  
719  C CD1 . PHE A 105 ? 0.7660 1.9948 0.6537 0.1429  -0.1096 -0.4862 1612 PHE A CD1 
720  C CD2 . PHE A 105 ? 0.7740 1.9960 0.6564 0.1455  -0.1150 -0.4896 1612 PHE A CD2 
721  C CE1 . PHE A 105 ? 0.7607 1.9932 0.6548 0.1416  -0.1102 -0.4875 1612 PHE A CE1 
722  C CE2 . PHE A 105 ? 0.7683 1.9944 0.6577 0.1444  -0.1155 -0.4912 1612 PHE A CE2 
723  C CZ  . PHE A 105 ? 0.7617 1.9930 0.6568 0.1424  -0.1129 -0.4902 1612 PHE A CZ  
724  N N   . VAL A 106 ? 0.6754 2.1648 0.5862 0.1256  -0.0913 -0.4234 1613 VAL A N   
725  C CA  . VAL A 106 ? 0.6801 2.1663 0.5852 0.1261  -0.0898 -0.4210 1613 VAL A CA  
726  C C   . VAL A 106 ? 0.6779 2.1666 0.5841 0.1254  -0.0851 -0.4187 1613 VAL A C   
727  O O   . VAL A 106 ? 0.6713 2.1651 0.5840 0.1240  -0.0837 -0.4183 1613 VAL A O   
728  C CB  . VAL A 106 ? 0.6786 2.1656 0.5855 0.1254  -0.0914 -0.4205 1613 VAL A CB  
729  C CG1 . VAL A 106 ? 0.6848 2.1675 0.5848 0.1261  -0.0905 -0.4187 1613 VAL A CG1 
730  C CG2 . VAL A 106 ? 0.6790 2.1649 0.5877 0.1256  -0.0961 -0.4232 1613 VAL A CG2 
731  N N   . CYS A 107 ? 0.6928 2.3457 0.5981 0.1987  -0.0829 -0.4307 1614 CYS A N   
732  C CA  . CYS A 107 ? 0.6916 2.3462 0.5980 0.1984  -0.0782 -0.4282 1614 CYS A CA  
733  C C   . CYS A 107 ? 0.6866 2.3452 0.5978 0.1967  -0.0772 -0.4259 1614 CYS A C   
734  O O   . CYS A 107 ? 0.6881 2.3453 0.5975 0.1967  -0.0785 -0.4255 1614 CYS A O   
735  C CB  . CYS A 107 ? 0.7001 2.3489 0.5982 0.1997  -0.0758 -0.4271 1614 CYS A CB  
736  S SG  . CYS A 107 ? 0.6994 2.3499 0.5995 0.1993  -0.0697 -0.4239 1614 CYS A SG  
737  N N   . ARG A 108 ? 0.6338 2.3174 0.5789 0.1797  -0.0727 -0.3614 1615 ARG A N   
738  C CA  . ARG A 108 ? 0.6292 2.3165 0.5790 0.1781  -0.0715 -0.3592 1615 ARG A CA  
739  C C   . ARG A 108 ? 0.6264 2.3165 0.5805 0.1773  -0.0680 -0.3569 1615 ARG A C   
740  O O   . ARG A 108 ? 0.6213 2.3152 0.5809 0.1762  -0.0681 -0.3574 1615 ARG A O   
741  C CB  . ARG A 108 ? 0.6233 2.3143 0.5784 0.1764  -0.0742 -0.3603 1615 ARG A CB  
742  C CG  . ARG A 108 ? 0.6202 2.3135 0.5782 0.1747  -0.0738 -0.3583 1615 ARG A CG  
743  C CD  . ARG A 108 ? 0.6145 2.3114 0.5779 0.1729  -0.0759 -0.3598 1615 ARG A CD  
744  N NE  . ARG A 108 ? 0.6127 2.3107 0.5777 0.1715  -0.0763 -0.3583 1615 ARG A NE  
745  C CZ  . ARG A 108 ? 0.6089 2.3092 0.5776 0.1700  -0.0778 -0.3596 1615 ARG A CZ  
746  N NH1 . ARG A 108 ? 0.6065 2.3081 0.5778 0.1695  -0.0793 -0.3621 1615 ARG A NH1 
747  N NH2 . ARG A 108 ? 0.6079 2.3087 0.5776 0.1687  -0.0780 -0.3583 1615 ARG A NH2 
748  N N   . PRO A 109 ? 0.6640 2.4892 0.6219 0.2621  -0.0696 -0.3946 1616 PRO A N   
749  C CA  . PRO A 109 ? 0.6621 2.4896 0.6245 0.2617  -0.0661 -0.3923 1616 PRO A CA  
750  C C   . PRO A 109 ? 0.6551 2.4878 0.6253 0.2592  -0.0662 -0.3905 1616 PRO A C   
751  O O   . PRO A 109 ? 0.6518 2.4873 0.6274 0.2585  -0.0649 -0.3896 1616 PRO A O   
752  C CB  . PRO A 109 ? 0.6680 2.4918 0.6260 0.2626  -0.0627 -0.3903 1616 PRO A CB  
753  C CG  . PRO A 109 ? 0.6709 2.4921 0.6238 0.2630  -0.0650 -0.3907 1616 PRO A CG  
754  C CD  . PRO A 109 ? 0.6705 2.4910 0.6215 0.2633  -0.0690 -0.3939 1616 PRO A CD  
755  N N   . GLU A 110 ? 0.5889 2.3809 0.5834 0.2084  -0.0608 -0.3149 1617 GLU A N   
756  C CA  . GLU A 110 ? 0.5831 2.3793 0.5839 0.2061  -0.0615 -0.3134 1617 GLU A CA  
757  C C   . GLU A 110 ? 0.5785 2.3774 0.5828 0.2047  -0.0639 -0.3154 1617 GLU A C   
758  O O   . GLU A 110 ? 0.5782 2.3767 0.5807 0.2048  -0.0663 -0.3179 1617 GLU A O   
759  C CB  . GLU A 110 ? 0.5832 2.3790 0.5829 0.2054  -0.0627 -0.3125 1617 GLU A CB  
760  C CG  . GLU A 110 ? 0.5779 2.3773 0.5831 0.2028  -0.0637 -0.3111 1617 GLU A CG  
761  C CD  . GLU A 110 ? 0.5759 2.3775 0.5862 0.2014  -0.0617 -0.3079 1617 GLU A CD  
762  O OE1 . GLU A 110 ? 0.5789 2.3791 0.5887 0.2027  -0.0588 -0.3061 1617 GLU A OE1 
763  O OE2 . GLU A 110 ? 0.5717 2.3761 0.5867 0.1992  -0.0627 -0.3072 1617 GLU A OE2 
764  N N   . ALA A 111 ? 0.6452 2.1248 0.6510 0.2354  -0.0758 -0.3587 1618 ALA A N   
765  C CA  . ALA A 111 ? 0.6410 2.1232 0.6503 0.2338  -0.0776 -0.3603 1618 ALA A CA  
766  C C   . ALA A 111 ? 0.6373 2.1217 0.6495 0.2311  -0.0793 -0.3596 1618 ALA A C   
767  O O   . ALA A 111 ? 0.6372 2.1219 0.6504 0.2302  -0.0786 -0.3571 1618 ALA A O   
768  C CB  . ALA A 111 ? 0.6393 2.1232 0.6528 0.2335  -0.0762 -0.3592 1618 ALA A CB  
769  N N   . GLY A 112 ? 0.5946 1.9075 0.6205 0.1254  -0.0679 -0.3041 1619 GLY A N   
770  C CA  . GLY A 112 ? 0.5918 1.9062 0.6197 0.1228  -0.0693 -0.3039 1619 GLY A CA  
771  C C   . GLY A 112 ? 0.5903 1.9050 0.6183 0.1220  -0.0711 -0.3072 1619 GLY A C   
772  O O   . GLY A 112 ? 0.5905 1.9051 0.6181 0.1231  -0.0715 -0.3093 1619 GLY A O   
773  N N   . PRO A 113 ? 0.5787 1.6896 0.6203 0.0209  -0.0623 -0.3093 1620 PRO A N   
774  C CA  . PRO A 113 ? 0.5772 1.6885 0.6196 0.0198  -0.0636 -0.3120 1620 PRO A CA  
775  C C   . PRO A 113 ? 0.5788 1.6886 0.6192 0.0219  -0.0648 -0.3151 1620 PRO A C   
776  O O   . PRO A 113 ? 0.5779 1.6880 0.6195 0.0219  -0.0656 -0.3176 1620 PRO A O   
777  C CB  . PRO A 113 ? 0.5761 1.6878 0.6194 0.0170  -0.0639 -0.3111 1620 PRO A CB  
778  C CG  . PRO A 113 ? 0.5776 1.6884 0.6195 0.0175  -0.0634 -0.3086 1620 PRO A CG  
779  C CD  . PRO A 113 ? 0.5788 1.6896 0.6204 0.0197  -0.0621 -0.3070 1620 PRO A CD  
780  N N   . THR A 114 ? 0.5364 1.7688 0.5718 -0.0109 -0.0577 -0.3106 1621 THR A N   
781  C CA  . THR A 114 ? 0.5384 1.7690 0.5720 -0.0088 -0.0593 -0.3131 1621 THR A CA  
782  C C   . THR A 114 ? 0.5405 1.7698 0.5722 -0.0065 -0.0597 -0.3145 1621 THR A C   
783  O O   . THR A 114 ? 0.5435 1.7704 0.5726 -0.0046 -0.0610 -0.3160 1621 THR A O   
784  C CB  . THR A 114 ? 0.5410 1.7696 0.5719 -0.0081 -0.0597 -0.3122 1621 THR A CB  
785  O OG1 . THR A 114 ? 0.5429 1.7708 0.5716 -0.0071 -0.0582 -0.3093 1621 THR A OG1 
786  C CG2 . THR A 114 ? 0.5392 1.7687 0.5720 -0.0103 -0.0599 -0.3120 1621 THR A CG2 
787  N N   . ASN A 115 ? 0.6336 1.8177 0.6347 0.0734  -0.0759 -0.3804 1622 ASN A N   
788  C CA  . ASN A 115 ? 0.6353 1.8184 0.6350 0.0754  -0.0762 -0.3817 1622 ASN A CA  
789  C C   . ASN A 115 ? 0.6332 1.8174 0.6357 0.0749  -0.0776 -0.3847 1622 ASN A C   
790  O O   . ASN A 115 ? 0.6313 1.8171 0.6359 0.0742  -0.0769 -0.3847 1622 ASN A O   
791  C CB  . ASN A 115 ? 0.6353 1.8191 0.6353 0.0755  -0.0740 -0.3795 1622 ASN A CB  
792  C CG  . ASN A 115 ? 0.6383 1.8204 0.6355 0.0767  -0.0723 -0.3770 1622 ASN A CG  
793  O OD1 . ASN A 115 ? 0.6396 1.8206 0.6350 0.0767  -0.0725 -0.3763 1622 ASN A OD1 
794  N ND2 . ASN A 115 ? 0.6396 1.8214 0.6365 0.0775  -0.0702 -0.3756 1622 ASN A ND2 
795  N N   . ARG A 116 ? 0.6546 1.6726 0.6415 0.0289  -0.0850 -0.3817 1623 ARG A N   
796  C CA  . ARG A 116 ? 0.6527 1.6716 0.6429 0.0285  -0.0863 -0.3846 1623 ARG A CA  
797  C C   . ARG A 116 ? 0.6554 1.6719 0.6446 0.0304  -0.0886 -0.3869 1623 ARG A C   
798  O O   . ARG A 116 ? 0.6582 1.6726 0.6446 0.0315  -0.0894 -0.3864 1623 ARG A O   
799  C CB  . ARG A 116 ? 0.6494 1.6704 0.6431 0.0256  -0.0856 -0.3849 1623 ARG A CB  
800  C CG  . ARG A 116 ? 0.6466 1.6699 0.6425 0.0236  -0.0842 -0.3837 1623 ARG A CG  
801  C CD  . ARG A 116 ? 0.6444 1.6689 0.6429 0.0206  -0.0838 -0.3844 1623 ARG A CD  
802  N NE  . ARG A 116 ? 0.6449 1.6688 0.6422 0.0195  -0.0833 -0.3829 1623 ARG A NE  
803  C CZ  . ARG A 116 ? 0.6444 1.6689 0.6410 0.0177  -0.0822 -0.3801 1623 ARG A CZ  
804  N NH1 . ARG A 116 ? 0.6433 1.6690 0.6406 0.0171  -0.0816 -0.3783 1623 ARG A NH1 
805  N NH2 . ARG A 116 ? 0.6450 1.6688 0.6406 0.0167  -0.0820 -0.3790 1623 ARG A NH2 
806  N N   . PRO A 117 ? 0.6565 1.6458 0.6402 -0.0162 -0.0917 -0.4049 1624 PRO A N   
807  C CA  . PRO A 117 ? 0.6589 1.6460 0.6428 -0.0146 -0.0944 -0.4070 1624 PRO A CA  
808  C C   . PRO A 117 ? 0.6579 1.6453 0.6447 -0.0155 -0.0948 -0.4079 1624 PRO A C   
809  O O   . PRO A 117 ? 0.6546 1.6443 0.6456 -0.0176 -0.0938 -0.4086 1624 PRO A O   
810  C CB  . PRO A 117 ? 0.6577 1.6456 0.6449 -0.0142 -0.0953 -0.4095 1624 PRO A CB  
811  C CG  . PRO A 117 ? 0.6537 1.6447 0.6437 -0.0165 -0.0930 -0.4088 1624 PRO A CG  
812  C CD  . PRO A 117 ? 0.6536 1.6452 0.6406 -0.0172 -0.0909 -0.4058 1624 PRO A CD  
813  N N   . MET A 118 ? 0.5689 1.6189 0.5822 -0.0590 -0.0868 -0.3310 1625 MET A N   
814  C CA  . MET A 118 ? 0.5685 1.6183 0.5845 -0.0595 -0.0874 -0.3318 1625 MET A CA  
815  C C   . MET A 118 ? 0.5709 1.6185 0.5888 -0.0579 -0.0908 -0.3341 1625 MET A C   
816  O O   . MET A 118 ? 0.5743 1.6194 0.5892 -0.0560 -0.0929 -0.3343 1625 MET A O   
817  C CB  . MET A 118 ? 0.5703 1.6189 0.5825 -0.0595 -0.0869 -0.3294 1625 MET A CB  
818  C CG  . MET A 118 ? 0.5679 1.6187 0.5792 -0.0614 -0.0839 -0.3269 1625 MET A CG  
819  S SD  . MET A 118 ? 0.5709 1.6198 0.5768 -0.0606 -0.0833 -0.3237 1625 MET A SD  
820  C CE  . MET A 118 ? 0.5717 1.6195 0.5793 -0.0608 -0.0848 -0.3246 1625 MET A CE  
821  N N   . LEU A 119 ? 0.5439 1.6321 0.5684 -0.0984 -0.0920 -0.3037 1626 LEU A N   
822  C CA  . LEU A 119 ? 0.5463 1.6323 0.5735 -0.0970 -0.0953 -0.3057 1626 LEU A CA  
823  C C   . LEU A 119 ? 0.5491 1.6329 0.5739 -0.0964 -0.0966 -0.3046 1626 LEU A C   
824  O O   . LEU A 119 ? 0.5474 1.6323 0.5751 -0.0976 -0.0954 -0.3046 1626 LEU A O   
825  C CB  . LEU A 119 ? 0.5434 1.6312 0.5786 -0.0982 -0.0952 -0.3084 1626 LEU A CB  
826  C CG  . LEU A 119 ? 0.5455 1.6313 0.5854 -0.0967 -0.0988 -0.3106 1626 LEU A CG  
827  C CD1 . LEU A 119 ? 0.5482 1.6320 0.5865 -0.0948 -0.1018 -0.3113 1626 LEU A CD1 
828  C CD2 . LEU A 119 ? 0.5424 1.6303 0.5909 -0.0982 -0.0976 -0.3129 1626 LEU A CD2 
829  N N   . ILE A 120 ? 0.5249 1.7603 0.5570 -0.0676 -0.0829 -0.2428 1627 ILE A N   
830  C CA  . ILE A 120 ? 0.5284 1.7611 0.5573 -0.0668 -0.0843 -0.2416 1627 ILE A CA  
831  C C   . ILE A 120 ? 0.5294 1.7608 0.5637 -0.0665 -0.0874 -0.2433 1627 ILE A C   
832  O O   . ILE A 120 ? 0.5286 1.7604 0.5651 -0.0671 -0.0872 -0.2431 1627 ILE A O   
833  C CB  . ILE A 120 ? 0.5339 1.7628 0.5541 -0.0652 -0.0855 -0.2397 1627 ILE A CB  
834  C CG1 . ILE A 120 ? 0.5380 1.7637 0.5545 -0.0644 -0.0869 -0.2382 1627 ILE A CG1 
835  C CG2 . ILE A 120 ? 0.5373 1.7635 0.5561 -0.0636 -0.0882 -0.2412 1627 ILE A CG2 
836  C CD1 . ILE A 120 ? 0.5435 1.7655 0.5507 -0.0634 -0.0868 -0.2360 1627 ILE A CD1 
837  N N   . SER A 121 ? 0.5244 1.8072 0.5341 -0.0986 -0.0948 -0.1719 1628 SER A N   
838  C CA  . SER A 121 ? 0.5253 1.8069 0.5416 -0.0982 -0.0982 -0.1738 1628 SER A CA  
839  C C   . SER A 121 ? 0.5264 1.8070 0.5462 -0.0971 -0.1011 -0.1758 1628 SER A C   
840  O O   . SER A 121 ? 0.5268 1.8073 0.5433 -0.0966 -0.1008 -0.1758 1628 SER A O   
841  C CB  . SER A 121 ? 0.5303 1.8079 0.5429 -0.0970 -0.1013 -0.1724 1628 SER A CB  
842  O OG  . SER A 121 ? 0.5303 1.8074 0.5505 -0.0970 -0.1040 -0.1741 1628 SER A OG  
843  N N   . LEU A 122 ? 0.5562 1.8307 0.5352 -0.1316 -0.1204 -0.1689 1629 LEU A N   
844  C CA  . LEU A 122 ? 0.5571 1.8306 0.5412 -0.1307 -0.1238 -0.1711 1629 LEU A CA  
845  C C   . LEU A 122 ? 0.5618 1.8313 0.5484 -0.1295 -0.1291 -0.1714 1629 LEU A C   
846  O O   . LEU A 122 ? 0.5618 1.8311 0.5516 -0.1298 -0.1297 -0.1713 1629 LEU A O   
847  C CB  . LEU A 122 ? 0.5514 1.8292 0.5454 -0.1322 -0.1211 -0.1733 1629 LEU A CB  
848  C CG  . LEU A 122 ? 0.5512 1.8289 0.5545 -0.1316 -0.1239 -0.1758 1629 LEU A CG  
849  C CD1 . LEU A 122 ? 0.5511 1.8290 0.5531 -0.1312 -0.1243 -0.1765 1629 LEU A CD1 
850  C CD2 . LEU A 122 ? 0.5466 1.8276 0.5602 -0.1332 -0.1211 -0.1779 1629 LEU A CD2 
851  N N   . ASP A 123 ? 0.6193 2.0841 0.5356 -0.1659 -0.1526 -0.1165 1630 ASP A N   
852  C CA  . ASP A 123 ? 0.6238 2.0846 0.5438 -0.1649 -0.1583 -0.1172 1630 ASP A CA  
853  C C   . ASP A 123 ? 0.6203 2.0835 0.5529 -0.1651 -0.1594 -0.1199 1630 ASP A C   
854  O O   . ASP A 123 ? 0.6184 2.0832 0.5529 -0.1651 -0.1587 -0.1211 1630 ASP A O   
855  C CB  . ASP A 123 ? 0.6314 2.0863 0.5424 -0.1633 -0.1630 -0.1163 1630 ASP A CB  
856  C CG  . ASP A 123 ? 0.6370 2.0871 0.5510 -0.1624 -0.1696 -0.1167 1630 ASP A CG  
857  O OD1 . ASP A 123 ? 0.6354 2.0863 0.5599 -0.1624 -0.1721 -0.1186 1630 ASP A OD1 
858  O OD2 . ASP A 123 ? 0.6434 2.0885 0.5492 -0.1617 -0.1724 -0.1149 1630 ASP A OD2 
859  N N   . LYS A 124 ? 0.5897 1.9318 0.5574 -0.1466 -0.1912 -0.0153 1631 LYS A N   
860  C CA  . LYS A 124 ? 0.5863 1.9308 0.5674 -0.1471 -0.1915 -0.0178 1631 LYS A CA  
861  C C   . LYS A 124 ? 0.5902 1.9314 0.5740 -0.1457 -0.1974 -0.0188 1631 LYS A C   
862  O O   . LYS A 124 ? 0.5874 1.9308 0.5772 -0.1459 -0.1966 -0.0206 1631 LYS A O   
863  C CB  . LYS A 124 ? 0.5853 1.9303 0.5751 -0.1474 -0.1918 -0.0185 1631 LYS A CB  
864  C CG  . LYS A 124 ? 0.5811 1.9295 0.5701 -0.1490 -0.1861 -0.0179 1631 LYS A CG  
865  C CD  . LYS A 124 ? 0.5820 1.9294 0.5766 -0.1490 -0.1875 -0.0181 1631 LYS A CD  
866  C CE  . LYS A 124 ? 0.5800 1.9291 0.5694 -0.1501 -0.1831 -0.0165 1631 LYS A CE  
867  N NZ  . LYS A 124 ? 0.5820 1.9293 0.5746 -0.1500 -0.1851 -0.0162 1631 LYS A NZ  
868  N N   . GLN A 125 ? 0.7025 2.2371 0.6212 -0.1075 -0.2702 -0.0948 1632 GLN A N   
869  C CA  . GLN A 125 ? 0.7073 2.2378 0.6286 -0.1062 -0.2766 -0.0956 1632 GLN A CA  
870  C C   . GLN A 125 ? 0.7079 2.2381 0.6242 -0.1059 -0.2764 -0.0960 1632 GLN A C   
871  O O   . GLN A 125 ? 0.7055 2.2374 0.6304 -0.1059 -0.2773 -0.0978 1632 GLN A O   
872  C CB  . GLN A 125 ? 0.7155 2.2393 0.6300 -0.1053 -0.2827 -0.0938 1632 GLN A CB  
873  C CG  . GLN A 125 ? 0.7158 2.2391 0.6375 -0.1054 -0.2847 -0.0936 1632 GLN A CG  
874  C CD  . GLN A 125 ? 0.7246 2.2408 0.6396 -0.1045 -0.2915 -0.0918 1632 GLN A CD  
875  O OE1 . GLN A 125 ? 0.7297 2.2421 0.6310 -0.1041 -0.2919 -0.0900 1632 GLN A OE1 
876  N NE2 . GLN A 125 ? 0.7268 2.2408 0.6516 -0.1041 -0.2969 -0.0926 1632 GLN A NE2 
877  N N   . THR A 126 ? 0.7899 2.3901 0.6530 -0.0861 -0.2861 -0.3115 1633 THR A N   
878  C CA  . THR A 126 ? 0.7919 2.3907 0.6487 -0.0856 -0.2865 -0.3116 1633 THR A CA  
879  C C   . THR A 126 ? 0.7847 2.3895 0.6447 -0.0865 -0.2806 -0.3127 1633 THR A C   
880  O O   . THR A 126 ? 0.7855 2.3898 0.6414 -0.0863 -0.2806 -0.3131 1633 THR A O   
881  C CB  . THR A 126 ? 0.7989 2.3925 0.6400 -0.0850 -0.2874 -0.3095 1633 THR A CB  
882  O OG1 . THR A 126 ? 0.8005 2.3930 0.6357 -0.0844 -0.2870 -0.3097 1633 THR A OG1 
883  C CG2 . THR A 126 ? 0.7964 2.3924 0.6314 -0.0856 -0.2820 -0.3077 1633 THR A CG2 
884  N N   . CYS A 127 ? 0.6896 1.8193 0.6836 -0.1106 -0.2407 -0.3359 1634 CYS A N   
885  C CA  . CYS A 127 ? 0.6830 1.8181 0.6797 -0.1119 -0.2349 -0.3368 1634 CYS A CA  
886  C C   . CYS A 127 ? 0.6837 1.8187 0.6688 -0.1119 -0.2320 -0.3352 1634 CYS A C   
887  O O   . CYS A 127 ? 0.6822 1.8185 0.6668 -0.1119 -0.2310 -0.3359 1634 CYS A O   
888  C CB  . CYS A 127 ? 0.6806 1.8175 0.6873 -0.1119 -0.2361 -0.3391 1634 CYS A CB  
889  S SG  . CYS A 127 ? 0.6796 1.8168 0.7018 -0.1120 -0.2390 -0.3411 1634 CYS A SG  
890  N N   . THR A 128 ? 0.7112 1.8689 0.6711 -0.0925 -0.2029 -0.4189 1635 THR A N   
891  C CA  . THR A 128 ? 0.7125 1.8696 0.6614 -0.0923 -0.2002 -0.4172 1635 THR A CA  
892  C C   . THR A 128 ? 0.7082 1.8690 0.6552 -0.0936 -0.1949 -0.4158 1635 THR A C   
893  O O   . THR A 128 ? 0.7087 1.8690 0.6557 -0.0939 -0.1948 -0.4149 1635 THR A O   
894  C CB  . THR A 128 ? 0.7209 1.8714 0.6591 -0.0909 -0.2041 -0.4158 1635 THR A CB  
895  O OG1 . THR A 128 ? 0.7255 1.8721 0.6661 -0.0899 -0.2099 -0.4171 1635 THR A OG1 
896  C CG2 . THR A 128 ? 0.7226 1.8723 0.6506 -0.0907 -0.2013 -0.4144 1635 THR A CG2 
897  N N   . LEU A 129 ? 0.6511 1.6408 0.6328 -0.0719 -0.1572 -0.3666 1636 LEU A N   
898  C CA  . LEU A 129 ? 0.6472 1.6403 0.6270 -0.0732 -0.1523 -0.3652 1636 LEU A CA  
899  C C   . LEU A 129 ? 0.6505 1.6415 0.6194 -0.0727 -0.1509 -0.3628 1636 LEU A C   
900  O O   . LEU A 129 ? 0.6517 1.6420 0.6161 -0.0722 -0.1504 -0.3625 1636 LEU A O   
901  C CB  . LEU A 129 ? 0.6410 1.6390 0.6260 -0.0749 -0.1483 -0.3662 1636 LEU A CB  
902  C CG  . LEU A 129 ? 0.6368 1.6378 0.6324 -0.0762 -0.1474 -0.3684 1636 LEU A CG  
903  C CD1 . LEU A 129 ? 0.6378 1.6377 0.6399 -0.0751 -0.1509 -0.3707 1636 LEU A CD1 
904  C CD2 . LEU A 129 ? 0.6314 1.6368 0.6289 -0.0782 -0.1423 -0.3684 1636 LEU A CD2 
905  N N   . PHE A 130 ? 0.6340 1.8423 0.6135 -0.0617 -0.1317 -0.3844 1637 PHE A N   
906  C CA  . PHE A 130 ? 0.6369 1.8434 0.6068 -0.0612 -0.1298 -0.3819 1637 PHE A CA  
907  C C   . PHE A 130 ? 0.6314 1.8426 0.6018 -0.0628 -0.1247 -0.3810 1637 PHE A C   
908  O O   . PHE A 130 ? 0.6268 1.8414 0.6025 -0.0644 -0.1225 -0.3811 1637 PHE A O   
909  C CB  . PHE A 130 ? 0.6408 1.8443 0.6066 -0.0608 -0.1312 -0.3804 1637 PHE A CB  
910  C CG  . PHE A 130 ? 0.6471 1.8453 0.6116 -0.0595 -0.1367 -0.3811 1637 PHE A CG  
911  C CD1 . PHE A 130 ? 0.6538 1.8469 0.6107 -0.0581 -0.1393 -0.3808 1637 PHE A CD1 
912  C CD2 . PHE A 130 ? 0.6468 1.8448 0.6174 -0.0595 -0.1393 -0.3819 1637 PHE A CD2 
913  C CE1 . PHE A 130 ? 0.6603 1.8480 0.6155 -0.0570 -0.1448 -0.3813 1637 PHE A CE1 
914  C CE2 . PHE A 130 ? 0.6528 1.8458 0.6227 -0.0584 -0.1448 -0.3824 1637 PHE A CE2 
915  C CZ  . PHE A 130 ? 0.6597 1.8474 0.6216 -0.0571 -0.1476 -0.3820 1637 PHE A CZ  
916  N N   . PHE A 131 ? 0.6519 1.7730 0.6268 -0.0274 -0.1177 -0.4124 1638 PHE A N   
917  C CA  . PHE A 131 ? 0.6474 1.7724 0.6222 -0.0287 -0.1132 -0.4110 1638 PHE A CA  
918  C C   . PHE A 131 ? 0.6507 1.7737 0.6174 -0.0282 -0.1112 -0.4083 1638 PHE A C   
919  O O   . PHE A 131 ? 0.6563 1.7752 0.6168 -0.0266 -0.1128 -0.4081 1638 PHE A O   
920  C CB  . PHE A 131 ? 0.6438 1.7717 0.6223 -0.0294 -0.1120 -0.4122 1638 PHE A CB  
921  C CG  . PHE A 131 ? 0.6390 1.7701 0.6261 -0.0307 -0.1118 -0.4142 1638 PHE A CG  
922  C CD1 . PHE A 131 ? 0.6342 1.7691 0.6247 -0.0329 -0.1085 -0.4137 1638 PHE A CD1 
923  C CD2 . PHE A 131 ? 0.6396 1.7699 0.6314 -0.0300 -0.1149 -0.4167 1638 PHE A CD2 
924  C CE1 . PHE A 131 ? 0.6305 1.7679 0.6284 -0.0344 -0.1080 -0.4156 1638 PHE A CE1 
925  C CE2 . PHE A 131 ? 0.6354 1.7686 0.6356 -0.0315 -0.1142 -0.4185 1638 PHE A CE2 
926  C CZ  . PHE A 131 ? 0.6310 1.7677 0.6339 -0.0335 -0.1106 -0.4181 1638 PHE A CZ  
927  N N   . SER A 132 ? 0.6313 1.8996 0.6003 0.0154  -0.1024 -0.4002 1639 SER A N   
928  C CA  . SER A 132 ? 0.6337 1.9007 0.5964 0.0157  -0.1001 -0.3977 1639 SER A CA  
929  C C   . SER A 132 ? 0.6288 1.9000 0.5937 0.0142  -0.0962 -0.3964 1639 SER A C   
930  O O   . SER A 132 ? 0.6239 1.8986 0.5939 0.0124  -0.0952 -0.3966 1639 SER A O   
931  C CB  . SER A 132 ? 0.6357 1.9012 0.5960 0.0157  -0.1001 -0.3961 1639 SER A CB  
932  O OG  . SER A 132 ? 0.6405 1.9019 0.5988 0.0171  -0.1040 -0.3971 1639 SER A OG  
933  N N   . TRP A 133 ? 0.6848 1.8874 0.6255 0.0635  -0.0964 -0.4230 1640 TRP A N   
934  C CA  . TRP A 133 ? 0.6809 1.8869 0.6235 0.0621  -0.0930 -0.4216 1640 TRP A CA  
935  C C   . TRP A 133 ? 0.6843 1.8884 0.6216 0.0630  -0.0907 -0.4189 1640 TRP A C   
936  O O   . TRP A 133 ? 0.6890 1.8898 0.6213 0.0645  -0.0907 -0.4190 1640 TRP A O   
937  C CB  . TRP A 133 ? 0.6790 1.8865 0.6241 0.0621  -0.0930 -0.4230 1640 TRP A CB  
938  C CG  . TRP A 133 ? 0.6740 1.8856 0.6229 0.0604  -0.0904 -0.4219 1640 TRP A CG  
939  C CD1 . TRP A 133 ? 0.6726 1.8857 0.6213 0.0593  -0.0878 -0.4192 1640 TRP A CD1 
940  C CD2 . TRP A 133 ? 0.6703 1.8845 0.6237 0.0593  -0.0903 -0.4232 1640 TRP A CD2 
941  N NE1 . TRP A 133 ? 0.6683 1.8848 0.6211 0.0575  -0.0863 -0.4187 1640 TRP A NE1 
942  C CE2 . TRP A 133 ? 0.6669 1.8841 0.6223 0.0575  -0.0877 -0.4212 1640 TRP A CE2 
943  C CE3 . TRP A 133 ? 0.6696 1.8840 0.6257 0.0595  -0.0922 -0.4257 1640 TRP A CE3 
944  C CZ2 . TRP A 133 ? 0.6630 1.8831 0.6227 0.0560  -0.0870 -0.4216 1640 TRP A CZ2 
945  C CZ3 . TRP A 133 ? 0.6656 1.8831 0.6259 0.0582  -0.0913 -0.4264 1640 TRP A CZ3 
946  C CH2 . TRP A 133 ? 0.6625 1.8826 0.6243 0.0564  -0.0887 -0.4242 1640 TRP A CH2 
947  N N   . HIS A 134 ? 0.6438 2.0269 0.5942 0.1110  -0.0866 -0.3901 1641 HIS A N   
948  C CA  . HIS A 134 ? 0.6468 2.0283 0.5930 0.1115  -0.0842 -0.3874 1641 HIS A CA  
949  C C   . HIS A 134 ? 0.6438 2.0282 0.5926 0.1106  -0.0812 -0.3858 1641 HIS A C   
950  O O   . HIS A 134 ? 0.6391 2.0270 0.5925 0.1086  -0.0800 -0.3846 1641 HIS A O   
951  C CB  . HIS A 134 ? 0.6471 2.0284 0.5926 0.1110  -0.0839 -0.3858 1641 HIS A CB  
952  C CG  . HIS A 134 ? 0.6515 2.0290 0.5934 0.1121  -0.0868 -0.3869 1641 HIS A CG  
953  N ND1 . HIS A 134 ? 0.6506 2.0281 0.5950 0.1121  -0.0900 -0.3894 1641 HIS A ND1 
954  C CD2 . HIS A 134 ? 0.6571 2.0306 0.5931 0.1133  -0.0869 -0.3856 1641 HIS A CD2 
955  C CE1 . HIS A 134 ? 0.6553 2.0290 0.5959 0.1133  -0.0922 -0.3896 1641 HIS A CE1 
956  N NE2 . HIS A 134 ? 0.6595 2.0306 0.5946 0.1140  -0.0905 -0.3874 1641 HIS A NE2 
957  N N   . THR A 135 ? 0.7438 2.1002 0.6481 0.1973  -0.0891 -0.4228 1642 THR A N   
958  C CA  . THR A 135 ? 0.7415 2.1002 0.6486 0.1967  -0.0863 -0.4212 1642 THR A CA  
959  C C   . THR A 135 ? 0.7466 2.1023 0.6491 0.1981  -0.0834 -0.4196 1642 THR A C   
960  O O   . THR A 135 ? 0.7527 2.1038 0.6489 0.1999  -0.0839 -0.4203 1642 THR A O   
961  C CB  . THR A 135 ? 0.7393 2.0995 0.6491 0.1966  -0.0870 -0.4232 1642 THR A CB  
962  O OG1 . THR A 135 ? 0.7438 2.1003 0.6493 0.1985  -0.0890 -0.4255 1642 THR A OG1 
963  C CG2 . THR A 135 ? 0.7334 2.0975 0.6491 0.1946  -0.0886 -0.4241 1642 THR A CG2 
964  N N   . PRO A 136 ? 0.7833 2.2636 0.6805 0.2901  -0.0842 -0.4390 1643 PRO A N   
965  C CA  . PRO A 136 ? 0.7879 2.2655 0.6819 0.2915  -0.0808 -0.4377 1643 PRO A CA  
966  C C   . PRO A 136 ? 0.7909 2.2663 0.6825 0.2928  -0.0807 -0.4397 1643 PRO A C   
967  O O   . PRO A 136 ? 0.7965 2.2682 0.6835 0.2944  -0.0784 -0.4393 1643 PRO A O   
968  C CB  . PRO A 136 ? 0.7836 2.2650 0.6840 0.2899  -0.0782 -0.4348 1643 PRO A CB  
969  C CG  . PRO A 136 ? 0.7771 2.2628 0.6834 0.2879  -0.0804 -0.4354 1643 PRO A CG  
970  C CD  . PRO A 136 ? 0.7769 2.2620 0.6811 0.2878  -0.0837 -0.4375 1643 PRO A CD  
971  N N   . LEU A 137 ? 0.9306 2.2026 0.7531 0.3228  -0.0881 -0.4918 1644 LEU A N   
972  C CA  . LEU A 137 ? 0.9331 2.2031 0.7536 0.3240  -0.0886 -0.4939 1644 LEU A CA  
973  C C   . LEU A 137 ? 0.9408 2.2047 0.7528 0.3260  -0.0899 -0.4957 1644 LEU A C   
974  O O   . LEU A 137 ? 0.9453 2.2060 0.7536 0.3273  -0.0892 -0.4968 1644 LEU A O   
975  C CB  . LEU A 137 ? 0.9278 2.2011 0.7532 0.3228  -0.0913 -0.4959 1644 LEU A CB  
976  C CG  . LEU A 137 ? 0.9212 2.1997 0.7542 0.3210  -0.0903 -0.4948 1644 LEU A CG  
977  C CD1 . LEU A 137 ? 0.9163 2.1978 0.7534 0.3194  -0.0931 -0.4966 1644 LEU A CD1 
978  C CD2 . LEU A 137 ? 0.9220 2.2004 0.7561 0.3217  -0.0883 -0.4948 1644 LEU A CD2 
979  N N   . ALA A 138 ? 0.8597 2.2437 0.6979 0.2637  -0.0800 -0.5024 1645 ALA A N   
980  C CA  . ALA A 138 ? 0.8673 2.2453 0.6974 0.2653  -0.0820 -0.5038 1645 ALA A CA  
981  C C   . ALA A 138 ? 0.8737 2.2474 0.6973 0.2660  -0.0794 -0.5019 1645 ALA A C   
982  O O   . ALA A 138 ? 0.8790 2.2484 0.6966 0.2667  -0.0813 -0.5022 1645 ALA A O   
983  C CB  . ALA A 138 ? 0.8657 2.2440 0.6968 0.2649  -0.0864 -0.5054 1645 ALA A CB  
984  N N   . CYS A 139 ? 0.8203 2.4532 0.6704 0.3402  -0.0668 -0.4753 1646 CYS A N   
985  C CA  . CYS A 139 ? 0.8260 2.4552 0.6709 0.3407  -0.0636 -0.4733 1646 CYS A CA  
986  C C   . CYS A 139 ? 0.8327 2.4576 0.6726 0.3420  -0.0599 -0.4731 1646 CYS A C   
987  O O   . CYS A 139 ? 0.8298 2.4573 0.6744 0.3418  -0.0573 -0.4727 1646 CYS A O   
988  C CB  . CYS A 139 ? 0.8205 2.4544 0.6716 0.3393  -0.0615 -0.4704 1646 CYS A CB  
989  S SG  . CYS A 139 ? 0.8151 2.4523 0.6698 0.3379  -0.0653 -0.4702 1646 CYS A SG  
990  N N   . GLU A 140 ? 0.9052 2.6383 0.7125 0.4223  -0.0546 -0.5386 1647 GLU A N   
991  C CA  . GLU A 140 ? 0.9134 2.6408 0.7141 0.4237  -0.0509 -0.5388 1647 GLU A CA  
992  C C   . GLU A 140 ? 0.9160 2.6425 0.7162 0.4235  -0.0454 -0.5360 1647 GLU A C   
993  O O   . GLU A 140 ? 0.9152 2.6431 0.7192 0.4237  -0.0412 -0.5350 1647 GLU A O   
994  C CB  . GLU A 140 ? 0.9233 2.6427 0.7127 0.4248  -0.0535 -0.5407 1647 GLU A CB  
995  C CG  . GLU A 140 ? 0.9338 2.6458 0.7141 0.4259  -0.0496 -0.5410 1647 GLU A CG  
996  C CD  . GLU A 140 ? 0.9448 2.6480 0.7126 0.4268  -0.0526 -0.5425 1647 GLU A CD  
997  O OE1 . GLU A 140 ? 0.9455 2.6472 0.7116 0.4271  -0.0573 -0.5447 1647 GLU A OE1 
998  O OE2 . GLU A 140 ? 0.9530 2.6504 0.7128 0.4271  -0.0502 -0.5412 1647 GLU A OE2 
999  N N   . GLN A 141 ? 0.8107 2.8125 0.6883 0.4370  -0.0381 -0.4932 1648 GLN A N   
1000 C CA  . GLN A 141 ? 0.8137 2.8142 0.6906 0.4370  -0.0331 -0.4905 1648 GLN A CA  
1001 C C   . GLN A 141 ? 0.8041 2.8122 0.6918 0.4356  -0.0324 -0.4880 1648 GLN A C   
1002 O O   . GLN A 141 ? 0.7957 2.8095 0.6907 0.4345  -0.0353 -0.4884 1648 GLN A O   
1003 C CB  . GLN A 141 ? 0.8224 2.8162 0.6891 0.4375  -0.0339 -0.4900 1648 GLN A CB  
1004 C CG  . GLN A 141 ? 0.8344 2.8192 0.6889 0.4388  -0.0331 -0.4916 1648 GLN A CG  
1005 C CD  . GLN A 141 ? 0.8437 2.8214 0.6878 0.4390  -0.0333 -0.4909 1648 GLN A CD  
1006 O OE1 . GLN A 141 ? 0.8407 2.8206 0.6869 0.4383  -0.0350 -0.4894 1648 GLN A OE1 
1007 N NE2 . GLN A 141 ? 0.8554 2.8244 0.6880 0.4399  -0.0320 -0.4920 1648 GLN A NE2 
1008 N N   . ALA A 142 ? 0.7403 2.8523 0.6985 0.4226  -0.0439 -0.4133 1649 ALA A N   
1009 C CA  . ALA A 142 ? 0.7326 2.8507 0.6998 0.4212  -0.0434 -0.4106 1649 ALA A CA  
1010 C C   . ALA A 142 ? 0.7325 2.8501 0.6971 0.4205  -0.0467 -0.4101 1649 ALA A C   
1011 O O   . ALA A 142 ? 0.7374 2.8507 0.6942 0.4212  -0.0498 -0.4120 1649 ALA A O   
1012 C CB  . ALA A 142 ? 0.7345 2.8523 0.7047 0.4212  -0.0375 -0.4079 1649 ALA A CB  
1013 N N   . THR A 143 ? 0.6425 2.7982 0.6278 0.2759  -0.0531 -0.3323 1650 THR A N   
1014 C CA  . THR A 143 ? 0.6420 2.7976 0.6257 0.2752  -0.0557 -0.3316 1650 THR A CA  
1015 C C   . THR A 143 ? 0.6488 2.8001 0.6274 0.2757  -0.0522 -0.3294 1650 THR A C   
1016 O O   . THR A 143 ? 0.6456 2.7998 0.6294 0.2748  -0.0507 -0.3269 1650 THR A O   
1017 C CB  . THR A 143 ? 0.6322 2.7949 0.6257 0.2734  -0.0577 -0.3305 1650 THR A CB  
1018 O OG1 . THR A 143 ? 0.6261 2.7930 0.6255 0.2728  -0.0593 -0.3319 1650 THR A OG1 
1019 C CG2 . THR A 143 ? 0.6309 2.7937 0.6226 0.2728  -0.0621 -0.3312 1650 THR A CG2 
1020 N N   . GLU A 144 ? 0.6439 2.9733 0.6165 0.2709  -0.0043 -0.3413 1651 GLU A N   
1021 C CA  . GLU A 144 ? 0.6518 2.9759 0.6179 0.2714  -0.0010 -0.3395 1651 GLU A CA  
1022 C C   . GLU A 144 ? 0.6503 2.9751 0.6159 0.2707  -0.0043 -0.3384 1651 GLU A C   
1023 O O   . GLU A 144 ? 0.6516 2.9745 0.6127 0.2707  -0.0089 -0.3402 1651 GLU A O   
1024 C CB  . GLU A 144 ? 0.6633 2.9788 0.6170 0.2727  0.0000  -0.3411 1651 GLU A CB  
1025 C CG  . GLU A 144 ? 0.6677 2.9807 0.6203 0.2736  0.0052  -0.3413 1651 GLU A CG  
1026 C CD  . GLU A 144 ? 0.6805 2.9838 0.6195 0.2748  0.0063  -0.3429 1651 GLU A CD  
1027 O OE1 . GLU A 144 ? 0.6878 2.9866 0.6227 0.2752  0.0121  -0.3416 1651 GLU A OE1 
1028 O OE2 . GLU A 144 ? 0.6837 2.9836 0.6161 0.2752  0.0015  -0.3452 1651 GLU A OE2 
1029 N N   . CYS A 145 ? 0.6143 2.9532 0.5657 0.1579  -0.0013 -0.2348 1652 CYS A N   
1030 C CA  . CYS A 145 ? 0.6121 2.9523 0.5643 0.1570  -0.0041 -0.2337 1652 CYS A CA  
1031 C C   . CYS A 145 ? 0.6145 2.9539 0.5676 0.1567  0.0000  -0.2303 1652 CYS A C   
1032 O O   . CYS A 145 ? 0.6136 2.9535 0.5669 0.1560  -0.0017 -0.2291 1652 CYS A O   
1033 C CB  . CYS A 145 ? 0.6014 2.9489 0.5631 0.1556  -0.0078 -0.2339 1652 CYS A CB  
1034 S SG  . CYS A 145 ? 0.5995 2.9473 0.5595 0.1551  -0.0138 -0.2351 1652 CYS A SG  
1035 N N   . SER A 146 ? 0.6045 3.1653 0.6511 0.1801  0.0419  -0.2468 1653 SER A N   
1036 C CA  . SER A 146 ? 0.6070 3.1670 0.6553 0.1800  0.0465  -0.2435 1653 SER A CA  
1037 C C   . SER A 146 ? 0.6187 3.1707 0.6571 0.1811  0.0513  -0.2433 1653 SER A C   
1038 O O   . SER A 146 ? 0.6236 3.1721 0.6577 0.1820  0.0537  -0.2449 1653 SER A O   
1039 C CB  . SER A 146 ? 0.5998 3.1659 0.6603 0.1791  0.0496  -0.2415 1653 SER A CB  
1040 O OG  . SER A 146 ? 0.6001 3.1662 0.6621 0.1799  0.0520  -0.2427 1653 SER A OG  
1041 N N   . VAL A 147 ? 0.6610 3.4692 0.6506 0.1493  0.1234  -0.2863 1654 VAL A N   
1042 C CA  . VAL A 147 ? 0.6728 3.4730 0.6526 0.1502  0.1282  -0.2858 1654 VAL A CA  
1043 C C   . VAL A 147 ? 0.6731 3.4743 0.6585 0.1498  0.1337  -0.2822 1654 VAL A C   
1044 O O   . VAL A 147 ? 0.6648 3.4723 0.6600 0.1488  0.1325  -0.2802 1654 VAL A O   
1045 C CB  . VAL A 147 ? 0.6811 3.4743 0.6482 0.1504  0.1247  -0.2870 1654 VAL A CB  
1046 C CG1 . VAL A 147 ? 0.6791 3.4738 0.6478 0.1497  0.1226  -0.2847 1654 VAL A CG1 
1047 C CG2 . VAL A 147 ? 0.6948 3.4783 0.6493 0.1513  0.1289  -0.2874 1654 VAL A CG2 
1048 N N   . ARG A 148 ? 0.7075 3.8372 0.7856 0.1054  0.2111  -0.3662 1655 ARG A N   
1049 C CA  . ARG A 148 ? 0.7084 3.8388 0.7923 0.1050  0.2173  -0.3628 1655 ARG A CA  
1050 C C   . ARG A 148 ? 0.7164 3.8412 0.7925 0.1049  0.2188  -0.3610 1655 ARG A C   
1051 O O   . ARG A 148 ? 0.7279 3.8441 0.7909 0.1054  0.2205  -0.3621 1655 ARG A O   
1052 C CB  . ARG A 148 ? 0.7134 3.8411 0.7978 0.1058  0.2242  -0.3630 1655 ARG A CB  
1053 C CG  . ARG A 148 ? 0.7094 3.8414 0.8063 0.1054  0.2299  -0.3600 1655 ARG A CG  
1054 C CD  . ARG A 148 ? 0.7148 3.8438 0.8121 0.1063  0.2368  -0.3605 1655 ARG A CD  
1055 N NE  . ARG A 148 ? 0.7082 3.8432 0.8205 0.1059  0.2407  -0.3580 1655 ARG A NE  
1056 C CZ  . ARG A 148 ? 0.6981 3.8403 0.8221 0.1055  0.2384  -0.3580 1655 ARG A CZ  
1057 N NH1 . ARG A 148 ? 0.6933 3.8379 0.8156 0.1055  0.2326  -0.3607 1655 ARG A NH1 
1058 N NH2 . ARG A 148 ? 0.6930 3.8401 0.8306 0.1052  0.2419  -0.3553 1655 ARG A NH2 
1059 N N   . ASN A 149 ? 0.7946 4.0122 0.6792 -0.0610 0.2678  -0.2475 1656 ASN A N   
1060 C CA  . ASN A 149 ? 0.8011 4.0144 0.6805 -0.0612 0.2698  -0.2451 1656 ASN A CA  
1061 C C   . ASN A 149 ? 0.8026 4.0164 0.6889 -0.0615 0.2773  -0.2421 1656 ASN A C   
1062 O O   . ASN A 149 ? 0.7960 4.0151 0.6925 -0.0623 0.2773  -0.2393 1656 ASN A O   
1063 C CB  . ASN A 149 ? 0.7944 4.0118 0.6769 -0.0623 0.2635  -0.2442 1656 ASN A CB  
1064 C CG  . ASN A 149 ? 0.8011 4.0140 0.6778 -0.0626 0.2648  -0.2421 1656 ASN A CG  
1065 O OD1 . ASN A 149 ? 0.8127 4.0174 0.6780 -0.0621 0.2682  -0.2423 1656 ASN A OD1 
1066 N ND2 . ASN A 149 ? 0.7940 4.0121 0.6784 -0.0636 0.2623  -0.2399 1656 ASN A ND2 
1067 N N   . GLY A 150 ? 0.8491 4.4794 0.9596 -0.1313 0.4054  -0.4975 1657 GLY A N   
1068 C CA  . GLY A 150 ? 0.8514 4.4815 0.9688 -0.1313 0.4133  -0.4950 1657 GLY A CA  
1069 C C   . GLY A 150 ? 0.8429 4.4798 0.9740 -0.1312 0.4151  -0.4948 1657 GLY A C   
1070 O O   . GLY A 150 ? 0.8438 4.4797 0.9729 -0.1305 0.4156  -0.4972 1657 GLY A O   
1071 N N   . SER A 151 ? 0.7193 4.3652 1.2703 0.0419  0.3459  -0.5946 1658 SER A N   
1072 C CA  . SER A 151 ? 0.7106 4.3633 1.2760 0.0417  0.3470  -0.5939 1658 SER A CA  
1073 C C   . SER A 151 ? 0.6988 4.3590 1.2709 0.0408  0.3391  -0.5946 1658 SER A C   
1074 O O   . SER A 151 ? 0.6926 4.3573 1.2721 0.0408  0.3380  -0.5956 1658 SER A O   
1075 C CB  . SER A 151 ? 0.7090 4.3644 1.2866 0.0412  0.3524  -0.5899 1658 SER A CB  
1076 O OG  . SER A 151 ? 0.7055 4.3634 1.2860 0.0401  0.3495  -0.5875 1658 SER A OG  
1077 N N   . SER A 152 ? 0.6338 3.7942 1.0096 0.0610  0.2246  -0.3019 1659 SER A N   
1078 C CA  . SER A 152 ? 0.6236 3.7903 1.0045 0.0601  0.2171  -0.3027 1659 SER A CA  
1079 C C   . SER A 152 ? 0.6249 3.7894 0.9957 0.0606  0.2124  -0.3066 1659 SER A C   
1080 O O   . SER A 152 ? 0.6330 3.7911 0.9914 0.0614  0.2119  -0.3080 1659 SER A O   
1081 C CB  . SER A 152 ? 0.6198 3.7891 1.0034 0.0588  0.2137  -0.3005 1659 SER A CB  
1082 O OG  . SER A 152 ? 0.6280 3.7911 0.9998 0.0593  0.2137  -0.3009 1659 SER A OG  
1083 N N   . ILE A 153 ? 0.6129 3.5007 0.8842 0.1275  0.1297  -0.2469 1660 ILE A N   
1084 C CA  . ILE A 153 ? 0.6130 3.4995 0.8768 0.1280  0.1252  -0.2506 1660 ILE A CA  
1085 C C   . ILE A 153 ? 0.6065 3.4966 0.8708 0.1271  0.1181  -0.2513 1660 ILE A C   
1086 O O   . ILE A 153 ? 0.5977 3.4941 0.8720 0.1257  0.1155  -0.2500 1660 ILE A O   
1087 C CB  . ILE A 153 ? 0.6097 3.4986 0.8782 0.1284  0.1260  -0.2522 1660 ILE A CB  
1088 C CG1 . ILE A 153 ? 0.6105 3.4976 0.8709 0.1290  0.1215  -0.2560 1660 ILE A CG1 
1089 C CG2 . ILE A 153 ? 0.5990 3.4960 0.8821 0.1272  0.1247  -0.2504 1660 ILE A CG2 
1090 C CD1 . ILE A 153 ? 0.6115 3.4980 0.8722 0.1299  0.1237  -0.2581 1660 ILE A CD1 
1091 N N   . VAL A 154 ? 0.5858 3.2422 0.5965 0.0662  0.0917  -0.0826 1661 VAL A N   
1092 C CA  . VAL A 154 ? 0.5807 3.2397 0.5912 0.0654  0.0851  -0.0837 1661 VAL A CA  
1093 C C   . VAL A 154 ? 0.5773 3.2378 0.5864 0.0658  0.0807  -0.0870 1661 VAL A C   
1094 O O   . VAL A 154 ? 0.5833 3.2391 0.5845 0.0670  0.0812  -0.0894 1661 VAL A O   
1095 C CB  . VAL A 154 ? 0.5876 3.2412 0.5884 0.0658  0.0837  -0.0834 1661 VAL A CB  
1096 C CG1 . VAL A 154 ? 0.5822 3.2386 0.5836 0.0649  0.0771  -0.0847 1661 VAL A CG1 
1097 C CG2 . VAL A 154 ? 0.5908 3.2432 0.5933 0.0654  0.0879  -0.0799 1661 VAL A CG2 
1098 N N   . ASP A 155 ? 0.5555 2.9906 0.5629 0.0702  0.0237  -0.1024 1662 ASP A N   
1099 C CA  . ASP A 155 ? 0.5513 2.9885 0.5589 0.0702  0.0197  -0.1055 1662 ASP A CA  
1100 C C   . ASP A 155 ? 0.5483 2.9865 0.5543 0.0696  0.0138  -0.1070 1662 ASP A C   
1101 O O   . ASP A 155 ? 0.5461 2.9859 0.5546 0.0687  0.0126  -0.1052 1662 ASP A O   
1102 C CB  . ASP A 155 ? 0.5432 2.9866 0.5615 0.0693  0.0200  -0.1049 1662 ASP A CB  
1103 C CG  . ASP A 155 ? 0.5408 2.9853 0.5586 0.0697  0.0176  -0.1080 1662 ASP A CG  
1104 O OD1 . ASP A 155 ? 0.5454 2.9858 0.5549 0.0706  0.0159  -0.1107 1662 ASP A OD1 
1105 O OD2 . ASP A 155 ? 0.5343 2.9836 0.5603 0.0688  0.0175  -0.1079 1662 ASP A OD2 
1106 N N   . LEU A 156 ? 0.5326 2.8345 0.4551 0.0272  -0.0021 -0.0891 1663 LEU A N   
1107 C CA  . LEU A 156 ? 0.5300 2.8327 0.4513 0.0266  -0.0076 -0.0908 1663 LEU A CA  
1108 C C   . LEU A 156 ? 0.5217 2.8299 0.4498 0.0258  -0.0107 -0.0926 1663 LEU A C   
1109 O O   . LEU A 156 ? 0.5193 2.8283 0.4470 0.0253  -0.0148 -0.0945 1663 LEU A O   
1110 C CB  . LEU A 156 ? 0.5377 2.8342 0.4486 0.0280  -0.0097 -0.0930 1663 LEU A CB  
1111 C CG  . LEU A 156 ? 0.5473 2.8372 0.4494 0.0288  -0.0076 -0.0916 1663 LEU A CG  
1112 C CD1 . LEU A 156 ? 0.5554 2.8387 0.4471 0.0300  -0.0097 -0.0940 1663 LEU A CD1 
1113 C CD2 . LEU A 156 ? 0.5465 2.8368 0.4494 0.0281  -0.0093 -0.0898 1663 LEU A CD2 
1114 N N   . SER A 157 ? 0.5336 2.6556 0.5098 -0.0041 -0.0220 -0.1299 1664 SER A N   
1115 C CA  . SER A 157 ? 0.5264 2.6532 0.5087 -0.0052 -0.0244 -0.1316 1664 SER A CA  
1116 C C   . SER A 157 ? 0.5197 2.6507 0.5074 -0.0070 -0.0278 -0.1315 1664 SER A C   
1117 O O   . SER A 157 ? 0.5156 2.6489 0.5053 -0.0076 -0.0307 -0.1336 1664 SER A O   
1118 C CB  . SER A 157 ? 0.5239 2.6533 0.5121 -0.0054 -0.0210 -0.1304 1664 SER A CB  
1119 O OG  . SER A 157 ? 0.5290 2.6550 0.5124 -0.0038 -0.0188 -0.1317 1664 SER A OG  
1120 N N   . PRO A 158 ? 0.4923 2.5515 0.4476 -0.1115 -0.0205 -0.0533 1665 PRO A N   
1121 C CA  . PRO A 158 ? 0.4870 2.5493 0.4462 -0.1132 -0.0239 -0.0535 1665 PRO A CA  
1122 C C   . PRO A 158 ? 0.4883 2.5488 0.4429 -0.1127 -0.0275 -0.0562 1665 PRO A C   
1123 O O   . PRO A 158 ? 0.4838 2.5468 0.4414 -0.1140 -0.0305 -0.0575 1665 PRO A O   
1124 C CB  . PRO A 158 ? 0.4871 2.5499 0.4489 -0.1141 -0.0223 -0.0500 1665 PRO A CB  
1125 C CG  . PRO A 158 ? 0.4940 2.5526 0.4506 -0.1124 -0.0188 -0.0487 1665 PRO A CG  
1126 C CD  . PRO A 158 ? 0.4959 2.5534 0.4509 -0.1111 -0.0168 -0.0502 1665 PRO A CD  
1127 N N   . LEU A 159 ? 0.4825 2.5754 0.4031 -0.1150 -0.0186 -0.0627 1666 LEU A N   
1128 C CA  . LEU A 159 ? 0.4846 2.5750 0.4009 -0.1146 -0.0222 -0.0649 1666 LEU A CA  
1129 C C   . LEU A 159 ? 0.4836 2.5741 0.3991 -0.1141 -0.0249 -0.0684 1666 LEU A C   
1130 O O   . LEU A 159 ? 0.4849 2.5737 0.3980 -0.1136 -0.0283 -0.0705 1666 LEU A O   
1131 C CB  . LEU A 159 ? 0.4927 2.5775 0.4010 -0.1132 -0.0217 -0.0641 1666 LEU A CB  
1132 C CG  . LEU A 159 ? 0.4943 2.5783 0.4025 -0.1137 -0.0207 -0.0614 1666 LEU A CG  
1133 C CD1 . LEU A 159 ? 0.5032 2.5808 0.4024 -0.1123 -0.0203 -0.0610 1666 LEU A CD1 
1134 C CD2 . LEU A 159 ? 0.4895 2.5763 0.4019 -0.1150 -0.0239 -0.0615 1666 LEU A CD2 
1135 N N   . ILE A 160 ? 0.4946 2.4739 0.4214 -0.0617 -0.0399 -0.1209 1667 ILE A N   
1136 C CA  . ILE A 160 ? 0.4933 2.4730 0.4200 -0.0612 -0.0421 -0.1242 1667 ILE A CA  
1137 C C   . ILE A 160 ? 0.4871 2.4705 0.4192 -0.0627 -0.0450 -0.1256 1667 ILE A C   
1138 O O   . ILE A 160 ? 0.4817 2.4691 0.4197 -0.0644 -0.0443 -0.1247 1667 ILE A O   
1139 C CB  . ILE A 160 ? 0.4923 2.4732 0.4206 -0.0610 -0.0395 -0.1243 1667 ILE A CB  
1140 C CG1 . ILE A 160 ? 0.4992 2.4758 0.4218 -0.0595 -0.0362 -0.1230 1667 ILE A CG1 
1141 C CG2 . ILE A 160 ? 0.4906 2.4721 0.4193 -0.0606 -0.0421 -0.1275 1667 ILE A CG2 
1142 C CD1 . ILE A 160 ? 0.4981 2.4762 0.4236 -0.0593 -0.0329 -0.1225 1667 ILE A CD1 
1143 N N   . HIS A 161 ? 0.4747 2.3058 0.4046 -0.0947 -0.0487 -0.0904 1668 HIS A N   
1144 C CA  . HIS A 161 ? 0.4696 2.3036 0.4044 -0.0958 -0.0513 -0.0925 1668 HIS A CA  
1145 C C   . HIS A 161 ? 0.4664 2.3027 0.4040 -0.0961 -0.0513 -0.0944 1668 HIS A C   
1146 O O   . HIS A 161 ? 0.4694 2.3034 0.4038 -0.0947 -0.0520 -0.0961 1668 HIS A O   
1147 C CB  . HIS A 161 ? 0.4724 2.3036 0.4047 -0.0951 -0.0548 -0.0944 1668 HIS A CB  
1148 C CG  . HIS A 161 ? 0.4681 2.3018 0.4054 -0.0965 -0.0566 -0.0954 1668 HIS A CG  
1149 N ND1 . HIS A 161 ? 0.4633 2.3001 0.4056 -0.0975 -0.0575 -0.0976 1668 HIS A ND1 
1150 C CD2 . HIS A 161 ? 0.4682 2.3016 0.4062 -0.0970 -0.0577 -0.0947 1668 HIS A CD2 
1151 C CE1 . HIS A 161 ? 0.4609 2.2989 0.4065 -0.0988 -0.0588 -0.0983 1668 HIS A CE1 
1152 N NE2 . HIS A 161 ? 0.4637 2.2997 0.4069 -0.0986 -0.0590 -0.0965 1668 HIS A NE2 
1153 N N   . ARG A 162 ? 0.4797 2.1985 0.4406 -0.0866 -0.0628 -0.1396 1669 ARG A N   
1154 C CA  . ARG A 162 ? 0.4765 2.1977 0.4404 -0.0872 -0.0625 -0.1411 1669 ARG A CA  
1155 C C   . ARG A 162 ? 0.4724 2.1958 0.4403 -0.0885 -0.0646 -0.1436 1669 ARG A C   
1156 O O   . ARG A 162 ? 0.4694 2.1949 0.4402 -0.0892 -0.0644 -0.1447 1669 ARG A O   
1157 C CB  . ARG A 162 ? 0.4739 2.1976 0.4409 -0.0883 -0.0597 -0.1386 1669 ARG A CB  
1158 C CG  . ARG A 162 ? 0.4778 2.1995 0.4418 -0.0869 -0.0570 -0.1363 1669 ARG A CG  
1159 C CD  . ARG A 162 ? 0.4749 2.1994 0.4434 -0.0882 -0.0544 -0.1339 1669 ARG A CD  
1160 N NE  . ARG A 162 ? 0.4788 2.2013 0.4451 -0.0869 -0.0513 -0.1316 1669 ARG A NE  
1161 C CZ  . ARG A 162 ? 0.4772 2.2016 0.4477 -0.0878 -0.0487 -0.1289 1669 ARG A CZ  
1162 N NH1 . ARG A 162 ? 0.4720 2.2001 0.4485 -0.0900 -0.0494 -0.1280 1669 ARG A NH1 
1163 N NH2 . ARG A 162 ? 0.4813 2.2036 0.4498 -0.0865 -0.0456 -0.1270 1669 ARG A NH2 
1164 N N   . THR A 163 ? 0.4565 2.0786 0.4392 -0.1263 -0.0579 -0.1125 1670 THR A N   
1165 C CA  . THR A 163 ? 0.4533 2.0771 0.4399 -0.1275 -0.0595 -0.1151 1670 THR A CA  
1166 C C   . THR A 163 ? 0.4559 2.0772 0.4413 -0.1261 -0.0623 -0.1177 1670 THR A C   
1167 O O   . THR A 163 ? 0.4540 2.0762 0.4424 -0.1263 -0.0636 -0.1203 1670 THR A O   
1168 C CB  . THR A 163 ? 0.4506 2.0760 0.4401 -0.1297 -0.0593 -0.1142 1670 THR A CB  
1169 O OG1 . THR A 163 ? 0.4534 2.0769 0.4404 -0.1290 -0.0597 -0.1125 1670 THR A OG1 
1170 C CG2 . THR A 163 ? 0.4475 2.0755 0.4394 -0.1317 -0.0573 -0.1123 1670 THR A CG2 
1171 N N   . GLY A 164 ? 0.4469 2.1871 0.4337 -0.1089 -0.0551 -0.1075 1671 GLY A N   
1172 C CA  . GLY A 164 ? 0.4503 2.1875 0.4355 -0.1075 -0.0582 -0.1094 1671 GLY A CA  
1173 C C   . GLY A 164 ? 0.4565 2.1895 0.4351 -0.1057 -0.0588 -0.1079 1671 GLY A C   
1174 O O   . GLY A 164 ? 0.4598 2.1908 0.4341 -0.1045 -0.0577 -0.1074 1671 GLY A O   
1175 N N   . GLY A 165 ? 0.4603 2.3116 0.4214 -0.0632 -0.0549 -0.0597 1672 GLY A N   
1176 C CA  . GLY A 165 ? 0.4668 2.3136 0.4212 -0.0619 -0.0553 -0.0581 1672 GLY A CA  
1177 C C   . GLY A 165 ? 0.4675 2.3136 0.4221 -0.0625 -0.0560 -0.0566 1672 GLY A C   
1178 O O   . GLY A 165 ? 0.4629 2.3121 0.4227 -0.0639 -0.0559 -0.0568 1672 GLY A O   
1179 N N   . TYR A 166 ? 0.5137 2.3438 0.4148 -0.0491 -0.0505 -0.0103 1673 TYR A N   
1180 C CA  . TYR A 166 ? 0.5154 2.3441 0.4158 -0.0494 -0.0513 -0.0087 1673 TYR A CA  
1181 C C   . TYR A 166 ? 0.5185 2.3441 0.4186 -0.0485 -0.0557 -0.0107 1673 TYR A C   
1182 O O   . TYR A 166 ? 0.5241 2.3455 0.4193 -0.0472 -0.0579 -0.0114 1673 TYR A O   
1183 C CB  . TYR A 166 ? 0.5209 2.3463 0.4145 -0.0487 -0.0491 -0.0059 1673 TYR A CB  
1184 C CG  . TYR A 166 ? 0.5181 2.3464 0.4127 -0.0494 -0.0447 -0.0035 1673 TYR A CG  
1185 C CD1 . TYR A 166 ? 0.5154 2.3459 0.4128 -0.0507 -0.0430 -0.0013 1673 TYR A CD1 
1186 C CD2 . TYR A 166 ? 0.5184 2.3469 0.4116 -0.0491 -0.0425 -0.0037 1673 TYR A CD2 
1187 C CE1 . TYR A 166 ? 0.5130 2.3460 0.4121 -0.0516 -0.0395 0.0008  1673 TYR A CE1 
1188 C CE2 . TYR A 166 ? 0.5159 2.3471 0.4109 -0.0498 -0.0386 -0.0015 1673 TYR A CE2 
1189 C CZ  . TYR A 166 ? 0.5132 2.3466 0.4113 -0.0509 -0.0372 0.0007  1673 TYR A CZ  
1190 O OH  . TYR A 166 ? 0.5109 2.3467 0.4115 -0.0518 -0.0337 0.0031  1673 TYR A OH  
1191 N N   . GLU A 167 ? 0.5847 2.4127 0.4646 0.0238  -0.0688 -0.0540 1674 GLU A N   
1192 C CA  . GLU A 167 ? 0.5871 2.4126 0.4683 0.0243  -0.0731 -0.0557 1674 GLU A CA  
1193 C C   . GLU A 167 ? 0.5935 2.4143 0.4688 0.0251  -0.0746 -0.0537 1674 GLU A C   
1194 O O   . GLU A 167 ? 0.5932 2.4147 0.4674 0.0244  -0.0724 -0.0513 1674 GLU A O   
1195 C CB  . GLU A 167 ? 0.5815 2.4105 0.4709 0.0230  -0.0737 -0.0573 1674 GLU A CB  
1196 C CG  . GLU A 167 ? 0.5762 2.4089 0.4716 0.0223  -0.0729 -0.0599 1674 GLU A CG  
1197 C CD  . GLU A 167 ? 0.5719 2.4072 0.4750 0.0211  -0.0736 -0.0619 1674 GLU A CD  
1198 O OE1 . GLU A 167 ? 0.5731 2.4072 0.4775 0.0210  -0.0750 -0.0615 1674 GLU A OE1 
1199 O OE2 . GLU A 167 ? 0.5675 2.4059 0.4754 0.0203  -0.0724 -0.0637 1674 GLU A OE2 
1200 N N   . ALA A 168 ? 0.6942 2.4705 0.5069 0.0962  -0.1054 -0.0171 1675 ALA A N   
1201 C CA  . ALA A 168 ? 0.7014 2.4725 0.5075 0.0969  -0.1071 -0.0152 1675 ALA A CA  
1202 C C   . ALA A 168 ? 0.7011 2.4717 0.5115 0.0966  -0.1105 -0.0154 1675 ALA A C   
1203 O O   . ALA A 168 ? 0.6972 2.4701 0.5150 0.0962  -0.1124 -0.0177 1675 ALA A O   
1204 C CB  . ALA A 168 ? 0.7093 2.4744 0.5078 0.0983  -0.1098 -0.0155 1675 ALA A CB  
1205 N N   . TYR A 169 ? 0.9253 2.4825 0.6241 0.1513  -0.1559 -0.0265 1676 TYR A N   
1206 C CA  . TYR A 169 ? 0.9256 2.4821 0.6277 0.1509  -0.1587 -0.0263 1676 TYR A CA  
1207 C C   . TYR A 169 ? 0.9301 2.4824 0.6327 0.1518  -0.1643 -0.0281 1676 TYR A C   
1208 O O   . TYR A 169 ? 0.9369 2.4842 0.6327 0.1528  -0.1666 -0.0280 1676 TYR A O   
1209 C CB  . TYR A 169 ? 0.9298 2.4837 0.6260 0.1509  -0.1572 -0.0230 1676 TYR A CB  
1210 C CG  . TYR A 169 ? 0.9306 2.4834 0.6295 0.1504  -0.1599 -0.0225 1676 TYR A CG  
1211 C CD1 . TYR A 169 ? 0.9385 2.4852 0.6319 0.1511  -0.1639 -0.0216 1676 TYR A CD1 
1212 C CD2 . TYR A 169 ? 0.9238 2.4815 0.6304 0.1493  -0.1586 -0.0227 1676 TYR A CD2 
1213 C CE1 . TYR A 169 ? 0.9392 2.4850 0.6355 0.1509  -0.1664 -0.0208 1676 TYR A CE1 
1214 C CE2 . TYR A 169 ? 0.9246 2.4813 0.6339 0.1490  -0.1608 -0.0221 1676 TYR A CE2 
1215 C CZ  . TYR A 169 ? 0.9321 2.4830 0.6365 0.1499  -0.1648 -0.0212 1676 TYR A CZ  
1216 O OH  . TYR A 169 ? 0.9328 2.4828 0.6403 0.1494  -0.1673 -0.0207 1676 TYR A OH  
1217 N N   . ASP A 170 ? 1.0249 2.6131 0.7484 0.3082  -0.1871 -0.0935 1677 ASP A N   
1218 C CA  . ASP A 170 ? 1.0286 2.6133 0.7546 0.3088  -0.1928 -0.0948 1677 ASP A CA  
1219 C C   . ASP A 170 ? 1.0366 2.6153 0.7556 0.3093  -0.1957 -0.0925 1677 ASP A C   
1220 O O   . ASP A 170 ? 1.0360 2.6150 0.7582 0.3088  -0.1967 -0.0917 1677 ASP A O   
1221 C CB  . ASP A 170 ? 1.0223 2.6110 0.7598 0.3082  -0.1937 -0.0971 1677 ASP A CB  
1222 C CG  . ASP A 170 ? 1.0239 2.6107 0.7668 0.3089  -0.1986 -0.0996 1677 ASP A CG  
1223 O OD1 . ASP A 170 ? 1.0311 2.6124 0.7683 0.3100  -0.2027 -0.0992 1677 ASP A OD1 
1224 O OD2 . ASP A 170 ? 1.0182 2.6089 0.7711 0.3084  -0.1985 -0.1019 1677 ASP A OD2 
1225 N N   . GLU A 171 ? 1.0960 2.6279 0.7886 0.2676  -0.2504 -0.0070 1678 GLU A N   
1226 C CA  . GLU A 171 ? 1.1050 2.6304 0.7884 0.2678  -0.2522 -0.0043 1678 GLU A CA  
1227 C C   . GLU A 171 ? 1.1082 2.6305 0.7947 0.2678  -0.2578 -0.0043 1678 GLU A C   
1228 O O   . GLU A 171 ? 1.1108 2.6313 0.7947 0.2675  -0.2578 -0.0020 1678 GLU A O   
1229 C CB  . GLU A 171 ? 1.1136 2.6328 0.7859 0.2687  -0.2529 -0.0038 1678 GLU A CB  
1230 C CG  . GLU A 171 ? 1.1166 2.6329 0.7898 0.2694  -0.2578 -0.0062 1678 GLU A CG  
1231 C CD  . GLU A 171 ? 1.1085 2.6307 0.7894 0.2694  -0.2560 -0.0088 1678 GLU A CD  
1232 O OE1 . GLU A 171 ? 1.1039 2.6302 0.7843 0.2691  -0.2506 -0.0086 1678 GLU A OE1 
1233 O OE2 . GLU A 171 ? 1.1069 2.6296 0.7947 0.2698  -0.2599 -0.0111 1678 GLU A OE2 
1234 N N   . SER A 172 ? 1.2512 2.7464 0.9228 0.4142  -0.2680 0.0088  1679 SER A N   
1235 C CA  . SER A 172 ? 1.2545 2.7465 0.9301 0.4144  -0.2737 0.0087  1679 SER A CA  
1236 C C   . SER A 172 ? 1.2492 2.7445 0.9369 0.4146  -0.2766 0.0055  1679 SER A C   
1237 O O   . SER A 172 ? 1.2450 2.7430 0.9421 0.4142  -0.2775 0.0048  1679 SER A O   
1238 C CB  . SER A 172 ? 1.2663 2.7493 0.9312 0.4149  -0.2786 0.0103  1679 SER A CB  
1239 O OG  . SER A 172 ? 1.2700 2.7496 0.9382 0.4147  -0.2842 0.0107  1679 SER A OG  
1240 N N   . THR A 179 ? 1.0519 2.8367 0.7185 0.5000  -0.0381 -0.2404 1686 THR A N   
1241 C CA  . THR A 179 ? 1.0564 2.8382 0.7156 0.5013  -0.0405 -0.2375 1686 THR A CA  
1242 C C   . THR A 179 ? 1.0600 2.8392 0.7170 0.5031  -0.0439 -0.2381 1686 THR A C   
1243 O O   . THR A 179 ? 1.0585 2.8390 0.7155 0.5033  -0.0430 -0.2391 1686 THR A O   
1244 C CB  . THR A 179 ? 1.0557 2.8386 0.7079 0.5006  -0.0373 -0.2347 1686 THR A CB  
1245 N N   . ASN A 180 ? 0.9032 2.8436 0.7199 0.4435  -0.0403 -0.1632 1687 ASN A N   
1246 C CA  . ASN A 180 ? 0.9080 2.8448 0.7216 0.4451  -0.0443 -0.1633 1687 ASN A CA  
1247 C C   . ASN A 180 ? 0.9128 2.8465 0.7154 0.4460  -0.0443 -0.1605 1687 ASN A C   
1248 O O   . ASN A 180 ? 0.9165 2.8476 0.7147 0.4462  -0.0454 -0.1583 1687 ASN A O   
1249 C CB  . ASN A 180 ? 0.9113 2.8450 0.7298 0.4460  -0.0493 -0.1643 1687 ASN A CB  
1250 N N   . PRO A 181 ? 0.7493 2.6210 0.6279 0.2651  -0.0697 -0.1333 1688 PRO A N   
1251 C CA  . PRO A 181 ? 0.7538 2.6227 0.6221 0.2657  -0.0688 -0.1307 1688 PRO A CA  
1252 C C   . PRO A 181 ? 0.7617 2.6245 0.6240 0.2671  -0.0733 -0.1305 1688 PRO A C   
1253 O O   . PRO A 181 ? 0.7636 2.6244 0.6301 0.2678  -0.0776 -0.1321 1688 PRO A O   
1254 C CB  . PRO A 181 ? 0.7501 2.6221 0.6179 0.2653  -0.0653 -0.1314 1688 PRO A CB  
1255 C CG  . PRO A 181 ? 0.7470 2.6208 0.6226 0.2653  -0.0668 -0.1344 1688 PRO A CG  
1256 C CD  . PRO A 181 ? 0.7454 2.6199 0.6288 0.2649  -0.0688 -0.1358 1688 PRO A CD  
1257 N N   . ASP A 182 ? 0.6743 2.6271 0.6018 0.2089  -0.0992 -0.0949 1689 ASP A N   
1258 C CA  . ASP A 182 ? 0.6828 2.6291 0.6027 0.2100  -0.1030 -0.0944 1689 ASP A CA  
1259 C C   . ASP A 182 ? 0.6855 2.6304 0.5976 0.2106  -0.1005 -0.0939 1689 ASP A C   
1260 O O   . ASP A 182 ? 0.6898 2.6312 0.5989 0.2115  -0.1032 -0.0951 1689 ASP A O   
1261 C CB  . ASP A 182 ? 0.6894 2.6308 0.6034 0.2104  -0.1052 -0.0922 1689 ASP A CB  
1262 C CG  . ASP A 182 ? 0.6907 2.6304 0.6106 0.2105  -0.1102 -0.0932 1689 ASP A CG  
1263 O OD1 . ASP A 182 ? 0.6902 2.6297 0.6156 0.2108  -0.1137 -0.0956 1689 ASP A OD1 
1264 O OD2 . ASP A 182 ? 0.6922 2.6307 0.6117 0.2100  -0.1111 -0.0917 1689 ASP A OD2 
1265 N N   . PHE A 183 ? 0.5942 2.5263 0.5088 0.1129  -0.1014 -0.0929 1690 PHE A N   
1266 C CA  . PHE A 183 ? 0.5963 2.5275 0.5043 0.1133  -0.0983 -0.0922 1690 PHE A CA  
1267 C C   . PHE A 183 ? 0.5885 2.5260 0.5008 0.1124  -0.0932 -0.0921 1690 PHE A C   
1268 O O   . PHE A 183 ? 0.5828 2.5246 0.5006 0.1114  -0.0913 -0.0916 1690 PHE A O   
1269 C CB  . PHE A 183 ? 0.6046 2.5301 0.5017 0.1138  -0.0975 -0.0896 1690 PHE A CB  
1270 C CG  . PHE A 183 ? 0.6134 2.5318 0.5049 0.1146  -0.1027 -0.0894 1690 PHE A CG  
1271 C CD1 . PHE A 183 ? 0.6205 2.5333 0.5058 0.1155  -0.1057 -0.0904 1690 PHE A CD1 
1272 C CD2 . PHE A 183 ? 0.6150 2.5320 0.5071 0.1142  -0.1046 -0.0882 1690 PHE A CD2 
1273 C CE1 . PHE A 183 ? 0.6294 2.5351 0.5090 0.1159  -0.1108 -0.0900 1690 PHE A CE1 
1274 C CE2 . PHE A 183 ? 0.6235 2.5337 0.5104 0.1147  -0.1097 -0.0878 1690 PHE A CE2 
1275 C CZ  . PHE A 183 ? 0.6309 2.5352 0.5113 0.1155  -0.1129 -0.0886 1690 PHE A CZ  
1276 N N   . TYR A 184 ? 0.5336 2.4484 0.4515 0.0428  -0.0778 -0.1005 1691 TYR A N   
1277 C CA  . TYR A 184 ? 0.5274 2.4474 0.4482 0.0419  -0.0731 -0.1001 1691 TYR A CA  
1278 C C   . TYR A 184 ? 0.5318 2.4493 0.4448 0.0425  -0.0698 -0.0983 1691 TYR A C   
1279 O O   . TYR A 184 ? 0.5377 2.4507 0.4448 0.0436  -0.0714 -0.0992 1691 TYR A O   
1280 C CB  . TYR A 184 ? 0.5216 2.4456 0.4494 0.0417  -0.0734 -0.1027 1691 TYR A CB  
1281 C CG  . TYR A 184 ? 0.5162 2.4436 0.4529 0.0408  -0.0751 -0.1045 1691 TYR A CG  
1282 C CD1 . TYR A 184 ? 0.5105 2.4422 0.4522 0.0392  -0.0727 -0.1037 1691 TYR A CD1 
1283 C CD2 . TYR A 184 ? 0.5171 2.4431 0.4575 0.0414  -0.0793 -0.1070 1691 TYR A CD2 
1284 C CE1 . TYR A 184 ? 0.5062 2.4405 0.4556 0.0384  -0.0738 -0.1055 1691 TYR A CE1 
1285 C CE2 . TYR A 184 ? 0.5124 2.4414 0.4615 0.0405  -0.0804 -0.1086 1691 TYR A CE2 
1286 C CZ  . TYR A 184 ? 0.5071 2.4402 0.4604 0.0390  -0.0776 -0.1080 1691 TYR A CZ  
1287 O OH  . TYR A 184 ? 0.5031 2.4386 0.4646 0.0381  -0.0782 -0.1098 1691 TYR A OH  
1288 N N   . ILE A 185 ? 0.5208 2.4872 0.4090 0.0313  -0.0712 -0.1064 1692 ILE A N   
1289 C CA  . ILE A 185 ? 0.5256 2.4892 0.4066 0.0318  -0.0679 -0.1045 1692 ILE A CA  
1290 C C   . ILE A 185 ? 0.5199 2.4884 0.4047 0.0309  -0.0632 -0.1036 1692 ILE A C   
1291 O O   . ILE A 185 ? 0.5130 2.4867 0.4045 0.0296  -0.0621 -0.1032 1692 ILE A O   
1292 C CB  . ILE A 185 ? 0.5310 2.4910 0.4065 0.0318  -0.0671 -0.1018 1692 ILE A CB  
1293 C CG1 . ILE A 185 ? 0.5370 2.4919 0.4087 0.0324  -0.0720 -0.1026 1692 ILE A CG1 
1294 C CG2 . ILE A 185 ? 0.5370 2.4934 0.4047 0.0324  -0.0634 -0.1000 1692 ILE A CG2 
1295 C CD1 . ILE A 185 ? 0.5389 2.4924 0.4095 0.0320  -0.0724 -0.1005 1692 ILE A CD1 
1296 N N   . ASN A 186 ? 0.5116 2.4813 0.3993 0.0320  -0.0614 -0.1370 1693 ASN A N   
1297 C CA  . ASN A 186 ? 0.5074 2.4809 0.3981 0.0315  -0.0570 -0.1360 1693 ASN A CA  
1298 C C   . ASN A 186 ? 0.5144 2.4835 0.3975 0.0326  -0.0537 -0.1344 1693 ASN A C   
1299 O O   . ASN A 186 ? 0.5202 2.4849 0.3974 0.0337  -0.0546 -0.1358 1693 ASN A O   
1300 C CB  . ASN A 186 ? 0.5021 2.4793 0.3980 0.0313  -0.0575 -0.1383 1693 ASN A CB  
1301 C CG  . ASN A 186 ? 0.4955 2.4781 0.3973 0.0300  -0.0540 -0.1371 1693 ASN A CG  
1302 O OD1 . ASN A 186 ? 0.4918 2.4774 0.3974 0.0288  -0.0526 -0.1353 1693 ASN A OD1 
1303 N ND2 . ASN A 186 ? 0.4942 2.4779 0.3970 0.0304  -0.0529 -0.1383 1693 ASN A ND2 
1304 N N   . ILE A 187 ? 0.5260 2.6469 0.3902 0.0505  -0.0452 -0.1354 1694 ILE A N   
1305 C CA  . ILE A 187 ? 0.5340 2.6497 0.3904 0.0513  -0.0421 -0.1337 1694 ILE A CA  
1306 C C   . ILE A 187 ? 0.5346 2.6507 0.3908 0.0516  -0.0373 -0.1330 1694 ILE A C   
1307 O O   . ILE A 187 ? 0.5389 2.6526 0.3918 0.0520  -0.0333 -0.1307 1694 ILE A O   
1308 C CB  . ILE A 187 ? 0.5360 2.6506 0.3910 0.0509  -0.0406 -0.1309 1694 ILE A CB  
1309 C CG1 . ILE A 187 ? 0.5279 2.6490 0.3917 0.0494  -0.0381 -0.1289 1694 ILE A CG1 
1310 C CG2 . ILE A 187 ? 0.5383 2.6504 0.3911 0.0509  -0.0452 -0.1316 1694 ILE A CG2 
1311 C CD1 . ILE A 187 ? 0.5308 2.6506 0.3930 0.0493  -0.0346 -0.1257 1694 ILE A CD1 
1312 N N   . CYS A 188 ? 0.5510 2.6814 0.4388 0.1013  -0.0408 -0.2134 1695 CYS A N   
1313 C CA  . CYS A 188 ? 0.5526 2.6825 0.4394 0.1018  -0.0368 -0.2133 1695 CYS A CA  
1314 C C   . CYS A 188 ? 0.5491 2.6812 0.4389 0.1020  -0.0386 -0.2160 1695 CYS A C   
1315 O O   . CYS A 188 ? 0.5544 2.6825 0.4389 0.1032  -0.0379 -0.2171 1695 CYS A O   
1316 C CB  . CYS A 188 ? 0.5484 2.6824 0.4412 0.1010  -0.0322 -0.2105 1695 CYS A CB  
1317 S SG  . CYS A 188 ? 0.5574 2.6858 0.4433 0.1018  -0.0269 -0.2079 1695 CYS A SG  
1318 N N   . GLN A 189 ? 0.5642 2.5122 0.4777 0.1001  -0.0608 -0.2561 1696 GLN A N   
1319 C CA  . GLN A 189 ? 0.5605 2.5107 0.4772 0.1001  -0.0631 -0.2588 1696 GLN A CA  
1320 C C   . GLN A 189 ? 0.5620 2.5101 0.4768 0.1005  -0.0681 -0.2610 1696 GLN A C   
1321 O O   . GLN A 189 ? 0.5634 2.5102 0.4769 0.1002  -0.0698 -0.2603 1696 GLN A O   
1322 C CB  . GLN A 189 ? 0.5511 2.5083 0.4774 0.0984  -0.0623 -0.2585 1696 GLN A CB  
1323 C CG  . GLN A 189 ? 0.5492 2.5088 0.4787 0.0980  -0.0579 -0.2563 1696 GLN A CG  
1324 C CD  . GLN A 189 ? 0.5408 2.5066 0.4792 0.0961  -0.0577 -0.2552 1696 GLN A CD  
1325 O OE1 . GLN A 189 ? 0.5391 2.5067 0.4805 0.0952  -0.0553 -0.2526 1696 GLN A OE1 
1326 N NE2 . GLN A 189 ? 0.5359 2.5047 0.4784 0.0953  -0.0601 -0.2572 1696 GLN A NE2 
1327 N N   . PRO A 190 ? 0.5625 2.4350 0.4724 0.0636  -0.0781 -0.2653 1697 PRO A N   
1328 C CA  . PRO A 190 ? 0.5634 2.4343 0.4729 0.0640  -0.0832 -0.2673 1697 PRO A CA  
1329 C C   . PRO A 190 ? 0.5561 2.4320 0.4734 0.0626  -0.0848 -0.2676 1697 PRO A C   
1330 O O   . PRO A 190 ? 0.5494 2.4305 0.4730 0.0612  -0.0826 -0.2667 1697 PRO A O   
1331 C CB  . PRO A 190 ? 0.5634 2.4339 0.4733 0.0645  -0.0847 -0.2698 1697 PRO A CB  
1332 C CG  . PRO A 190 ? 0.5657 2.4353 0.4727 0.0650  -0.0807 -0.2691 1697 PRO A CG  
1333 C CD  . PRO A 190 ? 0.5616 2.4350 0.4724 0.0640  -0.0767 -0.2664 1697 PRO A CD  
1334 N N   . LEU A 191 ? 0.5129 2.3109 0.4494 0.0096  -0.0737 -0.2050 1698 LEU A N   
1335 C CA  . LEU A 191 ? 0.5070 2.3090 0.4504 0.0082  -0.0753 -0.2055 1698 LEU A CA  
1336 C C   . LEU A 191 ? 0.4994 2.3068 0.4507 0.0071  -0.0750 -0.2072 1698 LEU A C   
1337 O O   . LEU A 191 ? 0.4992 2.3065 0.4513 0.0077  -0.0763 -0.2091 1698 LEU A O   
1338 C CB  . LEU A 191 ? 0.5108 2.3092 0.4527 0.0089  -0.0798 -0.2069 1698 LEU A CB  
1339 C CG  . LEU A 191 ? 0.5076 2.3079 0.4544 0.0081  -0.0816 -0.2069 1698 LEU A CG  
1340 C CD1 . LEU A 191 ? 0.5110 2.3091 0.4535 0.0080  -0.0804 -0.2043 1698 LEU A CD1 
1341 C CD2 . LEU A 191 ? 0.5097 2.3076 0.4578 0.0087  -0.0864 -0.2091 1698 LEU A CD2 
1342 N N   . ASN A 192 ? 0.4987 2.1434 0.4594 -0.0227 -0.0675 -0.2073 1699 ASN A N   
1343 C CA  . ASN A 192 ? 0.4919 2.1414 0.4596 -0.0241 -0.0671 -0.2087 1699 ASN A CA  
1344 C C   . ASN A 192 ? 0.4901 2.1402 0.4622 -0.0242 -0.0705 -0.2114 1699 ASN A C   
1345 O O   . ASN A 192 ? 0.4922 2.1403 0.4638 -0.0240 -0.0727 -0.2117 1699 ASN A O   
1346 C CB  . ASN A 192 ? 0.4872 2.1405 0.4585 -0.0259 -0.0644 -0.2066 1699 ASN A CB  
1347 C CG  . ASN A 192 ? 0.4875 2.1414 0.4570 -0.0260 -0.0610 -0.2041 1699 ASN A CG  
1348 O OD1 . ASN A 192 ? 0.4857 2.1412 0.4567 -0.0261 -0.0597 -0.2046 1699 ASN A OD1 
1349 N ND2 . ASN A 192 ? 0.4899 2.1425 0.4566 -0.0259 -0.0595 -0.2017 1699 ASN A ND2 
1350 N N   . PRO A 193 ? 0.4912 2.0445 0.4883 -0.0524 -0.0718 -0.2158 1700 PRO A N   
1351 C CA  . PRO A 193 ? 0.4901 2.0435 0.4916 -0.0524 -0.0747 -0.2186 1700 PRO A CA  
1352 C C   . PRO A 193 ? 0.4863 2.0422 0.4931 -0.0540 -0.0746 -0.2188 1700 PRO A C   
1353 O O   . PRO A 193 ? 0.4817 2.0411 0.4920 -0.0560 -0.0724 -0.2186 1700 PRO A O   
1354 C CB  . PRO A 193 ? 0.4870 2.0428 0.4917 -0.0527 -0.0742 -0.2203 1700 PRO A CB  
1355 C CG  . PRO A 193 ? 0.4842 2.0426 0.4887 -0.0540 -0.0707 -0.2184 1700 PRO A CG  
1356 C CD  . PRO A 193 ? 0.4877 2.0440 0.4867 -0.0533 -0.0693 -0.2155 1700 PRO A CD  
1357 N N   . MET A 194 ? 0.4560 1.9469 0.4909 -0.0854 -0.0608 -0.1306 1701 MET A N   
1358 C CA  . MET A 194 ? 0.4531 1.9458 0.4932 -0.0868 -0.0610 -0.1313 1701 MET A CA  
1359 C C   . MET A 194 ? 0.4505 1.9446 0.4973 -0.0870 -0.0623 -0.1343 1701 MET A C   
1360 O O   . MET A 194 ? 0.4502 1.9445 0.4978 -0.0865 -0.0630 -0.1358 1701 MET A O   
1361 C CB  . MET A 194 ? 0.4571 1.9466 0.4948 -0.0859 -0.0632 -0.1304 1701 MET A CB  
1362 C CG  . MET A 194 ? 0.4607 1.9480 0.4914 -0.0852 -0.0621 -0.1273 1701 MET A CG  
1363 S SD  . MET A 194 ? 0.4668 1.9493 0.4938 -0.0838 -0.0656 -0.1266 1701 MET A SD  
1364 C CE  . MET A 194 ? 0.4720 1.9504 0.4962 -0.0820 -0.0693 -0.1286 1701 MET A CE  
1365 N N   . HIS A 195 ? 0.4450 1.7924 0.5208 -0.1070 -0.0566 -0.1208 1702 HIS A N   
1366 C CA  . HIS A 195 ? 0.4428 1.7914 0.5257 -0.1074 -0.0575 -0.1238 1702 HIS A CA  
1367 C C   . HIS A 195 ? 0.4458 1.7917 0.5314 -0.1059 -0.0614 -0.1252 1702 HIS A C   
1368 O O   . HIS A 195 ? 0.4480 1.7921 0.5322 -0.1057 -0.0625 -0.1240 1702 HIS A O   
1369 C CB  . HIS A 195 ? 0.4385 1.7901 0.5261 -0.1098 -0.0546 -0.1244 1702 HIS A CB  
1370 C CG  . HIS A 195 ? 0.4366 1.7892 0.5319 -0.1102 -0.0549 -0.1275 1702 HIS A CG  
1371 N ND1 . HIS A 195 ? 0.4366 1.7887 0.5368 -0.1107 -0.0555 -0.1289 1702 HIS A ND1 
1372 C CD2 . HIS A 195 ? 0.4349 1.7887 0.5340 -0.1105 -0.0548 -0.1297 1702 HIS A CD2 
1373 C CE1 . HIS A 195 ? 0.4350 1.7880 0.5419 -0.1111 -0.0555 -0.1316 1702 HIS A CE1 
1374 N NE2 . HIS A 195 ? 0.4339 1.7880 0.5403 -0.1111 -0.0551 -0.1322 1702 HIS A NE2 
1375 N N   . ALA A 196 ? 0.4445 1.8510 0.5524 -0.1030 -0.0635 -0.1098 1703 ALA A N   
1376 C CA  . ALA A 196 ? 0.4471 1.8512 0.5594 -0.1018 -0.0675 -0.1114 1703 ALA A CA  
1377 C C   . ALA A 196 ? 0.4531 1.8527 0.5595 -0.1001 -0.0712 -0.1098 1703 ALA A C   
1378 O O   . ALA A 196 ? 0.4558 1.8529 0.5654 -0.0992 -0.0750 -0.1108 1703 ALA A O   
1379 C CB  . ALA A 196 ? 0.4445 1.8502 0.5642 -0.1032 -0.0666 -0.1127 1703 ALA A CB  
1380 N N   . VAL A 197 ? 0.4584 2.0825 0.5592 -0.0606 -0.0661 -0.0606 1704 VAL A N   
1381 C CA  . VAL A 197 ? 0.4650 2.0842 0.5586 -0.0590 -0.0692 -0.0590 1704 VAL A CA  
1382 C C   . VAL A 197 ? 0.4681 2.0852 0.5554 -0.0579 -0.0694 -0.0588 1704 VAL A C   
1383 O O   . VAL A 197 ? 0.4674 2.0856 0.5498 -0.0582 -0.0662 -0.0571 1704 VAL A O   
1384 C CB  . VAL A 197 ? 0.4665 2.0849 0.5547 -0.0593 -0.0675 -0.0564 1704 VAL A CB  
1385 C CG1 . VAL A 197 ? 0.4740 2.0867 0.5550 -0.0579 -0.0709 -0.0549 1704 VAL A CG1 
1386 C CG2 . VAL A 197 ? 0.4629 2.0837 0.5573 -0.0606 -0.0666 -0.0566 1704 VAL A CG2 
1387 N N   . PRO A 198 ? 0.4993 2.2285 0.5510 -0.0162 -0.1036 -0.1641 1705 PRO A N   
1388 C CA  . PRO A 198 ? 0.5022 2.2294 0.5486 -0.0152 -0.1040 -0.1642 1705 PRO A CA  
1389 C C   . PRO A 198 ? 0.5098 2.2316 0.5452 -0.0141 -0.1052 -0.1623 1705 PRO A C   
1390 O O   . PRO A 198 ? 0.5162 2.2329 0.5476 -0.0129 -0.1092 -0.1627 1705 PRO A O   
1391 C CB  . PRO A 198 ? 0.5030 2.2291 0.5551 -0.0144 -0.1083 -0.1668 1705 PRO A CB  
1392 C CG  . PRO A 198 ? 0.5014 2.2282 0.5614 -0.0149 -0.1103 -0.1678 1705 PRO A CG  
1393 C CD  . PRO A 198 ? 0.5010 2.2283 0.5585 -0.0155 -0.1083 -0.1659 1705 PRO A CD  
1394 N N   . CYS A 199 ? 0.5107 2.3252 0.5158 0.0044  -0.1057 -0.1706 1706 CYS A N   
1395 C CA  . CYS A 199 ? 0.5175 2.3273 0.5121 0.0054  -0.1052 -0.1685 1706 CYS A CA  
1396 C C   . CYS A 199 ? 0.5185 2.3278 0.5096 0.0060  -0.1037 -0.1692 1706 CYS A C   
1397 O O   . CYS A 199 ? 0.5128 2.3268 0.5070 0.0052  -0.1000 -0.1691 1706 CYS A O   
1398 C CB  . CYS A 199 ? 0.5162 2.3275 0.5080 0.0046  -0.1013 -0.1659 1706 CYS A CB  
1399 S SG  . CYS A 199 ? 0.5182 2.3277 0.5102 0.0043  -0.1032 -0.1648 1706 CYS A SG  
1400 N N   . PRO A 200 ? 0.5778 2.4195 0.5337 0.0146  -0.1323 -0.2632 1707 PRO A N   
1401 C CA  . PRO A 200 ? 0.5793 2.4200 0.5320 0.0152  -0.1315 -0.2639 1707 PRO A CA  
1402 C C   . PRO A 200 ? 0.5765 2.4202 0.5268 0.0148  -0.1257 -0.2624 1707 PRO A C   
1403 O O   . PRO A 200 ? 0.5796 2.4214 0.5241 0.0148  -0.1234 -0.2601 1707 PRO A O   
1404 C CB  . PRO A 200 ? 0.5900 2.4225 0.5327 0.0164  -0.1350 -0.2637 1707 PRO A CB  
1405 C CG  . PRO A 200 ? 0.5924 2.4224 0.5372 0.0164  -0.1395 -0.2639 1707 PRO A CG  
1406 C CD  . PRO A 200 ? 0.5857 2.4210 0.5367 0.0153  -0.1370 -0.2628 1707 PRO A CD  
1407 N N   . ALA A 201 ? 0.6053 2.2819 0.5429 0.0254  -0.1262 -0.3346 1708 ALA A N   
1408 C CA  . ALA A 201 ? 0.6018 2.2817 0.5389 0.0249  -0.1211 -0.3332 1708 ALA A CA  
1409 C C   . ALA A 201 ? 0.6091 2.2841 0.5362 0.0259  -0.1191 -0.3316 1708 ALA A C   
1410 O O   . ALA A 201 ? 0.6155 2.2855 0.5369 0.0270  -0.1211 -0.3325 1708 ALA A O   
1411 C CB  . ALA A 201 ? 0.5962 2.2803 0.5392 0.0244  -0.1202 -0.3350 1708 ALA A CB  
1412 N N   . GLY A 202 ? 0.6184 2.4088 0.5206 0.0709  -0.1124 -0.3555 1709 GLY A N   
1413 C CA  . GLY A 202 ? 0.6253 2.4111 0.5185 0.0716  -0.1096 -0.3537 1709 GLY A CA  
1414 C C   . GLY A 202 ? 0.6320 2.4128 0.5184 0.0719  -0.1103 -0.3522 1709 GLY A C   
1415 O O   . GLY A 202 ? 0.6371 2.4147 0.5168 0.0724  -0.1072 -0.3503 1709 GLY A O   
1416 N N   . ALA A 203 ? 0.5790 2.5026 0.4733 0.0725  -0.1106 -0.2723 1710 ALA A N   
1417 C CA  . ALA A 203 ? 0.5852 2.5041 0.4736 0.0728  -0.1120 -0.2707 1710 ALA A CA  
1418 C C   . ALA A 203 ? 0.5819 2.5039 0.4718 0.0719  -0.1080 -0.2682 1710 ALA A C   
1419 O O   . ALA A 203 ? 0.5734 2.5019 0.4714 0.0709  -0.1062 -0.2680 1710 ALA A O   
1420 C CB  . ALA A 203 ? 0.5854 2.5033 0.4772 0.0728  -0.1174 -0.2721 1710 ALA A CB  
1421 N N   . ALA A 204 ? 0.5575 2.5451 0.4284 0.0789  -0.0869 -0.2099 1711 ALA A N   
1422 C CA  . ALA A 204 ? 0.5554 2.5452 0.4272 0.0781  -0.0834 -0.2073 1711 ALA A CA  
1423 C C   . ALA A 204 ? 0.5558 2.5448 0.4287 0.0777  -0.0864 -0.2067 1711 ALA A C   
1424 O O   . ALA A 204 ? 0.5490 2.5432 0.4288 0.0767  -0.0856 -0.2061 1711 ALA A O   
1425 C CB  . ALA A 204 ? 0.5628 2.5478 0.4257 0.0786  -0.0794 -0.2053 1711 ALA A CB  
1426 N N   . VAL A 205 ? 0.5629 2.6105 0.4237 0.0974  -0.0956 -0.1500 1712 VAL A N   
1427 C CA  . VAL A 205 ? 0.5640 2.6103 0.4259 0.0973  -0.0992 -0.1497 1712 VAL A CA  
1428 C C   . VAL A 205 ? 0.5635 2.6092 0.4294 0.0975  -0.1049 -0.1523 1712 VAL A C   
1429 O O   . VAL A 205 ? 0.5686 2.6101 0.4303 0.0983  -0.1072 -0.1537 1712 VAL A O   
1430 C CB  . VAL A 205 ? 0.5743 2.6131 0.4256 0.0976  -0.0996 -0.1476 1712 VAL A CB  
1431 C CG1 . VAL A 205 ? 0.5743 2.6126 0.4278 0.0971  -0.1028 -0.1469 1712 VAL A CG1 
1432 C CG2 . VAL A 205 ? 0.5759 2.6145 0.4228 0.0974  -0.0936 -0.1453 1712 VAL A CG2 
1433 N N   . CYS A 206 ? 0.5523 2.6010 0.4672 0.0971  -0.1084 -0.1488 1713 CYS A N   
1434 C CA  . CYS A 206 ? 0.5502 2.5996 0.4715 0.0974  -0.1130 -0.1512 1713 CYS A CA  
1435 C C   . CYS A 206 ? 0.5524 2.5996 0.4754 0.0971  -0.1172 -0.1509 1713 CYS A C   
1436 O O   . CYS A 206 ? 0.5494 2.5990 0.4750 0.0965  -0.1155 -0.1497 1713 CYS A O   
1437 C CB  . CYS A 206 ? 0.5398 2.5969 0.4717 0.0965  -0.1110 -0.1527 1713 CYS A CB  
1438 S SG  . CYS A 206 ? 0.5367 2.5954 0.4768 0.0966  -0.1152 -0.1562 1713 CYS A SG  
1439 N N   . LYS A 207 ? 0.5794 2.6991 0.5249 0.1395  -0.1248 -0.1050 1714 LYS A N   
1440 C CA  . LYS A 207 ? 0.5818 2.6991 0.5297 0.1395  -0.1295 -0.1050 1714 LYS A CA  
1441 C C   . LYS A 207 ? 0.5760 2.6969 0.5354 0.1394  -0.1326 -0.1076 1714 LYS A C   
1442 O O   . LYS A 207 ? 0.5769 2.6968 0.5376 0.1400  -0.1351 -0.1096 1714 LYS A O   
1443 C CB  . LYS A 207 ? 0.5936 2.7017 0.5311 0.1403  -0.1339 -0.1041 1714 LYS A CB  
1444 C CG  . LYS A 207 ? 0.5969 2.7018 0.5371 0.1403  -0.1397 -0.1042 1714 LYS A CG  
1445 C CD  . LYS A 207 ? 0.6089 2.7044 0.5392 0.1409  -0.1450 -0.1039 1714 LYS A CD  
1446 C CE  . LYS A 207 ? 0.6116 2.7042 0.5468 0.1409  -0.1519 -0.1045 1714 LYS A CE  
1447 N NZ  . LYS A 207 ? 0.6236 2.7067 0.5492 0.1413  -0.1578 -0.1042 1714 LYS A NZ  
1448 N N   . VAL A 208 ? 0.5930 2.6858 0.5963 0.2000  -0.0997 -0.0520 1715 VAL A N   
1449 C CA  . VAL A 208 ? 0.5875 2.6838 0.6025 0.1997  -0.1020 -0.0546 1715 VAL A CA  
1450 C C   . VAL A 208 ? 0.5909 2.6841 0.6090 0.1999  -0.1071 -0.0544 1715 VAL A C   
1451 O O   . VAL A 208 ? 0.5892 2.6837 0.6091 0.1993  -0.1061 -0.0533 1715 VAL A O   
1452 C CB  . VAL A 208 ? 0.5774 2.6815 0.6010 0.1985  -0.0973 -0.0553 1715 VAL A CB  
1453 C CG1 . VAL A 208 ? 0.5724 2.6797 0.6080 0.1983  -0.0992 -0.0579 1715 VAL A CG1 
1454 C CG2 . VAL A 208 ? 0.5742 2.6813 0.5955 0.1984  -0.0930 -0.0555 1715 VAL A CG2 
1455 N N   . PRO A 209 ? 0.6305 2.8542 0.7261 0.2574  -0.1023 0.0531  1716 PRO A N   
1456 C CA  . PRO A 209 ? 0.6339 2.8544 0.7336 0.2574  -0.1079 0.0531  1716 PRO A CA  
1457 C C   . PRO A 209 ? 0.6265 2.8521 0.7408 0.2572  -0.1085 0.0507  1716 PRO A C   
1458 O O   . PRO A 209 ? 0.6207 2.8507 0.7412 0.2569  -0.1063 0.0487  1716 PRO A O   
1459 C CB  . PRO A 209 ? 0.6430 2.8563 0.7365 0.2583  -0.1137 0.0529  1716 PRO A CB  
1460 C CG  . PRO A 209 ? 0.6412 2.8560 0.7334 0.2587  -0.1115 0.0516  1716 PRO A CG  
1461 C CD  . PRO A 209 ? 0.6336 2.8549 0.7262 0.2581  -0.1042 0.0518  1716 PRO A CD  
1462 N N   . ILE A 210 ? 0.7191 2.9745 0.8751 0.4018  -0.0379 0.1286  1717 ILE A N   
1463 C CA  . ILE A 210 ? 0.7128 2.9725 0.8830 0.4014  -0.0384 0.1263  1717 ILE A CA  
1464 C C   . ILE A 210 ? 0.7130 2.9721 0.8899 0.4020  -0.0419 0.1239  1717 ILE A C   
1465 O O   . ILE A 210 ? 0.7061 2.9704 0.8929 0.4016  -0.0395 0.1216  1717 ILE A O   
1466 C CB  . ILE A 210 ? 0.7149 2.9726 0.8892 0.4013  -0.0416 0.1271  1717 ILE A CB  
1467 C CG1 . ILE A 210 ? 0.7135 2.9727 0.8828 0.4005  -0.0375 0.1292  1717 ILE A CG1 
1468 C CG2 . ILE A 210 ? 0.7095 2.9708 0.8992 0.4011  -0.0427 0.1246  1717 ILE A CG2 
1469 C CD1 . ILE A 210 ? 0.7044 2.9708 0.8796 0.3995  -0.0309 0.1283  1717 ILE A CD1 
1470 N N   . ASP A 211 ? 0.6354 3.1491 0.9414 0.3409  -0.0812 0.2610  1718 ASP A N   
1471 C CA  . ASP A 211 ? 0.6367 3.1489 0.9481 0.3415  -0.0855 0.2590  1718 ASP A CA  
1472 C C   . ASP A 211 ? 0.6416 3.1503 0.9420 0.3420  -0.0857 0.2594  1718 ASP A C   
1473 O O   . ASP A 211 ? 0.6508 3.1524 0.9410 0.3424  -0.0899 0.2610  1718 ASP A O   
1474 C CB  . ASP A 211 ? 0.6426 3.1497 0.9586 0.3418  -0.0931 0.2592  1718 ASP A CB  
1475 C CG  . ASP A 211 ? 0.6379 3.1483 0.9655 0.3413  -0.0929 0.2585  1718 ASP A CG  
1476 O OD1 . ASP A 211 ? 0.6297 3.1464 0.9683 0.3409  -0.0891 0.2565  1718 ASP A OD1 
1477 O OD2 . ASP A 211 ? 0.6429 3.1493 0.9683 0.3415  -0.0965 0.2603  1718 ASP A OD2 
1478 N N   . GLY A 212 ? 0.5679 3.0815 0.8199 0.1955  -0.1392 0.2044  1719 GLY A N   
1479 C CA  . GLY A 212 ? 0.5713 3.0826 0.8140 0.1959  -0.1385 0.2045  1719 GLY A CA  
1480 C C   . GLY A 212 ? 0.5653 3.0818 0.8049 0.1953  -0.1310 0.2047  1719 GLY A C   
1481 O O   . GLY A 212 ? 0.5614 3.0812 0.8008 0.1948  -0.1269 0.2058  1719 GLY A O   
1482 N N   . PRO A 213 ? 0.5453 2.8488 0.6956 0.1239  -0.1433 0.0487  1720 PRO A N   
1483 C CA  . PRO A 213 ? 0.5399 2.8482 0.6875 0.1234  -0.1368 0.0489  1720 PRO A CA  
1484 C C   . PRO A 213 ? 0.5440 2.8497 0.6793 0.1234  -0.1337 0.0515  1720 PRO A C   
1485 O O   . PRO A 213 ? 0.5525 2.8517 0.6794 0.1239  -0.1370 0.0531  1720 PRO A O   
1486 C CB  . PRO A 213 ? 0.5407 2.8483 0.6876 0.1240  -0.1377 0.0474  1720 PRO A CB  
1487 C CG  . PRO A 213 ? 0.5496 2.8498 0.6930 0.1248  -0.1448 0.0472  1720 PRO A CG  
1488 C CD  . PRO A 213 ? 0.5499 2.8495 0.7003 0.1247  -0.1483 0.0472  1720 PRO A CD  
1489 N N   . PRO A 214 ? 0.5383 2.6479 0.5963 0.1106  -0.1315 -0.0935 1721 PRO A N   
1490 C CA  . PRO A 214 ? 0.5419 2.6494 0.5891 0.1106  -0.1281 -0.0909 1721 PRO A CA  
1491 C C   . PRO A 214 ? 0.5504 2.6516 0.5866 0.1115  -0.1297 -0.0904 1721 PRO A C   
1492 O O   . PRO A 214 ? 0.5507 2.6515 0.5879 0.1120  -0.1310 -0.0921 1721 PRO A O   
1493 C CB  . PRO A 214 ? 0.5336 2.6480 0.5842 0.1098  -0.1218 -0.0908 1721 PRO A CB  
1494 C CG  . PRO A 214 ? 0.5260 2.6457 0.5887 0.1089  -0.1218 -0.0929 1721 PRO A CG  
1495 C CD  . PRO A 214 ? 0.5287 2.6458 0.5957 0.1097  -0.1272 -0.0948 1721 PRO A CD  
1496 N N   . ILE A 215 ? 0.5768 2.8405 0.5612 0.0863  -0.1679 -0.1457 1722 ILE A N   
1497 C CA  . ILE A 215 ? 0.5863 2.8429 0.5589 0.0869  -0.1692 -0.1451 1722 ILE A CA  
1498 C C   . ILE A 215 ? 0.5880 2.8442 0.5519 0.0869  -0.1633 -0.1430 1722 ILE A C   
1499 O O   . ILE A 215 ? 0.5860 2.8442 0.5496 0.0864  -0.1603 -0.1412 1722 ILE A O   
1500 C CB  . ILE A 215 ? 0.5967 2.8449 0.5630 0.0873  -0.1756 -0.1446 1722 ILE A CB  
1501 C CG1 . ILE A 215 ? 0.6062 2.8470 0.5628 0.0881  -0.1783 -0.1450 1722 ILE A CG1 
1502 C CG2 . ILE A 215 ? 0.6011 2.8463 0.5610 0.0870  -0.1746 -0.1420 1722 ILE A CG2 
1503 C CD1 . ILE A 215 ? 0.6043 2.8459 0.5678 0.0885  -0.1823 -0.1476 1722 ILE A CD1 
1504 N N   . ASP A 216 ? 0.6147 2.8384 0.5181 0.0802  -0.1719 -0.2442 1723 ASP A N   
1505 C CA  . ASP A 216 ? 0.6162 2.8396 0.5124 0.0802  -0.1660 -0.2425 1723 ASP A CA  
1506 C C   . ASP A 216 ? 0.6268 2.8425 0.5109 0.0803  -0.1661 -0.2404 1723 ASP A C   
1507 O O   . ASP A 216 ? 0.6368 2.8447 0.5110 0.0808  -0.1684 -0.2406 1723 ASP A O   
1508 C CB  . ASP A 216 ? 0.6171 2.8400 0.5108 0.0807  -0.1645 -0.2439 1723 ASP A CB  
1509 C CG  . ASP A 216 ? 0.6171 2.8409 0.5057 0.0807  -0.1580 -0.2425 1723 ASP A CG  
1510 O OD1 . ASP A 216 ? 0.6249 2.8433 0.5037 0.0807  -0.1562 -0.2406 1723 ASP A OD1 
1511 O OD2 . ASP A 216 ? 0.6095 2.8394 0.5042 0.0803  -0.1545 -0.2431 1723 ASP A OD2 
1512 N N   . ILE A 217 ? 0.6277 2.8906 0.4708 0.1306  -0.1542 -0.1807 1724 ILE A N   
1513 C CA  . ILE A 217 ? 0.6373 2.8933 0.4691 0.1307  -0.1535 -0.1782 1724 ILE A CA  
1514 C C   . ILE A 217 ? 0.6371 2.8943 0.4645 0.1306  -0.1464 -0.1764 1724 ILE A C   
1515 O O   . ILE A 217 ? 0.6438 2.8964 0.4631 0.1304  -0.1446 -0.1744 1724 ILE A O   
1516 C CB  . ILE A 217 ? 0.6379 2.8932 0.4716 0.1301  -0.1564 -0.1771 1724 ILE A CB  
1517 C CG1 . ILE A 217 ? 0.6266 2.8907 0.4710 0.1295  -0.1532 -0.1764 1724 ILE A CG1 
1518 C CG2 . ILE A 217 ? 0.6411 2.8929 0.4772 0.1304  -0.1639 -0.1785 1724 ILE A CG2 
1519 C CD1 . ILE A 217 ? 0.6280 2.8910 0.4720 0.1289  -0.1539 -0.1746 1724 ILE A CD1 
1520 N N   . GLY A 218 ? 0.6289 2.8003 0.4381 0.1242  -0.1270 -0.2116 1725 GLY A N   
1521 C CA  . GLY A 218 ? 0.6278 2.8010 0.4346 0.1239  -0.1203 -0.2099 1725 GLY A CA  
1522 C C   . GLY A 218 ? 0.6217 2.7998 0.4332 0.1240  -0.1169 -0.2109 1725 GLY A C   
1523 O O   . GLY A 218 ? 0.6122 2.7972 0.4339 0.1237  -0.1174 -0.2123 1725 GLY A O   
1524 N N   . ARG A 219 ? 0.6628 2.7751 0.4576 0.1283  -0.1137 -0.2840 1726 ARG A N   
1525 C CA  . ARG A 219 ? 0.6578 2.7744 0.4563 0.1284  -0.1094 -0.2845 1726 ARG A CA  
1526 C C   . ARG A 219 ? 0.6615 2.7764 0.4547 0.1286  -0.1032 -0.2824 1726 ARG A C   
1527 O O   . ARG A 219 ? 0.6720 2.7792 0.4545 0.1289  -0.1027 -0.2813 1726 ARG A O   
1528 C CB  . ARG A 219 ? 0.6618 2.7749 0.4569 0.1292  -0.1118 -0.2870 1726 ARG A CB  
1529 C CG  . ARG A 219 ? 0.6568 2.7727 0.4591 0.1292  -0.1172 -0.2894 1726 ARG A CG  
1530 C CD  . ARG A 219 ? 0.6611 2.7734 0.4598 0.1299  -0.1193 -0.2915 1726 ARG A CD  
1531 N NE  . ARG A 219 ? 0.6589 2.7719 0.4629 0.1300  -0.1252 -0.2937 1726 ARG A NE  
1532 C CZ  . ARG A 219 ? 0.6497 2.7694 0.4640 0.1298  -0.1257 -0.2953 1726 ARG A CZ  
1533 N NH1 . ARG A 219 ? 0.6419 2.7681 0.4620 0.1293  -0.1209 -0.2951 1726 ARG A NH1 
1534 N NH2 . ARG A 219 ? 0.6487 2.7683 0.4676 0.1298  -0.1312 -0.2973 1726 ARG A NH2 
1535 N N   . VAL A 220 ? 0.6590 2.7870 0.4493 0.1695  -0.0800 -0.2960 1727 VAL A N   
1536 C CA  . VAL A 220 ? 0.6611 2.7886 0.4488 0.1694  -0.0738 -0.2937 1727 VAL A CA  
1537 C C   . VAL A 220 ? 0.6713 2.7916 0.4488 0.1703  -0.0710 -0.2939 1727 VAL A C   
1538 O O   . VAL A 220 ? 0.6715 2.7915 0.4488 0.1709  -0.0711 -0.2958 1727 VAL A O   
1539 C CB  . VAL A 220 ? 0.6501 2.7864 0.4488 0.1686  -0.0702 -0.2926 1727 VAL A CB  
1540 C CG1 . VAL A 220 ? 0.6455 2.7851 0.4488 0.1688  -0.0701 -0.2946 1727 VAL A CG1 
1541 C CG2 . VAL A 220 ? 0.6520 2.7880 0.4493 0.1685  -0.0641 -0.2899 1727 VAL A CG2 
1542 N N   . ALA A 221 ? 0.7489 2.9973 0.4708 0.2069  -0.0593 -0.3544 1728 ALA A N   
1543 C CA  . ALA A 221 ? 0.7602 3.0005 0.4710 0.2075  -0.0562 -0.3546 1728 ALA A CA  
1544 C C   . ALA A 221 ? 0.7587 3.0013 0.4720 0.2076  -0.0489 -0.3531 1728 ALA A C   
1545 O O   . ALA A 221 ? 0.7547 3.0005 0.4724 0.2080  -0.0471 -0.3542 1728 ALA A O   
1546 C CB  . ALA A 221 ? 0.7720 3.0033 0.4709 0.2075  -0.0575 -0.3537 1728 ALA A CB  
1547 N N   . GLY A 222 ? 0.7699 3.1327 0.5241 0.2712  -0.0217 -0.3971 1729 GLY A N   
1548 C CA  . GLY A 222 ? 0.7689 3.1336 0.5261 0.2712  -0.0144 -0.3953 1729 GLY A CA  
1549 C C   . GLY A 222 ? 0.7606 3.1322 0.5272 0.2703  -0.0124 -0.3926 1729 GLY A C   
1550 O O   . GLY A 222 ? 0.7550 3.1302 0.5261 0.2696  -0.0164 -0.3923 1729 GLY A O   
1551 N N   . PRO A 223 ? 0.7064 3.2198 0.5462 0.2705  0.0054  -0.3600 1730 PRO A N   
1552 C CA  . PRO A 223 ? 0.7002 3.2189 0.5479 0.2698  0.0078  -0.3571 1730 PRO A CA  
1553 C C   . PRO A 223 ? 0.7074 3.2209 0.5478 0.2696  0.0078  -0.3553 1730 PRO A C   
1554 O O   . PRO A 223 ? 0.7189 3.2238 0.5473 0.2700  0.0083  -0.3560 1730 PRO A O   
1555 C CB  . PRO A 223 ? 0.7001 3.2201 0.5518 0.2700  0.0148  -0.3558 1730 PRO A CB  
1556 C CG  . PRO A 223 ? 0.7108 3.2228 0.5520 0.2711  0.0171  -0.3574 1730 PRO A CG  
1557 C CD  . PRO A 223 ? 0.7115 3.2218 0.5484 0.2714  0.0108  -0.3605 1730 PRO A CD  
1558 N N   . PRO A 224 ? 0.6728 3.2900 0.4696 0.1661  0.0401  -0.2542 1731 PRO A N   
1559 C CA  . PRO A 224 ? 0.6784 3.2915 0.4695 0.1659  0.0395  -0.2526 1731 PRO A CA  
1560 C C   . PRO A 224 ? 0.6901 3.2954 0.4717 0.1662  0.0450  -0.2511 1731 PRO A C   
1561 O O   . PRO A 224 ? 0.6905 3.2965 0.4748 0.1666  0.0511  -0.2500 1731 PRO A O   
1562 C CB  . PRO A 224 ? 0.6684 3.2892 0.4707 0.1649  0.0397  -0.2502 1731 PRO A CB  
1563 C CG  . PRO A 224 ? 0.6595 3.2873 0.4724 0.1647  0.0421  -0.2504 1731 PRO A CG  
1564 C CD  . PRO A 224 ? 0.6601 3.2868 0.4704 0.1652  0.0397  -0.2535 1731 PRO A CD  
1565 N N   . ILE A 225 ? 0.7792 3.7035 0.4574 0.1115  0.0817  -0.2588 1732 ILE A N   
1566 C CA  . ILE A 225 ? 0.7916 3.7075 0.4593 0.1116  0.0869  -0.2574 1732 ILE A CA  
1567 C C   . ILE A 225 ? 0.7914 3.7081 0.4611 0.1110  0.0890  -0.2542 1732 ILE A C   
1568 O O   . ILE A 225 ? 0.7843 3.7058 0.4599 0.1103  0.0848  -0.2536 1732 ILE A O   
1569 C CB  . ILE A 225 ? 0.8048 3.7101 0.4571 0.1120  0.0839  -0.2592 1732 ILE A CB  
1570 C CG1 . ILE A 225 ? 0.8046 3.7089 0.4545 0.1116  0.0764  -0.2596 1732 ILE A CG1 
1571 C CG2 . ILE A 225 ? 0.8065 3.7101 0.4562 0.1128  0.0834  -0.2621 1732 ILE A CG2 
1572 C CD1 . ILE A 225 ? 0.8194 3.7122 0.4534 0.1116  0.0741  -0.2601 1732 ILE A CD1 
1573 N N   . LEU A 226 ? 0.8845 4.0278 0.4586 -0.0414 0.1407  -0.1581 1733 LEU A N   
1574 C CA  . LEU A 226 ? 0.8844 4.0286 0.4612 -0.0421 0.1437  -0.1550 1733 LEU A CA  
1575 C C   . LEU A 226 ? 0.8985 4.0324 0.4610 -0.0423 0.1448  -0.1539 1733 LEU A C   
1576 O O   . LEU A 226 ? 0.9101 4.0357 0.4617 -0.0419 0.1483  -0.1547 1733 LEU A O   
1577 C CB  . LEU A 226 ? 0.8802 4.0289 0.4663 -0.0421 0.1509  -0.1529 1733 LEU A CB  
1578 C CG  . LEU A 226 ? 0.8774 4.0292 0.4699 -0.0428 0.1541  -0.1494 1733 LEU A CG  
1579 C CD1 . LEU A 226 ? 0.8652 4.0266 0.4735 -0.0432 0.1562  -0.1482 1733 LEU A CD1 
1580 C CD2 . LEU A 226 ? 0.8900 4.0335 0.4735 -0.0428 0.1607  -0.1477 1733 LEU A CD2 
1581 N N   . ASN A 227 ? 1.1417 4.3364 0.4078 -0.1939 0.1254  0.0192  1734 ASN A N   
1582 C CA  . ASN A 227 ? 1.1543 4.3398 0.4080 -0.1942 0.1263  0.0206  1734 ASN A CA  
1583 C C   . ASN A 227 ? 1.1573 4.3421 0.4128 -0.1946 0.1342  0.0236  1734 ASN A C   
1584 O O   . ASN A 227 ? 1.1476 4.3402 0.4151 -0.1949 0.1354  0.0256  1734 ASN A O   
1585 C CB  . ASN A 227 ? 1.1520 4.3383 0.4055 -0.1949 0.1193  0.0209  1734 ASN A CB  
1586 C CG  . ASN A 227 ? 1.1644 4.3417 0.4060 -0.1953 0.1199  0.0228  1734 ASN A CG  
1587 O OD1 . ASN A 227 ? 1.1776 4.3449 0.4052 -0.1952 0.1203  0.0219  1734 ASN A OD1 
1588 N ND2 . ASN A 227 ? 1.1605 4.3411 0.4074 -0.1959 0.1199  0.0253  1734 ASN A ND2 
1589 N N   . PRO A 228 ? 1.3347 4.9722 0.5001 -0.3987 0.2840  -0.0219 1735 PRO A N   
1590 C CA  . PRO A 228 ? 1.3389 4.9748 0.5054 -0.3989 0.2924  -0.0192 1735 PRO A CA  
1591 C C   . PRO A 228 ? 1.3388 4.9752 0.5067 -0.3998 0.2921  -0.0162 1735 PRO A C   
1592 O O   . PRO A 228 ? 1.3349 4.9754 0.5115 -0.4000 0.2973  -0.0137 1735 PRO A O   
1593 C CB  . PRO A 228 ? 1.3556 4.9794 0.5061 -0.3987 0.2969  -0.0201 1735 PRO A CB  
1594 C CG  . PRO A 228 ? 1.3619 4.9796 0.5006 -0.3989 0.2896  -0.0226 1735 PRO A CG  
1595 C CD  . PRO A 228 ? 1.3478 4.9749 0.4975 -0.3984 0.2827  -0.0242 1735 PRO A CD  
1596 N N   . ILE A 229 ? 1.6899 5.0350 0.4591 -0.6046 0.2035  0.2682  1736 ILE A N   
1597 C CA  . ILE A 229 ? 1.6921 5.0359 0.4602 -0.6054 0.2030  0.2709  1736 ILE A CA  
1598 C C   . ILE A 229 ? 1.6770 5.0319 0.4605 -0.6057 0.1996  0.2723  1736 ILE A C   
1599 O O   . ILE A 229 ? 1.6695 5.0310 0.4646 -0.6057 0.2043  0.2741  1736 ILE A O   
1600 C CB  . ILE A 229 ? 1.7039 5.0380 0.4567 -0.6058 0.1977  0.2705  1736 ILE A CB  
1601 C CG1 . ILE A 229 ? 1.7194 5.0419 0.4560 -0.6057 0.2003  0.2689  1736 ILE A CG1 
1602 C CG2 . ILE A 229 ? 1.7082 5.0397 0.4586 -0.6068 0.1987  0.2736  1736 ILE A CG2 
1603 C CD1 . ILE A 229 ? 1.7199 5.0406 0.4519 -0.6051 0.1941  0.2655  1736 ILE A CD1 
1604 N N   . ALA A 230 ? 1.5624 4.5158 0.4593 -0.5333 0.0483  0.4415  1737 ALA A N   
1605 C CA  . ALA A 230 ? 1.5494 4.5122 0.4593 -0.5338 0.0447  0.4426  1737 ALA A CA  
1606 C C   . ALA A 230 ? 1.5360 4.5083 0.4584 -0.5335 0.0428  0.4408  1737 ALA A C   
1607 O O   . ALA A 230 ? 1.5271 4.5050 0.4560 -0.5336 0.0368  0.4399  1737 ALA A O   
1608 C CB  . ALA A 230 ? 1.5511 4.5115 0.4563 -0.5343 0.0375  0.4424  1737 ALA A CB  
1609 N N   . ASN A 231 ? 1.0650 4.2054 0.4363 -0.3179 0.1084  0.2169  1738 ASN A N   
1610 C CA  . ASN A 231 ? 1.0539 4.2023 0.4359 -0.3174 0.1076  0.2152  1738 ASN A CA  
1611 C C   . ASN A 231 ? 1.0451 4.1985 0.4315 -0.3176 0.0997  0.2129  1738 ASN A C   
1612 O O   . ASN A 231 ? 1.0344 4.1956 0.4317 -0.3181 0.0974  0.2136  1738 ASN A O   
1613 C CB  . ASN A 231 ? 1.0455 4.2012 0.4407 -0.3179 0.1124  0.2177  1738 ASN A CB  
1614 C CG  . ASN A 231 ? 1.0508 4.2038 0.4452 -0.3174 0.1202  0.2181  1738 ASN A CG  
1615 O OD1 . ASN A 231 ? 1.0527 4.2041 0.4442 -0.3167 0.1211  0.2159  1738 ASN A OD1 
1616 N ND2 . ASN A 231 ? 1.0530 4.2057 0.4506 -0.3177 0.1261  0.2212  1738 ASN A ND2 
1617 N N   . GLU A 232 ? 0.9562 3.7788 0.3878 -0.1596 0.0089  0.1870  1739 GLU A N   
1618 C CA  . GLU A 232 ? 0.9487 3.7756 0.3844 -0.1595 0.0021  0.1844  1739 GLU A CA  
1619 C C   . GLU A 232 ? 0.9469 3.7749 0.3835 -0.1588 0.0028  0.1819  1739 GLU A C   
1620 O O   . GLU A 232 ? 0.9551 3.7776 0.3846 -0.1581 0.0071  0.1816  1739 GLU A O   
1621 C CB  . GLU A 232 ? 0.9559 3.7764 0.3817 -0.1595 -0.0038 0.1834  1739 GLU A CB  
1622 C CG  . GLU A 232 ? 0.9568 3.7766 0.3824 -0.1601 -0.0057 0.1855  1739 GLU A CG  
1623 C CD  . GLU A 232 ? 0.9664 3.7781 0.3806 -0.1601 -0.0110 0.1846  1739 GLU A CD  
1624 O OE1 . GLU A 232 ? 0.9658 3.7769 0.3785 -0.1597 -0.0164 0.1820  1739 GLU A OE1 
1625 O OE2 . GLU A 232 ? 0.9747 3.7807 0.3817 -0.1606 -0.0099 0.1868  1739 GLU A OE2 
1626 N N   . ILE A 233 ? 0.7618 3.5447 0.3763 -0.0156 0.0197  0.0170  1740 ILE A N   
1627 C CA  . ILE A 233 ? 0.7595 3.5438 0.3753 -0.0151 0.0196  0.0143  1740 ILE A CA  
1628 C C   . ILE A 233 ? 0.7599 3.5425 0.3720 -0.0148 0.0126  0.0115  1740 ILE A C   
1629 O O   . ILE A 233 ? 0.7547 3.5404 0.3709 -0.0153 0.0076  0.0113  1740 ILE A O   
1630 C CB  . ILE A 233 ? 0.7473 3.5410 0.3767 -0.0154 0.0215  0.0148  1740 ILE A CB  
1631 C CG1 . ILE A 233 ? 0.7490 3.5429 0.3809 -0.0153 0.0289  0.0170  1740 ILE A CG1 
1632 C CG2 . ILE A 233 ? 0.7427 3.5392 0.3748 -0.0149 0.0189  0.0118  1740 ILE A CG2 
1633 C CD1 . ILE A 233 ? 0.7483 3.5435 0.3840 -0.0161 0.0318  0.0204  1740 ILE A CD1 
1634 N N   . TYR A 234 ? 0.7579 3.3959 0.3657 0.0568  -0.0115 -0.0480 1741 TYR A N   
1635 C CA  . TYR A 234 ? 0.7588 3.3949 0.3634 0.0573  -0.0181 -0.0507 1741 TYR A CA  
1636 C C   . TYR A 234 ? 0.7531 3.3932 0.3626 0.0577  -0.0185 -0.0533 1741 TYR A C   
1637 O O   . TYR A 234 ? 0.7529 3.3938 0.3638 0.0581  -0.0133 -0.0531 1741 TYR A O   
1638 C CB  . TYR A 234 ? 0.7732 3.3982 0.3627 0.0575  -0.0197 -0.0513 1741 TYR A CB  
1639 C CG  . TYR A 234 ? 0.7810 3.4007 0.3636 0.0571  -0.0185 -0.0487 1741 TYR A CG  
1640 C CD1 . TYR A 234 ? 0.7765 3.3991 0.3637 0.0564  -0.0220 -0.0476 1741 TYR A CD1 
1641 C CD2 . TYR A 234 ? 0.7935 3.4046 0.3646 0.0571  -0.0137 -0.0476 1741 TYR A CD2 
1642 C CE1 . TYR A 234 ? 0.7838 3.4014 0.3647 0.0560  -0.0210 -0.0452 1741 TYR A CE1 
1643 C CE2 . TYR A 234 ? 0.8012 3.4070 0.3656 0.0566  -0.0125 -0.0452 1741 TYR A CE2 
1644 C CZ  . TYR A 234 ? 0.7962 3.4053 0.3655 0.0560  -0.0164 -0.0439 1741 TYR A CZ  
1645 O OH  . TYR A 234 ? 0.8038 3.4077 0.3666 0.0553  -0.0153 -0.0416 1741 TYR A OH  
1646 N N   . LEU A 235 ? 0.6828 3.1879 0.3760 0.1532  -0.0263 -0.1325 1742 LEU A N   
1647 C CA  . LEU A 235 ? 0.6779 3.1863 0.3752 0.1536  -0.0274 -0.1351 1742 LEU A CA  
1648 C C   . LEU A 235 ? 0.6820 3.1862 0.3742 0.1539  -0.0337 -0.1377 1742 LEU A C   
1649 O O   . LEU A 235 ? 0.6798 3.1848 0.3741 0.1536  -0.0390 -0.1381 1742 LEU A O   
1650 C CB  . LEU A 235 ? 0.6640 3.1828 0.3753 0.1528  -0.0275 -0.1351 1742 LEU A CB  
1651 C CG  . LEU A 235 ? 0.6577 3.1810 0.3750 0.1532  -0.0274 -0.1371 1742 LEU A CG  
1652 C CD1 . LEU A 235 ? 0.6637 3.1832 0.3757 0.1538  -0.0226 -0.1372 1742 LEU A CD1 
1653 C CD2 . LEU A 235 ? 0.6456 3.1781 0.3754 0.1521  -0.0263 -0.1363 1742 LEU A CD2 
1654 N N   . ASN A 236 ? 0.7101 3.1322 0.3833 0.1845  -0.0458 -0.1817 1743 ASN A N   
1655 C CA  . ASN A 236 ? 0.7160 3.1326 0.3829 0.1851  -0.0516 -0.1841 1743 ASN A CA  
1656 C C   . ASN A 236 ? 0.7071 3.1296 0.3826 0.1852  -0.0553 -0.1865 1743 ASN A C   
1657 O O   . ASN A 236 ? 0.6998 3.1282 0.3824 0.1852  -0.0522 -0.1870 1743 ASN A O   
1658 C CB  . ASN A 236 ? 0.7292 3.1362 0.3827 0.1855  -0.0494 -0.1845 1743 ASN A CB  
1659 C CG  . ASN A 236 ? 0.7285 3.1370 0.3831 0.1860  -0.0423 -0.1842 1743 ASN A CG  
1660 O OD1 . ASN A 236 ? 0.7175 3.1346 0.3834 0.1859  -0.0401 -0.1841 1743 ASN A OD1 
1661 N ND2 . ASN A 236 ? 0.7406 3.1405 0.3835 0.1862  -0.0386 -0.1838 1743 ASN A ND2 
1662 N N   . PHE A 237 ? 0.6930 2.9768 0.4008 0.1859  -0.0857 -0.1996 1744 PHE A N   
1663 C CA  . PHE A 237 ? 0.6856 2.9742 0.4012 0.1861  -0.0896 -0.2022 1744 PHE A CA  
1664 C C   . PHE A 237 ? 0.6937 2.9752 0.4024 0.1864  -0.0958 -0.2041 1744 PHE A C   
1665 O O   . PHE A 237 ? 0.6956 2.9751 0.4038 0.1862  -0.1009 -0.2040 1744 PHE A O   
1666 C CB  . PHE A 237 ? 0.6742 2.9711 0.4018 0.1852  -0.0917 -0.2020 1744 PHE A CB  
1667 C CG  . PHE A 237 ? 0.6658 2.9698 0.4010 0.1846  -0.0864 -0.2003 1744 PHE A CG  
1668 C CD1 . PHE A 237 ? 0.6578 2.9680 0.4005 0.1845  -0.0837 -0.2011 1744 PHE A CD1 
1669 C CD2 . PHE A 237 ? 0.6660 2.9703 0.4010 0.1841  -0.0842 -0.1977 1744 PHE A CD2 
1670 C CE1 . PHE A 237 ? 0.6504 2.9669 0.4002 0.1838  -0.0793 -0.1993 1744 PHE A CE1 
1671 C CE2 . PHE A 237 ? 0.6585 2.9692 0.4008 0.1835  -0.0797 -0.1959 1744 PHE A CE2 
1672 C CZ  . PHE A 237 ? 0.6508 2.9675 0.4005 0.1833  -0.0773 -0.1967 1744 PHE A CZ  
1673 N N   . GLU A 238 ? 0.7537 3.0165 0.4278 0.1931  -0.1218 -0.2517 1745 GLU A N   
1674 C CA  . GLU A 238 ? 0.7627 3.0178 0.4291 0.1934  -0.1277 -0.2533 1745 GLU A CA  
1675 C C   . GLU A 238 ? 0.7556 3.0151 0.4312 0.1935  -0.1335 -0.2556 1745 GLU A C   
1676 O O   . GLU A 238 ? 0.7466 3.0126 0.4322 0.1931  -0.1351 -0.2554 1745 GLU A O   
1677 C CB  . GLU A 238 ? 0.7722 3.0204 0.4281 0.1941  -0.1251 -0.2542 1745 GLU A CB  
1678 C CG  . GLU A 238 ? 0.7652 3.0193 0.4270 0.1943  -0.1195 -0.2547 1745 GLU A CG  
1679 C CD  . GLU A 238 ? 0.7756 3.0224 0.4263 0.1949  -0.1154 -0.2549 1745 GLU A CD  
1680 O OE1 . GLU A 238 ? 0.7861 3.0254 0.4259 0.1947  -0.1130 -0.2533 1745 GLU A OE1 
1681 O OE2 . GLU A 238 ? 0.7736 3.0219 0.4262 0.1953  -0.1141 -0.2565 1745 GLU A OE2 
1682 N N   . SER A 239 ? 0.7754 2.9951 0.4782 0.1446  -0.1712 -0.2987 1746 SER A N   
1683 C CA  . SER A 239 ? 0.7702 2.9928 0.4811 0.1447  -0.1772 -0.3009 1746 SER A CA  
1684 C C   . SER A 239 ? 0.7718 2.9928 0.4817 0.1453  -0.1787 -0.3032 1746 SER A C   
1685 O O   . SER A 239 ? 0.7775 2.9947 0.4797 0.1456  -0.1752 -0.3032 1746 SER A O   
1686 C CB  . SER A 239 ? 0.7769 2.9937 0.4842 0.1444  -0.1840 -0.3007 1746 SER A CB  
1687 O OG  . SER A 239 ? 0.7711 2.9914 0.4880 0.1445  -0.1895 -0.3025 1746 SER A OG  
1688 N N   . SER A 240 ? 0.8450 3.0471 0.5465 0.0741  -0.2234 -0.3513 1747 SER A N   
1689 C CA  . SER A 240 ? 0.8467 3.0470 0.5481 0.0746  -0.2264 -0.3535 1747 SER A CA  
1690 C C   . SER A 240 ? 0.8503 3.0468 0.5530 0.0746  -0.2345 -0.3549 1747 SER A C   
1691 O O   . SER A 240 ? 0.8518 3.0465 0.5554 0.0750  -0.2381 -0.3567 1747 SER A O   
1692 C CB  . SER A 240 ? 0.8343 3.0442 0.5475 0.0746  -0.2233 -0.3549 1747 SER A CB  
1693 O OG  . SER A 240 ? 0.8361 3.0441 0.5488 0.0751  -0.2257 -0.3571 1747 SER A OG  
1694 N N   . THR A 241 ? 0.8116 3.2175 0.5933 0.1002  -0.2707 -0.3688 1748 THR A N   
1695 C CA  . THR A 241 ? 0.8151 3.2174 0.5989 0.1001  -0.2786 -0.3697 1748 THR A CA  
1696 C C   . THR A 241 ? 0.8268 3.2200 0.5996 0.0998  -0.2818 -0.3677 1748 THR A C   
1697 O O   . THR A 241 ? 0.8269 3.2207 0.5968 0.0995  -0.2779 -0.3657 1748 THR A O   
1698 C CB  . THR A 241 ? 0.8029 3.2141 0.6025 0.0998  -0.2802 -0.3704 1748 THR A CB  
1699 O OG1 . THR A 241 ? 0.7959 3.2131 0.5994 0.0995  -0.2752 -0.3688 1748 THR A OG1 
1700 C CG2 . THR A 241 ? 0.7941 3.2119 0.6038 0.1001  -0.2799 -0.3727 1748 THR A CG2 
1701 N N   . PRO A 242 ? 0.8823 3.3415 0.6084 0.2118  -0.3285 -0.3743 1749 PRO A N   
1702 C CA  . PRO A 242 ? 0.8961 3.3446 0.6088 0.2115  -0.3318 -0.3727 1749 PRO A CA  
1703 C C   . PRO A 242 ? 0.8950 3.3441 0.6120 0.2109  -0.3352 -0.3713 1749 PRO A C   
1704 O O   . PRO A 242 ? 0.8849 3.3413 0.6158 0.2109  -0.3371 -0.3720 1749 PRO A O   
1705 C CB  . PRO A 242 ? 0.9060 3.3461 0.6127 0.2116  -0.3386 -0.3741 1749 PRO A CB  
1706 C CG  . PRO A 242 ? 0.8954 3.3430 0.6170 0.2119  -0.3416 -0.3763 1749 PRO A CG  
1707 C CD  . PRO A 242 ? 0.8815 3.3405 0.6132 0.2122  -0.3341 -0.3767 1749 PRO A CD  
1708 N N   . CYS A 243 ? 0.8692 3.3595 0.6063 0.3264  -0.3291 -0.3562 1750 CYS A N   
1709 C CA  . CYS A 243 ? 0.8702 3.3596 0.6093 0.3258  -0.3325 -0.3546 1750 CYS A CA  
1710 C C   . CYS A 243 ? 0.8781 3.3603 0.6162 0.3255  -0.3422 -0.3551 1750 CYS A C   
1711 O O   . CYS A 243 ? 0.8825 3.3608 0.6187 0.3258  -0.3461 -0.3567 1750 CYS A O   
1712 C CB  . CYS A 243 ? 0.8788 3.3623 0.6049 0.3253  -0.3285 -0.3521 1750 CYS A CB  
1713 S SG  . CYS A 243 ? 0.8763 3.3618 0.6069 0.3246  -0.3298 -0.3497 1750 CYS A SG  
1714 N N   . LEU A 244 ? 0.9122 3.5690 0.7360 0.4241  -0.4074 -0.4052 1751 LEU A N   
1715 C CA  . LEU A 244 ? 0.9199 3.5698 0.7435 0.4237  -0.4169 -0.4052 1751 LEU A CA  
1716 C C   . LEU A 244 ? 0.9375 3.5738 0.7429 0.4230  -0.4203 -0.4034 1751 LEU A C   
1717 O O   . LEU A 244 ? 0.9439 3.5747 0.7482 0.4223  -0.4271 -0.4023 1751 LEU A O   
1718 C CB  . LEU A 244 ? 0.9111 3.5673 0.7493 0.4237  -0.4201 -0.4052 1751 LEU A CB  
1719 C CG  . LEU A 244 ? 0.8955 3.5635 0.7524 0.4244  -0.4187 -0.4072 1751 LEU A CG  
1720 C CD1 . LEU A 244 ? 0.8877 3.5615 0.7567 0.4241  -0.4199 -0.4068 1751 LEU A CD1 
1721 C CD2 . LEU A 244 ? 0.8962 3.5628 0.7586 0.4246  -0.4248 -0.4095 1751 LEU A CD2 
1722 N N   . ALA A 245 ? 1.0716 3.5903 0.6809 0.5113  -0.4600 -0.3797 1752 ALA A N   
1723 C CA  . ALA A 245 ? 1.0894 3.5945 0.6796 0.5103  -0.4621 -0.3781 1752 ALA A CA  
1724 C C   . ALA A 245 ? 1.0975 3.5968 0.6749 0.5105  -0.4584 -0.3790 1752 ALA A C   
1725 O O   . ALA A 245 ? 1.1133 3.6005 0.6734 0.5097  -0.4595 -0.3779 1752 ALA A O   
1726 C CB  . ALA A 245 ? 1.0916 3.5958 0.6762 0.5098  -0.4578 -0.3754 1752 ALA A CB  
1727 N N   . ASP A 246 ? 1.1692 3.5434 0.6535 0.4289  -0.4693 -0.4320 1753 ASP A N   
1728 C CA  . ASP A 246 ? 1.1748 3.5451 0.6496 0.4291  -0.4654 -0.4332 1753 ASP A CA  
1729 C C   . ASP A 246 ? 1.1642 3.5422 0.6513 0.4300  -0.4661 -0.4359 1753 ASP A C   
1730 O O   . ASP A 246 ? 1.1678 3.5431 0.6491 0.4304  -0.4639 -0.4372 1753 ASP A O   
1731 C CB  . ASP A 246 ? 1.1737 3.5461 0.6427 0.4293  -0.4553 -0.4320 1753 ASP A CB  
1732 N N   . ASN A 250 ? 0.9716 3.2529 0.5229 0.2897  -0.2854 -0.3235 1757 ASN A N   
1733 C CA  . ASN A 250 ? 0.9570 3.2501 0.5202 0.2901  -0.2788 -0.3235 1757 ASN A CA  
1734 C C   . ASN A 250 ? 0.9511 3.2492 0.5195 0.2897  -0.2763 -0.3213 1757 ASN A C   
1735 O O   . ASN A 250 ? 0.9597 3.2517 0.5183 0.2892  -0.2750 -0.3194 1757 ASN A O   
1736 C CB  . ASN A 250 ? 0.9587 3.2514 0.5160 0.2904  -0.2712 -0.3235 1757 ASN A CB  
1737 C CG  . ASN A 250 ? 0.9513 3.2495 0.5161 0.2910  -0.2707 -0.3260 1757 ASN A CG  
1738 O OD1 . ASN A 250 ? 0.9375 3.2463 0.5161 0.2912  -0.2691 -0.3265 1757 ASN A OD1 
1739 N ND2 . ASN A 250 ? 0.9608 3.2514 0.5162 0.2913  -0.2723 -0.3273 1757 ASN A ND2 
1740 N N   . TYR A 251 ? 0.7998 3.1770 0.4843 0.2197  -0.2188 -0.2536 1758 TYR A N   
1741 C CA  . TYR A 251 ? 0.7925 3.1756 0.4836 0.2193  -0.2163 -0.2518 1758 TYR A CA  
1742 C C   . TYR A 251 ? 0.7908 3.1764 0.4790 0.2193  -0.2080 -0.2500 1758 TYR A C   
1743 O O   . TYR A 251 ? 0.7917 3.1771 0.4766 0.2196  -0.2036 -0.2506 1758 TYR A O   
1744 C CB  . TYR A 251 ? 0.7780 3.1718 0.4859 0.2194  -0.2176 -0.2531 1758 TYR A CB  
1745 C CG  . TYR A 251 ? 0.7774 3.1708 0.4913 0.2192  -0.2248 -0.2535 1758 TYR A CG  
1746 C CD1 . TYR A 251 ? 0.7783 3.1710 0.4923 0.2186  -0.2258 -0.2517 1758 TYR A CD1 
1747 C CD2 . TYR A 251 ? 0.7757 3.1694 0.4958 0.2195  -0.2303 -0.2558 1758 TYR A CD2 
1748 C CE1 . TYR A 251 ? 0.7777 3.1700 0.4979 0.2185  -0.2324 -0.2520 1758 TYR A CE1 
1749 C CE2 . TYR A 251 ? 0.7750 3.1685 0.5018 0.2193  -0.2369 -0.2561 1758 TYR A CE2 
1750 C CZ  . TYR A 251 ? 0.7761 3.1688 0.5028 0.2187  -0.2379 -0.2542 1758 TYR A CZ  
1751 O OH  . TYR A 251 ? 0.7755 3.1679 0.5093 0.2186  -0.2442 -0.2547 1758 TYR A OH  
1752 N N   . THR A 252 ? 0.7670 3.1232 0.4285 0.2259  -0.1661 -0.1631 1759 THR A N   
1753 C CA  . THR A 252 ? 0.7645 3.1238 0.4251 0.2257  -0.1582 -0.1612 1759 THR A CA  
1754 C C   . THR A 252 ? 0.7561 3.1220 0.4253 0.2252  -0.1570 -0.1595 1759 THR A C   
1755 O O   . THR A 252 ? 0.7565 3.1215 0.4277 0.2249  -0.1618 -0.1591 1759 THR A O   
1756 C CB  . THR A 252 ? 0.7786 3.1278 0.4233 0.2257  -0.1552 -0.1597 1759 THR A CB  
1757 O OG1 . THR A 252 ? 0.7754 3.1282 0.4210 0.2256  -0.1474 -0.1578 1759 THR A OG1 
1758 C CG2 . THR A 252 ? 0.7894 3.1300 0.4250 0.2251  -0.1598 -0.1582 1759 THR A CG2 
1759 N N   . SER A 253 ? 0.7218 3.0397 0.4046 0.1835  -0.1297 -0.0850 1760 SER A N   
1760 C CA  . SER A 253 ? 0.7139 3.0382 0.4045 0.1827  -0.1277 -0.0833 1760 SER A CA  
1761 C C   . SER A 253 ? 0.7137 3.0393 0.4022 0.1826  -0.1202 -0.0811 1760 SER A C   
1762 O O   . SER A 253 ? 0.7104 3.0390 0.4009 0.1828  -0.1159 -0.0815 1760 SER A O   
1763 C CB  . SER A 253 ? 0.7004 3.0344 0.4054 0.1826  -0.1289 -0.0847 1760 SER A CB  
1764 O OG  . SER A 253 ? 0.6932 3.0330 0.4053 0.1819  -0.1270 -0.0830 1760 SER A OG  
1765 N N   . LEU A 254 ? 0.7339 3.0930 0.3809 0.1556  -0.1083 -0.0324 1761 LEU A N   
1766 C CA  . LEU A 254 ? 0.7341 3.0942 0.3796 0.1554  -0.1013 -0.0300 1761 LEU A CA  
1767 C C   . LEU A 254 ? 0.7248 3.0922 0.3800 0.1547  -0.1001 -0.0283 1761 LEU A C   
1768 O O   . LEU A 254 ? 0.7237 3.0913 0.3812 0.1544  -0.1044 -0.0281 1761 LEU A O   
1769 C CB  . LEU A 254 ? 0.7482 3.0981 0.3795 0.1554  -0.0996 -0.0284 1761 LEU A CB  
1770 C CG  . LEU A 254 ? 0.7580 3.1008 0.3787 0.1561  -0.0974 -0.0294 1761 LEU A CG  
1771 C CD1 . LEU A 254 ? 0.7735 3.1044 0.3791 0.1559  -0.0996 -0.0287 1761 LEU A CD1 
1772 C CD2 . LEU A 254 ? 0.7565 3.1017 0.3781 0.1562  -0.0891 -0.0282 1761 LEU A CD2 
1773 N N   . ILE A 255 ? 0.7256 3.0294 0.3817 0.1115  -0.0956 0.0240  1762 ILE A N   
1774 C CA  . ILE A 255 ? 0.7170 3.0276 0.3821 0.1108  -0.0939 0.0258  1762 ILE A CA  
1775 C C   . ILE A 255 ? 0.7213 3.0299 0.3824 0.1106  -0.0882 0.0287  1762 ILE A C   
1776 O O   . ILE A 255 ? 0.7236 3.0312 0.3823 0.1108  -0.0830 0.0293  1762 ILE A O   
1777 C CB  . ILE A 255 ? 0.7044 3.0244 0.3817 0.1105  -0.0927 0.0248  1762 ILE A CB  
1778 C CG1 . ILE A 255 ? 0.7003 3.0223 0.3820 0.1106  -0.0982 0.0217  1762 ILE A CG1 
1779 C CG2 . ILE A 255 ? 0.6965 3.0227 0.3822 0.1094  -0.0912 0.0266  1762 ILE A CG2 
1780 C CD1 . ILE A 255 ? 0.6891 3.0194 0.3815 0.1102  -0.0973 0.0205  1762 ILE A CD1 
1781 N N   . ALA A 256 ? 0.7938 3.2087 0.3891 0.0144  -0.1059 0.1164  1763 ALA A N   
1782 C CA  . ALA A 256 ? 0.7975 3.2107 0.3899 0.0142  -0.1009 0.1194  1763 ALA A CA  
1783 C C   . ALA A 256 ? 0.7868 3.2084 0.3907 0.0132  -0.0988 0.1211  1763 ALA A C   
1784 O O   . ALA A 256 ? 0.7790 3.2057 0.3906 0.0127  -0.1024 0.1203  1763 ALA A O   
1785 C CB  . ALA A 256 ? 0.8076 3.2131 0.3904 0.0140  -0.1032 0.1208  1763 ALA A CB  
1786 N N   . PHE A 257 ? 0.7665 3.2095 0.3847 -0.0439 -0.0676 0.1597  1764 PHE A N   
1787 C CA  . PHE A 257 ? 0.7569 3.2075 0.3859 -0.0447 -0.0653 0.1615  1764 PHE A CA  
1788 C C   . PHE A 257 ? 0.7602 3.2092 0.3879 -0.0452 -0.0623 0.1648  1764 PHE A C   
1789 O O   . PHE A 257 ? 0.7694 3.2122 0.3889 -0.0449 -0.0586 0.1661  1764 PHE A O   
1790 C CB  . PHE A 257 ? 0.7514 3.2067 0.3866 -0.0447 -0.0610 0.1614  1764 PHE A CB  
1791 C CG  . PHE A 257 ? 0.7453 3.2044 0.3849 -0.0445 -0.0640 0.1583  1764 PHE A CG  
1792 C CD1 . PHE A 257 ? 0.7348 3.2011 0.3845 -0.0454 -0.0665 0.1578  1764 PHE A CD1 
1793 C CD2 . PHE A 257 ? 0.7506 3.2055 0.3838 -0.0436 -0.0644 0.1562  1764 PHE A CD2 
1794 C CE1 . PHE A 257 ? 0.7295 3.1991 0.3832 -0.0452 -0.0689 0.1550  1764 PHE A CE1 
1795 C CE2 . PHE A 257 ? 0.7449 3.2033 0.3825 -0.0434 -0.0671 0.1536  1764 PHE A CE2 
1796 C CZ  . PHE A 257 ? 0.7343 3.2002 0.3822 -0.0443 -0.0693 0.1529  1764 PHE A CZ  
1797 N N   . HIS A 258 ? 0.8357 3.2783 0.4332 -0.1579 -0.0798 0.3122  1765 HIS A N   
1798 C CA  . HIS A 258 ? 0.8369 3.2793 0.4353 -0.1585 -0.0772 0.3154  1765 HIS A CA  
1799 C C   . HIS A 258 ? 0.8280 3.2777 0.4374 -0.1592 -0.0737 0.3172  1765 HIS A C   
1800 O O   . HIS A 258 ? 0.8208 3.2756 0.4368 -0.1595 -0.0740 0.3158  1765 HIS A O   
1801 C CB  . HIS A 258 ? 0.8364 3.2785 0.4350 -0.1589 -0.0820 0.3158  1765 HIS A CB  
1802 C CG  . HIS A 258 ? 0.8465 3.2806 0.4342 -0.1583 -0.0851 0.3151  1765 HIS A CG  
1803 N ND1 . HIS A 258 ? 0.8459 3.2793 0.4333 -0.1585 -0.0913 0.3134  1765 HIS A ND1 
1804 C CD2 . HIS A 258 ? 0.8581 3.2840 0.4344 -0.1579 -0.0829 0.3158  1765 HIS A CD2 
1805 C CE1 . HIS A 258 ? 0.8564 3.2817 0.4332 -0.1580 -0.0931 0.3133  1765 HIS A CE1 
1806 N NE2 . HIS A 258 ? 0.8642 3.2847 0.4336 -0.1577 -0.0882 0.3147  1765 HIS A NE2 
1807 N N   . CYS A 259 ? 0.8065 3.2218 0.4501 -0.2205 -0.0384 0.3458  1766 CYS A N   
1808 C CA  . CYS A 259 ? 0.7983 3.2202 0.4526 -0.2214 -0.0359 0.3477  1766 CYS A CA  
1809 C C   . CYS A 259 ? 0.7932 3.2183 0.4525 -0.2224 -0.0397 0.3486  1766 CYS A C   
1810 O O   . CYS A 259 ? 0.7973 3.2197 0.4539 -0.2228 -0.0392 0.3508  1766 CYS A O   
1811 C CB  . CYS A 259 ? 0.8026 3.2227 0.4567 -0.2213 -0.0296 0.3508  1766 CYS A CB  
1812 S SG  . CYS A 259 ? 0.7936 3.2211 0.4610 -0.2228 -0.0272 0.3540  1766 CYS A SG  
1813 N N   . LYS A 260 ? 0.7655 2.9338 0.5454 -0.2222 -0.0571 0.3991  1767 LYS A N   
1814 C CA  . LYS A 260 ? 0.7602 2.9317 0.5455 -0.2232 -0.0604 0.3995  1767 LYS A CA  
1815 C C   . LYS A 260 ? 0.7512 2.9295 0.5468 -0.2246 -0.0597 0.4004  1767 LYS A C   
1816 O O   . LYS A 260 ? 0.7455 2.9273 0.5451 -0.2249 -0.0615 0.3982  1767 LYS A O   
1817 C CB  . LYS A 260 ? 0.7595 2.9303 0.5427 -0.2231 -0.0661 0.3966  1767 LYS A CB  
1818 C CG  . LYS A 260 ? 0.7558 2.9287 0.5432 -0.2240 -0.0693 0.3971  1767 LYS A CG  
1819 C CD  . LYS A 260 ? 0.7567 2.9277 0.5415 -0.2238 -0.0744 0.3943  1767 LYS A CD  
1820 C CE  . LYS A 260 ? 0.7543 2.9265 0.5426 -0.2247 -0.0772 0.3950  1767 LYS A CE  
1821 N NZ  . LYS A 260 ? 0.7558 2.9259 0.5420 -0.2241 -0.0821 0.3923  1767 LYS A NZ  
1822 N N   . ARG A 261 ? 0.6832 2.8010 0.5338 -0.2307 -0.0116 0.3140  1768 ARG A N   
1823 C CA  . ARG A 261 ? 0.6756 2.7991 0.5358 -0.2321 -0.0110 0.3152  1768 ARG A CA  
1824 C C   . ARG A 261 ? 0.6700 2.7966 0.5344 -0.2335 -0.0155 0.3143  1768 ARG A C   
1825 O O   . ARG A 261 ? 0.6722 2.7968 0.5340 -0.2336 -0.0176 0.3147  1768 ARG A O   
1826 C CB  . ARG A 261 ? 0.6770 2.8007 0.5407 -0.2326 -0.0070 0.3192  1768 ARG A CB  
1827 C CG  . ARG A 261 ? 0.6817 2.8031 0.5432 -0.2314 -0.0017 0.3201  1768 ARG A CG  
1828 C CD  . ARG A 261 ? 0.6826 2.8046 0.5489 -0.2319 0.0024  0.3240  1768 ARG A CD  
1829 N NE  . ARG A 261 ? 0.6838 2.8059 0.5525 -0.2313 0.0073  0.3249  1768 ARG A NE  
1830 C CZ  . ARG A 261 ? 0.6915 2.8089 0.5546 -0.2301 0.0120  0.3258  1768 ARG A CZ  
1831 N NH1 . ARG A 261 ? 0.6990 2.8110 0.5534 -0.2294 0.0122  0.3260  1768 ARG A NH1 
1832 N NH2 . ARG A 261 ? 0.6920 2.8100 0.5584 -0.2298 0.0164  0.3264  1768 ARG A NH2 
1833 N N   . GLY A 262 ? 0.6493 2.5819 0.5931 -0.2347 0.0003  0.2730  1769 GLY A N   
1834 C CA  . GLY A 262 ? 0.6443 2.5795 0.5919 -0.2363 -0.0034 0.2721  1769 GLY A CA  
1835 C C   . GLY A 262 ? 0.6383 2.5773 0.5905 -0.2372 -0.0048 0.2700  1769 GLY A C   
1836 O O   . GLY A 262 ? 0.6374 2.5775 0.5905 -0.2370 -0.0028 0.2696  1769 GLY A O   
1837 N N   . VAL A 263 ? 0.5999 2.4002 0.5563 -0.2211 -0.0108 0.1878  1770 VAL A N   
1838 C CA  . VAL A 263 ? 0.5947 2.3981 0.5548 -0.2223 -0.0122 0.1856  1770 VAL A CA  
1839 C C   . VAL A 263 ? 0.5952 2.3979 0.5520 -0.2211 -0.0131 0.1821  1770 VAL A C   
1840 O O   . VAL A 263 ? 0.5926 2.3972 0.5515 -0.2213 -0.0122 0.1811  1770 VAL A O   
1841 C CB  . VAL A 263 ? 0.5913 2.3962 0.5546 -0.2242 -0.0152 0.1849  1770 VAL A CB  
1842 C CG1 . VAL A 263 ? 0.5891 2.3959 0.5574 -0.2261 -0.0144 0.1881  1770 VAL A CG1 
1843 C CG2 . VAL A 263 ? 0.5942 2.3964 0.5540 -0.2234 -0.0173 0.1840  1770 VAL A CG2 
1844 N N   . SER A 264 ? 0.5887 2.4158 0.5204 -0.1887 -0.0430 0.2247  1771 SER A N   
1845 C CA  . SER A 264 ? 0.5899 2.4157 0.5184 -0.1873 -0.0443 0.2214  1771 SER A CA  
1846 C C   . SER A 264 ? 0.5932 2.4174 0.5182 -0.1860 -0.0416 0.2219  1771 SER A C   
1847 O O   . SER A 264 ? 0.5972 2.4193 0.5197 -0.1852 -0.0390 0.2243  1771 SER A O   
1848 C CB  . SER A 264 ? 0.5936 2.4161 0.5179 -0.1863 -0.0472 0.2198  1771 SER A CB  
1849 O OG  . SER A 264 ? 0.5965 2.4167 0.5166 -0.1847 -0.0480 0.2175  1771 SER A OG  
1850 N N   . MET A 265 ? 0.5824 2.5056 0.4155 -0.1922 -0.0518 0.1572  1772 MET A N   
1851 C CA  . MET A 265 ? 0.5859 2.5072 0.4153 -0.1906 -0.0496 0.1571  1772 MET A CA  
1852 C C   . MET A 265 ? 0.5919 2.5085 0.4140 -0.1888 -0.0513 0.1552  1772 MET A C   
1853 O O   . MET A 265 ? 0.5962 2.5100 0.4136 -0.1876 -0.0498 0.1548  1772 MET A O   
1854 C CB  . MET A 265 ? 0.5815 2.5060 0.4146 -0.1912 -0.0489 0.1557  1772 MET A CB  
1855 C CG  . MET A 265 ? 0.5781 2.5057 0.4167 -0.1924 -0.0461 0.1583  1772 MET A CG  
1856 S SD  . MET A 265 ? 0.5825 2.5083 0.4192 -0.1912 -0.0414 0.1608  1772 MET A SD  
1857 C CE  . MET A 265 ? 0.5812 2.5079 0.4178 -0.1904 -0.0410 0.1582  1772 MET A CE  
1858 N N   . GLY A 266 ? 0.6320 2.5227 0.4520 -0.1483 -0.0615 0.1809  1773 GLY A N   
1859 C CA  . GLY A 266 ? 0.6378 2.5238 0.4515 -0.1467 -0.0640 0.1793  1773 GLY A CA  
1860 C C   . GLY A 266 ? 0.6367 2.5229 0.4503 -0.1462 -0.0663 0.1758  1773 GLY A C   
1861 O O   . GLY A 266 ? 0.6318 2.5215 0.4497 -0.1467 -0.0656 0.1747  1773 GLY A O   
1862 N N   . THR A 267 ? 0.6183 2.5060 0.4417 -0.0918 -0.0771 0.1096  1774 THR A N   
1863 C CA  . THR A 267 ? 0.6182 2.5053 0.4414 -0.0912 -0.0798 0.1063  1774 THR A CA  
1864 C C   . THR A 267 ? 0.6268 2.5074 0.4417 -0.0896 -0.0820 0.1058  1774 THR A C   
1865 O O   . THR A 267 ? 0.6313 2.5085 0.4428 -0.0895 -0.0834 0.1071  1774 THR A O   
1866 C CB  . THR A 267 ? 0.6125 2.5029 0.4425 -0.0922 -0.0829 0.1040  1774 THR A CB  
1867 O OG1 . THR A 267 ? 0.6128 2.5023 0.4428 -0.0913 -0.0855 0.1010  1774 THR A OG1 
1868 C CG2 . THR A 267 ? 0.6142 2.5029 0.4443 -0.0923 -0.0852 0.1048  1774 THR A CG2 
1869 N N   . PRO A 268 ? 0.6471 2.6426 0.4334 -0.0211 -0.1058 0.0852  1775 PRO A N   
1870 C CA  . PRO A 268 ? 0.6561 2.6448 0.4337 -0.0198 -0.1080 0.0848  1775 PRO A CA  
1871 C C   . PRO A 268 ? 0.6584 2.6445 0.4358 -0.0197 -0.1132 0.0835  1775 PRO A C   
1872 O O   . PRO A 268 ? 0.6547 2.6428 0.4371 -0.0197 -0.1163 0.0810  1775 PRO A O   
1873 C CB  . PRO A 268 ? 0.6565 2.6449 0.4327 -0.0192 -0.1076 0.0828  1775 PRO A CB  
1874 C CG  . PRO A 268 ? 0.6470 2.6422 0.4325 -0.0200 -0.1071 0.0815  1775 PRO A CG  
1875 C CD  . PRO A 268 ? 0.6421 2.6414 0.4324 -0.0214 -0.1045 0.0837  1775 PRO A CD  
1876 N N   . LYS A 269 ? 0.7777 2.6613 0.5165 0.0201  -0.1398 0.1015  1776 LYS A N   
1877 C CA  . LYS A 269 ? 0.7809 2.6614 0.5191 0.0205  -0.1449 0.1008  1776 LYS A CA  
1878 C C   . LYS A 269 ? 0.7913 2.6639 0.5196 0.0215  -0.1475 0.1005  1776 LYS A C   
1879 O O   . LYS A 269 ? 0.7973 2.6660 0.5177 0.0219  -0.1447 0.1018  1776 LYS A O   
1880 C CB  . LYS A 269 ? 0.7808 2.6614 0.5201 0.0197  -0.1448 0.1031  1776 LYS A CB  
1881 C CG  . LYS A 269 ? 0.7713 2.6591 0.5199 0.0185  -0.1425 0.1035  1776 LYS A CG  
1882 C CD  . LYS A 269 ? 0.7661 2.6568 0.5224 0.0179  -0.1463 0.1011  1776 LYS A CD  
1883 C CE  . LYS A 269 ? 0.7584 2.6548 0.5223 0.0165  -0.1441 0.1018  1776 LYS A CE  
1884 N NZ  . LYS A 269 ? 0.7541 2.6528 0.5253 0.0160  -0.1473 0.0996  1776 LYS A NZ  
1885 N N   . LEU A 270 ? 0.8327 2.7672 0.5584 0.1234  -0.1911 0.0777  1777 LEU A N   
1886 C CA  . LEU A 270 ? 0.8430 2.7695 0.5595 0.1243  -0.1948 0.0775  1777 LEU A CA  
1887 C C   . LEU A 270 ? 0.8509 2.7715 0.5607 0.1242  -0.1965 0.0798  1777 LEU A C   
1888 O O   . LEU A 270 ? 0.8476 2.7704 0.5627 0.1237  -0.1981 0.0803  1777 LEU A O   
1889 C CB  . LEU A 270 ? 0.8415 2.7681 0.5629 0.1247  -0.2002 0.0746  1777 LEU A CB  
1890 C CG  . LEU A 270 ? 0.8514 2.7700 0.5657 0.1254  -0.2058 0.0738  1777 LEU A CG  
1891 C CD1 . LEU A 270 ? 0.8583 2.7720 0.5633 0.1260  -0.2047 0.0736  1777 LEU A CD1 
1892 C CD2 . LEU A 270 ? 0.8474 2.7679 0.5705 0.1254  -0.2111 0.0712  1777 LEU A CD2 
1893 N N   . LEU A 271 ? 1.0299 2.9225 0.5940 0.1377  -0.2337 0.1833  1778 LEU A N   
1894 C CA  . LEU A 271 ? 1.0385 2.9248 0.5950 0.1376  -0.2353 0.1855  1778 LEU A CA  
1895 C C   . LEU A 271 ? 1.0500 2.9271 0.5970 0.1378  -0.2407 0.1852  1778 LEU A C   
1896 O O   . LEU A 271 ? 1.0541 2.9276 0.6000 0.1377  -0.2452 0.1859  1778 LEU A O   
1897 C CB  . LEU A 271 ? 1.0417 2.9267 0.5923 0.1372  -0.2291 0.1885  1778 LEU A CB  
1898 C CG  . LEU A 271 ? 1.0458 2.9280 0.5935 0.1367  -0.2294 0.1912  1778 LEU A CG  
1899 C CD1 . LEU A 271 ? 1.0408 2.9278 0.5918 0.1361  -0.2232 0.1934  1778 LEU A CD1 
1900 C CD2 . LEU A 271 ? 1.0601 2.9317 0.5938 0.1368  -0.2313 0.1924  1778 LEU A CD2 
1901 N N   . ARG A 272 ? 1.0543 3.0871 0.5964 0.2418  -0.2739 0.1362  1779 ARG A N   
1902 C CA  . ARG A 272 ? 1.0660 3.0894 0.5982 0.2421  -0.2793 0.1358  1779 ARG A CA  
1903 C C   . ARG A 272 ? 1.0647 3.0883 0.5994 0.2426  -0.2825 0.1327  1779 ARG A C   
1904 O O   . ARG A 272 ? 1.0614 3.0879 0.5967 0.2431  -0.2788 0.1316  1779 ARG A O   
1905 C CB  . ARG A 272 ? 1.0787 3.0932 0.5959 0.2418  -0.2763 0.1377  1779 ARG A CB  
1906 C CG  . ARG A 272 ? 1.0833 3.0948 0.5960 0.2413  -0.2750 0.1407  1779 ARG A CG  
1907 C CD  . ARG A 272 ? 1.0987 3.0991 0.5950 0.2409  -0.2741 0.1423  1779 ARG A CD  
1908 N NE  . ARG A 272 ? 1.1024 3.1008 0.5945 0.2402  -0.2711 0.1455  1779 ARG A NE  
1909 C CZ  . ARG A 272 ? 1.1065 3.1014 0.5970 0.2397  -0.2752 0.1468  1779 ARG A CZ  
1910 N NH1 . ARG A 272 ? 1.1074 3.1005 0.6005 0.2397  -0.2829 0.1456  1779 ARG A NH1 
1911 N NH2 . ARG A 272 ? 1.1097 3.1030 0.5965 0.2391  -0.2718 0.1498  1779 ARG A NH2 
1912 N N   . THR A 273 ? 0.9839 3.1008 0.6211 0.3240  -0.2921 -0.0120 1780 THR A N   
1913 C CA  . THR A 273 ? 0.9828 3.0998 0.6234 0.3246  -0.2960 -0.0148 1780 THR A CA  
1914 C C   . THR A 273 ? 0.9969 3.1028 0.6245 0.3248  -0.3005 -0.0148 1780 THR A C   
1915 O O   . THR A 273 ? 1.0003 3.1027 0.6293 0.3248  -0.3075 -0.0160 1780 THR A O   
1916 C CB  . THR A 273 ? 0.9749 3.0969 0.6288 0.3246  -0.3012 -0.0164 1780 THR A CB  
1917 O OG1 . THR A 273 ? 0.9801 3.0978 0.6325 0.3242  -0.3057 -0.0149 1780 THR A OG1 
1918 C CG2 . THR A 273 ? 0.9610 3.0938 0.6276 0.3244  -0.2967 -0.0172 1780 THR A CG2 
1919 N N   . SER A 274 ? 1.0341 3.2639 0.5829 0.3695  -0.3163 0.0000  1781 SER A N   
1920 C CA  . SER A 274 ? 1.0486 3.2671 0.5833 0.3693  -0.3197 -0.0001 1781 SER A CA  
1921 C C   . SER A 274 ? 1.0473 3.2659 0.5858 0.3700  -0.3242 -0.0030 1781 SER A C   
1922 O O   . SER A 274 ? 1.0378 3.2638 0.5844 0.3705  -0.3212 -0.0048 1781 SER A O   
1923 C CB  . SER A 274 ? 1.0559 3.2699 0.5784 0.3693  -0.3129 0.0010  1781 SER A CB  
1924 O OG  . SER A 274 ? 1.0707 3.2732 0.5786 0.3691  -0.3158 0.0008  1781 SER A OG  
1925 N N   . GLU A 275 ? 1.0114 3.3661 0.6341 0.4329  -0.3585 -0.1376 1782 GLU A N   
1926 C CA  . GLU A 275 ? 1.0098 3.3647 0.6385 0.4334  -0.3646 -0.1401 1782 GLU A CA  
1927 C C   . GLU A 275 ? 1.0057 3.3639 0.6359 0.4341  -0.3614 -0.1422 1782 GLU A C   
1928 O O   . GLU A 275 ? 0.9978 3.3614 0.6391 0.4345  -0.3643 -0.1445 1782 GLU A O   
1929 C CB  . GLU A 275 ? 1.0239 3.3673 0.6429 0.4329  -0.3727 -0.1396 1782 GLU A CB  
1930 C CG  . GLU A 275 ? 1.0280 3.3681 0.6464 0.4320  -0.3770 -0.1377 1782 GLU A CG  
1931 C CD  . GLU A 275 ? 1.0143 3.3645 0.6502 0.4323  -0.3779 -0.1381 1782 GLU A CD  
1932 O OE1 . GLU A 275 ? 1.0077 3.3622 0.6551 0.4327  -0.3819 -0.1403 1782 GLU A OE1 
1933 O OE2 . GLU A 275 ? 1.0105 3.3641 0.6485 0.4320  -0.3743 -0.1363 1782 GLU A OE2 
1934 N N   . CYS A 276 ? 0.8998 3.3092 0.5335 0.3377  -0.2890 -0.1710 1783 CYS A N   
1935 C CA  . CYS A 276 ? 0.8957 3.3085 0.5308 0.3384  -0.2854 -0.1729 1783 CYS A CA  
1936 C C   . CYS A 276 ? 0.8887 3.3079 0.5256 0.3386  -0.2761 -0.1720 1783 CYS A C   
1937 O O   . CYS A 276 ? 0.8874 3.3080 0.5229 0.3391  -0.2721 -0.1731 1783 CYS A O   
1938 C CB  . CYS A 276 ? 0.9099 3.3116 0.5306 0.3384  -0.2878 -0.1735 1783 CYS A CB  
1939 S SG  . CYS A 276 ? 0.9148 3.3113 0.5372 0.3384  -0.2985 -0.1755 1783 CYS A SG  
1940 N N   . ASP A 277 ? 0.8542 3.1818 0.4681 0.2802  -0.2194 -0.0662 1784 ASP A N   
1941 C CA  . ASP A 277 ? 0.8480 3.1814 0.4640 0.2802  -0.2110 -0.0649 1784 ASP A CA  
1942 C C   . ASP A 277 ? 0.8346 3.1782 0.4648 0.2800  -0.2099 -0.0645 1784 ASP A C   
1943 O O   . ASP A 277 ? 0.8321 3.1769 0.4684 0.2797  -0.2152 -0.0648 1784 ASP A O   
1944 C CB  . ASP A 277 ? 0.8595 3.1850 0.4618 0.2797  -0.2074 -0.0625 1784 ASP A CB  
1945 C CG  . ASP A 277 ? 0.8574 3.1856 0.4580 0.2800  -0.1986 -0.0617 1784 ASP A CG  
1946 O OD1 . ASP A 277 ? 0.8452 3.1830 0.4570 0.2802  -0.1951 -0.0625 1784 ASP A OD1 
1947 O OD2 . ASP A 277 ? 0.8685 3.1890 0.4565 0.2797  -0.1951 -0.0603 1784 ASP A OD2 
1948 N N   . PHE A 278 ? 0.7863 3.0313 0.4595 0.2019  -0.1766 -0.0156 1785 PHE A N   
1949 C CA  . PHE A 278 ? 0.7743 3.0286 0.4599 0.2014  -0.1752 -0.0151 1785 PHE A CA  
1950 C C   . PHE A 278 ? 0.7723 3.0292 0.4569 0.2011  -0.1680 -0.0126 1785 PHE A C   
1951 O O   . PHE A 278 ? 0.7715 3.0297 0.4544 0.2013  -0.1626 -0.0125 1785 PHE A O   
1952 C CB  . PHE A 278 ? 0.7622 3.0252 0.4605 0.2017  -0.1755 -0.0175 1785 PHE A CB  
1953 C CG  . PHE A 278 ? 0.7611 3.0238 0.4649 0.2019  -0.1825 -0.0196 1785 PHE A CG  
1954 C CD1 . PHE A 278 ? 0.7575 3.0224 0.4683 0.2014  -0.1861 -0.0194 1785 PHE A CD1 
1955 C CD2 . PHE A 278 ? 0.7637 3.0239 0.4661 0.2023  -0.1854 -0.0218 1785 PHE A CD2 
1956 C CE1 . PHE A 278 ? 0.7565 3.0212 0.4734 0.2016  -0.1924 -0.0212 1785 PHE A CE1 
1957 C CE2 . PHE A 278 ? 0.7627 3.0227 0.4710 0.2026  -0.1921 -0.0237 1785 PHE A CE2 
1958 C CZ  . PHE A 278 ? 0.7590 3.0213 0.4748 0.2021  -0.1955 -0.0233 1785 PHE A CZ  
1959 N N   . VAL A 279 ? 0.8307 3.0251 0.4580 0.1436  -0.1753 0.0861  1786 VAL A N   
1960 C CA  . VAL A 279 ? 0.8293 3.0258 0.4560 0.1431  -0.1692 0.0887  1786 VAL A CA  
1961 C C   . VAL A 279 ? 0.8161 3.0226 0.4561 0.1427  -0.1676 0.0891  1786 VAL A C   
1962 O O   . VAL A 279 ? 0.8122 3.0210 0.4584 0.1423  -0.1715 0.0887  1786 VAL A O   
1963 C CB  . VAL A 279 ? 0.8397 3.0286 0.4566 0.1428  -0.1699 0.0913  1786 VAL A CB  
1964 C CG1 . VAL A 279 ? 0.8384 3.0294 0.4550 0.1423  -0.1632 0.0939  1786 VAL A CG1 
1965 C CG2 . VAL A 279 ? 0.8539 3.0320 0.4565 0.1430  -0.1717 0.0910  1786 VAL A CG2 
1966 N N   . PHE A 280 ? 0.7687 2.8955 0.4412 0.0873  -0.1339 0.0952  1787 PHE A N   
1967 C CA  . PHE A 280 ? 0.7570 2.8927 0.4411 0.0866  -0.1319 0.0957  1787 PHE A CA  
1968 C C   . PHE A 280 ? 0.7564 2.8936 0.4400 0.0863  -0.1262 0.0986  1787 PHE A C   
1969 O O   . PHE A 280 ? 0.7582 2.8948 0.4388 0.0864  -0.1212 0.0993  1787 PHE A O   
1970 C CB  . PHE A 280 ? 0.7481 2.8902 0.4405 0.0868  -0.1313 0.0934  1787 PHE A CB  
1971 C CG  . PHE A 280 ? 0.7468 2.8888 0.4423 0.0870  -0.1369 0.0904  1787 PHE A CG  
1972 C CD1 . PHE A 280 ? 0.7418 2.8869 0.4448 0.0866  -0.1409 0.0896  1787 PHE A CD1 
1973 C CD2 . PHE A 280 ? 0.7507 2.8896 0.4421 0.0878  -0.1383 0.0886  1787 PHE A CD2 
1974 C CE1 . PHE A 280 ? 0.7406 2.8856 0.4474 0.0869  -0.1458 0.0870  1787 PHE A CE1 
1975 C CE2 . PHE A 280 ? 0.7495 2.8883 0.4444 0.0882  -0.1436 0.0860  1787 PHE A CE2 
1976 C CZ  . PHE A 280 ? 0.7444 2.8864 0.4473 0.0878  -0.1474 0.0852  1787 PHE A CZ  
1977 N N   . GLU A 281 ? 0.8318 2.9551 0.4678 0.0000  -0.1523 0.1879  1788 GLU A N   
1978 C CA  . GLU A 281 ? 0.8314 2.9560 0.4675 -0.0006 -0.1474 0.1908  1788 GLU A CA  
1979 C C   . GLU A 281 ? 0.8196 2.9532 0.4674 -0.0013 -0.1451 0.1912  1788 GLU A C   
1980 O O   . GLU A 281 ? 0.8133 2.9509 0.4682 -0.0020 -0.1483 0.1904  1788 GLU A O   
1981 C CB  . GLU A 281 ? 0.8370 2.9574 0.4689 -0.0008 -0.1494 0.1928  1788 GLU A CB  
1982 C CG  . GLU A 281 ? 0.8430 2.9600 0.4688 -0.0010 -0.1446 0.1958  1788 GLU A CG  
1983 C CD  . GLU A 281 ? 0.8483 2.9612 0.4703 -0.0015 -0.1468 0.1977  1788 GLU A CD  
1984 O OE1 . GLU A 281 ? 0.8416 2.9592 0.4713 -0.0020 -0.1489 0.1982  1788 GLU A OE1 
1985 O OE2 . GLU A 281 ? 0.8595 2.9643 0.4704 -0.0013 -0.1465 0.1990  1788 GLU A OE2 
1986 N N   . TRP A 282 ? 0.7329 2.8706 0.4261 -0.0465 -0.0966 0.1737  1789 TRP A N   
1987 C CA  . TRP A 282 ? 0.7224 2.8681 0.4261 -0.0472 -0.0945 0.1739  1789 TRP A CA  
1988 C C   . TRP A 282 ? 0.7217 2.8688 0.4272 -0.0480 -0.0901 0.1773  1789 TRP A C   
1989 O O   . TRP A 282 ? 0.7259 2.8708 0.4276 -0.0476 -0.0856 0.1789  1789 TRP A O   
1990 C CB  . TRP A 282 ? 0.7186 2.8672 0.4251 -0.0471 -0.0926 0.1723  1789 TRP A CB  
1991 C CG  . TRP A 282 ? 0.7079 2.8644 0.4251 -0.0482 -0.0918 0.1720  1789 TRP A CG  
1992 C CD1 . TRP A 282 ? 0.7023 2.8631 0.4259 -0.0494 -0.0909 0.1738  1789 TRP A CD1 
1993 C CD2 . TRP A 282 ? 0.7023 2.8627 0.4242 -0.0483 -0.0920 0.1700  1789 TRP A CD2 
1994 N NE1 . TRP A 282 ? 0.6939 2.8607 0.4255 -0.0502 -0.0907 0.1729  1789 TRP A NE1 
1995 C CE2 . TRP A 282 ? 0.6936 2.8604 0.4245 -0.0496 -0.0912 0.1705  1789 TRP A CE2 
1996 C CE3 . TRP A 282 ? 0.7040 2.8629 0.4233 -0.0474 -0.0927 0.1676  1789 TRP A CE3 
1997 C CZ2 . TRP A 282 ? 0.6869 2.8584 0.4239 -0.0502 -0.0910 0.1689  1789 TRP A CZ2 
1998 C CZ3 . TRP A 282 ? 0.6968 2.8608 0.4228 -0.0478 -0.0926 0.1659  1789 TRP A CZ3 
1999 C CH2 . TRP A 282 ? 0.6885 2.8587 0.4230 -0.0493 -0.0917 0.1667  1789 TRP A CH2 
2000 N N   . GLU A 283 ? 0.7740 2.8926 0.4718 -0.1318 -0.1018 0.2660  1790 GLU A N   
2001 C CA  . GLU A 283 ? 0.7723 2.8930 0.4732 -0.1327 -0.0982 0.2691  1790 GLU A CA  
2002 C C   . GLU A 283 ? 0.7632 2.8908 0.4735 -0.1336 -0.0961 0.2694  1790 GLU A C   
2003 O O   . GLU A 283 ? 0.7562 2.8883 0.4730 -0.1345 -0.0987 0.2680  1790 GLU A O   
2004 C CB  . GLU A 283 ? 0.7724 2.8926 0.4742 -0.1333 -0.1009 0.2703  1790 GLU A CB  
2005 C CG  . GLU A 283 ? 0.7823 2.8951 0.4746 -0.1325 -0.1023 0.2709  1790 GLU A CG  
2006 C CD  . GLU A 283 ? 0.7818 2.8943 0.4755 -0.1331 -0.1067 0.2709  1790 GLU A CD  
2007 O OE1 . GLU A 283 ? 0.7782 2.8924 0.4753 -0.1331 -0.1108 0.2685  1790 GLU A OE1 
2008 O OE2 . GLU A 283 ? 0.7852 2.8956 0.4768 -0.1333 -0.1058 0.2736  1790 GLU A OE2 
2009 N N   . THR A 284 ? 0.6680 2.7958 0.4084 -0.1568 -0.0538 0.2003  1791 THR A N   
2010 C CA  . THR A 284 ? 0.6603 2.7941 0.4091 -0.1577 -0.0518 0.2006  1791 THR A CA  
2011 C C   . THR A 284 ? 0.6609 2.7954 0.4121 -0.1580 -0.0467 0.2039  1791 THR A C   
2012 O O   . THR A 284 ? 0.6681 2.7981 0.4134 -0.1571 -0.0434 0.2053  1791 THR A O   
2013 C CB  . THR A 284 ? 0.6589 2.7935 0.4075 -0.1571 -0.0520 0.1979  1791 THR A CB  
2014 O OG1 . THR A 284 ? 0.6527 2.7923 0.4086 -0.1579 -0.0494 0.1987  1791 THR A OG1 
2015 C CG2 . THR A 284 ? 0.6675 2.7961 0.4072 -0.1555 -0.0500 0.1975  1791 THR A CG2 
2016 N N   . PRO A 285 ? 0.6476 2.8525 0.4018 -0.1958 -0.0337 0.2138  1792 PRO A N   
2017 C CA  . PRO A 285 ? 0.6476 2.8537 0.4057 -0.1961 -0.0293 0.2171  1792 PRO A CA  
2018 C C   . PRO A 285 ? 0.6479 2.8545 0.4073 -0.1956 -0.0253 0.2170  1792 PRO A C   
2019 O O   . PRO A 285 ? 0.6492 2.8559 0.4114 -0.1957 -0.0211 0.2197  1792 PRO A O   
2020 C CB  . PRO A 285 ? 0.6398 2.8513 0.4069 -0.1981 -0.0307 0.2185  1792 PRO A CB  
2021 C CG  . PRO A 285 ? 0.6361 2.8491 0.4035 -0.1985 -0.0357 0.2157  1792 PRO A CG  
2022 C CD  . PRO A 285 ? 0.6396 2.8495 0.4006 -0.1970 -0.0370 0.2125  1792 PRO A CD  
2023 N N   . VAL A 286 ? 0.6019 2.8828 0.3859 -0.1319 -0.0118 0.0957  1793 VAL A N   
2024 C CA  . VAL A 286 ? 0.6025 2.8836 0.3874 -0.1313 -0.0083 0.0954  1793 VAL A CA  
2025 C C   . VAL A 286 ? 0.6120 2.8868 0.3882 -0.1297 -0.0048 0.0957  1793 VAL A C   
2026 O O   . VAL A 286 ? 0.6140 2.8881 0.3910 -0.1291 -0.0005 0.0964  1793 VAL A O   
2027 C CB  . VAL A 286 ? 0.5980 2.8816 0.3845 -0.1313 -0.0111 0.0922  1793 VAL A CB  
2028 C CG1 . VAL A 286 ? 0.6035 2.8824 0.3811 -0.1298 -0.0131 0.0894  1793 VAL A CG1 
2029 C CG2 . VAL A 286 ? 0.5952 2.8815 0.3870 -0.1314 -0.0080 0.0927  1793 VAL A CG2 
2030 N N   . VAL A 287 ? 0.6534 3.1562 0.3840 -0.1504 -0.0111 0.1053  1794 VAL A N   
2031 C CA  . VAL A 287 ? 0.6637 3.1596 0.3848 -0.1493 -0.0080 0.1058  1794 VAL A CA  
2032 C C   . VAL A 287 ? 0.6664 3.1611 0.3881 -0.1499 -0.0051 0.1093  1794 VAL A C   
2033 O O   . VAL A 287 ? 0.6741 3.1632 0.3878 -0.1493 -0.0049 0.1098  1794 VAL A O   
2034 C CB  . VAL A 287 ? 0.6701 3.1603 0.3810 -0.1484 -0.0119 0.1032  1794 VAL A CB  
2035 C CG1 . VAL A 287 ? 0.6818 3.1640 0.3817 -0.1474 -0.0085 0.1037  1794 VAL A CG1 
2036 C CG2 . VAL A 287 ? 0.6666 3.1586 0.3782 -0.1481 -0.0148 0.1000  1794 VAL A CG2 
2037 N N   . CYS A 288 ? 0.6760 3.2601 0.3914 -0.2022 -0.0052 0.1728  1795 CYS A N   
2038 C CA  . CYS A 288 ? 0.6776 3.2615 0.3958 -0.2028 -0.0017 0.1763  1795 CYS A CA  
2039 C C   . CYS A 288 ? 0.6758 3.2622 0.4012 -0.2029 0.0035  0.1781  1795 CYS A C   
2040 O O   . CYS A 288 ? 0.6705 3.2606 0.4011 -0.2029 0.0031  0.1768  1795 CYS A O   
2041 C CB  . CYS A 288 ? 0.6710 3.2593 0.3957 -0.2041 -0.0052 0.1775  1795 CYS A CB  
2042 S SG  . CYS A 288 ? 0.6725 3.2584 0.3907 -0.2041 -0.0114 0.1756  1795 CYS A SG  
2043 N N   . PRO A 289 ? 0.6975 3.3337 0.3959 -0.1748 0.0265  0.0746  1796 PRO A N   
2044 C CA  . PRO A 289 ? 0.6955 3.3343 0.4021 -0.1749 0.0315  0.0763  1796 PRO A CA  
2045 C C   . PRO A 289 ? 0.6864 3.3321 0.4058 -0.1765 0.0303  0.0789  1796 PRO A C   
2046 O O   . PRO A 289 ? 0.6828 3.3305 0.4039 -0.1775 0.0263  0.0794  1796 PRO A O   
2047 C CB  . PRO A 289 ? 0.7048 3.3380 0.4065 -0.1743 0.0375  0.0785  1796 PRO A CB  
2048 C CG  . PRO A 289 ? 0.7082 3.3385 0.4039 -0.1746 0.0348  0.0791  1796 PRO A CG  
2049 C CD  . PRO A 289 ? 0.7047 3.3360 0.3968 -0.1747 0.0280  0.0763  1796 PRO A CD  
2050 N N   . ASP A 290 ? 0.6795 3.2651 0.4194 -0.0758 0.0368  0.0425  1797 ASP A N   
2051 C CA  . ASP A 290 ? 0.6719 3.2633 0.4242 -0.0773 0.0359  0.0452  1797 ASP A CA  
2052 C C   . ASP A 290 ? 0.6749 3.2651 0.4301 -0.0776 0.0392  0.0489  1797 ASP A C   
2053 O O   . ASP A 290 ? 0.6789 3.2675 0.4367 -0.0771 0.0450  0.0507  1797 ASP A O   
2054 C CB  . ASP A 290 ? 0.6680 3.2628 0.4289 -0.0775 0.0383  0.0456  1797 ASP A CB  
2055 C CG  . ASP A 290 ? 0.6642 3.2608 0.4234 -0.0773 0.0346  0.0421  1797 ASP A CG  
2056 O OD1 . ASP A 290 ? 0.6585 3.2582 0.4190 -0.0785 0.0293  0.0410  1797 ASP A OD1 
2057 O OD2 . ASP A 290 ? 0.6670 3.2619 0.4238 -0.0762 0.0373  0.0406  1797 ASP A OD2 
2058 N N   . GLU A 291 ? 0.6448 3.3242 0.3893 -0.1149 0.0604  0.1115  1798 GLU A N   
2059 C CA  . GLU A 291 ? 0.6476 3.3258 0.3942 -0.1152 0.0627  0.1149  1798 GLU A CA  
2060 C C   . GLU A 291 ? 0.6416 3.3249 0.4018 -0.1167 0.0635  0.1181  1798 GLU A C   
2061 O O   . GLU A 291 ? 0.6344 3.3221 0.4007 -0.1181 0.0588  0.1182  1798 GLU A O   
2062 C CB  . GLU A 291 ? 0.6483 3.3251 0.3890 -0.1156 0.0584  0.1145  1798 GLU A CB  
2063 C CG  . GLU A 291 ? 0.6535 3.3273 0.3928 -0.1156 0.0612  0.1173  1798 GLU A CG  
2064 C CD  . GLU A 291 ? 0.6546 3.3266 0.3876 -0.1159 0.0566  0.1168  1798 GLU A CD  
2065 O OE1 . GLU A 291 ? 0.6491 3.3239 0.3826 -0.1167 0.0511  0.1147  1798 GLU A OE1 
2066 O OE2 . GLU A 291 ? 0.6611 3.3289 0.3888 -0.1155 0.0588  0.1181  1798 GLU A OE2 
2067 N N   . VAL A 292 ? 0.6274 3.1737 0.4117 -0.0754 0.0964  0.0913  1799 VAL A N   
2068 C CA  . VAL A 292 ? 0.6226 3.1731 0.4204 -0.0767 0.0974  0.0949  1799 VAL A CA  
2069 C C   . VAL A 292 ? 0.6210 3.1724 0.4210 -0.0780 0.0944  0.0973  1799 VAL A C   
2070 O O   . VAL A 292 ? 0.6265 3.1741 0.4194 -0.0773 0.0956  0.0976  1799 VAL A O   
2071 C CB  . VAL A 292 ? 0.6273 3.1761 0.4301 -0.0759 0.1049  0.0973  1799 VAL A CB  
2072 C CG1 . VAL A 292 ? 0.6219 3.1754 0.4401 -0.0772 0.1054  0.1010  1799 VAL A CG1 
2073 C CG2 . VAL A 292 ? 0.6297 3.1769 0.4295 -0.0745 0.1080  0.0947  1799 VAL A CG2 
2074 N N   . ARG A 293 ? 0.6226 2.9537 0.4574 0.0293  0.1151  0.1868  1800 ARG A N   
2075 C CA  . ARG A 293 ? 0.6202 2.9526 0.4576 0.0278  0.1115  0.1888  1800 ARG A CA  
2076 C C   . ARG A 293 ? 0.6244 2.9550 0.4652 0.0280  0.1156  0.1924  1800 ARG A C   
2077 O O   . ARG A 293 ? 0.6263 2.9569 0.4737 0.0284  0.1209  0.1947  1800 ARG A O   
2078 C CB  . ARG A 293 ? 0.6123 2.9497 0.4594 0.0258  0.1067  0.1898  1800 ARG A CB  
2079 C CG  . ARG A 293 ? 0.6096 2.9483 0.4590 0.0240  0.1022  0.1915  1800 ARG A CG  
2080 C CD  . ARG A 293 ? 0.6086 2.9465 0.4488 0.0238  0.0970  0.1881  1800 ARG A CD  
2081 N NE  . ARG A 293 ? 0.6096 2.9465 0.4483 0.0230  0.0951  0.1897  1800 ARG A NE  
2082 C CZ  . ARG A 293 ? 0.6058 2.9450 0.4512 0.0210  0.0917  0.1918  1800 ARG A CZ  
2083 N NH1 . ARG A 293 ? 0.6010 2.9435 0.4551 0.0194  0.0896  0.1931  1800 ARG A NH1 
2084 N NH2 . ARG A 293 ? 0.6072 2.9451 0.4505 0.0207  0.0900  0.1930  1800 ARG A NH2 
2085 N N   . MET A 294 ? 0.7001 2.9649 0.5859 0.1155  0.2058  0.3222  1801 MET A N   
2086 C CA  . MET A 294 ? 0.7041 2.9670 0.5922 0.1155  0.2092  0.3257  1801 MET A CA  
2087 C C   . MET A 294 ? 0.7009 2.9672 0.6035 0.1142  0.2111  0.3296  1801 MET A C   
2088 O O   . MET A 294 ? 0.7045 2.9696 0.6113 0.1150  0.2172  0.3314  1801 MET A O   
2089 C CB  . MET A 294 ? 0.7040 2.9661 0.5874 0.1147  0.2047  0.3257  1801 MET A CB  
2090 C CG  . MET A 294 ? 0.7102 2.9673 0.5797 0.1160  0.2048  0.3231  1801 MET A CG  
2091 S SD  . MET A 294 ? 0.7195 2.9712 0.5845 0.1171  0.2108  0.3258  1801 MET A SD  
2092 C CE  . MET A 294 ? 0.7163 2.9699 0.5862 0.1154  0.2065  0.3285  1801 MET A CE  
2093 N N   . ASP A 295 ? 0.6775 2.6252 0.6404 0.0861  0.2173  0.2777  1802 ASP A N   
2094 C CA  . ASP A 295 ? 0.6743 2.6252 0.6513 0.0847  0.2178  0.2818  1802 ASP A CA  
2095 C C   . ASP A 295 ? 0.6681 2.6230 0.6534 0.0834  0.2149  0.2818  1802 ASP A C   
2096 O O   . ASP A 295 ? 0.6632 2.6210 0.6555 0.0813  0.2100  0.2833  1802 ASP A O   
2097 C CB  . ASP A 295 ? 0.6731 2.6245 0.6531 0.0833  0.2146  0.2845  1802 ASP A CB  
2098 C CG  . ASP A 295 ? 0.6719 2.6226 0.6423 0.0828  0.2089  0.2818  1802 ASP A CG  
2099 O OD1 . ASP A 295 ? 0.6674 2.6201 0.6367 0.0819  0.2041  0.2795  1802 ASP A OD1 
2100 O OD2 . ASP A 295 ? 0.6758 2.6236 0.6398 0.0834  0.2092  0.2820  1802 ASP A OD2 
2101 N N   . GLY A 296 ? 0.6231 2.5078 0.5843 0.0203  0.1797  0.1499  1803 GLY A N   
2102 C CA  . GLY A 296 ? 0.6180 2.5062 0.5871 0.0193  0.1777  0.1498  1803 GLY A CA  
2103 C C   . GLY A 296 ? 0.6127 2.5030 0.5794 0.0176  0.1705  0.1476  1803 GLY A C   
2104 O O   . GLY A 296 ? 0.6124 2.5021 0.5706 0.0184  0.1691  0.1439  1803 GLY A O   
2105 N N   . CYS A 297 ? 0.6041 2.3271 0.5886 0.0430  0.1650  0.1577  1804 CYS A N   
2106 C CA  . CYS A 297 ? 0.5996 2.3243 0.5824 0.0410  0.1583  0.1561  1804 CYS A CA  
2107 C C   . CYS A 297 ? 0.5984 2.3233 0.5844 0.0390  0.1543  0.1586  1804 CYS A C   
2108 O O   . CYS A 297 ? 0.5948 2.3216 0.5870 0.0366  0.1498  0.1600  1804 CYS A O   
2109 C CB  . CYS A 297 ? 0.5957 2.3231 0.5864 0.0397  0.1568  0.1564  1804 CYS A CB  
2110 S SG  . CYS A 297 ? 0.5909 2.3198 0.5787 0.0373  0.1490  0.1541  1804 CYS A SG  
2111 N N   . THR A 298 ? 0.6803 2.2579 0.6897 0.1466  0.2181  0.2410  1805 THR A N   
2112 C CA  . THR A 298 ? 0.6797 2.2573 0.6917 0.1449  0.2149  0.2434  1805 THR A CA  
2113 C C   . THR A 298 ? 0.6815 2.2568 0.6823 0.1455  0.2128  0.2409  1805 THR A C   
2114 O O   . THR A 298 ? 0.6842 2.2575 0.6756 0.1474  0.2150  0.2380  1805 THR A O   
2115 C CB  . THR A 298 ? 0.6820 2.2594 0.7029 0.1451  0.2188  0.2479  1805 THR A CB  
2116 O OG1 . THR A 298 ? 0.6871 2.2620 0.7024 0.1476  0.2249  0.2472  1805 THR A OG1 
2117 C CG2 . THR A 298 ? 0.6797 2.2597 0.7139 0.1442  0.2199  0.2509  1805 THR A CG2 
2118 N N   . LEU A 299 ? 0.8006 2.3984 0.7920 0.3111  0.2741  0.3409  1806 LEU A N   
2119 C CA  . LEU A 299 ? 0.8019 2.3978 0.7841 0.3113  0.2716  0.3388  1806 LEU A CA  
2120 C C   . LEU A 299 ? 0.8048 2.3993 0.7888 0.3113  0.2730  0.3418  1806 LEU A C   
2121 O O   . LEU A 299 ? 0.8037 2.3994 0.7970 0.3098  0.2723  0.3456  1806 LEU A O   
2122 C CB  . LEU A 299 ? 0.7983 2.3951 0.7793 0.3089  0.2653  0.3373  1806 LEU A CB  
2123 C CG  . LEU A 299 ? 0.7988 2.3939 0.7716 0.3086  0.2617  0.3348  1806 LEU A CG  
2124 C CD1 . LEU A 299 ? 0.7997 2.3941 0.7759 0.3073  0.2599  0.3379  1806 LEU A CD1 
2125 C CD2 . LEU A 299 ? 0.8016 2.3946 0.7641 0.3109  0.2637  0.3314  1806 LEU A CD2 
2126 N N   . THR A 300 ? 1.0573 2.4561 0.9679 0.5214  0.4049  0.4794  1807 THR A N   
2127 C CA  . THR A 300 ? 1.0605 2.4575 0.9713 0.5216  0.4059  0.4821  1807 THR A CA  
2128 C C   . THR A 300 ? 1.0626 2.4571 0.9631 0.5221  0.4038  0.4794  1807 THR A C   
2129 O O   . THR A 300 ? 1.0662 2.4583 0.9579 0.5242  0.4059  0.4771  1807 THR A O   
2130 C CB  . THR A 300 ? 1.0649 2.4606 0.9788 0.5231  0.4128  0.4846  1807 THR A CB  
2131 O OG1 . THR A 300 ? 1.0685 2.4620 0.9810 0.5235  0.4138  0.4867  1807 THR A OG1 
2132 C CG2 . THR A 300 ? 1.0683 2.4620 0.9743 0.5254  0.4169  0.4819  1807 THR A CG2 
2133 N N   . ASP A 301 ? 1.3108 2.7027 1.1171 0.7961  0.4873  0.5960  1808 ASP A N   
2134 C CA  . ASP A 301 ? 1.3127 2.7023 1.1110 0.7965  0.4851  0.5942  1808 ASP A CA  
2135 C C   . ASP A 301 ? 1.3146 2.7034 1.1170 0.7958  0.4853  0.5978  1808 ASP A C   
2136 O O   . ASP A 301 ? 1.3124 2.7031 1.1240 0.7943  0.4844  0.6011  1808 ASP A O   
2137 C CB  . ASP A 301 ? 1.3089 2.6995 1.1049 0.7950  0.4794  0.5913  1808 ASP A CB  
2138 C CG  . ASP A 301 ? 1.3108 2.6991 1.0973 0.7958  0.4774  0.5881  1808 ASP A CG  
2139 O OD1 . ASP A 301 ? 1.3139 2.7002 1.0982 0.7965  0.4778  0.5892  1808 ASP A OD1 
2140 O OD2 . ASP A 301 ? 1.3092 2.6976 1.0909 0.7960  0.4753  0.5842  1808 ASP A OD2 
2141 N N   . GLU A 302 ? 1.7111 2.6557 1.4436 1.0112  0.7019  0.7756  1809 GLU A N   
2142 C CA  . GLU A 302 ? 1.7136 2.6570 1.4493 1.0109  0.7027  0.7791  1809 GLU A CA  
2143 C C   . GLU A 302 ? 1.7109 2.6550 1.4491 1.0089  0.6973  0.7797  1809 GLU A C   
2144 O O   . GLU A 302 ? 1.7121 2.6558 1.4546 1.0082  0.6973  0.7829  1809 GLU A O   
2145 C CB  . GLU A 302 ? 1.7197 2.6593 1.4472 1.0128  0.7059  0.7789  1809 GLU A CB  
2146 C CG  . GLU A 302 ? 1.7211 2.6585 1.4407 1.0131  0.7021  0.7767  1809 GLU A CG  
2147 C CD  . GLU A 302 ? 1.7217 2.6578 1.4320 1.0142  0.7009  0.7720  1809 GLU A CD  
2148 O OE1 . GLU A 302 ? 1.7246 2.6593 1.4306 1.0159  0.7045  0.7710  1809 GLU A OE1 
2149 O OE2 . GLU A 302 ? 1.7194 2.6557 1.4268 1.0137  0.6963  0.7695  1809 GLU A OE2 
2150 N N   . GLN A 303 ? 1.7761 2.5703 1.5607 1.0740  0.6890  0.7207  1810 GLN A N   
2151 C CA  . GLN A 303 ? 1.7738 2.5683 1.5602 1.0717  0.6838  0.7207  1810 GLN A CA  
2152 C C   . GLN A 303 ? 1.7714 2.5678 1.5683 1.0695  0.6826  0.7246  1810 GLN A C   
2153 O O   . GLN A 303 ? 1.7713 2.5674 1.5715 1.0680  0.6798  0.7265  1810 GLN A O   
2154 C CB  . GLN A 303 ? 1.7712 2.5659 1.5524 1.0712  0.6801  0.7164  1810 GLN A CB  
2155 C CG  . GLN A 303 ? 1.7734 2.5660 1.5449 1.0730  0.6801  0.7127  1810 GLN A CG  
2156 C CD  . GLN A 303 ? 1.7757 2.5662 1.5443 1.0730  0.6783  0.7129  1810 GLN A CD  
2157 O OE1 . GLN A 303 ? 1.7744 2.5651 1.5465 1.0712  0.6751  0.7142  1810 GLN A OE1 
2158 N NE2 . GLN A 303 ? 1.7795 2.5677 1.5415 1.0750  0.6801  0.7118  1810 GLN A NE2 
2159 N N   . LEU A 304 ? 1.5697 2.1519 1.6102 0.7973  0.6345  0.5587  1811 LEU A N   
2160 C CA  . LEU A 304 ? 1.5677 2.1518 1.6191 0.7954  0.6337  0.5625  1811 LEU A CA  
2161 C C   . LEU A 304 ? 1.5697 2.1543 1.6277 0.7968  0.6391  0.5661  1811 LEU A C   
2162 O O   . LEU A 304 ? 1.5693 2.1548 1.6369 0.7954  0.6391  0.5701  1811 LEU A O   
2163 C CB  . LEU A 304 ? 1.5642 2.1500 1.6179 0.7940  0.6309  0.5611  1811 LEU A CB  
2164 C CG  . LEU A 304 ? 1.5634 2.1501 1.6136 0.7954  0.6335  0.5582  1811 LEU A CG  
2165 C CD1 . LEU A 304 ? 1.5606 2.1493 1.6184 0.7939  0.6326  0.5595  1811 LEU A CD1 
2166 C CD2 . LEU A 304 ? 1.5631 2.1486 1.6028 0.7960  0.6316  0.5532  1811 LEU A CD2 
2167 N N   . LEU A 305 ? 1.5588 2.2315 1.5893 0.7682  0.6891  0.6416  1812 LEU A N   
2168 C CA  . LEU A 305 ? 1.5620 2.2343 1.5963 0.7699  0.6955  0.6442  1812 LEU A CA  
2169 C C   . LEU A 305 ? 1.5602 2.2348 1.6037 0.7698  0.6980  0.6460  1812 LEU A C   
2170 O O   . LEU A 305 ? 1.5630 2.2370 1.6068 0.7714  0.7038  0.6466  1812 LEU A O   
2171 C CB  . LEU A 305 ? 1.5647 2.2359 1.6027 0.7696  0.6966  0.6480  1812 LEU A CB  
2172 C CG  . LEU A 305 ? 1.5701 2.2390 1.6065 0.7717  0.7032  0.6496  1812 LEU A CG  
2173 C CD1 . LEU A 305 ? 1.5740 2.2398 1.5971 0.7738  0.7048  0.6459  1812 LEU A CD1 
2174 C CD2 . LEU A 305 ? 1.5721 2.2402 1.6137 0.7710  0.7037  0.6535  1812 LEU A CD2 
2175 N N   . TYR A 306 ? 1.2681 1.9530 1.4711 0.5098  0.5733  0.4681  1813 TYR A N   
2176 C CA  . TYR A 306 ? 1.2662 1.9532 1.4787 0.5095  0.5751  0.4699  1813 TYR A CA  
2177 C C   . TYR A 306 ? 1.2642 1.9521 1.4720 0.5101  0.5748  0.4663  1813 TYR A C   
2178 O O   . TYR A 306 ? 1.2642 1.9510 1.4617 0.5105  0.5728  0.4623  1813 TYR A O   
2179 C CB  . TYR A 306 ? 1.2634 1.9522 1.4874 0.5067  0.5709  0.4736  1813 TYR A CB  
2180 C CG  . TYR A 306 ? 1.2608 1.9495 1.4817 0.5044  0.5637  0.4722  1813 TYR A CG  
2181 C CD1 . TYR A 306 ? 1.2617 1.9488 1.4793 0.5033  0.5602  0.4724  1813 TYR A CD1 
2182 C CD2 . TYR A 306 ? 1.2579 1.9477 1.4790 0.5030  0.5605  0.4704  1813 TYR A CD2 
2183 C CE1 . TYR A 306 ? 1.2599 1.9465 1.4744 0.5009  0.5540  0.4708  1813 TYR A CE1 
2184 C CE2 . TYR A 306 ? 1.2563 1.9455 1.4740 0.5005  0.5543  0.4688  1813 TYR A CE2 
2185 C CZ  . TYR A 306 ? 1.2575 1.9449 1.4717 0.4997  0.5512  0.4690  1813 TYR A CZ  
2186 O OH  . TYR A 306 ? 1.2565 1.9428 1.4671 0.4972  0.5454  0.4675  1813 TYR A OH  
2187 N N   . SER A 307 ? 0.9631 1.9965 1.1398 0.3512  0.3995  0.3598  1814 SER A N   
2188 C CA  . SER A 307 ? 0.9616 1.9959 1.1349 0.3519  0.4002  0.3565  1814 SER A CA  
2189 C C   . SER A 307 ? 0.9574 1.9938 1.1366 0.3495  0.3955  0.3567  1814 SER A C   
2190 O O   . SER A 307 ? 0.9560 1.9936 1.1458 0.3476  0.3935  0.3605  1814 SER A O   
2191 C CB  . SER A 307 ? 0.9642 1.9983 1.1399 0.3542  0.4072  0.3571  1814 SER A CB  
2192 O OG  . SER A 307 ? 0.9634 1.9993 1.1528 0.3533  0.4092  0.3614  1814 SER A OG  
2193 N N   . PHE A 308 ? 0.7354 2.0271 0.9703 0.2137  0.2667  0.2637  1815 PHE A N   
2194 C CA  . PHE A 308 ? 0.7320 2.0252 0.9707 0.2117  0.2626  0.2633  1815 PHE A CA  
2195 C C   . PHE A 308 ? 0.7312 2.0259 0.9731 0.2131  0.2662  0.2626  1815 PHE A C   
2196 O O   . PHE A 308 ? 0.7321 2.0262 0.9658 0.2150  0.2687  0.2590  1815 PHE A O   
2197 C CB  . PHE A 308 ? 0.7307 2.0230 0.9597 0.2106  0.2578  0.2594  1815 PHE A CB  
2198 C CG  . PHE A 308 ? 0.7309 2.0219 0.9586 0.2085  0.2533  0.2603  1815 PHE A CG  
2199 C CD1 . PHE A 308 ? 0.7297 2.0210 0.9649 0.2055  0.2487  0.2633  1815 PHE A CD1 
2200 C CD2 . PHE A 308 ? 0.7326 2.0219 0.9514 0.2096  0.2531  0.2579  1815 PHE A CD2 
2201 C CE1 . PHE A 308 ? 0.7303 2.0201 0.9638 0.2036  0.2444  0.2639  1815 PHE A CE1 
2202 C CE2 . PHE A 308 ? 0.7329 2.0209 0.9505 0.2076  0.2488  0.2587  1815 PHE A CE2 
2203 C CZ  . PHE A 308 ? 0.7319 2.0200 0.9566 0.2046  0.2446  0.2615  1815 PHE A CZ  
2204 N N   . ASN A 309 ? 0.6363 1.9429 0.8641 0.0944  0.2204  0.2179  1816 ASN A N   
2205 C CA  . ASN A 309 ? 0.6357 1.9437 0.8683 0.0956  0.2240  0.2178  1816 ASN A CA  
2206 C C   . ASN A 309 ? 0.6328 1.9417 0.8634 0.0942  0.2201  0.2154  1816 ASN A C   
2207 O O   . ASN A 309 ? 0.6307 1.9407 0.8693 0.0917  0.2161  0.2177  1816 ASN A O   
2208 C CB  . ASN A 309 ? 0.6357 1.9451 0.8831 0.0951  0.2261  0.2226  1816 ASN A CB  
2209 C CG  . ASN A 309 ? 0.6358 1.9465 0.8886 0.0966  0.2313  0.2226  1816 ASN A CG  
2210 O OD1 . ASN A 309 ? 0.6363 1.9465 0.8811 0.0983  0.2337  0.2190  1816 ASN A OD1 
2211 N ND2 . ASN A 309 ? 0.6355 1.9476 0.9024 0.0961  0.2331  0.2268  1816 ASN A ND2 
2212 N N   . LEU A 310 ? 0.5492 2.0768 0.6986 0.0284  0.1410  0.1709  1817 LEU A N   
2213 C CA  . LEU A 310 ? 0.5467 2.0750 0.6930 0.0274  0.1377  0.1682  1817 LEU A CA  
2214 C C   . LEU A 310 ? 0.5457 2.0756 0.6984 0.0282  0.1406  0.1685  1817 LEU A C   
2215 O O   . LEU A 310 ? 0.5436 2.0743 0.6949 0.0273  0.1381  0.1666  1817 LEU A O   
2216 C CB  . LEU A 310 ? 0.5472 2.0741 0.6800 0.0285  0.1372  0.1632  1817 LEU A CB  
2217 C CG  . LEU A 310 ? 0.5477 2.0729 0.6733 0.0274  0.1333  0.1620  1817 LEU A CG  
2218 C CD1 . LEU A 310 ? 0.5490 2.0728 0.6626 0.0295  0.1347  0.1574  1817 LEU A CD1 
2219 C CD2 . LEU A 310 ? 0.5456 2.0709 0.6722 0.0241  0.1272  0.1621  1817 LEU A CD2 
2220 N N   . SER A 311 ? 0.5477 2.0727 0.6814 0.0107  0.1524  0.1605  1818 SER A N   
2221 C CA  . SER A 311 ? 0.5471 2.0736 0.6879 0.0116  0.1559  0.1609  1818 SER A CA  
2222 C C   . SER A 311 ? 0.5441 2.0725 0.6961 0.0091  0.1518  0.1638  1818 SER A C   
2223 O O   . SER A 311 ? 0.5429 2.0727 0.7000 0.0093  0.1533  0.1635  1818 SER A O   
2224 C CB  . SER A 311 ? 0.5502 2.0764 0.6966 0.0138  0.1630  0.1632  1818 SER A CB  
2225 O OG  . SER A 311 ? 0.5537 2.0776 0.6889 0.0164  0.1674  0.1601  1818 SER A OG  
2226 N N   . SER A 312 ? 0.4995 2.0633 0.7416 -0.0204 0.1133  0.1506  1819 SER A N   
2227 C CA  . SER A 312 ? 0.4972 2.0622 0.7488 -0.0233 0.1083  0.1532  1819 SER A CA  
2228 C C   . SER A 312 ? 0.4955 2.0603 0.7403 -0.0247 0.1042  0.1500  1819 SER A C   
2229 O O   . SER A 312 ? 0.4939 2.0597 0.7457 -0.0262 0.1018  0.1512  1819 SER A O   
2230 C CB  . SER A 312 ? 0.4975 2.0615 0.7529 -0.0261 0.1032  0.1564  1819 SER A CB  
2231 O OG  . SER A 312 ? 0.4983 2.0604 0.7416 -0.0266 0.1004  0.1537  1819 SER A OG  
2232 N N   . LEU A 313 ? 0.4765 2.1595 0.6376 -0.0373 0.0687  0.1360  1820 LEU A N   
2233 C CA  . LEU A 313 ? 0.4752 2.1578 0.6286 -0.0383 0.0654  0.1325  1820 LEU A CA  
2234 C C   . LEU A 313 ? 0.4747 2.1584 0.6257 -0.0357 0.0698  0.1297  1820 LEU A C   
2235 O O   . LEU A 313 ? 0.4733 2.1572 0.6206 -0.0364 0.0678  0.1272  1820 LEU A O   
2236 C CB  . LEU A 313 ? 0.4759 2.1566 0.6170 -0.0386 0.0630  0.1293  1820 LEU A CB  
2237 C CG  . LEU A 313 ? 0.4763 2.1553 0.6164 -0.0421 0.0568  0.1307  1820 LEU A CG  
2238 C CD1 . LEU A 313 ? 0.4773 2.1561 0.6266 -0.0430 0.0560  0.1353  1820 LEU A CD1 
2239 C CD2 . LEU A 313 ? 0.4772 2.1544 0.6050 -0.0417 0.0557  0.1269  1820 LEU A CD2 
2240 N N   . SER A 314 ? 0.5059 2.1809 0.6030 -0.0187 0.0962  0.1298  1821 SER A N   
2241 C CA  . SER A 314 ? 0.5063 2.1817 0.6006 -0.0161 0.1010  0.1272  1821 SER A CA  
2242 C C   . SER A 314 ? 0.5047 2.1820 0.6096 -0.0165 0.1017  0.1289  1821 SER A C   
2243 O O   . SER A 314 ? 0.5055 2.1833 0.6121 -0.0142 0.1067  0.1281  1821 SER A O   
2244 C CB  . SER A 314 ? 0.5096 2.1839 0.6015 -0.0131 0.1076  0.1270  1821 SER A CB  
2245 O OG  . SER A 314 ? 0.5105 2.1856 0.6143 -0.0127 0.1111  0.1310  1821 SER A OG  
2246 N N   . THR A 315 ? 0.4950 2.2064 0.6653 -0.0263 0.0995  0.1740  1822 THR A N   
2247 C CA  . THR A 315 ? 0.4934 2.2065 0.6752 -0.0272 0.0992  0.1764  1822 THR A CA  
2248 C C   . THR A 315 ? 0.4920 2.2057 0.6693 -0.0267 0.0988  0.1730  1822 THR A C   
2249 O O   . THR A 315 ? 0.4918 2.2067 0.6746 -0.0252 0.1030  0.1730  1822 THR A O   
2250 C CB  . THR A 315 ? 0.4924 2.2057 0.6839 -0.0308 0.0930  0.1807  1822 THR A CB  
2251 O OG1 . THR A 315 ? 0.4910 2.2058 0.6939 -0.0317 0.0926  0.1828  1822 THR A OG1 
2252 C CG2 . THR A 315 ? 0.4920 2.2036 0.6747 -0.0337 0.0863  0.1791  1822 THR A CG2 
2253 N N   . SER A 316 ? 0.4896 2.2767 0.6504 -0.0597 0.0790  0.1870  1823 SER A N   
2254 C CA  . SER A 316 ? 0.4882 2.2757 0.6450 -0.0597 0.0781  0.1842  1823 SER A CA  
2255 C C   . SER A 316 ? 0.4880 2.2741 0.6315 -0.0606 0.0749  0.1800  1823 SER A C   
2256 O O   . SER A 316 ? 0.4892 2.2739 0.6252 -0.0603 0.0746  0.1787  1823 SER A O   
2257 C CB  . SER A 316 ? 0.4867 2.2752 0.6538 -0.0625 0.0742  0.1870  1823 SER A CB  
2258 O OG  . SER A 316 ? 0.4869 2.2741 0.6557 -0.0659 0.0681  0.1895  1823 SER A OG  
2259 N N   . THR A 317 ? 0.4767 2.3921 0.6072 -0.0832 0.0524  0.1842  1824 THR A N   
2260 C CA  . THR A 317 ? 0.4765 2.3906 0.5954 -0.0838 0.0498  0.1800  1824 THR A CA  
2261 C C   . THR A 317 ? 0.4768 2.3892 0.5940 -0.0878 0.0434  0.1810  1824 THR A C   
2262 O O   . THR A 317 ? 0.4769 2.3892 0.6023 -0.0903 0.0403  0.1849  1824 THR A O   
2263 C CB  . THR A 317 ? 0.4750 2.3902 0.5929 -0.0833 0.0504  0.1775  1824 THR A CB  
2264 O OG1 . THR A 317 ? 0.4752 2.3916 0.5954 -0.0798 0.0562  0.1770  1824 THR A OG1 
2265 C CG2 . THR A 317 ? 0.4749 2.3889 0.5809 -0.0834 0.0487  0.1730  1824 THR A CG2 
2266 N N   . PHE A 318 ? 0.4493 2.4649 0.5328 -0.1061 0.0137  0.1738  1825 PHE A N   
2267 C CA  . PHE A 318 ? 0.4503 2.4636 0.5300 -0.1097 0.0081  0.1739  1825 PHE A CA  
2268 C C   . PHE A 318 ? 0.4501 2.4624 0.5206 -0.1105 0.0066  0.1697  1825 PHE A C   
2269 O O   . PHE A 318 ? 0.4492 2.4625 0.5146 -0.1077 0.0099  0.1662  1825 PHE A O   
2270 C CB  . PHE A 318 ? 0.4519 2.4636 0.5279 -0.1099 0.0074  0.1745  1825 PHE A CB  
2271 C CG  . PHE A 318 ? 0.4524 2.4646 0.5377 -0.1101 0.0078  0.1790  1825 PHE A CG  
2272 C CD1 . PHE A 318 ? 0.4536 2.4643 0.5436 -0.1134 0.0031  0.1825  1825 PHE A CD1 
2273 C CD2 . PHE A 318 ? 0.4521 2.4661 0.5412 -0.1067 0.0131  0.1798  1825 PHE A CD2 
2274 C CE1 . PHE A 318 ? 0.4540 2.4653 0.5533 -0.1136 0.0035  0.1869  1825 PHE A CE1 
2275 C CE2 . PHE A 318 ? 0.4527 2.4671 0.5508 -0.1068 0.0138  0.1841  1825 PHE A CE2 
2276 C CZ  . PHE A 318 ? 0.4534 2.4667 0.5571 -0.1102 0.0089  0.1876  1825 PHE A CZ  
2277 N N   . LYS A 319 ? 0.4524 2.5398 0.5248 -0.1398 -0.0031 0.1796  1826 LYS A N   
2278 C CA  . LYS A 319 ? 0.4526 2.5388 0.5166 -0.1409 -0.0044 0.1756  1826 LYS A CA  
2279 C C   . LYS A 319 ? 0.4552 2.5379 0.5114 -0.1437 -0.0078 0.1745  1826 LYS A C   
2280 O O   . LYS A 319 ? 0.4572 2.5375 0.5132 -0.1474 -0.0122 0.1758  1826 LYS A O   
2281 C CB  . LYS A 319 ? 0.4521 2.5385 0.5203 -0.1428 -0.0066 0.1766  1826 LYS A CB  
2282 C CG  . LYS A 319 ? 0.4497 2.5393 0.5251 -0.1401 -0.0031 0.1773  1826 LYS A CG  
2283 C CD  . LYS A 319 ? 0.4482 2.5393 0.5175 -0.1368 0.0010  0.1729  1826 LYS A CD  
2284 C CE  . LYS A 319 ? 0.4465 2.5403 0.5225 -0.1335 0.0052  0.1736  1826 LYS A CE  
2285 N NZ  . LYS A 319 ? 0.4455 2.5403 0.5288 -0.1350 0.0037  0.1755  1826 LYS A NZ  
2286 N N   . VAL A 320 ? 0.4504 2.5551 0.4492 -0.1568 -0.0135 0.1378  1827 VAL A N   
2287 C CA  . VAL A 320 ? 0.4528 2.5543 0.4438 -0.1590 -0.0161 0.1360  1827 VAL A CA  
2288 C C   . VAL A 320 ? 0.4529 2.5535 0.4363 -0.1595 -0.0160 0.1316  1827 VAL A C   
2289 O O   . VAL A 320 ? 0.4509 2.5535 0.4322 -0.1565 -0.0127 0.1287  1827 VAL A O   
2290 C CB  . VAL A 320 ? 0.4531 2.5546 0.4410 -0.1570 -0.0141 0.1351  1827 VAL A CB  
2291 C CG1 . VAL A 320 ? 0.4561 2.5539 0.4381 -0.1599 -0.0173 0.1343  1827 VAL A CG1 
2292 C CG2 . VAL A 320 ? 0.4525 2.5556 0.4483 -0.1554 -0.0126 0.1389  1827 VAL A CG2 
2293 N N   . THR A 321 ? 0.4668 2.5958 0.4543 -0.1790 -0.0130 0.1424  1828 THR A N   
2294 C CA  . THR A 321 ? 0.4674 2.5951 0.4483 -0.1799 -0.0131 0.1386  1828 THR A CA  
2295 C C   . THR A 321 ? 0.4711 2.5945 0.4438 -0.1828 -0.0152 0.1366  1828 THR A C   
2296 O O   . THR A 321 ? 0.4743 2.5946 0.4468 -0.1861 -0.0186 0.1391  1828 THR A O   
2297 C CB  . THR A 321 ? 0.4673 2.5951 0.4517 -0.1817 -0.0151 0.1402  1828 THR A CB  
2298 O OG1 . THR A 321 ? 0.4640 2.5957 0.4566 -0.1790 -0.0127 0.1421  1828 THR A OG1 
2299 C CG2 . THR A 321 ? 0.4676 2.5945 0.4455 -0.1824 -0.0146 0.1360  1828 THR A CG2 
2300 N N   . ARG A 322 ? 0.4847 2.6177 0.4266 -0.1935 0.0026  0.1190  1829 ARG A N   
2301 C CA  . ARG A 322 ? 0.4883 2.6172 0.4222 -0.1961 0.0013  0.1163  1829 ARG A CA  
2302 C C   . ARG A 322 ? 0.4877 2.6167 0.4165 -0.1955 0.0034  0.1116  1829 ARG A C   
2303 O O   . ARG A 322 ? 0.4845 2.6166 0.4138 -0.1918 0.0065  0.1093  1829 ARG A O   
2304 C CB  . ARG A 322 ? 0.4890 2.6172 0.4208 -0.1950 0.0021  0.1156  1829 ARG A CB  
2305 C CG  . ARG A 322 ? 0.4926 2.6174 0.4245 -0.1983 -0.0010 0.1189  1829 ARG A CG  
2306 C CD  . ARG A 322 ? 0.4937 2.6173 0.4222 -0.1975 -0.0001 0.1172  1829 ARG A CD  
2307 N NE  . ARG A 322 ? 0.4942 2.6167 0.4161 -0.1969 0.0017  0.1124  1829 ARG A NE  
2308 C CZ  . ARG A 322 ? 0.4937 2.6166 0.4133 -0.1948 0.0038  0.1098  1829 ARG A CZ  
2309 N NH1 . ARG A 322 ? 0.4927 2.6169 0.4155 -0.1930 0.0040  0.1119  1829 ARG A NH1 
2310 N NH2 . ARG A 322 ? 0.4943 2.6161 0.4088 -0.1944 0.0054  0.1054  1829 ARG A NH2 
2311 N N   . ASP A 323 ? 0.4998 2.6563 0.4611 -0.2117 0.0149  0.1203  1830 ASP A N   
2312 C CA  . ASP A 323 ? 0.5000 2.6559 0.4563 -0.2117 0.0166  0.1162  1830 ASP A CA  
2313 C C   . ASP A 323 ? 0.4958 2.6559 0.4561 -0.2090 0.0185  0.1155  1830 ASP A C   
2314 O O   . ASP A 323 ? 0.4930 2.6556 0.4528 -0.2058 0.0214  0.1124  1830 ASP A O   
2315 C CB  . ASP A 323 ? 0.5001 2.6556 0.4518 -0.2102 0.0192  0.1120  1830 ASP A CB  
2316 C CG  . ASP A 323 ? 0.5041 2.6556 0.4521 -0.2125 0.0176  0.1125  1830 ASP A CG  
2317 O OD1 . ASP A 323 ? 0.5076 2.6560 0.4551 -0.2160 0.0144  0.1155  1830 ASP A OD1 
2318 O OD2 . ASP A 323 ? 0.5039 2.6554 0.4497 -0.2108 0.0196  0.1099  1830 ASP A OD2 
2319 N N   . SER A 324 ? 0.4715 2.6136 0.5314 -0.2498 -0.0054 0.1454  1831 SER A N   
2320 C CA  . SER A 324 ? 0.4678 2.6137 0.5322 -0.2476 -0.0038 0.1454  1831 SER A CA  
2321 C C   . SER A 324 ? 0.4636 2.6140 0.5338 -0.2431 -0.0012 0.1460  1831 SER A C   
2322 O O   . SER A 324 ? 0.4610 2.6142 0.5364 -0.2414 -0.0003 0.1473  1831 SER A O   
2323 C CB  . SER A 324 ? 0.4674 2.6133 0.5273 -0.2472 -0.0023 0.1410  1831 SER A CB  
2324 O OG  . SER A 324 ? 0.4717 2.6132 0.5264 -0.2515 -0.0044 0.1404  1831 SER A OG  
2325 N N   . ARG A 325 ? 0.4572 2.5301 0.4950 -0.1755 -0.0059 0.0901  1832 ARG A N   
2326 C CA  . ARG A 325 ? 0.4542 2.5305 0.4958 -0.1712 -0.0031 0.0905  1832 ARG A CA  
2327 C C   . ARG A 325 ? 0.4537 2.5313 0.5024 -0.1712 -0.0038 0.0952  1832 ARG A C   
2328 O O   . ARG A 325 ? 0.4553 2.5314 0.5047 -0.1722 -0.0052 0.0974  1832 ARG A O   
2329 C CB  . ARG A 325 ? 0.4544 2.5304 0.4920 -0.1694 -0.0015 0.0879  1832 ARG A CB  
2330 C CG  . ARG A 325 ? 0.4540 2.5299 0.4864 -0.1684 0.0000  0.0832  1832 ARG A CG  
2331 C CD  . ARG A 325 ? 0.4544 2.5297 0.4836 -0.1666 0.0013  0.0808  1832 ARG A CD  
2332 N NE  . ARG A 325 ? 0.4575 2.5295 0.4834 -0.1694 -0.0003 0.0810  1832 ARG A NE  
2333 C CZ  . ARG A 325 ? 0.4597 2.5290 0.4805 -0.1715 -0.0008 0.0781  1832 ARG A CZ  
2334 N NH1 . ARG A 325 ? 0.4590 2.5286 0.4777 -0.1712 0.0003  0.0747  1832 ARG A NH1 
2335 N NH2 . ARG A 325 ? 0.4629 2.5288 0.4808 -0.1741 -0.0023 0.0784  1832 ARG A NH2 
2336 N N   . THR A 326 ? 0.4557 2.5135 0.5210 -0.1477 -0.0013 0.1379  1833 THR A N   
2337 C CA  . THR A 326 ? 0.4550 2.5143 0.5283 -0.1474 -0.0015 0.1424  1833 THR A CA  
2338 C C   . THR A 326 ? 0.4533 2.5150 0.5288 -0.1431 0.0023  0.1423  1833 THR A C   
2339 O O   . THR A 326 ? 0.4515 2.5154 0.5283 -0.1404 0.0049  0.1411  1833 THR A O   
2340 C CB  . THR A 326 ? 0.4540 2.5144 0.5329 -0.1483 -0.0024 0.1444  1833 THR A CB  
2341 O OG1 . THR A 326 ? 0.4562 2.5138 0.5317 -0.1523 -0.0060 0.1439  1833 THR A OG1 
2342 C CG2 . THR A 326 ? 0.4536 2.5152 0.5418 -0.1484 -0.0031 0.1492  1833 THR A CG2 
2343 N N   . TYR A 327 ? 0.4533 2.4645 0.4748 -0.1177 -0.0044 0.0923  1834 TYR A N   
2344 C CA  . TYR A 327 ? 0.4525 2.4655 0.4758 -0.1142 -0.0010 0.0927  1834 TYR A CA  
2345 C C   . TYR A 327 ? 0.4518 2.4665 0.4841 -0.1134 0.0000  0.0970  1834 TYR A C   
2346 O O   . TYR A 327 ? 0.4518 2.4664 0.4896 -0.1159 -0.0024 0.0998  1834 TYR A O   
2347 C CB  . TYR A 327 ? 0.4540 2.4655 0.4738 -0.1141 -0.0013 0.0926  1834 TYR A CB  
2348 C CG  . TYR A 327 ? 0.4546 2.4647 0.4662 -0.1137 -0.0013 0.0882  1834 TYR A CG  
2349 C CD1 . TYR A 327 ? 0.4564 2.4639 0.4639 -0.1167 -0.0041 0.0874  1834 TYR A CD1 
2350 C CD2 . TYR A 327 ? 0.4537 2.4648 0.4619 -0.1105 0.0013  0.0850  1834 TYR A CD2 
2351 C CE1 . TYR A 327 ? 0.4570 2.4632 0.4579 -0.1164 -0.0038 0.0834  1834 TYR A CE1 
2352 C CE2 . TYR A 327 ? 0.4542 2.4642 0.4560 -0.1102 0.0012  0.0811  1834 TYR A CE2 
2353 C CZ  . TYR A 327 ? 0.4557 2.4633 0.4542 -0.1132 -0.0012 0.0803  1834 TYR A CZ  
2354 O OH  . TYR A 327 ? 0.4563 2.4627 0.4492 -0.1128 -0.0010 0.0763  1834 TYR A OH  
2355 N N   . SER A 328 ? 0.4637 2.4892 0.4894 -0.0900 0.0091  0.0903  1835 SER A N   
2356 C CA  . SER A 328 ? 0.4634 2.4904 0.4976 -0.0890 0.0109  0.0940  1835 SER A CA  
2357 C C   . SER A 328 ? 0.4647 2.4914 0.4982 -0.0869 0.0135  0.0948  1835 SER A C   
2358 O O   . SER A 328 ? 0.4653 2.4918 0.4934 -0.0842 0.0163  0.0922  1835 SER A O   
2359 C CB  . SER A 328 ? 0.4622 2.4910 0.4995 -0.0869 0.0140  0.0935  1835 SER A CB  
2360 O OG  . SER A 328 ? 0.4622 2.4923 0.5080 -0.0857 0.0164  0.0970  1835 SER A OG  
2361 N N   . VAL A 329 ? 0.4551 2.4907 0.4424 -0.0917 0.0081  0.0781  1836 VAL A N   
2362 C CA  . VAL A 329 ? 0.4565 2.4917 0.4433 -0.0900 0.0102  0.0791  1836 VAL A CA  
2363 C C   . VAL A 329 ? 0.4567 2.4931 0.4531 -0.0891 0.0126  0.0833  1836 VAL A C   
2364 O O   . VAL A 329 ? 0.4562 2.4930 0.4604 -0.0914 0.0104  0.0868  1836 VAL A O   
2365 C CB  . VAL A 329 ? 0.4577 2.4909 0.4411 -0.0922 0.0068  0.0794  1836 VAL A CB  
2366 C CG1 . VAL A 329 ? 0.4591 2.4919 0.4417 -0.0903 0.0091  0.0803  1836 VAL A CG1 
2367 C CG2 . VAL A 329 ? 0.4577 2.4895 0.4323 -0.0930 0.0048  0.0753  1836 VAL A CG2 
2368 N N   . GLY A 330 ? 0.4763 2.4745 0.4623 -0.0685 0.0310  0.0819  1837 GLY A N   
2369 C CA  . GLY A 330 ? 0.4771 2.4762 0.4716 -0.0675 0.0342  0.0856  1837 GLY A CA  
2370 C C   . GLY A 330 ? 0.4795 2.4773 0.4708 -0.0658 0.0368  0.0860  1837 GLY A C   
2371 O O   . GLY A 330 ? 0.4812 2.4781 0.4658 -0.0631 0.0401  0.0834  1837 GLY A O   
2372 N N   . VAL A 331 ? 0.4821 2.4848 0.4576 -0.0621 0.0476  0.0940  1838 VAL A N   
2373 C CA  . VAL A 331 ? 0.4845 2.4860 0.4578 -0.0606 0.0500  0.0948  1838 VAL A CA  
2374 C C   . VAL A 331 ? 0.4863 2.4882 0.4642 -0.0581 0.0559  0.0965  1838 VAL A C   
2375 O O   . VAL A 331 ? 0.4857 2.4889 0.4737 -0.0586 0.0571  0.0997  1838 VAL A O   
2376 C CB  . VAL A 331 ? 0.4845 2.4856 0.4622 -0.0631 0.0467  0.0982  1838 VAL A CB  
2377 C CG1 . VAL A 331 ? 0.4870 2.4870 0.4640 -0.0615 0.0496  0.0996  1838 VAL A CG1 
2378 C CG2 . VAL A 331 ? 0.4837 2.4836 0.4552 -0.0654 0.0414  0.0961  1838 VAL A CG2 
2379 N N   . CYS A 332 ? 0.5300 2.5837 0.4655 -0.0296 0.0746  0.0844  1839 CYS A N   
2380 C CA  . CYS A 332 ? 0.5329 2.5860 0.4702 -0.0272 0.0807  0.0852  1839 CYS A CA  
2381 C C   . CYS A 332 ? 0.5320 2.5864 0.4740 -0.0263 0.0832  0.0848  1839 CYS A C   
2382 O O   . CYS A 332 ? 0.5343 2.5884 0.4804 -0.0248 0.0882  0.0863  1839 CYS A O   
2383 C CB  . CYS A 332 ? 0.5346 2.5876 0.4793 -0.0273 0.0829  0.0895  1839 CYS A CB  
2384 S SG  . CYS A 332 ? 0.5377 2.5881 0.4747 -0.0266 0.0829  0.0894  1839 CYS A SG  
2385 N N   . THR A 333 ? 0.5452 2.5650 0.5108 -0.0239 0.0764  0.0392  1840 THR A N   
2386 C CA  . THR A 333 ? 0.5440 2.5652 0.5137 -0.0233 0.0781  0.0386  1840 THR A CA  
2387 C C   . THR A 333 ? 0.5424 2.5636 0.5042 -0.0233 0.0754  0.0344  1840 THR A C   
2388 O O   . THR A 333 ? 0.5409 2.5619 0.4981 -0.0251 0.0710  0.0331  1840 THR A O   
2389 C CB  . THR A 333 ? 0.5412 2.5646 0.5233 -0.0256 0.0758  0.0423  1840 THR A CB  
2390 O OG1 . THR A 333 ? 0.5423 2.5657 0.5320 -0.0262 0.0769  0.0465  1840 THR A OG1 
2391 C CG2 . THR A 333 ? 0.5407 2.5653 0.5288 -0.0247 0.0788  0.0425  1840 THR A CG2 
2392 N N   . PHE A 334 ? 0.5710 2.5658 0.5501 -0.0403 0.0700  -0.0144 1841 PHE A N   
2393 C CA  . PHE A 334 ? 0.5695 2.5645 0.5420 -0.0403 0.0679  -0.0184 1841 PHE A CA  
2394 C C   . PHE A 334 ? 0.5657 2.5623 0.5415 -0.0432 0.0625  -0.0181 1841 PHE A C   
2395 O O   . PHE A 334 ? 0.5641 2.5622 0.5493 -0.0450 0.0614  -0.0149 1841 PHE A O   
2396 C CB  . PHE A 334 ? 0.5705 2.5655 0.5434 -0.0381 0.0718  -0.0198 1841 PHE A CB  
2397 C CG  . PHE A 334 ? 0.5752 2.5677 0.5424 -0.0351 0.0769  -0.0210 1841 PHE A CG  
2398 C CD1 . PHE A 334 ? 0.5775 2.5676 0.5333 -0.0337 0.0768  -0.0244 1841 PHE A CD1 
2399 C CD2 . PHE A 334 ? 0.5778 2.5698 0.5510 -0.0340 0.0821  -0.0186 1841 PHE A CD2 
2400 C CE1 . PHE A 334 ? 0.5827 2.5698 0.5324 -0.0313 0.0812  -0.0254 1841 PHE A CE1 
2401 C CE2 . PHE A 334 ? 0.5831 2.5720 0.5501 -0.0313 0.0873  -0.0197 1841 PHE A CE2 
2402 C CZ  . PHE A 334 ? 0.5857 2.5720 0.5406 -0.0300 0.0865  -0.0230 1841 PHE A CZ  
2403 N N   . ALA A 335 ? 0.5187 2.5040 0.5301 -0.0303 0.0419  0.0304  1842 ALA A N   
2404 C CA  . ALA A 335 ? 0.5161 2.5021 0.5285 -0.0333 0.0368  0.0303  1842 ALA A CA  
2405 C C   . ALA A 335 ? 0.5141 2.5017 0.5328 -0.0342 0.0362  0.0310  1842 ALA A C   
2406 O O   . ALA A 335 ? 0.5129 2.5013 0.5391 -0.0368 0.0337  0.0340  1842 ALA A O   
2407 C CB  . ALA A 335 ? 0.5159 2.5008 0.5185 -0.0335 0.0346  0.0262  1842 ALA A CB  
2408 N N   . VAL A 336 ? 0.5762 2.4986 0.6930 0.0121  0.0832  0.0052  1843 VAL A N   
2409 C CA  . VAL A 336 ? 0.5745 2.4984 0.6972 0.0116  0.0830  0.0059  1843 VAL A CA  
2410 C C   . VAL A 336 ? 0.5760 2.5003 0.7036 0.0142  0.0885  0.0070  1843 VAL A C   
2411 O O   . VAL A 336 ? 0.5784 2.5014 0.7000 0.0171  0.0922  0.0048  1843 VAL A O   
2412 C CB  . VAL A 336 ? 0.5733 2.4972 0.6896 0.0116  0.0816  0.0019  1843 VAL A CB  
2413 C CG1 . VAL A 336 ? 0.5714 2.4969 0.6944 0.0105  0.0807  0.0027  1843 VAL A CG1 
2414 C CG2 . VAL A 336 ? 0.5726 2.4956 0.6828 0.0094  0.0772  0.0001  1843 VAL A CG2 
2415 N N   . GLY A 337 ? 0.6518 2.5789 0.8358 0.0381  0.1560  -0.0392 1844 GLY A N   
2416 C CA  . GLY A 337 ? 0.6533 2.5808 0.8438 0.0403  0.1613  -0.0377 1844 GLY A CA  
2417 C C   . GLY A 337 ? 0.6536 2.5812 0.8420 0.0423  0.1641  -0.0405 1844 GLY A C   
2418 O O   . GLY A 337 ? 0.6527 2.5801 0.8339 0.0423  0.1621  -0.0439 1844 GLY A O   
2419 N N   . PRO A 338 ? 0.8101 2.6315 1.0875 0.0636  0.2666  -0.1527 1845 PRO A N   
2420 C CA  . PRO A 338 ? 0.8111 2.6322 1.0868 0.0656  0.2700  -0.1552 1845 PRO A CA  
2421 C C   . PRO A 338 ? 0.8077 2.6306 1.0864 0.0640  0.2666  -0.1561 1845 PRO A C   
2422 O O   . PRO A 338 ? 0.8082 2.6308 1.0832 0.0657  0.2682  -0.1588 1845 PRO A O   
2423 C CB  . PRO A 338 ? 0.8134 2.6344 1.0981 0.0671  0.2757  -0.1526 1845 PRO A CB  
2424 C CG  . PRO A 338 ? 0.8119 2.6343 1.1064 0.0650  0.2739  -0.1481 1845 PRO A CG  
2425 C CD  . PRO A 338 ? 0.8113 2.6330 1.0984 0.0636  0.2696  -0.1485 1845 PRO A CD  
2426 N N   . GLU A 339 ? 0.8102 2.5851 1.2855 0.1686  0.3190  -0.0230 1846 GLU A N   
2427 C CA  . GLU A 339 ? 0.8074 2.5837 1.2859 0.1668  0.3154  -0.0233 1846 GLU A CA  
2428 C C   . GLU A 339 ? 0.8066 2.5823 1.2740 0.1667  0.3127  -0.0275 1846 GLU A C   
2429 O O   . GLU A 339 ? 0.8066 2.5823 1.2711 0.1682  0.3143  -0.0304 1846 GLU A O   
2430 C CB  . GLU A 339 ? 0.8054 2.5828 1.2926 0.1633  0.3106  -0.0195 1846 GLU A CB  
2431 C CG  . GLU A 339 ? 0.8032 2.5819 1.2967 0.1615  0.3075  -0.0186 1846 GLU A CG  
2432 C CD  . GLU A 339 ? 0.8021 2.5813 1.3053 0.1580  0.3028  -0.0142 1846 GLU A CD  
2433 O OE1 . GLU A 339 ? 0.8029 2.5818 1.3099 0.1573  0.3025  -0.0115 1846 GLU A OE1 
2434 O OE2 . GLU A 339 ? 0.8006 2.5804 1.3078 0.1560  0.2991  -0.0136 1846 GLU A OE2 
2435 N N   . GLN A 340 ? 0.7503 2.4980 1.1663 0.1213  0.2399  -0.0137 1847 GLN A N   
2436 C CA  . GLN A 340 ? 0.7497 2.4967 1.1557 0.1211  0.2375  -0.0176 1847 GLN A CA  
2437 C C   . GLN A 340 ? 0.7519 2.4974 1.1487 0.1242  0.2408  -0.0209 1847 GLN A C   
2438 O O   . GLN A 340 ? 0.7520 2.4971 1.1428 0.1254  0.2413  -0.0244 1847 GLN A O   
2439 C CB  . GLN A 340 ? 0.7488 2.4952 1.1521 0.1178  0.2324  -0.0171 1847 GLN A CB  
2440 C CG  . GLN A 340 ? 0.7482 2.4938 1.1422 0.1172  0.2299  -0.0209 1847 GLN A CG  
2441 C CD  . GLN A 340 ? 0.7466 2.4931 1.1420 0.1164  0.2285  -0.0222 1847 GLN A CD  
2442 O OE1 . GLN A 340 ? 0.7455 2.4930 1.1488 0.1146  0.2268  -0.0196 1847 GLN A OE1 
2443 N NE2 . GLN A 340 ? 0.7464 2.4926 1.1345 0.1177  0.2291  -0.0263 1847 GLN A NE2 
2444 N N   . GLY A 341 ? 0.7571 2.5384 0.9775 0.0403  0.1835  -0.1492 1848 GLY A N   
2445 C CA  . GLY A 341 ? 0.7602 2.5396 0.9726 0.0432  0.1870  -0.1516 1848 GLY A CA  
2446 C C   . GLY A 341 ? 0.7605 2.5387 0.9624 0.0441  0.1855  -0.1560 1848 GLY A C   
2447 O O   . GLY A 341 ? 0.7630 2.5397 0.9594 0.0467  0.1886  -0.1585 1848 GLY A O   
2448 N N   . GLY A 342 ? 0.7214 2.4847 0.8997 -0.0013 0.1248  -0.1457 1849 GLY A N   
2449 C CA  . GLY A 342 ? 0.7215 2.4837 0.8908 -0.0007 0.1233  -0.1498 1849 GLY A CA  
2450 C C   . GLY A 342 ? 0.7241 2.4843 0.8864 0.0007  0.1243  -0.1510 1849 GLY A C   
2451 O O   . GLY A 342 ? 0.7259 2.4847 0.8816 0.0028  0.1254  -0.1542 1849 GLY A O   
2452 N N   . CYS A 343 ? 0.6443 2.5304 0.6674 -0.0228 0.0419  -0.1278 1850 CYS A N   
2453 C CA  . CYS A 343 ? 0.6468 2.5309 0.6639 -0.0216 0.0425  -0.1286 1850 CYS A CA  
2454 C C   . CYS A 343 ? 0.6500 2.5330 0.6687 -0.0196 0.0467  -0.1263 1850 CYS A C   
2455 O O   . CYS A 343 ? 0.6504 2.5335 0.6731 -0.0205 0.0471  -0.1233 1850 CYS A O   
2456 C CB  . CYS A 343 ? 0.6455 2.5297 0.6627 -0.0241 0.0390  -0.1274 1850 CYS A CB  
2457 S SG  . CYS A 343 ? 0.6427 2.5275 0.6571 -0.0265 0.0344  -0.1301 1850 CYS A SG  
2458 N N   . LYS A 344 ? 0.7098 2.7015 0.6666 -0.0192 0.0559  -0.2032 1851 LYS A N   
2459 C CA  . LYS A 344 ? 0.7140 2.7038 0.6707 -0.0172 0.0604  -0.2017 1851 LYS A CA  
2460 C C   . LYS A 344 ? 0.7167 2.7043 0.6678 -0.0166 0.0601  -0.2016 1851 LYS A C   
2461 O O   . LYS A 344 ? 0.7167 2.7034 0.6611 -0.0166 0.0575  -0.2041 1851 LYS A O   
2462 C CB  . LYS A 344 ? 0.7173 2.7052 0.6698 -0.0147 0.0639  -0.2038 1851 LYS A CB  
2463 C CG  . LYS A 344 ? 0.7216 2.7077 0.6763 -0.0131 0.0693  -0.2018 1851 LYS A CG  
2464 C CD  . LYS A 344 ? 0.7265 2.7094 0.6740 -0.0104 0.0727  -0.2045 1851 LYS A CD  
2465 C CE  . LYS A 344 ? 0.7318 2.7121 0.6804 -0.0089 0.0785  -0.2023 1851 LYS A CE  
2466 N NZ  . LYS A 344 ? 0.7377 2.7140 0.6784 -0.0065 0.0820  -0.2049 1851 LYS A NZ  
2467 N N   . ASP A 345 ? 0.6502 2.7835 0.5255 -0.0172 0.0258  -0.1291 1852 ASP A N   
2468 C CA  . ASP A 345 ? 0.6528 2.7841 0.5240 -0.0168 0.0258  -0.1283 1852 ASP A CA  
2469 C C   . ASP A 345 ? 0.6493 2.7822 0.5221 -0.0193 0.0211  -0.1275 1852 ASP A C   
2470 O O   . ASP A 345 ? 0.6505 2.7827 0.5236 -0.0197 0.0210  -0.1256 1852 ASP A O   
2471 C CB  . ASP A 345 ? 0.6573 2.7851 0.5178 -0.0148 0.0265  -0.1315 1852 ASP A CB  
2472 C CG  . ASP A 345 ? 0.6626 2.7875 0.5204 -0.0125 0.0317  -0.1316 1852 ASP A CG  
2473 O OD1 . ASP A 345 ? 0.6636 2.7889 0.5277 -0.0122 0.0355  -0.1288 1852 ASP A OD1 
2474 O OD2 . ASP A 345 ? 0.6661 2.7882 0.5155 -0.0108 0.0320  -0.1344 1852 ASP A OD2 
2475 N N   . GLY A 346 ? 0.5784 2.6342 0.4826 -0.0373 0.0111  -0.0566 1853 GLY A N   
2476 C CA  . GLY A 346 ? 0.5757 2.6325 0.4803 -0.0397 0.0068  -0.0564 1853 GLY A CA  
2477 C C   . GLY A 346 ? 0.5744 2.6324 0.4867 -0.0419 0.0060  -0.0524 1853 GLY A C   
2478 O O   . GLY A 346 ? 0.5725 2.6323 0.4923 -0.0430 0.0062  -0.0502 1853 GLY A O   
2479 N N   . GLY A 347 ? 0.5237 2.6241 0.4238 -0.0471 0.0163  0.0116  1854 GLY A N   
2480 C CA  . GLY A 347 ? 0.5227 2.6239 0.4295 -0.0491 0.0149  0.0154  1854 GLY A CA  
2481 C C   . GLY A 347 ? 0.5196 2.6219 0.4284 -0.0522 0.0103  0.0155  1854 GLY A C   
2482 O O   . GLY A 347 ? 0.5185 2.6217 0.4343 -0.0544 0.0087  0.0187  1854 GLY A O   
2483 N N   . VAL A 348 ? 0.4882 2.5009 0.4290 -0.0719 0.0031  0.0320  1855 VAL A N   
2484 C CA  . VAL A 348 ? 0.4859 2.4991 0.4271 -0.0749 -0.0008 0.0313  1855 VAL A CA  
2485 C C   . VAL A 348 ? 0.4848 2.4984 0.4226 -0.0742 -0.0008 0.0277  1855 VAL A C   
2486 O O   . VAL A 348 ? 0.4858 2.4988 0.4181 -0.0719 0.0006  0.0248  1855 VAL A O   
2487 C CB  . VAL A 348 ? 0.4864 2.4981 0.4230 -0.0763 -0.0038 0.0300  1855 VAL A CB  
2488 C CG1 . VAL A 348 ? 0.4850 2.4965 0.4213 -0.0795 -0.0074 0.0293  1855 VAL A CG1 
2489 C CG2 . VAL A 348 ? 0.4878 2.4988 0.4273 -0.0768 -0.0038 0.0335  1855 VAL A CG2 
2490 N N   . CYS A 349 ? 0.5039 2.4450 0.5072 -0.0500 -0.0010 0.0153  1856 CYS A N   
2491 C CA  . CYS A 349 ? 0.5027 2.4444 0.5038 -0.0496 -0.0010 0.0122  1856 CYS A CA  
2492 C C   . CYS A 349 ? 0.5013 2.4429 0.5018 -0.0529 -0.0048 0.0115  1856 CYS A C   
2493 O O   . CYS A 349 ? 0.5007 2.4426 0.5064 -0.0553 -0.0068 0.0142  1856 CYS A O   
2494 C CB  . CYS A 349 ? 0.5022 2.4454 0.5087 -0.0483 0.0015  0.0137  1856 CYS A CB  
2495 S SG  . CYS A 349 ? 0.5005 2.4447 0.5059 -0.0480 0.0015  0.0108  1856 CYS A SG  
2496 N N   . LEU A 350 ? 0.4818 2.3379 0.5197 -0.0641 -0.0076 0.0392  1857 LEU A N   
2497 C CA  . LEU A 350 ? 0.4811 2.3366 0.5172 -0.0671 -0.0104 0.0377  1857 LEU A CA  
2498 C C   . LEU A 350 ? 0.4796 2.3364 0.5181 -0.0672 -0.0104 0.0373  1857 LEU A C   
2499 O O   . LEU A 350 ? 0.4790 2.3364 0.5149 -0.0653 -0.0087 0.0344  1857 LEU A O   
2500 C CB  . LEU A 350 ? 0.4817 2.3358 0.5109 -0.0668 -0.0110 0.0337  1857 LEU A CB  
2501 C CG  . LEU A 350 ? 0.4815 2.3346 0.5076 -0.0694 -0.0132 0.0313  1857 LEU A CG  
2502 C CD1 . LEU A 350 ? 0.4828 2.3341 0.5098 -0.0733 -0.0162 0.0335  1857 LEU A CD1 
2503 C CD2 . LEU A 350 ? 0.4820 2.3341 0.5023 -0.0684 -0.0130 0.0273  1857 LEU A CD2 
2504 N N   . LEU A 351 ? 0.4942 2.3652 0.6589 -0.0286 0.0142  0.0797  1858 LEU A N   
2505 C CA  . LEU A 351 ? 0.4928 2.3651 0.6610 -0.0289 0.0142  0.0798  1858 LEU A CA  
2506 C C   . LEU A 351 ? 0.4925 2.3641 0.6562 -0.0307 0.0125  0.0768  1858 LEU A C   
2507 O O   . LEU A 351 ? 0.4938 2.3633 0.6532 -0.0331 0.0104  0.0756  1858 LEU A O   
2508 C CB  . LEU A 351 ? 0.4927 2.3654 0.6686 -0.0311 0.0126  0.0842  1858 LEU A CB  
2509 C CG  . LEU A 351 ? 0.4925 2.3667 0.6756 -0.0292 0.0152  0.0874  1858 LEU A CG  
2510 C CD1 . LEU A 351 ? 0.4927 2.3668 0.6833 -0.0320 0.0125  0.0920  1858 LEU A CD1 
2511 C CD2 . LEU A 351 ? 0.4914 2.3674 0.6769 -0.0263 0.0184  0.0865  1858 LEU A CD2 
2512 N N   . SER A 352 ? 0.4946 2.2875 0.7947 0.0094  0.0205  0.0970  1859 SER A N   
2513 C CA  . SER A 352 ? 0.4942 2.2866 0.7916 0.0077  0.0188  0.0945  1859 SER A CA  
2514 C C   . SER A 352 ? 0.4929 2.2869 0.7961 0.0074  0.0187  0.0964  1859 SER A C   
2515 O O   . SER A 352 ? 0.4927 2.2863 0.7949 0.0054  0.0172  0.0952  1859 SER A O   
2516 C CB  . SER A 352 ? 0.4937 2.2863 0.7855 0.0100  0.0206  0.0900  1859 SER A CB  
2517 O OG  . SER A 352 ? 0.4949 2.2861 0.7819 0.0103  0.0205  0.0885  1859 SER A OG  
2518 N N   . GLY A 353 ? 0.5374 2.4297 0.9999 0.1121  0.0741  0.1272  1860 GLY A N   
2519 C CA  . GLY A 353 ? 0.5362 2.4300 1.0052 0.1123  0.0746  0.1289  1860 GLY A CA  
2520 C C   . GLY A 353 ? 0.5351 2.4303 1.0028 0.1154  0.0775  0.1261  1860 GLY A C   
2521 O O   . GLY A 353 ? 0.5344 2.4311 1.0076 0.1168  0.0794  0.1273  1860 GLY A O   
2522 N N   . THR A 354 ? 0.5905 2.2557 1.1167 0.1497  0.1010  -0.0130 1861 THR A N   
2523 C CA  . THR A 354 ? 0.5898 2.2558 1.1137 0.1524  0.1032  -0.0162 1861 THR A CA  
2524 C C   . THR A 354 ? 0.5909 2.2566 1.1110 0.1559  0.1059  -0.0178 1861 THR A C   
2525 O O   . THR A 354 ? 0.5912 2.2574 1.1120 0.1586  0.1086  -0.0186 1861 THR A O   
2526 C CB  . THR A 354 ? 0.5892 2.2547 1.1086 0.1509  0.1013  -0.0195 1861 THR A CB  
2527 O OG1 . THR A 354 ? 0.5888 2.2549 1.1055 0.1536  0.1032  -0.0227 1861 THR A OG1 
2528 C CG2 . THR A 354 ? 0.5903 2.2540 1.1041 0.1492  0.0996  -0.0209 1861 THR A CG2 
2529 N N   . LYS A 355 ? 0.5792 2.2275 0.9167 0.0690  0.0551  -0.1111 1862 LYS A N   
2530 C CA  . LYS A 355 ? 0.5807 2.2282 0.9138 0.0720  0.0573  -0.1129 1862 LYS A CA  
2531 C C   . LYS A 355 ? 0.5822 2.2292 0.9170 0.0728  0.0586  -0.1101 1862 LYS A C   
2532 O O   . LYS A 355 ? 0.5831 2.2304 0.9206 0.0749  0.0614  -0.1086 1862 LYS A O   
2533 C CB  . LYS A 355 ? 0.5810 2.2273 0.9078 0.0719  0.0559  -0.1164 1862 LYS A CB  
2534 C CG  . LYS A 355 ? 0.5798 2.2265 0.9046 0.0715  0.0551  -0.1198 1862 LYS A CG  
2535 C CD  . LYS A 355 ? 0.5803 2.2271 0.9032 0.0749  0.0571  -0.1220 1862 LYS A CD  
2536 C CE  . LYS A 355 ? 0.5790 2.2263 0.9009 0.0745  0.0562  -0.1248 1862 LYS A CE  
2537 N NZ  . LYS A 355 ? 0.5798 2.2269 0.8995 0.0776  0.0579  -0.1272 1862 LYS A NZ  
2538 N N   . GLY A 356 ? 0.5557 2.3274 0.7149 -0.0052 0.0242  -0.0590 1863 GLY A N   
2539 C CA  . GLY A 356 ? 0.5572 2.3282 0.7174 -0.0046 0.0252  -0.0566 1863 GLY A CA  
2540 C C   . GLY A 356 ? 0.5590 2.3286 0.7131 -0.0023 0.0263  -0.0588 1863 GLY A C   
2541 O O   . GLY A 356 ? 0.5598 2.3290 0.7104 0.0000  0.0277  -0.0615 1863 GLY A O   
2542 N N   . ALA A 357 ? 0.5392 2.3422 0.5683 -0.0515 -0.0193 -0.0582 1864 ALA A N   
2543 C CA  . ALA A 357 ? 0.5411 2.3425 0.5648 -0.0496 -0.0186 -0.0601 1864 ALA A CA  
2544 C C   . ALA A 357 ? 0.5426 2.3433 0.5675 -0.0496 -0.0182 -0.0571 1864 ALA A C   
2545 O O   . ALA A 357 ? 0.5420 2.3427 0.5689 -0.0520 -0.0201 -0.0555 1864 ALA A O   
2546 C CB  . ALA A 357 ? 0.5405 2.3412 0.5599 -0.0507 -0.0210 -0.0634 1864 ALA A CB  
2547 N N   . SER A 358 ? 0.5353 2.4764 0.4752 -0.0653 -0.0226 -0.0277 1865 SER A N   
2548 C CA  . SER A 358 ? 0.5372 2.4774 0.4782 -0.0649 -0.0215 -0.0250 1865 SER A CA  
2549 C C   . SER A 358 ? 0.5379 2.4768 0.4751 -0.0657 -0.0236 -0.0260 1865 SER A C   
2550 O O   . SER A 358 ? 0.5380 2.4761 0.4704 -0.0652 -0.0248 -0.0293 1865 SER A O   
2551 C CB  . SER A 358 ? 0.5403 2.4793 0.4795 -0.0619 -0.0178 -0.0247 1865 SER A CB  
2552 O OG  . SER A 358 ? 0.5427 2.4804 0.4816 -0.0615 -0.0166 -0.0225 1865 SER A OG  
2553 N N   . PHE A 359 ? 0.4921 2.4560 0.4068 -0.0948 -0.0225 0.0377  1866 PHE A N   
2554 C CA  . PHE A 359 ? 0.4930 2.4556 0.4046 -0.0954 -0.0241 0.0372  1866 PHE A CA  
2555 C C   . PHE A 359 ? 0.4959 2.4571 0.4066 -0.0938 -0.0221 0.0392  1866 PHE A C   
2556 O O   . PHE A 359 ? 0.4966 2.4569 0.4067 -0.0945 -0.0234 0.0401  1866 PHE A O   
2557 C CB  . PHE A 359 ? 0.4914 2.4544 0.4060 -0.0988 -0.0271 0.0388  1866 PHE A CB  
2558 C CG  . PHE A 359 ? 0.4899 2.4528 0.4021 -0.1005 -0.0295 0.0357  1866 PHE A CG  
2559 C CD1 . PHE A 359 ? 0.4881 2.4522 0.4024 -0.1018 -0.0300 0.0353  1866 PHE A CD1 
2560 C CD2 . PHE A 359 ? 0.4905 2.4520 0.3984 -0.1010 -0.0310 0.0333  1866 PHE A CD2 
2561 C CE1 . PHE A 359 ? 0.4872 2.4509 0.3989 -0.1036 -0.0320 0.0324  1866 PHE A CE1 
2562 C CE2 . PHE A 359 ? 0.4896 2.4507 0.3953 -0.1027 -0.0329 0.0304  1866 PHE A CE2 
2563 C CZ  . PHE A 359 ? 0.4880 2.4502 0.3954 -0.1040 -0.0333 0.0299  1866 PHE A CZ  
2564 N N   . GLY A 360 ? 0.5179 2.6178 0.3880 -0.0876 -0.0179 0.0414  1867 GLY A N   
2565 C CA  . GLY A 360 ? 0.5214 2.6195 0.3900 -0.0857 -0.0155 0.0432  1867 GLY A CA  
2566 C C   . GLY A 360 ? 0.5230 2.6213 0.3952 -0.0846 -0.0116 0.0456  1867 GLY A C   
2567 O O   . GLY A 360 ? 0.5210 2.6212 0.4003 -0.0860 -0.0113 0.0483  1867 GLY A O   
2568 N N   . ARG A 361 ? 0.5754 2.7650 0.4022 -0.0568 -0.0093 -0.0031 1868 ARG A N   
2569 C CA  . ARG A 361 ? 0.5780 2.7671 0.4072 -0.0553 -0.0049 -0.0010 1868 ARG A CA  
2570 C C   . ARG A 361 ? 0.5788 2.7680 0.4134 -0.0560 -0.0031 0.0030  1868 ARG A C   
2571 O O   . ARG A 361 ? 0.5810 2.7686 0.4126 -0.0557 -0.0035 0.0038  1868 ARG A O   
2572 C CB  . ARG A 361 ? 0.5833 2.7688 0.4045 -0.0527 -0.0023 -0.0031 1868 ARG A CB  
2573 C CG  . ARG A 361 ? 0.5830 2.7683 0.4003 -0.0518 -0.0028 -0.0065 1868 ARG A CG  
2574 C CD  . ARG A 361 ? 0.5886 2.7698 0.3966 -0.0494 -0.0019 -0.0088 1868 ARG A CD  
2575 N NE  . ARG A 361 ? 0.5942 2.7725 0.4003 -0.0478 0.0028  -0.0073 1868 ARG A NE  
2576 C CZ  . ARG A 361 ? 0.5991 2.7742 0.4013 -0.0471 0.0046  -0.0059 1868 ARG A CZ  
2577 N NH1 . ARG A 361 ? 0.5990 2.7736 0.3989 -0.0478 0.0017  -0.0057 1868 ARG A NH1 
2578 N NH2 . ARG A 361 ? 0.6046 2.7768 0.4049 -0.0458 0.0093  -0.0044 1868 ARG A NH2 
2579 N N   . LEU A 362 ? 0.5592 2.8065 0.4012 -0.0379 0.0242  0.0252  1869 LEU A N   
2580 C CA  . LEU A 362 ? 0.5595 2.8074 0.4085 -0.0386 0.0259  0.0294  1869 LEU A CA  
2581 C C   . LEU A 362 ? 0.5647 2.8096 0.4098 -0.0370 0.0293  0.0305  1869 LEU A C   
2582 O O   . LEU A 362 ? 0.5651 2.8100 0.4132 -0.0377 0.0291  0.0333  1869 LEU A O   
2583 C CB  . LEU A 362 ? 0.5580 2.8079 0.4161 -0.0390 0.0281  0.0318  1869 LEU A CB  
2584 C CG  . LEU A 362 ? 0.5583 2.8091 0.4255 -0.0399 0.0303  0.0362  1869 LEU A CG  
2585 C CD1 . LEU A 362 ? 0.5553 2.8075 0.4269 -0.0425 0.0259  0.0384  1869 LEU A CD1 
2586 C CD2 . LEU A 362 ? 0.5572 2.8097 0.4330 -0.0397 0.0329  0.0379  1869 LEU A CD2 
2587 N N   . GLN A 363 ? 0.5903 3.0034 0.3970 -0.0522 0.0337  0.0384  1870 GLN A N   
2588 C CA  . GLN A 363 ? 0.5964 3.0058 0.3979 -0.0505 0.0373  0.0392  1870 GLN A CA  
2589 C C   . GLN A 363 ? 0.5978 3.0054 0.3933 -0.0507 0.0344  0.0386  1870 GLN A C   
2590 O O   . GLN A 363 ? 0.6016 3.0071 0.3958 -0.0502 0.0366  0.0406  1870 GLN A O   
2591 C CB  . GLN A 363 ? 0.6013 3.0075 0.3955 -0.0482 0.0406  0.0368  1870 GLN A CB  
2592 C CG  . GLN A 363 ? 0.6018 3.0087 0.4015 -0.0476 0.0450  0.0377  1870 GLN A CG  
2593 C CD  . GLN A 363 ? 0.5970 3.0068 0.3998 -0.0482 0.0428  0.0359  1870 GLN A CD  
2594 O OE1 . GLN A 363 ? 0.5920 3.0044 0.3964 -0.0498 0.0381  0.0350  1870 GLN A OE1 
2595 N NE2 . GLN A 363 ? 0.5989 3.0081 0.4024 -0.0469 0.0465  0.0351  1870 GLN A NE2 
2596 N N   . SER A 364 ? 0.5779 2.9937 0.3890 -0.0498 0.0228  0.0940  1871 SER A N   
2597 C CA  . SER A 364 ? 0.5790 2.9932 0.3846 -0.0500 0.0198  0.0930  1871 SER A CA  
2598 C C   . SER A 364 ? 0.5765 2.9923 0.3875 -0.0520 0.0178  0.0958  1871 SER A C   
2599 O O   . SER A 364 ? 0.5773 2.9919 0.3847 -0.0522 0.0153  0.0952  1871 SER A O   
2600 C CB  . SER A 364 ? 0.5767 2.9912 0.3778 -0.0502 0.0159  0.0891  1871 SER A CB  
2601 O OG  . SER A 364 ? 0.5709 2.9890 0.3778 -0.0522 0.0131  0.0890  1871 SER A OG  
2602 N N   . MET A 365 ? 0.5468 2.8841 0.3984 -0.0403 0.0489  0.1028  1872 MET A N   
2603 C CA  . MET A 365 ? 0.5443 2.8833 0.4021 -0.0425 0.0467  0.1058  1872 MET A CA  
2604 C C   . MET A 365 ? 0.5476 2.8844 0.4024 -0.0421 0.0469  0.1071  1872 MET A C   
2605 O O   . MET A 365 ? 0.5523 2.8866 0.4045 -0.0405 0.0507  0.1083  1872 MET A O   
2606 C CB  . MET A 365 ? 0.5426 2.8838 0.4104 -0.0434 0.0487  0.1093  1872 MET A CB  
2607 C CG  . MET A 365 ? 0.5410 2.8834 0.4157 -0.0454 0.0471  0.1128  1872 MET A CG  
2608 S SD  . MET A 365 ? 0.5383 2.8835 0.4259 -0.0469 0.0482  0.1168  1872 MET A SD  
2609 C CE  . MET A 365 ? 0.5380 2.8835 0.4314 -0.0489 0.0461  0.1208  1872 MET A CE  
2610 N N   . LYS A 366 ? 0.6059 2.8905 0.4576 0.0975  0.0850  0.1951  1873 LYS A N   
2611 C CA  . LYS A 366 ? 0.6083 2.8912 0.4581 0.0975  0.0844  0.1967  1873 LYS A CA  
2612 C C   . LYS A 366 ? 0.6053 2.8899 0.4619 0.0951  0.0816  0.1993  1873 LYS A C   
2613 O O   . LYS A 366 ? 0.6015 2.8880 0.4604 0.0931  0.0782  0.1984  1873 LYS A O   
2614 C CB  . LYS A 366 ? 0.6098 2.8905 0.4510 0.0983  0.0820  0.1932  1873 LYS A CB  
2615 C CG  . LYS A 366 ? 0.6147 2.8923 0.4480 0.1008  0.0844  0.1914  1873 LYS A CG  
2616 C CD  . LYS A 366 ? 0.6161 2.8916 0.4420 0.1014  0.0813  0.1884  1873 LYS A CD  
2617 C CE  . LYS A 366 ? 0.6183 2.8922 0.4433 0.1010  0.0803  0.1902  1873 LYS A CE  
2618 N NZ  . LYS A 366 ? 0.6190 2.8912 0.4383 0.1014  0.0768  0.1872  1873 LYS A NZ  
2619 N N   . LEU A 367 ? 0.6517 2.6038 0.5455 0.1695  0.1309  0.2172  1874 LEU A N   
2620 C CA  . LEU A 367 ? 0.6495 2.6028 0.5496 0.1673  0.1281  0.2201  1874 LEU A CA  
2621 C C   . LEU A 367 ? 0.6514 2.6029 0.5477 0.1671  0.1264  0.2203  1874 LEU A C   
2622 O O   . LEU A 367 ? 0.6554 2.6048 0.5486 0.1687  0.1292  0.2212  1874 LEU A O   
2623 C CB  . LEU A 367 ? 0.6494 2.6041 0.5589 0.1668  0.1308  0.2243  1874 LEU A CB  
2624 C CG  . LEU A 367 ? 0.6461 2.6034 0.5629 0.1656  0.1307  0.2252  1874 LEU A CG  
2625 C CD1 . LEU A 367 ? 0.6468 2.6049 0.5733 0.1653  0.1339  0.2296  1874 LEU A CD1 
2626 C CD2 . LEU A 367 ? 0.6424 2.6010 0.5611 0.1627  0.1254  0.2247  1874 LEU A CD2 
2627 N N   . ASP A 368 ? 0.8175 2.7184 0.6667 0.4368  0.1732  0.2908  1875 ASP A N   
2628 C CA  . ASP A 368 ? 0.8190 2.7182 0.6651 0.4365  0.1711  0.2908  1875 ASP A CA  
2629 C C   . ASP A 368 ? 0.8167 2.7169 0.6682 0.4338  0.1676  0.2928  1875 ASP A C   
2630 O O   . ASP A 368 ? 0.8139 2.7157 0.6700 0.4318  0.1659  0.2933  1875 ASP A O   
2631 C CB  . ASP A 368 ? 0.8194 2.7172 0.6574 0.4374  0.1691  0.2863  1875 ASP A CB  
2632 C CG  . ASP A 368 ? 0.8229 2.7188 0.6545 0.4401  0.1720  0.2847  1875 ASP A CG  
2633 O OD1 . ASP A 368 ? 0.8266 2.7209 0.6573 0.4413  0.1748  0.2867  1875 ASP A OD1 
2634 O OD2 . ASP A 368 ? 0.8222 2.7181 0.6496 0.4408  0.1714  0.2811  1875 ASP A OD2 
2635 N N   . TYR A 369 ? 0.9469 2.4928 0.8179 0.5540  0.2132  0.2831  1876 TYR A N   
2636 C CA  . TYR A 369 ? 0.9455 2.4917 0.8211 0.5514  0.2098  0.2851  1876 TYR A CA  
2637 C C   . TYR A 369 ? 0.9452 2.4900 0.8155 0.5504  0.2060  0.2820  1876 TYR A C   
2638 O O   . TYR A 369 ? 0.9471 2.4903 0.8120 0.5518  0.2061  0.2802  1876 TYR A O   
2639 C CB  . TYR A 369 ? 0.9476 2.4932 0.8274 0.5515  0.2110  0.2892  1876 TYR A CB  
2640 C CG  . TYR A 369 ? 0.9463 2.4923 0.8326 0.5486  0.2080  0.2921  1876 TYR A CG  
2641 C CD1 . TYR A 369 ? 0.9469 2.4914 0.8311 0.5475  0.2047  0.2919  1876 TYR A CD1 
2642 C CD2 . TYR A 369 ? 0.9447 2.4924 0.8393 0.5472  0.2080  0.2953  1876 TYR A CD2 
2643 C CE1 . TYR A 369 ? 0.9463 2.4907 0.8360 0.5447  0.2016  0.2946  1876 TYR A CE1 
2644 C CE2 . TYR A 369 ? 0.9440 2.4917 0.8444 0.5446  0.2046  0.2982  1876 TYR A CE2 
2645 C CZ  . TYR A 369 ? 0.9450 2.4909 0.8425 0.5433  0.2014  0.2978  1876 TYR A CZ  
2646 O OH  . TYR A 369 ? 0.9448 2.4903 0.8477 0.5406  0.1979  0.3005  1876 TYR A OH  
2647 N N   . ARG A 370 ? 0.9833 2.7250 0.8520 0.6887  0.1764  0.2302  1877 ARG A N   
2648 C CA  . ARG A 370 ? 0.9833 2.7235 0.8479 0.6875  0.1730  0.2276  1877 ARG A CA  
2649 C C   . ARG A 370 ? 0.9844 2.7235 0.8523 0.6856  0.1710  0.2307  1877 ARG A C   
2650 O O   . ARG A 370 ? 0.9838 2.7235 0.8576 0.6837  0.1699  0.2338  1877 ARG A O   
2651 C CB  . ARG A 370 ? 0.9814 2.7218 0.8451 0.6854  0.1708  0.2251  1877 ARG A CB  
2652 C CG  . ARG A 370 ? 0.9816 2.7205 0.8389 0.6854  0.1692  0.2206  1877 ARG A CG  
2653 C CD  . ARG A 370 ? 0.9810 2.7189 0.8377 0.6822  0.1660  0.2193  1877 ARG A CD  
2654 N NE  . ARG A 370 ? 0.9793 2.7185 0.8368 0.6814  0.1662  0.2185  1877 ARG A NE  
2655 C CZ  . ARG A 370 ? 0.9792 2.7172 0.8349 0.6789  0.1641  0.2167  1877 ARG A CZ  
2656 N NH1 . ARG A 370 ? 0.9808 2.7164 0.8337 0.6769  0.1616  0.2152  1877 ARG A NH1 
2657 N NH2 . ARG A 370 ? 0.9778 2.7170 0.8344 0.6783  0.1643  0.2161  1877 ARG A NH2 
2658 N N   . HIS A 371 ? 1.3065 2.5877 1.1009 0.9210  0.2477  0.2649  1878 HIS A N   
2659 C CA  . HIS A 371 ? 1.3078 2.5878 1.1048 0.9196  0.2459  0.2676  1878 HIS A CA  
2660 C C   . HIS A 371 ? 1.3076 2.5861 1.1033 0.9168  0.2418  0.2662  1878 HIS A C   
2661 O O   . HIS A 371 ? 1.3084 2.5859 1.1074 0.9147  0.2398  0.2687  1878 HIS A O   
2662 C CB  . HIS A 371 ? 1.3101 2.5889 1.1041 0.9218  0.2471  0.2678  1878 HIS A CB  
2663 C CG  . HIS A 371 ? 1.3114 2.5909 1.1060 0.9243  0.2513  0.2694  1878 HIS A CG  
2664 N ND1 . HIS A 371 ? 1.3116 2.5914 1.1022 0.9264  0.2536  0.2671  1878 HIS A ND1 
2665 C CD2 . HIS A 371 ? 1.3130 2.5926 1.1116 0.9250  0.2535  0.2734  1878 HIS A CD2 
2666 C CE1 . HIS A 371 ? 1.3136 2.5934 1.1051 0.9282  0.2572  0.2693  1878 HIS A CE1 
2667 N NE2 . HIS A 371 ? 1.3145 2.5942 1.1109 0.9273  0.2574  0.2732  1878 HIS A NE2 
2668 N N   . GLN A 372 ? 1.3009 2.9198 1.0835 1.0403  0.1897  0.1629  1879 GLN A N   
2669 C CA  . GLN A 372 ? 1.3012 2.9183 1.0817 1.0375  0.1867  0.1607  1879 GLN A CA  
2670 C C   . GLN A 372 ? 1.3008 2.9178 1.0852 1.0345  0.1846  0.1631  1879 GLN A C   
2671 O O   . GLN A 372 ? 1.3023 2.9174 1.0880 1.0319  0.1818  0.1648  1879 GLN A O   
2672 C CB  . GLN A 372 ? 1.3006 2.9173 1.0756 1.0382  0.1870  0.1557  1879 GLN A CB  
2673 C CG  . GLN A 372 ? 1.3011 2.9158 1.0736 1.0353  0.1844  0.1533  1879 GLN A CG  
2674 C CD  . GLN A 372 ? 1.3031 2.9152 1.0727 1.0343  0.1827  0.1512  1879 GLN A CD  
2675 O OE1 . GLN A 372 ? 1.3046 2.9154 1.0761 1.0334  0.1812  0.1537  1879 GLN A OE1 
2676 N NE2 . GLN A 372 ? 1.3032 2.9144 1.0686 1.0348  0.1829  0.1467  1879 GLN A NE2 
2677 N N   . ASP A 373 ? 1.0326 2.6065 0.9602 0.7199  0.1332  0.0762  1880 ASP A N   
2678 C CA  . ASP A 373 ? 1.0323 2.6060 0.9632 0.7171  0.1312  0.0781  1880 ASP A CA  
2679 C C   . ASP A 373 ? 1.0317 2.6072 0.9704 0.7171  0.1319  0.0829  1880 ASP A C   
2680 O O   . ASP A 373 ? 1.0315 2.6070 0.9743 0.7149  0.1301  0.0851  1880 ASP A O   
2681 C CB  . ASP A 373 ? 1.0310 2.6054 0.9590 0.7170  0.1316  0.0750  1880 ASP A CB  
2682 C CG  . ASP A 373 ? 1.0317 2.6046 0.9605 0.7134  0.1287  0.0756  1880 ASP A CG  
2683 O OD1 . ASP A 373 ? 1.0336 2.6044 0.9643 0.7106  0.1257  0.0781  1880 ASP A OD1 
2684 O OD2 . ASP A 373 ? 1.0306 2.6041 0.9578 0.7131  0.1290  0.0737  1880 ASP A OD2 
2685 N N   . GLU A 374 ? 1.0198 2.1864 1.0520 0.5756  0.1624  0.0970  1881 GLU A N   
2686 C CA  . GLU A 374 ? 1.0194 2.1878 1.0593 0.5763  0.1642  0.1014  1881 GLU A CA  
2687 C C   . GLU A 374 ? 1.0176 2.1880 1.0606 0.5764  0.1658  0.1018  1881 GLU A C   
2688 O O   . GLU A 374 ? 1.0171 2.1881 1.0671 0.5748  0.1645  0.1052  1881 GLU A O   
2689 C CB  . GLU A 374 ? 1.0205 2.1878 1.0661 0.5737  0.1612  0.1054  1881 GLU A CB  
2690 C CG  . GLU A 374 ? 1.0224 2.1879 1.0663 0.5737  0.1601  0.1059  1881 GLU A CG  
2691 C CD  . GLU A 374 ? 1.0236 2.1881 1.0737 0.5712  0.1571  0.1102  1881 GLU A CD  
2692 O OE1 . GLU A 374 ? 1.0235 2.1876 1.0774 0.5685  0.1545  0.1120  1881 GLU A OE1 
2693 O OE2 . GLU A 374 ? 1.0249 2.1887 1.0762 0.5716  0.1572  0.1120  1881 GLU A OE2 
2694 N N   . ALA A 375 ? 0.7716 2.2526 0.8177 0.3664  0.1196  0.0945  1882 ALA A N   
2695 C CA  . ALA A 375 ? 0.7698 2.2526 0.8180 0.3666  0.1211  0.0943  1882 ALA A CA  
2696 C C   . ALA A 375 ? 0.7697 2.2541 0.8178 0.3700  0.1259  0.0939  1882 ALA A C   
2697 O O   . ALA A 375 ? 0.7712 2.2550 0.8161 0.3722  0.1280  0.0935  1882 ALA A O   
2698 C CB  . ALA A 375 ? 0.7691 2.2511 0.8115 0.3655  0.1191  0.0901  1882 ALA A CB  
2699 N N   . VAL A 376 ? 0.6588 2.2451 0.6991 0.1974  0.1274  0.1425  1883 VAL A N   
2700 C CA  . VAL A 376 ? 0.6590 2.2465 0.6989 0.2003  0.1321  0.1421  1883 VAL A CA  
2701 C C   . VAL A 376 ? 0.6577 2.2457 0.6923 0.2011  0.1324  0.1379  1883 VAL A C   
2702 O O   . VAL A 376 ? 0.6560 2.2446 0.6922 0.1993  0.1304  0.1375  1883 VAL A O   
2703 C CB  . VAL A 376 ? 0.6586 2.2478 0.7078 0.2004  0.1344  0.1462  1883 VAL A CB  
2704 C CG1 . VAL A 376 ? 0.6593 2.2493 0.7074 0.2035  0.1395  0.1453  1883 VAL A CG1 
2705 C CG2 . VAL A 376 ? 0.6600 2.2488 0.7148 0.2000  0.1345  0.1502  1883 VAL A CG2 
2706 N N   . VAL A 377 ? 0.6089 2.5390 0.5709 0.1697  0.1001  0.1517  1884 VAL A N   
2707 C CA  . VAL A 377 ? 0.6079 2.5383 0.5646 0.1706  0.1004  0.1475  1884 VAL A CA  
2708 C C   . VAL A 377 ? 0.6083 2.5396 0.5655 0.1730  0.1044  0.1474  1884 VAL A C   
2709 O O   . VAL A 377 ? 0.6108 2.5412 0.5656 0.1754  0.1075  0.1476  1884 VAL A O   
2710 C CB  . VAL A 377 ? 0.6091 2.5377 0.5578 0.1718  0.0993  0.1439  1884 VAL A CB  
2711 C CG1 . VAL A 377 ? 0.6077 2.5367 0.5519 0.1720  0.0988  0.1396  1884 VAL A CG1 
2712 C CG2 . VAL A 377 ? 0.6093 2.5367 0.5576 0.1696  0.0960  0.1440  1884 VAL A CG2 
2713 N N   . LEU A 378 ? 0.5310 2.5458 0.4717 -0.0212 0.0687  0.1011  1885 LEU A N   
2714 C CA  . LEU A 378 ? 0.5311 2.5468 0.4718 -0.0193 0.0720  0.1004  1885 LEU A CA  
2715 C C   . LEU A 378 ? 0.5303 2.5457 0.4642 -0.0185 0.0712  0.0957  1885 LEU A C   
2716 O O   . LEU A 378 ? 0.5285 2.5441 0.4612 -0.0205 0.0680  0.0939  1885 LEU A O   
2717 C CB  . LEU A 378 ? 0.5292 2.5469 0.4782 -0.0205 0.0724  0.1031  1885 LEU A CB  
2718 C CG  . LEU A 378 ? 0.5282 2.5471 0.4781 -0.0194 0.0746  0.1017  1885 LEU A CG  
2719 C CD1 . LEU A 378 ? 0.5309 2.5489 0.4774 -0.0162 0.0794  0.1009  1885 LEU A CD1 
2720 C CD2 . LEU A 378 ? 0.5264 2.5472 0.4860 -0.0209 0.0745  0.1050  1885 LEU A CD2 
2721 N N   . SER A 379 ? 0.5234 2.6929 0.4258 -0.0272 0.0454  0.1156  1886 SER A N   
2722 C CA  . SER A 379 ? 0.5229 2.6920 0.4191 -0.0263 0.0445  0.1114  1886 SER A CA  
2723 C C   . SER A 379 ? 0.5244 2.6933 0.4185 -0.0238 0.0480  0.1102  1886 SER A C   
2724 O O   . SER A 379 ? 0.5278 2.6952 0.4201 -0.0219 0.0511  0.1111  1886 SER A O   
2725 C CB  . SER A 379 ? 0.5244 2.6916 0.4142 -0.0256 0.0428  0.1089  1886 SER A CB  
2726 O OG  . SER A 379 ? 0.5280 2.6933 0.4152 -0.0238 0.0452  0.1099  1886 SER A OG  
2727 N N   . TYR A 380 ? 0.5071 2.7867 0.3877 -0.1011 0.0163  0.0778  1887 TYR A N   
2728 C CA  . TYR A 380 ? 0.5086 2.7876 0.3859 -0.0989 0.0189  0.0759  1887 TYR A CA  
2729 C C   . TYR A 380 ? 0.5089 2.7868 0.3790 -0.0980 0.0171  0.0716  1887 TYR A C   
2730 O O   . TYR A 380 ? 0.5071 2.7852 0.3762 -0.0996 0.0138  0.0701  1887 TYR A O   
2731 C CB  . TYR A 380 ? 0.5062 2.7874 0.3884 -0.0995 0.0198  0.0763  1887 TYR A CB  
2732 C CG  . TYR A 380 ? 0.5048 2.7877 0.3958 -0.1010 0.0205  0.0803  1887 TYR A CG  
2733 C CD1 . TYR A 380 ? 0.5072 2.7895 0.4017 -0.1001 0.0239  0.0835  1887 TYR A CD1 
2734 C CD2 . TYR A 380 ? 0.5014 2.7862 0.3974 -0.1036 0.0176  0.0812  1887 TYR A CD2 
2735 C CE1 . TYR A 380 ? 0.5059 2.7898 0.4095 -0.1014 0.0242  0.0873  1887 TYR A CE1 
2736 C CE2 . TYR A 380 ? 0.5003 2.7864 0.4049 -0.1052 0.0176  0.0850  1887 TYR A CE2 
2737 C CZ  . TYR A 380 ? 0.5024 2.7882 0.4111 -0.1040 0.0210  0.0882  1887 TYR A CZ  
2738 O OH  . TYR A 380 ? 0.5012 2.7885 0.4194 -0.1055 0.0209  0.0921  1887 TYR A OH  
2739 N N   . VAL A 381 ? 0.5290 2.7086 0.3931 -0.0987 -0.0080 0.1058  1888 VAL A N   
2740 C CA  . VAL A 381 ? 0.5297 2.7079 0.3875 -0.0976 -0.0097 0.1018  1888 VAL A CA  
2741 C C   . VAL A 381 ? 0.5311 2.7087 0.3859 -0.0957 -0.0077 0.0998  1888 VAL A C   
2742 O O   . VAL A 381 ? 0.5324 2.7101 0.3893 -0.0949 -0.0044 0.1015  1888 VAL A O   
2743 C CB  . VAL A 381 ? 0.5331 2.7086 0.3858 -0.0966 -0.0104 0.1014  1888 VAL A CB  
2744 C CG1 . VAL A 381 ? 0.5384 2.7111 0.3873 -0.0944 -0.0071 0.1027  1888 VAL A CG1 
2745 C CG2 . VAL A 381 ? 0.5329 2.7075 0.3809 -0.0961 -0.0133 0.0975  1888 VAL A CG2 
2746 N N   . ASN A 382 ? 0.5729 2.7216 0.3945 -0.0905 -0.0454 0.0754  1889 ASN A N   
2747 C CA  . ASN A 382 ? 0.5745 2.7222 0.3926 -0.0887 -0.0443 0.0731  1889 ASN A CA  
2748 C C   . ASN A 382 ? 0.5713 2.7216 0.3939 -0.0895 -0.0432 0.0732  1889 ASN A C   
2749 O O   . ASN A 382 ? 0.5732 2.7230 0.3959 -0.0882 -0.0403 0.0737  1889 ASN A O   
2750 C CB  . ASN A 382 ? 0.5805 2.7247 0.3936 -0.0864 -0.0412 0.0740  1889 ASN A CB  
2751 C CG  . ASN A 382 ? 0.5842 2.7255 0.3923 -0.0859 -0.0425 0.0740  1889 ASN A CG  
2752 O OD1 . ASN A 382 ? 0.5888 2.7274 0.3943 -0.0848 -0.0401 0.0759  1889 ASN A OD1 
2753 N ND2 . ASN A 382 ? 0.5825 2.7239 0.3894 -0.0864 -0.0461 0.0718  1889 ASN A ND2 
2754 N N   . GLY A 383 ? 0.5454 2.5630 0.4122 -0.0901 -0.0430 -0.0013 1890 GLY A N   
2755 C CA  . GLY A 383 ? 0.5422 2.5623 0.4134 -0.0910 -0.0428 -0.0013 1890 GLY A CA  
2756 C C   . GLY A 383 ? 0.5418 2.5618 0.4098 -0.0901 -0.0434 -0.0049 1890 GLY A C   
2757 O O   . GLY A 383 ? 0.5449 2.5630 0.4090 -0.0879 -0.0417 -0.0060 1890 GLY A O   
2758 N N   . ASP A 384 ? 0.5704 2.4234 0.4519 -0.0944 -0.0728 -0.0485 1891 ASP A N   
2759 C CA  . ASP A 384 ? 0.5696 2.4227 0.4486 -0.0938 -0.0738 -0.0522 1891 ASP A CA  
2760 C C   . ASP A 384 ? 0.5698 2.4217 0.4453 -0.0939 -0.0763 -0.0549 1891 ASP A C   
2761 O O   . ASP A 384 ? 0.5700 2.4214 0.4456 -0.0948 -0.0775 -0.0540 1891 ASP A O   
2762 C CB  . ASP A 384 ? 0.5660 2.4214 0.4491 -0.0957 -0.0746 -0.0524 1891 ASP A CB  
2763 C CG  . ASP A 384 ? 0.5661 2.4224 0.4518 -0.0947 -0.0720 -0.0511 1891 ASP A CG  
2764 O OD1 . ASP A 384 ? 0.5680 2.4232 0.4505 -0.0926 -0.0707 -0.0529 1891 ASP A OD1 
2765 O OD2 . ASP A 384 ? 0.5645 2.4224 0.4555 -0.0961 -0.0715 -0.0483 1891 ASP A OD2 
2766 N N   . ARG A 385 ? 0.5430 2.2718 0.4467 -0.1607 -0.0832 0.0248  1892 ARG A N   
2767 C CA  . ARG A 385 ? 0.5429 2.2708 0.4445 -0.1607 -0.0855 0.0219  1892 ARG A CA  
2768 C C   . ARG A 385 ? 0.5397 2.2692 0.4443 -0.1636 -0.0870 0.0215  1892 ARG A C   
2769 O O   . ARG A 385 ? 0.5372 2.2684 0.4445 -0.1652 -0.0870 0.0217  1892 ARG A O   
2770 C CB  . ARG A 385 ? 0.5434 2.2707 0.4426 -0.1592 -0.0861 0.0185  1892 ARG A CB  
2771 C CG  . ARG A 385 ? 0.5478 2.2724 0.4424 -0.1565 -0.0852 0.0183  1892 ARG A CG  
2772 C CD  . ARG A 385 ? 0.5486 2.2722 0.4408 -0.1552 -0.0868 0.0148  1892 ARG A CD  
2773 N NE  . ARG A 385 ? 0.5465 2.2717 0.4404 -0.1553 -0.0860 0.0137  1892 ARG A NE  
2774 C CZ  . ARG A 385 ? 0.5476 2.2719 0.4395 -0.1539 -0.0868 0.0110  1892 ARG A CZ  
2775 N NH1 . ARG A 385 ? 0.5511 2.2725 0.4390 -0.1523 -0.0883 0.0093  1892 ARG A NH1 
2776 N NH2 . ARG A 385 ? 0.5454 2.2714 0.4393 -0.1543 -0.0860 0.0104  1892 ARG A NH2 
2777 N N   . CYS A 386 ? 0.4822 2.0367 0.4278 -0.1791 -0.0570 0.1238  1893 CYS A N   
2778 C CA  . CYS A 386 ? 0.4802 2.0353 0.4277 -0.1817 -0.0584 0.1233  1893 CYS A CA  
2779 C C   . CYS A 386 ? 0.4783 2.0341 0.4262 -0.1826 -0.0590 0.1199  1893 CYS A C   
2780 O O   . CYS A 386 ? 0.4786 2.0343 0.4253 -0.1808 -0.0592 0.1176  1893 CYS A O   
2781 C CB  . CYS A 386 ? 0.4816 2.0351 0.4279 -0.1818 -0.0595 0.1230  1893 CYS A CB  
2782 S SG  . CYS A 386 ? 0.4833 2.0362 0.4300 -0.1817 -0.0588 0.1272  1893 CYS A SG  
2783 N N   . PRO A 387 ? 0.4686 1.7404 0.4485 -0.1369 -0.0665 0.0910  1894 PRO A N   
2784 C CA  . PRO A 387 ? 0.4671 1.7394 0.4474 -0.1381 -0.0667 0.0882  1894 PRO A CA  
2785 C C   . PRO A 387 ? 0.4675 1.7389 0.4468 -0.1374 -0.0675 0.0844  1894 PRO A C   
2786 O O   . PRO A 387 ? 0.4687 1.7388 0.4474 -0.1372 -0.0681 0.0841  1894 PRO A O   
2787 C CB  . PRO A 387 ? 0.4665 1.7387 0.4480 -0.1416 -0.0674 0.0895  1894 PRO A CB  
2788 C CG  . PRO A 387 ? 0.4671 1.7394 0.4497 -0.1421 -0.0672 0.0935  1894 PRO A CG  
2789 C CD  . PRO A 387 ? 0.4686 1.7402 0.4498 -0.1395 -0.0668 0.0936  1894 PRO A CD  
2790 N N   . PRO A 388 ? 0.4705 1.6022 0.4987 -0.1439 -0.0900 0.1216  1895 PRO A N   
2791 C CA  . PRO A 388 ? 0.4707 1.6017 0.4990 -0.1432 -0.0908 0.1180  1895 PRO A CA  
2792 C C   . PRO A 388 ? 0.4704 1.6007 0.4996 -0.1460 -0.0908 0.1164  1895 PRO A C   
2793 O O   . PRO A 388 ? 0.4699 1.6004 0.4992 -0.1486 -0.0904 0.1177  1895 PRO A O   
2794 C CB  . PRO A 388 ? 0.4695 1.6016 0.4984 -0.1422 -0.0904 0.1162  1895 PRO A CB  
2795 C CG  . PRO A 388 ? 0.4682 1.6017 0.4977 -0.1438 -0.0895 0.1184  1895 PRO A CG  
2796 C CD  . PRO A 388 ? 0.4691 1.6024 0.4981 -0.1438 -0.0892 0.1221  1895 PRO A CD  
2797 N N   . GLU A 389 ? 0.4564 1.3636 0.5754 -0.1416 -0.0570 0.2056  1896 GLU A N   
2798 C CA  . GLU A 389 ? 0.4566 1.3628 0.5766 -0.1440 -0.0566 0.2035  1896 GLU A CA  
2799 C C   . GLU A 389 ? 0.4562 1.3624 0.5782 -0.1432 -0.0566 0.1995  1896 GLU A C   
2800 O O   . GLU A 389 ? 0.4560 1.3627 0.5787 -0.1406 -0.0573 0.1986  1896 GLU A O   
2801 C CB  . GLU A 389 ? 0.4582 1.3628 0.5779 -0.1445 -0.0571 0.2040  1896 GLU A CB  
2802 C CG  . GLU A 389 ? 0.4588 1.3632 0.5769 -0.1457 -0.0573 0.2079  1896 GLU A CG  
2803 C CD  . GLU A 389 ? 0.4604 1.3632 0.5783 -0.1460 -0.0579 0.2082  1896 GLU A CD  
2804 O OE1 . GLU A 389 ? 0.4611 1.3631 0.5801 -0.1445 -0.0584 0.2062  1896 GLU A OE1 
2805 O OE2 . GLU A 389 ? 0.4611 1.3632 0.5781 -0.1481 -0.0579 0.2108  1896 GLU A OE2 
2806 N N   . THR A 390 ? 0.4559 1.2010 0.6603 -0.1216 -0.0390 0.2065  1897 THR A N   
2807 C CA  . THR A 390 ? 0.4557 1.2006 0.6630 -0.1208 -0.0386 0.2028  1897 THR A CA  
2808 C C   . THR A 390 ? 0.4569 1.2006 0.6661 -0.1195 -0.0395 0.2014  1897 THR A C   
2809 O O   . THR A 390 ? 0.4580 1.2008 0.6659 -0.1198 -0.0399 0.2032  1897 THR A O   
2810 C CB  . THR A 390 ? 0.4560 1.2001 0.6638 -0.1239 -0.0368 0.2005  1897 THR A CB  
2811 O OG1 . THR A 390 ? 0.4580 1.2000 0.6647 -0.1263 -0.0361 0.2005  1897 THR A OG1 
2812 C CG2 . THR A 390 ? 0.4552 1.2002 0.6608 -0.1256 -0.0362 0.2021  1897 THR A CG2 
2813 N N   . ASP A 391 ? 0.4724 1.2639 0.8636 -0.1336 -0.0533 0.3438  1898 ASP A N   
2814 C CA  . ASP A 391 ? 0.4736 1.2639 0.8675 -0.1323 -0.0544 0.3425  1898 ASP A CA  
2815 C C   . ASP A 391 ? 0.4749 1.2636 0.8697 -0.1343 -0.0531 0.3416  1898 ASP A C   
2816 O O   . ASP A 391 ? 0.4761 1.2636 0.8723 -0.1333 -0.0542 0.3415  1898 ASP A O   
2817 C CB  . ASP A 391 ? 0.4732 1.2638 0.8714 -0.1305 -0.0551 0.3393  1898 ASP A CB  
2818 C CG  . ASP A 391 ? 0.4727 1.2643 0.8698 -0.1279 -0.0570 0.3402  1898 ASP A CG  
2819 O OD1 . ASP A 391 ? 0.4736 1.2649 0.8673 -0.1264 -0.0582 0.3429  1898 ASP A OD1 
2820 O OD2 . ASP A 391 ? 0.4718 1.2641 0.8713 -0.1272 -0.0571 0.3382  1898 ASP A OD2 
2821 N N   . ASP A 392 ? 0.5071 1.0211 0.9893 -0.1304 0.0357  0.3163  1899 ASP A N   
2822 C CA  . ASP A 392 ? 0.5091 1.0209 0.9912 -0.1328 0.0373  0.3154  1899 ASP A CA  
2823 C C   . ASP A 392 ? 0.5102 1.0211 0.9885 -0.1339 0.0364  0.3188  1899 ASP A C   
2824 O O   . ASP A 392 ? 0.5118 1.0211 0.9905 -0.1347 0.0366  0.3185  1899 ASP A O   
2825 C CB  . ASP A 392 ? 0.5100 1.0207 0.9913 -0.1360 0.0399  0.3136  1899 ASP A CB  
2826 C CG  . ASP A 392 ? 0.5090 1.0205 0.9944 -0.1351 0.0408  0.3104  1899 ASP A CG  
2827 O OD1 . ASP A 392 ? 0.5089 1.0204 0.9993 -0.1333 0.0405  0.3079  1899 ASP A OD1 
2828 O OD2 . ASP A 392 ? 0.5082 1.0205 0.9923 -0.1362 0.0417  0.3102  1899 ASP A OD2 
2829 N N   . GLY A 393 ? 0.5187 1.0801 0.8750 -0.1616 0.0261  0.3163  1900 GLY A N   
2830 C CA  . GLY A 393 ? 0.5195 1.0804 0.8728 -0.1624 0.0253  0.3199  1900 GLY A CA  
2831 C C   . GLY A 393 ? 0.5199 1.0804 0.8698 -0.1652 0.0259  0.3221  1900 GLY A C   
2832 O O   . GLY A 393 ? 0.5207 1.0806 0.8685 -0.1664 0.0252  0.3251  1900 GLY A O   
2833 N N   . VAL A 394 ? 0.5130 0.9630 0.7000 -0.1655 0.0348  0.1800  1901 VAL A N   
2834 C CA  . VAL A 394 ? 0.5135 0.9631 0.6975 -0.1683 0.0350  0.1821  1901 VAL A CA  
2835 C C   . VAL A 394 ? 0.5111 0.9634 0.6952 -0.1667 0.0340  0.1846  1901 VAL A C   
2836 O O   . VAL A 394 ? 0.5094 0.9634 0.6951 -0.1647 0.0342  0.1833  1901 VAL A O   
2837 C CB  . VAL A 394 ? 0.5152 0.9629 0.6981 -0.1712 0.0368  0.1794  1901 VAL A CB  
2838 C CG1 . VAL A 394 ? 0.5136 0.9627 0.6997 -0.1694 0.0377  0.1762  1901 VAL A CG1 
2839 C CG2 . VAL A 394 ? 0.5162 0.9631 0.6957 -0.1741 0.0366  0.1817  1901 VAL A CG2 
2840 N N   . PRO A 395 ? 0.4772 1.1045 0.5656 -0.1546 -0.0182 0.1477  1902 PRO A N   
2841 C CA  . PRO A 395 ? 0.4753 1.1049 0.5642 -0.1530 -0.0187 0.1504  1902 PRO A CA  
2842 C C   . PRO A 395 ? 0.4742 1.1048 0.5632 -0.1541 -0.0183 0.1498  1902 PRO A C   
2843 O O   . PRO A 395 ? 0.4756 1.1045 0.5632 -0.1571 -0.0176 0.1486  1902 PRO A O   
2844 C CB  . PRO A 395 ? 0.4762 1.1052 0.5640 -0.1545 -0.0197 0.1544  1902 PRO A CB  
2845 C CG  . PRO A 395 ? 0.4789 1.1049 0.5646 -0.1579 -0.0196 0.1536  1902 PRO A CG  
2846 C CD  . PRO A 395 ? 0.4795 1.1046 0.5658 -0.1571 -0.0186 0.1499  1902 PRO A CD  
2847 N N   . CYS A 396 ? 0.4467 1.1131 0.5151 -0.1482 -0.0564 0.0494  1903 CYS A N   
2848 C CA  . CYS A 396 ? 0.4455 1.1131 0.5143 -0.1486 -0.0562 0.0491  1903 CYS A CA  
2849 C C   . CYS A 396 ? 0.4458 1.1133 0.5140 -0.1511 -0.0568 0.0524  1903 CYS A C   
2850 O O   . CYS A 396 ? 0.4465 1.1135 0.5144 -0.1516 -0.0575 0.0555  1903 CYS A O   
2851 C CB  . CYS A 396 ? 0.4436 1.1134 0.5140 -0.1451 -0.0560 0.0487  1903 CYS A CB  
2852 S SG  . CYS A 396 ? 0.4436 1.1133 0.5150 -0.1422 -0.0560 0.0450  1903 CYS A SG  
2853 N N   . VAL A 397 ? 0.4486 1.0575 0.5102 -0.1714 -0.0712 0.0296  1904 VAL A N   
2854 C CA  . VAL A 397 ? 0.4491 1.0577 0.5104 -0.1740 -0.0722 0.0328  1904 VAL A CA  
2855 C C   . VAL A 397 ? 0.4469 1.0579 0.5104 -0.1728 -0.0723 0.0339  1904 VAL A C   
2856 O O   . VAL A 397 ? 0.4461 1.0576 0.5098 -0.1727 -0.0716 0.0315  1904 VAL A O   
2857 C CB  . VAL A 397 ? 0.4520 1.0575 0.5103 -0.1782 -0.0724 0.0318  1904 VAL A CB  
2858 C CG1 . VAL A 397 ? 0.4528 1.0577 0.5110 -0.1809 -0.0738 0.0351  1904 VAL A CG1 
2859 C CG2 . VAL A 397 ? 0.4547 1.0574 0.5107 -0.1798 -0.0723 0.0311  1904 VAL A CG2 
2860 N N   . PHE A 398 ? 0.4295 1.1650 0.5569 -0.1412 -0.0819 -0.0262 1905 PHE A N   
2861 C CA  . PHE A 398 ? 0.4276 1.1653 0.5576 -0.1403 -0.0817 -0.0247 1905 PHE A CA  
2862 C C   . PHE A 398 ? 0.4283 1.1654 0.5595 -0.1431 -0.0832 -0.0212 1905 PHE A C   
2863 O O   . PHE A 398 ? 0.4297 1.1656 0.5608 -0.1448 -0.0842 -0.0187 1905 PHE A O   
2864 C CB  . PHE A 398 ? 0.4264 1.1659 0.5582 -0.1365 -0.0810 -0.0236 1905 PHE A CB  
2865 C CG  . PHE A 398 ? 0.4264 1.1659 0.5568 -0.1335 -0.0802 -0.0265 1905 PHE A CG  
2866 C CD1 . PHE A 398 ? 0.4257 1.1655 0.5556 -0.1328 -0.0798 -0.0300 1905 PHE A CD1 
2867 C CD2 . PHE A 398 ? 0.4272 1.1664 0.5570 -0.1316 -0.0799 -0.0258 1905 PHE A CD2 
2868 C CE1 . PHE A 398 ? 0.4259 1.1656 0.5550 -0.1303 -0.0794 -0.0326 1905 PHE A CE1 
2869 C CE2 . PHE A 398 ? 0.4276 1.1665 0.5561 -0.1290 -0.0795 -0.0284 1905 PHE A CE2 
2870 C CZ  . PHE A 398 ? 0.4269 1.1661 0.5553 -0.1283 -0.0794 -0.0318 1905 PHE A CZ  
2871 N N   . PRO A 399 ? 0.4230 1.1204 0.6257 -0.1324 -0.0944 -0.0776 1906 PRO A N   
2872 C CA  . PRO A 399 ? 0.4215 1.1202 0.6243 -0.1312 -0.0935 -0.0806 1906 PRO A CA  
2873 C C   . PRO A 399 ? 0.4230 1.1197 0.6228 -0.1339 -0.0935 -0.0834 1906 PRO A C   
2874 O O   . PRO A 399 ? 0.4256 1.1196 0.6231 -0.1374 -0.0945 -0.0824 1906 PRO A O   
2875 C CB  . PRO A 399 ? 0.4201 1.1205 0.6263 -0.1310 -0.0939 -0.0781 1906 PRO A CB  
2876 C CG  . PRO A 399 ? 0.4212 1.1208 0.6292 -0.1333 -0.0952 -0.0741 1906 PRO A CG  
2877 C CD  . PRO A 399 ? 0.4234 1.1206 0.6284 -0.1350 -0.0960 -0.0741 1906 PRO A CD  
2878 N N   . PHE A 400 ? 0.4284 0.9326 0.6213 -0.1377 -0.1032 -0.0949 1907 PHE A N   
2879 C CA  . PHE A 400 ? 0.4299 0.9322 0.6204 -0.1400 -0.1027 -0.0978 1907 PHE A CA  
2880 C C   . PHE A 400 ? 0.4283 0.9321 0.6203 -0.1395 -0.1023 -0.0992 1907 PHE A C   
2881 O O   . PHE A 400 ? 0.4259 0.9322 0.6204 -0.1365 -0.1020 -0.0992 1907 PHE A O   
2882 C CB  . PHE A 400 ? 0.4306 0.9320 0.6197 -0.1391 -0.1015 -0.1011 1907 PHE A CB  
2883 C CG  . PHE A 400 ? 0.4284 0.9319 0.6195 -0.1351 -0.1008 -0.1033 1907 PHE A CG  
2884 C CD1 . PHE A 400 ? 0.4274 0.9316 0.6195 -0.1342 -0.1001 -0.1063 1907 PHE A CD1 
2885 C CD2 . PHE A 400 ? 0.4277 0.9321 0.6196 -0.1322 -0.1009 -0.1023 1907 PHE A CD2 
2886 C CE1 . PHE A 400 ? 0.4258 0.9316 0.6197 -0.1307 -0.0997 -0.1083 1907 PHE A CE1 
2887 C CE2 . PHE A 400 ? 0.4264 0.9322 0.6196 -0.1287 -0.1005 -0.1044 1907 PHE A CE2 
2888 C CZ  . PHE A 400 ? 0.4255 0.9319 0.6197 -0.1280 -0.1001 -0.1072 1907 PHE A CZ  
2889 N N   . ILE A 401 ? 0.4454 0.8375 0.7570 -0.1101 -0.1421 -0.1387 1908 ILE A N   
2890 C CA  . ILE A 401 ? 0.4443 0.8374 0.7570 -0.1102 -0.1420 -0.1400 1908 ILE A CA  
2891 C C   . ILE A 401 ? 0.4436 0.8371 0.7565 -0.1085 -0.1404 -0.1442 1908 ILE A C   
2892 O O   . ILE A 401 ? 0.4451 0.8369 0.7565 -0.1090 -0.1394 -0.1464 1908 ILE A O   
2893 C CB  . ILE A 401 ? 0.4471 0.8375 0.7573 -0.1146 -0.1429 -0.1388 1908 ILE A CB  
2894 C CG1 . ILE A 401 ? 0.4488 0.8378 0.7584 -0.1168 -0.1448 -0.1348 1908 ILE A CG1 
2895 C CG2 . ILE A 401 ? 0.4455 0.8375 0.7578 -0.1145 -0.1430 -0.1391 1908 ILE A CG2 
2896 C CD1 . ILE A 401 ? 0.4530 0.8382 0.7588 -0.1217 -0.1462 -0.1337 1908 ILE A CD1 
2897 N N   . PHE A 402 ? 0.4497 0.7917 0.8352 -0.0799 -0.1623 -0.1969 1909 PHE A N   
2898 C CA  . PHE A 402 ? 0.4489 0.7915 0.8355 -0.0784 -0.1612 -0.2008 1909 PHE A CA  
2899 C C   . PHE A 402 ? 0.4475 0.7914 0.8358 -0.0781 -0.1612 -0.2014 1909 PHE A C   
2900 O O   . PHE A 402 ? 0.4454 0.7915 0.8358 -0.0759 -0.1618 -0.2002 1909 PHE A O   
2901 C CB  . PHE A 402 ? 0.4473 0.7914 0.8356 -0.0742 -0.1609 -0.2018 1909 PHE A CB  
2902 C CG  . PHE A 402 ? 0.4468 0.7912 0.8366 -0.0727 -0.1601 -0.2056 1909 PHE A CG  
2903 C CD1 . PHE A 402 ? 0.4485 0.7910 0.8376 -0.0738 -0.1591 -0.2081 1909 PHE A CD1 
2904 C CD2 . PHE A 402 ? 0.4449 0.7911 0.8370 -0.0700 -0.1605 -0.2070 1909 PHE A CD2 
2905 C CE1 . PHE A 402 ? 0.4480 0.7908 0.8396 -0.0724 -0.1583 -0.2116 1909 PHE A CE1 
2906 C CE2 . PHE A 402 ? 0.4446 0.7909 0.8386 -0.0685 -0.1600 -0.2104 1909 PHE A CE2 
2907 C CZ  . PHE A 402 ? 0.4460 0.7907 0.8402 -0.0697 -0.1589 -0.2126 1909 PHE A CZ  
2908 N N   . ASN A 403 ? 0.4760 0.7122 1.1162 -0.0759 -0.2307 -0.2072 1910 ASN A N   
2909 C CA  . ASN A 403 ? 0.4752 0.7122 1.1166 -0.0766 -0.2307 -0.2079 1910 ASN A CA  
2910 C C   . ASN A 403 ? 0.4752 0.7125 1.1165 -0.0782 -0.2321 -0.2045 1910 ASN A C   
2911 O O   . ASN A 403 ? 0.4753 0.7125 1.1169 -0.0798 -0.2324 -0.2046 1910 ASN A O   
2912 C CB  . ASN A 403 ? 0.4724 0.7120 1.1172 -0.0728 -0.2304 -0.2101 1910 ASN A CB  
2913 C CG  . ASN A 403 ? 0.4728 0.7118 1.1185 -0.0722 -0.2291 -0.2140 1910 ASN A CG  
2914 O OD1 . ASN A 403 ? 0.4716 0.7117 1.1192 -0.0690 -0.2292 -0.2153 1910 ASN A OD1 
2915 N ND2 . ASN A 403 ? 0.4749 0.7119 1.1194 -0.0753 -0.2277 -0.2155 1910 ASN A ND2 
2916 N N   . GLY A 404 ? 0.4834 0.7687 1.1951 -0.0586 -0.2460 -0.2037 1911 GLY A N   
2917 C CA  . GLY A 404 ? 0.4833 0.7690 1.1959 -0.0601 -0.2477 -0.2002 1911 GLY A CA  
2918 C C   . GLY A 404 ? 0.4812 0.7691 1.1967 -0.0573 -0.2483 -0.1976 1911 GLY A C   
2919 O O   . GLY A 404 ? 0.4802 0.7693 1.1983 -0.0573 -0.2492 -0.1950 1911 GLY A O   
2920 N N   . LYS A 405 ? 0.4778 0.9610 1.0564 0.0012  -0.2096 -0.3186 1912 LYS A N   
2921 C CA  . LYS A 405 ? 0.4764 0.9613 1.0570 0.0041  -0.2097 -0.3165 1912 LYS A CA  
2922 C C   . LYS A 405 ? 0.4778 0.9614 1.0568 0.0035  -0.2098 -0.3151 1912 LYS A C   
2923 O O   . LYS A 405 ? 0.4795 0.9612 1.0558 0.0021  -0.2094 -0.3167 1912 LYS A O   
2924 C CB  . LYS A 405 ? 0.4748 0.9614 1.0565 0.0081  -0.2085 -0.3190 1912 LYS A CB  
2925 C CG  . LYS A 405 ? 0.4732 0.9613 1.0569 0.0093  -0.2084 -0.3201 1912 LYS A CG  
2926 C CD  . LYS A 405 ? 0.4721 0.9618 1.0586 0.0109  -0.2085 -0.3176 1912 LYS A CD  
2927 C CE  . LYS A 405 ? 0.4708 0.9619 1.0586 0.0140  -0.2080 -0.3195 1912 LYS A CE  
2928 N NZ  . LYS A 405 ? 0.4702 0.9615 1.0585 0.0127  -0.2082 -0.3219 1912 LYS A NZ  
2929 N N   . SER A 406 ? 0.4440 1.0854 0.8434 -0.0254 -0.1497 -0.2497 1913 SER A N   
2930 C CA  . SER A 406 ? 0.4451 1.0856 0.8435 -0.0255 -0.1499 -0.2481 1913 SER A CA  
2931 C C   . SER A 406 ? 0.4442 1.0859 0.8430 -0.0216 -0.1486 -0.2488 1913 SER A C   
2932 O O   . SER A 406 ? 0.4430 1.0863 0.8437 -0.0189 -0.1480 -0.2486 1913 SER A O   
2933 C CB  . SER A 406 ? 0.4456 1.0859 0.8462 -0.0274 -0.1510 -0.2439 1913 SER A CB  
2934 O OG  . SER A 406 ? 0.4473 1.0860 0.8463 -0.0288 -0.1518 -0.2424 1913 SER A OG  
2935 N N   . TYR A 407 ? 0.4337 1.2356 0.7060 -0.0463 -0.1080 -0.2485 1914 TYR A N   
2936 C CA  . TYR A 407 ? 0.4335 1.2359 0.7054 -0.0427 -0.1071 -0.2495 1914 TYR A CA  
2937 C C   . TYR A 407 ? 0.4346 1.2363 0.7059 -0.0423 -0.1071 -0.2472 1914 TYR A C   
2938 O O   . TYR A 407 ? 0.4356 1.2361 0.7061 -0.0447 -0.1079 -0.2461 1914 TYR A O   
2939 C CB  . TYR A 407 ? 0.4337 1.2354 0.7040 -0.0419 -0.1070 -0.2536 1914 TYR A CB  
2940 C CG  . TYR A 407 ? 0.4326 1.2352 0.7038 -0.0414 -0.1067 -0.2560 1914 TYR A CG  
2941 C CD1 . TYR A 407 ? 0.4327 1.2347 0.7037 -0.0441 -0.1068 -0.2572 1914 TYR A CD1 
2942 C CD2 . TYR A 407 ? 0.4318 1.2356 0.7039 -0.0381 -0.1063 -0.2569 1914 TYR A CD2 
2943 C CE1 . TYR A 407 ? 0.4316 1.2345 0.7037 -0.0436 -0.1067 -0.2592 1914 TYR A CE1 
2944 C CE2 . TYR A 407 ? 0.4308 1.2353 0.7039 -0.0377 -0.1063 -0.2590 1914 TYR A CE2 
2945 C CZ  . TYR A 407 ? 0.4304 1.2348 0.7039 -0.0403 -0.1064 -0.2601 1914 TYR A CZ  
2946 O OH  . TYR A 407 ? 0.4294 1.2346 0.7041 -0.0399 -0.1064 -0.2621 1914 TYR A OH  
2947 N N   . GLU A 408 ? 0.4251 1.4908 0.6390 -0.0760 -0.0679 -0.1993 1915 GLU A N   
2948 C CA  . GLU A 408 ? 0.4261 1.4914 0.6399 -0.0754 -0.0676 -0.1968 1915 GLU A CA  
2949 C C   . GLU A 408 ? 0.4274 1.4915 0.6387 -0.0734 -0.0675 -0.1985 1915 GLU A C   
2950 O O   . GLU A 408 ? 0.4284 1.4917 0.6391 -0.0738 -0.0676 -0.1969 1915 GLU A O   
2951 C CB  . GLU A 408 ? 0.4260 1.4923 0.6420 -0.0737 -0.0666 -0.1941 1915 GLU A CB  
2952 C CG  . GLU A 408 ? 0.4250 1.4923 0.6447 -0.0759 -0.0670 -0.1912 1915 GLU A CG  
2953 C CD  . GLU A 408 ? 0.4258 1.4924 0.6468 -0.0777 -0.0676 -0.1879 1915 GLU A CD  
2954 O OE1 . GLU A 408 ? 0.4270 1.4925 0.6459 -0.0773 -0.0676 -0.1879 1915 GLU A OE1 
2955 O OE2 . GLU A 408 ? 0.4254 1.4924 0.6496 -0.0798 -0.0684 -0.1852 1915 GLU A OE2 
2956 N N   . GLU A 409 ? 0.4292 1.5908 0.5535 -0.0945 -0.0487 -0.1495 1916 GLU A N   
2957 C CA  . GLU A 409 ? 0.4306 1.5910 0.5528 -0.0927 -0.0491 -0.1513 1916 GLU A CA  
2958 C C   . GLU A 409 ? 0.4302 1.5902 0.5522 -0.0927 -0.0496 -0.1552 1916 GLU A C   
2959 O O   . GLU A 409 ? 0.4289 1.5897 0.5521 -0.0939 -0.0496 -0.1565 1916 GLU A O   
2960 C CB  . GLU A 409 ? 0.4322 1.5921 0.5530 -0.0895 -0.0485 -0.1507 1916 GLU A CB  
2961 C CG  . GLU A 409 ? 0.4326 1.5923 0.5525 -0.0872 -0.0485 -0.1534 1916 GLU A CG  
2962 C CD  . GLU A 409 ? 0.4316 1.5926 0.5529 -0.0869 -0.0476 -0.1527 1916 GLU A CD  
2963 O OE1 . GLU A 409 ? 0.4298 1.5922 0.5535 -0.0890 -0.0474 -0.1511 1916 GLU A OE1 
2964 O OE2 . GLU A 409 ? 0.4330 1.5934 0.5528 -0.0843 -0.0474 -0.1537 1916 GLU A OE2 
2965 N N   . CYS A 410 ? 0.4275 1.5098 0.5121 -0.1096 -0.0568 -0.1124 1917 CYS A N   
2966 C CA  . CYS A 410 ? 0.4273 1.5092 0.5126 -0.1093 -0.0575 -0.1160 1917 CYS A CA  
2967 C C   . CYS A 410 ? 0.4266 1.5093 0.5125 -0.1076 -0.0575 -0.1177 1917 CYS A C   
2968 O O   . CYS A 410 ? 0.4276 1.5101 0.5122 -0.1053 -0.0575 -0.1169 1917 CYS A O   
2969 C CB  . CYS A 410 ? 0.4291 1.5095 0.5134 -0.1074 -0.0582 -0.1171 1917 CYS A CB  
2970 S SG  . CYS A 410 ? 0.4300 1.5093 0.5138 -0.1092 -0.0584 -0.1155 1917 CYS A SG  
2971 N N   . ILE A 411 ? 0.4506 1.4738 0.5529 -0.0859 -0.0584 -0.2318 1918 ILE A N   
2972 C CA  . ILE A 411 ? 0.4498 1.4738 0.5531 -0.0847 -0.0584 -0.2334 1918 ILE A CA  
2973 C C   . ILE A 411 ? 0.4499 1.4734 0.5549 -0.0837 -0.0593 -0.2371 1918 ILE A C   
2974 O O   . ILE A 411 ? 0.4507 1.4731 0.5562 -0.0838 -0.0597 -0.2382 1918 ILE A O   
2975 C CB  . ILE A 411 ? 0.4481 1.4734 0.5525 -0.0869 -0.0577 -0.2327 1918 ILE A CB  
2976 C CG1 . ILE A 411 ? 0.4479 1.4727 0.5528 -0.0904 -0.0573 -0.2333 1918 ILE A CG1 
2977 C CG2 . ILE A 411 ? 0.4479 1.4740 0.5518 -0.0869 -0.0573 -0.2293 1918 ILE A CG2 
2978 C CD1 . ILE A 411 ? 0.4469 1.4724 0.5525 -0.0929 -0.0568 -0.2331 1918 ILE A CD1 
2979 N N   . ILE A 412 ? 0.4682 1.4642 0.5667 -0.0932 -0.0759 -0.2702 1919 ILE A N   
2980 C CA  . ILE A 412 ? 0.4683 1.4639 0.5691 -0.0922 -0.0768 -0.2734 1919 ILE A CA  
2981 C C   . ILE A 412 ? 0.4666 1.4635 0.5697 -0.0931 -0.0764 -0.2752 1919 ILE A C   
2982 O O   . ILE A 412 ? 0.4667 1.4637 0.5703 -0.0913 -0.0773 -0.2763 1919 ILE A O   
2983 C CB  . ILE A 412 ? 0.4704 1.4646 0.5700 -0.0890 -0.0786 -0.2741 1919 ILE A CB  
2984 C CG1 . ILE A 412 ? 0.4718 1.4656 0.5678 -0.0873 -0.0785 -0.2716 1919 ILE A CG1 
2985 C CG2 . ILE A 412 ? 0.4720 1.4646 0.5717 -0.0885 -0.0795 -0.2746 1919 ILE A CG2 
2986 C CD1 . ILE A 412 ? 0.4713 1.4659 0.5673 -0.0865 -0.0784 -0.2720 1919 ILE A CD1 
2987 N N   . GLU A 413 ? 0.4980 1.2945 0.6311 -0.0834 -0.0834 -0.3133 1920 GLU A N   
2988 C CA  . GLU A 413 ? 0.4968 1.2941 0.6321 -0.0846 -0.0828 -0.3151 1920 GLU A CA  
2989 C C   . GLU A 413 ? 0.4970 1.2936 0.6351 -0.0856 -0.0821 -0.3181 1920 GLU A C   
2990 O O   . GLU A 413 ? 0.4979 1.2934 0.6355 -0.0873 -0.0813 -0.3179 1920 GLU A O   
2991 C CB  . GLU A 413 ? 0.4960 1.2939 0.6301 -0.0873 -0.0816 -0.3131 1920 GLU A CB  
2992 C CG  . GLU A 413 ? 0.4953 1.2944 0.6283 -0.0864 -0.0820 -0.3106 1920 GLU A CG  
2993 C CD  . GLU A 413 ? 0.4941 1.2943 0.6288 -0.0859 -0.0821 -0.3118 1920 GLU A CD  
2994 O OE1 . GLU A 413 ? 0.4940 1.2941 0.6307 -0.0847 -0.0825 -0.3147 1920 GLU A OE1 
2995 O OE2 . GLU A 413 ? 0.4933 1.2945 0.6278 -0.0866 -0.0819 -0.3098 1920 GLU A OE2 
2996 N N   . SER A 414 ? 0.4922 1.2025 0.6146 -0.1070 -0.0878 -0.2842 1921 SER A N   
2997 C CA  . SER A 414 ? 0.4924 1.2021 0.6187 -0.1080 -0.0870 -0.2874 1921 SER A CA  
2998 C C   . SER A 414 ? 0.4937 1.2021 0.6209 -0.1075 -0.0873 -0.2881 1921 SER A C   
2999 O O   . SER A 414 ? 0.4942 1.2018 0.6241 -0.1090 -0.0857 -0.2901 1921 SER A O   
3000 C CB  . SER A 414 ? 0.4922 1.2018 0.6186 -0.1115 -0.0847 -0.2879 1921 SER A CB  
3001 O OG  . SER A 414 ? 0.4932 1.2019 0.6157 -0.1138 -0.0838 -0.2856 1921 SER A OG  
3002 N N   . ARG A 415 ? 0.4618 1.2706 0.5550 -0.1352 -0.0768 -0.2187 1922 ARG A N   
3003 C CA  . ARG A 415 ? 0.4631 1.2706 0.5574 -0.1343 -0.0776 -0.2193 1922 ARG A CA  
3004 C C   . ARG A 415 ? 0.4644 1.2712 0.5577 -0.1312 -0.0803 -0.2187 1922 ARG A C   
3005 O O   . ARG A 415 ? 0.4646 1.2717 0.5547 -0.1298 -0.0812 -0.2170 1922 ARG A O   
3006 C CB  . ARG A 415 ? 0.4638 1.2706 0.5551 -0.1365 -0.0763 -0.2173 1922 ARG A CB  
3007 C CG  . ARG A 415 ? 0.4641 1.2702 0.5571 -0.1395 -0.0740 -0.2189 1922 ARG A CG  
3008 C CD  . ARG A 415 ? 0.4650 1.2702 0.5540 -0.1419 -0.0728 -0.2167 1922 ARG A CD  
3009 N NE  . ARG A 415 ? 0.4661 1.2700 0.5555 -0.1451 -0.0705 -0.2182 1922 ARG A NE  
3010 C CZ  . ARG A 415 ? 0.4664 1.2700 0.5536 -0.1479 -0.0689 -0.2177 1922 ARG A CZ  
3011 N NH1 . ARG A 415 ? 0.4652 1.2702 0.5504 -0.1477 -0.0698 -0.2155 1922 ARG A NH1 
3012 N NH2 . ARG A 415 ? 0.4684 1.2700 0.5552 -0.1509 -0.0666 -0.2193 1922 ARG A NH2 
3013 N N   . ALA A 416 ? 0.4667 1.4631 0.5455 -0.1605 -0.0798 -0.1853 1923 ALA A N   
3014 C CA  . ALA A 416 ? 0.4687 1.4637 0.5466 -0.1574 -0.0826 -0.1851 1923 ALA A CA  
3015 C C   . ALA A 416 ? 0.4703 1.4643 0.5428 -0.1568 -0.0832 -0.1820 1923 ALA A C   
3016 O O   . ALA A 416 ? 0.4712 1.4650 0.5398 -0.1554 -0.0838 -0.1803 1923 ALA A O   
3017 C CB  . ALA A 416 ? 0.4696 1.4635 0.5528 -0.1567 -0.0842 -0.1876 1923 ALA A CB  
3018 N N   . LYS A 417 ? 0.4373 1.5471 0.5317 -0.1553 -0.0732 -0.0860 1924 LYS A N   
3019 C CA  . LYS A 417 ? 0.4387 1.5477 0.5286 -0.1547 -0.0734 -0.0830 1924 LYS A CA  
3020 C C   . LYS A 417 ? 0.4373 1.5476 0.5242 -0.1569 -0.0711 -0.0807 1924 LYS A C   
3021 O O   . LYS A 417 ? 0.4354 1.5470 0.5239 -0.1589 -0.0694 -0.0813 1924 LYS A O   
3022 C CB  . LYS A 417 ? 0.4398 1.5475 0.5314 -0.1550 -0.0740 -0.0834 1924 LYS A CB  
3023 C CG  . LYS A 417 ? 0.4419 1.5483 0.5291 -0.1541 -0.0747 -0.0807 1924 LYS A CG  
3024 C CD  . LYS A 417 ? 0.4447 1.5493 0.5290 -0.1512 -0.0772 -0.0799 1924 LYS A CD  
3025 C CE  . LYS A 417 ? 0.4469 1.5502 0.5259 -0.1507 -0.0772 -0.0768 1924 LYS A CE  
3026 N NZ  . LYS A 417 ? 0.4505 1.5515 0.5254 -0.1482 -0.0793 -0.0760 1924 LYS A NZ  
3027 N N   . LEU A 418 ? 0.4362 1.5601 0.5279 -0.1369 -0.0627 -0.1050 1925 LEU A N   
3028 C CA  . LEU A 418 ? 0.4351 1.5602 0.5244 -0.1386 -0.0610 -0.1023 1925 LEU A CA  
3029 C C   . LEU A 418 ? 0.4342 1.5595 0.5244 -0.1414 -0.0597 -0.1019 1925 LEU A C   
3030 O O   . LEU A 418 ? 0.4353 1.5595 0.5255 -0.1416 -0.0599 -0.1018 1925 LEU A O   
3031 C CB  . LEU A 418 ? 0.4369 1.5612 0.5224 -0.1369 -0.0614 -0.0995 1925 LEU A CB  
3032 C CG  . LEU A 418 ? 0.4387 1.5621 0.5220 -0.1342 -0.0623 -0.0996 1925 LEU A CG  
3033 C CD1 . LEU A 418 ? 0.4422 1.5632 0.5219 -0.1323 -0.0635 -0.0980 1925 LEU A CD1 
3034 C CD2 . LEU A 418 ? 0.4375 1.5623 0.5198 -0.1347 -0.0610 -0.0980 1925 LEU A CD2 
3035 N N   . TRP A 419 ? 0.4151 1.2659 0.5255 -0.1102 -0.0644 -0.0825 1926 TRP A N   
3036 C CA  . TRP A 419 ? 0.4150 1.2653 0.5256 -0.1133 -0.0631 -0.0825 1926 TRP A CA  
3037 C C   . TRP A 419 ? 0.4146 1.2654 0.5229 -0.1155 -0.0623 -0.0794 1926 TRP A C   
3038 O O   . TRP A 419 ? 0.4137 1.2658 0.5214 -0.1147 -0.0625 -0.0777 1926 TRP A O   
3039 C CB  . TRP A 419 ? 0.4144 1.2648 0.5276 -0.1149 -0.0621 -0.0856 1926 TRP A CB  
3040 C CG  . TRP A 419 ? 0.4130 1.2647 0.5263 -0.1155 -0.0617 -0.0855 1926 TRP A CG  
3041 C CD1 . TRP A 419 ? 0.4121 1.2648 0.5265 -0.1133 -0.0625 -0.0864 1926 TRP A CD1 
3042 C CD2 . TRP A 419 ? 0.4127 1.2645 0.5247 -0.1186 -0.0604 -0.0846 1926 TRP A CD2 
3043 N NE1 . TRP A 419 ? 0.4109 1.2647 0.5252 -0.1147 -0.0617 -0.0860 1926 TRP A NE1 
3044 C CE2 . TRP A 419 ? 0.4114 1.2645 0.5242 -0.1181 -0.0606 -0.0847 1926 TRP A CE2 
3045 C CE3 . TRP A 419 ? 0.4139 1.2644 0.5240 -0.1218 -0.0595 -0.0834 1926 TRP A CE3 
3046 C CZ2 . TRP A 419 ? 0.4110 1.2644 0.5229 -0.1207 -0.0597 -0.0839 1926 TRP A CZ2 
3047 C CZ3 . TRP A 419 ? 0.4140 1.2643 0.5227 -0.1244 -0.0588 -0.0825 1926 TRP A CZ3 
3048 C CH2 . TRP A 419 ? 0.4124 1.2643 0.5223 -0.1238 -0.0590 -0.0828 1926 TRP A CH2 
3049 N N   . CYS A 420 ? 0.4148 1.1443 0.5307 -0.1142 -0.0641 -0.0785 1927 CYS A N   
3050 C CA  . CYS A 420 ? 0.4149 1.1444 0.5289 -0.1167 -0.0637 -0.0755 1927 CYS A CA  
3051 C C   . CYS A 420 ? 0.4160 1.1440 0.5293 -0.1203 -0.0627 -0.0767 1927 CYS A C   
3052 O O   . CYS A 420 ? 0.4167 1.1437 0.5311 -0.1208 -0.0619 -0.0798 1927 CYS A O   
3053 C CB  . CYS A 420 ? 0.4157 1.1448 0.5283 -0.1164 -0.0644 -0.0725 1927 CYS A CB  
3054 S SG  . CYS A 420 ? 0.4177 1.1445 0.5297 -0.1178 -0.0643 -0.0736 1927 CYS A SG  
3055 N N   . SER A 421 ? 0.4316 0.9241 0.5245 -0.1404 -0.0562 -0.0560 1928 SER A N   
3056 C CA  . SER A 421 ? 0.4339 0.9239 0.5247 -0.1442 -0.0555 -0.0566 1928 SER A CA  
3057 C C   . SER A 421 ? 0.4359 0.9240 0.5248 -0.1456 -0.0559 -0.0549 1928 SER A C   
3058 O O   . SER A 421 ? 0.4352 0.9242 0.5244 -0.1439 -0.0568 -0.0524 1928 SER A O   
3059 C CB  . SER A 421 ? 0.4341 0.9240 0.5237 -0.1467 -0.0557 -0.0549 1928 SER A CB  
3060 O OG  . SER A 421 ? 0.4371 0.9240 0.5239 -0.1507 -0.0549 -0.0559 1928 SER A OG  
3061 N N   . THR A 422 ? 0.4818 0.8387 0.5263 -0.1955 -0.0324 0.0245  1929 THR A N   
3062 C CA  . THR A 422 ? 0.4843 0.8389 0.5264 -0.1973 -0.0328 0.0261  1929 THR A CA  
3063 C C   . THR A 422 ? 0.4871 0.8391 0.5256 -0.2014 -0.0333 0.0281  1929 THR A C   
3064 O O   . THR A 422 ? 0.4898 0.8392 0.5258 -0.2036 -0.0337 0.0295  1929 THR A O   
3065 C CB  . THR A 422 ? 0.4861 0.8387 0.5284 -0.1975 -0.0313 0.0229  1929 THR A CB  
3066 O OG1 . THR A 422 ? 0.4871 0.8386 0.5297 -0.1987 -0.0296 0.0195  1929 THR A OG1 
3067 C CG2 . THR A 422 ? 0.4839 0.8385 0.5296 -0.1934 -0.0318 0.0220  1929 THR A CG2 
3068 N N   . THR A 423 ? 0.5227 0.7565 0.5123 -0.2353 -0.0496 0.0055  1930 THR A N   
3069 C CA  . THR A 423 ? 0.5254 0.7568 0.5117 -0.2391 -0.0505 0.0078  1930 THR A CA  
3070 C C   . THR A 423 ? 0.5228 0.7569 0.5113 -0.2382 -0.0522 0.0109  1930 THR A C   
3071 O O   . THR A 423 ? 0.5192 0.7568 0.5111 -0.2346 -0.0522 0.0111  1930 THR A O   
3072 C CB  . THR A 423 ? 0.5284 0.7570 0.5118 -0.2421 -0.0491 0.0052  1930 THR A CB  
3073 O OG1 . THR A 423 ? 0.5254 0.7567 0.5119 -0.2400 -0.0482 0.0032  1930 THR A OG1 
3074 C CG2 . THR A 423 ? 0.5316 0.7570 0.5130 -0.2433 -0.0469 0.0020  1930 THR A CG2 
3075 N N   . ALA A 424 ? 0.5084 0.7879 0.5462 -0.2380 -0.0903 0.0103  1931 ALA A N   
3076 C CA  . ALA A 424 ? 0.5063 0.7880 0.5465 -0.2375 -0.0917 0.0131  1931 ALA A CA  
3077 C C   . ALA A 424 ? 0.5045 0.7879 0.5461 -0.2366 -0.0908 0.0110  1931 ALA A C   
3078 O O   . ALA A 424 ? 0.5017 0.7879 0.5464 -0.2349 -0.0913 0.0126  1931 ALA A O   
3079 C CB  . ALA A 424 ? 0.5096 0.7884 0.5475 -0.2416 -0.0939 0.0164  1931 ALA A CB  
3080 N N   . ASP A 425 ? 0.5016 0.7283 0.6219 -0.2166 -0.0837 -0.0346 1932 ASP A N   
3081 C CA  . ASP A 425 ? 0.5004 0.7282 0.6217 -0.2161 -0.0826 -0.0368 1932 ASP A CA  
3082 C C   . ASP A 425 ? 0.5004 0.7280 0.6220 -0.2151 -0.0803 -0.0412 1932 ASP A C   
3083 O O   . ASP A 425 ? 0.5039 0.7281 0.6225 -0.2172 -0.0790 -0.0430 1932 ASP A O   
3084 C CB  . ASP A 425 ? 0.5038 0.7286 0.6217 -0.2205 -0.0834 -0.0359 1932 ASP A CB  
3085 C CG  . ASP A 425 ? 0.5019 0.7285 0.6217 -0.2199 -0.0829 -0.0370 1932 ASP A CG  
3086 O OD1 . ASP A 425 ? 0.4983 0.7281 0.6217 -0.2166 -0.0819 -0.0390 1932 ASP A OD1 
3087 O OD2 . ASP A 425 ? 0.5044 0.7289 0.6218 -0.2231 -0.0839 -0.0357 1932 ASP A OD2 
3088 N N   . TYR A 426 ? 0.4771 0.6990 0.6482 -0.1856 -0.0566 -0.0829 1933 TYR A N   
3089 C CA  . TYR A 426 ? 0.4768 0.6988 0.6494 -0.1844 -0.0546 -0.0870 1933 TYR A CA  
3090 C C   . TYR A 426 ? 0.4785 0.6990 0.6499 -0.1869 -0.0533 -0.0891 1933 TYR A C   
3091 O O   . TYR A 426 ? 0.4812 0.6991 0.6513 -0.1886 -0.0513 -0.0918 1933 TYR A O   
3092 C CB  . TYR A 426 ? 0.4727 0.6985 0.6498 -0.1799 -0.0549 -0.0879 1933 TYR A CB  
3093 C CG  . TYR A 426 ? 0.4721 0.6983 0.6518 -0.1783 -0.0533 -0.0921 1933 TYR A CG  
3094 C CD1 . TYR A 426 ? 0.4726 0.6981 0.6536 -0.1770 -0.0527 -0.0940 1933 TYR A CD1 
3095 C CD2 . TYR A 426 ? 0.4712 0.6982 0.6525 -0.1783 -0.0527 -0.0939 1933 TYR A CD2 
3096 C CE1 . TYR A 426 ? 0.4720 0.6979 0.6565 -0.1756 -0.0513 -0.0976 1933 TYR A CE1 
3097 C CE2 . TYR A 426 ? 0.4706 0.6980 0.6551 -0.1771 -0.0513 -0.0974 1933 TYR A CE2 
3098 C CZ  . TYR A 426 ? 0.4710 0.6979 0.6573 -0.1756 -0.0507 -0.0993 1933 TYR A CZ  
3099 O OH  . TYR A 426 ? 0.4705 0.6977 0.6608 -0.1745 -0.0496 -0.1028 1933 TYR A OH  
3100 N N   . ASP A 427 ? 0.4986 0.6545 0.8487 -0.1975 -0.0681 -0.0689 1934 ASP A N   
3101 C CA  . ASP A 427 ? 0.5002 0.6547 0.8491 -0.1999 -0.0671 -0.0705 1934 ASP A CA  
3102 C C   . ASP A 427 ? 0.5058 0.6553 0.8493 -0.2045 -0.0659 -0.0710 1934 ASP A C   
3103 O O   . ASP A 427 ? 0.5082 0.6556 0.8502 -0.2064 -0.0640 -0.0734 1934 ASP A O   
3104 C CB  . ASP A 427 ? 0.4988 0.6548 0.8482 -0.2002 -0.0690 -0.0678 1934 ASP A CB  
3105 C CG  . ASP A 427 ? 0.4939 0.6544 0.8482 -0.1958 -0.0697 -0.0675 1934 ASP A CG  
3106 O OD1 . ASP A 427 ? 0.4919 0.6541 0.8489 -0.1929 -0.0688 -0.0701 1934 ASP A OD1 
3107 O OD2 . ASP A 427 ? 0.4924 0.6545 0.8478 -0.1957 -0.0714 -0.0649 1934 ASP A OD2 
3108 N N   . ARG A 428 ? 0.5900 0.6643 0.7183 -0.2592 -0.0348 0.0313  1935 ARG A N   
3109 C CA  . ARG A 428 ? 0.5962 0.6650 0.7183 -0.2639 -0.0342 0.0315  1935 ARG A CA  
3110 C C   . ARG A 428 ? 0.5989 0.6651 0.7195 -0.2644 -0.0318 0.0286  1935 ARG A C   
3111 O O   . ARG A 428 ? 0.6042 0.6658 0.7203 -0.2678 -0.0298 0.0269  1935 ARG A O   
3112 C CB  . ARG A 428 ? 0.5979 0.6652 0.7172 -0.2660 -0.0372 0.0357  1935 ARG A CB  
3113 C CG  . ARG A 428 ? 0.6048 0.6661 0.7171 -0.2714 -0.0375 0.0366  1935 ARG A CG  
3114 C CD  . ARG A 428 ? 0.6060 0.6663 0.7168 -0.2730 -0.0412 0.0412  1935 ARG A CD  
3115 N NE  . ARG A 428 ? 0.6059 0.6661 0.7169 -0.2721 -0.0417 0.0423  1935 ARG A NE  
3116 C CZ  . ARG A 428 ? 0.6044 0.6659 0.7172 -0.2714 -0.0445 0.0461  1935 ARG A CZ  
3117 N NH1 . ARG A 428 ? 0.6026 0.6660 0.7178 -0.2716 -0.0469 0.0493  1935 ARG A NH1 
3118 N NH2 . ARG A 428 ? 0.6045 0.6658 0.7174 -0.2705 -0.0447 0.0467  1935 ARG A NH2 
3119 N N   . ASP A 429 ? 0.6012 0.6468 0.6034 -0.2617 0.0077  -0.0103 1936 ASP A N   
3120 C CA  . ASP A 429 ? 0.6036 0.6469 0.6049 -0.2619 0.0096  -0.0125 1936 ASP A CA  
3121 C C   . ASP A 429 ? 0.6001 0.6464 0.6072 -0.2581 0.0111  -0.0155 1936 ASP A C   
3122 O O   . ASP A 429 ? 0.6020 0.6465 0.6094 -0.2583 0.0131  -0.0179 1936 ASP A O   
3123 C CB  . ASP A 429 ? 0.6045 0.6469 0.6039 -0.2624 0.0076  -0.0094 1936 ASP A CB  
3124 C CG  . ASP A 429 ? 0.6089 0.6475 0.6025 -0.2666 0.0060  -0.0065 1936 ASP A CG  
3125 O OD1 . ASP A 429 ? 0.6149 0.6482 0.6029 -0.2705 0.0074  -0.0076 1936 ASP A OD1 
3126 O OD2 . ASP A 429 ? 0.6068 0.6474 0.6013 -0.2662 0.0031  -0.0028 1936 ASP A OD2 
3127 N N   . HIS A 430 ? 0.5234 0.6391 0.6630 -0.2052 0.0068  -0.0790 1937 HIS A N   
3128 C CA  . HIS A 430 ? 0.5202 0.6387 0.6654 -0.2013 0.0076  -0.0817 1937 HIS A CA  
3129 C C   . HIS A 430 ? 0.5203 0.6385 0.6668 -0.1999 0.0076  -0.0822 1937 HIS A C   
3130 O O   . HIS A 430 ? 0.5210 0.6384 0.6702 -0.1992 0.0094  -0.0854 1937 HIS A O   
3131 C CB  . HIS A 430 ? 0.5212 0.6388 0.6684 -0.2020 0.0103  -0.0856 1937 HIS A CB  
3132 C CG  . HIS A 430 ? 0.5199 0.6389 0.6675 -0.2025 0.0099  -0.0854 1937 HIS A CG  
3133 N ND1 . HIS A 430 ? 0.5157 0.6385 0.6681 -0.1992 0.0091  -0.0860 1937 HIS A ND1 
3134 C CD2 . HIS A 430 ? 0.5226 0.6394 0.6660 -0.2060 0.0103  -0.0843 1937 HIS A CD2 
3135 C CE1 . HIS A 430 ? 0.5156 0.6386 0.6672 -0.2004 0.0089  -0.0856 1937 HIS A CE1 
3136 N NE2 . HIS A 430 ? 0.5197 0.6392 0.6659 -0.2046 0.0097  -0.0846 1937 HIS A NE2 
3137 N N   . GLU A 431 ? 0.5046 0.6770 0.5592 -0.1983 0.0024  -0.0544 1938 GLU A N   
3138 C CA  . GLU A 431 ? 0.5046 0.6768 0.5601 -0.1968 0.0020  -0.0542 1938 GLU A CA  
3139 C C   . GLU A 431 ? 0.5006 0.6765 0.5592 -0.1928 0.0000  -0.0526 1938 GLU A C   
3140 O O   . GLU A 431 ? 0.4991 0.6766 0.5568 -0.1923 -0.0017 -0.0494 1938 GLU A O   
3141 C CB  . GLU A 431 ? 0.5080 0.6772 0.5586 -0.1999 0.0015  -0.0518 1938 GLU A CB  
3142 C CG  . GLU A 431 ? 0.5132 0.6776 0.5602 -0.2036 0.0038  -0.0540 1938 GLU A CG  
3143 C CD  . GLU A 431 ? 0.5142 0.6775 0.5630 -0.2026 0.0052  -0.0560 1938 GLU A CD  
3144 O OE1 . GLU A 431 ? 0.5119 0.6771 0.5629 -0.2000 0.0035  -0.0548 1938 GLU A OE1 
3145 O OE2 . GLU A 431 ? 0.5176 0.6778 0.5657 -0.2045 0.0080  -0.0592 1938 GLU A OE2 
3146 N N   . TRP A 432 ? 0.4541 0.8314 0.5646 -0.1509 -0.0143 -0.0456 1939 TRP A N   
3147 C CA  . TRP A 432 ? 0.4510 0.8313 0.5641 -0.1471 -0.0163 -0.0445 1939 TRP A CA  
3148 C C   . TRP A 432 ? 0.4509 0.8311 0.5670 -0.1446 -0.0165 -0.0461 1939 TRP A C   
3149 O O   . TRP A 432 ? 0.4527 0.8310 0.5699 -0.1457 -0.0152 -0.0485 1939 TRP A O   
3150 C CB  . TRP A 432 ? 0.4487 0.8312 0.5641 -0.1454 -0.0164 -0.0456 1939 TRP A CB  
3151 C CG  . TRP A 432 ? 0.4485 0.8310 0.5680 -0.1446 -0.0153 -0.0496 1939 TRP A CG  
3152 C CD1 . TRP A 432 ? 0.4502 0.8310 0.5702 -0.1469 -0.0130 -0.0520 1939 TRP A CD1 
3153 C CD2 . TRP A 432 ? 0.4471 0.8309 0.5707 -0.1412 -0.0163 -0.0513 1939 TRP A CD2 
3154 N NE1 . TRP A 432 ? 0.4494 0.8308 0.5745 -0.1451 -0.0124 -0.0553 1939 TRP A NE1 
3155 C CE2 . TRP A 432 ? 0.4475 0.8307 0.5749 -0.1415 -0.0147 -0.0548 1939 TRP A CE2 
3156 C CE3 . TRP A 432 ? 0.4459 0.8309 0.5703 -0.1378 -0.0185 -0.0500 1939 TRP A CE3 
3157 C CZ2 . TRP A 432 ? 0.4465 0.8305 0.5791 -0.1388 -0.0154 -0.0571 1939 TRP A CZ2 
3158 C CZ3 . TRP A 432 ? 0.4453 0.8309 0.5739 -0.1351 -0.0195 -0.0522 1939 TRP A CZ3 
3159 C CH2 . TRP A 432 ? 0.4455 0.8306 0.5784 -0.1357 -0.0182 -0.0557 1939 TRP A CH2 
3160 N N   . GLY A 433 ? 0.4376 0.9988 0.6025 -0.1264 -0.0221 0.0305  1940 GLY A N   
3161 C CA  . GLY A 433 ? 0.4376 0.9988 0.6052 -0.1238 -0.0230 0.0294  1940 GLY A CA  
3162 C C   . GLY A 433 ? 0.4362 0.9991 0.6040 -0.1204 -0.0252 0.0307  1940 GLY A C   
3163 O O   . GLY A 433 ? 0.4352 0.9993 0.6009 -0.1202 -0.0255 0.0331  1940 GLY A O   
3164 N N   . PHE A 434 ? 0.4233 1.2779 0.6062 -0.1127 -0.0560 0.0727  1941 PHE A N   
3165 C CA  . PHE A 434 ? 0.4229 1.2783 0.6054 -0.1096 -0.0581 0.0738  1941 PHE A CA  
3166 C C   . PHE A 434 ? 0.4239 1.2789 0.6029 -0.1089 -0.0588 0.0772  1941 PHE A C   
3167 O O   . PHE A 434 ? 0.4249 1.2788 0.6037 -0.1097 -0.0588 0.0777  1941 PHE A O   
3168 C CB  . PHE A 434 ? 0.4235 1.2783 0.6097 -0.1071 -0.0595 0.0714  1941 PHE A CB  
3169 C CG  . PHE A 434 ? 0.4225 1.2780 0.6124 -0.1070 -0.0593 0.0684  1941 PHE A CG  
3170 C CD1 . PHE A 434 ? 0.4212 1.2781 0.6099 -0.1070 -0.0590 0.0688  1941 PHE A CD1 
3171 C CD2 . PHE A 434 ? 0.4228 1.2777 0.6179 -0.1067 -0.0595 0.0653  1941 PHE A CD2 
3172 C CE1 . PHE A 434 ? 0.4202 1.2778 0.6125 -0.1067 -0.0588 0.0662  1941 PHE A CE1 
3173 C CE2 . PHE A 434 ? 0.4219 1.2775 0.6210 -0.1063 -0.0592 0.0627  1941 PHE A CE2 
3174 C CZ  . PHE A 434 ? 0.4206 1.2775 0.6181 -0.1064 -0.0588 0.0631  1941 PHE A CZ  
3175 N N   . CYS A 435 ? 0.4326 1.4901 0.5359 -0.1491 -0.0790 0.0793  1942 CYS A N   
3176 C CA  . CYS A 435 ? 0.4335 1.4907 0.5338 -0.1484 -0.0794 0.0825  1942 CYS A CA  
3177 C C   . CYS A 435 ? 0.4355 1.4913 0.5353 -0.1459 -0.0811 0.0828  1942 CYS A C   
3178 O O   . CYS A 435 ? 0.4363 1.4916 0.5367 -0.1438 -0.0825 0.0812  1942 CYS A O   
3179 C CB  . CYS A 435 ? 0.4329 1.4912 0.5312 -0.1476 -0.0790 0.0847  1942 CYS A CB  
3180 S SG  . CYS A 435 ? 0.4309 1.4907 0.5295 -0.1507 -0.0775 0.0856  1942 CYS A SG  
3181 N N   . ARG A 436 ? 0.4650 1.6589 0.5754 -0.1949 -0.0992 0.1982  1943 ARG A N   
3182 C CA  . ARG A 436 ? 0.4673 1.6597 0.5762 -0.1928 -0.1008 0.1992  1943 ARG A CA  
3183 C C   . ARG A 436 ? 0.4681 1.6605 0.5738 -0.1928 -0.1001 0.2029  1943 ARG A C   
3184 O O   . ARG A 436 ? 0.4679 1.6602 0.5735 -0.1944 -0.0995 0.2046  1943 ARG A O   
3185 C CB  . ARG A 436 ? 0.4682 1.6593 0.5795 -0.1930 -0.1018 0.1976  1943 ARG A CB  
3186 C CG  . ARG A 436 ? 0.4675 1.6586 0.5798 -0.1957 -0.1005 0.1977  1943 ARG A CG  
3187 C CD  . ARG A 436 ? 0.4691 1.6586 0.5826 -0.1953 -0.1014 0.1974  1943 ARG A CD  
3188 N NE  . ARG A 436 ? 0.4691 1.6581 0.5825 -0.1979 -0.1002 0.1982  1943 ARG A NE  
3189 C CZ  . ARG A 436 ? 0.4696 1.6585 0.5803 -0.1987 -0.1001 0.2013  1943 ARG A CZ  
3190 N NH1 . ARG A 436 ? 0.4701 1.6593 0.5782 -0.1973 -0.1005 0.2041  1943 ARG A NH1 
3191 N NH2 . ARG A 436 ? 0.4699 1.6580 0.5806 -0.2012 -0.0992 0.2017  1943 ARG A NH2 
3192 N N   . HIS A 437 ? 0.4863 1.8762 0.4934 -0.2198 -0.1049 0.1562  1944 HIS A N   
3193 C CA  . HIS A 437 ? 0.4871 1.8771 0.4916 -0.2197 -0.1037 0.1598  1944 HIS A CA  
3194 C C   . HIS A 437 ? 0.4896 1.8778 0.4923 -0.2190 -0.1044 0.1617  1944 HIS A C   
3195 O O   . HIS A 437 ? 0.4918 1.8781 0.4938 -0.2177 -0.1061 0.1605  1944 HIS A O   
3196 C CB  . HIS A 437 ? 0.4881 1.8780 0.4904 -0.2179 -0.1032 0.1605  1944 HIS A CB  
3197 C CG  . HIS A 437 ? 0.4855 1.8774 0.4897 -0.2188 -0.1024 0.1591  1944 HIS A CG  
3198 N ND1 . HIS A 437 ? 0.4848 1.8768 0.4905 -0.2184 -0.1033 0.1560  1944 HIS A ND1 
3199 C CD2 . HIS A 437 ? 0.4836 1.8772 0.4886 -0.2202 -0.1009 0.1607  1944 HIS A CD2 
3200 C CE1 . HIS A 437 ? 0.4826 1.8763 0.4896 -0.2194 -0.1023 0.1556  1944 HIS A CE1 
3201 N NE2 . HIS A 437 ? 0.4819 1.8766 0.4884 -0.2205 -0.1009 0.1586  1944 HIS A NE2 
3202 N N   . SER A 438 ? 0.4838 1.9255 0.4739 -0.2273 -0.0690 0.1824  1945 SER A N   
3203 C CA  . SER A 438 ? 0.4861 1.9263 0.4745 -0.2267 -0.0693 0.1845  1945 SER A CA  
3204 C C   . SER A 438 ? 0.4892 1.9280 0.4740 -0.2246 -0.0687 0.1864  1945 SER A C   
3205 O O   . SER A 438 ? 0.4888 1.9285 0.4731 -0.2242 -0.0671 0.1875  1945 SER A O   
3206 C CB  . SER A 438 ? 0.4846 1.9259 0.4745 -0.2291 -0.0684 0.1870  1945 SER A CB  
3207 O OG  . SER A 438 ? 0.4868 1.9267 0.4754 -0.2286 -0.0687 0.1893  1945 SER A OG  
3208 N N   . ASN A 439 ? 0.5158 2.1554 0.4675 -0.2231 -0.0848 0.2137  1946 ASN A N   
3209 C CA  . ASN A 439 ? 0.5199 2.1572 0.4672 -0.2212 -0.0841 0.2155  1946 ASN A CA  
3210 C C   . ASN A 439 ? 0.5209 2.1581 0.4676 -0.2216 -0.0825 0.2193  1946 ASN A C   
3211 O O   . ASN A 439 ? 0.5250 2.1597 0.4679 -0.2203 -0.0819 0.2210  1946 ASN A O   
3212 C CB  . ASN A 439 ? 0.5239 2.1580 0.4680 -0.2194 -0.0864 0.2140  1946 ASN A CB  
3213 C CG  . ASN A 439 ? 0.5230 2.1572 0.4685 -0.2187 -0.0882 0.2105  1946 ASN A CG  
3214 O OD1 . ASN A 439 ? 0.5199 2.1557 0.4695 -0.2199 -0.0892 0.2084  1946 ASN A OD1 
3215 N ND2 . ASN A 439 ? 0.5260 2.1582 0.4680 -0.2170 -0.0886 0.2098  1946 ASN A ND2 
3216 N N   . SER A 440 ? 0.5060 2.1799 0.4559 -0.2246 -0.0483 0.1767  1947 SER A N   
3217 C CA  . SER A 440 ? 0.5064 2.1805 0.4569 -0.2252 -0.0467 0.1803  1947 SER A CA  
3218 C C   . SER A 440 ? 0.5040 2.1805 0.4571 -0.2263 -0.0447 0.1821  1947 SER A C   
3219 O O   . SER A 440 ? 0.5012 2.1794 0.4562 -0.2272 -0.0447 0.1805  1947 SER A O   
3220 C CB  . SER A 440 ? 0.5050 2.1795 0.4578 -0.2272 -0.0480 0.1808  1947 SER A CB  
3221 O OG  . SER A 440 ? 0.5014 2.1779 0.4573 -0.2292 -0.0485 0.1791  1947 SER A OG  
3222 N N   . TYR A 441 ? 0.5216 2.3341 0.4091 -0.1643 -0.0562 0.1164  1948 TYR A N   
3223 C CA  . TYR A 441 ? 0.5198 2.3342 0.4104 -0.1651 -0.0542 0.1186  1948 TYR A CA  
3224 C C   . TYR A 441 ? 0.5176 2.3336 0.4124 -0.1676 -0.0542 0.1212  1948 TYR A C   
3225 O O   . TYR A 441 ? 0.5183 2.3335 0.4129 -0.1683 -0.0553 0.1221  1948 TYR A O   
3226 C CB  . TYR A 441 ? 0.5232 2.3362 0.4116 -0.1632 -0.0515 0.1203  1948 TYR A CB  
3227 C CG  . TYR A 441 ? 0.5252 2.3369 0.4099 -0.1613 -0.0511 0.1178  1948 TYR A CG  
3228 C CD1 . TYR A 441 ? 0.5250 2.3375 0.4108 -0.1606 -0.0487 0.1184  1948 TYR A CD1 
3229 C CD2 . TYR A 441 ? 0.5275 2.3369 0.4080 -0.1599 -0.0531 0.1150  1948 TYR A CD2 
3230 C CE1 . TYR A 441 ? 0.5272 2.3381 0.4093 -0.1589 -0.0485 0.1160  1948 TYR A CE1 
3231 C CE2 . TYR A 441 ? 0.5297 2.3375 0.4067 -0.1582 -0.0531 0.1128  1948 TYR A CE2 
3232 C CZ  . TYR A 441 ? 0.5296 2.3381 0.4072 -0.1578 -0.0507 0.1133  1948 TYR A CZ  
3233 O OH  . TYR A 441 ? 0.5320 2.3388 0.4059 -0.1562 -0.0507 0.1111  1948 TYR A OH  
3234 N N   . ARG A 442 ? 0.5008 2.4583 0.4053 -0.1080 -0.0417 0.0573  1949 ARG A N   
3235 C CA  . ARG A 442 ? 0.4987 2.4575 0.4075 -0.1106 -0.0425 0.0597  1949 ARG A CA  
3236 C C   . ARG A 442 ? 0.5003 2.4586 0.4108 -0.1106 -0.0414 0.0634  1949 ARG A C   
3237 O O   . ARG A 442 ? 0.5023 2.4602 0.4127 -0.1089 -0.0390 0.0650  1949 ARG A O   
3238 C CB  . ARG A 442 ? 0.4961 2.4570 0.4086 -0.1120 -0.0421 0.0603  1949 ARG A CB  
3239 C CG  . ARG A 442 ? 0.4941 2.4557 0.4057 -0.1129 -0.0436 0.0568  1949 ARG A CG  
3240 C CD  . ARG A 442 ? 0.4918 2.4551 0.4072 -0.1149 -0.0436 0.0579  1949 ARG A CD  
3241 N NE  . ARG A 442 ? 0.4903 2.4541 0.4045 -0.1152 -0.0445 0.0548  1949 ARG A NE  
3242 C CZ  . ARG A 442 ? 0.4884 2.4533 0.4050 -0.1174 -0.0452 0.0549  1949 ARG A CZ  
3243 N NH1 . ARG A 442 ? 0.4878 2.4533 0.4081 -0.1194 -0.0456 0.0581  1949 ARG A NH1 
3244 N NH2 . ARG A 442 ? 0.4874 2.4526 0.4026 -0.1177 -0.0456 0.0518  1949 ARG A NH2 
3245 N N   . THR A 443 ? 0.4851 2.4873 0.3991 -0.1243 -0.0115 0.0718  1950 THR A N   
3246 C CA  . THR A 443 ? 0.4864 2.4881 0.4025 -0.1247 -0.0109 0.0754  1950 THR A CA  
3247 C C   . THR A 443 ? 0.4843 2.4873 0.4055 -0.1277 -0.0120 0.0778  1950 THR A C   
3248 O O   . THR A 443 ? 0.4825 2.4860 0.4040 -0.1297 -0.0140 0.0763  1950 THR A O   
3249 C CB  . THR A 443 ? 0.4882 2.4882 0.4014 -0.1243 -0.0120 0.0749  1950 THR A CB  
3250 O OG1 . THR A 443 ? 0.4867 2.4865 0.3995 -0.1263 -0.0147 0.0728  1950 THR A OG1 
3251 C CG2 . THR A 443 ? 0.4909 2.4891 0.3990 -0.1216 -0.0114 0.0725  1950 THR A CG2 
3252 N N   . SER A 444 ? 0.4740 2.6312 0.3950 -0.1347 0.0109  0.0248  1951 SER A N   
3253 C CA  . SER A 444 ? 0.4726 2.6306 0.3986 -0.1376 0.0093  0.0275  1951 SER A CA  
3254 C C   . SER A 444 ? 0.4741 2.6315 0.4029 -0.1377 0.0097  0.0311  1951 SER A C   
3255 O O   . SER A 444 ? 0.4758 2.6331 0.4051 -0.1356 0.0125  0.0328  1951 SER A O   
3256 C CB  . SER A 444 ? 0.4709 2.6306 0.4015 -0.1384 0.0098  0.0289  1951 SER A CB  
3257 O OG  . SER A 444 ? 0.4718 2.6321 0.4045 -0.1361 0.0131  0.0305  1951 SER A OG  
3258 N N   . SER A 445 ? 0.4881 2.5541 0.4173 -0.1058 0.0403  0.0584  1952 SER A N   
3259 C CA  . SER A 445 ? 0.4894 2.5548 0.4214 -0.1062 0.0403  0.0617  1952 SER A CA  
3260 C C   . SER A 445 ? 0.4886 2.5542 0.4259 -0.1093 0.0377  0.0646  1952 SER A C   
3261 O O   . SER A 445 ? 0.4878 2.5529 0.4241 -0.1118 0.0351  0.0635  1952 SER A O   
3262 C CB  . SER A 445 ? 0.4910 2.5546 0.4183 -0.1057 0.0392  0.0599  1952 SER A CB  
3263 O OG  . SER A 445 ? 0.4903 2.5531 0.4142 -0.1072 0.0366  0.0570  1952 SER A OG  
3264 N N   . ILE A 446 ? 0.4902 2.5258 0.4407 -0.1360 0.0538  0.0408  1953 ILE A N   
3265 C CA  . ILE A 446 ? 0.4899 2.5255 0.4461 -0.1391 0.0513  0.0441  1953 ILE A CA  
3266 C C   . ILE A 446 ? 0.4915 2.5258 0.4487 -0.1396 0.0502  0.0465  1953 ILE A C   
3267 O O   . ILE A 446 ? 0.4925 2.5272 0.4520 -0.1378 0.0527  0.0487  1953 ILE A O   
3268 C CB  . ILE A 446 ? 0.4889 2.5264 0.4530 -0.1389 0.0529  0.0476  1953 ILE A CB  
3269 C CG1 . ILE A 446 ? 0.4874 2.5260 0.4507 -0.1384 0.0538  0.0454  1953 ILE A CG1 
3270 C CG2 . ILE A 446 ? 0.4888 2.5260 0.4592 -0.1421 0.0496  0.0511  1953 ILE A CG2 
3271 C CD1 . ILE A 446 ? 0.4868 2.5273 0.4568 -0.1370 0.0568  0.0478  1953 ILE A CD1 
3272 N N   . ILE A 447 ? 0.5386 2.4248 0.5326 0.0454  0.0700  0.0560  1954 ILE A N   
3273 C CA  . ILE A 447 ? 0.5402 2.4250 0.5352 0.0443  0.0685  0.0582  1954 ILE A CA  
3274 C C   . ILE A 447 ? 0.5403