data_2V90
# 
_entry.id   2V90 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.322 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2V90         
PDBE  EBI-33471    
WWPDB D_1290033471 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2V90 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Uppenberg, J.'    1  ? 
'Gileadi, C.'      2  ? 
'Phillips, C.'     3  ? 
'Elkins, J.'       4  ? 
'Bunkoczi, G.'     5  ? 
'Cooper, C.'       6  ? 
'Pike, A.C.W.'     7  ? 
'Salah, E.'        8  ? 
'Ugochukwu, E.'    9  ? 
'Arrowsmith, C.H.' 10 ? 
'Edwards, A.'      11 ? 
'Sundstrom, M.'    12 ? 
'Weigelt, J.'      13 ? 
'Doyle, D.A.'      14 ? 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of the 3Rd Pdz Domain of Intestine- and Kidney-Enriched Pdz Domain Ikepp (Pdzd3)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Uppenberg, J.'    1  ? 
primary 'Gileadi, C.'      2  ? 
primary 'Phillips, C.'     3  ? 
primary 'Elkins, J.'       4  ? 
primary 'Bunkoczi, G.'     5  ? 
primary 'Cooper, C.'       6  ? 
primary 'Pike, A.C.W.'     7  ? 
primary 'Salah, E.'        8  ? 
primary 'Ugochukwu, E.'    9  ? 
primary 'Arrowsmith, C.H.' 10 ? 
primary 'Edwards, A.'      11 ? 
primary 'Sundstrom, M.'    12 ? 
primary 'Weigelt, J.'      13 ? 
primary 'Doyle, D.A.'      14 ? 
# 
_cell.entry_id           2V90 
_cell.length_a           48.150 
_cell.length_b           97.950 
_cell.length_c           59.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.59 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2V90 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PDZ DOMAIN-CONTAINING PROTEIN 3' 10257.568 6   ? ? 'PDZ DOMAIN, RESIDUES 246-335' ? 
2 non-polymer syn 'SULFATE ION'                     96.063    3   ? ? ?                              ? 
3 water       nat water                             18.015    388 ? ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'PDZ DOMAIN-CONTAINING PROTEIN 2, INTESTINAL AND KIDNEY-ENRICHED PDZ PROTEIN, INTESTINE- AND KIDNEY-ENRICHED PDZ DOMAIN IKEPP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSC
VSLTVVDPEADRETSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSC
VSLTVVDPEADRETSV
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  LYS n 
1 4  PRO n 
1 5  ARG n 
1 6  CYS n 
1 7  LEU n 
1 8  HIS n 
1 9  LEU n 
1 10 GLU n 
1 11 LYS n 
1 12 GLY n 
1 13 PRO n 
1 14 GLN n 
1 15 GLY n 
1 16 PHE n 
1 17 GLY n 
1 18 PHE n 
1 19 LEU n 
1 20 LEU n 
1 21 ARG n 
1 22 GLU n 
1 23 GLU n 
1 24 LYS n 
1 25 GLY n 
1 26 LEU n 
1 27 ASP n 
1 28 GLY n 
1 29 ARG n 
1 30 PRO n 
1 31 GLY n 
1 32 GLN n 
1 33 PHE n 
1 34 LEU n 
1 35 TRP n 
1 36 GLU n 
1 37 VAL n 
1 38 ASP n 
1 39 PRO n 
1 40 GLY n 
1 41 LEU n 
1 42 PRO n 
1 43 ALA n 
1 44 LYS n 
1 45 LYS n 
1 46 ALA n 
1 47 GLY n 
1 48 MET n 
1 49 GLN n 
1 50 ALA n 
1 51 GLY n 
1 52 ASP n 
1 53 ARG n 
1 54 LEU n 
1 55 VAL n 
1 56 ALA n 
1 57 VAL n 
1 58 ALA n 
1 59 GLY n 
1 60 GLU n 
1 61 SER n 
1 62 VAL n 
1 63 GLU n 
1 64 GLY n 
1 65 LEU n 
1 66 GLY n 
1 67 HIS n 
1 68 GLU n 
1 69 GLU n 
1 70 THR n 
1 71 VAL n 
1 72 SER n 
1 73 ARG n 
1 74 ILE n 
1 75 GLN n 
1 76 GLY n 
1 77 GLN n 
1 78 GLY n 
1 79 SER n 
1 80 CYS n 
1 81 VAL n 
1 82 SER n 
1 83 LEU n 
1 84 THR n 
1 85 VAL n 
1 86 VAL n 
1 87 ASP n 
1 88 PRO n 
1 89 GLU n 
1 90 ALA n 
1 91 ASP n 
1 92 ARG n 
1 93 GLU n 
1 94 THR n 
1 95 SER n 
1 96 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              R3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2V90        1 ? ? 2V90   ? 
2 UNP PDZD3_HUMAN 1 ? ? Q86UT5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2V90 A 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
2  2 2V90 A 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
3  1 2V90 A 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
4  1 2V90 B 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
5  2 2V90 B 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
6  1 2V90 B 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
7  1 2V90 C 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
8  2 2V90 C 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
9  1 2V90 C 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
10 1 2V90 D 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
11 2 2V90 D 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
12 1 2V90 D 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
13 1 2V90 E 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
14 2 2V90 E 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
15 1 2V90 E 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
16 1 2V90 F 1  ? 2  ? 2V90   244 ? 245 ? 244 245 
17 2 2V90 F 3  ? 92 ? Q86UT5 246 ? 335 ? 246 335 
18 1 2V90 F 93 ? 96 ? 2V90   336 ? 339 ? 336 339 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2V90 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   42 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '2M (NH4)2SO4, 0.1M BIS-TRIS, PH=5.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-04-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03315 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             1.03315 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2V90 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42.70 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   36079 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.10 
_reflns_shell.percent_possible_all   94.7 
_reflns_shell.Rmerge_I_obs           0.28 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.70 
_reflns_shell.pdbx_redundancy        3.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2V90 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     34206 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_obs                          0.196 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1798 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               16.85 
_refine.aniso_B[1][1]                            -0.64000 
_refine.aniso_B[2][2]                            0.19000 
_refine.aniso_B[3][3]                            0.26000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.59000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1G9O' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.216 
_refine.pdbx_overall_ESU_R_Free                  0.193 
_refine.overall_SU_ML                            0.135 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.184 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4213 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             388 
_refine_hist.number_atoms_total               4616 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 4320 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3042 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.475  1.992  ? 5825 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.923  3.000  ? 7415 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.891  5.000  ? 560  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.090 24.233 ? 189  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.858 15.000 ? 738  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.960 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.088  0.200  ? 625  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 4886 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 816  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.200  0.200  ? 720  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.202  0.200  ? 3059 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.165  0.200  ? 1965 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.084  0.200  ? 2520 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.170  0.200  ? 282  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.259  0.200  ? 40   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.250  0.200  ? 103  'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.153  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.276  3.000  ? 2885 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.324  5.000  ? 4429 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.078  8.000  ? 1597 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 9.687  11.000 ? 1396 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 458 0.22 0.50  'medium positional' 1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 458 0.20 0.00  'medium positional' 1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 458 0.17 0.00  'medium positional' 1 3  'X-RAY DIFFRACTION' ? ? ? 
4 D 458 0.20 0.00  'medium positional' 1 4  'X-RAY DIFFRACTION' ? ? ? 
5 E 458 0.24 0.00  'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
6 F 458 0.28 0.00  'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? 
1 A 522 0.52 5.00  'loose positional'  1 7  'X-RAY DIFFRACTION' ? ? ? 
2 B 522 0.58 0.01  'loose positional'  1 8  'X-RAY DIFFRACTION' ? ? ? 
3 C 522 0.40 0.00  'loose positional'  1 9  'X-RAY DIFFRACTION' ? ? ? 
4 D 522 0.41 0.00  'loose positional'  1 10 'X-RAY DIFFRACTION' ? ? ? 
5 E 522 0.51 0.00  'loose positional'  1 11 'X-RAY DIFFRACTION' ? ? ? 
6 F 522 0.62 0.00  'loose positional'  1 12 'X-RAY DIFFRACTION' ? ? ? 
1 A 458 1.35 2.00  'medium thermal'    1 13 'X-RAY DIFFRACTION' ? ? ? 
2 B 458 1.23 0.00  'medium thermal'    1 14 'X-RAY DIFFRACTION' ? ? ? 
3 C 458 1.19 0.00  'medium thermal'    1 15 'X-RAY DIFFRACTION' ? ? ? 
4 D 458 1.17 0.00  'medium thermal'    1 16 'X-RAY DIFFRACTION' ? ? ? 
5 E 458 1.11 0.00  'medium thermal'    1 17 'X-RAY DIFFRACTION' ? ? ? 
6 F 458 1.15 0.00  'medium thermal'    1 18 'X-RAY DIFFRACTION' ? ? ? 
1 A 522 1.23 10.00 'loose thermal'     1 19 'X-RAY DIFFRACTION' ? ? ? 
2 B 522 1.15 0.02  'loose thermal'     1 20 'X-RAY DIFFRACTION' ? ? ? 
3 C 522 1.26 0.00  'loose thermal'     1 21 'X-RAY DIFFRACTION' ? ? ? 
4 D 522 1.16 0.00  'loose thermal'     1 22 'X-RAY DIFFRACTION' ? ? ? 
5 E 522 1.19 0.00  'loose thermal'     1 23 'X-RAY DIFFRACTION' ? ? ? 
6 F 522 1.12 0.00  'loose thermal'     1 24 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             2477 
_refine_ls_shell.R_factor_R_work                  0.2120 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3160 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             109 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.999960  -0.006190 0.005780  0.006320  0.999720  -0.022630 -0.005640 0.022660  0.999730  19.25825 48.58855  30.25384  
2 given ? -0.999960 0.007900  -0.004990 0.000350  -0.502090 -0.864820 -0.009330 -0.864780 0.502060  29.15355 -51.12002 -29.03732 
3 given ? -0.999770 0.019700  -0.008000 -0.002930 -0.500120 -0.865950 -0.021060 -0.865730 0.500060  48.38662 -2.11191  0.71022   
4 given ? 0.999940  -0.007200 0.008770  -0.011310 -0.573580 0.819070  -0.000870 -0.819120 -0.573620 0.23440  -28.58708 -43.79194 
5 given ? 0.999960  -0.003920 0.008020  -0.008810 -0.577480 0.816350  0.001430  -0.816390 -0.577500 19.18380 20.06012  -14.01673 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
5 E 1 
6 F 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 244 A 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 244 B 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
3 C 244 C 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
4 D 244 D 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
5 E 244 E 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
6 F 244 F 267 1 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 275 A 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 275 B 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
3 C 275 C 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
4 D 275 D 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
5 E 275 E 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
6 F 275 F 299 2 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 300 A 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 300 B 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
3 C 300 C 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
4 D 300 D 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
5 E 300 E 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
6 F 300 F 332 3 5 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2V90 
_struct.title                     
'Crystal structure of the 3rd PDZ domain of intestine- and kidney- enriched PDZ domain IKEPP (PDZD3)' 
_struct.pdbx_descriptor           'PDZ DOMAIN-CONTAINING PROTEIN 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2V90 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'PDZD3, MEMBRANE, PDZ DOMAIN, PROTEIN-BINDING, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 41 ? ALA A 46 ? LEU A 284 ALA A 289 1 ? 6  
HELX_P HELX_P2  2  GLY A 66 ? GLY A 76 ? GLY A 309 GLY A 319 1 ? 11 
HELX_P HELX_P3  3  LEU B 41 ? ALA B 46 ? LEU B 284 ALA B 289 1 ? 6  
HELX_P HELX_P4  4  GLY B 66 ? GLY B 76 ? GLY B 309 GLY B 319 1 ? 11 
HELX_P HELX_P5  5  LEU C 41 ? ALA C 46 ? LEU C 284 ALA C 289 1 ? 6  
HELX_P HELX_P6  6  GLY C 66 ? GLY C 76 ? GLY C 309 GLY C 319 1 ? 11 
HELX_P HELX_P7  7  LEU D 41 ? ALA D 46 ? LEU D 284 ALA D 289 1 ? 6  
HELX_P HELX_P8  8  GLY D 66 ? GLY D 76 ? GLY D 309 GLY D 319 1 ? 11 
HELX_P HELX_P9  9  LEU E 41 ? ALA E 46 ? LEU E 284 ALA E 289 1 ? 6  
HELX_P HELX_P10 10 GLY E 66 ? GLY E 76 ? GLY E 309 GLY E 319 1 ? 11 
HELX_P HELX_P11 11 LEU F 41 ? ALA F 46 ? LEU F 284 ALA F 289 1 ? 6  
HELX_P HELX_P12 12 GLY F 66 ? GLY F 76 ? GLY F 309 GLY F 319 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 4 ? 
BA ? 5 ? 
BB ? 4 ? 
CA ? 4 ? 
CB ? 3 ? 
CC ? 3 ? 
DA ? 4 ? 
DB ? 3 ? 
DC ? 3 ? 
EA ? 4 ? 
FA ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 5  ? GLU A 10 ? ARG A 248 GLU A 253 
AA 2 CYS A 80 ? VAL A 86 ? CYS A 323 VAL A 329 
AA 3 ASP A 52 ? VAL A 57 ? ASP A 295 VAL A 300 
AA 4 PRO A 30 ? VAL A 37 ? PRO A 273 VAL A 280 
AA 5 PHE A 18 ? LYS A 24 ? PHE A 261 LYS A 267 
AB 1 ARG A 5  ? GLU A 10 ? ARG A 248 GLU A 253 
AB 2 CYS A 80 ? VAL A 86 ? CYS A 323 VAL A 329 
AB 3 ASP A 52 ? VAL A 57 ? ASP A 295 VAL A 300 
AB 4 GLU A 60 ? SER A 61 ? GLU A 303 SER A 304 
BA 1 ARG B 5  ? GLU B 10 ? ARG B 248 GLU B 253 
BA 2 CYS B 80 ? VAL B 86 ? CYS B 323 VAL B 329 
BA 3 ARG B 53 ? VAL B 57 ? ARG B 296 VAL B 300 
BA 4 PRO B 30 ? VAL B 37 ? PRO B 273 VAL B 280 
BA 5 PHE B 18 ? LYS B 24 ? PHE B 261 LYS B 267 
BB 1 ARG B 5  ? GLU B 10 ? ARG B 248 GLU B 253 
BB 2 CYS B 80 ? VAL B 86 ? CYS B 323 VAL B 329 
BB 3 ARG B 53 ? VAL B 57 ? ARG B 296 VAL B 300 
BB 4 GLU B 60 ? SER B 61 ? GLU B 303 SER B 304 
CA 1 ARG C 5  ? GLU C 10 ? ARG C 248 GLU C 253 
CA 2 CYS C 80 ? VAL C 86 ? CYS C 323 VAL C 329 
CA 3 ARG C 53 ? VAL C 57 ? ARG C 296 VAL C 300 
CA 4 GLU C 60 ? SER C 61 ? GLU C 303 SER C 304 
CB 1 PRO C 30 ? VAL C 37 ? PRO C 273 VAL C 280 
CB 2 PHE C 18 ? LYS C 24 ? PHE C 261 LYS C 267 
CB 3 GLU E 93 ? VAL E 96 ? GLU E 336 VAL E 339 
CC 1 GLU C 93 ? VAL C 96 ? GLU C 336 VAL C 339 
CC 2 PHE E 18 ? LYS E 24 ? PHE E 261 LYS E 267 
CC 3 PRO E 30 ? VAL E 37 ? PRO E 273 VAL E 280 
DA 1 ARG D 5  ? GLU D 10 ? ARG D 248 GLU D 253 
DA 2 CYS D 80 ? VAL D 86 ? CYS D 323 VAL D 329 
DA 3 ARG D 53 ? VAL D 57 ? ARG D 296 VAL D 300 
DA 4 GLU D 60 ? SER D 61 ? GLU D 303 SER D 304 
DB 1 PRO D 30 ? VAL D 37 ? PRO D 273 VAL D 280 
DB 2 PHE D 18 ? LYS D 24 ? PHE D 261 LYS D 267 
DB 3 GLU F 93 ? VAL F 96 ? GLU F 336 VAL F 339 
DC 1 GLU D 93 ? VAL D 96 ? GLU D 336 VAL D 339 
DC 2 PHE F 18 ? LYS F 24 ? PHE F 261 LYS F 267 
DC 3 PRO F 30 ? VAL F 37 ? PRO F 273 VAL F 280 
EA 1 ARG E 5  ? GLU E 10 ? ARG E 248 GLU E 253 
EA 2 CYS E 80 ? VAL E 86 ? CYS E 323 VAL E 329 
EA 3 ARG E 53 ? VAL E 57 ? ARG E 296 VAL E 300 
EA 4 GLU E 60 ? SER E 61 ? GLU E 303 SER E 304 
FA 1 ARG F 5  ? GLU F 10 ? ARG F 248 GLU F 253 
FA 2 CYS F 80 ? VAL F 86 ? CYS F 323 VAL F 329 
FA 3 ARG F 53 ? VAL F 57 ? ARG F 296 VAL F 300 
FA 4 GLU F 60 ? SER F 61 ? GLU F 303 SER F 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 9  ? N LEU A 252 O VAL A 81 ? O VAL A 324 
AA 2 3 N VAL A 86 ? N VAL A 329 O ARG A 53 ? O ARG A 296 
AA 3 4 N LEU A 54 ? N LEU A 297 O GLN A 32 ? O GLN A 275 
AA 4 5 N TRP A 35 ? N TRP A 278 O LEU A 19 ? O LEU A 262 
AB 1 2 N LEU A 9  ? N LEU A 252 O VAL A 81 ? O VAL A 324 
AB 2 3 N VAL A 86 ? N VAL A 329 O ARG A 53 ? O ARG A 296 
AB 3 4 N VAL A 57 ? N VAL A 300 O GLU A 60 ? O GLU A 303 
BA 1 2 N LEU B 9  ? N LEU B 252 O VAL B 81 ? O VAL B 324 
BA 2 3 N VAL B 86 ? N VAL B 329 O ARG B 53 ? O ARG B 296 
BA 3 4 N LEU B 54 ? N LEU B 297 O GLN B 32 ? O GLN B 275 
BA 4 5 N TRP B 35 ? N TRP B 278 O LEU B 19 ? O LEU B 262 
BB 1 2 N LEU B 9  ? N LEU B 252 O VAL B 81 ? O VAL B 324 
BB 2 3 N VAL B 86 ? N VAL B 329 O ARG B 53 ? O ARG B 296 
BB 3 4 N VAL B 57 ? N VAL B 300 O GLU B 60 ? O GLU B 303 
CA 1 2 N LEU C 9  ? N LEU C 252 O VAL C 81 ? O VAL C 324 
CA 2 3 N VAL C 86 ? N VAL C 329 O ARG C 53 ? O ARG C 296 
CA 3 4 N VAL C 57 ? N VAL C 300 O GLU C 60 ? O GLU C 303 
CB 1 2 N TRP C 35 ? N TRP C 278 O LEU C 19 ? O LEU C 262 
CB 2 3 N LEU C 20 ? N LEU C 263 O THR E 94 ? O THR E 337 
CC 1 2 N VAL C 96 ? N VAL C 339 O PHE E 18 ? O PHE E 261 
CC 2 3 N GLU E 23 ? N GLU E 266 O GLY E 31 ? O GLY E 274 
DA 1 2 N LEU D 9  ? N LEU D 252 O VAL D 81 ? O VAL D 324 
DA 2 3 N VAL D 86 ? N VAL D 329 O ARG D 53 ? O ARG D 296 
DA 3 4 N VAL D 57 ? N VAL D 300 O GLU D 60 ? O GLU D 303 
DB 1 2 N TRP D 35 ? N TRP D 278 O LEU D 19 ? O LEU D 262 
DB 2 3 N LEU D 20 ? N LEU D 263 O THR F 94 ? O THR F 337 
DC 1 2 N VAL D 96 ? N VAL D 339 O PHE F 18 ? O PHE F 261 
DC 2 3 N GLU F 23 ? N GLU F 266 O GLY F 31 ? O GLY F 274 
EA 1 2 N LEU E 9  ? N LEU E 252 O VAL E 81 ? O VAL E 324 
EA 2 3 N VAL E 86 ? N VAL E 329 O ARG E 53 ? O ARG E 296 
EA 3 4 N VAL E 57 ? N VAL E 300 O GLU E 60 ? O GLU E 303 
FA 1 2 N LEU F 9  ? N LEU F 252 O VAL F 81 ? O VAL F 324 
FA 2 3 N VAL F 86 ? N VAL F 329 O ARG F 53 ? O ARG F 296 
FA 3 4 N VAL F 57 ? N VAL F 300 O GLU F 60 ? O GLU F 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A1340' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B1340' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B1341' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 25 ? GLY A 268  . ? 1_555 ? 
2  AC1 5 LEU A 26 ? LEU A 269  . ? 1_555 ? 
3  AC1 5 ASP A 27 ? ASP A 270  . ? 1_555 ? 
4  AC1 5 HOH J .  ? HOH A 2073 . ? 1_555 ? 
5  AC1 5 HOH J .  ? HOH A 2074 . ? 1_555 ? 
6  AC2 6 GLY B 25 ? GLY B 268  . ? 1_555 ? 
7  AC2 6 LEU B 26 ? LEU B 269  . ? 1_555 ? 
8  AC2 6 ASP B 27 ? ASP B 270  . ? 1_555 ? 
9  AC2 6 SO4 I .  ? SO4 B 1341 . ? 1_555 ? 
10 AC2 6 HOH K .  ? HOH B 2063 . ? 1_555 ? 
11 AC2 6 HOH K .  ? HOH B 2064 . ? 1_555 ? 
12 AC3 4 GLY B 25 ? GLY B 268  . ? 1_555 ? 
13 AC3 4 ARG B 53 ? ARG B 296  . ? 1_555 ? 
14 AC3 4 SO4 H .  ? SO4 B 1340 . ? 1_555 ? 
15 AC3 4 HOH K .  ? HOH B 2065 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2V90 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2V90 
_atom_sites.fract_transf_matrix[1][1]   0.020768 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003509 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010209 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017045 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2  ? 14.272  -50.584 -0.668  1.00 42.95 ? 245  MET A N   1 
ATOM   2    C CA  . MET A 1 2  ? 13.406  -49.491 -0.130  1.00 41.97 ? 245  MET A CA  1 
ATOM   3    C C   . MET A 1 2  ? 11.964  -49.984 0.150   1.00 38.86 ? 245  MET A C   1 
ATOM   4    O O   . MET A 1 2  ? 11.352  -50.670 -0.666  1.00 41.17 ? 245  MET A O   1 
ATOM   5    C CB  . MET A 1 2  ? 13.397  -48.317 -1.118  1.00 42.87 ? 245  MET A CB  1 
ATOM   6    C CG  . MET A 1 2  ? 13.138  -46.954 -0.494  1.00 48.09 ? 245  MET A CG  1 
ATOM   7    S SD  . MET A 1 2  ? 14.580  -46.183 0.279   1.00 68.69 ? 245  MET A SD  1 
ATOM   8    C CE  . MET A 1 2  ? 15.705  -46.045 -1.111  1.00 64.35 ? 245  MET A CE  1 
ATOM   9    N N   . LYS A 1 3  ? 11.432  -49.634 1.315   1.00 34.15 ? 246  LYS A N   1 
ATOM   10   C CA  . LYS A 1 3  ? 10.068  -49.994 1.670   1.00 36.23 ? 246  LYS A CA  1 
ATOM   11   C C   . LYS A 1 3  ? 9.125   -49.018 0.981   1.00 32.16 ? 246  LYS A C   1 
ATOM   12   O O   . LYS A 1 3  ? 9.326   -47.796 1.071   1.00 24.85 ? 246  LYS A O   1 
ATOM   13   C CB  . LYS A 1 3  ? 9.855   -49.919 3.184   1.00 34.27 ? 246  LYS A CB  1 
ATOM   14   C CG  . LYS A 1 3  ? 10.755  -50.850 3.982   1.00 42.63 ? 246  LYS A CG  1 
ATOM   15   C CD  . LYS A 1 3  ? 10.859  -50.434 5.453   1.00 40.86 ? 246  LYS A CD  1 
ATOM   16   C CE  . LYS A 1 3  ? 12.129  -50.982 6.096   1.00 51.40 ? 246  LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 3  ? 12.501  -50.226 7.324   1.00 62.28 ? 246  LYS A NZ  1 
ATOM   18   N N   . PRO A 1 4  ? 8.097   -49.540 0.293   1.00 28.35 ? 247  PRO A N   1 
ATOM   19   C CA  . PRO A 1 4  ? 7.134   -48.673 -0.378  1.00 25.22 ? 247  PRO A CA  1 
ATOM   20   C C   . PRO A 1 4  ? 6.429   -47.706 0.576   1.00 24.63 ? 247  PRO A C   1 
ATOM   21   O O   . PRO A 1 4  ? 6.226   -48.031 1.741   1.00 23.24 ? 247  PRO A O   1 
ATOM   22   C CB  . PRO A 1 4  ? 6.119   -49.662 -0.969  1.00 23.29 ? 247  PRO A CB  1 
ATOM   23   C CG  . PRO A 1 4  ? 6.824   -50.948 -1.069  1.00 22.78 ? 247  PRO A CG  1 
ATOM   24   C CD  . PRO A 1 4  ? 7.786   -50.965 0.083   1.00 30.15 ? 247  PRO A CD  1 
ATOM   25   N N   . ARG A 1 5  ? 6.080   -46.523 0.074   1.00 20.10 ? 248  ARG A N   1 
ATOM   26   C CA  . ARG A 1 5  ? 5.349   -45.519 0.828   1.00 22.32 ? 248  ARG A CA  1 
ATOM   27   C C   . ARG A 1 5  ? 4.076   -45.179 0.084   1.00 19.95 ? 248  ARG A C   1 
ATOM   28   O O   . ARG A 1 5  ? 4.095   -44.999 -1.112  1.00 14.82 ? 248  ARG A O   1 
ATOM   29   C CB  . ARG A 1 5  ? 6.154   -44.239 0.976   1.00 22.63 ? 248  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 5  ? 7.490   -44.381 1.677   1.00 33.21 ? 248  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 5  ? 8.356   -43.159 1.342   1.00 38.54 ? 248  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 5  ? 7.663   -41.916 1.645   1.00 38.64 ? 248  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 5  ? 7.722   -40.790 0.940   1.00 34.54 ? 248  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 5  ? 8.464   -40.674 -0.156  1.00 31.02 ? 248  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 5  ? 7.015   -39.755 1.350   1.00 32.27 ? 248  ARG A NH2 1 
ATOM   36   N N   . CYS A 1 6  ? 2.976   -45.063 0.812   1.00 21.80 ? 249  CYS A N   1 
ATOM   37   C CA  . CYS A 1 6  ? 1.693   -44.761 0.212   1.00 21.82 ? 249  CYS A CA  1 
ATOM   38   C C   . CYS A 1 6  ? 1.329   -43.310 0.532   1.00 22.39 ? 249  CYS A C   1 
ATOM   39   O O   . CYS A 1 6  ? 1.101   -42.957 1.687   1.00 26.91 ? 249  CYS A O   1 
ATOM   40   C CB  . CYS A 1 6  ? 0.637   -45.758 0.678   1.00 22.21 ? 249  CYS A CB  1 
ATOM   41   S SG  . CYS A 1 6  ? -0.948  -45.479 -0.066  1.00 23.94 ? 249  CYS A SG  1 
ATOM   42   N N   . LEU A 1 7  ? 1.291   -42.482 -0.514  1.00 18.45 ? 250  LEU A N   1 
ATOM   43   C CA  . LEU A 1 7  ? 1.018   -41.058 -0.407  1.00 21.00 ? 250  LEU A CA  1 
ATOM   44   C C   . LEU A 1 7  ? -0.394  -40.820 -0.908  1.00 20.41 ? 250  LEU A C   1 
ATOM   45   O O   . LEU A 1 7  ? -0.873  -41.528 -1.787  1.00 21.51 ? 250  LEU A O   1 
ATOM   46   C CB  . LEU A 1 7  ? 2.021   -40.261 -1.254  1.00 25.41 ? 250  LEU A CB  1 
ATOM   47   C CG  . LEU A 1 7  ? 3.448   -40.827 -1.270  1.00 28.85 ? 250  LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 7  ? 4.159   -40.464 -2.541  1.00 29.36 ? 250  LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 7  ? 4.201   -40.377 -0.092  1.00 27.51 ? 250  LEU A CD2 1 
ATOM   50   N N   . HIS A 1 8  ? -1.052  -39.814 -0.336  1.00 21.28 ? 251  HIS A N   1 
ATOM   51   C CA  . HIS A 1 8  ? -2.431  -39.454 -0.665  1.00 18.78 ? 251  HIS A CA  1 
ATOM   52   C C   . HIS A 1 8  ? -2.371  -38.009 -1.094  1.00 16.23 ? 251  HIS A C   1 
ATOM   53   O O   . HIS A 1 8  ? -1.915  -37.179 -0.350  1.00 17.87 ? 251  HIS A O   1 
ATOM   54   C CB  . HIS A 1 8  ? -3.343  -39.684 0.564   1.00 19.57 ? 251  HIS A CB  1 
ATOM   55   C CG  . HIS A 1 8  ? -3.324  -41.103 1.051   1.00 25.96 ? 251  HIS A CG  1 
ATOM   56   N ND1 . HIS A 1 8  ? -4.230  -42.049 0.618   1.00 41.14 ? 251  HIS A ND1 1 
ATOM   57   C CD2 . HIS A 1 8  ? -2.466  -41.756 1.871   1.00 31.23 ? 251  HIS A CD2 1 
ATOM   58   C CE1 . HIS A 1 8  ? -3.950  -43.214 1.175   1.00 28.04 ? 251  HIS A CE1 1 
ATOM   59   N NE2 . HIS A 1 8  ? -2.877  -43.066 1.930   1.00 30.42 ? 251  HIS A NE2 1 
ATOM   60   N N   . LEU A 1 9  ? -2.745  -37.740 -2.341  1.00 17.87 ? 252  LEU A N   1 
ATOM   61   C CA  . LEU A 1 9  ? -2.598  -36.429 -2.950  1.00 16.26 ? 252  LEU A CA  1 
ATOM   62   C C   . LEU A 1 9  ? -3.978  -35.882 -3.212  1.00 17.22 ? 252  LEU A C   1 
ATOM   63   O O   . LEU A 1 9  ? -4.924  -36.623 -3.500  1.00 17.62 ? 252  LEU A O   1 
ATOM   64   C CB  . LEU A 1 9  ? -1.821  -36.483 -4.278  1.00 18.87 ? 252  LEU A CB  1 
ATOM   65   C CG  . LEU A 1 9  ? -0.292  -36.708 -4.302  1.00 19.71 ? 252  LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 9  ? 0.060   -38.058 -3.866  1.00 21.94 ? 252  LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 9  ? 0.317   -36.494 -5.698  1.00 15.21 ? 252  LEU A CD2 1 
ATOM   68   N N   . GLU A 1 10 ? -4.093  -34.573 -3.110  1.00 15.93 ? 253  GLU A N   1 
ATOM   69   C CA  . GLU A 1 10 ? -5.322  -33.903 -3.465  1.00 19.02 ? 253  GLU A CA  1 
ATOM   70   C C   . GLU A 1 10 ? -4.971  -32.893 -4.545  1.00 19.26 ? 253  GLU A C   1 
ATOM   71   O O   . GLU A 1 10 ? -3.981  -32.183 -4.467  1.00 17.20 ? 253  GLU A O   1 
ATOM   72   C CB  . GLU A 1 10 ? -5.951  -33.255 -2.231  1.00 18.96 ? 253  GLU A CB  1 
ATOM   73   C CG  . GLU A 1 10 ? -6.681  -34.250 -1.308  1.00 33.02 ? 253  GLU A CG  1 
ATOM   74   C CD  . GLU A 1 10 ? -5.767  -35.130 -0.436  1.00 51.81 ? 253  GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 10 ? -4.596  -34.754 -0.190  1.00 59.48 ? 253  GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 10 ? -6.241  -36.202 0.022   1.00 62.74 ? 253  GLU A OE2 1 
ATOM   77   N N   . LYS A 1 11 ? -5.801  -32.857 -5.563  1.00 18.60 ? 254  LYS A N   1 
ATOM   78   C CA  . LYS A 1 11 ? -5.473  -32.214 -6.792  1.00 20.39 ? 254  LYS A CA  1 
ATOM   79   C C   . LYS A 1 11 ? -5.848  -30.772 -6.604  1.00 24.29 ? 254  LYS A C   1 
ATOM   80   O O   . LYS A 1 11 ? -6.777  -30.441 -5.844  1.00 25.55 ? 254  LYS A O   1 
ATOM   81   C CB  . LYS A 1 11 ? -6.282  -32.916 -7.891  1.00 23.70 ? 254  LYS A CB  1 
ATOM   82   C CG  . LYS A 1 11 ? -5.839  -32.763 -9.327  1.00 16.62 ? 254  LYS A CG  1 
ATOM   83   C CD  . LYS A 1 11 ? -6.696  -33.737 -10.142 1.00 28.22 ? 254  LYS A CD  1 
ATOM   84   C CE  . LYS A 1 11 ? -6.687  -33.505 -11.608 1.00 30.78 ? 254  LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 11 ? -7.641  -34.467 -12.217 1.00 30.14 ? 254  LYS A NZ  1 
ATOM   86   N N   . GLY A 1 12 ? -5.092  -29.890 -7.228  1.00 21.21 ? 255  GLY A N   1 
ATOM   87   C CA  . GLY A 1 12 ? -5.406  -28.476 -7.183  1.00 20.57 ? 255  GLY A CA  1 
ATOM   88   C C   . GLY A 1 12 ? -5.569  -27.972 -8.601  1.00 24.44 ? 255  GLY A C   1 
ATOM   89   O O   . GLY A 1 12 ? -5.515  -28.750 -9.551  1.00 22.99 ? 255  GLY A O   1 
ATOM   90   N N   . PRO A 1 13 ? -5.723  -26.655 -8.757  1.00 28.42 ? 256  PRO A N   1 
ATOM   91   C CA  . PRO A 1 13 ? -5.974  -26.070 -10.068 1.00 32.32 ? 256  PRO A CA  1 
ATOM   92   C C   . PRO A 1 13 ? -4.907  -26.389 -11.127 1.00 32.41 ? 256  PRO A C   1 
ATOM   93   O O   . PRO A 1 13 ? -5.221  -26.342 -12.316 1.00 38.14 ? 256  PRO A O   1 
ATOM   94   C CB  . PRO A 1 13 ? -6.020  -24.563 -9.787  1.00 32.84 ? 256  PRO A CB  1 
ATOM   95   C CG  . PRO A 1 13 ? -6.229  -24.429 -8.336  1.00 34.04 ? 256  PRO A CG  1 
ATOM   96   C CD  . PRO A 1 13 ? -5.633  -25.640 -7.698  1.00 30.51 ? 256  PRO A CD  1 
ATOM   97   N N   . GLN A 1 14 ? -3.678  -26.715 -10.715 1.00 26.31 ? 257  GLN A N   1 
ATOM   98   C CA  . GLN A 1 14 ? -2.597  -26.954 -11.671 1.00 26.72 ? 257  GLN A CA  1 
ATOM   99   C C   . GLN A 1 14 ? -2.205  -28.434 -11.761 1.00 24.81 ? 257  GLN A C   1 
ATOM   100  O O   . GLN A 1 14 ? -1.137  -28.757 -12.251 1.00 28.08 ? 257  GLN A O   1 
ATOM   101  C CB  . GLN A 1 14 ? -1.379  -26.111 -11.304 1.00 27.84 ? 257  GLN A CB  1 
ATOM   102  C CG  . GLN A 1 14 ? -1.688  -24.634 -11.102 1.00 25.70 ? 257  GLN A CG  1 
ATOM   103  C CD  . GLN A 1 14 ? -0.908  -24.048 -9.938  1.00 46.73 ? 257  GLN A CD  1 
ATOM   104  O OE1 . GLN A 1 14 ? 0.315   -23.871 -10.026 1.00 46.82 ? 257  GLN A OE1 1 
ATOM   105  N NE2 . GLN A 1 14 ? -1.607  -23.766 -8.828  1.00 28.09 ? 257  GLN A NE2 1 
ATOM   106  N N   . GLY A 1 15 ? -3.094  -29.314 -11.281 1.00 23.45 ? 258  GLY A N   1 
ATOM   107  C CA  . GLY A 1 15 ? -2.872  -30.732 -11.239 1.00 19.13 ? 258  GLY A CA  1 
ATOM   108  C C   . GLY A 1 15 ? -2.239  -31.222 -9.953  1.00 19.12 ? 258  GLY A C   1 
ATOM   109  O O   . GLY A 1 15 ? -2.310  -30.572 -8.896  1.00 17.93 ? 258  GLY A O   1 
ATOM   110  N N   . PHE A 1 16 ? -1.633  -32.393 -10.061 1.00 16.10 ? 259  PHE A N   1 
ATOM   111  C CA  . PHE A 1 16 ? -0.871  -32.991 -8.973  1.00 18.31 ? 259  PHE A CA  1 
ATOM   112  C C   . PHE A 1 16 ? 0.562   -32.473 -8.859  1.00 19.01 ? 259  PHE A C   1 
ATOM   113  O O   . PHE A 1 16 ? 1.110   -32.411 -7.750  1.00 18.90 ? 259  PHE A O   1 
ATOM   114  C CB  . PHE A 1 16 ? -0.851  -34.496 -9.135  1.00 18.92 ? 259  PHE A CB  1 
ATOM   115  C CG  . PHE A 1 16 ? -2.173  -35.130 -8.885  1.00 22.32 ? 259  PHE A CG  1 
ATOM   116  C CD1 . PHE A 1 16 ? -2.777  -35.010 -7.635  1.00 17.14 ? 259  PHE A CD1 1 
ATOM   117  C CD2 . PHE A 1 16 ? -2.825  -35.847 -9.883  1.00 22.58 ? 259  PHE A CD2 1 
ATOM   118  C CE1 . PHE A 1 16 ? -4.010  -35.584 -7.377  1.00 19.31 ? 259  PHE A CE1 1 
ATOM   119  C CE2 . PHE A 1 16 ? -4.087  -36.420 -9.622  1.00 21.09 ? 259  PHE A CE2 1 
ATOM   120  C CZ  . PHE A 1 16 ? -4.667  -36.286 -8.359  1.00 21.32 ? 259  PHE A CZ  1 
ATOM   121  N N   . GLY A 1 17 ? 1.165   -32.112 -9.992  1.00 14.53 ? 260  GLY A N   1 
ATOM   122  C CA  . GLY A 1 17 ? 2.528   -31.582 -10.015 1.00 15.44 ? 260  GLY A CA  1 
ATOM   123  C C   . GLY A 1 17 ? 3.656   -32.611 -10.090 1.00 17.00 ? 260  GLY A C   1 
ATOM   124  O O   . GLY A 1 17 ? 4.648   -32.546 -9.356  1.00 17.94 ? 260  GLY A O   1 
ATOM   125  N N   . PHE A 1 18 ? 3.528   -33.560 -10.996 1.00 11.93 ? 261  PHE A N   1 
ATOM   126  C CA  . PHE A 1 18 ? 4.647   -34.452 -11.279 1.00 14.86 ? 261  PHE A CA  1 
ATOM   127  C C   . PHE A 1 18 ? 4.663   -34.850 -12.739 1.00 15.95 ? 261  PHE A C   1 
ATOM   128  O O   . PHE A 1 18 ? 3.617   -34.863 -13.400 1.00 11.39 ? 261  PHE A O   1 
ATOM   129  C CB  . PHE A 1 18 ? 4.737   -35.666 -10.311 1.00 16.92 ? 261  PHE A CB  1 
ATOM   130  C CG  . PHE A 1 18 ? 3.605   -36.678 -10.411 1.00 17.72 ? 261  PHE A CG  1 
ATOM   131  C CD1 . PHE A 1 18 ? 3.687   -37.759 -11.290 1.00 18.46 ? 261  PHE A CD1 1 
ATOM   132  C CD2 . PHE A 1 18 ? 2.525   -36.618 -9.546  1.00 15.47 ? 261  PHE A CD2 1 
ATOM   133  C CE1 . PHE A 1 18 ? 2.674   -38.729 -11.361 1.00 20.57 ? 261  PHE A CE1 1 
ATOM   134  C CE2 . PHE A 1 18 ? 1.498   -37.587 -9.599  1.00 25.42 ? 261  PHE A CE2 1 
ATOM   135  C CZ  . PHE A 1 18 ? 1.582   -38.644 -10.525 1.00 20.80 ? 261  PHE A CZ  1 
ATOM   136  N N   . LEU A 1 19 ? 5.865   -35.136 -13.240 1.00 14.92 ? 262  LEU A N   1 
ATOM   137  C CA  . LEU A 1 19 ? 6.042   -35.752 -14.571 1.00 15.90 ? 262  LEU A CA  1 
ATOM   138  C C   . LEU A 1 19 ? 6.256   -37.265 -14.441 1.00 15.68 ? 262  LEU A C   1 
ATOM   139  O O   . LEU A 1 19 ? 7.211   -37.692 -13.808 1.00 14.93 ? 262  LEU A O   1 
ATOM   140  C CB  . LEU A 1 19 ? 7.234   -35.109 -15.278 1.00 16.26 ? 262  LEU A CB  1 
ATOM   141  C CG  . LEU A 1 19 ? 7.627   -35.615 -16.666 1.00 18.32 ? 262  LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 19 ? 6.493   -35.228 -17.667 1.00 11.82 ? 262  LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 19 ? 9.032   -35.059 -17.066 1.00 14.66 ? 262  LEU A CD2 1 
ATOM   144  N N   . LEU A 1 20 ? 5.335   -38.063 -15.009 1.00 10.91 ? 263  LEU A N   1 
ATOM   145  C CA  . LEU A 1 20 ? 5.503   -39.513 -15.124 1.00 14.40 ? 263  LEU A CA  1 
ATOM   146  C C   . LEU A 1 20 ? 6.173   -39.871 -16.414 1.00 13.76 ? 263  LEU A C   1 
ATOM   147  O O   . LEU A 1 20 ? 5.682   -39.527 -17.488 1.00 13.50 ? 263  LEU A O   1 
ATOM   148  C CB  . LEU A 1 20 ? 4.165   -40.230 -15.081 1.00 13.38 ? 263  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 20 ? 4.161   -41.716 -14.750 1.00 15.98 ? 263  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 20 ? 4.569   -41.937 -13.281 1.00 14.78 ? 263  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 20 ? 2.751   -42.223 -15.041 1.00 16.07 ? 263  LEU A CD2 1 
ATOM   152  N N   . ARG A 1 21 ? 7.264   -40.617 -16.303 1.00 15.93 ? 264  ARG A N   1 
ATOM   153  C CA  . ARG A 1 21 ? 7.948   -41.124 -17.466 1.00 15.33 ? 264  ARG A CA  1 
ATOM   154  C C   . ARG A 1 21 ? 8.123   -42.664 -17.425 1.00 12.51 ? 264  ARG A C   1 
ATOM   155  O O   . ARG A 1 21 ? 8.491   -43.268 -16.411 1.00 11.66 ? 264  ARG A O   1 
ATOM   156  C CB  . ARG A 1 21 ? 9.293   -40.394 -17.646 1.00 12.41 ? 264  ARG A CB  1 
ATOM   157  C CG  . ARG A 1 21 ? 9.999   -40.766 -18.929 1.00 19.60 ? 264  ARG A CG  1 
ATOM   158  C CD  . ARG A 1 21 ? 11.414  -40.242 -18.997 1.00 24.40 ? 264  ARG A CD  1 
ATOM   159  N NE  . ARG A 1 21 ? 11.447  -38.800 -19.144 1.00 35.36 ? 264  ARG A NE  1 
ATOM   160  C CZ  . ARG A 1 21 ? 11.436  -38.149 -20.302 1.00 50.47 ? 264  ARG A CZ  1 
ATOM   161  N NH1 . ARG A 1 21 ? 11.388  -38.823 -21.456 1.00 55.97 ? 264  ARG A NH1 1 
ATOM   162  N NH2 . ARG A 1 21 ? 11.469  -36.812 -20.304 1.00 39.06 ? 264  ARG A NH2 1 
ATOM   163  N N   . GLU A 1 22 ? 7.864   -43.304 -18.552 1.00 11.51 ? 265  GLU A N   1 
ATOM   164  C CA  . GLU A 1 22 ? 8.139   -44.748 -18.644 1.00 9.74  ? 265  GLU A CA  1 
ATOM   165  C C   . GLU A 1 22 ? 9.657   -44.960 -18.855 1.00 15.40 ? 265  GLU A C   1 
ATOM   166  O O   . GLU A 1 22 ? 10.311  -44.142 -19.492 1.00 16.28 ? 265  GLU A O   1 
ATOM   167  C CB  . GLU A 1 22 ? 7.330   -45.337 -19.783 1.00 12.72 ? 265  GLU A CB  1 
ATOM   168  C CG  . GLU A 1 22 ? 7.562   -46.792 -20.034 1.00 5.34  ? 265  GLU A CG  1 
ATOM   169  C CD  . GLU A 1 22 ? 6.578   -47.342 -21.002 1.00 14.79 ? 265  GLU A CD  1 
ATOM   170  O OE1 . GLU A 1 22 ? 5.396   -47.329 -20.667 1.00 13.30 ? 265  GLU A OE1 1 
ATOM   171  O OE2 . GLU A 1 22 ? 6.988   -47.802 -22.090 1.00 17.30 ? 265  GLU A OE2 1 
ATOM   172  N N   . GLU A 1 23 ? 10.221  -45.983 -18.203 1.00 15.51 ? 266  GLU A N   1 
ATOM   173  C CA  . GLU A 1 23 ? 11.450  -46.628 -18.627 1.00 12.34 ? 266  GLU A CA  1 
ATOM   174  C C   . GLU A 1 23 ? 11.228  -48.128 -18.734 1.00 11.48 ? 266  GLU A C   1 
ATOM   175  O O   . GLU A 1 23 ? 10.616  -48.746 -17.866 1.00 12.43 ? 266  GLU A O   1 
ATOM   176  C CB  . GLU A 1 23 ? 12.606  -46.365 -17.673 1.00 13.08 ? 266  GLU A CB  1 
ATOM   177  C CG  . GLU A 1 23 ? 13.126  -44.980 -17.673 1.00 16.86 ? 266  GLU A CG  1 
ATOM   178  C CD  . GLU A 1 23 ? 13.883  -44.558 -18.912 1.00 17.55 ? 266  GLU A CD  1 
ATOM   179  O OE1 . GLU A 1 23 ? 14.178  -45.384 -19.786 1.00 16.76 ? 266  GLU A OE1 1 
ATOM   180  O OE2 . GLU A 1 23 ? 14.210  -43.365 -19.007 1.00 20.27 ? 266  GLU A OE2 1 
ATOM   181  N N   . LYS A 1 24 ? 11.671  -48.700 -19.840 1.00 15.42 ? 267  LYS A N   1 
ATOM   182  C CA  . LYS A 1 24 ? 11.631  -50.146 -19.989 1.00 17.98 ? 267  LYS A CA  1 
ATOM   183  C C   . LYS A 1 24 ? 12.900  -50.735 -19.441 1.00 18.53 ? 267  LYS A C   1 
ATOM   184  O O   . LYS A 1 24 ? 13.990  -50.121 -19.501 1.00 18.15 ? 267  LYS A O   1 
ATOM   185  C CB  . LYS A 1 24 ? 11.434  -50.537 -21.456 1.00 18.29 ? 267  LYS A CB  1 
ATOM   186  C CG  . LYS A 1 24 ? 10.089  -50.129 -21.991 1.00 17.80 ? 267  LYS A CG  1 
ATOM   187  C CD  . LYS A 1 24 ? 9.955   -50.448 -23.463 1.00 30.29 ? 267  LYS A CD  1 
ATOM   188  C CE  . LYS A 1 24 ? 8.499   -50.435 -23.878 1.00 34.27 ? 267  LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 24 ? 8.267   -51.136 -25.162 1.00 39.43 ? 267  LYS A NZ  1 
ATOM   190  N N   . GLY A 1 25 ? 12.774  -51.921 -18.873 1.00 15.10 ? 268  GLY A N   1 
ATOM   191  C CA  . GLY A 1 25 ? 13.954  -52.698 -18.582 1.00 18.52 ? 268  GLY A CA  1 
ATOM   192  C C   . GLY A 1 25 ? 14.691  -53.120 -19.841 1.00 15.09 ? 268  GLY A C   1 
ATOM   193  O O   . GLY A 1 25 ? 14.219  -52.950 -20.978 1.00 12.94 ? 268  GLY A O   1 
ATOM   194  N N   . LEU A 1 26 ? 15.874  -53.675 -19.612 1.00 15.43 ? 269  LEU A N   1 
ATOM   195  C CA  . LEU A 1 26 ? 16.643  -54.354 -20.627 1.00 19.51 ? 269  LEU A CA  1 
ATOM   196  C C   . LEU A 1 26 ? 15.800  -55.494 -21.234 1.00 17.52 ? 269  LEU A C   1 
ATOM   197  O O   . LEU A 1 26 ? 15.961  -55.836 -22.400 1.00 20.37 ? 269  LEU A O   1 
ATOM   198  C CB  . LEU A 1 26 ? 17.939  -54.908 -20.011 1.00 18.96 ? 269  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 26 ? 18.888  -53.909 -19.318 1.00 22.09 ? 269  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 26 ? 19.960  -54.662 -18.487 1.00 23.90 ? 269  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 26 ? 19.531  -53.005 -20.345 1.00 25.34 ? 269  LEU A CD2 1 
ATOM   202  N N   . ASP A 1 27 ? 14.889  -56.051 -20.445 1.00 18.00 ? 270  ASP A N   1 
ATOM   203  C CA  . ASP A 1 27 ? 13.953  -57.079 -20.928 1.00 19.11 ? 270  ASP A CA  1 
ATOM   204  C C   . ASP A 1 27 ? 12.678  -56.520 -21.594 1.00 18.90 ? 270  ASP A C   1 
ATOM   205  O O   . ASP A 1 27 ? 11.780  -57.291 -21.970 1.00 22.30 ? 270  ASP A O   1 
ATOM   206  C CB  . ASP A 1 27 ? 13.589  -58.014 -19.777 1.00 22.30 ? 270  ASP A CB  1 
ATOM   207  C CG  . ASP A 1 27 ? 12.791  -57.332 -18.705 1.00 20.30 ? 270  ASP A CG  1 
ATOM   208  O OD1 . ASP A 1 27 ? 12.386  -56.174 -18.900 1.00 15.88 ? 270  ASP A OD1 1 
ATOM   209  O OD2 . ASP A 1 27 ? 12.545  -57.971 -17.671 1.00 20.04 ? 270  ASP A OD2 1 
ATOM   210  N N   . GLY A 1 28 ? 12.611  -55.194 -21.757 1.00 13.58 ? 271  GLY A N   1 
ATOM   211  C CA  . GLY A 1 28 ? 11.475  -54.536 -22.418 1.00 15.26 ? 271  GLY A CA  1 
ATOM   212  C C   . GLY A 1 28 ? 10.298  -54.225 -21.492 1.00 15.75 ? 271  GLY A C   1 
ATOM   213  O O   . GLY A 1 28 ? 9.384   -53.502 -21.892 1.00 15.67 ? 271  GLY A O   1 
ATOM   214  N N   . ARG A 1 29 ? 10.322  -54.727 -20.248 1.00 7.22  ? 272  ARG A N   1 
ATOM   215  C CA  . ARG A 1 29 ? 9.177   -54.518 -19.332 1.00 16.32 ? 272  ARG A CA  1 
ATOM   216  C C   . ARG A 1 29 ? 9.059   -53.103 -18.843 1.00 15.15 ? 272  ARG A C   1 
ATOM   217  O O   . ARG A 1 29 ? 10.013  -52.576 -18.298 1.00 12.08 ? 272  ARG A O   1 
ATOM   218  C CB  . ARG A 1 29 ? 9.287   -55.427 -18.140 1.00 19.31 ? 272  ARG A CB  1 
ATOM   219  C CG  . ARG A 1 29 ? 8.105   -55.399 -17.224 1.00 20.37 ? 272  ARG A CG  1 
ATOM   220  C CD  . ARG A 1 29 ? 8.177   -56.578 -16.240 1.00 30.97 ? 272  ARG A CD  1 
ATOM   221  N NE  . ARG A 1 29 ? 7.904   -57.842 -16.931 1.00 51.27 ? 272  ARG A NE  1 
ATOM   222  C CZ  . ARG A 1 29 ? 8.389   -59.035 -16.584 1.00 57.41 ? 272  ARG A CZ  1 
ATOM   223  N NH1 . ARG A 1 29 ? 8.062   -60.102 -17.300 1.00 64.95 ? 272  ARG A NH1 1 
ATOM   224  N NH2 . ARG A 1 29 ? 9.204   -59.176 -15.542 1.00 71.50 ? 272  ARG A NH2 1 
ATOM   225  N N   . PRO A 1 30 ? 7.879   -52.470 -19.008 1.00 13.76 ? 273  PRO A N   1 
ATOM   226  C CA  . PRO A 1 30 ? 7.829   -51.092 -18.565 1.00 10.20 ? 273  PRO A CA  1 
ATOM   227  C C   . PRO A 1 30 ? 7.707   -50.879 -17.051 1.00 10.30 ? 273  PRO A C   1 
ATOM   228  O O   . PRO A 1 30 ? 7.058   -51.652 -16.349 1.00 15.78 ? 273  PRO A O   1 
ATOM   229  C CB  . PRO A 1 30 ? 6.583   -50.542 -19.287 1.00 18.51 ? 273  PRO A CB  1 
ATOM   230  C CG  . PRO A 1 30 ? 5.735   -51.656 -19.501 1.00 17.53 ? 273  PRO A CG  1 
ATOM   231  C CD  . PRO A 1 30 ? 6.584   -52.904 -19.563 1.00 14.14 ? 273  PRO A CD  1 
ATOM   232  N N   . GLY A 1 31 ? 8.400   -49.849 -16.573 1.00 10.87 ? 274  GLY A N   1 
ATOM   233  C CA  . GLY A 1 31 ? 8.232   -49.278 -15.245 1.00 18.78 ? 274  GLY A CA  1 
ATOM   234  C C   . GLY A 1 31 ? 7.917   -47.798 -15.416 1.00 15.76 ? 274  GLY A C   1 
ATOM   235  O O   . GLY A 1 31 ? 8.317   -47.162 -16.419 1.00 13.89 ? 274  GLY A O   1 
ATOM   236  N N   . GLN A 1 32 ? 7.161   -47.256 -14.477 1.00 15.44 ? 275  GLN A N   1 
ATOM   237  C CA  . GLN A 1 32 ? 6.764   -45.825 -14.531 1.00 15.32 ? 275  GLN A CA  1 
ATOM   238  C C   . GLN A 1 32 ? 7.424   -45.089 -13.408 1.00 16.65 ? 275  GLN A C   1 
ATOM   239  O O   . GLN A 1 32 ? 7.336   -45.508 -12.253 1.00 15.67 ? 275  GLN A O   1 
ATOM   240  C CB  . GLN A 1 32 ? 5.254   -45.645 -14.452 1.00 12.28 ? 275  GLN A CB  1 
ATOM   241  C CG  . GLN A 1 32 ? 4.508   -46.550 -15.435 1.00 10.14 ? 275  GLN A CG  1 
ATOM   242  C CD  . GLN A 1 32 ? 4.750   -46.164 -16.882 1.00 12.81 ? 275  GLN A CD  1 
ATOM   243  O OE1 . GLN A 1 32 ? 4.888   -44.966 -17.204 1.00 15.41 ? 275  GLN A OE1 1 
ATOM   244  N NE2 . GLN A 1 32 ? 4.756   -47.164 -17.776 1.00 14.07 ? 275  GLN A NE2 1 
ATOM   245  N N   . PHE A 1 33 ? 8.099   -43.990 -13.757 1.00 9.96  ? 276  PHE A N   1 
ATOM   246  C CA  . PHE A 1 33 ? 8.884   -43.211 -12.761 1.00 14.12 ? 276  PHE A CA  1 
ATOM   247  C C   . PHE A 1 33 ? 8.407   -41.785 -12.643 1.00 12.03 ? 276  PHE A C   1 
ATOM   248  O O   . PHE A 1 33 ? 7.993   -41.173 -13.645 1.00 16.08 ? 276  PHE A O   1 
ATOM   249  C CB  . PHE A 1 33 ? 10.367  -43.234 -13.134 1.00 16.59 ? 276  PHE A CB  1 
ATOM   250  C CG  . PHE A 1 33 ? 10.945  -44.607 -13.131 1.00 13.37 ? 276  PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 33 ? 11.561  -45.116 -11.986 1.00 17.26 ? 276  PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 33 ? 10.820  -45.428 -14.245 1.00 14.85 ? 276  PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 33 ? 12.090  -46.421 -11.981 1.00 18.02 ? 276  PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 33 ? 11.316  -46.720 -14.238 1.00 18.86 ? 276  PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 33 ? 11.965  -47.210 -13.111 1.00 16.80 ? 276  PHE A CZ  1 
ATOM   256  N N   . LEU A 1 34 ? 8.438   -41.267 -11.418 1.00 14.11 ? 277  LEU A N   1 
ATOM   257  C CA  . LEU A 1 34 ? 8.140   -39.869 -11.136 1.00 17.00 ? 277  LEU A CA  1 
ATOM   258  C C   . LEU A 1 34 ? 9.412   -39.157 -11.375 1.00 18.64 ? 277  LEU A C   1 
ATOM   259  O O   . LEU A 1 34 ? 10.287  -39.157 -10.501 1.00 17.47 ? 277  LEU A O   1 
ATOM   260  C CB  . LEU A 1 34 ? 7.709   -39.625 -9.686  0.70 13.43 ? 277  LEU A CB  1 
ATOM   261  C CG  . LEU A 1 34 ? 6.268   -39.883 -9.308  0.70 19.75 ? 277  LEU A CG  1 
ATOM   262  C CD1 . LEU A 1 34 ? 6.004   -41.360 -8.995  0.70 5.85  ? 277  LEU A CD1 1 
ATOM   263  C CD2 . LEU A 1 34 ? 5.950   -39.011 -8.124  0.70 17.94 ? 277  LEU A CD2 1 
ATOM   264  N N   . TRP A 1 35 ? 9.495   -38.541 -12.555 1.00 15.18 ? 278  TRP A N   1 
ATOM   265  C CA  . TRP A 1 35 ? 10.737  -38.031 -13.131 1.00 14.29 ? 278  TRP A CA  1 
ATOM   266  C C   . TRP A 1 35 ? 11.096  -36.676 -12.609 1.00 18.14 ? 278  TRP A C   1 
ATOM   267  O O   . TRP A 1 35 ? 12.262  -36.383 -12.459 1.00 18.11 ? 278  TRP A O   1 
ATOM   268  C CB  . TRP A 1 35 ? 10.625  -37.902 -14.645 1.00 15.49 ? 278  TRP A CB  1 
ATOM   269  C CG  . TRP A 1 35 ? 11.948  -38.108 -15.333 1.00 17.91 ? 278  TRP A CG  1 
ATOM   270  C CD1 . TRP A 1 35 ? 12.863  -37.145 -15.689 1.00 23.34 ? 278  TRP A CD1 1 
ATOM   271  C CD2 . TRP A 1 35 ? 12.532  -39.361 -15.687 1.00 13.20 ? 278  TRP A CD2 1 
ATOM   272  N NE1 . TRP A 1 35 ? 13.957  -37.732 -16.272 1.00 17.16 ? 278  TRP A NE1 1 
ATOM   273  C CE2 . TRP A 1 35 ? 13.792  -39.090 -16.252 1.00 17.81 ? 278  TRP A CE2 1 
ATOM   274  C CE3 . TRP A 1 35 ? 12.125  -40.694 -15.543 1.00 17.86 ? 278  TRP A CE3 1 
ATOM   275  C CZ2 . TRP A 1 35 ? 14.638  -40.103 -16.725 1.00 19.73 ? 278  TRP A CZ2 1 
ATOM   276  C CZ3 . TRP A 1 35 ? 12.981  -41.706 -15.994 1.00 24.69 ? 278  TRP A CZ3 1 
ATOM   277  C CH2 . TRP A 1 35 ? 14.216  -41.393 -16.591 1.00 20.43 ? 278  TRP A CH2 1 
ATOM   278  N N   . GLU A 1 36 ? 10.087  -35.830 -12.432 1.00 16.21 ? 279  GLU A N   1 
ATOM   279  C CA  . GLU A 1 36 ? 10.237  -34.551 -11.811 1.00 16.57 ? 279  GLU A CA  1 
ATOM   280  C C   . GLU A 1 36 ? 9.043   -34.316 -10.927 1.00 15.47 ? 279  GLU A C   1 
ATOM   281  O O   . GLU A 1 36 ? 7.937   -34.719 -11.252 1.00 13.69 ? 279  GLU A O   1 
ATOM   282  C CB  . GLU A 1 36 ? 10.356  -33.448 -12.883 1.00 20.11 ? 279  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 36 ? 11.346  -33.800 -14.001 1.00 33.17 ? 279  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 36 ? 11.525  -32.707 -15.045 1.00 43.00 ? 279  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 36 ? 10.706  -31.749 -15.072 1.00 50.29 ? 279  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 36 ? 12.487  -32.837 -15.851 1.00 55.34 ? 279  GLU A OE2 1 
ATOM   287  N N   . VAL A 1 37 ? 9.272   -33.675 -9.788  1.00 15.04 ? 280  VAL A N   1 
ATOM   288  C CA  . VAL A 1 37 ? 8.184   -33.285 -8.903  1.00 21.16 ? 280  VAL A CA  1 
ATOM   289  C C   . VAL A 1 37 ? 8.227   -31.781 -8.705  1.00 20.74 ? 280  VAL A C   1 
ATOM   290  O O   . VAL A 1 37 ? 9.196   -31.269 -8.184  1.00 16.56 ? 280  VAL A O   1 
ATOM   291  C CB  . VAL A 1 37 ? 8.318   -33.983 -7.543  1.00 23.48 ? 280  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 37 ? 7.146   -33.624 -6.641  1.00 21.44 ? 280  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 37 ? 8.421   -35.462 -7.739  1.00 15.21 ? 280  VAL A CG2 1 
ATOM   294  N N   . ASP A 1 38 ? 7.179   -31.081 -9.119  1.00 18.08 ? 281  ASP A N   1 
ATOM   295  C CA  . ASP A 1 38 ? 7.158   -29.615 -9.057  1.00 18.81 ? 281  ASP A CA  1 
ATOM   296  C C   . ASP A 1 38 ? 7.081   -29.083 -7.615  1.00 15.33 ? 281  ASP A C   1 
ATOM   297  O O   . ASP A 1 38 ? 6.248   -29.516 -6.832  1.00 10.48 ? 281  ASP A O   1 
ATOM   298  C CB  . ASP A 1 38 ? 5.991   -29.098 -9.890  1.00 16.08 ? 281  ASP A CB  1 
ATOM   299  C CG  . ASP A 1 38 ? 6.007   -29.693 -11.301 1.00 34.80 ? 281  ASP A CG  1 
ATOM   300  O OD1 . ASP A 1 38 ? 7.115   -29.736 -11.874 1.00 37.70 ? 281  ASP A OD1 1 
ATOM   301  O OD2 . ASP A 1 38 ? 4.954   -30.180 -11.800 1.00 33.46 ? 281  ASP A OD2 1 
ATOM   302  N N   . PRO A 1 39 ? 7.981   -28.153 -7.256  1.00 16.65 ? 282  PRO A N   1 
ATOM   303  C CA  . PRO A 1 39 ? 7.869   -27.479 -5.969  1.00 17.51 ? 282  PRO A CA  1 
ATOM   304  C C   . PRO A 1 39 ? 6.494   -26.827 -5.805  1.00 13.59 ? 282  PRO A C   1 
ATOM   305  O O   . PRO A 1 39 ? 5.928   -26.361 -6.783  1.00 13.66 ? 282  PRO A O   1 
ATOM   306  C CB  . PRO A 1 39 ? 8.953   -26.409 -6.024  1.00 16.37 ? 282  PRO A CB  1 
ATOM   307  C CG  . PRO A 1 39 ? 9.816   -26.719 -7.144  1.00 22.97 ? 282  PRO A CG  1 
ATOM   308  C CD  . PRO A 1 39 ? 9.139   -27.692 -8.043  1.00 21.47 ? 282  PRO A CD  1 
ATOM   309  N N   . GLY A 1 40 ? 5.964   -26.847 -4.584  1.00 13.21 ? 283  GLY A N   1 
ATOM   310  C CA  . GLY A 1 40 ? 4.762   -26.095 -4.238  1.00 9.90  ? 283  GLY A CA  1 
ATOM   311  C C   . GLY A 1 40 ? 3.437   -26.673 -4.706  1.00 7.80  ? 283  GLY A C   1 
ATOM   312  O O   . GLY A 1 40 ? 2.393   -26.041 -4.541  1.00 4.94  ? 283  GLY A O   1 
ATOM   313  N N   . LEU A 1 41 ? 3.460   -27.889 -5.247  1.00 11.99 ? 284  LEU A N   1 
ATOM   314  C CA  . LEU A 1 41 ? 2.254   -28.526 -5.717  1.00 12.92 ? 284  LEU A CA  1 
ATOM   315  C C   . LEU A 1 41 ? 2.034   -29.830 -4.952  1.00 10.78 ? 284  LEU A C   1 
ATOM   316  O O   . LEU A 1 41 ? 2.904   -30.255 -4.187  1.00 11.17 ? 284  LEU A O   1 
ATOM   317  C CB  . LEU A 1 41 ? 2.332   -28.708 -7.227  1.00 8.88  ? 284  LEU A CB  1 
ATOM   318  C CG  . LEU A 1 41 ? 2.256   -27.401 -8.001  1.00 17.18 ? 284  LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 41 ? 2.419   -27.629 -9.512  1.00 18.84 ? 284  LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 41 ? 0.921   -26.698 -7.666  1.00 22.25 ? 284  LEU A CD2 1 
ATOM   321  N N   . PRO A 1 42 ? 0.840   -30.404 -5.074  1.00 16.93 ? 285  PRO A N   1 
ATOM   322  C CA  . PRO A 1 42 ? 0.427   -31.430 -4.133  1.00 16.80 ? 285  PRO A CA  1 
ATOM   323  C C   . PRO A 1 42 ? 1.355   -32.608 -3.982  1.00 19.78 ? 285  PRO A C   1 
ATOM   324  O O   . PRO A 1 42 ? 1.522   -33.091 -2.848  1.00 22.29 ? 285  PRO A O   1 
ATOM   325  C CB  . PRO A 1 42 ? -0.907  -31.875 -4.695  1.00 21.19 ? 285  PRO A CB  1 
ATOM   326  C CG  . PRO A 1 42 ? -1.435  -30.622 -5.271  1.00 20.06 ? 285  PRO A CG  1 
ATOM   327  C CD  . PRO A 1 42 ? -0.256  -30.086 -6.004  1.00 16.12 ? 285  PRO A CD  1 
ATOM   328  N N   . ALA A 1 43 ? 1.935   -33.077 -5.088  1.00 17.67 ? 286  ALA A N   1 
ATOM   329  C CA  . ALA A 1 43 ? 2.839   -34.208 -5.053  1.00 16.02 ? 286  ALA A CA  1 
ATOM   330  C C   . ALA A 1 43 ? 3.983   -33.918 -4.123  1.00 17.52 ? 286  ALA A C   1 
ATOM   331  O O   . ALA A 1 43 ? 4.206   -34.651 -3.154  1.00 16.06 ? 286  ALA A O   1 
ATOM   332  C CB  . ALA A 1 43 ? 3.361   -34.592 -6.477  1.00 15.92 ? 286  ALA A CB  1 
ATOM   333  N N   . LYS A 1 44 ? 4.704   -32.836 -4.406  1.00 19.26 ? 287  LYS A N   1 
ATOM   334  C CA  . LYS A 1 44 ? 5.827   -32.397 -3.559  1.00 21.78 ? 287  LYS A CA  1 
ATOM   335  C C   . LYS A 1 44 ? 5.464   -32.259 -2.096  1.00 24.94 ? 287  LYS A C   1 
ATOM   336  O O   . LYS A 1 44 ? 6.171   -32.760 -1.217  1.00 24.77 ? 287  LYS A O   1 
ATOM   337  C CB  . LYS A 1 44 ? 6.357   -31.038 -4.040  1.00 22.95 ? 287  LYS A CB  1 
ATOM   338  C CG  . LYS A 1 44 ? 7.664   -30.602 -3.401  1.00 29.97 ? 287  LYS A CG  1 
ATOM   339  C CD  . LYS A 1 44 ? 8.843   -31.287 -4.042  1.00 33.53 ? 287  LYS A CD  1 
ATOM   340  C CE  . LYS A 1 44 ? 10.156  -30.829 -3.456  1.00 42.93 ? 287  LYS A CE  1 
ATOM   341  N NZ  . LYS A 1 44 ? 11.303  -31.562 -4.080  1.00 53.12 ? 287  LYS A NZ  1 
ATOM   342  N N   . LYS A 1 45 ? 4.366   -31.557 -1.839  1.00 26.15 ? 288  LYS A N   1 
ATOM   343  C CA  . LYS A 1 45 ? 3.965   -31.243 -0.476  1.00 27.96 ? 288  LYS A CA  1 
ATOM   344  C C   . LYS A 1 45 ? 3.504   -32.497 0.250   1.00 29.65 ? 288  LYS A C   1 
ATOM   345  O O   . LYS A 1 45 ? 3.586   -32.577 1.484   1.00 31.39 ? 288  LYS A O   1 
ATOM   346  C CB  . LYS A 1 45 ? 2.873   -30.175 -0.475  1.00 29.27 ? 288  LYS A CB  1 
ATOM   347  C CG  . LYS A 1 45 ? 3.333   -28.882 -1.133  1.00 22.93 ? 288  LYS A CG  1 
ATOM   348  C CD  . LYS A 1 45 ? 2.297   -27.816 -1.067  1.00 21.40 ? 288  LYS A CD  1 
ATOM   349  C CE  . LYS A 1 45 ? 2.526   -26.940 0.091   1.00 14.29 ? 288  LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 45 ? 1.787   -25.670 -0.025  1.00 19.40 ? 288  LYS A NZ  1 
ATOM   351  N N   . ALA A 1 46 ? 3.040   -33.477 -0.523  1.00 27.77 ? 289  ALA A N   1 
ATOM   352  C CA  . ALA A 1 46 ? 2.658   -34.778 0.018   1.00 27.77 ? 289  ALA A CA  1 
ATOM   353  C C   . ALA A 1 46 ? 3.850   -35.752 0.118   1.00 28.95 ? 289  ALA A C   1 
ATOM   354  O O   . ALA A 1 46 ? 3.662   -36.948 0.385   1.00 34.26 ? 289  ALA A O   1 
ATOM   355  C CB  . ALA A 1 46 ? 1.540   -35.357 -0.787  1.00 22.44 ? 289  ALA A CB  1 
ATOM   356  N N   . GLY A 1 47 ? 5.062   -35.223 -0.061  1.00 28.02 ? 290  GLY A N   1 
ATOM   357  C CA  . GLY A 1 47 ? 6.301   -35.965 0.167   1.00 28.91 ? 290  GLY A CA  1 
ATOM   358  C C   . GLY A 1 47 ? 6.911   -36.790 -0.963  1.00 27.89 ? 290  GLY A C   1 
ATOM   359  O O   . GLY A 1 47 ? 7.874   -37.508 -0.735  1.00 29.05 ? 290  GLY A O   1 
ATOM   360  N N   . MET A 1 48 ? 6.378   -36.681 -2.177  1.00 25.75 ? 291  MET A N   1 
ATOM   361  C CA  . MET A 1 48 ? 6.920   -37.413 -3.338  1.00 21.55 ? 291  MET A CA  1 
ATOM   362  C C   . MET A 1 48 ? 8.281   -36.882 -3.740  1.00 16.91 ? 291  MET A C   1 
ATOM   363  O O   . MET A 1 48 ? 8.512   -35.685 -3.678  1.00 21.85 ? 291  MET A O   1 
ATOM   364  C CB  A MET A 1 48 ? 5.994   -37.301 -4.541  0.70 21.75 ? 291  MET A CB  1 
ATOM   365  C CB  B MET A 1 48 ? 5.893   -37.408 -4.501  0.30 20.78 ? 291  MET A CB  1 
ATOM   366  C CG  A MET A 1 48 ? 5.150   -38.517 -4.763  0.70 31.19 ? 291  MET A CG  1 
ATOM   367  C CG  B MET A 1 48 ? 6.464   -37.425 -5.920  0.30 16.13 ? 291  MET A CG  1 
ATOM   368  S SD  A MET A 1 48 ? 3.444   -38.062 -5.010  0.70 31.61 ? 291  MET A SD  1 
ATOM   369  S SD  B MET A 1 48 ? 5.355   -37.821 -7.307  0.30 11.16 ? 291  MET A SD  1 
ATOM   370  C CE  A MET A 1 48 ? 3.081   -39.001 -6.488  0.70 27.58 ? 291  MET A CE  1 
ATOM   371  C CE  B MET A 1 48 ? 3.727   -37.860 -6.561  0.30 18.67 ? 291  MET A CE  1 
ATOM   372  N N   . GLN A 1 49 ? 9.174   -37.781 -4.155  1.00 21.19 ? 292  GLN A N   1 
ATOM   373  C CA  . GLN A 1 49 ? 10.544  -37.443 -4.570  1.00 22.06 ? 292  GLN A CA  1 
ATOM   374  C C   . GLN A 1 49 ? 10.783  -37.738 -6.041  1.00 19.91 ? 292  GLN A C   1 
ATOM   375  O O   . GLN A 1 49 ? 10.368  -38.796 -6.560  1.00 16.46 ? 292  GLN A O   1 
ATOM   376  C CB  . GLN A 1 49 ? 11.571  -38.293 -3.803  1.00 23.77 ? 292  GLN A CB  1 
ATOM   377  C CG  . GLN A 1 49 ? 11.611  -38.117 -2.317  1.00 32.46 ? 292  GLN A CG  1 
ATOM   378  C CD  . GLN A 1 49 ? 12.594  -39.078 -1.634  1.00 33.60 ? 292  GLN A CD  1 
ATOM   379  O OE1 . GLN A 1 49 ? 13.351  -39.802 -2.293  1.00 33.91 ? 292  GLN A OE1 1 
ATOM   380  N NE2 . GLN A 1 49 ? 12.581  -39.080 -0.306  1.00 47.35 ? 292  GLN A NE2 1 
ATOM   381  N N   . ALA A 1 50 ? 11.483  -36.835 -6.727  1.00 17.62 ? 293  ALA A N   1 
ATOM   382  C CA  . ALA A 1 50 ? 11.954  -37.134 -8.091  1.00 21.84 ? 293  ALA A CA  1 
ATOM   383  C C   . ALA A 1 50 ? 12.768  -38.399 -8.038  1.00 18.38 ? 293  ALA A C   1 
ATOM   384  O O   . ALA A 1 50 ? 13.561  -38.595 -7.114  1.00 17.56 ? 293  ALA A O   1 
ATOM   385  C CB  . ALA A 1 50 ? 12.796  -36.010 -8.665  1.00 21.03 ? 293  ALA A CB  1 
ATOM   386  N N   . GLY A 1 51 ? 12.559  -39.275 -9.019  1.00 20.14 ? 294  GLY A N   1 
ATOM   387  C CA  . GLY A 1 51 ? 13.153  -40.604 -8.978  1.00 17.26 ? 294  GLY A CA  1 
ATOM   388  C C   . GLY A 1 51 ? 12.322  -41.688 -8.308  1.00 19.66 ? 294  GLY A C   1 
ATOM   389  O O   . GLY A 1 51 ? 12.733  -42.840 -8.291  1.00 15.88 ? 294  GLY A O   1 
ATOM   390  N N   . ASP A 1 52 ? 11.178  -41.341 -7.718  1.00 18.64 ? 295  ASP A N   1 
ATOM   391  C CA  . ASP A 1 52 ? 10.293  -42.367 -7.160  1.00 11.06 ? 295  ASP A CA  1 
ATOM   392  C C   . ASP A 1 52 ? 9.825   -43.308 -8.296  1.00 14.10 ? 295  ASP A C   1 
ATOM   393  O O   . ASP A 1 52 ? 9.471   -42.870 -9.420  1.00 15.15 ? 295  ASP A O   1 
ATOM   394  C CB  . ASP A 1 52 ? 9.039   -41.740 -6.499  1.00 13.63 ? 295  ASP A CB  1 
ATOM   395  C CG  . ASP A 1 52 ? 9.266   -41.246 -5.067  1.00 15.77 ? 295  ASP A CG  1 
ATOM   396  O OD1 . ASP A 1 52 ? 10.299  -41.558 -4.455  1.00 17.89 ? 295  ASP A OD1 1 
ATOM   397  O OD2 . ASP A 1 52 ? 8.359   -40.553 -4.536  1.00 16.13 ? 295  ASP A OD2 1 
ATOM   398  N N   . ARG A 1 53 ? 9.761   -44.587 -8.010  1.00 11.99 ? 296  ARG A N   1 
ATOM   399  C CA  . ARG A 1 53 ? 9.105   -45.507 -8.902  1.00 14.17 ? 296  ARG A CA  1 
ATOM   400  C C   . ARG A 1 53 ? 7.672   -45.642 -8.441  1.00 10.40 ? 296  ARG A C   1 
ATOM   401  O O   . ARG A 1 53 ? 7.440   -45.941 -7.264  1.00 17.42 ? 296  ARG A O   1 
ATOM   402  C CB  . ARG A 1 53 ? 9.769   -46.869 -8.847  1.00 17.95 ? 296  ARG A CB  1 
ATOM   403  C CG  . ARG A 1 53 ? 9.031   -47.906 -9.678  1.00 12.24 ? 296  ARG A CG  1 
ATOM   404  C CD  . ARG A 1 53 ? 9.419   -49.263 -9.280  1.00 18.65 ? 296  ARG A CD  1 
ATOM   405  N NE  . ARG A 1 53 ? 10.799  -49.523 -9.662  1.00 18.59 ? 296  ARG A NE  1 
ATOM   406  C CZ  . ARG A 1 53 ? 11.182  -50.016 -10.834 1.00 14.66 ? 296  ARG A CZ  1 
ATOM   407  N NH1 . ARG A 1 53 ? 10.309  -50.401 -11.739 1.00 21.80 ? 296  ARG A NH1 1 
ATOM   408  N NH2 . ARG A 1 53 ? 12.465  -50.188 -11.059 1.00 21.36 ? 296  ARG A NH2 1 
ATOM   409  N N   . LEU A 1 54 ? 6.717   -45.499 -9.362  1.00 11.36 ? 297  LEU A N   1 
ATOM   410  C CA  . LEU A 1 54 ? 5.287   -45.711 -9.032  1.00 12.17 ? 297  LEU A CA  1 
ATOM   411  C C   . LEU A 1 54 ? 4.890   -47.186 -9.131  1.00 14.96 ? 297  LEU A C   1 
ATOM   412  O O   . LEU A 1 54 ? 4.942   -47.759 -10.236 1.00 13.62 ? 297  LEU A O   1 
ATOM   413  C CB  . LEU A 1 54 ? 4.404   -44.875 -9.944  1.00 8.60  ? 297  LEU A CB  1 
ATOM   414  C CG  . LEU A 1 54 ? 2.901   -44.911 -9.704  1.00 12.29 ? 297  LEU A CG  1 
ATOM   415  C CD1 . LEU A 1 54 ? 2.597   -44.273 -8.373  1.00 10.04 ? 297  LEU A CD1 1 
ATOM   416  C CD2 . LEU A 1 54 ? 2.214   -44.140 -10.855 1.00 16.52 ? 297  LEU A CD2 1 
ATOM   417  N N   . VAL A 1 55 ? 4.515   -47.792 -7.994  1.00 12.54 ? 298  VAL A N   1 
ATOM   418  C CA  . VAL A 1 55 ? 4.211   -49.231 -7.947  1.00 13.75 ? 298  VAL A CA  1 
ATOM   419  C C   . VAL A 1 55 ? 2.725   -49.552 -7.767  1.00 11.46 ? 298  VAL A C   1 
ATOM   420  O O   . VAL A 1 55 ? 2.307   -50.634 -8.134  1.00 11.94 ? 298  VAL A O   1 
ATOM   421  C CB  . VAL A 1 55 ? 5.024   -50.024 -6.864  1.00 13.64 ? 298  VAL A CB  1 
ATOM   422  C CG1 . VAL A 1 55 ? 6.526   -49.955 -7.152  1.00 13.78 ? 298  VAL A CG1 1 
ATOM   423  C CG2 . VAL A 1 55 ? 4.676   -49.594 -5.424  1.00 9.51  ? 298  VAL A CG2 1 
ATOM   424  N N   . ALA A 1 56 ? 1.937   -48.614 -7.253  1.00 11.15 ? 299  ALA A N   1 
ATOM   425  C CA  . ALA A 1 56 ? 0.474   -48.830 -7.137  1.00 16.60 ? 299  ALA A CA  1 
ATOM   426  C C   . ALA A 1 56 ? -0.301  -47.520 -7.224  1.00 12.37 ? 299  ALA A C   1 
ATOM   427  O O   . ALA A 1 56 ? 0.197   -46.481 -6.802  1.00 16.11 ? 299  ALA A O   1 
ATOM   428  C CB  . ALA A 1 56 ? 0.149   -49.569 -5.830  1.00 9.75  ? 299  ALA A CB  1 
ATOM   429  N N   . VAL A 1 57 ? -1.499  -47.580 -7.799  1.00 16.86 ? 300  VAL A N   1 
ATOM   430  C CA  . VAL A 1 57 ? -2.441  -46.433 -7.856  1.00 11.55 ? 300  VAL A CA  1 
ATOM   431  C C   . VAL A 1 57 ? -3.767  -46.928 -7.271  1.00 16.27 ? 300  VAL A C   1 
ATOM   432  O O   . VAL A 1 57 ? -4.270  -48.007 -7.657  1.00 14.66 ? 300  VAL A O   1 
ATOM   433  C CB  . VAL A 1 57 ? -2.686  -45.937 -9.328  1.00 13.52 ? 300  VAL A CB  1 
ATOM   434  C CG1 . VAL A 1 57 ? -3.829  -44.846 -9.415  1.00 11.00 ? 300  VAL A CG1 1 
ATOM   435  C CG2 . VAL A 1 57 ? -1.378  -45.455 -9.973  1.00 11.16 ? 300  VAL A CG2 1 
ATOM   436  N N   . ALA A 1 58 ? -4.315  -46.165 -6.324  1.00 18.45 ? 301  ALA A N   1 
ATOM   437  C CA  . ALA A 1 58 ? -5.604  -46.526 -5.727  1.00 19.67 ? 301  ALA A CA  1 
ATOM   438  C C   . ALA A 1 58 ? -5.555  -47.951 -5.224  1.00 15.62 ? 301  ALA A C   1 
ATOM   439  O O   . ALA A 1 58 ? -6.551  -48.682 -5.328  1.00 14.75 ? 301  ALA A O   1 
ATOM   440  C CB  . ALA A 1 58 ? -6.727  -46.365 -6.748  1.00 14.54 ? 301  ALA A CB  1 
ATOM   441  N N   . GLY A 1 59 ? -4.396  -48.361 -4.715  1.00 13.12 ? 302  GLY A N   1 
ATOM   442  C CA  . GLY A 1 59 ? -4.243  -49.706 -4.125  1.00 14.38 ? 302  GLY A CA  1 
ATOM   443  C C   . GLY A 1 59 ? -3.999  -50.847 -5.109  1.00 14.16 ? 302  GLY A C   1 
ATOM   444  O O   . GLY A 1 59 ? -3.841  -51.990 -4.715  1.00 11.20 ? 302  GLY A O   1 
ATOM   445  N N   . GLU A 1 60 ? -3.974  -50.564 -6.398  1.00 11.57 ? 303  GLU A N   1 
ATOM   446  C CA  . GLU A 1 60 ? -3.810  -51.633 -7.390  1.00 9.87  ? 303  GLU A CA  1 
ATOM   447  C C   . GLU A 1 60 ? -2.462  -51.514 -8.032  1.00 13.87 ? 303  GLU A C   1 
ATOM   448  O O   . GLU A 1 60 ? -2.027  -50.423 -8.349  1.00 12.29 ? 303  GLU A O   1 
ATOM   449  C CB  . GLU A 1 60 ? -4.935  -51.590 -8.427  1.00 16.17 ? 303  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 60 ? -6.257  -52.063 -7.800  1.00 19.61 ? 303  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 60 ? -7.384  -52.274 -8.785  1.00 22.11 ? 303  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 60 ? -7.142  -52.700 -9.927  1.00 32.20 ? 303  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 60 ? -8.537  -52.046 -8.382  1.00 36.32 ? 303  GLU A OE2 1 
ATOM   454  N N   . SER A 1 61 ? -1.792  -52.639 -8.232  1.00 15.04 ? 304  SER A N   1 
ATOM   455  C CA  . SER A 1 61 ? -0.431  -52.582 -8.735  1.00 18.45 ? 304  SER A CA  1 
ATOM   456  C C   . SER A 1 61 ? -0.357  -52.015 -10.153 1.00 20.38 ? 304  SER A C   1 
ATOM   457  O O   . SER A 1 61 ? -1.165  -52.347 -11.020 1.00 18.87 ? 304  SER A O   1 
ATOM   458  C CB  . SER A 1 61 ? 0.248   -53.950 -8.680  1.00 17.65 ? 304  SER A CB  1 
ATOM   459  O OG  . SER A 1 61 ? 1.471   -53.939 -9.405  1.00 13.08 ? 304  SER A OG  1 
ATOM   460  N N   . VAL A 1 62 ? 0.633   -51.157 -10.382 1.00 13.27 ? 305  VAL A N   1 
ATOM   461  C CA  . VAL A 1 62 ? 0.947   -50.755 -11.743 1.00 15.00 ? 305  VAL A CA  1 
ATOM   462  C C   . VAL A 1 62 ? 2.320   -51.311 -12.170 1.00 13.57 ? 305  VAL A C   1 
ATOM   463  O O   . VAL A 1 62 ? 2.914   -50.830 -13.119 1.00 11.13 ? 305  VAL A O   1 
ATOM   464  C CB  . VAL A 1 62 ? 0.790   -49.225 -11.938 1.00 11.54 ? 305  VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 62 ? -0.685  -48.839 -11.821 1.00 11.60 ? 305  VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 62 ? 1.672   -48.391 -10.921 1.00 10.39 ? 305  VAL A CG2 1 
ATOM   467  N N   . GLU A 1 63 ? 2.806   -52.332 -11.457 1.00 11.62 ? 306  GLU A N   1 
ATOM   468  C CA  . GLU A 1 63 ? 4.062   -52.971 -11.822 1.00 15.65 ? 306  GLU A CA  1 
ATOM   469  C C   . GLU A 1 63 ? 3.875   -53.693 -13.159 1.00 14.96 ? 306  GLU A C   1 
ATOM   470  O O   . GLU A 1 63 ? 2.890   -54.392 -13.355 1.00 14.29 ? 306  GLU A O   1 
ATOM   471  C CB  . GLU A 1 63 ? 4.547   -53.918 -10.714 1.00 15.65 ? 306  GLU A CB  1 
ATOM   472  C CG  . GLU A 1 63 ? 4.977   -53.149 -9.438  1.00 20.41 ? 306  GLU A CG  1 
ATOM   473  C CD  . GLU A 1 63 ? 5.367   -54.027 -8.261  1.00 22.06 ? 306  GLU A CD  1 
ATOM   474  O OE1 . GLU A 1 63 ? 5.506   -55.250 -8.431  1.00 17.27 ? 306  GLU A OE1 1 
ATOM   475  O OE2 . GLU A 1 63 ? 5.536   -53.477 -7.149  1.00 18.09 ? 306  GLU A OE2 1 
ATOM   476  N N   . GLY A 1 64 ? 4.807   -53.479 -14.084 1.00 16.69 ? 307  GLY A N   1 
ATOM   477  C CA  . GLY A 1 64 ? 4.754   -54.107 -15.389 1.00 17.91 ? 307  GLY A CA  1 
ATOM   478  C C   . GLY A 1 64 ? 3.728   -53.523 -16.351 1.00 16.42 ? 307  GLY A C   1 
ATOM   479  O O   . GLY A 1 64 ? 3.568   -54.047 -17.453 1.00 17.25 ? 307  GLY A O   1 
ATOM   480  N N   . LEU A 1 65 ? 3.043   -52.450 -15.945 1.00 13.17 ? 308  LEU A N   1 
ATOM   481  C CA  . LEU A 1 65 ? 2.012   -51.821 -16.748 1.00 13.49 ? 308  LEU A CA  1 
ATOM   482  C C   . LEU A 1 65 ? 2.578   -50.688 -17.579 1.00 12.71 ? 308  LEU A C   1 
ATOM   483  O O   . LEU A 1 65 ? 3.521   -50.009 -17.155 1.00 12.59 ? 308  LEU A O   1 
ATOM   484  C CB  . LEU A 1 65 ? 0.871   -51.268 -15.890 1.00 12.05 ? 308  LEU A CB  1 
ATOM   485  C CG  . LEU A 1 65 ? -0.078  -52.251 -15.183 1.00 15.60 ? 308  LEU A CG  1 
ATOM   486  C CD1 . LEU A 1 65 ? -1.308  -51.468 -14.648 1.00 16.36 ? 308  LEU A CD1 1 
ATOM   487  C CD2 . LEU A 1 65 ? -0.530  -53.390 -16.063 1.00 19.50 ? 308  LEU A CD2 1 
ATOM   488  N N   . GLY A 1 66 ? 1.973   -50.483 -18.753 1.00 13.99 ? 309  GLY A N   1 
ATOM   489  C CA  . GLY A 1 66 ? 2.399   -49.435 -19.690 1.00 15.51 ? 309  GLY A CA  1 
ATOM   490  C C   . GLY A 1 66 ? 1.983   -48.057 -19.240 1.00 11.94 ? 309  GLY A C   1 
ATOM   491  O O   . GLY A 1 66 ? 1.309   -47.888 -18.219 1.00 14.13 ? 309  GLY A O   1 
ATOM   492  N N   . HIS A 1 67 ? 2.337   -47.063 -20.038 1.00 14.61 ? 310  HIS A N   1 
ATOM   493  C CA  . HIS A 1 67 ? 2.238   -45.662 -19.638 1.00 14.25 ? 310  HIS A CA  1 
ATOM   494  C C   . HIS A 1 67 ? 0.822   -45.091 -19.701 1.00 14.83 ? 310  HIS A C   1 
ATOM   495  O O   . HIS A 1 67 ? 0.294   -44.584 -18.691 1.00 11.64 ? 310  HIS A O   1 
ATOM   496  C CB  . HIS A 1 67 ? 3.174   -44.829 -20.485 1.00 16.52 ? 310  HIS A CB  1 
ATOM   497  C CG  . HIS A 1 67 ? 3.271   -43.414 -20.036 1.00 10.65 ? 310  HIS A CG  1 
ATOM   498  N ND1 . HIS A 1 67 ? 3.958   -43.049 -18.897 1.00 14.13 ? 310  HIS A ND1 1 
ATOM   499  C CD2 . HIS A 1 67 ? 2.766   -42.276 -20.563 1.00 11.88 ? 310  HIS A CD2 1 
ATOM   500  C CE1 . HIS A 1 67 ? 3.868   -41.742 -18.737 1.00 13.63 ? 310  HIS A CE1 1 
ATOM   501  N NE2 . HIS A 1 67 ? 3.163   -41.246 -19.737 1.00 14.61 ? 310  HIS A NE2 1 
ATOM   502  N N   . GLU A 1 68 ? 0.197   -45.190 -20.865 1.00 18.04 ? 311  GLU A N   1 
ATOM   503  C CA  . GLU A 1 68 ? -1.205  -44.784 -21.017 1.00 18.44 ? 311  GLU A CA  1 
ATOM   504  C C   . GLU A 1 68 ? -2.109  -45.467 -19.960 1.00 14.14 ? 311  GLU A C   1 
ATOM   505  O O   . GLU A 1 68 ? -2.899  -44.809 -19.327 1.00 11.11 ? 311  GLU A O   1 
ATOM   506  C CB  . GLU A 1 68 ? -1.711  -45.004 -22.465 1.00 14.59 ? 311  GLU A CB  1 
ATOM   507  C CG  . GLU A 1 68 ? -1.879  -46.487 -22.910 1.00 35.81 ? 311  GLU A CG  1 
ATOM   508  C CD  . GLU A 1 68 ? -2.821  -46.716 -24.125 1.00 38.09 ? 311  GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 68 ? -3.275  -45.729 -24.760 1.00 46.22 ? 311  GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 68 ? -3.102  -47.905 -24.432 1.00 31.58 ? 311  GLU A OE2 1 
ATOM   511  N N   . GLU A 1 69 ? -1.905  -46.756 -19.726 1.00 14.76 ? 312  GLU A N   1 
ATOM   512  C CA  . GLU A 1 69 ? -2.650  -47.500 -18.724 1.00 14.30 ? 312  GLU A CA  1 
ATOM   513  C C   . GLU A 1 69 ? -2.462  -46.984 -17.291 1.00 12.72 ? 312  GLU A C   1 
ATOM   514  O O   . GLU A 1 69 ? -3.410  -46.995 -16.506 1.00 12.20 ? 312  GLU A O   1 
ATOM   515  C CB  . GLU A 1 69 ? -2.308  -49.003 -18.820 1.00 16.35 ? 312  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 69 ? -2.954  -49.879 -17.734 1.00 25.97 ? 312  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 69 ? -4.457  -50.000 -17.909 1.00 32.97 ? 312  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 69 ? -4.913  -49.989 -19.074 1.00 30.74 ? 312  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 69 ? -5.182  -50.112 -16.899 1.00 21.05 ? 312  GLU A OE2 1 
ATOM   520  N N   . THR A 1 70 ? -1.261  -46.527 -16.950 1.00 16.28 ? 313  THR A N   1 
ATOM   521  C CA  . THR A 1 70 ? -0.975  -46.022 -15.612 1.00 15.93 ? 313  THR A CA  1 
ATOM   522  C C   . THR A 1 70 ? -1.521  -44.645 -15.441 1.00 12.65 ? 313  THR A C   1 
ATOM   523  O O   . THR A 1 70 ? -2.159  -44.355 -14.432 1.00 13.03 ? 313  THR A O   1 
ATOM   524  C CB  . THR A 1 70 ? 0.516   -46.091 -15.331 1.00 12.70 ? 313  THR A CB  1 
ATOM   525  O OG1 . THR A 1 70 ? 0.878   -47.459 -15.401 1.00 13.34 ? 313  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 70 ? 0.893   -45.529 -13.953 1.00 10.39 ? 313  THR A CG2 1 
ATOM   527  N N   . VAL A 1 71 ? -1.306  -43.794 -16.442 1.00 12.22 ? 314  VAL A N   1 
ATOM   528  C CA  . VAL A 1 71 ? -1.943  -42.503 -16.462 1.00 9.18  ? 314  VAL A CA  1 
ATOM   529  C C   . VAL A 1 71 ? -3.497  -42.642 -16.300 1.00 12.51 ? 314  VAL A C   1 
ATOM   530  O O   . VAL A 1 71 ? -4.098  -41.953 -15.491 1.00 14.99 ? 314  VAL A O   1 
ATOM   531  C CB  . VAL A 1 71 ? -1.560  -41.672 -17.772 1.00 15.92 ? 314  VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71 ? -2.436  -40.456 -17.937 1.00 13.62 ? 314  VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71 ? -0.074  -41.225 -17.768 1.00 10.20 ? 314  VAL A CG2 1 
ATOM   534  N N   . SER A 1 72 ? -4.136  -43.534 -17.051 1.00 9.06  ? 315  SER A N   1 
ATOM   535  C CA  . SER A 1 72 ? -5.602  -43.607 -17.015 1.00 13.88 ? 315  SER A CA  1 
ATOM   536  C C   . SER A 1 72 ? -6.046  -43.967 -15.604 1.00 15.33 ? 315  SER A C   1 
ATOM   537  O O   . SER A 1 72 ? -7.024  -43.420 -15.072 1.00 12.39 ? 315  SER A O   1 
ATOM   538  C CB  . SER A 1 72 ? -6.130  -44.608 -18.056 1.00 8.66  ? 315  SER A CB  1 
ATOM   539  O OG  . SER A 1 72 ? -6.405  -45.852 -17.484 1.00 27.79 ? 315  SER A OG  1 
ATOM   540  N N   . ARG A 1 73 ? -5.276  -44.839 -14.962 1.00 14.71 ? 316  ARG A N   1 
ATOM   541  C CA  . ARG A 1 73 ? -5.576  -45.218 -13.589 1.00 15.27 ? 316  ARG A CA  1 
ATOM   542  C C   . ARG A 1 73 ? -5.447  -44.057 -12.622 1.00 16.26 ? 316  ARG A C   1 
ATOM   543  O O   . ARG A 1 73 ? -6.248  -43.944 -11.715 1.00 14.79 ? 316  ARG A O   1 
ATOM   544  C CB  . ARG A 1 73 ? -4.682  -46.360 -13.153 1.00 13.52 ? 316  ARG A CB  1 
ATOM   545  C CG  . ARG A 1 73 ? -5.175  -47.680 -13.668 1.00 19.20 ? 316  ARG A CG  1 
ATOM   546  C CD  . ARG A 1 73 ? -4.073  -48.664 -13.646 1.00 24.67 ? 316  ARG A CD  1 
ATOM   547  N NE  . ARG A 1 73 ? -4.536  -49.957 -14.142 1.00 26.67 ? 316  ARG A NE  1 
ATOM   548  C CZ  . ARG A 1 73 ? -4.865  -50.987 -13.375 1.00 26.35 ? 316  ARG A CZ  1 
ATOM   549  N NH1 . ARG A 1 73 ? -4.775  -50.905 -12.051 1.00 24.50 ? 316  ARG A NH1 1 
ATOM   550  N NH2 . ARG A 1 73 ? -5.262  -52.127 -13.951 1.00 33.74 ? 316  ARG A NH2 1 
ATOM   551  N N   . ILE A 1 74 ? -4.438  -43.201 -12.801 1.00 14.55 ? 317  ILE A N   1 
ATOM   552  C CA  . ILE A 1 74 ? -4.313  -42.003 -11.948 1.00 14.96 ? 317  ILE A CA  1 
ATOM   553  C C   . ILE A 1 74 ? -5.471  -41.056 -12.192 1.00 13.85 ? 317  ILE A C   1 
ATOM   554  O O   . ILE A 1 74 ? -6.042  -40.509 -11.245 1.00 9.71  ? 317  ILE A O   1 
ATOM   555  C CB  . ILE A 1 74 ? -2.996  -41.251 -12.217 1.00 14.53 ? 317  ILE A CB  1 
ATOM   556  C CG1 . ILE A 1 74 ? -1.809  -42.104 -11.784 1.00 12.13 ? 317  ILE A CG1 1 
ATOM   557  C CG2 . ILE A 1 74 ? -2.943  -39.910 -11.475 1.00 15.77 ? 317  ILE A CG2 1 
ATOM   558  C CD1 . ILE A 1 74 ? -0.527  -41.773 -12.544 1.00 14.03 ? 317  ILE A CD1 1 
ATOM   559  N N   . GLN A 1 75 ? -5.772  -40.826 -13.476 1.00 13.71 ? 318  GLN A N   1 
ATOM   560  C CA  . GLN A 1 75 ? -6.905  -39.952 -13.894 1.00 16.38 ? 318  GLN A CA  1 
ATOM   561  C C   . GLN A 1 75 ? -8.276  -40.447 -13.402 1.00 19.88 ? 318  GLN A C   1 
ATOM   562  O O   . GLN A 1 75 ? -9.212  -39.651 -13.137 1.00 15.78 ? 318  GLN A O   1 
ATOM   563  C CB  . GLN A 1 75 ? -6.928  -39.836 -15.425 1.00 15.13 ? 318  GLN A CB  1 
ATOM   564  C CG  . GLN A 1 75 ? -5.735  -39.055 -15.943 1.00 15.64 ? 318  GLN A CG  1 
ATOM   565  C CD  . GLN A 1 75 ? -5.754  -38.805 -17.420 1.00 22.50 ? 318  GLN A CD  1 
ATOM   566  O OE1 . GLN A 1 75 ? -6.211  -39.627 -18.216 1.00 21.49 ? 318  GLN A OE1 1 
ATOM   567  N NE2 . GLN A 1 75 ? -5.216  -37.653 -17.811 1.00 27.78 ? 318  GLN A NE2 1 
ATOM   568  N N   . GLY A 1 76 ? -8.395  -41.767 -13.294 1.00 12.55 ? 319  GLY A N   1 
ATOM   569  C CA  . GLY A 1 76 ? -9.653  -42.398 -12.935 1.00 14.03 ? 319  GLY A CA  1 
ATOM   570  C C   . GLY A 1 76 ? -10.032 -42.143 -11.496 1.00 15.01 ? 319  GLY A C   1 
ATOM   571  O O   . GLY A 1 76 ? -11.163 -42.408 -11.103 1.00 14.80 ? 319  GLY A O   1 
ATOM   572  N N   . GLN A 1 77 ? -9.082  -41.638 -10.706 1.00 14.87 ? 320  GLN A N   1 
ATOM   573  C CA  . GLN A 1 77 ? -9.316  -41.396 -9.286  1.00 12.07 ? 320  GLN A CA  1 
ATOM   574  C C   . GLN A 1 77 ? -9.780  -39.985 -8.967  1.00 17.32 ? 320  GLN A C   1 
ATOM   575  O O   . GLN A 1 77 ? -10.136 -39.698 -7.819  1.00 19.45 ? 320  GLN A O   1 
ATOM   576  C CB  . GLN A 1 77 ? -8.040  -41.697 -8.518  1.00 15.87 ? 320  GLN A CB  1 
ATOM   577  C CG  . GLN A 1 77 ? -7.788  -43.168 -8.431  1.00 12.36 ? 320  GLN A CG  1 
ATOM   578  C CD  . GLN A 1 77 ? -8.870  -43.881 -7.712  1.00 18.21 ? 320  GLN A CD  1 
ATOM   579  O OE1 . GLN A 1 77 ? -9.121  -43.604 -6.538  1.00 21.65 ? 320  GLN A OE1 1 
ATOM   580  N NE2 . GLN A 1 77 ? -9.524  -44.816 -8.388  1.00 16.20 ? 320  GLN A NE2 1 
ATOM   581  N N   . GLY A 1 78 ? -9.774  -39.112 -9.971  1.00 12.41 ? 321  GLY A N   1 
ATOM   582  C CA  . GLY A 1 78 ? -10.331 -37.778 -9.837  1.00 18.57 ? 321  GLY A CA  1 
ATOM   583  C C   . GLY A 1 78 ? -9.482  -36.886 -8.961  1.00 19.10 ? 321  GLY A C   1 
ATOM   584  O O   . GLY A 1 78 ? -8.252  -36.838 -9.118  1.00 17.23 ? 321  GLY A O   1 
ATOM   585  N N   . SER A 1 79 ? -10.143 -36.182 -8.036  1.00 22.02 ? 322  SER A N   1 
ATOM   586  C CA  . SER A 1 79 ? -9.498  -35.122 -7.249  1.00 24.76 ? 322  SER A CA  1 
ATOM   587  C C   . SER A 1 79 ? -8.554  -35.657 -6.184  1.00 24.42 ? 322  SER A C   1 
ATOM   588  O O   . SER A 1 79 ? -7.614  -34.966 -5.801  1.00 26.52 ? 322  SER A O   1 
ATOM   589  C CB  . SER A 1 79 ? -10.551 -34.267 -6.563  1.00 23.39 ? 322  SER A CB  1 
ATOM   590  O OG  . SER A 1 79 ? -11.414 -33.691 -7.524  1.00 38.54 ? 322  SER A OG  1 
ATOM   591  N N   . CYS A 1 80 ? -8.842  -36.855 -5.671  1.00 20.50 ? 323  CYS A N   1 
ATOM   592  C CA  . CYS A 1 80 ? -8.003  -37.499 -4.650  1.00 22.19 ? 323  CYS A CA  1 
ATOM   593  C C   . CYS A 1 80 ? -7.480  -38.830 -5.130  1.00 23.91 ? 323  CYS A C   1 
ATOM   594  O O   . CYS A 1 80 ? -8.245  -39.648 -5.645  1.00 23.27 ? 323  CYS A O   1 
ATOM   595  C CB  . CYS A 1 80 ? -8.794  -37.723 -3.377  1.00 24.45 ? 323  CYS A CB  1 
ATOM   596  S SG  . CYS A 1 80 ? -9.258  -36.205 -2.611  1.00 46.11 ? 323  CYS A SG  1 
ATOM   597  N N   . VAL A 1 81 ? -6.177  -39.041 -4.964  1.00 22.15 ? 324  VAL A N   1 
ATOM   598  C CA  . VAL A 1 81 ? -5.531  -40.264 -5.432  1.00 18.13 ? 324  VAL A CA  1 
ATOM   599  C C   . VAL A 1 81 ? -4.491  -40.738 -4.422  1.00 18.79 ? 324  VAL A C   1 
ATOM   600  O O   . VAL A 1 81 ? -3.701  -39.954 -3.881  1.00 19.59 ? 324  VAL A O   1 
ATOM   601  C CB  . VAL A 1 81 ? -4.893  -40.097 -6.840  1.00 19.23 ? 324  VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 81 ? -3.758  -39.105 -6.818  1.00 17.57 ? 324  VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 81 ? -4.402  -41.412 -7.364  1.00 15.91 ? 324  VAL A CG2 1 
ATOM   604  N N   . SER A 1 82 ? -4.567  -42.035 -4.140  1.00 16.67 ? 325  SER A N   1 
ATOM   605  C CA  . SER A 1 82 ? -3.538  -42.784 -3.455  1.00 20.11 ? 325  SER A CA  1 
ATOM   606  C C   . SER A 1 82 ? -2.465  -43.235 -4.464  1.00 14.60 ? 325  SER A C   1 
ATOM   607  O O   . SER A 1 82 ? -2.790  -43.792 -5.518  1.00 16.08 ? 325  SER A O   1 
ATOM   608  C CB  . SER A 1 82 ? -4.152  -44.019 -2.805  1.00 21.49 ? 325  SER A CB  1 
ATOM   609  O OG  . SER A 1 82 ? -3.128  -44.830 -2.293  1.00 32.65 ? 325  SER A OG  1 
ATOM   610  N N   . LEU A 1 83 ? -1.198  -42.970 -4.149  1.00 17.75 ? 326  LEU A N   1 
ATOM   611  C CA  . LEU A 1 83 ? -0.074  -43.430 -4.967  1.00 16.14 ? 326  LEU A CA  1 
ATOM   612  C C   . LEU A 1 83 ? 0.930   -44.138 -4.080  1.00 15.64 ? 326  LEU A C   1 
ATOM   613  O O   . LEU A 1 83 ? 1.330   -43.611 -3.041  1.00 17.61 ? 326  LEU A O   1 
ATOM   614  C CB  . LEU A 1 83 ? 0.601   -42.234 -5.637  1.00 13.90 ? 326  LEU A CB  1 
ATOM   615  C CG  . LEU A 1 83 ? -0.258  -41.342 -6.544  1.00 20.57 ? 326  LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 83 ? 0.523   -40.139 -6.980  1.00 14.69 ? 326  LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 83 ? -0.751  -42.135 -7.775  1.00 11.97 ? 326  LEU A CD2 1 
ATOM   618  N N   . THR A 1 84 ? 1.346   -45.330 -4.468  1.00 14.51 ? 327  THR A N   1 
ATOM   619  C CA  . THR A 1 84 ? 2.406   -46.017 -3.736  1.00 15.82 ? 327  THR A CA  1 
ATOM   620  C C   . THR A 1 84 ? 3.699   -46.008 -4.490  1.00 13.58 ? 327  THR A C   1 
ATOM   621  O O   . THR A 1 84 ? 3.747   -46.447 -5.626  1.00 11.37 ? 327  THR A O   1 
ATOM   622  C CB  . THR A 1 84 ? 2.100   -47.487 -3.458  1.00 15.22 ? 327  THR A CB  1 
ATOM   623  O OG1 . THR A 1 84 ? 0.819   -47.599 -2.827  1.00 18.52 ? 327  THR A OG1 1 
ATOM   624  C CG2 . THR A 1 84 ? 3.170   -48.069 -2.574  1.00 7.02  ? 327  THR A CG2 1 
ATOM   625  N N   . VAL A 1 85 ? 4.750   -45.549 -3.821  1.00 13.06 ? 328  VAL A N   1 
ATOM   626  C CA  . VAL A 1 85 ? 6.027   -45.368 -4.466  1.00 8.89  ? 328  VAL A CA  1 
ATOM   627  C C   . VAL A 1 85 ? 7.130   -46.122 -3.778  1.00 12.74 ? 328  VAL A C   1 
ATOM   628  O O   . VAL A 1 85 ? 7.009   -46.482 -2.605  1.00 15.36 ? 328  VAL A O   1 
ATOM   629  C CB  . VAL A 1 85 ? 6.378   -43.869 -4.568  1.00 15.18 ? 328  VAL A CB  1 
ATOM   630  C CG1 . VAL A 1 85 ? 5.368   -43.161 -5.467  1.00 11.46 ? 328  VAL A CG1 1 
ATOM   631  C CG2 . VAL A 1 85 ? 6.462   -43.192 -3.172  1.00 15.00 ? 328  VAL A CG2 1 
ATOM   632  N N   . VAL A 1 86 ? 8.210   -46.357 -4.520  1.00 15.74 ? 329  VAL A N   1 
ATOM   633  C CA  . VAL A 1 86 ? 9.471   -46.838 -3.969  1.00 16.48 ? 329  VAL A CA  1 
ATOM   634  C C   . VAL A 1 86 ? 10.499  -45.730 -4.188  1.00 15.85 ? 329  VAL A C   1 
ATOM   635  O O   . VAL A 1 86 ? 10.788  -45.366 -5.310  1.00 18.01 ? 329  VAL A O   1 
ATOM   636  C CB  . VAL A 1 86 ? 9.924   -48.175 -4.622  1.00 16.73 ? 329  VAL A CB  1 
ATOM   637  C CG1 . VAL A 1 86 ? 11.424  -48.493 -4.312  1.00 18.50 ? 329  VAL A CG1 1 
ATOM   638  C CG2 . VAL A 1 86 ? 9.040   -49.335 -4.135  1.00 16.55 ? 329  VAL A CG2 1 
ATOM   639  N N   . ASP A 1 87 ? 11.011  -45.165 -3.103  1.00 16.76 ? 330  ASP A N   1 
ATOM   640  C CA  . ASP A 1 87 ? 11.945  -44.069 -3.198  1.00 20.23 ? 330  ASP A CA  1 
ATOM   641  C C   . ASP A 1 87 ? 13.295  -44.521 -3.710  1.00 18.19 ? 330  ASP A C   1 
ATOM   642  O O   . ASP A 1 87 ? 13.708  -45.675 -3.494  1.00 15.96 ? 330  ASP A O   1 
ATOM   643  C CB  . ASP A 1 87 ? 12.148  -43.374 -1.859  1.00 21.49 ? 330  ASP A CB  1 
ATOM   644  C CG  . ASP A 1 87 ? 10.900  -42.722 -1.345  1.00 22.54 ? 330  ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 87 ? 10.334  -41.823 -1.991  1.00 22.03 ? 330  ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 87 ? 10.506  -43.114 -0.252  1.00 23.21 ? 330  ASP A OD2 1 
ATOM   647  N N   . PRO A 1 88 ? 13.993  -43.607 -4.399  1.00 20.64 ? 331  PRO A N   1 
ATOM   648  C CA  . PRO A 1 88 ? 15.369  -43.839 -4.825  1.00 22.04 ? 331  PRO A CA  1 
ATOM   649  C C   . PRO A 1 88 ? 16.367  -43.605 -3.682  1.00 23.83 ? 331  PRO A C   1 
ATOM   650  O O   . PRO A 1 88 ? 15.974  -43.195 -2.586  1.00 20.89 ? 331  PRO A O   1 
ATOM   651  C CB  . PRO A 1 88 ? 15.572  -42.785 -5.914  1.00 22.98 ? 331  PRO A CB  1 
ATOM   652  C CG  . PRO A 1 88 ? 14.685  -41.664 -5.495  1.00 23.90 ? 331  PRO A CG  1 
ATOM   653  C CD  . PRO A 1 88 ? 13.502  -42.279 -4.810  1.00 19.49 ? 331  PRO A CD  1 
ATOM   654  N N   . GLU A 1 89 ? 17.645  -43.873 -3.954  1.00 30.07 ? 332  GLU A N   1 
ATOM   655  C CA  . GLU A 1 89 ? 18.756  -43.319 -3.162  1.00 32.06 ? 332  GLU A CA  1 
ATOM   656  C C   . GLU A 1 89 ? 19.211  -41.958 -3.754  1.00 34.76 ? 332  GLU A C   1 
ATOM   657  O O   . GLU A 1 89 ? 19.926  -41.892 -4.768  1.00 32.60 ? 332  GLU A O   1 
ATOM   658  C CB  . GLU A 1 89 ? 19.905  -44.323 -3.090  1.00 37.61 ? 332  GLU A CB  1 
ATOM   659  C CG  . GLU A 1 89 ? 19.672  -45.487 -2.099  1.00 41.75 ? 332  GLU A CG  1 
ATOM   660  C CD  . GLU A 1 89 ? 19.162  -46.771 -2.754  1.00 53.14 ? 332  GLU A CD  1 
ATOM   661  O OE1 . GLU A 1 89 ? 17.973  -46.827 -3.156  1.00 52.51 ? 332  GLU A OE1 1 
ATOM   662  O OE2 . GLU A 1 89 ? 19.960  -47.736 -2.850  1.00 52.12 ? 332  GLU A OE2 1 
ATOM   663  N N   . ALA A 1 90 ? 18.783  -40.865 -3.118  1.00 39.17 ? 333  ALA A N   1 
ATOM   664  C CA  . ALA A 1 90 ? 18.929  -39.505 -3.692  1.00 39.18 ? 333  ALA A CA  1 
ATOM   665  C C   . ALA A 1 90 ? 20.373  -38.990 -3.840  1.00 35.93 ? 333  ALA A C   1 
ATOM   666  O O   . ALA A 1 90 ? 20.602  -37.982 -4.545  1.00 26.38 ? 333  ALA A O   1 
ATOM   667  C CB  . ALA A 1 90 ? 18.097  -38.497 -2.899  1.00 40.37 ? 333  ALA A CB  1 
ATOM   668  N N   . ASP A 1 91 ? 21.322  -39.671 -3.179  1.00 30.92 ? 334  ASP A N   1 
ATOM   669  C CA  . ASP A 1 91 ? 22.766  -39.436 -3.356  1.00 26.10 ? 334  ASP A CA  1 
ATOM   670  C C   . ASP A 1 91 ? 23.401  -40.192 -4.552  1.00 20.76 ? 334  ASP A C   1 
ATOM   671  O O   . ASP A 1 91 ? 24.579  -40.003 -4.834  1.00 24.48 ? 334  ASP A O   1 
ATOM   672  C CB  . ASP A 1 91 ? 23.515  -39.860 -2.094  1.00 28.30 ? 334  ASP A CB  1 
ATOM   673  C CG  . ASP A 1 91 ? 23.503  -41.385 -1.891  1.00 44.11 ? 334  ASP A CG  1 
ATOM   674  O OD1 . ASP A 1 91 ? 22.447  -42.033 -2.154  1.00 30.96 ? 334  ASP A OD1 1 
ATOM   675  O OD2 . ASP A 1 91 ? 24.559  -41.922 -1.489  1.00 57.82 ? 334  ASP A OD2 1 
ATOM   676  N N   . ARG A 1 92 ? 22.638  -41.063 -5.211  1.00 16.76 ? 335  ARG A N   1 
ATOM   677  C CA  . ARG A 1 92 ? 23.111  -41.810 -6.382  1.00 10.93 ? 335  ARG A CA  1 
ATOM   678  C C   . ARG A 1 92 ? 22.696  -41.094 -7.660  1.00 12.88 ? 335  ARG A C   1 
ATOM   679  O O   . ARG A 1 92 ? 22.014  -41.645 -8.515  1.00 13.61 ? 335  ARG A O   1 
ATOM   680  C CB  . ARG A 1 92 ? 22.615  -43.252 -6.324  1.00 12.80 ? 335  ARG A CB  1 
ATOM   681  C CG  . ARG A 1 92 ? 23.100  -43.930 -5.059  1.00 10.13 ? 335  ARG A CG  1 
ATOM   682  C CD  . ARG A 1 92 ? 22.856  -45.409 -5.020  1.00 26.39 ? 335  ARG A CD  1 
ATOM   683  N NE  . ARG A 1 92 ? 23.470  -46.019 -3.839  1.00 28.93 ? 335  ARG A NE  1 
ATOM   684  C CZ  . ARG A 1 92 ? 23.423  -47.318 -3.536  1.00 36.11 ? 335  ARG A CZ  1 
ATOM   685  N NH1 . ARG A 1 92 ? 22.773  -48.172 -4.321  1.00 29.03 ? 335  ARG A NH1 1 
ATOM   686  N NH2 . ARG A 1 92 ? 24.034  -47.773 -2.440  1.00 28.96 ? 335  ARG A NH2 1 
ATOM   687  N N   . GLU A 1 93 ? 23.103  -39.834 -7.737  1.00 12.99 ? 336  GLU A N   1 
ATOM   688  C CA  . GLU A 1 93 ? 22.947  -38.973 -8.919  1.00 9.94  ? 336  GLU A CA  1 
ATOM   689  C C   . GLU A 1 93 ? 24.205  -38.134 -9.011  1.00 9.27  ? 336  GLU A C   1 
ATOM   690  O O   . GLU A 1 93 ? 24.798  -37.776 -7.983  1.00 15.08 ? 336  GLU A O   1 
ATOM   691  C CB  . GLU A 1 93 ? 21.704  -38.075 -8.808  1.00 13.38 ? 336  GLU A CB  1 
ATOM   692  C CG  . GLU A 1 93 ? 21.683  -37.287 -7.507  1.00 15.02 ? 336  GLU A CG  1 
ATOM   693  C CD  . GLU A 1 93 ? 20.590  -36.266 -7.431  1.00 19.56 ? 336  GLU A CD  1 
ATOM   694  O OE1 . GLU A 1 93 ? 19.419  -36.678 -7.271  1.00 31.80 ? 336  GLU A OE1 1 
ATOM   695  O OE2 . GLU A 1 93 ? 20.916  -35.053 -7.480  1.00 40.26 ? 336  GLU A OE2 1 
ATOM   696  N N   . THR A 1 94 ? 24.689  -37.914 -10.232 1.00 7.52  ? 337  THR A N   1 
ATOM   697  C CA  . THR A 1 94 ? 25.910  -37.160 -10.453 1.00 6.36  ? 337  THR A CA  1 
ATOM   698  C C   . THR A 1 94 ? 25.782  -36.365 -11.746 1.00 3.69  ? 337  THR A C   1 
ATOM   699  O O   . THR A 1 94 ? 25.421  -36.919 -12.779 1.00 6.27  ? 337  THR A O   1 
ATOM   700  C CB  . THR A 1 94 ? 27.200  -38.079 -10.515 1.00 9.26  ? 337  THR A CB  1 
ATOM   701  O OG1 . THR A 1 94 ? 27.198  -38.986 -9.418  1.00 10.75 ? 337  THR A OG1 1 
ATOM   702  C CG2 . THR A 1 94 ? 28.464  -37.271 -10.470 1.00 12.98 ? 337  THR A CG2 1 
ATOM   703  N N   . SER A 1 95 ? 26.087  -35.074 -11.672 1.00 7.69  ? 338  SER A N   1 
ATOM   704  C CA  . SER A 1 95 ? 26.228  -34.225 -12.852 1.00 6.31  ? 338  SER A CA  1 
ATOM   705  C C   . SER A 1 95 ? 27.650  -34.356 -13.401 1.00 13.73 ? 338  SER A C   1 
ATOM   706  O O   . SER A 1 95 ? 28.595  -34.069 -12.695 1.00 11.28 ? 338  SER A O   1 
ATOM   707  C CB  . SER A 1 95 ? 25.995  -32.765 -12.478 1.00 9.42  ? 338  SER A CB  1 
ATOM   708  O OG  . SER A 1 95 ? 26.140  -31.931 -13.620 1.00 17.32 ? 338  SER A OG  1 
ATOM   709  N N   . VAL A 1 96 ? 27.771  -34.802 -14.653 1.00 14.92 ? 339  VAL A N   1 
ATOM   710  C CA  . VAL A 1 96 ? 29.035  -34.978 -15.337 1.00 21.40 ? 339  VAL A CA  1 
ATOM   711  C C   . VAL A 1 96 ? 29.137  -34.017 -16.549 1.00 17.92 ? 339  VAL A C   1 
ATOM   712  O O   . VAL A 1 96 ? 28.171  -33.429 -17.054 1.00 14.61 ? 339  VAL A O   1 
ATOM   713  C CB  . VAL A 1 96 ? 29.221  -36.486 -15.770 1.00 6.91  ? 339  VAL A CB  1 
ATOM   714  C CG1 . VAL A 1 96 ? 29.311  -37.396 -14.545 1.00 33.42 ? 339  VAL A CG1 1 
ATOM   715  C CG2 . VAL A 1 96 ? 28.091  -36.928 -16.652 1.00 20.50 ? 339  VAL A CG2 1 
ATOM   716  O OXT . VAL A 1 96 ? 30.210  -33.772 -17.074 1.00 25.22 ? 339  VAL A OXT 1 
ATOM   717  N N   . MET B 1 2  ? 33.701  -1.596  28.050  1.00 48.13 ? 245  MET B N   1 
ATOM   718  C CA  . MET B 1 2  ? 32.885  -0.652  28.873  1.00 46.60 ? 245  MET B CA  1 
ATOM   719  C C   . MET B 1 2  ? 31.481  -1.202  29.169  1.00 41.09 ? 245  MET B C   1 
ATOM   720  O O   . MET B 1 2  ? 30.885  -1.914  28.361  1.00 39.32 ? 245  MET B O   1 
ATOM   721  C CB  . MET B 1 2  ? 32.789  0.709   28.176  1.00 45.98 ? 245  MET B CB  1 
ATOM   722  C CG  . MET B 1 2  ? 34.128  1.442   28.081  1.00 56.84 ? 245  MET B CG  1 
ATOM   723  S SD  . MET B 1 2  ? 34.425  2.636   29.405  1.00 61.85 ? 245  MET B SD  1 
ATOM   724  C CE  . MET B 1 2  ? 36.191  2.914   29.207  1.00 49.39 ? 245  MET B CE  1 
ATOM   725  N N   . LYS B 1 3  ? 30.973  -0.885  30.352  1.00 39.85 ? 246  LYS B N   1 
ATOM   726  C CA  . LYS B 1 3  ? 29.634  -1.277  30.740  1.00 38.56 ? 246  LYS B CA  1 
ATOM   727  C C   . LYS B 1 3  ? 28.673  -0.308  30.075  1.00 34.24 ? 246  LYS B C   1 
ATOM   728  O O   . LYS B 1 3  ? 28.807  0.901   30.270  1.00 29.53 ? 246  LYS B O   1 
ATOM   729  C CB  . LYS B 1 3  ? 29.458  -1.200  32.264  1.00 40.89 ? 246  LYS B CB  1 
ATOM   730  C CG  . LYS B 1 3  ? 30.303  -2.192  33.045  1.00 47.98 ? 246  LYS B CG  1 
ATOM   731  C CD  . LYS B 1 3  ? 29.995  -2.170  34.551  1.00 42.06 ? 246  LYS B CD  1 
ATOM   732  C CE  . LYS B 1 3  ? 30.874  -1.180  35.311  1.00 52.11 ? 246  LYS B CE  1 
ATOM   733  N NZ  . LYS B 1 3  ? 32.313  -1.589  35.367  1.00 46.43 ? 246  LYS B NZ  1 
ATOM   734  N N   . PRO B 1 4  ? 27.684  -0.825  29.316  1.00 28.77 ? 247  PRO B N   1 
ATOM   735  C CA  . PRO B 1 4  ? 26.722  0.061   28.667  1.00 25.77 ? 247  PRO B CA  1 
ATOM   736  C C   . PRO B 1 4  ? 25.951  0.965   29.629  1.00 23.64 ? 247  PRO B C   1 
ATOM   737  O O   . PRO B 1 4  ? 25.641  0.565   30.752  1.00 25.98 ? 247  PRO B O   1 
ATOM   738  C CB  . PRO B 1 4  ? 25.755  -0.914  27.961  1.00 26.05 ? 247  PRO B CB  1 
ATOM   739  C CG  . PRO B 1 4  ? 26.493  -2.181  27.823  1.00 23.16 ? 247  PRO B CG  1 
ATOM   740  C CD  . PRO B 1 4  ? 27.394  -2.242  29.025  1.00 30.14 ? 247  PRO B CD  1 
ATOM   741  N N   . ARG B 1 5  ? 25.673  2.186   29.178  1.00 25.45 ? 248  ARG B N   1 
ATOM   742  C CA  . ARG B 1 5  ? 24.882  3.165   29.930  1.00 24.09 ? 248  ARG B CA  1 
ATOM   743  C C   . ARG B 1 5  ? 23.618  3.552   29.172  1.00 20.97 ? 248  ARG B C   1 
ATOM   744  O O   . ARG B 1 5  ? 23.670  3.964   28.011  1.00 15.50 ? 248  ARG B O   1 
ATOM   745  C CB  . ARG B 1 5  ? 25.667  4.456   30.147  1.00 24.46 ? 248  ARG B CB  1 
ATOM   746  C CG  . ARG B 1 5  ? 27.025  4.320   30.771  1.00 31.43 ? 248  ARG B CG  1 
ATOM   747  C CD  . ARG B 1 5  ? 27.850  5.528   30.357  1.00 39.14 ? 248  ARG B CD  1 
ATOM   748  N NE  . ARG B 1 5  ? 27.163  6.755   30.728  1.00 39.07 ? 248  ARG B NE  1 
ATOM   749  C CZ  . ARG B 1 5  ? 27.204  7.915   30.076  1.00 35.31 ? 248  ARG B CZ  1 
ATOM   750  N NH1 . ARG B 1 5  ? 27.912  8.082   28.964  1.00 29.82 ? 248  ARG B NH1 1 
ATOM   751  N NH2 . ARG B 1 5  ? 26.510  8.929   30.563  1.00 31.14 ? 248  ARG B NH2 1 
ATOM   752  N N   . CYS B 1 6  ? 22.488  3.479   29.867  1.00 21.64 ? 249  CYS B N   1 
ATOM   753  C CA  . CYS B 1 6  ? 21.219  3.844   29.301  1.00 20.42 ? 249  CYS B CA  1 
ATOM   754  C C   . CYS B 1 6  ? 20.862  5.249   29.739  1.00 23.80 ? 249  CYS B C   1 
ATOM   755  O O   . CYS B 1 6  ? 20.716  5.515   30.925  1.00 24.26 ? 249  CYS B O   1 
ATOM   756  C CB  . CYS B 1 6  ? 20.131  2.884   29.758  1.00 23.89 ? 249  CYS B CB  1 
ATOM   757  S SG  . CYS B 1 6  ? 18.584  3.286   29.000  1.00 24.62 ? 249  CYS B SG  1 
ATOM   758  N N   . LEU B 1 7  ? 20.722  6.142   28.769  1.00 18.54 ? 250  LEU B N   1 
ATOM   759  C CA  . LEU B 1 7  ? 20.426  7.527   29.037  1.00 19.53 ? 250  LEU B CA  1 
ATOM   760  C C   . LEU B 1 7  ? 19.053  7.821   28.470  1.00 20.42 ? 250  LEU B C   1 
ATOM   761  O O   . LEU B 1 7  ? 18.590  7.157   27.536  1.00 24.12 ? 250  LEU B O   1 
ATOM   762  C CB  . LEU B 1 7  ? 21.507  8.423   28.414  1.00 25.85 ? 250  LEU B CB  1 
ATOM   763  C CG  . LEU B 1 7  ? 22.910  8.051   28.944  1.00 29.35 ? 250  LEU B CG  1 
ATOM   764  C CD1 . LEU B 1 7  ? 24.007  8.358   27.975  1.00 29.41 ? 250  LEU B CD1 1 
ATOM   765  C CD2 . LEU B 1 7  ? 23.155  8.695   30.304  1.00 30.00 ? 250  LEU B CD2 1 
ATOM   766  N N   . HIS B 1 8  ? 18.388  8.801   29.068  1.00 21.88 ? 251  HIS B N   1 
ATOM   767  C CA  . HIS B 1 8  ? 17.031  9.165   28.701  1.00 21.22 ? 251  HIS B CA  1 
ATOM   768  C C   . HIS B 1 8  ? 17.059  10.643  28.356  1.00 20.61 ? 251  HIS B C   1 
ATOM   769  O O   . HIS B 1 8  ? 17.349  11.469  29.201  1.00 19.61 ? 251  HIS B O   1 
ATOM   770  C CB  . HIS B 1 8  ? 16.095  8.862   29.874  1.00 22.37 ? 251  HIS B CB  1 
ATOM   771  C CG  . HIS B 1 8  ? 16.159  7.434   30.329  1.00 36.32 ? 251  HIS B CG  1 
ATOM   772  N ND1 . HIS B 1 8  ? 15.337  6.450   29.816  1.00 31.67 ? 251  HIS B ND1 1 
ATOM   773  C CD2 . HIS B 1 8  ? 16.971  6.818   31.222  1.00 23.41 ? 251  HIS B CD2 1 
ATOM   774  C CE1 . HIS B 1 8  ? 15.623  5.297   30.395  1.00 15.44 ? 251  HIS B CE1 1 
ATOM   775  N NE2 . HIS B 1 8  ? 16.615  5.491   31.246  1.00 23.90 ? 251  HIS B NE2 1 
ATOM   776  N N   . LEU B 1 9  ? 16.835  10.950  27.083  1.00 19.23 ? 252  LEU B N   1 
ATOM   777  C CA  . LEU B 1 9  ? 16.887  12.308  26.592  1.00 18.33 ? 252  LEU B CA  1 
ATOM   778  C C   . LEU B 1 9  ? 15.499  12.843  26.298  1.00 15.94 ? 252  LEU B C   1 
ATOM   779  O O   . LEU B 1 9  ? 14.577  12.088  25.980  1.00 16.85 ? 252  LEU B O   1 
ATOM   780  C CB  . LEU B 1 9  ? 17.710  12.380  25.303  1.00 18.54 ? 252  LEU B CB  1 
ATOM   781  C CG  . LEU B 1 9  ? 19.129  11.817  25.323  1.00 19.63 ? 252  LEU B CG  1 
ATOM   782  C CD1 . LEU B 1 9  ? 19.755  12.083  23.962  1.00 17.34 ? 252  LEU B CD1 1 
ATOM   783  C CD2 . LEU B 1 9  ? 19.923  12.482  26.482  1.00 17.04 ? 252  LEU B CD2 1 
ATOM   784  N N   . GLU B 1 10 ? 15.379  14.164  26.373  1.00 14.72 ? 253  GLU B N   1 
ATOM   785  C CA  . GLU B 1 10 ? 14.139  14.844  26.068  1.00 19.89 ? 253  GLU B CA  1 
ATOM   786  C C   . GLU B 1 10 ? 14.407  15.838  24.943  1.00 22.42 ? 253  GLU B C   1 
ATOM   787  O O   . GLU B 1 10 ? 15.282  16.683  25.044  1.00 18.96 ? 253  GLU B O   1 
ATOM   788  C CB  . GLU B 1 10 ? 13.569  15.539  27.325  1.00 19.13 ? 253  GLU B CB  1 
ATOM   789  C CG  . GLU B 1 10 ? 12.744  14.631  28.234  1.00 32.17 ? 253  GLU B CG  1 
ATOM   790  C CD  . GLU B 1 10 ? 13.560  13.611  29.037  1.00 46.49 ? 253  GLU B CD  1 
ATOM   791  O OE1 . GLU B 1 10 ? 14.704  13.909  29.438  1.00 51.80 ? 253  GLU B OE1 1 
ATOM   792  O OE2 . GLU B 1 10 ? 13.034  12.502  29.290  1.00 63.77 ? 253  GLU B OE2 1 
ATOM   793  N N   . LYS B 1 11 ? 13.647  15.714  23.866  1.00 20.75 ? 254  LYS B N   1 
ATOM   794  C CA  . LYS B 1 11 ? 13.851  16.521  22.682  1.00 22.03 ? 254  LYS B CA  1 
ATOM   795  C C   . LYS B 1 11 ? 13.402  17.965  22.963  1.00 25.18 ? 254  LYS B C   1 
ATOM   796  O O   . LYS B 1 11 ? 12.389  18.202  23.637  1.00 26.06 ? 254  LYS B O   1 
ATOM   797  C CB  . LYS B 1 11 ? 13.049  15.898  21.515  1.00 23.71 ? 254  LYS B CB  1 
ATOM   798  C CG  . LYS B 1 11 ? 13.625  16.159  20.132  1.00 18.07 ? 254  LYS B CG  1 
ATOM   799  C CD  . LYS B 1 11 ? 12.583  16.021  19.030  1.00 26.73 ? 254  LYS B CD  1 
ATOM   800  C CE  . LYS B 1 11 ? 12.371  14.604  18.566  1.00 28.49 ? 254  LYS B CE  1 
ATOM   801  N NZ  . LYS B 1 11 ? 11.559  14.555  17.314  1.00 29.23 ? 254  LYS B NZ  1 
ATOM   802  N N   . GLY B 1 12 ? 14.186  18.930  22.501  1.00 22.79 ? 255  GLY B N   1 
ATOM   803  C CA  . GLY B 1 12 ? 13.773  20.315  22.505  1.00 20.71 ? 255  GLY B CA  1 
ATOM   804  C C   . GLY B 1 12 ? 13.594  20.777  21.066  1.00 25.98 ? 255  GLY B C   1 
ATOM   805  O O   . GLY B 1 12 ? 13.679  19.971  20.131  1.00 24.18 ? 255  GLY B O   1 
ATOM   806  N N   . PRO B 1 13 ? 13.385  22.090  20.868  1.00 29.14 ? 256  PRO B N   1 
ATOM   807  C CA  . PRO B 1 13 ? 13.186  22.677  19.535  1.00 31.89 ? 256  PRO B CA  1 
ATOM   808  C C   . PRO B 1 13 ? 14.266  22.332  18.492  1.00 32.48 ? 256  PRO B C   1 
ATOM   809  O O   . PRO B 1 13 ? 14.034  22.519  17.297  1.00 35.85 ? 256  PRO B O   1 
ATOM   810  C CB  . PRO B 1 13 ? 13.228  24.183  19.807  1.00 33.55 ? 256  PRO B CB  1 
ATOM   811  C CG  . PRO B 1 13 ? 12.908  24.335  21.255  1.00 33.19 ? 256  PRO B CG  1 
ATOM   812  C CD  . PRO B 1 13 ? 13.368  23.103  21.939  1.00 29.84 ? 256  PRO B CD  1 
ATOM   813  N N   . GLN B 1 14 ? 15.430  21.859  18.932  1.00 29.28 ? 257  GLN B N   1 
ATOM   814  C CA  . GLN B 1 14 ? 16.559  21.642  18.028  1.00 26.70 ? 257  GLN B CA  1 
ATOM   815  C C   . GLN B 1 14 ? 17.028  20.190  17.995  1.00 26.31 ? 257  GLN B C   1 
ATOM   816  O O   . GLN B 1 14 ? 18.183  19.909  17.660  1.00 28.73 ? 257  GLN B O   1 
ATOM   817  C CB  . GLN B 1 14 ? 17.706  22.573  18.417  1.00 29.98 ? 257  GLN B CB  1 
ATOM   818  C CG  . GLN B 1 14 ? 17.291  24.042  18.536  1.00 31.29 ? 257  GLN B CG  1 
ATOM   819  C CD  . GLN B 1 14 ? 18.197  24.805  19.461  1.00 33.83 ? 257  GLN B CD  1 
ATOM   820  O OE1 . GLN B 1 14 ? 19.431  24.731  19.335  1.00 27.29 ? 257  GLN B OE1 1 
ATOM   821  N NE2 . GLN B 1 14 ? 17.604  25.531  20.416  1.00 30.62 ? 257  GLN B NE2 1 
ATOM   822  N N   . GLY B 1 15 ? 16.117  19.273  18.319  1.00 21.35 ? 258  GLY B N   1 
ATOM   823  C CA  . GLY B 1 15 ? 16.433  17.863  18.387  1.00 21.25 ? 258  GLY B CA  1 
ATOM   824  C C   . GLY B 1 15 ? 17.160  17.464  19.653  1.00 19.16 ? 258  GLY B C   1 
ATOM   825  O O   . GLY B 1 15 ? 17.071  18.133  20.675  1.00 22.25 ? 258  GLY B O   1 
ATOM   826  N N   . PHE B 1 16 ? 17.876  16.350  19.563  1.00 20.15 ? 259  PHE B N   1 
ATOM   827  C CA  . PHE B 1 16 ? 18.572  15.748  20.690  1.00 17.35 ? 259  PHE B CA  1 
ATOM   828  C C   . PHE B 1 16 ? 20.036  16.201  20.807  1.00 19.86 ? 259  PHE B C   1 
ATOM   829  O O   . PHE B 1 16 ? 20.653  16.066  21.876  1.00 18.94 ? 259  PHE B O   1 
ATOM   830  C CB  . PHE B 1 16 ? 18.518  14.236  20.554  1.00 19.43 ? 259  PHE B CB  1 
ATOM   831  C CG  . PHE B 1 16 ? 17.143  13.665  20.716  1.00 24.00 ? 259  PHE B CG  1 
ATOM   832  C CD1 . PHE B 1 16 ? 16.491  13.732  21.960  1.00 16.97 ? 259  PHE B CD1 1 
ATOM   833  C CD2 . PHE B 1 16 ? 16.488  13.076  19.638  1.00 21.49 ? 259  PHE B CD2 1 
ATOM   834  C CE1 . PHE B 1 16 ? 15.231  13.216  22.120  1.00 18.03 ? 259  PHE B CE1 1 
ATOM   835  C CE2 . PHE B 1 16 ? 15.214  12.562  19.792  1.00 20.50 ? 259  PHE B CE2 1 
ATOM   836  C CZ  . PHE B 1 16 ? 14.579  12.625  21.036  1.00 20.87 ? 259  PHE B CZ  1 
ATOM   837  N N   . GLY B 1 17 ? 20.597  16.667  19.689  1.00 15.55 ? 260  GLY B N   1 
ATOM   838  C CA  . GLY B 1 17 ? 21.916  17.212  19.649  1.00 17.06 ? 260  GLY B CA  1 
ATOM   839  C C   . GLY B 1 17 ? 23.054  16.232  19.444  1.00 17.06 ? 260  GLY B C   1 
ATOM   840  O O   . GLY B 1 17 ? 24.074  16.321  20.137  1.00 16.69 ? 260  GLY B O   1 
ATOM   841  N N   . PHE B 1 18 ? 22.896  15.309  18.505  1.00 11.87 ? 261  PHE B N   1 
ATOM   842  C CA  . PHE B 1 18 ? 24.007  14.440  18.140  1.00 14.77 ? 261  PHE B CA  1 
ATOM   843  C C   . PHE B 1 18 ? 23.986  14.006  16.686  1.00 16.14 ? 261  PHE B C   1 
ATOM   844  O O   . PHE B 1 18 ? 22.917  13.839  16.089  1.00 13.10 ? 261  PHE B O   1 
ATOM   845  C CB  . PHE B 1 18 ? 24.152  13.228  19.104  1.00 14.41 ? 261  PHE B CB  1 
ATOM   846  C CG  . PHE B 1 18 ? 23.052  12.193  19.029  1.00 18.74 ? 261  PHE B CG  1 
ATOM   847  C CD1 . PHE B 1 18 ? 23.144  11.094  18.148  1.00 17.41 ? 261  PHE B CD1 1 
ATOM   848  C CD2 . PHE B 1 18 ? 21.977  12.245  19.899  1.00 10.31 ? 261  PHE B CD2 1 
ATOM   849  C CE1 . PHE B 1 18 ? 22.170  10.123  18.114  1.00 19.91 ? 261  PHE B CE1 1 
ATOM   850  C CE2 . PHE B 1 18 ? 20.991  11.258  19.879  1.00 21.11 ? 261  PHE B CE2 1 
ATOM   851  C CZ  . PHE B 1 18 ? 21.080  10.197  18.991  1.00 19.50 ? 261  PHE B CZ  1 
ATOM   852  N N   . LEU B 1 19 ? 25.193  13.800  16.142  1.00 14.31 ? 262  LEU B N   1 
ATOM   853  C CA  . LEU B 1 19 ? 25.398  13.172  14.844  1.00 16.94 ? 262  LEU B CA  1 
ATOM   854  C C   . LEU B 1 19 ? 25.623  11.654  15.008  1.00 13.38 ? 262  LEU B C   1 
ATOM   855  O O   . LEU B 1 19 ? 26.523  11.220  15.720  1.00 16.89 ? 262  LEU B O   1 
ATOM   856  C CB  . LEU B 1 19 ? 26.603  13.810  14.140  1.00 16.92 ? 262  LEU B CB  1 
ATOM   857  C CG  . LEU B 1 19 ? 26.969  13.338  12.726  1.00 18.57 ? 262  LEU B CG  1 
ATOM   858  C CD1 . LEU B 1 19 ? 25.850  13.708  11.739  1.00 15.87 ? 262  LEU B CD1 1 
ATOM   859  C CD2 . LEU B 1 19 ? 28.351  13.955  12.297  1.00 16.77 ? 262  LEU B CD2 1 
ATOM   860  N N   . LEU B 1 20 ? 24.795  10.865  14.338  1.00 14.00 ? 263  LEU B N   1 
ATOM   861  C CA  . LEU B 1 20 ? 24.928  9.403   14.293  1.00 14.64 ? 263  LEU B CA  1 
ATOM   862  C C   . LEU B 1 20 ? 25.554  9.034   12.969  1.00 14.39 ? 263  LEU B C   1 
ATOM   863  O O   . LEU B 1 20 ? 25.111  9.479   11.915  1.00 10.25 ? 263  LEU B O   1 
ATOM   864  C CB  . LEU B 1 20 ? 23.565  8.742   14.404  1.00 11.97 ? 263  LEU B CB  1 
ATOM   865  C CG  . LEU B 1 20 ? 23.534  7.242   14.642  1.00 12.23 ? 263  LEU B CG  1 
ATOM   866  C CD1 . LEU B 1 20 ? 23.985  6.945   16.063  1.00 11.14 ? 263  LEU B CD1 1 
ATOM   867  C CD2 . LEU B 1 20 ? 22.102  6.753   14.346  1.00 15.40 ? 263  LEU B CD2 1 
ATOM   868  N N   . ARG B 1 21 ? 26.619  8.252   13.020  1.00 12.09 ? 264  ARG B N   1 
ATOM   869  C CA  . ARG B 1 21 ? 27.303  7.846   11.785  1.00 12.94 ? 264  ARG B CA  1 
ATOM   870  C C   . ARG B 1 21 ? 27.548  6.358   11.811  1.00 13.37 ? 264  ARG B C   1 
ATOM   871  O O   . ARG B 1 21 ? 27.998  5.827   12.817  1.00 12.76 ? 264  ARG B O   1 
ATOM   872  C CB  . ARG B 1 21 ? 28.647  8.581   11.625  1.00 13.52 ? 264  ARG B CB  1 
ATOM   873  C CG  . ARG B 1 21 ? 29.361  8.189   10.372  1.00 17.48 ? 264  ARG B CG  1 
ATOM   874  C CD  . ARG B 1 21 ? 30.762  8.712   10.302  1.00 26.46 ? 264  ARG B CD  1 
ATOM   875  N NE  . ARG B 1 21 ? 30.754  10.146  10.119  1.00 36.14 ? 264  ARG B NE  1 
ATOM   876  C CZ  . ARG B 1 21 ? 30.776  10.771  8.951   1.00 50.81 ? 264  ARG B CZ  1 
ATOM   877  N NH1 . ARG B 1 21 ? 30.822  10.091  7.796   1.00 56.16 ? 264  ARG B NH1 1 
ATOM   878  N NH2 . ARG B 1 21 ? 30.761  12.102  8.945   1.00 44.74 ? 264  ARG B NH2 1 
ATOM   879  N N   . GLU B 1 22 ? 27.285  5.697   10.684  1.00 12.87 ? 265  GLU B N   1 
ATOM   880  C CA  . GLU B 1 22 ? 27.601  4.274   10.525  1.00 11.03 ? 265  GLU B CA  1 
ATOM   881  C C   . GLU B 1 22 ? 29.081  4.060   10.238  1.00 13.31 ? 265  GLU B C   1 
ATOM   882  O O   . GLU B 1 22 ? 29.695  4.830   9.462   1.00 14.46 ? 265  GLU B O   1 
ATOM   883  C CB  . GLU B 1 22 ? 26.779  3.718   9.366   1.00 12.75 ? 265  GLU B CB  1 
ATOM   884  C CG  . GLU B 1 22 ? 27.097  2.304   8.982   1.00 10.83 ? 265  GLU B CG  1 
ATOM   885  C CD  . GLU B 1 22 ? 25.986  1.695   8.123   1.00 14.92 ? 265  GLU B CD  1 
ATOM   886  O OE1 . GLU B 1 22 ? 24.818  1.644   8.567   1.00 14.56 ? 265  GLU B OE1 1 
ATOM   887  O OE2 . GLU B 1 22 ? 26.287  1.304   6.992   1.00 17.14 ? 265  GLU B OE2 1 
ATOM   888  N N   . GLU B 1 23 ? 29.670  3.056   10.901  1.00 11.68 ? 266  GLU B N   1 
ATOM   889  C CA  . GLU B 1 23 ? 30.925  2.498   10.470  1.00 12.19 ? 266  GLU B CA  1 
ATOM   890  C C   . GLU B 1 23 ? 30.742  1.016   10.315  1.00 10.64 ? 266  GLU B C   1 
ATOM   891  O O   . GLU B 1 23 ? 30.229  0.348   11.222  1.00 12.66 ? 266  GLU B O   1 
ATOM   892  C CB  . GLU B 1 23 ? 32.068  2.820   11.423  1.00 10.09 ? 266  GLU B CB  1 
ATOM   893  C CG  . GLU B 1 23 ? 32.517  4.256   11.387  1.00 19.43 ? 266  GLU B CG  1 
ATOM   894  C CD  . GLU B 1 23 ? 33.420  4.607   10.230  1.00 15.38 ? 266  GLU B CD  1 
ATOM   895  O OE1 . GLU B 1 23 ? 33.829  3.721   9.438   1.00 20.24 ? 266  GLU B OE1 1 
ATOM   896  O OE2 . GLU B 1 23 ? 33.751  5.798   10.118  1.00 24.02 ? 266  GLU B OE2 1 
ATOM   897  N N   . LYS B 1 24 ? 31.159  0.504   9.155   1.00 16.02 ? 267  LYS B N   1 
ATOM   898  C CA  . LYS B 1 24 ? 31.153  -0.944  8.934   1.00 17.99 ? 267  LYS B CA  1 
ATOM   899  C C   . LYS B 1 24 ? 32.403  -1.594  9.476   1.00 18.27 ? 267  LYS B C   1 
ATOM   900  O O   . LYS B 1 24 ? 33.516  -1.018  9.439   1.00 17.26 ? 267  LYS B O   1 
ATOM   901  C CB  . LYS B 1 24 ? 30.975  -1.299  7.454   1.00 18.00 ? 267  LYS B CB  1 
ATOM   902  C CG  . LYS B 1 24 ? 29.563  -1.116  6.985   1.00 19.71 ? 267  LYS B CG  1 
ATOM   903  C CD  . LYS B 1 24 ? 29.414  -1.316  5.510   1.00 29.10 ? 267  LYS B CD  1 
ATOM   904  C CE  . LYS B 1 24 ? 27.941  -1.396  5.133   1.00 33.74 ? 267  LYS B CE  1 
ATOM   905  N NZ  . LYS B 1 24 ? 27.742  -1.830  3.716   1.00 40.20 ? 267  LYS B NZ  1 
ATOM   906  N N   . GLY B 1 25 ? 32.204  -2.798  9.993   1.00 18.35 ? 268  GLY B N   1 
ATOM   907  C CA  . GLY B 1 25 ? 33.297  -3.652  10.350  1.00 18.26 ? 268  GLY B CA  1 
ATOM   908  C C   . GLY B 1 25 ? 34.097  -4.017  9.119   1.00 12.54 ? 268  GLY B C   1 
ATOM   909  O O   . GLY B 1 25 ? 33.662  -3.814  7.965   1.00 12.20 ? 268  GLY B O   1 
ATOM   910  N N   . LEU B 1 26 ? 35.248  -4.602  9.393   1.00 14.73 ? 269  LEU B N   1 
ATOM   911  C CA  . LEU B 1 26 ? 36.074  -5.212  8.390   1.00 14.04 ? 269  LEU B CA  1 
ATOM   912  C C   . LEU B 1 26 ? 35.301  -6.362  7.731   1.00 18.53 ? 269  LEU B C   1 
ATOM   913  O O   . LEU B 1 26 ? 35.562  -6.700  6.585   1.00 21.12 ? 269  LEU B O   1 
ATOM   914  C CB  . LEU B 1 26 ? 37.343  -5.761  9.034   1.00 16.58 ? 269  LEU B CB  1 
ATOM   915  C CG  . LEU B 1 26 ? 38.429  -4.802  9.560   1.00 28.01 ? 269  LEU B CG  1 
ATOM   916  C CD1 . LEU B 1 26 ? 39.446  -5.587  10.405  1.00 23.38 ? 269  LEU B CD1 1 
ATOM   917  C CD2 . LEU B 1 26 ? 39.133  -4.064  8.445   1.00 19.03 ? 269  LEU B CD2 1 
ATOM   918  N N   . ASP B 1 27 ? 34.353  -6.959  8.468   1.00 17.22 ? 270  ASP B N   1 
ATOM   919  C CA  . ASP B 1 27 ? 33.447  -7.987  7.916   1.00 17.01 ? 270  ASP B CA  1 
ATOM   920  C C   . ASP B 1 27 ? 32.123  -7.475  7.333   1.00 12.56 ? 270  ASP B C   1 
ATOM   921  O O   . ASP B 1 27 ? 31.256  -8.279  6.962   1.00 11.29 ? 270  ASP B O   1 
ATOM   922  C CB  . ASP B 1 27 ? 33.144  -9.022  8.985   1.00 17.73 ? 270  ASP B CB  1 
ATOM   923  C CG  . ASP B 1 27 ? 32.405  -8.441  10.148  1.00 11.80 ? 270  ASP B CG  1 
ATOM   924  O OD1 . ASP B 1 27 ? 32.116  -7.236  10.126  1.00 8.20  ? 270  ASP B OD1 1 
ATOM   925  O OD2 . ASP B 1 27 ? 32.142  -9.188  11.099  1.00 16.57 ? 270  ASP B OD2 1 
ATOM   926  N N   . GLY B 1 28 ? 31.997  -6.158  7.220   1.00 13.24 ? 271  GLY B N   1 
ATOM   927  C CA  . GLY B 1 28 ? 30.866  -5.528  6.553   1.00 12.84 ? 271  GLY B CA  1 
ATOM   928  C C   . GLY B 1 28 ? 29.738  -5.144  7.478   1.00 14.64 ? 271  GLY B C   1 
ATOM   929  O O   . GLY B 1 28 ? 28.853  -4.395  7.077   1.00 11.15 ? 271  GLY B O   1 
ATOM   930  N N   . ARG B 1 29 ? 29.764  -5.646  8.716   1.00 9.38  ? 272  ARG B N   1 
ATOM   931  C CA  . ARG B 1 29 ? 28.637  -5.482  9.619   1.00 13.26 ? 272  ARG B CA  1 
ATOM   932  C C   . ARG B 1 29 ? 28.605  -4.065  10.139  1.00 15.06 ? 272  ARG B C   1 
ATOM   933  O O   . ARG B 1 29 ? 29.637  -3.550  10.568  1.00 16.89 ? 272  ARG B O   1 
ATOM   934  C CB  . ARG B 1 29 ? 28.759  -6.481  10.760  1.00 21.94 ? 272  ARG B CB  1 
ATOM   935  C CG  . ARG B 1 29 ? 27.642  -6.440  11.764  1.00 14.71 ? 272  ARG B CG  1 
ATOM   936  C CD  . ARG B 1 29 ? 27.933  -7.464  12.845  1.00 32.25 ? 272  ARG B CD  1 
ATOM   937  N NE  . ARG B 1 29 ? 27.681  -8.812  12.346  1.00 39.73 ? 272  ARG B NE  1 
ATOM   938  C CZ  . ARG B 1 29 ? 28.351  -9.904  12.703  1.00 54.96 ? 272  ARG B CZ  1 
ATOM   939  N NH1 . ARG B 1 29 ? 28.003  -11.082 12.186  1.00 44.37 ? 272  ARG B NH1 1 
ATOM   940  N NH2 . ARG B 1 29 ? 29.366  -9.830  13.564  1.00 68.95 ? 272  ARG B NH2 1 
ATOM   941  N N   . PRO B 1 30 ? 27.437  -3.401  10.034  1.00 8.16  ? 273  PRO B N   1 
ATOM   942  C CA  . PRO B 1 30 ? 27.339  -2.034  10.446  1.00 9.63  ? 273  PRO B CA  1 
ATOM   943  C C   . PRO B 1 30 ? 27.217  -1.793  11.936  1.00 11.79 ? 273  PRO B C   1 
ATOM   944  O O   . PRO B 1 30 ? 26.613  -2.587  12.667  1.00 15.25 ? 273  PRO B O   1 
ATOM   945  C CB  . PRO B 1 30 ? 26.078  -1.557  9.722   1.00 14.12 ? 273  PRO B CB  1 
ATOM   946  C CG  . PRO B 1 30 ? 25.225  -2.738  9.673   1.00 22.48 ? 273  PRO B CG  1 
ATOM   947  C CD  . PRO B 1 30 ? 26.164  -3.877  9.452   1.00 13.87 ? 273  PRO B CD  1 
ATOM   948  N N   . GLY B 1 31 ? 27.866  -0.715  12.380  1.00 15.72 ? 274  GLY B N   1 
ATOM   949  C CA  . GLY B 1 31 ? 27.686  -0.195  13.708  1.00 13.90 ? 274  GLY B CA  1 
ATOM   950  C C   . GLY B 1 31 ? 27.329  1.288   13.602  1.00 13.57 ? 274  GLY B C   1 
ATOM   951  O O   . GLY B 1 31 ? 27.652  1.934   12.616  1.00 11.31 ? 274  GLY B O   1 
ATOM   952  N N   . GLN B 1 32 ? 26.680  1.823   14.617  1.00 11.14 ? 275  GLN B N   1 
ATOM   953  C CA  . GLN B 1 32 ? 26.230  3.231   14.594  1.00 15.09 ? 275  GLN B CA  1 
ATOM   954  C C   . GLN B 1 32 ? 26.917  3.944   15.740  1.00 15.83 ? 275  GLN B C   1 
ATOM   955  O O   . GLN B 1 32 ? 26.860  3.475   16.875  1.00 15.70 ? 275  GLN B O   1 
ATOM   956  C CB  . GLN B 1 32 ? 24.707  3.338   14.747  1.00 15.84 ? 275  GLN B CB  1 
ATOM   957  C CG  . GLN B 1 32 ? 23.889  2.556   13.706  1.00 15.74 ? 275  GLN B CG  1 
ATOM   958  C CD  . GLN B 1 32 ? 24.262  2.881   12.242  1.00 15.17 ? 275  GLN B CD  1 
ATOM   959  O OE1 . GLN B 1 32 ? 24.575  4.032   11.895  1.00 15.27 ? 275  GLN B OE1 1 
ATOM   960  N NE2 . GLN B 1 32 ? 24.194  1.862   11.374  1.00 11.89 ? 275  GLN B NE2 1 
ATOM   961  N N   . PHE B 1 33 ? 27.567  5.064   15.440  1.00 16.17 ? 276  PHE B N   1 
ATOM   962  C CA  . PHE B 1 33 ? 28.406  5.765   16.426  1.00 11.90 ? 276  PHE B CA  1 
ATOM   963  C C   . PHE B 1 33 ? 27.941  7.185   16.567  1.00 13.50 ? 276  PHE B C   1 
ATOM   964  O O   . PHE B 1 33 ? 27.528  7.842   15.576  1.00 15.03 ? 276  PHE B O   1 
ATOM   965  C CB  . PHE B 1 33 ? 29.892  5.704   16.006  1.00 14.97 ? 276  PHE B CB  1 
ATOM   966  C CG  . PHE B 1 33 ? 30.450  4.296   15.959  1.00 14.27 ? 276  PHE B CG  1 
ATOM   967  C CD1 . PHE B 1 33 ? 31.025  3.708   17.082  1.00 14.43 ? 276  PHE B CD1 1 
ATOM   968  C CD2 . PHE B 1 33 ? 30.339  3.544   14.814  1.00 12.21 ? 276  PHE B CD2 1 
ATOM   969  C CE1 . PHE B 1 33 ? 31.526  2.410   17.019  1.00 12.63 ? 276  PHE B CE1 1 
ATOM   970  C CE2 . PHE B 1 33 ? 30.784  2.211   14.762  1.00 18.43 ? 276  PHE B CE2 1 
ATOM   971  C CZ  . PHE B 1 33 ? 31.378  1.657   15.858  1.00 16.75 ? 276  PHE B CZ  1 
ATOM   972  N N   . LEU B 1 34 ? 27.974  7.659   17.799  1.00 17.05 ? 277  LEU B N   1 
ATOM   973  C CA  . LEU B 1 34 ? 27.706  9.071   18.091  1.00 14.42 ? 277  LEU B CA  1 
ATOM   974  C C   . LEU B 1 34 ? 28.971  9.754   17.726  1.00 20.85 ? 277  LEU B C   1 
ATOM   975  O O   . LEU B 1 34 ? 29.944  9.738   18.490  1.00 22.58 ? 277  LEU B O   1 
ATOM   976  C CB  . LEU B 1 34 ? 27.380  9.298   19.549  0.70 16.48 ? 277  LEU B CB  1 
ATOM   977  C CG  . LEU B 1 34 ? 25.925  9.042   19.895  0.70 8.24  ? 277  LEU B CG  1 
ATOM   978  C CD1 . LEU B 1 34 ? 25.533  7.538   19.905  0.70 10.97 ? 277  LEU B CD1 1 
ATOM   979  C CD2 . LEU B 1 34 ? 25.651  9.720   21.247  0.70 18.08 ? 277  LEU B CD2 1 
ATOM   980  N N   . TRP B 1 35 ? 28.988  10.298  16.522  1.00 13.33 ? 278  TRP B N   1 
ATOM   981  C CA  . TRP B 1 35 ? 30.183  10.860  15.995  1.00 15.60 ? 278  TRP B CA  1 
ATOM   982  C C   . TRP B 1 35 ? 30.496  12.161  16.693  1.00 18.40 ? 278  TRP B C   1 
ATOM   983  O O   . TRP B 1 35 ? 31.654  12.439  16.964  1.00 18.35 ? 278  TRP B O   1 
ATOM   984  C CB  . TRP B 1 35 ? 30.088  11.124  14.495  1.00 18.24 ? 278  TRP B CB  1 
ATOM   985  C CG  . TRP B 1 35 ? 31.413  10.904  13.816  1.00 15.21 ? 278  TRP B CG  1 
ATOM   986  C CD1 . TRP B 1 35 ? 32.297  11.851  13.369  1.00 21.38 ? 278  TRP B CD1 1 
ATOM   987  C CD2 . TRP B 1 35 ? 32.016  9.635   13.535  1.00 14.37 ? 278  TRP B CD2 1 
ATOM   988  N NE1 . TRP B 1 35 ? 33.388  11.237  12.796  1.00 16.07 ? 278  TRP B NE1 1 
ATOM   989  C CE2 . TRP B 1 35 ? 33.253  9.882   12.920  1.00 20.50 ? 278  TRP B CE2 1 
ATOM   990  C CE3 . TRP B 1 35 ? 31.623  8.318   13.742  1.00 18.79 ? 278  TRP B CE3 1 
ATOM   991  C CZ2 . TRP B 1 35 ? 34.094  8.848   12.491  1.00 18.37 ? 278  TRP B CZ2 1 
ATOM   992  C CZ3 . TRP B 1 35 ? 32.459  7.293   13.329  1.00 20.55 ? 278  TRP B CZ3 1 
ATOM   993  C CH2 . TRP B 1 35 ? 33.678  7.568   12.715  1.00 20.75 ? 278  TRP B CH2 1 
ATOM   994  N N   . GLU B 1 36 ? 29.462  12.961  16.929  1.00 15.51 ? 279  GLU B N   1 
ATOM   995  C CA  . GLU B 1 36 ? 29.594  14.260  17.526  1.00 16.36 ? 279  GLU B CA  1 
ATOM   996  C C   . GLU B 1 36 ? 28.383  14.556  18.399  1.00 18.04 ? 279  GLU B C   1 
ATOM   997  O O   . GLU B 1 36 ? 27.288  14.116  18.097  1.00 14.86 ? 279  GLU B O   1 
ATOM   998  C CB  . GLU B 1 36 ? 29.845  15.320  16.427  1.00 22.82 ? 279  GLU B CB  1 
ATOM   999  C CG  . GLU B 1 36 ? 31.376  15.672  16.284  1.00 34.59 ? 279  GLU B CG  1 
ATOM   1000 C CD  . GLU B 1 36 ? 31.886  15.735  14.842  1.00 46.46 ? 279  GLU B CD  1 
ATOM   1001 O OE1 . GLU B 1 36 ? 31.141  16.230  13.955  1.00 52.18 ? 279  GLU B OE1 1 
ATOM   1002 O OE2 . GLU B 1 36 ? 33.053  15.307  14.612  1.00 54.42 ? 279  GLU B OE2 1 
ATOM   1003 N N   . VAL B 1 37 ? 28.623  15.228  19.527  1.00 14.64 ? 280  VAL B N   1 
ATOM   1004 C CA  . VAL B 1 37 ? 27.601  15.507  20.522  1.00 20.36 ? 280  VAL B CA  1 
ATOM   1005 C C   . VAL B 1 37 ? 27.633  17.010  20.804  1.00 19.08 ? 280  VAL B C   1 
ATOM   1006 O O   . VAL B 1 37 ? 28.617  17.517  21.305  1.00 18.32 ? 280  VAL B O   1 
ATOM   1007 C CB  . VAL B 1 37 ? 27.810  14.665  21.841  1.00 22.50 ? 280  VAL B CB  1 
ATOM   1008 C CG1 . VAL B 1 37 ? 26.672  14.910  22.822  1.00 19.09 ? 280  VAL B CG1 1 
ATOM   1009 C CG2 . VAL B 1 37 ? 27.891  13.155  21.535  1.00 16.16 ? 280  VAL B CG2 1 
ATOM   1010 N N   . ASP B 1 38 ? 26.561  17.717  20.451  1.00 16.95 ? 281  ASP B N   1 
ATOM   1011 C CA  . ASP B 1 38 ? 26.557  19.188  20.515  1.00 20.58 ? 281  ASP B CA  1 
ATOM   1012 C C   . ASP B 1 38 ? 26.408  19.700  21.940  1.00 16.27 ? 281  ASP B C   1 
ATOM   1013 O O   . ASP B 1 38 ? 25.543  19.232  22.662  1.00 16.09 ? 281  ASP B O   1 
ATOM   1014 C CB  . ASP B 1 38 ? 25.421  19.767  19.678  1.00 17.50 ? 281  ASP B CB  1 
ATOM   1015 C CG  . ASP B 1 38 ? 25.463  19.290  18.241  1.00 31.50 ? 281  ASP B CG  1 
ATOM   1016 O OD1 . ASP B 1 38 ? 26.577  19.092  17.718  1.00 39.91 ? 281  ASP B OD1 1 
ATOM   1017 O OD2 . ASP B 1 38 ? 24.382  19.080  17.650  1.00 35.85 ? 281  ASP B OD2 1 
ATOM   1018 N N   . PRO B 1 39 ? 27.230  20.692  22.332  1.00 20.36 ? 282  PRO B N   1 
ATOM   1019 C CA  . PRO B 1 39 ? 27.096  21.341  23.645  1.00 17.59 ? 282  PRO B CA  1 
ATOM   1020 C C   . PRO B 1 39 ? 25.748  22.040  23.847  1.00 14.95 ? 282  PRO B C   1 
ATOM   1021 O O   . PRO B 1 39 ? 25.192  22.586  22.894  1.00 11.91 ? 282  PRO B O   1 
ATOM   1022 C CB  . PRO B 1 39 ? 28.215  22.387  23.652  1.00 17.35 ? 282  PRO B CB  1 
ATOM   1023 C CG  . PRO B 1 39 ? 28.669  22.522  22.268  1.00 23.94 ? 282  PRO B CG  1 
ATOM   1024 C CD  . PRO B 1 39 ? 28.339  21.257  21.546  1.00 19.68 ? 282  PRO B CD  1 
ATOM   1025 N N   . GLY B 1 40 ? 25.238  22.004  25.087  1.00 13.40 ? 283  GLY B N   1 
ATOM   1026 C CA  . GLY B 1 40 ? 24.006  22.704  25.466  1.00 10.54 ? 283  GLY B CA  1 
ATOM   1027 C C   . GLY B 1 40 ? 22.703  22.121  24.967  1.00 5.12  ? 283  GLY B C   1 
ATOM   1028 O O   . GLY B 1 40 ? 21.631  22.715  25.154  1.00 6.48  ? 283  GLY B O   1 
ATOM   1029 N N   . LEU B 1 41 ? 22.777  20.976  24.299  1.00 14.08 ? 284  LEU B N   1 
ATOM   1030 C CA  . LEU B 1 41 ? 21.585  20.289  23.847  1.00 12.94 ? 284  LEU B CA  1 
ATOM   1031 C C   . LEU B 1 41 ? 21.443  18.979  24.658  1.00 9.41  ? 284  LEU B C   1 
ATOM   1032 O O   . LEU B 1 41 ? 22.376  18.589  25.361  1.00 15.36 ? 284  LEU B O   1 
ATOM   1033 C CB  . LEU B 1 41 ? 21.659  20.101  22.334  1.00 13.65 ? 284  LEU B CB  1 
ATOM   1034 C CG  . LEU B 1 41 ? 21.473  21.400  21.552  1.00 16.64 ? 284  LEU B CG  1 
ATOM   1035 C CD1 . LEU B 1 41 ? 21.605  21.092  20.060  1.00 16.85 ? 284  LEU B CD1 1 
ATOM   1036 C CD2 . LEU B 1 41 ? 20.110  22.050  21.868  1.00 23.78 ? 284  LEU B CD2 1 
ATOM   1037 N N   . PRO B 1 42 ? 20.262  18.351  24.634  1.00 13.87 ? 285  PRO B N   1 
ATOM   1038 C CA  . PRO B 1 42 ? 19.958  17.220  25.535  1.00 16.02 ? 285  PRO B CA  1 
ATOM   1039 C C   . PRO B 1 42 ? 20.977  16.088  25.598  1.00 18.44 ? 285  PRO B C   1 
ATOM   1040 O O   . PRO B 1 42 ? 21.320  15.629  26.695  1.00 21.32 ? 285  PRO B O   1 
ATOM   1041 C CB  . PRO B 1 42 ? 18.617  16.737  25.016  1.00 19.24 ? 285  PRO B CB  1 
ATOM   1042 C CG  . PRO B 1 42 ? 17.976  18.002  24.521  1.00 18.17 ? 285  PRO B CG  1 
ATOM   1043 C CD  . PRO B 1 42 ? 19.085  18.716  23.829  1.00 14.65 ? 285  PRO B CD  1 
ATOM   1044 N N   . ALA B 1 43 ? 21.477  15.640  24.455  1.00 16.15 ? 286  ALA B N   1 
ATOM   1045 C CA  . ALA B 1 43 ? 22.422  14.544  24.444  1.00 16.44 ? 286  ALA B CA  1 
ATOM   1046 C C   . ALA B 1 43 ? 23.648  14.871  25.299  1.00 17.87 ? 286  ALA B C   1 
ATOM   1047 O O   . ALA B 1 43 ? 23.996  14.130  26.229  1.00 16.61 ? 286  ALA B O   1 
ATOM   1048 C CB  . ALA B 1 43 ? 22.820  14.187  23.004  1.00 17.27 ? 286  ALA B CB  1 
ATOM   1049 N N   . LYS B 1 44 ? 24.290  15.997  25.009  1.00 16.89 ? 287  LYS B N   1 
ATOM   1050 C CA  . LYS B 1 44 ? 25.390  16.454  25.834  1.00 21.82 ? 287  LYS B CA  1 
ATOM   1051 C C   . LYS B 1 44 ? 24.984  16.520  27.305  1.00 24.91 ? 287  LYS B C   1 
ATOM   1052 O O   . LYS B 1 44 ? 25.693  16.000  28.165  1.00 27.15 ? 287  LYS B O   1 
ATOM   1053 C CB  . LYS B 1 44 ? 25.895  17.819  25.380  1.00 19.85 ? 287  LYS B CB  1 
ATOM   1054 C CG  . LYS B 1 44 ? 27.138  18.275  26.097  1.00 31.10 ? 287  LYS B CG  1 
ATOM   1055 C CD  . LYS B 1 44 ? 28.385  17.583  25.583  1.00 31.62 ? 287  LYS B CD  1 
ATOM   1056 C CE  . LYS B 1 44 ? 29.638  18.046  26.318  1.00 42.06 ? 287  LYS B CE  1 
ATOM   1057 N NZ  . LYS B 1 44 ? 30.862  17.471  25.689  1.00 52.75 ? 287  LYS B NZ  1 
ATOM   1058 N N   . LYS B 1 45 ? 23.841  17.133  27.589  1.00 25.34 ? 288  LYS B N   1 
ATOM   1059 C CA  . LYS B 1 45 ? 23.405  17.319  28.977  1.00 27.91 ? 288  LYS B CA  1 
ATOM   1060 C C   . LYS B 1 45 ? 22.933  16.038  29.680  1.00 28.26 ? 288  LYS B C   1 
ATOM   1061 O O   . LYS B 1 45 ? 22.602  16.086  30.866  1.00 31.10 ? 288  LYS B O   1 
ATOM   1062 C CB  . LYS B 1 45 ? 22.311  18.387  29.053  1.00 28.81 ? 288  LYS B CB  1 
ATOM   1063 C CG  . LYS B 1 45 ? 22.750  19.746  28.562  1.00 23.83 ? 288  LYS B CG  1 
ATOM   1064 C CD  . LYS B 1 45 ? 21.582  20.723  28.523  1.00 23.15 ? 288  LYS B CD  1 
ATOM   1065 C CE  . LYS B 1 45 ? 21.458  21.494  29.802  1.00 12.66 ? 288  LYS B CE  1 
ATOM   1066 N NZ  . LYS B 1 45 ? 20.814  22.838  29.612  1.00 17.69 ? 288  LYS B NZ  1 
ATOM   1067 N N   . ALA B 1 46 ? 22.881  14.910  28.964  1.00 26.52 ? 289  ALA B N   1 
ATOM   1068 C CA  . ALA B 1 46 ? 22.651  13.598  29.587  1.00 25.84 ? 289  ALA B CA  1 
ATOM   1069 C C   . ALA B 1 46 ? 23.948  12.828  29.742  1.00 28.16 ? 289  ALA B C   1 
ATOM   1070 O O   . ALA B 1 46 ? 23.936  11.659  30.108  1.00 35.00 ? 289  ALA B O   1 
ATOM   1071 C CB  . ALA B 1 46 ? 21.657  12.781  28.791  1.00 26.18 ? 289  ALA B CB  1 
ATOM   1072 N N   . GLY B 1 47 ? 25.067  13.490  29.471  1.00 28.73 ? 290  GLY B N   1 
ATOM   1073 C CA  . GLY B 1 47 ? 26.368  12.862  29.584  1.00 31.01 ? 290  GLY B CA  1 
ATOM   1074 C C   . GLY B 1 47 ? 26.744  11.930  28.446  1.00 29.23 ? 290  GLY B C   1 
ATOM   1075 O O   . GLY B 1 47 ? 27.593  11.058  28.632  1.00 30.84 ? 290  GLY B O   1 
ATOM   1076 N N   . MET B 1 48 ? 26.152  12.123  27.270  1.00 26.33 ? 291  MET B N   1 
ATOM   1077 C CA  . MET B 1 48 ? 26.598  11.402  26.068  1.00 21.65 ? 291  MET B CA  1 
ATOM   1078 C C   . MET B 1 48 ? 27.913  11.944  25.574  1.00 19.40 ? 291  MET B C   1 
ATOM   1079 O O   . MET B 1 48 ? 28.152  13.153  25.616  1.00 17.77 ? 291  MET B O   1 
ATOM   1080 C CB  A MET B 1 48 ? 25.536  11.442  24.983  0.70 22.21 ? 291  MET B CB  1 
ATOM   1081 C CB  B MET B 1 48 ? 25.546  11.526  24.940  0.30 21.14 ? 291  MET B CB  1 
ATOM   1082 C CG  A MET B 1 48 ? 24.522  10.335  25.178  0.70 33.70 ? 291  MET B CG  1 
ATOM   1083 C CG  B MET B 1 48 ? 25.790  10.618  23.700  0.30 23.04 ? 291  MET B CG  1 
ATOM   1084 S SD  A MET B 1 48 ? 22.926  10.782  24.546  0.70 25.46 ? 291  MET B SD  1 
ATOM   1085 S SD  B MET B 1 48 ? 25.033  11.141  22.127  0.30 19.95 ? 291  MET B SD  1 
ATOM   1086 C CE  A MET B 1 48 ? 22.996  10.179  22.860  0.70 42.52 ? 291  MET B CE  1 
ATOM   1087 C CE  B MET B 1 48 ? 23.399  10.413  22.224  0.30 23.31 ? 291  MET B CE  1 
ATOM   1088 N N   . GLN B 1 49 ? 28.748  11.052  25.042  1.00 20.43 ? 292  GLN B N   1 
ATOM   1089 C CA  . GLN B 1 49 ? 30.096  11.390  24.611  1.00 23.57 ? 292  GLN B CA  1 
ATOM   1090 C C   . GLN B 1 49 ? 30.315  11.079  23.149  1.00 21.51 ? 292  GLN B C   1 
ATOM   1091 O O   . GLN B 1 49 ? 29.948  10.001  22.682  1.00 17.55 ? 292  GLN B O   1 
ATOM   1092 C CB  . GLN B 1 49 ? 31.112  10.556  25.410  1.00 25.04 ? 292  GLN B CB  1 
ATOM   1093 C CG  . GLN B 1 49 ? 31.270  10.948  26.853  1.00 33.81 ? 292  GLN B CG  1 
ATOM   1094 C CD  . GLN B 1 49 ? 31.884  9.833   27.690  1.00 34.80 ? 292  GLN B CD  1 
ATOM   1095 O OE1 . GLN B 1 49 ? 32.826  9.153   27.254  1.00 34.47 ? 292  GLN B OE1 1 
ATOM   1096 N NE2 . GLN B 1 49 ? 31.343  9.634   28.895  1.00 46.93 ? 292  GLN B NE2 1 
ATOM   1097 N N   . ALA B 1 50 ? 30.939  12.002  22.415  1.00 20.89 ? 293  ALA B N   1 
ATOM   1098 C CA  . ALA B 1 50 ? 31.414  11.664  21.073  1.00 20.43 ? 293  ALA B CA  1 
ATOM   1099 C C   . ALA B 1 50 ? 32.230  10.412  21.180  1.00 19.48 ? 293  ALA B C   1 
ATOM   1100 O O   . ALA B 1 50 ? 32.988  10.238  22.135  1.00 16.88 ? 293  ALA B O   1 
ATOM   1101 C CB  . ALA B 1 50 ? 32.248  12.777  20.471  1.00 23.18 ? 293  ALA B CB  1 
ATOM   1102 N N   . GLY B 1 51 ? 32.060  9.524   20.203  1.00 16.53 ? 294  GLY B N   1 
ATOM   1103 C CA  . GLY B 1 51 ? 32.686  8.227   20.230  1.00 17.65 ? 294  GLY B CA  1 
ATOM   1104 C C   . GLY B 1 51 ? 31.839  7.121   20.837  1.00 18.33 ? 294  GLY B C   1 
ATOM   1105 O O   . GLY B 1 51 ? 32.214  5.971   20.712  1.00 19.94 ? 294  GLY B O   1 
ATOM   1106 N N   . ASP B 1 52 ? 30.709  7.449   21.477  1.00 18.45 ? 295  ASP B N   1 
ATOM   1107 C CA  . ASP B 1 52 ? 29.808  6.410   22.015  1.00 16.45 ? 295  ASP B CA  1 
ATOM   1108 C C   . ASP B 1 52 ? 29.319  5.526   20.849  1.00 16.37 ? 295  ASP B C   1 
ATOM   1109 O O   . ASP B 1 52 ? 28.976  6.022   19.768  1.00 18.48 ? 295  ASP B O   1 
ATOM   1110 C CB  . ASP B 1 52 ? 28.567  7.022   22.715  1.00 13.88 ? 295  ASP B CB  1 
ATOM   1111 C CG  . ASP B 1 52 ? 28.825  7.535   24.145  1.00 16.85 ? 295  ASP B CG  1 
ATOM   1112 O OD1 . ASP B 1 52 ? 29.852  7.240   24.779  1.00 17.22 ? 295  ASP B OD1 1 
ATOM   1113 O OD2 . ASP B 1 52 ? 27.940  8.270   24.660  1.00 14.58 ? 295  ASP B OD2 1 
ATOM   1114 N N   . ARG B 1 53 ? 29.276  4.229   21.082  1.00 13.05 ? 296  ARG B N   1 
ATOM   1115 C CA  . ARG B 1 53 ? 28.643  3.296   20.186  1.00 15.91 ? 296  ARG B CA  1 
ATOM   1116 C C   . ARG B 1 53 ? 27.203  3.189   20.677  1.00 10.95 ? 296  ARG B C   1 
ATOM   1117 O O   . ARG B 1 53 ? 27.010  2.982   21.864  1.00 16.90 ? 296  ARG B O   1 
ATOM   1118 C CB  . ARG B 1 53 ? 29.315  1.921   20.272  1.00 14.79 ? 296  ARG B CB  1 
ATOM   1119 C CG  . ARG B 1 53 ? 28.532  0.818   19.538  1.00 12.20 ? 296  ARG B CG  1 
ATOM   1120 C CD  . ARG B 1 53 ? 28.992  -0.515  19.901  1.00 20.58 ? 296  ARG B CD  1 
ATOM   1121 N NE  . ARG B 1 53 ? 30.323  -0.777  19.393  1.00 16.01 ? 296  ARG B NE  1 
ATOM   1122 C CZ  . ARG B 1 53 ? 30.591  -1.154  18.152  1.00 17.56 ? 296  ARG B CZ  1 
ATOM   1123 N NH1 . ARG B 1 53 ? 29.638  -1.381  17.279  1.00 27.49 ? 296  ARG B NH1 1 
ATOM   1124 N NH2 . ARG B 1 53 ? 31.828  -1.339  17.802  1.00 22.95 ? 296  ARG B NH2 1 
ATOM   1125 N N   . LEU B 1 54 ? 26.229  3.359   19.772  1.00 14.40 ? 297  LEU B N   1 
ATOM   1126 C CA  . LEU B 1 54 ? 24.802  3.145   20.086  1.00 15.75 ? 297  LEU B CA  1 
ATOM   1127 C C   . LEU B 1 54 ? 24.434  1.652   19.932  1.00 18.42 ? 297  LEU B C   1 
ATOM   1128 O O   . LEU B 1 54 ? 24.539  1.083   18.813  1.00 11.01 ? 297  LEU B O   1 
ATOM   1129 C CB  . LEU B 1 54 ? 23.914  4.015   19.191  1.00 15.22 ? 297  LEU B CB  1 
ATOM   1130 C CG  . LEU B 1 54 ? 22.416  3.979   19.490  1.00 7.47  ? 297  LEU B CG  1 
ATOM   1131 C CD1 . LEU B 1 54 ? 22.210  4.494   20.893  1.00 14.71 ? 297  LEU B CD1 1 
ATOM   1132 C CD2 . LEU B 1 54 ? 21.652  4.815   18.480  1.00 15.99 ? 297  LEU B CD2 1 
ATOM   1133 N N   . VAL B 1 55 ? 24.078  1.010   21.057  1.00 14.82 ? 298  VAL B N   1 
ATOM   1134 C CA  . VAL B 1 55 ? 23.789  -0.427  21.075  1.00 13.98 ? 298  VAL B CA  1 
ATOM   1135 C C   . VAL B 1 55 ? 22.291  -0.782  21.266  1.00 14.03 ? 298  VAL B C   1 
ATOM   1136 O O   . VAL B 1 55 ? 21.875  -1.874  20.857  1.00 13.37 ? 298  VAL B O   1 
ATOM   1137 C CB  . VAL B 1 55 ? 24.631  -1.227  22.124  1.00 14.44 ? 298  VAL B CB  1 
ATOM   1138 C CG1 . VAL B 1 55 ? 26.133  -1.055  21.873  1.00 14.89 ? 298  VAL B CG1 1 
ATOM   1139 C CG2 . VAL B 1 55 ? 24.253  -0.869  23.572  1.00 8.96  ? 298  VAL B CG2 1 
ATOM   1140 N N   . ALA B 1 56 ? 21.513  0.116   21.880  1.00 14.28 ? 299  ALA B N   1 
ATOM   1141 C CA  . ALA B 1 56 ? 20.042  -0.048  21.961  1.00 14.81 ? 299  ALA B CA  1 
ATOM   1142 C C   . ALA B 1 56 ? 19.280  1.281   21.859  1.00 13.96 ? 299  ALA B C   1 
ATOM   1143 O O   . ALA B 1 56 ? 19.818  2.358   22.160  1.00 16.90 ? 299  ALA B O   1 
ATOM   1144 C CB  . ALA B 1 56 ? 19.640  -0.799  23.242  1.00 13.25 ? 299  ALA B CB  1 
ATOM   1145 N N   . VAL B 1 57 ? 18.040  1.189   21.378  1.00 15.13 ? 300  VAL B N   1 
ATOM   1146 C CA  . VAL B 1 57 ? 17.081  2.307   21.342  1.00 16.20 ? 300  VAL B CA  1 
ATOM   1147 C C   . VAL B 1 57 ? 15.732  1.808   21.864  1.00 18.99 ? 300  VAL B C   1 
ATOM   1148 O O   . VAL B 1 57 ? 15.218  0.799   21.358  1.00 15.33 ? 300  VAL B O   1 
ATOM   1149 C CB  . VAL B 1 57 ? 16.819  2.846   19.917  1.00 15.28 ? 300  VAL B CB  1 
ATOM   1150 C CG1 . VAL B 1 57 ? 15.722  3.950   19.949  1.00 17.12 ? 300  VAL B CG1 1 
ATOM   1151 C CG2 . VAL B 1 57 ? 18.097  3.369   19.284  1.00 10.36 ? 300  VAL B CG2 1 
ATOM   1152 N N   . ALA B 1 58 ? 15.176  2.530   22.843  1.00 13.26 ? 301  ALA B N   1 
ATOM   1153 C CA  . ALA B 1 58 ? 13.873  2.215   23.441  1.00 20.13 ? 301  ALA B CA  1 
ATOM   1154 C C   . ALA B 1 58 ? 13.870  0.805   23.994  1.00 15.64 ? 301  ALA B C   1 
ATOM   1155 O O   . ALA B 1 58 ? 12.860  0.109   23.937  1.00 17.83 ? 301  ALA B O   1 
ATOM   1156 C CB  . ALA B 1 58 ? 12.761  2.386   22.418  1.00 17.85 ? 301  ALA B CB  1 
ATOM   1157 N N   . GLY B 1 59 ? 15.017  0.372   24.503  1.00 16.27 ? 302  GLY B N   1 
ATOM   1158 C CA  . GLY B 1 59 ? 15.151  -0.954  25.090  1.00 16.70 ? 302  GLY B CA  1 
ATOM   1159 C C   . GLY B 1 59 ? 15.453  -2.059  24.096  1.00 16.47 ? 302  GLY B C   1 
ATOM   1160 O O   . GLY B 1 59 ? 15.673  -3.193  24.489  1.00 15.50 ? 302  GLY B O   1 
ATOM   1161 N N   . GLU B 1 60 ? 15.464  -1.748  22.810  1.00 16.54 ? 303  GLU B N   1 
ATOM   1162 C CA  . GLU B 1 60 ? 15.721  -2.764  21.791  1.00 14.42 ? 303  GLU B CA  1 
ATOM   1163 C C   . GLU B 1 60 ? 17.103  -2.622  21.161  1.00 15.23 ? 303  GLU B C   1 
ATOM   1164 O O   . GLU B 1 60 ? 17.560  -1.521  20.878  1.00 16.04 ? 303  GLU B O   1 
ATOM   1165 C CB  . GLU B 1 60 ? 14.644  -2.723  20.723  1.00 15.45 ? 303  GLU B CB  1 
ATOM   1166 C CG  . GLU B 1 60 ? 13.258  -3.075  21.275  1.00 16.66 ? 303  GLU B CG  1 
ATOM   1167 C CD  . GLU B 1 60 ? 12.213  -3.289  20.195  1.00 21.57 ? 303  GLU B CD  1 
ATOM   1168 O OE1 . GLU B 1 60 ? 12.498  -3.932  19.156  1.00 30.98 ? 303  GLU B OE1 1 
ATOM   1169 O OE2 . GLU B 1 60 ? 11.082  -2.823  20.401  1.00 34.68 ? 303  GLU B OE2 1 
ATOM   1170 N N   . SER B 1 61 ? 17.749  -3.752  20.916  1.00 15.34 ? 304  SER B N   1 
ATOM   1171 C CA  . SER B 1 61 ? 19.057  -3.763  20.265  1.00 20.22 ? 304  SER B CA  1 
ATOM   1172 C C   . SER B 1 61 ? 19.053  -3.188  18.856  1.00 19.42 ? 304  SER B C   1 
ATOM   1173 O O   . SER B 1 61 ? 18.222  -3.551  18.016  1.00 14.58 ? 304  SER B O   1 
ATOM   1174 C CB  . SER B 1 61 ? 19.594  -5.184  20.189  1.00 17.52 ? 304  SER B CB  1 
ATOM   1175 O OG  . SER B 1 61 ? 20.910  -5.203  19.699  1.00 15.74 ? 304  SER B OG  1 
ATOM   1176 N N   . VAL B 1 62 ? 20.031  -2.324  18.601  1.00 16.45 ? 305  VAL B N   1 
ATOM   1177 C CA  . VAL B 1 62 ? 20.368  -1.916  17.249  1.00 14.76 ? 305  VAL B CA  1 
ATOM   1178 C C   . VAL B 1 62 ? 21.761  -2.429  16.844  1.00 14.96 ? 305  VAL B C   1 
ATOM   1179 O O   . VAL B 1 62 ? 22.318  -1.947  15.879  1.00 12.07 ? 305  VAL B O   1 
ATOM   1180 C CB  . VAL B 1 62 ? 20.271  -0.358  17.079  1.00 17.24 ? 305  VAL B CB  1 
ATOM   1181 C CG1 . VAL B 1 62 ? 18.801  0.098   17.230  1.00 13.04 ? 305  VAL B CG1 1 
ATOM   1182 C CG2 . VAL B 1 62 ? 21.196  0.391   18.074  1.00 9.59  ? 305  VAL B CG2 1 
ATOM   1183 N N   . GLU B 1 63 ? 22.306  -3.421  17.571  1.00 12.13 ? 306  GLU B N   1 
ATOM   1184 C CA  . GLU B 1 63 ? 23.578  -4.023  17.176  1.00 16.09 ? 306  GLU B CA  1 
ATOM   1185 C C   . GLU B 1 63 ? 23.347  -4.731  15.850  1.00 14.68 ? 306  GLU B C   1 
ATOM   1186 O O   . GLU B 1 63 ? 22.319  -5.359  15.659  1.00 14.68 ? 306  GLU B O   1 
ATOM   1187 C CB  . GLU B 1 63 ? 24.098  -5.005  18.240  1.00 17.70 ? 306  GLU B CB  1 
ATOM   1188 C CG  . GLU B 1 63 ? 24.542  -4.291  19.533  1.00 19.78 ? 306  GLU B CG  1 
ATOM   1189 C CD  . GLU B 1 63 ? 24.917  -5.244  20.655  1.00 24.01 ? 306  GLU B CD  1 
ATOM   1190 O OE1 . GLU B 1 63 ? 25.063  -6.457  20.417  1.00 14.21 ? 306  GLU B OE1 1 
ATOM   1191 O OE2 . GLU B 1 63 ? 25.044  -4.770  21.797  1.00 21.25 ? 306  GLU B OE2 1 
ATOM   1192 N N   . GLY B 1 64 ? 24.279  -4.553  14.926  1.00 15.75 ? 307  GLY B N   1 
ATOM   1193 C CA  . GLY B 1 64 ? 24.245  -5.172  13.623  1.00 16.26 ? 307  GLY B CA  1 
ATOM   1194 C C   . GLY B 1 64 ? 23.254  -4.560  12.648  1.00 19.32 ? 307  GLY B C   1 
ATOM   1195 O O   . GLY B 1 64 ? 23.085  -5.082  11.552  1.00 11.60 ? 307  GLY B O   1 
ATOM   1196 N N   . LEU B 1 65 ? 22.580  -3.482  13.060  1.00 13.35 ? 308  LEU B N   1 
ATOM   1197 C CA  . LEU B 1 65 ? 21.550  -2.832  12.237  1.00 16.17 ? 308  LEU B CA  1 
ATOM   1198 C C   . LEU B 1 65 ? 22.131  -1.718  11.425  1.00 16.70 ? 308  LEU B C   1 
ATOM   1199 O O   . LEU B 1 65 ? 23.086  -1.051  11.869  1.00 12.87 ? 308  LEU B O   1 
ATOM   1200 C CB  . LEU B 1 65 ? 20.427  -2.206  13.095  1.00 9.69  ? 308  LEU B CB  1 
ATOM   1201 C CG  . LEU B 1 65 ? 19.475  -3.149  13.825  1.00 19.36 ? 308  LEU B CG  1 
ATOM   1202 C CD1 . LEU B 1 65 ? 18.252  -2.317  14.284  1.00 20.05 ? 308  LEU B CD1 1 
ATOM   1203 C CD2 . LEU B 1 65 ? 19.029  -4.327  12.974  1.00 17.60 ? 308  LEU B CD2 1 
ATOM   1204 N N   . GLY B 1 66 ? 21.494  -1.483  10.270  1.00 14.57 ? 309  GLY B N   1 
ATOM   1205 C CA  . GLY B 1 66 ? 21.810  -0.364  9.405   1.00 12.17 ? 309  GLY B CA  1 
ATOM   1206 C C   . GLY B 1 66 ? 21.381  0.999   9.944   1.00 13.67 ? 309  GLY B C   1 
ATOM   1207 O O   . GLY B 1 66 ? 20.695  1.111   10.956  1.00 11.58 ? 309  GLY B O   1 
ATOM   1208 N N   . HIS B 1 67 ? 21.773  2.027   9.206   1.00 10.15 ? 310  HIS B N   1 
ATOM   1209 C CA  . HIS B 1 67 ? 21.711  3.404   9.651   1.00 13.09 ? 310  HIS B CA  1 
ATOM   1210 C C   . HIS B 1 67 ? 20.279  3.918   9.647   1.00 13.36 ? 310  HIS B C   1 
ATOM   1211 O O   . HIS B 1 67 ? 19.772  4.420   10.659  1.00 13.85 ? 310  HIS B O   1 
ATOM   1212 C CB  . HIS B 1 67 ? 22.633  4.271   8.786   1.00 12.85 ? 310  HIS B CB  1 
ATOM   1213 C CG  . HIS B 1 67 ? 22.632  5.707   9.181   1.00 12.62 ? 310  HIS B CG  1 
ATOM   1214 N ND1 . HIS B 1 67 ? 23.246  6.157   10.327  1.00 12.33 ? 310  HIS B ND1 1 
ATOM   1215 C CD2 . HIS B 1 67 ? 22.066  6.788   8.600   1.00 11.22 ? 310  HIS B CD2 1 
ATOM   1216 C CE1 . HIS B 1 67 ? 23.028  7.450   10.456  1.00 13.80 ? 310  HIS B CE1 1 
ATOM   1217 N NE2 . HIS B 1 67 ? 22.334  7.862   9.413   1.00 13.19 ? 310  HIS B NE2 1 
ATOM   1218 N N   . GLU B 1 68 ? 19.609  3.772   8.519   1.00 12.90 ? 311  GLU B N   1 
ATOM   1219 C CA  . GLU B 1 68 ? 18.194  4.204   8.394   1.00 16.16 ? 311  GLU B CA  1 
ATOM   1220 C C   . GLU B 1 68 ? 17.247  3.452   9.319   1.00 13.16 ? 311  GLU B C   1 
ATOM   1221 O O   . GLU B 1 68 ? 16.312  4.030   9.870   1.00 11.06 ? 311  GLU B O   1 
ATOM   1222 C CB  . GLU B 1 68 ? 17.733  4.094   6.936   1.00 16.02 ? 311  GLU B CB  1 
ATOM   1223 C CG  . GLU B 1 68 ? 18.476  5.091   6.016   1.00 33.54 ? 311  GLU B CG  1 
ATOM   1224 C CD  . GLU B 1 68 ? 18.471  6.542   6.519   1.00 35.91 ? 311  GLU B CD  1 
ATOM   1225 O OE1 . GLU B 1 68 ? 17.455  6.986   7.112   1.00 43.73 ? 311  GLU B OE1 1 
ATOM   1226 O OE2 . GLU B 1 68 ? 19.482  7.260   6.311   1.00 45.16 ? 311  GLU B OE2 1 
ATOM   1227 N N   . GLU B 1 69 ? 17.512  2.176   9.519   1.00 12.22 ? 312  GLU B N   1 
ATOM   1228 C CA  . GLU B 1 69 ? 16.760  1.397   10.484  1.00 12.91 ? 312  GLU B CA  1 
ATOM   1229 C C   . GLU B 1 69 ? 16.962  1.972   11.895  1.00 13.25 ? 312  GLU B C   1 
ATOM   1230 O O   . GLU B 1 69 ? 16.015  2.128   12.626  1.00 11.20 ? 312  GLU B O   1 
ATOM   1231 C CB  . GLU B 1 69 ? 17.179  -0.069  10.418  1.00 16.27 ? 312  GLU B CB  1 
ATOM   1232 C CG  . GLU B 1 69 ? 16.537  -0.930  11.492  1.00 24.31 ? 312  GLU B CG  1 
ATOM   1233 C CD  . GLU B 1 69 ? 15.037  -1.074  11.311  1.00 30.09 ? 312  GLU B CD  1 
ATOM   1234 O OE1 . GLU B 1 69 ? 14.558  -0.893  10.182  1.00 26.81 ? 312  GLU B OE1 1 
ATOM   1235 O OE2 . GLU B 1 69 ? 14.334  -1.402  12.281  1.00 24.90 ? 312  GLU B OE2 1 
ATOM   1236 N N   . THR B 1 70 ? 18.206  2.320   12.249  1.00 16.11 ? 313  THR B N   1 
ATOM   1237 C CA  . THR B 1 70 ? 18.506  2.810   13.588  1.00 13.84 ? 313  THR B CA  1 
ATOM   1238 C C   . THR B 1 70 ? 17.882  4.175   13.791  1.00 12.36 ? 313  THR B C   1 
ATOM   1239 O O   . THR B 1 70 ? 17.265  4.414   14.818  1.00 10.33 ? 313  THR B O   1 
ATOM   1240 C CB  . THR B 1 70 ? 20.027  2.849   13.875  1.00 14.05 ? 313  THR B CB  1 
ATOM   1241 O OG1 . THR B 1 70 ? 20.534  1.517   13.787  1.00 11.27 ? 313  THR B OG1 1 
ATOM   1242 C CG2 . THR B 1 70 ? 20.332  3.422   15.277  1.00 12.10 ? 313  THR B CG2 1 
ATOM   1243 N N   . VAL B 1 71 ? 18.057  5.057   12.811  1.00 8.16  ? 314  VAL B N   1 
ATOM   1244 C CA  . VAL B 1 71 ? 17.505  6.388   12.871  1.00 9.27  ? 314  VAL B CA  1 
ATOM   1245 C C   . VAL B 1 71 ? 16.002  6.291   13.090  1.00 11.83 ? 314  VAL B C   1 
ATOM   1246 O O   . VAL B 1 71 ? 15.406  7.008   13.913  1.00 14.33 ? 314  VAL B O   1 
ATOM   1247 C CB  . VAL B 1 71 ? 17.879  7.252   11.567  1.00 12.26 ? 314  VAL B CB  1 
ATOM   1248 C CG1 . VAL B 1 71 ? 17.087  8.508   11.481  1.00 14.50 ? 314  VAL B CG1 1 
ATOM   1249 C CG2 . VAL B 1 71 ? 19.372  7.585   11.560  1.00 10.38 ? 314  VAL B CG2 1 
ATOM   1250 N N   . SER B 1 72 ? 15.374  5.403   12.340  1.00 12.66 ? 315  SER B N   1 
ATOM   1251 C CA  . SER B 1 72 ? 13.939  5.298   12.375  1.00 13.00 ? 315  SER B CA  1 
ATOM   1252 C C   . SER B 1 72 ? 13.464  4.924   13.770  1.00 13.89 ? 315  SER B C   1 
ATOM   1253 O O   . SER B 1 72 ? 12.470  5.458   14.266  1.00 11.67 ? 315  SER B O   1 
ATOM   1254 C CB  . SER B 1 72 ? 13.519  4.275   11.344  1.00 12.78 ? 315  SER B CB  1 
ATOM   1255 O OG  . SER B 1 72 ? 12.147  4.048   11.346  1.00 24.90 ? 315  SER B OG  1 
ATOM   1256 N N   . ARG B 1 73 ? 14.203  4.034   14.425  1.00 13.91 ? 316  ARG B N   1 
ATOM   1257 C CA  . ARG B 1 73 ? 13.862  3.660   15.798  1.00 15.13 ? 316  ARG B CA  1 
ATOM   1258 C C   . ARG B 1 73 ? 13.955  4.867   16.754  1.00 15.38 ? 316  ARG B C   1 
ATOM   1259 O O   . ARG B 1 73 ? 13.118  5.045   17.609  1.00 8.56  ? 316  ARG B O   1 
ATOM   1260 C CB  . ARG B 1 73 ? 14.749  2.512   16.246  1.00 13.35 ? 316  ARG B CB  1 
ATOM   1261 C CG  . ARG B 1 73 ? 14.344  1.226   15.578  1.00 16.32 ? 316  ARG B CG  1 
ATOM   1262 C CD  . ARG B 1 73 ? 15.400  0.213   15.642  1.00 25.18 ? 316  ARG B CD  1 
ATOM   1263 N NE  . ARG B 1 73 ? 14.962  -1.030  14.988  1.00 24.39 ? 316  ARG B NE  1 
ATOM   1264 C CZ  . ARG B 1 73 ? 14.775  -2.182  15.609  1.00 24.13 ? 316  ARG B CZ  1 
ATOM   1265 N NH1 . ARG B 1 73 ? 14.992  -2.283  16.912  1.00 26.81 ? 316  ARG B NH1 1 
ATOM   1266 N NH2 . ARG B 1 73 ? 14.401  -3.253  14.917  1.00 33.96 ? 316  ARG B NH2 1 
ATOM   1267 N N   . ILE B 1 74 ? 14.978  5.692   16.581  1.00 14.34 ? 317  ILE B N   1 
ATOM   1268 C CA  . ILE B 1 74 ? 15.135  6.891   17.390  1.00 13.89 ? 317  ILE B CA  1 
ATOM   1269 C C   . ILE B 1 74 ? 13.959  7.846   17.147  1.00 13.47 ? 317  ILE B C   1 
ATOM   1270 O O   . ILE B 1 74 ? 13.354  8.340   18.088  1.00 15.84 ? 317  ILE B O   1 
ATOM   1271 C CB  . ILE B 1 74 ? 16.462  7.610   17.086  1.00 12.90 ? 317  ILE B CB  1 
ATOM   1272 C CG1 . ILE B 1 74 ? 17.641  6.723   17.495  1.00 10.87 ? 317  ILE B CG1 1 
ATOM   1273 C CG2 . ILE B 1 74 ? 16.547  8.956   17.848  1.00 14.36 ? 317  ILE B CG2 1 
ATOM   1274 C CD1 . ILE B 1 74 ? 18.979  7.133   16.788  1.00 9.68  ? 317  ILE B CD1 1 
ATOM   1275 N N   . GLN B 1 75 ? 13.637  8.071   15.876  1.00 14.58 ? 318  GLN B N   1 
ATOM   1276 C CA  . GLN B 1 75 ? 12.527  8.953   15.485  1.00 16.32 ? 318  GLN B CA  1 
ATOM   1277 C C   . GLN B 1 75 ? 11.147  8.439   15.997  1.00 19.33 ? 318  GLN B C   1 
ATOM   1278 O O   . GLN B 1 75 ? 10.256  9.220   16.347  1.00 13.59 ? 318  GLN B O   1 
ATOM   1279 C CB  . GLN B 1 75 ? 12.537  9.149   13.957  1.00 15.62 ? 318  GLN B CB  1 
ATOM   1280 C CG  . GLN B 1 75 ? 13.743  9.940   13.453  1.00 15.05 ? 318  GLN B CG  1 
ATOM   1281 C CD  . GLN B 1 75 ? 13.787  10.098  11.946  1.00 24.41 ? 318  GLN B CD  1 
ATOM   1282 O OE1 . GLN B 1 75 ? 13.306  9.249   11.185  1.00 19.64 ? 318  GLN B OE1 1 
ATOM   1283 N NE2 . GLN B 1 75 ? 14.369  11.202  11.502  1.00 25.76 ? 318  GLN B NE2 1 
ATOM   1284 N N   . GLY B 1 76 ? 10.976  7.125   16.065  1.00 13.59 ? 319  GLY B N   1 
ATOM   1285 C CA  . GLY B 1 76 ? 9.676   6.564   16.464  1.00 14.04 ? 319  GLY B CA  1 
ATOM   1286 C C   . GLY B 1 76 ? 9.382   6.742   17.937  1.00 15.39 ? 319  GLY B C   1 
ATOM   1287 O O   . GLY B 1 76 ? 8.311   6.392   18.388  1.00 12.98 ? 319  GLY B O   1 
ATOM   1288 N N   . GLN B 1 77 ? 10.353  7.241   18.704  1.00 14.60 ? 320  GLN B N   1 
ATOM   1289 C CA  . GLN B 1 77 ? 10.143  7.465   20.127  1.00 13.94 ? 320  GLN B CA  1 
ATOM   1290 C C   . GLN B 1 77 ? 9.664   8.865   20.451  1.00 16.10 ? 320  GLN B C   1 
ATOM   1291 O O   . GLN B 1 77 ? 9.337   9.157   21.594  1.00 18.33 ? 320  GLN B O   1 
ATOM   1292 C CB  . GLN B 1 77 ? 11.445  7.183   20.876  1.00 13.96 ? 320  GLN B CB  1 
ATOM   1293 C CG  . GLN B 1 77 ? 11.771  5.743   20.899  1.00 11.27 ? 320  GLN B CG  1 
ATOM   1294 C CD  . GLN B 1 77 ? 10.622  4.965   21.496  1.00 15.82 ? 320  GLN B CD  1 
ATOM   1295 O OE1 . GLN B 1 77 ? 10.256  5.203   22.638  1.00 19.51 ? 320  GLN B OE1 1 
ATOM   1296 N NE2 . GLN B 1 77 ? 10.009  4.087   20.709  1.00 17.86 ? 320  GLN B NE2 1 
ATOM   1297 N N   . GLY B 1 78 ? 9.666   9.745   19.457  1.00 16.92 ? 321  GLY B N   1 
ATOM   1298 C CA  . GLY B 1 78 ? 9.104   11.074  19.631  1.00 19.21 ? 321  GLY B CA  1 
ATOM   1299 C C   . GLY B 1 78 ? 9.940   11.918  20.567  1.00 18.51 ? 321  GLY B C   1 
ATOM   1300 O O   . GLY B 1 78 ? 11.159  11.899  20.490  1.00 15.51 ? 321  GLY B O   1 
ATOM   1301 N N   . SER B 1 79 ? 9.265   12.586  21.503  1.00 23.37 ? 322  SER B N   1 
ATOM   1302 C CA  . SER B 1 79 ? 9.885   13.576  22.401  1.00 26.79 ? 322  SER B CA  1 
ATOM   1303 C C   . SER B 1 79 ? 10.849  12.994  23.437  1.00 23.89 ? 322  SER B C   1 
ATOM   1304 O O   . SER B 1 79 ? 11.780  13.668  23.849  1.00 26.88 ? 322  SER B O   1 
ATOM   1305 C CB  . SER B 1 79 ? 8.797   14.360  23.133  1.00 23.37 ? 322  SER B CB  1 
ATOM   1306 O OG  . SER B 1 79 ? 7.776   14.746  22.239  1.00 36.49 ? 322  SER B OG  1 
ATOM   1307 N N   . CYS B 1 80 ? 10.596  11.762  23.877  1.00 23.21 ? 323  CYS B N   1 
ATOM   1308 C CA  . CYS B 1 80 ? 11.443  11.086  24.859  1.00 21.14 ? 323  CYS B CA  1 
ATOM   1309 C C   . CYS B 1 80 ? 12.007  9.791   24.300  1.00 23.72 ? 323  CYS B C   1 
ATOM   1310 O O   . CYS B 1 80 ? 11.265  8.947   23.787  1.00 21.72 ? 323  CYS B O   1 
ATOM   1311 C CB  . CYS B 1 80 ? 10.640  10.812  26.115  1.00 26.30 ? 323  CYS B CB  1 
ATOM   1312 S SG  . CYS B 1 80 ? 10.111  12.331  26.878  1.00 43.89 ? 323  CYS B SG  1 
ATOM   1313 N N   . VAL B 1 81 ? 13.326  9.646   24.387  1.00 21.14 ? 324  VAL B N   1 
ATOM   1314 C CA  . VAL B 1 81 ? 14.009  8.456   23.883  1.00 19.44 ? 324  VAL B CA  1 
ATOM   1315 C C   . VAL B 1 81 ? 15.071  7.990   24.872  1.00 21.05 ? 324  VAL B C   1 
ATOM   1316 O O   . VAL B 1 81 ? 15.872  8.782   25.410  1.00 19.58 ? 324  VAL B O   1 
ATOM   1317 C CB  . VAL B 1 81 ? 14.660  8.691   22.507  1.00 19.83 ? 324  VAL B CB  1 
ATOM   1318 C CG1 . VAL B 1 81 ? 15.857  9.608   22.644  1.00 20.00 ? 324  VAL B CG1 1 
ATOM   1319 C CG2 . VAL B 1 81 ? 15.083  7.380   21.865  1.00 17.30 ? 324  VAL B CG2 1 
ATOM   1320 N N   . SER B 1 82 ? 15.041  6.684   25.101  1.00 17.28 ? 325  SER B N   1 
ATOM   1321 C CA  . SER B 1 82 ? 16.052  5.961   25.838  1.00 17.98 ? 325  SER B CA  1 
ATOM   1322 C C   . SER B 1 82 ? 17.077  5.475   24.826  1.00 14.82 ? 325  SER B C   1 
ATOM   1323 O O   . SER B 1 82 ? 16.698  4.922   23.809  1.00 17.86 ? 325  SER B O   1 
ATOM   1324 C CB  . SER B 1 82 ? 15.390  4.771   26.554  1.00 21.48 ? 325  SER B CB  1 
ATOM   1325 O OG  . SER B 1 82 ? 16.329  3.759   26.818  1.00 32.70 ? 325  SER B OG  1 
ATOM   1326 N N   . LEU B 1 83 ? 18.358  5.725   25.090  1.00 17.75 ? 326  LEU B N   1 
ATOM   1327 C CA  . LEU B 1 83 ? 19.465  5.287   24.225  1.00 17.17 ? 326  LEU B CA  1 
ATOM   1328 C C   . LEU B 1 83 ? 20.461  4.549   25.089  1.00 19.80 ? 326  LEU B C   1 
ATOM   1329 O O   . LEU B 1 83 ? 20.819  5.053   26.165  1.00 22.77 ? 326  LEU B O   1 
ATOM   1330 C CB  . LEU B 1 83 ? 20.162  6.491   23.576  1.00 15.68 ? 326  LEU B CB  1 
ATOM   1331 C CG  . LEU B 1 83 ? 19.312  7.330   22.613  1.00 19.23 ? 326  LEU B CG  1 
ATOM   1332 C CD1 . LEU B 1 83 ? 20.030  8.612   22.237  1.00 16.06 ? 326  LEU B CD1 1 
ATOM   1333 C CD2 . LEU B 1 83 ? 18.908  6.523   21.387  1.00 15.89 ? 326  LEU B CD2 1 
ATOM   1334 N N   . THR B 1 84 ? 20.920  3.375   24.641  1.00 16.73 ? 327  THR B N   1 
ATOM   1335 C CA  . THR B 1 84 ? 22.003  2.678   25.339  1.00 13.55 ? 327  THR B CA  1 
ATOM   1336 C C   . THR B 1 84 ? 23.280  2.754   24.546  1.00 13.46 ? 327  THR B C   1 
ATOM   1337 O O   . THR B 1 84 ? 23.285  2.452   23.336  1.00 11.19 ? 327  THR B O   1 
ATOM   1338 C CB  . THR B 1 84 ? 21.638  1.224   25.689  1.00 17.76 ? 327  THR B CB  1 
ATOM   1339 O OG1 . THR B 1 84 ? 20.349  1.224   26.305  1.00 13.69 ? 327  THR B OG1 1 
ATOM   1340 C CG2 . THR B 1 84 ? 22.635  0.616   26.695  1.00 12.58 ? 327  THR B CG2 1 
ATOM   1341 N N   . VAL B 1 85 ? 24.343  3.192   25.237  1.00 11.61 ? 328  VAL B N   1 
ATOM   1342 C CA  . VAL B 1 85 ? 25.638  3.384   24.625  1.00 11.85 ? 328  VAL B CA  1 
ATOM   1343 C C   . VAL B 1 85 ? 26.739  2.680   25.367  1.00 13.55 ? 328  VAL B C   1 
ATOM   1344 O O   . VAL B 1 85 ? 26.625  2.419   26.562  1.00 15.40 ? 328  VAL B O   1 
ATOM   1345 C CB  . VAL B 1 85 ? 26.008  4.898   24.559  1.00 12.38 ? 328  VAL B CB  1 
ATOM   1346 C CG1 . VAL B 1 85 ? 24.996  5.641   23.683  1.00 9.19  ? 328  VAL B CG1 1 
ATOM   1347 C CG2 . VAL B 1 85 ? 26.102  5.488   25.964  1.00 17.03 ? 328  VAL B CG2 1 
ATOM   1348 N N   . VAL B 1 86 ? 27.804  2.365   24.624  1.00 18.74 ? 329  VAL B N   1 
ATOM   1349 C CA  . VAL B 1 86 ? 29.059  1.936   25.175  1.00 16.47 ? 329  VAL B CA  1 
ATOM   1350 C C   . VAL B 1 86 ? 30.052  3.085   24.968  1.00 17.81 ? 329  VAL B C   1 
ATOM   1351 O O   . VAL B 1 86 ? 30.361  3.445   23.844  1.00 12.99 ? 329  VAL B O   1 
ATOM   1352 C CB  . VAL B 1 86 ? 29.550  0.661   24.498  1.00 18.28 ? 329  VAL B CB  1 
ATOM   1353 C CG1 . VAL B 1 86 ? 30.996  0.369   24.903  1.00 20.75 ? 329  VAL B CG1 1 
ATOM   1354 C CG2 . VAL B 1 86 ? 28.640  -0.508  24.865  1.00 17.84 ? 329  VAL B CG2 1 
ATOM   1355 N N   . ASP B 1 87 ? 30.547  3.651   26.062  1.00 16.89 ? 330  ASP B N   1 
ATOM   1356 C CA  . ASP B 1 87 ? 31.478  4.743   25.964  1.00 18.01 ? 330  ASP B CA  1 
ATOM   1357 C C   . ASP B 1 87 ? 32.824  4.277   25.428  1.00 18.61 ? 330  ASP B C   1 
ATOM   1358 O O   . ASP B 1 87 ? 33.203  3.112   25.582  1.00 18.48 ? 330  ASP B O   1 
ATOM   1359 C CB  . ASP B 1 87 ? 31.665  5.430   27.309  1.00 21.28 ? 330  ASP B CB  1 
ATOM   1360 C CG  . ASP B 1 87 ? 30.415  6.131   27.791  1.00 19.27 ? 330  ASP B CG  1 
ATOM   1361 O OD1 . ASP B 1 87 ? 29.739  6.837   27.026  1.00 24.40 ? 330  ASP B OD1 1 
ATOM   1362 O OD2 . ASP B 1 87 ? 30.126  5.994   28.970  1.00 26.04 ? 330  ASP B OD2 1 
ATOM   1363 N N   . PRO B 1 88 ? 33.533  5.189   24.755  1.00 19.71 ? 331  PRO B N   1 
ATOM   1364 C CA  . PRO B 1 88 ? 34.909  4.954   24.372  1.00 23.94 ? 331  PRO B CA  1 
ATOM   1365 C C   . PRO B 1 88 ? 35.870  5.219   25.516  1.00 23.01 ? 331  PRO B C   1 
ATOM   1366 O O   . PRO B 1 88 ? 35.477  5.758   26.546  1.00 20.81 ? 331  PRO B O   1 
ATOM   1367 C CB  . PRO B 1 88 ? 35.144  6.001   23.285  1.00 24.17 ? 331  PRO B CB  1 
ATOM   1368 C CG  . PRO B 1 88 ? 34.253  7.119   23.665  1.00 23.66 ? 331  PRO B CG  1 
ATOM   1369 C CD  . PRO B 1 88 ? 33.059  6.519   24.320  1.00 21.67 ? 331  PRO B CD  1 
ATOM   1370 N N   . GLU B 1 89 ? 37.132  4.853   25.301  1.00 31.98 ? 332  GLU B N   1 
ATOM   1371 C CA  . GLU B 1 89 ? 38.258  5.402   26.066  1.00 32.91 ? 332  GLU B CA  1 
ATOM   1372 C C   . GLU B 1 89 ? 38.625  6.800   25.520  1.00 35.44 ? 332  GLU B C   1 
ATOM   1373 O O   . GLU B 1 89 ? 39.164  6.952   24.396  1.00 34.54 ? 332  GLU B O   1 
ATOM   1374 C CB  . GLU B 1 89 ? 39.450  4.447   26.020  1.00 37.68 ? 332  GLU B CB  1 
ATOM   1375 C CG  . GLU B 1 89 ? 39.256  3.162   26.838  1.00 40.97 ? 332  GLU B CG  1 
ATOM   1376 C CD  . GLU B 1 89 ? 38.668  2.000   26.043  1.00 52.74 ? 332  GLU B CD  1 
ATOM   1377 O OE1 . GLU B 1 89 ? 39.131  0.860   26.258  1.00 49.24 ? 332  GLU B OE1 1 
ATOM   1378 O OE2 . GLU B 1 89 ? 37.754  2.215   25.209  1.00 53.62 ? 332  GLU B OE2 1 
ATOM   1379 N N   . ALA B 1 90 ? 38.318  7.830   26.314  1.00 40.19 ? 333  ALA B N   1 
ATOM   1380 C CA  . ALA B 1 90 ? 38.416  9.243   25.865  1.00 42.26 ? 333  ALA B CA  1 
ATOM   1381 C C   . ALA B 1 90 ? 39.855  9.745   25.608  1.00 39.83 ? 333  ALA B C   1 
ATOM   1382 O O   . ALA B 1 90 ? 40.059  10.728  24.873  1.00 40.53 ? 333  ALA B O   1 
ATOM   1383 C CB  . ALA B 1 90 ? 37.702  10.168  26.858  1.00 43.72 ? 333  ALA B CB  1 
ATOM   1384 N N   . ASP B 1 91 ? 40.834  9.064   26.212  1.00 28.12 ? 334  ASP B N   1 
ATOM   1385 C CA  . ASP B 1 91 ? 42.261  9.333   25.993  1.00 25.04 ? 334  ASP B CA  1 
ATOM   1386 C C   . ASP B 1 91 ? 42.828  8.644   24.744  1.00 12.74 ? 334  ASP B C   1 
ATOM   1387 O O   . ASP B 1 91 ? 43.974  8.882   24.391  1.00 22.28 ? 334  ASP B O   1 
ATOM   1388 C CB  . ASP B 1 91 ? 43.065  8.810   27.187  1.00 26.62 ? 334  ASP B CB  1 
ATOM   1389 C CG  . ASP B 1 91 ? 42.920  7.290   27.352  1.00 42.94 ? 334  ASP B CG  1 
ATOM   1390 O OD1 . ASP B 1 91 ? 41.816  6.747   27.032  1.00 29.19 ? 334  ASP B OD1 1 
ATOM   1391 O OD2 . ASP B 1 91 ? 43.910  6.653   27.768  1.00 51.01 ? 334  ASP B OD2 1 
ATOM   1392 N N   . ARG B 1 92 ? 42.058  7.759   24.117  1.00 9.99  ? 335  ARG B N   1 
ATOM   1393 C CA  . ARG B 1 92 ? 42.496  7.071   22.897  1.00 11.83 ? 335  ARG B CA  1 
ATOM   1394 C C   . ARG B 1 92 ? 42.061  7.841   21.683  1.00 6.97  ? 335  ARG B C   1 
ATOM   1395 O O   . ARG B 1 92 ? 41.396  7.325   20.800  1.00 14.01 ? 335  ARG B O   1 
ATOM   1396 C CB  . ARG B 1 92 ? 42.010  5.638   22.876  1.00 9.38  ? 335  ARG B CB  1 
ATOM   1397 C CG  . ARG B 1 92 ? 42.555  4.928   24.067  1.00 15.60 ? 335  ARG B CG  1 
ATOM   1398 C CD  . ARG B 1 92 ? 42.450  3.462   23.982  1.00 17.37 ? 335  ARG B CD  1 
ATOM   1399 N NE  . ARG B 1 92 ? 43.046  2.876   25.183  1.00 22.11 ? 335  ARG B NE  1 
ATOM   1400 C CZ  . ARG B 1 92 ? 42.904  1.605   25.553  1.00 32.43 ? 335  ARG B CZ  1 
ATOM   1401 N NH1 . ARG B 1 92 ? 42.190  0.762   24.813  1.00 21.59 ? 335  ARG B NH1 1 
ATOM   1402 N NH2 . ARG B 1 92 ? 43.491  1.173   26.665  1.00 24.54 ? 335  ARG B NH2 1 
ATOM   1403 N N   . GLU B 1 93 ? 42.509  9.083   21.648  1.00 10.79 ? 336  GLU B N   1 
ATOM   1404 C CA  . GLU B 1 93 ? 42.305  9.967   20.526  1.00 9.04  ? 336  GLU B CA  1 
ATOM   1405 C C   . GLU B 1 93 ? 43.543  10.808  20.458  1.00 7.75  ? 336  GLU B C   1 
ATOM   1406 O O   . GLU B 1 93 ? 44.149  11.131  21.484  1.00 10.33 ? 336  GLU B O   1 
ATOM   1407 C CB  . GLU B 1 93 ? 41.042  10.832  20.704  1.00 12.93 ? 336  GLU B CB  1 
ATOM   1408 C CG  . GLU B 1 93 ? 41.091  11.670  21.971  1.00 14.21 ? 336  GLU B CG  1 
ATOM   1409 C CD  . GLU B 1 93 ? 39.886  12.559  22.168  1.00 19.28 ? 336  GLU B CD  1 
ATOM   1410 O OE1 . GLU B 1 93 ? 38.757  12.051  22.072  1.00 36.12 ? 336  GLU B OE1 1 
ATOM   1411 O OE2 . GLU B 1 93 ? 40.079  13.765  22.456  1.00 20.67 ? 336  GLU B OE2 1 
ATOM   1412 N N   . THR B 1 94 ? 43.963  11.102  19.238  1.00 7.96  ? 337  THR B N   1 
ATOM   1413 C CA  . THR B 1 94 ? 45.179  11.830  19.015  1.00 5.09  ? 337  THR B CA  1 
ATOM   1414 C C   . THR B 1 94 ? 45.066  12.630  17.721  1.00 2.00  ? 337  THR B C   1 
ATOM   1415 O O   . THR B 1 94 ? 44.766  12.092  16.657  1.00 5.78  ? 337  THR B O   1 
ATOM   1416 C CB  . THR B 1 94 ? 46.443  10.913  18.997  1.00 9.24  ? 337  THR B CB  1 
ATOM   1417 O OG1 . THR B 1 94 ? 46.456  10.087  20.166  1.00 8.72  ? 337  THR B OG1 1 
ATOM   1418 C CG2 . THR B 1 94 ? 47.693  11.720  18.970  1.00 7.18  ? 337  THR B CG2 1 
ATOM   1419 N N   . SER B 1 95 ? 45.323  13.916  17.842  1.00 7.14  ? 338  SER B N   1 
ATOM   1420 C CA  . SER B 1 95 ? 45.444  14.803  16.712  1.00 10.30 ? 338  SER B CA  1 
ATOM   1421 C C   . SER B 1 95 ? 46.858  14.677  16.167  1.00 8.27  ? 338  SER B C   1 
ATOM   1422 O O   . SER B 1 95 ? 47.808  14.911  16.878  1.00 8.01  ? 338  SER B O   1 
ATOM   1423 C CB  . SER B 1 95 ? 45.198  16.253  17.118  1.00 11.48 ? 338  SER B CB  1 
ATOM   1424 O OG  . SER B 1 95 ? 45.444  17.110  16.002  1.00 23.27 ? 338  SER B OG  1 
ATOM   1425 N N   . VAL B 1 96 ? 46.993  14.314  14.899  1.00 7.92  ? 339  VAL B N   1 
ATOM   1426 C CA  . VAL B 1 96 ? 48.304  14.274  14.280  1.00 16.32 ? 339  VAL B CA  1 
ATOM   1427 C C   . VAL B 1 96 ? 48.324  15.148  13.029  1.00 14.07 ? 339  VAL B C   1 
ATOM   1428 O O   . VAL B 1 96 ? 47.284  15.540  12.493  1.00 10.67 ? 339  VAL B O   1 
ATOM   1429 C CB  . VAL B 1 96 ? 48.747  12.813  13.963  1.00 17.34 ? 339  VAL B CB  1 
ATOM   1430 C CG1 . VAL B 1 96 ? 48.637  11.924  15.218  1.00 22.32 ? 339  VAL B CG1 1 
ATOM   1431 C CG2 . VAL B 1 96 ? 47.959  12.252  12.861  1.00 10.52 ? 339  VAL B CG2 1 
ATOM   1432 O OXT . VAL B 1 96 ? 49.405  15.473  12.546  1.00 17.34 ? 339  VAL B OXT 1 
ATOM   1433 N N   . PRO C 1 4  ? 20.398  -26.649 13.545  1.00 28.41 ? 247  PRO C N   1 
ATOM   1434 C CA  . PRO C 1 4  ? 21.490  -26.350 12.627  1.00 26.90 ? 247  PRO C CA  1 
ATOM   1435 C C   . PRO C 1 4  ? 22.400  -27.541 12.361  1.00 25.93 ? 247  PRO C C   1 
ATOM   1436 O O   . PRO C 1 4  ? 22.784  -28.245 13.295  1.00 28.29 ? 247  PRO C O   1 
ATOM   1437 C CB  . PRO C 1 4  ? 22.262  -25.232 13.327  1.00 24.60 ? 247  PRO C CB  1 
ATOM   1438 C CG  . PRO C 1 4  ? 21.802  -25.217 14.744  1.00 26.76 ? 247  PRO C CG  1 
ATOM   1439 C CD  . PRO C 1 4  ? 20.725  -26.255 14.923  1.00 31.16 ? 247  PRO C CD  1 
ATOM   1440 N N   . ARG C 1 5  ? 22.741  -27.763 11.095  1.00 24.49 ? 248  ARG C N   1 
ATOM   1441 C CA  . ARG C 1 5  ? 23.525  -28.931 10.709  1.00 23.94 ? 248  ARG C CA  1 
ATOM   1442 C C   . ARG C 1 5  ? 24.805  -28.504 10.029  1.00 22.04 ? 248  ARG C C   1 
ATOM   1443 O O   . ARG C 1 5  ? 24.759  -27.657 9.147   1.00 18.66 ? 248  ARG C O   1 
ATOM   1444 C CB  . ARG C 1 5  ? 22.749  -29.770 9.718   1.00 25.14 ? 248  ARG C CB  1 
ATOM   1445 C CG  . ARG C 1 5  ? 21.390  -30.225 10.171  1.00 31.57 ? 248  ARG C CG  1 
ATOM   1446 C CD  . ARG C 1 5  ? 20.546  -30.484 8.939   1.00 37.09 ? 248  ARG C CD  1 
ATOM   1447 N NE  . ARG C 1 5  ? 21.247  -31.347 7.999   1.00 38.20 ? 248  ARG C NE  1 
ATOM   1448 C CZ  . ARG C 1 5  ? 21.202  -31.260 6.672   1.00 35.49 ? 248  ARG C CZ  1 
ATOM   1449 N NH1 . ARG C 1 5  ? 20.488  -30.321 6.048   1.00 30.09 ? 248  ARG C NH1 1 
ATOM   1450 N NH2 . ARG C 1 5  ? 21.905  -32.131 5.961   1.00 33.81 ? 248  ARG C NH2 1 
ATOM   1451 N N   . CYS C 1 6  ? 25.935  -29.099 10.416  1.00 21.17 ? 249  CYS C N   1 
ATOM   1452 C CA  . CYS C 1 6  ? 27.202  -28.785 9.780   1.00 21.32 ? 249  CYS C CA  1 
ATOM   1453 C C   . CYS C 1 6  ? 27.476  -29.820 8.711   1.00 23.40 ? 249  CYS C C   1 
ATOM   1454 O O   . CYS C 1 6  ? 27.525  -31.018 8.992   1.00 25.56 ? 249  CYS C O   1 
ATOM   1455 C CB  . CYS C 1 6  ? 28.365  -28.748 10.775  1.00 22.78 ? 249  CYS C CB  1 
ATOM   1456 S SG  . CYS C 1 6  ? 29.956  -28.413 9.946   1.00 25.36 ? 249  CYS C SG  1 
ATOM   1457 N N   . LEU C 1 7  ? 27.671  -29.343 7.490   1.00 19.87 ? 250  LEU C N   1 
ATOM   1458 C CA  . LEU C 1 7  ? 27.920  -30.199 6.355   1.00 21.50 ? 250  LEU C CA  1 
ATOM   1459 C C   . LEU C 1 7  ? 29.339  -29.953 5.892   1.00 19.95 ? 250  LEU C C   1 
ATOM   1460 O O   . LEU C 1 7  ? 29.821  -28.838 5.962   1.00 21.42 ? 250  LEU C O   1 
ATOM   1461 C CB  . LEU C 1 7  ? 26.915  -29.854 5.262   1.00 25.29 ? 250  LEU C CB  1 
ATOM   1462 C CG  . LEU C 1 7  ? 25.493  -29.736 5.825   1.00 29.25 ? 250  LEU C CG  1 
ATOM   1463 C CD1 . LEU C 1 7  ? 24.543  -28.998 4.898   1.00 28.29 ? 250  LEU C CD1 1 
ATOM   1464 C CD2 . LEU C 1 7  ? 24.983  -31.132 6.173   1.00 30.29 ? 250  LEU C CD2 1 
ATOM   1465 N N   . HIS C 1 8  ? 30.021  -30.995 5.431   1.00 19.98 ? 251  HIS C N   1 
ATOM   1466 C CA  . HIS C 1 8  ? 31.342  -30.823 4.852   1.00 23.12 ? 251  HIS C CA  1 
ATOM   1467 C C   . HIS C 1 8  ? 31.299  -31.094 3.337   1.00 22.04 ? 251  HIS C C   1 
ATOM   1468 O O   . HIS C 1 8  ? 30.825  -32.149 2.898   1.00 17.08 ? 251  HIS C O   1 
ATOM   1469 C CB  . HIS C 1 8  ? 32.351  -31.730 5.563   1.00 27.25 ? 251  HIS C CB  1 
ATOM   1470 C CG  . HIS C 1 8  ? 32.203  -31.736 7.055   1.00 35.83 ? 251  HIS C CG  1 
ATOM   1471 N ND1 . HIS C 1 8  ? 32.896  -30.872 7.878   1.00 55.61 ? 251  HIS C ND1 1 
ATOM   1472 C CD2 . HIS C 1 8  ? 31.429  -32.492 7.871   1.00 42.86 ? 251  HIS C CD2 1 
ATOM   1473 C CE1 . HIS C 1 8  ? 32.562  -31.103 9.135   1.00 48.75 ? 251  HIS C CE1 1 
ATOM   1474 N NE2 . HIS C 1 8  ? 31.672  -32.080 9.158   1.00 52.64 ? 251  HIS C NE2 1 
ATOM   1475 N N   . LEU C 1 9  ? 31.775  -30.137 2.539   1.00 16.64 ? 252  LEU C N   1 
ATOM   1476 C CA  . LEU C 1 9  ? 31.761  -30.307 1.082   1.00 19.67 ? 252  LEU C CA  1 
ATOM   1477 C C   . LEU C 1 9  ? 33.160  -30.323 0.451   1.00 18.71 ? 252  LEU C C   1 
ATOM   1478 O O   . LEU C 1 9  ? 34.055  -29.537 0.814   1.00 18.42 ? 252  LEU C O   1 
ATOM   1479 C CB  . LEU C 1 9  ? 30.922  -29.228 0.389   1.00 16.78 ? 252  LEU C CB  1 
ATOM   1480 C CG  . LEU C 1 9  ? 29.448  -28.949 0.753   1.00 23.77 ? 252  LEU C CG  1 
ATOM   1481 C CD1 . LEU C 1 9  ? 29.233  -28.495 2.176   1.00 23.94 ? 252  LEU C CD1 1 
ATOM   1482 C CD2 . LEU C 1 9  ? 28.964  -27.871 -0.161  1.00 12.95 ? 252  LEU C CD2 1 
ATOM   1483 N N   . GLU C 1 10 ? 33.311  -31.204 -0.526  1.00 15.54 ? 253  GLU C N   1 
ATOM   1484 C CA  . GLU C 1 10 ? 34.461  -31.232 -1.401  1.00 18.31 ? 253  GLU C CA  1 
ATOM   1485 C C   . GLU C 1 10 ? 34.057  -30.662 -2.769  1.00 18.62 ? 253  GLU C C   1 
ATOM   1486 O O   . GLU C 1 10 ? 33.091  -31.100 -3.382  1.00 19.67 ? 253  GLU C O   1 
ATOM   1487 C CB  . GLU C 1 10 ? 34.981  -32.666 -1.545  1.00 19.30 ? 253  GLU C CB  1 
ATOM   1488 C CG  . GLU C 1 10 ? 36.409  -32.767 -2.066  1.00 31.57 ? 253  GLU C CG  1 
ATOM   1489 N N   . LYS C 1 11 ? 34.811  -29.682 -3.238  1.00 18.22 ? 254  LYS C N   1 
ATOM   1490 C CA  . LYS C 1 11 ? 34.506  -28.953 -4.456  1.00 22.36 ? 254  LYS C CA  1 
ATOM   1491 C C   . LYS C 1 11 ? 34.811  -29.806 -5.666  1.00 23.31 ? 254  LYS C C   1 
ATOM   1492 O O   . LYS C 1 11 ? 35.750  -30.607 -5.664  1.00 24.98 ? 254  LYS C O   1 
ATOM   1493 C CB  . LYS C 1 11 ? 35.381  -27.700 -4.476  1.00 25.65 ? 254  LYS C CB  1 
ATOM   1494 C CG  . LYS C 1 11 ? 35.064  -26.598 -5.454  1.00 24.06 ? 254  LYS C CG  1 
ATOM   1495 C CD  . LYS C 1 11 ? 35.698  -25.302 -4.908  1.00 26.03 ? 254  LYS C CD  1 
ATOM   1496 C CE  . LYS C 1 11 ? 35.969  -24.281 -5.943  1.00 28.49 ? 254  LYS C CE  1 
ATOM   1497 N NZ  . LYS C 1 11 ? 36.842  -23.225 -5.376  1.00 30.35 ? 254  LYS C NZ  1 
ATOM   1498 N N   . GLY C 1 12 ? 34.027  -29.622 -6.719  1.00 24.23 ? 255  GLY C N   1 
ATOM   1499 C CA  . GLY C 1 12 ? 34.273  -30.329 -7.975  1.00 22.31 ? 255  GLY C CA  1 
ATOM   1500 C C   . GLY C 1 12 ? 34.629  -29.344 -9.067  1.00 22.55 ? 255  GLY C C   1 
ATOM   1501 O O   . GLY C 1 12 ? 34.871  -28.161 -8.804  1.00 20.96 ? 255  GLY C O   1 
ATOM   1502 N N   . PRO C 1 13 ? 34.647  -29.816 -10.310 1.00 28.33 ? 256  PRO C N   1 
ATOM   1503 C CA  . PRO C 1 13 ? 35.090  -28.943 -11.398 1.00 33.27 ? 256  PRO C CA  1 
ATOM   1504 C C   . PRO C 1 13 ? 34.098  -27.794 -11.608 1.00 32.51 ? 256  PRO C C   1 
ATOM   1505 O O   . PRO C 1 13 ? 34.481  -26.685 -11.994 1.00 37.92 ? 256  PRO C O   1 
ATOM   1506 C CB  . PRO C 1 13 ? 35.151  -29.881 -12.614 1.00 32.80 ? 256  PRO C CB  1 
ATOM   1507 C CG  . PRO C 1 13 ? 34.976  -31.256 -12.085 1.00 33.01 ? 256  PRO C CG  1 
ATOM   1508 C CD  . PRO C 1 13 ? 34.249  -31.145 -10.789 1.00 31.74 ? 256  PRO C CD  1 
ATOM   1509 N N   . GLN C 1 14 ? 32.830  -28.054 -11.320 1.00 28.72 ? 257  GLN C N   1 
ATOM   1510 C CA  . GLN C 1 14 ? 31.831  -27.009 -11.379 1.00 27.20 ? 257  GLN C CA  1 
ATOM   1511 C C   . GLN C 1 14 ? 31.371  -26.573 -9.991  1.00 25.69 ? 257  GLN C C   1 
ATOM   1512 O O   . GLN C 1 14 ? 30.223  -26.208 -9.814  1.00 28.26 ? 257  GLN C O   1 
ATOM   1513 C CB  . GLN C 1 14 ? 30.660  -27.469 -12.246 1.00 30.47 ? 257  GLN C CB  1 
ATOM   1514 C CG  . GLN C 1 14 ? 31.031  -27.632 -13.720 1.00 33.21 ? 257  GLN C CG  1 
ATOM   1515 C CD  . GLN C 1 14 ? 31.476  -26.319 -14.391 1.00 43.12 ? 257  GLN C CD  1 
ATOM   1516 O OE1 . GLN C 1 14 ? 30.677  -25.398 -14.573 1.00 50.29 ? 257  GLN C OE1 1 
ATOM   1517 N NE2 . GLN C 1 14 ? 32.749  -26.251 -14.782 1.00 27.00 ? 257  GLN C NE2 1 
ATOM   1518 N N   . GLY C 1 15 ? 32.276  -26.580 -9.011  1.00 22.16 ? 258  GLY C N   1 
ATOM   1519 C CA  . GLY C 1 15 ? 32.003  -25.929 -7.730  1.00 19.83 ? 258  GLY C CA  1 
ATOM   1520 C C   . GLY C 1 15 ? 31.286  -26.826 -6.741  1.00 15.95 ? 258  GLY C C   1 
ATOM   1521 O O   . GLY C 1 15 ? 31.324  -28.041 -6.866  1.00 18.80 ? 258  GLY C O   1 
ATOM   1522 N N   . PHE C 1 16 ? 30.640  -26.222 -5.756  1.00 15.51 ? 259  PHE C N   1 
ATOM   1523 C CA  . PHE C 1 16 ? 29.927  -26.946 -4.667  1.00 16.95 ? 259  PHE C CA  1 
ATOM   1524 C C   . PHE C 1 16 ? 28.494  -27.390 -5.002  1.00 17.54 ? 259  PHE C C   1 
ATOM   1525 O O   . PHE C 1 16 ? 27.983  -28.377 -4.451  1.00 16.73 ? 259  PHE C O   1 
ATOM   1526 C CB  . PHE C 1 16 ? 29.954  -26.084 -3.391  1.00 15.91 ? 259  PHE C CB  1 
ATOM   1527 C CG  . PHE C 1 16 ? 31.348  -25.897 -2.830  1.00 22.29 ? 259  PHE C CG  1 
ATOM   1528 C CD1 . PHE C 1 16 ? 32.047  -26.983 -2.341  1.00 18.65 ? 259  PHE C CD1 1 
ATOM   1529 C CD2 . PHE C 1 16 ? 31.955  -24.647 -2.784  1.00 19.97 ? 259  PHE C CD2 1 
ATOM   1530 C CE1 . PHE C 1 16 ? 33.333  -26.841 -1.817  1.00 16.77 ? 259  PHE C CE1 1 
ATOM   1531 C CE2 . PHE C 1 16 ? 33.238  -24.511 -2.267  1.00 19.57 ? 259  PHE C CE2 1 
ATOM   1532 C CZ  . PHE C 1 16 ? 33.921  -25.605 -1.787  1.00 18.68 ? 259  PHE C CZ  1 
ATOM   1533 N N   . GLY C 1 17 ? 27.864  -26.688 -5.928  1.00 15.53 ? 260  GLY C N   1 
ATOM   1534 C CA  . GLY C 1 17 ? 26.523  -26.990 -6.347  1.00 15.93 ? 260  GLY C CA  1 
ATOM   1535 C C   . GLY C 1 17 ? 25.390  -26.306 -5.591  1.00 17.11 ? 260  GLY C C   1 
ATOM   1536 O O   . GLY C 1 17 ? 24.389  -26.935 -5.300  1.00 14.65 ? 260  GLY C O   1 
ATOM   1537 N N   . PHE C 1 18 ? 25.543  -25.022 -5.280  1.00 15.40 ? 261  PHE C N   1 
ATOM   1538 C CA  . PHE C 1 18 ? 24.403  -24.212 -4.791  1.00 16.54 ? 261  PHE C CA  1 
ATOM   1539 C C   . PHE C 1 18 ? 24.401  -22.755 -5.252  1.00 14.50 ? 261  PHE C C   1 
ATOM   1540 O O   . PHE C 1 18 ? 25.435  -22.176 -5.623  1.00 13.90 ? 261  PHE C O   1 
ATOM   1541 C CB  . PHE C 1 18 ? 24.234  -24.321 -3.256  1.00 14.38 ? 261  PHE C CB  1 
ATOM   1542 C CG  . PHE C 1 18 ? 25.397  -23.793 -2.447  1.00 16.85 ? 261  PHE C CG  1 
ATOM   1543 C CD1 . PHE C 1 18 ? 25.385  -22.498 -1.953  1.00 17.62 ? 261  PHE C CD1 1 
ATOM   1544 C CD2 . PHE C 1 18 ? 26.454  -24.612 -2.113  1.00 14.70 ? 261  PHE C CD2 1 
ATOM   1545 C CE1 . PHE C 1 18 ? 26.448  -22.027 -1.177  1.00 17.51 ? 261  PHE C CE1 1 
ATOM   1546 C CE2 . PHE C 1 18 ? 27.528  -24.154 -1.352  1.00 23.29 ? 261  PHE C CE2 1 
ATOM   1547 C CZ  . PHE C 1 18 ? 27.525  -22.875 -0.879  1.00 16.97 ? 261  PHE C CZ  1 
ATOM   1548 N N   . LEU C 1 19 ? 23.193  -22.184 -5.261  1.00 14.68 ? 262  LEU C N   1 
ATOM   1549 C CA  . LEU C 1 19 ? 22.929  -20.759 -5.513  1.00 15.87 ? 262  LEU C CA  1 
ATOM   1550 C C   . LEU C 1 19 ? 22.672  -20.095 -4.168  1.00 13.52 ? 262  LEU C C   1 
ATOM   1551 O O   . LEU C 1 19 ? 21.738  -20.499 -3.475  1.00 16.74 ? 262  LEU C O   1 
ATOM   1552 C CB  . LEU C 1 19 ? 21.648  -20.620 -6.352  1.00 19.99 ? 262  LEU C CB  1 
ATOM   1553 C CG  . LEU C 1 19 ? 21.206  -19.205 -6.736  1.00 16.07 ? 262  LEU C CG  1 
ATOM   1554 C CD1 . LEU C 1 19 ? 22.271  -18.610 -7.642  1.00 12.59 ? 262  LEU C CD1 1 
ATOM   1555 C CD2 . LEU C 1 19 ? 19.889  -19.280 -7.469  1.00 18.24 ? 262  LEU C CD2 1 
ATOM   1556 N N   . LEU C 1 20 ? 23.514  -19.157 -3.761  1.00 11.02 ? 263  LEU C N   1 
ATOM   1557 C CA  . LEU C 1 20 ? 23.260  -18.360 -2.539  1.00 15.36 ? 263  LEU C CA  1 
ATOM   1558 C C   . LEU C 1 20 ? 22.608  -17.044 -2.937  1.00 14.19 ? 263  LEU C C   1 
ATOM   1559 O O   . LEU C 1 20 ? 23.066  -16.392 -3.866  1.00 12.69 ? 263  LEU C O   1 
ATOM   1560 C CB  . LEU C 1 20 ? 24.561  -18.095 -1.805  1.00 12.44 ? 263  LEU C CB  1 
ATOM   1561 C CG  . LEU C 1 20 ? 24.554  -17.614 -0.370  1.00 17.97 ? 263  LEU C CG  1 
ATOM   1562 C CD1 . LEU C 1 20 ? 23.943  -18.683 0.579   1.00 14.05 ? 263  LEU C CD1 1 
ATOM   1563 C CD2 . LEU C 1 20 ? 25.987  -17.251 0.015   1.00 15.77 ? 263  LEU C CD2 1 
ATOM   1564 N N   . ARG C 1 21 ? 21.541  -16.651 -2.239  1.00 12.72 ? 264  ARG C N   1 
ATOM   1565 C CA  . ARG C 1 21 ? 20.908  -15.392 -2.509  1.00 13.91 ? 264  ARG C CA  1 
ATOM   1566 C C   . ARG C 1 21 ? 20.616  -14.661 -1.219  1.00 11.24 ? 264  ARG C C   1 
ATOM   1567 O O   . ARG C 1 21 ? 20.166  -15.269 -0.234  1.00 14.97 ? 264  ARG C O   1 
ATOM   1568 C CB  . ARG C 1 21 ? 19.610  -15.578 -3.282  1.00 13.24 ? 264  ARG C CB  1 
ATOM   1569 C CG  . ARG C 1 21 ? 18.892  -14.245 -3.461  1.00 14.90 ? 264  ARG C CG  1 
ATOM   1570 C CD  . ARG C 1 21 ? 17.533  -14.347 -4.045  1.00 24.56 ? 264  ARG C CD  1 
ATOM   1571 N NE  . ARG C 1 21 ? 17.587  -14.701 -5.447  1.00 36.74 ? 264  ARG C NE  1 
ATOM   1572 C CZ  . ARG C 1 21 ? 17.796  -13.846 -6.440  1.00 49.32 ? 264  ARG C CZ  1 
ATOM   1573 N NH1 . ARG C 1 21 ? 17.980  -12.536 -6.201  1.00 53.58 ? 264  ARG C NH1 1 
ATOM   1574 N NH2 . ARG C 1 21 ? 17.815  -14.317 -7.682  1.00 44.64 ? 264  ARG C NH2 1 
ATOM   1575 N N   . GLU C 1 22 ? 20.928  -13.376 -1.203  1.00 12.92 ? 265  GLU C N   1 
ATOM   1576 C CA  . GLU C 1 22 ? 20.628  -12.538 -0.037  1.00 14.38 ? 265  GLU C CA  1 
ATOM   1577 C C   . GLU C 1 22 ? 19.144  -12.133 0.000   1.00 14.32 ? 265  GLU C C   1 
ATOM   1578 O O   . GLU C 1 22 ? 18.565  -11.778 -1.014  1.00 15.26 ? 265  GLU C O   1 
ATOM   1579 C CB  . GLU C 1 22 ? 21.514  -11.283 -0.055  1.00 13.19 ? 265  GLU C CB  1 
ATOM   1580 C CG  . GLU C 1 22 ? 21.151  -10.272 1.000   1.00 13.20 ? 265  GLU C CG  1 
ATOM   1581 C CD  . GLU C 1 22 ? 22.182  -9.191  1.115   1.00 14.00 ? 265  GLU C CD  1 
ATOM   1582 O OE1 . GLU C 1 22 ? 23.357  -9.513  1.337   1.00 15.87 ? 265  GLU C OE1 1 
ATOM   1583 O OE2 . GLU C 1 22 ? 21.807  -8.021  1.006   1.00 16.60 ? 265  GLU C OE2 1 
ATOM   1584 N N   . GLU C 1 23 ? 18.524  -12.171 1.171   1.00 13.94 ? 266  GLU C N   1 
ATOM   1585 C CA  . GLU C 1 23 ? 17.304  -11.430 1.377   1.00 11.92 ? 266  GLU C CA  1 
ATOM   1586 C C   . GLU C 1 23 ? 17.374  -10.752 2.704   1.00 10.79 ? 266  GLU C C   1 
ATOM   1587 O O   . GLU C 1 23 ? 17.614  -11.407 3.728   1.00 17.28 ? 266  GLU C O   1 
ATOM   1588 C CB  . GLU C 1 23 ? 16.087  -12.331 1.387   1.00 14.59 ? 266  GLU C CB  1 
ATOM   1589 C CG  . GLU C 1 23 ? 15.746  -12.949 0.076   1.00 13.02 ? 266  GLU C CG  1 
ATOM   1590 C CD  . GLU C 1 23 ? 15.174  -12.002 -0.958  1.00 20.76 ? 266  GLU C CD  1 
ATOM   1591 O OE1 . GLU C 1 23 ? 14.872  -10.836 -0.630  1.00 18.98 ? 266  GLU C OE1 1 
ATOM   1592 O OE2 . GLU C 1 23 ? 15.017  -12.456 -2.119  1.00 23.19 ? 266  GLU C OE2 1 
ATOM   1593 N N   . LYS C 1 24 ? 17.096  -9.459  2.724   1.00 12.33 ? 267  LYS C N   1 
ATOM   1594 C CA  . LYS C 1 24 ? 16.963  -8.745  4.004   1.00 15.94 ? 267  LYS C CA  1 
ATOM   1595 C C   . LYS C 1 24 ? 15.658  -8.998  4.739   1.00 18.39 ? 267  LYS C C   1 
ATOM   1596 O O   . LYS C 1 24 ? 14.610  -9.195  4.128   1.00 16.67 ? 267  LYS C O   1 
ATOM   1597 C CB  . LYS C 1 24 ? 17.186  -7.258  3.823   1.00 17.91 ? 267  LYS C CB  1 
ATOM   1598 C CG  . LYS C 1 24 ? 18.619  -6.943  3.496   1.00 19.71 ? 267  LYS C CG  1 
ATOM   1599 C CD  . LYS C 1 24 ? 18.739  -5.538  2.969   1.00 29.66 ? 267  LYS C CD  1 
ATOM   1600 C CE  . LYS C 1 24 ? 20.185  -5.127  2.821   1.00 32.61 ? 267  LYS C CE  1 
ATOM   1601 N NZ  . LYS C 1 24 ? 20.275  -3.697  2.428   1.00 39.37 ? 267  LYS C NZ  1 
ATOM   1602 N N   . GLY C 1 25 ? 15.752  -9.017  6.065   1.00 14.28 ? 268  GLY C N   1 
ATOM   1603 C CA  . GLY C 1 25 ? 14.586  -9.157  6.923   1.00 16.16 ? 268  GLY C CA  1 
ATOM   1604 C C   . GLY C 1 25 ? 14.008  -7.784  7.171   1.00 17.50 ? 268  GLY C C   1 
ATOM   1605 O O   . GLY C 1 25 ? 14.510  -6.805  6.626   1.00 10.34 ? 268  GLY C O   1 
ATOM   1606 N N   . LEU C 1 26 ? 12.984  -7.730  8.024   1.00 16.11 ? 269  LEU C N   1 
ATOM   1607 C CA  . LEU C 1 26 ? 12.220  -6.507  8.286   1.00 18.85 ? 269  LEU C CA  1 
ATOM   1608 C C   . LEU C 1 26 ? 12.993  -5.466  9.117   1.00 16.64 ? 269  LEU C C   1 
ATOM   1609 O O   . LEU C 1 26 ? 12.597  -4.302  9.163   1.00 17.25 ? 269  LEU C O   1 
ATOM   1610 C CB  . LEU C 1 26 ? 10.868  -6.848  8.950   1.00 16.81 ? 269  LEU C CB  1 
ATOM   1611 C CG  . LEU C 1 26 ? 9.747   -7.418  8.082   1.00 16.22 ? 269  LEU C CG  1 
ATOM   1612 C CD1 . LEU C 1 26 ? 8.560   -7.758  8.929   1.00 18.16 ? 269  LEU C CD1 1 
ATOM   1613 C CD2 . LEU C 1 26 ? 9.330   -6.437  6.978   1.00 20.13 ? 269  LEU C CD2 1 
ATOM   1614 N N   . ASP C 1 27 ? 14.075  -5.891  9.771   1.00 10.61 ? 270  ASP C N   1 
ATOM   1615 C CA  . ASP C 1 27 ? 14.992  -4.983  10.446  1.00 13.38 ? 270  ASP C CA  1 
ATOM   1616 C C   . ASP C 1 27 ? 16.201  -4.633  9.564   1.00 13.89 ? 270  ASP C C   1 
ATOM   1617 O O   . ASP C 1 27 ? 17.149  -3.938  10.004  1.00 15.16 ? 270  ASP C O   1 
ATOM   1618 C CB  . ASP C 1 27 ? 15.445  -5.564  11.802  1.00 16.94 ? 270  ASP C CB  1 
ATOM   1619 C CG  . ASP C 1 27 ? 16.160  -6.897  11.676  1.00 7.04  ? 270  ASP C CG  1 
ATOM   1620 O OD1 . ASP C 1 27 ? 16.387  -7.352  10.551  1.00 11.96 ? 270  ASP C OD1 1 
ATOM   1621 O OD2 . ASP C 1 27 ? 16.442  -7.525  12.721  1.00 13.26 ? 270  ASP C OD2 1 
ATOM   1622 N N   . GLY C 1 28 ? 16.137  -5.064  8.313   1.00 16.21 ? 271  GLY C N   1 
ATOM   1623 C CA  . GLY C 1 28 ? 17.182  -4.781  7.333   1.00 15.08 ? 271  GLY C CA  1 
ATOM   1624 C C   . GLY C 1 28 ? 18.396  -5.701  7.380   1.00 10.27 ? 271  GLY C C   1 
ATOM   1625 O O   . GLY C 1 28 ? 19.273  -5.557  6.561   1.00 13.92 ? 271  GLY C O   1 
ATOM   1626 N N   . ARG C 1 29 ? 18.450  -6.636  8.334   1.00 10.09 ? 272  ARG C N   1 
ATOM   1627 C CA  . ARG C 1 29 ? 19.603  -7.515  8.478   1.00 12.79 ? 272  ARG C CA  1 
ATOM   1628 C C   . ARG C 1 29 ? 19.581  -8.540  7.343   1.00 8.28  ? 272  ARG C C   1 
ATOM   1629 O O   . ARG C 1 29 ? 18.505  -9.035  6.953   1.00 8.76  ? 272  ARG C O   1 
ATOM   1630 C CB  . ARG C 1 29 ? 19.649  -8.158  9.862   1.00 17.33 ? 272  ARG C CB  1 
ATOM   1631 C CG  . ARG C 1 29 ? 20.102  -7.182  10.955  1.00 18.10 ? 272  ARG C CG  1 
ATOM   1632 C CD  . ARG C 1 29 ? 20.443  -7.873  12.283  1.00 15.66 ? 272  ARG C CD  1 
ATOM   1633 N NE  . ARG C 1 29 ? 19.232  -8.436  12.876  1.00 12.37 ? 272  ARG C NE  1 
ATOM   1634 C CZ  . ARG C 1 29 ? 19.198  -9.341  13.852  1.00 29.15 ? 272  ARG C CZ  1 
ATOM   1635 N NH1 . ARG C 1 29 ? 20.318  -9.820  14.386  1.00 20.91 ? 272  ARG C NH1 1 
ATOM   1636 N NH2 . ARG C 1 29 ? 18.022  -9.776  14.291  1.00 22.41 ? 272  ARG C NH2 1 
ATOM   1637 N N   . PRO C 1 30 ? 20.728  -8.759  6.683   1.00 15.13 ? 273  PRO C N   1 
ATOM   1638 C CA  . PRO C 1 30 ? 20.625  -9.790  5.614   1.00 13.10 ? 273  PRO C CA  1 
ATOM   1639 C C   . PRO C 1 30 ? 20.706  -11.216 6.085   1.00 13.06 ? 273  PRO C C   1 
ATOM   1640 O O   . PRO C 1 30 ? 21.453  -11.518 6.998   1.00 16.16 ? 273  PRO C O   1 
ATOM   1641 C CB  . PRO C 1 30 ? 21.814  -9.489  4.720   1.00 13.95 ? 273  PRO C CB  1 
ATOM   1642 C CG  . PRO C 1 30 ? 22.850  -8.892  5.681   1.00 20.71 ? 273  PRO C CG  1 
ATOM   1643 C CD  . PRO C 1 30 ? 22.066  -8.139  6.741   1.00 12.87 ? 273  PRO C CD  1 
ATOM   1644 N N   . GLY C 1 31 ? 20.002  -12.102 5.381   1.00 14.83 ? 274  GLY C N   1 
ATOM   1645 C CA  . GLY C 1 31 ? 20.179  -13.536 5.525   1.00 17.85 ? 274  GLY C CA  1 
ATOM   1646 C C   . GLY C 1 31 ? 20.686  -14.030 4.196   1.00 11.92 ? 274  GLY C C   1 
ATOM   1647 O O   . GLY C 1 31 ? 20.313  -13.484 3.175   1.00 13.13 ? 274  GLY C O   1 
ATOM   1648 N N   . GLN C 1 32 ? 21.550  -15.031 4.208   1.00 14.99 ? 275  GLN C N   1 
ATOM   1649 C CA  . GLN C 1 32 ? 22.043  -15.641 2.952   1.00 15.35 ? 275  GLN C CA  1 
ATOM   1650 C C   . GLN C 1 32 ? 21.392  -16.996 2.839   1.00 15.88 ? 275  GLN C C   1 
ATOM   1651 O O   . GLN C 1 32 ? 21.592  -17.847 3.687   1.00 16.90 ? 275  GLN C O   1 
ATOM   1652 C CB  . GLN C 1 32 ? 23.572  -15.765 2.971   1.00 18.28 ? 275  GLN C CB  1 
ATOM   1653 C CG  . GLN C 1 32 ? 24.288  -14.459 3.283   1.00 11.41 ? 275  GLN C CG  1 
ATOM   1654 C CD  . GLN C 1 32 ? 23.977  -13.338 2.294   1.00 9.42  ? 275  GLN C CD  1 
ATOM   1655 O OE1 . GLN C 1 32 ? 23.743  -13.595 1.103   1.00 11.65 ? 275  GLN C OE1 1 
ATOM   1656 N NE2 . GLN C 1 32 ? 23.960  -12.074 2.791   1.00 10.67 ? 275  GLN C NE2 1 
ATOM   1657 N N   . PHE C 1 33 ? 20.605  -17.178 1.791   1.00 16.01 ? 276  PHE C N   1 
ATOM   1658 C CA  . PHE C 1 33 ? 19.785  -18.374 1.631   1.00 13.75 ? 276  PHE C CA  1 
ATOM   1659 C C   . PHE C 1 33 ? 20.292  -19.239 0.486   1.00 12.39 ? 276  PHE C C   1 
ATOM   1660 O O   . PHE C 1 33 ? 20.703  -18.731 -0.531  1.00 14.66 ? 276  PHE C O   1 
ATOM   1661 C CB  . PHE C 1 33 ? 18.335  -17.966 1.368   1.00 12.52 ? 276  PHE C CB  1 
ATOM   1662 C CG  . PHE C 1 33 ? 17.735  -17.202 2.502   1.00 13.33 ? 276  PHE C CG  1 
ATOM   1663 C CD1 . PHE C 1 33 ? 17.245  -17.867 3.621   1.00 16.24 ? 276  PHE C CD1 1 
ATOM   1664 C CD2 . PHE C 1 33 ? 17.755  -15.813 2.497   1.00 15.04 ? 276  PHE C CD2 1 
ATOM   1665 C CE1 . PHE C 1 33 ? 16.749  -17.139 4.697   1.00 15.80 ? 276  PHE C CE1 1 
ATOM   1666 C CE2 . PHE C 1 33 ? 17.257  -15.103 3.582   1.00 15.95 ? 276  PHE C CE2 1 
ATOM   1667 C CZ  . PHE C 1 33 ? 16.789  -15.751 4.663   1.00 13.90 ? 276  PHE C CZ  1 
ATOM   1668 N N   . LEU C 1 34 ? 20.229  -20.549 0.670   1.00 15.20 ? 277  LEU C N   1 
ATOM   1669 C CA  . LEU C 1 34 ? 20.568  -21.496 -0.394  1.00 13.90 ? 277  LEU C CA  1 
ATOM   1670 C C   . LEU C 1 34 ? 19.285  -21.661 -1.219  1.00 16.36 ? 277  LEU C C   1 
ATOM   1671 O O   . LEU C 1 34 ? 18.335  -22.367 -0.849  1.00 17.96 ? 277  LEU C O   1 
ATOM   1672 C CB  . LEU C 1 34 ? 21.135  -22.808 0.201   1.00 17.76 ? 277  LEU C CB  1 
ATOM   1673 C CG  . LEU C 1 34 ? 22.266  -22.603 1.267   1.00 20.17 ? 277  LEU C CG  1 
ATOM   1674 C CD1 . LEU C 1 34 ? 22.512  -23.850 2.106   1.00 44.99 ? 277  LEU C CD1 1 
ATOM   1675 C CD2 . LEU C 1 34 ? 23.576  -22.154 0.673   1.00 30.29 ? 277  LEU C CD2 1 
ATOM   1676 N N   . TRP C 1 35 ? 19.241  -20.899 -2.298  1.00 10.52 ? 278  TRP C N   1 
ATOM   1677 C CA  . TRP C 1 35 ? 18.065  -20.719 -3.104  1.00 15.69 ? 278  TRP C CA  1 
ATOM   1678 C C   . TRP C 1 35 ? 17.815  -21.945 -3.978  1.00 20.19 ? 278  TRP C C   1 
ATOM   1679 O O   . TRP C 1 35 ? 16.683  -22.339 -4.216  1.00 17.93 ? 278  TRP C O   1 
ATOM   1680 C CB  . TRP C 1 35 ? 18.251  -19.485 -3.977  1.00 17.70 ? 278  TRP C CB  1 
ATOM   1681 C CG  . TRP C 1 35 ? 16.959  -18.746 -4.251  1.00 13.64 ? 278  TRP C CG  1 
ATOM   1682 C CD1 . TRP C 1 35 ? 16.129  -18.897 -5.344  1.00 20.60 ? 278  TRP C CD1 1 
ATOM   1683 C CD2 . TRP C 1 35 ? 16.330  -17.783 -3.406  1.00 18.34 ? 278  TRP C CD2 1 
ATOM   1684 N NE1 . TRP C 1 35 ? 15.042  -18.076 -5.224  1.00 20.64 ? 278  TRP C NE1 1 
ATOM   1685 C CE2 . TRP C 1 35 ? 15.126  -17.391 -4.039  1.00 17.81 ? 278  TRP C CE2 1 
ATOM   1686 C CE3 . TRP C 1 35 ? 16.659  -17.214 -2.174  1.00 17.75 ? 278  TRP C CE3 1 
ATOM   1687 C CZ2 . TRP C 1 35 ? 14.283  -16.419 -3.505  1.00 17.55 ? 278  TRP C CZ2 1 
ATOM   1688 C CZ3 . TRP C 1 35 ? 15.806  -16.272 -1.631  1.00 22.92 ? 278  TRP C CZ3 1 
ATOM   1689 C CH2 . TRP C 1 35 ? 14.632  -15.881 -2.298  1.00 22.29 ? 278  TRP C CH2 1 
ATOM   1690 N N   . GLU C 1 36 ? 18.898  -22.544 -4.453  1.00 14.71 ? 279  GLU C N   1 
ATOM   1691 C CA  . GLU C 1 36 ? 18.825  -23.757 -5.257  1.00 18.31 ? 279  GLU C CA  1 
ATOM   1692 C C   . GLU C 1 36 ? 20.006  -24.653 -4.871  1.00 13.81 ? 279  GLU C C   1 
ATOM   1693 O O   . GLU C 1 36 ? 21.087  -24.167 -4.563  1.00 12.84 ? 279  GLU C O   1 
ATOM   1694 C CB  . GLU C 1 36 ? 18.882  -23.376 -6.746  1.00 19.05 ? 279  GLU C CB  1 
ATOM   1695 C CG  . GLU C 1 36 ? 17.615  -22.716 -7.300  1.00 33.37 ? 279  GLU C CG  1 
ATOM   1696 C CD  . GLU C 1 36 ? 17.870  -21.914 -8.579  1.00 44.04 ? 279  GLU C CD  1 
ATOM   1697 O OE1 . GLU C 1 36 ? 18.816  -22.256 -9.336  1.00 49.37 ? 279  GLU C OE1 1 
ATOM   1698 O OE2 . GLU C 1 36 ? 17.111  -20.938 -8.814  1.00 56.40 ? 279  GLU C OE2 1 
ATOM   1699 N N   . VAL C 1 37 ? 19.787  -25.957 -4.833  1.00 16.88 ? 280  VAL C N   1 
ATOM   1700 C CA  . VAL C 1 37 ? 20.864  -26.906 -4.618  1.00 21.37 ? 280  VAL C CA  1 
ATOM   1701 C C   . VAL C 1 37 ? 20.918  -27.826 -5.846  1.00 22.37 ? 280  VAL C C   1 
ATOM   1702 O O   . VAL C 1 37 ? 19.994  -28.568 -6.124  1.00 21.50 ? 280  VAL C O   1 
ATOM   1703 C CB  . VAL C 1 37 ? 20.701  -27.673 -3.285  1.00 22.47 ? 280  VAL C CB  1 
ATOM   1704 C CG1 . VAL C 1 37 ? 21.875  -28.586 -3.084  1.00 19.40 ? 280  VAL C CG1 1 
ATOM   1705 C CG2 . VAL C 1 37 ? 20.633  -26.669 -2.131  1.00 19.60 ? 280  VAL C CG2 1 
ATOM   1706 N N   . ASP C 1 38 ? 22.004  -27.736 -6.594  1.00 17.09 ? 281  ASP C N   1 
ATOM   1707 C CA  . ASP C 1 38 ? 22.098  -28.417 -7.899  1.00 21.87 ? 281  ASP C CA  1 
ATOM   1708 C C   . ASP C 1 38 ? 22.116  -29.930 -7.780  1.00 14.30 ? 281  ASP C C   1 
ATOM   1709 O O   . ASP C 1 38 ? 22.844  -30.485 -6.973  1.00 13.79 ? 281  ASP C O   1 
ATOM   1710 C CB  . ASP C 1 38 ? 23.312  -27.916 -8.691  1.00 15.68 ? 281  ASP C CB  1 
ATOM   1711 C CG  . ASP C 1 38 ? 23.336  -26.370 -8.786  1.00 36.09 ? 281  ASP C CG  1 
ATOM   1712 O OD1 . ASP C 1 38 ? 22.315  -25.793 -9.227  1.00 42.17 ? 281  ASP C OD1 1 
ATOM   1713 O OD2 . ASP C 1 38 ? 24.336  -25.731 -8.384  1.00 35.24 ? 281  ASP C OD2 1 
ATOM   1714 N N   . PRO C 1 39 ? 21.288  -30.600 -8.593  1.00 20.43 ? 282  PRO C N   1 
ATOM   1715 C CA  . PRO C 1 39 ? 21.286  -32.060 -8.652  1.00 18.65 ? 282  PRO C CA  1 
ATOM   1716 C C   . PRO C 1 39 ? 22.647  -32.627 -9.054  1.00 14.84 ? 282  PRO C C   1 
ATOM   1717 O O   . PRO C 1 39 ? 23.313  -32.088 -9.945  1.00 14.58 ? 282  PRO C O   1 
ATOM   1718 C CB  . PRO C 1 39 ? 20.235  -32.381 -9.731  1.00 19.56 ? 282  PRO C CB  1 
ATOM   1719 C CG  . PRO C 1 39 ? 19.414  -31.181 -9.864  1.00 25.02 ? 282  PRO C CG  1 
ATOM   1720 C CD  . PRO C 1 39 ? 20.300  -30.012 -9.514  1.00 20.75 ? 282  PRO C CD  1 
ATOM   1721 N N   . GLY C 1 40 ? 23.065  -33.680 -8.361  1.00 11.71 ? 283  GLY C N   1 
ATOM   1722 C CA  . GLY C 1 40 ? 24.275  -34.398 -8.691  1.00 10.03 ? 283  GLY C CA  1 
ATOM   1723 C C   . GLY C 1 40 ? 25.585  -33.723 -8.421  1.00 8.11  ? 283  GLY C C   1 
ATOM   1724 O O   . GLY C 1 40 ? 26.615  -34.109 -9.003  1.00 5.60  ? 283  GLY C O   1 
ATOM   1725 N N   . LEU C 1 41 ? 25.559  -32.740 -7.535  1.00 13.67 ? 284  LEU C N   1 
ATOM   1726 C CA  . LEU C 1 41 ? 26.745  -31.962 -7.177  1.00 13.30 ? 284  LEU C CA  1 
ATOM   1727 C C   . LEU C 1 41 ? 26.914  -31.998 -5.661  1.00 10.41 ? 284  LEU C C   1 
ATOM   1728 O O   . LEU C 1 41 ? 25.978  -32.427 -4.966  1.00 11.06 ? 284  LEU C O   1 
ATOM   1729 C CB  . LEU C 1 41 ? 26.636  -30.537 -7.716  1.00 8.31  ? 284  LEU C CB  1 
ATOM   1730 C CG  . LEU C 1 41 ? 26.772  -30.293 -9.236  1.00 16.31 ? 284  LEU C CG  1 
ATOM   1731 C CD1 . LEU C 1 41 ? 26.951  -28.822 -9.530  1.00 20.54 ? 284  LEU C CD1 1 
ATOM   1732 C CD2 . LEU C 1 41 ? 27.934  -31.072 -9.838  1.00 24.99 ? 284  LEU C CD2 1 
ATOM   1733 N N   . PRO C 1 42 ? 28.121  -31.637 -5.151  1.00 14.32 ? 285  PRO C N   1 
ATOM   1734 C CA  . PRO C 1 42 ? 28.501  -31.827 -3.744  1.00 16.05 ? 285  PRO C CA  1 
ATOM   1735 C C   . PRO C 1 42 ? 27.495  -31.418 -2.680  1.00 16.61 ? 285  PRO C C   1 
ATOM   1736 O O   . PRO C 1 42 ? 27.228  -32.204 -1.784  1.00 19.90 ? 285  PRO C O   1 
ATOM   1737 C CB  . PRO C 1 42 ? 29.816  -31.054 -3.635  1.00 18.49 ? 285  PRO C CB  1 
ATOM   1738 C CG  . PRO C 1 42 ? 30.431  -31.308 -4.980  1.00 17.69 ? 285  PRO C CG  1 
ATOM   1739 C CD  . PRO C 1 42 ? 29.268  -31.092 -5.915  1.00 16.09 ? 285  PRO C CD  1 
ATOM   1740 N N   . ALA C 1 43 ? 26.900  -30.243 -2.804  1.00 19.91 ? 286  ALA C N   1 
ATOM   1741 C CA  . ALA C 1 43 ? 25.995  -29.724 -1.783  1.00 15.22 ? 286  ALA C CA  1 
ATOM   1742 C C   . ALA C 1 43 ? 24.800  -30.659 -1.628  1.00 17.42 ? 286  ALA C C   1 
ATOM   1743 O O   . ALA C 1 43 ? 24.483  -31.089 -0.523  1.00 16.81 ? 286  ALA C O   1 
ATOM   1744 C CB  . ALA C 1 43 ? 25.532  -28.365 -2.156  1.00 16.29 ? 286  ALA C CB  1 
ATOM   1745 N N   . LYS C 1 44 ? 24.143  -30.948 -2.748  1.00 18.74 ? 287  LYS C N   1 
ATOM   1746 C CA  . LYS C 1 44 ? 23.053  -31.912 -2.795  1.00 20.73 ? 287  LYS C CA  1 
ATOM   1747 C C   . LYS C 1 44 ? 23.460  -33.228 -2.137  1.00 25.94 ? 287  LYS C C   1 
ATOM   1748 O O   . LYS C 1 44 ? 22.793  -33.741 -1.217  1.00 25.62 ? 287  LYS C O   1 
ATOM   1749 C CB  . LYS C 1 44 ? 22.653  -32.151 -4.260  1.00 21.58 ? 287  LYS C CB  1 
ATOM   1750 C CG  . LYS C 1 44 ? 21.486  -33.124 -4.476  1.00 31.06 ? 287  LYS C CG  1 
ATOM   1751 C CD  . LYS C 1 44 ? 20.149  -32.437 -4.452  1.00 33.87 ? 287  LYS C CD  1 
ATOM   1752 C CE  . LYS C 1 44 ? 19.031  -33.383 -4.869  1.00 40.71 ? 287  LYS C CE  1 
ATOM   1753 N NZ  . LYS C 1 44 ? 17.953  -32.676 -5.614  1.00 52.27 ? 287  LYS C NZ  1 
ATOM   1754 N N   . LYS C 1 45 ? 24.570  -33.775 -2.615  1.00 26.59 ? 288  LYS C N   1 
ATOM   1755 C CA  . LYS C 1 45 ? 25.031  -35.060 -2.135  1.00 27.85 ? 288  LYS C CA  1 
ATOM   1756 C C   . LYS C 1 45 ? 25.581  -34.950 -0.712  1.00 26.99 ? 288  LYS C C   1 
ATOM   1757 O O   . LYS C 1 45 ? 25.731  -35.954 -0.053  1.00 29.76 ? 288  LYS C O   1 
ATOM   1758 C CB  . LYS C 1 45 ? 26.043  -35.662 -3.112  1.00 28.96 ? 288  LYS C CB  1 
ATOM   1759 C CG  . LYS C 1 45 ? 25.469  -35.865 -4.536  1.00 22.95 ? 288  LYS C CG  1 
ATOM   1760 C CD  . LYS C 1 45 ? 26.556  -36.193 -5.555  1.00 21.65 ? 288  LYS C CD  1 
ATOM   1761 C CE  . LYS C 1 45 ? 26.943  -37.620 -5.469  1.00 13.97 ? 288  LYS C CE  1 
ATOM   1762 N NZ  . LYS C 1 45 ? 27.839  -38.056 -6.541  1.00 17.41 ? 288  LYS C NZ  1 
ATOM   1763 N N   . ALA C 1 46 ? 25.852  -33.730 -0.235  1.00 29.74 ? 289  ALA C N   1 
ATOM   1764 C CA  . ALA C 1 46 ? 26.257  -33.487 1.176   1.00 26.00 ? 289  ALA C CA  1 
ATOM   1765 C C   . ALA C 1 46 ? 25.069  -33.288 2.149   1.00 29.57 ? 289  ALA C C   1 
ATOM   1766 O O   . ALA C 1 46 ? 25.286  -33.072 3.356   1.00 35.66 ? 289  ALA C O   1 
ATOM   1767 C CB  . ALA C 1 46 ? 27.202  -32.296 1.264   1.00 26.08 ? 289  ALA C CB  1 
ATOM   1768 N N   . GLY C 1 47 ? 23.838  -33.372 1.639   1.00 27.39 ? 290  GLY C N   1 
ATOM   1769 C CA  . GLY C 1 47 ? 22.635  -33.203 2.457   1.00 27.95 ? 290  GLY C CA  1 
ATOM   1770 C C   . GLY C 1 47 ? 21.987  -31.816 2.455   1.00 29.16 ? 290  GLY C C   1 
ATOM   1771 O O   . GLY C 1 47 ? 21.018  -31.580 3.186   1.00 28.64 ? 290  GLY C O   1 
ATOM   1772 N N   . MET C 1 48 ? 22.486  -30.890 1.640   1.00 24.90 ? 291  MET C N   1 
ATOM   1773 C CA  . MET C 1 48 ? 21.918  -29.534 1.638   1.00 23.07 ? 291  MET C CA  1 
ATOM   1774 C C   . MET C 1 48 ? 20.539  -29.524 0.993   1.00 21.31 ? 291  MET C C   1 
ATOM   1775 O O   . MET C 1 48 ? 20.253  -30.331 0.117   1.00 17.71 ? 291  MET C O   1 
ATOM   1776 C CB  A MET C 1 48 ? 22.879  -28.525 1.016   0.50 21.49 ? 291  MET C CB  1 
ATOM   1777 C CB  B MET C 1 48 ? 22.865  -28.573 0.894   0.50 21.84 ? 291  MET C CB  1 
ATOM   1778 C CG  A MET C 1 48 ? 23.932  -28.129 2.031   0.50 25.67 ? 291  MET C CG  1 
ATOM   1779 C CG  B MET C 1 48 ? 22.407  -27.115 0.808   0.50 26.95 ? 291  MET C CG  1 
ATOM   1780 S SD  A MET C 1 48 ? 25.458  -27.491 1.392   0.50 25.09 ? 291  MET C SD  1 
ATOM   1781 S SD  B MET C 1 48 ? 23.556  -26.032 -0.089  0.50 26.23 ? 291  MET C SD  1 
ATOM   1782 C CE  A MET C 1 48 ? 24.824  -26.264 0.258   0.50 36.20 ? 291  MET C CE  1 
ATOM   1783 C CE  B MET C 1 48 ? 24.912  -25.955 1.086   0.50 16.18 ? 291  MET C CE  1 
ATOM   1784 N N   . GLN C 1 49 ? 19.673  -28.629 1.480   1.00 22.13 ? 292  GLN C N   1 
ATOM   1785 C CA  . GLN C 1 49 ? 18.345  -28.414 0.913   1.00 23.39 ? 292  GLN C CA  1 
ATOM   1786 C C   . GLN C 1 49 ? 18.160  -26.983 0.410   1.00 21.48 ? 292  GLN C C   1 
ATOM   1787 O O   . GLN C 1 49 ? 18.616  -26.033 1.056   1.00 16.44 ? 292  GLN C O   1 
ATOM   1788 C CB  . GLN C 1 49 ? 17.284  -28.679 1.994   1.00 23.16 ? 292  GLN C CB  1 
ATOM   1789 C CG  . GLN C 1 49 ? 17.201  -30.128 2.458   1.00 32.17 ? 292  GLN C CG  1 
ATOM   1790 C CD  . GLN C 1 49 ? 16.491  -30.274 3.799   1.00 34.46 ? 292  GLN C CD  1 
ATOM   1791 O OE1 . GLN C 1 49 ? 15.922  -29.311 4.339   1.00 35.68 ? 292  GLN C OE1 1 
ATOM   1792 N NE2 . GLN C 1 49 ? 16.529  -31.483 4.350   1.00 47.13 ? 292  GLN C NE2 1 
ATOM   1793 N N   . ALA C 1 50 ? 17.458  -26.817 -0.710  1.00 19.38 ? 293  ALA C N   1 
ATOM   1794 C CA  . ALA C 1 50 ? 16.966  -25.479 -1.084  1.00 23.22 ? 293  ALA C CA  1 
ATOM   1795 C C   . ALA C 1 50 ? 16.052  -24.972 0.051   1.00 20.43 ? 293  ALA C C   1 
ATOM   1796 O O   . ALA C 1 50 ? 15.231  -25.733 0.599   1.00 16.53 ? 293  ALA C O   1 
ATOM   1797 C CB  . ALA C 1 50 ? 16.230  -25.483 -2.418  1.00 20.71 ? 293  ALA C CB  1 
ATOM   1798 N N   . GLY C 1 51 ? 16.231  -23.712 0.420   1.00 15.61 ? 294  GLY C N   1 
ATOM   1799 C CA  . GLY C 1 51 ? 15.525  -23.124 1.595   1.00 16.51 ? 294  GLY C CA  1 
ATOM   1800 C C   . GLY C 1 51 ? 16.371  -23.058 2.868   1.00 19.27 ? 294  GLY C C   1 
ATOM   1801 O O   . GLY C 1 51 ? 16.021  -22.339 3.826   1.00 21.27 ? 294  GLY C O   1 
ATOM   1802 N N   . ASP C 1 52 ? 17.490  -23.794 2.887   1.00 17.84 ? 295  ASP C N   1 
ATOM   1803 C CA  . ASP C 1 52 ? 18.473  -23.662 3.959   1.00 13.75 ? 295  ASP C CA  1 
ATOM   1804 C C   . ASP C 1 52 ? 18.932  -22.218 4.108   1.00 14.06 ? 295  ASP C C   1 
ATOM   1805 O O   . ASP C 1 52 ? 19.091  -21.489 3.113   1.00 12.96 ? 295  ASP C O   1 
ATOM   1806 C CB  . ASP C 1 52 ? 19.691  -24.545 3.682   1.00 14.63 ? 295  ASP C CB  1 
ATOM   1807 C CG  . ASP C 1 52 ? 19.489  -25.998 4.065   1.00 16.43 ? 295  ASP C CG  1 
ATOM   1808 O OD1 . ASP C 1 52 ? 18.400  -26.383 4.553   1.00 19.70 ? 295  ASP C OD1 1 
ATOM   1809 O OD2 . ASP C 1 52 ? 20.455  -26.774 3.847   1.00 19.29 ? 295  ASP C OD2 1 
ATOM   1810 N N   . ARG C 1 53 ? 19.127  -21.806 5.359   1.00 16.61 ? 296  ARG C N   1 
ATOM   1811 C CA  . ARG C 1 53 ? 19.820  -20.576 5.652   1.00 16.25 ? 296  ARG C CA  1 
ATOM   1812 C C   . ARG C 1 53 ? 21.238  -20.870 6.089   1.00 10.80 ? 296  ARG C C   1 
ATOM   1813 O O   . ARG C 1 53 ? 21.457  -21.721 6.918   1.00 17.18 ? 296  ARG C O   1 
ATOM   1814 C CB  . ARG C 1 53 ? 19.107  -19.752 6.736   1.00 16.97 ? 296  ARG C CB  1 
ATOM   1815 C CG  . ARG C 1 53 ? 19.678  -18.328 6.781   1.00 16.14 ? 296  ARG C CG  1 
ATOM   1816 C CD  . ARG C 1 53 ? 18.971  -17.365 7.709   1.00 18.94 ? 296  ARG C CD  1 
ATOM   1817 N NE  . ARG C 1 53 ? 19.342  -17.647 9.080   1.00 22.27 ? 296  ARG C NE  1 
ATOM   1818 C CZ  . ARG C 1 53 ? 18.532  -18.170 9.977   1.00 21.98 ? 296  ARG C CZ  1 
ATOM   1819 N NH1 . ARG C 1 53 ? 17.270  -18.439 9.673   1.00 29.87 ? 296  ARG C NH1 1 
ATOM   1820 N NH2 . ARG C 1 53 ? 18.982  -18.401 11.194  1.00 27.55 ? 296  ARG C NH2 1 
ATOM   1821 N N   . LEU C 1 54 ? 22.202  -20.150 5.516   1.00 13.69 ? 297  LEU C N   1 
ATOM   1822 C CA  . LEU C 1 54 ? 23.621  -20.310 5.870   1.00 14.37 ? 297  LEU C CA  1 
ATOM   1823 C C   . LEU C 1 54 ? 23.937  -19.545 7.157   1.00 16.51 ? 297  LEU C C   1 
ATOM   1824 O O   . LEU C 1 54 ? 23.734  -18.322 7.253   1.00 15.55 ? 297  LEU C O   1 
ATOM   1825 C CB  . LEU C 1 54 ? 24.536  -19.877 4.707   1.00 14.57 ? 297  LEU C CB  1 
ATOM   1826 C CG  . LEU C 1 54 ? 26.031  -20.181 4.884   1.00 16.29 ? 297  LEU C CG  1 
ATOM   1827 C CD1 . LEU C 1 54 ? 26.288  -21.686 5.033   1.00 8.47  ? 297  LEU C CD1 1 
ATOM   1828 C CD2 . LEU C 1 54 ? 26.845  -19.630 3.744   1.00 11.56 ? 297  LEU C CD2 1 
ATOM   1829 N N   . VAL C 1 55 ? 24.402  -20.280 8.166   1.00 14.84 ? 298  VAL C N   1 
ATOM   1830 C CA  . VAL C 1 55 ? 24.656  -19.699 9.459   1.00 14.52 ? 298  VAL C CA  1 
ATOM   1831 C C   . VAL C 1 55 ? 26.142  -19.672 9.806   1.00 12.99 ? 298  VAL C C   1 
ATOM   1832 O O   . VAL C 1 55 ? 26.561  -18.793 10.519  1.00 12.24 ? 298  VAL C O   1 
ATOM   1833 C CB  . VAL C 1 55 ? 23.764  -20.303 10.566  1.00 16.57 ? 298  VAL C CB  1 
ATOM   1834 C CG1 . VAL C 1 55 ? 22.287  -20.094 10.197  1.00 8.40  ? 298  VAL C CG1 1 
ATOM   1835 C CG2 . VAL C 1 55 ? 24.052  -21.802 10.842  1.00 12.34 ? 298  VAL C CG2 1 
ATOM   1836 N N   . ALA C 1 56 ? 26.950  -20.565 9.244   1.00 15.02 ? 299  ALA C N   1 
ATOM   1837 C CA  . ALA C 1 56 ? 28.376  -20.486 9.480   1.00 13.94 ? 299  ALA C CA  1 
ATOM   1838 C C   . ALA C 1 56 ? 29.179  -21.011 8.315   1.00 14.88 ? 299  ALA C C   1 
ATOM   1839 O O   . ALA C 1 56 ? 28.707  -21.856 7.545   1.00 16.12 ? 299  ALA C O   1 
ATOM   1840 C CB  . ALA C 1 56 ? 28.742  -21.242 10.764  1.00 14.12 ? 299  ALA C CB  1 
ATOM   1841 N N   . VAL C 1 57 ? 30.404  -20.496 8.208   1.00 16.34 ? 300  VAL C N   1 
ATOM   1842 C CA  . VAL C 1 57 ? 31.372  -20.938 7.195   1.00 12.24 ? 300  VAL C CA  1 
ATOM   1843 C C   . VAL C 1 57 ? 32.681  -21.221 7.891   1.00 15.34 ? 300  VAL C C   1 
ATOM   1844 O O   . VAL C 1 57 ? 33.229  -20.352 8.563   1.00 15.05 ? 300  VAL C O   1 
ATOM   1845 C CB  . VAL C 1 57 ? 31.556  -19.894 6.090   1.00 14.14 ? 300  VAL C CB  1 
ATOM   1846 C CG1 . VAL C 1 57 ? 32.710  -20.270 5.204   1.00 16.46 ? 300  VAL C CG1 1 
ATOM   1847 C CG2 . VAL C 1 57 ? 30.248  -19.763 5.249   1.00 13.40 ? 300  VAL C CG2 1 
ATOM   1848 N N   . ALA C 1 58 ? 33.161  -22.454 7.774   1.00 18.21 ? 301  ALA C N   1 
ATOM   1849 C CA  . ALA C 1 58 ? 34.384  -22.859 8.448   1.00 17.82 ? 301  ALA C CA  1 
ATOM   1850 C C   . ALA C 1 58 ? 34.278  -22.661 9.963   1.00 19.86 ? 301  ALA C C   1 
ATOM   1851 O O   . ALA C 1 58 ? 35.205  -22.158 10.589  1.00 15.03 ? 301  ALA C O   1 
ATOM   1852 C CB  . ALA C 1 58 ? 35.568  -22.080 7.897   1.00 18.69 ? 301  ALA C CB  1 
ATOM   1853 N N   . GLY C 1 59 ? 33.131  -23.021 10.540  1.00 21.21 ? 302  GLY C N   1 
ATOM   1854 C CA  . GLY C 1 59 ? 32.901  -22.853 11.973  1.00 16.83 ? 302  GLY C CA  1 
ATOM   1855 C C   . GLY C 1 59 ? 32.708  -21.436 12.493  1.00 18.40 ? 302  GLY C C   1 
ATOM   1856 O O   . GLY C 1 59 ? 32.441  -21.258 13.696  1.00 18.10 ? 302  GLY C O   1 
ATOM   1857 N N   . GLU C 1 60 ? 32.867  -20.423 11.633  1.00 16.55 ? 303  GLU C N   1 
ATOM   1858 C CA  . GLU C 1 60 ? 32.662  -19.019 12.038  1.00 14.41 ? 303  GLU C CA  1 
ATOM   1859 C C   . GLU C 1 60 ? 31.310  -18.513 11.596  1.00 14.51 ? 303  GLU C C   1 
ATOM   1860 O O   . GLU C 1 60 ? 30.919  -18.710 10.446  1.00 18.08 ? 303  GLU C O   1 
ATOM   1861 C CB  . GLU C 1 60 ? 33.727  -18.110 11.450  1.00 15.47 ? 303  GLU C CB  1 
ATOM   1862 C CG  . GLU C 1 60 ? 35.115  -18.499 11.883  1.00 19.47 ? 303  GLU C CG  1 
ATOM   1863 C CD  . GLU C 1 60 ? 35.899  -17.357 12.452  1.00 23.93 ? 303  GLU C CD  1 
ATOM   1864 O OE1 . GLU C 1 60 ? 35.809  -16.231 11.921  1.00 35.19 ? 303  GLU C OE1 1 
ATOM   1865 O OE2 . GLU C 1 60 ? 36.630  -17.588 13.429  1.00 34.37 ? 303  GLU C OE2 1 
ATOM   1866 N N   . SER C 1 61 ? 30.594  -17.850 12.492  1.00 12.73 ? 304  SER C N   1 
ATOM   1867 C CA  . SER C 1 61 ? 29.253  -17.339 12.176  1.00 19.00 ? 304  SER C CA  1 
ATOM   1868 C C   . SER C 1 61 ? 29.308  -16.347 11.025  1.00 16.41 ? 304  SER C C   1 
ATOM   1869 O O   . SER C 1 61 ? 30.196  -15.515 10.976  1.00 18.97 ? 304  SER C O   1 
ATOM   1870 C CB  . SER C 1 61 ? 28.610  -16.675 13.412  1.00 20.93 ? 304  SER C CB  1 
ATOM   1871 O OG  . SER C 1 61 ? 27.273  -16.228 13.165  1.00 21.51 ? 304  SER C OG  1 
ATOM   1872 N N   . VAL C 1 62 ? 28.387  -16.486 10.081  1.00 14.46 ? 305  VAL C N   1 
ATOM   1873 C CA  . VAL C 1 62 ? 28.187  -15.511 9.014   1.00 15.43 ? 305  VAL C CA  1 
ATOM   1874 C C   . VAL C 1 62 ? 26.794  -14.881 9.160   1.00 12.09 ? 305  VAL C C   1 
ATOM   1875 O O   . VAL C 1 62 ? 26.285  -14.211 8.276   1.00 18.21 ? 305  VAL C O   1 
ATOM   1876 C CB  . VAL C 1 62 ? 28.448  -16.136 7.603   1.00 14.71 ? 305  VAL C CB  1 
ATOM   1877 C CG1 . VAL C 1 62 ? 29.867  -16.708 7.545   1.00 13.02 ? 305  VAL C CG1 1 
ATOM   1878 C CG2 . VAL C 1 62 ? 27.394  -17.245 7.230   1.00 12.46 ? 305  VAL C CG2 1 
ATOM   1879 N N   . GLU C 1 63 ? 26.176  -15.050 10.310  1.00 12.89 ? 306  GLU C N   1 
ATOM   1880 C CA  . GLU C 1 63 ? 24.803  -14.541 10.482  1.00 13.74 ? 306  GLU C CA  1 
ATOM   1881 C C   . GLU C 1 63 ? 24.741  -13.023 10.534  1.00 13.14 ? 306  GLU C C   1 
ATOM   1882 O O   . GLU C 1 63 ? 25.485  -12.358 11.279  1.00 12.12 ? 306  GLU C O   1 
ATOM   1883 C CB  . GLU C 1 63 ? 24.143  -15.179 11.704  1.00 17.06 ? 306  GLU C CB  1 
ATOM   1884 C CG  . GLU C 1 63 ? 23.509  -16.481 11.347  1.00 23.13 ? 306  GLU C CG  1 
ATOM   1885 C CD  . GLU C 1 63 ? 22.791  -17.107 12.497  1.00 23.84 ? 306  GLU C CD  1 
ATOM   1886 O OE1 . GLU C 1 63 ? 23.453  -17.413 13.493  1.00 24.26 ? 306  GLU C OE1 1 
ATOM   1887 O OE2 . GLU C 1 63 ? 21.566  -17.310 12.410  1.00 25.77 ? 306  GLU C OE2 1 
ATOM   1888 N N   . GLY C 1 64 ? 23.857  -12.454 9.721   1.00 14.40 ? 307  GLY C N   1 
ATOM   1889 C CA  . GLY C 1 64 ? 23.806  -11.002 9.558   1.00 18.51 ? 307  GLY C CA  1 
ATOM   1890 C C   . GLY C 1 64 ? 24.922  -10.399 8.704   1.00 15.00 ? 307  GLY C C   1 
ATOM   1891 O O   . GLY C 1 64 ? 25.032  -9.157  8.628   1.00 13.26 ? 307  GLY C O   1 
ATOM   1892 N N   . LEU C 1 65 ? 25.743  -11.240 8.063   1.00 15.03 ? 308  LEU C N   1 
ATOM   1893 C CA  . LEU C 1 65 ? 26.769  -10.732 7.127   1.00 15.20 ? 308  LEU C CA  1 
ATOM   1894 C C   . LEU C 1 65 ? 26.219  -10.552 5.715   1.00 14.05 ? 308  LEU C C   1 
ATOM   1895 O O   . LEU C 1 65 ? 25.293  -11.238 5.295   1.00 13.23 ? 308  LEU C O   1 
ATOM   1896 C CB  . LEU C 1 65 ? 28.053  -11.590 7.085   1.00 13.45 ? 308  LEU C CB  1 
ATOM   1897 C CG  . LEU C 1 65 ? 28.967  -11.592 8.324   1.00 15.49 ? 308  LEU C CG  1 
ATOM   1898 C CD1 . LEU C 1 65 ? 30.212  -12.394 8.040   1.00 17.19 ? 308  LEU C CD1 1 
ATOM   1899 C CD2 . LEU C 1 65 ? 29.311  -10.206 8.827   1.00 21.35 ? 308  LEU C CD2 1 
ATOM   1900 N N   . GLY C 1 66 ? 26.822  -9.605  5.006   1.00 13.63 ? 309  GLY C N   1 
ATOM   1901 C CA  . GLY C 1 66 ? 26.480  -9.307  3.631   1.00 13.16 ? 309  GLY C CA  1 
ATOM   1902 C C   . GLY C 1 66 ? 26.893  -10.377 2.644   1.00 10.70 ? 309  GLY C C   1 
ATOM   1903 O O   . GLY C 1 66 ? 27.585  -11.326 2.962   1.00 9.72  ? 309  GLY C O   1 
ATOM   1904 N N   . HIS C 1 67 ? 26.438  -10.202 1.420   1.00 12.73 ? 310  HIS C N   1 
ATOM   1905 C CA  . HIS C 1 67 ? 26.557  -11.233 0.430   1.00 15.15 ? 310  HIS C CA  1 
ATOM   1906 C C   . HIS C 1 67 ? 27.995  -11.464 0.018   1.00 14.60 ? 310  HIS C C   1 
ATOM   1907 O O   . HIS C 1 67 ? 28.511  -12.600 0.089   1.00 12.09 ? 310  HIS C O   1 
ATOM   1908 C CB  . HIS C 1 67 ? 25.661  -10.921 -0.776  1.00 13.41 ? 310  HIS C CB  1 
ATOM   1909 C CG  . HIS C 1 67 ? 25.573  -12.049 -1.748  1.00 10.97 ? 310  HIS C CG  1 
ATOM   1910 N ND1 . HIS C 1 67 ? 24.839  -13.188 -1.500  1.00 15.02 ? 310  HIS C ND1 1 
ATOM   1911 C CD2 . HIS C 1 67 ? 26.159  -12.230 -2.956  1.00 13.13 ? 310  HIS C CD2 1 
ATOM   1912 C CE1 . HIS C 1 67 ? 24.986  -14.023 -2.511  1.00 16.32 ? 310  HIS C CE1 1 
ATOM   1913 N NE2 . HIS C 1 67 ? 25.786  -13.470 -3.401  1.00 12.16 ? 310  HIS C NE2 1 
ATOM   1914 N N   . GLU C 1 68 ? 28.672  -10.418 -0.438  1.00 15.18 ? 311  GLU C N   1 
ATOM   1915 C CA  . GLU C 1 68 ? 30.046  -10.641 -0.907  1.00 20.54 ? 311  GLU C CA  1 
ATOM   1916 C C   . GLU C 1 68 ? 30.995  -11.054 0.221   1.00 11.94 ? 311  GLU C C   1 
ATOM   1917 O O   . GLU C 1 68 ? 31.953  -11.782 -0.031  1.00 13.55 ? 311  GLU C O   1 
ATOM   1918 C CB  . GLU C 1 68 ? 30.617  -9.467  -1.724  1.00 21.59 ? 311  GLU C CB  1 
ATOM   1919 C CG  . GLU C 1 68 ? 30.915  -8.187  -1.015  1.00 35.55 ? 311  GLU C CG  1 
ATOM   1920 C CD  . GLU C 1 68 ? 31.649  -7.192  -1.944  1.00 38.17 ? 311  GLU C CD  1 
ATOM   1921 O OE1 . GLU C 1 68 ? 31.123  -6.888  -3.043  1.00 61.61 ? 311  GLU C OE1 1 
ATOM   1922 O OE2 . GLU C 1 68 ? 32.748  -6.720  -1.571  1.00 68.62 ? 311  GLU C OE2 1 
ATOM   1923 N N   . GLU C 1 69 ? 30.739  -10.613 1.454   1.00 13.96 ? 312  GLU C N   1 
ATOM   1924 C CA  . GLU C 1 69 ? 31.569  -11.060 2.565   1.00 13.21 ? 312  GLU C CA  1 
ATOM   1925 C C   . GLU C 1 69 ? 31.387  -12.558 2.698   1.00 11.78 ? 312  GLU C C   1 
ATOM   1926 O O   . GLU C 1 69 ? 32.340  -13.280 2.843   1.00 14.41 ? 312  GLU C O   1 
ATOM   1927 C CB  . GLU C 1 69 ? 31.166  -10.391 3.858   1.00 14.50 ? 312  GLU C CB  1 
ATOM   1928 C CG  . GLU C 1 69 ? 31.860  -10.928 5.083   1.00 21.84 ? 312  GLU C CG  1 
ATOM   1929 C CD  . GLU C 1 69 ? 33.354  -10.683 5.080   1.00 30.51 ? 312  GLU C CD  1 
ATOM   1930 O OE1 . GLU C 1 69 ? 33.831  -9.847  4.280   1.00 19.48 ? 312  GLU C OE1 1 
ATOM   1931 O OE2 . GLU C 1 69 ? 34.057  -11.334 5.885   1.00 18.44 ? 312  GLU C OE2 1 
ATOM   1932 N N   . THR C 1 70 ? 30.137  -13.009 2.664   1.00 16.45 ? 313  THR C N   1 
ATOM   1933 C CA  . THR C 1 70 ? 29.817  -14.434 2.759   1.00 14.68 ? 313  THR C CA  1 
ATOM   1934 C C   . THR C 1 70 ? 30.456  -15.282 1.638   1.00 17.26 ? 313  THR C C   1 
ATOM   1935 O O   . THR C 1 70 ? 31.095  -16.310 1.918   1.00 11.99 ? 313  THR C O   1 
ATOM   1936 C CB  . THR C 1 70 ? 28.302  -14.645 2.825   1.00 13.70 ? 313  THR C CB  1 
ATOM   1937 O OG1 . THR C 1 70 ? 27.781  -13.807 3.866   1.00 17.92 ? 313  THR C OG1 1 
ATOM   1938 C CG2 . THR C 1 70 ? 27.970  -16.065 3.111   1.00 7.76  ? 313  THR C CG2 1 
ATOM   1939 N N   . VAL C 1 71 ? 30.325  -14.839 0.389   1.00 14.11 ? 314  VAL C N   1 
ATOM   1940 C CA  . VAL C 1 71 ? 30.927  -15.565 -0.737  1.00 12.74 ? 314  VAL C CA  1 
ATOM   1941 C C   . VAL C 1 71 ? 32.453  -15.595 -0.597  1.00 13.80 ? 314  VAL C C   1 
ATOM   1942 O O   . VAL C 1 71 ? 33.095  -16.629 -0.835  1.00 11.99 ? 314  VAL C O   1 
ATOM   1943 C CB  . VAL C 1 71 ? 30.560  -14.906 -2.126  1.00 12.15 ? 314  VAL C CB  1 
ATOM   1944 C CG1 . VAL C 1 71 ? 31.290  -15.657 -3.314  1.00 9.75  ? 314  VAL C CG1 1 
ATOM   1945 C CG2 . VAL C 1 71 ? 29.070  -14.910 -2.311  1.00 11.31 ? 314  VAL C CG2 1 
ATOM   1946 N N   . SER C 1 72 ? 33.051  -14.462 -0.203  1.00 15.14 ? 315  SER C N   1 
ATOM   1947 C CA  . SER C 1 72 ? 34.518  -14.411 -0.122  1.00 14.00 ? 315  SER C CA  1 
ATOM   1948 C C   . SER C 1 72 ? 35.004  -15.433 0.905   1.00 12.27 ? 315  SER C C   1 
ATOM   1949 O O   . SER C 1 72 ? 36.040  -16.086 0.710   1.00 16.50 ? 315  SER C O   1 
ATOM   1950 C CB  . SER C 1 72 ? 35.051  -12.995 0.183   1.00 12.84 ? 315  SER C CB  1 
ATOM   1951 O OG  . SER C 1 72 ? 34.971  -12.676 1.554   1.00 28.65 ? 315  SER C OG  1 
ATOM   1952 N N   . ARG C 1 73 ? 34.254  -15.592 1.984   1.00 14.15 ? 316  ARG C N   1 
ATOM   1953 C CA  . ARG C 1 73 ? 34.627  -16.537 3.034   1.00 11.36 ? 316  ARG C CA  1 
ATOM   1954 C C   . ARG C 1 73 ? 34.560  -17.971 2.535   1.00 16.80 ? 316  ARG C C   1 
ATOM   1955 O O   . ARG C 1 73 ? 35.467  -18.766 2.797   1.00 15.67 ? 316  ARG C O   1 
ATOM   1956 C CB  . ARG C 1 73 ? 33.740  -16.348 4.244   1.00 13.97 ? 316  ARG C CB  1 
ATOM   1957 C CG  . ARG C 1 73 ? 34.072  -15.098 5.022   1.00 15.31 ? 316  ARG C CG  1 
ATOM   1958 C CD  . ARG C 1 73 ? 33.226  -15.026 6.209   1.00 25.24 ? 316  ARG C CD  1 
ATOM   1959 N NE  . ARG C 1 73 ? 33.451  -13.795 6.940   1.00 22.43 ? 316  ARG C NE  1 
ATOM   1960 C CZ  . ARG C 1 73 ? 33.576  -13.713 8.256   1.00 24.36 ? 316  ARG C CZ  1 
ATOM   1961 N NH1 . ARG C 1 73 ? 33.503  -14.793 9.016   1.00 23.10 ? 316  ARG C NH1 1 
ATOM   1962 N NH2 . ARG C 1 73 ? 33.751  -12.528 8.813   1.00 30.62 ? 316  ARG C NH2 1 
ATOM   1963 N N   . ILE C 1 74 ? 33.509  -18.292 1.785   1.00 16.05 ? 317  ILE C N   1 
ATOM   1964 C CA  . ILE C 1 74 ? 33.398  -19.620 1.134   1.00 15.49 ? 317  ILE C CA  1 
ATOM   1965 C C   . ILE C 1 74 ? 34.532  -19.808 0.112   1.00 13.52 ? 317  ILE C C   1 
ATOM   1966 O O   . ILE C 1 74 ? 35.173  -20.855 0.068   1.00 19.32 ? 317  ILE C O   1 
ATOM   1967 C CB  . ILE C 1 74 ? 32.017  -19.782 0.422   1.00 17.48 ? 317  ILE C CB  1 
ATOM   1968 C CG1 . ILE C 1 74 ? 30.858  -19.758 1.440   1.00 16.04 ? 317  ILE C CG1 1 
ATOM   1969 C CG2 . ILE C 1 74 ? 31.993  -21.017 -0.502  1.00 15.28 ? 317  ILE C CG2 1 
ATOM   1970 C CD1 . ILE C 1 74 ? 29.512  -19.518 0.773   1.00 12.50 ? 317  ILE C CD1 1 
ATOM   1971 N N   . GLN C 1 75 ? 34.757  -18.808 -0.736  1.00 16.40 ? 318  GLN C N   1 
ATOM   1972 C CA  . GLN C 1 75 ? 35.865  -18.856 -1.710  1.00 17.86 ? 318  GLN C CA  1 
ATOM   1973 C C   . GLN C 1 75 ? 37.221  -19.057 -1.026  1.00 18.12 ? 318  GLN C C   1 
ATOM   1974 O O   . GLN C 1 75 ? 38.058  -19.862 -1.471  1.00 16.36 ? 318  GLN C O   1 
ATOM   1975 C CB  . GLN C 1 75 ? 35.877  -17.581 -2.561  1.00 14.22 ? 318  GLN C CB  1 
ATOM   1976 C CG  . GLN C 1 75 ? 34.718  -17.515 -3.520  1.00 22.09 ? 318  GLN C CG  1 
ATOM   1977 C CD  . GLN C 1 75 ? 34.727  -16.300 -4.431  1.00 25.14 ? 318  GLN C CD  1 
ATOM   1978 O OE1 . GLN C 1 75 ? 35.041  -15.185 -4.012  1.00 21.87 ? 318  GLN C OE1 1 
ATOM   1979 N NE2 . GLN C 1 75 ? 34.312  -16.507 -5.684  1.00 25.81 ? 318  GLN C NE2 1 
ATOM   1980 N N   . GLY C 1 76 ? 37.415  -18.332 0.068   1.00 11.00 ? 319  GLY C N   1 
ATOM   1981 C CA  . GLY C 1 76 ? 38.635  -18.355 0.836   1.00 14.71 ? 319  GLY C CA  1 
ATOM   1982 C C   . GLY C 1 76 ? 39.010  -19.698 1.431   1.00 15.14 ? 319  GLY C C   1 
ATOM   1983 O O   . GLY C 1 76 ? 40.149  -19.883 1.892   1.00 14.89 ? 319  GLY C O   1 
ATOM   1984 N N   . GLN C 1 77 ? 38.064  -20.635 1.441   1.00 15.71 ? 320  GLN C N   1 
ATOM   1985 C CA  . GLN C 1 77 ? 38.313  -21.969 1.982   1.00 13.74 ? 320  GLN C CA  1 
ATOM   1986 C C   . GLN C 1 77 ? 38.854  -22.987 0.966   1.00 14.01 ? 320  GLN C C   1 
ATOM   1987 O O   . GLN C 1 77 ? 39.205  -24.100 1.352   1.00 17.47 ? 320  GLN C O   1 
ATOM   1988 C CB  . GLN C 1 77 ? 37.043  -22.520 2.649   1.00 17.25 ? 320  GLN C CB  1 
ATOM   1989 C CG  . GLN C 1 77 ? 36.645  -21.802 3.961   1.00 12.88 ? 320  GLN C CG  1 
ATOM   1990 C CD  . GLN C 1 77 ? 37.711  -21.940 5.032   1.00 21.78 ? 320  GLN C CD  1 
ATOM   1991 O OE1 . GLN C 1 77 ? 38.042  -23.044 5.469   1.00 18.74 ? 320  GLN C OE1 1 
ATOM   1992 N NE2 . GLN C 1 77 ? 38.250  -20.813 5.464   1.00 19.00 ? 320  GLN C NE2 1 
ATOM   1993 N N   . GLY C 1 78 ? 38.887  -22.652 -0.318  1.00 18.73 ? 321  GLY C N   1 
ATOM   1994 C CA  . GLY C 1 78 ? 39.418  -23.575 -1.346  1.00 16.51 ? 321  GLY C CA  1 
ATOM   1995 C C   . GLY C 1 78 ? 38.542  -24.787 -1.623  1.00 18.90 ? 321  GLY C C   1 
ATOM   1996 O O   . GLY C 1 78 ? 37.296  -24.685 -1.651  1.00 18.13 ? 321  GLY C O   1 
ATOM   1997 N N   . SER C 1 79 ? 39.194  -25.936 -1.822  1.00 20.24 ? 322  SER C N   1 
ATOM   1998 C CA  . SER C 1 79 ? 38.552  -27.179 -2.234  1.00 24.08 ? 322  SER C CA  1 
ATOM   1999 C C   . SER C 1 79 ? 37.589  -27.776 -1.212  1.00 25.13 ? 322  SER C C   1 
ATOM   2000 O O   . SER C 1 79 ? 36.577  -28.361 -1.592  1.00 27.66 ? 322  SER C O   1 
ATOM   2001 C CB  . SER C 1 79 ? 39.611  -28.225 -2.564  1.00 24.85 ? 322  SER C CB  1 
ATOM   2002 O OG  . SER C 1 79 ? 40.305  -27.870 -3.746  1.00 37.97 ? 322  SER C OG  1 
ATOM   2003 N N   . CYS C 1 80 ? 37.908  -27.648 0.072   1.00 22.02 ? 323  CYS C N   1 
ATOM   2004 C CA  . CYS C 1 80 ? 37.083  -28.214 1.136   1.00 22.36 ? 323  CYS C CA  1 
ATOM   2005 C C   . CYS C 1 80 ? 36.506  -27.097 1.986   1.00 24.02 ? 323  CYS C C   1 
ATOM   2006 O O   . CYS C 1 80 ? 37.202  -26.113 2.274   1.00 22.11 ? 323  CYS C O   1 
ATOM   2007 C CB  . CYS C 1 80 ? 37.900  -29.178 1.999   1.00 23.80 ? 323  CYS C CB  1 
ATOM   2008 S SG  . CYS C 1 80 ? 38.386  -30.660 1.111   1.00 42.20 ? 323  CYS C SG  1 
ATOM   2009 N N   . VAL C 1 81 ? 35.233  -27.263 2.370   1.00 21.12 ? 324  VAL C N   1 
ATOM   2010 C CA  . VAL C 1 81 ? 34.467  -26.248 3.101   1.00 19.44 ? 324  VAL C CA  1 
ATOM   2011 C C   . VAL C 1 81 ? 33.455  -26.892 4.081   1.00 20.79 ? 324  VAL C C   1 
ATOM   2012 O O   . VAL C 1 81 ? 32.720  -27.831 3.738   1.00 18.13 ? 324  VAL C O   1 
ATOM   2013 C CB  . VAL C 1 81 ? 33.743  -25.238 2.134   1.00 21.50 ? 324  VAL C CB  1 
ATOM   2014 C CG1 . VAL C 1 81 ? 32.407  -25.808 1.581   1.00 18.16 ? 324  VAL C CG1 1 
ATOM   2015 C CG2 . VAL C 1 81 ? 33.485  -23.908 2.836   1.00 19.37 ? 324  VAL C CG2 1 
ATOM   2016 N N   . SER C 1 82 ? 33.487  -26.401 5.315   1.00 17.95 ? 325  SER C N   1 
ATOM   2017 C CA  . SER C 1 82 ? 32.469  -26.631 6.331   1.00 19.28 ? 325  SER C CA  1 
ATOM   2018 C C   . SER C 1 82 ? 31.419  -25.517 6.265   1.00 19.96 ? 325  SER C C   1 
ATOM   2019 O O   . SER C 1 82 ? 31.786  -24.336 6.281   1.00 20.16 ? 325  SER C O   1 
ATOM   2020 C CB  . SER C 1 82 ? 33.139  -26.589 7.718   1.00 23.67 ? 325  SER C CB  1 
ATOM   2021 O OG  . SER C 1 82 ? 32.295  -27.126 8.727   1.00 32.40 ? 325  SER C OG  1 
ATOM   2022 N N   . LEU C 1 83 ? 30.134  -25.901 6.175   1.00 20.54 ? 326  LEU C N   1 
ATOM   2023 C CA  . LEU C 1 83 ? 28.990  -24.975 6.184   1.00 20.65 ? 326  LEU C CA  1 
ATOM   2024 C C   . LEU C 1 83 ? 27.889  -25.397 7.174   1.00 19.14 ? 326  LEU C C   1 
ATOM   2025 O O   . LEU C 1 83 ? 27.419  -26.527 7.139   1.00 20.17 ? 326  LEU C O   1 
ATOM   2026 C CB  . LEU C 1 83 ? 28.338  -24.903 4.806   1.00 18.34 ? 326  LEU C CB  1 
ATOM   2027 C CG  . LEU C 1 83 ? 29.245  -24.568 3.629   1.00 19.93 ? 326  LEU C CG  1 
ATOM   2028 C CD1 . LEU C 1 83 ? 28.540  -24.994 2.372   1.00 16.26 ? 326  LEU C CD1 1 
ATOM   2029 C CD2 . LEU C 1 83 ? 29.566  -23.084 3.579   1.00 13.75 ? 326  LEU C CD2 1 
ATOM   2030 N N   . THR C 1 84 ? 27.442  -24.470 8.022   1.00 20.22 ? 327  THR C N   1 
ATOM   2031 C CA  . THR C 1 84 ? 26.327  -24.759 8.936   1.00 13.49 ? 327  THR C CA  1 
ATOM   2032 C C   . THR C 1 84 ? 25.055  -24.084 8.471   1.00 13.94 ? 327  THR C C   1 
ATOM   2033 O O   . THR C 1 84 ? 25.025  -22.882 8.158   1.00 17.32 ? 327  THR C O   1 
ATOM   2034 C CB  . THR C 1 84 ? 26.684  -24.375 10.368  1.00 16.80 ? 327  THR C CB  1 
ATOM   2035 O OG1 . THR C 1 84 ? 28.020  -24.803 10.632  1.00 17.94 ? 327  THR C OG1 1 
ATOM   2036 C CG2 . THR C 1 84 ? 25.716  -25.005 11.384  1.00 11.78 ? 327  THR C CG2 1 
ATOM   2037 N N   . VAL C 1 85 ? 24.006  -24.883 8.349   1.00 14.34 ? 328  VAL C N   1 
ATOM   2038 C CA  . VAL C 1 85 ? 22.750  -24.424 7.804   1.00 14.26 ? 328  VAL C CA  1 
ATOM   2039 C C   . VAL C 1 85 ? 21.635  -24.655 8.809   1.00 15.52 ? 328  VAL C C   1 
ATOM   2040 O O   . VAL C 1 85 ? 21.726  -25.543 9.662   1.00 19.06 ? 328  VAL C O   1 
ATOM   2041 C CB  . VAL C 1 85 ? 22.414  -25.144 6.471   1.00 18.08 ? 328  VAL C CB  1 
ATOM   2042 C CG1 . VAL C 1 85 ? 23.502  -24.861 5.396   1.00 8.42  ? 328  VAL C CG1 1 
ATOM   2043 C CG2 . VAL C 1 85 ? 22.219  -26.650 6.695   1.00 15.76 ? 328  VAL C CG2 1 
ATOM   2044 N N   . VAL C 1 86 ? 20.591  -23.834 8.724   1.00 15.88 ? 329  VAL C N   1 
ATOM   2045 C CA  . VAL C 1 86 ? 19.329  -24.136 9.400   1.00 17.76 ? 329  VAL C CA  1 
ATOM   2046 C C   . VAL C 1 86 ? 18.305  -24.503 8.333   1.00 17.64 ? 329  VAL C C   1 
ATOM   2047 O O   . VAL C 1 86 ? 18.073  -23.727 7.413   1.00 20.44 ? 329  VAL C O   1 
ATOM   2048 C CB  . VAL C 1 86 ? 18.826  -22.943 10.240  1.00 18.45 ? 329  VAL C CB  1 
ATOM   2049 C CG1 . VAL C 1 86 ? 17.495  -23.265 10.899  1.00 23.26 ? 329  VAL C CG1 1 
ATOM   2050 C CG2 . VAL C 1 86 ? 19.834  -22.605 11.317  1.00 22.11 ? 329  VAL C CG2 1 
ATOM   2051 N N   . ASP C 1 87 ? 17.703  -25.686 8.443   1.00 20.11 ? 330  ASP C N   1 
ATOM   2052 C CA  . ASP C 1 87 ? 16.725  -26.138 7.437   1.00 23.08 ? 330  ASP C CA  1 
ATOM   2053 C C   . ASP C 1 87 ? 15.393  -25.438 7.562   1.00 22.12 ? 330  ASP C C   1 
ATOM   2054 O O   . ASP C 1 87 ? 15.022  -25.012 8.648   1.00 23.62 ? 330  ASP C O   1 
ATOM   2055 C CB  . ASP C 1 87 ? 16.462  -27.633 7.527   1.00 23.93 ? 330  ASP C CB  1 
ATOM   2056 C CG  . ASP C 1 87 ? 17.692  -28.440 7.265   1.00 27.02 ? 330  ASP C CG  1 
ATOM   2057 O OD1 . ASP C 1 87 ? 18.174  -28.435 6.112   1.00 25.85 ? 330  ASP C OD1 1 
ATOM   2058 O OD2 . ASP C 1 87 ? 18.178  -29.061 8.231   1.00 27.82 ? 330  ASP C OD2 1 
ATOM   2059 N N   . PRO C 1 88 ? 14.667  -25.326 6.436   1.00 23.40 ? 331  PRO C N   1 
ATOM   2060 C CA  . PRO C 1 88 ? 13.328  -24.774 6.407   1.00 24.26 ? 331  PRO C CA  1 
ATOM   2061 C C   . PRO C 1 88 ? 12.261  -25.777 6.779   1.00 28.89 ? 331  PRO C C   1 
ATOM   2062 O O   . PRO C 1 88 ? 12.544  -26.978 6.931   1.00 27.74 ? 331  PRO C O   1 
ATOM   2063 C CB  . PRO C 1 88 ? 13.169  -24.372 4.943   1.00 25.07 ? 331  PRO C CB  1 
ATOM   2064 C CG  . PRO C 1 88 ? 13.922  -25.413 4.224   1.00 24.17 ? 331  PRO C CG  1 
ATOM   2065 C CD  . PRO C 1 88 ? 15.118  -25.692 5.082   1.00 21.87 ? 331  PRO C CD  1 
ATOM   2066 N N   . GLU C 1 89 ? 11.038  -25.272 6.948   1.00 32.82 ? 332  GLU C N   1 
ATOM   2067 C CA  . GLU C 1 89 ? 9.856   -26.119 6.971   1.00 35.04 ? 332  GLU C CA  1 
ATOM   2068 C C   . GLU C 1 89 ? 9.419   -26.275 5.518   1.00 36.12 ? 332  GLU C C   1 
ATOM   2069 O O   . GLU C 1 89 ? 9.107   -25.291 4.858   1.00 37.34 ? 332  GLU C O   1 
ATOM   2070 C CB  . GLU C 1 89 ? 8.748   -25.474 7.812   1.00 39.48 ? 332  GLU C CB  1 
ATOM   2071 C CG  . GLU C 1 89 ? 8.922   -25.612 9.332   1.00 41.70 ? 332  GLU C CG  1 
ATOM   2072 C CD  . GLU C 1 89 ? 9.695   -24.468 9.988   1.00 52.27 ? 332  GLU C CD  1 
ATOM   2073 O OE1 . GLU C 1 89 ? 9.595   -23.304 9.540   1.00 51.67 ? 332  GLU C OE1 1 
ATOM   2074 O OE2 . GLU C 1 89 ? 10.396  -24.740 10.984  1.00 53.27 ? 332  GLU C OE2 1 
ATOM   2075 N N   . ALA C 1 90 ? 9.406   -27.504 5.010   1.00 46.83 ? 333  ALA C N   1 
ATOM   2076 C CA  . ALA C 1 90 ? 9.164   -27.746 3.572   1.00 50.05 ? 333  ALA C CA  1 
ATOM   2077 C C   . ALA C 1 90 ? 7.666   -27.731 3.200   1.00 50.95 ? 333  ALA C C   1 
ATOM   2078 O O   . ALA C 1 90 ? 7.299   -27.950 2.043   1.00 53.48 ? 333  ALA C O   1 
ATOM   2079 C CB  . ALA C 1 90 ? 9.817   -29.062 3.140   1.00 46.61 ? 333  ALA C CB  1 
ATOM   2080 N N   . ASP C 1 91 ? 6.819   -27.460 4.189   1.00 48.38 ? 334  ASP C N   1 
ATOM   2081 C CA  . ASP C 1 91 ? 5.378   -27.302 3.994   1.00 47.85 ? 334  ASP C CA  1 
ATOM   2082 C C   . ASP C 1 91 ? 4.985   -25.821 3.885   1.00 42.94 ? 334  ASP C C   1 
ATOM   2083 O O   . ASP C 1 91 ? 3.811   -25.463 4.094   1.00 48.83 ? 334  ASP C O   1 
ATOM   2084 C CB  . ASP C 1 91 ? 4.627   -27.966 5.159   1.00 52.91 ? 334  ASP C CB  1 
ATOM   2085 C CG  . ASP C 1 91 ? 5.247   -27.650 6.526   1.00 67.20 ? 334  ASP C CG  1 
ATOM   2086 O OD1 . ASP C 1 91 ? 4.494   -27.587 7.525   1.00 93.99 ? 334  ASP C OD1 1 
ATOM   2087 O OD2 . ASP C 1 91 ? 6.486   -27.473 6.601   1.00 71.15 ? 334  ASP C OD2 1 
ATOM   2088 N N   . ARG C 1 92 ? 5.969   -24.964 3.590   1.00 26.08 ? 335  ARG C N   1 
ATOM   2089 C CA  . ARG C 1 92 ? 5.746   -23.534 3.472   1.00 24.81 ? 335  ARG C CA  1 
ATOM   2090 C C   . ARG C 1 92 ? 6.280   -23.051 2.130   1.00 15.18 ? 335  ARG C C   1 
ATOM   2091 O O   . ARG C 1 92 ? 6.987   -22.047 2.070   1.00 12.34 ? 335  ARG C O   1 
ATOM   2092 C CB  . ARG C 1 92 ? 6.433   -22.766 4.618   1.00 23.94 ? 335  ARG C CB  1 
ATOM   2093 C CG  . ARG C 1 92 ? 6.084   -23.274 6.024   1.00 21.73 ? 335  ARG C CG  1 
ATOM   2094 C CD  . ARG C 1 92 ? 5.423   -22.241 6.856   1.00 32.29 ? 335  ARG C CD  1 
ATOM   2095 N NE  . ARG C 1 92 ? 4.852   -22.794 8.089   1.00 31.56 ? 335  ARG C NE  1 
ATOM   2096 C CZ  . ARG C 1 92 ? 5.414   -22.754 9.301   1.00 42.82 ? 335  ARG C CZ  1 
ATOM   2097 N NH1 . ARG C 1 92 ? 6.605   -22.196 9.506   1.00 43.66 ? 335  ARG C NH1 1 
ATOM   2098 N NH2 . ARG C 1 92 ? 4.767   -23.284 10.332  1.00 52.68 ? 335  ARG C NH2 1 
ATOM   2099 N N   . GLU C 1 93 ? 5.966   -23.788 1.071   1.00 11.19 ? 336  GLU C N   1 
ATOM   2100 C CA  . GLU C 1 93 ? 6.140   -23.284 -0.309  1.00 12.55 ? 336  GLU C CA  1 
ATOM   2101 C C   . GLU C 1 93 ? 4.907   -23.732 -1.117  1.00 16.27 ? 336  GLU C C   1 
ATOM   2102 O O   . GLU C 1 93 ? 4.409   -24.853 -0.933  1.00 15.62 ? 336  GLU C O   1 
ATOM   2103 C CB  . GLU C 1 93 ? 7.457   -23.725 -0.960  1.00 22.10 ? 336  GLU C CB  1 
ATOM   2104 C CG  . GLU C 1 93 ? 7.524   -25.147 -1.424  1.00 26.18 ? 336  GLU C CG  1 
ATOM   2105 C CD  . GLU C 1 93 ? 8.817   -25.491 -2.156  1.00 20.64 ? 336  GLU C CD  1 
ATOM   2106 O OE1 . GLU C 1 93 ? 9.061   -26.705 -2.311  1.00 55.62 ? 336  GLU C OE1 1 
ATOM   2107 O OE2 . GLU C 1 93 ? 9.562   -24.577 -2.604  1.00 37.37 ? 336  GLU C OE2 1 
ATOM   2108 N N   . THR C 1 94 ? 4.381   -22.829 -1.943  1.00 11.26 ? 337  THR C N   1 
ATOM   2109 C CA  . THR C 1 94 ? 3.103   -23.040 -2.624  1.00 8.73  ? 337  THR C CA  1 
ATOM   2110 C C   . THR C 1 94 ? 3.187   -22.354 -3.992  1.00 14.22 ? 337  THR C C   1 
ATOM   2111 O O   . THR C 1 94 ? 3.503   -21.187 -4.060  1.00 9.23  ? 337  THR C O   1 
ATOM   2112 C CB  . THR C 1 94 ? 1.933   -22.462 -1.850  1.00 4.34  ? 337  THR C CB  1 
ATOM   2113 O OG1 . THR C 1 94 ? 1.807   -23.141 -0.592  1.00 14.26 ? 337  THR C OG1 1 
ATOM   2114 C CG2 . THR C 1 94 ? 0.624   -22.673 -2.633  1.00 6.91  ? 337  THR C CG2 1 
ATOM   2115 N N   . SER C 1 95 ? 2.938   -23.109 -5.058  1.00 13.73 ? 338  SER C N   1 
ATOM   2116 C CA  . SER C 1 95 ? 2.753   -22.550 -6.383  1.00 15.24 ? 338  SER C CA  1 
ATOM   2117 C C   . SER C 1 95 ? 1.337   -22.017 -6.518  1.00 9.13  ? 338  SER C C   1 
ATOM   2118 O O   . SER C 1 95 ? 0.371   -22.721 -6.226  1.00 10.60 ? 338  SER C O   1 
ATOM   2119 C CB  . SER C 1 95 ? 2.992   -23.626 -7.431  1.00 20.66 ? 338  SER C CB  1 
ATOM   2120 O OG  . SER C 1 95 ? 3.066   -23.080 -8.724  1.00 18.39 ? 338  SER C OG  1 
ATOM   2121 N N   . VAL C 1 96 ? 1.224   -20.769 -6.942  1.00 14.12 ? 339  VAL C N   1 
ATOM   2122 C CA  . VAL C 1 96 ? -0.054  -20.136 -7.187  1.00 15.00 ? 339  VAL C CA  1 
ATOM   2123 C C   . VAL C 1 96 ? -0.099  -19.526 -8.592  1.00 19.03 ? 339  VAL C C   1 
ATOM   2124 O O   . VAL C 1 96 ? 0.864   -19.541 -9.378  1.00 12.23 ? 339  VAL C O   1 
ATOM   2125 C CB  . VAL C 1 96 ? -0.397  -19.070 -6.109  1.00 14.38 ? 339  VAL C CB  1 
ATOM   2126 C CG1 . VAL C 1 96 ? -0.587  -19.745 -4.732  1.00 18.79 ? 339  VAL C CG1 1 
ATOM   2127 C CG2 . VAL C 1 96 ? 0.648   -18.003 -6.023  1.00 11.23 ? 339  VAL C CG2 1 
ATOM   2128 O OXT . VAL C 1 96 ? -1.152  -19.024 -8.950  1.00 13.16 ? 339  VAL C OXT 1 
ATOM   2129 N N   . PRO D 1 4  ? 39.087  22.172  43.466  1.00 27.39 ? 247  PRO D N   1 
ATOM   2130 C CA  . PRO D 1 4  ? 40.067  22.422  42.413  1.00 26.32 ? 247  PRO D CA  1 
ATOM   2131 C C   . PRO D 1 4  ? 40.812  21.171  42.031  1.00 25.79 ? 247  PRO D C   1 
ATOM   2132 O O   . PRO D 1 4  ? 40.906  20.254  42.829  1.00 26.12 ? 247  PRO D O   1 
ATOM   2133 C CB  . PRO D 1 4  ? 41.043  23.410  43.045  1.00 23.47 ? 247  PRO D CB  1 
ATOM   2134 C CG  . PRO D 1 4  ? 40.312  24.038  44.126  1.00 25.90 ? 247  PRO D CG  1 
ATOM   2135 C CD  . PRO D 1 4  ? 39.334  23.015  44.642  1.00 31.02 ? 247  PRO D CD  1 
ATOM   2136 N N   . ARG D 1 5  ? 41.347  21.145  40.820  1.00 25.12 ? 248  ARG D N   1 
ATOM   2137 C CA  . ARG D 1 5  ? 42.117  20.009  40.355  1.00 23.87 ? 248  ARG D CA  1 
ATOM   2138 C C   . ARG D 1 5  ? 43.402  20.464  39.702  1.00 22.17 ? 248  ARG D C   1 
ATOM   2139 O O   . ARG D 1 5  ? 43.376  21.283  38.770  1.00 16.89 ? 248  ARG D O   1 
ATOM   2140 C CB  . ARG D 1 5  ? 41.326  19.238  39.323  1.00 24.11 ? 248  ARG D CB  1 
ATOM   2141 C CG  . ARG D 1 5  ? 40.103  18.544  39.849  1.00 32.27 ? 248  ARG D CG  1 
ATOM   2142 C CD  . ARG D 1 5  ? 39.262  18.136  38.672  1.00 37.63 ? 248  ARG D CD  1 
ATOM   2143 N NE  . ARG D 1 5  ? 40.057  17.391  37.701  1.00 40.32 ? 248  ARG D NE  1 
ATOM   2144 C CZ  . ARG D 1 5  ? 39.993  17.530  36.379  1.00 34.75 ? 248  ARG D CZ  1 
ATOM   2145 N NH1 . ARG D 1 5  ? 39.174  18.399  35.814  1.00 29.08 ? 248  ARG D NH1 1 
ATOM   2146 N NH2 . ARG D 1 5  ? 40.766  16.780  35.616  1.00 34.65 ? 248  ARG D NH2 1 
ATOM   2147 N N   . CYS D 1 6  ? 44.515  19.899  40.166  1.00 21.66 ? 249  CYS D N   1 
ATOM   2148 C CA  . CYS D 1 6  ? 45.809  20.130  39.554  1.00 22.46 ? 249  CYS D CA  1 
ATOM   2149 C C   . CYS D 1 6  ? 46.030  19.127  38.434  1.00 23.23 ? 249  CYS D C   1 
ATOM   2150 O O   . CYS D 1 6  ? 45.875  17.913  38.619  1.00 27.44 ? 249  CYS D O   1 
ATOM   2151 C CB  . CYS D 1 6  ? 46.926  20.021  40.591  1.00 22.11 ? 249  CYS D CB  1 
ATOM   2152 S SG  . CYS D 1 6  ? 48.543  20.511  39.951  1.00 28.91 ? 249  CYS D SG  1 
ATOM   2153 N N   . LEU D 1 7  ? 46.412  19.650  37.279  1.00 20.64 ? 250  LEU D N   1 
ATOM   2154 C CA  . LEU D 1 7  ? 46.639  18.864  36.078  1.00 21.83 ? 250  LEU D CA  1 
ATOM   2155 C C   . LEU D 1 7  ? 48.083  19.060  35.648  1.00 20.13 ? 250  LEU D C   1 
ATOM   2156 O O   . LEU D 1 7  ? 48.626  20.139  35.785  1.00 23.22 ? 250  LEU D O   1 
ATOM   2157 C CB  . LEU D 1 7  ? 45.665  19.323  34.984  1.00 24.73 ? 250  LEU D CB  1 
ATOM   2158 C CG  . LEU D 1 7  ? 44.240  19.596  35.525  1.00 29.64 ? 250  LEU D CG  1 
ATOM   2159 C CD1 . LEU D 1 7  ? 43.324  20.302  34.528  1.00 26.83 ? 250  LEU D CD1 1 
ATOM   2160 C CD2 . LEU D 1 7  ? 43.599  18.315  36.019  1.00 29.69 ? 250  LEU D CD2 1 
ATOM   2161 N N   . HIS D 1 8  ? 48.718  18.002  35.172  1.00 18.86 ? 251  HIS D N   1 
ATOM   2162 C CA  . HIS D 1 8  ? 50.095  18.071  34.705  1.00 21.54 ? 251  HIS D CA  1 
ATOM   2163 C C   . HIS D 1 8  ? 50.076  17.778  33.208  1.00 21.88 ? 251  HIS D C   1 
ATOM   2164 O O   . HIS D 1 8  ? 49.708  16.689  32.788  1.00 20.26 ? 251  HIS D O   1 
ATOM   2165 C CB  . HIS D 1 8  ? 50.978  17.060  35.453  1.00 25.60 ? 251  HIS D CB  1 
ATOM   2166 C CG  . HIS D 1 8  ? 51.037  17.285  36.934  1.00 39.62 ? 251  HIS D CG  1 
ATOM   2167 N ND1 . HIS D 1 8  ? 49.998  16.957  37.780  1.00 42.07 ? 251  HIS D ND1 1 
ATOM   2168 C CD2 . HIS D 1 8  ? 52.010  17.808  37.718  1.00 54.88 ? 251  HIS D CD2 1 
ATOM   2169 C CE1 . HIS D 1 8  ? 50.330  17.268  39.020  1.00 47.51 ? 251  HIS D CE1 1 
ATOM   2170 N NE2 . HIS D 1 8  ? 51.546  17.785  39.010  1.00 50.82 ? 251  HIS D NE2 1 
ATOM   2171 N N   . LEU D 1 9  ? 50.415  18.779  32.402  1.00 15.96 ? 252  LEU D N   1 
ATOM   2172 C CA  . LEU D 1 9  ? 50.388  18.629  30.967  1.00 19.19 ? 252  LEU D CA  1 
ATOM   2173 C C   . LEU D 1 9  ? 51.796  18.656  30.378  1.00 17.86 ? 252  LEU D C   1 
ATOM   2174 O O   . LEU D 1 9  ? 52.673  19.394  30.854  1.00 16.56 ? 252  LEU D O   1 
ATOM   2175 C CB  . LEU D 1 9  ? 49.543  19.732  30.338  1.00 17.92 ? 252  LEU D CB  1 
ATOM   2176 C CG  . LEU D 1 9  ? 48.079  19.938  30.757  1.00 19.70 ? 252  LEU D CG  1 
ATOM   2177 C CD1 . LEU D 1 9  ? 47.867  20.379  32.191  1.00 19.90 ? 252  LEU D CD1 1 
ATOM   2178 C CD2 . LEU D 1 9  ? 47.571  20.992  29.829  1.00 11.02 ? 252  LEU D CD2 1 
ATOM   2179 N N   . GLU D 1 10 ? 51.982  17.846  29.339  1.00 13.79 ? 253  GLU D N   1 
ATOM   2180 C CA  . GLU D 1 10 ? 53.188  17.827  28.540  1.00 18.51 ? 253  GLU D CA  1 
ATOM   2181 C C   . GLU D 1 10 ? 52.904  18.345  27.132  1.00 21.23 ? 253  GLU D C   1 
ATOM   2182 O O   . GLU D 1 10 ? 52.057  17.828  26.394  1.00 20.08 ? 253  GLU D O   1 
ATOM   2183 C CB  . GLU D 1 10 ? 53.750  16.413  28.498  1.00 20.13 ? 253  GLU D CB  1 
ATOM   2184 C CG  . GLU D 1 10 ? 54.184  15.953  29.873  1.00 34.01 ? 253  GLU D CG  1 
ATOM   2185 C CD  . GLU D 1 10 ? 54.745  14.557  29.882  1.00 56.38 ? 253  GLU D CD  1 
ATOM   2186 O OE1 . GLU D 1 10 ? 55.591  14.255  29.010  1.00 66.13 ? 253  GLU D OE1 1 
ATOM   2187 O OE2 . GLU D 1 10 ? 54.346  13.771  30.771  1.00 65.89 ? 253  GLU D OE2 1 
ATOM   2188 N N   . LYS D 1 11 ? 53.625  19.384  26.756  1.00 20.05 ? 254  LYS D N   1 
ATOM   2189 C CA  . LYS D 1 11 ? 53.348  20.094  25.524  1.00 21.23 ? 254  LYS D CA  1 
ATOM   2190 C C   . LYS D 1 11 ? 53.816  19.277  24.320  1.00 24.82 ? 254  LYS D C   1 
ATOM   2191 O O   . LYS D 1 11 ? 54.850  18.617  24.384  1.00 24.88 ? 254  LYS D O   1 
ATOM   2192 C CB  . LYS D 1 11 ? 54.088  21.424  25.599  1.00 23.01 ? 254  LYS D CB  1 
ATOM   2193 C CG  . LYS D 1 11 ? 53.719  22.478  24.590  1.00 23.24 ? 254  LYS D CG  1 
ATOM   2194 C CD  . LYS D 1 11 ? 54.444  23.806  24.955  1.00 26.76 ? 254  LYS D CD  1 
ATOM   2195 C CE  . LYS D 1 11 ? 54.917  24.549  23.719  1.00 27.89 ? 254  LYS D CE  1 
ATOM   2196 N NZ  . LYS D 1 11 ? 55.907  25.617  24.056  1.00 31.50 ? 254  LYS D NZ  1 
ATOM   2197 N N   . GLY D 1 12 ? 53.064  19.337  23.221  1.00 24.58 ? 255  GLY D N   1 
ATOM   2198 C CA  . GLY D 1 12 ? 53.462  18.701  21.961  1.00 20.90 ? 255  GLY D CA  1 
ATOM   2199 C C   . GLY D 1 12 ? 53.676  19.732  20.859  1.00 23.79 ? 255  GLY D C   1 
ATOM   2200 O O   . GLY D 1 12 ? 53.704  20.938  21.126  1.00 22.24 ? 255  GLY D O   1 
ATOM   2201 N N   . PRO D 1 13 ? 53.777  19.277  19.597  1.00 29.49 ? 256  PRO D N   1 
ATOM   2202 C CA  . PRO D 1 13 ? 54.159  20.220  18.541  1.00 32.20 ? 256  PRO D CA  1 
ATOM   2203 C C   . PRO D 1 13 ? 53.104  21.325  18.342  1.00 32.21 ? 256  PRO D C   1 
ATOM   2204 O O   . PRO D 1 13 ? 53.437  22.459  17.983  1.00 34.58 ? 256  PRO D O   1 
ATOM   2205 C CB  . PRO D 1 13 ? 54.304  19.331  17.283  1.00 33.41 ? 256  PRO D CB  1 
ATOM   2206 C CG  . PRO D 1 13 ? 54.216  17.919  17.744  1.00 32.62 ? 256  PRO D CG  1 
ATOM   2207 C CD  . PRO D 1 13 ? 53.499  17.931  19.070  1.00 31.51 ? 256  PRO D CD  1 
ATOM   2208 N N   . GLN D 1 14 ? 51.846  21.003  18.611  1.00 28.12 ? 257  GLN D N   1 
ATOM   2209 C CA  . GLN D 1 14 ? 50.792  21.983  18.461  1.00 26.40 ? 257  GLN D CA  1 
ATOM   2210 C C   . GLN D 1 14 ? 50.336  22.544  19.798  1.00 25.65 ? 257  GLN D C   1 
ATOM   2211 O O   . GLN D 1 14 ? 49.252  23.104  19.903  1.00 26.41 ? 257  GLN D O   1 
ATOM   2212 C CB  . GLN D 1 14 ? 49.656  21.391  17.637  1.00 30.06 ? 257  GLN D CB  1 
ATOM   2213 C CG  . GLN D 1 14 ? 50.048  21.242  16.157  1.00 35.80 ? 257  GLN D CG  1 
ATOM   2214 C CD  . GLN D 1 14 ? 50.606  22.550  15.549  1.00 51.48 ? 257  GLN D CD  1 
ATOM   2215 O OE1 . GLN D 1 14 ? 49.882  23.541  15.388  1.00 43.99 ? 257  GLN D OE1 1 
ATOM   2216 N NE2 . GLN D 1 14 ? 51.902  22.548  15.227  1.00 52.91 ? 257  GLN D NE2 1 
ATOM   2217 N N   . GLY D 1 15 ? 51.207  22.445  20.803  1.00 23.11 ? 258  GLY D N   1 
ATOM   2218 C CA  . GLY D 1 15 ? 50.986  23.078  22.083  1.00 19.08 ? 258  GLY D CA  1 
ATOM   2219 C C   . GLY D 1 15 ? 50.252  22.154  23.015  1.00 17.31 ? 258  GLY D C   1 
ATOM   2220 O O   . GLY D 1 15 ? 50.322  20.948  22.868  1.00 20.68 ? 258  GLY D O   1 
ATOM   2221 N N   . PHE D 1 16 ? 49.556  22.741  23.979  1.00 16.80 ? 259  PHE D N   1 
ATOM   2222 C CA  . PHE D 1 16 ? 48.808  22.009  25.005  1.00 17.57 ? 259  PHE D CA  1 
ATOM   2223 C C   . PHE D 1 16 ? 47.389  21.597  24.596  1.00 17.44 ? 259  PHE D C   1 
ATOM   2224 O O   . PHE D 1 16 ? 46.866  20.630  25.127  1.00 16.07 ? 259  PHE D O   1 
ATOM   2225 C CB  . PHE D 1 16 ? 48.756  22.829  26.301  1.00 15.59 ? 259  PHE D CB  1 
ATOM   2226 C CG  . PHE D 1 16 ? 50.105  23.069  26.927  1.00 21.08 ? 259  PHE D CG  1 
ATOM   2227 C CD1 . PHE D 1 16 ? 50.817  22.021  27.502  1.00 20.08 ? 259  PHE D CD1 1 
ATOM   2228 C CD2 . PHE D 1 16 ? 50.654  24.346  26.976  1.00 23.61 ? 259  PHE D CD2 1 
ATOM   2229 C CE1 . PHE D 1 16 ? 52.049  22.237  28.095  1.00 17.78 ? 259  PHE D CE1 1 
ATOM   2230 C CE2 . PHE D 1 16 ? 51.888  24.568  27.560  1.00 18.39 ? 259  PHE D CE2 1 
ATOM   2231 C CZ  . PHE D 1 16 ? 52.592  23.508  28.121  1.00 20.49 ? 259  PHE D CZ  1 
ATOM   2232 N N   . GLY D 1 17 ? 46.769  22.327  23.677  1.00 14.45 ? 260  GLY D N   1 
ATOM   2233 C CA  . GLY D 1 17 ? 45.433  21.984  23.193  1.00 16.96 ? 260  GLY D CA  1 
ATOM   2234 C C   . GLY D 1 17 ? 44.285  22.651  23.966  1.00 15.38 ? 260  GLY D C   1 
ATOM   2235 O O   . GLY D 1 17 ? 43.315  21.998  24.306  1.00 13.98 ? 260  GLY D O   1 
ATOM   2236 N N   . PHE D 1 18 ? 44.412  23.940  24.275  1.00 14.40 ? 261  PHE D N   1 
ATOM   2237 C CA  . PHE D 1 18 ? 43.278  24.690  24.852  1.00 14.58 ? 261  PHE D CA  1 
ATOM   2238 C C   . PHE D 1 18 ? 43.260  26.146  24.461  1.00 15.09 ? 261  PHE D C   1 
ATOM   2239 O O   . PHE D 1 18 ? 44.302  26.748  24.126  1.00 14.64 ? 261  PHE D O   1 
ATOM   2240 C CB  . PHE D 1 18 ? 43.105  24.503  26.396  1.00 16.83 ? 261  PHE D CB  1 
ATOM   2241 C CG  . PHE D 1 18 ? 44.213  25.087  27.256  1.00 16.85 ? 261  PHE D CG  1 
ATOM   2242 C CD1 . PHE D 1 18 ? 44.146  26.401  27.712  1.00 15.88 ? 261  PHE D CD1 1 
ATOM   2243 C CD2 . PHE D 1 18 ? 45.278  24.301  27.661  1.00 15.26 ? 261  PHE D CD2 1 
ATOM   2244 C CE1 . PHE D 1 18 ? 45.176  26.945  28.510  1.00 19.31 ? 261  PHE D CE1 1 
ATOM   2245 C CE2 . PHE D 1 18 ? 46.319  24.826  28.475  1.00 24.91 ? 261  PHE D CE2 1 
ATOM   2246 C CZ  . PHE D 1 18 ? 46.265  26.131  28.906  1.00 19.48 ? 261  PHE D CZ  1 
ATOM   2247 N N   . LEU D 1 19 ? 42.043  26.701  24.473  1.00 15.21 ? 262  LEU D N   1 
ATOM   2248 C CA  . LEU D 1 19 ? 41.789  28.126  24.249  1.00 17.63 ? 262  LEU D CA  1 
ATOM   2249 C C   . LEU D 1 19 ? 41.519  28.778  25.590  1.00 13.32 ? 262  LEU D C   1 
ATOM   2250 O O   . LEU D 1 19 ? 40.575  28.380  26.269  1.00 16.75 ? 262  LEU D O   1 
ATOM   2251 C CB  . LEU D 1 19 ? 40.565  28.318  23.332  1.00 19.18 ? 262  LEU D CB  1 
ATOM   2252 C CG  . LEU D 1 19 ? 40.122  29.747  22.977  1.00 17.11 ? 262  LEU D CG  1 
ATOM   2253 C CD1 . LEU D 1 19 ? 41.189  30.419  22.143  1.00 11.85 ? 262  LEU D CD1 1 
ATOM   2254 C CD2 . LEU D 1 19 ? 38.797  29.687  22.198  1.00 18.44 ? 262  LEU D CD2 1 
ATOM   2255 N N   . LEU D 1 20 ? 42.350  29.752  25.977  1.00 12.61 ? 263  LEU D N   1 
ATOM   2256 C CA  . LEU D 1 20 ? 42.143  30.544  27.192  1.00 12.33 ? 263  LEU D CA  1 
ATOM   2257 C C   . LEU D 1 20 ? 41.524  31.879  26.820  1.00 16.34 ? 263  LEU D C   1 
ATOM   2258 O O   . LEU D 1 20 ? 42.050  32.574  25.947  1.00 15.55 ? 263  LEU D O   1 
ATOM   2259 C CB  . LEU D 1 20 ? 43.480  30.763  27.914  1.00 11.04 ? 263  LEU D CB  1 
ATOM   2260 C CG  . LEU D 1 20 ? 43.417  31.332  29.318  1.00 16.49 ? 263  LEU D CG  1 
ATOM   2261 C CD1 . LEU D 1 20 ? 42.875  30.272  30.349  1.00 11.22 ? 263  LEU D CD1 1 
ATOM   2262 C CD2 . LEU D 1 20 ? 44.784  31.875  29.721  1.00 15.47 ? 263  LEU D CD2 1 
ATOM   2263 N N   . ARG D 1 21 ? 40.400  32.240  27.447  1.00 15.16 ? 264  ARG D N   1 
ATOM   2264 C CA  . ARG D 1 21 ? 39.745  33.500  27.173  1.00 15.26 ? 264  ARG D CA  1 
ATOM   2265 C C   . ARG D 1 21 ? 39.367  34.232  28.448  1.00 8.62  ? 264  ARG D C   1 
ATOM   2266 O O   . ARG D 1 21 ? 38.769  33.662  29.323  1.00 14.03 ? 264  ARG D O   1 
ATOM   2267 C CB  . ARG D 1 21 ? 38.446  33.318  26.367  1.00 16.45 ? 264  ARG D CB  1 
ATOM   2268 C CG  . ARG D 1 21 ? 37.684  34.653  26.208  1.00 16.33 ? 264  ARG D CG  1 
ATOM   2269 C CD  . ARG D 1 21 ? 36.329  34.578  25.497  1.00 25.63 ? 264  ARG D CD  1 
ATOM   2270 N NE  . ARG D 1 21 ? 36.406  34.040  24.156  1.00 36.33 ? 264  ARG D NE  1 
ATOM   2271 C CZ  . ARG D 1 21 ? 36.540  34.763  23.046  1.00 49.05 ? 264  ARG D CZ  1 
ATOM   2272 N NH1 . ARG D 1 21 ? 36.626  36.100  23.092  1.00 55.07 ? 264  ARG D NH1 1 
ATOM   2273 N NH2 . ARG D 1 21 ? 36.591  34.130  21.883  1.00 44.51 ? 264  ARG D NH2 1 
ATOM   2274 N N   . GLU D 1 22 ? 39.708  35.520  28.511  1.00 12.86 ? 265  GLU D N   1 
ATOM   2275 C CA  . GLU D 1 22 ? 39.383  36.373  29.665  1.00 14.36 ? 265  GLU D CA  1 
ATOM   2276 C C   . GLU D 1 22 ? 37.903  36.765  29.714  1.00 12.43 ? 265  GLU D C   1 
ATOM   2277 O O   . GLU D 1 22 ? 37.317  37.122  28.689  1.00 16.03 ? 265  GLU D O   1 
ATOM   2278 C CB  . GLU D 1 22 ? 40.222  37.662  29.618  1.00 15.00 ? 265  GLU D CB  1 
ATOM   2279 C CG  . GLU D 1 22 ? 39.922  38.668  30.769  1.00 9.12  ? 265  GLU D CG  1 
ATOM   2280 C CD  . GLU D 1 22 ? 41.014  39.696  30.873  1.00 12.39 ? 265  GLU D CD  1 
ATOM   2281 O OE1 . GLU D 1 22 ? 42.173  39.308  31.054  1.00 16.03 ? 265  GLU D OE1 1 
ATOM   2282 O OE2 . GLU D 1 22 ? 40.733  40.881  30.755  1.00 16.02 ? 265  GLU D OE2 1 
ATOM   2283 N N   . GLU D 1 23 ? 37.303  36.702  30.897  1.00 13.81 ? 266  GLU D N   1 
ATOM   2284 C CA  . GLU D 1 23 ? 36.065  37.427  31.140  1.00 12.43 ? 266  GLU D CA  1 
ATOM   2285 C C   . GLU D 1 23 ? 36.108  38.065  32.471  1.00 12.67 ? 266  GLU D C   1 
ATOM   2286 O O   . GLU D 1 23 ? 36.345  37.405  33.507  1.00 13.35 ? 266  GLU D O   1 
ATOM   2287 C CB  . GLU D 1 23 ? 34.829  36.524  31.112  1.00 17.30 ? 266  GLU D CB  1 
ATOM   2288 C CG  . GLU D 1 23 ? 34.529  35.892  29.767  1.00 16.67 ? 266  GLU D CG  1 
ATOM   2289 C CD  . GLU D 1 23 ? 33.960  36.835  28.716  1.00 20.41 ? 266  GLU D CD  1 
ATOM   2290 O OE1 . GLU D 1 23 ? 33.610  37.994  29.012  1.00 22.22 ? 266  GLU D OE1 1 
ATOM   2291 O OE2 . GLU D 1 23 ? 33.857  36.389  27.563  1.00 23.74 ? 266  GLU D OE2 1 
ATOM   2292 N N   . LYS D 1 24 ? 35.824  39.348  32.463  1.00 12.72 ? 267  LYS D N   1 
ATOM   2293 C CA  . LYS D 1 24 ? 35.741  40.090  33.711  1.00 16.88 ? 267  LYS D CA  1 
ATOM   2294 C C   . LYS D 1 24 ? 34.435  39.863  34.443  1.00 12.29 ? 267  LYS D C   1 
ATOM   2295 O O   . LYS D 1 24 ? 33.369  39.663  33.843  1.00 13.55 ? 267  LYS D O   1 
ATOM   2296 C CB  . LYS D 1 24 ? 35.989  41.567  33.462  1.00 14.96 ? 267  LYS D CB  1 
ATOM   2297 C CG  . LYS D 1 24 ? 37.461  41.887  33.204  1.00 16.63 ? 267  LYS D CG  1 
ATOM   2298 C CD  . LYS D 1 24 ? 37.615  43.305  32.681  1.00 28.89 ? 267  LYS D CD  1 
ATOM   2299 C CE  . LYS D 1 24 ? 39.069  43.757  32.747  1.00 33.97 ? 267  LYS D CE  1 
ATOM   2300 N NZ  . LYS D 1 24 ? 39.249  45.108  32.136  1.00 38.42 ? 267  LYS D NZ  1 
ATOM   2301 N N   . GLY D 1 25 ? 34.537  39.877  35.760  1.00 12.21 ? 268  GLY D N   1 
ATOM   2302 C CA  . GLY D 1 25 ? 33.385  39.760  36.632  1.00 10.40 ? 268  GLY D CA  1 
ATOM   2303 C C   . GLY D 1 25 ? 32.751  41.114  36.855  1.00 12.18 ? 268  GLY D C   1 
ATOM   2304 O O   . GLY D 1 25 ? 33.222  42.113  36.311  1.00 13.04 ? 268  GLY D O   1 
ATOM   2305 N N   . LEU D 1 26 ? 31.718  41.147  37.699  1.00 15.30 ? 269  LEU D N   1 
ATOM   2306 C CA  . LEU D 1 26 ? 30.924  42.366  37.963  1.00 18.37 ? 269  LEU D CA  1 
ATOM   2307 C C   . LEU D 1 26 ? 31.675  43.453  38.762  1.00 15.38 ? 269  LEU D C   1 
ATOM   2308 O O   . LEU D 1 26 ? 31.289  44.622  38.736  1.00 21.29 ? 269  LEU D O   1 
ATOM   2309 C CB  . LEU D 1 26 ? 29.610  42.004  38.690  1.00 23.35 ? 269  LEU D CB  1 
ATOM   2310 C CG  . LEU D 1 26 ? 28.489  41.366  37.863  1.00 15.45 ? 269  LEU D CG  1 
ATOM   2311 C CD1 . LEU D 1 26 ? 27.222  41.207  38.720  1.00 21.91 ? 269  LEU D CD1 1 
ATOM   2312 C CD2 . LEU D 1 26 ? 28.172  42.210  36.627  1.00 31.12 ? 269  LEU D CD2 1 
ATOM   2313 N N   . ASP D 1 27 ? 32.720  43.056  39.488  1.00 12.75 ? 270  ASP D N   1 
ATOM   2314 C CA  . ASP D 1 27 ? 33.624  44.016  40.151  1.00 9.74  ? 270  ASP D CA  1 
ATOM   2315 C C   . ASP D 1 27 ? 34.833  44.325  39.248  1.00 13.59 ? 270  ASP D C   1 
ATOM   2316 O O   . ASP D 1 27 ? 35.784  45.010  39.645  1.00 13.90 ? 270  ASP D O   1 
ATOM   2317 C CB  . ASP D 1 27 ? 34.071  43.474  41.512  1.00 9.33  ? 270  ASP D CB  1 
ATOM   2318 C CG  . ASP D 1 27 ? 34.861  42.193  41.392  1.00 12.12 ? 270  ASP D CG  1 
ATOM   2319 O OD1 . ASP D 1 27 ? 35.124  41.795  40.254  1.00 13.56 ? 270  ASP D OD1 1 
ATOM   2320 O OD2 . ASP D 1 27 ? 35.217  41.592  42.420  1.00 16.19 ? 270  ASP D OD2 1 
ATOM   2321 N N   . GLY D 1 28 ? 34.791  43.808  38.031  1.00 13.87 ? 271  GLY D N   1 
ATOM   2322 C CA  . GLY D 1 28 ? 35.807  44.122  37.032  1.00 14.62 ? 271  GLY D CA  1 
ATOM   2323 C C   . GLY D 1 28 ? 37.020  43.208  37.087  1.00 12.81 ? 271  GLY D C   1 
ATOM   2324 O O   . GLY D 1 28 ? 37.910  43.338  36.268  1.00 9.56  ? 271  GLY D O   1 
ATOM   2325 N N   . ARG D 1 29 ? 37.054  42.259  38.025  1.00 15.75 ? 272  ARG D N   1 
ATOM   2326 C CA  . ARG D 1 29 ? 38.222  41.400  38.167  1.00 16.04 ? 272  ARG D CA  1 
ATOM   2327 C C   . ARG D 1 29 ? 38.252  40.359  37.063  1.00 11.98 ? 272  ARG D C   1 
ATOM   2328 O O   . ARG D 1 29 ? 37.214  39.731  36.768  1.00 12.66 ? 272  ARG D O   1 
ATOM   2329 C CB  . ARG D 1 29 ? 38.288  40.754  39.556  1.00 14.99 ? 272  ARG D CB  1 
ATOM   2330 C CG  . ARG D 1 29 ? 38.860  41.703  40.611  1.00 11.63 ? 272  ARG D CG  1 
ATOM   2331 C CD  . ARG D 1 29 ? 39.206  40.966  41.898  1.00 23.03 ? 272  ARG D CD  1 
ATOM   2332 N NE  . ARG D 1 29 ? 37.996  40.509  42.592  1.00 21.60 ? 272  ARG D NE  1 
ATOM   2333 C CZ  . ARG D 1 29 ? 37.987  39.610  43.573  1.00 30.78 ? 272  ARG D CZ  1 
ATOM   2334 N NH1 . ARG D 1 29 ? 39.121  39.034  43.974  1.00 34.60 ? 272  ARG D NH1 1 
ATOM   2335 N NH2 . ARG D 1 29 ? 36.838  39.276  44.153  1.00 26.83 ? 272  ARG D NH2 1 
ATOM   2336 N N   . PRO D 1 30 ? 39.409  40.232  36.395  1.00 12.42 ? 273  PRO D N   1 
ATOM   2337 C CA  . PRO D 1 30 ? 39.523  39.267  35.324  1.00 13.83 ? 273  PRO D CA  1 
ATOM   2338 C C   . PRO D 1 30 ? 39.558  37.807  35.761  1.00 15.97 ? 273  PRO D C   1 
ATOM   2339 O O   . PRO D 1 30 ? 40.348  37.430  36.636  1.00 16.35 ? 273  PRO D O   1 
ATOM   2340 C CB  . PRO D 1 30 ? 40.847  39.648  34.667  1.00 10.55 ? 273  PRO D CB  1 
ATOM   2341 C CG  . PRO D 1 30 ? 41.616  40.313  35.691  1.00 21.26 ? 273  PRO D CG  1 
ATOM   2342 C CD  . PRO D 1 30 ? 40.640  41.036  36.529  1.00 8.86  ? 273  PRO D CD  1 
ATOM   2343 N N   . GLY D 1 31 ? 38.721  36.994  35.129  1.00 16.59 ? 274  GLY D N   1 
ATOM   2344 C CA  . GLY D 1 31 ? 38.868  35.536  35.174  1.00 17.02 ? 274  GLY D CA  1 
ATOM   2345 C C   . GLY D 1 31 ? 39.426  35.009  33.881  1.00 15.34 ? 274  GLY D C   1 
ATOM   2346 O O   . GLY D 1 31 ? 39.151  35.562  32.828  1.00 10.83 ? 274  GLY D O   1 
ATOM   2347 N N   . GLN D 1 32 ? 40.198  33.926  33.956  1.00 16.08 ? 275  GLN D N   1 
ATOM   2348 C CA  . GLN D 1 32 ? 40.748  33.304  32.762  1.00 17.05 ? 275  GLN D CA  1 
ATOM   2349 C C   . GLN D 1 32 ? 40.124  31.924  32.641  1.00 15.28 ? 275  GLN D C   1 
ATOM   2350 O O   . GLN D 1 32 ? 40.301  31.080  33.516  1.00 11.82 ? 275  GLN D O   1 
ATOM   2351 C CB  . GLN D 1 32 ? 42.278  33.238  32.846  1.00 16.87 ? 275  GLN D CB  1 
ATOM   2352 C CG  . GLN D 1 32 ? 42.973  34.582  33.048  1.00 10.02 ? 275  GLN D CG  1 
ATOM   2353 C CD  . GLN D 1 32 ? 42.678  35.657  31.985  1.00 12.79 ? 275  GLN D CD  1 
ATOM   2354 O OE1 . GLN D 1 32 ? 42.541  35.379  30.772  1.00 15.42 ? 275  GLN D OE1 1 
ATOM   2355 N NE2 . GLN D 1 32 ? 42.633  36.905  32.437  1.00 10.64 ? 275  GLN D NE2 1 
ATOM   2356 N N   . PHE D 1 33 ? 39.359  31.726  31.572  1.00 15.45 ? 276  PHE D N   1 
ATOM   2357 C CA  . PHE D 1 33 ? 38.569  30.509  31.402  1.00 14.79 ? 276  PHE D CA  1 
ATOM   2358 C C   . PHE D 1 33 ? 39.114  29.613  30.291  1.00 13.90 ? 276  PHE D C   1 
ATOM   2359 O O   . PHE D 1 33 ? 39.587  30.104  29.274  1.00 14.90 ? 276  PHE D O   1 
ATOM   2360 C CB  . PHE D 1 33 ? 37.102  30.891  31.138  1.00 13.81 ? 276  PHE D CB  1 
ATOM   2361 C CG  . PHE D 1 33 ? 36.481  31.607  32.301  1.00 15.02 ? 276  PHE D CG  1 
ATOM   2362 C CD1 . PHE D 1 33 ? 35.973  30.883  33.391  1.00 9.57  ? 276  PHE D CD1 1 
ATOM   2363 C CD2 . PHE D 1 33 ? 36.534  32.967  32.389  1.00 16.09 ? 276  PHE D CD2 1 
ATOM   2364 C CE1 . PHE D 1 33 ? 35.461  31.534  34.490  1.00 17.16 ? 276  PHE D CE1 1 
ATOM   2365 C CE2 . PHE D 1 33 ? 36.025  33.631  33.545  1.00 12.73 ? 276  PHE D CE2 1 
ATOM   2366 C CZ  . PHE D 1 33 ? 35.500  32.925  34.558  1.00 12.76 ? 276  PHE D CZ  1 
ATOM   2367 N N   . LEU D 1 34 ? 39.062  28.297  30.507  1.00 12.95 ? 277  LEU D N   1 
ATOM   2368 C CA  . LEU D 1 34 ? 39.432  27.342  29.451  1.00 14.55 ? 277  LEU D CA  1 
ATOM   2369 C C   . LEU D 1 34 ? 38.157  27.169  28.595  1.00 15.18 ? 277  LEU D C   1 
ATOM   2370 O O   . LEU D 1 34 ? 37.188  26.472  28.974  1.00 15.14 ? 277  LEU D O   1 
ATOM   2371 C CB  . LEU D 1 34 ? 39.979  26.024  30.046  1.00 16.63 ? 277  LEU D CB  1 
ATOM   2372 C CG  . LEU D 1 34 ? 41.083  26.243  31.120  1.00 15.86 ? 277  LEU D CG  1 
ATOM   2373 C CD1 . LEU D 1 34 ? 41.301  24.995  31.966  1.00 40.88 ? 277  LEU D CD1 1 
ATOM   2374 C CD2 . LEU D 1 34 ? 42.393  26.731  30.512  1.00 32.06 ? 277  LEU D CD2 1 
ATOM   2375 N N   . TRP D 1 35 ? 38.146  27.883  27.471  1.00 13.49 ? 278  TRP D N   1 
ATOM   2376 C CA  . TRP D 1 35 ? 36.944  28.091  26.662  1.00 16.24 ? 278  TRP D CA  1 
ATOM   2377 C C   . TRP D 1 35 ? 36.660  26.923  25.756  1.00 18.39 ? 278  TRP D C   1 
ATOM   2378 O O   . TRP D 1 35 ? 35.507  26.567  25.510  1.00 15.76 ? 278  TRP D O   1 
ATOM   2379 C CB  . TRP D 1 35 ? 37.112  29.325  25.804  1.00 14.49 ? 278  TRP D CB  1 
ATOM   2380 C CG  . TRP D 1 35 ? 35.813  30.045  25.526  1.00 17.40 ? 278  TRP D CG  1 
ATOM   2381 C CD1 . TRP D 1 35 ? 35.006  29.888  24.438  1.00 23.37 ? 278  TRP D CD1 1 
ATOM   2382 C CD2 . TRP D 1 35 ? 35.189  31.059  26.345  1.00 16.47 ? 278  TRP D CD2 1 
ATOM   2383 N NE1 . TRP D 1 35 ? 33.905  30.722  24.545  1.00 18.99 ? 278  TRP D NE1 1 
ATOM   2384 C CE2 . TRP D 1 35 ? 33.998  31.449  25.699  1.00 18.06 ? 278  TRP D CE2 1 
ATOM   2385 C CE3 . TRP D 1 35 ? 35.505  31.646  27.571  1.00 19.78 ? 278  TRP D CE3 1 
ATOM   2386 C CZ2 . TRP D 1 35 ? 33.129  32.424  26.231  1.00 14.70 ? 278  TRP D CZ2 1 
ATOM   2387 C CZ3 . TRP D 1 35 ? 34.639  32.624  28.106  1.00 20.98 ? 278  TRP D CZ3 1 
ATOM   2388 C CH2 . TRP D 1 35 ? 33.468  32.992  27.438  1.00 18.92 ? 278  TRP D CH2 1 
ATOM   2389 N N   . GLU D 1 36 ? 37.730  26.342  25.241  1.00 15.24 ? 279  GLU D N   1 
ATOM   2390 C CA  . GLU D 1 36 ? 37.637  25.180  24.385  1.00 18.35 ? 279  GLU D CA  1 
ATOM   2391 C C   . GLU D 1 36 ? 38.797  24.279  24.722  1.00 15.09 ? 279  GLU D C   1 
ATOM   2392 O O   . GLU D 1 36 ? 39.889  24.749  25.046  1.00 17.03 ? 279  GLU D O   1 
ATOM   2393 C CB  . GLU D 1 36 ? 37.739  25.612  22.943  1.00 20.10 ? 279  GLU D CB  1 
ATOM   2394 C CG  . GLU D 1 36 ? 36.634  26.498  22.462  1.00 32.57 ? 279  GLU D CG  1 
ATOM   2395 C CD  . GLU D 1 36 ? 36.887  27.018  21.052  1.00 44.49 ? 279  GLU D CD  1 
ATOM   2396 O OE1 . GLU D 1 36 ? 37.721  26.424  20.328  1.00 48.96 ? 279  GLU D OE1 1 
ATOM   2397 O OE2 . GLU D 1 36 ? 36.242  28.024  20.669  1.00 56.83 ? 279  GLU D OE2 1 
ATOM   2398 N N   . VAL D 1 37 ? 38.561  22.986  24.682  1.00 14.81 ? 280  VAL D N   1 
ATOM   2399 C CA  . VAL D 1 37 ? 39.630  22.030  24.913  1.00 20.62 ? 280  VAL D CA  1 
ATOM   2400 C C   . VAL D 1 37 ? 39.678  21.091  23.719  1.00 23.05 ? 280  VAL D C   1 
ATOM   2401 O O   . VAL D 1 37 ? 38.736  20.334  23.436  1.00 20.11 ? 280  VAL D O   1 
ATOM   2402 C CB  . VAL D 1 37 ? 39.477  21.271  26.242  1.00 22.43 ? 280  VAL D CB  1 
ATOM   2403 C CG1 . VAL D 1 37 ? 40.633  20.296  26.406  1.00 18.16 ? 280  VAL D CG1 1 
ATOM   2404 C CG2 . VAL D 1 37 ? 39.450  22.271  27.397  1.00 15.27 ? 280  VAL D CG2 1 
ATOM   2405 N N   . ASP D 1 38 ? 40.797  21.148  23.022  1.00 16.01 ? 281  ASP D N   1 
ATOM   2406 C CA  . ASP D 1 38 ? 40.900  20.478  21.737  1.00 20.86 ? 281  ASP D CA  1 
ATOM   2407 C C   . ASP D 1 38 ? 41.010  18.969  21.871  1.00 15.76 ? 281  ASP D C   1 
ATOM   2408 O O   . ASP D 1 38 ? 41.734  18.461  22.723  1.00 16.56 ? 281  ASP D O   1 
ATOM   2409 C CB  . ASP D 1 38 ? 42.076  21.061  20.955  1.00 14.23 ? 281  ASP D CB  1 
ATOM   2410 C CG  . ASP D 1 38 ? 42.020  22.600  20.914  1.00 34.74 ? 281  ASP D CG  1 
ATOM   2411 O OD1 . ASP D 1 38 ? 40.890  23.149  20.828  1.00 43.04 ? 281  ASP D OD1 1 
ATOM   2412 O OD2 . ASP D 1 38 ? 43.080  23.255  21.031  1.00 37.58 ? 281  ASP D OD2 1 
ATOM   2413 N N   . PRO D 1 39 ? 40.265  18.248  21.029  1.00 19.53 ? 282  PRO D N   1 
ATOM   2414 C CA  . PRO D 1 39 ? 40.346  16.797  20.970  1.00 16.78 ? 282  PRO D CA  1 
ATOM   2415 C C   . PRO D 1 39 ? 41.719  16.264  20.545  1.00 13.77 ? 282  PRO D C   1 
ATOM   2416 O O   . PRO D 1 39 ? 42.358  16.799  19.639  1.00 10.54 ? 282  PRO D O   1 
ATOM   2417 C CB  . PRO D 1 39 ? 39.256  16.400  19.950  1.00 18.74 ? 282  PRO D CB  1 
ATOM   2418 C CG  . PRO D 1 39 ? 38.698  17.611  19.407  1.00 24.27 ? 282  PRO D CG  1 
ATOM   2419 C CD  . PRO D 1 39 ? 39.277  18.806  20.090  1.00 19.77 ? 282  PRO D CD  1 
ATOM   2420 N N   . GLY D 1 40 ? 42.164  15.226  21.233  1.00 10.24 ? 283  GLY D N   1 
ATOM   2421 C CA  . GLY D 1 40 ? 43.408  14.550  20.909  1.00 9.01  ? 283  GLY D CA  1 
ATOM   2422 C C   . GLY D 1 40 ? 44.675  15.279  21.233  1.00 6.61  ? 283  GLY D C   1 
ATOM   2423 O O   . GLY D 1 40 ? 45.714  14.975  20.672  1.00 7.21  ? 283  GLY D O   1 
ATOM   2424 N N   . LEU D 1 41 ? 44.598  16.243  22.141  1.00 14.30 ? 284  LEU D N   1 
ATOM   2425 C CA  . LEU D 1 41 ? 45.755  17.021  22.532  1.00 13.78 ? 284  LEU D CA  1 
ATOM   2426 C C   . LEU D 1 41 ? 45.940  16.923  24.053  1.00 13.92 ? 284  LEU D C   1 
ATOM   2427 O O   . LEU D 1 41 ? 45.061  16.419  24.719  1.00 13.94 ? 284  LEU D O   1 
ATOM   2428 C CB  . LEU D 1 41 ? 45.595  18.453  22.034  1.00 12.52 ? 284  LEU D CB  1 
ATOM   2429 C CG  . LEU D 1 41 ? 45.687  18.633  20.514  1.00 19.39 ? 284  LEU D CG  1 
ATOM   2430 C CD1 . LEU D 1 41 ? 45.481  20.118  20.176  1.00 20.10 ? 284  LEU D CD1 1 
ATOM   2431 C CD2 . LEU D 1 41 ? 47.003  18.134  19.960  1.00 22.35 ? 284  LEU D CD2 1 
ATOM   2432 N N   . PRO D 1 42 ? 47.122  17.327  24.585  1.00 15.68 ? 285  PRO D N   1 
ATOM   2433 C CA  . PRO D 1 42 ? 47.491  17.086  25.992  1.00 17.81 ? 285  PRO D CA  1 
ATOM   2434 C C   . PRO D 1 42 ? 46.455  17.486  27.079  1.00 17.83 ? 285  PRO D C   1 
ATOM   2435 O O   . PRO D 1 42 ? 46.265  16.753  28.063  1.00 17.74 ? 285  PRO D O   1 
ATOM   2436 C CB  . PRO D 1 42 ? 48.818  17.860  26.135  1.00 16.69 ? 285  PRO D CB  1 
ATOM   2437 C CG  . PRO D 1 42 ? 49.405  17.762  24.782  1.00 18.78 ? 285  PRO D CG  1 
ATOM   2438 C CD  . PRO D 1 42 ? 48.236  17.959  23.852  1.00 16.84 ? 285  PRO D CD  1 
ATOM   2439 N N   . ALA D 1 43 ? 45.756  18.588  26.877  1.00 15.11 ? 286  ALA D N   1 
ATOM   2440 C CA  . ALA D 1 43 ? 44.876  19.145  27.902  1.00 14.80 ? 286  ALA D CA  1 
ATOM   2441 C C   . ALA D 1 43 ? 43.611  18.303  28.047  1.00 18.43 ? 286  ALA D C   1 
ATOM   2442 O O   . ALA D 1 43 ? 43.244  17.884  29.159  1.00 17.97 ? 286  ALA D O   1 
ATOM   2443 C CB  . ALA D 1 43 ? 44.522  20.548  27.552  1.00 12.97 ? 286  ALA D CB  1 
ATOM   2444 N N   . LYS D 1 44 ? 42.943  18.063  26.927  1.00 18.02 ? 287  LYS D N   1 
ATOM   2445 C CA  . LYS D 1 44 ? 41.848  17.094  26.882  1.00 21.90 ? 287  LYS D CA  1 
ATOM   2446 C C   . LYS D 1 44 ? 42.292  15.770  27.486  1.00 25.07 ? 287  LYS D C   1 
ATOM   2447 O O   . LYS D 1 44 ? 41.662  15.228  28.395  1.00 26.59 ? 287  LYS D O   1 
ATOM   2448 C CB  . LYS D 1 44 ? 41.411  16.854  25.438  1.00 22.15 ? 287  LYS D CB  1 
ATOM   2449 C CG  . LYS D 1 44 ? 40.309  15.799  25.252  1.00 30.35 ? 287  LYS D CG  1 
ATOM   2450 C CD  . LYS D 1 44 ? 38.910  16.394  25.348  1.00 34.76 ? 287  LYS D CD  1 
ATOM   2451 C CE  . LYS D 1 44 ? 37.876  15.462  24.705  1.00 41.38 ? 287  LYS D CE  1 
ATOM   2452 N NZ  . LYS D 1 44 ? 36.982  16.172  23.746  1.00 51.80 ? 287  LYS D NZ  1 
ATOM   2453 N N   . LYS D 1 45 ? 43.390  15.241  26.969  1.00 28.05 ? 288  LYS D N   1 
ATOM   2454 C CA  . LYS D 1 45 ? 43.842  13.930  27.392  1.00 28.68 ? 288  LYS D CA  1 
ATOM   2455 C C   . LYS D 1 45 ? 44.255  13.928  28.866  1.00 28.04 ? 288  LYS D C   1 
ATOM   2456 O O   . LYS D 1 45 ? 44.286  12.875  29.472  1.00 30.50 ? 288  LYS D O   1 
ATOM   2457 C CB  . LYS D 1 45 ? 44.941  13.399  26.453  1.00 28.96 ? 288  LYS D CB  1 
ATOM   2458 C CG  . LYS D 1 45 ? 44.417  13.155  25.016  1.00 25.32 ? 288  LYS D CG  1 
ATOM   2459 C CD  . LYS D 1 45 ? 45.523  12.894  23.993  1.00 22.98 ? 288  LYS D CD  1 
ATOM   2460 C CE  . LYS D 1 45 ? 46.166  11.575  24.191  1.00 13.44 ? 288  LYS D CE  1 
ATOM   2461 N NZ  . LYS D 1 45 ? 46.654  10.956  22.924  1.00 15.31 ? 288  LYS D NZ  1 
ATOM   2462 N N   . ALA D 1 46 ? 44.501  15.104  29.451  1.00 28.13 ? 289  ALA D N   1 
ATOM   2463 C CA  . ALA D 1 46 ? 44.900  15.217  30.866  1.00 26.63 ? 289  ALA D CA  1 
ATOM   2464 C C   . ALA D 1 46 ? 43.773  15.636  31.830  1.00 29.31 ? 289  ALA D C   1 
ATOM   2465 O O   . ALA D 1 46 ? 44.045  16.000  32.991  1.00 33.85 ? 289  ALA D O   1 
ATOM   2466 C CB  . ALA D 1 46 ? 46.083  16.153  31.012  1.00 23.15 ? 289  ALA D CB  1 
ATOM   2467 N N   . GLY D 1 47 ? 42.530  15.571  31.355  1.00 27.83 ? 290  GLY D N   1 
ATOM   2468 C CA  . GLY D 1 47 ? 41.358  15.816  32.181  1.00 27.53 ? 290  GLY D CA  1 
ATOM   2469 C C   . GLY D 1 47 ? 40.742  17.209  32.133  1.00 28.54 ? 290  GLY D C   1 
ATOM   2470 O O   . GLY D 1 47 ? 39.724  17.448  32.783  1.00 29.05 ? 290  GLY D O   1 
ATOM   2471 N N   . MET D 1 48 ? 41.326  18.129  31.369  1.00 24.81 ? 291  MET D N   1 
ATOM   2472 C CA  . MET D 1 48 ? 40.808  19.490  31.322  1.00 20.87 ? 291  MET D CA  1 
ATOM   2473 C C   . MET D 1 48 ? 39.438  19.526  30.648  1.00 20.48 ? 291  MET D C   1 
ATOM   2474 O O   . MET D 1 48 ? 39.203  18.792  29.700  1.00 11.86 ? 291  MET D O   1 
ATOM   2475 C CB  A MET D 1 48 ? 41.803  20.429  30.645  0.50 20.26 ? 291  MET D CB  1 
ATOM   2476 C CB  B MET D 1 48 ? 41.783  20.420  30.588  0.50 19.33 ? 291  MET D CB  1 
ATOM   2477 C CG  A MET D 1 48 ? 42.982  20.722  31.547  0.50 27.18 ? 291  MET D CG  1 
ATOM   2478 C CG  B MET D 1 48 ? 41.331  21.881  30.535  0.50 20.43 ? 291  MET D CG  1 
ATOM   2479 S SD  A MET D 1 48 ? 44.276  21.739  30.855  0.50 29.14 ? 291  MET D SD  1 
ATOM   2480 S SD  B MET D 1 48 ? 42.444  22.967  29.636  0.50 23.61 ? 291  MET D SD  1 
ATOM   2481 C CE  A MET D 1 48 ? 43.337  23.161  30.308  0.50 44.57 ? 291  MET D CE  1 
ATOM   2482 C CE  B MET D 1 48 ? 43.771  23.128  30.838  0.50 33.33 ? 291  MET D CE  1 
ATOM   2483 N N   . GLN D 1 49 ? 38.540  20.366  31.179  1.00 21.01 ? 292  GLN D N   1 
ATOM   2484 C CA  . GLN D 1 49 ? 37.188  20.560  30.649  1.00 22.14 ? 292  GLN D CA  1 
ATOM   2485 C C   . GLN D 1 49 ? 36.960  21.977  30.161  1.00 21.19 ? 292  GLN D C   1 
ATOM   2486 O O   . GLN D 1 49 ? 37.350  22.932  30.829  1.00 19.17 ? 292  GLN D O   1 
ATOM   2487 C CB  . GLN D 1 49 ? 36.134  20.281  31.727  1.00 22.40 ? 292  GLN D CB  1 
ATOM   2488 C CG  . GLN D 1 49 ? 36.053  18.859  32.206  1.00 31.15 ? 292  GLN D CG  1 
ATOM   2489 C CD  . GLN D 1 49 ? 35.146  18.716  33.419  1.00 33.75 ? 292  GLN D CD  1 
ATOM   2490 O OE1 . GLN D 1 49 ? 34.394  19.640  33.774  1.00 34.43 ? 292  GLN D OE1 1 
ATOM   2491 N NE2 . GLN D 1 49 ? 35.211  17.555  34.064  1.00 47.46 ? 292  GLN D NE2 1 
ATOM   2492 N N   . ALA D 1 50 ? 36.291  22.114  29.019  1.00 18.65 ? 293  ALA D N   1 
ATOM   2493 C CA  . ALA D 1 50 ? 35.863  23.429  28.577  1.00 23.93 ? 293  ALA D CA  1 
ATOM   2494 C C   . ALA D 1 50 ? 34.956  23.930  29.687  1.00 17.95 ? 293  ALA D C   1 
ATOM   2495 O O   . ALA D 1 50 ? 34.174  23.170  30.227  1.00 16.53 ? 293  ALA D O   1 
ATOM   2496 C CB  . ALA D 1 50 ? 35.138  23.383  27.221  1.00 20.69 ? 293  ALA D CB  1 
ATOM   2497 N N   . GLY D 1 51 ? 35.096  25.194  30.050  1.00 16.71 ? 294  GLY D N   1 
ATOM   2498 C CA  . GLY D 1 51 ? 34.332  25.770  31.171  1.00 18.65 ? 294  GLY D CA  1 
ATOM   2499 C C   . GLY D 1 51 ? 35.126  25.875  32.472  1.00 19.28 ? 294  GLY D C   1 
ATOM   2500 O O   . GLY D 1 51 ? 34.741  26.595  33.383  1.00 16.11 ? 294  GLY D O   1 
ATOM   2501 N N   . ASP D 1 52 ? 36.218  25.121  32.585  1.00 16.86 ? 295  ASP D N   1 
ATOM   2502 C CA  . ASP D 1 52 ? 37.162  25.292  33.702  1.00 12.99 ? 295  ASP D CA  1 
ATOM   2503 C C   . ASP D 1 52 ? 37.662  26.716  33.832  1.00 9.96  ? 295  ASP D C   1 
ATOM   2504 O O   . ASP D 1 52 ? 37.906  27.397  32.830  1.00 15.64 ? 295  ASP D O   1 
ATOM   2505 C CB  . ASP D 1 52 ? 38.398  24.415  33.499  1.00 15.08 ? 295  ASP D CB  1 
ATOM   2506 C CG  . ASP D 1 52 ? 38.137  22.971  33.752  1.00 17.13 ? 295  ASP D CG  1 
ATOM   2507 O OD1 . ASP D 1 52 ? 37.033  22.650  34.199  1.00 18.92 ? 295  ASP D OD1 1 
ATOM   2508 O OD2 . ASP D 1 52 ? 39.033  22.154  33.474  1.00 13.39 ? 295  ASP D OD2 1 
ATOM   2509 N N   . ARG D 1 53 ? 37.842  27.154  35.077  1.00 15.75 ? 296  ARG D N   1 
ATOM   2510 C CA  . ARG D 1 53 ? 38.501  28.419  35.364  1.00 13.89 ? 296  ARG D CA  1 
ATOM   2511 C C   . ARG D 1 53 ? 39.917  28.111  35.823  1.00 8.74  ? 296  ARG D C   1 
ATOM   2512 O O   . ARG D 1 53 ? 40.128  27.271  36.690  1.00 13.54 ? 296  ARG D O   1 
ATOM   2513 C CB  . ARG D 1 53 ? 37.771  29.204  36.441  1.00 16.63 ? 296  ARG D CB  1 
ATOM   2514 C CG  . ARG D 1 53 ? 38.383  30.613  36.686  1.00 13.60 ? 296  ARG D CG  1 
ATOM   2515 C CD  . ARG D 1 53 ? 37.590  31.402  37.719  1.00 18.50 ? 296  ARG D CD  1 
ATOM   2516 N NE  . ARG D 1 53 ? 37.817  30.818  39.034  1.00 22.24 ? 296  ARG D NE  1 
ATOM   2517 C CZ  . ARG D 1 53 ? 37.205  31.172  40.141  1.00 21.65 ? 296  ARG D CZ  1 
ATOM   2518 N NH1 . ARG D 1 53 ? 36.265  32.111  40.130  1.00 35.25 ? 296  ARG D NH1 1 
ATOM   2519 N NH2 . ARG D 1 53 ? 37.507  30.555  41.274  1.00 26.73 ? 296  ARG D NH2 1 
ATOM   2520 N N   . LEU D 1 54 ? 40.888  28.793  35.237  1.00 12.21 ? 297  LEU D N   1 
ATOM   2521 C CA  . LEU D 1 54 ? 42.287  28.599  35.618  1.00 12.45 ? 297  LEU D CA  1 
ATOM   2522 C C   . LEU D 1 54 ? 42.574  29.371  36.897  1.00 15.11 ? 297  LEU D C   1 
ATOM   2523 O O   . LEU D 1 54 ? 42.327  30.579  36.973  1.00 13.29 ? 297  LEU D O   1 
ATOM   2524 C CB  . LEU D 1 54 ? 43.211  29.044  34.483  1.00 14.76 ? 297  LEU D CB  1 
ATOM   2525 C CG  . LEU D 1 54 ? 44.710  28.835  34.676  1.00 16.01 ? 297  LEU D CG  1 
ATOM   2526 C CD1 . LEU D 1 54 ? 45.016  27.355  34.829  1.00 10.61 ? 297  LEU D CD1 1 
ATOM   2527 C CD2 . LEU D 1 54 ? 45.462  29.461  33.485  1.00 14.06 ? 297  LEU D CD2 1 
ATOM   2528 N N   . VAL D 1 55 ? 43.054  28.672  37.932  1.00 13.71 ? 298  VAL D N   1 
ATOM   2529 C CA  . VAL D 1 55 ? 43.260  29.334  39.205  1.00 14.07 ? 298  VAL D CA  1 
ATOM   2530 C C   . VAL D 1 55 ? 44.728  29.381  39.601  1.00 13.93 ? 298  VAL D C   1 
ATOM   2531 O O   . VAL D 1 55 ? 45.107  30.242  40.392  1.00 13.60 ? 298  VAL D O   1 
ATOM   2532 C CB  . VAL D 1 55 ? 42.353  28.768  40.334  1.00 15.14 ? 298  VAL D CB  1 
ATOM   2533 C CG1 . VAL D 1 55 ? 40.901  28.902  39.931  1.00 10.36 ? 298  VAL D CG1 1 
ATOM   2534 C CG2 . VAL D 1 55 ? 42.691  27.342  40.655  1.00 12.51 ? 298  VAL D CG2 1 
ATOM   2535 N N   . ALA D 1 56 ? 45.548  28.497  39.033  1.00 13.87 ? 299  ALA D N   1 
ATOM   2536 C CA  . ALA D 1 56 ? 46.980  28.496  39.325  1.00 16.56 ? 299  ALA D CA  1 
ATOM   2537 C C   . ALA D 1 56 ? 47.819  27.954  38.177  1.00 13.97 ? 299  ALA D C   1 
ATOM   2538 O O   . ALA D 1 56 ? 47.328  27.206  37.331  1.00 18.24 ? 299  ALA D O   1 
ATOM   2539 C CB  . ALA D 1 56 ? 47.271  27.731  40.644  1.00 14.05 ? 299  ALA D CB  1 
ATOM   2540 N N   . VAL D 1 57 ? 49.069  28.408  38.103  1.00 12.89 ? 300  VAL D N   1 
ATOM   2541 C CA  . VAL D 1 57 ? 50.006  27.932  37.091  1.00 14.09 ? 300  VAL D CA  1 
ATOM   2542 C C   . VAL D 1 57 ? 51.299  27.674  37.811  1.00 17.15 ? 300  VAL D C   1 
ATOM   2543 O O   . VAL D 1 57 ? 51.849  28.589  38.450  1.00 17.96 ? 300  VAL D O   1 
ATOM   2544 C CB  . VAL D 1 57 ? 50.293  28.953  35.936  1.00 14.85 ? 300  VAL D CB  1 
ATOM   2545 C CG1 . VAL D 1 57 ? 51.473  28.457  35.091  1.00 11.41 ? 300  VAL D CG1 1 
ATOM   2546 C CG2 . VAL D 1 57 ? 49.070  29.169  35.039  1.00 10.93 ? 300  VAL D CG2 1 
ATOM   2547 N N   . ALA D 1 58 ? 51.788  26.437  37.716  1.00 16.98 ? 301  ALA D N   1 
ATOM   2548 C CA  . ALA D 1 58 ? 53.035  26.055  38.368  1.00 17.75 ? 301  ALA D CA  1 
ATOM   2549 C C   . ALA D 1 58 ? 52.935  26.261  39.886  1.00 17.38 ? 301  ALA D C   1 
ATOM   2550 O O   . ALA D 1 58 ? 53.899  26.694  40.554  1.00 13.16 ? 301  ALA D O   1 
ATOM   2551 C CB  . ALA D 1 58 ? 54.209  26.853  37.779  1.00 18.34 ? 301  ALA D CB  1 
ATOM   2552 N N   . GLY D 1 59 ? 51.749  25.987  40.425  1.00 20.06 ? 302  GLY D N   1 
ATOM   2553 C CA  . GLY D 1 59 ? 51.476  26.196  41.864  1.00 18.52 ? 302  GLY D CA  1 
ATOM   2554 C C   . GLY D 1 59 ? 51.283  27.616  42.391  1.00 17.77 ? 302  GLY D C   1 
ATOM   2555 O O   . GLY D 1 59 ? 50.993  27.800  43.575  1.00 19.12 ? 302  GLY D O   1 
ATOM   2556 N N   . GLU D 1 60 ? 51.487  28.617  41.544  1.00 16.46 ? 303  GLU D N   1 
ATOM   2557 C CA  . GLU D 1 60 ? 51.305  30.022  41.919  1.00 13.89 ? 303  GLU D CA  1 
ATOM   2558 C C   . GLU D 1 60 ? 49.919  30.412  41.506  1.00 15.00 ? 303  GLU D C   1 
ATOM   2559 O O   . GLU D 1 60 ? 49.506  30.129  40.381  1.00 13.70 ? 303  GLU D O   1 
ATOM   2560 C CB  . GLU D 1 60 ? 52.286  30.921  41.173  1.00 16.02 ? 303  GLU D CB  1 
ATOM   2561 C CG  . GLU D 1 60 ? 53.736  30.556  41.372  1.00 18.69 ? 303  GLU D CG  1 
ATOM   2562 C CD  . GLU D 1 60 ? 54.436  31.537  42.234  1.00 23.08 ? 303  GLU D CD  1 
ATOM   2563 O OE1 . GLU D 1 60 ? 54.642  32.665  41.754  1.00 35.36 ? 303  GLU D OE1 1 
ATOM   2564 O OE2 . GLU D 1 60 ? 54.774  31.201  43.385  1.00 32.18 ? 303  GLU D OE2 1 
ATOM   2565 N N   . SER D 1 61 ? 49.188  31.061  42.394  1.00 15.02 ? 304  SER D N   1 
ATOM   2566 C CA  . SER D 1 61 ? 47.866  31.550  42.051  1.00 17.69 ? 304  SER D CA  1 
ATOM   2567 C C   . SER D 1 61 ? 47.989  32.458  40.842  1.00 17.86 ? 304  SER D C   1 
ATOM   2568 O O   . SER D 1 61 ? 48.952  33.210  40.726  1.00 17.41 ? 304  SER D O   1 
ATOM   2569 C CB  . SER D 1 61 ? 47.255  32.328  43.234  1.00 18.36 ? 304  SER D CB  1 
ATOM   2570 O OG  . SER D 1 61 ? 45.946  32.815  42.927  1.00 15.49 ? 304  SER D OG  1 
ATOM   2571 N N   . VAL D 1 62 ? 47.018  32.375  39.941  1.00 15.63 ? 305  VAL D N   1 
ATOM   2572 C CA  . VAL D 1 62 ? 46.856  33.356  38.895  1.00 16.26 ? 305  VAL D CA  1 
ATOM   2573 C C   . VAL D 1 62 ? 45.477  34.028  38.986  1.00 15.40 ? 305  VAL D C   1 
ATOM   2574 O O   . VAL D 1 62 ? 45.119  34.801  38.142  1.00 13.71 ? 305  VAL D O   1 
ATOM   2575 C CB  . VAL D 1 62 ? 47.123  32.758  37.473  1.00 15.90 ? 305  VAL D CB  1 
ATOM   2576 C CG1 . VAL D 1 62 ? 48.512  32.287  37.370  1.00 12.96 ? 305  VAL D CG1 1 
ATOM   2577 C CG2 . VAL D 1 62 ? 46.171  31.612  37.127  1.00 8.68  ? 305  VAL D CG2 1 
ATOM   2578 N N   . GLU D 1 63 ? 44.724  33.787  40.054  1.00 14.94 ? 306  GLU D N   1 
ATOM   2579 C CA  . GLU D 1 63 ? 43.376  34.353  40.164  1.00 15.57 ? 306  GLU D CA  1 
ATOM   2580 C C   . GLU D 1 63 ? 43.408  35.878  40.247  1.00 13.78 ? 306  GLU D C   1 
ATOM   2581 O O   . GLU D 1 63 ? 44.094  36.434  41.115  1.00 15.95 ? 306  GLU D O   1 
ATOM   2582 C CB  . GLU D 1 63 ? 42.680  33.811  41.421  1.00 19.89 ? 306  GLU D CB  1 
ATOM   2583 C CG  . GLU D 1 63 ? 42.153  32.391  41.233  1.00 24.56 ? 306  GLU D CG  1 
ATOM   2584 C CD  . GLU D 1 63 ? 41.280  31.961  42.373  1.00 24.49 ? 306  GLU D CD  1 
ATOM   2585 O OE1 . GLU D 1 63 ? 41.819  31.732  43.460  1.00 22.81 ? 306  GLU D OE1 1 
ATOM   2586 O OE2 . GLU D 1 63 ? 40.054  31.857  42.190  1.00 23.97 ? 306  GLU D OE2 1 
ATOM   2587 N N   . GLY D 1 64 ? 42.629  36.544  39.396  1.00 13.38 ? 307  GLY D N   1 
ATOM   2588 C CA  . GLY D 1 64 ? 42.634  38.009  39.323  1.00 17.47 ? 307  GLY D CA  1 
ATOM   2589 C C   . GLY D 1 64 ? 43.742  38.588  38.457  1.00 16.59 ? 307  GLY D C   1 
ATOM   2590 O O   . GLY D 1 64 ? 43.892  39.830  38.386  1.00 16.62 ? 307  GLY D O   1 
ATOM   2591 N N   . LEU D 1 65 ? 44.535  37.717  37.812  1.00 14.38 ? 308  LEU D N   1 
ATOM   2592 C CA  . LEU D 1 65 ? 45.594  38.180  36.915  1.00 16.31 ? 308  LEU D CA  1 
ATOM   2593 C C   . LEU D 1 65 ? 45.044  38.330  35.499  1.00 13.29 ? 308  LEU D C   1 
ATOM   2594 O O   . LEU D 1 65 ? 44.105  37.642  35.124  1.00 15.13 ? 308  LEU D O   1 
ATOM   2595 C CB  . LEU D 1 65 ? 46.802  37.250  36.919  1.00 14.14 ? 308  LEU D CB  1 
ATOM   2596 C CG  . LEU D 1 65 ? 47.672  37.261  38.181  1.00 17.73 ? 308  LEU D CG  1 
ATOM   2597 C CD1 . LEU D 1 65 ? 48.861  36.430  37.890  1.00 15.97 ? 308  LEU D CD1 1 
ATOM   2598 C CD2 . LEU D 1 65 ? 48.061  38.669  38.632  1.00 16.25 ? 308  LEU D CD2 1 
ATOM   2599 N N   . GLY D 1 66 ? 45.632  39.245  34.744  1.00 13.33 ? 309  GLY D N   1 
ATOM   2600 C CA  . GLY D 1 66 ? 45.195  39.545  33.389  1.00 14.20 ? 309  GLY D CA  1 
ATOM   2601 C C   . GLY D 1 66 ? 45.654  38.491  32.414  1.00 14.03 ? 309  GLY D C   1 
ATOM   2602 O O   . GLY D 1 66 ? 46.396  37.567  32.760  1.00 15.10 ? 309  GLY D O   1 
ATOM   2603 N N   . HIS D 1 67 ? 45.211  38.655  31.184  1.00 14.01 ? 310  HIS D N   1 
ATOM   2604 C CA  . HIS D 1 67 ? 45.324  37.629  30.204  1.00 15.97 ? 310  HIS D CA  1 
ATOM   2605 C C   . HIS D 1 67 ? 46.784  37.429  29.787  1.00 14.23 ? 310  HIS D C   1 
ATOM   2606 O O   . HIS D 1 67 ? 47.320  36.325  29.862  1.00 13.76 ? 310  HIS D O   1 
ATOM   2607 C CB  . HIS D 1 67 ? 44.405  37.937  29.019  1.00 11.60 ? 310  HIS D CB  1 
ATOM   2608 C CG  . HIS D 1 67 ? 44.342  36.834  28.023  1.00 6.42  ? 310  HIS D CG  1 
ATOM   2609 N ND1 . HIS D 1 67 ? 43.755  35.621  28.296  1.00 13.74 ? 310  HIS D ND1 1 
ATOM   2610 C CD2 . HIS D 1 67 ? 44.903  36.717  26.789  1.00 13.95 ? 310  HIS D CD2 1 
ATOM   2611 C CE1 . HIS D 1 67 ? 43.890  34.827  27.248  1.00 13.15 ? 310  HIS D CE1 1 
ATOM   2612 N NE2 . HIS D 1 67 ? 44.587  35.468  26.315  1.00 11.00 ? 310  HIS D NE2 1 
ATOM   2613 N N   . GLU D 1 68 ? 47.419  38.509  29.370  1.00 17.94 ? 311  GLU D N   1 
ATOM   2614 C CA  . GLU D 1 68 ? 48.786  38.457  28.889  1.00 18.26 ? 311  GLU D CA  1 
ATOM   2615 C C   . GLU D 1 68 ? 49.732  37.925  29.960  1.00 14.88 ? 311  GLU D C   1 
ATOM   2616 O O   . GLU D 1 68 ? 50.679  37.196  29.645  1.00 11.84 ? 311  GLU D O   1 
ATOM   2617 C CB  . GLU D 1 68 ? 49.247  39.843  28.397  1.00 20.18 ? 311  GLU D CB  1 
ATOM   2618 C CG  . GLU D 1 68 ? 49.632  40.850  29.465  1.00 35.14 ? 311  GLU D CG  1 
ATOM   2619 N N   . GLU D 1 69 ? 49.479  38.304  31.216  1.00 12.43 ? 312  GLU D N   1 
ATOM   2620 C CA  . GLU D 1 69 ? 50.289  37.851  32.314  1.00 12.83 ? 312  GLU D CA  1 
ATOM   2621 C C   . GLU D 1 69 ? 50.139  36.343  32.435  1.00 13.48 ? 312  GLU D C   1 
ATOM   2622 O O   . GLU D 1 69 ? 51.158  35.622  32.439  1.00 17.10 ? 312  GLU D O   1 
ATOM   2623 C CB  . GLU D 1 69 ? 49.868  38.532  33.609  1.00 15.98 ? 312  GLU D CB  1 
ATOM   2624 C CG  . GLU D 1 69 ? 50.623  38.035  34.827  1.00 24.63 ? 312  GLU D CG  1 
ATOM   2625 C CD  . GLU D 1 69 ? 52.136  38.267  34.735  1.00 30.56 ? 312  GLU D CD  1 
ATOM   2626 O OE1 . GLU D 1 69 ? 52.585  39.097  33.929  1.00 25.05 ? 312  GLU D OE1 1 
ATOM   2627 O OE2 . GLU D 1 69 ? 52.892  37.610  35.466  1.00 20.81 ? 312  GLU D OE2 1 
ATOM   2628 N N   . THR D 1 70 ? 48.880  35.874  32.506  1.00 15.38 ? 313  THR D N   1 
ATOM   2629 C CA  . THR D 1 70 ? 48.584  34.439  32.617  1.00 12.99 ? 313  THR D CA  1 
ATOM   2630 C C   . THR D 1 70 ? 49.195  33.613  31.486  1.00 16.69 ? 313  THR D C   1 
ATOM   2631 O O   . THR D 1 70 ? 49.871  32.621  31.738  1.00 15.68 ? 313  THR D O   1 
ATOM   2632 C CB  . THR D 1 70 ? 47.074  34.140  32.721  1.00 16.67 ? 313  THR D CB  1 
ATOM   2633 O OG1 . THR D 1 70 ? 46.521  34.911  33.786  1.00 15.40 ? 313  THR D OG1 1 
ATOM   2634 C CG2 . THR D 1 70 ? 46.813  32.603  32.986  1.00 10.90 ? 313  THR D CG2 1 
ATOM   2635 N N   . VAL D 1 71 ? 48.979  34.023  30.248  1.00 14.72 ? 314  VAL D N   1 
ATOM   2636 C CA  . VAL D 1 71 ? 49.612  33.347  29.116  1.00 9.87  ? 314  VAL D CA  1 
ATOM   2637 C C   . VAL D 1 71 ? 51.128  33.308  29.257  1.00 11.54 ? 314  VAL D C   1 
ATOM   2638 O O   . VAL D 1 71 ? 51.733  32.262  29.029  1.00 15.65 ? 314  VAL D O   1 
ATOM   2639 C CB  . VAL D 1 71 ? 49.187  34.018  27.784  1.00 14.25 ? 314  VAL D CB  1 
ATOM   2640 C CG1 . VAL D 1 71 ? 50.058  33.617  26.631  1.00 15.03 ? 314  VAL D CG1 1 
ATOM   2641 C CG2 . VAL D 1 71 ? 47.722  33.676  27.486  1.00 12.37 ? 314  VAL D CG2 1 
ATOM   2642 N N   . SER D 1 72 ? 51.754  34.416  29.658  1.00 13.64 ? 315  SER D N   1 
ATOM   2643 C CA  . SER D 1 72 ? 53.235  34.450  29.759  1.00 14.32 ? 315  SER D CA  1 
ATOM   2644 C C   . SER D 1 72 ? 53.733  33.474  30.822  1.00 12.57 ? 315  SER D C   1 
ATOM   2645 O O   . SER D 1 72 ? 54.800  32.871  30.670  1.00 11.05 ? 315  SER D O   1 
ATOM   2646 C CB  . SER D 1 72 ? 53.816  35.878  29.946  1.00 13.76 ? 315  SER D CB  1 
ATOM   2647 O OG  . SER D 1 72 ? 53.452  36.485  31.178  1.00 27.01 ? 315  SER D OG  1 
ATOM   2648 N N   . ARG D 1 73 ? 52.915  33.251  31.839  1.00 15.35 ? 316  ARG D N   1 
ATOM   2649 C CA  . ARG D 1 73 ? 53.225  32.271  32.873  1.00 12.91 ? 316  ARG D CA  1 
ATOM   2650 C C   . ARG D 1 73 ? 53.206  30.856  32.336  1.00 18.00 ? 316  ARG D C   1 
ATOM   2651 O O   . ARG D 1 73 ? 54.149  30.095  32.585  1.00 18.19 ? 316  ARG D O   1 
ATOM   2652 C CB  . ARG D 1 73 ? 52.292  32.422  34.070  1.00 13.83 ? 316  ARG D CB  1 
ATOM   2653 C CG  . ARG D 1 73 ? 52.673  33.611  34.940  1.00 17.40 ? 316  ARG D CG  1 
ATOM   2654 C CD  . ARG D 1 73 ? 51.603  33.947  35.910  1.00 23.71 ? 316  ARG D CD  1 
ATOM   2655 N NE  . ARG D 1 73 ? 51.963  35.137  36.677  1.00 23.45 ? 316  ARG D NE  1 
ATOM   2656 C CZ  . ARG D 1 73 ? 52.186  35.181  37.984  1.00 26.12 ? 316  ARG D CZ  1 
ATOM   2657 N NH1 . ARG D 1 73 ? 52.080  34.099  38.752  1.00 24.32 ? 316  ARG D NH1 1 
ATOM   2658 N NH2 . ARG D 1 73 ? 52.484  36.344  38.534  1.00 30.50 ? 316  ARG D NH2 1 
ATOM   2659 N N   . ILE D 1 74 ? 52.150  30.510  31.600  1.00 16.40 ? 317  ILE D N   1 
ATOM   2660 C CA  . ILE D 1 74 ? 52.071  29.224  30.914  1.00 15.96 ? 317  ILE D CA  1 
ATOM   2661 C C   . ILE D 1 74 ? 53.272  29.074  29.977  1.00 15.21 ? 317  ILE D C   1 
ATOM   2662 O O   . ILE D 1 74 ? 54.035  28.127  30.113  1.00 15.02 ? 317  ILE D O   1 
ATOM   2663 C CB  . ILE D 1 74 ? 50.723  29.061  30.134  1.00 15.36 ? 317  ILE D CB  1 
ATOM   2664 C CG1 . ILE D 1 74 ? 49.526  29.039  31.125  1.00 12.95 ? 317  ILE D CG1 1 
ATOM   2665 C CG2 . ILE D 1 74 ? 50.784  27.821  29.197  1.00 19.50 ? 317  ILE D CG2 1 
ATOM   2666 C CD1 . ILE D 1 74 ? 48.138  29.443  30.496  1.00 13.17 ? 317  ILE D CD1 1 
ATOM   2667 N N   . GLN D 1 75 ? 53.472  30.047  29.091  1.00 17.16 ? 318  GLN D N   1 
ATOM   2668 C CA  . GLN D 1 75 ? 54.568  30.009  28.111  1.00 18.24 ? 318  GLN D CA  1 
ATOM   2669 C C   . GLN D 1 75 ? 55.943  29.853  28.753  1.00 19.42 ? 318  GLN D C   1 
ATOM   2670 O O   . GLN D 1 75 ? 56.781  29.085  28.262  1.00 17.10 ? 318  GLN D O   1 
ATOM   2671 C CB  . GLN D 1 75 ? 54.540  31.250  27.230  1.00 17.75 ? 318  GLN D CB  1 
ATOM   2672 C CG  . GLN D 1 75 ? 53.368  31.259  26.299  1.00 20.95 ? 318  GLN D CG  1 
ATOM   2673 C CD  . GLN D 1 75 ? 53.352  32.440  25.343  1.00 26.16 ? 318  GLN D CD  1 
ATOM   2674 O OE1 . GLN D 1 75 ? 53.788  33.552  25.666  1.00 23.72 ? 318  GLN D OE1 1 
ATOM   2675 N NE2 . GLN D 1 75 ? 52.808  32.204  24.156  1.00 28.21 ? 318  GLN D NE2 1 
ATOM   2676 N N   . GLY D 1 76 ? 56.146  30.556  29.866  1.00 14.34 ? 319  GLY D N   1 
ATOM   2677 C CA  . GLY D 1 76 ? 57.413  30.566  30.557  1.00 15.97 ? 319  GLY D CA  1 
ATOM   2678 C C   . GLY D 1 76 ? 57.738  29.284  31.301  1.00 15.86 ? 319  GLY D C   1 
ATOM   2679 O O   . GLY D 1 76 ? 58.825  29.152  31.850  1.00 13.02 ? 319  GLY D O   1 
ATOM   2680 N N   . GLN D 1 77 ? 56.793  28.348  31.338  1.00 14.77 ? 320  GLN D N   1 
ATOM   2681 C CA  . GLN D 1 77 ? 57.022  27.050  31.966  1.00 11.18 ? 320  GLN D CA  1 
ATOM   2682 C C   . GLN D 1 77 ? 57.551  25.979  30.983  1.00 15.65 ? 320  GLN D C   1 
ATOM   2683 O O   . GLN D 1 77 ? 57.823  24.857  31.393  1.00 18.20 ? 320  GLN D O   1 
ATOM   2684 C CB  . GLN D 1 77 ? 55.740  26.551  32.631  1.00 16.21 ? 320  GLN D CB  1 
ATOM   2685 C CG  . GLN D 1 77 ? 55.380  27.217  33.965  1.00 9.81  ? 320  GLN D CG  1 
ATOM   2686 C CD  . GLN D 1 77 ? 56.395  26.951  35.017  1.00 19.41 ? 320  GLN D CD  1 
ATOM   2687 O OE1 . GLN D 1 77 ? 56.503  25.837  35.535  1.00 22.34 ? 320  GLN D OE1 1 
ATOM   2688 N NE2 . GLN D 1 77 ? 57.175  27.969  35.340  1.00 20.55 ? 320  GLN D NE2 1 
ATOM   2689 N N   . GLY D 1 78 ? 57.659  26.303  29.697  1.00 16.27 ? 321  GLY D N   1 
ATOM   2690 C CA  . GLY D 1 78 ? 58.204  25.364  28.709  1.00 17.83 ? 321  GLY D CA  1 
ATOM   2691 C C   . GLY D 1 78 ? 57.357  24.130  28.426  1.00 18.62 ? 321  GLY D C   1 
ATOM   2692 O O   . GLY D 1 78 ? 56.125  24.196  28.373  1.00 12.36 ? 321  GLY D O   1 
ATOM   2693 N N   . SER D 1 79 ? 58.040  23.001  28.248  1.00 21.78 ? 322  SER D N   1 
ATOM   2694 C CA  . SER D 1 79 ? 57.437  21.757  27.762  1.00 25.28 ? 322  SER D CA  1 
ATOM   2695 C C   . SER D 1 79 ? 56.433  21.126  28.710  1.00 25.09 ? 322  SER D C   1 
ATOM   2696 O O   . SER D 1 79 ? 55.522  20.411  28.279  1.00 26.88 ? 322  SER D O   1 
ATOM   2697 C CB  . SER D 1 79 ? 58.536  20.737  27.457  1.00 23.09 ? 322  SER D CB  1 
ATOM   2698 O OG  . SER D 1 79 ? 59.200  21.107  26.272  1.00 37.08 ? 322  SER D OG  1 
ATOM   2699 N N   . CYS D 1 80 ? 56.610  21.377  30.000  1.00 22.25 ? 323  CYS D N   1 
ATOM   2700 C CA  . CYS D 1 80 ? 55.761  20.766  31.016  1.00 23.57 ? 323  CYS D CA  1 
ATOM   2701 C C   . CYS D 1 80 ? 55.185  21.859  31.919  1.00 24.02 ? 323  CYS D C   1 
ATOM   2702 O O   . CYS D 1 80 ? 55.924  22.748  32.350  1.00 23.09 ? 323  CYS D O   1 
ATOM   2703 C CB  . CYS D 1 80 ? 56.582  19.754  31.822  1.00 23.82 ? 323  CYS D CB  1 
ATOM   2704 S SG  . CYS D 1 80 ? 57.283  18.443  30.800  1.00 44.69 ? 323  CYS D SG  1 
ATOM   2705 N N   . VAL D 1 81 ? 53.875  21.794  32.182  1.00 20.38 ? 324  VAL D N   1 
ATOM   2706 C CA  . VAL D 1 81 ? 53.180  22.788  33.013  1.00 20.32 ? 324  VAL D CA  1 
ATOM   2707 C C   . VAL D 1 81 ? 52.140  22.147  33.935  1.00 19.96 ? 324  VAL D C   1 
ATOM   2708 O O   . VAL D 1 81 ? 51.338  21.293  33.518  1.00 20.91 ? 324  VAL D O   1 
ATOM   2709 C CB  . VAL D 1 81 ? 52.518  23.935  32.171  1.00 22.71 ? 324  VAL D CB  1 
ATOM   2710 C CG1 . VAL D 1 81 ? 51.318  23.432  31.301  1.00 17.52 ? 324  VAL D CG1 1 
ATOM   2711 C CG2 . VAL D 1 81 ? 52.061  25.052  33.074  1.00 21.97 ? 324  VAL D CG2 1 
ATOM   2712 N N   . SER D 1 82 ? 52.165  22.572  35.194  1.00 19.86 ? 325  SER D N   1 
ATOM   2713 C CA  . SER D 1 82 ? 51.110  22.269  36.147  1.00 18.74 ? 325  SER D CA  1 
ATOM   2714 C C   . SER D 1 82 ? 50.066  23.384  36.131  1.00 19.08 ? 325  SER D C   1 
ATOM   2715 O O   . SER D 1 82 ? 50.404  24.567  36.227  1.00 21.46 ? 325  SER D O   1 
ATOM   2716 C CB  . SER D 1 82 ? 51.688  22.105  37.557  1.00 24.79 ? 325  SER D CB  1 
ATOM   2717 O OG  . SER D 1 82 ? 50.787  21.355  38.352  1.00 30.56 ? 325  SER D OG  1 
ATOM   2718 N N   . LEU D 1 83 ? 48.801  22.997  35.962  1.00 18.57 ? 326  LEU D N   1 
ATOM   2719 C CA  . LEU D 1 83 ? 47.668  23.922  35.906  1.00 17.69 ? 326  LEU D CA  1 
ATOM   2720 C C   . LEU D 1 83 ? 46.608  23.488  36.900  1.00 17.31 ? 326  LEU D C   1 
ATOM   2721 O O   . LEU D 1 83 ? 46.204  22.325  36.907  1.00 19.08 ? 326  LEU D O   1 
ATOM   2722 C CB  . LEU D 1 83 ? 47.027  23.895  34.514  1.00 16.43 ? 326  LEU D CB  1 
ATOM   2723 C CG  . LEU D 1 83 ? 47.891  24.268  33.326  1.00 17.78 ? 326  LEU D CG  1 
ATOM   2724 C CD1 . LEU D 1 83 ? 47.039  24.144  32.087  1.00 15.54 ? 326  LEU D CD1 1 
ATOM   2725 C CD2 . LEU D 1 83 ? 48.429  25.695  33.495  1.00 16.07 ? 326  LEU D CD2 1 
ATOM   2726 N N   . THR D 1 84 ? 46.144  24.419  37.729  1.00 20.48 ? 327  THR D N   1 
ATOM   2727 C CA  . THR D 1 84 ? 45.075  24.129  38.678  1.00 14.32 ? 327  THR D CA  1 
ATOM   2728 C C   . THR D 1 84 ? 43.823  24.807  38.173  1.00 13.72 ? 327  THR D C   1 
ATOM   2729 O O   . THR D 1 84 ? 43.841  25.992  37.806  1.00 12.28 ? 327  THR D O   1 
ATOM   2730 C CB  . THR D 1 84 ? 45.416  24.594  40.111  1.00 17.63 ? 327  THR D CB  1 
ATOM   2731 O OG1 . THR D 1 84 ? 46.605  23.932  40.547  1.00 16.68 ? 327  THR D OG1 1 
ATOM   2732 C CG2 . THR D 1 84 ? 44.265  24.288  41.093  1.00 9.99  ? 327  THR D CG2 1 
ATOM   2733 N N   . VAL D 1 85 ? 42.744  24.038  38.096  1.00 9.65  ? 328  VAL D N   1 
ATOM   2734 C CA  . VAL D 1 85 ? 41.508  24.546  37.559  1.00 11.08 ? 328  VAL D CA  1 
ATOM   2735 C C   . VAL D 1 85 ? 40.378  24.297  38.545  1.00 15.40 ? 328  VAL D C   1 
ATOM   2736 O O   . VAL D 1 85 ? 40.502  23.486  39.460  1.00 13.46 ? 328  VAL D O   1 
ATOM   2737 C CB  . VAL D 1 85 ? 41.191  23.903  36.175  1.00 18.76 ? 328  VAL D CB  1 
ATOM   2738 C CG1 . VAL D 1 85 ? 42.244  24.325  35.094  1.00 11.14 ? 328  VAL D CG1 1 
ATOM   2739 C CG2 . VAL D 1 85 ? 41.094  22.391  36.281  1.00 15.97 ? 328  VAL D CG2 1 
ATOM   2740 N N   . VAL D 1 86 ? 39.289  25.029  38.360  1.00 19.62 ? 329  VAL D N   1 
ATOM   2741 C CA  . VAL D 1 86 ? 38.031  24.749  39.042  1.00 19.75 ? 329  VAL D CA  1 
ATOM   2742 C C   . VAL D 1 86 ? 36.965  24.431  37.995  1.00 18.64 ? 329  VAL D C   1 
ATOM   2743 O O   . VAL D 1 86 ? 36.705  25.237  37.123  1.00 18.41 ? 329  VAL D O   1 
ATOM   2744 C CB  . VAL D 1 86 ? 37.594  25.936  39.880  1.00 19.69 ? 329  VAL D CB  1 
ATOM   2745 C CG1 . VAL D 1 86 ? 36.273  25.651  40.516  1.00 22.66 ? 329  VAL D CG1 1 
ATOM   2746 C CG2 . VAL D 1 86 ? 38.625  26.199  40.956  1.00 18.45 ? 329  VAL D CG2 1 
ATOM   2747 N N   . ASP D 1 87 ? 36.383  23.239  38.064  1.00 19.18 ? 330  ASP D N   1 
ATOM   2748 C CA  . ASP D 1 87 ? 35.431  22.786  37.035  1.00 21.79 ? 330  ASP D CA  1 
ATOM   2749 C C   . ASP D 1 87 ? 34.080  23.460  37.171  1.00 23.35 ? 330  ASP D C   1 
ATOM   2750 O O   . ASP D 1 87 ? 33.677  23.830  38.282  1.00 24.29 ? 330  ASP D O   1 
ATOM   2751 C CB  . ASP D 1 87 ? 35.221  21.284  37.095  1.00 22.67 ? 330  ASP D CB  1 
ATOM   2752 C CG  . ASP D 1 87 ? 36.502  20.522  36.989  1.00 23.95 ? 330  ASP D CG  1 
ATOM   2753 O OD1 . ASP D 1 87 ? 37.090  20.457  35.876  1.00 26.10 ? 330  ASP D OD1 1 
ATOM   2754 O OD2 . ASP D 1 87 ? 36.912  19.987  38.031  1.00 26.37 ? 330  ASP D OD2 1 
ATOM   2755 N N   . PRO D 1 88 ? 33.371  23.627  36.043  1.00 23.50 ? 331  PRO D N   1 
ATOM   2756 C CA  . PRO D 1 88 ? 32.050  24.211  36.095  1.00 24.68 ? 331  PRO D CA  1 
ATOM   2757 C C   . PRO D 1 88 ? 30.999  23.178  36.498  1.00 26.85 ? 331  PRO D C   1 
ATOM   2758 O O   . PRO D 1 88 ? 31.332  22.015  36.772  1.00 28.10 ? 331  PRO D O   1 
ATOM   2759 C CB  . PRO D 1 88 ? 31.830  24.670  34.656  1.00 24.66 ? 331  PRO D CB  1 
ATOM   2760 C CG  . PRO D 1 88 ? 32.533  23.643  33.855  1.00 26.30 ? 331  PRO D CG  1 
ATOM   2761 C CD  . PRO D 1 88 ? 33.757  23.284  34.661  1.00 23.55 ? 331  PRO D CD  1 
ATOM   2762 N N   . GLU D 1 89 ? 29.744  23.611  36.558  1.00 32.36 ? 332  GLU D N   1 
ATOM   2763 C CA  . GLU D 1 89 ? 28.614  22.686  36.584  1.00 33.45 ? 332  GLU D CA  1 
ATOM   2764 C C   . GLU D 1 89 ? 28.120  22.515  35.152  1.00 35.54 ? 332  GLU D C   1 
ATOM   2765 O O   . GLU D 1 89 ? 27.760  23.488  34.486  1.00 35.88 ? 332  GLU D O   1 
ATOM   2766 C CB  . GLU D 1 89 ? 27.493  23.217  37.477  1.00 40.08 ? 332  GLU D CB  1 
ATOM   2767 C CG  . GLU D 1 89 ? 27.753  23.103  38.985  1.00 41.25 ? 332  GLU D CG  1 
ATOM   2768 C CD  . GLU D 1 89 ? 28.601  24.240  39.538  1.00 52.18 ? 332  GLU D CD  1 
ATOM   2769 O OE1 . GLU D 1 89 ? 28.345  25.421  39.208  1.00 52.17 ? 332  GLU D OE1 1 
ATOM   2770 O OE2 . GLU D 1 89 ? 29.525  23.950  40.322  1.00 53.65 ? 332  GLU D OE2 1 
ATOM   2771 N N   . ALA D 1 90 ? 28.089  21.273  34.683  1.00 43.91 ? 333  ALA D N   1 
ATOM   2772 C CA  . ALA D 1 90 ? 27.878  20.987  33.255  1.00 47.46 ? 333  ALA D CA  1 
ATOM   2773 C C   . ALA D 1 90 ? 26.412  21.048  32.812  1.00 44.88 ? 333  ALA D C   1 
ATOM   2774 O O   . ALA D 1 90 ? 26.121  20.885  31.628  1.00 43.44 ? 333  ALA D O   1 
ATOM   2775 C CB  . ALA D 1 90 ? 28.487  19.631  32.894  1.00 46.30 ? 333  ALA D CB  1 
ATOM   2776 N N   . ASP D 1 91 ? 25.499  21.275  33.754  1.00 40.42 ? 334  ASP D N   1 
ATOM   2777 C CA  . ASP D 1 91 ? 24.101  21.505  33.425  1.00 38.39 ? 334  ASP D CA  1 
ATOM   2778 C C   . ASP D 1 91 ? 23.793  23.004  33.318  1.00 38.24 ? 334  ASP D C   1 
ATOM   2779 O O   . ASP D 1 91 ? 22.624  23.392  33.370  1.00 39.80 ? 334  ASP D O   1 
ATOM   2780 C CB  . ASP D 1 91 ? 23.196  20.869  34.487  1.00 41.37 ? 334  ASP D CB  1 
ATOM   2781 N N   . ARG D 1 92 ? 24.826  23.843  33.186  1.00 30.25 ? 335  ARG D N   1 
ATOM   2782 C CA  . ARG D 1 92 ? 24.633  25.284  33.121  1.00 22.57 ? 335  ARG D CA  1 
ATOM   2783 C C   . ARG D 1 92 ? 25.148  25.804  31.790  1.00 18.78 ? 335  ARG D C   1 
ATOM   2784 O O   . ARG D 1 92 ? 25.794  26.847  31.750  1.00 10.66 ? 335  ARG D O   1 
ATOM   2785 C CB  . ARG D 1 92 ? 25.363  26.005  34.262  1.00 27.15 ? 335  ARG D CB  1 
ATOM   2786 C CG  . ARG D 1 92 ? 25.043  25.493  35.636  1.00 29.33 ? 335  ARG D CG  1 
ATOM   2787 C CD  . ARG D 1 92 ? 24.291  26.515  36.427  1.00 31.35 ? 335  ARG D CD  1 
ATOM   2788 N NE  . ARG D 1 92 ? 23.911  26.063  37.767  1.00 26.54 ? 335  ARG D NE  1 
ATOM   2789 C CZ  . ARG D 1 92 ? 24.561  26.325  38.908  1.00 41.97 ? 335  ARG D CZ  1 
ATOM   2790 N NH1 . ARG D 1 92 ? 25.688  27.025  38.929  1.00 42.53 ? 335  ARG D NH1 1 
ATOM   2791 N NH2 . ARG D 1 92 ? 24.076  25.865  40.055  1.00 36.82 ? 335  ARG D NH2 1 
ATOM   2792 N N   . GLU D 1 93 ? 24.926  25.035  30.724  1.00 16.11 ? 336  GLU D N   1 
ATOM   2793 C CA  . GLU D 1 93 ? 25.083  25.520  29.360  1.00 18.56 ? 336  GLU D CA  1 
ATOM   2794 C C   . GLU D 1 93 ? 23.833  25.060  28.590  1.00 19.64 ? 336  GLU D C   1 
ATOM   2795 O O   . GLU D 1 93 ? 23.344  23.929  28.783  1.00 16.79 ? 336  GLU D O   1 
ATOM   2796 C CB  . GLU D 1 93 ? 26.416  25.115  28.696  1.00 25.55 ? 336  GLU D CB  1 
ATOM   2797 C CG  . GLU D 1 93 ? 26.706  23.627  28.541  1.00 29.56 ? 336  GLU D CG  1 
ATOM   2798 C CD  . GLU D 1 93 ? 27.768  23.300  27.452  1.00 35.05 ? 336  GLU D CD  1 
ATOM   2799 O OE1 . GLU D 1 93 ? 27.815  22.114  27.066  1.00 60.45 ? 336  GLU D OE1 1 
ATOM   2800 O OE2 . GLU D 1 93 ? 28.539  24.188  26.968  1.00 25.25 ? 336  GLU D OE2 1 
ATOM   2801 N N   . THR D 1 94 ? 23.275  25.977  27.795  1.00 16.08 ? 337  THR D N   1 
ATOM   2802 C CA  . THR D 1 94 ? 22.031  25.749  27.052  1.00 11.24 ? 337  THR D CA  1 
ATOM   2803 C C   . THR D 1 94 ? 22.134  26.412  25.682  1.00 16.21 ? 337  THR D C   1 
ATOM   2804 O O   . THR D 1 94 ? 22.470  27.577  25.588  1.00 9.60  ? 337  THR D O   1 
ATOM   2805 C CB  . THR D 1 94 ? 20.814  26.271  27.772  1.00 12.81 ? 337  THR D CB  1 
ATOM   2806 O OG1 . THR D 1 94 ? 20.810  25.794  29.126  1.00 20.46 ? 337  THR D OG1 1 
ATOM   2807 C CG2 . THR D 1 94 ? 19.544  25.775  27.081  1.00 18.32 ? 337  THR D CG2 1 
ATOM   2808 N N   . SER D 1 95 ? 21.896  25.646  24.623  1.00 14.27 ? 338  SER D N   1 
ATOM   2809 C CA  . SER D 1 95 ? 21.781  26.202  23.287  1.00 14.30 ? 338  SER D CA  1 
ATOM   2810 C C   . SER D 1 95 ? 20.361  26.733  23.137  1.00 14.67 ? 338  SER D C   1 
ATOM   2811 O O   . SER D 1 95 ? 19.388  26.035  23.406  1.00 15.22 ? 338  SER D O   1 
ATOM   2812 C CB  . SER D 1 95 ? 22.079  25.141  22.207  1.00 23.81 ? 338  SER D CB  1 
ATOM   2813 O OG  . SER D 1 95 ? 22.288  25.725  20.924  1.00 22.73 ? 338  SER D OG  1 
ATOM   2814 N N   . VAL D 1 96 ? 20.245  27.984  22.719  1.00 15.17 ? 339  VAL D N   1 
ATOM   2815 C CA  . VAL D 1 96 ? 18.948  28.588  22.449  1.00 22.16 ? 339  VAL D CA  1 
ATOM   2816 C C   . VAL D 1 96 ? 18.901  29.189  21.044  1.00 21.36 ? 339  VAL D C   1 
ATOM   2817 O O   . VAL D 1 96 ? 19.885  29.140  20.295  1.00 16.31 ? 339  VAL D O   1 
ATOM   2818 C CB  . VAL D 1 96 ? 18.626  29.682  23.474  1.00 20.63 ? 339  VAL D CB  1 
ATOM   2819 C CG1 . VAL D 1 96 ? 18.563  29.084  24.873  1.00 32.70 ? 339  VAL D CG1 1 
ATOM   2820 C CG2 . VAL D 1 96 ? 19.660  30.775  23.426  1.00 27.07 ? 339  VAL D CG2 1 
ATOM   2821 O OXT . VAL D 1 96 ? 17.872  29.750  20.672  1.00 17.65 ? 339  VAL D OXT 1 
ATOM   2822 N N   . MET E 1 2  ? 14.956  -0.643  -2.778  1.00 50.99 ? 245  MET E N   1 
ATOM   2823 C CA  . MET E 1 2  ? 14.034  -0.823  -3.941  1.00 49.54 ? 245  MET E CA  1 
ATOM   2824 C C   . MET E 1 2  ? 12.612  -0.366  -3.591  1.00 48.07 ? 245  MET E C   1 
ATOM   2825 O O   . MET E 1 2  ? 12.069  -0.741  -2.548  1.00 48.75 ? 245  MET E O   1 
ATOM   2826 C CB  . MET E 1 2  ? 14.027  -2.289  -4.385  1.00 49.39 ? 245  MET E CB  1 
ATOM   2827 N N   . LYS E 1 3  ? 12.023  0.457   -4.461  1.00 47.21 ? 246  LYS E N   1 
ATOM   2828 C CA  . LYS E 1 3  ? 10.660  0.972   -4.260  1.00 42.82 ? 246  LYS E CA  1 
ATOM   2829 C C   . LYS E 1 3  ? 9.659   -0.169  -4.447  1.00 39.03 ? 246  LYS E C   1 
ATOM   2830 O O   . LYS E 1 3  ? 9.780   -0.935  -5.411  1.00 38.85 ? 246  LYS E O   1 
ATOM   2831 C CB  . LYS E 1 3  ? 10.337  2.087   -5.266  1.00 44.47 ? 246  LYS E CB  1 
ATOM   2832 C CG  . LYS E 1 3  ? 11.227  3.324   -5.174  1.00 45.47 ? 246  LYS E CG  1 
ATOM   2833 N N   . PRO E 1 4  ? 8.676   -0.303  -3.527  1.00 30.56 ? 247  PRO E N   1 
ATOM   2834 C CA  . PRO E 1 4  ? 7.593   -1.267  -3.807  1.00 27.23 ? 247  PRO E CA  1 
ATOM   2835 C C   . PRO E 1 4  ? 6.927   -1.010  -5.173  1.00 27.44 ? 247  PRO E C   1 
ATOM   2836 O O   . PRO E 1 4  ? 6.798   0.149   -5.609  1.00 23.35 ? 247  PRO E O   1 
ATOM   2837 C CB  . PRO E 1 4  ? 6.589   -1.048  -2.669  1.00 26.67 ? 247  PRO E CB  1 
ATOM   2838 C CG  . PRO E 1 4  ? 7.345   -0.308  -1.579  1.00 26.16 ? 247  PRO E CG  1 
ATOM   2839 C CD  . PRO E 1 4  ? 8.530   0.369   -2.220  1.00 30.05 ? 247  PRO E CD  1 
ATOM   2840 N N   . ARG E 1 5  ? 6.532   -2.091  -5.844  1.00 22.47 ? 248  ARG E N   1 
ATOM   2841 C CA  . ARG E 1 5  ? 5.820   -2.017  -7.105  1.00 22.97 ? 248  ARG E CA  1 
ATOM   2842 C C   . ARG E 1 5  ? 4.510   -2.784  -6.956  1.00 20.06 ? 248  ARG E C   1 
ATOM   2843 O O   . ARG E 1 5  ? 4.529   -3.947  -6.565  1.00 16.44 ? 248  ARG E O   1 
ATOM   2844 C CB  . ARG E 1 5  ? 6.629   -2.671  -8.217  1.00 24.31 ? 248  ARG E CB  1 
ATOM   2845 C CG  . ARG E 1 5  ? 8.002   -2.081  -8.454  1.00 34.87 ? 248  ARG E CG  1 
ATOM   2846 C CD  . ARG E 1 5  ? 8.852   -3.071  -9.212  1.00 37.79 ? 248  ARG E CD  1 
ATOM   2847 N NE  . ARG E 1 5  ? 8.162   -3.538  -10.406 1.00 39.77 ? 248  ARG E NE  1 
ATOM   2848 C CZ  . ARG E 1 5  ? 8.236   -4.770  -10.914 1.00 37.23 ? 248  ARG E CZ  1 
ATOM   2849 N NH1 . ARG E 1 5  ? 8.988   -5.710  -10.351 1.00 30.38 ? 248  ARG E NH1 1 
ATOM   2850 N NH2 . ARG E 1 5  ? 7.540   -5.065  -12.012 1.00 35.15 ? 248  ARG E NH2 1 
ATOM   2851 N N   . CYS E 1 6  ? 3.396   -2.139  -7.275  1.00 21.09 ? 249  CYS E N   1 
ATOM   2852 C CA  . CYS E 1 6  ? 2.079   -2.764  -7.197  1.00 19.94 ? 249  CYS E CA  1 
ATOM   2853 C C   . CYS E 1 6  ? 1.658   -3.160  -8.601  1.00 22.41 ? 249  CYS E C   1 
ATOM   2854 O O   . CYS E 1 6  ? 1.541   -2.319  -9.485  1.00 24.41 ? 249  CYS E O   1 
ATOM   2855 C CB  . CYS E 1 6  ? 1.033   -1.835  -6.585  1.00 23.93 ? 249  CYS E CB  1 
ATOM   2856 S SG  . CYS E 1 6  ? -0.600  -2.633  -6.423  1.00 29.65 ? 249  CYS E SG  1 
ATOM   2857 N N   . LEU E 1 7  ? 1.458   -4.457  -8.783  1.00 17.97 ? 250  LEU E N   1 
ATOM   2858 C CA  . LEU E 1 7  ? 1.120   -5.052  -10.050 1.00 21.19 ? 250  LEU E CA  1 
ATOM   2859 C C   . LEU E 1 7  ? -0.253  -5.722  -9.924  1.00 20.47 ? 250  LEU E C   1 
ATOM   2860 O O   . LEU E 1 7  ? -0.613  -6.219  -8.861  1.00 22.62 ? 250  LEU E O   1 
ATOM   2861 C CB  . LEU E 1 7  ? 2.197   -6.071  -10.394 1.00 25.49 ? 250  LEU E CB  1 
ATOM   2862 C CG  . LEU E 1 7  ? 3.611   -5.468  -10.469 1.00 29.08 ? 250  LEU E CG  1 
ATOM   2863 C CD1 . LEU E 1 7  ? 4.646   -6.524  -10.356 1.00 26.29 ? 250  LEU E CD1 1 
ATOM   2864 C CD2 . LEU E 1 7  ? 3.802   -4.645  -11.744 1.00 27.04 ? 250  LEU E CD2 1 
ATOM   2865 N N   . HIS E 1 8  ? -1.035  -5.695  -10.990 1.00 20.30 ? 251  HIS E N   1 
ATOM   2866 C CA  . HIS E 1 8  ? -2.372  -6.302  -10.981 1.00 21.92 ? 251  HIS E CA  1 
ATOM   2867 C C   . HIS E 1 8  ? -2.367  -7.479  -11.939 1.00 20.76 ? 251  HIS E C   1 
ATOM   2868 O O   . HIS E 1 8  ? -2.029  -7.317  -13.110 1.00 23.19 ? 251  HIS E O   1 
ATOM   2869 C CB  A HIS E 1 8  ? -3.478  -5.315  -11.362 0.50 23.21 ? 251  HIS E CB  1 
ATOM   2870 C CB  B HIS E 1 8  ? -3.385  -5.220  -11.369 0.50 21.76 ? 251  HIS E CB  1 
ATOM   2871 C CG  A HIS E 1 8  ? -4.855  -5.822  -11.048 0.50 26.24 ? 251  HIS E CG  1 
ATOM   2872 C CG  B HIS E 1 8  ? -3.244  -3.970  -10.553 0.50 22.38 ? 251  HIS E CG  1 
ATOM   2873 N ND1 A HIS E 1 8  ? -5.494  -5.556  -9.853  0.50 17.69 ? 251  HIS E ND1 1 
ATOM   2874 N ND1 B HIS E 1 8  ? -4.082  -3.673  -9.499  0.50 21.19 ? 251  HIS E ND1 1 
ATOM   2875 C CD2 A HIS E 1 8  ? -5.699  -6.607  -11.759 0.50 20.88 ? 251  HIS E CD2 1 
ATOM   2876 C CD2 B HIS E 1 8  ? -2.323  -2.977  -10.592 0.50 18.53 ? 251  HIS E CD2 1 
ATOM   2877 C CE1 A HIS E 1 8  ? -6.677  -6.145  -9.848  0.50 29.62 ? 251  HIS E CE1 1 
ATOM   2878 C CE1 B HIS E 1 8  ? -3.701  -2.537  -8.944  0.50 16.43 ? 251  HIS E CE1 1 
ATOM   2879 N NE2 A HIS E 1 8  ? -6.830  -6.782  -10.997 0.50 37.34 ? 251  HIS E NE2 1 
ATOM   2880 N NE2 B HIS E 1 8  ? -2.634  -2.096  -9.585  0.50 14.38 ? 251  HIS E NE2 1 
ATOM   2881 N N   . LEU E 1 9  ? -2.654  -8.672  -11.430 1.00 16.65 ? 252  LEU E N   1 
ATOM   2882 C CA  . LEU E 1 9  ? -2.564  -9.897  -12.237 1.00 19.98 ? 252  LEU E CA  1 
ATOM   2883 C C   . LEU E 1 9  ? -3.971  -10.430 -12.439 1.00 17.90 ? 252  LEU E C   1 
ATOM   2884 O O   . LEU E 1 9  ? -4.833  -10.249 -11.596 1.00 17.09 ? 252  LEU E O   1 
ATOM   2885 C CB  . LEU E 1 9  ? -1.687  -10.983 -11.561 1.00 14.10 ? 252  LEU E CB  1 
ATOM   2886 C CG  . LEU E 1 9  ? -0.264  -10.603 -11.097 1.00 18.61 ? 252  LEU E CG  1 
ATOM   2887 C CD1 . LEU E 1 9  ? 0.481   -11.847 -10.652 1.00 19.41 ? 252  LEU E CD1 1 
ATOM   2888 C CD2 . LEU E 1 9  ? 0.537   -9.858  -12.154 1.00 17.68 ? 252  LEU E CD2 1 
ATOM   2889 N N   . GLU E 1 10 ? -4.174  -11.087 -13.575 1.00 19.00 ? 253  GLU E N   1 
ATOM   2890 C CA  . GLU E 1 10 ? -5.405  -11.774 -13.905 1.00 18.75 ? 253  GLU E CA  1 
ATOM   2891 C C   . GLU E 1 10 ? -4.974  -13.192 -14.176 1.00 20.99 ? 253  GLU E C   1 
ATOM   2892 O O   . GLU E 1 10 ? -4.108  -13.409 -15.014 1.00 21.57 ? 253  GLU E O   1 
ATOM   2893 C CB  . GLU E 1 10 ? -6.017  -11.129 -15.155 1.00 22.10 ? 253  GLU E CB  1 
ATOM   2894 C CG  . GLU E 1 10 ? -5.811  -9.600  -15.173 1.00 31.69 ? 253  GLU E CG  1 
ATOM   2895 C CD  . GLU E 1 10 ? -6.614  -8.899  -16.243 1.00 31.97 ? 253  GLU E CD  1 
ATOM   2896 O OE1 . GLU E 1 10 ? -6.564  -9.333  -17.420 1.00 39.76 ? 253  GLU E OE1 1 
ATOM   2897 O OE2 . GLU E 1 10 ? -7.279  -7.899  -15.903 1.00 43.72 ? 253  GLU E OE2 1 
ATOM   2898 N N   . LYS E 1 11 ? -5.503  -14.161 -13.447 1.00 19.20 ? 254  LYS E N   1 
ATOM   2899 C CA  . LYS E 1 11 ? -5.016  -15.517 -13.628 1.00 22.72 ? 254  LYS E CA  1 
ATOM   2900 C C   . LYS E 1 11 ? -5.755  -16.242 -14.732 1.00 24.07 ? 254  LYS E C   1 
ATOM   2901 O O   . LYS E 1 11 ? -6.926  -15.953 -15.010 1.00 22.88 ? 254  LYS E O   1 
ATOM   2902 C CB  . LYS E 1 11 ? -5.056  -16.309 -12.314 1.00 23.86 ? 254  LYS E CB  1 
ATOM   2903 C CG  . LYS E 1 11 ? -6.387  -16.868 -11.866 1.00 21.44 ? 254  LYS E CG  1 
ATOM   2904 C CD  . LYS E 1 11 ? -6.333  -17.183 -10.351 1.00 27.96 ? 254  LYS E CD  1 
ATOM   2905 C CE  . LYS E 1 11 ? -7.168  -18.367 -9.943  1.00 29.47 ? 254  LYS E CE  1 
ATOM   2906 N NZ  . LYS E 1 11 ? -7.398  -18.362 -8.477  1.00 30.57 ? 254  LYS E NZ  1 
ATOM   2907 N N   . GLY E 1 12 ? -5.045  -17.175 -15.359 1.00 22.10 ? 255  GLY E N   1 
ATOM   2908 C CA  . GLY E 1 12 ? -5.635  -18.114 -16.288 1.00 22.30 ? 255  GLY E CA  1 
ATOM   2909 C C   . GLY E 1 12 ? -5.643  -19.511 -15.676 1.00 24.46 ? 255  GLY E C   1 
ATOM   2910 O O   . GLY E 1 12 ? -5.514  -19.661 -14.453 1.00 19.94 ? 255  GLY E O   1 
ATOM   2911 N N   . PRO E 1 13 ? -5.766  -20.549 -16.523 1.00 29.98 ? 256  PRO E N   1 
ATOM   2912 C CA  . PRO E 1 13 ? -5.864  -21.949 -16.047 1.00 30.85 ? 256  PRO E CA  1 
ATOM   2913 C C   . PRO E 1 13 ? -4.601  -22.461 -15.338 1.00 30.51 ? 256  PRO E C   1 
ATOM   2914 O O   . PRO E 1 13 ? -4.669  -23.402 -14.556 1.00 36.42 ? 256  PRO E O   1 
ATOM   2915 C CB  . PRO E 1 13 ? -6.122  -22.750 -17.322 1.00 35.10 ? 256  PRO E CB  1 
ATOM   2916 C CG  . PRO E 1 13 ? -5.742  -21.857 -18.463 1.00 34.52 ? 256  PRO E CG  1 
ATOM   2917 C CD  . PRO E 1 13 ? -5.790  -20.437 -17.993 1.00 32.23 ? 256  PRO E CD  1 
ATOM   2918 N N   . GLN E 1 14 ? -3.462  -21.838 -15.601 1.00 26.82 ? 257  GLN E N   1 
ATOM   2919 C CA  . GLN E 1 14 ? -2.215  -22.251 -14.982 1.00 25.34 ? 257  GLN E CA  1 
ATOM   2920 C C   . GLN E 1 14 ? -1.808  -21.335 -13.812 1.00 26.69 ? 257  GLN E C   1 
ATOM   2921 O O   . GLN E 1 14 ? -0.697  -21.455 -13.301 1.00 25.96 ? 257  GLN E O   1 
ATOM   2922 C CB  . GLN E 1 14 ? -1.115  -22.331 -16.048 1.00 28.91 ? 257  GLN E CB  1 
ATOM   2923 N N   . GLY E 1 15 ? -2.724  -20.435 -13.411 1.00 21.95 ? 258  GLY E N   1 
ATOM   2924 C CA  . GLY E 1 15 ? -2.615  -19.633 -12.196 1.00 21.76 ? 258  GLY E CA  1 
ATOM   2925 C C   . GLY E 1 15 ? -1.874  -18.346 -12.447 1.00 19.27 ? 258  GLY E C   1 
ATOM   2926 O O   . GLY E 1 15 ? -1.763  -17.922 -13.578 1.00 21.94 ? 258  GLY E O   1 
ATOM   2927 N N   . PHE E 1 16 ? -1.347  -17.735 -11.395 1.00 15.76 ? 259  PHE E N   1 
ATOM   2928 C CA  . PHE E 1 16 ? -0.597  -16.474 -11.522 1.00 17.30 ? 259  PHE E CA  1 
ATOM   2929 C C   . PHE E 1 16 ? 0.836   -16.661 -12.025 1.00 17.78 ? 259  PHE E C   1 
ATOM   2930 O O   . PHE E 1 16 ? 1.401   -15.745 -12.598 1.00 17.03 ? 259  PHE E O   1 
ATOM   2931 C CB  . PHE E 1 16 ? -0.596  -15.709 -10.200 1.00 20.01 ? 259  PHE E CB  1 
ATOM   2932 C CG  . PHE E 1 16 ? -1.978  -15.290 -9.757  1.00 18.47 ? 259  PHE E CG  1 
ATOM   2933 C CD1 . PHE E 1 16 ? -2.705  -14.369 -10.512 1.00 16.63 ? 259  PHE E CD1 1 
ATOM   2934 C CD2 . PHE E 1 16 ? -2.560  -15.850 -8.620  1.00 21.95 ? 259  PHE E CD2 1 
ATOM   2935 C CE1 . PHE E 1 16 ? -3.986  -14.000 -10.140 1.00 17.53 ? 259  PHE E CE1 1 
ATOM   2936 C CE2 . PHE E 1 16 ? -3.831  -15.487 -8.229  1.00 18.74 ? 259  PHE E CE2 1 
ATOM   2937 C CZ  . PHE E 1 16 ? -4.555  -14.554 -8.988  1.00 20.92 ? 259  PHE E CZ  1 
ATOM   2938 N N   . GLY E 1 17 ? 1.411   -17.828 -11.779 1.00 14.46 ? 260  GLY E N   1 
ATOM   2939 C CA  . GLY E 1 17 ? 2.753   -18.159 -12.268 1.00 19.50 ? 260  GLY E CA  1 
ATOM   2940 C C   . GLY E 1 17 ? 3.907   -17.873 -11.322 1.00 17.35 ? 260  GLY E C   1 
ATOM   2941 O O   . GLY E 1 17 ? 4.955   -17.373 -11.752 1.00 17.11 ? 260  GLY E O   1 
ATOM   2942 N N   . PHE E 1 18 ? 3.740   -18.151 -10.022 1.00 17.27 ? 261  PHE E N   1 
ATOM   2943 C CA  . PHE E 1 18 ? 4.877   -18.055 -9.117  1.00 16.14 ? 261  PHE E CA  1 
ATOM   2944 C C   . PHE E 1 18 ? 4.822   -19.003 -7.952  1.00 15.75 ? 261  PHE E C   1 
ATOM   2945 O O   . PHE E 1 18 ? 3.753   -19.447 -7.539  1.00 16.29 ? 261  PHE E O   1 
ATOM   2946 C CB  . PHE E 1 18 ? 5.109   -16.631 -8.601  1.00 16.44 ? 261  PHE E CB  1 
ATOM   2947 C CG  . PHE E 1 18 ? 4.000   -16.091 -7.765  1.00 15.76 ? 261  PHE E CG  1 
ATOM   2948 C CD1 . PHE E 1 18 ? 4.014   -16.259 -6.377  1.00 13.78 ? 261  PHE E CD1 1 
ATOM   2949 C CD2 . PHE E 1 18 ? 2.960   -15.359 -8.353  1.00 11.37 ? 261  PHE E CD2 1 
ATOM   2950 C CE1 . PHE E 1 18 ? 2.986   -15.727 -5.597  1.00 20.59 ? 261  PHE E CE1 1 
ATOM   2951 C CE2 . PHE E 1 18 ? 1.950   -14.827 -7.577  1.00 20.51 ? 261  PHE E CE2 1 
ATOM   2952 C CZ  . PHE E 1 18 ? 1.962   -15.020 -6.204  1.00 17.74 ? 261  PHE E CZ  1 
ATOM   2953 N N   . LEU E 1 19 ? 6.021   -19.306 -7.457  1.00 17.90 ? 262  LEU E N   1 
ATOM   2954 C CA  . LEU E 1 19 ? 6.260   -20.138 -6.287  1.00 17.36 ? 262  LEU E CA  1 
ATOM   2955 C C   . LEU E 1 19 ? 6.571   -19.222 -5.104  1.00 10.82 ? 262  LEU E C   1 
ATOM   2956 O O   . LEU E 1 19 ? 7.560   -18.489 -5.127  1.00 16.54 ? 262  LEU E O   1 
ATOM   2957 C CB  . LEU E 1 19 ? 7.458   -21.067 -6.542  1.00 15.70 ? 262  LEU E CB  1 
ATOM   2958 C CG  . LEU E 1 19 ? 7.764   -22.050 -5.388  1.00 15.02 ? 262  LEU E CG  1 
ATOM   2959 C CD1 . LEU E 1 19 ? 6.627   -23.006 -5.321  1.00 10.87 ? 262  LEU E CD1 1 
ATOM   2960 C CD2 . LEU E 1 19 ? 9.039   -22.810 -5.623  1.00 17.62 ? 262  LEU E CD2 1 
ATOM   2961 N N   . LEU E 1 20 ? 5.727   -19.294 -4.076  1.00 12.90 ? 263  LEU E N   1 
ATOM   2962 C CA  . LEU E 1 20 ? 5.858   -18.510 -2.870  1.00 11.17 ? 263  LEU E CA  1 
ATOM   2963 C C   . LEU E 1 20 ? 6.454   -19.426 -1.840  1.00 12.60 ? 263  LEU E C   1 
ATOM   2964 O O   . LEU E 1 20 ? 5.952   -20.513 -1.628  1.00 14.57 ? 263  LEU E O   1 
ATOM   2965 C CB  . LEU E 1 20 ? 4.474   -18.041 -2.376  1.00 11.71 ? 263  LEU E CB  1 
ATOM   2966 C CG  . LEU E 1 20 ? 4.439   -16.933 -1.322  1.00 15.70 ? 263  LEU E CG  1 
ATOM   2967 C CD1 . LEU E 1 20 ? 5.173   -15.694 -1.808  1.00 12.08 ? 263  LEU E CD1 1 
ATOM   2968 C CD2 . LEU E 1 20 ? 2.961   -16.609 -0.934  1.00 15.40 ? 263  LEU E CD2 1 
ATOM   2969 N N   . ARG E 1 21 ? 7.545   -19.007 -1.216  1.00 11.50 ? 264  ARG E N   1 
ATOM   2970 C CA  . ARG E 1 21 ? 8.125   -19.787 -0.173  1.00 12.62 ? 264  ARG E CA  1 
ATOM   2971 C C   . ARG E 1 21 ? 8.444   -18.925 1.050   1.00 13.74 ? 264  ARG E C   1 
ATOM   2972 O O   . ARG E 1 21 ? 9.037   -17.877 0.936   1.00 12.50 ? 264  ARG E O   1 
ATOM   2973 C CB  . ARG E 1 21 ? 9.412   -20.424 -0.663  1.00 11.38 ? 264  ARG E CB  1 
ATOM   2974 C CG  . ARG E 1 21 ? 10.096  -21.191 0.438   1.00 21.14 ? 264  ARG E CG  1 
ATOM   2975 C CD  . ARG E 1 21 ? 11.513  -21.478 0.148   1.00 27.36 ? 264  ARG E CD  1 
ATOM   2976 N NE  . ARG E 1 21 ? 11.633  -22.648 -0.679  1.00 33.01 ? 264  ARG E NE  1 
ATOM   2977 C CZ  . ARG E 1 21 ? 11.775  -23.888 -0.222  1.00 49.93 ? 264  ARG E CZ  1 
ATOM   2978 N NH1 . ARG E 1 21 ? 11.816  -24.150 1.083   1.00 55.53 ? 264  ARG E NH1 1 
ATOM   2979 N NH2 . ARG E 1 21 ? 11.891  -24.881 -1.090  1.00 45.95 ? 264  ARG E NH2 1 
ATOM   2980 N N   . GLU E 1 22 ? 8.123   -19.424 2.231   1.00 12.10 ? 265  GLU E N   1 
ATOM   2981 C CA  . GLU E 1 22 ? 8.434   -18.667 3.436   1.00 16.43 ? 265  GLU E CA  1 
ATOM   2982 C C   . GLU E 1 22 ? 9.913   -18.773 3.809   1.00 14.92 ? 265  GLU E C   1 
ATOM   2983 O O   . GLU E 1 22 ? 10.501  -19.865 3.741   1.00 14.16 ? 265  GLU E O   1 
ATOM   2984 C CB  . GLU E 1 22 ? 7.600   -19.170 4.581   1.00 12.09 ? 265  GLU E CB  1 
ATOM   2985 C CG  . GLU E 1 22 ? 7.918   -18.478 5.883   1.00 9.47  ? 265  GLU E CG  1 
ATOM   2986 C CD  . GLU E 1 22 ? 6.918   -18.815 6.910   1.00 14.87 ? 265  GLU E CD  1 
ATOM   2987 O OE1 . GLU E 1 22 ? 5.751   -18.398 6.718   1.00 14.86 ? 265  GLU E OE1 1 
ATOM   2988 O OE2 . GLU E 1 22 ? 7.291   -19.506 7.900   1.00 21.43 ? 265  GLU E OE2 1 
ATOM   2989 N N   . GLU E 1 23 ? 10.522  -17.656 4.202   1.00 13.74 ? 266  GLU E N   1 
ATOM   2990 C CA  . GLU E 1 23 ? 11.814  -17.717 4.919   1.00 15.49 ? 266  GLU E CA  1 
ATOM   2991 C C   . GLU E 1 23 ? 11.798  -16.832 6.119   1.00 15.81 ? 266  GLU E C   1 
ATOM   2992 O O   . GLU E 1 23 ? 11.444  -15.664 6.009   1.00 15.65 ? 266  GLU E O   1 
ATOM   2993 C CB  . GLU E 1 23 ? 12.970  -17.304 4.032   1.00 17.40 ? 266  GLU E CB  1 
ATOM   2994 C CG  . GLU E 1 23 ? 13.380  -18.351 2.995   1.00 15.95 ? 266  GLU E CG  1 
ATOM   2995 C CD  . GLU E 1 23 ? 14.095  -19.551 3.574   1.00 17.96 ? 266  GLU E CD  1 
ATOM   2996 O OE1 . GLU E 1 23 ? 14.329  -19.672 4.806   1.00 21.29 ? 266  GLU E OE1 1 
ATOM   2997 O OE2 . GLU E 1 23 ? 14.396  -20.429 2.789   1.00 24.72 ? 266  GLU E OE2 1 
ATOM   2998 N N   . LYS E 1 24 ? 12.205  -17.362 7.269   1.00 14.66 ? 267  LYS E N   1 
ATOM   2999 C CA  . LYS E 1 24 ? 12.368  -16.500 8.423   1.00 18.11 ? 267  LYS E CA  1 
ATOM   3000 C C   . LYS E 1 24 ? 13.676  -15.707 8.381   1.00 18.06 ? 267  LYS E C   1 
ATOM   3001 O O   . LYS E 1 24 ? 14.742  -16.226 8.064   1.00 15.05 ? 267  LYS E O   1 
ATOM   3002 C CB  . LYS E 1 24 ? 12.247  -17.279 9.730   1.00 18.09 ? 267  LYS E CB  1 
ATOM   3003 C CG  . LYS E 1 24 ? 10.861  -17.785 10.010  1.00 19.19 ? 267  LYS E CG  1 
ATOM   3004 C CD  . LYS E 1 24 ? 10.906  -18.947 11.020  1.00 28.12 ? 267  LYS E CD  1 
ATOM   3005 C CE  . LYS E 1 24 ? 9.544   -19.577 11.206  1.00 34.14 ? 267  LYS E CE  1 
ATOM   3006 N NZ  . LYS E 1 24 ? 8.789   -18.816 12.236  1.00 43.13 ? 267  LYS E NZ  1 
ATOM   3007 N N   . GLY E 1 25 ? 13.571  -14.430 8.731   1.00 16.58 ? 268  GLY E N   1 
ATOM   3008 C CA  . GLY E 1 25 ? 14.733  -13.620 8.879   1.00 15.55 ? 268  GLY E CA  1 
ATOM   3009 C C   . GLY E 1 25 ? 15.403  -13.924 10.192  1.00 20.40 ? 268  GLY E C   1 
ATOM   3010 O O   . GLY E 1 25 ? 14.973  -14.795 10.957  1.00 18.76 ? 268  GLY E O   1 
ATOM   3011 N N   . LEU E 1 26 ? 16.474  -13.182 10.441  1.00 18.31 ? 269  LEU E N   1 
ATOM   3012 C CA  . LEU E 1 26 ? 17.294  -13.359 11.616  1.00 20.11 ? 269  LEU E CA  1 
ATOM   3013 C C   . LEU E 1 26 ? 16.499  -13.007 12.892  1.00 14.12 ? 269  LEU E C   1 
ATOM   3014 O O   . LEU E 1 26 ? 16.749  -13.567 13.957  1.00 17.17 ? 269  LEU E O   1 
ATOM   3015 C CB  . LEU E 1 26 ? 18.552  -12.487 11.492  1.00 10.94 ? 269  LEU E CB  1 
ATOM   3016 C CG  . LEU E 1 26 ? 19.733  -12.922 10.610  1.00 31.45 ? 269  LEU E CG  1 
ATOM   3017 C CD1 . LEU E 1 26 ? 20.795  -11.777 10.538  1.00 28.26 ? 269  LEU E CD1 1 
ATOM   3018 C CD2 . LEU E 1 26 ? 20.347  -14.181 11.166  1.00 34.25 ? 269  LEU E CD2 1 
ATOM   3019 N N   . ASP E 1 27 ? 15.531  -12.097 12.773  1.00 14.37 ? 270  ASP E N   1 
ATOM   3020 C CA  . ASP E 1 27 ? 14.733  -11.712 13.939  1.00 19.89 ? 270  ASP E CA  1 
ATOM   3021 C C   . ASP E 1 27 ? 13.586  -12.681 14.255  1.00 13.49 ? 270  ASP E C   1 
ATOM   3022 O O   . ASP E 1 27 ? 12.907  -12.546 15.274  1.00 16.06 ? 270  ASP E O   1 
ATOM   3023 C CB  . ASP E 1 27 ? 14.248  -10.266 13.825  1.00 20.14 ? 270  ASP E CB  1 
ATOM   3024 C CG  . ASP E 1 27 ? 13.300  -10.031 12.668  1.00 29.27 ? 270  ASP E CG  1 
ATOM   3025 O OD1 . ASP E 1 27 ? 12.952  -10.979 11.907  1.00 20.67 ? 270  ASP E OD1 1 
ATOM   3026 O OD2 . ASP E 1 27 ? 12.895  -8.852  12.543  1.00 23.00 ? 270  ASP E OD2 1 
ATOM   3027 N N   . GLY E 1 28 ? 13.383  -13.653 13.379  1.00 16.07 ? 271  GLY E N   1 
ATOM   3028 C CA  . GLY E 1 28 ? 12.379  -14.671 13.587  1.00 16.51 ? 271  GLY E CA  1 
ATOM   3029 C C   . GLY E 1 28 ? 11.149  -14.413 12.737  1.00 17.11 ? 271  GLY E C   1 
ATOM   3030 O O   . GLY E 1 28 ? 10.339  -15.310 12.534  1.00 20.15 ? 271  GLY E O   1 
ATOM   3031 N N   . ARG E 1 29 ? 11.012  -13.198 12.211  1.00 16.86 ? 272  ARG E N   1 
ATOM   3032 C CA  . ARG E 1 29 ? 9.805   -12.852 11.476  1.00 16.62 ? 272  ARG E CA  1 
ATOM   3033 C C   . ARG E 1 29 ? 9.829   -13.487 10.076  1.00 13.74 ? 272  ARG E C   1 
ATOM   3034 O O   . ARG E 1 29 ? 10.859  -13.491 9.381   1.00 17.88 ? 272  ARG E O   1 
ATOM   3035 C CB  . ARG E 1 29 ? 9.605   -11.328 11.417  1.00 14.72 ? 272  ARG E CB  1 
ATOM   3036 C CG  . ARG E 1 29 ? 9.209   -10.750 12.723  1.00 11.33 ? 272  ARG E CG  1 
ATOM   3037 C CD  . ARG E 1 29 ? 8.875   -9.280  12.645  1.00 19.79 ? 272  ARG E CD  1 
ATOM   3038 N NE  . ARG E 1 29 ? 10.083  -8.466  12.591  1.00 11.73 ? 272  ARG E NE  1 
ATOM   3039 C CZ  . ARG E 1 29 ? 10.097  -7.135  12.643  1.00 20.76 ? 272  ARG E CZ  1 
ATOM   3040 N NH1 . ARG E 1 29 ? 11.243  -6.470  12.610  1.00 18.27 ? 272  ARG E NH1 1 
ATOM   3041 N NH2 . ARG E 1 29 ? 8.972   -6.462  12.721  1.00 18.54 ? 272  ARG E NH2 1 
ATOM   3042 N N   . PRO E 1 30 ? 8.704   -14.076 9.671   1.00 14.93 ? 273  PRO E N   1 
ATOM   3043 C CA  . PRO E 1 30 ? 8.668   -14.726 8.353   1.00 14.32 ? 273  PRO E CA  1 
ATOM   3044 C C   . PRO E 1 30 ? 8.535   -13.714 7.193   1.00 17.37 ? 273  PRO E C   1 
ATOM   3045 O O   . PRO E 1 30 ? 7.831   -12.701 7.319   1.00 20.16 ? 273  PRO E O   1 
ATOM   3046 C CB  . PRO E 1 30 ? 7.451   -15.600 8.440   1.00 11.54 ? 273  PRO E CB  1 
ATOM   3047 C CG  . PRO E 1 30 ? 6.547   -14.885 9.360   1.00 19.70 ? 273  PRO E CG  1 
ATOM   3048 C CD  . PRO E 1 30 ? 7.413   -14.184 10.376  1.00 14.45 ? 273  PRO E CD  1 
ATOM   3049 N N   . GLY E 1 31 ? 9.265   -13.953 6.109   1.00 14.83 ? 274  GLY E N   1 
ATOM   3050 C CA  . GLY E 1 31 ? 9.037   -13.249 4.833   1.00 15.26 ? 274  GLY E CA  1 
ATOM   3051 C C   . GLY E 1 31 ? 8.561   -14.289 3.825   1.00 14.35 ? 274  GLY E C   1 
ATOM   3052 O O   . GLY E 1 31 ? 8.933   -15.445 3.923   1.00 15.22 ? 274  GLY E O   1 
ATOM   3053 N N   . GLN E 1 32 ? 7.701   -13.885 2.894   1.00 15.64 ? 275  GLN E N   1 
ATOM   3054 C CA  . GLN E 1 32 ? 7.210   -14.753 1.827   1.00 15.27 ? 275  GLN E CA  1 
ATOM   3055 C C   . GLN E 1 32 ? 7.868   -14.244 0.570   1.00 13.20 ? 275  GLN E C   1 
ATOM   3056 O O   . GLN E 1 32 ? 7.738   -13.055 0.252   1.00 11.97 ? 275  GLN E O   1 
ATOM   3057 C CB  . GLN E 1 32 ? 5.680   -14.635 1.708   1.00 15.47 ? 275  GLN E CB  1 
ATOM   3058 C CG  . GLN E 1 32 ? 4.945   -14.851 3.001   1.00 14.64 ? 275  GLN E CG  1 
ATOM   3059 C CD  . GLN E 1 32 ? 5.266   -16.184 3.589   1.00 13.99 ? 275  GLN E CD  1 
ATOM   3060 O OE1 . GLN E 1 32 ? 5.457   -17.153 2.855   1.00 11.20 ? 275  GLN E OE1 1 
ATOM   3061 N NE2 . GLN E 1 32 ? 5.360   -16.248 4.925   1.00 11.95 ? 275  GLN E NE2 1 
ATOM   3062 N N   . PHE E 1 33 ? 8.628   -15.107 -0.104  1.00 13.23 ? 276  PHE E N   1 
ATOM   3063 C CA  . PHE E 1 33 ? 9.428   -14.681 -1.249  1.00 10.81 ? 276  PHE E CA  1 
ATOM   3064 C C   . PHE E 1 33 ? 8.928   -15.318 -2.499  1.00 12.40 ? 276  PHE E C   1 
ATOM   3065 O O   . PHE E 1 33 ? 8.484   -16.466 -2.456  1.00 14.31 ? 276  PHE E O   1 
ATOM   3066 C CB  . PHE E 1 33 ? 10.914  -14.990 -1.004  1.00 13.35 ? 276  PHE E CB  1 
ATOM   3067 C CG  . PHE E 1 33 ? 11.446  -14.239 0.163   1.00 15.24 ? 276  PHE E CG  1 
ATOM   3068 C CD1 . PHE E 1 33 ? 11.902  -12.960 0.006   1.00 9.39  ? 276  PHE E CD1 1 
ATOM   3069 C CD2 . PHE E 1 33 ? 11.362  -14.769 1.436   1.00 16.02 ? 276  PHE E CD2 1 
ATOM   3070 C CE1 . PHE E 1 33 ? 12.321  -12.210 1.076   1.00 16.33 ? 276  PHE E CE1 1 
ATOM   3071 C CE2 . PHE E 1 33 ? 11.787  -14.024 2.530   1.00 20.48 ? 276  PHE E CE2 1 
ATOM   3072 C CZ  . PHE E 1 33 ? 12.263  -12.744 2.346   1.00 12.97 ? 276  PHE E CZ  1 
ATOM   3073 N N   . LEU E 1 34 ? 9.004   -14.584 -3.612  1.00 14.31 ? 277  LEU E N   1 
ATOM   3074 C CA  . LEU E 1 34 ? 8.873   -15.188 -4.947  1.00 13.57 ? 277  LEU E CA  1 
ATOM   3075 C C   . LEU E 1 34 ? 10.138  -15.982 -5.264  1.00 17.52 ? 277  LEU E C   1 
ATOM   3076 O O   . LEU E 1 34 ? 11.202  -15.442 -5.681  1.00 16.05 ? 277  LEU E O   1 
ATOM   3077 C CB  . LEU E 1 34 ? 8.540   -14.166 -6.046  1.00 22.42 ? 277  LEU E CB  1 
ATOM   3078 C CG  . LEU E 1 34 ? 7.323   -13.260 -5.857  1.00 26.04 ? 277  LEU E CG  1 
ATOM   3079 C CD1 . LEU E 1 34 ? 6.882   -12.632 -7.217  1.00 18.38 ? 277  LEU E CD1 1 
ATOM   3080 C CD2 . LEU E 1 34 ? 6.194   -13.978 -5.208  1.00 23.29 ? 277  LEU E CD2 1 
ATOM   3081 N N   . TRP E 1 35 ? 10.022  -17.285 -5.025  1.00 13.77 ? 278  TRP E N   1 
ATOM   3082 C CA  . TRP E 1 35 ? 11.157  -18.181 -5.136  1.00 13.89 ? 278  TRP E CA  1 
ATOM   3083 C C   . TRP E 1 35 ? 11.486  -18.439 -6.593  1.00 16.99 ? 278  TRP E C   1 
ATOM   3084 O O   . TRP E 1 35 ? 12.642  -18.557 -6.963  1.00 18.85 ? 278  TRP E O   1 
ATOM   3085 C CB  . TRP E 1 35 ? 10.880  -19.512 -4.424  1.00 13.97 ? 278  TRP E CB  1 
ATOM   3086 C CG  . TRP E 1 35 ? 12.146  -20.150 -3.838  1.00 16.90 ? 278  TRP E CG  1 
ATOM   3087 C CD1 . TRP E 1 35 ? 12.866  -21.189 -4.355  1.00 21.63 ? 278  TRP E CD1 1 
ATOM   3088 C CD2 . TRP E 1 35 ? 12.827  -19.761 -2.630  1.00 16.77 ? 278  TRP E CD2 1 
ATOM   3089 N NE1 . TRP E 1 35 ? 13.947  -21.473 -3.546  1.00 16.09 ? 278  TRP E NE1 1 
ATOM   3090 C CE2 . TRP E 1 35 ? 13.940  -20.623 -2.476  1.00 18.47 ? 278  TRP E CE2 1 
ATOM   3091 C CE3 . TRP E 1 35 ? 12.593  -18.784 -1.657  1.00 21.86 ? 278  TRP E CE3 1 
ATOM   3092 C CZ2 . TRP E 1 35 ? 14.807  -20.530 -1.393  1.00 20.85 ? 278  TRP E CZ2 1 
ATOM   3093 C CZ3 . TRP E 1 35 ? 13.450  -18.699 -0.586  1.00 18.33 ? 278  TRP E CZ3 1 
ATOM   3094 C CH2 . TRP E 1 35 ? 14.552  -19.546 -0.468  1.00 19.07 ? 278  TRP E CH2 1 
ATOM   3095 N N   . GLU E 1 36 ? 10.450  -18.550 -7.410  1.00 17.72 ? 279  GLU E N   1 
ATOM   3096 C CA  . GLU E 1 36 ? 10.575  -18.716 -8.857  1.00 16.34 ? 279  GLU E CA  1 
ATOM   3097 C C   . GLU E 1 36 ? 9.349   -18.068 -9.474  1.00 17.16 ? 279  GLU E C   1 
ATOM   3098 O O   . GLU E 1 36 ? 8.266   -18.116 -8.892  1.00 14.66 ? 279  GLU E O   1 
ATOM   3099 C CB  . GLU E 1 36 ? 10.587  -20.202 -9.262  1.00 23.17 ? 279  GLU E CB  1 
ATOM   3100 C CG  . GLU E 1 36 ? 11.648  -21.071 -8.616  1.00 32.68 ? 279  GLU E CG  1 
ATOM   3101 C CD  . GLU E 1 36 ? 11.428  -22.565 -8.846  1.00 43.38 ? 279  GLU E CD  1 
ATOM   3102 O OE1 . GLU E 1 36 ? 10.750  -22.926 -9.843  1.00 53.23 ? 279  GLU E OE1 1 
ATOM   3103 O OE2 . GLU E 1 36 ? 11.943  -23.379 -8.030  1.00 54.81 ? 279  GLU E OE2 1 
ATOM   3104 N N   . VAL E 1 37 ? 9.523   -17.463 -10.646 1.00 17.27 ? 280  VAL E N   1 
ATOM   3105 C CA  . VAL E 1 37 ? 8.441   -16.862 -11.414 1.00 20.07 ? 280  VAL E CA  1 
ATOM   3106 C C   . VAL E 1 37 ? 8.442   -17.484 -12.805 1.00 21.56 ? 280  VAL E C   1 
ATOM   3107 O O   . VAL E 1 37 ? 9.441   -17.406 -13.489 1.00 18.64 ? 280  VAL E O   1 
ATOM   3108 C CB  . VAL E 1 37 ? 8.648   -15.352 -11.558 1.00 24.32 ? 280  VAL E CB  1 
ATOM   3109 C CG1 . VAL E 1 37 ? 7.500   -14.749 -12.354 1.00 22.60 ? 280  VAL E CG1 1 
ATOM   3110 C CG2 . VAL E 1 37 ? 8.772   -14.685 -10.177 1.00 19.36 ? 280  VAL E CG2 1 
ATOM   3111 N N   . ASP E 1 38 ? 7.326   -18.085 -13.217 1.00 17.84 ? 281  ASP E N   1 
ATOM   3112 C CA  . ASP E 1 38 ? 7.257   -18.870 -14.454 1.00 20.90 ? 281  ASP E CA  1 
ATOM   3113 C C   . ASP E 1 38 ? 7.235   -17.968 -15.676 1.00 15.55 ? 281  ASP E C   1 
ATOM   3114 O O   . ASP E 1 38 ? 6.455   -17.012 -15.724 1.00 15.18 ? 281  ASP E O   1 
ATOM   3115 C CB  . ASP E 1 38 ? 5.992   -19.720 -14.477 1.00 19.60 ? 281  ASP E CB  1 
ATOM   3116 C CG  . ASP E 1 38 ? 5.891   -20.651 -13.293 1.00 33.05 ? 281  ASP E CG  1 
ATOM   3117 O OD1 . ASP E 1 38 ? 6.876   -21.376 -13.017 1.00 42.19 ? 281  ASP E OD1 1 
ATOM   3118 O OD2 . ASP E 1 38 ? 4.830   -20.664 -12.647 1.00 34.54 ? 281  ASP E OD2 1 
ATOM   3119 N N   . PRO E 1 39 ? 8.099   -18.254 -16.661 1.00 18.55 ? 282  PRO E N   1 
ATOM   3120 C CA  . PRO E 1 39 ? 8.035   -17.505 -17.907 1.00 18.06 ? 282  PRO E CA  1 
ATOM   3121 C C   . PRO E 1 39 ? 6.640   -17.563 -18.566 1.00 14.29 ? 282  PRO E C   1 
ATOM   3122 O O   . PRO E 1 39 ? 5.988   -18.597 -18.524 1.00 10.11 ? 282  PRO E O   1 
ATOM   3123 C CB  . PRO E 1 39 ? 9.084   -18.208 -18.800 1.00 18.20 ? 282  PRO E CB  1 
ATOM   3124 C CG  . PRO E 1 39 ? 9.945   -18.957 -17.896 1.00 22.55 ? 282  PRO E CG  1 
ATOM   3125 C CD  . PRO E 1 39 ? 9.174   -19.257 -16.668 1.00 19.50 ? 282  PRO E CD  1 
ATOM   3126 N N   . GLY E 1 40 ? 6.205   -16.458 -19.176 1.00 14.64 ? 283  GLY E N   1 
ATOM   3127 C CA  . GLY E 1 40 ? 4.989   -16.453 -19.989 1.00 10.60 ? 283  GLY E CA  1 
ATOM   3128 C C   . GLY E 1 40 ? 3.669   -16.558 -19.254 1.00 7.97  ? 283  GLY E C   1 
ATOM   3129 O O   . GLY E 1 40 ? 2.604   -16.675 -19.874 1.00 8.69  ? 283  GLY E O   1 
ATOM   3130 N N   . LEU E 1 41 ? 3.732   -16.533 -17.939 1.00 14.02 ? 284  LEU E N   1 
ATOM   3131 C CA  . LEU E 1 41 ? 2.563   -16.543 -17.109 1.00 13.40 ? 284  LEU E CA  1 
ATOM   3132 C C   . LEU E 1 41 ? 2.398   -15.128 -16.486 1.00 12.79 ? 284  LEU E C   1 
ATOM   3133 O O   . LEU E 1 41 ? 3.311   -14.302 -16.597 1.00 13.36 ? 284  LEU E O   1 
ATOM   3134 C CB  . LEU E 1 41 ? 2.678   -17.677 -16.093 1.00 7.75  ? 284  LEU E CB  1 
ATOM   3135 C CG  . LEU E 1 41 ? 2.407   -19.091 -16.612 1.00 19.94 ? 284  LEU E CG  1 
ATOM   3136 C CD1 . LEU E 1 41 ? 2.595   -20.100 -15.508 1.00 18.26 ? 284  LEU E CD1 1 
ATOM   3137 C CD2 . LEU E 1 41 ? 1.013   -19.210 -17.218 1.00 24.93 ? 284  LEU E CD2 1 
ATOM   3138 N N   . PRO E 1 42 ? 1.212   -14.821 -15.917 1.00 15.74 ? 285  PRO E N   1 
ATOM   3139 C CA  . PRO E 1 42 ? 0.908   -13.419 -15.488 1.00 19.38 ? 285  PRO E CA  1 
ATOM   3140 C C   . PRO E 1 42 ? 1.966   -12.657 -14.664 1.00 18.74 ? 285  PRO E C   1 
ATOM   3141 O O   . PRO E 1 42 ? 2.329   -11.522 -15.026 1.00 18.26 ? 285  PRO E O   1 
ATOM   3142 C CB  . PRO E 1 42 ? -0.414  -13.580 -14.719 1.00 18.24 ? 285  PRO E CB  1 
ATOM   3143 C CG  . PRO E 1 42 ? -1.087  -14.739 -15.443 1.00 14.85 ? 285  PRO E CG  1 
ATOM   3144 C CD  . PRO E 1 42 ? 0.054   -15.710 -15.671 1.00 14.56 ? 285  PRO E CD  1 
ATOM   3145 N N   . ALA E 1 43 ? 2.442   -13.247 -13.565 1.00 15.11 ? 286  ALA E N   1 
ATOM   3146 C CA  . ALA E 1 43 ? 3.409   -12.578 -12.707 1.00 12.27 ? 286  ALA E CA  1 
ATOM   3147 C C   . ALA E 1 43 ? 4.626   -12.113 -13.473 1.00 14.52 ? 286  ALA E C   1 
ATOM   3148 O O   . ALA E 1 43 ? 5.047   -10.985 -13.326 1.00 16.24 ? 286  ALA E O   1 
ATOM   3149 C CB  . ALA E 1 43 ? 3.842   -13.490 -11.547 1.00 15.86 ? 286  ALA E CB  1 
ATOM   3150 N N   . LYS E 1 44 ? 5.200   -13.015 -14.270 1.00 19.86 ? 287  LYS E N   1 
ATOM   3151 C CA  . LYS E 1 44 ? 6.364   -12.700 -15.100 1.00 22.58 ? 287  LYS E CA  1 
ATOM   3152 C C   . LYS E 1 44 ? 6.045   -11.597 -16.093 1.00 24.74 ? 287  LYS E C   1 
ATOM   3153 O O   . LYS E 1 44 ? 6.839   -10.679 -16.268 1.00 22.02 ? 287  LYS E O   1 
ATOM   3154 C CB  . LYS E 1 44 ? 6.835   -13.938 -15.869 1.00 20.68 ? 287  LYS E CB  1 
ATOM   3155 C CG  . LYS E 1 44 ? 8.130   -13.727 -16.675 1.00 30.84 ? 287  LYS E CG  1 
ATOM   3156 C CD  . LYS E 1 44 ? 9.310   -13.508 -15.750 1.00 33.06 ? 287  LYS E CD  1 
ATOM   3157 C CE  . LYS E 1 44 ? 10.636  -13.855 -16.404 1.00 41.73 ? 287  LYS E CE  1 
ATOM   3158 N NZ  . LYS E 1 44 ? 11.628  -14.326 -15.392 1.00 51.76 ? 287  LYS E NZ  1 
ATOM   3159 N N   . LYS E 1 45 ? 4.885   -11.698 -16.740 1.00 26.10 ? 288  LYS E N   1 
ATOM   3160 C CA  . LYS E 1 45 ? 4.477   -10.710 -17.738 1.00 26.56 ? 288  LYS E CA  1 
ATOM   3161 C C   . LYS E 1 45 ? 4.293   -9.309  -17.124 1.00 26.63 ? 288  LYS E C   1 
ATOM   3162 O O   . LYS E 1 45 ? 4.442   -8.311  -17.822 1.00 27.49 ? 288  LYS E O   1 
ATOM   3163 C CB  . LYS E 1 45 ? 3.230   -11.189 -18.503 1.00 27.42 ? 288  LYS E CB  1 
ATOM   3164 C CG  . LYS E 1 45 ? 3.527   -12.389 -19.401 1.00 20.61 ? 288  LYS E CG  1 
ATOM   3165 C CD  . LYS E 1 45 ? 2.344   -12.843 -20.260 1.00 21.90 ? 288  LYS E CD  1 
ATOM   3166 C CE  . LYS E 1 45 ? 2.100   -11.920 -21.450 1.00 10.39 ? 288  LYS E CE  1 
ATOM   3167 N NZ  . LYS E 1 45 ? 1.604   -12.601 -22.647 1.00 17.42 ? 288  LYS E NZ  1 
ATOM   3168 N N   . ALA E 1 46 ? 4.015   -9.261  -15.816 1.00 28.78 ? 289  ALA E N   1 
ATOM   3169 C CA  . ALA E 1 46 ? 3.956   -8.024  -15.024 1.00 25.13 ? 289  ALA E CA  1 
ATOM   3170 C C   . ALA E 1 46 ? 5.327   -7.570  -14.481 1.00 28.02 ? 289  ALA E C   1 
ATOM   3171 O O   . ALA E 1 46 ? 5.400   -6.609  -13.724 1.00 35.93 ? 289  ALA E O   1 
ATOM   3172 C CB  . ALA E 1 46 ? 2.961   -8.193  -13.858 1.00 22.79 ? 289  ALA E CB  1 
ATOM   3173 N N   . GLY E 1 47 ? 6.412   -8.253  -14.843 1.00 27.64 ? 290  GLY E N   1 
ATOM   3174 C CA  . GLY E 1 47 ? 7.748   -7.860  -14.393 1.00 28.58 ? 290  GLY E CA  1 
ATOM   3175 C C   . GLY E 1 47 ? 8.194   -8.354  -13.010 1.00 29.91 ? 290  GLY E C   1 
ATOM   3176 O O   . GLY E 1 47 ? 9.279   -7.974  -12.536 1.00 28.95 ? 290  GLY E O   1 
ATOM   3177 N N   . MET E 1 48 ? 7.380   -9.189  -12.358 1.00 25.42 ? 291  MET E N   1 
ATOM   3178 C CA  . MET E 1 48 ? 7.788   -9.822  -11.090 1.00 23.60 ? 291  MET E CA  1 
ATOM   3179 C C   . MET E 1 48 ? 8.994   -10.720 -11.326 1.00 21.11 ? 291  MET E C   1 
ATOM   3180 O O   . MET E 1 48 ? 9.098   -11.373 -12.369 1.00 21.09 ? 291  MET E O   1 
ATOM   3181 C CB  . MET E 1 48 ? 6.644   -10.629 -10.464 1.00 19.39 ? 291  MET E CB  1 
ATOM   3182 C CG  . MET E 1 48 ? 5.481   -9.760  -10.007 1.00 30.84 ? 291  MET E CG  1 
ATOM   3183 S SD  . MET E 1 48 ? 4.092   -10.695 -9.295  1.00 29.64 ? 291  MET E SD  1 
ATOM   3184 C CE  . MET E 1 48 ? 3.341   -9.449  -8.252  1.00 46.73 ? 291  MET E CE  1 
ATOM   3185 N N   . GLN E 1 49 ? 9.895   -10.742 -10.343 1.00 22.23 ? 292  GLN E N   1 
ATOM   3186 C CA  . GLN E 1 49 ? 11.181  -11.408 -10.456 1.00 24.26 ? 292  GLN E CA  1 
ATOM   3187 C C   . GLN E 1 49 ? 11.380  -12.412 -9.350  1.00 19.44 ? 292  GLN E C   1 
ATOM   3188 O O   . GLN E 1 49 ? 10.938  -12.176 -8.242  1.00 16.53 ? 292  GLN E O   1 
ATOM   3189 C CB  . GLN E 1 49 ? 12.311  -10.399 -10.293 1.00 23.98 ? 292  GLN E CB  1 
ATOM   3190 C CG  . GLN E 1 49 ? 12.144  -9.060  -10.956 1.00 32.94 ? 292  GLN E CG  1 
ATOM   3191 C CD  . GLN E 1 49 ? 13.343  -8.163  -10.677 1.00 33.26 ? 292  GLN E CD  1 
ATOM   3192 O OE1 . GLN E 1 49 ? 14.321  -8.594  -10.077 1.00 35.23 ? 292  GLN E OE1 1 
ATOM   3193 N NE2 . GLN E 1 49 ? 13.264  -6.914  -11.103 1.00 47.04 ? 292  GLN E NE2 1 
ATOM   3194 N N   . ALA E 1 50 ? 12.094  -13.503 -9.626  1.00 17.68 ? 293  ALA E N   1 
ATOM   3195 C CA  . ALA E 1 50 ? 12.598  -14.345 -8.554  1.00 20.36 ? 293  ALA E CA  1 
ATOM   3196 C C   . ALA E 1 50 ? 13.440  -13.494 -7.573  1.00 17.23 ? 293  ALA E C   1 
ATOM   3197 O O   . ALA E 1 50 ? 14.257  -12.672 -7.999  1.00 14.61 ? 293  ALA E O   1 
ATOM   3198 C CB  . ALA E 1 50 ? 13.413  -15.483 -9.106  1.00 23.01 ? 293  ALA E CB  1 
ATOM   3199 N N   . GLY E 1 51 ? 13.229  -13.699 -6.276  1.00 14.71 ? 294  GLY E N   1 
ATOM   3200 C CA  . GLY E 1 51 ? 13.857  -12.885 -5.227  1.00 15.69 ? 294  GLY E CA  1 
ATOM   3201 C C   . GLY E 1 51 ? 13.026  -11.732 -4.734  1.00 19.13 ? 294  GLY E C   1 
ATOM   3202 O O   . GLY E 1 51 ? 13.346  -11.140 -3.692  1.00 16.00 ? 294  GLY E O   1 
ATOM   3203 N N   . ASP E 1 52 ? 11.945  -11.409 -5.451  1.00 17.59 ? 295  ASP E N   1 
ATOM   3204 C CA  . ASP E 1 52 ? 10.969  -10.432 -4.957  1.00 13.76 ? 295  ASP E CA  1 
ATOM   3205 C C   . ASP E 1 52 ? 10.443  -10.871 -3.623  1.00 14.69 ? 295  ASP E C   1 
ATOM   3206 O O   . ASP E 1 52 ? 10.180  -12.050 -3.421  1.00 15.19 ? 295  ASP E O   1 
ATOM   3207 C CB  . ASP E 1 52 ? 9.755   -10.336 -5.887  1.00 14.79 ? 295  ASP E CB  1 
ATOM   3208 C CG  . ASP E 1 52 ? 9.976   -9.436  -7.041  1.00 15.24 ? 295  ASP E CG  1 
ATOM   3209 O OD1 . ASP E 1 52 ? 11.054  -8.827  -7.122  1.00 21.34 ? 295  ASP E OD1 1 
ATOM   3210 O OD2 . ASP E 1 52 ? 9.073   -9.353  -7.873  1.00 16.49 ? 295  ASP E OD2 1 
ATOM   3211 N N   . ARG E 1 53 ? 10.253  -9.926  -2.724  1.00 16.22 ? 296  ARG E N   1 
ATOM   3212 C CA  . ARG E 1 53 ? 9.484   -10.172 -1.496  1.00 13.25 ? 296  ARG E CA  1 
ATOM   3213 C C   . ARG E 1 53 ? 8.084   -9.661  -1.753  1.00 13.23 ? 296  ARG E C   1 
ATOM   3214 O O   . ARG E 1 53 ? 7.903   -8.540  -2.281  1.00 13.80 ? 296  ARG E O   1 
ATOM   3215 C CB  . ARG E 1 53 ? 10.086  -9.445  -0.292  1.00 14.65 ? 296  ARG E CB  1 
ATOM   3216 C CG  . ARG E 1 53 ? 9.485   -9.791  1.041   1.00 10.80 ? 296  ARG E CG  1 
ATOM   3217 C CD  . ARG E 1 53 ? 10.248  -9.169  2.165   1.00 15.27 ? 296  ARG E CD  1 
ATOM   3218 N NE  . ARG E 1 53 ? 9.976   -7.729  2.323   1.00 16.40 ? 296  ARG E NE  1 
ATOM   3219 C CZ  . ARG E 1 53 ? 10.760  -6.753  1.890   1.00 16.00 ? 296  ARG E CZ  1 
ATOM   3220 N NH1 . ARG E 1 53 ? 11.874  -7.018  1.223   1.00 26.55 ? 296  ARG E NH1 1 
ATOM   3221 N NH2 . ARG E 1 53 ? 10.428  -5.490  2.117   1.00 18.04 ? 296  ARG E NH2 1 
ATOM   3222 N N   . LEU E 1 54 ? 7.098   -10.494 -1.364  1.00 15.54 ? 297  LEU E N   1 
ATOM   3223 C CA  . LEU E 1 54 ? 5.684   -10.148 -1.421  1.00 13.19 ? 297  LEU E CA  1 
ATOM   3224 C C   . LEU E 1 54 ? 5.364   -9.375  -0.175  1.00 14.59 ? 297  LEU E C   1 
ATOM   3225 O O   . LEU E 1 54 ? 5.499   -9.907  0.935   1.00 11.20 ? 297  LEU E O   1 
ATOM   3226 C CB  . LEU E 1 54 ? 4.784   -11.377 -1.489  1.00 15.47 ? 297  LEU E CB  1 
ATOM   3227 C CG  . LEU E 1 54 ? 3.284   -11.087 -1.643  1.00 14.45 ? 297  LEU E CG  1 
ATOM   3228 C CD1 . LEU E 1 54 ? 2.997   -10.367 -2.956  1.00 14.04 ? 297  LEU E CD1 1 
ATOM   3229 C CD2 . LEU E 1 54 ? 2.504   -12.345 -1.552  1.00 14.76 ? 297  LEU E CD2 1 
ATOM   3230 N N   . VAL E 1 55 ? 4.961   -8.123  -0.391  1.00 15.36 ? 298  VAL E N   1 
ATOM   3231 C CA  . VAL E 1 55 ? 4.720   -7.187  0.673   1.00 16.21 ? 298  VAL E CA  1 
ATOM   3232 C C   . VAL E 1 55 ? 3.263   -6.784  0.860   1.00 15.52 ? 298  VAL E C   1 
ATOM   3233 O O   . VAL E 1 55 ? 2.904   -6.318  1.937   1.00 15.96 ? 298  VAL E O   1 
ATOM   3234 C CB  . VAL E 1 55 ? 5.672   -5.950  0.573   1.00 14.57 ? 298  VAL E CB  1 
ATOM   3235 C CG1 . VAL E 1 55 ? 7.069   -6.431  0.453   1.00 10.53 ? 298  VAL E CG1 1 
ATOM   3236 C CG2 . VAL E 1 55 ? 5.325   -4.990  -0.567  1.00 14.35 ? 298  VAL E CG2 1 
ATOM   3237 N N   . ALA E 1 56 ? 2.421   -6.970  -0.150  1.00 14.51 ? 299  ALA E N   1 
ATOM   3238 C CA  . ALA E 1 56 ? 0.996   -6.652  -0.003  1.00 14.96 ? 299  ALA E CA  1 
ATOM   3239 C C   . ALA E 1 56 ? 0.166   -7.520  -0.932  1.00 15.19 ? 299  ALA E C   1 
ATOM   3240 O O   . ALA E 1 56 ? 0.620   -7.872  -2.027  1.00 16.56 ? 299  ALA E O   1 
ATOM   3241 C CB  . ALA E 1 56 ? 0.719   -5.118  -0.288  1.00 10.30 ? 299  ALA E CB  1 
ATOM   3242 N N   . VAL E 1 57 ? -1.040  -7.858  -0.465  1.00 17.32 ? 300  VAL E N   1 
ATOM   3243 C CA  . VAL E 1 57 ? -2.100  -8.512  -1.264  1.00 12.96 ? 300  VAL E CA  1 
ATOM   3244 C C   . VAL E 1 57 ? -3.427  -7.748  -1.094  1.00 12.96 ? 300  VAL E C   1 
ATOM   3245 O O   . VAL E 1 57 ? -3.881  -7.558  0.043   1.00 16.87 ? 300  VAL E O   1 
ATOM   3246 C CB  . VAL E 1 57 ? -2.352  -9.945  -0.779  1.00 10.22 ? 300  VAL E CB  1 
ATOM   3247 C CG1 . VAL E 1 57 ? -3.575  -10.590 -1.518  1.00 15.17 ? 300  VAL E CG1 1 
ATOM   3248 C CG2 . VAL E 1 57 ? -1.087  -10.776 -0.975  1.00 13.09 ? 300  VAL E CG2 1 
ATOM   3249 N N   . ALA E 1 58 ? -4.012  -7.300  -2.211  1.00 13.15 ? 301  ALA E N   1 
ATOM   3250 C CA  . ALA E 1 58 ? -5.271  -6.567  -2.198  1.00 18.20 ? 301  ALA E CA  1 
ATOM   3251 C C   . ALA E 1 58 ? -5.104  -5.247  -1.458  1.00 17.14 ? 301  ALA E C   1 
ATOM   3252 O O   . ALA E 1 58 ? -6.032  -4.737  -0.847  1.00 13.64 ? 301  ALA E O   1 
ATOM   3253 C CB  . ALA E 1 58 ? -6.371  -7.420  -1.562  1.00 17.06 ? 301  ALA E CB  1 
ATOM   3254 N N   . GLY E 1 59 ? -3.897  -4.687  -1.524  1.00 20.28 ? 302  GLY E N   1 
ATOM   3255 C CA  . GLY E 1 59 ? -3.625  -3.392  -0.908  1.00 17.05 ? 302  GLY E CA  1 
ATOM   3256 C C   . GLY E 1 59 ? -3.265  -3.451  0.570   1.00 19.17 ? 302  GLY E C   1 
ATOM   3257 O O   . GLY E 1 59 ? -2.887  -2.432  1.137   1.00 15.94 ? 302  GLY E O   1 
ATOM   3258 N N   . GLU E 1 60 ? -3.372  -4.637  1.185   1.00 16.21 ? 303  GLU E N   1 
ATOM   3259 C CA  . GLU E 1 60 ? -3.117  -4.812  2.611   1.00 12.44 ? 303  GLU E CA  1 
ATOM   3260 C C   . GLU E 1 60 ? -1.762  -5.450  2.817   1.00 15.84 ? 303  GLU E C   1 
ATOM   3261 O O   . GLU E 1 60 ? -1.425  -6.399  2.146   1.00 15.19 ? 303  GLU E O   1 
ATOM   3262 C CB  . GLU E 1 60 ? -4.194  -5.681  3.247   1.00 18.45 ? 303  GLU E CB  1 
ATOM   3263 C CG  . GLU E 1 60 ? -5.379  -4.908  3.758   1.00 16.90 ? 303  GLU E CG  1 
ATOM   3264 C CD  . GLU E 1 60 ? -6.494  -5.821  4.210   1.00 23.98 ? 303  GLU E CD  1 
ATOM   3265 O OE1 . GLU E 1 60 ? -6.567  -6.128  5.413   1.00 29.22 ? 303  GLU E OE1 1 
ATOM   3266 O OE2 . GLU E 1 60 ? -7.287  -6.257  3.345   1.00 35.24 ? 303  GLU E OE2 1 
ATOM   3267 N N   . SER E 1 61 ? -0.976  -4.912  3.744   1.00 13.42 ? 304  SER E N   1 
ATOM   3268 C CA  . SER E 1 61 ? 0.358   -5.423  3.978   1.00 19.04 ? 304  SER E CA  1 
ATOM   3269 C C   . SER E 1 61 ? 0.345   -6.900  4.419   1.00 19.33 ? 304  SER E C   1 
ATOM   3270 O O   . SER E 1 61 ? -0.470  -7.296  5.262   1.00 15.89 ? 304  SER E O   1 
ATOM   3271 C CB  . SER E 1 61 ? 1.066   -4.588  5.031   1.00 18.01 ? 304  SER E CB  1 
ATOM   3272 O OG  . SER E 1 61 ? 2.364   -5.096  5.223   1.00 18.91 ? 304  SER E OG  1 
ATOM   3273 N N   . VAL E 1 62 ? 1.242   -7.695  3.836   1.00 14.88 ? 305  VAL E N   1 
ATOM   3274 C CA  . VAL E 1 62 ? 1.529   -9.032  4.355   1.00 18.50 ? 305  VAL E CA  1 
ATOM   3275 C C   . VAL E 1 62 ? 2.988   -9.131  4.756   1.00 15.71 ? 305  VAL E C   1 
ATOM   3276 O O   . VAL E 1 62 ? 3.540   -10.227 4.821   1.00 11.30 ? 305  VAL E O   1 
ATOM   3277 C CB  . VAL E 1 62 ? 1.177   -10.162 3.326   1.00 15.43 ? 305  VAL E CB  1 
ATOM   3278 C CG1 . VAL E 1 62 ? -0.321  -10.123 3.049   1.00 13.25 ? 305  VAL E CG1 1 
ATOM   3279 C CG2 . VAL E 1 62 ? 2.008   -10.055 2.041   1.00 12.81 ? 305  VAL E CG2 1 
ATOM   3280 N N   . GLU E 1 63 ? 3.620   -7.987  5.030   1.00 14.40 ? 306  GLU E N   1 
ATOM   3281 C CA  . GLU E 1 63 ? 4.952   -7.999  5.618   1.00 15.05 ? 306  GLU E CA  1 
ATOM   3282 C C   . GLU E 1 63 ? 4.837   -8.706  6.972   1.00 12.85 ? 306  GLU E C   1 
ATOM   3283 O O   . GLU E 1 63 ? 3.921   -8.433  7.739   1.00 13.09 ? 306  GLU E O   1 
ATOM   3284 C CB  . GLU E 1 63 ? 5.507   -6.575  5.795   1.00 13.13 ? 306  GLU E CB  1 
ATOM   3285 C CG  . GLU E 1 63 ? 5.792   -5.874  4.513   1.00 17.66 ? 306  GLU E CG  1 
ATOM   3286 C CD  . GLU E 1 63 ? 7.173   -6.162  3.942   1.00 26.72 ? 306  GLU E CD  1 
ATOM   3287 O OE1 . GLU E 1 63 ? 7.628   -7.362  3.904   1.00 17.74 ? 306  GLU E OE1 1 
ATOM   3288 O OE2 . GLU E 1 63 ? 7.822   -5.165  3.533   1.00 18.55 ? 306  GLU E OE2 1 
ATOM   3289 N N   . GLY E 1 64 ? 5.737   -9.650  7.238   1.00 16.95 ? 307  GLY E N   1 
ATOM   3290 C CA  . GLY E 1 64 ? 5.738   -10.355 8.498   1.00 17.36 ? 307  GLY E CA  1 
ATOM   3291 C C   . GLY E 1 64 ? 4.653   -11.400 8.696   1.00 15.05 ? 307  GLY E C   1 
ATOM   3292 O O   . GLY E 1 64 ? 4.521   -11.926 9.779   1.00 15.61 ? 307  GLY E O   1 
ATOM   3293 N N   . LEU E 1 65 ? 3.869   -11.705 7.665   1.00 14.98 ? 308  LEU E N   1 
ATOM   3294 C CA  . LEU E 1 65 ? 2.736   -12.629 7.809   1.00 13.73 ? 308  LEU E CA  1 
ATOM   3295 C C   . LEU E 1 65 ? 3.169   -14.064 7.413   1.00 14.90 ? 308  LEU E C   1 
ATOM   3296 O O   . LEU E 1 65 ? 4.022   -14.235 6.568   1.00 15.05 ? 308  LEU E O   1 
ATOM   3297 C CB  . LEU E 1 65 ? 1.571   -12.155 6.920   1.00 16.36 ? 308  LEU E CB  1 
ATOM   3298 C CG  . LEU E 1 65 ? 0.187   -12.774 7.091   1.00 18.12 ? 308  LEU E CG  1 
ATOM   3299 C CD1 . LEU E 1 65 ? -0.408  -12.428 8.471   1.00 16.43 ? 308  LEU E CD1 1 
ATOM   3300 C CD2 . LEU E 1 65 ? -0.747  -12.324 5.980   1.00 18.06 ? 308  LEU E CD2 1 
ATOM   3301 N N   . GLY E 1 66 ? 2.557   -15.062 8.040   1.00 11.92 ? 309  GLY E N   1 
ATOM   3302 C CA  . GLY E 1 66 ? 2.859   -16.479 7.807   1.00 16.36 ? 309  GLY E CA  1 
ATOM   3303 C C   . GLY E 1 66 ? 2.368   -16.962 6.452   1.00 14.32 ? 309  GLY E C   1 
ATOM   3304 O O   . GLY E 1 66 ? 1.644   -16.239 5.750   1.00 11.82 ? 309  GLY E O   1 
ATOM   3305 N N   . HIS E 1 67 ? 2.770   -18.181 6.091   1.00 15.79 ? 310  HIS E N   1 
ATOM   3306 C CA  . HIS E 1 67 ? 2.609   -18.691 4.721   1.00 11.86 ? 310  HIS E CA  1 
ATOM   3307 C C   . HIS E 1 67 ? 1.137   -18.956 4.395   1.00 13.67 ? 310  HIS E C   1 
ATOM   3308 O O   . HIS E 1 67 ? 0.607   -18.429 3.411   1.00 12.65 ? 310  HIS E O   1 
ATOM   3309 C CB  . HIS E 1 67 ? 3.431   -19.972 4.505   1.00 14.17 ? 310  HIS E CB  1 
ATOM   3310 C CG  . HIS E 1 67 ? 3.552   -20.375 3.061   1.00 9.83  ? 310  HIS E CG  1 
ATOM   3311 N ND1 . HIS E 1 67 ? 4.125   -19.561 2.112   1.00 13.68 ? 310  HIS E ND1 1 
ATOM   3312 C CD2 . HIS E 1 67 ? 3.095   -21.459 2.401   1.00 8.11  ? 310  HIS E CD2 1 
ATOM   3313 C CE1 . HIS E 1 67 ? 4.049   -20.147 0.936   1.00 12.51 ? 310  HIS E CE1 1 
ATOM   3314 N NE2 . HIS E 1 67 ? 3.427   -21.303 1.085   1.00 11.72 ? 310  HIS E NE2 1 
ATOM   3315 N N   . GLU E 1 68 ? 0.477   -19.752 5.231   1.00 17.06 ? 311  GLU E N   1 
ATOM   3316 C CA  . GLU E 1 68 ? -0.901  -20.151 4.915   1.00 18.97 ? 311  GLU E CA  1 
ATOM   3317 C C   . GLU E 1 68 ? -1.805  -18.936 4.945   1.00 16.23 ? 311  GLU E C   1 
ATOM   3318 O O   . GLU E 1 68 ? -2.660  -18.805 4.093   1.00 15.94 ? 311  GLU E O   1 
ATOM   3319 C CB  . GLU E 1 68 ? -1.433  -21.229 5.856   1.00 20.82 ? 311  GLU E CB  1 
ATOM   3320 C CG  . GLU E 1 68 ? -0.713  -22.587 5.797   1.00 35.68 ? 311  GLU E CG  1 
ATOM   3321 C CD  . GLU E 1 68 ? -0.361  -23.072 4.388   1.00 40.73 ? 311  GLU E CD  1 
ATOM   3322 O OE1 . GLU E 1 68 ? 0.811   -23.460 4.186   1.00 53.47 ? 311  GLU E OE1 1 
ATOM   3323 O OE2 . GLU E 1 68 ? -1.239  -23.089 3.494   1.00 42.87 ? 311  GLU E OE2 1 
ATOM   3324 N N   . GLU E 1 69 ? -1.601  -18.034 5.902   1.00 14.70 ? 312  GLU E N   1 
ATOM   3325 C CA  . GLU E 1 69 ? -2.364  -16.795 5.917   1.00 14.31 ? 312  GLU E CA  1 
ATOM   3326 C C   . GLU E 1 69 ? -2.170  -15.955 4.662   1.00 14.55 ? 312  GLU E C   1 
ATOM   3327 O O   . GLU E 1 69 ? -3.141  -15.357 4.159   1.00 12.06 ? 312  GLU E O   1 
ATOM   3328 C CB  . GLU E 1 69 ? -2.017  -15.957 7.133   1.00 15.79 ? 312  GLU E CB  1 
ATOM   3329 C CG  . GLU E 1 69 ? -2.659  -14.572 7.156   1.00 28.53 ? 312  GLU E CG  1 
ATOM   3330 C CD  . GLU E 1 69 ? -4.154  -14.579 7.400   1.00 35.91 ? 312  GLU E CD  1 
ATOM   3331 O OE1 . GLU E 1 69 ? -4.755  -15.683 7.401   1.00 32.61 ? 312  GLU E OE1 1 
ATOM   3332 O OE2 . GLU E 1 69 ? -4.718  -13.464 7.608   1.00 30.69 ? 312  GLU E OE2 1 
ATOM   3333 N N   . THR E 1 70 ? -0.916  -15.890 4.167   1.00 16.10 ? 313  THR E N   1 
ATOM   3334 C CA  . THR E 1 70 ? -0.623  -15.167 2.943   1.00 13.12 ? 313  THR E CA  1 
ATOM   3335 C C   . THR E 1 70 ? -1.257  -15.843 1.702   1.00 15.54 ? 313  THR E C   1 
ATOM   3336 O O   . THR E 1 70 ? -1.844  -15.170 0.834   1.00 14.94 ? 313  THR E O   1 
ATOM   3337 C CB  . THR E 1 70 ? 0.886   -14.973 2.757   1.00 13.36 ? 313  THR E CB  1 
ATOM   3338 O OG1 . THR E 1 70 ? 1.409   -14.324 3.930   1.00 11.79 ? 313  THR E OG1 1 
ATOM   3339 C CG2 . THR E 1 70 ? 1.173   -14.095 1.544   1.00 12.16 ? 313  THR E CG2 1 
ATOM   3340 N N   . VAL E 1 71 ? -1.118  -17.159 1.610   1.00 13.32 ? 314  VAL E N   1 
ATOM   3341 C CA  . VAL E 1 71 ? -1.732  -17.902 0.506   1.00 12.14 ? 314  VAL E CA  1 
ATOM   3342 C C   . VAL E 1 71 ? -3.268  -17.796 0.514   1.00 10.60 ? 314  VAL E C   1 
ATOM   3343 O O   . VAL E 1 71 ? -3.862  -17.664 -0.522  1.00 17.37 ? 314  VAL E O   1 
ATOM   3344 C CB  . VAL E 1 71 ? -1.346  -19.386 0.522   1.00 13.35 ? 314  VAL E CB  1 
ATOM   3345 C CG1 . VAL E 1 71 ? -2.161  -20.150 -0.541  1.00 13.57 ? 314  VAL E CG1 1 
ATOM   3346 C CG2 . VAL E 1 71 ? 0.199   -19.580 0.272   1.00 15.00 ? 314  VAL E CG2 1 
ATOM   3347 N N   . SER E 1 72 ? -3.913  -17.853 1.670   1.00 12.44 ? 315  SER E N   1 
ATOM   3348 C CA  . SER E 1 72 ? -5.364  -17.751 1.703   1.00 9.53  ? 315  SER E CA  1 
ATOM   3349 C C   . SER E 1 72 ? -5.814  -16.351 1.260   1.00 10.66 ? 315  SER E C   1 
ATOM   3350 O O   . SER E 1 72 ? -6.860  -16.175 0.608   1.00 11.30 ? 315  SER E O   1 
ATOM   3351 C CB  . SER E 1 72 ? -5.898  -18.114 3.085   1.00 14.69 ? 315  SER E CB  1 
ATOM   3352 O OG  . SER E 1 72 ? -5.152  -17.445 4.052   1.00 30.57 ? 315  SER E OG  1 
ATOM   3353 N N   . ARG E 1 73 ? -5.018  -15.349 1.586   1.00 15.84 ? 316  ARG E N   1 
ATOM   3354 C CA  . ARG E 1 73 ? -5.341  -13.977 1.184   1.00 14.87 ? 316  ARG E CA  1 
ATOM   3355 C C   . ARG E 1 73 ? -5.289  -13.810 -0.321  1.00 16.12 ? 316  ARG E C   1 
ATOM   3356 O O   . ARG E 1 73 ? -6.123  -13.113 -0.892  1.00 15.41 ? 316  ARG E O   1 
ATOM   3357 C CB  . ARG E 1 73 ? -4.411  -12.967 1.861   1.00 11.22 ? 316  ARG E CB  1 
ATOM   3358 C CG  . ARG E 1 73 ? -4.849  -12.602 3.234   1.00 19.37 ? 316  ARG E CG  1 
ATOM   3359 C CD  . ARG E 1 73 ? -3.849  -11.711 3.870   1.00 22.93 ? 316  ARG E CD  1 
ATOM   3360 N NE  . ARG E 1 73 ? -4.183  -11.437 5.262   1.00 22.21 ? 316  ARG E NE  1 
ATOM   3361 C CZ  . ARG E 1 73 ? -4.568  -10.265 5.754   1.00 26.81 ? 316  ARG E CZ  1 
ATOM   3362 N NH1 . ARG E 1 73 ? -4.754  -9.194  4.981   1.00 28.13 ? 316  ARG E NH1 1 
ATOM   3363 N NH2 . ARG E 1 73 ? -4.820  -10.174 7.050   1.00 37.26 ? 316  ARG E NH2 1 
ATOM   3364 N N   . ILE E 1 74 ? -4.299  -14.441 -0.954  1.00 16.23 ? 317  ILE E N   1 
ATOM   3365 C CA  . ILE E 1 74 ? -4.190  -14.456 -2.406  1.00 14.81 ? 317  ILE E CA  1 
ATOM   3366 C C   . ILE E 1 74 ? -5.370  -15.225 -2.989  1.00 16.31 ? 317  ILE E C   1 
ATOM   3367 O O   . ILE E 1 74 ? -6.021  -14.752 -3.920  1.00 15.66 ? 317  ILE E O   1 
ATOM   3368 C CB  . ILE E 1 74 ? -2.860  -15.124 -2.880  1.00 17.78 ? 317  ILE E CB  1 
ATOM   3369 C CG1 . ILE E 1 74 ? -1.648  -14.268 -2.478  1.00 16.71 ? 317  ILE E CG1 1 
ATOM   3370 C CG2 . ILE E 1 74 ? -2.855  -15.326 -4.388  1.00 15.11 ? 317  ILE E CG2 1 
ATOM   3371 C CD1 . ILE E 1 74 ? -0.289  -14.970 -2.697  1.00 11.39 ? 317  ILE E CD1 1 
ATOM   3372 N N   . GLN E 1 75 ? -5.652  -16.404 -2.424  1.00 16.15 ? 318  GLN E N   1 
ATOM   3373 C CA  . GLN E 1 75 ? -6.766  -17.251 -2.896  1.00 16.62 ? 318  GLN E CA  1 
ATOM   3374 C C   . GLN E 1 75 ? -8.128  -16.586 -2.691  1.00 18.41 ? 318  GLN E C   1 
ATOM   3375 O O   . GLN E 1 75 ? -9.027  -16.725 -3.531  1.00 16.97 ? 318  GLN E O   1 
ATOM   3376 C CB  . GLN E 1 75 ? -6.724  -18.609 -2.195  1.00 18.23 ? 318  GLN E CB  1 
ATOM   3377 C CG  . GLN E 1 75 ? -5.544  -19.436 -2.633  1.00 17.39 ? 318  GLN E CG  1 
ATOM   3378 C CD  . GLN E 1 75 ? -5.459  -20.830 -1.992  1.00 24.18 ? 318  GLN E CD  1 
ATOM   3379 O OE1 . GLN E 1 75 ? -5.951  -21.071 -0.885  1.00 20.75 ? 318  GLN E OE1 1 
ATOM   3380 N NE2 . GLN E 1 75 ? -4.817  -21.748 -2.703  1.00 25.58 ? 318  GLN E NE2 1 
ATOM   3381 N N   . GLY E 1 76 ? -8.273  -15.856 -1.583  1.00 14.97 ? 319  GLY E N   1 
ATOM   3382 C CA  . GLY E 1 76 ? -9.492  -15.114 -1.269  1.00 15.29 ? 319  GLY E CA  1 
ATOM   3383 C C   . GLY E 1 76 ? -9.933  -14.068 -2.285  1.00 18.87 ? 319  GLY E C   1 
ATOM   3384 O O   . GLY E 1 76 ? -11.116 -13.648 -2.273  1.00 16.06 ? 319  GLY E O   1 
ATOM   3385 N N   . GLN E 1 77 ? -8.993  -13.660 -3.155  1.00 14.95 ? 320  GLN E N   1 
ATOM   3386 C CA  . GLN E 1 77 ? -9.202  -12.631 -4.161  1.00 12.74 ? 320  GLN E CA  1 
ATOM   3387 C C   . GLN E 1 77 ? -9.686  -13.163 -5.492  1.00 14.84 ? 320  GLN E C   1 
ATOM   3388 O O   . GLN E 1 77 ? -10.120 -12.383 -6.335  1.00 17.75 ? 320  GLN E O   1 
ATOM   3389 C CB  . GLN E 1 77 ? -7.905  -11.822 -4.393  1.00 15.60 ? 320  GLN E CB  1 
ATOM   3390 C CG  . GLN E 1 77 ? -7.482  -10.900 -3.243  1.00 11.56 ? 320  GLN E CG  1 
ATOM   3391 C CD  . GLN E 1 77 ? -8.551  -9.931  -2.896  1.00 21.29 ? 320  GLN E CD  1 
ATOM   3392 O OE1 . GLN E 1 77 ? -8.944  -9.115  -3.729  1.00 18.01 ? 320  GLN E OE1 1 
ATOM   3393 N NE2 . GLN E 1 77 ? -9.056  -10.008 -1.663  1.00 17.78 ? 320  GLN E NE2 1 
ATOM   3394 N N   . GLY E 1 78 ? -9.595  -14.481 -5.699  1.00 20.24 ? 321  GLY E N   1 
ATOM   3395 C CA  . GLY E 1 78 ? -10.108 -15.126 -6.915  1.00 19.06 ? 321  GLY E CA  1 
ATOM   3396 C C   . GLY E 1 78 ? -9.299  -14.839 -8.175  1.00 20.18 ? 321  GLY E C   1 
ATOM   3397 O O   . GLY E 1 78 ? -8.072  -14.867 -8.153  1.00 19.57 ? 321  GLY E O   1 
ATOM   3398 N N   . SER E 1 79 ? -10.001 -14.498 -9.254  1.00 22.07 ? 322  SER E N   1 
ATOM   3399 C CA  . SER E 1 79 ? -9.426  -14.377 -10.604 1.00 26.35 ? 322  SER E CA  1 
ATOM   3400 C C   . SER E 1 79 ? -8.433  -13.245 -10.798 1.00 26.05 ? 322  SER E C   1 
ATOM   3401 O O   . SER E 1 79 ? -7.529  -13.362 -11.632 1.00 24.57 ? 322  SER E O   1 
ATOM   3402 C CB  . SER E 1 79 ? -10.550 -14.178 -11.635 1.00 25.11 ? 322  SER E CB  1 
ATOM   3403 O OG  . SER E 1 79 ? -11.448 -15.263 -11.614 1.00 35.59 ? 322  SER E OG  1 
ATOM   3404 N N   . CYS E 1 80 ? -8.636  -12.142 -10.066 1.00 23.47 ? 323  CYS E N   1 
ATOM   3405 C CA  . CYS E 1 80 ? -7.860  -10.912 -10.243 1.00 22.32 ? 323  CYS E CA  1 
ATOM   3406 C C   . CYS E 1 80 ? -7.294  -10.467 -8.897  1.00 26.04 ? 323  CYS E C   1 
ATOM   3407 O O   . CYS E 1 80 ? -8.028  -10.354 -7.907  1.00 24.56 ? 323  CYS E O   1 
ATOM   3408 C CB  . CYS E 1 80 ? -8.740  -9.812  -10.845 1.00 23.59 ? 323  CYS E CB  1 
ATOM   3409 S SG  . CYS E 1 80 ? -9.256  -10.160 -12.562 1.00 42.80 ? 323  CYS E SG  1 
ATOM   3410 N N   . VAL E 1 81 ? -5.991  -10.225 -8.848  1.00 21.09 ? 324  VAL E N   1 
ATOM   3411 C CA  . VAL E 1 81 ? -5.363  -9.885  -7.591  1.00 16.41 ? 324  VAL E CA  1 
ATOM   3412 C C   . VAL E 1 81 ? -4.337  -8.777  -7.788  1.00 20.78 ? 324  VAL E C   1 
ATOM   3413 O O   . VAL E 1 81 ? -3.563  -8.791  -8.762  1.00 16.84 ? 324  VAL E O   1 
ATOM   3414 C CB  . VAL E 1 81 ? -4.720  -11.140 -6.970  1.00 21.98 ? 324  VAL E CB  1 
ATOM   3415 C CG1 . VAL E 1 81 ? -3.521  -11.596 -7.799  1.00 18.54 ? 324  VAL E CG1 1 
ATOM   3416 C CG2 . VAL E 1 81 ? -4.364  -10.915 -5.509  1.00 18.27 ? 324  VAL E CG2 1 
ATOM   3417 N N   . SER E 1 82 ? -4.362  -7.819  -6.861  1.00 16.89 ? 325  SER E N   1 
ATOM   3418 C CA  . SER E 1 82 ? -3.323  -6.834  -6.687  1.00 18.66 ? 325  SER E CA  1 
ATOM   3419 C C   . SER E 1 82 ? -2.286  -7.441  -5.748  1.00 18.25 ? 325  SER E C   1 
ATOM   3420 O O   . SER E 1 82 ? -2.633  -8.014  -4.694  1.00 18.60 ? 325  SER E O   1 
ATOM   3421 C CB  . SER E 1 82 ? -3.915  -5.561  -6.058  1.00 24.98 ? 325  SER E CB  1 
ATOM   3422 O OG  . SER E 1 82 ? -3.010  -4.476  -6.098  1.00 30.53 ? 325  SER E OG  1 
ATOM   3423 N N   . LEU E 1 83 ? -1.015  -7.333  -6.142  1.00 17.84 ? 326  LEU E N   1 
ATOM   3424 C CA  . LEU E 1 83 ? 0.131   -7.798  -5.338  1.00 19.63 ? 326  LEU E CA  1 
ATOM   3425 C C   . LEU E 1 83 ? 1.217   -6.725  -5.387  1.00 18.46 ? 326  LEU E C   1 
ATOM   3426 O O   . LEU E 1 83 ? 1.552   -6.223  -6.461  1.00 22.29 ? 326  LEU E O   1 
ATOM   3427 C CB  . LEU E 1 83 ? 0.708   -9.124  -5.883  1.00 17.33 ? 326  LEU E CB  1 
ATOM   3428 C CG  . LEU E 1 83 ? -0.231  -10.317 -6.001  1.00 18.70 ? 326  LEU E CG  1 
ATOM   3429 C CD1 . LEU E 1 83 ? 0.381   -11.466 -6.812  1.00 13.46 ? 326  LEU E CD1 1 
ATOM   3430 C CD2 . LEU E 1 83 ? -0.588  -10.807 -4.627  1.00 15.53 ? 326  LEU E CD2 1 
ATOM   3431 N N   . THR E 1 84 ? 1.774   -6.398  -4.234  1.00 17.34 ? 327  THR E N   1 
ATOM   3432 C CA  . THR E 1 84 ? 2.899   -5.480  -4.145  1.00 16.44 ? 327  THR E CA  1 
ATOM   3433 C C   . THR E 1 84 ? 4.163   -6.280  -3.786  1.00 14.44 ? 327  THR E C   1 
ATOM   3434 O O   . THR E 1 84 ? 4.142   -7.171  -2.946  1.00 13.67 ? 327  THR E O   1 
ATOM   3435 C CB  . THR E 1 84 ? 2.602   -4.317  -3.148  1.00 18.35 ? 327  THR E CB  1 
ATOM   3436 O OG1 . THR E 1 84 ? 1.349   -3.743  -3.483  1.00 17.52 ? 327  THR E OG1 1 
ATOM   3437 C CG2 . THR E 1 84 ? 3.639   -3.213  -3.198  1.00 13.56 ? 327  THR E CG2 1 
ATOM   3438 N N   . VAL E 1 85 ? 5.241   -5.962  -4.499  1.00 12.63 ? 328  VAL E N   1 
ATOM   3439 C CA  . VAL E 1 85 ? 6.522   -6.599  -4.333  1.00 12.81 ? 328  VAL E CA  1 
ATOM   3440 C C   . VAL E 1 85 ? 7.634   -5.575  -4.159  1.00 12.43 ? 328  VAL E C   1 
ATOM   3441 O O   . VAL E 1 85 ? 7.542   -4.426  -4.619  1.00 15.11 ? 328  VAL E O   1 
ATOM   3442 C CB  . VAL E 1 85 ? 6.902   -7.487  -5.563  1.00 16.79 ? 328  VAL E CB  1 
ATOM   3443 C CG1 . VAL E 1 85 ? 5.901   -8.687  -5.740  1.00 13.16 ? 328  VAL E CG1 1 
ATOM   3444 C CG2 . VAL E 1 85 ? 7.026   -6.602  -6.858  1.00 15.38 ? 328  VAL E CG2 1 
ATOM   3445 N N   . VAL E 1 86 ? 8.689   -6.016  -3.496  1.00 13.47 ? 329  VAL E N   1 
ATOM   3446 C CA  . VAL E 1 86 ? 9.940   -5.278  -3.432  1.00 19.25 ? 329  VAL E CA  1 
ATOM   3447 C C   . VAL E 1 86 ? 11.007  -6.133  -4.114  1.00 17.57 ? 329  VAL E C   1 
ATOM   3448 O O   . VAL E 1 86 ? 11.234  -7.271  -3.721  1.00 13.68 ? 329  VAL E O   1 
ATOM   3449 C CB  . VAL E 1 86 ? 10.375  -4.974  -1.980  1.00 17.28 ? 329  VAL E CB  1 
ATOM   3450 C CG1 . VAL E 1 86 ? 11.864  -4.575  -1.938  1.00 22.81 ? 329  VAL E CG1 1 
ATOM   3451 C CG2 . VAL E 1 86 ? 9.534   -3.845  -1.396  1.00 19.23 ? 329  VAL E CG2 1 
ATOM   3452 N N   . ASP E 1 87 ? 11.628  -5.571  -5.148  1.00 17.63 ? 330  ASP E N   1 
ATOM   3453 C CA  . ASP E 1 87 ? 12.579  -6.296  -5.968  1.00 22.47 ? 330  ASP E CA  1 
ATOM   3454 C C   . ASP E 1 87 ? 13.936  -6.423  -5.284  1.00 21.40 ? 330  ASP E C   1 
ATOM   3455 O O   . ASP E 1 87 ? 14.300  -5.568  -4.471  1.00 19.60 ? 330  ASP E O   1 
ATOM   3456 C CB  . ASP E 1 87 ? 12.743  -5.614  -7.325  1.00 19.15 ? 330  ASP E CB  1 
ATOM   3457 C CG  . ASP E 1 87 ? 11.511  -5.720  -8.175  1.00 24.00 ? 330  ASP E CG  1 
ATOM   3458 O OD1 . ASP E 1 87 ? 10.949  -6.838  -8.363  1.00 22.04 ? 330  ASP E OD1 1 
ATOM   3459 O OD2 . ASP E 1 87 ? 11.100  -4.668  -8.678  1.00 25.85 ? 330  ASP E OD2 1 
ATOM   3460 N N   . PRO E 1 88 ? 14.682  -7.496  -5.620  1.00 21.89 ? 331  PRO E N   1 
ATOM   3461 C CA  . PRO E 1 88 ? 16.008  -7.741  -5.068  1.00 23.93 ? 331  PRO E CA  1 
ATOM   3462 C C   . PRO E 1 88 ? 17.054  -6.897  -5.762  1.00 25.20 ? 331  PRO E C   1 
ATOM   3463 O O   . PRO E 1 88 ? 16.776  -6.325  -6.823  1.00 25.00 ? 331  PRO E O   1 
ATOM   3464 C CB  . PRO E 1 88 ? 16.251  -9.227  -5.409  1.00 25.24 ? 331  PRO E CB  1 
ATOM   3465 C CG  . PRO E 1 88 ? 15.521  -9.436  -6.673  1.00 24.88 ? 331  PRO E CG  1 
ATOM   3466 C CD  . PRO E 1 88 ? 14.306  -8.536  -6.602  1.00 24.75 ? 331  PRO E CD  1 
ATOM   3467 N N   . GLU E 1 89 ? 18.261  -6.835  -5.195  1.00 31.99 ? 332  GLU E N   1 
ATOM   3468 C CA  . GLU E 1 89 ? 19.429  -6.387  -5.970  1.00 33.70 ? 332  GLU E CA  1 
ATOM   3469 C C   . GLU E 1 89 ? 20.031  -7.554  -6.779  1.00 33.49 ? 332  GLU E C   1 
ATOM   3470 O O   . GLU E 1 89 ? 20.512  -8.530  -6.216  1.00 35.42 ? 332  GLU E O   1 
ATOM   3471 C CB  . GLU E 1 89 ? 20.476  -5.769  -5.055  1.00 37.33 ? 332  GLU E CB  1 
ATOM   3472 C CG  . GLU E 1 89 ? 19.980  -4.543  -4.281  1.00 43.27 ? 332  GLU E CG  1 
ATOM   3473 C CD  . GLU E 1 89 ? 19.749  -4.796  -2.804  1.00 51.73 ? 332  GLU E CD  1 
ATOM   3474 O OE1 . GLU E 1 89 ? 19.981  -5.931  -2.348  1.00 53.24 ? 332  GLU E OE1 1 
ATOM   3475 O OE2 . GLU E 1 89 ? 19.358  -3.849  -2.086  1.00 53.30 ? 332  GLU E OE2 1 
ATOM   3476 N N   . ALA E 1 90 ? 20.014  -7.433  -8.106  1.00 43.92 ? 333  ALA E N   1 
ATOM   3477 C CA  . ALA E 1 90 ? 20.413  -8.521  -9.029  1.00 45.02 ? 333  ALA E CA  1 
ATOM   3478 C C   . ALA E 1 90 ? 21.781  -9.151  -8.740  1.00 42.82 ? 333  ALA E C   1 
ATOM   3479 O O   . ALA E 1 90 ? 22.019  -10.312 -9.088  1.00 39.32 ? 333  ALA E O   1 
ATOM   3480 C CB  . ALA E 1 90 ? 20.372  -8.023  -10.484 1.00 47.58 ? 333  ALA E CB  1 
ATOM   3481 N N   . ASP E 1 91 ? 22.661  -8.373  -8.112  1.00 36.97 ? 334  ASP E N   1 
ATOM   3482 C CA  . ASP E 1 91 ? 24.032  -8.782  -7.795  1.00 35.08 ? 334  ASP E CA  1 
ATOM   3483 C C   . ASP E 1 91 ? 24.211  -9.458  -6.420  1.00 28.26 ? 334  ASP E C   1 
ATOM   3484 O O   . ASP E 1 91 ? 25.337  -9.706  -5.998  1.00 26.62 ? 334  ASP E O   1 
ATOM   3485 C CB  . ASP E 1 91 ? 24.939  -7.552  -7.858  1.00 37.81 ? 334  ASP E CB  1 
ATOM   3486 C CG  . ASP E 1 91 ? 24.480  -6.440  -6.915  1.00 51.10 ? 334  ASP E CG  1 
ATOM   3487 O OD1 . ASP E 1 91 ? 23.249  -6.207  -6.812  1.00 42.34 ? 334  ASP E OD1 1 
ATOM   3488 O OD2 . ASP E 1 91 ? 25.350  -5.804  -6.284  1.00 71.94 ? 334  ASP E OD2 1 
ATOM   3489 N N   . ARG E 1 92 ? 23.126  -9.749  -5.709  1.00 19.17 ? 335  ARG E N   1 
ATOM   3490 C CA  . ARG E 1 92 ? 23.255  -10.396 -4.410  1.00 15.30 ? 335  ARG E CA  1 
ATOM   3491 C C   . ARG E 1 92 ? 22.748  -11.825 -4.483  1.00 9.37  ? 335  ARG E C   1 
ATOM   3492 O O   . ARG E 1 92 ? 22.072  -12.306 -3.591  1.00 14.11 ? 335  ARG E O   1 
ATOM   3493 C CB  . ARG E 1 92 ? 22.612  -9.557  -3.294  1.00 11.73 ? 335  ARG E CB  1 
ATOM   3494 C CG  . ARG E 1 92 ? 23.106  -8.118  -3.292  1.00 14.11 ? 335  ARG E CG  1 
ATOM   3495 C CD  . ARG E 1 92 ? 23.405  -7.605  -1.944  1.00 22.25 ? 335  ARG E CD  1 
ATOM   3496 N NE  . ARG E 1 92 ? 23.805  -6.194  -1.962  1.00 30.73 ? 335  ARG E NE  1 
ATOM   3497 C CZ  . ARG E 1 92 ? 23.524  -5.301  -1.008  1.00 27.18 ? 335  ARG E CZ  1 
ATOM   3498 N NH1 . ARG E 1 92 ? 22.816  -5.634  0.058   1.00 26.21 ? 335  ARG E NH1 1 
ATOM   3499 N NH2 . ARG E 1 92 ? 23.950  -4.049  -1.119  1.00 27.36 ? 335  ARG E NH2 1 
ATOM   3500 N N   . GLU E 1 93 ? 23.117  -12.490 -5.584  1.00 11.19 ? 336  GLU E N   1 
ATOM   3501 C CA  . GLU E 1 93 ? 22.953  -13.926 -5.793  1.00 16.53 ? 336  GLU E CA  1 
ATOM   3502 C C   . GLU E 1 93 ? 24.244  -14.434 -6.440  1.00 13.47 ? 336  GLU E C   1 
ATOM   3503 O O   . GLU E 1 93 ? 24.776  -13.805 -7.342  1.00 10.62 ? 336  GLU E O   1 
ATOM   3504 C CB  . GLU E 1 93 ? 21.750  -14.236 -6.713  1.00 15.10 ? 336  GLU E CB  1 
ATOM   3505 C CG  . GLU E 1 93 ? 21.761  -13.475 -8.061  1.00 26.66 ? 336  GLU E CG  1 
ATOM   3506 C CD  . GLU E 1 93 ? 21.113  -14.258 -9.213  1.00 33.13 ? 336  GLU E CD  1 
ATOM   3507 O OE1 . GLU E 1 93 ? 21.633  -14.183 -10.359 1.00 49.32 ? 336  GLU E OE1 1 
ATOM   3508 O OE2 . GLU E 1 93 ? 20.109  -14.965 -8.970  1.00 49.05 ? 336  GLU E OE2 1 
ATOM   3509 N N   . THR E 1 94 ? 24.758  -15.556 -5.965  1.00 12.23 ? 337  THR E N   1 
ATOM   3510 C CA  . THR E 1 94 ? 25.969  -16.124 -6.507  1.00 8.24  ? 337  THR E CA  1 
ATOM   3511 C C   . THR E 1 94 ? 25.916  -17.636 -6.518  1.00 8.07  ? 337  THR E C   1 
ATOM   3512 O O   . THR E 1 94 ? 25.549  -18.262 -5.521  1.00 10.41 ? 337  THR E O   1 
ATOM   3513 C CB  . THR E 1 94 ? 27.205  -15.686 -5.676  1.00 14.66 ? 337  THR E CB  1 
ATOM   3514 O OG1 . THR E 1 94 ? 27.236  -14.247 -5.551  1.00 8.57  ? 337  THR E OG1 1 
ATOM   3515 C CG2 . THR E 1 94 ? 28.478  -16.203 -6.303  1.00 2.00  ? 337  THR E CG2 1 
ATOM   3516 N N   . SER E 1 95 ? 26.301  -18.215 -7.654  1.00 13.16 ? 338  SER E N   1 
ATOM   3517 C CA  . SER E 1 95 ? 26.423  -19.648 -7.785  1.00 11.27 ? 338  SER E CA  1 
ATOM   3518 C C   . SER E 1 95 ? 27.833  -20.049 -7.371  1.00 10.86 ? 338  SER E C   1 
ATOM   3519 O O   . SER E 1 95 ? 28.822  -19.534 -7.909  1.00 3.19  ? 338  SER E O   1 
ATOM   3520 C CB  . SER E 1 95 ? 26.103  -20.094 -9.226  1.00 21.82 ? 338  SER E CB  1 
ATOM   3521 O OG  . SER E 1 95 ? 26.355  -21.483 -9.409  1.00 12.31 ? 338  SER E OG  1 
ATOM   3522 N N   . VAL E 1 96 ? 27.935  -20.937 -6.383  1.00 12.38 ? 339  VAL E N   1 
ATOM   3523 C CA  . VAL E 1 96 ? 29.239  -21.384 -5.871  1.00 18.04 ? 339  VAL E CA  1 
ATOM   3524 C C   . VAL E 1 96 ? 29.381  -22.901 -6.064  1.00 20.88 ? 339  VAL E C   1 
ATOM   3525 O O   . VAL E 1 96 ? 28.392  -23.606 -6.206  1.00 17.27 ? 339  VAL E O   1 
ATOM   3526 C CB  . VAL E 1 96 ? 29.439  -20.995 -4.362  1.00 21.14 ? 339  VAL E CB  1 
ATOM   3527 C CG1 . VAL E 1 96 ? 29.394  -19.475 -4.162  1.00 23.58 ? 339  VAL E CG1 1 
ATOM   3528 C CG2 . VAL E 1 96 ? 28.389  -21.652 -3.487  1.00 19.65 ? 339  VAL E CG2 1 
ATOM   3529 O OXT . VAL E 1 96 ? 30.468  -23.480 -6.066  1.00 19.57 ? 339  VAL E OXT 1 
ATOM   3530 N N   . MET F 1 2  ? 33.590  47.490  27.124  1.00 56.89 ? 245  MET F N   1 
ATOM   3531 C CA  . MET F 1 2  ? 32.812  47.896  25.911  1.00 54.92 ? 245  MET F CA  1 
ATOM   3532 C C   . MET F 1 2  ? 31.418  48.430  26.273  1.00 54.10 ? 245  MET F C   1 
ATOM   3533 O O   . MET F 1 2  ? 30.875  48.122  27.342  1.00 54.95 ? 245  MET F O   1 
ATOM   3534 C CB  . MET F 1 2  ? 32.690  46.713  24.944  1.00 53.95 ? 245  MET F CB  1 
ATOM   3535 N N   . LYS F 1 3  ? 30.856  49.248  25.383  1.00 52.42 ? 246  LYS F N   1 
ATOM   3536 C CA  . LYS F 1 3  ? 29.497  49.767  25.546  1.00 47.36 ? 246  LYS F CA  1 
ATOM   3537 C C   . LYS F 1 3  ? 28.509  48.637  25.282  1.00 40.84 ? 246  LYS F C   1 
ATOM   3538 O O   . LYS F 1 3  ? 28.695  47.885  24.325  1.00 43.63 ? 246  LYS F O   1 
ATOM   3539 C CB  . LYS F 1 3  ? 29.222  50.903  24.557  1.00 47.00 ? 246  LYS F CB  1 
ATOM   3540 C CG  . LYS F 1 3  ? 30.101  52.123  24.743  1.00 53.74 ? 246  LYS F CG  1 
ATOM   3541 N N   . PRO F 1 4  ? 27.463  48.502  26.124  1.00 31.63 ? 247  PRO F N   1 
ATOM   3542 C CA  . PRO F 1 4  ? 26.396  47.521  25.832  1.00 27.62 ? 247  PRO F CA  1 
ATOM   3543 C C   . PRO F 1 4  ? 25.755  47.748  24.457  1.00 25.92 ? 247  PRO F C   1 
ATOM   3544 O O   . PRO F 1 4  ? 25.634  48.892  24.013  1.00 25.32 ? 247  PRO F O   1 
ATOM   3545 C CB  . PRO F 1 4  ? 25.356  47.771  26.936  1.00 26.53 ? 247  PRO F CB  1 
ATOM   3546 C CG  . PRO F 1 4  ? 26.071  48.507  28.029  1.00 25.61 ? 247  PRO F CG  1 
ATOM   3547 C CD  . PRO F 1 4  ? 27.231  49.230  27.387  1.00 31.09 ? 247  PRO F CD  1 
ATOM   3548 N N   . ARG F 1 5  ? 25.363  46.664  23.795  1.00 23.16 ? 248  ARG F N   1 
ATOM   3549 C CA  . ARG F 1 5  ? 24.636  46.728  22.531  1.00 24.85 ? 248  ARG F CA  1 
ATOM   3550 C C   . ARG F 1 5  ? 23.340  45.947  22.696  1.00 21.26 ? 248  ARG F C   1 
ATOM   3551 O O   . ARG F 1 5  ? 23.395  44.752  22.974  1.00 16.26 ? 248  ARG F O   1 
ATOM   3552 C CB  . ARG F 1 5  ? 25.459  46.107  21.391  1.00 24.15 ? 248  ARG F CB  1 
ATOM   3553 C CG  . ARG F 1 5  ? 26.811  46.760  21.159  1.00 32.72 ? 248  ARG F CG  1 
ATOM   3554 C CD  . ARG F 1 5  ? 27.721  45.879  20.308  1.00 37.17 ? 248  ARG F CD  1 
ATOM   3555 N NE  . ARG F 1 5  ? 27.025  45.356  19.131  1.00 40.18 ? 248  ARG F NE  1 
ATOM   3556 C CZ  . ARG F 1 5  ? 26.956  44.068  18.769  1.00 36.83 ? 248  ARG F CZ  1 
ATOM   3557 N NH1 . ARG F 1 5  ? 27.581  43.113  19.460  1.00 31.83 ? 248  ARG F NH1 1 
ATOM   3558 N NH2 . ARG F 1 5  ? 26.259  43.731  17.676  1.00 35.50 ? 248  ARG F NH2 1 
ATOM   3559 N N   . CYS F 1 6  ? 22.203  46.632  22.529  1.00 20.67 ? 249  CYS F N   1 
ATOM   3560 C CA  . CYS F 1 6  ? 20.862  46.021  22.558  1.00 22.92 ? 249  CYS F CA  1 
ATOM   3561 C C   . CYS F 1 6  ? 20.437  45.627  21.142  1.00 23.13 ? 249  CYS F C   1 
ATOM   3562 O O   . CYS F 1 6  ? 20.287  46.473  20.271  1.00 26.10 ? 249  CYS F O   1 
ATOM   3563 C CB  . CYS F 1 6  ? 19.811  46.971  23.142  1.00 21.65 ? 249  CYS F CB  1 
ATOM   3564 S SG  . CYS F 1 6  ? 18.134  46.224  23.215  1.00 27.53 ? 249  CYS F SG  1 
ATOM   3565 N N   . LEU F 1 7  ? 20.242  44.334  20.938  1.00 21.40 ? 250  LEU F N   1 
ATOM   3566 C CA  . LEU F 1 7  ? 19.925  43.789  19.636  1.00 22.53 ? 250  LEU F CA  1 
ATOM   3567 C C   . LEU F 1 7  ? 18.543  43.118  19.714  1.00 21.80 ? 250  LEU F C   1 
ATOM   3568 O O   . LEU F 1 7  ? 18.116  42.658  20.774  1.00 22.49 ? 250  LEU F O   1 
ATOM   3569 C CB  . LEU F 1 7  ? 21.030  42.801  19.247  1.00 25.21 ? 250  LEU F CB  1 
ATOM   3570 C CG  . LEU F 1 7  ? 22.434  43.438  19.128  1.00 29.98 ? 250  LEU F CG  1 
ATOM   3571 C CD1 . LEU F 1 7  ? 23.557  42.421  19.272  1.00 28.61 ? 250  LEU F CD1 1 
ATOM   3572 C CD2 . LEU F 1 7  ? 22.602  44.219  17.837  1.00 27.86 ? 250  LEU F CD2 1 
ATOM   3573 N N   . HIS F 1 8  ? 17.824  43.102  18.600  1.00 23.19 ? 251  HIS F N   1 
ATOM   3574 C CA  . HIS F 1 8  ? 16.485  42.502  18.565  1.00 21.96 ? 251  HIS F CA  1 
ATOM   3575 C C   . HIS F 1 8  ? 16.472  41.263  17.680  1.00 22.11 ? 251  HIS F C   1 
ATOM   3576 O O   . HIS F 1 8  ? 16.810  41.343  16.488  1.00 19.34 ? 251  HIS F O   1 
ATOM   3577 C CB  . HIS F 1 8  ? 15.479  43.547  18.095  1.00 25.67 ? 251  HIS F CB  1 
ATOM   3578 C CG  . HIS F 1 8  ? 15.441  44.755  18.979  1.00 33.80 ? 251  HIS F CG  1 
ATOM   3579 N ND1 . HIS F 1 8  ? 16.356  45.782  18.877  1.00 36.26 ? 251  HIS F ND1 1 
ATOM   3580 C CD2 . HIS F 1 8  ? 14.636  45.070  20.024  1.00 50.18 ? 251  HIS F CD2 1 
ATOM   3581 C CE1 . HIS F 1 8  ? 16.096  46.693  19.799  1.00 41.38 ? 251  HIS F CE1 1 
ATOM   3582 N NE2 . HIS F 1 8  ? 15.057  46.286  20.506  1.00 43.17 ? 251  HIS F NE2 1 
ATOM   3583 N N   . LEU F 1 9  ? 16.108  40.119  18.259  1.00 17.52 ? 252  LEU F N   1 
ATOM   3584 C CA  . LEU F 1 9  ? 16.145  38.865  17.514  1.00 18.24 ? 252  LEU F CA  1 
ATOM   3585 C C   . LEU F 1 9  ? 14.755  38.346  17.253  1.00 17.19 ? 252  LEU F C   1 
ATOM   3586 O O   . LEU F 1 9  ? 13.863  38.477  18.097  1.00 18.21 ? 252  LEU F O   1 
ATOM   3587 C CB  . LEU F 1 9  ? 16.945  37.798  18.266  1.00 14.34 ? 252  LEU F CB  1 
ATOM   3588 C CG  . LEU F 1 9  ? 18.383  38.185  18.662  1.00 20.53 ? 252  LEU F CG  1 
ATOM   3589 C CD1 . LEU F 1 9  ? 19.064  36.991  19.327  1.00 20.99 ? 252  LEU F CD1 1 
ATOM   3590 C CD2 . LEU F 1 9  ? 19.200  38.684  17.477  1.00 18.13 ? 252  LEU F CD2 1 
ATOM   3591 N N   . GLU F 1 10 ? 14.588  37.748  16.080  1.00 16.61 ? 253  GLU F N   1 
ATOM   3592 C CA  . GLU F 1 10 ? 13.434  36.914  15.782  1.00 19.81 ? 253  GLU F CA  1 
ATOM   3593 C C   . GLU F 1 10 ? 13.957  35.528  15.561  1.00 21.20 ? 253  GLU F C   1 
ATOM   3594 O O   . GLU F 1 10 ? 14.855  35.327  14.741  1.00 20.54 ? 253  GLU F O   1 
ATOM   3595 C CB  . GLU F 1 10 ? 12.733  37.387  14.518  1.00 20.07 ? 253  GLU F CB  1 
ATOM   3596 C CG  . GLU F 1 10 ? 12.033  38.729  14.656  1.00 33.08 ? 253  GLU F CG  1 
ATOM   3597 C CD  . GLU F 1 10 ? 12.692  39.832  13.840  1.00 51.36 ? 253  GLU F CD  1 
ATOM   3598 O OE1 . GLU F 1 10 ? 13.828  40.251  14.184  1.00 47.02 ? 253  GLU F OE1 1 
ATOM   3599 O OE2 . GLU F 1 10 ? 12.065  40.280  12.852  1.00 49.28 ? 253  GLU F OE2 1 
ATOM   3600 N N   . LYS F 1 11 ? 13.415  34.550  16.270  1.00 21.73 ? 254  LYS F N   1 
ATOM   3601 C CA  . LYS F 1 11 ? 13.888  33.206  16.057  1.00 21.21 ? 254  LYS F CA  1 
ATOM   3602 C C   . LYS F 1 11 ? 13.075  32.545  14.976  1.00 23.27 ? 254  LYS F C   1 
ATOM   3603 O O   . LYS F 1 11 ? 11.917  32.890  14.739  1.00 21.99 ? 254  LYS F O   1 
ATOM   3604 C CB  . LYS F 1 11 ? 13.928  32.395  17.346  1.00 22.48 ? 254  LYS F CB  1 
ATOM   3605 C CG  . LYS F 1 11 ? 12.677  31.778  17.841  1.00 20.41 ? 254  LYS F CG  1 
ATOM   3606 C CD  . LYS F 1 11 ? 12.868  31.285  19.284  1.00 28.66 ? 254  LYS F CD  1 
ATOM   3607 C CE  . LYS F 1 11 ? 11.725  30.388  19.756  1.00 28.15 ? 254  LYS F CE  1 
ATOM   3608 N NZ  . LYS F 1 11 ? 11.300  30.714  21.143  1.00 27.98 ? 254  LYS F NZ  1 
ATOM   3609 N N   . GLY F 1 12 ? 13.739  31.644  14.279  1.00 22.36 ? 255  GLY F N   1 
ATOM   3610 C CA  . GLY F 1 12 ? 13.100  30.706  13.381  1.00 22.89 ? 255  GLY F CA  1 
ATOM   3611 C C   . GLY F 1 12 ? 13.213  29.302  13.951  1.00 23.49 ? 255  GLY F C   1 
ATOM   3612 O O   . GLY F 1 12 ? 13.440  29.135  15.152  1.00 23.18 ? 255  GLY F O   1 
ATOM   3613 N N   . PRO F 1 13 ? 13.098  28.276  13.087  1.00 30.20 ? 256  PRO F N   1 
ATOM   3614 C CA  . PRO F 1 13 ? 12.986  26.884  13.563  1.00 30.83 ? 256  PRO F CA  1 
ATOM   3615 C C   . PRO F 1 13 ? 14.251  26.370  14.242  1.00 31.41 ? 256  PRO F C   1 
ATOM   3616 O O   . PRO F 1 13 ? 14.216  25.345  14.916  1.00 38.49 ? 256  PRO F O   1 
ATOM   3617 C CB  . PRO F 1 13 ? 12.697  26.093  12.285  1.00 34.44 ? 256  PRO F CB  1 
ATOM   3618 C CG  . PRO F 1 13 ? 13.167  26.961  11.154  1.00 33.88 ? 256  PRO F CG  1 
ATOM   3619 C CD  . PRO F 1 13 ? 13.104  28.379  11.616  1.00 30.25 ? 256  PRO F CD  1 
ATOM   3620 N N   . GLN F 1 14 ? 15.351  27.096  14.081  1.00 27.46 ? 257  GLN F N   1 
ATOM   3621 C CA  . GLN F 1 14 ? 16.648  26.688  14.594  1.00 27.74 ? 257  GLN F CA  1 
ATOM   3622 C C   . GLN F 1 14 ? 17.028  27.476  15.872  1.00 26.23 ? 257  GLN F C   1 
ATOM   3623 O O   . GLN F 1 14 ? 18.050  27.199  16.489  1.00 22.77 ? 257  GLN F O   1 
ATOM   3624 C CB  . GLN F 1 14 ? 17.686  26.847  13.467  1.00 29.69 ? 257  GLN F CB  1 
ATOM   3625 C CG  . GLN F 1 14 ? 17.140  26.354  12.100  1.00 25.13 ? 257  GLN F CG  1 
ATOM   3626 C CD  . GLN F 1 14 ? 17.826  26.927  10.861  1.00 40.10 ? 257  GLN F CD  1 
ATOM   3627 O OE1 . GLN F 1 14 ? 18.998  26.621  10.575  1.00 40.20 ? 257  GLN F OE1 1 
ATOM   3628 N NE2 . GLN F 1 14 ? 17.064  27.707  10.074  1.00 28.77 ? 257  GLN F NE2 1 
ATOM   3629 N N   . GLY F 1 15 ? 16.169  28.422  16.272  1.00 23.26 ? 258  GLY F N   1 
ATOM   3630 C CA  . GLY F 1 15 ? 16.338  29.196  17.503  1.00 21.55 ? 258  GLY F CA  1 
ATOM   3631 C C   . GLY F 1 15 ? 17.104  30.476  17.269  1.00 20.79 ? 258  GLY F C   1 
ATOM   3632 O O   . GLY F 1 15 ? 17.274  30.907  16.141  1.00 23.74 ? 258  GLY F O   1 
ATOM   3633 N N   . PHE F 1 16 ? 17.592  31.074  18.342  1.00 17.55 ? 259  PHE F N   1 
ATOM   3634 C CA  . PHE F 1 16 ? 18.320  32.341  18.265  1.00 16.87 ? 259  PHE F CA  1 
ATOM   3635 C C   . PHE F 1 16 ? 19.773  32.188  17.792  1.00 17.00 ? 259  PHE F C   1 
ATOM   3636 O O   . PHE F 1 16 ? 20.318  33.136  17.231  1.00 16.67 ? 259  PHE F O   1 
ATOM   3637 C CB  . PHE F 1 16 ? 18.247  33.091  19.603  1.00 19.16 ? 259  PHE F CB  1 
ATOM   3638 C CG  . PHE F 1 16 ? 16.845  33.485  19.986  1.00 16.79 ? 259  PHE F CG  1 
ATOM   3639 C CD1 . PHE F 1 16 ? 16.125  34.369  19.189  1.00 18.02 ? 259  PHE F CD1 1 
ATOM   3640 C CD2 . PHE F 1 16 ? 16.228  32.939  21.102  1.00 20.62 ? 259  PHE F CD2 1 
ATOM   3641 C CE1 . PHE F 1 16 ? 14.820  34.711  19.507  1.00 16.33 ? 259  PHE F CE1 1 
ATOM   3642 C CE2 . PHE F 1 16 ? 14.925  33.301  21.437  1.00 19.75 ? 259  PHE F CE2 1 
ATOM   3643 C CZ  . PHE F 1 16 ? 14.218  34.177  20.633  1.00 19.01 ? 259  PHE F CZ  1 
ATOM   3644 N N   . GLY F 1 17 ? 20.381  31.017  18.017  1.00 12.99 ? 260  GLY F N   1 
ATOM   3645 C CA  . GLY F 1 17 ? 21.733  30.742  17.546  1.00 17.68 ? 260  GLY F CA  1 
ATOM   3646 C C   . GLY F 1 17 ? 22.895  31.020  18.473  1.00 15.89 ? 260  GLY F C   1 
ATOM   3647 O O   . GLY F 1 17 ? 23.943  31.543  18.055  1.00 19.82 ? 260  GLY F O   1 
ATOM   3648 N N   . PHE F 1 18 ? 22.752  30.662  19.736  1.00 14.90 ? 261  PHE F N   1 
ATOM   3649 C CA  . PHE F 1 18 ? 23.873  30.809  20.652  1.00 17.44 ? 261  PHE F CA  1 
ATOM   3650 C C   . PHE F 1 18 ? 23.816  29.800  21.779  1.00 15.93 ? 261  PHE F C   1 
ATOM   3651 O O   . PHE F 1 18 ? 22.755  29.335  22.154  1.00 14.32 ? 261  PHE F O   1 
ATOM   3652 C CB  . PHE F 1 18 ? 24.037  32.268  21.167  1.00 16.92 ? 261  PHE F CB  1 
ATOM   3653 C CG  . PHE F 1 18 ? 22.891  32.784  22.010  1.00 17.14 ? 261  PHE F CG  1 
ATOM   3654 C CD1 . PHE F 1 18 ? 22.872  32.599  23.399  1.00 16.36 ? 261  PHE F CD1 1 
ATOM   3655 C CD2 . PHE F 1 18 ? 21.856  33.519  21.419  1.00 17.01 ? 261  PHE F CD2 1 
ATOM   3656 C CE1 . PHE F 1 18 ? 21.829  33.100  24.176  1.00 20.89 ? 261  PHE F CE1 1 
ATOM   3657 C CE2 . PHE F 1 18 ? 20.807  34.013  22.179  1.00 22.76 ? 261  PHE F CE2 1 
ATOM   3658 C CZ  . PHE F 1 18 ? 20.793  33.805  23.574  1.00 19.71 ? 261  PHE F CZ  1 
ATOM   3659 N N   . LEU F 1 19 ? 24.997  29.442  22.262  1.00 14.52 ? 262  LEU F N   1 
ATOM   3660 C CA  . LEU F 1 19 ? 25.161  28.669  23.470  1.00 17.36 ? 262  LEU F CA  1 
ATOM   3661 C C   . LEU F 1 19 ? 25.455  29.630  24.623  1.00 13.61 ? 262  LEU F C   1 
ATOM   3662 O O   . LEU F 1 19 ? 26.430  30.371  24.574  1.00 15.39 ? 262  LEU F O   1 
ATOM   3663 C CB  . LEU F 1 19 ? 26.319  27.687  23.281  1.00 18.04 ? 262  LEU F CB  1 
ATOM   3664 C CG  . LEU F 1 19 ? 26.700  26.796  24.467  1.00 13.36 ? 262  LEU F CG  1 
ATOM   3665 C CD1 . LEU F 1 19 ? 25.657  25.775  24.732  1.00 12.61 ? 262  LEU F CD1 1 
ATOM   3666 C CD2 . LEU F 1 19 ? 28.003  26.143  24.144  1.00 14.49 ? 262  LEU F CD2 1 
ATOM   3667 N N   . LEU F 1 20 ? 24.591  29.600  25.639  1.00 11.14 ? 263  LEU F N   1 
ATOM   3668 C CA  . LEU F 1 20 ? 24.744  30.361  26.874  1.00 14.64 ? 263  LEU F CA  1 
ATOM   3669 C C   . LEU F 1 20 ? 25.274  29.433  27.957  1.00 11.25 ? 263  LEU F C   1 
ATOM   3670 O O   . LEU F 1 20 ? 24.713  28.390  28.200  1.00 13.13 ? 263  LEU F O   1 
ATOM   3671 C CB  . LEU F 1 20 ? 23.392  30.913  27.343  1.00 12.92 ? 263  LEU F CB  1 
ATOM   3672 C CG  . LEU F 1 20 ? 23.407  31.955  28.459  1.00 11.46 ? 263  LEU F CG  1 
ATOM   3673 C CD1 . LEU F 1 20 ? 24.001  33.270  27.920  1.00 12.17 ? 263  LEU F CD1 1 
ATOM   3674 C CD2 . LEU F 1 20 ? 22.008  32.139  29.001  1.00 14.35 ? 263  LEU F CD2 1 
ATOM   3675 N N   . ARG F 1 21 ? 26.368  29.836  28.584  1.00 10.46 ? 264  ARG F N   1 
ATOM   3676 C CA  . ARG F 1 21 ? 26.987  29.072  29.621  1.00 12.78 ? 264  ARG F CA  1 
ATOM   3677 C C   . ARG F 1 21 ? 27.332  29.957  30.815  1.00 11.37 ? 264  ARG F C   1 
ATOM   3678 O O   . ARG F 1 21 ? 27.876  31.043  30.653  1.00 14.71 ? 264  ARG F O   1 
ATOM   3679 C CB  . ARG F 1 21 ? 28.259  28.426  29.082  1.00 11.27 ? 264  ARG F CB  1 
ATOM   3680 C CG  . ARG F 1 21 ? 29.000  27.670  30.168  1.00 21.60 ? 264  ARG F CG  1 
ATOM   3681 C CD  . ARG F 1 21 ? 30.412  27.433  29.851  1.00 26.02 ? 264  ARG F CD  1 
ATOM   3682 N NE  . ARG F 1 21 ? 30.565  26.304  28.962  1.00 35.61 ? 264  ARG F NE  1 
ATOM   3683 C CZ  . ARG F 1 21 ? 30.596  25.034  29.352  1.00 49.61 ? 264  ARG F CZ  1 
ATOM   3684 N NH1 . ARG F 1 21 ? 30.463  24.708  30.637  1.00 55.91 ? 264  ARG F NH1 1 
ATOM   3685 N NH2 . ARG F 1 21 ? 30.759  24.083  28.444  1.00 45.39 ? 264  ARG F NH2 1 
ATOM   3686 N N   . GLU F 1 22 ? 27.050  29.474  32.019  1.00 11.36 ? 265  GLU F N   1 
ATOM   3687 C CA  . GLU F 1 22 ? 27.310  30.274  33.221  1.00 14.86 ? 265  GLU F CA  1 
ATOM   3688 C C   . GLU F 1 22 ? 28.745  30.097  33.645  1.00 13.90 ? 265  GLU F C   1 
ATOM   3689 O O   . GLU F 1 22 ? 29.303  28.969  33.581  1.00 15.23 ? 265  GLU F O   1 
ATOM   3690 C CB  . GLU F 1 22 ? 26.396  29.835  34.350  1.00 10.64 ? 265  GLU F CB  1 
ATOM   3691 C CG  . GLU F 1 22 ? 26.656  30.525  35.675  1.00 10.22 ? 265  GLU F CG  1 
ATOM   3692 C CD  . GLU F 1 22 ? 25.669  30.103  36.710  1.00 18.37 ? 265  GLU F CD  1 
ATOM   3693 O OE1 . GLU F 1 22 ? 24.486  30.428  36.526  1.00 19.63 ? 265  GLU F OE1 1 
ATOM   3694 O OE2 . GLU F 1 22 ? 26.073  29.451  37.716  1.00 22.62 ? 265  GLU F OE2 1 
ATOM   3695 N N   . GLU F 1 23 ? 29.364  31.196  34.034  1.00 12.82 ? 266  GLU F N   1 
ATOM   3696 C CA  . GLU F 1 23 ? 30.645  31.134  34.755  1.00 16.30 ? 266  GLU F CA  1 
ATOM   3697 C C   . GLU F 1 23 ? 30.586  32.081  35.919  1.00 13.67 ? 266  GLU F C   1 
ATOM   3698 O O   . GLU F 1 23 ? 30.300  33.275  35.742  1.00 18.05 ? 266  GLU F O   1 
ATOM   3699 C CB  . GLU F 1 23 ? 31.836  31.491  33.860  1.00 15.45 ? 266  GLU F CB  1 
ATOM   3700 C CG  . GLU F 1 23 ? 32.240  30.441  32.805  1.00 18.00 ? 266  GLU F CG  1 
ATOM   3701 C CD  . GLU F 1 23 ? 32.819  29.149  33.388  1.00 19.93 ? 266  GLU F CD  1 
ATOM   3702 O OE1 . GLU F 1 23 ? 33.121  29.097  34.595  1.00 17.07 ? 266  GLU F OE1 1 
ATOM   3703 O OE2 . GLU F 1 23 ? 32.932  28.165  32.635  1.00 25.41 ? 266  GLU F OE2 1 
ATOM   3704 N N   . LYS F 1 24 ? 30.889  31.570  37.110  1.00 15.96 ? 267  LYS F N   1 
ATOM   3705 C CA  . LYS F 1 24 ? 30.979  32.407  38.298  1.00 19.00 ? 267  LYS F CA  1 
ATOM   3706 C C   . LYS F 1 24 ? 32.251  33.213  38.275  1.00 19.70 ? 267  LYS F C   1 
ATOM   3707 O O   . LYS F 1 24 ? 33.307  32.713  37.865  1.00 16.92 ? 267  LYS F O   1 
ATOM   3708 C CB  . LYS F 1 24 ? 30.944  31.566  39.563  1.00 17.53 ? 267  LYS F CB  1 
ATOM   3709 C CG  . LYS F 1 24 ? 29.576  31.005  39.874  1.00 21.85 ? 267  LYS F CG  1 
ATOM   3710 C CD  . LYS F 1 24 ? 29.658  29.942  40.964  1.00 30.11 ? 267  LYS F CD  1 
ATOM   3711 C CE  . LYS F 1 24 ? 28.283  29.521  41.468  1.00 35.25 ? 267  LYS F CE  1 
ATOM   3712 N NZ  . LYS F 1 24 ? 28.043  29.987  42.869  1.00 40.07 ? 267  LYS F NZ  1 
ATOM   3713 N N   . GLY F 1 25 ? 32.150  34.465  38.735  1.00 15.77 ? 268  GLY F N   1 
ATOM   3714 C CA  . GLY F 1 25 ? 33.300  35.333  38.751  1.00 19.11 ? 268  GLY F CA  1 
ATOM   3715 C C   . GLY F 1 25 ? 34.096  35.039  39.992  1.00 18.70 ? 268  GLY F C   1 
ATOM   3716 O O   . GLY F 1 25 ? 33.726  34.163  40.788  1.00 15.57 ? 268  GLY F O   1 
ATOM   3717 N N   . LEU F 1 26 ? 35.183  35.794  40.164  1.00 21.08 ? 269  LEU F N   1 
ATOM   3718 C CA  . LEU F 1 26 ? 36.052  35.629  41.326  1.00 23.80 ? 269  LEU F CA  1 
ATOM   3719 C C   . LEU F 1 26 ? 35.277  35.965  42.598  1.00 18.89 ? 269  LEU F C   1 
ATOM   3720 O O   . LEU F 1 26 ? 35.502  35.356  43.627  1.00 16.00 ? 269  LEU F O   1 
ATOM   3721 C CB  . LEU F 1 26 ? 37.315  36.482  41.224  1.00 19.49 ? 269  LEU F CB  1 
ATOM   3722 C CG  . LEU F 1 26 ? 38.547  35.867  40.558  1.00 40.09 ? 269  LEU F CG  1 
ATOM   3723 C CD1 . LEU F 1 26 ? 39.533  36.965  40.170  1.00 50.86 ? 269  LEU F CD1 1 
ATOM   3724 C CD2 . LEU F 1 26 ? 39.194  34.868  41.509  1.00 46.39 ? 269  LEU F CD2 1 
ATOM   3725 N N   . ASP F 1 27 ? 34.353  36.918  42.501  1.00 14.22 ? 270  ASP F N   1 
ATOM   3726 C CA  . ASP F 1 27 ? 33.522  37.311  43.652  1.00 13.31 ? 270  ASP F CA  1 
ATOM   3727 C C   . ASP F 1 27 ? 32.374  36.345  43.937  1.00 4.88  ? 270  ASP F C   1 
ATOM   3728 O O   . ASP F 1 27 ? 31.624  36.526  44.889  1.00 12.72 ? 270  ASP F O   1 
ATOM   3729 C CB  . ASP F 1 27 ? 32.989  38.741  43.473  1.00 14.28 ? 270  ASP F CB  1 
ATOM   3730 C CG  . ASP F 1 27 ? 31.965  38.891  42.359  1.00 17.73 ? 270  ASP F CG  1 
ATOM   3731 O OD1 . ASP F 1 27 ? 31.584  37.916  41.643  1.00 19.86 ? 270  ASP F OD1 1 
ATOM   3732 O OD2 . ASP F 1 27 ? 31.535  40.052  42.202  1.00 23.35 ? 270  ASP F OD2 1 
ATOM   3733 N N   . GLY F 1 28 ? 32.226  35.331  43.097  1.00 13.26 ? 271  GLY F N   1 
ATOM   3734 C CA  . GLY F 1 28 ? 31.191  34.336  43.287  1.00 11.71 ? 271  GLY F CA  1 
ATOM   3735 C C   . GLY F 1 28 ? 29.898  34.624  42.516  1.00 12.69 ? 271  GLY F C   1 
ATOM   3736 O O   . GLY F 1 28 ? 29.002  33.812  42.516  1.00 12.22 ? 271  GLY F O   1 
ATOM   3737 N N   . ARG F 1 29 ? 29.770  35.779  41.873  1.00 16.23 ? 272  ARG F N   1 
ATOM   3738 C CA  . ARG F 1 29 ? 28.526  36.064  41.160  1.00 14.28 ? 272  ARG F CA  1 
ATOM   3739 C C   . ARG F 1 29 ? 28.560  35.458  39.732  1.00 12.25 ? 272  ARG F C   1 
ATOM   3740 O O   . ARG F 1 29 ? 29.577  35.528  39.040  1.00 12.27 ? 272  ARG F O   1 
ATOM   3741 C CB  . ARG F 1 29 ? 28.255  37.576  41.145  1.00 15.45 ? 272  ARG F CB  1 
ATOM   3742 C CG  . ARG F 1 29 ? 28.001  38.129  42.497  1.00 6.36  ? 272  ARG F CG  1 
ATOM   3743 C CD  . ARG F 1 29 ? 27.625  39.605  42.476  1.00 16.43 ? 272  ARG F CD  1 
ATOM   3744 N NE  . ARG F 1 29 ? 28.816  40.438  42.370  1.00 14.49 ? 272  ARG F NE  1 
ATOM   3745 C CZ  . ARG F 1 29 ? 28.802  41.756  42.185  1.00 18.13 ? 272  ARG F CZ  1 
ATOM   3746 N NH1 . ARG F 1 29 ? 27.663  42.408  42.053  1.00 25.61 ? 272  ARG F NH1 1 
ATOM   3747 N NH2 . ARG F 1 29 ? 29.942  42.429  42.136  1.00 16.21 ? 272  ARG F NH2 1 
ATOM   3748 N N   . PRO F 1 30 ? 27.468  34.816  39.307  1.00 15.76 ? 273  PRO F N   1 
ATOM   3749 C CA  . PRO F 1 30 ? 27.505  34.254  37.962  1.00 17.67 ? 273  PRO F CA  1 
ATOM   3750 C C   . PRO F 1 30 ? 27.316  35.294  36.850  1.00 21.62 ? 273  PRO F C   1 
ATOM   3751 O O   . PRO F 1 30 ? 26.656  36.345  37.030  1.00 18.17 ? 273  PRO F O   1 
ATOM   3752 C CB  . PRO F 1 30 ? 26.391  33.229  37.983  1.00 17.06 ? 273  PRO F CB  1 
ATOM   3753 C CG  . PRO F 1 30 ? 25.392  33.816  38.928  1.00 23.56 ? 273  PRO F CG  1 
ATOM   3754 C CD  . PRO F 1 30 ? 26.186  34.550  39.982  1.00 21.77 ? 273  PRO F CD  1 
ATOM   3755 N N   . GLY F 1 31 ? 28.018  35.041  35.757  1.00 16.42 ? 274  GLY F N   1 
ATOM   3756 C CA  . GLY F 1 31 ? 27.783  35.696  34.496  1.00 17.08 ? 274  GLY F CA  1 
ATOM   3757 C C   . GLY F 1 31 ? 27.276  34.625  33.556  1.00 14.60 ? 274  GLY F C   1 
ATOM   3758 O O   . GLY F 1 31 ? 27.599  33.445  33.723  1.00 13.39 ? 274  GLY F O   1 
ATOM   3759 N N   . GLN F 1 32 ? 26.458  35.043  32.605  1.00 15.19 ? 275  GLN F N   1 
ATOM   3760 C CA  . GLN F 1 32 ? 25.969  34.208  31.532  1.00 15.13 ? 275  GLN F CA  1 
ATOM   3761 C C   . GLN F 1 32 ? 26.682  34.715  30.286  1.00 14.85 ? 275  GLN F C   1 
ATOM   3762 O O   . GLN F 1 32 ? 26.566  35.894  29.908  1.00 15.42 ? 275  GLN F O   1 
ATOM   3763 C CB  . GLN F 1 32 ? 24.445  34.360  31.384  1.00 15.57 ? 275  GLN F CB  1 
ATOM   3764 C CG  . GLN F 1 32 ? 23.651  34.058  32.648  1.00 12.99 ? 275  GLN F CG  1 
ATOM   3765 C CD  . GLN F 1 32 ? 23.936  32.703  33.234  1.00 12.39 ? 275  GLN F CD  1 
ATOM   3766 O OE1 . GLN F 1 32 ? 24.082  31.726  32.515  1.00 10.35 ? 275  GLN F OE1 1 
ATOM   3767 N NE2 . GLN F 1 32 ? 24.006  32.628  34.571  1.00 17.36 ? 275  GLN F NE2 1 
ATOM   3768 N N   . PHE F 1 33 ? 27.412  33.823  29.645  1.00 11.28 ? 276  PHE F N   1 
ATOM   3769 C CA  . PHE F 1 33 ? 28.242  34.209  28.542  1.00 10.97 ? 276  PHE F CA  1 
ATOM   3770 C C   . PHE F 1 33 ? 27.767  33.518  27.311  1.00 15.28 ? 276  PHE F C   1 
ATOM   3771 O O   . PHE F 1 33 ? 27.333  32.370  27.377  1.00 14.52 ? 276  PHE F O   1 
ATOM   3772 C CB  . PHE F 1 33 ? 29.689  33.873  28.860  1.00 10.96 ? 276  PHE F CB  1 
ATOM   3773 C CG  . PHE F 1 33 ? 30.202  34.620  30.032  1.00 14.20 ? 276  PHE F CG  1 
ATOM   3774 C CD1 . PHE F 1 33 ? 30.632  35.930  29.877  1.00 13.67 ? 276  PHE F CD1 1 
ATOM   3775 C CD2 . PHE F 1 33 ? 30.176  34.074  31.284  1.00 11.12 ? 276  PHE F CD2 1 
ATOM   3776 C CE1 . PHE F 1 33 ? 31.061  36.660  30.914  1.00 13.37 ? 276  PHE F CE1 1 
ATOM   3777 C CE2 . PHE F 1 33 ? 30.616  34.834  32.378  1.00 19.40 ? 276  PHE F CE2 1 
ATOM   3778 C CZ  . PHE F 1 33 ? 31.042  36.126  32.182  1.00 16.38 ? 276  PHE F CZ  1 
ATOM   3779 N N   . LEU F 1 34 ? 27.843  34.223  26.189  1.00 17.11 ? 277  LEU F N   1 
ATOM   3780 C CA  . LEU F 1 34 ? 27.668  33.588  24.888  1.00 17.00 ? 277  LEU F CA  1 
ATOM   3781 C C   . LEU F 1 34 ? 28.960  32.857  24.533  1.00 18.26 ? 277  LEU F C   1 
ATOM   3782 O O   . LEU F 1 34 ? 29.930  33.446  24.043  1.00 21.31 ? 277  LEU F O   1 
ATOM   3783 C CB  . LEU F 1 34 ? 27.300  34.592  23.803  1.00 19.85 ? 277  LEU F CB  1 
ATOM   3784 C CG  . LEU F 1 34 ? 26.053  35.472  23.980  1.00 19.02 ? 277  LEU F CG  1 
ATOM   3785 C CD1 . LEU F 1 34 ? 25.552  35.919  22.607  1.00 19.92 ? 277  LEU F CD1 1 
ATOM   3786 C CD2 . LEU F 1 34 ? 24.960  34.812  24.736  1.00 22.02 ? 277  LEU F CD2 1 
ATOM   3787 N N   . TRP F 1 35 ? 28.951  31.563  24.797  1.00 16.30 ? 278  TRP F N   1 
ATOM   3788 C CA  . TRP F 1 35 ? 30.120  30.712  24.628  1.00 14.67 ? 278  TRP F CA  1 
ATOM   3789 C C   . TRP F 1 35 ? 30.443  30.503  23.169  1.00 19.40 ? 278  TRP F C   1 
ATOM   3790 O O   . TRP F 1 35 ? 31.597  30.313  22.800  1.00 18.12 ? 278  TRP F O   1 
ATOM   3791 C CB  . TRP F 1 35 ? 29.876  29.339  25.273  1.00 15.52 ? 278  TRP F CB  1 
ATOM   3792 C CG  . TRP F 1 35 ? 31.134  28.787  25.965  1.00 17.25 ? 278  TRP F CG  1 
ATOM   3793 C CD1 . TRP F 1 35 ? 31.967  27.800  25.518  1.00 20.45 ? 278  TRP F CD1 1 
ATOM   3794 C CD2 . TRP F 1 35 ? 31.690  29.244  27.209  1.00 17.61 ? 278  TRP F CD2 1 
ATOM   3795 N NE1 . TRP F 1 35 ? 33.004  27.607  26.411  1.00 16.45 ? 278  TRP F NE1 1 
ATOM   3796 C CE2 . TRP F 1 35 ? 32.847  28.471  27.464  1.00 21.64 ? 278  TRP F CE2 1 
ATOM   3797 C CE3 . TRP F 1 35 ? 31.323  30.231  28.132  1.00 21.63 ? 278  TRP F CE3 1 
ATOM   3798 C CZ2 . TRP F 1 35 ? 33.633  28.660  28.601  1.00 17.74 ? 278  TRP F CZ2 1 
ATOM   3799 C CZ3 . TRP F 1 35 ? 32.099  30.406  29.257  1.00 20.36 ? 278  TRP F CZ3 1 
ATOM   3800 C CH2 . TRP F 1 35 ? 33.241  29.621  29.483  1.00 18.77 ? 278  TRP F CH2 1 
ATOM   3801 N N   . GLU F 1 36 ? 29.395  30.491  22.355  1.00 17.68 ? 279  GLU F N   1 
ATOM   3802 C CA  . GLU F 1 36 ? 29.492  30.243  20.950  1.00 16.43 ? 279  GLU F CA  1 
ATOM   3803 C C   . GLU F 1 36 ? 28.271  30.878  20.316  1.00 19.52 ? 279  GLU F C   1 
ATOM   3804 O O   . GLU F 1 36 ? 27.210  30.929  20.942  1.00 19.36 ? 279  GLU F O   1 
ATOM   3805 C CB  . GLU F 1 36 ? 29.495  28.729  20.706  1.00 24.74 ? 279  GLU F CB  1 
ATOM   3806 C CG  . GLU F 1 36 ? 30.275  28.260  19.492  1.00 32.26 ? 279  GLU F CG  1 
ATOM   3807 C CD  . GLU F 1 36 ? 29.400  28.064  18.256  1.00 46.40 ? 279  GLU F CD  1 
ATOM   3808 O OE1 . GLU F 1 36 ? 29.926  28.067  17.114  1.00 51.49 ? 279  GLU F OE1 1 
ATOM   3809 O OE2 . GLU F 1 36 ? 28.172  27.889  18.425  1.00 57.57 ? 279  GLU F OE2 1 
ATOM   3810 N N   . VAL F 1 37 ? 28.446  31.390  19.096  1.00 20.15 ? 280  VAL F N   1 
ATOM   3811 C CA  . VAL F 1 37 ? 27.361  31.965  18.292  1.00 20.87 ? 280  VAL F CA  1 
ATOM   3812 C C   . VAL F 1 37 ? 27.392  31.347  16.893  1.00 21.44 ? 280  VAL F C   1 
ATOM   3813 O O   . VAL F 1 37 ? 28.422  31.371  16.207  1.00 21.73 ? 280  VAL F O   1 
ATOM   3814 C CB  . VAL F 1 37 ? 27.460  33.487  18.202  1.00 24.86 ? 280  VAL F CB  1 
ATOM   3815 C CG1 . VAL F 1 37 ? 26.201  34.042  17.569  1.00 20.95 ? 280  VAL F CG1 1 
ATOM   3816 C CG2 . VAL F 1 37 ? 27.657  34.115  19.608  1.00 18.05 ? 280  VAL F CG2 1 
ATOM   3817 N N   . ASP F 1 38 ? 26.260  30.772  16.496  1.00 15.87 ? 281  ASP F N   1 
ATOM   3818 C CA  . ASP F 1 38 ? 26.145  29.973  15.287  1.00 19.41 ? 281  ASP F CA  1 
ATOM   3819 C C   . ASP F 1 38 ? 26.147  30.879  14.058  1.00 14.90 ? 281  ASP F C   1 
ATOM   3820 O O   . ASP F 1 38 ? 25.393  31.852  14.019  1.00 17.84 ? 281  ASP F O   1 
ATOM   3821 C CB  . ASP F 1 38 ? 24.856  29.143  15.314  1.00 14.36 ? 281  ASP F CB  1 
ATOM   3822 C CG  . ASP F 1 38 ? 24.805  28.182  16.466  1.00 31.28 ? 281  ASP F CG  1 
ATOM   3823 O OD1 . ASP F 1 38 ? 25.829  27.521  16.748  1.00 42.12 ? 281  ASP F OD1 1 
ATOM   3824 O OD2 . ASP F 1 38 ? 23.739  28.082  17.094  1.00 36.77 ? 281  ASP F OD2 1 
ATOM   3825 N N   . PRO F 1 39 ? 27.019  30.593  13.075  1.00 17.17 ? 282  PRO F N   1 
ATOM   3826 C CA  . PRO F 1 39 ? 26.965  31.374  11.854  1.00 17.42 ? 282  PRO F CA  1 
ATOM   3827 C C   . PRO F 1 39 ? 25.604  31.304  11.205  1.00 13.63 ? 282  PRO F C   1 
ATOM   3828 O O   . PRO F 1 39 ? 25.044  30.214  11.061  1.00 10.65 ? 282  PRO F O   1 
ATOM   3829 C CB  . PRO F 1 39 ? 27.995  30.687  10.940  1.00 17.60 ? 282  PRO F CB  1 
ATOM   3830 C CG  . PRO F 1 39 ? 28.850  29.928  11.818  1.00 23.44 ? 282  PRO F CG  1 
ATOM   3831 C CD  . PRO F 1 39 ? 28.085  29.584  13.034  1.00 17.25 ? 282  PRO F CD  1 
ATOM   3832 N N   . GLY F 1 40 ? 25.083  32.458  10.797  1.00 12.60 ? 283  GLY F N   1 
ATOM   3833 C CA  . GLY F 1 40 ? 23.929  32.488  9.901   1.00 9.20  ? 283  GLY F CA  1 
ATOM   3834 C C   . GLY F 1 40 ? 22.605  32.320  10.612  1.00 7.09  ? 283  GLY F C   1 
ATOM   3835 O O   . GLY F 1 40 ? 21.566  32.256  9.965   1.00 6.72  ? 283  GLY F O   1 
ATOM   3836 N N   . LEU F 1 41 ? 22.651  32.203  11.934  1.00 11.04 ? 284  LEU F N   1 
ATOM   3837 C CA  . LEU F 1 41 ? 21.462  32.239  12.779  1.00 13.68 ? 284  LEU F CA  1 
ATOM   3838 C C   . LEU F 1 41 ? 21.272  33.659  13.356  1.00 10.83 ? 284  LEU F C   1 
ATOM   3839 O O   . LEU F 1 41 ? 22.150  34.505  13.185  1.00 12.08 ? 284  LEU F O   1 
ATOM   3840 C CB  . LEU F 1 41 ? 21.554  31.159  13.856  1.00 10.53 ? 284  LEU F CB  1 
ATOM   3841 C CG  . LEU F 1 41 ? 21.295  29.758  13.319  1.00 18.36 ? 284  LEU F CG  1 
ATOM   3842 C CD1 . LEU F 1 41 ? 21.274  28.731  14.428  1.00 18.92 ? 284  LEU F CD1 1 
ATOM   3843 C CD2 . LEU F 1 41 ? 19.986  29.710  12.519  1.00 23.04 ? 284  LEU F CD2 1 
ATOM   3844 N N   . PRO F 1 42 ? 20.078  33.963  13.930  1.00 17.56 ? 285  PRO F N   1 
ATOM   3845 C CA  . PRO F 1 42 ? 19.719  35.355  14.343  1.00 18.26 ? 285  PRO F CA  1 
ATOM   3846 C C   . PRO F 1 42 ? 20.737  36.159  15.142  1.00 19.59 ? 285  PRO F C   1 
ATOM   3847 O O   . PRO F 1 42 ? 21.086  37.262  14.720  1.00 18.59 ? 285  PRO F O   1 
ATOM   3848 C CB  . PRO F 1 42 ? 18.407  35.162  15.121  1.00 18.74 ? 285  PRO F CB  1 
ATOM   3849 C CG  . PRO F 1 42 ? 17.778  34.019  14.384  1.00 18.84 ? 285  PRO F CG  1 
ATOM   3850 C CD  . PRO F 1 42 ? 18.934  33.055  14.144  1.00 16.04 ? 285  PRO F CD  1 
ATOM   3851 N N   . ALA F 1 43 ? 21.238  35.604  16.253  1.00 17.86 ? 286  ALA F N   1 
ATOM   3852 C CA  . ALA F 1 43 ? 22.259  36.259  17.060  1.00 15.36 ? 286  ALA F CA  1 
ATOM   3853 C C   . ALA F 1 43 ? 23.510  36.695  16.255  1.00 16.31 ? 286  ALA F C   1 
ATOM   3854 O O   . ALA F 1 43 ? 23.934  37.849  16.313  1.00 15.22 ? 286  ALA F O   1 
ATOM   3855 C CB  . ALA F 1 43 ? 22.659  35.336  18.251  1.00 15.48 ? 286  ALA F CB  1 
ATOM   3856 N N   . LYS F 1 44 ? 24.110  35.783  15.499  1.00 19.36 ? 287  LYS F N   1 
ATOM   3857 C CA  . LYS F 1 44 ? 25.266  36.160  14.677  1.00 22.44 ? 287  LYS F CA  1 
ATOM   3858 C C   . LYS F 1 44 ? 24.934  37.257  13.678  1.00 25.18 ? 287  LYS F C   1 
ATOM   3859 O O   . LYS F 1 44 ? 25.728  38.178  13.491  1.00 26.37 ? 287  LYS F O   1 
ATOM   3860 C CB  . LYS F 1 44 ? 25.841  34.951  13.933  1.00 22.19 ? 287  LYS F CB  1 
ATOM   3861 C CG  . LYS F 1 44 ? 27.210  35.201  13.326  1.00 30.60 ? 287  LYS F CG  1 
ATOM   3862 C CD  . LYS F 1 44 ? 28.271  35.274  14.394  1.00 34.10 ? 287  LYS F CD  1 
ATOM   3863 C CE  . LYS F 1 44 ? 29.647  34.928  13.831  1.00 42.30 ? 287  LYS F CE  1 
ATOM   3864 N NZ  . LYS F 1 44 ? 30.538  34.403  14.903  1.00 52.29 ? 287  LYS F NZ  1 
ATOM   3865 N N   . LYS F 1 45 ? 23.766  37.151  13.044  1.00 25.92 ? 288  LYS F N   1 
ATOM   3866 C CA  . LYS F 1 45 ? 23.338  38.118  12.044  1.00 26.55 ? 288  LYS F CA  1 
ATOM   3867 C C   . LYS F 1 45 ? 23.098  39.508  12.634  1.00 28.23 ? 288  LYS F C   1 
ATOM   3868 O O   . LYS F 1 45 ? 23.219  40.508  11.922  1.00 30.84 ? 288  LYS F O   1 
ATOM   3869 C CB  . LYS F 1 45 ? 22.103  37.615  11.286  1.00 24.94 ? 288  LYS F CB  1 
ATOM   3870 C CG  . LYS F 1 45 ? 22.405  36.427  10.385  1.00 23.48 ? 288  LYS F CG  1 
ATOM   3871 C CD  . LYS F 1 45 ? 21.245  36.069  9.480   1.00 22.51 ? 288  LYS F CD  1 
ATOM   3872 C CE  . LYS F 1 45 ? 21.112  37.070  8.330   1.00 12.39 ? 288  LYS F CE  1 
ATOM   3873 N NZ  . LYS F 1 45 ? 20.433  36.503  7.206   1.00 15.78 ? 288  LYS F NZ  1 
ATOM   3874 N N   . ALA F 1 46 ? 22.772  39.546  13.928  1.00 28.68 ? 289  ALA F N   1 
ATOM   3875 C CA  . ALA F 1 46 ? 22.657  40.771  14.714  1.00 26.00 ? 289  ALA F CA  1 
ATOM   3876 C C   . ALA F 1 46 ? 23.981  41.218  15.352  1.00 29.45 ? 289  ALA F C   1 
ATOM   3877 O O   . ALA F 1 46 ? 23.982  42.112  16.204  1.00 35.89 ? 289  ALA F O   1 
ATOM   3878 C CB  . ALA F 1 46 ? 21.627  40.576  15.807  1.00 23.18 ? 289  ALA F CB  1 
ATOM   3879 N N   . GLY F 1 47 ? 25.094  40.586  14.972  1.00 28.58 ? 290  GLY F N   1 
ATOM   3880 C CA  . GLY F 1 47 ? 26.428  41.040  15.371  1.00 29.35 ? 290  GLY F CA  1 
ATOM   3881 C C   . GLY F 1 47 ? 26.963  40.516  16.707  1.00 29.20 ? 290  GLY F C   1 
ATOM   3882 O O   . GLY F 1 47 ? 28.068  40.899  17.132  1.00 29.96 ? 290  GLY F O   1 
ATOM   3883 N N   . MET F 1 48 ? 26.204  39.638  17.362  1.00 26.68 ? 291  MET F N   1 
ATOM   3884 C CA  . MET F 1 48 ? 26.665  38.981  18.588  1.00 22.89 ? 291  MET F CA  1 
ATOM   3885 C C   . MET F 1 48 ? 27.859  38.096  18.326  1.00 23.03 ? 291  MET F C   1 
ATOM   3886 O O   . MET F 1 48 ? 28.017  37.550  17.218  1.00 19.16 ? 291  MET F O   1 
ATOM   3887 C CB  . MET F 1 48 ? 25.545  38.175  19.231  1.00 25.44 ? 291  MET F CB  1 
ATOM   3888 C CG  . MET F 1 48 ? 24.598  39.056  19.999  1.00 36.08 ? 291  MET F CG  1 
ATOM   3889 S SD  . MET F 1 48 ? 23.022  38.293  20.382  1.00 32.52 ? 291  MET F SD  1 
ATOM   3890 C CE  . MET F 1 48 ? 21.996  39.747  20.554  1.00 41.34 ? 291  MET F CE  1 
ATOM   3891 N N   . GLN F 1 49 ? 28.680  37.949  19.373  1.00 23.46 ? 292  GLN F N   1 
ATOM   3892 C CA  . GLN F 1 49 ? 30.011  37.372  19.288  1.00 23.99 ? 292  GLN F CA  1 
ATOM   3893 C C   . GLN F 1 49 ? 30.253  36.402  20.415  1.00 19.49 ? 292  GLN F C   1 
ATOM   3894 O O   . GLN F 1 49 ? 29.907  36.692  21.566  1.00 16.68 ? 292  GLN F O   1 
ATOM   3895 C CB  . GLN F 1 49 ? 31.061  38.471  19.457  1.00 25.42 ? 292  GLN F CB  1 
ATOM   3896 C CG  . GLN F 1 49 ? 30.981  39.615  18.477  1.00 33.27 ? 292  GLN F CG  1 
ATOM   3897 C CD  . GLN F 1 49 ? 32.051  40.648  18.761  1.00 34.05 ? 292  GLN F CD  1 
ATOM   3898 O OE1 . GLN F 1 49 ? 32.979  40.391  19.533  1.00 36.71 ? 292  GLN F OE1 1 
ATOM   3899 N NE2 . GLN F 1 49 ? 31.923  41.825  18.154  1.00 47.41 ? 292  GLN F NE2 1 
ATOM   3900 N N   . ALA F 1 50 ? 30.893  35.274  20.109  1.00 19.93 ? 293  ALA F N   1 
ATOM   3901 C CA  . ALA F 1 50 ? 31.348  34.376  21.154  1.00 20.39 ? 293  ALA F CA  1 
ATOM   3902 C C   . ALA F 1 50 ? 32.256  35.199  22.106  1.00 19.23 ? 293  ALA F C   1 
ATOM   3903 O O   . ALA F 1 50 ? 33.166  35.955  21.670  1.00 16.38 ? 293  ALA F O   1 
ATOM   3904 C CB  . ALA F 1 50 ? 32.057  33.188  20.575  1.00 22.31 ? 293  ALA F CB  1 
ATOM   3905 N N   . GLY F 1 51 ? 31.949  35.112  23.394  1.00 16.76 ? 294  GLY F N   1 
ATOM   3906 C CA  . GLY F 1 51 ? 32.637  35.900  24.414  1.00 19.32 ? 294  GLY F CA  1 
ATOM   3907 C C   . GLY F 1 51 ? 31.800  37.045  24.930  1.00 21.33 ? 294  GLY F C   1 
ATOM   3908 O O   . GLY F 1 51 ? 32.080  37.602  26.015  1.00 19.33 ? 294  GLY F O   1 
ATOM   3909 N N   . ASP F 1 52 ? 30.754  37.397  24.181  1.00 15.90 ? 295  ASP F N   1 
ATOM   3910 C CA  . ASP F 1 52 ? 29.791  38.411  24.675  1.00 14.59 ? 295  ASP F CA  1 
ATOM   3911 C C   . ASP F 1 52 ? 29.294  38.037  26.052  1.00 13.24 ? 295  ASP F C   1 
ATOM   3912 O O   . ASP F 1 52 ? 29.063  36.870  26.306  1.00 11.48 ? 295  ASP F O   1 
ATOM   3913 C CB  . ASP F 1 52 ? 28.566  38.489  23.750  1.00 14.45 ? 295  ASP F CB  1 
ATOM   3914 C CG  . ASP F 1 52 ? 28.813  39.305  22.525  1.00 16.74 ? 295  ASP F CG  1 
ATOM   3915 O OD1 . ASP F 1 52 ? 29.872  39.965  22.484  1.00 19.28 ? 295  ASP F OD1 1 
ATOM   3916 O OD2 . ASP F 1 52 ? 27.938  39.314  21.623  1.00 16.73 ? 295  ASP F OD2 1 
ATOM   3917 N N   . ARG F 1 53 ? 29.091  39.004  26.934  1.00 16.05 ? 296  ARG F N   1 
ATOM   3918 C CA  . ARG F 1 53 ? 28.309  38.731  28.154  1.00 14.53 ? 296  ARG F CA  1 
ATOM   3919 C C   . ARG F 1 53 ? 26.859  39.144  27.931  1.00 14.27 ? 296  ARG F C   1 
ATOM   3920 O O   . ARG F 1 53 ? 26.598  40.238  27.422  1.00 14.65 ? 296  ARG F O   1 
ATOM   3921 C CB  . ARG F 1 53 ? 28.898  39.461  29.369  1.00 15.87 ? 296  ARG F CB  1 
ATOM   3922 C CG  . ARG F 1 53 ? 28.348  39.013  30.691  1.00 12.41 ? 296  ARG F CG  1 
ATOM   3923 C CD  . ARG F 1 53 ? 29.012  39.722  31.872  1.00 19.14 ? 296  ARG F CD  1 
ATOM   3924 N NE  . ARG F 1 53 ? 28.766  41.163  31.922  1.00 15.22 ? 296  ARG F NE  1 
ATOM   3925 C CZ  . ARG F 1 53 ? 29.608  42.127  31.533  1.00 18.20 ? 296  ARG F CZ  1 
ATOM   3926 N NH1 . ARG F 1 53 ? 30.776  41.863  30.985  1.00 24.26 ? 296  ARG F NH1 1 
ATOM   3927 N NH2 . ARG F 1 53 ? 29.241  43.398  31.661  1.00 23.84 ? 296  ARG F NH2 1 
ATOM   3928 N N   . LEU F 1 54 ? 25.909  38.284  28.320  1.00 15.94 ? 297  LEU F N   1 
ATOM   3929 C CA  . LEU F 1 54 ? 24.472  38.640  28.269  1.00 13.84 ? 297  LEU F CA  1 
ATOM   3930 C C   . LEU F 1 54 ? 24.141  39.471  29.494  1.00 14.34 ? 297  LEU F C   1 
ATOM   3931 O O   . LEU F 1 54 ? 24.242  38.960  30.608  1.00 15.72 ? 297  LEU F O   1 
ATOM   3932 C CB  . LEU F 1 54 ? 23.535  37.416  28.219  1.00 15.09 ? 297  LEU F CB  1 
ATOM   3933 C CG  . LEU F 1 54 ? 22.044  37.705  27.986  1.00 14.82 ? 297  LEU F CG  1 
ATOM   3934 C CD1 . LEU F 1 54 ? 21.837  38.442  26.629  1.00 10.08 ? 297  LEU F CD1 1 
ATOM   3935 C CD2 . LEU F 1 54 ? 21.180  36.404  28.064  1.00 13.89 ? 297  LEU F CD2 1 
ATOM   3936 N N   . VAL F 1 55 ? 23.727  40.725  29.270  1.00 12.22 ? 298  VAL F N   1 
ATOM   3937 C CA  . VAL F 1 55 ? 23.513  41.681  30.350  1.00 14.01 ? 298  VAL F CA  1 
ATOM   3938 C C   . VAL F 1 55 ? 22.039  42.115  30.534  1.00 15.30 ? 298  VAL F C   1 
ATOM   3939 O O   . VAL F 1 55 ? 21.640  42.561  31.618  1.00 16.51 ? 298  VAL F O   1 
ATOM   3940 C CB  . VAL F 1 55 ? 24.464  42.924  30.212  1.00 13.79 ? 298  VAL F CB  1 
ATOM   3941 C CG1 . VAL F 1 55 ? 25.912  42.463  30.126  1.00 9.06  ? 298  VAL F CG1 1 
ATOM   3942 C CG2 . VAL F 1 55 ? 24.119  43.791  29.013  1.00 15.84 ? 298  VAL F CG2 1 
ATOM   3943 N N   . ALA F 1 56 ? 21.232  41.993  29.497  1.00 14.92 ? 299  ALA F N   1 
ATOM   3944 C CA  . ALA F 1 56 ? 19.799  42.256  29.654  1.00 16.66 ? 299  ALA F CA  1 
ATOM   3945 C C   . ALA F 1 56 ? 18.997  41.374  28.721  1.00 15.36 ? 299  ALA F C   1 
ATOM   3946 O O   . ALA F 1 56 ? 19.456  41.038  27.606  1.00 16.96 ? 299  ALA F O   1 
ATOM   3947 C CB  . ALA F 1 56 ? 19.464  43.773  29.416  1.00 12.13 ? 299  ALA F CB  1 
ATOM   3948 N N   . VAL F 1 57 ? 17.820  40.979  29.219  1.00 17.56 ? 300  VAL F N   1 
ATOM   3949 C CA  . VAL F 1 57 ? 16.768  40.349  28.419  1.00 15.26 ? 300  VAL F CA  1 
ATOM   3950 C C   . VAL F 1 57 ? 15.467  41.163  28.541  1.00 13.76 ? 300  VAL F C   1 
ATOM   3951 O O   . VAL F 1 57 ? 15.003  41.430  29.655  1.00 12.32 ? 300  VAL F O   1 
ATOM   3952 C CB  . VAL F 1 57 ? 16.492  38.916  28.891  1.00 10.39 ? 300  VAL F CB  1 
ATOM   3953 C CG1 . VAL F 1 57 ? 15.397  38.234  28.006  1.00 13.54 ? 300  VAL F CG1 1 
ATOM   3954 C CG2 . VAL F 1 57 ? 17.813  38.088  28.894  1.00 7.68  ? 300  VAL F CG2 1 
ATOM   3955 N N   . ALA F 1 58 ? 14.911  41.553  27.391  1.00 15.15 ? 301  ALA F N   1 
ATOM   3956 C CA  . ALA F 1 58 ? 13.654  42.293  27.323  1.00 16.90 ? 301  ALA F CA  1 
ATOM   3957 C C   . ALA F 1 58 ? 13.742  43.593  28.134  1.00 18.90 ? 301  ALA F C   1 
ATOM   3958 O O   . ALA F 1 58 ? 12.799  43.975  28.822  1.00 16.86 ? 301  ALA F O   1 
ATOM   3959 C CB  . ALA F 1 58 ? 12.498  41.423  27.824  1.00 17.95 ? 301  ALA F CB  1 
ATOM   3960 N N   . GLY F 1 59 ? 14.890  44.263  28.052  1.00 20.05 ? 302  GLY F N   1 
ATOM   3961 C CA  . GLY F 1 59 ? 15.084  45.534  28.734  1.00 16.19 ? 302  GLY F CA  1 
ATOM   3962 C C   . GLY F 1 59 ? 15.403  45.422  30.217  1.00 18.87 ? 302  GLY F C   1 
ATOM   3963 O O   . GLY F 1 59 ? 15.658  46.433  30.825  1.00 15.47 ? 302  GLY F O   1 
ATOM   3964 N N   . GLU F 1 60 ? 15.388  44.214  30.804  1.00 14.72 ? 303  GLU F N   1 
ATOM   3965 C CA  . GLU F 1 60 ? 15.673  44.055  32.238  1.00 15.10 ? 303  GLU F CA  1 
ATOM   3966 C C   . GLU F 1 60 ? 17.024  43.403  32.395  1.00 14.54 ? 303  GLU F C   1 
ATOM   3967 O O   . GLU F 1 60 ? 17.386  42.515  31.633  1.00 14.65 ? 303  GLU F O   1 
ATOM   3968 C CB  . GLU F 1 60 ? 14.624  43.211  32.949  1.00 18.46 ? 303  GLU F CB  1 
ATOM   3969 C CG  . GLU F 1 60 ? 13.403  43.980  33.308  1.00 15.38 ? 303  GLU F CG  1 
ATOM   3970 C CD  . GLU F 1 60 ? 12.278  43.099  33.773  1.00 22.32 ? 303  GLU F CD  1 
ATOM   3971 O OE1 . GLU F 1 60 ? 12.231  42.745  34.969  1.00 32.06 ? 303  GLU F OE1 1 
ATOM   3972 O OE2 . GLU F 1 60 ? 11.426  42.755  32.939  1.00 33.78 ? 303  GLU F OE2 1 
ATOM   3973 N N   . SER F 1 61 ? 17.767  43.869  33.388  1.00 16.77 ? 304  SER F N   1 
ATOM   3974 C CA  . SER F 1 61 ? 19.105  43.377  33.633  1.00 17.99 ? 304  SER F CA  1 
ATOM   3975 C C   . SER F 1 61 ? 19.129  41.922  34.122  1.00 19.05 ? 304  SER F C   1 
ATOM   3976 O O   . SER F 1 61 ? 18.410  41.581  35.069  1.00 16.32 ? 304  SER F O   1 
ATOM   3977 C CB  . SER F 1 61 ? 19.806  44.270  34.651  1.00 18.18 ? 304  SER F CB  1 
ATOM   3978 O OG  . SER F 1 61 ? 21.180  43.940  34.718  1.00 15.50 ? 304  SER F OG  1 
ATOM   3979 N N   . VAL F 1 62 ? 19.950  41.089  33.449  1.00 19.07 ? 305  VAL F N   1 
ATOM   3980 C CA  . VAL F 1 62 ? 20.324  39.754  33.942  1.00 17.86 ? 305  VAL F CA  1 
ATOM   3981 C C   . VAL F 1 62 ? 21.789  39.673  34.392  1.00 15.24 ? 305  VAL F C   1 
ATOM   3982 O O   . VAL F 1 62 ? 22.380  38.580  34.464  1.00 16.01 ? 305  VAL F O   1 
ATOM   3983 C CB  . VAL F 1 62 ? 19.988  38.629  32.908  1.00 17.14 ? 305  VAL F CB  1 
ATOM   3984 C CG1 . VAL F 1 62 ? 18.479  38.660  32.621  1.00 11.39 ? 305  VAL F CG1 1 
ATOM   3985 C CG2 . VAL F 1 62 ? 20.859  38.734  31.590  1.00 13.10 ? 305  VAL F CG2 1 
ATOM   3986 N N   . GLU F 1 63 ? 22.368  40.821  34.732  1.00 16.05 ? 306  GLU F N   1 
ATOM   3987 C CA  . GLU F 1 63 ? 23.742  40.861  35.254  1.00 18.37 ? 306  GLU F CA  1 
ATOM   3988 C C   . GLU F 1 63 ? 23.682  40.181  36.599  1.00 15.33 ? 306  GLU F C   1 
ATOM   3989 O O   . GLU F 1 63 ? 22.781  40.456  37.368  1.00 12.62 ? 306  GLU F O   1 
ATOM   3990 C CB  . GLU F 1 63 ? 24.240  42.291  35.452  1.00 16.88 ? 306  GLU F CB  1 
ATOM   3991 C CG  . GLU F 1 63 ? 24.502  43.040  34.188  1.00 22.82 ? 306  GLU F CG  1 
ATOM   3992 C CD  . GLU F 1 63 ? 25.875  42.780  33.615  1.00 21.10 ? 306  GLU F CD  1 
ATOM   3993 O OE1 . GLU F 1 63 ? 26.334  41.613  33.616  1.00 20.93 ? 306  GLU F OE1 1 
ATOM   3994 O OE2 . GLU F 1 63 ? 26.493  43.740  33.130  1.00 19.55 ? 306  GLU F OE2 1 
ATOM   3995 N N   . GLY F 1 64 ? 24.603  39.258  36.855  1.00 18.36 ? 307  GLY F N   1 
ATOM   3996 C CA  . GLY F 1 64 ? 24.633  38.544  38.124  1.00 17.03 ? 307  GLY F CA  1 
ATOM   3997 C C   . GLY F 1 64 ? 23.498  37.564  38.366  1.00 15.40 ? 307  GLY F C   1 
ATOM   3998 O O   . GLY F 1 64 ? 23.311  37.135  39.488  1.00 14.37 ? 307  GLY F O   1 
ATOM   3999 N N   . LEU F 1 65 ? 22.751  37.212  37.331  1.00 13.77 ? 308  LEU F N   1 
ATOM   4000 C CA  . LEU F 1 65 ? 21.583  36.323  37.442  1.00 15.78 ? 308  LEU F CA  1 
ATOM   4001 C C   . LEU F 1 65 ? 21.953  34.882  37.040  1.00 15.39 ? 308  LEU F C   1 
ATOM   4002 O O   . LEU F 1 65 ? 22.847  34.676  36.204  1.00 15.29 ? 308  LEU F O   1 
ATOM   4003 C CB  . LEU F 1 65 ? 20.438  36.835  36.543  1.00 16.87 ? 308  LEU F CB  1 
ATOM   4004 C CG  . LEU F 1 65 ? 19.028  36.278  36.742  1.00 19.30 ? 308  LEU F CG  1 
ATOM   4005 C CD1 . LEU F 1 65 ? 18.481  36.693  38.115  1.00 18.49 ? 308  LEU F CD1 1 
ATOM   4006 C CD2 . LEU F 1 65 ? 18.064  36.727  35.640  1.00 16.61 ? 308  LEU F CD2 1 
ATOM   4007 N N   . GLY F 1 66 ? 21.244  33.914  37.638  1.00 14.17 ? 309  GLY F N   1 
ATOM   4008 C CA  . GLY F 1 66 ? 21.564  32.494  37.517  1.00 16.84 ? 309  GLY F CA  1 
ATOM   4009 C C   . GLY F 1 66 ? 21.171  31.929  36.160  1.00 13.95 ? 309  GLY F C   1 
ATOM   4010 O O   . GLY F 1 66 ? 20.405  32.552  35.423  1.00 16.70 ? 309  GLY F O   1 
ATOM   4011 N N   . HIS F 1 67 ? 21.680  30.739  35.838  1.00 11.73 ? 310  HIS F N   1 
ATOM   4012 C CA  . HIS F 1 67 ? 21.517  30.206  34.476  1.00 15.76 ? 310  HIS F CA  1 
ATOM   4013 C C   . HIS F 1 67 ? 20.046  29.903  34.136  1.00 13.94 ? 310  HIS F C   1 
ATOM   4014 O O   . HIS F 1 67 ? 19.532  30.303  33.089  1.00 11.49 ? 310  HIS F O   1 
ATOM   4015 C CB  . HIS F 1 67 ? 22.357  28.949  34.274  1.00 13.75 ? 310  HIS F CB  1 
ATOM   4016 C CG  . HIS F 1 67 ? 22.343  28.453  32.867  1.00 13.25 ? 310  HIS F CG  1 
ATOM   4017 N ND1 . HIS F 1 67 ? 22.978  29.127  31.853  1.00 16.57 ? 310  HIS F ND1 1 
ATOM   4018 C CD2 . HIS F 1 67 ? 21.767  27.366  32.301  1.00 11.57 ? 310  HIS F CD2 1 
ATOM   4019 C CE1 . HIS F 1 67 ? 22.801  28.476  30.721  1.00 15.05 ? 310  HIS F CE1 1 
ATOM   4020 N NE2 . HIS F 1 67 ? 22.055  27.412  30.961  1.00 12.80 ? 310  HIS F NE2 1 
ATOM   4021 N N   . GLU F 1 68 ? 19.367  29.188  35.014  1.00 17.79 ? 311  GLU F N   1 
ATOM   4022 C CA  . GLU F 1 68 ? 18.026  28.741  34.670  1.00 19.77 ? 311  GLU F CA  1 
ATOM   4023 C C   . GLU F 1 68 ? 17.072  29.936  34.642  1.00 15.33 ? 311  GLU F C   1 
ATOM   4024 O O   . GLU F 1 68 ? 16.209  29.990  33.780  1.00 13.06 ? 311  GLU F O   1 
ATOM   4025 C CB  . GLU F 1 68 ? 17.522  27.626  35.595  1.00 23.21 ? 311  GLU F CB  1 
ATOM   4026 C CG  . GLU F 1 68 ? 18.302  26.296  35.492  1.00 35.28 ? 311  GLU F CG  1 
ATOM   4027 C CD  . GLU F 1 68 ? 18.361  25.687  34.083  1.00 46.75 ? 311  GLU F CD  1 
ATOM   4028 O OE1 . GLU F 1 68 ? 19.376  25.023  33.771  1.00 58.53 ? 311  GLU F OE1 1 
ATOM   4029 O OE2 . GLU F 1 68 ? 17.409  25.852  33.287  1.00 51.59 ? 311  GLU F OE2 1 
ATOM   4030 N N   . GLU F 1 69 ? 17.230  30.887  35.565  1.00 14.75 ? 312  GLU F N   1 
ATOM   4031 C CA  . GLU F 1 69 ? 16.409  32.088  35.541  1.00 15.25 ? 312  GLU F CA  1 
ATOM   4032 C C   . GLU F 1 69 ? 16.614  32.934  34.277  1.00 15.56 ? 312  GLU F C   1 
ATOM   4033 O O   . GLU F 1 69 ? 15.658  33.519  33.748  1.00 14.29 ? 312  GLU F O   1 
ATOM   4034 C CB  . GLU F 1 69 ? 16.657  32.951  36.767  1.00 15.34 ? 312  GLU F CB  1 
ATOM   4035 C CG  . GLU F 1 69 ? 16.055  34.356  36.691  1.00 28.22 ? 312  GLU F CG  1 
ATOM   4036 C CD  . GLU F 1 69 ? 14.528  34.409  36.657  1.00 35.81 ? 312  GLU F CD  1 
ATOM   4037 O OE1 . GLU F 1 69 ? 13.877  33.662  35.882  1.00 30.83 ? 312  GLU F OE1 1 
ATOM   4038 O OE2 . GLU F 1 69 ? 13.975  35.250  37.404  1.00 27.19 ? 312  GLU F OE2 1 
ATOM   4039 N N   . THR F 1 70 ? 17.861  33.027  33.817  1.00 16.46 ? 313  THR F N   1 
ATOM   4040 C CA  . THR F 1 70 ? 18.160  33.729  32.561  1.00 13.54 ? 313  THR F CA  1 
ATOM   4041 C C   . THR F 1 70 ? 17.534  33.001  31.374  1.00 15.02 ? 313  THR F C   1 
ATOM   4042 O O   . THR F 1 70 ? 16.991  33.635  30.428  1.00 14.45 ? 313  THR F O   1 
ATOM   4043 C CB  . THR F 1 70 ? 19.682  33.897  32.392  1.00 13.33 ? 313  THR F CB  1 
ATOM   4044 O OG1 . THR F 1 70 ? 20.211  34.500  33.592  1.00 14.45 ? 313  THR F OG1 1 
ATOM   4045 C CG2 . THR F 1 70 ? 19.994  34.778  31.202  1.00 9.66  ? 313  THR F CG2 1 
ATOM   4046 N N   . VAL F 1 71 ? 17.580  31.672  31.420  1.00 14.83 ? 314  VAL F N   1 
ATOM   4047 C CA  . VAL F 1 71 ? 17.014  30.864  30.321  1.00 11.67 ? 314  VAL F CA  1 
ATOM   4048 C C   . VAL F 1 71 ? 15.506  31.030  30.304  1.00 13.00 ? 314  VAL F C   1 
ATOM   4049 O O   . VAL F 1 71 ? 14.915  31.177  29.220  1.00 16.09 ? 314  VAL F O   1 
ATOM   4050 C CB  . VAL F 1 71 ? 17.416  29.357  30.414  1.00 13.09 ? 314  VAL F CB  1 
ATOM   4051 C CG1 . VAL F 1 71 ? 16.674  28.492  29.336  1.00 12.49 ? 314  VAL F CG1 1 
ATOM   4052 C CG2 . VAL F 1 71 ? 18.940  29.183  30.226  1.00 11.99 ? 314  VAL F CG2 1 
ATOM   4053 N N   . SER F 1 72 ? 14.869  31.042  31.487  1.00 11.96 ? 315  SER F N   1 
ATOM   4054 C CA  . SER F 1 72 ? 13.400  31.199  31.533  1.00 11.11 ? 315  SER F CA  1 
ATOM   4055 C C   . SER F 1 72 ? 12.968  32.582  31.007  1.00 15.28 ? 315  SER F C   1 
ATOM   4056 O O   . SER F 1 72 ? 12.041  32.710  30.180  1.00 11.71 ? 315  SER F O   1 
ATOM   4057 C CB  . SER F 1 72 ? 12.803  30.884  32.921  1.00 13.47 ? 315  SER F CB  1 
ATOM   4058 O OG  . SER F 1 72 ? 13.497  31.530  33.965  1.00 30.98 ? 315  SER F OG  1 
ATOM   4059 N N   . ARG F 1 73 ? 13.678  33.614  31.425  1.00 17.64 ? 316  ARG F N   1 
ATOM   4060 C CA  . ARG F 1 73 ? 13.426  34.961  30.903  1.00 15.43 ? 316  ARG F CA  1 
ATOM   4061 C C   . ARG F 1 73 ? 13.496  35.085  29.386  1.00 18.58 ? 316  ARG F C   1 
ATOM   4062 O O   . ARG F 1 73 ? 12.648  35.757  28.775  1.00 14.59 ? 316  ARG F O   1 
ATOM   4063 C CB  . ARG F 1 73 ? 14.390  35.940  31.529  1.00 12.97 ? 316  ARG F CB  1 
ATOM   4064 C CG  . ARG F 1 73 ? 13.939  36.354  32.891  1.00 19.12 ? 316  ARG F CG  1 
ATOM   4065 C CD  . ARG F 1 73 ? 15.047  36.966  33.667  1.00 21.39 ? 316  ARG F CD  1 
ATOM   4066 N NE  . ARG F 1 73 ? 14.499  37.546  34.887  1.00 21.23 ? 316  ARG F NE  1 
ATOM   4067 C CZ  . ARG F 1 73 ? 14.466  38.847  35.193  1.00 26.91 ? 316  ARG F CZ  1 
ATOM   4068 N NH1 . ARG F 1 73 ? 14.994  39.773  34.398  1.00 27.79 ? 316  ARG F NH1 1 
ATOM   4069 N NH2 . ARG F 1 73 ? 13.912  39.233  36.338  1.00 36.40 ? 316  ARG F NH2 1 
ATOM   4070 N N   . ILE F 1 74 ? 14.510  34.453  28.783  1.00 14.86 ? 317  ILE F N   1 
ATOM   4071 C CA  . ILE F 1 74 ? 14.607  34.388  27.331  1.00 16.66 ? 317  ILE F CA  1 
ATOM   4072 C C   . ILE F 1 74 ? 13.401  33.622  26.791  1.00 17.49 ? 317  ILE F C   1 
ATOM   4073 O O   . ILE F 1 74 ? 12.687  34.098  25.886  1.00 16.79 ? 317  ILE F O   1 
ATOM   4074 C CB  . ILE F 1 74 ? 15.932  33.684  26.878  1.00 17.69 ? 317  ILE F CB  1 
ATOM   4075 C CG1 . ILE F 1 74 ? 17.134  34.542  27.272  1.00 16.84 ? 317  ILE F CG1 1 
ATOM   4076 C CG2 . ILE F 1 74 ? 15.950  33.441  25.361  1.00 13.73 ? 317  ILE F CG2 1 
ATOM   4077 C CD1 . ILE F 1 74 ? 18.503  33.759  27.236  1.00 12.49 ? 317  ILE F CD1 1 
ATOM   4078 N N   . GLN F 1 75 ? 13.153  32.444  27.364  1.00 17.62 ? 318  GLN F N   1 
ATOM   4079 C CA  . GLN F 1 75 ? 12.028  31.606  26.912  1.00 17.64 ? 318  GLN F CA  1 
ATOM   4080 C C   . GLN F 1 75 ? 10.659  32.240  27.115  1.00 17.09 ? 318  GLN F C   1 
ATOM   4081 O O   . GLN F 1 75 ? 9.773   32.068  26.271  1.00 14.20 ? 318  GLN F O   1 
ATOM   4082 C CB  . GLN F 1 75 ? 12.049  30.255  27.612  1.00 18.38 ? 318  GLN F CB  1 
ATOM   4083 C CG  . GLN F 1 75 ? 13.205  29.360  27.178  1.00 19.51 ? 318  GLN F CG  1 
ATOM   4084 C CD  . GLN F 1 75 ? 13.271  28.066  28.010  1.00 23.93 ? 318  GLN F CD  1 
ATOM   4085 O OE1 . GLN F 1 75 ? 12.605  27.942  29.042  1.00 19.81 ? 318  GLN F OE1 1 
ATOM   4086 N NE2 . GLN F 1 75 ? 14.064  27.104  27.545  1.00 28.07 ? 318  GLN F NE2 1 
ATOM   4087 N N   . GLY F 1 76 ? 10.482  32.959  28.230  1.00 14.12 ? 319  GLY F N   1 
ATOM   4088 C CA  . GLY F 1 76 ? 9.231   33.667  28.514  1.00 15.13 ? 319  GLY F CA  1 
ATOM   4089 C C   . GLY F 1 76 ? 8.824   34.705  27.471  1.00 17.71 ? 319  GLY F C   1 
ATOM   4090 O O   . GLY F 1 76 ? 7.664   35.176  27.477  1.00 15.87 ? 319  GLY F O   1 
ATOM   4091 N N   . GLN F 1 77 ? 9.753   35.037  26.562  1.00 13.89 ? 320  GLN F N   1 
ATOM   4092 C CA  . GLN F 1 77 ? 9.568   36.091  25.567  1.00 12.11 ? 320  GLN F CA  1 
ATOM   4093 C C   . GLN F 1 77 ? 9.047   35.570  24.248  1.00 18.58 ? 320  GLN F C   1 
ATOM   4094 O O   . GLN F 1 77 ? 8.580   36.350  23.431  1.00 20.51 ? 320  GLN F O   1 
ATOM   4095 C CB  . GLN F 1 77 ? 10.882  36.834  25.321  1.00 16.92 ? 320  GLN F CB  1 
ATOM   4096 C CG  . GLN F 1 77 ? 11.295  37.833  26.426  1.00 13.81 ? 320  GLN F CG  1 
ATOM   4097 C CD  . GLN F 1 77 ? 10.232  38.830  26.717  1.00 19.28 ? 320  GLN F CD  1 
ATOM   4098 O OE1 . GLN F 1 77 ? 9.837   39.577  25.835  1.00 23.09 ? 320  GLN F OE1 1 
ATOM   4099 N NE2 . GLN F 1 77 ? 9.720   38.828  27.959  1.00 15.46 ? 320  GLN F NE2 1 
ATOM   4100 N N   . GLY F 1 78 ? 9.126   34.257  24.031  1.00 18.59 ? 321  GLY F N   1 
ATOM   4101 C CA  . GLY F 1 78 ? 8.603   33.655  22.827  1.00 19.49 ? 321  GLY F CA  1 
ATOM   4102 C C   . GLY F 1 78 ? 9.501   33.873  21.606  1.00 22.09 ? 321  GLY F C   1 
ATOM   4103 O O   . GLY F 1 78 ? 10.729  33.757  21.697  1.00 19.40 ? 321  GLY F O   1 
ATOM   4104 N N   . SER F 1 79 ? 8.869   34.241  20.488  1.00 21.01 ? 322  SER F N   1 
ATOM   4105 C CA  . SER F 1 79 ? 9.497   34.267  19.152  1.00 26.42 ? 322  SER F CA  1 
ATOM   4106 C C   . SER F 1 79 ? 10.403  35.459  18.901  1.00 25.85 ? 322  SER F C   1 
ATOM   4107 O O   . SER F 1 79 ? 11.345  35.347  18.106  1.00 27.27 ? 322  SER F O   1 
ATOM   4108 C CB  . SER F 1 79 ? 8.417   34.240  18.051  1.00 23.91 ? 322  SER F CB  1 
ATOM   4109 O OG  . SER F 1 79 ? 7.376   35.176  18.300  1.00 30.71 ? 322  SER F OG  1 
ATOM   4110 N N   . CYS F 1 80 ? 10.104  36.588  19.554  1.00 20.77 ? 323  CYS F N   1 
ATOM   4111 C CA  . CYS F 1 80 ? 10.858  37.833  19.381  1.00 22.09 ? 323  CYS F CA  1 
ATOM   4112 C C   . CYS F 1 80 ? 11.453  38.325  20.696  1.00 27.03 ? 323  CYS F C   1 
ATOM   4113 O O   . CYS F 1 80 ? 10.711  38.548  21.661  1.00 25.46 ? 323  CYS F O   1 
ATOM   4114 C CB  . CYS F 1 80 ? 9.932   38.916  18.821  1.00 23.86 ? 323  CYS F CB  1 
ATOM   4115 S SG  . CYS F 1 80 ? 9.451   38.640  17.070  1.00 45.98 ? 323  CYS F SG  1 
ATOM   4116 N N   . VAL F 1 81 ? 12.769  38.539  20.744  1.00 23.58 ? 324  VAL F N   1 
ATOM   4117 C CA  . VAL F 1 81 ? 13.393  38.988  21.987  1.00 19.56 ? 324  VAL F CA  1 
ATOM   4118 C C   . VAL F 1 81 ? 14.430  40.096  21.798  1.00 22.57 ? 324  VAL F C   1 
ATOM   4119 O O   . VAL F 1 81 ? 15.172  40.141  20.798  1.00 19.55 ? 324  VAL F O   1 
ATOM   4120 C CB  . VAL F 1 81 ? 14.023  37.807  22.746  1.00 23.33 ? 324  VAL F CB  1 
ATOM   4121 C CG1 . VAL F 1 81 ? 15.309  37.339  22.068  1.00 17.72 ? 324  VAL F CG1 1 
ATOM   4122 C CG2 . VAL F 1 81 ? 14.276  38.193  24.204  1.00 19.10 ? 324  VAL F CG2 1 
ATOM   4123 N N   . SER F 1 82 ? 14.466  40.998  22.781  1.00 17.43 ? 325  SER F N   1 
ATOM   4124 C CA  . SER F 1 82 ? 15.531  41.960  22.909  1.00 19.16 ? 325  SER F CA  1 
ATOM   4125 C C   . SER F 1 82 ? 16.565  41.382  23.873  1.00 18.47 ? 325  SER F C   1 
ATOM   4126 O O   . SER F 1 82 ? 16.215  40.873  24.962  1.00 20.44 ? 325  SER F O   1 
ATOM   4127 C CB  . SER F 1 82 ? 14.969  43.276  23.449  1.00 24.93 ? 325  SER F CB  1 
ATOM   4128 O OG  . SER F 1 82 ? 15.963  44.280  23.542  1.00 31.48 ? 325  SER F OG  1 
ATOM   4129 N N   . LEU F 1 83 ? 17.836  41.478  23.482  1.00 17.20 ? 326  LEU F N   1 
ATOM   4130 C CA  . LEU F 1 83 ? 18.976  41.012  24.299  1.00 18.80 ? 326  LEU F CA  1 
ATOM   4131 C C   . LEU F 1 83 ? 20.050  42.111  24.269  1.00 20.08 ? 326  LEU F C   1 
ATOM   4132 O O   . LEU F 1 83 ? 20.387  42.626  23.204  1.00 21.41 ? 326  LEU F O   1 
ATOM   4133 C CB  . LEU F 1 83 ? 19.571  39.703  23.736  1.00 18.44 ? 326  LEU F CB  1 
ATOM   4134 C CG  . LEU F 1 83 ? 18.662  38.475  23.582  1.00 20.66 ? 326  LEU F CG  1 
ATOM   4135 C CD1 . LEU F 1 83 ? 19.305  37.365  22.725  1.00 12.80 ? 326  LEU F CD1 1 
ATOM   4136 C CD2 . LEU F 1 83 ? 18.279  37.920  24.940  1.00 15.27 ? 326  LEU F CD2 1 
ATOM   4137 N N   . THR F 1 84 ? 20.575  42.476  25.430  1.00 19.11 ? 327  THR F N   1 
ATOM   4138 C CA  . THR F 1 84 ? 21.702  43.391  25.488  1.00 16.91 ? 327  THR F CA  1 
ATOM   4139 C C   . THR F 1 84 ? 22.980  42.583  25.827  1.00 13.96 ? 327  THR F C   1 
ATOM   4140 O O   . THR F 1 84 ? 22.980  41.739  26.705  1.00 15.18 ? 327  THR F O   1 
ATOM   4141 C CB  . THR F 1 84 ? 21.408  44.571  26.446  1.00 16.05 ? 327  THR F CB  1 
ATOM   4142 O OG1 . THR F 1 84 ? 20.135  45.126  26.111  1.00 19.01 ? 327  THR F OG1 1 
ATOM   4143 C CG2 . THR F 1 84 ? 22.447  45.668  26.340  1.00 13.31 ? 327  THR F CG2 1 
ATOM   4144 N N   . VAL F 1 85 ? 24.035  42.809  25.049  1.00 10.88 ? 328  VAL F N   1 
ATOM   4145 C CA  . VAL F 1 85 ? 25.307  42.139  25.243  1.00 13.36 ? 328  VAL F CA  1 
ATOM   4146 C C   . VAL F 1 85 ? 26.445  43.138  25.412  1.00 15.14 ? 328  VAL F C   1 
ATOM   4147 O O   . VAL F 1 85 ? 26.375  44.282  24.952  1.00 17.56 ? 328  VAL F O   1 
ATOM   4148 C CB  . VAL F 1 85 ? 25.677  41.233  24.040  1.00 17.99 ? 328  VAL F CB  1 
ATOM   4149 C CG1 . VAL F 1 85 ? 24.558  40.205  23.774  1.00 12.03 ? 328  VAL F CG1 1 
ATOM   4150 C CG2 . VAL F 1 85 ? 25.975  42.114  22.796  1.00 18.18 ? 328  VAL F CG2 1 
ATOM   4151 N N   . VAL F 1 86 ? 27.498  42.686  26.073  1.00 16.77 ? 329  VAL F N   1 
ATOM   4152 C CA  . VAL F 1 86 ? 28.731  43.449  26.156  1.00 18.48 ? 329  VAL F CA  1 
ATOM   4153 C C   . VAL F 1 86 ? 29.830  42.615  25.515  1.00 15.51 ? 329  VAL F C   1 
ATOM   4154 O O   . VAL F 1 86 ? 30.105  41.480  25.912  1.00 15.18 ? 329  VAL F O   1 
ATOM   4155 C CB  . VAL F 1 86 ? 29.104  43.833  27.605  1.00 16.60 ? 329  VAL F CB  1 
ATOM   4156 C CG1 . VAL F 1 86 ? 30.504  44.437  27.652  1.00 19.49 ? 329  VAL F CG1 1 
ATOM   4157 C CG2 . VAL F 1 86 ? 28.091  44.829  28.152  1.00 20.51 ? 329  VAL F CG2 1 
ATOM   4158 N N   . ASP F 1 87 ? 30.452  43.205  24.511  1.00 19.88 ? 330  ASP F N   1 
ATOM   4159 C CA  . ASP F 1 87 ? 31.462  42.529  23.744  1.00 22.99 ? 330  ASP F CA  1 
ATOM   4160 C C   . ASP F 1 87 ? 32.760  42.376  24.513  1.00 23.27 ? 330  ASP F C   1 
ATOM   4161 O O   . ASP F 1 87 ? 33.086  43.220  25.375  1.00 20.09 ? 330  ASP F O   1 
ATOM   4162 C CB  . ASP F 1 87 ? 31.725  43.284  22.444  1.00 23.21 ? 330  ASP F CB  1 
ATOM   4163 C CG  . ASP F 1 87 ? 30.528  43.314  21.556  1.00 22.93 ? 330  ASP F CG  1 
ATOM   4164 O OD1 . ASP F 1 87 ? 29.966  42.238  21.270  1.00 23.81 ? 330  ASP F OD1 1 
ATOM   4165 O OD2 . ASP F 1 87 ? 30.140  44.425  21.157  1.00 29.21 ? 330  ASP F OD2 1 
ATOM   4166 N N   . PRO F 1 88 ? 33.506  41.293  24.190  1.00 22.49 ? 331  PRO F N   1 
ATOM   4167 C CA  . PRO F 1 88 ? 34.817  41.044  24.740  1.00 24.74 ? 331  PRO F CA  1 
ATOM   4168 C C   . PRO F 1 88 ? 35.910  41.794  23.945  1.00 25.66 ? 331  PRO F C   1 
ATOM   4169 O O   . PRO F 1 88 ? 35.651  42.316  22.838  1.00 22.53 ? 331  PRO F O   1 
ATOM   4170 C CB  . PRO F 1 88 ? 34.960  39.510  24.582  1.00 24.36 ? 331  PRO F CB  1 
ATOM   4171 C CG  . PRO F 1 88 ? 34.245  39.236  23.298  1.00 24.54 ? 331  PRO F CG  1 
ATOM   4172 C CD  . PRO F 1 88 ? 33.123  40.235  23.227  1.00 22.64 ? 331  PRO F CD  1 
ATOM   4173 N N   . GLU F 1 89 ? 37.115  41.853  24.520  1.00 30.82 ? 332  GLU F N   1 
ATOM   4174 C CA  . GLU F 1 89 ? 38.298  42.290  23.779  1.00 31.64 ? 332  GLU F CA  1 
ATOM   4175 C C   . GLU F 1 89 ? 38.741  41.202  22.793  1.00 33.70 ? 332  GLU F C   1 
ATOM   4176 O O   . GLU F 1 89 ? 38.915  40.038  23.164  1.00 34.97 ? 332  GLU F O   1 
ATOM   4177 C CB  . GLU F 1 89 ? 39.439  42.649  24.729  1.00 37.54 ? 332  GLU F CB  1 
ATOM   4178 C CG  . GLU F 1 89 ? 39.427  44.076  25.211  1.00 42.05 ? 332  GLU F CG  1 
ATOM   4179 C CD  . GLU F 1 89 ? 38.092  44.509  25.787  1.00 52.68 ? 332  GLU F CD  1 
ATOM   4180 O OE1 . GLU F 1 89 ? 37.347  43.658  26.312  1.00 52.99 ? 332  GLU F OE1 1 
ATOM   4181 O OE2 . GLU F 1 89 ? 37.781  45.718  25.706  1.00 55.30 ? 332  GLU F OE2 1 
ATOM   4182 N N   . ALA F 1 90 ? 38.922  41.609  21.536  1.00 37.43 ? 333  ALA F N   1 
ATOM   4183 C CA  . ALA F 1 90 ? 39.348  40.728  20.442  1.00 36.39 ? 333  ALA F CA  1 
ATOM   4184 C C   . ALA F 1 90 ? 40.594  39.915  20.778  1.00 35.13 ? 333  ALA F C   1 
ATOM   4185 O O   . ALA F 1 90 ? 40.725  38.763  20.344  1.00 34.11 ? 333  ALA F O   1 
ATOM   4186 C CB  . ALA F 1 90 ? 39.602  41.556  19.164  1.00 34.13 ? 333  ALA F CB  1 
ATOM   4187 N N   . ASP F 1 91 ? 41.486  40.523  21.563  1.00 30.46 ? 334  ASP F N   1 
ATOM   4188 C CA  . ASP F 1 91 ? 42.833  40.007  21.776  1.00 29.95 ? 334  ASP F CA  1 
ATOM   4189 C C   . ASP F 1 91 ? 43.092  39.419  23.169  1.00 19.71 ? 334  ASP F C   1 
ATOM   4190 O O   . ASP F 1 91 ? 44.247  39.181  23.523  1.00 22.96 ? 334  ASP F O   1 
ATOM   4191 C CB  . ASP F 1 91 ? 43.838  41.124  21.499  1.00 33.27 ? 334  ASP F CB  1 
ATOM   4192 C CG  . ASP F 1 91 ? 43.605  42.357  22.374  1.00 51.32 ? 334  ASP F CG  1 
ATOM   4193 O OD1 . ASP F 1 91 ? 44.444  43.284  22.323  1.00 65.70 ? 334  ASP F OD1 1 
ATOM   4194 O OD2 . ASP F 1 91 ? 42.585  42.398  23.105  1.00 52.96 ? 334  ASP F OD2 1 
ATOM   4195 N N   . ARG F 1 92 ? 42.033  39.204  23.958  1.00 20.04 ? 335  ARG F N   1 
ATOM   4196 C CA  . ARG F 1 92 ? 42.142  38.469  25.234  1.00 13.90 ? 335  ARG F CA  1 
ATOM   4197 C C   . ARG F 1 92 ? 41.587  37.069  25.121  1.00 9.08  ? 335  ARG F C   1 
ATOM   4198 O O   . ARG F 1 92 ? 40.856  36.590  25.985  1.00 8.78  ? 335  ARG F O   1 
ATOM   4199 C CB  . ARG F 1 92 ? 41.503  39.242  26.396  1.00 11.62 ? 335  ARG F CB  1 
ATOM   4200 C CG  . ARG F 1 92 ? 41.987  40.666  26.408  1.00 4.93  ? 335  ARG F CG  1 
ATOM   4201 C CD  . ARG F 1 92 ? 41.802  41.370  27.675  1.00 15.09 ? 335  ARG F CD  1 
ATOM   4202 N NE  . ARG F 1 92 ? 42.338  42.726  27.596  1.00 21.24 ? 335  ARG F NE  1 
ATOM   4203 C CZ  . ARG F 1 92 ? 42.230  43.635  28.561  1.00 23.60 ? 335  ARG F CZ  1 
ATOM   4204 N NH1 . ARG F 1 92 ? 41.576  43.355  29.673  1.00 19.28 ? 335  ARG F NH1 1 
ATOM   4205 N NH2 . ARG F 1 92 ? 42.765  44.837  28.412  1.00 30.99 ? 335  ARG F NH2 1 
ATOM   4206 N N   . GLU F 1 93 ? 41.968  36.404  24.043  1.00 8.89  ? 336  GLU F N   1 
ATOM   4207 C CA  . GLU F 1 93 ? 41.745  34.968  23.908  1.00 12.01 ? 336  GLU F CA  1 
ATOM   4208 C C   . GLU F 1 93 ? 43.077  34.452  23.322  1.00 8.27  ? 336  GLU F C   1 
ATOM   4209 O O   . GLU F 1 93 ? 43.668  35.129  22.506  1.00 14.57 ? 336  GLU F O   1 
ATOM   4210 C CB  . GLU F 1 93 ? 40.531  34.702  22.994  1.00 9.94  ? 336  GLU F CB  1 
ATOM   4211 C CG  . GLU F 1 93 ? 40.744  35.095  21.562  1.00 27.40 ? 336  GLU F CG  1 
ATOM   4212 C CD  . GLU F 1 93 ? 39.533  34.855  20.707  1.00 25.24 ? 336  GLU F CD  1 
ATOM   4213 O OE1 . GLU F 1 93 ? 38.614  35.690  20.763  1.00 43.86 ? 336  GLU F OE1 1 
ATOM   4214 O OE2 . GLU F 1 93 ? 39.507  33.838  19.981  1.00 33.28 ? 336  GLU F OE2 1 
ATOM   4215 N N   . THR F 1 94 ? 43.602  33.333  23.819  1.00 10.22 ? 337  THR F N   1 
ATOM   4216 C CA  . THR F 1 94 ? 44.835  32.769  23.274  1.00 12.14 ? 337  THR F CA  1 
ATOM   4217 C C   . THR F 1 94 ? 44.746  31.251  23.265  1.00 8.83  ? 337  THR F C   1 
ATOM   4218 O O   . THR F 1 94 ? 44.389  30.614  24.252  1.00 10.51 ? 337  THR F O   1 
ATOM   4219 C CB  . THR F 1 94 ? 46.124  33.213  24.054  1.00 12.09 ? 337  THR F CB  1 
ATOM   4220 O OG1 . THR F 1 94 ? 46.126  34.631  24.265  1.00 4.73  ? 337  THR F OG1 1 
ATOM   4221 C CG2 . THR F 1 94 ? 47.410  32.811  23.274  1.00 2.00  ? 337  THR F CG2 1 
ATOM   4222 N N   . SER F 1 95 ? 45.086  30.675  22.131  1.00 7.90  ? 338  SER F N   1 
ATOM   4223 C CA  . SER F 1 95 ? 45.182  29.243  22.007  1.00 9.58  ? 338  SER F CA  1 
ATOM   4224 C C   . SER F 1 95 ? 46.631  28.838  22.382  1.00 13.31 ? 338  SER F C   1 
ATOM   4225 O O   . SER F 1 95 ? 47.609  29.332  21.783  1.00 12.61 ? 338  SER F O   1 
ATOM   4226 C CB  . SER F 1 95 ? 44.754  28.838  20.588  1.00 11.39 ? 338  SER F CB  1 
ATOM   4227 O OG  . SER F 1 95 ? 45.113  27.515  20.258  1.00 8.75  ? 338  SER F OG  1 
ATOM   4228 N N   . VAL F 1 96 ? 46.765  27.994  23.409  1.00 8.81  ? 339  VAL F N   1 
ATOM   4229 C CA  . VAL F 1 96 ? 48.083  27.513  23.871  1.00 15.50 ? 339  VAL F CA  1 
ATOM   4230 C C   . VAL F 1 96 ? 48.191  25.981  23.713  1.00 20.58 ? 339  VAL F C   1 
ATOM   4231 O O   . VAL F 1 96 ? 47.213  25.295  23.433  1.00 12.30 ? 339  VAL F O   1 
ATOM   4232 C CB  . VAL F 1 96 ? 48.344  27.884  25.347  1.00 23.12 ? 339  VAL F CB  1 
ATOM   4233 C CG1 . VAL F 1 96 ? 48.208  29.400  25.570  1.00 27.20 ? 339  VAL F CG1 1 
ATOM   4234 C CG2 . VAL F 1 96 ? 47.385  27.145  26.266  1.00 12.31 ? 339  VAL F CG2 1 
ATOM   4235 O OXT . VAL F 1 96 ? 49.247  25.366  23.877  1.00 15.58 ? 339  VAL F OXT 1 
HETATM 4236 S S   . SO4 G 2 .  ? 15.939  -55.445 -16.217 1.00 37.09 ? 1340 SO4 A S   1 
HETATM 4237 O O1  . SO4 G 2 .  ? 16.645  -54.259 -16.766 1.00 31.08 ? 1340 SO4 A O1  1 
HETATM 4238 O O2  . SO4 G 2 .  ? 15.644  -56.381 -17.307 1.00 43.25 ? 1340 SO4 A O2  1 
HETATM 4239 O O3  . SO4 G 2 .  ? 16.757  -56.087 -15.184 1.00 40.22 ? 1340 SO4 A O3  1 
HETATM 4240 O O4  . SO4 G 2 .  ? 14.668  -55.010 -15.660 1.00 51.43 ? 1340 SO4 A O4  1 
HETATM 4241 S S   . SO4 H 2 .  ? 35.495  -6.472  12.657  1.00 44.88 ? 1340 SO4 B S   1 
HETATM 4242 O O1  . SO4 H 2 .  ? 36.009  -5.178  12.185  1.00 30.48 ? 1340 SO4 B O1  1 
HETATM 4243 O O2  . SO4 H 2 .  ? 35.247  -7.359  11.499  1.00 40.49 ? 1340 SO4 B O2  1 
HETATM 4244 O O3  . SO4 H 2 .  ? 36.442  -7.113  13.584  1.00 51.96 ? 1340 SO4 B O3  1 
HETATM 4245 O O4  . SO4 H 2 .  ? 34.267  -6.214  13.396  1.00 32.57 ? 1340 SO4 B O4  1 
HETATM 4246 S S   . SO4 I 2 .  ? 34.120  -2.292  14.440  1.00 69.39 ? 1341 SO4 B S   1 
HETATM 4247 O O1  . SO4 I 2 .  ? 34.516  -3.189  13.368  1.00 29.88 ? 1341 SO4 B O1  1 
HETATM 4248 O O2  . SO4 I 2 .  ? 33.786  -0.978  13.868  1.00 28.37 ? 1341 SO4 B O2  1 
HETATM 4249 O O3  . SO4 I 2 .  ? 33.017  -3.019  15.072  1.00 28.42 ? 1341 SO4 B O3  1 
HETATM 4250 O O4  . SO4 I 2 .  ? 35.215  -2.033  15.383  1.00 60.15 ? 1341 SO4 B O4  1 
HETATM 4251 O O   . HOH J 3 .  ? 11.033  -52.707 -2.421  1.00 41.64 ? 2001 HOH A O   1 
HETATM 4252 O O   . HOH J 3 .  ? 14.793  -50.439 -3.885  1.00 33.01 ? 2002 HOH A O   1 
HETATM 4253 O O   . HOH J 3 .  ? 10.145  -45.603 3.090   1.00 26.72 ? 2003 HOH A O   1 
HETATM 4254 O O   . HOH J 3 .  ? 7.741   -42.599 6.444   1.00 48.18 ? 2004 HOH A O   1 
HETATM 4255 O O   . HOH J 3 .  ? 3.550   -42.186 3.626   1.00 45.71 ? 2005 HOH A O   1 
HETATM 4256 O O   . HOH J 3 .  ? -2.001  -26.553 -6.182  1.00 27.73 ? 2006 HOH A O   1 
HETATM 4257 O O   . HOH J 3 .  ? -6.112  -40.944 -1.056  1.00 32.79 ? 2007 HOH A O   1 
HETATM 4258 O O   . HOH J 3 .  ? -1.945  -33.265 -1.483  1.00 25.70 ? 2008 HOH A O   1 
HETATM 4259 O O   . HOH J 3 .  ? -9.235  -31.313 -4.614  1.00 40.47 ? 2009 HOH A O   1 
HETATM 4260 O O   . HOH J 3 .  ? -9.260  -27.741 -7.803  1.00 30.73 ? 2010 HOH A O   1 
HETATM 4261 O O   . HOH J 3 .  ? -7.848  -48.081 -10.095 1.00 37.01 ? 2011 HOH A O   1 
HETATM 4262 O O   . HOH J 3 .  ? -2.572  -27.964 -8.432  1.00 28.02 ? 2012 HOH A O   1 
HETATM 4263 O O   . HOH J 3 .  ? 3.637   -47.876 -22.703 1.00 17.52 ? 2013 HOH A O   1 
HETATM 4264 O O   . HOH J 3 .  ? 15.364  -46.259 -22.037 1.00 13.41 ? 2014 HOH A O   1 
HETATM 4265 O O   . HOH J 3 .  ? 12.793  -47.045 -22.049 1.00 8.02  ? 2015 HOH A O   1 
HETATM 4266 O O   . HOH J 3 .  ? 15.774  -48.925 -21.164 1.00 13.38 ? 2016 HOH A O   1 
HETATM 4267 O O   . HOH J 3 .  ? 15.632  -51.182 -22.436 1.00 29.36 ? 2017 HOH A O   1 
HETATM 4268 O O   . HOH J 3 .  ? 13.734  -60.473 -17.403 1.00 31.49 ? 2018 HOH A O   1 
HETATM 4269 O O   . HOH J 3 .  ? 8.165   -54.858 -24.240 1.00 31.72 ? 2019 HOH A O   1 
HETATM 4270 O O   . HOH J 3 .  ? 11.060  -52.943 -16.040 1.00 16.07 ? 2020 HOH A O   1 
HETATM 4271 O O   . HOH J 3 .  ? 13.254  -33.399 -12.026 1.00 23.75 ? 2021 HOH A O   1 
HETATM 4272 O O   . HOH J 3 .  ? 13.196  -34.555 -18.000 1.00 33.55 ? 2022 HOH A O   1 
HETATM 4273 O O   . HOH J 3 .  ? 11.808  -32.529 -9.595  1.00 15.45 ? 2023 HOH A O   1 
HETATM 4274 O O   . HOH J 3 .  ? 11.691  -29.826 -9.941  0.50 15.78 ? 2024 HOH A O   1 
HETATM 4275 O O   . HOH J 3 .  ? 10.325  -29.705 -11.136 0.50 12.02 ? 2025 HOH A O   1 
HETATM 4276 O O   . HOH J 3 .  ? 4.609   -31.412 -6.966  1.00 8.99  ? 2026 HOH A O   1 
HETATM 4277 O O   . HOH J 3 .  ? 4.926   -31.679 -14.086 1.00 33.74 ? 2027 HOH A O   1 
HETATM 4278 O O   . HOH J 3 .  ? 6.155   -25.306 -9.381  1.00 34.73 ? 2028 HOH A O   1 
HETATM 4279 O O   . HOH J 3 .  ? -0.387  -26.768 -4.189  1.00 32.55 ? 2029 HOH A O   1 
HETATM 4280 O O   . HOH J 3 .  ? 12.512  -34.279 -2.348  1.00 42.88 ? 2030 HOH A O   1 
HETATM 4281 O O   . HOH J 3 .  ? 6.142   -31.223 2.927   1.00 40.58 ? 2031 HOH A O   1 
HETATM 4282 O O   . HOH J 3 .  ? 10.288  -36.746 1.191   1.00 41.35 ? 2032 HOH A O   1 
HETATM 4283 O O   . HOH J 3 .  ? 13.418  -41.509 0.934   1.00 43.67 ? 2033 HOH A O   1 
HETATM 4284 O O   . HOH J 3 .  ? 15.528  -37.674 -5.466  1.00 37.57 ? 2034 HOH A O   1 
HETATM 4285 O O   . HOH J 3 .  ? 7.433   -50.938 -11.678 1.00 13.75 ? 2035 HOH A O   1 
HETATM 4286 O O   . HOH J 3 .  ? 5.681   -48.770 -12.475 1.00 8.02  ? 2036 HOH A O   1 
HETATM 4287 O O   . HOH J 3 .  ? 2.348   -52.744 -6.235  1.00 8.91  ? 2037 HOH A O   1 
HETATM 4288 O O   . HOH J 3 .  ? -5.320  -48.528 -10.340 1.00 20.48 ? 2038 HOH A O   1 
HETATM 4289 O O   . HOH J 3 .  ? -1.859  -47.018 -3.968  1.00 8.73  ? 2039 HOH A O   1 
HETATM 4290 O O   . HOH J 3 .  ? -8.683  -52.380 -11.989 1.00 25.92 ? 2040 HOH A O   1 
HETATM 4291 O O   . HOH J 3 .  ? -8.497  -49.296 -8.018  1.00 41.26 ? 2041 HOH A O   1 
HETATM 4292 O O   . HOH J 3 .  ? 2.738   -56.932 -9.404  1.00 40.24 ? 2042 HOH A O   1 
HETATM 4293 O O   . HOH J 3 .  ? -3.263  -54.718 -8.726  1.00 22.07 ? 2043 HOH A O   1 
HETATM 4294 O O   . HOH J 3 .  ? -3.380  -53.494 -11.608 1.00 38.93 ? 2044 HOH A O   1 
HETATM 4295 O O   . HOH J 3 .  ? 4.543   -56.722 -17.802 1.00 17.57 ? 2045 HOH A O   1 
HETATM 4296 O O   . HOH J 3 .  ? 7.451   -52.428 -13.594 1.00 13.18 ? 2046 HOH A O   1 
HETATM 4297 O O   . HOH J 3 .  ? 2.561   -53.944 -19.897 1.00 18.17 ? 2047 HOH A O   1 
HETATM 4298 O O   . HOH J 3 .  ? 1.490   -46.343 -23.262 1.00 18.09 ? 2048 HOH A O   1 
HETATM 4299 O O   . HOH J 3 .  ? -3.977  -42.630 -20.914 1.00 32.40 ? 2049 HOH A O   1 
HETATM 4300 O O   . HOH J 3 .  ? -6.644  -46.226 -22.226 1.00 49.19 ? 2050 HOH A O   1 
HETATM 4301 O O   . HOH J 3 .  ? -7.182  -52.154 -16.792 1.00 40.81 ? 2051 HOH A O   1 
HETATM 4302 O O   . HOH J 3 .  ? -4.438  -50.766 -21.638 1.00 46.35 ? 2052 HOH A O   1 
HETATM 4303 O O   . HOH J 3 .  ? -7.129  -50.465 -20.928 1.00 40.90 ? 2053 HOH A O   1 
HETATM 4304 O O   . HOH J 3 .  ? -0.471  -48.711 -21.402 1.00 16.79 ? 2054 HOH A O   1 
HETATM 4305 O O   . HOH J 3 .  ? -8.097  -45.406 -11.161 1.00 13.53 ? 2055 HOH A O   1 
HETATM 4306 O O   . HOH J 3 .  ? -10.004 -37.168 -13.830 1.00 27.95 ? 2056 HOH A O   1 
HETATM 4307 O O   . HOH J 3 .  ? -6.061  -41.205 -20.268 1.00 41.94 ? 2057 HOH A O   1 
HETATM 4308 O O   . HOH J 3 .  ? -7.083  -43.297 -4.830  1.00 18.19 ? 2058 HOH A O   1 
HETATM 4309 O O   . HOH J 3 .  ? -12.084 -46.978 -8.224  1.00 42.17 ? 2059 HOH A O   1 
HETATM 4310 O O   . HOH J 3 .  ? -6.824  -37.776 -11.147 1.00 15.71 ? 2060 HOH A O   1 
HETATM 4311 O O   . HOH J 3 .  ? -13.006 -37.184 -7.790  1.00 31.34 ? 2061 HOH A O   1 
HETATM 4312 O O   . HOH J 3 .  ? -10.449 -41.008 -5.352  1.00 28.09 ? 2062 HOH A O   1 
HETATM 4313 O O   . HOH J 3 .  ? 10.363  -46.016 -0.755  1.00 17.20 ? 2063 HOH A O   1 
HETATM 4314 O O   . HOH J 3 .  ? 15.492  -47.686 -4.285  1.00 13.15 ? 2064 HOH A O   1 
HETATM 4315 O O   . HOH J 3 .  ? 18.060  -45.420 -6.520  1.00 15.55 ? 2065 HOH A O   1 
HETATM 4316 O O   . HOH J 3 .  ? 18.704  -42.356 -7.248  1.00 17.87 ? 2066 HOH A O   1 
HETATM 4317 O O   . HOH J 3 .  ? 24.391  -51.340 -2.155  1.00 24.78 ? 2067 HOH A O   1 
HETATM 4318 O O   . HOH J 3 .  ? -9.127  -31.883 -2.118  1.00 32.65 ? 2068 HOH A O   1 
HETATM 4319 O O   . HOH J 3 .  ? 23.538  -31.696 -15.120 1.00 33.03 ? 2069 HOH A O   1 
HETATM 4320 O O   . HOH J 3 .  ? 29.288  -30.614 -13.103 1.00 39.88 ? 2070 HOH A O   1 
HETATM 4321 O O   . HOH J 3 .  ? 30.369  -34.242 -10.527 1.00 45.80 ? 2071 HOH A O   1 
HETATM 4322 O O   . HOH J 3 .  ? 32.907  -32.654 -15.469 1.00 48.91 ? 2072 HOH A O   1 
HETATM 4323 O O   . HOH J 3 .  ? 12.532  -55.223 -16.338 1.00 15.34 ? 2073 HOH A O   1 
HETATM 4324 O O   . HOH J 3 .  ? 18.277  -53.190 -15.031 1.00 25.24 ? 2074 HOH A O   1 
HETATM 4325 O O   . HOH K 3 .  ? 34.163  -1.647  25.159  1.00 32.78 ? 2001 HOH B O   1 
HETATM 4326 O O   . HOH K 3 .  ? 30.177  -3.987  27.032  1.00 36.41 ? 2002 HOH B O   1 
HETATM 4327 O O   . HOH K 3 .  ? 30.063  2.627   28.586  1.00 22.61 ? 2003 HOH B O   1 
HETATM 4328 O O   . HOH K 3 .  ? 33.530  15.547  22.264  1.00 50.24 ? 2004 HOH B O   1 
HETATM 4329 O O   . HOH K 3 .  ? 16.901  21.906  24.070  1.00 30.75 ? 2005 HOH B O   1 
HETATM 4330 O O   . HOH K 3 .  ? 13.230  8.126   28.380  1.00 37.41 ? 2006 HOH B O   1 
HETATM 4331 O O   . HOH K 3 .  ? 17.680  15.577  27.930  1.00 32.05 ? 2007 HOH B O   1 
HETATM 4332 O O   . HOH K 3 .  ? 9.774   17.030  25.503  1.00 37.00 ? 2008 HOH B O   1 
HETATM 4333 O O   . HOH K 3 .  ? 9.783   20.292  21.558  1.00 41.12 ? 2009 HOH B O   1 
HETATM 4334 O O   . HOH K 3 .  ? 18.780  1.574   3.154   1.00 51.32 ? 2010 HOH B O   1 
HETATM 4335 O O   . HOH K 3 .  ? -9.775  -46.077 -15.844 0.50 15.67 ? 2011 HOH B O   1 
HETATM 4336 O O   . HOH K 3 .  ? 16.587  10.595  8.098   1.00 27.94 ? 2012 HOH B O   1 
HETATM 4337 O O   . HOH K 3 .  ? 23.286  1.119   6.411   1.00 18.33 ? 2013 HOH B O   1 
HETATM 4338 O O   . HOH K 3 .  ? 35.059  2.861   7.038   1.00 17.50 ? 2014 HOH B O   1 
HETATM 4339 O O   . HOH K 3 .  ? 35.357  0.349   8.074   1.00 13.53 ? 2015 HOH B O   1 
HETATM 4340 O O   . HOH K 3 .  ? 32.189  2.172   6.927   1.00 9.98  ? 2016 HOH B O   1 
HETATM 4341 O O   . HOH K 3 .  ? 48.758  7.067   22.615  1.00 35.49 ? 2017 HOH B O   1 
HETATM 4342 O O   . HOH K 3 .  ? 32.829  -11.525 11.643  1.00 28.70 ? 2018 HOH B O   1 
HETATM 4343 O O   . HOH K 3 .  ? 30.649  -3.699  12.881  1.00 14.70 ? 2019 HOH B O   1 
HETATM 4344 O O   . HOH K 3 .  ? 27.072  -3.597  15.431  1.00 21.16 ? 2020 HOH B O   1 
HETATM 4345 O O   . HOH K 3 .  ? 32.542  14.689  11.671  1.00 44.81 ? 2021 HOH B O   1 
HETATM 4346 O O   . HOH K 3 .  ? 30.472  18.885  23.134  1.00 58.47 ? 2022 HOH B O   1 
HETATM 4347 O O   . HOH K 3 .  ? 30.162  19.232  18.526  1.00 37.58 ? 2023 HOH B O   1 
HETATM 4348 O O   . HOH K 3 .  ? 31.232  16.201  19.796  1.00 18.39 ? 2024 HOH B O   1 
HETATM 4349 O O   . HOH K 3 .  ? 23.843  17.420  22.581  1.00 13.64 ? 2025 HOH B O   1 
HETATM 4350 O O   . HOH K 3 .  ? 25.320  23.312  20.273  1.00 35.34 ? 2026 HOH B O   1 
HETATM 4351 O O   . HOH K 3 .  ? 18.971  22.051  25.299  1.00 30.69 ? 2027 HOH B O   1 
HETATM 4352 O O   . HOH K 3 .  ? 29.474  12.080  30.862  1.00 41.90 ? 2028 HOH B O   1 
HETATM 4353 O O   . HOH K 3 .  ? 34.809  11.130  23.571  1.00 24.29 ? 2029 HOH B O   1 
HETATM 4354 O O   . HOH K 3 .  ? 26.991  -1.910  17.437  1.00 17.30 ? 2030 HOH B O   1 
HETATM 4355 O O   . HOH K 3 .  ? 25.166  0.168   16.679  1.00 9.09  ? 2031 HOH B O   1 
HETATM 4356 O O   . HOH K 3 .  ? 21.893  -3.851  22.882  1.00 9.38  ? 2032 HOH B O   1 
HETATM 4357 O O   . HOH K 3 .  ? 14.695  0.184   19.066  1.00 20.66 ? 2033 HOH B O   1 
HETATM 4358 O O   . HOH K 3 .  ? 12.791  2.126   27.373  1.00 44.51 ? 2034 HOH B O   1 
HETATM 4359 O O   . HOH K 3 .  ? 11.081  -0.321  21.512  1.00 33.01 ? 2035 HOH B O   1 
HETATM 4360 O O   . HOH K 3 .  ? 10.741  -3.362  17.048  1.00 29.51 ? 2036 HOH B O   1 
HETATM 4361 O O   . HOH K 3 .  ? 22.020  -7.873  19.815  1.00 25.93 ? 2037 HOH B O   1 
HETATM 4362 O O   . HOH K 3 .  ? 23.927  -7.581  10.976  1.00 12.62 ? 2038 HOH B O   1 
HETATM 4363 O O   . HOH K 3 .  ? 21.970  -4.814  9.091   1.00 13.45 ? 2039 HOH B O   1 
HETATM 4364 O O   . HOH K 3 .  ? 20.957  2.518   5.893   1.00 19.28 ? 2040 HOH B O   1 
HETATM 4365 O O   . HOH K 3 .  ? 15.178  6.128   8.461   1.00 24.53 ? 2041 HOH B O   1 
HETATM 4366 O O   . HOH K 3 .  ? 18.662  9.276   7.769   1.00 39.02 ? 2042 HOH B O   1 
HETATM 4367 O O   . HOH K 3 .  ? 18.924  0.262   7.573   1.00 24.29 ? 2043 HOH B O   1 
HETATM 4368 O O   . HOH K 3 .  ? 12.121  -3.265  12.418  1.00 38.83 ? 2044 HOH B O   1 
HETATM 4369 O O   . HOH K 3 .  ? -10.020 -45.870 -14.100 0.50 4.72  ? 2045 HOH B O   1 
HETATM 4370 O O   . HOH K 3 .  ? 15.700  -4.969  17.750  1.00 31.65 ? 2046 HOH B O   1 
HETATM 4371 O O   . HOH K 3 .  ? 11.039  3.487   18.075  1.00 14.06 ? 2047 HOH B O   1 
HETATM 4372 O O   . HOH K 3 .  ? 14.059  9.794   8.785   1.00 37.46 ? 2048 HOH B O   1 
HETATM 4373 O O   . HOH K 3 .  ? 8.925   7.758   23.598  1.00 33.60 ? 2049 HOH B O   1 
HETATM 4374 O O   . HOH K 3 .  ? 12.558  11.057  18.254  1.00 24.23 ? 2050 HOH B O   1 
HETATM 4375 O O   . HOH K 3 .  ? 6.754   11.997  21.745  1.00 26.78 ? 2051 HOH B O   1 
HETATM 4376 O O   . HOH K 3 .  ? 12.700  5.465   24.545  1.00 27.11 ? 2052 HOH B O   1 
HETATM 4377 O O   . HOH K 3 .  ? 17.511  1.875   25.287  1.00 17.30 ? 2053 HOH B O   1 
HETATM 4378 O O   . HOH K 3 .  ? 34.716  1.130   24.808  1.00 18.60 ? 2054 HOH B O   1 
HETATM 4379 O O   . HOH K 3 .  ? 37.423  3.378   22.646  1.00 16.81 ? 2055 HOH B O   1 
HETATM 4380 O O   . HOH K 3 .  ? 38.181  6.577   21.857  1.00 29.85 ? 2056 HOH B O   1 
HETATM 4381 O O   . HOH K 3 .  ? 43.260  4.171   28.023  1.00 35.16 ? 2057 HOH B O   1 
HETATM 4382 O O   . HOH K 3 .  ? 46.498  7.608   23.829  1.00 45.17 ? 2058 HOH B O   1 
HETATM 4383 O O   . HOH K 3 .  ? 17.969  18.625  28.316  1.00 38.27 ? 2059 HOH B O   1 
HETATM 4384 O O   . HOH K 3 .  ? 10.596  17.181  27.641  1.00 35.41 ? 2060 HOH B O   1 
HETATM 4385 O O   . HOH K 3 .  ? 48.897  9.530   21.634  1.00 31.31 ? 2061 HOH B O   1 
HETATM 4386 O O   . HOH K 3 .  ? 15.400  -0.023  1.506   1.00 59.46 ? 2062 HOH B O   1 
HETATM 4387 O O   . HOH K 3 .  ? 37.839  -3.976  13.738  1.00 32.76 ? 2063 HOH B O   1 
HETATM 4388 O O   . HOH K 3 .  ? 32.124  -5.932  12.438  1.00 19.54 ? 2064 HOH B O   1 
HETATM 4389 O O   . HOH K 3 .  ? 31.482  -0.988  13.220  1.00 18.49 ? 2065 HOH B O   1 
HETATM 4390 O O   . HOH L 3 .  ? 16.214  -28.781 -4.271  1.00 39.35 ? 2001 HOH C O   1 
HETATM 4391 O O   . HOH L 3 .  ? 27.908  -33.304 5.204   1.00 40.46 ? 2002 HOH C O   1 
HETATM 4392 O O   . HOH L 3 .  ? 32.440  -34.603 -3.773  1.00 47.70 ? 2003 HOH C O   1 
HETATM 4393 O O   . HOH L 3 .  ? 31.272  -33.524 -0.616  1.00 21.29 ? 2004 HOH C O   1 
HETATM 4394 O O   . HOH L 3 .  ? 38.662  -22.433 -9.150  1.00 34.00 ? 2005 HOH C O   1 
HETATM 4395 O O   . HOH L 3 .  ? 37.220  -26.365 -13.023 1.00 49.48 ? 2006 HOH C O   1 
HETATM 4396 O O   . HOH L 3 .  ? 24.734  -5.526  5.805   1.00 35.21 ? 2007 HOH C O   1 
HETATM 4397 O O   . HOH L 3 .  ? 38.848  -15.747 3.880   1.00 28.03 ? 2008 HOH C O   1 
HETATM 4398 O O   . HOH L 3 .  ? 37.212  -26.691 7.635   1.00 49.57 ? 2009 HOH C O   1 
HETATM 4399 O O   . HOH L 3 .  ? 18.973  -10.782 -3.301  1.00 15.78 ? 2010 HOH C O   1 
HETATM 4400 O O   . HOH L 3 .  ? 25.161  -7.583  1.041   1.00 15.96 ? 2011 HOH C O   1 
HETATM 4401 O O   . HOH L 3 .  ? 16.123  -12.672 6.016   1.00 6.50  ? 2012 HOH C O   1 
HETATM 4402 O O   . HOH L 3 .  ? 13.518  -8.521  -2.087  1.00 18.32 ? 2013 HOH C O   1 
HETATM 4403 O O   . HOH L 3 .  ? 17.211  -8.054  0.385   1.00 19.04 ? 2014 HOH C O   1 
HETATM 4404 O O   . HOH L 3 .  ? 13.849  -9.167  1.612   1.00 10.88 ? 2015 HOH C O   1 
HETATM 4405 O O   . HOH L 3 .  ? 12.032  -8.404  4.780   1.00 12.15 ? 2016 HOH C O   1 
HETATM 4406 O O   . HOH L 3 .  ? 12.709  -5.491  4.421   1.00 37.70 ? 2017 HOH C O   1 
HETATM 4407 O O   . HOH L 3 .  ? 16.128  -9.954  10.444  1.00 14.69 ? 2018 HOH C O   1 
HETATM 4408 O O   . HOH L 3 .  ? 19.384  -2.942  9.287   1.00 11.47 ? 2019 HOH C O   1 
HETATM 4409 O O   . HOH L 3 .  ? 16.077  -6.183  15.484  1.00 27.46 ? 2020 HOH C O   1 
HETATM 4410 O O   . HOH L 3 .  ? 19.941  -3.005  5.448   1.00 31.05 ? 2021 HOH C O   1 
HETATM 4411 O O   . HOH L 3 .  ? 23.632  -13.580 6.927   1.00 25.38 ? 2022 HOH C O   1 
HETATM 4412 O O   . HOH L 3 .  ? 14.882  -23.861 -6.118  1.00 48.57 ? 2023 HOH C O   1 
HETATM 4413 O O   . HOH L 3 .  ? 14.537  -21.750 -7.639  1.00 33.19 ? 2024 HOH C O   1 
HETATM 4414 O O   . HOH L 3 .  ? 16.470  -17.602 -9.155  1.00 40.11 ? 2025 HOH C O   1 
HETATM 4415 O O   . HOH L 3 .  ? 17.073  -26.926 -5.458  1.00 23.63 ? 2026 HOH C O   1 
HETATM 4416 O O   . HOH L 3 .  ? 29.203  -34.091 -8.154  1.00 32.42 ? 2027 HOH C O   1 
HETATM 4417 O O   . HOH L 3 .  ? 28.866  -33.886 -0.693  1.00 23.67 ? 2028 HOH C O   1 
HETATM 4418 O O   . HOH L 3 .  ? 24.624  -29.821 -5.101  1.00 16.24 ? 2029 HOH C O   1 
HETATM 4419 O O   . HOH L 3 .  ? 15.789  -34.746 -6.092  1.00 48.53 ? 2030 HOH C O   1 
HETATM 4420 O O   . HOH L 3 .  ? 14.783  -31.263 -5.519  1.00 57.42 ? 2031 HOH C O   1 
HETATM 4421 O O   . HOH L 3 .  ? 18.399  -33.453 2.824   1.00 41.55 ? 2032 HOH C O   1 
HETATM 4422 O O   . HOH L 3 .  ? 16.754  -29.194 -2.053  1.00 28.31 ? 2033 HOH C O   1 
HETATM 4423 O O   . HOH L 3 .  ? 15.643  -18.718 8.027   1.00 20.14 ? 2034 HOH C O   1 
HETATM 4424 O O   . HOH L 3 .  ? 22.451  -15.917 6.826   1.00 19.52 ? 2035 HOH C O   1 
HETATM 4425 O O   . HOH L 3 .  ? 33.907  -17.921 7.726   1.00 18.13 ? 2036 HOH C O   1 
HETATM 4426 O O   . HOH L 3 .  ? 26.214  -7.093  7.545   1.00 19.22 ? 2037 HOH C O   1 
HETATM 4427 O O   . HOH L 3 .  ? 28.694  -7.964  5.894   1.00 12.12 ? 2038 HOH C O   1 
HETATM 4428 O O   . HOH L 3 .  ? 34.334  -8.033  0.969   1.00 51.12 ? 2039 HOH C O   1 
HETATM 4429 O O   . HOH L 3 .  ? 27.296  -7.767  -0.550  1.00 20.00 ? 2040 HOH C O   1 
HETATM 4430 O O   . HOH L 3 .  ? 36.440  -10.879 7.707   1.00 50.40 ? 2041 HOH C O   1 
HETATM 4431 O O   . HOH L 3 .  ? 29.193  -8.107  1.860   1.00 13.45 ? 2042 HOH C O   1 
HETATM 4432 O O   . HOH L 3 .  ? 37.433  -18.304 4.419   1.00 18.41 ? 2043 HOH C O   1 
HETATM 4433 O O   . HOH L 3 .  ? 34.669  -12.590 -4.301  1.00 43.79 ? 2044 HOH C O   1 
HETATM 4434 O O   . HOH L 3 .  ? 38.665  -20.908 -4.242  1.00 32.06 ? 2045 HOH C O   1 
HETATM 4435 O O   . HOH L 3 .  ? 42.389  -22.177 2.194   1.00 33.61 ? 2046 HOH C O   1 
HETATM 4436 O O   . HOH L 3 .  ? 36.106  -24.975 5.890   1.00 30.83 ? 2047 HOH C O   1 
HETATM 4437 O O   . HOH L 3 .  ? 40.804  -26.498 1.013   1.00 54.13 ? 2048 HOH C O   1 
HETATM 4438 O O   . HOH L 3 .  ? 35.974  -22.407 -2.045  1.00 16.46 ? 2049 HOH C O   1 
HETATM 4439 O O   . HOH L 3 .  ? 42.355  -26.094 -0.919  1.00 33.66 ? 2050 HOH C O   1 
HETATM 4440 O O   . HOH L 3 .  ? 35.188  -26.457 10.319  1.00 34.77 ? 2051 HOH C O   1 
HETATM 4441 O O   . HOH L 3 .  ? 30.596  -24.236 9.560   1.00 12.93 ? 2052 HOH C O   1 
HETATM 4442 O O   . HOH L 3 .  ? 29.024  -25.056 12.807  1.00 37.74 ? 2053 HOH C O   1 
HETATM 4443 O O   . HOH L 3 .  ? 15.282  -26.599 11.409  1.00 54.14 ? 2054 HOH C O   1 
HETATM 4444 O O   . HOH L 3 .  ? 12.569  -28.778 5.190   1.00 44.05 ? 2055 HOH C O   1 
HETATM 4445 O O   . HOH L 3 .  ? 9.559   -21.068 7.974   1.00 34.55 ? 2056 HOH C O   1 
HETATM 4446 O O   . HOH L 3 .  ? -0.312  -23.542 0.744   1.00 23.41 ? 2057 HOH C O   1 
HETATM 4447 O O   . HOH L 3 .  ? 5.251   -22.003 -9.592  1.00 32.17 ? 2058 HOH C O   1 
HETATM 4448 O O   . HOH M 3 .  ? 34.045  45.213  33.711  1.00 43.20 ? 2001 HOH D O   1 
HETATM 4449 O O   . HOH M 3 .  ? 43.692  15.648  38.677  1.00 44.26 ? 2002 HOH D O   1 
HETATM 4450 O O   . HOH M 3 .  ? 53.471  18.113  33.617  1.00 35.11 ? 2003 HOH D O   1 
HETATM 4451 O O   . HOH M 3 .  ? 54.962  14.193  26.063  1.00 48.37 ? 2004 HOH D O   1 
HETATM 4452 O O   . HOH M 3 .  ? 52.482  15.080  25.303  1.00 31.76 ? 2005 HOH D O   1 
HETATM 4453 O O   . HOH M 3 .  ? 37.205  13.495  36.469  1.00 43.25 ? 2006 HOH D O   1 
HETATM 4454 O O   . HOH M 3 .  ? 57.870  26.695  20.882  1.00 45.39 ? 2007 HOH D O   1 
HETATM 4455 O O   . HOH M 3 .  ? 47.077  23.852  20.841  1.00 25.68 ? 2008 HOH D O   1 
HETATM 4456 O O   . HOH M 3 .  ? 43.809  43.499  34.928  1.00 25.06 ? 2009 HOH D O   1 
HETATM 4457 O O   . HOH M 3 .  ? 54.066  39.406  26.587  1.00 51.04 ? 2010 HOH D O   1 
HETATM 4458 O O   . HOH M 3 .  ? 52.672  41.024  30.125  1.00 52.31 ? 2011 HOH D O   1 
HETATM 4459 O O   . HOH M 3 .  ? 57.887  33.458  33.566  1.00 40.41 ? 2012 HOH D O   1 
HETATM 4460 O O   . HOH M 3 .  ? 38.391  41.541  29.293  1.00 24.40 ? 2013 HOH D O   1 
HETATM 4461 O O   . HOH M 3 .  ? 37.824  38.065  26.481  1.00 23.70 ? 2014 HOH D O   1 
HETATM 4462 O O   . HOH M 3 .  ? 43.764  41.247  30.629  1.00 26.20 ? 2015 HOH D O   1 
HETATM 4463 O O   . HOH M 3 .  ? 34.919  36.165  35.712  1.00 7.67  ? 2016 HOH D O   1 
HETATM 4464 O O   . HOH M 3 .  ? 32.181  40.238  27.792  1.00 26.16 ? 2017 HOH D O   1 
HETATM 4465 O O   . HOH M 3 .  ? 35.763  40.804  30.093  1.00 21.39 ? 2018 HOH D O   1 
HETATM 4466 O O   . HOH M 3 .  ? 30.702  40.672  34.383  1.00 20.78 ? 2019 HOH D O   1 
HETATM 4467 O O   . HOH M 3 .  ? 32.725  39.748  31.088  1.00 13.76 ? 2020 HOH D O   1 
HETATM 4468 O O   . HOH M 3 .  ? 31.069  43.380  34.495  1.00 21.44 ? 2021 HOH D O   1 
HETATM 4469 O O   . HOH M 3 .  ? 34.551  42.911  45.085  1.00 30.14 ? 2022 HOH D O   1 
HETATM 4470 O O   . HOH M 3 .  ? 38.260  45.840  38.932  1.00 11.58 ? 2023 HOH D O   1 
HETATM 4471 O O   . HOH M 3 .  ? 35.839  37.621  37.765  1.00 13.67 ? 2024 HOH D O   1 
HETATM 4472 O O   . HOH M 3 .  ? 1.792   -10.833 11.813  0.50 21.65 ? 2025 HOH D O   1 
HETATM 4473 O O   . HOH M 3 .  ? 42.078  40.346  44.323  1.00 49.86 ? 2026 HOH D O   1 
HETATM 4474 O O   . HOH M 3 .  ? 33.273  27.042  22.023  1.00 42.05 ? 2027 HOH D O   1 
HETATM 4475 O O   . HOH M 3 .  ? 36.739  21.625  20.924  1.00 43.87 ? 2028 HOH D O   1 
HETATM 4476 O O   . HOH M 3 .  ? 35.976  22.120  24.040  1.00 15.67 ? 2029 HOH D O   1 
HETATM 4477 O O   . HOH M 3 .  ? 43.437  19.321  24.517  1.00 10.67 ? 2030 HOH D O   1 
HETATM 4478 O O   . HOH M 3 .  ? 48.363  14.754  21.787  1.00 23.76 ? 2031 HOH D O   1 
HETATM 4479 O O   . HOH M 3 .  ? 34.719  17.816  23.340  1.00 50.00 ? 2032 HOH D O   1 
HETATM 4480 O O   . HOH M 3 .  ? 35.942  14.802  21.418  1.00 43.07 ? 2033 HOH D O   1 
HETATM 4481 O O   . HOH M 3 .  ? 35.009  13.751  23.635  1.00 37.67 ? 2034 HOH D O   1 
HETATM 4482 O O   . HOH M 3 .  ? 37.061  15.742  33.242  1.00 45.67 ? 2035 HOH D O   1 
HETATM 4483 O O   . HOH M 3 .  ? 35.326  19.447  27.576  1.00 24.88 ? 2036 HOH D O   1 
HETATM 4484 O O   . HOH M 3 .  ? 41.153  32.927  36.704  1.00 15.01 ? 2037 HOH D O   1 
HETATM 4485 O O   . HOH M 3 .  ? 52.464  31.296  37.645  1.00 23.21 ? 2038 HOH D O   1 
HETATM 4486 O O   . HOH M 3 .  ? 56.852  27.786  40.212  1.00 45.15 ? 2039 HOH D O   1 
HETATM 4487 O O   . HOH M 3 .  ? 54.868  22.863  39.097  1.00 37.06 ? 2040 HOH D O   1 
HETATM 4488 O O   . HOH M 3 .  ? 39.624  29.562  44.342  1.00 54.83 ? 2041 HOH D O   1 
HETATM 4489 O O   . HOH M 3 .  ? 44.890  41.871  37.249  1.00 26.62 ? 2042 HOH D O   1 
HETATM 4490 O O   . HOH M 3 .  ? 47.521  41.091  35.545  1.00 15.21 ? 2043 HOH D O   1 
HETATM 4491 O O   . HOH M 3 .  ? 45.905  41.178  29.134  1.00 16.02 ? 2044 HOH D O   1 
HETATM 4492 O O   . HOH M 3 .  ? 48.011  40.719  31.894  1.00 20.38 ? 2045 HOH D O   1 
HETATM 4493 O O   . HOH M 3 .  ? 55.165  38.326  37.469  1.00 44.71 ? 2046 HOH D O   1 
HETATM 4494 O O   . HOH M 3 .  ? 54.034  39.029  30.176  1.00 51.04 ? 2047 HOH D O   1 
HETATM 4495 O O   . HOH M 3 .  ? 56.135  30.671  34.316  1.00 17.69 ? 2048 HOH D O   1 
HETATM 4496 O O   . HOH M 3 .  ? 56.924  27.322  26.283  1.00 36.25 ? 2049 HOH D O   1 
HETATM 4497 O O   . HOH M 3 .  ? 53.841  36.608  25.335  1.00 53.61 ? 2050 HOH D O   1 
HETATM 4498 O O   . HOH M 3 .  ? 60.863  27.106  31.945  1.00 35.25 ? 2051 HOH D O   1 
HETATM 4499 O O   . HOH M 3 .  ? 54.667  26.351  27.454  1.00 23.59 ? 2052 HOH D O   1 
HETATM 4500 O O   . HOH M 3 .  ? 61.310  23.440  29.159  1.00 37.56 ? 2053 HOH D O   1 
HETATM 4501 O O   . HOH M 3 .  ? 49.246  24.586  39.406  1.00 20.91 ? 2054 HOH D O   1 
HETATM 4502 O O   . HOH M 3 .  ? 47.597  24.169  42.902  1.00 36.25 ? 2055 HOH D O   1 
HETATM 4503 O O   . HOH M 3 .  ? 36.950  21.472  40.395  1.00 30.50 ? 2056 HOH D O   1 
HETATM 4504 O O   . HOH M 3 .  ? 32.586  20.319  40.100  1.00 32.18 ? 2057 HOH D O   1 
HETATM 4505 O O   . HOH M 3 .  ? 29.006  27.857  37.297  1.00 36.81 ? 2058 HOH D O   1 
HETATM 4506 O O   . HOH M 3 .  ? 31.605  23.889  24.881  1.00 28.18 ? 2059 HOH D O   1 
HETATM 4507 O O   . HOH M 3 .  ? 24.431  27.170  19.937  1.00 35.40 ? 2060 HOH D O   1 
HETATM 4508 O O   . HOH N 3 .  ? 10.951  -3.089  -5.937  1.00 26.81 ? 2001 HOH E O   1 
HETATM 4509 O O   . HOH N 3 .  ? 6.912   -2.465  -13.513 1.00 44.56 ? 2002 HOH E O   1 
HETATM 4510 O O   . HOH N 3 .  ? -0.258  -6.920  -15.443 1.00 36.33 ? 2003 HOH E O   1 
HETATM 4511 O O   . HOH N 3 .  ? -2.348  -10.359 -15.707 1.00 25.96 ? 2004 HOH E O   1 
HETATM 4512 O O   . HOH N 3 .  ? -3.081  -11.827 -17.677 1.00 31.90 ? 2005 HOH E O   1 
HETATM 4513 O O   . HOH N 3 .  ? -5.887  -5.578  -15.247 1.00 53.75 ? 2006 HOH E O   1 
HETATM 4514 O O   . HOH N 3 .  ? -9.393  -15.604 -15.097 1.00 26.61 ? 2007 HOH E O   1 
HETATM 4515 O O   . HOH N 3 .  ? 15.732  -3.558  3.522   1.00 31.26 ? 2008 HOH E O   1 
HETATM 4516 O O   . HOH N 3 .  ? -6.301  -21.011 -12.304 1.00 40.53 ? 2009 HOH E O   1 
HETATM 4517 O O   . HOH N 3 .  ? 10.457  -10.173 5.530   1.00 12.26 ? 2010 HOH E O   1 
HETATM 4518 O O   . HOH N 3 .  ? 5.729   -8.259  11.896  1.00 29.79 ? 2011 HOH E O   1 
HETATM 4519 O O   . HOH N 3 .  ? -2.633  -19.421 9.489   1.00 40.88 ? 2012 HOH E O   1 
HETATM 4520 O O   . HOH N 3 .  ? 12.363  -25.233 -4.252  1.00 39.62 ? 2013 HOH E O   1 
HETATM 4521 O O   . HOH N 3 .  ? -12.978 -7.455  -5.599  1.00 60.89 ? 2014 HOH E O   1 
HETATM 4522 O O   . HOH N 3 .  ? -9.509  -13.409 2.046   1.00 26.71 ? 2015 HOH E O   1 
HETATM 4523 O O   . HOH N 3 .  ? 10.002  -22.618 3.536   1.00 40.78 ? 2016 HOH E O   1 
HETATM 4524 O O   . HOH N 3 .  ? 4.226   -19.598 8.419   1.00 31.58 ? 2017 HOH E O   1 
HETATM 4525 O O   . HOH N 3 .  ? 15.682  -21.449 6.818   1.00 23.48 ? 2018 HOH E O   1 
HETATM 4526 O O   . HOH N 3 .  ? 6.805   -21.457 13.294  1.00 35.61 ? 2019 HOH E O   1 
HETATM 4527 O O   . HOH N 3 .  ? 12.471  -20.114 7.421   1.00 23.19 ? 2020 HOH E O   1 
HETATM 4528 O O   . HOH N 3 .  ? 15.621  -16.935 12.191  1.00 31.69 ? 2021 HOH E O   1 
HETATM 4529 O O   . HOH N 3 .  ? 13.614  -12.915 5.769   1.00 18.22 ? 2022 HOH E O   1 
HETATM 4530 O O   . HOH N 3 .  ? 17.072  -11.408 8.140   1.00 13.59 ? 2023 HOH E O   1 
HETATM 4531 O O   . HOH N 3 .  ? 14.558  -16.026 16.494  1.00 48.38 ? 2024 HOH E O   1 
HETATM 4532 O O   . HOH N 3 .  ? 12.638  -10.376 9.353   1.00 14.80 ? 2025 HOH E O   1 
HETATM 4533 O O   . HOH N 3 .  ? 11.745  -11.732 7.338   1.00 18.21 ? 2026 HOH E O   1 
HETATM 4534 O O   . HOH N 3 .  ? 12.438  -17.860 -11.720 1.00 26.52 ? 2027 HOH E O   1 
HETATM 4535 O O   . HOH N 3 .  ? 4.847   -15.796 -14.152 1.00 17.60 ? 2028 HOH E O   1 
HETATM 4536 O O   . HOH N 3 .  ? 10.162  -21.032 -13.070 1.00 37.95 ? 2029 HOH E O   1 
HETATM 4537 O O   . HOH N 3 .  ? 6.267   -21.346 -18.028 1.00 30.24 ? 2030 HOH E O   1 
HETATM 4538 O O   . HOH N 3 .  ? 0.000   -15.582 -19.341 1.00 29.75 ? 2031 HOH E O   1 
HETATM 4539 O O   . HOH N 3 .  ? 0.156   -9.670  -16.254 1.00 39.60 ? 2032 HOH E O   1 
HETATM 4540 O O   . HOH N 3 .  ? 11.424  -11.582 -14.374 1.00 37.89 ? 2033 HOH E O   1 
HETATM 4541 O O   . HOH N 3 .  ? -0.498  -12.148 -24.844 1.00 35.62 ? 2034 HOH E O   1 
HETATM 4542 O O   . HOH N 3 .  ? 6.113   -6.246  -18.368 1.00 45.60 ? 2035 HOH E O   1 
HETATM 4543 O O   . HOH N 3 .  ? 12.838  -14.649 -12.299 0.50 18.85 ? 2036 HOH E O   1 
HETATM 4544 O O   . HOH N 3 .  ? 14.002  -5.049  2.333   1.00 46.18 ? 2037 HOH E O   1 
HETATM 4545 O O   . HOH N 3 .  ? 12.157  -3.182  1.847   1.00 29.63 ? 2038 HOH E O   1 
HETATM 4546 O O   . HOH N 3 .  ? 6.298   -11.103 3.064   1.00 7.24  ? 2039 HOH E O   1 
HETATM 4547 O O   . HOH N 3 .  ? -4.887  -9.254  1.866   1.00 19.99 ? 2040 HOH E O   1 
HETATM 4548 O O   . HOH N 3 .  ? -1.402  -4.943  -3.163  1.00 11.99 ? 2041 HOH E O   1 
HETATM 4549 O O   . HOH N 3 .  ? -7.589  -9.373  1.808   1.00 32.02 ? 2042 HOH E O   1 
HETATM 4550 O O   . HOH N 3 .  ? -2.603  -6.548  6.685   1.00 15.14 ? 2043 HOH E O   1 
HETATM 4551 O O   . HOH N 3 .  ? 7.780   -9.927  4.963   1.00 8.15  ? 2044 HOH E O   1 
HETATM 4552 O O   . HOH N 3 .  ? 1.946   -9.365  9.951   0.50 26.92 ? 2045 HOH E O   1 
HETATM 4553 O O   . HOH N 3 .  ? 7.100   -2.836  2.023   1.00 36.77 ? 2046 HOH E O   1 
HETATM 4554 O O   . HOH N 3 .  ? 3.138   -13.618 11.363  1.00 44.02 ? 2047 HOH E O   1 
HETATM 4555 O O   . HOH N 3 .  ? 6.091   -11.044 11.548  1.00 19.57 ? 2048 HOH E O   1 
HETATM 4556 O O   . HOH N 3 .  ? 1.653   -20.943 7.815   1.00 24.87 ? 2049 HOH E O   1 
HETATM 4557 O O   . HOH N 3 .  ? 0.755   -25.259 2.552   1.00 35.54 ? 2050 HOH E O   1 
HETATM 4558 O O   . HOH N 3 .  ? -5.412  -20.155 6.535   1.00 41.19 ? 2051 HOH E O   1 
HETATM 4559 O O   . HOH N 3 .  ? -6.976  -12.641 7.833   1.00 39.36 ? 2052 HOH E O   1 
HETATM 4560 O O   . HOH N 3 .  ? -0.147  -17.977 8.315   1.00 19.73 ? 2053 HOH E O   1 
HETATM 4561 O O   . HOH N 3 .  ? -3.568  -22.003 -5.562  1.00 45.30 ? 2054 HOH E O   1 
HETATM 4562 O O   . HOH N 3 .  ? -6.620  -23.735 -4.899  1.00 46.50 ? 2055 HOH E O   1 
HETATM 4563 O O   . HOH N 3 .  ? -9.160  -18.888 -5.597  1.00 18.38 ? 2056 HOH E O   1 
HETATM 4564 O O   . HOH N 3 .  ? -6.740  -7.517  -5.025  1.00 21.66 ? 2057 HOH E O   1 
HETATM 4565 O O   . HOH N 3 .  ? -11.985 -9.597  -4.522  1.00 43.94 ? 2058 HOH E O   1 
HETATM 4566 O O   . HOH N 3 .  ? -8.314  -11.893 0.125   1.00 17.14 ? 2059 HOH E O   1 
HETATM 4567 O O   . HOH N 3 .  ? -6.699  -16.062 -6.382  1.00 14.67 ? 2060 HOH E O   1 
HETATM 4568 O O   . HOH N 3 .  ? -9.994  -17.530 -12.040 1.00 49.49 ? 2061 HOH E O   1 
HETATM 4569 O O   . HOH N 3 .  ? -10.381 -9.431  -6.764  1.00 28.97 ? 2062 HOH E O   1 
HETATM 4570 O O   . HOH N 3 .  ? 15.630  -4.613  -2.539  1.00 28.52 ? 2063 HOH E O   1 
HETATM 4571 O O   . HOH N 3 .  ? 18.688  -8.168  -2.737  1.00 30.84 ? 2064 HOH E O   1 
HETATM 4572 O O   . HOH N 3 .  ? 19.524  -7.286  -0.224  1.00 17.98 ? 2065 HOH E O   1 
HETATM 4573 O O   . HOH N 3 .  ? 20.684  -2.350  -6.235  1.00 40.94 ? 2066 HOH E O   1 
HETATM 4574 O O   . HOH N 3 .  ? 27.058  -8.548  -4.785  1.00 39.04 ? 2067 HOH E O   1 
HETATM 4575 O O   . HOH N 3 .  ? 24.990  -2.792  -9.496  1.00 47.64 ? 2068 HOH E O   1 
HETATM 4576 O O   . HOH N 3 .  ? 30.898  -18.285 -8.762  1.00 45.64 ? 2069 HOH E O   1 
HETATM 4577 O O   . HOH N 3 .  ? 23.680  -22.824 -8.967  1.00 30.73 ? 2070 HOH E O   1 
HETATM 4578 O O   . HOH N 3 .  ? 12.766  -27.790 -3.539  1.00 51.25 ? 2071 HOH E O   1 
HETATM 4579 O O   . HOH N 3 .  ? 32.970  -22.111 -6.087  1.00 17.76 ? 2072 HOH E O   1 
HETATM 4580 O O   . HOH O 3 .  ? 29.407  45.572  23.673  1.00 45.68 ? 2001 HOH F O   1 
HETATM 4581 O O   . HOH O 3 .  ? 18.632  45.273  16.273  1.00 31.65 ? 2002 HOH F O   1 
HETATM 4582 O O   . HOH O 3 .  ? 12.474  42.190  16.442  1.00 49.37 ? 2003 HOH F O   1 
HETATM 4583 O O   . HOH O 3 .  ? 16.393  38.577  14.041  1.00 28.89 ? 2004 HOH F O   1 
HETATM 4584 O O   . HOH O 3 .  ? 12.371  40.974  9.849   1.00 56.48 ? 2005 HOH F O   1 
HETATM 4585 O O   . HOH O 3 .  ? 13.360  30.180  23.887  1.00 28.75 ? 2006 HOH F O   1 
HETATM 4586 O O   . HOH O 3 .  ? 29.292  38.783  35.295  1.00 13.43 ? 2007 HOH F O   1 
HETATM 4587 O O   . HOH O 3 .  ? 9.254   35.609  31.941  1.00 25.98 ? 2008 HOH F O   1 
HETATM 4588 O O   . HOH O 3 .  ? 29.060  26.282  33.328  1.00 32.80 ? 2009 HOH F O   1 
HETATM 4589 O O   . HOH O 3 .  ? 23.010  29.127  38.305  1.00 23.93 ? 2010 HOH F O   1 
HETATM 4590 O O   . HOH O 3 .  ? 31.921  35.683  35.423  1.00 13.21 ? 2011 HOH F O   1 
HETATM 4591 O O   . HOH O 3 .  ? 34.487  27.316  36.457  1.00 23.19 ? 2012 HOH F O   1 
HETATM 4592 O O   . HOH O 3 .  ? 31.428  28.725  37.318  1.00 23.65 ? 2013 HOH F O   1 
HETATM 4593 O O   . HOH O 3 .  ? 25.426  27.678  43.312  1.00 48.22 ? 2014 HOH F O   1 
HETATM 4594 O O   . HOH O 3 .  ? 34.431  30.231  38.006  1.00 25.03 ? 2015 HOH F O   1 
HETATM 4595 O O   . HOH O 3 .  ? 34.383  31.950  42.985  1.00 53.31 ? 2016 HOH F O   1 
HETATM 4596 O O   . HOH O 3 .  ? 34.589  38.677  40.117  1.00 18.02 ? 2017 HOH F O   1 
HETATM 4597 O O   . HOH O 3 .  ? 31.617  38.580  39.054  1.00 17.88 ? 2018 HOH F O   1 
HETATM 4598 O O   . HOH O 3 .  ? 28.485  32.108  44.211  1.00 21.32 ? 2019 HOH F O   1 
HETATM 4599 O O   . HOH O 3 .  ? 24.624  40.898  41.915  1.00 42.06 ? 2020 HOH F O   1 
HETATM 4600 O O   . HOH O 3 .  ? 30.692  37.165  36.900  1.00 21.33 ? 2021 HOH F O   1 
HETATM 4601 O O   . HOH O 3 .  ? 31.193  30.919  17.960  1.00 29.60 ? 2022 HOH F O   1 
HETATM 4602 O O   . HOH O 3 .  ? 25.105  27.629  11.745  1.00 26.92 ? 2023 HOH F O   1 
HETATM 4603 O O   . HOH O 3 .  ? 18.856  33.192  10.462  1.00 22.66 ? 2024 HOH F O   1 
HETATM 4604 O O   . HOH O 3 .  ? 32.523  37.349  15.095  1.00 47.65 ? 2025 HOH F O   1 
HETATM 4605 O O   . HOH O 3 .  ? 30.881  32.246  15.264  1.00 46.49 ? 2026 HOH F O   1 
HETATM 4606 O O   . HOH O 3 .  ? 31.589  34.508  17.280  1.00 36.36 ? 2027 HOH F O   1 
HETATM 4607 O O   . HOH O 3 .  ? 14.860  -14.294 -12.798 0.50 10.70 ? 2028 HOH F O   1 
HETATM 4608 O O   . HOH O 3 .  ? 23.718  33.280  15.682  1.00 21.69 ? 2029 HOH F O   1 
HETATM 4609 O O   . HOH O 3 .  ? 19.577  38.584  5.386   1.00 43.22 ? 2030 HOH F O   1 
HETATM 4610 O O   . HOH O 3 .  ? 25.422  42.100  11.091  1.00 44.60 ? 2031 HOH F O   1 
HETATM 4611 O O   . HOH O 3 .  ? 18.641  36.569  5.383   1.00 28.55 ? 2032 HOH F O   1 
HETATM 4612 O O   . HOH O 3 .  ? 29.955  37.950  15.557  1.00 44.58 ? 2033 HOH F O   1 
HETATM 4613 O O   . HOH O 3 .  ? 34.817  43.835  17.968  1.00 42.18 ? 2034 HOH F O   1 
HETATM 4614 O O   . HOH O 3 .  ? 34.660  36.186  19.550  1.00 33.21 ? 2035 HOH F O   1 
HETATM 4615 O O   . HOH O 3 .  ? 25.141  37.725  32.762  1.00 13.66 ? 2036 HOH F O   1 
HETATM 4616 O O   . HOH O 3 .  ? 14.148  39.676  31.587  1.00 22.82 ? 2037 HOH F O   1 
HETATM 4617 O O   . HOH O 3 .  ? 16.124  42.236  36.241  1.00 22.63 ? 2038 HOH F O   1 
HETATM 4618 O O   . HOH O 3 .  ? 22.122  43.011  38.289  1.00 23.70 ? 2039 HOH F O   1 
HETATM 4619 O O   . HOH O 3 .  ? 27.391  46.081  34.373  1.00 47.42 ? 2040 HOH F O   1 
HETATM 4620 O O   . HOH O 3 .  ? 26.702  39.165  34.750  1.00 16.25 ? 2041 HOH F O   1 
HETATM 4621 O O   . HOH O 3 .  ? 24.762  37.912  41.273  1.00 19.69 ? 2042 HOH F O   1 
HETATM 4622 O O   . HOH O 3 .  ? 24.650  36.172  35.231  1.00 29.76 ? 2043 HOH F O   1 
HETATM 4623 O O   . HOH O 3 .  ? 19.061  23.574  31.773  1.00 41.33 ? 2044 HOH F O   1 
HETATM 4624 O O   . HOH O 3 .  ? 20.595  28.088  37.620  1.00 28.45 ? 2045 HOH F O   1 
HETATM 4625 O O   . HOH O 3 .  ? 15.398  27.441  32.558  1.00 34.57 ? 2046 HOH F O   1 
HETATM 4626 O O   . HOH O 3 .  ? 14.620  36.993  38.455  1.00 34.04 ? 2047 HOH F O   1 
HETATM 4627 O O   . HOH O 3 .  ? 18.703  30.874  37.969  1.00 31.15 ? 2048 HOH F O   1 
HETATM 4628 O O   . HOH O 3 .  ? 10.448  36.848  29.947  1.00 20.51 ? 2049 HOH F O   1 
HETATM 4629 O O   . HOH O 3 .  ? 9.594   30.144  24.120  1.00 37.60 ? 2050 HOH F O   1 
HETATM 4630 O O   . HOH O 3 .  ? 14.911  26.804  24.593  1.00 40.35 ? 2051 HOH F O   1 
HETATM 4631 O O   . HOH O 3 .  ? 12.175  32.555  23.493  1.00 17.02 ? 2052 HOH F O   1 
HETATM 4632 O O   . HOH O 3 .  ? 8.542   39.630  22.989  1.00 32.13 ? 2053 HOH F O   1 
HETATM 4633 O O   . HOH O 3 .  ? 17.373  43.922  26.324  1.00 7.57  ? 2054 HOH F O   1 
HETATM 4634 O O   . HOH O 3 .  ? 37.273  40.625  26.983  1.00 31.65 ? 2055 HOH F O   1 
HETATM 4635 O O   . HOH O 3 .  ? 44.993  43.437  25.301  1.00 48.98 ? 2056 HOH F O   1 
HETATM 4636 O O   . HOH O 3 .  ? 42.856  46.449  31.683  1.00 29.04 ? 2057 HOH F O   1 
HETATM 4637 O O   . HOH O 3 .  ? 10.512  28.229  24.730  1.00 42.43 ? 2058 HOH F O   1 
HETATM 4638 O O   . HOH O 3 .  ? 49.523  27.660  19.676  1.00 41.61 ? 2059 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  244 ?   ?   ?   A . n 
A 1 2  MET 2  245 245 MET MET A . n 
A 1 3  LYS 3  246 246 LYS LYS A . n 
A 1 4  PRO 4  247 247 PRO PRO A . n 
A 1 5  ARG 5  248 248 ARG ARG A . n 
A 1 6  CYS 6  249 249 CYS CYS A . n 
A 1 7  LEU 7  250 250 LEU LEU A . n 
A 1 8  HIS 8  251 251 HIS HIS A . n 
A 1 9  LEU 9  252 252 LEU LEU A . n 
A 1 10 GLU 10 253 253 GLU GLU A . n 
A 1 11 LYS 11 254 254 LYS LYS A . n 
A 1 12 GLY 12 255 255 GLY GLY A . n 
A 1 13 PRO 13 256 256 PRO PRO A . n 
A 1 14 GLN 14 257 257 GLN GLN A . n 
A 1 15 GLY 15 258 258 GLY GLY A . n 
A 1 16 PHE 16 259 259 PHE PHE A . n 
A 1 17 GLY 17 260 260 GLY GLY A . n 
A 1 18 PHE 18 261 261 PHE PHE A . n 
A 1 19 LEU 19 262 262 LEU LEU A . n 
A 1 20 LEU 20 263 263 LEU LEU A . n 
A 1 21 ARG 21 264 264 ARG ARG A . n 
A 1 22 GLU 22 265 265 GLU GLU A . n 
A 1 23 GLU 23 266 266 GLU GLU A . n 
A 1 24 LYS 24 267 267 LYS LYS A . n 
A 1 25 GLY 25 268 268 GLY GLY A . n 
A 1 26 LEU 26 269 269 LEU LEU A . n 
A 1 27 ASP 27 270 270 ASP ASP A . n 
A 1 28 GLY 28 271 271 GLY GLY A . n 
A 1 29 ARG 29 272 272 ARG ARG A . n 
A 1 30 PRO 30 273 273 PRO PRO A . n 
A 1 31 GLY 31 274 274 GLY GLY A . n 
A 1 32 GLN 32 275 275 GLN GLN A . n 
A 1 33 PHE 33 276 276 PHE PHE A . n 
A 1 34 LEU 34 277 277 LEU LEU A . n 
A 1 35 TRP 35 278 278 TRP TRP A . n 
A 1 36 GLU 36 279 279 GLU GLU A . n 
A 1 37 VAL 37 280 280 VAL VAL A . n 
A 1 38 ASP 38 281 281 ASP ASP A . n 
A 1 39 PRO 39 282 282 PRO PRO A . n 
A 1 40 GLY 40 283 283 GLY GLY A . n 
A 1 41 LEU 41 284 284 LEU LEU A . n 
A 1 42 PRO 42 285 285 PRO PRO A . n 
A 1 43 ALA 43 286 286 ALA ALA A . n 
A 1 44 LYS 44 287 287 LYS LYS A . n 
A 1 45 LYS 45 288 288 LYS LYS A . n 
A 1 46 ALA 46 289 289 ALA ALA A . n 
A 1 47 GLY 47 290 290 GLY GLY A . n 
A 1 48 MET 48 291 291 MET MET A . n 
A 1 49 GLN 49 292 292 GLN GLN A . n 
A 1 50 ALA 50 293 293 ALA ALA A . n 
A 1 51 GLY 51 294 294 GLY GLY A . n 
A 1 52 ASP 52 295 295 ASP ASP A . n 
A 1 53 ARG 53 296 296 ARG ARG A . n 
A 1 54 LEU 54 297 297 LEU LEU A . n 
A 1 55 VAL 55 298 298 VAL VAL A . n 
A 1 56 ALA 56 299 299 ALA ALA A . n 
A 1 57 VAL 57 300 300 VAL VAL A . n 
A 1 58 ALA 58 301 301 ALA ALA A . n 
A 1 59 GLY 59 302 302 GLY GLY A . n 
A 1 60 GLU 60 303 303 GLU GLU A . n 
A 1 61 SER 61 304 304 SER SER A . n 
A 1 62 VAL 62 305 305 VAL VAL A . n 
A 1 63 GLU 63 306 306 GLU GLU A . n 
A 1 64 GLY 64 307 307 GLY GLY A . n 
A 1 65 LEU 65 308 308 LEU LEU A . n 
A 1 66 GLY 66 309 309 GLY GLY A . n 
A 1 67 HIS 67 310 310 HIS HIS A . n 
A 1 68 GLU 68 311 311 GLU GLU A . n 
A 1 69 GLU 69 312 312 GLU GLU A . n 
A 1 70 THR 70 313 313 THR THR A . n 
A 1 71 VAL 71 314 314 VAL VAL A . n 
A 1 72 SER 72 315 315 SER SER A . n 
A 1 73 ARG 73 316 316 ARG ARG A . n 
A 1 74 ILE 74 317 317 ILE ILE A . n 
A 1 75 GLN 75 318 318 GLN GLN A . n 
A 1 76 GLY 76 319 319 GLY GLY A . n 
A 1 77 GLN 77 320 320 GLN GLN A . n 
A 1 78 GLY 78 321 321 GLY GLY A . n 
A 1 79 SER 79 322 322 SER SER A . n 
A 1 80 CYS 80 323 323 CYS CYS A . n 
A 1 81 VAL 81 324 324 VAL VAL A . n 
A 1 82 SER 82 325 325 SER SER A . n 
A 1 83 LEU 83 326 326 LEU LEU A . n 
A 1 84 THR 84 327 327 THR THR A . n 
A 1 85 VAL 85 328 328 VAL VAL A . n 
A 1 86 VAL 86 329 329 VAL VAL A . n 
A 1 87 ASP 87 330 330 ASP ASP A . n 
A 1 88 PRO 88 331 331 PRO PRO A . n 
A 1 89 GLU 89 332 332 GLU GLU A . n 
A 1 90 ALA 90 333 333 ALA ALA A . n 
A 1 91 ASP 91 334 334 ASP ASP A . n 
A 1 92 ARG 92 335 335 ARG ARG A . n 
A 1 93 GLU 93 336 336 GLU GLU A . n 
A 1 94 THR 94 337 337 THR THR A . n 
A 1 95 SER 95 338 338 SER SER A . n 
A 1 96 VAL 96 339 339 VAL VAL A . n 
B 1 1  SER 1  244 ?   ?   ?   B . n 
B 1 2  MET 2  245 245 MET MET B . n 
B 1 3  LYS 3  246 246 LYS LYS B . n 
B 1 4  PRO 4  247 247 PRO PRO B . n 
B 1 5  ARG 5  248 248 ARG ARG B . n 
B 1 6  CYS 6  249 249 CYS CYS B . n 
B 1 7  LEU 7  250 250 LEU LEU B . n 
B 1 8  HIS 8  251 251 HIS HIS B . n 
B 1 9  LEU 9  252 252 LEU LEU B . n 
B 1 10 GLU 10 253 253 GLU GLU B . n 
B 1 11 LYS 11 254 254 LYS LYS B . n 
B 1 12 GLY 12 255 255 GLY GLY B . n 
B 1 13 PRO 13 256 256 PRO PRO B . n 
B 1 14 GLN 14 257 257 GLN GLN B . n 
B 1 15 GLY 15 258 258 GLY GLY B . n 
B 1 16 PHE 16 259 259 PHE PHE B . n 
B 1 17 GLY 17 260 260 GLY GLY B . n 
B 1 18 PHE 18 261 261 PHE PHE B . n 
B 1 19 LEU 19 262 262 LEU LEU B . n 
B 1 20 LEU 20 263 263 LEU LEU B . n 
B 1 21 ARG 21 264 264 ARG ARG B . n 
B 1 22 GLU 22 265 265 GLU GLU B . n 
B 1 23 GLU 23 266 266 GLU GLU B . n 
B 1 24 LYS 24 267 267 LYS LYS B . n 
B 1 25 GLY 25 268 268 GLY GLY B . n 
B 1 26 LEU 26 269 269 LEU LEU B . n 
B 1 27 ASP 27 270 270 ASP ASP B . n 
B 1 28 GLY 28 271 271 GLY GLY B . n 
B 1 29 ARG 29 272 272 ARG ARG B . n 
B 1 30 PRO 30 273 273 PRO PRO B . n 
B 1 31 GLY 31 274 274 GLY GLY B . n 
B 1 32 GLN 32 275 275 GLN GLN B . n 
B 1 33 PHE 33 276 276 PHE PHE B . n 
B 1 34 LEU 34 277 277 LEU LEU B . n 
B 1 35 TRP 35 278 278 TRP TRP B . n 
B 1 36 GLU 36 279 279 GLU GLU B . n 
B 1 37 VAL 37 280 280 VAL VAL B . n 
B 1 38 ASP 38 281 281 ASP ASP B . n 
B 1 39 PRO 39 282 282 PRO PRO B . n 
B 1 40 GLY 40 283 283 GLY GLY B . n 
B 1 41 LEU 41 284 284 LEU LEU B . n 
B 1 42 PRO 42 285 285 PRO PRO B . n 
B 1 43 ALA 43 286 286 ALA ALA B . n 
B 1 44 LYS 44 287 287 LYS LYS B . n 
B 1 45 LYS 45 288 288 LYS LYS B . n 
B 1 46 ALA 46 289 289 ALA ALA B . n 
B 1 47 GLY 47 290 290 GLY GLY B . n 
B 1 48 MET 48 291 291 MET MET B . n 
B 1 49 GLN 49 292 292 GLN GLN B . n 
B 1 50 ALA 50 293 293 ALA ALA B . n 
B 1 51 GLY 51 294 294 GLY GLY B . n 
B 1 52 ASP 52 295 295 ASP ASP B . n 
B 1 53 ARG 53 296 296 ARG ARG B . n 
B 1 54 LEU 54 297 297 LEU LEU B . n 
B 1 55 VAL 55 298 298 VAL VAL B . n 
B 1 56 ALA 56 299 299 ALA ALA B . n 
B 1 57 VAL 57 300 300 VAL VAL B . n 
B 1 58 ALA 58 301 301 ALA ALA B . n 
B 1 59 GLY 59 302 302 GLY GLY B . n 
B 1 60 GLU 60 303 303 GLU GLU B . n 
B 1 61 SER 61 304 304 SER SER B . n 
B 1 62 VAL 62 305 305 VAL VAL B . n 
B 1 63 GLU 63 306 306 GLU GLU B . n 
B 1 64 GLY 64 307 307 GLY GLY B . n 
B 1 65 LEU 65 308 308 LEU LEU B . n 
B 1 66 GLY 66 309 309 GLY GLY B . n 
B 1 67 HIS 67 310 310 HIS HIS B . n 
B 1 68 GLU 68 311 311 GLU GLU B . n 
B 1 69 GLU 69 312 312 GLU GLU B . n 
B 1 70 THR 70 313 313 THR THR B . n 
B 1 71 VAL 71 314 314 VAL VAL B . n 
B 1 72 SER 72 315 315 SER SER B . n 
B 1 73 ARG 73 316 316 ARG ARG B . n 
B 1 74 ILE 74 317 317 ILE ILE B . n 
B 1 75 GLN 75 318 318 GLN GLN B . n 
B 1 76 GLY 76 319 319 GLY GLY B . n 
B 1 77 GLN 77 320 320 GLN GLN B . n 
B 1 78 GLY 78 321 321 GLY GLY B . n 
B 1 79 SER 79 322 322 SER SER B . n 
B 1 80 CYS 80 323 323 CYS CYS B . n 
B 1 81 VAL 81 324 324 VAL VAL B . n 
B 1 82 SER 82 325 325 SER SER B . n 
B 1 83 LEU 83 326 326 LEU LEU B . n 
B 1 84 THR 84 327 327 THR THR B . n 
B 1 85 VAL 85 328 328 VAL VAL B . n 
B 1 86 VAL 86 329 329 VAL VAL B . n 
B 1 87 ASP 87 330 330 ASP ASP B . n 
B 1 88 PRO 88 331 331 PRO PRO B . n 
B 1 89 GLU 89 332 332 GLU GLU B . n 
B 1 90 ALA 90 333 333 ALA ALA B . n 
B 1 91 ASP 91 334 334 ASP ASP B . n 
B 1 92 ARG 92 335 335 ARG ARG B . n 
B 1 93 GLU 93 336 336 GLU GLU B . n 
B 1 94 THR 94 337 337 THR THR B . n 
B 1 95 SER 95 338 338 SER SER B . n 
B 1 96 VAL 96 339 339 VAL VAL B . n 
C 1 1  SER 1  244 ?   ?   ?   C . n 
C 1 2  MET 2  245 ?   ?   ?   C . n 
C 1 3  LYS 3  246 ?   ?   ?   C . n 
C 1 4  PRO 4  247 247 PRO PRO C . n 
C 1 5  ARG 5  248 248 ARG ARG C . n 
C 1 6  CYS 6  249 249 CYS CYS C . n 
C 1 7  LEU 7  250 250 LEU LEU C . n 
C 1 8  HIS 8  251 251 HIS HIS C . n 
C 1 9  LEU 9  252 252 LEU LEU C . n 
C 1 10 GLU 10 253 253 GLU GLU C . n 
C 1 11 LYS 11 254 254 LYS LYS C . n 
C 1 12 GLY 12 255 255 GLY GLY C . n 
C 1 13 PRO 13 256 256 PRO PRO C . n 
C 1 14 GLN 14 257 257 GLN GLN C . n 
C 1 15 GLY 15 258 258 GLY GLY C . n 
C 1 16 PHE 16 259 259 PHE PHE C . n 
C 1 17 GLY 17 260 260 GLY GLY C . n 
C 1 18 PHE 18 261 261 PHE PHE C . n 
C 1 19 LEU 19 262 262 LEU LEU C . n 
C 1 20 LEU 20 263 263 LEU LEU C . n 
C 1 21 ARG 21 264 264 ARG ARG C . n 
C 1 22 GLU 22 265 265 GLU GLU C . n 
C 1 23 GLU 23 266 266 GLU GLU C . n 
C 1 24 LYS 24 267 267 LYS LYS C . n 
C 1 25 GLY 25 268 268 GLY GLY C . n 
C 1 26 LEU 26 269 269 LEU LEU C . n 
C 1 27 ASP 27 270 270 ASP ASP C . n 
C 1 28 GLY 28 271 271 GLY GLY C . n 
C 1 29 ARG 29 272 272 ARG ARG C . n 
C 1 30 PRO 30 273 273 PRO PRO C . n 
C 1 31 GLY 31 274 274 GLY GLY C . n 
C 1 32 GLN 32 275 275 GLN GLN C . n 
C 1 33 PHE 33 276 276 PHE PHE C . n 
C 1 34 LEU 34 277 277 LEU LEU C . n 
C 1 35 TRP 35 278 278 TRP TRP C . n 
C 1 36 GLU 36 279 279 GLU GLU C . n 
C 1 37 VAL 37 280 280 VAL VAL C . n 
C 1 38 ASP 38 281 281 ASP ASP C . n 
C 1 39 PRO 39 282 282 PRO PRO C . n 
C 1 40 GLY 40 283 283 GLY GLY C . n 
C 1 41 LEU 41 284 284 LEU LEU C . n 
C 1 42 PRO 42 285 285 PRO PRO C . n 
C 1 43 ALA 43 286 286 ALA ALA C . n 
C 1 44 LYS 44 287 287 LYS LYS C . n 
C 1 45 LYS 45 288 288 LYS LYS C . n 
C 1 46 ALA 46 289 289 ALA ALA C . n 
C 1 47 GLY 47 290 290 GLY GLY C . n 
C 1 48 MET 48 291 291 MET MET C . n 
C 1 49 GLN 49 292 292 GLN GLN C . n 
C 1 50 ALA 50 293 293 ALA ALA C . n 
C 1 51 GLY 51 294 294 GLY GLY C . n 
C 1 52 ASP 52 295 295 ASP ASP C . n 
C 1 53 ARG 53 296 296 ARG ARG C . n 
C 1 54 LEU 54 297 297 LEU LEU C . n 
C 1 55 VAL 55 298 298 VAL VAL C . n 
C 1 56 ALA 56 299 299 ALA ALA C . n 
C 1 57 VAL 57 300 300 VAL VAL C . n 
C 1 58 ALA 58 301 301 ALA ALA C . n 
C 1 59 GLY 59 302 302 GLY GLY C . n 
C 1 60 GLU 60 303 303 GLU GLU C . n 
C 1 61 SER 61 304 304 SER SER C . n 
C 1 62 VAL 62 305 305 VAL VAL C . n 
C 1 63 GLU 63 306 306 GLU GLU C . n 
C 1 64 GLY 64 307 307 GLY GLY C . n 
C 1 65 LEU 65 308 308 LEU LEU C . n 
C 1 66 GLY 66 309 309 GLY GLY C . n 
C 1 67 HIS 67 310 310 HIS HIS C . n 
C 1 68 GLU 68 311 311 GLU GLU C . n 
C 1 69 GLU 69 312 312 GLU GLU C . n 
C 1 70 THR 70 313 313 THR THR C . n 
C 1 71 VAL 71 314 314 VAL VAL C . n 
C 1 72 SER 72 315 315 SER SER C . n 
C 1 73 ARG 73 316 316 ARG ARG C . n 
C 1 74 ILE 74 317 317 ILE ILE C . n 
C 1 75 GLN 75 318 318 GLN GLN C . n 
C 1 76 GLY 76 319 319 GLY GLY C . n 
C 1 77 GLN 77 320 320 GLN GLN C . n 
C 1 78 GLY 78 321 321 GLY GLY C . n 
C 1 79 SER 79 322 322 SER SER C . n 
C 1 80 CYS 80 323 323 CYS CYS C . n 
C 1 81 VAL 81 324 324 VAL VAL C . n 
C 1 82 SER 82 325 325 SER SER C . n 
C 1 83 LEU 83 326 326 LEU LEU C . n 
C 1 84 THR 84 327 327 THR THR C . n 
C 1 85 VAL 85 328 328 VAL VAL C . n 
C 1 86 VAL 86 329 329 VAL VAL C . n 
C 1 87 ASP 87 330 330 ASP ASP C . n 
C 1 88 PRO 88 331 331 PRO PRO C . n 
C 1 89 GLU 89 332 332 GLU GLU C . n 
C 1 90 ALA 90 333 333 ALA ALA C . n 
C 1 91 ASP 91 334 334 ASP ASP C . n 
C 1 92 ARG 92 335 335 ARG ARG C . n 
C 1 93 GLU 93 336 336 GLU GLU C . n 
C 1 94 THR 94 337 337 THR THR C . n 
C 1 95 SER 95 338 338 SER SER C . n 
C 1 96 VAL 96 339 339 VAL VAL C . n 
D 1 1  SER 1  244 ?   ?   ?   D . n 
D 1 2  MET 2  245 ?   ?   ?   D . n 
D 1 3  LYS 3  246 ?   ?   ?   D . n 
D 1 4  PRO 4  247 247 PRO PRO D . n 
D 1 5  ARG 5  248 248 ARG ARG D . n 
D 1 6  CYS 6  249 249 CYS CYS D . n 
D 1 7  LEU 7  250 250 LEU LEU D . n 
D 1 8  HIS 8  251 251 HIS HIS D . n 
D 1 9  LEU 9  252 252 LEU LEU D . n 
D 1 10 GLU 10 253 253 GLU GLU D . n 
D 1 11 LYS 11 254 254 LYS LYS D . n 
D 1 12 GLY 12 255 255 GLY GLY D . n 
D 1 13 PRO 13 256 256 PRO PRO D . n 
D 1 14 GLN 14 257 257 GLN GLN D . n 
D 1 15 GLY 15 258 258 GLY GLY D . n 
D 1 16 PHE 16 259 259 PHE PHE D . n 
D 1 17 GLY 17 260 260 GLY GLY D . n 
D 1 18 PHE 18 261 261 PHE PHE D . n 
D 1 19 LEU 19 262 262 LEU LEU D . n 
D 1 20 LEU 20 263 263 LEU LEU D . n 
D 1 21 ARG 21 264 264 ARG ARG D . n 
D 1 22 GLU 22 265 265 GLU GLU D . n 
D 1 23 GLU 23 266 266 GLU GLU D . n 
D 1 24 LYS 24 267 267 LYS LYS D . n 
D 1 25 GLY 25 268 268 GLY GLY D . n 
D 1 26 LEU 26 269 269 LEU LEU D . n 
D 1 27 ASP 27 270 270 ASP ASP D . n 
D 1 28 GLY 28 271 271 GLY GLY D . n 
D 1 29 ARG 29 272 272 ARG ARG D . n 
D 1 30 PRO 30 273 273 PRO PRO D . n 
D 1 31 GLY 31 274 274 GLY GLY D . n 
D 1 32 GLN 32 275 275 GLN GLN D . n 
D 1 33 PHE 33 276 276 PHE PHE D . n 
D 1 34 LEU 34 277 277 LEU LEU D . n 
D 1 35 TRP 35 278 278 TRP TRP D . n 
D 1 36 GLU 36 279 279 GLU GLU D . n 
D 1 37 VAL 37 280 280 VAL VAL D . n 
D 1 38 ASP 38 281 281 ASP ASP D . n 
D 1 39 PRO 39 282 282 PRO PRO D . n 
D 1 40 GLY 40 283 283 GLY GLY D . n 
D 1 41 LEU 41 284 284 LEU LEU D . n 
D 1 42 PRO 42 285 285 PRO PRO D . n 
D 1 43 ALA 43 286 286 ALA ALA D . n 
D 1 44 LYS 44 287 287 LYS LYS D . n 
D 1 45 LYS 45 288 288 LYS LYS D . n 
D 1 46 ALA 46 289 289 ALA ALA D . n 
D 1 47 GLY 47 290 290 GLY GLY D . n 
D 1 48 MET 48 291 291 MET MET D . n 
D 1 49 GLN 49 292 292 GLN GLN D . n 
D 1 50 ALA 50 293 293 ALA ALA D . n 
D 1 51 GLY 51 294 294 GLY GLY D . n 
D 1 52 ASP 52 295 295 ASP ASP D . n 
D 1 53 ARG 53 296 296 ARG ARG D . n 
D 1 54 LEU 54 297 297 LEU LEU D . n 
D 1 55 VAL 55 298 298 VAL VAL D . n 
D 1 56 ALA 56 299 299 ALA ALA D . n 
D 1 57 VAL 57 300 300 VAL VAL D . n 
D 1 58 ALA 58 301 301 ALA ALA D . n 
D 1 59 GLY 59 302 302 GLY GLY D . n 
D 1 60 GLU 60 303 303 GLU GLU D . n 
D 1 61 SER 61 304 304 SER SER D . n 
D 1 62 VAL 62 305 305 VAL VAL D . n 
D 1 63 GLU 63 306 306 GLU GLU D . n 
D 1 64 GLY 64 307 307 GLY GLY D . n 
D 1 65 LEU 65 308 308 LEU LEU D . n 
D 1 66 GLY 66 309 309 GLY GLY D . n 
D 1 67 HIS 67 310 310 HIS HIS D . n 
D 1 68 GLU 68 311 311 GLU GLU D . n 
D 1 69 GLU 69 312 312 GLU GLU D . n 
D 1 70 THR 70 313 313 THR THR D . n 
D 1 71 VAL 71 314 314 VAL VAL D . n 
D 1 72 SER 72 315 315 SER SER D . n 
D 1 73 ARG 73 316 316 ARG ARG D . n 
D 1 74 ILE 74 317 317 ILE ILE D . n 
D 1 75 GLN 75 318 318 GLN GLN D . n 
D 1 76 GLY 76 319 319 GLY GLY D . n 
D 1 77 GLN 77 320 320 GLN GLN D . n 
D 1 78 GLY 78 321 321 GLY GLY D . n 
D 1 79 SER 79 322 322 SER SER D . n 
D 1 80 CYS 80 323 323 CYS CYS D . n 
D 1 81 VAL 81 324 324 VAL VAL D . n 
D 1 82 SER 82 325 325 SER SER D . n 
D 1 83 LEU 83 326 326 LEU LEU D . n 
D 1 84 THR 84 327 327 THR THR D . n 
D 1 85 VAL 85 328 328 VAL VAL D . n 
D 1 86 VAL 86 329 329 VAL VAL D . n 
D 1 87 ASP 87 330 330 ASP ASP D . n 
D 1 88 PRO 88 331 331 PRO PRO D . n 
D 1 89 GLU 89 332 332 GLU GLU D . n 
D 1 90 ALA 90 333 333 ALA ALA D . n 
D 1 91 ASP 91 334 334 ASP ASP D . n 
D 1 92 ARG 92 335 335 ARG ARG D . n 
D 1 93 GLU 93 336 336 GLU GLU D . n 
D 1 94 THR 94 337 337 THR THR D . n 
D 1 95 SER 95 338 338 SER SER D . n 
D 1 96 VAL 96 339 339 VAL VAL D . n 
E 1 1  SER 1  244 ?   ?   ?   E . n 
E 1 2  MET 2  245 245 MET MET E . n 
E 1 3  LYS 3  246 246 LYS LYS E . n 
E 1 4  PRO 4  247 247 PRO PRO E . n 
E 1 5  ARG 5  248 248 ARG ARG E . n 
E 1 6  CYS 6  249 249 CYS CYS E . n 
E 1 7  LEU 7  250 250 LEU LEU E . n 
E 1 8  HIS 8  251 251 HIS HIS E . n 
E 1 9  LEU 9  252 252 LEU LEU E . n 
E 1 10 GLU 10 253 253 GLU GLU E . n 
E 1 11 LYS 11 254 254 LYS LYS E . n 
E 1 12 GLY 12 255 255 GLY GLY E . n 
E 1 13 PRO 13 256 256 PRO PRO E . n 
E 1 14 GLN 14 257 257 GLN GLN E . n 
E 1 15 GLY 15 258 258 GLY GLY E . n 
E 1 16 PHE 16 259 259 PHE PHE E . n 
E 1 17 GLY 17 260 260 GLY GLY E . n 
E 1 18 PHE 18 261 261 PHE PHE E . n 
E 1 19 LEU 19 262 262 LEU LEU E . n 
E 1 20 LEU 20 263 263 LEU LEU E . n 
E 1 21 ARG 21 264 264 ARG ARG E . n 
E 1 22 GLU 22 265 265 GLU GLU E . n 
E 1 23 GLU 23 266 266 GLU GLU E . n 
E 1 24 LYS 24 267 267 LYS LYS E . n 
E 1 25 GLY 25 268 268 GLY GLY E . n 
E 1 26 LEU 26 269 269 LEU LEU E . n 
E 1 27 ASP 27 270 270 ASP ASP E . n 
E 1 28 GLY 28 271 271 GLY GLY E . n 
E 1 29 ARG 29 272 272 ARG ARG E . n 
E 1 30 PRO 30 273 273 PRO PRO E . n 
E 1 31 GLY 31 274 274 GLY GLY E . n 
E 1 32 GLN 32 275 275 GLN GLN E . n 
E 1 33 PHE 33 276 276 PHE PHE E . n 
E 1 34 LEU 34 277 277 LEU LEU E . n 
E 1 35 TRP 35 278 278 TRP TRP E . n 
E 1 36 GLU 36 279 279 GLU GLU E . n 
E 1 37 VAL 37 280 280 VAL VAL E . n 
E 1 38 ASP 38 281 281 ASP ASP E . n 
E 1 39 PRO 39 282 282 PRO PRO E . n 
E 1 40 GLY 40 283 283 GLY GLY E . n 
E 1 41 LEU 41 284 284 LEU LEU E . n 
E 1 42 PRO 42 285 285 PRO PRO E . n 
E 1 43 ALA 43 286 286 ALA ALA E . n 
E 1 44 LYS 44 287 287 LYS LYS E . n 
E 1 45 LYS 45 288 288 LYS LYS E . n 
E 1 46 ALA 46 289 289 ALA ALA E . n 
E 1 47 GLY 47 290 290 GLY GLY E . n 
E 1 48 MET 48 291 291 MET MET E . n 
E 1 49 GLN 49 292 292 GLN GLN E . n 
E 1 50 ALA 50 293 293 ALA ALA E . n 
E 1 51 GLY 51 294 294 GLY GLY E . n 
E 1 52 ASP 52 295 295 ASP ASP E . n 
E 1 53 ARG 53 296 296 ARG ARG E . n 
E 1 54 LEU 54 297 297 LEU LEU E . n 
E 1 55 VAL 55 298 298 VAL VAL E . n 
E 1 56 ALA 56 299 299 ALA ALA E . n 
E 1 57 VAL 57 300 300 VAL VAL E . n 
E 1 58 ALA 58 301 301 ALA ALA E . n 
E 1 59 GLY 59 302 302 GLY GLY E . n 
E 1 60 GLU 60 303 303 GLU GLU E . n 
E 1 61 SER 61 304 304 SER SER E . n 
E 1 62 VAL 62 305 305 VAL VAL E . n 
E 1 63 GLU 63 306 306 GLU GLU E . n 
E 1 64 GLY 64 307 307 GLY GLY E . n 
E 1 65 LEU 65 308 308 LEU LEU E . n 
E 1 66 GLY 66 309 309 GLY GLY E . n 
E 1 67 HIS 67 310 310 HIS HIS E . n 
E 1 68 GLU 68 311 311 GLU GLU E . n 
E 1 69 GLU 69 312 312 GLU GLU E . n 
E 1 70 THR 70 313 313 THR THR E . n 
E 1 71 VAL 71 314 314 VAL VAL E . n 
E 1 72 SER 72 315 315 SER SER E . n 
E 1 73 ARG 73 316 316 ARG ARG E . n 
E 1 74 ILE 74 317 317 ILE ILE E . n 
E 1 75 GLN 75 318 318 GLN GLN E . n 
E 1 76 GLY 76 319 319 GLY GLY E . n 
E 1 77 GLN 77 320 320 GLN GLN E . n 
E 1 78 GLY 78 321 321 GLY GLY E . n 
E 1 79 SER 79 322 322 SER SER E . n 
E 1 80 CYS 80 323 323 CYS CYS E . n 
E 1 81 VAL 81 324 324 VAL VAL E . n 
E 1 82 SER 82 325 325 SER SER E . n 
E 1 83 LEU 83 326 326 LEU LEU E . n 
E 1 84 THR 84 327 327 THR THR E . n 
E 1 85 VAL 85 328 328 VAL VAL E . n 
E 1 86 VAL 86 329 329 VAL VAL E . n 
E 1 87 ASP 87 330 330 ASP ASP E . n 
E 1 88 PRO 88 331 331 PRO PRO E . n 
E 1 89 GLU 89 332 332 GLU GLU E . n 
E 1 90 ALA 90 333 333 ALA ALA E . n 
E 1 91 ASP 91 334 334 ASP ASP E . n 
E 1 92 ARG 92 335 335 ARG ARG E . n 
E 1 93 GLU 93 336 336 GLU GLU E . n 
E 1 94 THR 94 337 337 THR THR E . n 
E 1 95 SER 95 338 338 SER SER E . n 
E 1 96 VAL 96 339 339 VAL VAL E . n 
F 1 1  SER 1  244 ?   ?   ?   F . n 
F 1 2  MET 2  245 245 MET MET F . n 
F 1 3  LYS 3  246 246 LYS LYS F . n 
F 1 4  PRO 4  247 247 PRO PRO F . n 
F 1 5  ARG 5  248 248 ARG ARG F . n 
F 1 6  CYS 6  249 249 CYS CYS F . n 
F 1 7  LEU 7  250 250 LEU LEU F . n 
F 1 8  HIS 8  251 251 HIS HIS F . n 
F 1 9  LEU 9  252 252 LEU LEU F . n 
F 1 10 GLU 10 253 253 GLU GLU F . n 
F 1 11 LYS 11 254 254 LYS LYS F . n 
F 1 12 GLY 12 255 255 GLY GLY F . n 
F 1 13 PRO 13 256 256 PRO PRO F . n 
F 1 14 GLN 14 257 257 GLN GLN F . n 
F 1 15 GLY 15 258 258 GLY GLY F . n 
F 1 16 PHE 16 259 259 PHE PHE F . n 
F 1 17 GLY 17 260 260 GLY GLY F . n 
F 1 18 PHE 18 261 261 PHE PHE F . n 
F 1 19 LEU 19 262 262 LEU LEU F . n 
F 1 20 LEU 20 263 263 LEU LEU F . n 
F 1 21 ARG 21 264 264 ARG ARG F . n 
F 1 22 GLU 22 265 265 GLU GLU F . n 
F 1 23 GLU 23 266 266 GLU GLU F . n 
F 1 24 LYS 24 267 267 LYS LYS F . n 
F 1 25 GLY 25 268 268 GLY GLY F . n 
F 1 26 LEU 26 269 269 LEU LEU F . n 
F 1 27 ASP 27 270 270 ASP ASP F . n 
F 1 28 GLY 28 271 271 GLY GLY F . n 
F 1 29 ARG 29 272 272 ARG ARG F . n 
F 1 30 PRO 30 273 273 PRO PRO F . n 
F 1 31 GLY 31 274 274 GLY GLY F . n 
F 1 32 GLN 32 275 275 GLN GLN F . n 
F 1 33 PHE 33 276 276 PHE PHE F . n 
F 1 34 LEU 34 277 277 LEU LEU F . n 
F 1 35 TRP 35 278 278 TRP TRP F . n 
F 1 36 GLU 36 279 279 GLU GLU F . n 
F 1 37 VAL 37 280 280 VAL VAL F . n 
F 1 38 ASP 38 281 281 ASP ASP F . n 
F 1 39 PRO 39 282 282 PRO PRO F . n 
F 1 40 GLY 40 283 283 GLY GLY F . n 
F 1 41 LEU 41 284 284 LEU LEU F . n 
F 1 42 PRO 42 285 285 PRO PRO F . n 
F 1 43 ALA 43 286 286 ALA ALA F . n 
F 1 44 LYS 44 287 287 LYS LYS F . n 
F 1 45 LYS 45 288 288 LYS LYS F . n 
F 1 46 ALA 46 289 289 ALA ALA F . n 
F 1 47 GLY 47 290 290 GLY GLY F . n 
F 1 48 MET 48 291 291 MET MET F . n 
F 1 49 GLN 49 292 292 GLN GLN F . n 
F 1 50 ALA 50 293 293 ALA ALA F . n 
F 1 51 GLY 51 294 294 GLY GLY F . n 
F 1 52 ASP 52 295 295 ASP ASP F . n 
F 1 53 ARG 53 296 296 ARG ARG F . n 
F 1 54 LEU 54 297 297 LEU LEU F . n 
F 1 55 VAL 55 298 298 VAL VAL F . n 
F 1 56 ALA 56 299 299 ALA ALA F . n 
F 1 57 VAL 57 300 300 VAL VAL F . n 
F 1 58 ALA 58 301 301 ALA ALA F . n 
F 1 59 GLY 59 302 302 GLY GLY F . n 
F 1 60 GLU 60 303 303 GLU GLU F . n 
F 1 61 SER 61 304 304 SER SER F . n 
F 1 62 VAL 62 305 305 VAL VAL F . n 
F 1 63 GLU 63 306 306 GLU GLU F . n 
F 1 64 GLY 64 307 307 GLY GLY F . n 
F 1 65 LEU 65 308 308 LEU LEU F . n 
F 1 66 GLY 66 309 309 GLY GLY F . n 
F 1 67 HIS 67 310 310 HIS HIS F . n 
F 1 68 GLU 68 311 311 GLU GLU F . n 
F 1 69 GLU 69 312 312 GLU GLU F . n 
F 1 70 THR 70 313 313 THR THR F . n 
F 1 71 VAL 71 314 314 VAL VAL F . n 
F 1 72 SER 72 315 315 SER SER F . n 
F 1 73 ARG 73 316 316 ARG ARG F . n 
F 1 74 ILE 74 317 317 ILE ILE F . n 
F 1 75 GLN 75 318 318 GLN GLN F . n 
F 1 76 GLY 76 319 319 GLY GLY F . n 
F 1 77 GLN 77 320 320 GLN GLN F . n 
F 1 78 GLY 78 321 321 GLY GLY F . n 
F 1 79 SER 79 322 322 SER SER F . n 
F 1 80 CYS 80 323 323 CYS CYS F . n 
F 1 81 VAL 81 324 324 VAL VAL F . n 
F 1 82 SER 82 325 325 SER SER F . n 
F 1 83 LEU 83 326 326 LEU LEU F . n 
F 1 84 THR 84 327 327 THR THR F . n 
F 1 85 VAL 85 328 328 VAL VAL F . n 
F 1 86 VAL 86 329 329 VAL VAL F . n 
F 1 87 ASP 87 330 330 ASP ASP F . n 
F 1 88 PRO 88 331 331 PRO PRO F . n 
F 1 89 GLU 89 332 332 GLU GLU F . n 
F 1 90 ALA 90 333 333 ALA ALA F . n 
F 1 91 ASP 91 334 334 ASP ASP F . n 
F 1 92 ARG 92 335 335 ARG ARG F . n 
F 1 93 GLU 93 336 336 GLU GLU F . n 
F 1 94 THR 94 337 337 THR THR F . n 
F 1 95 SER 95 338 338 SER SER F . n 
F 1 96 VAL 96 339 339 VAL VAL F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 2 SO4 1  1340 1340 SO4 SO4 A . 
H 2 SO4 1  1340 1340 SO4 SO4 B . 
I 2 SO4 1  1341 1341 SO4 SO4 B . 
J 3 HOH 1  2001 2001 HOH HOH A . 
J 3 HOH 2  2002 2002 HOH HOH A . 
J 3 HOH 3  2003 2003 HOH HOH A . 
J 3 HOH 4  2004 2004 HOH HOH A . 
J 3 HOH 5  2005 2005 HOH HOH A . 
J 3 HOH 6  2006 2006 HOH HOH A . 
J 3 HOH 7  2007 2007 HOH HOH A . 
J 3 HOH 8  2008 2008 HOH HOH A . 
J 3 HOH 9  2009 2009 HOH HOH A . 
J 3 HOH 10 2010 2010 HOH HOH A . 
J 3 HOH 11 2011 2011 HOH HOH A . 
J 3 HOH 12 2012 2012 HOH HOH A . 
J 3 HOH 13 2013 2013 HOH HOH A . 
J 3 HOH 14 2014 2014 HOH HOH A . 
J 3 HOH 15 2015 2015 HOH HOH A . 
J 3 HOH 16 2016 2016 HOH HOH A . 
J 3 HOH 17 2017 2017 HOH HOH A . 
J 3 HOH 18 2018 2018 HOH HOH A . 
J 3 HOH 19 2019 2019 HOH HOH A . 
J 3 HOH 20 2020 2020 HOH HOH A . 
J 3 HOH 21 2021 2021 HOH HOH A . 
J 3 HOH 22 2022 2022 HOH HOH A . 
J 3 HOH 23 2023 2023 HOH HOH A . 
J 3 HOH 24 2024 2024 HOH HOH A . 
J 3 HOH 25 2025 2025 HOH HOH A . 
J 3 HOH 26 2026 2026 HOH HOH A . 
J 3 HOH 27 2027 2027 HOH HOH A . 
J 3 HOH 28 2028 2028 HOH HOH A . 
J 3 HOH 29 2029 2029 HOH HOH A . 
J 3 HOH 30 2030 2030 HOH HOH A . 
J 3 HOH 31 2031 2031 HOH HOH A . 
J 3 HOH 32 2032 2032 HOH HOH A . 
J 3 HOH 33 2033 2033 HOH HOH A . 
J 3 HOH 34 2034 2034 HOH HOH A . 
J 3 HOH 35 2035 2035 HOH HOH A . 
J 3 HOH 36 2036 2036 HOH HOH A . 
J 3 HOH 37 2037 2037 HOH HOH A . 
J 3 HOH 38 2038 2038 HOH HOH A . 
J 3 HOH 39 2039 2039 HOH HOH A . 
J 3 HOH 40 2040 2040 HOH HOH A . 
J 3 HOH 41 2041 2041 HOH HOH A . 
J 3 HOH 42 2042 2042 HOH HOH A . 
J 3 HOH 43 2043 2043 HOH HOH A . 
J 3 HOH 44 2044 2044 HOH HOH A . 
J 3 HOH 45 2045 2045 HOH HOH A . 
J 3 HOH 46 2046 2046 HOH HOH A . 
J 3 HOH 47 2047 2047 HOH HOH A . 
J 3 HOH 48 2048 2048 HOH HOH A . 
J 3 HOH 49 2049 2049 HOH HOH A . 
J 3 HOH 50 2050 2050 HOH HOH A . 
J 3 HOH 51 2051 2051 HOH HOH A . 
J 3 HOH 52 2052 2052 HOH HOH A . 
J 3 HOH 53 2053 2053 HOH HOH A . 
J 3 HOH 54 2054 2054 HOH HOH A . 
J 3 HOH 55 2055 2055 HOH HOH A . 
J 3 HOH 56 2056 2056 HOH HOH A . 
J 3 HOH 57 2057 2057 HOH HOH A . 
J 3 HOH 58 2058 2058 HOH HOH A . 
J 3 HOH 59 2059 2059 HOH HOH A . 
J 3 HOH 60 2060 2060 HOH HOH A . 
J 3 HOH 61 2061 2061 HOH HOH A . 
J 3 HOH 62 2062 2062 HOH HOH A . 
J 3 HOH 63 2063 2063 HOH HOH A . 
J 3 HOH 64 2064 2064 HOH HOH A . 
J 3 HOH 65 2065 2065 HOH HOH A . 
J 3 HOH 66 2066 2066 HOH HOH A . 
J 3 HOH 67 2067 2067 HOH HOH A . 
J 3 HOH 68 2068 2068 HOH HOH A . 
J 3 HOH 69 2069 2069 HOH HOH A . 
J 3 HOH 70 2070 2070 HOH HOH A . 
J 3 HOH 71 2071 2071 HOH HOH A . 
J 3 HOH 72 2072 2072 HOH HOH A . 
J 3 HOH 73 2073 2073 HOH HOH A . 
J 3 HOH 74 2074 2074 HOH HOH A . 
K 3 HOH 1  2001 2001 HOH HOH B . 
K 3 HOH 2  2002 2002 HOH HOH B . 
K 3 HOH 3  2003 2003 HOH HOH B . 
K 3 HOH 4  2004 2004 HOH HOH B . 
K 3 HOH 5  2005 2005 HOH HOH B . 
K 3 HOH 6  2006 2006 HOH HOH B . 
K 3 HOH 7  2007 2007 HOH HOH B . 
K 3 HOH 8  2008 2008 HOH HOH B . 
K 3 HOH 9  2009 2009 HOH HOH B . 
K 3 HOH 10 2010 2010 HOH HOH B . 
K 3 HOH 11 2011 2011 HOH HOH B . 
K 3 HOH 12 2012 2012 HOH HOH B . 
K 3 HOH 13 2013 2013 HOH HOH B . 
K 3 HOH 14 2014 2014 HOH HOH B . 
K 3 HOH 15 2015 2015 HOH HOH B . 
K 3 HOH 16 2016 2016 HOH HOH B . 
K 3 HOH 17 2017 2017 HOH HOH B . 
K 3 HOH 18 2018 2018 HOH HOH B . 
K 3 HOH 19 2019 2019 HOH HOH B . 
K 3 HOH 20 2020 2020 HOH HOH B . 
K 3 HOH 21 2021 2021 HOH HOH B . 
K 3 HOH 22 2022 2022 HOH HOH B . 
K 3 HOH 23 2023 2023 HOH HOH B . 
K 3 HOH 24 2024 2024 HOH HOH B . 
K 3 HOH 25 2025 2025 HOH HOH B . 
K 3 HOH 26 2026 2026 HOH HOH B . 
K 3 HOH 27 2027 2027 HOH HOH B . 
K 3 HOH 28 2028 2028 HOH HOH B . 
K 3 HOH 29 2029 2029 HOH HOH B . 
K 3 HOH 30 2030 2030 HOH HOH B . 
K 3 HOH 31 2031 2031 HOH HOH B . 
K 3 HOH 32 2032 2032 HOH HOH B . 
K 3 HOH 33 2033 2033 HOH HOH B . 
K 3 HOH 34 2034 2034 HOH HOH B . 
K 3 HOH 35 2035 2035 HOH HOH B . 
K 3 HOH 36 2036 2036 HOH HOH B . 
K 3 HOH 37 2037 2037 HOH HOH B . 
K 3 HOH 38 2038 2038 HOH HOH B . 
K 3 HOH 39 2039 2039 HOH HOH B . 
K 3 HOH 40 2040 2040 HOH HOH B . 
K 3 HOH 41 2041 2041 HOH HOH B . 
K 3 HOH 42 2042 2042 HOH HOH B . 
K 3 HOH 43 2043 2043 HOH HOH B . 
K 3 HOH 44 2044 2044 HOH HOH B . 
K 3 HOH 45 2045 2045 HOH HOH B . 
K 3 HOH 46 2046 2046 HOH HOH B . 
K 3 HOH 47 2047 2047 HOH HOH B . 
K 3 HOH 48 2048 2048 HOH HOH B . 
K 3 HOH 49 2049 2049 HOH HOH B . 
K 3 HOH 50 2050 2050 HOH HOH B . 
K 3 HOH 51 2051 2051 HOH HOH B . 
K 3 HOH 52 2052 2052 HOH HOH B . 
K 3 HOH 53 2053 2053 HOH HOH B . 
K 3 HOH 54 2054 2054 HOH HOH B . 
K 3 HOH 55 2055 2055 HOH HOH B . 
K 3 HOH 56 2056 2056 HOH HOH B . 
K 3 HOH 57 2057 2057 HOH HOH B . 
K 3 HOH 58 2058 2058 HOH HOH B . 
K 3 HOH 59 2059 2059 HOH HOH B . 
K 3 HOH 60 2060 2060 HOH HOH B . 
K 3 HOH 61 2061 2061 HOH HOH B . 
K 3 HOH 62 2062 2062 HOH HOH B . 
K 3 HOH 63 2063 2063 HOH HOH B . 
K 3 HOH 64 2064 2064 HOH HOH B . 
K 3 HOH 65 2065 2065 HOH HOH B . 
L 3 HOH 1  2001 2001 HOH HOH C . 
L 3 HOH 2  2002 2002 HOH HOH C . 
L 3 HOH 3  2003 2003 HOH HOH C . 
L 3 HOH 4  2004 2004 HOH HOH C . 
L 3 HOH 5  2005 2005 HOH HOH C . 
L 3 HOH 6  2006 2006 HOH HOH C . 
L 3 HOH 7  2007 2007 HOH HOH C . 
L 3 HOH 8  2008 2008 HOH HOH C . 
L 3 HOH 9  2009 2009 HOH HOH C . 
L 3 HOH 10 2010 2010 HOH HOH C . 
L 3 HOH 11 2011 2011 HOH HOH C . 
L 3 HOH 12 2012 2012 HOH HOH C . 
L 3 HOH 13 2013 2013 HOH HOH C . 
L 3 HOH 14 2014 2014 HOH HOH C . 
L 3 HOH 15 2015 2015 HOH HOH C . 
L 3 HOH 16 2016 2016 HOH HOH C . 
L 3 HOH 17 2017 2017 HOH HOH C . 
L 3 HOH 18 2018 2018 HOH HOH C . 
L 3 HOH 19 2019 2019 HOH HOH C . 
L 3 HOH 20 2020 2020 HOH HOH C . 
L 3 HOH 21 2021 2021 HOH HOH C . 
L 3 HOH 22 2022 2022 HOH HOH C . 
L 3 HOH 23 2023 2023 HOH HOH C . 
L 3 HOH 24 2024 2024 HOH HOH C . 
L 3 HOH 25 2025 2025 HOH HOH C . 
L 3 HOH 26 2026 2026 HOH HOH C . 
L 3 HOH 27 2027 2027 HOH HOH C . 
L 3 HOH 28 2028 2028 HOH HOH C . 
L 3 HOH 29 2029 2029 HOH HOH C . 
L 3 HOH 30 2030 2030 HOH HOH C . 
L 3 HOH 31 2031 2031 HOH HOH C . 
L 3 HOH 32 2032 2032 HOH HOH C . 
L 3 HOH 33 2033 2033 HOH HOH C . 
L 3 HOH 34 2034 2034 HOH HOH C . 
L 3 HOH 35 2035 2035 HOH HOH C . 
L 3 HOH 36 2036 2036 HOH HOH C . 
L 3 HOH 37 2037 2037 HOH HOH C . 
L 3 HOH 38 2038 2038 HOH HOH C . 
L 3 HOH 39 2039 2039 HOH HOH C . 
L 3 HOH 40 2040 2040 HOH HOH C . 
L 3 HOH 41 2041 2041 HOH HOH C . 
L 3 HOH 42 2042 2042 HOH HOH C . 
L 3 HOH 43 2043 2043 HOH HOH C . 
L 3 HOH 44 2044 2044 HOH HOH C . 
L 3 HOH 45 2045 2045 HOH HOH C . 
L 3 HOH 46 2046 2046 HOH HOH C . 
L 3 HOH 47 2047 2047 HOH HOH C . 
L 3 HOH 48 2048 2048 HOH HOH C . 
L 3 HOH 49 2049 2049 HOH HOH C . 
L 3 HOH 50 2050 2050 HOH HOH C . 
L 3 HOH 51 2051 2051 HOH HOH C . 
L 3 HOH 52 2052 2052 HOH HOH C . 
L 3 HOH 53 2053 2053 HOH HOH C . 
L 3 HOH 54 2054 2054 HOH HOH C . 
L 3 HOH 55 2055 2055 HOH HOH C . 
L 3 HOH 56 2056 2056 HOH HOH C . 
L 3 HOH 57 2057 2057 HOH HOH C . 
L 3 HOH 58 2058 2058 HOH HOH C . 
M 3 HOH 1  2001 2001 HOH HOH D . 
M 3 HOH 2  2002 2002 HOH HOH D . 
M 3 HOH 3  2003 2003 HOH HOH D . 
M 3 HOH 4  2004 2004 HOH HOH D . 
M 3 HOH 5  2005 2005 HOH HOH D . 
M 3 HOH 6  2006 2006 HOH HOH D . 
M 3 HOH 7  2007 2007 HOH HOH D . 
M 3 HOH 8  2008 2008 HOH HOH D . 
M 3 HOH 9  2009 2009 HOH HOH D . 
M 3 HOH 10 2010 2010 HOH HOH D . 
M 3 HOH 11 2011 2011 HOH HOH D . 
M 3 HOH 12 2012 2012 HOH HOH D . 
M 3 HOH 13 2013 2013 HOH HOH D . 
M 3 HOH 14 2014 2014 HOH HOH D . 
M 3 HOH 15 2015 2015 HOH HOH D . 
M 3 HOH 16 2016 2016 HOH HOH D . 
M 3 HOH 17 2017 2017 HOH HOH D . 
M 3 HOH 18 2018 2018 HOH HOH D . 
M 3 HOH 19 2019 2019 HOH HOH D . 
M 3 HOH 20 2020 2020 HOH HOH D . 
M 3 HOH 21 2021 2021 HOH HOH D . 
M 3 HOH 22 2022 2022 HOH HOH D . 
M 3 HOH 23 2023 2023 HOH HOH D . 
M 3 HOH 24 2024 2024 HOH HOH D . 
M 3 HOH 25 2025 2025 HOH HOH D . 
M 3 HOH 26 2026 2026 HOH HOH D . 
M 3 HOH 27 2027 2027 HOH HOH D . 
M 3 HOH 28 2028 2028 HOH HOH D . 
M 3 HOH 29 2029 2029 HOH HOH D . 
M 3 HOH 30 2030 2030 HOH HOH D . 
M 3 HOH 31 2031 2031 HOH HOH D . 
M 3 HOH 32 2032 2032 HOH HOH D . 
M 3 HOH 33 2033 2033 HOH HOH D . 
M 3 HOH 34 2034 2034 HOH HOH D . 
M 3 HOH 35 2035 2035 HOH HOH D . 
M 3 HOH 36 2036 2036 HOH HOH D . 
M 3 HOH 37 2037 2037 HOH HOH D . 
M 3 HOH 38 2038 2038 HOH HOH D . 
M 3 HOH 39 2039 2039 HOH HOH D . 
M 3 HOH 40 2040 2040 HOH HOH D . 
M 3 HOH 41 2041 2041 HOH HOH D . 
M 3 HOH 42 2042 2042 HOH HOH D . 
M 3 HOH 43 2043 2043 HOH HOH D . 
M 3 HOH 44 2044 2044 HOH HOH D . 
M 3 HOH 45 2045 2045 HOH HOH D . 
M 3 HOH 46 2046 2046 HOH HOH D . 
M 3 HOH 47 2047 2047 HOH HOH D . 
M 3 HOH 48 2048 2048 HOH HOH D . 
M 3 HOH 49 2049 2049 HOH HOH D . 
M 3 HOH 50 2050 2050 HOH HOH D . 
M 3 HOH 51 2051 2051 HOH HOH D . 
M 3 HOH 52 2052 2052 HOH HOH D . 
M 3 HOH 53 2053 2053 HOH HOH D . 
M 3 HOH 54 2054 2054 HOH HOH D . 
M 3 HOH 55 2055 2055 HOH HOH D . 
M 3 HOH 56 2056 2056 HOH HOH D . 
M 3 HOH 57 2057 2057 HOH HOH D . 
M 3 HOH 58 2058 2058 HOH HOH D . 
M 3 HOH 59 2059 2059 HOH HOH D . 
M 3 HOH 60 2060 2060 HOH HOH D . 
N 3 HOH 1  2001 2001 HOH HOH E . 
N 3 HOH 2  2002 2002 HOH HOH E . 
N 3 HOH 3  2003 2003 HOH HOH E . 
N 3 HOH 4  2004 2004 HOH HOH E . 
N 3 HOH 5  2005 2005 HOH HOH E . 
N 3 HOH 6  2006 2006 HOH HOH E . 
N 3 HOH 7  2007 2007 HOH HOH E . 
N 3 HOH 8  2008 2008 HOH HOH E . 
N 3 HOH 9  2009 2009 HOH HOH E . 
N 3 HOH 10 2010 2010 HOH HOH E . 
N 3 HOH 11 2011 2011 HOH HOH E . 
N 3 HOH 12 2012 2012 HOH HOH E . 
N 3 HOH 13 2013 2013 HOH HOH E . 
N 3 HOH 14 2014 2014 HOH HOH E . 
N 3 HOH 15 2015 2015 HOH HOH E . 
N 3 HOH 16 2016 2016 HOH HOH E . 
N 3 HOH 17 2017 2017 HOH HOH E . 
N 3 HOH 18 2018 2018 HOH HOH E . 
N 3 HOH 19 2019 2019 HOH HOH E . 
N 3 HOH 20 2020 2020 HOH HOH E . 
N 3 HOH 21 2021 2021 HOH HOH E . 
N 3 HOH 22 2022 2022 HOH HOH E . 
N 3 HOH 23 2023 2023 HOH HOH E . 
N 3 HOH 24 2024 2024 HOH HOH E . 
N 3 HOH 25 2025 2025 HOH HOH E . 
N 3 HOH 26 2026 2026 HOH HOH E . 
N 3 HOH 27 2027 2027 HOH HOH E . 
N 3 HOH 28 2028 2028 HOH HOH E . 
N 3 HOH 29 2029 2029 HOH HOH E . 
N 3 HOH 30 2030 2030 HOH HOH E . 
N 3 HOH 31 2031 2031 HOH HOH E . 
N 3 HOH 32 2032 2032 HOH HOH E . 
N 3 HOH 33 2033 2033 HOH HOH E . 
N 3 HOH 34 2034 2034 HOH HOH E . 
N 3 HOH 35 2035 2035 HOH HOH E . 
N 3 HOH 36 2036 2036 HOH HOH E . 
N 3 HOH 37 2037 2037 HOH HOH E . 
N 3 HOH 38 2038 2038 HOH HOH E . 
N 3 HOH 39 2039 2039 HOH HOH E . 
N 3 HOH 40 2040 2040 HOH HOH E . 
N 3 HOH 41 2041 2041 HOH HOH E . 
N 3 HOH 42 2042 2042 HOH HOH E . 
N 3 HOH 43 2043 2043 HOH HOH E . 
N 3 HOH 44 2044 2044 HOH HOH E . 
N 3 HOH 45 2045 2045 HOH HOH E . 
N 3 HOH 46 2046 2046 HOH HOH E . 
N 3 HOH 47 2047 2047 HOH HOH E . 
N 3 HOH 48 2048 2048 HOH HOH E . 
N 3 HOH 49 2049 2049 HOH HOH E . 
N 3 HOH 50 2050 2050 HOH HOH E . 
N 3 HOH 51 2051 2051 HOH HOH E . 
N 3 HOH 52 2052 2052 HOH HOH E . 
N 3 HOH 53 2053 2053 HOH HOH E . 
N 3 HOH 54 2054 2054 HOH HOH E . 
N 3 HOH 55 2055 2055 HOH HOH E . 
N 3 HOH 56 2056 2056 HOH HOH E . 
N 3 HOH 57 2057 2057 HOH HOH E . 
N 3 HOH 58 2058 2058 HOH HOH E . 
N 3 HOH 59 2059 2059 HOH HOH E . 
N 3 HOH 60 2060 2060 HOH HOH E . 
N 3 HOH 61 2061 2061 HOH HOH E . 
N 3 HOH 62 2062 2062 HOH HOH E . 
N 3 HOH 63 2063 2063 HOH HOH E . 
N 3 HOH 64 2064 2064 HOH HOH E . 
N 3 HOH 65 2065 2065 HOH HOH E . 
N 3 HOH 66 2066 2066 HOH HOH E . 
N 3 HOH 67 2067 2067 HOH HOH E . 
N 3 HOH 68 2068 2068 HOH HOH E . 
N 3 HOH 69 2069 2069 HOH HOH E . 
N 3 HOH 70 2070 2070 HOH HOH E . 
N 3 HOH 71 2071 2071 HOH HOH E . 
N 3 HOH 72 2072 2072 HOH HOH E . 
O 3 HOH 1  2001 2001 HOH HOH F . 
O 3 HOH 2  2002 2002 HOH HOH F . 
O 3 HOH 3  2003 2003 HOH HOH F . 
O 3 HOH 4  2004 2004 HOH HOH F . 
O 3 HOH 5  2005 2005 HOH HOH F . 
O 3 HOH 6  2006 2006 HOH HOH F . 
O 3 HOH 7  2007 2007 HOH HOH F . 
O 3 HOH 8  2008 2008 HOH HOH F . 
O 3 HOH 9  2009 2009 HOH HOH F . 
O 3 HOH 10 2010 2010 HOH HOH F . 
O 3 HOH 11 2011 2011 HOH HOH F . 
O 3 HOH 12 2012 2012 HOH HOH F . 
O 3 HOH 13 2013 2013 HOH HOH F . 
O 3 HOH 14 2014 2014 HOH HOH F . 
O 3 HOH 15 2015 2015 HOH HOH F . 
O 3 HOH 16 2016 2016 HOH HOH F . 
O 3 HOH 17 2017 2017 HOH HOH F . 
O 3 HOH 18 2018 2018 HOH HOH F . 
O 3 HOH 19 2019 2019 HOH HOH F . 
O 3 HOH 20 2020 2020 HOH HOH F . 
O 3 HOH 21 2021 2021 HOH HOH F . 
O 3 HOH 22 2022 2022 HOH HOH F . 
O 3 HOH 23 2023 2023 HOH HOH F . 
O 3 HOH 24 2024 2024 HOH HOH F . 
O 3 HOH 25 2025 2025 HOH HOH F . 
O 3 HOH 26 2026 2026 HOH HOH F . 
O 3 HOH 27 2027 2027 HOH HOH F . 
O 3 HOH 28 2028 2028 HOH HOH F . 
O 3 HOH 29 2029 2029 HOH HOH F . 
O 3 HOH 30 2030 2030 HOH HOH F . 
O 3 HOH 31 2031 2031 HOH HOH F . 
O 3 HOH 32 2032 2032 HOH HOH F . 
O 3 HOH 33 2033 2033 HOH HOH F . 
O 3 HOH 34 2034 2034 HOH HOH F . 
O 3 HOH 35 2035 2035 HOH HOH F . 
O 3 HOH 36 2036 2036 HOH HOH F . 
O 3 HOH 37 2037 2037 HOH HOH F . 
O 3 HOH 38 2038 2038 HOH HOH F . 
O 3 HOH 39 2039 2039 HOH HOH F . 
O 3 HOH 40 2040 2040 HOH HOH F . 
O 3 HOH 41 2041 2041 HOH HOH F . 
O 3 HOH 42 2042 2042 HOH HOH F . 
O 3 HOH 43 2043 2043 HOH HOH F . 
O 3 HOH 44 2044 2044 HOH HOH F . 
O 3 HOH 45 2045 2045 HOH HOH F . 
O 3 HOH 46 2046 2046 HOH HOH F . 
O 3 HOH 47 2047 2047 HOH HOH F . 
O 3 HOH 48 2048 2048 HOH HOH F . 
O 3 HOH 49 2049 2049 HOH HOH F . 
O 3 HOH 50 2050 2050 HOH HOH F . 
O 3 HOH 51 2051 2051 HOH HOH F . 
O 3 HOH 52 2052 2052 HOH HOH F . 
O 3 HOH 53 2053 2053 HOH HOH F . 
O 3 HOH 54 2054 2054 HOH HOH F . 
O 3 HOH 55 2055 2055 HOH HOH F . 
O 3 HOH 56 2056 2056 HOH HOH F . 
O 3 HOH 57 2057 2057 HOH HOH F . 
O 3 HOH 58 2058 2058 HOH HOH F . 
O 3 HOH 59 2059 2059 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,J,L,N   
2 1 B,D,F,H,I,K,M,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-02-28 
4 'Structure model' 1 3 2020-03-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Source and taxonomy'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen            
2 4 'Structure model' pdbx_database_status      
3 4 'Structure model' pdbx_struct_assembly      
4 4 'Structure model' pdbx_struct_assembly_gen  
5 4 'Structure model' pdbx_struct_assembly_prop 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'        
2 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
3 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
4 3 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
5 3 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
6 4 'Structure model' '_pdbx_database_status.status_code_sf'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 5.2995  -41.8697 -9.6254 -0.0210 -0.0803 -0.0702 -0.0306 0.0058  -0.0122 3.4807 1.0563 0.6207 
-0.1868 -0.2934 -0.2742 0.1687  -0.2304 0.0532  0.1656  -0.0877 -0.0234 0.0417  -0.0337 -0.0809 
'X-RAY DIFFRACTION' 2 ? refined 24.7695 7.0052   19.6598 -0.0122 -0.0680 -0.0683 -0.0278 0.0207  -0.0156 3.0706 1.1388 1.2009 
0.3280  0.0924  0.2339  0.1567  -0.2553 0.1195  0.2491  -0.1393 0.0433  0.0110  -0.0693 -0.0174 
'X-RAY DIFFRACTION' 3 ? refined 23.7061 -21.5426 1.9500  -0.0386 -0.0500 -0.0192 0.0087  -0.0177 -0.0275 3.3846 1.5008 0.7576 
-0.5972 -0.2844 0.1992  -0.0078 -0.0800 -0.3736 0.2709  0.0279  -0.1230 0.1497  0.0288  -0.0201 
'X-RAY DIFFRACTION' 4 ? refined 42.5827 27.2955  31.6913 0.0129  -0.0652 -0.0588 0.0052  -0.0304 -0.0088 3.3111 2.2305 1.0788 
-0.9149 -0.5183 0.8506  -0.0142 -0.1475 -0.2936 0.3336  0.0264  -0.1596 0.1467  0.1002  -0.0122 
'X-RAY DIFFRACTION' 5 ? refined 5.6602  -12.6624 -3.8867 -0.0519 -0.0444 -0.0551 0.0249  0.0076  -0.0379 2.7214 0.9487 1.5781 
-0.3478 0.9577  0.1659  -0.0155 0.1338  0.0797  -0.0223 -0.0865 0.0371  -0.0951 -0.0824 0.1019  
'X-RAY DIFFRACTION' 6 ? refined 24.4390 36.1391  25.7232 0.0221  -0.0174 -0.0493 0.0325  -0.0158 -0.0282 3.2220 0.8533 1.4356 
-0.3194 1.2404  0.3897  0.0595  0.1987  0.1127  -0.0673 -0.1346 0.0731  -0.1336 -0.0896 0.0751  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 244 ? ? A 339 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 244 ? ? B 339 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 244 ? ? C 339 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 244 ? ? D 339 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 244 ? ? E 339 ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 F 244 ? ? F 339 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.3.0034 ? 1 
XDS    'data reduction' .        ? 2 
XDS    'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2V90 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE LAST 4 RESIDUES (GLU336-VAL339) IS A COMMON PDZ-BINDING
SEQUENCE ENGINEERED AT THE C-TERMINUS OF THE PROTEIN TO PROMOTE
MACROMOLECULAR CONTACTS. THE FIRST TWO RESIDUES BELONG TO A
CLEAVED HIS-TAG LINKER
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   F 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    312 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   F 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2047 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 335 ? ? -95.66  55.94 
2 1 ARG B 335 ? ? -91.75  57.78 
3 1 ARG F 335 ? ? -104.67 45.71 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C GLU 253 ? CD  ? C GLU 10 CD  
2  1 Y 1 C GLU 253 ? OE1 ? C GLU 10 OE1 
3  1 Y 1 C GLU 253 ? OE2 ? C GLU 10 OE2 
4  1 Y 1 D GLU 311 ? CD  ? D GLU 68 CD  
5  1 Y 1 D GLU 311 ? OE1 ? D GLU 68 OE1 
6  1 Y 1 D GLU 311 ? OE2 ? D GLU 68 OE2 
7  1 Y 1 D ASP 334 ? CG  ? D ASP 91 CG  
8  1 Y 1 D ASP 334 ? OD1 ? D ASP 91 OD1 
9  1 Y 1 D ASP 334 ? OD2 ? D ASP 91 OD2 
10 1 Y 1 E MET 245 ? CG  ? E MET 2  CG  
11 1 Y 1 E MET 245 ? SD  ? E MET 2  SD  
12 1 Y 1 E MET 245 ? CE  ? E MET 2  CE  
13 1 Y 1 E LYS 246 ? CD  ? E LYS 3  CD  
14 1 Y 1 E LYS 246 ? CE  ? E LYS 3  CE  
15 1 Y 1 E LYS 246 ? NZ  ? E LYS 3  NZ  
16 1 Y 1 E GLN 257 ? CG  ? E GLN 14 CG  
17 1 Y 1 E GLN 257 ? CD  ? E GLN 14 CD  
18 1 Y 1 E GLN 257 ? OE1 ? E GLN 14 OE1 
19 1 Y 1 E GLN 257 ? NE2 ? E GLN 14 NE2 
20 1 Y 1 F MET 245 ? CG  ? F MET 2  CG  
21 1 Y 1 F MET 245 ? SD  ? F MET 2  SD  
22 1 Y 1 F MET 245 ? CE  ? F MET 2  CE  
23 1 Y 1 F LYS 246 ? CD  ? F LYS 3  CD  
24 1 Y 1 F LYS 246 ? CE  ? F LYS 3  CE  
25 1 Y 1 F LYS 246 ? NZ  ? F LYS 3  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 244 ? A SER 1 
2  1 Y 1 B SER 244 ? B SER 1 
3  1 Y 1 C SER 244 ? C SER 1 
4  1 Y 1 C MET 245 ? C MET 2 
5  1 Y 1 C LYS 246 ? C LYS 3 
6  1 Y 1 D SER 244 ? D SER 1 
7  1 Y 1 D MET 245 ? D MET 2 
8  1 Y 1 D LYS 246 ? D LYS 3 
9  1 Y 1 E SER 244 ? E SER 1 
10 1 Y 1 F SER 244 ? F SER 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#