data_2V93
# 
_entry.id   2V93 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2V93         
PDBE  EBI-33531    
WWPDB D_1290033531 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1A7L 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        
;DOMINANT B-CELL EPITOPE FROM THE PRES2 REGION OF HEPATITISB VIRUS IN THE FORM OF AN INSERTED PEPTIDE SEGMENT INMALTODEXTRIN- BINDING PROTEIN
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2V93 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.' 1 
'Tang, C.'    2 
# 
_citation.id                        primary 
_citation.title                     'Open-to-Closed Transition in Apo Maltose-Binding Protein Observed by Paramagnetic NMR.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            449 
_citation.page_first                1078 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17960247 
_citation.pdbx_database_id_DOI      10.1038/NATURE06232 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tang, C.'         1 
primary 'Schwieters, C.D.' 2 
primary 'Clore, G.M.'      3 
# 
_cell.entry_id           2V93 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2V93 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MALTOSE-BINDING PERIPLASMIC PROTEIN'                                  40757.273 1 ? YES ? ? 
2 non-polymer syn '1-(1-HYDROXY-2,2,6,6-TETRAMETHYLPIPERIDIN-4-YL)PYRROLIDINE-2,5-DIONE' 254.325   2 ? ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MALTODEXTRIN-BINDING PROTEIN, MMBP, MALTOSE BINDING PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPCKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT
PDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPL
IAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYCIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT
MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPCKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT
PDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPL
IAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYCIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT
MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ILE n 
1 3   GLU n 
1 4   GLU n 
1 5   GLY n 
1 6   LYS n 
1 7   LEU n 
1 8   VAL n 
1 9   ILE n 
1 10  TRP n 
1 11  ILE n 
1 12  ASN n 
1 13  GLY n 
1 14  ASP n 
1 15  LYS n 
1 16  GLY n 
1 17  TYR n 
1 18  ASN n 
1 19  GLY n 
1 20  LEU n 
1 21  ALA n 
1 22  GLU n 
1 23  VAL n 
1 24  GLY n 
1 25  LYS n 
1 26  LYS n 
1 27  PHE n 
1 28  GLU n 
1 29  LYS n 
1 30  ASP n 
1 31  THR n 
1 32  GLY n 
1 33  ILE n 
1 34  LYS n 
1 35  VAL n 
1 36  THR n 
1 37  VAL n 
1 38  GLU n 
1 39  HIS n 
1 40  PRO n 
1 41  CYS n 
1 42  LYS n 
1 43  LEU n 
1 44  GLU n 
1 45  GLU n 
1 46  LYS n 
1 47  PHE n 
1 48  PRO n 
1 49  GLN n 
1 50  VAL n 
1 51  ALA n 
1 52  ALA n 
1 53  THR n 
1 54  GLY n 
1 55  ASP n 
1 56  GLY n 
1 57  PRO n 
1 58  ASP n 
1 59  ILE n 
1 60  ILE n 
1 61  PHE n 
1 62  TRP n 
1 63  ALA n 
1 64  HIS n 
1 65  ASP n 
1 66  ARG n 
1 67  PHE n 
1 68  GLY n 
1 69  GLY n 
1 70  TYR n 
1 71  ALA n 
1 72  GLN n 
1 73  SER n 
1 74  GLY n 
1 75  LEU n 
1 76  LEU n 
1 77  ALA n 
1 78  GLU n 
1 79  ILE n 
1 80  THR n 
1 81  PRO n 
1 82  ASP n 
1 83  LYS n 
1 84  ALA n 
1 85  PHE n 
1 86  GLN n 
1 87  ASP n 
1 88  LYS n 
1 89  LEU n 
1 90  TYR n 
1 91  PRO n 
1 92  PHE n 
1 93  THR n 
1 94  TRP n 
1 95  ASP n 
1 96  ALA n 
1 97  VAL n 
1 98  ARG n 
1 99  TYR n 
1 100 ASN n 
1 101 GLY n 
1 102 LYS n 
1 103 LEU n 
1 104 ILE n 
1 105 ALA n 
1 106 TYR n 
1 107 PRO n 
1 108 ILE n 
1 109 ALA n 
1 110 VAL n 
1 111 GLU n 
1 112 ALA n 
1 113 LEU n 
1 114 SER n 
1 115 LEU n 
1 116 ILE n 
1 117 TYR n 
1 118 ASN n 
1 119 LYS n 
1 120 ASP n 
1 121 LEU n 
1 122 LEU n 
1 123 PRO n 
1 124 ASN n 
1 125 PRO n 
1 126 PRO n 
1 127 LYS n 
1 128 THR n 
1 129 TRP n 
1 130 GLU n 
1 131 GLU n 
1 132 ILE n 
1 133 PRO n 
1 134 ALA n 
1 135 LEU n 
1 136 ASP n 
1 137 LYS n 
1 138 GLU n 
1 139 LEU n 
1 140 LYS n 
1 141 ALA n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 SER n 
1 146 ALA n 
1 147 LEU n 
1 148 MET n 
1 149 PHE n 
1 150 ASN n 
1 151 LEU n 
1 152 GLN n 
1 153 GLU n 
1 154 PRO n 
1 155 TYR n 
1 156 PHE n 
1 157 THR n 
1 158 TRP n 
1 159 PRO n 
1 160 LEU n 
1 161 ILE n 
1 162 ALA n 
1 163 ALA n 
1 164 ASP n 
1 165 GLY n 
1 166 GLY n 
1 167 TYR n 
1 168 ALA n 
1 169 PHE n 
1 170 LYS n 
1 171 TYR n 
1 172 GLU n 
1 173 ASN n 
1 174 GLY n 
1 175 LYS n 
1 176 TYR n 
1 177 ASP n 
1 178 ILE n 
1 179 LYS n 
1 180 ASP n 
1 181 VAL n 
1 182 GLY n 
1 183 VAL n 
1 184 ASP n 
1 185 ASN n 
1 186 ALA n 
1 187 GLY n 
1 188 ALA n 
1 189 LYS n 
1 190 ALA n 
1 191 GLY n 
1 192 LEU n 
1 193 THR n 
1 194 PHE n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 LEU n 
1 199 ILE n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 HIS n 
1 204 MET n 
1 205 ASN n 
1 206 ALA n 
1 207 ASP n 
1 208 THR n 
1 209 ASP n 
1 210 TYR n 
1 211 CYS n 
1 212 ILE n 
1 213 ALA n 
1 214 GLU n 
1 215 ALA n 
1 216 ALA n 
1 217 PHE n 
1 218 ASN n 
1 219 LYS n 
1 220 GLY n 
1 221 GLU n 
1 222 THR n 
1 223 ALA n 
1 224 MET n 
1 225 THR n 
1 226 ILE n 
1 227 ASN n 
1 228 GLY n 
1 229 PRO n 
1 230 TRP n 
1 231 ALA n 
1 232 TRP n 
1 233 SER n 
1 234 ASN n 
1 235 ILE n 
1 236 ASP n 
1 237 THR n 
1 238 SER n 
1 239 LYS n 
1 240 VAL n 
1 241 ASN n 
1 242 TYR n 
1 243 GLY n 
1 244 VAL n 
1 245 THR n 
1 246 VAL n 
1 247 LEU n 
1 248 PRO n 
1 249 THR n 
1 250 PHE n 
1 251 LYS n 
1 252 GLY n 
1 253 GLN n 
1 254 PRO n 
1 255 SER n 
1 256 LYS n 
1 257 PRO n 
1 258 PHE n 
1 259 VAL n 
1 260 GLY n 
1 261 VAL n 
1 262 LEU n 
1 263 SER n 
1 264 ALA n 
1 265 GLY n 
1 266 ILE n 
1 267 ASN n 
1 268 ALA n 
1 269 ALA n 
1 270 SER n 
1 271 PRO n 
1 272 ASN n 
1 273 LYS n 
1 274 GLU n 
1 275 LEU n 
1 276 ALA n 
1 277 LYS n 
1 278 GLU n 
1 279 PHE n 
1 280 LEU n 
1 281 GLU n 
1 282 ASN n 
1 283 TYR n 
1 284 LEU n 
1 285 LEU n 
1 286 THR n 
1 287 ASP n 
1 288 GLU n 
1 289 GLY n 
1 290 LEU n 
1 291 GLU n 
1 292 ALA n 
1 293 VAL n 
1 294 ASN n 
1 295 LYS n 
1 296 ASP n 
1 297 LYS n 
1 298 PRO n 
1 299 LEU n 
1 300 GLY n 
1 301 ALA n 
1 302 VAL n 
1 303 ALA n 
1 304 LEU n 
1 305 LYS n 
1 306 SER n 
1 307 TYR n 
1 308 GLU n 
1 309 GLU n 
1 310 GLU n 
1 311 LEU n 
1 312 ALA n 
1 313 LYS n 
1 314 ASP n 
1 315 PRO n 
1 316 ARG n 
1 317 ILE n 
1 318 ALA n 
1 319 ALA n 
1 320 THR n 
1 321 MET n 
1 322 GLU n 
1 323 ASN n 
1 324 ALA n 
1 325 GLN n 
1 326 LYS n 
1 327 GLY n 
1 328 GLU n 
1 329 ILE n 
1 330 MET n 
1 331 PRO n 
1 332 ASN n 
1 333 ILE n 
1 334 PRO n 
1 335 GLN n 
1 336 MET n 
1 337 SER n 
1 338 ALA n 
1 339 PHE n 
1 340 TRP n 
1 341 TYR n 
1 342 ALA n 
1 343 VAL n 
1 344 ARG n 
1 345 THR n 
1 346 ALA n 
1 347 VAL n 
1 348 ILE n 
1 349 ASN n 
1 350 ALA n 
1 351 ALA n 
1 352 SER n 
1 353 GLY n 
1 354 ARG n 
1 355 GLN n 
1 356 THR n 
1 357 VAL n 
1 358 ASP n 
1 359 GLU n 
1 360 ALA n 
1 361 LEU n 
1 362 LYS n 
1 363 ASP n 
1 364 ALA n 
1 365 GLN n 
1 366 THR n 
1 367 ARG n 
1 368 ILE n 
1 369 THR n 
1 370 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)STAR' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET11A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MALE_ECO57 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P0AEY0 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2V93 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 370 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0AEY0 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  396 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       370 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2V93 CYS A 41  ? UNP P0AEY0 ASP 67  'engineered mutation' 41  1 
1 2V93 CYS A 211 ? UNP P0AEY0 SER 237 'engineered mutation' 211 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                             ? 'C5 H11 N O2 S'  149.211 
MXT non-polymer         . '1-(1-HYDROXY-2,2,6,6-TETRAMETHYLPIPERIDIN-4-YL)PYRROLIDINE-2,5-DIONE' ? 'C13 H22 N2 O3'  254.325 
PHE 'L-peptide linking' y PHENYLALANINE                                                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                 ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 'TRIPLE RESONANCE FOR ASSIGNMENT OF PROTEIN'                                                   1 
2 1 '2D HETERONUCLEAR FOR DIPOLAR COUPLING MEASUREMENTS IN LIQUID CRYSTALLINE MEDIUM OF PHAGE PF1' 1 
3 1 '2D TROSY- BASED INTERLEAVED 1H-T2 1H- 15N CORRELATION EXPERIMENTS'                            1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            310.0 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1.0 
_pdbx_nmr_exptl_sample_conditions.pH                     7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '0MM NACL' 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      '10MM TRIS-HCL' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           2V93 
_pdbx_nmr_refine.method             'CONJOINED RIGID BODY/TORSION ANGLE SIMULATED ANNEALING DYNAMICS' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2V93 
_pdbx_nmr_details.text       
;REFINEMENT OF THE MINOR FORM OF APO MBP WAS CARRIED OUT BY CONJOINED RIGID BODY AND TORSION ANGLE SIMULATED ANNEALING SUBJECT TO A TARGET FUNCTION COMPRISING A PRE PEUDOPOTENTIAL, A QUARTIC VAN DER WAALS REPULSION TERM TO PREVENT ATOMIC OVERLAP, A MULTIDIMENSIONAL TORSION ANGLE DATABASE OF MEAN FORCE, AND APPROPRIATE TORSION ANGLE AND HYDROGEN BONDING DISTANCE RESTRAINTS WITHIN THE LINKER. THE CALCULATED GAMMA2 RATES ARE GIVEN BY A POPULATION WEIGHTED AVERAGE OF THE GAMMA2 RATES OF THE MAJOR (OPEN, 1OMP) AND MINOR STATES OF MBP. THE MINOR FORM OF APO MBP ( 5 PERCENT OCCUPANCY, CHAIN C) IS REPRESENTED BY A SECOND CONFORMER ALLOWING RIGID-BODY INTERDOMAIN MOVEMENT BY GIVING THE LINKER REGIONS (RESIDUES 106-114, 252-265 AND 314-333) FULL TORSIONAL DEGREES OF FREEDOM (WITH THE EXCEPTION OF THE HELIX, RESIDUES 315-326, WHOSE BACKBONE IS ALSO TREATED AS A RIGID BODY). THE STRUCTURE OF THE MAJOR (95 PERCENT OCCUPANCY, CHAIN O) IS FIXED DURING THE CALCULATION TO THAT OF THE CRYSTAL STRUCTURE OF APO MBP ( 1OMP). THE PARAMAGNETIC PROBES (MALEIMIDE-TEMPO, MXT) AT POSITIONS 41 (D41C) AND 211 (S211C) ARE REPRESENTED BY A SIX-CONFORMER ENSEMBLE FOR BOTH THE MAJOR OPEN AND MINOR CLOSED STATES (ALTLOC A-F, A-C AND D-F ARE FOR THE TWO DIFFERENT ENANTIOMERS OF CONJUGATED MALEIMIDE-TEMPO). ONLY THE BACKBONE COORDINATES AND THE COORDINATES OF THE PARAMAGNETIC PROBE (RESIDUES 500 AND 600) ARE DEPOSITED.
;
# 
_pdbx_nmr_ensemble.entry_id                             2V93 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    50 
_pdbx_nmr_ensemble.conformer_selection_criteria         'PRE AND VDW ENERGIES' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           NIH       ? 
;SCHWIETERS, KUSZEWSKI, CLORE OTHER REFINEMENT REMARKS. REFINEMENT OF THE MINOR FORM OF APO MBP WAS CARRIED OUT BY CONJOINED RIGID BODY/TORSION ANGLE SIMULATED ANNEALING SUBJECT TO A TARGET FUNCTION COMPRISING A PRE PEUDOPOTENTIAL, A QUARTIC VAN DER WAALS REPULSION TERM TO PREVENT ATOMIC OVERLAP, A MULTIDIMENSIONAL TORS
;
1 
'structure solution' XPLOR-NIH ? ? 2 
# 
_exptl.entry_id          2V93 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2V93 
_struct.title                     
;EQUILLIBRIUM MIXTURE OF OPEN AND PARTIALLY-CLOSED SPECIES IN THE APO STATE OF MALTODEXTRIN-BINDING PROTEIN BY PARAMAGNETIC RELAXATION ENHANCEMENT NMR
;
_struct.pdbx_descriptor           'MALTOSE-BINDING PERIPLASMIC PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2V93 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
;MBP, PRE, PERIPLASM, TRANSPORT, DOMAIN MOTION, RAPID CONFORMATIONAL EXCHANGE, TRANSPORT PROTEIN, SUGAR TRANSPORT, MINOR SPECIES IN SOLUTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 16  ? GLY A 32  ? GLY A 16  GLY A 32  1 ? 17 
HELX_P HELX_P2  2  LYS A 42  ? ALA A 52  ? LYS A 42  ALA A 52  1 ? 11 
HELX_P HELX_P3  3  ALA A 63  ? ASP A 65  ? ALA A 63  ASP A 65  5 ? 3  
HELX_P HELX_P4  4  ARG A 66  ? SER A 73  ? ARG A 66  SER A 73  1 ? 8  
HELX_P HELX_P5  5  ASP A 82  ? ASP A 87  ? ASP A 82  ASP A 87  1 ? 6  
HELX_P HELX_P6  6  TYR A 90  ? ASP A 95  ? TYR A 90  ASP A 95  1 ? 6  
HELX_P HELX_P7  7  GLU A 131 ? ALA A 141 ? GLU A 131 ALA A 141 1 ? 11 
HELX_P HELX_P8  8  GLU A 153 ? ASP A 164 ? GLU A 153 ASP A 164 1 ? 12 
HELX_P HELX_P9  9  ASN A 185 ? ASN A 201 ? ASN A 185 ASN A 201 1 ? 17 
HELX_P HELX_P10 10 ASP A 209 ? LYS A 219 ? ASP A 209 LYS A 219 1 ? 11 
HELX_P HELX_P11 11 GLY A 228 ? TRP A 230 ? GLY A 228 TRP A 230 5 ? 3  
HELX_P HELX_P12 12 ALA A 231 ? LYS A 239 ? ALA A 231 LYS A 239 1 ? 9  
HELX_P HELX_P13 13 ASN A 272 ? TYR A 283 ? ASN A 272 TYR A 283 1 ? 12 
HELX_P HELX_P14 14 THR A 286 ? LYS A 297 ? THR A 286 LYS A 297 1 ? 12 
HELX_P HELX_P15 15 LEU A 304 ? ALA A 312 ? LEU A 304 ALA A 312 1 ? 9  
HELX_P HELX_P16 16 ASP A 314 ? GLY A 327 ? ASP A 314 GLY A 327 1 ? 14 
HELX_P HELX_P17 17 GLN A 335 ? SER A 352 ? GLN A 335 SER A 352 1 ? 18 
HELX_P HELX_P18 18 THR A 356 ? THR A 369 ? THR A 356 THR A 369 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A CYS 41  SG A ? ? 1_555 B MXT . C11 A ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.724 ? 
covale2  covale ? ? A CYS 41  SG B ? ? 1_555 B MXT . C11 B ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.740 ? 
covale3  covale ? ? A CYS 41  SG C ? ? 1_555 B MXT . C11 C ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.734 ? 
covale4  covale ? ? A CYS 41  SG D ? ? 1_555 B MXT . C11 D ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.733 ? 
covale5  covale ? ? A CYS 41  SG E ? ? 1_555 B MXT . C11 E ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.736 ? 
covale6  covale ? ? A CYS 41  SG F ? ? 1_555 B MXT . C11 F ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.721 ? 
covale7  covale ? ? A CYS 41  SG U ? ? 1_555 B MXT . C11 U ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.724 ? 
covale8  covale ? ? A CYS 41  SG V ? ? 1_555 B MXT . C11 V ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.740 ? 
covale9  covale ? ? A CYS 41  SG W ? ? 1_555 B MXT . C11 W ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.734 ? 
covale10 covale ? ? A CYS 41  SG X ? ? 1_555 B MXT . C11 X ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.732 ? 
covale11 covale ? ? A CYS 41  SG Y ? ? 1_555 B MXT . C11 Y ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.737 ? 
covale12 covale ? ? A CYS 41  SG Z ? ? 1_555 B MXT . C11 Z ? A CYS 41  A MXT 500 1_555 ? ? ? ? ? ? ? 1.721 ? 
covale13 covale ? ? A CYS 211 SG A ? ? 1_555 C MXT . C11 A ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.725 ? 
covale14 covale ? ? A CYS 211 SG B ? ? 1_555 C MXT . C11 B ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.735 ? 
covale15 covale ? ? A CYS 211 SG C ? ? 1_555 C MXT . C11 C ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.730 ? 
covale16 covale ? ? A CYS 211 SG D ? ? 1_555 C MXT . C11 D ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.736 ? 
covale17 covale ? ? A CYS 211 SG E ? ? 1_555 C MXT . C11 E ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.742 ? 
covale18 covale ? ? A CYS 211 SG F ? ? 1_555 C MXT . C11 F ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.735 ? 
covale19 covale ? ? A CYS 211 SG U ? ? 1_555 C MXT . C11 U ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.725 ? 
covale20 covale ? ? A CYS 211 SG V ? ? 1_555 C MXT . C11 V ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.734 ? 
covale21 covale ? ? A CYS 211 SG W ? ? 1_555 C MXT . C11 W ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.731 ? 
covale22 covale ? ? A CYS 211 SG X ? ? 1_555 C MXT . C11 X ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.735 ? 
covale23 covale ? ? A CYS 211 SG Y ? ? 1_555 C MXT . C11 Y ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.741 ? 
covale24 covale ? ? A CYS 211 SG Z ? ? 1_555 C MXT . C11 Z ? A CYS 211 A MXT 600 1_555 ? ? ? ? ? ? ? 1.736 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 2 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 35  ? GLU A 38  ? VAL A 35  GLU A 38  
AA 2 LEU A 7   ? TRP A 10  ? LEU A 7   TRP A 10  
AA 3 ILE A 59  ? ILE A 60  ? ILE A 59  ILE A 60  
AB 1 ARG A 98  ? TYR A 99  ? ARG A 98  TYR A 99  
AB 2 LYS A 102 ? LEU A 103 ? LYS A 102 LEU A 103 
AC 1 SER A 145 ? LEU A 147 ? SER A 145 LEU A 147 
AC 2 THR A 222 ? ASN A 227 ? THR A 222 ASN A 227 
AC 3 SER A 114 ? ASN A 118 ? SER A 114 ASN A 118 
AC 4 TYR A 242 ? THR A 245 ? TYR A 242 THR A 245 
AD 1 TYR A 167 ? TYR A 171 ? TYR A 167 TYR A 171 
AD 2 TYR A 176 ? GLY A 182 ? TYR A 176 GLY A 182 
AE 1 THR A 249 ? PHE A 250 ? THR A 249 PHE A 250 
AE 2 GLN A 253 ? PRO A 254 ? GLN A 253 PRO A 254 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 36  ? N THR A 36  O LEU A 7   ? O LEU A 7   
AA 2 3 N TRP A 10  ? N TRP A 10  O ILE A 59  ? O ILE A 59  
AB 1 2 N TYR A 99  ? N TYR A 99  O LYS A 102 ? O LYS A 102 
AC 1 2 O SER A 145 ? O SER A 145 N ALA A 223 ? N ALA A 223 
AC 2 3 N ASN A 227 ? N ASN A 227 O SER A 114 ? O SER A 114 
AC 3 4 N TYR A 117 ? N TYR A 117 O GLY A 243 ? O GLY A 243 
AD 1 2 O LYS A 170 ? O LYS A 170 N ASP A 177 ? N ASP A 177 
AE 1 2 N PHE A 250 ? N PHE A 250 O GLN A 253 ? O GLN A 253 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MXT A 500' 
AC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE MXT A 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ASN A 12  ? ASN A 12  . ? 1_555 ? 
2  AC1 12 GLY A 13  ? GLY A 13  . ? 1_555 ? 
3  AC1 12 ASP A 14  ? ASP A 14  . ? 1_555 ? 
4  AC1 12 HIS A 39  ? HIS A 39  . ? 1_555 ? 
5  AC1 12 PRO A 40  ? PRO A 40  . ? 1_555 ? 
6  AC1 12 CYS A 41  ? CYS A 41  . ? 1_555 ? 
7  AC1 12 LYS A 42  ? LYS A 42  . ? 1_555 ? 
8  AC1 12 GLU A 153 ? GLU A 153 . ? 1_555 ? 
9  AC1 12 PRO A 154 ? PRO A 154 . ? 1_555 ? 
10 AC1 12 TYR A 155 ? TYR A 155 . ? 1_555 ? 
11 AC1 12 SER A 337 ? SER A 337 . ? 1_555 ? 
12 AC1 12 TRP A 340 ? TRP A 340 . ? 1_555 ? 
13 AC2 27 MET A 148 ? MET A 148 . ? 1_555 ? 
14 AC2 27 PHE A 149 ? PHE A 149 . ? 1_555 ? 
15 AC2 27 ASN A 150 ? ASN A 150 . ? 1_555 ? 
16 AC2 27 LEU A 151 ? LEU A 151 . ? 1_555 ? 
17 AC2 27 GLN A 152 ? GLN A 152 . ? 1_555 ? 
18 AC2 27 GLU A 153 ? GLU A 153 . ? 1_555 ? 
19 AC2 27 PRO A 154 ? PRO A 154 . ? 1_555 ? 
20 AC2 27 TYR A 155 ? TYR A 155 . ? 1_555 ? 
21 AC2 27 PHE A 156 ? PHE A 156 . ? 1_555 ? 
22 AC2 27 THR A 157 ? THR A 157 . ? 1_555 ? 
23 AC2 27 TRP A 158 ? TRP A 158 . ? 1_555 ? 
24 AC2 27 PRO A 159 ? PRO A 159 . ? 1_555 ? 
25 AC2 27 LEU A 160 ? LEU A 160 . ? 1_555 ? 
26 AC2 27 ILE A 161 ? ILE A 161 . ? 1_555 ? 
27 AC2 27 ALA A 162 ? ALA A 162 . ? 1_555 ? 
28 AC2 27 GLY A 191 ? GLY A 191 . ? 1_555 ? 
29 AC2 27 LEU A 192 ? LEU A 192 . ? 1_555 ? 
30 AC2 27 THR A 193 ? THR A 193 . ? 1_555 ? 
31 AC2 27 PHE A 194 ? PHE A 194 . ? 1_555 ? 
32 AC2 27 LEU A 195 ? LEU A 195 . ? 1_555 ? 
33 AC2 27 VAL A 196 ? VAL A 196 . ? 1_555 ? 
34 AC2 27 ASP A 197 ? ASP A 197 . ? 1_555 ? 
35 AC2 27 LEU A 198 ? LEU A 198 . ? 1_555 ? 
36 AC2 27 CYS A 211 ? CYS A 211 . ? 1_555 ? 
37 AC2 27 LYS A 256 ? LYS A 256 . ? 1_555 ? 
38 AC2 27 PRO A 257 ? PRO A 257 . ? 1_555 ? 
39 AC2 27 PHE A 258 ? PHE A 258 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2V93 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2V93 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . GLY A 1 5   ? -19.436 18.281  47.658 1.00  0.00 ? 5   GLY A N    1  
ATOM   2      C CA   . GLY A 1 5   ? -20.256 17.263  46.989 1.00  0.00 ? 5   GLY A CA   1  
ATOM   3      C C    . GLY A 1 5   ? -19.681 16.619  45.734 1.00  0.00 ? 5   GLY A C    1  
ATOM   4      O O    . GLY A 1 5   ? -20.381 15.911  44.984 1.00  0.00 ? 5   GLY A O    1  
ATOM   5      N N    . LYS A 1 6   ? -18.410 16.871  45.483 1.00  0.00 ? 6   LYS A N    1  
ATOM   6      C CA   . LYS A 1 6   ? -17.701 16.290  44.352 1.00  0.00 ? 6   LYS A CA   1  
ATOM   7      C C    . LYS A 1 6   ? -16.238 16.160  44.725 1.00  0.00 ? 6   LYS A C    1  
ATOM   8      O O    . LYS A 1 6   ? -15.856 16.416  45.876 1.00  0.00 ? 6   LYS A O    1  
ATOM   9      H H    . LYS A 1 6   ? -17.914 17.447  46.103 1.00  0.00 ? 6   LYS A H    1  
ATOM   10     N N    . LEU A 1 7   ? -15.448 15.679  43.787 1.00  0.00 ? 7   LEU A N    1  
ATOM   11     C CA   . LEU A 1 7   ? -13.994 15.539  44.048 1.00  0.00 ? 7   LEU A CA   1  
ATOM   12     C C    . LEU A 1 7   ? -13.247 16.164  42.881 1.00  0.00 ? 7   LEU A C    1  
ATOM   13     O O    . LEU A 1 7   ? -13.594 16.051  41.722 1.00  0.00 ? 7   LEU A O    1  
ATOM   14     H H    . LEU A 1 7   ? -15.816 15.432  42.914 1.00  0.00 ? 7   LEU A H    1  
ATOM   15     N N    . VAL A 1 8   ? -12.240 16.944  43.210 1.00  0.00 ? 8   VAL A N    1  
ATOM   16     C CA   . VAL A 1 8   ? -11.351 17.522  42.203 1.00  0.00 ? 8   VAL A CA   1  
ATOM   17     C C    . VAL A 1 8   ? -9.954  17.034  42.623 1.00  0.00 ? 8   VAL A C    1  
ATOM   18     O O    . VAL A 1 8   ? -9.566  17.009  43.781 1.00  0.00 ? 8   VAL A O    1  
ATOM   19     H H    . VAL A 1 8   ? -12.032 17.076  44.159 1.00  0.00 ? 8   VAL A H    1  
ATOM   20     N N    . ILE A 1 9   ? -9.302  16.490  41.606 1.00  0.00 ? 9   ILE A N    1  
ATOM   21     C CA   . ILE A 1 9   ? -7.951  15.929  41.766 1.00  0.00 ? 9   ILE A CA   1  
ATOM   22     C C    . ILE A 1 9   ? -6.985  16.595  40.789 1.00  0.00 ? 9   ILE A C    1  
ATOM   23     O O    . ILE A 1 9   ? -7.370  16.900  39.660 1.00  0.00 ? 9   ILE A O    1  
ATOM   24     H H    . ILE A 1 9   ? -9.736  16.446  40.729 1.00  0.00 ? 9   ILE A H    1  
ATOM   25     N N    . TRP A 1 10  ? -5.792  16.784  41.289 1.00  0.00 ? 10  TRP A N    1  
ATOM   26     C CA   . TRP A 1 10  ? -4.654  17.363  40.578 1.00  0.00 ? 10  TRP A CA   1  
ATOM   27     C C    . TRP A 1 10  ? -3.522  16.342  40.531 1.00  0.00 ? 10  TRP A C    1  
ATOM   28     O O    . TRP A 1 10  ? -3.092  15.793  41.548 1.00  0.00 ? 10  TRP A O    1  
ATOM   29     H H    . TRP A 1 10  ? -5.641  16.490  42.212 1.00  0.00 ? 10  TRP A H    1  
ATOM   30     N N    . ILE A 1 11  ? -3.062  16.105  39.325 1.00  0.00 ? 11  ILE A N    1  
ATOM   31     C CA   . ILE A 1 11  ? -1.975  15.158  39.055 1.00  0.00 ? 11  ILE A CA   1  
ATOM   32     C C    . ILE A 1 11  ? -1.195  15.730  37.888 1.00  0.00 ? 11  ILE A C    1  
ATOM   33     O O    . ILE A 1 11  ? -1.783  16.434  37.066 1.00  0.00 ? 11  ILE A O    1  
ATOM   34     H H    . ILE A 1 11  ? -3.463  16.584  38.569 1.00  0.00 ? 11  ILE A H    1  
ATOM   35     N N    . ASN A 1 12  ? 0.072   15.467  37.812 1.00  0.00 ? 12  ASN A N    1  
ATOM   36     C CA   . ASN A 1 12  ? 0.920   15.955  36.701 1.00  0.00 ? 12  ASN A CA   1  
ATOM   37     C C    . ASN A 1 12  ? 0.487   15.306  35.373 1.00  0.00 ? 12  ASN A C    1  
ATOM   38     O O    . ASN A 1 12  ? 0.082   14.148  35.323 1.00  0.00 ? 12  ASN A O    1  
ATOM   39     H H    . ASN A 1 12  ? 0.481   14.910  38.507 1.00  0.00 ? 12  ASN A H    1  
ATOM   40     N N    . GLY A 1 13  ? 0.640   16.082  34.315 1.00  0.00 ? 13  GLY A N    1  
ATOM   41     C CA   . GLY A 1 13  ? 0.348   15.726  32.946 1.00  0.00 ? 13  GLY A CA   1  
ATOM   42     C C    . GLY A 1 13  ? 1.094   14.523  32.386 1.00  0.00 ? 13  GLY A C    1  
ATOM   43     O O    . GLY A 1 13  ? 0.583   13.875  31.441 1.00  0.00 ? 13  GLY A O    1  
ATOM   44     H H    . GLY A 1 13  ? 1.005   16.978  34.472 1.00  0.00 ? 13  GLY A H    1  
ATOM   45     N N    . ASP A 1 14  ? 2.190   14.156  32.951 1.00  0.00 ? 14  ASP A N    1  
ATOM   46     C CA   . ASP A 1 14  ? 3.074   13.047  32.589 1.00  0.00 ? 14  ASP A CA   1  
ATOM   47     C C    . ASP A 1 14  ? 2.699   11.718  33.251 1.00  0.00 ? 14  ASP A C    1  
ATOM   48     O O    . ASP A 1 14  ? 3.467   10.726  33.217 1.00  0.00 ? 14  ASP A O    1  
ATOM   49     H H    . ASP A 1 14  ? 2.472   14.692  33.721 1.00  0.00 ? 14  ASP A H    1  
ATOM   50     N N    . LYS A 1 15  ? 1.550   11.692  33.888 1.00  0.00 ? 15  LYS A N    1  
ATOM   51     C CA   . LYS A 1 15  ? 0.986   10.561  34.614 1.00  0.00 ? 15  LYS A CA   1  
ATOM   52     C C    . LYS A 1 15  ? -0.299  10.094  33.936 1.00  0.00 ? 15  LYS A C    1  
ATOM   53     O O    . LYS A 1 15  ? -0.859  10.787  33.108 1.00  0.00 ? 15  LYS A O    1  
ATOM   54     H H    . LYS A 1 15  ? 1.027   12.521  33.888 1.00  0.00 ? 15  LYS A H    1  
ATOM   55     N N    . GLY A 1 16  ? -0.750  8.945   34.379 1.00  0.00 ? 16  GLY A N    1  
ATOM   56     C CA   . GLY A 1 16  ? -1.941  8.334   33.816 1.00  0.00 ? 16  GLY A CA   1  
ATOM   57     C C    . GLY A 1 16  ? -3.210  8.947   34.367 1.00  0.00 ? 16  GLY A C    1  
ATOM   58     O O    . GLY A 1 16  ? -3.973  8.236   35.038 1.00  0.00 ? 16  GLY A O    1  
ATOM   59     H H    . GLY A 1 16  ? -0.258  8.476   35.084 1.00  0.00 ? 16  GLY A H    1  
ATOM   60     N N    . TYR A 1 17  ? -3.414  10.206  34.041 1.00  0.00 ? 17  TYR A N    1  
ATOM   61     C CA   . TYR A 1 17  ? -4.633  10.902  34.494 1.00  0.00 ? 17  TYR A CA   1  
ATOM   62     C C    . TYR A 1 17  ? -5.889  10.477  33.771 1.00  0.00 ? 17  TYR A C    1  
ATOM   63     O O    . TYR A 1 17  ? -7.020  10.829  34.172 1.00  0.00 ? 17  TYR A O    1  
ATOM   64     H H    . TYR A 1 17  ? -2.763  10.676  33.479 1.00  0.00 ? 17  TYR A H    1  
ATOM   65     N N    . ASN A 1 18  ? -5.764  9.742   32.675 1.00  0.00 ? 18  ASN A N    1  
ATOM   66     C CA   . ASN A 1 18  ? -6.914  9.241   31.901 1.00  0.00 ? 18  ASN A CA   1  
ATOM   67     C C    . ASN A 1 18  ? -7.367  7.963   32.612 1.00  0.00 ? 18  ASN A C    1  
ATOM   68     O O    . ASN A 1 18  ? -8.562  7.662   32.656 1.00  0.00 ? 18  ASN A O    1  
ATOM   69     H H    . ASN A 1 18  ? -4.863  9.503   32.375 1.00  0.00 ? 18  ASN A H    1  
ATOM   70     N N    . GLY A 1 19  ? -6.402  7.253   33.115 1.00  0.00 ? 19  GLY A N    1  
ATOM   71     C CA   . GLY A 1 19  ? -6.681  5.997   33.862 1.00  0.00 ? 19  GLY A CA   1  
ATOM   72     C C    . GLY A 1 19  ? -7.287  6.388   35.208 1.00  0.00 ? 19  GLY A C    1  
ATOM   73     O O    . GLY A 1 19  ? -8.183  5.705   35.721 1.00  0.00 ? 19  GLY A O    1  
ATOM   74     H H    . GLY A 1 19  ? -5.476  7.559   33.016 1.00  0.00 ? 19  GLY A H    1  
ATOM   75     N N    . LEU A 1 20  ? -6.741  7.455   35.789 1.00  0.00 ? 20  LEU A N    1  
ATOM   76     C CA   . LEU A 1 20  ? -7.274  7.941   37.073 1.00  0.00 ? 20  LEU A CA   1  
ATOM   77     C C    . LEU A 1 20  ? -8.708  8.448   36.858 1.00  0.00 ? 20  LEU A C    1  
ATOM   78     O O    . LEU A 1 20  ? -9.542  8.187   37.752 1.00  0.00 ? 20  LEU A O    1  
ATOM   79     H H    . LEU A 1 20  ? -6.003  7.930   35.352 1.00  0.00 ? 20  LEU A H    1  
ATOM   80     N N    . ALA A 1 21  ? -9.002  9.116   35.762 1.00  0.00 ? 21  ALA A N    1  
ATOM   81     C CA   . ALA A 1 21  ? -10.327 9.587   35.408 1.00  0.00 ? 21  ALA A CA   1  
ATOM   82     C C    . ALA A 1 21  ? -11.287 8.402   35.234 1.00  0.00 ? 21  ALA A C    1  
ATOM   83     O O    . ALA A 1 21  ? -12.493 8.630   35.396 1.00  0.00 ? 21  ALA A O    1  
ATOM   84     H H    . ALA A 1 21  ? -8.280  9.268   35.118 1.00  0.00 ? 21  ALA A H    1  
ATOM   85     N N    . GLU A 1 22  ? -10.822 7.220   34.910 1.00  0.00 ? 22  GLU A N    1  
ATOM   86     C CA   . GLU A 1 22  ? -11.568 5.995   34.743 1.00  0.00 ? 22  GLU A CA   1  
ATOM   87     C C    . GLU A 1 22  ? -11.933 5.325   36.064 1.00  0.00 ? 22  GLU A C    1  
ATOM   88     O O    . GLU A 1 22  ? -12.943 4.591   36.176 1.00  0.00 ? 22  GLU A O    1  
ATOM   89     H H    . GLU A 1 22  ? -9.852  7.156   34.790 1.00  0.00 ? 22  GLU A H    1  
ATOM   90     N N    . VAL A 1 23  ? -11.090 5.531   37.072 1.00  0.00 ? 23  VAL A N    1  
ATOM   91     C CA   . VAL A 1 23  ? -11.358 4.994   38.417 1.00  0.00 ? 23  VAL A CA   1  
ATOM   92     C C    . VAL A 1 23  ? -12.497 5.865   38.989 1.00  0.00 ? 23  VAL A C    1  
ATOM   93     O O    . VAL A 1 23  ? -13.354 5.398   39.733 1.00  0.00 ? 23  VAL A O    1  
ATOM   94     H H    . VAL A 1 23  ? -10.296 6.087   36.927 1.00  0.00 ? 23  VAL A H    1  
ATOM   95     N N    . GLY A 1 24  ? -12.446 7.101   38.578 1.00  0.00 ? 24  GLY A N    1  
ATOM   96     C CA   . GLY A 1 24  ? -13.385 8.138   38.944 1.00  0.00 ? 24  GLY A CA   1  
ATOM   97     C C    . GLY A 1 24  ? -14.791 7.925   38.412 1.00  0.00 ? 24  GLY A C    1  
ATOM   98     O O    . GLY A 1 24  ? -15.758 8.309   39.073 1.00  0.00 ? 24  GLY A O    1  
ATOM   99     H H    . GLY A 1 24  ? -11.717 7.345   37.969 1.00  0.00 ? 24  GLY A H    1  
ATOM   100    N N    . LYS A 1 25  ? -14.898 7.359   37.218 1.00  0.00 ? 25  LYS A N    1  
ATOM   101    C CA   . LYS A 1 25  ? -16.181 7.078   36.573 1.00  0.00 ? 25  LYS A CA   1  
ATOM   102    C C    . LYS A 1 25  ? -16.842 5.933   37.321 1.00  0.00 ? 25  LYS A C    1  
ATOM   103    O O    . LYS A 1 25  ? -18.057 5.921   37.592 1.00  0.00 ? 25  LYS A O    1  
ATOM   104    H H    . LYS A 1 25  ? -14.076 7.111   36.745 1.00  0.00 ? 25  LYS A H    1  
ATOM   105    N N    . LYS A 1 26  ? -16.050 4.980   37.719 1.00  0.00 ? 26  LYS A N    1  
ATOM   106    C CA   . LYS A 1 26  ? -16.455 3.830   38.525 1.00  0.00 ? 26  LYS A CA   1  
ATOM   107    C C    . LYS A 1 26  ? -16.947 4.321   39.888 1.00  0.00 ? 26  LYS A C    1  
ATOM   108    O O    . LYS A 1 26  ? -17.947 3.802   40.445 1.00  0.00 ? 26  LYS A O    1  
ATOM   109    H H    . LYS A 1 26  ? -15.097 5.068   37.507 1.00  0.00 ? 26  LYS A H    1  
ATOM   110    N N    . PHE A 1 27  ? -16.262 5.315   40.463 1.00  0.00 ? 27  PHE A N    1  
ATOM   111    C CA   . PHE A 1 27  ? -16.655 5.863   41.772 1.00  0.00 ? 27  PHE A CA   1  
ATOM   112    C C    . PHE A 1 27  ? -18.006 6.568   41.605 1.00  0.00 ? 27  PHE A C    1  
ATOM   113    O O    . PHE A 1 27  ? -18.891 6.370   42.453 1.00  0.00 ? 27  PHE A O    1  
ATOM   114    H H    . PHE A 1 27  ? -15.482 5.689   40.002 1.00  0.00 ? 27  PHE A H    1  
ATOM   115    N N    . GLU A 1 28  ? -18.140 7.348   40.581 1.00  0.00 ? 28  GLU A N    1  
ATOM   116    C CA   . GLU A 1 28  ? -19.345 8.112   40.279 1.00  0.00 ? 28  GLU A CA   1  
ATOM   117    C C    . GLU A 1 28  ? -20.545 7.208   40.027 1.00  0.00 ? 28  GLU A C    1  
ATOM   118    O O    . GLU A 1 28  ? -21.692 7.652   40.114 1.00  0.00 ? 28  GLU A O    1  
ATOM   119    H H    . GLU A 1 28  ? -17.376 7.441   39.975 1.00  0.00 ? 28  GLU A H    1  
ATOM   120    N N    . LYS A 1 29  ? -20.264 5.957   39.730 1.00  0.00 ? 29  LYS A N    1  
ATOM   121    C CA   . LYS A 1 29  ? -21.266 4.927   39.443 1.00  0.00 ? 29  LYS A CA   1  
ATOM   122    C C    . LYS A 1 29  ? -21.932 4.416   40.707 1.00  0.00 ? 29  LYS A C    1  
ATOM   123    O O    . LYS A 1 29  ? -23.182 4.332   40.749 1.00  0.00 ? 29  LYS A O    1  
ATOM   124    H H    . LYS A 1 29  ? -19.319 5.699   39.692 1.00  0.00 ? 29  LYS A H    1  
ATOM   125    N N    . ASP A 1 30  ? -21.135 4.075   41.705 1.00  0.00 ? 30  ASP A N    1  
ATOM   126    C CA   . ASP A 1 30  ? -21.709 3.557   42.951 1.00  0.00 ? 30  ASP A CA   1  
ATOM   127    C C    . ASP A 1 30  ? -21.927 4.665   43.986 1.00  0.00 ? 30  ASP A C    1  
ATOM   128    O O    . ASP A 1 30  ? -22.221 4.303   45.147 1.00  0.00 ? 30  ASP A O    1  
ATOM   129    H H    . ASP A 1 30  ? -20.163 4.157   41.608 1.00  0.00 ? 30  ASP A H    1  
ATOM   130    N N    . THR A 1 31  ? -21.793 5.914   43.593 1.00  0.00 ? 31  THR A N    1  
ATOM   131    C CA   . THR A 1 31  ? -21.916 7.014   44.567 1.00  0.00 ? 31  THR A CA   1  
ATOM   132    C C    . THR A 1 31  ? -22.706 8.183   44.057 1.00  0.00 ? 31  THR A C    1  
ATOM   133    O O    . THR A 1 31  ? -23.466 8.826   44.830 1.00  0.00 ? 31  THR A O    1  
ATOM   134    H H    . THR A 1 31  ? -21.560 6.109   42.661 1.00  0.00 ? 31  THR A H    1  
ATOM   135    N N    . GLY A 1 32  ? -22.552 8.507   42.805 1.00  0.00 ? 32  GLY A N    1  
ATOM   136    C CA   . GLY A 1 32  ? -23.216 9.637   42.163 1.00  0.00 ? 32  GLY A CA   1  
ATOM   137    C C    . GLY A 1 32  ? -22.359 10.889  42.239 1.00  0.00 ? 32  GLY A C    1  
ATOM   138    O O    . GLY A 1 32  ? -22.683 11.943  41.683 1.00  0.00 ? 32  GLY A O    1  
ATOM   139    H H    . GLY A 1 32  ? -21.933 7.972   42.266 1.00  0.00 ? 32  GLY A H    1  
ATOM   140    N N    . ILE A 1 33  ? -21.253 10.726  42.978 1.00  0.00 ? 33  ILE A N    1  
ATOM   141    C CA   . ILE A 1 33  ? -20.294 11.821  43.160 1.00  0.00 ? 33  ILE A CA   1  
ATOM   142    C C    . ILE A 1 33  ? -19.358 11.828  41.934 1.00  0.00 ? 33  ILE A C    1  
ATOM   143    O O    . ILE A 1 33  ? -18.732 10.801  41.662 1.00  0.00 ? 33  ILE A O    1  
ATOM   144    H H    . ILE A 1 33  ? -21.078 9.858   43.398 1.00  0.00 ? 33  ILE A H    1  
ATOM   145    N N    . LYS A 1 34  ? -19.348 12.971  41.299 1.00  0.00 ? 34  LYS A N    1  
ATOM   146    C CA   . LYS A 1 34  ? -18.508 13.215  40.138 1.00  0.00 ? 34  LYS A CA   1  
ATOM   147    C C    . LYS A 1 34  ? -17.085 13.536  40.599 1.00  0.00 ? 34  LYS A C    1  
ATOM   148    O O    . LYS A 1 34  ? -16.910 14.344  41.538 1.00  0.00 ? 34  LYS A O    1  
ATOM   149    H H    . LYS A 1 34  ? -19.910 13.700  41.635 1.00  0.00 ? 34  LYS A H    1  
ATOM   150    N N    . VAL A 1 35  ? -16.121 12.927  39.948 1.00  0.00 ? 35  VAL A N    1  
ATOM   151    C CA   . VAL A 1 35  ? -14.679 13.144  40.218 1.00  0.00 ? 35  VAL A CA   1  
ATOM   152    C C    . VAL A 1 35  ? -14.171 13.961  39.031 1.00  0.00 ? 35  VAL A C    1  
ATOM   153    O O    . VAL A 1 35  ? -14.693 13.751  37.934 1.00  0.00 ? 35  VAL A O    1  
ATOM   154    H H    . VAL A 1 35  ? -16.368 12.316  39.222 1.00  0.00 ? 35  VAL A H    1  
ATOM   155    N N    . THR A 1 36  ? -13.303 14.902  39.220 1.00  0.00 ? 36  THR A N    1  
ATOM   156    C CA   . THR A 1 36  ? -12.728 15.751  38.197 1.00  0.00 ? 36  THR A CA   1  
ATOM   157    C C    . THR A 1 36  ? -11.211 15.687  38.269 1.00  0.00 ? 36  THR A C    1  
ATOM   158    O O    . THR A 1 36  ? -10.630 16.067  39.306 1.00  0.00 ? 36  THR A O    1  
ATOM   159    H H    . THR A 1 36  ? -13.003 15.051  40.141 1.00  0.00 ? 36  THR A H    1  
ATOM   160    N N    . VAL A 1 37  ? -10.620 15.219  37.191 1.00  0.00 ? 37  VAL A N    1  
ATOM   161    C CA   . VAL A 1 37  ? -9.147  15.122  37.155 1.00  0.00 ? 37  VAL A CA   1  
ATOM   162    C C    . VAL A 1 37  ? -8.645  16.241  36.249 1.00  0.00 ? 37  VAL A C    1  
ATOM   163    O O    . VAL A 1 37  ? -9.170  16.490  35.172 1.00  0.00 ? 37  VAL A O    1  
ATOM   164    H H    . VAL A 1 37  ? -11.153 14.942  36.416 1.00  0.00 ? 37  VAL A H    1  
ATOM   165    N N    . GLU A 1 38  ? -7.633  16.906  36.741 1.00  0.00 ? 38  GLU A N    1  
ATOM   166    C CA   . GLU A 1 38  ? -6.971  18.000  36.017 1.00  0.00 ? 38  GLU A CA   1  
ATOM   167    C C    . GLU A 1 38  ? -5.466  17.862  36.240 1.00  0.00 ? 38  GLU A C    1  
ATOM   168    O O    . GLU A 1 38  ? -5.055  17.206  37.196 1.00  0.00 ? 38  GLU A O    1  
ATOM   169    H H    . GLU A 1 38  ? -7.286  16.649  37.621 1.00  0.00 ? 38  GLU A H    1  
ATOM   170    N N    . HIS A 1 39  ? -4.741  18.458  35.326 1.00  0.00 ? 39  HIS A N    1  
ATOM   171    C CA   . HIS A 1 39  ? -3.265  18.417  35.374 1.00  0.00 ? 39  HIS A CA   1  
ATOM   172    C C    . HIS A 1 39  ? -2.706  19.784  34.997 1.00  0.00 ? 39  HIS A C    1  
ATOM   173    O O    . HIS A 1 39  ? -2.105  19.936  33.913 1.00  0.00 ? 39  HIS A O    1  
ATOM   174    H H    . HIS A 1 39  ? -5.185  18.932  34.592 1.00  0.00 ? 39  HIS A H    1  
ATOM   175    N N    . PRO A 1 40  ? -2.905  20.761  35.875 1.00  0.00 ? 40  PRO A N    1  
ATOM   176    C CA   . PRO A 1 40  ? -2.449  22.134  35.641 1.00  0.00 ? 40  PRO A CA   1  
ATOM   177    C C    . PRO A 1 40  ? -0.939  22.221  35.643 1.00  0.00 ? 40  PRO A C    1  
ATOM   178    O O    . PRO A 1 40  ? -0.232  21.409  36.230 1.00  0.00 ? 40  PRO A O    1  
ATOM   179    N N    . CYS A 1 41  ? -0.475  23.259  34.950 1.00  0.00 ? 41  CYS A N    1  
ATOM   180    C CA   . CYS A 1 41  ? 0.937   23.605  34.814 1.00  0.00 ? 41  CYS A CA   1  
ATOM   181    C C    . CYS A 1 41  ? 1.533   23.979  36.151 1.00  0.00 ? 41  CYS A C    1  
ATOM   182    O O    . CYS A 1 41  ? 0.873   24.800  36.833 1.00  0.00 ? 41  CYS A O    1  
ATOM   183    C CB   . CYS A 1 41  ? 1.066   24.735  33.774 1.00  0.00 ? 41  CYS A CB   1  
ATOM   184    S SG   A CYS A 1 41  ? 0.331   26.264  34.396 0.16  0.00 ? 41  CYS A SG   1  
ATOM   185    S SG   B CYS A 1 41  ? 0.642   24.137  32.123 0.16  0.00 ? 41  CYS A SG   1  
ATOM   186    S SG   C CYS A 1 41  ? 2.106   24.215  32.390 0.16  0.00 ? 41  CYS A SG   1  
ATOM   187    S SG   D CYS A 1 41  ? 2.801   25.158  33.500 0.16  0.00 ? 41  CYS A SG   1  
ATOM   188    S SG   E CYS A 1 41  ? 1.642   24.084  32.189 0.16  0.00 ? 41  CYS A SG   1  
ATOM   189    S SG   F CYS A 1 41  ? 2.804   25.085  33.420 0.16  0.00 ? 41  CYS A SG   1  
ATOM   190    S SG   U CYS A 1 41  ? 1.037   24.067  32.096 0.010 0.00 ? 41  CYS A SG   1  
ATOM   191    S SG   V CYS A 1 41  ? 2.749   24.818  33.124 0.010 0.00 ? 41  CYS A SG   1  
ATOM   192    S SG   W CYS A 1 41  ? 2.499   25.776  34.134 0.010 0.00 ? 41  CYS A SG   1  
ATOM   193    S SG   X CYS A 1 41  ? 2.562   24.524  32.782 0.010 0.00 ? 41  CYS A SG   1  
ATOM   194    S SG   Y CYS A 1 41  ? 2.742   24.798  33.101 0.010 0.00 ? 41  CYS A SG   1  
ATOM   195    S SG   Z CYS A 1 41  ? 2.112   24.218  32.393 0.010 0.00 ? 41  CYS A SG   1  
ATOM   196    H H    . CYS A 1 41  ? -1.148  23.856  34.490 1.00  0.00 ? 41  CYS A H    1  
ATOM   197    N N    . LYS A 1 42  ? 2.697   23.477  36.464 1.00  0.00 ? 42  LYS A N    1  
ATOM   198    C CA   . LYS A 1 42  ? 3.405   23.767  37.726 1.00  0.00 ? 42  LYS A CA   1  
ATOM   199    C C    . LYS A 1 42  ? 2.412   23.691  38.892 1.00  0.00 ? 42  LYS A C    1  
ATOM   200    O O    . LYS A 1 42  ? 2.393   24.619  39.704 1.00  0.00 ? 42  LYS A O    1  
ATOM   201    H H    . LYS A 1 42  ? 3.122   22.877  35.816 1.00  0.00 ? 42  LYS A H    1  
ATOM   202    N N    . LEU A 1 43  ? 1.630   22.626  38.925 1.00  0.00 ? 43  LEU A N    1  
ATOM   203    C CA   . LEU A 1 43  ? 0.588   22.482  39.958 1.00  0.00 ? 43  LEU A CA   1  
ATOM   204    C C    . LEU A 1 43  ? 1.187   22.430  41.355 1.00  0.00 ? 43  LEU A C    1  
ATOM   205    O O    . LEU A 1 43  ? 0.477   22.767  42.337 1.00  0.00 ? 43  LEU A O    1  
ATOM   206    H H    . LEU A 1 43  ? 1.712   21.946  38.225 1.00  0.00 ? 43  LEU A H    1  
ATOM   207    N N    . GLU A 1 44  ? 2.438   22.006  41.459 1.00  0.00 ? 44  GLU A N    1  
ATOM   208    C CA   . GLU A 1 44  ? 3.096   21.891  42.775 1.00  0.00 ? 44  GLU A CA   1  
ATOM   209    C C    . GLU A 1 44  ? 3.489   23.281  43.292 1.00  0.00 ? 44  GLU A C    1  
ATOM   210    O O    . GLU A 1 44  ? 3.788   23.464  44.470 1.00  0.00 ? 44  GLU A O    1  
ATOM   211    H H    . GLU A 1 44  ? 2.926   21.745  40.650 1.00  0.00 ? 44  GLU A H    1  
ATOM   212    N N    . GLU A 1 45  ? 3.466   24.244  42.398 1.00  0.00 ? 45  GLU A N    1  
ATOM   213    C CA   . GLU A 1 45  ? 3.761   25.646  42.714 1.00  0.00 ? 45  GLU A CA   1  
ATOM   214    C C    . GLU A 1 45  ? 2.436   26.350  43.014 1.00  0.00 ? 45  GLU A C    1  
ATOM   215    O O    . GLU A 1 45  ? 2.342   27.161  43.934 1.00  0.00 ? 45  GLU A O    1  
ATOM   216    H H    . GLU A 1 45  ? 3.205   24.020  41.480 1.00  0.00 ? 45  GLU A H    1  
ATOM   217    N N    . LYS A 1 46  ? 1.457   25.997  42.206 1.00  0.00 ? 46  LYS A N    1  
ATOM   218    C CA   . LYS A 1 46  ? 0.125   26.530  42.320 1.00  0.00 ? 46  LYS A CA   1  
ATOM   219    C C    . LYS A 1 46  ? -0.585  26.038  43.568 1.00  0.00 ? 46  LYS A C    1  
ATOM   220    O O    . LYS A 1 46  ? -1.383  26.828  44.103 1.00  0.00 ? 46  LYS A O    1  
ATOM   221    H H    . LYS A 1 46  ? 1.641   25.340  41.502 1.00  0.00 ? 46  LYS A H    1  
ATOM   222    N N    . PHE A 1 47  ? -0.367  24.812  43.980 1.00  0.00 ? 47  PHE A N    1  
ATOM   223    C CA   . PHE A 1 47  ? -1.017  24.240  45.140 1.00  0.00 ? 47  PHE A CA   1  
ATOM   224    C C    . PHE A 1 47  ? -0.884  25.155  46.373 1.00  0.00 ? 47  PHE A C    1  
ATOM   225    O O    . PHE A 1 47  ? -1.882  25.552  46.977 1.00  0.00 ? 47  PHE A O    1  
ATOM   226    H H    . PHE A 1 47  ? 0.251   24.250  43.467 1.00  0.00 ? 47  PHE A H    1  
ATOM   227    N N    . PRO A 1 48  ? 0.340   25.403  46.790 1.00  0.00 ? 48  PRO A N    1  
ATOM   228    C CA   . PRO A 1 48  ? 0.583   26.209  47.993 1.00  0.00 ? 48  PRO A CA   1  
ATOM   229    C C    . PRO A 1 48  ? -0.133  27.532  47.978 1.00  0.00 ? 48  PRO A C    1  
ATOM   230    O O    . PRO A 1 48  ? -0.637  27.980  49.044 1.00  0.00 ? 48  PRO A O    1  
ATOM   231    N N    . GLN A 1 49  ? -0.291  28.164  46.852 1.00  0.00 ? 49  GLN A N    1  
ATOM   232    C CA   . GLN A 1 49  ? -0.952  29.429  46.655 1.00  0.00 ? 49  GLN A CA   1  
ATOM   233    C C    . GLN A 1 49  ? -2.465  29.342  46.867 1.00  0.00 ? 49  GLN A C    1  
ATOM   234    O O    . GLN A 1 49  ? -2.996  30.166  47.633 1.00  0.00 ? 49  GLN A O    1  
ATOM   235    H H    . GLN A 1 49  ? 0.075   27.732  46.052 1.00  0.00 ? 49  GLN A H    1  
ATOM   236    N N    . VAL A 1 50  ? -3.124  28.474  46.145 1.00  0.00 ? 50  VAL A N    1  
ATOM   237    C CA   . VAL A 1 50  ? -4.569  28.321  46.243 1.00  0.00 ? 50  VAL A CA   1  
ATOM   238    C C    . VAL A 1 50  ? -4.988  27.675  47.540 1.00  0.00 ? 50  VAL A C    1  
ATOM   239    O O    . VAL A 1 50  ? -6.085  28.043  48.012 1.00  0.00 ? 50  VAL A O    1  
ATOM   240    H H    . VAL A 1 50  ? -2.632  27.920  45.504 1.00  0.00 ? 50  VAL A H    1  
ATOM   241    N N    . ALA A 1 51  ? -4.250  26.743  48.091 1.00  0.00 ? 51  ALA A N    1  
ATOM   242    C CA   . ALA A 1 51  ? -4.600  26.055  49.321 1.00  0.00 ? 51  ALA A CA   1  
ATOM   243    C C    . ALA A 1 51  ? -4.510  27.033  50.515 1.00  0.00 ? 51  ALA A C    1  
ATOM   244    O O    . ALA A 1 51  ? -5.339  26.897  51.428 1.00  0.00 ? 51  ALA A O    1  
ATOM   245    H H    . ALA A 1 51  ? -3.422  26.482  47.636 1.00  0.00 ? 51  ALA A H    1  
ATOM   246    N N    . ALA A 1 52  ? -3.521  27.930  50.470 1.00  0.00 ? 52  ALA A N    1  
ATOM   247    C CA   . ALA A 1 52  ? -3.332  28.932  51.520 1.00  0.00 ? 52  ALA A CA   1  
ATOM   248    C C    . ALA A 1 52  ? -4.578  29.819  51.661 1.00  0.00 ? 52  ALA A C    1  
ATOM   249    O O    . ALA A 1 52  ? -4.826  30.428  52.714 1.00  0.00 ? 52  ALA A O    1  
ATOM   250    H H    . ALA A 1 52  ? -2.913  27.928  49.701 1.00  0.00 ? 52  ALA A H    1  
ATOM   251    N N    . THR A 1 53  ? -5.403  29.893  50.627 1.00  0.00 ? 53  THR A N    1  
ATOM   252    C CA   . THR A 1 53  ? -6.623  30.672  50.627 1.00  0.00 ? 53  THR A CA   1  
ATOM   253    C C    . THR A 1 53  ? -7.893  29.812  50.693 1.00  0.00 ? 53  THR A C    1  
ATOM   254    O O    . THR A 1 53  ? -8.979  30.323  50.390 1.00  0.00 ? 53  THR A O    1  
ATOM   255    H H    . THR A 1 53  ? -5.182  29.381  49.821 1.00  0.00 ? 53  THR A H    1  
ATOM   256    N N    . GLY A 1 54  ? -7.747  28.565  51.077 1.00  0.00 ? 54  GLY A N    1  
ATOM   257    C CA   . GLY A 1 54  ? -8.789  27.570  51.196 1.00  0.00 ? 54  GLY A CA   1  
ATOM   258    C C    . GLY A 1 54  ? -9.410  27.192  49.862 1.00  0.00 ? 54  GLY A C    1  
ATOM   259    O O    . GLY A 1 54  ? -10.615 26.896  49.731 1.00  0.00 ? 54  GLY A O    1  
ATOM   260    H H    . GLY A 1 54  ? -6.837  28.276  51.294 1.00  0.00 ? 54  GLY A H    1  
ATOM   261    N N    . ASP A 1 55  ? -8.605  27.199  48.821 1.00  0.00 ? 55  ASP A N    1  
ATOM   262    C CA   . ASP A 1 55  ? -9.009  26.823  47.468 1.00  0.00 ? 55  ASP A CA   1  
ATOM   263    C C    . ASP A 1 55  ? -8.147  25.604  47.059 1.00  0.00 ? 55  ASP A C    1  
ATOM   264    O O    . ASP A 1 55  ? -7.446  25.018  47.892 1.00  0.00 ? 55  ASP A O    1  
ATOM   265    H H    . ASP A 1 55  ? -7.668  27.445  48.968 1.00  0.00 ? 55  ASP A H    1  
ATOM   266    N N    . GLY A 1 56  ? -8.250  25.277  45.788 1.00  0.00 ? 56  GLY A N    1  
ATOM   267    C CA   . GLY A 1 56  ? -7.507  24.162  45.182 1.00  0.00 ? 56  GLY A CA   1  
ATOM   268    C C    . GLY A 1 56  ? -8.349  22.882  45.094 1.00  0.00 ? 56  GLY A C    1  
ATOM   269    O O    . GLY A 1 56  ? -9.586  22.928  45.258 1.00  0.00 ? 56  GLY A O    1  
ATOM   270    H H    . GLY A 1 56  ? -8.842  25.808  45.216 1.00  0.00 ? 56  GLY A H    1  
ATOM   271    N N    . PRO A 1 57  ? -7.654  21.783  44.805 1.00  0.00 ? 57  PRO A N    1  
ATOM   272    C CA   . PRO A 1 57  ? -8.285  20.471  44.655 1.00  0.00 ? 57  PRO A CA   1  
ATOM   273    C C    . PRO A 1 57  ? -8.430  19.819  46.002 1.00  0.00 ? 57  PRO A C    1  
ATOM   274    O O    . PRO A 1 57  ? -7.719  20.203  46.944 1.00  0.00 ? 57  PRO A O    1  
ATOM   275    N N    . ASP A 1 58  ? -9.279  18.832  46.094 1.00  0.00 ? 58  ASP A N    1  
ATOM   276    C CA   . ASP A 1 58  ? -9.519  18.026  47.268 1.00  0.00 ? 58  ASP A CA   1  
ATOM   277    C C    . ASP A 1 58  ? -8.310  17.144  47.546 1.00  0.00 ? 58  ASP A C    1  
ATOM   278    O O    . ASP A 1 58  ? -7.885  16.865  48.675 1.00  0.00 ? 58  ASP A O    1  
ATOM   279    H H    . ASP A 1 58  ? -9.765  18.586  45.280 1.00  0.00 ? 58  ASP A H    1  
ATOM   280    N N    . ILE A 1 59  ? -7.778  16.705  46.380 1.00  0.00 ? 59  ILE A N    1  
ATOM   281    C CA   . ILE A 1 59  ? -6.606  15.808  46.434 1.00  0.00 ? 59  ILE A CA   1  
ATOM   282    C C    . ILE A 1 59  ? -5.561  16.162  45.409 1.00  0.00 ? 59  ILE A C    1  
ATOM   283    O O    . ILE A 1 59  ? -5.836  16.569  44.297 1.00  0.00 ? 59  ILE A O    1  
ATOM   284    H H    . ILE A 1 59  ? -8.173  16.962  45.521 1.00  0.00 ? 59  ILE A H    1  
ATOM   285    N N    . ILE A 1 60  ? -4.323  16.025  45.844 1.00  0.00 ? 60  ILE A N    1  
ATOM   286    C CA   . ILE A 1 60  ? -3.138  16.349  45.042 1.00  0.00 ? 60  ILE A CA   1  
ATOM   287    C C    . ILE A 1 60  ? -2.187  15.165  45.002 1.00  0.00 ? 60  ILE A C    1  
ATOM   288    O O    . ILE A 1 60  ? -1.924  14.551  46.026 1.00  0.00 ? 60  ILE A O    1  
ATOM   289    H H    . ILE A 1 60  ? -4.188  15.715  46.764 1.00  0.00 ? 60  ILE A H    1  
ATOM   290    N N    . PHE A 1 61  ? -1.617  14.925  43.823 1.00  0.00 ? 61  PHE A N    1  
ATOM   291    C CA   . PHE A 1 61  ? -0.644  13.816  43.671 1.00  0.00 ? 61  PHE A CA   1  
ATOM   292    C C    . PHE A 1 61  ? 0.733   14.459  43.395 1.00  0.00 ? 61  PHE A C    1  
ATOM   293    O O    . PHE A 1 61  ? 0.750   15.295  42.506 1.00  0.00 ? 61  PHE A O    1  
ATOM   294    H H    . PHE A 1 61  ? -1.824  15.499  43.056 1.00  0.00 ? 61  PHE A H    1  
ATOM   295    N N    . TRP A 1 62  ? 1.715   14.094  44.108 1.00  0.00 ? 62  TRP A N    1  
ATOM   296    C CA   . TRP A 1 62  ? 3.111   14.587  43.882 1.00  0.00 ? 62  TRP A CA   1  
ATOM   297    C C    . TRP A 1 62  ? 4.036   13.702  44.637 1.00  0.00 ? 62  TRP A C    1  
ATOM   298    O O    . TRP A 1 62  ? 3.670   12.938  45.549 1.00  0.00 ? 62  TRP A O    1  
ATOM   299    H H    . TRP A 1 62  ? 1.563   13.422  44.806 1.00  0.00 ? 62  TRP A H    1  
ATOM   300    N N    . ALA A 1 63  ? 5.328   13.772  44.282 1.00  0.00 ? 63  ALA A N    1  
ATOM   301    C CA   . ALA A 1 63  ? 6.367   13.049  45.003 1.00  0.00 ? 63  ALA A CA   1  
ATOM   302    C C    . ALA A 1 63  ? 6.266   13.521  46.477 1.00  0.00 ? 63  ALA A C    1  
ATOM   303    O O    . ALA A 1 63  ? 6.055   14.722  46.714 1.00  0.00 ? 63  ALA A O    1  
ATOM   304    H H    . ALA A 1 63  ? 5.589   14.384  43.563 1.00  0.00 ? 63  ALA A H    1  
ATOM   305    N N    . HIS A 1 64  ? 6.514   12.642  47.398 1.00  0.00 ? 64  HIS A N    1  
ATOM   306    C CA   . HIS A 1 64  ? 6.430   12.852  48.824 1.00  0.00 ? 64  HIS A CA   1  
ATOM   307    C C    . HIS A 1 64  ? 7.278   13.991  49.392 1.00  0.00 ? 64  HIS A C    1  
ATOM   308    O O    . HIS A 1 64  ? 6.896   14.594  50.418 1.00  0.00 ? 64  HIS A O    1  
ATOM   309    H H    . HIS A 1 64  ? 6.750   11.740  47.097 1.00  0.00 ? 64  HIS A H    1  
ATOM   310    N N    . ASP A 1 65  ? 8.442   14.212  48.800 1.00  0.00 ? 65  ASP A N    1  
ATOM   311    C CA   . ASP A 1 65  ? 9.394   15.195  49.333 1.00  0.00 ? 65  ASP A CA   1  
ATOM   312    C C    . ASP A 1 65  ? 8.800   16.588  49.431 1.00  0.00 ? 65  ASP A C    1  
ATOM   313    O O    . ASP A 1 65  ? 9.086   17.351  50.368 1.00  0.00 ? 65  ASP A O    1  
ATOM   314    H H    . ASP A 1 65  ? 8.706   13.653  48.040 1.00  0.00 ? 65  ASP A H    1  
ATOM   315    N N    . ARG A 1 66  ? 7.958   16.977  48.537 1.00  0.00 ? 66  ARG A N    1  
ATOM   316    C CA   . ARG A 1 66  ? 7.302   18.247  48.468 1.00  0.00 ? 66  ARG A CA   1  
ATOM   317    C C    . ARG A 1 66  ? 6.227   18.405  49.548 1.00  0.00 ? 66  ARG A C    1  
ATOM   318    O O    . ARG A 1 66  ? 5.935   19.567  49.832 1.00  0.00 ? 66  ARG A O    1  
ATOM   319    H H    . ARG A 1 66  ? 7.745   16.335  47.828 1.00  0.00 ? 66  ARG A H    1  
ATOM   320    N N    . PHE A 1 67  ? 5.702   17.320  50.057 1.00  0.00 ? 67  PHE A N    1  
ATOM   321    C CA   . PHE A 1 67  ? 4.624   17.243  51.032 1.00  0.00 ? 67  PHE A CA   1  
ATOM   322    C C    . PHE A 1 67  ? 5.040   17.781  52.393 1.00  0.00 ? 67  PHE A C    1  
ATOM   323    O O    . PHE A 1 67  ? 4.176   18.254  53.134 1.00  0.00 ? 67  PHE A O    1  
ATOM   324    H H    . PHE A 1 67  ? 6.039   16.468  49.710 1.00  0.00 ? 67  PHE A H    1  
ATOM   325    N N    . GLY A 1 68  ? 6.318   17.714  52.667 1.00  0.00 ? 68  GLY A N    1  
ATOM   326    C CA   . GLY A 1 68  ? 6.886   18.214  53.934 1.00  0.00 ? 68  GLY A CA   1  
ATOM   327    C C    . GLY A 1 68  ? 6.626   19.724  54.110 1.00  0.00 ? 68  GLY A C    1  
ATOM   328    O O    . GLY A 1 68  ? 6.197   20.138  55.203 1.00  0.00 ? 68  GLY A O    1  
ATOM   329    H H    . GLY A 1 68  ? 6.923   17.331  51.999 1.00  0.00 ? 68  GLY A H    1  
ATOM   330    N N    . GLY A 1 69  ? 6.888   20.497  53.105 1.00  0.00 ? 69  GLY A N    1  
ATOM   331    C CA   . GLY A 1 69  ? 6.703   21.932  53.038 1.00  0.00 ? 69  GLY A CA   1  
ATOM   332    C C    . GLY A 1 69  ? 5.233   22.297  53.078 1.00  0.00 ? 69  GLY A C    1  
ATOM   333    O O    . GLY A 1 69  ? 4.826   23.271  53.692 1.00  0.00 ? 69  GLY A O    1  
ATOM   334    H H    . GLY A 1 69  ? 7.236   20.063  52.299 1.00  0.00 ? 69  GLY A H    1  
ATOM   335    N N    . TYR A 1 70  ? 4.398   21.511  52.399 1.00  0.00 ? 70  TYR A N    1  
ATOM   336    C CA   . TYR A 1 70  ? 2.943   21.677  52.372 1.00  0.00 ? 70  TYR A CA   1  
ATOM   337    C C    . TYR A 1 70  ? 2.339   21.452  53.785 1.00  0.00 ? 70  TYR A C    1  
ATOM   338    O O    . TYR A 1 70  ? 1.476   22.229  54.230 1.00  0.00 ? 70  TYR A O    1  
ATOM   339    H H    . TYR A 1 70  ? 4.780   20.749  51.915 1.00  0.00 ? 70  TYR A H    1  
ATOM   340    N N    . ALA A 1 71  ? 2.719   20.401  54.453 1.00  0.00 ? 71  ALA A N    1  
ATOM   341    C CA   . ALA A 1 71  ? 2.339   19.970  55.762 1.00  0.00 ? 71  ALA A CA   1  
ATOM   342    C C    . ALA A 1 71  ? 2.748   21.028  56.826 1.00  0.00 ? 71  ALA A C    1  
ATOM   343    O O    . ALA A 1 71  ? 2.025   21.267  57.798 1.00  0.00 ? 71  ALA A O    1  
ATOM   344    H H    . ALA A 1 71  ? 3.369   19.827  53.996 1.00  0.00 ? 71  ALA A H    1  
ATOM   345    N N    . GLN A 1 72  ? 3.913   21.572  56.609 1.00  0.00 ? 72  GLN A N    1  
ATOM   346    C CA   . GLN A 1 72  ? 4.502   22.585  57.493 1.00  0.00 ? 72  GLN A CA   1  
ATOM   347    C C    . GLN A 1 72  ? 3.503   23.747  57.555 1.00  0.00 ? 72  GLN A C    1  
ATOM   348    O O    . GLN A 1 72  ? 3.267   24.149  58.688 1.00  0.00 ? 72  GLN A O    1  
ATOM   349    H H    . GLN A 1 72  ? 4.423   21.285  55.823 1.00  0.00 ? 72  GLN A H    1  
ATOM   350    N N    . SER A 1 73  ? 3.008   24.206  56.438 1.00  0.00 ? 73  SER A N    1  
ATOM   351    C CA   . SER A 1 73  ? 2.052   25.278  56.346 1.00  0.00 ? 73  SER A CA   1  
ATOM   352    C C    . SER A 1 73  ? 0.601   24.900  56.603 1.00  0.00 ? 73  SER A C    1  
ATOM   353    O O    . SER A 1 73  ? -0.263  25.746  56.296 1.00  0.00 ? 73  SER A O    1  
ATOM   354    H H    . SER A 1 73  ? 3.300   23.784  55.604 1.00  0.00 ? 73  SER A H    1  
ATOM   355    N N    . GLY A 1 74  ? 0.366   23.692  57.033 1.00  0.00 ? 74  GLY A N    1  
ATOM   356    C CA   . GLY A 1 74  ? -0.890  23.087  57.382 1.00  0.00 ? 74  GLY A CA   1  
ATOM   357    C C    . GLY A 1 74  ? -1.859  22.924  56.228 1.00  0.00 ? 74  GLY A C    1  
ATOM   358    O O    . GLY A 1 74  ? -3.074  23.007  56.421 1.00  0.00 ? 74  GLY A O    1  
ATOM   359    H H    . GLY A 1 74  ? 1.156   23.125  57.154 1.00  0.00 ? 74  GLY A H    1  
ATOM   360    N N    . LEU A 1 75  ? -1.314  22.645  55.054 1.00  0.00 ? 75  LEU A N    1  
ATOM   361    C CA   . LEU A 1 75  ? -2.121  22.503  53.845 1.00  0.00 ? 75  LEU A CA   1  
ATOM   362    C C    . LEU A 1 75  ? -2.714  21.111  53.645 1.00  0.00 ? 75  LEU A C    1  
ATOM   363    O O    . LEU A 1 75  ? -3.631  20.978  52.825 1.00  0.00 ? 75  LEU A O    1  
ATOM   364    H H    . LEU A 1 75  ? -0.340  22.559  54.989 1.00  0.00 ? 75  LEU A H    1  
ATOM   365    N N    . LEU A 1 76  ? -2.263  20.130  54.347 1.00  0.00 ? 76  LEU A N    1  
ATOM   366    C CA   . LEU A 1 76  ? -2.702  18.763  54.252 1.00  0.00 ? 76  LEU A CA   1  
ATOM   367    C C    . LEU A 1 76  ? -3.419  18.224  55.488 1.00  0.00 ? 76  LEU A C    1  
ATOM   368    O O    . LEU A 1 76  ? -2.936  18.389  56.628 1.00  0.00 ? 76  LEU A O    1  
ATOM   369    H H    . LEU A 1 76  ? -1.548  20.328  54.988 1.00  0.00 ? 76  LEU A H    1  
ATOM   370    N N    . ALA A 1 77  ? -4.491  17.484  55.205 1.00  0.00 ? 77  ALA A N    1  
ATOM   371    C CA   . ALA A 1 77  ? -5.236  16.815  56.260 1.00  0.00 ? 77  ALA A CA   1  
ATOM   372    C C    . ALA A 1 77  ? -4.446  15.589  56.695 1.00  0.00 ? 77  ALA A C    1  
ATOM   373    O O    . ALA A 1 77  ? -3.725  14.910  55.924 1.00  0.00 ? 77  ALA A O    1  
ATOM   374    H H    . ALA A 1 77  ? -4.743  17.337  54.270 1.00  0.00 ? 77  ALA A H    1  
ATOM   375    N N    . GLU A 1 78  ? -4.579  15.346  57.988 1.00  0.00 ? 78  GLU A N    1  
ATOM   376    C CA   . GLU A 1 78  ? -3.971  14.190  58.628 1.00  0.00 ? 78  GLU A CA   1  
ATOM   377    C C    . GLU A 1 78  ? -4.844  13.002  58.166 1.00  0.00 ? 78  GLU A C    1  
ATOM   378    O O    . GLU A 1 78  ? -6.066  13.171  58.027 1.00  0.00 ? 78  GLU A O    1  
ATOM   379    H H    . GLU A 1 78  ? -5.142  15.941  58.525 1.00  0.00 ? 78  GLU A H    1  
ATOM   380    N N    . ILE A 1 79  ? -4.186  11.911  57.874 1.00  0.00 ? 79  ILE A N    1  
ATOM   381    C CA   . ILE A 1 79  ? -4.911  10.704  57.402 1.00  0.00 ? 79  ILE A CA   1  
ATOM   382    C C    . ILE A 1 79  ? -4.855  9.648   58.468 1.00  0.00 ? 79  ILE A C    1  
ATOM   383    O O    . ILE A 1 79  ? -3.956  9.516   59.281 1.00  0.00 ? 79  ILE A O    1  
ATOM   384    H H    . ILE A 1 79  ? -3.210  11.893  57.957 1.00  0.00 ? 79  ILE A H    1  
ATOM   385    N N    . THR A 1 80  ? -5.909  8.818   58.430 1.00  0.00 ? 80  THR A N    1  
ATOM   386    C CA   . THR A 1 80  ? -5.962  7.735   59.414 1.00  0.00 ? 80  THR A CA   1  
ATOM   387    C C    . THR A 1 80  ? -6.435  6.408   58.883 1.00  0.00 ? 80  THR A C    1  
ATOM   388    O O    . THR A 1 80  ? -7.521  5.942   59.279 1.00  0.00 ? 80  THR A O    1  
ATOM   389    H H    . THR A 1 80  ? -6.615  8.928   57.760 1.00  0.00 ? 80  THR A H    1  
ATOM   390    N N    . PRO A 1 81  ? -5.613  5.804   58.038 1.00  0.00 ? 81  PRO A N    1  
ATOM   391    C CA   . PRO A 1 81  ? -5.957  4.471   57.518 1.00  0.00 ? 81  PRO A CA   1  
ATOM   392    C C    . PRO A 1 81  ? -5.850  3.575   58.737 1.00  0.00 ? 81  PRO A C    1  
ATOM   393    O O    . PRO A 1 81  ? -4.960  3.843   59.582 1.00  0.00 ? 81  PRO A O    1  
ATOM   394    N N    . ASP A 1 82  ? -6.644  2.541   58.830 1.00  0.00 ? 82  ASP A N    1  
ATOM   395    C CA   . ASP A 1 82  ? -6.507  1.630   60.008 1.00  0.00 ? 82  ASP A CA   1  
ATOM   396    C C    . ASP A 1 82  ? -5.395  0.624   59.690 1.00  0.00 ? 82  ASP A C    1  
ATOM   397    O O    . ASP A 1 82  ? -4.920  0.528   58.540 1.00  0.00 ? 82  ASP A O    1  
ATOM   398    H H    . ASP A 1 82  ? -7.296  2.349   58.124 1.00  0.00 ? 82  ASP A H    1  
ATOM   399    N N    . LYS A 1 83  ? -4.995  -0.070  60.725 1.00  0.00 ? 83  LYS A N    1  
ATOM   400    C CA   . LYS A 1 83  ? -3.918  -1.062  60.713 1.00  0.00 ? 83  LYS A CA   1  
ATOM   401    C C    . LYS A 1 83  ? -3.953  -1.972  59.500 1.00  0.00 ? 83  LYS A C    1  
ATOM   402    O O    . LYS A 1 83  ? -2.941  -2.235  58.851 1.00  0.00 ? 83  LYS A O    1  
ATOM   403    H H    . LYS A 1 83  ? -5.431  0.111   61.583 1.00  0.00 ? 83  LYS A H    1  
ATOM   404    N N    . ALA A 1 84  ? -5.132  -2.442  59.243 1.00  0.00 ? 84  ALA A N    1  
ATOM   405    C CA   . ALA A 1 84  ? -5.494  -3.366  58.184 1.00  0.00 ? 84  ALA A CA   1  
ATOM   406    C C    . ALA A 1 84  ? -5.217  -2.809  56.797 1.00  0.00 ? 84  ALA A C    1  
ATOM   407    O O    . ALA A 1 84  ? -4.777  -3.567  55.927 1.00  0.00 ? 84  ALA A O    1  
ATOM   408    H H    . ALA A 1 84  ? -5.853  -2.164  59.845 1.00  0.00 ? 84  ALA A H    1  
ATOM   409    N N    . PHE A 1 85  ? -5.539  -1.531  56.626 1.00  0.00 ? 85  PHE A N    1  
ATOM   410    C CA   . PHE A 1 85  ? -5.300  -0.898  55.338 1.00  0.00 ? 85  PHE A CA   1  
ATOM   411    C C    . PHE A 1 85  ? -3.766  -0.718  55.216 1.00  0.00 ? 85  PHE A C    1  
ATOM   412    O O    . PHE A 1 85  ? -3.206  -0.898  54.155 1.00  0.00 ? 85  PHE A O    1  
ATOM   413    H H    . PHE A 1 85  ? -5.926  -1.016  57.365 1.00  0.00 ? 85  PHE A H    1  
ATOM   414    N N    . GLN A 1 86  ? -3.158  -0.381  56.311 1.00  0.00 ? 86  GLN A N    1  
ATOM   415    C CA   . GLN A 1 86  ? -1.736  -0.105  56.378 1.00  0.00 ? 86  GLN A CA   1  
ATOM   416    C C    . GLN A 1 86  ? -0.880  -1.289  55.981 1.00  0.00 ? 86  GLN A C    1  
ATOM   417    O O    . GLN A 1 86  ? 0.223   -1.106  55.426 1.00  0.00 ? 86  GLN A O    1  
ATOM   418    H H    . GLN A 1 86  ? -3.693  -0.266  57.124 1.00  0.00 ? 86  GLN A H    1  
ATOM   419    N N    . ASP A 1 87  ? -1.359  -2.460  56.316 1.00  0.00 ? 87  ASP A N    1  
ATOM   420    C CA   . ASP A 1 87  ? -0.649  -3.724  56.040 1.00  0.00 ? 87  ASP A CA   1  
ATOM   421    C C    . ASP A 1 87  ? -0.730  -4.122  54.579 1.00  0.00 ? 87  ASP A C    1  
ATOM   422    O O    . ASP A 1 87  ? 0.006   -5.033  54.156 1.00  0.00 ? 87  ASP A O    1  
ATOM   423    H H    . ASP A 1 87  ? -2.217  -2.498  56.788 1.00  0.00 ? 87  ASP A H    1  
ATOM   424    N N    . LYS A 1 88  ? -1.528  -3.471  53.787 1.00  0.00 ? 88  LYS A N    1  
ATOM   425    C CA   . LYS A 1 88  ? -1.674  -3.720  52.359 1.00  0.00 ? 88  LYS A CA   1  
ATOM   426    C C    . LYS A 1 88  ? -0.520  -3.119  51.532 1.00  0.00 ? 88  LYS A C    1  
ATOM   427    O O    . LYS A 1 88  ? -0.377  -3.482  50.371 1.00  0.00 ? 88  LYS A O    1  
ATOM   428    H H    . LYS A 1 88  ? -2.054  -2.739  54.175 1.00  0.00 ? 88  LYS A H    1  
ATOM   429    N N    . LEU A 1 89  ? 0.234   -2.213  52.091 1.00  0.00 ? 89  LEU A N    1  
ATOM   430    C CA   . LEU A 1 89  ? 1.351   -1.527  51.476 1.00  0.00 ? 89  LEU A CA   1  
ATOM   431    C C    . LEU A 1 89  ? 2.666   -1.866  52.182 1.00  0.00 ? 89  LEU A C    1  
ATOM   432    O O    . LEU A 1 89  ? 2.712   -2.272  53.342 1.00  0.00 ? 89  LEU A O    1  
ATOM   433    H H    . LEU A 1 89  ? 0.018   -1.967  53.014 1.00  0.00 ? 89  LEU A H    1  
ATOM   434    N N    . TYR A 1 90  ? 3.754   -1.711  51.412 1.00  0.00 ? 90  TYR A N    1  
ATOM   435    C CA   . TYR A 1 90  ? 5.116   -1.954  51.947 1.00  0.00 ? 90  TYR A CA   1  
ATOM   436    C C    . TYR A 1 90  ? 5.327   -0.969  53.091 1.00  0.00 ? 90  TYR A C    1  
ATOM   437    O O    . TYR A 1 90  ? 5.068   0.239   52.893 1.00  0.00 ? 90  TYR A O    1  
ATOM   438    H H    . TYR A 1 90  ? 3.649   -1.404  50.487 1.00  0.00 ? 90  TYR A H    1  
ATOM   439    N N    . PRO A 1 91  ? 5.756   -1.487  54.222 1.00  0.00 ? 91  PRO A N    1  
ATOM   440    C CA   . PRO A 1 91  ? 5.959   -0.685  55.435 1.00  0.00 ? 91  PRO A CA   1  
ATOM   441    C C    . PRO A 1 91  ? 6.783   0.575   55.251 1.00  0.00 ? 91  PRO A C    1  
ATOM   442    O O    . PRO A 1 91  ? 6.424   1.685   55.699 1.00  0.00 ? 91  PRO A O    1  
ATOM   443    N N    . PHE A 1 92  ? 7.884   0.429   54.517 1.00  0.00 ? 92  PHE A N    1  
ATOM   444    C CA   . PHE A 1 92  ? 8.836   1.484   54.225 1.00  0.00 ? 92  PHE A CA   1  
ATOM   445    C C    . PHE A 1 92  ? 8.161   2.624   53.506 1.00  0.00 ? 92  PHE A C    1  
ATOM   446    O O    . PHE A 1 92  ? 8.649   3.766   53.612 1.00  0.00 ? 92  PHE A O    1  
ATOM   447    H H    . PHE A 1 92  ? 8.073   -0.464  54.160 1.00  0.00 ? 92  PHE A H    1  
ATOM   448    N N    . THR A 1 93  ? 7.085   2.394   52.794 1.00  0.00 ? 93  THR A N    1  
ATOM   449    C CA   . THR A 1 93  ? 6.408   3.445   52.062 1.00  0.00 ? 93  THR A CA   1  
ATOM   450    C C    . THR A 1 93  ? 5.663   4.410   53.010 1.00  0.00 ? 93  THR A C    1  
ATOM   451    O O    . THR A 1 93  ? 5.554   5.589   52.630 1.00  0.00 ? 93  THR A O    1  
ATOM   452    H H    . THR A 1 93  ? 6.737   1.479   52.742 1.00  0.00 ? 93  THR A H    1  
ATOM   453    N N    . TRP A 1 94  ? 5.254   3.913   54.142 1.00  0.00 ? 94  TRP A N    1  
ATOM   454    C CA   . TRP A 1 94  ? 4.545   4.762   55.137 1.00  0.00 ? 94  TRP A CA   1  
ATOM   455    C C    . TRP A 1 94  ? 5.508   5.767   55.753 1.00  0.00 ? 94  TRP A C    1  
ATOM   456    O O    . TRP A 1 94  ? 5.076   6.855   56.166 1.00  0.00 ? 94  TRP A O    1  
ATOM   457    H H    . TRP A 1 94  ? 5.430   2.971   54.348 1.00  0.00 ? 94  TRP A H    1  
ATOM   458    N N    . ASP A 1 95  ? 6.783   5.486   55.791 1.00  0.00 ? 95  ASP A N    1  
ATOM   459    C CA   . ASP A 1 95  ? 7.816   6.362   56.303 1.00  0.00 ? 95  ASP A CA   1  
ATOM   460    C C    . ASP A 1 95  ? 8.003   7.617   55.474 1.00  0.00 ? 95  ASP A C    1  
ATOM   461    O O    . ASP A 1 95  ? 8.486   8.650   56.015 1.00  0.00 ? 95  ASP A O    1  
ATOM   462    H H    . ASP A 1 95  ? 7.067   4.626   55.416 1.00  0.00 ? 95  ASP A H    1  
ATOM   463    N N    . ALA A 1 96  ? 7.658   7.595   54.211 1.00  0.00 ? 96  ALA A N    1  
ATOM   464    C CA   . ALA A 1 96  ? 7.795   8.669   53.276 1.00  0.00 ? 96  ALA A CA   1  
ATOM   465    C C    . ALA A 1 96  ? 6.734   9.777   53.412 1.00  0.00 ? 96  ALA A C    1  
ATOM   466    O O    . ALA A 1 96  ? 6.903   10.888  52.891 1.00  0.00 ? 96  ALA A O    1  
ATOM   467    H H    . ALA A 1 96  ? 7.291   6.754   53.868 1.00  0.00 ? 96  ALA A H    1  
ATOM   468    N N    . VAL A 1 97  ? 5.602   9.376   53.967 1.00  0.00 ? 97  VAL A N    1  
ATOM   469    C CA   . VAL A 1 97  ? 4.439   10.266  54.095 1.00  0.00 ? 97  VAL A CA   1  
ATOM   470    C C    . VAL A 1 97  ? 4.108   10.645  55.550 1.00  0.00 ? 97  VAL A C    1  
ATOM   471    O O    . VAL A 1 97  ? 2.954   10.925  55.852 1.00  0.00 ? 97  VAL A O    1  
ATOM   472    H H    . VAL A 1 97  ? 5.516   8.441   54.245 1.00  0.00 ? 97  VAL A H    1  
ATOM   473    N N    . ARG A 1 98  ? 5.081   10.592  56.394 1.00  0.00 ? 98  ARG A N    1  
ATOM   474    C CA   . ARG A 1 98  ? 5.028   10.963  57.803 1.00  0.00 ? 98  ARG A CA   1  
ATOM   475    C C    . ARG A 1 98  ? 5.704   12.339  57.927 1.00  0.00 ? 98  ARG A C    1  
ATOM   476    O O    . ARG A 1 98  ? 6.821   12.553  57.418 1.00  0.00 ? 98  ARG A O    1  
ATOM   477    H H    . ARG A 1 98  ? 5.953   10.313  56.045 1.00  0.00 ? 98  ARG A H    1  
ATOM   478    N N    . TYR A 1 99  ? 5.018   13.282  58.545 1.00  0.00 ? 99  TYR A N    1  
ATOM   479    C CA   . TYR A 1 99  ? 5.548   14.631  58.772 1.00  0.00 ? 99  TYR A CA   1  
ATOM   480    C C    . TYR A 1 99  ? 5.403   14.884  60.288 1.00  0.00 ? 99  TYR A C    1  
ATOM   481    O O    . TYR A 1 99  ? 4.299   15.147  60.765 1.00  0.00 ? 99  TYR A O    1  
ATOM   482    H H    . TYR A 1 99  ? 4.127   13.065  58.889 1.00  0.00 ? 99  TYR A H    1  
ATOM   483    N N    . ASN A 1 100 ? 6.526   14.693  60.934 1.00  0.00 ? 100 ASN A N    1  
ATOM   484    C CA   . ASN A 1 100 ? 6.701   14.831  62.375 1.00  0.00 ? 100 ASN A CA   1  
ATOM   485    C C    . ASN A 1 100 ? 5.708   13.956  63.119 1.00  0.00 ? 100 ASN A C    1  
ATOM   486    O O    . ASN A 1 100 ? 4.949   14.428  63.954 1.00  0.00 ? 100 ASN A O    1  
ATOM   487    H H    . ASN A 1 100 ? 7.308   14.422  60.408 1.00  0.00 ? 100 ASN A H    1  
ATOM   488    N N    . GLY A 1 101 ? 5.733   12.692  62.727 1.00  0.00 ? 101 GLY A N    1  
ATOM   489    C CA   . GLY A 1 101 ? 4.893   11.662  63.297 1.00  0.00 ? 101 GLY A CA   1  
ATOM   490    C C    . GLY A 1 101 ? 3.524   11.514  62.679 1.00  0.00 ? 101 GLY A C    1  
ATOM   491    O O    . GLY A 1 101 ? 2.994   10.380  62.742 1.00  0.00 ? 101 GLY A O    1  
ATOM   492    H H    . GLY A 1 101 ? 6.362   12.439  62.021 1.00  0.00 ? 101 GLY A H    1  
ATOM   493    N N    . LYS A 1 102 ? 2.965   12.555  62.116 1.00  0.00 ? 102 LYS A N    1  
ATOM   494    C CA   . LYS A 1 102 ? 1.635   12.543  61.501 1.00  0.00 ? 102 LYS A CA   1  
ATOM   495    C C    . LYS A 1 102 ? 1.682   12.032  60.047 1.00  0.00 ? 102 LYS A C    1  
ATOM   496    O O    . LYS A 1 102 ? 2.557   12.482  59.308 1.00  0.00 ? 102 LYS A O    1  
ATOM   497    H H    . LYS A 1 102 ? 3.463   13.400  62.118 1.00  0.00 ? 102 LYS A H    1  
ATOM   498    N N    . LEU A 1 103 ? 0.770   11.148  59.723 1.00  0.00 ? 103 LEU A N    1  
ATOM   499    C CA   . LEU A 1 103 ? 0.595   10.600  58.362 1.00  0.00 ? 103 LEU A CA   1  
ATOM   500    C C    . LEU A 1 103 ? -0.137  11.692  57.568 1.00  0.00 ? 103 LEU A C    1  
ATOM   501    O O    . LEU A 1 103 ? -1.291  12.039  57.923 1.00  0.00 ? 103 LEU A O    1  
ATOM   502    H H    . LEU A 1 103 ? 0.131   10.872  60.413 1.00  0.00 ? 103 LEU A H    1  
ATOM   503    N N    . ILE A 1 104 ? 0.462   12.190  56.514 1.00  0.00 ? 104 ILE A N    1  
ATOM   504    C CA   . ILE A 1 104 ? -0.110  13.250  55.697 1.00  0.00 ? 104 ILE A CA   1  
ATOM   505    C C    . ILE A 1 104 ? -0.373  12.913  54.245 1.00  0.00 ? 104 ILE A C    1  
ATOM   506    O O    . ILE A 1 104 ? -0.717  13.819  53.455 1.00  0.00 ? 104 ILE A O    1  
ATOM   507    H H    . ILE A 1 104 ? 1.348   11.846  56.277 1.00  0.00 ? 104 ILE A H    1  
ATOM   508    N N    . ALA A 1 105 ? -0.290  11.634  53.887 1.00  0.00 ? 105 ALA A N    1  
ATOM   509    C CA   . ALA A 1 105 ? -0.579  11.239  52.481 1.00  0.00 ? 105 ALA A CA   1  
ATOM   510    C C    . ALA A 1 105 ? -0.545  9.722   52.329 1.00  0.00 ? 105 ALA A C    1  
ATOM   511    O O    . ALA A 1 105 ? -0.021  9.040   53.168 1.00  0.00 ? 105 ALA A O    1  
ATOM   512    H H    . ALA A 1 105 ? -0.066  10.951  54.553 1.00  0.00 ? 105 ALA A H    1  
ATOM   513    N N    C TYR A 1 106 ? -1.129  9.277   51.225 0.05  0.00 ? 106 TYR A N    1  
ATOM   514    N N    O TYR A 1 106 ? -1.129  9.277   51.225 0.95  0.00 ? 106 TYR A N    1  
ATOM   515    C CA   C TYR A 1 106 ? -1.002  7.819   50.873 0.05  0.00 ? 106 TYR A CA   1  
ATOM   516    C CA   O TYR A 1 106 ? -1.092  7.802   50.927 0.95  0.00 ? 106 TYR A CA   1  
ATOM   517    C C    C TYR A 1 106 ? -0.090  7.736   49.607 0.05  0.00 ? 106 TYR A C    1  
ATOM   518    C C    O TYR A 1 106 ? -0.002  7.589   49.828 0.95  0.00 ? 106 TYR A C    1  
ATOM   519    O O    C TYR A 1 106 ? -0.560  8.149   48.567 0.05  0.00 ? 106 TYR A O    1  
ATOM   520    O O    O TYR A 1 106 ? -0.054  8.319   48.859 0.95  0.00 ? 106 TYR A O    1  
ATOM   521    H H    C TYR A 1 106 ? -1.593  9.897   50.623 0.05  0.00 ? 106 TYR A H    1  
ATOM   522    H H    O TYR A 1 106 ? -1.534  9.904   50.589 0.95  0.00 ? 106 TYR A H    1  
ATOM   523    N N    C PRO A 1 107 ? 1.071   7.173   49.823 0.05  0.00 ? 107 PRO A N    1  
ATOM   524    N N    O PRO A 1 107 ? 0.814   6.596   50.072 0.95  0.00 ? 107 PRO A N    1  
ATOM   525    C CA   C PRO A 1 107 ? 2.113   7.060   48.754 0.05  0.00 ? 107 PRO A CA   1  
ATOM   526    C CA   O PRO A 1 107 ? 1.916   6.221   49.130 0.95  0.00 ? 107 PRO A CA   1  
ATOM   527    C C    C PRO A 1 107 ? 1.428   6.588   47.480 0.05  0.00 ? 107 PRO A C    1  
ATOM   528    C C    O PRO A 1 107 ? 1.287   5.570   47.907 0.95  0.00 ? 107 PRO A C    1  
ATOM   529    O O    C PRO A 1 107 ? 0.278   6.137   47.581 0.05  0.00 ? 107 PRO A O    1  
ATOM   530    O O    O PRO A 1 107 ? 0.311   4.828   48.091 0.95  0.00 ? 107 PRO A O    1  
ATOM   531    N N    C ILE A 1 108 ? 1.983   6.753   46.325 0.05  0.00 ? 108 ILE A N    1  
ATOM   532    N N    O ILE A 1 108 ? 1.687   5.867   46.715 0.95  0.00 ? 108 ILE A N    1  
ATOM   533    C CA   C ILE A 1 108 ? 1.381   6.359   45.043 0.05  0.00 ? 108 ILE A CA   1  
ATOM   534    C CA   O ILE A 1 108 ? 1.128   5.299   45.480 0.95  0.00 ? 108 ILE A CA   1  
ATOM   535    C C    C ILE A 1 108 ? 2.409   5.729   44.069 0.05  0.00 ? 108 ILE A C    1  
ATOM   536    C C    O ILE A 1 108 ? 2.152   4.429   44.707 0.95  0.00 ? 108 ILE A C    1  
ATOM   537    O O    C ILE A 1 108 ? 2.552   4.503   43.992 0.05  0.00 ? 108 ILE A O    1  
ATOM   538    O O    O ILE A 1 108 ? 1.992   3.209   44.581 0.95  0.00 ? 108 ILE A O    1  
ATOM   539    H H    C ILE A 1 108 ? 2.865   7.180   46.300 0.05  0.00 ? 108 ILE A H    1  
ATOM   540    H H    O ILE A 1 108 ? 2.408   6.525   46.627 0.95  0.00 ? 108 ILE A H    1  
ATOM   541    N N    C ALA A 1 109 ? 3.131   6.617   43.388 0.05  0.00 ? 109 ALA A N    1  
ATOM   542    N N    O ALA A 1 109 ? 3.209   5.101   44.255 0.95  0.00 ? 109 ALA A N    1  
ATOM   543    C CA   C ALA A 1 109 ? 4.146   6.200   42.361 0.05  0.00 ? 109 ALA A CA   1  
ATOM   544    C CA   O ALA A 1 109 ? 4.301   4.435   43.466 0.95  0.00 ? 109 ALA A CA   1  
ATOM   545    C C    C ALA A 1 109 ? 5.169   7.283   42.147 0.05  0.00 ? 109 ALA A C    1  
ATOM   546    C C    O ALA A 1 109 ? 5.647   4.698   44.084 0.95  0.00 ? 109 ALA A C    1  
ATOM   547    O O    C ALA A 1 109 ? 5.212   8.243   42.931 0.05  0.00 ? 109 ALA A O    1  
ATOM   548    O O    O ALA A 1 109 ? 5.769   5.614   44.912 0.95  0.00 ? 109 ALA A O    1  
ATOM   549    H H    C ALA A 1 109 ? 2.988   7.572   43.554 0.05  0.00 ? 109 ALA A H    1  
ATOM   550    H H    O ALA A 1 109 ? 3.271   6.063   44.432 0.95  0.00 ? 109 ALA A H    1  
ATOM   551    N N    C VAL A 1 110 ? 6.028   7.180   41.166 0.05  0.00 ? 110 VAL A N    1  
ATOM   552    N N    O VAL A 1 110 ? 6.664   3.934   43.776 0.95  0.00 ? 110 VAL A N    1  
ATOM   553    C CA   C VAL A 1 110 ? 7.120   8.111   40.845 0.05  0.00 ? 110 VAL A CA   1  
ATOM   554    C CA   O VAL A 1 110 ? 8.035   4.034   44.297 0.95  0.00 ? 110 VAL A CA   1  
ATOM   555    C C    C VAL A 1 110 ? 7.411   8.090   39.329 0.05  0.00 ? 110 VAL A C    1  
ATOM   556    C C    O VAL A 1 110 ? 9.044   4.119   43.132 0.95  0.00 ? 110 VAL A C    1  
ATOM   557    O O    C VAL A 1 110 ? 7.122   7.108   38.614 0.05  0.00 ? 110 VAL A O    1  
ATOM   558    O O    O VAL A 1 110 ? 8.899   3.458   42.083 0.95  0.00 ? 110 VAL A O    1  
ATOM   559    H H    C VAL A 1 110 ? 5.943   6.392   40.591 0.05  0.00 ? 110 VAL A H    1  
ATOM   560    H H    O VAL A 1 110 ? 6.490   3.210   43.140 0.95  0.00 ? 110 VAL A H    1  
ATOM   561    N N    C GLU A 1 111 ? 7.930   9.183   38.801 0.05  0.00 ? 111 GLU A N    1  
ATOM   562    N N    O GLU A 1 111 ? 10.045  4.970   43.264 0.95  0.00 ? 111 GLU A N    1  
ATOM   563    C CA   C GLU A 1 111 ? 8.289   9.293   37.373 0.05  0.00 ? 111 GLU A CA   1  
ATOM   564    C CA   O GLU A 1 111 ? 11.075  5.166   42.224 0.95  0.00 ? 111 GLU A CA   1  
ATOM   565    C C    C GLU A 1 111 ? 9.768   9.536   37.235 0.05  0.00 ? 111 GLU A C    1  
ATOM   566    C C    O GLU A 1 111 ? 12.439  5.216   42.859 0.95  0.00 ? 111 GLU A C    1  
ATOM   567    O O    C GLU A 1 111 ? 10.436  9.887   38.240 0.05  0.00 ? 111 GLU A O    1  
ATOM   568    O O    O GLU A 1 111 ? 12.587  5.784   43.970 0.95  0.00 ? 111 GLU A O    1  
ATOM   569    H H    C GLU A 1 111 ? 8.076   9.961   39.381 0.05  0.00 ? 111 GLU A H    1  
ATOM   570    H H    O GLU A 1 111 ? 10.103  5.502   44.086 0.95  0.00 ? 111 GLU A H    1  
ATOM   571    N N    C ALA A 1 112 ? 10.307  9.275   36.043 0.05  0.00 ? 112 ALA A N    1  
ATOM   572    N N    O ALA A 1 112 ? 13.416  4.565   42.226 0.95  0.00 ? 112 ALA A N    1  
ATOM   573    C CA   C ALA A 1 112 ? 11.732  9.418   35.775 0.05  0.00 ? 112 ALA A CA   1  
ATOM   574    C CA   O ALA A 1 112 ? 14.787  4.531   42.718 0.95  0.00 ? 112 ALA A CA   1  
ATOM   575    C C    C ALA A 1 112 ? 11.920  9.069   34.286 0.05  0.00 ? 112 ALA A C    1  
ATOM   576    C C    O ALA A 1 112 ? 15.667  4.205   41.496 0.95  0.00 ? 112 ALA A C    1  
ATOM   577    O O    C ALA A 1 112 ? 11.003  8.416   33.722 0.05  0.00 ? 112 ALA A O    1  
ATOM   578    O O    O ALA A 1 112 ? 15.120  3.619   40.525 0.95  0.00 ? 112 ALA A O    1  
ATOM   579    H H    C ALA A 1 112 ? 9.720   8.979   35.316 0.05  0.00 ? 112 ALA A H    1  
ATOM   580    H H    O ALA A 1 112 ? 13.204  4.093   41.393 0.95  0.00 ? 112 ALA A H    1  
ATOM   581    N N    C LEU A 1 113 ? 13.019  9.535   33.734 0.05  0.00 ? 113 LEU A N    1  
ATOM   582    N N    O LEU A 1 113 ? 16.913  4.619   41.574 0.95  0.00 ? 113 LEU A N    1  
ATOM   583    C CA   C LEU A 1 113 ? 13.328  9.256   32.300 0.05  0.00 ? 113 LEU A CA   1  
ATOM   584    C CA   O LEU A 1 113 ? 17.885  4.322   40.480 0.95  0.00 ? 113 LEU A CA   1  
ATOM   585    C C    C LEU A 1 113 ? 14.400  8.187   32.256 0.05  0.00 ? 113 LEU A C    1  
ATOM   586    C C    O LEU A 1 113 ? 18.165  2.834   40.500 0.95  0.00 ? 113 LEU A C    1  
ATOM   587    O O    C LEU A 1 113 ? 15.052  7.855   33.222 0.05  0.00 ? 113 LEU A O    1  
ATOM   588    O O    O LEU A 1 113 ? 18.103  2.156   41.502 0.95  0.00 ? 113 LEU A O    1  
ATOM   589    H H    C LEU A 1 113 ? 13.657  10.040  34.278 0.05  0.00 ? 113 LEU A H    1  
ATOM   590    H H    O LEU A 1 113 ? 17.215  5.097   42.374 0.95  0.00 ? 113 LEU A H    1  
ATOM   591    N N    C SER A 1 114 ? 14.660  7.726   31.020 0.05  0.00 ? 114 SER A N    1  
ATOM   592    N N    O SER A 1 114 ? 18.616  2.349   39.330 0.95  0.00 ? 114 SER A N    1  
ATOM   593    C CA   C SER A 1 114 ? 15.735  6.736   30.805 0.05  0.00 ? 114 SER A CA   1  
ATOM   594    C CA   O SER A 1 114 ? 18.987  0.924   39.207 0.95  0.00 ? 114 SER A CA   1  
ATOM   595    C C    C SER A 1 114 ? 16.072  6.773   29.270 0.05  0.00 ? 114 SER A C    1  
ATOM   596    C C    O SER A 1 114 ? 20.256  0.873   38.282 0.95  0.00 ? 114 SER A C    1  
ATOM   597    O O    C SER A 1 114 ? 15.373  7.499   28.602 0.05  0.00 ? 114 SER A O    1  
ATOM   598    O O    O SER A 1 114 ? 20.509  1.897   37.690 0.95  0.00 ? 114 SER A O    1  
ATOM   599    H H    C SER A 1 114 ? 14.157  8.076   30.255 0.05  0.00 ? 114 SER A H    1  
ATOM   600    H H    O SER A 1 114 ? 18.734  2.952   38.566 0.95  0.00 ? 114 SER A H    1  
ATOM   601    N N    C LEU A 1 115 ? 17.068  6.043   28.942 0.05  0.00 ? 115 LEU A N    1  
ATOM   602    N N    O LEU A 1 115 ? 20.869  -0.248  38.307 0.95  0.00 ? 115 LEU A N    1  
ATOM   603    C CA   C LEU A 1 115 ? 17.503  5.926   27.501 0.05  0.00 ? 115 LEU A CA   1  
ATOM   604    C CA   O LEU A 1 115 ? 22.049  -0.507  37.401 0.95  0.00 ? 115 LEU A CA   1  
ATOM   605    C C    C LEU A 1 115 ? 16.640  4.809   26.878 0.05  0.00 ? 115 LEU A C    1  
ATOM   606    C C    O LEU A 1 115 ? 21.466  -0.998  36.060 0.95  0.00 ? 115 LEU A C    1  
ATOM   607    O O    C LEU A 1 115 ? 16.673  3.725   27.469 0.05  0.00 ? 115 LEU A O    1  
ATOM   608    O O    O LEU A 1 115 ? 20.710  -1.971  36.138 0.95  0.00 ? 115 LEU A O    1  
ATOM   609    H H    C LEU A 1 115 ? 17.516  5.502   29.626 0.05  0.00 ? 115 LEU A H    1  
ATOM   610    H H    O LEU A 1 115 ? 20.529  -0.971  38.874 0.95  0.00 ? 115 LEU A H    1  
ATOM   611    N N    C ILE A 1 116 ? 15.900  5.096   25.865 0.05  0.00 ? 116 ILE A N    1  
ATOM   612    N N    O ILE A 1 116 ? 21.730  -0.329  34.993 0.95  0.00 ? 116 ILE A N    1  
ATOM   613    C CA   C ILE A 1 116 ? 15.015  4.136   25.161 0.05  0.00 ? 116 ILE A CA   1  
ATOM   614    C CA   O ILE A 1 116 ? 21.242  -0.670  33.634 0.95  0.00 ? 116 ILE A CA   1  
ATOM   615    C C    C ILE A 1 116 ? 15.702  3.838   23.819 0.05  0.00 ? 116 ILE A C    1  
ATOM   616    C C    O ILE A 1 116 ? 22.461  -1.218  32.875 0.95  0.00 ? 116 ILE A C    1  
ATOM   617    O O    C ILE A 1 116 ? 16.014  4.850   23.184 0.05  0.00 ? 116 ILE A O    1  
ATOM   618    O O    O ILE A 1 116 ? 23.450  -0.480  32.924 0.95  0.00 ? 116 ILE A O    1  
ATOM   619    H H    C ILE A 1 116 ? 15.922  6.019   25.535 0.05  0.00 ? 116 ILE A H    1  
ATOM   620    H H    O ILE A 1 116 ? 22.295  0.467   35.085 0.95  0.00 ? 116 ILE A H    1  
ATOM   621    N N    C TYR A 1 117 ? 15.874  2.602   23.402 0.05  0.00 ? 117 TYR A N    1  
ATOM   622    N N    O TYR A 1 117 ? 22.394  -2.349  32.206 0.95  0.00 ? 117 TYR A N    1  
ATOM   623    C CA   C TYR A 1 117 ? 16.592  2.382   22.117 0.05  0.00 ? 117 TYR A CA   1  
ATOM   624    C CA   O TYR A 1 117 ? 23.625  -2.848  31.535 0.95  0.00 ? 117 TYR A CA   1  
ATOM   625    C C    C TYR A 1 117 ? 15.916  1.274   21.327 0.05  0.00 ? 117 TYR A C    1  
ATOM   626    C C    O TYR A 1 117 ? 23.279  -3.419  30.171 0.95  0.00 ? 117 TYR A C    1  
ATOM   627    O O    C TYR A 1 117 ? 15.178  0.502   21.907 0.05  0.00 ? 117 TYR A O    1  
ATOM   628    O O    O TYR A 1 117 ? 22.127  -3.731  29.937 0.95  0.00 ? 117 TYR A O    1  
ATOM   629    H H    C TYR A 1 117 ? 15.567  1.843   23.942 0.05  0.00 ? 117 TYR A H    1  
ATOM   630    H H    O TYR A 1 117 ? 21.562  -2.867  32.179 0.95  0.00 ? 117 TYR A H    1  
ATOM   631    N N    C ASN A 1 118 ? 16.165  1.278   20.056 0.05  0.00 ? 118 ASN A N    1  
ATOM   632    N N    O ASN A 1 118 ? 24.268  -3.487  29.338 0.95  0.00 ? 118 ASN A N    1  
ATOM   633    C CA   C ASN A 1 118 ? 15.574  0.351   19.058 0.05  0.00 ? 118 ASN A CA   1  
ATOM   634    C CA   O ASN A 1 118 ? 24.180  -3.937  27.926 0.95  0.00 ? 118 ASN A CA   1  
ATOM   635    C C    C ASN A 1 118 ? 16.553  -0.820  18.947 0.05  0.00 ? 118 ASN A C    1  
ATOM   636    C C    O ASN A 1 118 ? 24.479  -5.438  27.948 0.95  0.00 ? 118 ASN A C    1  
ATOM   637    O O    C ASN A 1 118 ? 17.626  -0.582  18.439 0.05  0.00 ? 118 ASN A O    1  
ATOM   638    O O    O ASN A 1 118 ? 25.613  -5.759  28.225 0.95  0.00 ? 118 ASN A O    1  
ATOM   639    H H    C ASN A 1 118 ? 16.758  1.980   19.719 0.05  0.00 ? 118 ASN A H    1  
ATOM   640    H H    O ASN A 1 118 ? 25.140  -3.172  29.653 0.95  0.00 ? 118 ASN A H    1  
ATOM   641    N N    C LYS A 1 119 ? 16.148  -1.968  19.483 0.05  0.00 ? 119 LYS A N    1  
ATOM   642    N N    O LYS A 1 119 ? 23.442  -6.240  27.725 0.95  0.00 ? 119 LYS A N    1  
ATOM   643    C CA   C LYS A 1 119 ? 16.992  -3.170  19.535 0.05  0.00 ? 119 LYS A CA   1  
ATOM   644    C CA   O LYS A 1 119 ? 23.535  -7.705  27.787 0.95  0.00 ? 119 LYS A CA   1  
ATOM   645    C C    C LYS A 1 119 ? 17.340  -3.706  18.151 0.05  0.00 ? 119 LYS A C    1  
ATOM   646    C C    O LYS A 1 119 ? 24.467  -8.282  26.728 0.95  0.00 ? 119 LYS A C    1  
ATOM   647    O O    C LYS A 1 119 ? 18.393  -4.381  18.051 0.05  0.00 ? 119 LYS A O    1  
ATOM   648    O O    O LYS A 1 119 ? 24.990  -9.395  26.977 0.95  0.00 ? 119 LYS A O    1  
ATOM   649    H H    C LYS A 1 119 ? 15.266  -1.999  19.908 0.05  0.00 ? 119 LYS A H    1  
ATOM   650    H H    O LYS A 1 119 ? 22.565  -5.835  27.562 0.95  0.00 ? 119 LYS A H    1  
ATOM   651    N N    C ASP A 1 120 ? 16.520  -3.371  17.188 0.05  0.00 ? 120 ASP A N    1  
ATOM   652    N N    O ASP A 1 120 ? 24.663  -7.534  25.673 0.95  0.00 ? 120 ASP A N    1  
ATOM   653    C CA   C ASP A 1 120 ? 16.763  -3.779  15.780 0.05  0.00 ? 120 ASP A CA   1  
ATOM   654    C CA   O ASP A 1 120 ? 25.587  -7.946  24.585 0.95  0.00 ? 120 ASP A CA   1  
ATOM   655    C C    C ASP A 1 120 ? 17.792  -2.893  15.093 0.05  0.00 ? 120 ASP A C    1  
ATOM   656    C C    O ASP A 1 120 ? 27.044  -7.681  24.935 0.95  0.00 ? 120 ASP A C    1  
ATOM   657    O O    C ASP A 1 120 ? 18.437  -3.360  14.108 0.05  0.00 ? 120 ASP A O    1  
ATOM   658    O O    O ASP A 1 120 ? 27.942  -8.368  24.365 0.95  0.00 ? 120 ASP A O    1  
ATOM   659    H H    C ASP A 1 120 ? 15.745  -2.809  17.395 0.05  0.00 ? 120 ASP A H    1  
ATOM   660    H H    O ASP A 1 120 ? 24.215  -6.664  25.615 0.95  0.00 ? 120 ASP A H    1  
ATOM   661    N N    C LEU A 1 121 ? 18.023  -1.658  15.481 0.05  0.00 ? 121 LEU A N    1  
ATOM   662    N N    O LEU A 1 121 ? 27.399  -6.756  25.799 0.95  0.00 ? 121 LEU A N    1  
ATOM   663    C CA   C LEU A 1 121 ? 19.001  -0.772  14.840 0.05  0.00 ? 121 LEU A CA   1  
ATOM   664    C CA   O LEU A 1 121 ? 28.792  -6.466  26.157 0.95  0.00 ? 121 LEU A CA   1  
ATOM   665    C C    C LEU A 1 121 ? 20.308  -0.730  15.600 0.05  0.00 ? 121 LEU A C    1  
ATOM   666    C C    O LEU A 1 121 ? 29.191  -7.131  27.455 0.95  0.00 ? 121 LEU A C    1  
ATOM   667    O O    C LEU A 1 121 ? 21.365  -0.479  15.016 0.05  0.00 ? 121 LEU A O    1  
ATOM   668    O O    O LEU A 1 121 ? 30.368  -7.429  27.671 0.95  0.00 ? 121 LEU A O    1  
ATOM   669    H H    C LEU A 1 121 ? 17.510  -1.309  16.238 0.05  0.00 ? 121 LEU A H    1  
ATOM   670    H H    O LEU A 1 121 ? 26.693  -6.227  26.225 0.95  0.00 ? 121 LEU A H    1  
ATOM   671    N N    C LEU A 1 122 ? 20.154  -0.961  16.902 0.05  0.00 ? 122 LEU A N    1  
ATOM   672    N N    O LEU A 1 122 ? 28.162  -7.308  28.281 0.95  0.00 ? 122 LEU A N    1  
ATOM   673    C CA   C LEU A 1 122 ? 21.271  -0.859  17.838 0.05  0.00 ? 122 LEU A CA   1  
ATOM   674    C CA   O LEU A 1 122 ? 28.342  -7.832  29.633 0.95  0.00 ? 122 LEU A CA   1  
ATOM   675    C C    C LEU A 1 122 ? 21.290  -2.078  18.750 0.05  0.00 ? 122 LEU A C    1  
ATOM   676    C C    O LEU A 1 122 ? 27.320  -8.929  29.899 0.95  0.00 ? 122 LEU A C    1  
ATOM   677    O O    C LEU A 1 122 ? 20.396  -2.207  19.577 0.05  0.00 ? 122 LEU A O    1  
ATOM   678    O O    O LEU A 1 122 ? 26.139  -8.619  30.001 0.95  0.00 ? 122 LEU A O    1  
ATOM   679    H H    C LEU A 1 122 ? 19.256  -1.133  17.251 0.05  0.00 ? 122 LEU A H    1  
ATOM   680    H H    O LEU A 1 122 ? 27.272  -7.012  28.001 0.95  0.00 ? 122 LEU A H    1  
ATOM   681    N N    C PRO A 1 123 ? 22.325  -2.885  18.570 0.05  0.00 ? 123 PRO A N    1  
ATOM   682    N N    O PRO A 1 123 ? 27.835  -10.142 30.030 0.95  0.00 ? 123 PRO A N    1  
ATOM   683    C CA   C PRO A 1 123 ? 22.564  -4.110  19.326 0.05  0.00 ? 123 PRO A CA   1  
ATOM   684    C CA   O PRO A 1 123 ? 27.059  -11.349 30.294 0.95  0.00 ? 123 PRO A CA   1  
ATOM   685    C C    C PRO A 1 123 ? 22.691  -3.841  20.817 0.05  0.00 ? 123 PRO A C    1  
ATOM   686    C C    O PRO A 1 123 ? 26.278  -11.249 31.594 0.95  0.00 ? 123 PRO A C    1  
ATOM   687    O O    C PRO A 1 123 ? 22.015  -4.409  21.690 0.05  0.00 ? 123 PRO A O    1  
ATOM   688    O O    O PRO A 1 123 ? 25.053  -11.429 31.691 0.95  0.00 ? 123 PRO A O    1  
ATOM   689    N N    C ASN A 1 124 ? 23.642  -2.959  21.077 0.05  0.00 ? 124 ASN A N    1  
ATOM   690    N N    O ASN A 1 124 ? 27.069  -10.988 32.622 0.95  0.00 ? 124 ASN A N    1  
ATOM   691    C CA   C ASN A 1 124 ? 23.929  -2.532  22.460 0.05  0.00 ? 124 ASN A CA   1  
ATOM   692    C CA   O ASN A 1 124 ? 26.523  -10.829 33.984 0.95  0.00 ? 124 ASN A CA   1  
ATOM   693    C C    C ASN A 1 124 ? 23.924  -0.997  22.459 0.05  0.00 ? 124 ASN A C    1  
ATOM   694    C C    O ASN A 1 124 ? 27.081  -9.509  34.533 0.95  0.00 ? 124 ASN A C    1  
ATOM   695    O O    C ASN A 1 124 ? 24.542  -0.401  21.581 0.05  0.00 ? 124 ASN A O    1  
ATOM   696    O O    O ASN A 1 124 ? 28.280  -9.274  34.411 0.95  0.00 ? 124 ASN A O    1  
ATOM   697    H H    C ASN A 1 124 ? 24.155  -2.572  20.338 0.05  0.00 ? 124 ASN A H    1  
ATOM   698    H H    O ASN A 1 124 ? 28.032  -10.886 32.475 0.95  0.00 ? 124 ASN A H    1  
ATOM   699    N N    C PRO A 1 125 ? 23.212  -0.474  23.432 0.05  0.00 ? 125 PRO A N    1  
ATOM   700    N N    O PRO A 1 125 ? 26.166  -8.739  35.078 0.95  0.00 ? 125 PRO A N    1  
ATOM   701    C CA   C PRO A 1 125 ? 23.129  1.001   23.578 0.05  0.00 ? 125 PRO A CA   1  
ATOM   702    C CA   O PRO A 1 125 ? 26.555  -7.436  35.675 0.95  0.00 ? 125 PRO A CA   1  
ATOM   703    C C    C PRO A 1 125 ? 24.507  1.512   23.944 0.05  0.00 ? 125 PRO A C    1  
ATOM   704    C C    O PRO A 1 125 ? 27.428  -7.718  36.880 0.95  0.00 ? 125 PRO A C    1  
ATOM   705    O O    C PRO A 1 125 ? 25.272  0.778   24.573 0.05  0.00 ? 125 PRO A O    1  
ATOM   706    O O    O PRO A 1 125 ? 27.265  -8.766  37.508 0.95  0.00 ? 125 PRO A O    1  
ATOM   707    N N    C PRO A 1 126 ? 24.785  2.765   23.602 0.05  0.00 ? 126 PRO A N    1  
ATOM   708    N N    O PRO A 1 126 ? 28.293  -6.769  37.220 0.95  0.00 ? 126 PRO A N    1  
ATOM   709    C CA   C PRO A 1 126 ? 26.077  3.386   23.921 0.05  0.00 ? 126 PRO A CA   1  
ATOM   710    C CA   O PRO A 1 126 ? 29.179  -6.909  38.383 0.95  0.00 ? 126 PRO A CA   1  
ATOM   711    C C    C PRO A 1 126 ? 26.146  3.602   25.434 0.05  0.00 ? 126 PRO A C    1  
ATOM   712    C C    O PRO A 1 126 ? 28.326  -6.826  39.650 0.95  0.00 ? 126 PRO A C    1  
ATOM   713    O O    C PRO A 1 126 ? 25.086  3.874   25.991 0.05  0.00 ? 126 PRO A O    1  
ATOM   714    O O    O PRO A 1 126 ? 27.355  -6.075  39.601 0.95  0.00 ? 126 PRO A O    1  
ATOM   715    N N    C LYS A 1 127 ? 27.313  3.464   25.992 0.05  0.00 ? 127 LYS A N    1  
ATOM   716    N N    O LYS A 1 127 ? 28.696  -7.565  40.655 0.95  0.00 ? 127 LYS A N    1  
ATOM   717    C CA   C LYS A 1 127 ? 27.493  3.643   27.397 0.05  0.00 ? 127 LYS A CA   1  
ATOM   718    C CA   O LYS A 1 127 ? 27.974  -7.565  41.886 0.95  0.00 ? 127 LYS A CA   1  
ATOM   719    C C    C LYS A 1 127 ? 27.813  5.088   27.755 0.05  0.00 ? 127 LYS A C    1  
ATOM   720    C C    O LYS A 1 127 ? 28.484  -6.503  42.851 0.95  0.00 ? 127 LYS A C    1  
ATOM   721    O O    C LYS A 1 127 ? 27.618  5.537   28.870 0.05  0.00 ? 127 LYS A O    1  
ATOM   722    O O    O LYS A 1 127 ? 27.797  -6.067  43.757 0.95  0.00 ? 127 LYS A O    1  
ATOM   723    H H    C LYS A 1 127 ? 28.086  3.233   25.436 0.05  0.00 ? 127 LYS A H    1  
ATOM   724    H H    O LYS A 1 127 ? 29.489  -8.133  40.565 0.95  0.00 ? 127 LYS A H    1  
ATOM   725    N N    C THR A 1 128 ? 28.236  5.780   26.752 0.05  0.00 ? 128 THR A N    1  
ATOM   726    N N    O THR A 1 128 ? 29.669  -6.081  42.564 0.95  0.00 ? 128 THR A N    1  
ATOM   727    C CA   C THR A 1 128 ? 28.734  7.162   26.784 0.05  0.00 ? 128 THR A CA   1  
ATOM   728    C CA   O THR A 1 128 ? 30.486  -5.150  43.354 0.95  0.00 ? 128 THR A CA   1  
ATOM   729    C C    C THR A 1 128 ? 28.053  8.101   25.834 0.05  0.00 ? 128 THR A C    1  
ATOM   730    C C    O THR A 1 128 ? 30.987  -3.954  42.601 0.95  0.00 ? 128 THR A C    1  
ATOM   731    O O    C THR A 1 128 ? 27.596  7.700   24.747 0.05  0.00 ? 128 THR A O    1  
ATOM   732    O O    O THR A 1 128 ? 31.238  -4.017  41.383 0.95  0.00 ? 128 THR A O    1  
ATOM   733    H H    C THR A 1 128 ? 28.300  5.313   25.892 0.05  0.00 ? 128 THR A H    1  
ATOM   734    H H    O THR A 1 128 ? 30.097  -6.477  41.776 0.95  0.00 ? 128 THR A H    1  
ATOM   735    N N    C TRP A 1 129 ? 27.999  9.391   26.227 0.05  0.00 ? 129 TRP A N    1  
ATOM   736    N N    O TRP A 1 129 ? 31.168  -2.836  43.335 0.95  0.00 ? 129 TRP A N    1  
ATOM   737    C CA   C TRP A 1 129 ? 27.469  10.443  25.377 0.05  0.00 ? 129 TRP A CA   1  
ATOM   738    C CA   O TRP A 1 129 ? 31.747  -1.625  42.780 0.95  0.00 ? 129 TRP A CA   1  
ATOM   739    C C    C TRP A 1 129 ? 28.547  10.760  24.282 0.05  0.00 ? 129 TRP A C    1  
ATOM   740    C C    O TRP A 1 129 ? 33.293  -1.855  42.641 0.95  0.00 ? 129 TRP A C    1  
ATOM   741    O O    C TRP A 1 129 ? 28.170  11.152  23.203 0.05  0.00 ? 129 TRP A O    1  
ATOM   742    O O    O TRP A 1 129 ? 33.881  -1.278  41.758 0.95  0.00 ? 129 TRP A O    1  
ATOM   743    H H    C TRP A 1 129 ? 28.395  9.638   27.089 0.05  0.00 ? 129 TRP A H    1  
ATOM   744    H H    O TRP A 1 129 ? 30.967  -2.864  44.294 0.95  0.00 ? 129 TRP A H    1  
ATOM   745    N N    C GLU A 1 130 ? 29.797  10.643  24.639 0.05  0.00 ? 130 GLU A N    1  
ATOM   746    N N    O GLU A 1 130 ? 33.857  -2.610  43.545 0.95  0.00 ? 130 GLU A N    1  
ATOM   747    C CA   C GLU A 1 130 ? 30.936  10.973  23.803 0.05  0.00 ? 130 GLU A CA   1  
ATOM   748    C CA   O GLU A 1 130 ? 35.281  -2.871  43.641 0.95  0.00 ? 130 GLU A CA   1  
ATOM   749    C C    C GLU A 1 130 ? 31.005  10.166  22.524 0.05  0.00 ? 130 GLU A C    1  
ATOM   750    C C    O GLU A 1 130 ? 35.859  -3.543  42.414 0.95  0.00 ? 130 GLU A C    1  
ATOM   751    O O    C GLU A 1 130 ? 31.544  10.644  21.512 0.05  0.00 ? 130 GLU A O    1  
ATOM   752    O O    O GLU A 1 130 ? 37.049  -3.363  42.106 0.95  0.00 ? 130 GLU A O    1  
ATOM   753    H H    C GLU A 1 130 ? 29.980  10.364  25.560 0.05  0.00 ? 130 GLU A H    1  
ATOM   754    H H    O GLU A 1 130 ? 33.282  -2.983  44.245 0.95  0.00 ? 130 GLU A H    1  
ATOM   755    N N    C GLU A 1 131 ? 30.379  9.012   22.542 0.05  0.00 ? 131 GLU A N    1  
ATOM   756    N N    O GLU A 1 131 ? 35.006  -4.215  41.675 0.95  0.00 ? 131 GLU A N    1  
ATOM   757    C CA   C GLU A 1 131 ? 30.380  8.125   21.367 0.05  0.00 ? 131 GLU A CA   1  
ATOM   758    C CA   O GLU A 1 131 ? 35.443  -4.925  40.462 0.95  0.00 ? 131 GLU A CA   1  
ATOM   759    C C    C GLU A 1 131 ? 29.173  8.299   20.513 0.05  0.00 ? 131 GLU A C    1  
ATOM   760    C C    O GLU A 1 131 ? 35.250  -4.122  39.223 0.95  0.00 ? 131 GLU A C    1  
ATOM   761    O O    C GLU A 1 131 ? 29.095  7.598   19.473 0.05  0.00 ? 131 GLU A O    1  
ATOM   762    O O    O GLU A 1 131 ? 35.614  -4.638  38.137 0.95  0.00 ? 131 GLU A O    1  
ATOM   763    H H    C GLU A 1 131 ? 29.909  8.732   23.356 0.05  0.00 ? 131 GLU A H    1  
ATOM   764    H H    O GLU A 1 131 ? 34.063  -4.251  41.941 0.95  0.00 ? 131 GLU A H    1  
ATOM   765    N N    C ILE A 1 132 ? 28.242  9.197   20.796 0.05  0.00 ? 132 ILE A N    1  
ATOM   766    N N    O ILE A 1 132 ? 34.772  -2.888  39.260 0.95  0.00 ? 132 ILE A N    1  
ATOM   767    C CA   C ILE A 1 132 ? 27.060  9.404   19.989 0.05  0.00 ? 132 ILE A CA   1  
ATOM   768    C CA   O ILE A 1 132 ? 34.577  -2.071  38.083 0.95  0.00 ? 132 ILE A CA   1  
ATOM   769    C C    C ILE A 1 132 ? 27.317  10.006  18.617 0.05  0.00 ? 132 ILE A C    1  
ATOM   770    C C    O ILE A 1 132 ? 35.856  -1.625  37.393 0.95  0.00 ? 132 ILE A C    1  
ATOM   771    O O    C ILE A 1 132 ? 26.722  9.548   17.613 0.05  0.00 ? 132 ILE A O    1  
ATOM   772    O O    O ILE A 1 132 ? 35.940  -1.670  36.143 0.95  0.00 ? 132 ILE A O    1  
ATOM   773    H H    C ILE A 1 132 ? 28.364  9.756   21.592 0.05  0.00 ? 132 ILE A H    1  
ATOM   774    H H    O ILE A 1 132 ? 34.543  -2.505  40.133 0.95  0.00 ? 132 ILE A H    1  
ATOM   775    N N    C PRO A 1 133 ? 28.133  11.027  18.525 0.05  0.00 ? 133 PRO A N    1  
ATOM   776    N N    O PRO A 1 133 ? 36.835  -1.161  38.130 0.95  0.00 ? 133 PRO A N    1  
ATOM   777    C CA   C PRO A 1 133 ? 28.469  11.642  17.241 0.05  0.00 ? 133 PRO A CA   1  
ATOM   778    C CA   O PRO A 1 133 ? 38.115  -0.748  37.554 0.95  0.00 ? 133 PRO A CA   1  
ATOM   779    C C    C PRO A 1 133 ? 28.922  10.627  16.181 0.05  0.00 ? 133 PRO A C    1  
ATOM   780    C C    O PRO A 1 133 ? 38.733  -1.804  36.626 0.95  0.00 ? 133 PRO A C    1  
ATOM   781    O O    C PRO A 1 133 ? 28.406  10.689  15.057 0.05  0.00 ? 133 PRO A O    1  
ATOM   782    O O    O PRO A 1 133 ? 39.137  -1.438  35.514 0.95  0.00 ? 133 PRO A O    1  
ATOM   783    N N    C ALA A 1 134 ? 29.829  9.754   16.474 0.05  0.00 ? 134 ALA A N    1  
ATOM   784    N N    O ALA A 1 134 ? 38.832  -3.030  37.024 0.95  0.00 ? 134 ALA A N    1  
ATOM   785    C CA   C ALA A 1 134 ? 30.397  8.694   15.659 0.05  0.00 ? 134 ALA A CA   1  
ATOM   786    C CA   O ALA A 1 134 ? 39.352  -4.194  36.328 0.95  0.00 ? 134 ALA A CA   1  
ATOM   787    C C    C ALA A 1 134 ? 29.354  7.671   15.235 0.05  0.00 ? 134 ALA A C    1  
ATOM   788    C C    O ALA A 1 134 ? 38.554  -4.521  35.075 0.95  0.00 ? 134 ALA A C    1  
ATOM   789    O O    C ALA A 1 134 ? 29.290  7.142   14.088 0.05  0.00 ? 134 ALA A O    1  
ATOM   790    O O    O ALA A 1 134 ? 39.060  -4.892  33.977 0.95  0.00 ? 134 ALA A O    1  
ATOM   791    H H    C ALA A 1 134 ? 30.177  9.806   17.389 0.05  0.00 ? 134 ALA A H    1  
ATOM   792    H H    O ALA A 1 134 ? 38.493  -3.203  37.927 0.95  0.00 ? 134 ALA A H    1  
ATOM   793    N N    C LEU A 1 135 ? 28.480  7.329   16.152 0.05  0.00 ? 135 LEU A N    1  
ATOM   794    N N    O LEU A 1 135 ? 37.251  -4.409  35.179 0.95  0.00 ? 135 LEU A N    1  
ATOM   795    C CA   C LEU A 1 135 ? 27.373  6.407   15.968 0.05  0.00 ? 135 LEU A CA   1  
ATOM   796    C CA   O LEU A 1 135 ? 36.292  -4.627  34.111 0.95  0.00 ? 135 LEU A CA   1  
ATOM   797    C C    C LEU A 1 135 ? 26.359  7.013   14.997 0.05  0.00 ? 135 LEU A C    1  
ATOM   798    C C    O LEU A 1 135 ? 36.462  -3.546  33.043 0.95  0.00 ? 135 LEU A C    1  
ATOM   799    O O    C LEU A 1 135 ? 25.785  6.300   14.176 0.05  0.00 ? 135 LEU A O    1  
ATOM   800    O O    O LEU A 1 135 ? 36.348  -3.829  31.852 0.95  0.00 ? 135 LEU A O    1  
ATOM   801    H H    C LEU A 1 135 ? 28.566  7.754   17.031 0.05  0.00 ? 135 LEU A H    1  
ATOM   802    H H    O LEU A 1 135 ? 36.896  -4.127  36.048 0.95  0.00 ? 135 LEU A H    1  
ATOM   803    N N    C ASP A 1 136 ? 26.149  8.314   15.151 0.05  0.00 ? 136 ASP A N    1  
ATOM   804    N N    O ASP A 1 136 ? 36.697  -2.329  33.515 0.95  0.00 ? 136 ASP A N    1  
ATOM   805    C CA   C ASP A 1 136 ? 25.214  9.033   14.294 0.05  0.00 ? 136 ASP A CA   1  
ATOM   806    C CA   O ASP A 1 136 ? 36.887  -1.196  32.617 0.95  0.00 ? 136 ASP A CA   1  
ATOM   807    C C    C ASP A 1 136 ? 25.736  9.004   12.825 0.05  0.00 ? 136 ASP A C    1  
ATOM   808    C C    O ASP A 1 136 ? 38.176  -1.423  31.769 0.95  0.00 ? 136 ASP A C    1  
ATOM   809    O O    C ASP A 1 136 ? 24.877  8.874   11.961 0.05  0.00 ? 136 ASP A O    1  
ATOM   810    O O    O ASP A 1 136 ? 38.112  -1.058  30.601 0.95  0.00 ? 136 ASP A O    1  
ATOM   811    H H    C ASP A 1 136 ? 26.634  8.800   15.850 0.05  0.00 ? 136 ASP A H    1  
ATOM   812    H H    O ASP A 1 136 ? 36.747  -2.190  34.483 0.95  0.00 ? 136 ASP A H    1  
ATOM   813    N N    C LYS A 1 137 ? 27.017  9.160   12.650 0.05  0.00 ? 137 LYS A N    1  
ATOM   814    N N    O LYS A 1 137 ? 39.204  -1.936  32.382 0.95  0.00 ? 137 LYS A N    1  
ATOM   815    C CA   C LYS A 1 137 ? 27.613  9.138   11.283 0.05  0.00 ? 137 LYS A CA   1  
ATOM   816    C CA   O LYS A 1 137 ? 40.479  -2.199  31.654 0.95  0.00 ? 137 LYS A CA   1  
ATOM   817    C C    C LYS A 1 137 ? 27.465  7.733   10.685 0.05  0.00 ? 137 LYS A C    1  
ATOM   818    C C    O LYS A 1 137 ? 40.253  -3.303  30.614 0.95  0.00 ? 137 LYS A C    1  
ATOM   819    O O    C LYS A 1 137 ? 27.071  7.600   9.508  0.05  0.00 ? 137 LYS A O    1  
ATOM   820    O O    O LYS A 1 137 ? 40.702  -3.164  29.457 0.95  0.00 ? 137 LYS A O    1  
ATOM   821    H H    C LYS A 1 137 ? 27.599  9.287   13.428 0.05  0.00 ? 137 LYS A H    1  
ATOM   822    H H    O LYS A 1 137 ? 39.137  -2.158  33.334 0.95  0.00 ? 137 LYS A H    1  
ATOM   823    N N    C GLU A 1 138 ? 27.586  6.681   11.468 0.05  0.00 ? 138 GLU A N    1  
ATOM   824    N N    O GLU A 1 138 ? 39.444  -4.303  30.897 0.95  0.00 ? 138 GLU A N    1  
ATOM   825    C CA   C GLU A 1 138 ? 27.401  5.311   10.996 0.05  0.00 ? 138 GLU A CA   1  
ATOM   826    C CA   O GLU A 1 138 ? 39.125  -5.364  29.945 0.95  0.00 ? 138 GLU A CA   1  
ATOM   827    C C    C GLU A 1 138 ? 25.969  5.002   10.639 0.05  0.00 ? 138 GLU A C    1  
ATOM   828    C C    O GLU A 1 138 ? 38.283  -4.882  28.790 0.95  0.00 ? 138 GLU A C    1  
ATOM   829    O O    C GLU A 1 138 ? 25.706  4.288   9.644  0.05  0.00 ? 138 GLU A O    1  
ATOM   830    O O    O GLU A 1 138 ? 38.490  -5.317  27.634 0.95  0.00 ? 138 GLU A O    1  
ATOM   831    H H    C GLU A 1 138 ? 27.772  6.826   12.420 0.05  0.00 ? 138 GLU A H    1  
ATOM   832    H H    O GLU A 1 138 ? 39.006  -4.315  31.774 0.95  0.00 ? 138 GLU A H    1  
ATOM   833    N N    C LEU A 1 139 ? 25.031  5.531   11.421 0.05  0.00 ? 139 LEU A N    1  
ATOM   834    N N    O LEU A 1 139 ? 37.343  -3.983  29.070 0.95  0.00 ? 139 LEU A N    1  
ATOM   835    C CA   C LEU A 1 139 ? 23.610  5.336   11.186 0.05  0.00 ? 139 LEU A CA   1  
ATOM   836    C CA   O LEU A 1 139 ? 36.472  -3.415  28.055 0.95  0.00 ? 139 LEU A CA   1  
ATOM   837    C C    C LEU A 1 139 ? 23.078  6.143   10.022 0.05  0.00 ? 139 LEU A C    1  
ATOM   838    C C    O LEU A 1 139 ? 37.163  -2.399  27.172 0.95  0.00 ? 139 LEU A C    1  
ATOM   839    O O    C LEU A 1 139 ? 22.116  5.765   9.350  0.05  0.00 ? 139 LEU A O    1  
ATOM   840    O O    O LEU A 1 139 ? 36.815  -2.202  26.006 0.95  0.00 ? 139 LEU A O    1  
ATOM   841    H H    C LEU A 1 139 ? 25.309  6.087   12.178 0.05  0.00 ? 139 LEU A H    1  
ATOM   842    H H    O LEU A 1 139 ? 37.243  -3.681  29.997 0.95  0.00 ? 139 LEU A H    1  
ATOM   843    N N    C LYS A 1 140 ? 23.671  7.285   9.793  0.05  0.00 ? 140 LYS A N    1  
ATOM   844    N N    O LYS A 1 140 ? 38.125  -1.711  27.728 0.95  0.00 ? 140 LYS A N    1  
ATOM   845    C CA   C LYS A 1 140 ? 23.347  8.231   8.736  0.05  0.00 ? 140 LYS A CA   1  
ATOM   846    C CA   O LYS A 1 140 ? 38.937  -0.687  27.089 0.95  0.00 ? 140 LYS A CA   1  
ATOM   847    C C    C LYS A 1 140 ? 23.664  7.587   7.356  0.05  0.00 ? 140 LYS A C    1  
ATOM   848    C C    O LYS A 1 140 ? 39.806  -1.341  25.977 0.95  0.00 ? 140 LYS A C    1  
ATOM   849    O O    C LYS A 1 140 ? 23.000  7.881   6.373  0.05  0.00 ? 140 LYS A O    1  
ATOM   850    O O    O LYS A 1 140 ? 40.105  -0.706  24.976 0.95  0.00 ? 140 LYS A O    1  
ATOM   851    H H    C LYS A 1 140 ? 24.408  7.526   10.390 0.05  0.00 ? 140 LYS A H    1  
ATOM   852    H H    O LYS A 1 140 ? 38.321  -1.907  28.667 0.95  0.00 ? 140 LYS A H    1  
ATOM   853    N N    C ALA A 1 141 ? 24.656  6.754   7.364  0.05  0.00 ? 141 ALA A N    1  
ATOM   854    N N    O ALA A 1 141 ? 40.162  -2.563  26.218 0.95  0.00 ? 141 ALA A N    1  
ATOM   855    C CA   C ALA A 1 141 ? 25.090  5.954   6.201  0.05  0.00 ? 141 ALA A CA   1  
ATOM   856    C CA   O ALA A 1 141 ? 40.912  -3.420  25.279 0.95  0.00 ? 141 ALA A CA   1  
ATOM   857    C C    C ALA A 1 141 ? 23.935  5.093   5.691  0.05  0.00 ? 141 ALA A C    1  
ATOM   858    C C    O ALA A 1 141 ? 40.154  -3.547  23.958 0.95  0.00 ? 141 ALA A C    1  
ATOM   859    O O    C ALA A 1 141 ? 23.961  4.734   4.509  0.05  0.00 ? 141 ALA A O    1  
ATOM   860    O O    O ALA A 1 141 ? 40.804  -3.817  22.942 0.95  0.00 ? 141 ALA A O    1  
ATOM   861    H H    C ALA A 1 141 ? 25.118  6.603   8.215  0.05  0.00 ? 141 ALA A H    1  
ATOM   862    H H    O ALA A 1 141 ? 39.865  -2.966  27.061 0.95  0.00 ? 141 ALA A H    1  
ATOM   863    N N    C LYS A 1 142 ? 22.960  4.765   6.513  0.05  0.00 ? 142 LYS A N    1  
ATOM   864    N N    O LYS A 1 142 ? 38.849  -3.367  23.940 0.95  0.00 ? 142 LYS A N    1  
ATOM   865    C CA   C LYS A 1 142 ? 21.784  3.983   6.202  0.05  0.00 ? 142 LYS A CA   1  
ATOM   866    C CA   O LYS A 1 142 ? 37.977  -3.424  22.788 0.95  0.00 ? 142 LYS A CA   1  
ATOM   867    C C    C LYS A 1 142 ? 20.473  4.766   6.236  0.05  0.00 ? 142 LYS A C    1  
ATOM   868    C C    O LYS A 1 142 ? 37.363  -2.084  22.389 0.95  0.00 ? 142 LYS A C    1  
ATOM   869    O O    C LYS A 1 142 ? 19.360  4.159   6.158  0.05  0.00 ? 142 LYS A O    1  
ATOM   870    O O    O LYS A 1 142 ? 36.446  -2.033  21.512 0.95  0.00 ? 142 LYS A O    1  
ATOM   871    H H    C LYS A 1 142 ? 23.031  5.100   7.431  0.05  0.00 ? 142 LYS A H    1  
ATOM   872    H H    O LYS A 1 142 ? 38.426  -3.156  24.798 0.95  0.00 ? 142 LYS A H    1  
ATOM   873    N N    C GLY A 1 143 ? 20.579  6.069   6.372  0.05  0.00 ? 143 GLY A N    1  
ATOM   874    N N    O GLY A 1 143 ? 37.822  -1.025  23.018 0.95  0.00 ? 143 GLY A N    1  
ATOM   875    C CA   C GLY A 1 143 ? 19.419  6.948   6.387  0.05  0.00 ? 143 GLY A CA   1  
ATOM   876    C CA   O GLY A 1 143 ? 37.356  0.321   22.721 0.95  0.00 ? 143 GLY A CA   1  
ATOM   877    C C    C GLY A 1 143 ? 18.747  7.009   7.778  0.05  0.00 ? 143 GLY A C    1  
ATOM   878    C C    O GLY A 1 143 ? 36.029  0.656   23.440 0.95  0.00 ? 143 GLY A C    1  
ATOM   879    O O    C GLY A 1 143 ? 17.616  7.465   7.829  0.05  0.00 ? 143 GLY A O    1  
ATOM   880    O O    O GLY A 1 143 ? 35.405  1.623   23.033 0.95  0.00 ? 143 GLY A O    1  
ATOM   881    H H    C GLY A 1 143 ? 21.473  6.465   6.442  0.05  0.00 ? 143 GLY A H    1  
ATOM   882    H H    O GLY A 1 143 ? 38.520  -1.145  23.696 0.95  0.00 ? 143 GLY A H    1  
ATOM   883    N N    C LYS A 1 144 ? 19.432  6.607   8.810  0.05  0.00 ? 144 LYS A N    1  
ATOM   884    N N    O LYS A 1 144 ? 35.674  -0.085  24.451 0.95  0.00 ? 144 LYS A N    1  
ATOM   885    C CA   C LYS A 1 144 ? 18.888  6.639   10.186 0.05  0.00 ? 144 LYS A CA   1  
ATOM   886    C CA   O LYS A 1 144 ? 34.432  0.160   25.217 0.95  0.00 ? 144 LYS A CA   1  
ATOM   887    C C    C LYS A 1 144 ? 19.746  7.586   11.024 0.05  0.00 ? 144 LYS A C    1  
ATOM   888    C C    O LYS A 1 144 ? 34.810  0.498   26.658 0.95  0.00 ? 144 LYS A C    1  
ATOM   889    O O    C LYS A 1 144 ? 20.927  7.796   10.694 0.05  0.00 ? 144 LYS A O    1  
ATOM   890    O O    O LYS A 1 144 ? 35.892  0.090   27.119 0.95  0.00 ? 144 LYS A O    1  
ATOM   891    H H    C LYS A 1 144 ? 20.346  6.280   8.672  0.05  0.00 ? 144 LYS A H    1  
ATOM   892    H H    O LYS A 1 144 ? 36.256  -0.826  24.721 0.95  0.00 ? 144 LYS A H    1  
ATOM   893    N N    C SER A 1 145 ? 19.189  8.111   12.124 0.05  0.00 ? 145 SER A N    1  
ATOM   894    N N    O SER A 1 145 ? 33.918  1.185   27.384 0.95  0.00 ? 145 SER A N    1  
ATOM   895    C CA   C SER A 1 145 ? 19.957  8.967   13.048 0.05  0.00 ? 145 SER A CA   1  
ATOM   896    C CA   O SER A 1 145 ? 34.148  1.487   28.810 0.95  0.00 ? 145 SER A CA   1  
ATOM   897    C C    C SER A 1 145 ? 20.113  8.187   14.375 0.05  0.00 ? 145 SER A C    1  
ATOM   898    C C    O SER A 1 145 ? 33.109  0.679   29.624 0.95  0.00 ? 145 SER A C    1  
ATOM   899    O O    C SER A 1 145 ? 19.352  7.270   14.681 0.05  0.00 ? 145 SER A O    1  
ATOM   900    O O    O SER A 1 145 ? 32.067  0.267   29.117 0.95  0.00 ? 145 SER A O    1  
ATOM   901    H H    C SER A 1 145 ? 18.264  7.874   12.350 0.05  0.00 ? 145 SER A H    1  
ATOM   902    H H    O SER A 1 145 ? 33.066  1.444   26.973 0.95  0.00 ? 145 SER A H    1  
ATOM   903    N N    C ALA A 1 146 ? 21.097  8.566   15.163 0.05  0.00 ? 146 ALA A N    1  
ATOM   904    N N    O ALA A 1 146 ? 33.397  0.467   30.891 0.95  0.00 ? 146 ALA A N    1  
ATOM   905    C CA   C ALA A 1 146 ? 21.398  7.944   16.436 0.05  0.00 ? 146 ALA A CA   1  
ATOM   906    C CA   O ALA A 1 146 ? 32.549  -0.276  31.799 0.95  0.00 ? 146 ALA A CA   1  
ATOM   907    C C    C ALA A 1 146 ? 20.373  8.281   17.518 0.05  0.00 ? 146 ALA A C    1  
ATOM   908    C C    O ALA A 1 146 ? 31.286  0.489   32.192 0.95  0.00 ? 146 ALA A C    1  
ATOM   909    O O    C ALA A 1 146 ? 19.777  7.364   18.116 0.05  0.00 ? 146 ALA A O    1  
ATOM   910    O O    O ALA A 1 146 ? 30.165  -0.021  31.997 0.95  0.00 ? 146 ALA A O    1  
ATOM   911    H H    C ALA A 1 146 ? 21.664  9.307   14.868 0.05  0.00 ? 146 ALA A H    1  
ATOM   912    H H    O ALA A 1 146 ? 34.239  0.827   31.239 0.95  0.00 ? 146 ALA A H    1  
ATOM   913    N N    C LEU A 1 147 ? 20.134  9.563   17.766 0.05  0.00 ? 147 LEU A N    1  
ATOM   914    N N    O LEU A 1 147 ? 31.434  1.700   32.713 0.95  0.00 ? 147 LEU A N    1  
ATOM   915    C CA   C LEU A 1 147 ? 19.243  10.002  18.846 0.05  0.00 ? 147 LEU A CA   1  
ATOM   916    C CA   O LEU A 1 147 ? 30.299  2.485   33.214 0.95  0.00 ? 147 LEU A CA   1  
ATOM   917    C C    C LEU A 1 147 ? 18.433  11.223  18.540 0.05  0.00 ? 147 LEU A C    1  
ATOM   918    C C    O LEU A 1 147 ? 30.400  3.961   32.983 0.95  0.00 ? 147 LEU A C    1  
ATOM   919    O O    C LEU A 1 147 ? 18.952  12.131  17.844 0.05  0.00 ? 147 LEU A O    1  
ATOM   920    O O    O LEU A 1 147 ? 31.530  4.506   33.059 0.95  0.00 ? 147 LEU A O    1  
ATOM   921    H H    C LEU A 1 147 ? 20.619  10.240  17.249 0.05  0.00 ? 147 LEU A H    1  
ATOM   922    H H    O LEU A 1 147 ? 32.340  2.057   32.825 0.95  0.00 ? 147 LEU A H    1  
ATOM   923    N N    C MET A 1 148 ? 17.214  11.279  19.020 0.05  0.00 ? 148 MET A N    1  
ATOM   924    N N    O MET A 1 148 ? 29.294  4.610   32.712 0.95  0.00 ? 148 MET A N    1  
ATOM   925    C CA   C MET A 1 148 ? 16.333  12.415  18.911 0.05  0.00 ? 148 MET A CA   1  
ATOM   926    C CA   O MET A 1 148 ? 29.189  6.040   32.562 0.95  0.00 ? 148 MET A CA   1  
ATOM   927    C C    C MET A 1 148 ? 15.535  12.533  20.232 0.05  0.00 ? 148 MET A C    1  
ATOM   928    C C    O MET A 1 148 ? 27.844  6.491   33.181 0.95  0.00 ? 148 MET A C    1  
ATOM   929    O O    C MET A 1 148 ? 14.876  11.546  20.599 0.05  0.00 ? 148 MET A O    1  
ATOM   930    O O    O MET A 1 148 ? 26.804  5.964   32.750 0.95  0.00 ? 148 MET A O    1  
ATOM   931    H H    C MET A 1 148 ? 16.904  10.516  19.551 0.05  0.00 ? 148 MET A H    1  
ATOM   932    H H    O MET A 1 148 ? 28.464  4.090   32.674 0.95  0.00 ? 148 MET A H    1  
ATOM   933    N N    C PHE A 1 149 ? 15.564  13.687  20.864 0.05  0.00 ? 149 PHE A N    1  
ATOM   934    N N    O PHE A 1 149 ? 27.876  7.439   34.093 0.95  0.00 ? 149 PHE A N    1  
ATOM   935    C CA   C PHE A 1 149 ? 14.794  13.927  22.097 0.05  0.00 ? 149 PHE A CA   1  
ATOM   936    C CA   O PHE A 1 149 ? 26.651  7.984   34.703 0.95  0.00 ? 149 PHE A CA   1  
ATOM   937    C C    C PHE A 1 149 ? 14.378  15.416  22.116 0.05  0.00 ? 149 PHE A C    1  
ATOM   938    C C    O PHE A 1 149 ? 26.904  9.474   35.029 0.95  0.00 ? 149 PHE A C    1  
ATOM   939    O O    C PHE A 1 149 ? 14.851  16.223  21.319 0.05  0.00 ? 149 PHE A O    1  
ATOM   940    O O    O PHE A 1 149 ? 28.031  9.961   34.967 0.95  0.00 ? 149 PHE A O    1  
ATOM   941    H H    C PHE A 1 149 ? 16.086  14.423  20.481 0.05  0.00 ? 149 PHE A H    1  
ATOM   942    H H    O PHE A 1 149 ? 28.742  7.821   34.347 0.95  0.00 ? 149 PHE A H    1  
ATOM   943    N N    C ASN A 1 150 ? 13.476  15.718  23.038 0.05  0.00 ? 150 ASN A N    1  
ATOM   944    N N    O ASN A 1 150 ? 25.814  10.154  35.353 0.95  0.00 ? 150 ASN A N    1  
ATOM   945    C CA   C ASN A 1 150 ? 12.947  17.069  23.221 0.05  0.00 ? 150 ASN A CA   1  
ATOM   946    C CA   O ASN A 1 150 ? 25.835  11.576  35.694 0.95  0.00 ? 150 ASN A CA   1  
ATOM   947    C C    C ASN A 1 150 ? 14.060  18.009  23.695 0.05  0.00 ? 150 ASN A C    1  
ATOM   948    C C    O ASN A 1 150 ? 26.617  11.794  36.992 0.95  0.00 ? 150 ASN A C    1  
ATOM   949    O O    C ASN A 1 150 ? 14.524  17.889  24.807 0.05  0.00 ? 150 ASN A O    1  
ATOM   950    O O    O ASN A 1 150 ? 26.165  11.405  38.046 0.95  0.00 ? 150 ASN A O    1  
ATOM   951    H H    C ASN A 1 150 ? 13.146  15.004  23.621 0.05  0.00 ? 150 ASN A H    1  
ATOM   952    H H    O ASN A 1 150 ? 24.955  9.684   35.363 0.95  0.00 ? 150 ASN A H    1  
ATOM   953    N N    C LEU A 1 151 ? 14.462  18.931  22.852 0.05  0.00 ? 151 LEU A N    1  
ATOM   954    N N    O LEU A 1 151 ? 27.768  12.417  36.899 0.95  0.00 ? 151 LEU A N    1  
ATOM   955    C CA   C LEU A 1 151 ? 15.483  19.905  23.163 0.05  0.00 ? 151 LEU A CA   1  
ATOM   956    C CA   O LEU A 1 151 ? 28.607  12.718  38.036 0.95  0.00 ? 151 LEU A CA   1  
ATOM   957    C C    C LEU A 1 151 ? 14.894  21.211  23.723 0.05  0.00 ? 151 LEU A C    1  
ATOM   958    C C    O LEU A 1 151 ? 28.327  14.116  38.615 0.95  0.00 ? 151 LEU A C    1  
ATOM   959    O O    C LEU A 1 151 ? 15.697  21.989  24.233 0.05  0.00 ? 151 LEU A O    1  
ATOM   960    O O    O LEU A 1 151 ? 28.819  14.351  39.716 0.95  0.00 ? 151 LEU A O    1  
ATOM   961    H H    C LEU A 1 151 ? 14.036  18.972  21.970 0.05  0.00 ? 151 LEU A H    1  
ATOM   962    H H    O LEU A 1 151 ? 28.068  12.709  36.012 0.95  0.00 ? 151 LEU A H    1  
ATOM   963    N N    C GLN A 1 152 ? 13.633  21.406  23.656 0.05  0.00 ? 152 GLN A N    1  
ATOM   964    N N    O GLN A 1 152 ? 27.597  14.930  37.955 0.95  0.00 ? 152 GLN A N    1  
ATOM   965    C CA   C GLN A 1 152 ? 12.916  22.614  24.036 0.05  0.00 ? 152 GLN A CA   1  
ATOM   966    C CA   O GLN A 1 152 ? 27.312  16.317  38.292 0.95  0.00 ? 152 GLN A CA   1  
ATOM   967    C C    C GLN A 1 152 ? 12.745  22.862  25.523 0.05  0.00 ? 152 GLN A C    1  
ATOM   968    C C    O GLN A 1 152 ? 26.327  16.552  39.421 0.95  0.00 ? 152 GLN A C    1  
ATOM   969    O O    C GLN A 1 152 ? 12.770  24.025  25.973 0.05  0.00 ? 152 GLN A O    1  
ATOM   970    O O    O GLN A 1 152 ? 26.477  17.518  40.196 0.95  0.00 ? 152 GLN A O    1  
ATOM   971    H H    C GLN A 1 152 ? 13.102  20.693  23.246 0.05  0.00 ? 152 GLN A H    1  
ATOM   972    H H    O GLN A 1 152 ? 27.246  14.607  37.099 0.95  0.00 ? 152 GLN A H    1  
ATOM   973    N N    C GLU A 1 153 ? 12.526  21.791  26.264 0.05  0.00 ? 153 GLU A N    1  
ATOM   974    N N    O GLU A 1 153 ? 25.310  15.711  39.483 0.95  0.00 ? 153 GLU A N    1  
ATOM   975    C CA   C GLU A 1 153 ? 12.320  21.880  27.706 0.05  0.00 ? 153 GLU A CA   1  
ATOM   976    C CA   O GLU A 1 153 ? 24.272  15.829  40.502 0.95  0.00 ? 153 GLU A CA   1  
ATOM   977    C C    C GLU A 1 153 ? 13.485  21.375  28.474 0.05  0.00 ? 153 GLU A C    1  
ATOM   978    C C    O GLU A 1 153 ? 24.372  14.767  41.533 0.95  0.00 ? 153 GLU A C    1  
ATOM   979    O O    C GLU A 1 153 ? 14.048  20.289  28.213 0.05  0.00 ? 153 GLU A O    1  
ATOM   980    O O    O GLU A 1 153 ? 24.521  13.558  41.247 0.95  0.00 ? 153 GLU A O    1  
ATOM   981    H H    C GLU A 1 153 ? 12.487  20.913  25.830 0.05  0.00 ? 153 GLU A H    1  
ATOM   982    H H    O GLU A 1 153 ? 25.244  14.996  38.815 0.95  0.00 ? 153 GLU A H    1  
ATOM   983    N N    C PRO A 1 154 ? 13.923  22.170  29.483 0.05  0.00 ? 154 PRO A N    1  
ATOM   984    N N    O PRO A 1 154 ? 24.303  15.182  42.824 0.95  0.00 ? 154 PRO A N    1  
ATOM   985    C CA   C PRO A 1 154 ? 15.055  21.817  30.313 0.05  0.00 ? 154 PRO A CA   1  
ATOM   986    C CA   O PRO A 1 154 ? 24.395  14.264  43.939 0.95  0.00 ? 154 PRO A CA   1  
ATOM   987    C C    C PRO A 1 154 ? 14.911  20.492  31.084 0.05  0.00 ? 154 PRO A C    1  
ATOM   988    C C    O PRO A 1 154 ? 23.317  13.166  43.972 0.95  0.00 ? 154 PRO A C    1  
ATOM   989    O O    C PRO A 1 154 ? 15.930  19.959  31.470 0.05  0.00 ? 154 PRO A O    1  
ATOM   990    O O    O PRO A 1 154 ? 23.555  12.171  44.623 0.95  0.00 ? 154 PRO A O    1  
ATOM   991    N N    C TYR A 1 155 ? 13.713  20.069  31.345 0.05  0.00 ? 155 TYR A N    1  
ATOM   992    N N    O TYR A 1 155 ? 22.191  13.403  43.373 0.95  0.00 ? 155 TYR A N    1  
ATOM   993    C CA   C TYR A 1 155 ? 13.461  18.785  32.034 0.05  0.00 ? 155 TYR A CA   1  
ATOM   994    C CA   O TYR A 1 155 ? 21.108  12.399  43.300 0.95  0.00 ? 155 TYR A CA   1  
ATOM   995    C C    C TYR A 1 155 ? 14.203  17.675  31.238 0.05  0.00 ? 155 TYR A C    1  
ATOM   996    C C    O TYR A 1 155 ? 21.714  11.102  42.694 0.95  0.00 ? 155 TYR A C    1  
ATOM   997    O O    C TYR A 1 155 ? 14.872  16.804  31.794 0.05  0.00 ? 155 TYR A O    1  
ATOM   998    O O    O TYR A 1 155 ? 21.485  9.988   43.165 0.95  0.00 ? 155 TYR A O    1  
ATOM   999    H H    C TYR A 1 155 ? 12.948  20.604  31.046 0.05  0.00 ? 155 TYR A H    1  
ATOM   1000   H H    O TYR A 1 155 ? 22.067  14.266  42.925 0.95  0.00 ? 155 TYR A H    1  
ATOM   1001   N N    C PHE A 1 156 ? 14.111  17.747  29.916 0.05  0.00 ? 156 PHE A N    1  
ATOM   1002   N N    O PHE A 1 156 ? 22.533  11.269  41.664 0.95  0.00 ? 156 PHE A N    1  
ATOM   1003   C CA   C PHE A 1 156 ? 14.777  16.803  29.014 0.05  0.00 ? 156 PHE A CA   1  
ATOM   1004   C CA   O PHE A 1 156 ? 23.218  10.158  40.997 0.95  0.00 ? 156 PHE A CA   1  
ATOM   1005   C C    C PHE A 1 156 ? 16.253  17.033  28.824 0.05  0.00 ? 156 PHE A C    1  
ATOM   1006   C C    O PHE A 1 156 ? 24.413  9.610   41.730 0.95  0.00 ? 156 PHE A C    1  
ATOM   1007   O O    C PHE A 1 156 ? 17.028  16.048  28.741 0.05  0.00 ? 156 PHE A O    1  
ATOM   1008   O O    O PHE A 1 156 ? 24.626  8.372   41.730 0.95  0.00 ? 156 PHE A O    1  
ATOM   1009   H H    C PHE A 1 156 ? 13.590  18.480  29.524 0.05  0.00 ? 156 PHE A H    1  
ATOM   1010   H H    O PHE A 1 156 ? 22.706  12.181  41.348 0.95  0.00 ? 156 PHE A H    1  
ATOM   1011   N N    C THR A 1 157 ? 16.781  18.254  28.824 0.05  0.00 ? 157 THR A N    1  
ATOM   1012   N N    O THR A 1 157 ? 25.213  10.388  42.454 0.95  0.00 ? 157 THR A N    1  
ATOM   1013   C CA   C THR A 1 157 ? 18.207  18.454  28.619 0.05  0.00 ? 157 THR A CA   1  
ATOM   1014   C CA   O THR A 1 157 ? 26.374  9.841   43.138 0.95  0.00 ? 157 THR A CA   1  
ATOM   1015   C C    C THR A 1 157 ? 19.027  18.434  29.871 0.05  0.00 ? 157 THR A C    1  
ATOM   1016   C C    O THR A 1 157 ? 26.106  9.350   44.526 0.95  0.00 ? 157 THR A C    1  
ATOM   1017   O O    C THR A 1 157 ? 20.231  18.201  29.827 0.05  0.00 ? 157 THR A O    1  
ATOM   1018   O O    O THR A 1 157 ? 26.856  8.537   45.058 0.95  0.00 ? 157 THR A O    1  
ATOM   1019   H H    C THR A 1 157 ? 16.199  19.032  28.951 0.05  0.00 ? 157 THR A H    1  
ATOM   1020   H H    O THR A 1 157 ? 25.025  11.348  42.517 0.95  0.00 ? 157 THR A H    1  
ATOM   1021   N N    C TRP A 1 158 ? 18.401  18.627  31.021 0.05  0.00 ? 158 TRP A N    1  
ATOM   1022   N N    O TRP A 1 158 ? 25.014  9.785   45.135 0.95  0.00 ? 158 TRP A N    1  
ATOM   1023   C CA   C TRP A 1 158 ? 19.114  18.619  32.305 0.05  0.00 ? 158 TRP A CA   1  
ATOM   1024   C CA   O TRP A 1 158 ? 24.658  9.358   46.494 0.95  0.00 ? 158 TRP A CA   1  
ATOM   1025   C C    C TRP A 1 158 ? 20.003  17.436  32.556 0.05  0.00 ? 158 TRP A C    1  
ATOM   1026   C C    O TRP A 1 158 ? 24.659  7.877   46.739 0.95  0.00 ? 158 TRP A C    1  
ATOM   1027   O O    C TRP A 1 158 ? 21.118  17.651  33.088 0.05  0.00 ? 158 TRP A O    1  
ATOM   1028   O O    O TRP A 1 158 ? 25.141  7.468   47.822 0.95  0.00 ? 158 TRP A O    1  
ATOM   1029   H H    C TRP A 1 158 ? 17.433  18.777  31.017 0.05  0.00 ? 158 TRP A H    1  
ATOM   1030   H H    O TRP A 1 158 ? 24.423  10.408  44.663 0.95  0.00 ? 158 TRP A H    1  
ATOM   1031   N N    C PRO A 1 159 ? 19.581  16.186  32.247 0.05  0.00 ? 159 PRO A N    1  
ATOM   1032   N N    O PRO A 1 159 ? 24.120  7.033   45.826 0.95  0.00 ? 159 PRO A N    1  
ATOM   1033   C CA   C PRO A 1 159 ? 20.457  15.031  32.505 0.05  0.00 ? 159 PRO A CA   1  
ATOM   1034   C CA   O PRO A 1 159 ? 24.118  5.582   46.079 0.95  0.00 ? 159 PRO A CA   1  
ATOM   1035   C C    C PRO A 1 159 ? 21.873  15.194  32.030 0.05  0.00 ? 159 PRO A C    1  
ATOM   1036   C C    O PRO A 1 159 ? 25.433  5.019   46.540 0.95  0.00 ? 159 PRO A C    1  
ATOM   1037   O O    C PRO A 1 159 ? 22.819  14.807  32.742 0.05  0.00 ? 159 PRO A O    1  
ATOM   1038   O O    O PRO A 1 159 ? 25.465  4.173   47.453 0.95  0.00 ? 159 PRO A O    1  
ATOM   1039   N N    C LEU A 1 160 ? 22.051  15.739  30.826 0.05  0.00 ? 160 LEU A N    1  
ATOM   1040   N N    O LEU A 1 160 ? 26.530  5.450   45.915 0.95  0.00 ? 160 LEU A N    1  
ATOM   1041   C CA   C LEU A 1 160 ? 23.360  15.974  30.211 0.05  0.00 ? 160 LEU A CA   1  
ATOM   1042   C CA   O LEU A 1 160 ? 27.890  5.010   46.237 0.95  0.00 ? 160 LEU A CA   1  
ATOM   1043   C C    C LEU A 1 160 ? 24.081  17.192  30.831 0.05  0.00 ? 160 LEU A C    1  
ATOM   1044   C C    O LEU A 1 160 ? 28.417  5.660   47.535 0.95  0.00 ? 160 LEU A C    1  
ATOM   1045   O O    C LEU A 1 160 ? 25.255  17.097  31.137 0.05  0.00 ? 160 LEU A O    1  
ATOM   1046   O O    O LEU A 1 160 ? 28.971  4.966   48.367 0.95  0.00 ? 160 LEU A O    1  
ATOM   1047   H H    C LEU A 1 160 ? 21.253  16.003  30.322 0.05  0.00 ? 160 LEU A H    1  
ATOM   1048   H H    O LEU A 1 160 ? 26.418  6.106   45.196 0.95  0.00 ? 160 LEU A H    1  
ATOM   1049   N N    C ILE A 1 161 ? 23.341  18.282  30.974 0.05  0.00 ? 161 ILE A N    1  
ATOM   1050   N N    O ILE A 1 161 ? 28.227  6.968   47.638 0.95  0.00 ? 161 ILE A N    1  
ATOM   1051   C CA   C ILE A 1 161 ? 23.877  19.536  31.545 0.05  0.00 ? 161 ILE A CA   1  
ATOM   1052   C CA   O ILE A 1 161 ? 28.675  7.746   48.812 0.95  0.00 ? 161 ILE A CA   1  
ATOM   1053   C C    C ILE A 1 161 ? 24.405  19.326  32.948 0.05  0.00 ? 161 ILE A C    1  
ATOM   1054   C C    O ILE A 1 161 ? 28.044  7.234   50.090 0.95  0.00 ? 161 ILE A C    1  
ATOM   1055   O O    C ILE A 1 161 ? 25.502  19.760  33.285 0.05  0.00 ? 161 ILE A O    1  
ATOM   1056   O O    O ILE A 1 161 ? 28.720  7.031   51.094 0.95  0.00 ? 161 ILE A O    1  
ATOM   1057   H H    C ILE A 1 161 ? 22.404  18.257  30.688 0.05  0.00 ? 161 ILE A H    1  
ATOM   1058   H H    O ILE A 1 161 ? 27.775  7.437   46.906 0.95  0.00 ? 161 ILE A H    1  
ATOM   1059   N N    C ALA A 1 162 ? 23.682  18.610  33.782 0.05  0.00 ? 162 ALA A N    1  
ATOM   1060   N N    O ALA A 1 162 ? 26.760  6.952   50.078 0.95  0.00 ? 162 ALA A N    1  
ATOM   1061   C CA   C ALA A 1 162 ? 24.034  18.290  35.152 0.05  0.00 ? 162 ALA A CA   1  
ATOM   1062   C CA   O ALA A 1 162 ? 25.993  6.437   51.196 0.95  0.00 ? 162 ALA A CA   1  
ATOM   1063   C C    C ALA A 1 162 ? 25.076  17.232  35.355 0.05  0.00 ? 162 ALA A C    1  
ATOM   1064   C C    O ALA A 1 162 ? 26.173  4.987   51.532 0.95  0.00 ? 162 ALA A C    1  
ATOM   1065   O O    C ALA A 1 162 ? 25.784  17.220  36.390 0.05  0.00 ? 162 ALA A O    1  
ATOM   1066   O O    O ALA A 1 162 ? 25.974  4.570   52.698 0.95  0.00 ? 162 ALA A O    1  
ATOM   1067   H H    C ALA A 1 162 ? 22.835  18.251  33.443 0.05  0.00 ? 162 ALA A H    1  
ATOM   1068   H H    O ALA A 1 162 ? 26.281  7.091   49.234 0.95  0.00 ? 162 ALA A H    1  
ATOM   1069   N N    C ALA A 1 163 ? 25.213  16.256  34.476 0.05  0.00 ? 163 ALA A N    1  
ATOM   1070   N N    O ALA A 1 163 ? 26.476  4.118   50.585 0.95  0.00 ? 163 ALA A N    1  
ATOM   1071   C CA   C ALA A 1 163 ? 26.134  15.134  34.532 0.05  0.00 ? 163 ALA A CA   1  
ATOM   1072   C CA   O ALA A 1 163 ? 26.648  2.682   50.721 0.95  0.00 ? 163 ALA A CA   1  
ATOM   1073   C C    C ALA A 1 163 ? 27.475  15.420  35.184 0.05  0.00 ? 163 ALA A C    1  
ATOM   1074   C C    O ALA A 1 163 ? 27.229  2.214   52.043 0.95  0.00 ? 163 ALA A C    1  
ATOM   1075   O O    C ALA A 1 163 ? 27.840  14.744  36.157 0.05  0.00 ? 163 ALA A O    1  
ATOM   1076   O O    O ALA A 1 163 ? 26.597  1.404   52.738 0.95  0.00 ? 163 ALA A O    1  
ATOM   1077   H H    C ALA A 1 163 ? 24.603  16.277  33.708 0.05  0.00 ? 163 ALA A H    1  
ATOM   1078   H H    O ALA A 1 163 ? 26.572  4.481   49.679 0.95  0.00 ? 163 ALA A H    1  
ATOM   1079   N N    C ASP A 1 164 ? 28.224  16.368  34.631 0.05  0.00 ? 164 ASP A N    1  
ATOM   1080   N N    O ASP A 1 164 ? 28.434  2.670   52.366 0.95  0.00 ? 164 ASP A N    1  
ATOM   1081   C CA   C ASP A 1 164 ? 29.537  16.733  35.118 0.05  0.00 ? 164 ASP A CA   1  
ATOM   1082   C CA   O ASP A 1 164 ? 29.132  2.291   53.577 0.95  0.00 ? 164 ASP A CA   1  
ATOM   1083   C C    C ASP A 1 164 ? 29.604  17.799  36.198 0.05  0.00 ? 164 ASP A C    1  
ATOM   1084   C C    O ASP A 1 164 ? 28.868  3.125   54.818 0.95  0.00 ? 164 ASP A C    1  
ATOM   1085   O O    C ASP A 1 164 ? 30.651  18.447  36.383 0.05  0.00 ? 164 ASP A O    1  
ATOM   1086   O O    O ASP A 1 164 ? 29.686  3.138   55.757 0.95  0.00 ? 164 ASP A O    1  
ATOM   1087   H H    C ASP A 1 164 ? 27.877  16.830  33.838 0.05  0.00 ? 164 ASP A H    1  
ATOM   1088   H H    O ASP A 1 164 ? 28.883  3.278   51.742 0.95  0.00 ? 164 ASP A H    1  
ATOM   1089   N N    C GLY A 1 165 ? 28.581  17.988  36.990 0.05  0.00 ? 165 GLY A N    1  
ATOM   1090   N N    O GLY A 1 165 ? 27.740  3.774   54.938 0.95  0.00 ? 165 GLY A N    1  
ATOM   1091   C CA   C GLY A 1 165 ? 28.634  18.981  38.081 0.05  0.00 ? 165 GLY A CA   1  
ATOM   1092   C CA   O GLY A 1 165 ? 27.433  4.552   56.155 0.95  0.00 ? 165 GLY A CA   1  
ATOM   1093   C C    C GLY A 1 165 ? 27.512  19.936  38.234 0.05  0.00 ? 165 GLY A C    1  
ATOM   1094   C C    O GLY A 1 165 ? 26.931  5.938   56.010 0.95  0.00 ? 165 GLY A C    1  
ATOM   1095   O O    C GLY A 1 165 ? 27.516  20.608  39.277 0.05  0.00 ? 165 GLY A O    1  
ATOM   1096   O O    O GLY A 1 165 ? 26.505  6.467   57.048 0.95  0.00 ? 165 GLY A O    1  
ATOM   1097   H H    C GLY A 1 165 ? 27.777  17.437  36.879 0.05  0.00 ? 165 GLY A H    1  
ATOM   1098   H H    O GLY A 1 165 ? 27.072  3.717   54.222 0.95  0.00 ? 165 GLY A H    1  
ATOM   1099   N N    C GLY A 1 166 ? 26.555  20.073  37.379 0.05  0.00 ? 166 GLY A N    1  
ATOM   1100   N N    O GLY A 1 166 ? 26.893  6.582   54.892 0.95  0.00 ? 166 GLY A N    1  
ATOM   1101   C CA   C GLY A 1 166 ? 25.439  21.018  37.537 0.05  0.00 ? 166 GLY A CA   1  
ATOM   1102   C CA   O GLY A 1 166 ? 26.388  7.957   54.751 0.95  0.00 ? 166 GLY A CA   1  
ATOM   1103   C C    C GLY A 1 166 ? 24.434  20.517  38.541 0.05  0.00 ? 166 GLY A C    1  
ATOM   1104   C C    O GLY A 1 166 ? 24.883  7.996   54.794 0.95  0.00 ? 166 GLY A C    1  
ATOM   1105   O O    C GLY A 1 166 ? 24.297  19.315  38.757 0.05  0.00 ? 166 GLY A O    1  
ATOM   1106   O O    O GLY A 1 166 ? 24.213  7.024   54.452 0.95  0.00 ? 166 GLY A O    1  
ATOM   1107   H H    C GLY A 1 166 ? 26.571  19.510  36.576 0.05  0.00 ? 166 GLY A H    1  
ATOM   1108   H H    O GLY A 1 166 ? 27.217  6.126   54.087 0.95  0.00 ? 166 GLY A H    1  
ATOM   1109   N N    C TYR A 1 167 ? 23.701  21.438  39.139 0.05  0.00 ? 167 TYR A N    1  
ATOM   1110   N N    O TYR A 1 167 ? 24.342  9.135   55.185 0.95  0.00 ? 167 TYR A N    1  
ATOM   1111   C CA   C TYR A 1 167 ? 22.622  21.157  40.116 0.05  0.00 ? 167 TYR A CA   1  
ATOM   1112   C CA   O TYR A 1 167 ? 22.885  9.401   55.247 0.95  0.00 ? 167 TYR A CA   1  
ATOM   1113   C C    C TYR A 1 167 ? 21.751  22.422  40.172 0.05  0.00 ? 167 TYR A C    1  
ATOM   1114   C C    O TYR A 1 167 ? 22.727  10.930  55.275 0.95  0.00 ? 167 TYR A C    1  
ATOM   1115   O O    C TYR A 1 167 ? 22.299  23.465  39.803 0.05  0.00 ? 167 TYR A O    1  
ATOM   1116   O O    O TYR A 1 167 ? 23.714  11.562  55.664 0.95  0.00 ? 167 TYR A O    1  
ATOM   1117   H H    C TYR A 1 167 ? 23.859  22.374  38.894 0.05  0.00 ? 167 TYR A H    1  
ATOM   1118   H H    O TYR A 1 167 ? 24.948  9.868   55.420 0.95  0.00 ? 167 TYR A H    1  
ATOM   1119   N N    C ALA A 1 168 ? 20.514  22.316  40.564 0.05  0.00 ? 168 ALA A N    1  
ATOM   1120   N N    O ALA A 1 168 ? 21.607  11.453  54.868 0.95  0.00 ? 168 ALA A N    1  
ATOM   1121   C CA   C ALA A 1 168 ? 19.594  23.448  40.633 0.05  0.00 ? 168 ALA A CA   1  
ATOM   1122   C CA   O ALA A 1 168 ? 21.359  12.892  54.832 0.95  0.00 ? 168 ALA A CA   1  
ATOM   1123   C C    C ALA A 1 168 ? 19.964  24.276  41.884 0.05  0.00 ? 168 ALA A C    1  
ATOM   1124   C C    O ALA A 1 168 ? 21.101  13.359  56.282 0.95  0.00 ? 168 ALA A C    1  
ATOM   1125   O O    C ALA A 1 168 ? 20.473  25.387  41.727 0.05  0.00 ? 168 ALA A O    1  
ATOM   1126   O O    O ALA A 1 168 ? 21.949  14.060  56.836 0.95  0.00 ? 168 ALA A O    1  
ATOM   1127   H H    C ALA A 1 168 ? 20.180  21.428  40.809 0.05  0.00 ? 168 ALA A H    1  
ATOM   1128   H H    O ALA A 1 168 ? 20.900  10.851  54.556 0.95  0.00 ? 168 ALA A H    1  
ATOM   1129   N N    C PHE A 1 169 ? 19.799  23.660  43.037 0.05  0.00 ? 169 PHE A N    1  
ATOM   1130   N N    O PHE A 1 169 ? 20.020  12.864  56.850 0.95  0.00 ? 169 PHE A N    1  
ATOM   1131   C CA   C PHE A 1 169 ? 20.075  24.242  44.360 0.05  0.00 ? 169 PHE A CA   1  
ATOM   1132   C CA   O PHE A 1 169 ? 19.562  13.164  58.215 0.95  0.00 ? 169 PHE A CA   1  
ATOM   1133   C C    C PHE A 1 169 ? 20.792  23.257  45.259 0.05  0.00 ? 169 PHE A C    1  
ATOM   1134   C C    O PHE A 1 169 ? 19.101  11.913  58.933 0.95  0.00 ? 169 PHE A C    1  
ATOM   1135   O O    C PHE A 1 169 ? 20.369  22.081  45.393 0.05  0.00 ? 169 PHE A O    1  
ATOM   1136   O O    O PHE A 1 169 ? 18.302  11.113  58.384 0.95  0.00 ? 169 PHE A O    1  
ATOM   1137   H H    C PHE A 1 169 ? 19.459  22.741  43.010 0.05  0.00 ? 169 PHE A H    1  
ATOM   1138   H H    O PHE A 1 169 ? 19.474  12.249  56.316 0.95  0.00 ? 169 PHE A H    1  
ATOM   1139   N N    C LYS A 1 170 ? 21.854  23.679  45.890 0.05  0.00 ? 170 LYS A N    1  
ATOM   1140   N N    O LYS A 1 170 ? 19.559  11.705  60.137 0.95  0.00 ? 170 LYS A N    1  
ATOM   1141   C CA   C LYS A 1 170 ? 22.609  22.808  46.791 0.05  0.00 ? 170 LYS A CA   1  
ATOM   1142   C CA   O LYS A 1 170 ? 19.164  10.532  60.917 0.95  0.00 ? 170 LYS A CA   1  
ATOM   1143   C C    C LYS A 1 170 ? 21.728  22.327  47.939 0.05  0.00 ? 170 LYS A C    1  
ATOM   1144   C C    O LYS A 1 170 ? 17.656  10.518  61.144 0.95  0.00 ? 170 LYS A C    1  
ATOM   1145   O O    C LYS A 1 170 ? 21.080  23.103  48.633 0.05  0.00 ? 170 LYS A O    1  
ATOM   1146   O O    O LYS A 1 170 ? 17.057  11.485  61.602 0.95  0.00 ? 170 LYS A O    1  
ATOM   1147   H H    C LYS A 1 170 ? 22.149  24.604  45.761 0.05  0.00 ? 170 LYS A H    1  
ATOM   1148   H H    O LYS A 1 170 ? 20.177  12.354  60.531 0.95  0.00 ? 170 LYS A H    1  
ATOM   1149   N N    C TYR A 1 171 ? 21.688  21.010  48.117 0.05  0.00 ? 171 TYR A N    1  
ATOM   1150   N N    O TYR A 1 171 ? 17.033  9.400   60.784 0.95  0.00 ? 171 TYR A N    1  
ATOM   1151   C CA   C TYR A 1 171 ? 20.873  20.406  49.192 0.05  0.00 ? 171 TYR A CA   1  
ATOM   1152   C CA   O TYR A 1 171 ? 15.571  9.250   60.946 0.95  0.00 ? 171 TYR A CA   1  
ATOM   1153   C C    C TYR A 1 171 ? 21.842  19.695  50.132 0.05  0.00 ? 171 TYR A C    1  
ATOM   1154   C C    O TYR A 1 171 ? 15.353  8.104   61.929 0.95  0.00 ? 171 TYR A C    1  
ATOM   1155   O O    C TYR A 1 171 ? 22.755  18.999  49.642 0.05  0.00 ? 171 TYR A O    1  
ATOM   1156   O O    O TYR A 1 171 ? 16.027  7.061   61.797 0.95  0.00 ? 171 TYR A O    1  
ATOM   1157   H H    C TYR A 1 171 ? 22.208  20.429  47.523 0.05  0.00 ? 171 TYR A H    1  
ATOM   1158   H H    O TYR A 1 171 ? 17.553  8.662   60.403 0.95  0.00 ? 171 TYR A H    1  
ATOM   1159   N N    C GLU A 1 172 ? 21.628  19.906  51.430 0.05  0.00 ? 172 GLU A N    1  
ATOM   1160   N N    O GLU A 1 172 ? 14.447  8.337   62.878 0.95  0.00 ? 172 GLU A N    1  
ATOM   1161   C CA   C GLU A 1 172 ? 22.552  19.236  52.374 0.05  0.00 ? 172 GLU A CA   1  
ATOM   1162   C CA   O GLU A 1 172 ? 14.211  7.248   63.854 0.95  0.00 ? 172 GLU A CA   1  
ATOM   1163   C C    C GLU A 1 172 ? 22.031  19.005  53.757 0.05  0.00 ? 172 GLU A C    1  
ATOM   1164   C C    O GLU A 1 172 ? 12.884  7.255   64.543 0.95  0.00 ? 172 GLU A C    1  
ATOM   1165   O O    C GLU A 1 172 ? 22.877  18.843  54.685 0.05  0.00 ? 172 GLU A O    1  
ATOM   1166   O O    O GLU A 1 172 ? 12.791  6.643   65.648 0.95  0.00 ? 172 GLU A O    1  
ATOM   1167   H H    C GLU A 1 172 ? 20.898  20.478  51.745 0.05  0.00 ? 172 GLU A H    1  
ATOM   1168   H H    O GLU A 1 172 ? 13.964  9.187   62.930 0.95  0.00 ? 172 GLU A H    1  
ATOM   1169   N N    C ASN A 1 173 ? 20.716  18.901  53.944 0.05  0.00 ? 173 ASN A N    1  
ATOM   1170   N N    O ASN A 1 173 ? 11.844  7.829   63.940 0.95  0.00 ? 173 ASN A N    1  
ATOM   1171   C CA   C ASN A 1 173 ? 20.175  18.712  55.303 0.05  0.00 ? 173 ASN A CA   1  
ATOM   1172   C CA   O ASN A 1 173 ? 10.534  7.883   64.615 0.95  0.00 ? 173 ASN A CA   1  
ATOM   1173   C C    C ASN A 1 173 ? 18.662  18.798  55.345 0.05  0.00 ? 173 ASN A C    1  
ATOM   1174   C C    O ASN A 1 173 ? 9.525   8.728   63.862 0.95  0.00 ? 173 ASN A C    1  
ATOM   1175   O O    C ASN A 1 173 ? 18.129  19.369  56.337 0.05  0.00 ? 173 ASN A O    1  
ATOM   1176   O O    O ASN A 1 173 ? 8.735   9.447   64.536 0.95  0.00 ? 173 ASN A O    1  
ATOM   1177   H H    C ASN A 1 173 ? 20.106  18.976  53.181 0.05  0.00 ? 173 ASN A H    1  
ATOM   1178   H H    O ASN A 1 173 ? 11.956  8.239   63.057 0.95  0.00 ? 173 ASN A H    1  
ATOM   1179   N N    C GLY A 1 174 ? 17.990  18.294  54.339 0.05  0.00 ? 174 GLY A N    1  
ATOM   1180   N N    O GLY A 1 174 ? 9.541   8.683   62.553 0.95  0.00 ? 174 GLY A N    1  
ATOM   1181   C CA   C GLY A 1 174 ? 16.507  18.380  54.306 0.05  0.00 ? 174 GLY A CA   1  
ATOM   1182   C CA   O GLY A 1 174 ? 8.601   9.515   61.759 0.95  0.00 ? 174 GLY A CA   1  
ATOM   1183   C C    C GLY A 1 174 ? 16.128  19.816  53.921 0.05  0.00 ? 174 GLY A C    1  
ATOM   1184   C C    O GLY A 1 174 ? 9.121   10.959  61.778 0.95  0.00 ? 174 GLY A C    1  
ATOM   1185   O O    C GLY A 1 174 ? 14.939  20.185  53.865 0.05  0.00 ? 174 GLY A O    1  
ATOM   1186   O O    O GLY A 1 174 ? 8.495   11.886  61.227 0.95  0.00 ? 174 GLY A O    1  
ATOM   1187   H H    C GLY A 1 174 ? 18.470  17.879  53.592 0.05  0.00 ? 174 GLY A H    1  
ATOM   1188   H H    O GLY A 1 174 ? 10.194  8.114   62.093 0.95  0.00 ? 174 GLY A H    1  
ATOM   1189   N N    C LYS A 1 175 ? 17.195  20.547  53.644 0.05  0.00 ? 175 LYS A N    1  
ATOM   1190   N N    O LYS A 1 175 ? 10.281  11.054  62.405 0.95  0.00 ? 175 LYS A N    1  
ATOM   1191   C CA   C LYS A 1 175 ? 17.141  21.962  53.292 0.05  0.00 ? 175 LYS A CA   1  
ATOM   1192   C CA   O LYS A 1 175 ? 10.990  12.312  62.617 0.95  0.00 ? 175 LYS A CA   1  
ATOM   1193   C C    C LYS A 1 175 ? 18.044  22.310  52.108 0.05  0.00 ? 175 LYS A C    1  
ATOM   1194   C C    O LYS A 1 175 ? 12.487  12.201  62.327 0.95  0.00 ? 175 LYS A C    1  
ATOM   1195   O O    C LYS A 1 175 ? 19.189  21.885  51.935 0.05  0.00 ? 175 LYS A O    1  
ATOM   1196   O O    O LYS A 1 175 ? 13.210  11.259  62.660 0.95  0.00 ? 175 LYS A O    1  
ATOM   1197   H H    C LYS A 1 175 ? 18.074  20.121  53.708 0.05  0.00 ? 175 LYS A H    1  
ATOM   1198   H H    O LYS A 1 175 ? 10.673  10.236  62.775 0.95  0.00 ? 175 LYS A H    1  
ATOM   1199   N N    C TYR A 1 176 ? 17.445  23.158  51.290 0.05  0.00 ? 176 TYR A N    1  
ATOM   1200   N N    O TYR A 1 176 ? 12.924  13.272  61.686 0.95  0.00 ? 176 TYR A N    1  
ATOM   1201   C CA   C TYR A 1 176 ? 18.009  23.714  50.078 0.05  0.00 ? 176 TYR A CA   1  
ATOM   1202   C CA   O TYR A 1 176 ? 14.289  13.514  61.267 0.95  0.00 ? 176 TYR A CA   1  
ATOM   1203   C C    C TYR A 1 176 ? 18.576  25.119  50.345 0.05  0.00 ? 176 TYR A C    1  
ATOM   1204   C C    O TYR A 1 176 ? 15.009  14.419  62.281 0.95  0.00 ? 176 TYR A C    1  
ATOM   1205   O O    C TYR A 1 176 ? 17.821  25.956  50.874 0.05  0.00 ? 176 TYR A O    1  
ATOM   1206   O O    O TYR A 1 176 ? 14.467  15.500  62.578 0.95  0.00 ? 176 TYR A O    1  
ATOM   1207   H H    C TYR A 1 176 ? 16.538  23.445  51.532 0.05  0.00 ? 176 TYR A H    1  
ATOM   1208   H H    O TYR A 1 176 ? 12.265  13.970  61.485 0.95  0.00 ? 176 TYR A H    1  
ATOM   1209   N N    C ASP A 1 177 ? 19.816  25.321  49.961 0.05  0.00 ? 177 ASP A N    1  
ATOM   1210   N N    O ASP A 1 177 ? 16.161  13.976  62.730 0.95  0.00 ? 177 ASP A N    1  
ATOM   1211   C CA   C ASP A 1 177 ? 20.511  26.621  50.066 0.05  0.00 ? 177 ASP A CA   1  
ATOM   1212   C CA   O ASP A 1 177 ? 17.034  14.733  63.652 0.95  0.00 ? 177 ASP A CA   1  
ATOM   1213   C C    C ASP A 1 177 ? 20.201  27.357  48.750 0.05  0.00 ? 177 ASP A C    1  
ATOM   1214   C C    O ASP A 1 177 ? 17.946  15.581  62.748 0.95  0.00 ? 177 ASP A C    1  
ATOM   1215   O O    C ASP A 1 177 ? 20.828  27.031  47.726 0.05  0.00 ? 177 ASP A O    1  
ATOM   1216   O O    O ASP A 1 177 ? 18.909  15.026  62.188 0.95  0.00 ? 177 ASP A O    1  
ATOM   1217   H H    C ASP A 1 177 ? 20.293  24.577  49.539 0.05  0.00 ? 177 ASP A H    1  
ATOM   1218   H H    O ASP A 1 177 ? 16.482  13.112  62.398 0.95  0.00 ? 177 ASP A H    1  
ATOM   1219   N N    C ILE A 1 178 ? 19.274  28.290  48.786 0.05  0.00 ? 178 ILE A N    1  
ATOM   1220   N N    O ILE A 1 178 ? 17.643  16.854  62.611 0.95  0.00 ? 178 ILE A N    1  
ATOM   1221   C CA   C ILE A 1 178 ? 18.862  28.988  47.574 0.05  0.00 ? 178 ILE A CA   1  
ATOM   1222   C CA   O ILE A 1 178 ? 18.405  17.717  61.717 0.95  0.00 ? 178 ILE A CA   1  
ATOM   1223   C C    C ILE A 1 178 ? 19.830  29.972  46.966 0.05  0.00 ? 178 ILE A C    1  
ATOM   1224   C C    O ILE A 1 178 ? 19.806  18.095  62.129 0.95  0.00 ? 178 ILE A C    1  
ATOM   1225   O O    C ILE A 1 178 ? 19.537  30.593  45.915 0.05  0.00 ? 178 ILE A O    1  
ATOM   1226   O O    O ILE A 1 178 ? 20.516  18.824  61.394 0.95  0.00 ? 178 ILE A O    1  
ATOM   1227   H H    C ILE A 1 178 ? 18.820  28.484  49.632 0.05  0.00 ? 178 ILE A H    1  
ATOM   1228   H H    O ILE A 1 178 ? 16.862  17.215  63.080 0.95  0.00 ? 178 ILE A H    1  
ATOM   1229   N N    C LYS A 1 179 ? 20.980  30.127  47.562 0.05  0.00 ? 179 LYS A N    1  
ATOM   1230   N N    O LYS A 1 179 ? 20.248  17.614  63.259 0.95  0.00 ? 179 LYS A N    1  
ATOM   1231   C CA   C LYS A 1 179 ? 22.025  31.020  47.081 0.05  0.00 ? 179 LYS A CA   1  
ATOM   1232   C CA   O LYS A 1 179 ? 21.584  17.868  63.777 0.95  0.00 ? 179 LYS A CA   1  
ATOM   1233   C C    C LYS A 1 179 ? 23.192  30.174  46.579 0.05  0.00 ? 179 LYS A C    1  
ATOM   1234   C C    O LYS A 1 179 ? 22.382  16.568  63.720 0.95  0.00 ? 179 LYS A C    1  
ATOM   1235   O O    C LYS A 1 179 ? 24.238  30.717  46.247 0.05  0.00 ? 179 LYS A O    1  
ATOM   1236   O O    O LYS A 1 179 ? 23.495  16.515  64.226 0.95  0.00 ? 179 LYS A O    1  
ATOM   1237   H H    C LYS A 1 179 ? 21.157  29.600  48.369 0.05  0.00 ? 179 LYS A H    1  
ATOM   1238   H H    O LYS A 1 179 ? 19.652  17.036  63.779 0.95  0.00 ? 179 LYS A H    1  
ATOM   1239   N N    C ASP A 1 180 ? 22.953  28.879  46.552 0.05  0.00 ? 180 ASP A N    1  
ATOM   1240   N N    O ASP A 1 180 ? 21.766  15.579  63.104 0.95  0.00 ? 180 ASP A N    1  
ATOM   1241   C CA   C ASP A 1 180 ? 23.917  27.889  46.044 0.05  0.00 ? 180 ASP A CA   1  
ATOM   1242   C CA   O ASP A 1 180 ? 22.379  14.259  62.881 0.95  0.00 ? 180 ASP A CA   1  
ATOM   1243   C C    C ASP A 1 180 ? 23.183  27.237  44.848 0.05  0.00 ? 180 ASP A C    1  
ATOM   1244   C C    O ASP A 1 180 ? 22.422  14.127  61.340 0.95  0.00 ? 180 ASP A C    1  
ATOM   1245   O O    C ASP A 1 180 ? 22.387  26.312  44.989 0.05  0.00 ? 180 ASP A O    1  
ATOM   1246   O O    O ASP A 1 180 ? 21.460  13.733  60.685 0.95  0.00 ? 180 ASP A O    1  
ATOM   1247   H H    C ASP A 1 180 ? 22.073  28.561  46.847 0.05  0.00 ? 180 ASP A H    1  
ATOM   1248   H H    O ASP A 1 180 ? 20.870  15.743  62.740 0.95  0.00 ? 180 ASP A H    1  
ATOM   1249   N N    C VAL A 1 181 ? 23.424  27.860  43.728 0.05  0.00 ? 181 VAL A N    1  
ATOM   1250   N N    O VAL A 1 181 ? 23.535  14.588  60.841 0.95  0.00 ? 181 VAL A N    1  
ATOM   1251   C CA   C VAL A 1 181 ? 22.850  27.480  42.405 0.05  0.00 ? 181 VAL A CA   1  
ATOM   1252   C CA   O VAL A 1 181 ? 23.867  14.613  59.387 0.95  0.00 ? 181 VAL A CA   1  
ATOM   1253   C C    C VAL A 1 181 ? 23.971  26.940  41.546 0.05  0.00 ? 181 VAL A C    1  
ATOM   1254   C C    O VAL A 1 181 ? 24.976  13.615  59.143 0.95  0.00 ? 181 VAL A C    1  
ATOM   1255   O O    C VAL A 1 181 ? 25.091  27.510  41.604 0.05  0.00 ? 181 VAL A O    1  
ATOM   1256   O O    O VAL A 1 181 ? 25.897  13.530  59.996 0.95  0.00 ? 181 VAL A O    1  
ATOM   1257   H H    C VAL A 1 181 ? 24.018  28.640  43.759 0.05  0.00 ? 181 VAL A H    1  
ATOM   1258   H H    O VAL A 1 181 ? 24.198  14.953  61.465 0.95  0.00 ? 181 VAL A H    1  
ATOM   1259   N N    C GLY A 1 182 ? 23.691  25.870  40.805 0.05  0.00 ? 182 GLY A N    1  
ATOM   1260   N N    O GLY A 1 182 ? 24.877  12.871  58.043 0.95  0.00 ? 182 GLY A N    1  
ATOM   1261   C CA   C GLY A 1 182 ? 24.732  25.255  39.970 0.05  0.00 ? 182 GLY A CA   1  
ATOM   1262   C CA   O GLY A 1 182 ? 25.889  11.849  57.747 0.95  0.00 ? 182 GLY A CA   1  
ATOM   1263   C C    C GLY A 1 182 ? 24.531  25.225  38.472 0.05  0.00 ? 182 GLY A C    1  
ATOM   1264   C C    O GLY A 1 182 ? 26.712  11.991  56.487 0.95  0.00 ? 182 GLY A C    1  
ATOM   1265   O O    C GLY A 1 182 ? 24.837  24.204  37.814 0.05  0.00 ? 182 GLY A O    1  
ATOM   1266   O O    O GLY A 1 182 ? 26.970  10.987  55.783 0.95  0.00 ? 182 GLY A O    1  
ATOM   1267   H H    C GLY A 1 182 ? 22.795  25.474  40.838 0.05  0.00 ? 182 GLY A H    1  
ATOM   1268   H H    O GLY A 1 182 ? 24.111  12.988  57.443 0.95  0.00 ? 182 GLY A H    1  
ATOM   1269   N N    C VAL A 1 183 ? 24.037  26.308  37.883 0.05  0.00 ? 183 VAL A N    1  
ATOM   1270   N N    O VAL A 1 183 ? 27.158  13.200  56.161 0.95  0.00 ? 183 VAL A N    1  
ATOM   1271   C CA   C VAL A 1 183 ? 23.814  26.335  36.439 0.05  0.00 ? 183 VAL A CA   1  
ATOM   1272   C CA   O VAL A 1 183 ? 27.952  13.400  54.951 0.95  0.00 ? 183 VAL A CA   1  
ATOM   1273   C C    C VAL A 1 183 ? 24.965  26.994  35.690 0.05  0.00 ? 183 VAL A C    1  
ATOM   1274   C C    O VAL A 1 183 ? 29.447  13.411  55.238 0.95  0.00 ? 183 VAL A C    1  
ATOM   1275   O O    C VAL A 1 183 ? 25.043  26.848  34.459 0.05  0.00 ? 183 VAL A O    1  
ATOM   1276   O O    O VAL A 1 183 ? 30.242  13.300  54.290 0.95  0.00 ? 183 VAL A O    1  
ATOM   1277   H H    C VAL A 1 183 ? 23.815  27.096  38.423 0.05  0.00 ? 183 VAL A H    1  
ATOM   1278   H H    O VAL A 1 183 ? 26.948  13.966  56.736 0.95  0.00 ? 183 VAL A H    1  
ATOM   1279   N N    C ASP A 1 184 ? 25.847  27.669  36.405 0.05  0.00 ? 184 ASP A N    1  
ATOM   1280   N N    O ASP A 1 184 ? 29.823  13.509  56.501 0.95  0.00 ? 184 ASP A N    1  
ATOM   1281   C CA   C ASP A 1 184 ? 26.947  28.382  35.749 0.05  0.00 ? 184 ASP A CA   1  
ATOM   1282   C CA   O ASP A 1 184 ? 31.244  13.588  56.851 0.95  0.00 ? 184 ASP A CA   1  
ATOM   1283   C C    C ASP A 1 184 ? 28.280  27.757  36.020 0.05  0.00 ? 184 ASP A C    1  
ATOM   1284   C C    O ASP A 1 184 ? 31.734  12.359  57.551 0.95  0.00 ? 184 ASP A C    1  
ATOM   1285   O O    C ASP A 1 184 ? 29.322  28.353  35.633 0.05  0.00 ? 184 ASP A O    1  
ATOM   1286   O O    O ASP A 1 184 ? 32.899  12.355  58.032 0.95  0.00 ? 184 ASP A O    1  
ATOM   1287   H H    C ASP A 1 184 ? 25.742  27.728  37.378 0.05  0.00 ? 184 ASP A H    1  
ATOM   1288   H H    O ASP A 1 184 ? 29.145  13.570  57.207 0.95  0.00 ? 184 ASP A H    1  
ATOM   1289   N N    C ASN A 1 185 ? 28.322  26.625  36.685 0.05  0.00 ? 185 ASN A N    1  
ATOM   1290   N N    O ASN A 1 185 ? 30.918  11.336  57.672 0.95  0.00 ? 185 ASN A N    1  
ATOM   1291   C CA   C ASN A 1 185 ? 29.673  26.036  36.938 0.05  0.00 ? 185 ASN A CA   1  
ATOM   1292   C CA   O ASN A 1 185 ? 31.444  10.129  58.382 0.95  0.00 ? 185 ASN A CA   1  
ATOM   1293   C C    C ASN A 1 185 ? 30.221  25.395  35.649 0.05  0.00 ? 185 ASN A C    1  
ATOM   1294   C C    O ASN A 1 185 ? 32.410  9.356   57.465 0.95  0.00 ? 185 ASN A C    1  
ATOM   1295   O O    C ASN A 1 185 ? 29.599  25.341  34.581 0.05  0.00 ? 185 ASN A O    1  
ATOM   1296   O O    O ASN A 1 185 ? 32.665  9.674   56.297 0.95  0.00 ? 185 ASN A O    1  
ATOM   1297   H H    C ASN A 1 185 ? 27.504  26.186  37.002 0.05  0.00 ? 185 ASN A H    1  
ATOM   1298   H H    O ASN A 1 185 ? 30.005  11.363  57.316 0.95  0.00 ? 185 ASN A H    1  
ATOM   1299   N N    C ALA A 1 186 ? 31.459  24.952  35.768 0.05  0.00 ? 186 ALA A N    1  
ATOM   1300   N N    O ALA A 1 186 ? 33.001  8.338   58.064 0.95  0.00 ? 186 ALA A N    1  
ATOM   1301   C CA   C ALA A 1 186 ? 32.214  24.337  34.686 0.05  0.00 ? 186 ALA A CA   1  
ATOM   1302   C CA   O ALA A 1 186 ? 33.982  7.472   57.425 0.95  0.00 ? 186 ALA A CA   1  
ATOM   1303   C C    C ALA A 1 186 ? 31.473  23.073  34.237 0.05  0.00 ? 186 ALA A C    1  
ATOM   1304   C C    O ALA A 1 186 ? 33.314  6.785   56.229 0.95  0.00 ? 186 ALA A C    1  
ATOM   1305   O O    C ALA A 1 186 ? 31.387  22.772  33.031 0.05  0.00 ? 186 ALA A O    1  
ATOM   1306   O O    O ALA A 1 186 ? 33.926  6.623   55.156 0.95  0.00 ? 186 ALA A O    1  
ATOM   1307   H H    C ALA A 1 186 ? 31.906  25.064  36.633 0.05  0.00 ? 186 ALA A H    1  
ATOM   1308   H H    O ALA A 1 186 ? 32.782  8.168   59.004 0.95  0.00 ? 186 ALA A H    1  
ATOM   1309   N N    C GLY A 1 187 ? 30.904  22.406  35.221 0.05  0.00 ? 187 GLY A N    1  
ATOM   1310   N N    O GLY A 1 187 ? 32.053  6.460   56.432 0.95  0.00 ? 187 GLY A N    1  
ATOM   1311   C CA   C GLY A 1 187 ? 30.126  21.179  35.052 0.05  0.00 ? 187 GLY A CA   1  
ATOM   1312   C CA   O GLY A 1 187 ? 31.193  5.810   55.443 0.95  0.00 ? 187 GLY A CA   1  
ATOM   1313   C C    C GLY A 1 187 ? 29.030  21.389  34.020 0.05  0.00 ? 187 GLY A C    1  
ATOM   1314   C C    O GLY A 1 187 ? 31.203  6.596   54.142 0.95  0.00 ? 187 GLY A C    1  
ATOM   1315   O O    C GLY A 1 187 ? 29.026  20.708  32.986 0.05  0.00 ? 187 GLY A O    1  
ATOM   1316   O O    O GLY A 1 187 ? 31.620  6.059   53.107 0.95  0.00 ? 187 GLY A O    1  
ATOM   1317   H H    C GLY A 1 187 ? 30.999  22.764  36.128 0.05  0.00 ? 187 GLY A H    1  
ATOM   1318   H H    O GLY A 1 187 ? 31.661  6.678   57.303 0.95  0.00 ? 187 GLY A H    1  
ATOM   1319   N N    C ALA A 1 188 ? 28.123  22.310  34.326 0.05  0.00 ? 188 ALA A N    1  
ATOM   1320   N N    O ALA A 1 188 ? 30.734  7.837   54.217 0.95  0.00 ? 188 ALA A N    1  
ATOM   1321   C CA   C ALA A 1 188 ? 27.002  22.650  33.461 0.05  0.00 ? 188 ALA A CA   1  
ATOM   1322   C CA   O ALA A 1 188 ? 30.667  8.739   53.076 0.95  0.00 ? 188 ALA A CA   1  
ATOM   1323   C C    C ALA A 1 188 ? 27.518  23.178  32.118 0.05  0.00 ? 188 ALA A C    1  
ATOM   1324   C C    O ALA A 1 188 ? 32.073  8.988   52.521 0.95  0.00 ? 188 ALA A C    1  
ATOM   1325   O O    C ALA A 1 188 ? 26.945  22.927  31.055 0.05  0.00 ? 188 ALA A O    1  
ATOM   1326   O O    O ALA A 1 188 ? 32.285  9.112   51.313 0.95  0.00 ? 188 ALA A O    1  
ATOM   1327   H H    C ALA A 1 188 ? 28.213  22.787  35.178 0.05  0.00 ? 188 ALA A H    1  
ATOM   1328   H H    O ALA A 1 188 ? 30.418  8.163   55.086 0.95  0.00 ? 188 ALA A H    1  
ATOM   1329   N N    C LYS A 1 189 ? 28.600  23.944  32.209 0.05  0.00 ? 189 LYS A N    1  
ATOM   1330   N N    O LYS A 1 189 ? 33.019  9.089   53.449 0.95  0.00 ? 189 LYS A N    1  
ATOM   1331   C CA   C LYS A 1 189 ? 29.233  24.518  31.027 0.05  0.00 ? 189 LYS A CA   1  
ATOM   1332   C CA   O LYS A 1 189 ? 34.417  9.311   53.097 0.95  0.00 ? 189 LYS A CA   1  
ATOM   1333   C C    C LYS A 1 189 ? 29.718  23.388  30.110 0.05  0.00 ? 189 LYS A C    1  
ATOM   1334   C C    O LYS A 1 189 ? 34.922  8.133   52.253 0.95  0.00 ? 189 LYS A C    1  
ATOM   1335   O O    C LYS A 1 189 ? 29.467  23.457  28.889 0.05  0.00 ? 189 LYS A O    1  
ATOM   1336   O O    O LYS A 1 189 ? 35.568  8.374   51.213 0.95  0.00 ? 189 LYS A O    1  
ATOM   1337   H H    C LYS A 1 189 ? 28.988  24.118  33.091 0.05  0.00 ? 189 LYS A H    1  
ATOM   1338   H H    O LYS A 1 189 ? 32.772  9.002   54.393 0.95  0.00 ? 189 LYS A H    1  
ATOM   1339   N N    C ALA A 1 190 ? 30.388  22.398  30.685 0.05  0.00 ? 190 ALA A N    1  
ATOM   1340   N N    O ALA A 1 190 ? 34.637  6.916   52.696 0.95  0.00 ? 190 ALA A N    1  
ATOM   1341   C CA   C ALA A 1 190 ? 30.868  21.255  29.871 0.05  0.00 ? 190 ALA A CA   1  
ATOM   1342   C CA   O ALA A 1 190 ? 35.068  5.725   51.924 0.95  0.00 ? 190 ALA A CA   1  
ATOM   1343   C C    C ALA A 1 190 ? 29.697  20.592  29.148 0.05  0.00 ? 190 ALA A C    1  
ATOM   1344   C C    O ALA A 1 190 ? 34.508  5.786   50.504 0.95  0.00 ? 190 ALA A C    1  
ATOM   1345   O O    C ALA A 1 190 ? 29.777  20.358  27.934 0.05  0.00 ? 190 ALA A O    1  
ATOM   1346   O O    O ALA A 1 190 ? 35.261  5.597   49.538 0.95  0.00 ? 190 ALA A O    1  
ATOM   1347   H H    C ALA A 1 190 ? 30.551  22.413  31.651 0.05  0.00 ? 190 ALA A H    1  
ATOM   1348   H H    O ALA A 1 190 ? 34.127  6.803   53.525 0.95  0.00 ? 190 ALA A H    1  
ATOM   1349   N N    C GLY A 1 191 ? 28.625  20.306  29.847 0.05  0.00 ? 191 GLY A N    1  
ATOM   1350   N N    O GLY A 1 191 ? 33.234  6.057   50.355 0.95  0.00 ? 191 GLY A N    1  
ATOM   1351   C CA   C GLY A 1 191 ? 27.425  19.673  29.337 0.05  0.00 ? 191 GLY A CA   1  
ATOM   1352   C CA   O GLY A 1 191 ? 32.529  6.149   49.092 0.95  0.00 ? 191 GLY A CA   1  
ATOM   1353   C C    C GLY A 1 191 ? 26.667  20.338  28.223 0.05  0.00 ? 191 GLY A C    1  
ATOM   1354   C C    O GLY A 1 191 ? 32.984  7.155   48.075 0.95  0.00 ? 191 GLY A C    1  
ATOM   1355   O O    C GLY A 1 191 ? 26.280  19.732  27.212 0.05  0.00 ? 191 GLY A O    1  
ATOM   1356   O O    O GLY A 1 191 ? 33.157  6.878   46.878 0.95  0.00 ? 191 GLY A O    1  
ATOM   1357   H H    C GLY A 1 191 ? 28.638  20.536  30.799 0.05  0.00 ? 191 GLY A H    1  
ATOM   1358   H H    O GLY A 1 191 ? 32.711  6.206   51.170 0.95  0.00 ? 191 GLY A H    1  
ATOM   1359   N N    C LEU A 1 192 ? 26.387  21.640  28.397 0.05  0.00 ? 192 LEU A N    1  
ATOM   1360   N N    O LEU A 1 192 ? 33.160  8.409   48.525 0.95  0.00 ? 192 LEU A N    1  
ATOM   1361   C CA   C LEU A 1 192 ? 25.675  22.464  27.436 0.05  0.00 ? 192 LEU A CA   1  
ATOM   1362   C CA   O LEU A 1 192 ? 33.605  9.522   47.705 0.95  0.00 ? 192 LEU A CA   1  
ATOM   1363   C C    C LEU A 1 192 ? 26.531  22.621  26.182 0.05  0.00 ? 192 LEU A C    1  
ATOM   1364   C C    O LEU A 1 192 ? 35.047  9.275   47.268 0.95  0.00 ? 192 LEU A C    1  
ATOM   1365   O O    C LEU A 1 192 ? 26.006  22.665  25.089 0.05  0.00 ? 192 LEU A O    1  
ATOM   1366   O O    O LEU A 1 192 ? 35.417  9.629   46.168 0.95  0.00 ? 192 LEU A O    1  
ATOM   1367   H H    C LEU A 1 192 ? 26.690  22.066  29.227 0.05  0.00 ? 192 LEU A H    1  
ATOM   1368   H H    O LEU A 1 192 ? 32.982  8.583   49.473 0.95  0.00 ? 192 LEU A H    1  
ATOM   1369   N N    C THR A 1 193 ? 27.816  22.733  26.390 0.05  0.00 ? 193 THR A N    1  
ATOM   1370   N N    O THR A 1 193 ? 35.814  8.706   48.159 0.95  0.00 ? 193 THR A N    1  
ATOM   1371   C CA   C THR A 1 193 ? 28.760  22.861  25.269 0.05  0.00 ? 193 THR A CA   1  
ATOM   1372   C CA   O THR A 1 193 ? 37.217  8.383   47.860 0.95  0.00 ? 193 THR A CA   1  
ATOM   1373   C C    C THR A 1 193 ? 28.638  21.582  24.430 0.05  0.00 ? 193 THR A C    1  
ATOM   1374   C C    O THR A 1 193 ? 37.211  7.384   46.696 0.95  0.00 ? 193 THR A C    1  
ATOM   1375   O O    C THR A 1 193 ? 28.510  21.695  23.221 0.05  0.00 ? 193 THR A O    1  
ATOM   1376   O O    O THR A 1 193 ? 37.948  7.600   45.746 0.95  0.00 ? 193 THR A O    1  
ATOM   1377   H H    C THR A 1 193 ? 28.159  22.713  27.308 0.05  0.00 ? 193 THR A H    1  
ATOM   1378   H H    O THR A 1 193 ? 35.442  8.473   49.036 0.95  0.00 ? 193 THR A H    1  
ATOM   1379   N N    C PHE A 1 194 ? 28.693  20.442  25.096 0.05  0.00 ? 194 PHE A N    1  
ATOM   1380   N N    O PHE A 1 194 ? 36.401  6.348   46.823 0.95  0.00 ? 194 PHE A N    1  
ATOM   1381   C CA   C PHE A 1 194 ? 28.562  19.156  24.348 0.05  0.00 ? 194 PHE A CA   1  
ATOM   1382   C CA   O PHE A 1 194 ? 36.327  5.343   45.720 0.95  0.00 ? 194 PHE A CA   1  
ATOM   1383   C C    C PHE A 1 194 ? 27.262  19.136  23.556 0.05  0.00 ? 194 PHE A C    1  
ATOM   1384   C C    O PHE A 1 194 ? 35.961  6.025   44.409 0.95  0.00 ? 194 PHE A C    1  
ATOM   1385   O O    C PHE A 1 194 ? 27.223  18.675  22.379 0.05  0.00 ? 194 PHE A O    1  
ATOM   1386   O O    O PHE A 1 194 ? 36.527  5.701   43.325 0.95  0.00 ? 194 PHE A O    1  
ATOM   1387   H H    C PHE A 1 194 ? 28.806  20.442  26.070 0.05  0.00 ? 194 PHE A H    1  
ATOM   1388   H H    O PHE A 1 194 ? 35.847  6.247   47.625 0.95  0.00 ? 194 PHE A H    1  
ATOM   1389   N N    C LEU A 1 195 ? 26.188  19.614  24.170 0.05  0.00 ? 195 LEU A N    1  
ATOM   1390   N N    O LEU A 1 195 ? 35.019  6.957   44.469 0.95  0.00 ? 195 LEU A N    1  
ATOM   1391   C CA   C LEU A 1 195 ? 24.881  19.630  23.516 0.05  0.00 ? 195 LEU A CA   1  
ATOM   1392   C CA   O LEU A 1 195 ? 34.572  7.667   43.272 0.95  0.00 ? 195 LEU A CA   1  
ATOM   1393   C C    C LEU A 1 195 ? 24.875  20.521  22.277 0.05  0.00 ? 195 LEU A C    1  
ATOM   1394   C C    O LEU A 1 195 ? 35.695  8.490   42.646 0.95  0.00 ? 195 LEU A C    1  
ATOM   1395   O O    C LEU A 1 195 ? 24.328  20.161  21.229 0.05  0.00 ? 195 LEU A O    1  
ATOM   1396   O O    O LEU A 1 195 ? 35.875  8.506   41.423 0.95  0.00 ? 195 LEU A O    1  
ATOM   1397   H H    C LEU A 1 195 ? 26.268  19.952  25.086 0.05  0.00 ? 195 LEU A H    1  
ATOM   1398   H H    O LEU A 1 195 ? 34.604  7.166   45.332 0.95  0.00 ? 195 LEU A H    1  
ATOM   1399   N N    C VAL A 1 196 ? 25.447  21.703  22.442 0.05  0.00 ? 196 VAL A N    1  
ATOM   1400   N N    O VAL A 1 196 ? 36.403  9.205   43.505 0.95  0.00 ? 196 VAL A N    1  
ATOM   1401   C CA   C VAL A 1 196 ? 25.506  22.717  21.393 0.05  0.00 ? 196 VAL A CA   1  
ATOM   1402   C CA   O VAL A 1 196 ? 37.491  10.092  43.102 0.95  0.00 ? 196 VAL A CA   1  
ATOM   1403   C C    C VAL A 1 196 ? 26.298  22.157  20.210 0.05  0.00 ? 196 VAL A C    1  
ATOM   1404   C C    O VAL A 1 196 ? 38.582  9.259   42.427 0.95  0.00 ? 196 VAL A C    1  
ATOM   1405   O O    C VAL A 1 196 ? 25.806  22.355  19.093 0.05  0.00 ? 196 VAL A O    1  
ATOM   1406   O O    O VAL A 1 196 ? 39.047  9.729   41.382 0.95  0.00 ? 196 VAL A O    1  
ATOM   1407   H H    C VAL A 1 196 ? 25.825  21.919  23.320 0.05  0.00 ? 196 VAL A H    1  
ATOM   1408   H H    O VAL A 1 196 ? 36.167  9.159   44.455 0.95  0.00 ? 196 VAL A H    1  
ATOM   1409   N N    C ASP A 1 197 ? 27.388  21.519  20.483 0.05  0.00 ? 197 ASP A N    1  
ATOM   1410   N N    O ASP A 1 197 ? 38.902  8.142   42.993 0.95  0.00 ? 197 ASP A N    1  
ATOM   1411   C CA   C ASP A 1 197 ? 28.262  20.891  19.485 0.05  0.00 ? 197 ASP A CA   1  
ATOM   1412   C CA   O ASP A 1 197 ? 39.904  7.200   42.478 0.95  0.00 ? 197 ASP A CA   1  
ATOM   1413   C C    C ASP A 1 197 ? 27.482  19.820  18.682 0.05  0.00 ? 197 ASP A C    1  
ATOM   1414   C C    O ASP A 1 197 ? 39.509  6.714   41.061 0.95  0.00 ? 197 ASP A C    1  
ATOM   1415   O O    C ASP A 1 197 ? 27.843  19.543  17.524 0.05  0.00 ? 197 ASP A O    1  
ATOM   1416   O O    O ASP A 1 197 ? 40.398  6.343   40.274 0.95  0.00 ? 197 ASP A O    1  
ATOM   1417   H H    C ASP A 1 197 ? 27.640  21.432  21.427 0.05  0.00 ? 197 ASP A H    1  
ATOM   1418   H H    O ASP A 1 197 ? 38.429  7.897   43.816 0.95  0.00 ? 197 ASP A H    1  
ATOM   1419   N N    C LEU A 1 198 ? 26.491  19.211  19.295 0.05  0.00 ? 198 LEU A N    1  
ATOM   1420   N N    O LEU A 1 198 ? 38.227  6.671   40.775 0.95  0.00 ? 198 LEU A N    1  
ATOM   1421   C CA   C LEU A 1 198 ? 25.689  18.192  18.668 0.05  0.00 ? 198 LEU A CA   1  
ATOM   1422   C CA   O LEU A 1 198 ? 37.723  6.233   39.498 0.95  0.00 ? 198 LEU A CA   1  
ATOM   1423   C C    C LEU A 1 198 ? 24.849  18.813  17.563 0.05  0.00 ? 198 LEU A C    1  
ATOM   1424   C C    O LEU A 1 198 ? 38.101  7.244   38.427 0.95  0.00 ? 198 LEU A C    1  
ATOM   1425   O O    C LEU A 1 198 ? 24.764  18.206  16.505 0.05  0.00 ? 198 LEU A O    1  
ATOM   1426   O O    O LEU A 1 198 ? 38.507  6.813   37.357 0.95  0.00 ? 198 LEU A O    1  
ATOM   1427   H H    C LEU A 1 198 ? 26.292  19.458  20.221 0.05  0.00 ? 198 LEU A H    1  
ATOM   1428   H H    O LEU A 1 198 ? 37.585  6.944   41.462 0.95  0.00 ? 198 LEU A H    1  
ATOM   1429   N N    C ILE A 1 199 ? 24.255  19.941  17.906 0.05  0.00 ? 199 ILE A N    1  
ATOM   1430   N N    O ILE A 1 199 ? 37.894  8.501   38.774 0.95  0.00 ? 199 ILE A N    1  
ATOM   1431   C CA   C ILE A 1 199 ? 23.373  20.660  17.010 0.05  0.00 ? 199 ILE A CA   1  
ATOM   1432   C CA   O ILE A 1 199 ? 38.145  9.608   37.875 0.95  0.00 ? 199 ILE A CA   1  
ATOM   1433   C C    C ILE A 1 199 ? 24.118  21.313  15.839 0.05  0.00 ? 199 ILE A C    1  
ATOM   1434   C C    O ILE A 1 199 ? 39.640  9.840   37.619 0.95  0.00 ? 199 ILE A C    1  
ATOM   1435   O O    C ILE A 1 199 ? 23.614  21.275  14.714 0.05  0.00 ? 199 ILE A O    1  
ATOM   1436   O O    O ILE A 1 199 ? 40.015  10.114  36.477 0.95  0.00 ? 199 ILE A O    1  
ATOM   1437   H H    C ILE A 1 199 ? 24.391  20.289  18.813 0.05  0.00 ? 199 ILE A H    1  
ATOM   1438   H H    O ILE A 1 199 ? 37.526  8.690   39.663 0.95  0.00 ? 199 ILE A H    1  
ATOM   1439   N N    C LYS A 1 200 ? 25.254  21.906  16.139 0.05  0.00 ? 200 LYS A N    1  
ATOM   1440   N N    O LYS A 1 200 ? 40.423  9.756   38.673 0.95  0.00 ? 200 LYS A N    1  
ATOM   1441   C CA   C LYS A 1 200 ? 26.021  22.600  15.085 0.05  0.00 ? 200 LYS A CA   1  
ATOM   1442   C CA   O LYS A 1 200 ? 41.872  10.006  38.534 0.95  0.00 ? 200 LYS A CA   1  
ATOM   1443   C C    C LYS A 1 200 ? 26.710  21.617  14.149 0.05  0.00 ? 200 LYS A C    1  
ATOM   1444   C C    O LYS A 1 200 ? 42.579  8.851   37.839 0.95  0.00 ? 200 LYS A C    1  
ATOM   1445   O O    C LYS A 1 200 ? 26.915  21.926  12.953 0.05  0.00 ? 200 LYS A O    1  
ATOM   1446   O O    O LYS A 1 200 ? 43.603  9.064   37.149 0.95  0.00 ? 200 LYS A O    1  
ATOM   1447   H H    C LYS A 1 200 ? 25.575  21.911  17.065 0.05  0.00 ? 200 LYS A H    1  
ATOM   1448   H H    O LYS A 1 200 ? 40.041  9.555   39.553 0.95  0.00 ? 200 LYS A H    1  
ATOM   1449   N N    C ASN A 1 201 ? 27.018  20.436  14.650 0.05  0.00 ? 201 ASN A N    1  
ATOM   1450   N N    O ASN A 1 201 ? 42.030  7.658   37.961 0.95  0.00 ? 201 ASN A N    1  
ATOM   1451   C CA   C ASN A 1 201 ? 27.648  19.362  13.880 0.05  0.00 ? 201 ASN A CA   1  
ATOM   1452   C CA   O ASN A 1 201 ? 42.558  6.448   37.328 0.95  0.00 ? 201 ASN A CA   1  
ATOM   1453   C C    C ASN A 1 201 ? 26.571  18.486  13.208 0.05  0.00 ? 201 ASN A C    1  
ATOM   1454   C C    O ASN A 1 201 ? 41.951  6.275   35.921 0.95  0.00 ? 201 ASN A C    1  
ATOM   1455   O O    C ASN A 1 201 ? 26.886  17.408  12.687 0.05  0.00 ? 201 ASN A O    1  
ATOM   1456   O O    O ASN A 1 201 ? 42.105  5.212   35.306 0.95  0.00 ? 201 ASN A O    1  
ATOM   1457   H H    C ASN A 1 201 ? 26.790  20.259  15.587 0.05  0.00 ? 201 ASN A H    1  
ATOM   1458   H H    O ASN A 1 201 ? 41.207  7.581   38.488 0.95  0.00 ? 201 ASN A H    1  
ATOM   1459   N N    C LYS A 1 202 ? 25.380  18.981  13.267 0.05  0.00 ? 202 LYS A N    1  
ATOM   1460   N N    O LYS A 1 202 ? 41.296  7.306   35.502 0.95  0.00 ? 202 LYS A N    1  
ATOM   1461   C CA   C LYS A 1 202 ? 24.200  18.444  12.663 0.05  0.00 ? 202 LYS A CA   1  
ATOM   1462   C CA   O LYS A 1 202 ? 40.700  7.474   34.213 0.95  0.00 ? 202 LYS A CA   1  
ATOM   1463   C C    C LYS A 1 202 ? 23.779  17.055  13.050 0.05  0.00 ? 202 LYS A C    1  
ATOM   1464   C C    O LYS A 1 202 ? 39.660  6.480   33.781 0.95  0.00 ? 202 LYS A C    1  
ATOM   1465   O O    C LYS A 1 202 ? 22.962  16.451  12.332 0.05  0.00 ? 202 LYS A O    1  
ATOM   1466   O O    O LYS A 1 202 ? 39.357  6.410   32.576 0.95  0.00 ? 202 LYS A O    1  
ATOM   1467   H H    C LYS A 1 202 ? 25.285  19.842  13.726 0.05  0.00 ? 202 LYS A H    1  
ATOM   1468   H H    O LYS A 1 202 ? 41.250  8.073   36.110 0.95  0.00 ? 202 LYS A H    1  
ATOM   1469   N N    C HIS A 1 203 ? 24.221  16.598  14.197 0.05  0.00 ? 203 HIS A N    1  
ATOM   1470   N N    O HIS A 1 203 ? 39.048  5.811   34.729 0.95  0.00 ? 203 HIS A N    1  
ATOM   1471   C CA   C HIS A 1 203 ? 23.867  15.292  14.751 0.05  0.00 ? 203 HIS A CA   1  
ATOM   1472   C CA   O HIS A 1 203 ? 37.976  4.846   34.490 0.95  0.00 ? 203 HIS A CA   1  
ATOM   1473   C C    C HIS A 1 203 ? 22.488  15.379  15.388 0.05  0.00 ? 203 HIS A C    1  
ATOM   1474   C C    O HIS A 1 203 ? 36.672  5.597   34.263 0.95  0.00 ? 203 HIS A C    1  
ATOM   1475   O O    C HIS A 1 203 ? 21.904  14.337  15.678 0.05  0.00 ? 203 HIS A O    1  
ATOM   1476   O O    O HIS A 1 203 ? 35.713  4.987   33.794 0.95  0.00 ? 203 HIS A O    1  
ATOM   1477   H H    C HIS A 1 203 ? 24.799  17.182  14.731 0.05  0.00 ? 203 HIS A H    1  
ATOM   1478   H H    O HIS A 1 203 ? 39.303  5.994   35.657 0.95  0.00 ? 203 HIS A H    1  
ATOM   1479   N N    C MET A 1 204 ? 22.052  16.596  15.533 0.05  0.00 ? 204 MET A N    1  
ATOM   1480   N N    O MET A 1 204 ? 36.730  6.858   34.576 0.95  0.00 ? 204 MET A N    1  
ATOM   1481   C CA   C MET A 1 204 ? 20.768  17.004  16.159 0.05  0.00 ? 204 MET A CA   1  
ATOM   1482   C CA   O MET A 1 204 ? 35.615  7.837   34.507 0.95  0.00 ? 204 MET A CA   1  
ATOM   1483   C C    C MET A 1 204 ? 20.297  18.355  15.630 0.05  0.00 ? 204 MET A C    1  
ATOM   1484   C C    O MET A 1 204 ? 36.135  9.260   34.336 0.95  0.00 ? 204 MET A C    1  
ATOM   1485   O O    C MET A 1 204 ? 21.117  19.215  15.331 0.05  0.00 ? 204 MET A O    1  
ATOM   1486   O O    O MET A 1 204 ? 37.192  9.593   34.860 0.95  0.00 ? 204 MET A O    1  
ATOM   1487   H H    C MET A 1 204 ? 22.642  17.315  15.224 0.05  0.00 ? 204 MET A H    1  
ATOM   1488   H H    O MET A 1 204 ? 37.588  7.188   34.917 0.95  0.00 ? 204 MET A H    1  
ATOM   1489   N N    C ASN A 1 205 ? 19.018  18.554  15.466 0.05  0.00 ? 205 ASN A N    1  
ATOM   1490   N N    O ASN A 1 205 ? 35.457  10.091  33.594 0.95  0.00 ? 205 ASN A N    1  
ATOM   1491   C CA   C ASN A 1 205 ? 18.310  19.735  15.017 0.05  0.00 ? 205 ASN A CA   1  
ATOM   1492   C CA   O ASN A 1 205 ? 35.704  11.487  33.295 0.95  0.00 ? 205 ASN A CA   1  
ATOM   1493   C C    C ASN A 1 205 ? 17.817  20.521  16.247 0.05  0.00 ? 205 ASN A C    1  
ATOM   1494   C C    O ASN A 1 205 ? 34.866  12.360  34.249 0.95  0.00 ? 205 ASN A C    1  
ATOM   1495   O O    C ASN A 1 205 ? 17.197  19.924  17.131 0.05  0.00 ? 205 ASN A O    1  
ATOM   1496   O O    O ASN A 1 205 ? 33.661  12.125  34.373 0.95  0.00 ? 205 ASN A O    1  
ATOM   1497   H H    C ASN A 1 205 ? 18.447  17.793  15.704 0.05  0.00 ? 205 ASN A H    1  
ATOM   1498   H H    O ASN A 1 205 ? 34.643  9.719   33.193 0.95  0.00 ? 205 ASN A H    1  
ATOM   1499   N N    C ALA A 1 206 ? 18.050  21.829  16.183 0.05  0.00 ? 206 ALA A N    1  
ATOM   1500   N N    O ALA A 1 206 ? 35.541  13.366  34.796 0.95  0.00 ? 206 ALA A N    1  
ATOM   1501   C CA   C ALA A 1 206 ? 17.658  22.673  17.326 0.05  0.00 ? 206 ALA A CA   1  
ATOM   1502   C CA   O ALA A 1 206 ? 34.848  14.241  35.758 0.95  0.00 ? 206 ALA A CA   1  
ATOM   1503   C C    C ALA A 1 206 ? 16.171  22.770  17.525 0.05  0.00 ? 206 ALA A C    1  
ATOM   1504   C C    O ALA A 1 206 ? 33.759  15.075  35.143 0.95  0.00 ? 206 ALA A C    1  
ATOM   1505   O O    C ALA A 1 206 ? 15.722  23.210  18.601 0.05  0.00 ? 206 ALA A O    1  
ATOM   1506   O O    O ALA A 1 206 ? 32.923  15.635  35.879 0.95  0.00 ? 206 ALA A O    1  
ATOM   1507   H H    C ALA A 1 206 ? 18.500  22.218  15.404 0.05  0.00 ? 206 ALA A H    1  
ATOM   1508   H H    O ALA A 1 206 ? 36.488  13.505  34.585 0.95  0.00 ? 206 ALA A H    1  
ATOM   1509   N N    C ASP A 1 207 ? 15.369  22.365  16.557 0.05  0.00 ? 207 ASP A N    1  
ATOM   1510   N N    O ASP A 1 207 ? 33.700  15.180  33.828 0.95  0.00 ? 207 ASP A N    1  
ATOM   1511   C CA   C ASP A 1 207 ? 13.911  22.481  16.710 0.05  0.00 ? 207 ASP A CA   1  
ATOM   1512   C CA   O ASP A 1 207 ? 32.667  16.017  33.201 0.95  0.00 ? 207 ASP A CA   1  
ATOM   1513   C C    C ASP A 1 207 ? 13.196  21.199  17.093 0.05  0.00 ? 207 ASP A C    1  
ATOM   1514   C C    O ASP A 1 207 ? 31.472  15.264  32.646 0.95  0.00 ? 207 ASP A C    1  
ATOM   1515   O O    C ASP A 1 207 ? 11.967  21.187  17.047 0.05  0.00 ? 207 ASP A O    1  
ATOM   1516   O O    O ASP A 1 207 ? 30.674  15.884  31.944 0.95  0.00 ? 207 ASP A O    1  
ATOM   1517   H H    C ASP A 1 207 ? 15.745  22.009  15.724 0.05  0.00 ? 207 ASP A H    1  
ATOM   1518   H H    O ASP A 1 207 ? 34.360  14.718  33.269 0.95  0.00 ? 207 ASP A H    1  
ATOM   1519   N N    C THR A 1 208 ? 13.939  20.197  17.504 0.05  0.00 ? 208 THR A N    1  
ATOM   1520   N N    O THR A 1 208 ? 31.338  14.006  32.999 0.95  0.00 ? 208 THR A N    1  
ATOM   1521   C CA   C THR A 1 208 ? 13.313  18.916  17.928 0.05  0.00 ? 208 THR A CA   1  
ATOM   1522   C CA   O THR A 1 208 ? 30.176  13.208  32.524 0.95  0.00 ? 208 THR A CA   1  
ATOM   1523   C C    C THR A 1 208 ? 12.555  19.117  19.247 0.05  0.00 ? 208 THR A C    1  
ATOM   1524   C C    O THR A 1 208 ? 28.889  13.709  33.192 0.95  0.00 ? 208 THR A C    1  
ATOM   1525   O O    C THR A 1 208 ? 13.117  19.523  20.255 0.05  0.00 ? 208 THR A O    1  
ATOM   1526   O O    O THR A 1 208 ? 28.762  13.727  34.409 0.95  0.00 ? 208 THR A O    1  
ATOM   1527   H H    C THR A 1 208 ? 14.913  20.300  17.551 0.05  0.00 ? 208 THR A H    1  
ATOM   1528   H H    O THR A 1 208 ? 31.997  13.596  33.597 0.95  0.00 ? 208 THR A H    1  
ATOM   1529   N N    C ASP A 1 209 ? 11.282  18.834  19.231 0.05  0.00 ? 209 ASP A N    1  
ATOM   1530   N N    O ASP A 1 209 ? 27.944  14.117  32.392 0.95  0.00 ? 209 ASP A N    1  
ATOM   1531   C CA   C ASP A 1 209 ? 10.405  18.944  20.396 0.05  0.00 ? 209 ASP A CA   1  
ATOM   1532   C CA   O ASP A 1 209 ? 26.643  14.608  32.846 0.95  0.00 ? 209 ASP A CA   1  
ATOM   1533   C C    C ASP A 1 209 ? 9.936   17.552  20.802 0.05  0.00 ? 209 ASP A C    1  
ATOM   1534   C C    O ASP A 1 209 ? 25.558  13.635  32.402 0.95  0.00 ? 209 ASP A C    1  
ATOM   1535   O O    C ASP A 1 209 ? 10.460  16.554  20.300 0.05  0.00 ? 209 ASP A O    1  
ATOM   1536   O O    O ASP A 1 209 ? 25.869  12.532  31.943 0.95  0.00 ? 209 ASP A O    1  
ATOM   1537   H H    C ASP A 1 209 ? 10.892  18.517  18.389 0.05  0.00 ? 209 ASP A H    1  
ATOM   1538   H H    O ASP A 1 209 ? 28.111  14.081  31.426 0.95  0.00 ? 209 ASP A H    1  
ATOM   1539   N N    C TYR A 1 210 ? 8.959   17.501  21.682 0.05  0.00 ? 210 TYR A N    1  
ATOM   1540   N N    O TYR A 1 210 ? 24.316  14.051  32.527 0.95  0.00 ? 210 TYR A N    1  
ATOM   1541   C CA   C TYR A 1 210 ? 8.409   16.249  22.206 0.05  0.00 ? 210 TYR A CA   1  
ATOM   1542   C CA   O TYR A 1 210 ? 23.152  13.234  32.180 0.95  0.00 ? 210 TYR A CA   1  
ATOM   1543   C C    C TYR A 1 210 ? 7.783   15.381  21.121 0.05  0.00 ? 210 TYR A C    1  
ATOM   1544   C C    O TYR A 1 210 ? 23.117  12.856  30.703 0.95  0.00 ? 210 TYR A C    1  
ATOM   1545   O O    C TYR A 1 210 ? 8.072   14.188  21.053 0.05  0.00 ? 210 TYR A O    1  
ATOM   1546   O O    O TYR A 1 210 ? 22.919  11.687  30.378 0.95  0.00 ? 210 TYR A O    1  
ATOM   1547   H H    C TYR A 1 210 ? 8.594   18.344  22.020 0.05  0.00 ? 210 TYR A H    1  
ATOM   1548   H H    O TYR A 1 210 ? 24.161  14.947  32.891 0.95  0.00 ? 210 TYR A H    1  
ATOM   1549   N N    C CYS A 1 211 ? 6.934   15.987  20.332 0.05  0.00 ? 211 CYS A N    1  
ATOM   1550   N N    O CYS A 1 211 ? 23.280  13.845  29.863 0.95  0.00 ? 211 CYS A N    1  
ATOM   1551   C CA   C CYS A 1 211 ? 6.185   15.344  19.257 0.05  0.00 ? 211 CYS A CA   1  
ATOM   1552   C CA   O CYS A 1 211 ? 23.238  13.723  28.409 0.95  0.00 ? 211 CYS A CA   1  
ATOM   1553   C C    C CYS A 1 211 ? 7.114   14.810  18.194 0.05  0.00 ? 211 CYS A C    1  
ATOM   1554   C C    O CYS A 1 211 ? 24.353  12.836  27.908 0.95  0.00 ? 211 CYS A C    1  
ATOM   1555   O O    C CYS A 1 211 ? 6.828   13.707  17.696 0.05  0.00 ? 211 CYS A O    1  
ATOM   1556   O O    O CYS A 1 211 ? 24.080  12.057  26.978 0.95  0.00 ? 211 CYS A O    1  
ATOM   1557   C CB   C CYS A 1 211 ? 5.168   16.356  18.695 0.05  0.00 ? 211 CYS A CB   1  
ATOM   1558   C CB   O CYS A 1 211 ? 23.290  15.136  27.797 0.95  0.00 ? 211 CYS A CB   1  
ATOM   1559   S SG   A CYS A 1 211 ? 21.713  15.556  27.023 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1560   S SG   B CYS A 1 211 ? 23.103  16.396  29.078 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1561   S SG   C CYS A 1 211 ? 23.714  15.058  26.041 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1562   S SG   D CYS A 1 211 ? 24.290  15.145  26.292 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1563   S SG   E CYS A 1 211 ? 22.785  16.378  29.008 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1564   S SG   F CYS A 1 211 ? 24.451  15.192  26.413 0.16  0.00 ? 211 CYS A SG   1  
ATOM   1565   S SG   U CYS A 1 211 ? 4.448   15.751  17.153 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1566   S SG   V CYS A 1 211 ? 3.912   15.519  17.703 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1567   S SG   W CYS A 1 211 ? 3.527   16.072  19.398 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1568   S SG   X CYS A 1 211 ? 5.969   17.935  18.333 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1569   S SG   Y CYS A 1 211 ? 4.749   15.961  16.983 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1570   S SG   Z CYS A 1 211 ? 6.001   17.615  17.701 0.010 0.00 ? 211 CYS A SG   1  
ATOM   1571   H H    C CYS A 1 211 ? 6.786   16.976  20.478 0.05  0.00 ? 211 CYS A H    1  
ATOM   1572   H H    O CYS A 1 211 ? 23.448  14.763  30.250 0.95  0.00 ? 211 CYS A H    1  
ATOM   1573   N N    C ILE A 1 212 ? 8.038   15.607  17.752 0.05  0.00 ? 212 ILE A N    1  
ATOM   1574   N N    O ILE A 1 212 ? 25.549  13.068  28.356 0.95  0.00 ? 212 ILE A N    1  
ATOM   1575   C CA   C ILE A 1 212 ? 8.963   15.254  16.686 0.05  0.00 ? 212 ILE A CA   1  
ATOM   1576   C CA   O ILE A 1 212 ? 26.728  12.340  27.916 0.95  0.00 ? 212 ILE A CA   1  
ATOM   1577   C C    C ILE A 1 212 ? 9.822   14.065  17.092 0.05  0.00 ? 212 ILE A C    1  
ATOM   1578   C C    O ILE A 1 212 ? 26.607  10.862  28.260 0.95  0.00 ? 212 ILE A C    1  
ATOM   1579   O O    C ILE A 1 212 ? 9.920   13.134  16.264 0.05  0.00 ? 212 ILE A O    1  
ATOM   1580   O O    O ILE A 1 212 ? 26.868  10.049  27.348 0.95  0.00 ? 212 ILE A O    1  
ATOM   1581   H H    C ILE A 1 212 ? 8.124   16.488  18.169 0.05  0.00 ? 212 ILE A H    1  
ATOM   1582   H H    O ILE A 1 212 ? 25.658  13.763  29.037 0.95  0.00 ? 212 ILE A H    1  
ATOM   1583   N N    C ALA A 1 213 ? 10.461  14.087  18.244 0.05  0.00 ? 213 ALA A N    1  
ATOM   1584   N N    O ALA A 1 213 ? 26.298  10.504  29.490 0.95  0.00 ? 213 ALA A N    1  
ATOM   1585   C CA   C ALA A 1 213 ? 11.317  12.969  18.656 0.05  0.00 ? 213 ALA A CA   1  
ATOM   1586   C CA   O ALA A 1 213 ? 26.197  9.089   29.863 0.95  0.00 ? 213 ALA A CA   1  
ATOM   1587   C C    C ALA A 1 213 ? 10.544  11.669  18.840 0.05  0.00 ? 213 ALA A C    1  
ATOM   1588   C C    O ALA A 1 213 ? 25.085  8.359   29.119 0.95  0.00 ? 213 ALA A C    1  
ATOM   1589   O O    C ALA A 1 213 ? 11.064  10.558  18.591 0.05  0.00 ? 213 ALA A O    1  
ATOM   1590   O O    O ALA A 1 213 ? 25.189  7.151   28.810 0.95  0.00 ? 213 ALA A O    1  
ATOM   1591   H H    C ALA A 1 213 ? 10.375  14.869  18.828 0.05  0.00 ? 213 ALA A H    1  
ATOM   1592   H H    O ALA A 1 213 ? 26.149  11.194  30.170 0.95  0.00 ? 213 ALA A H    1  
ATOM   1593   N N    C GLU A 1 214 ? 9.347   11.789  19.346 0.05  0.00 ? 214 GLU A N    1  
ATOM   1594   N N    O GLU A 1 214 ? 24.000  9.051   28.903 0.95  0.00 ? 214 GLU A N    1  
ATOM   1595   C CA   C GLU A 1 214 ? 8.465   10.700  19.632 0.05  0.00 ? 214 GLU A CA   1  
ATOM   1596   C CA   O GLU A 1 214 ? 22.827  8.554   28.253 0.95  0.00 ? 214 GLU A CA   1  
ATOM   1597   C C    C GLU A 1 214 ? 8.015   9.979   18.345 0.05  0.00 ? 214 GLU A C    1  
ATOM   1598   C C    O GLU A 1 214 ? 23.094  8.222   26.771 0.95  0.00 ? 214 GLU A C    1  
ATOM   1599   O O    C GLU A 1 214 ? 8.000   8.759   18.337 0.05  0.00 ? 214 GLU A O    1  
ATOM   1600   O O    O GLU A 1 214 ? 22.644  7.182   26.318 0.95  0.00 ? 214 GLU A O    1  
ATOM   1601   H H    C GLU A 1 214 ? 9.038   12.692  19.567 0.05  0.00 ? 214 GLU A H    1  
ATOM   1602   H H    O GLU A 1 214 ? 23.980  9.975   29.229 0.95  0.00 ? 214 GLU A H    1  
ATOM   1603   N N    C ALA A 1 215 ? 7.632   10.736  17.362 0.05  0.00 ? 215 ALA A N    1  
ATOM   1604   N N    O ALA A 1 215 ? 23.750  9.110   26.088 0.95  0.00 ? 215 ALA A N    1  
ATOM   1605   C CA   C ALA A 1 215 ? 7.168   10.216  16.078 0.05  0.00 ? 215 ALA A CA   1  
ATOM   1606   C CA   O ALA A 1 215 ? 24.079  8.958   24.673 0.95  0.00 ? 215 ALA A CA   1  
ATOM   1607   C C    C ALA A 1 215 ? 8.350   9.542   15.376 0.05  0.00 ? 215 ALA A C    1  
ATOM   1608   C C    O ALA A 1 215 ? 25.078  7.806   24.533 0.95  0.00 ? 215 ALA A C    1  
ATOM   1609   O O    C ALA A 1 215 ? 8.132   8.464   14.777 0.05  0.00 ? 215 ALA A O    1  
ATOM   1610   O O    O ALA A 1 215 ? 24.926  7.018   23.572 0.95  0.00 ? 215 ALA A O    1  
ATOM   1611   H H    C ALA A 1 215 ? 7.650   11.707  17.489 0.05  0.00 ? 215 ALA A H    1  
ATOM   1612   H H    O ALA A 1 215 ? 24.034  9.929   26.544 0.95  0.00 ? 215 ALA A H    1  
ATOM   1613   N N    C ALA A 1 216 ? 9.492   10.143  15.493 0.05  0.00 ? 216 ALA A N    1  
ATOM   1614   N N    O ALA A 1 216 ? 25.987  7.734   25.454 0.95  0.00 ? 216 ALA A N    1  
ATOM   1615   C CA   C ALA A 1 216 ? 10.728  9.672   14.881 0.05  0.00 ? 216 ALA A CA   1  
ATOM   1616   C CA   O ALA A 1 216 ? 27.039  6.725   25.485 0.95  0.00 ? 216 ALA A CA   1  
ATOM   1617   C C    C ALA A 1 216 ? 11.141  8.325   15.426 0.05  0.00 ? 216 ALA A C    1  
ATOM   1618   C C    O ALA A 1 216 ? 26.471  5.333   25.638 0.95  0.00 ? 216 ALA A C    1  
ATOM   1619   O O    C ALA A 1 216 ? 11.516  7.413   14.645 0.05  0.00 ? 216 ALA A O    1  
ATOM   1620   O O    O ALA A 1 216 ? 26.894  4.393   24.917 0.95  0.00 ? 216 ALA A O    1  
ATOM   1621   H H    C ALA A 1 216 ? 9.523   10.973  16.013 0.05  0.00 ? 216 ALA A H    1  
ATOM   1622   H H    O ALA A 1 216 ? 25.975  8.408   26.165 0.95  0.00 ? 216 ALA A H    1  
ATOM   1623   N N    C PHE A 1 217 ? 11.110  8.194   16.753 0.05  0.00 ? 217 PHE A N    1  
ATOM   1624   N N    O PHE A 1 217 ? 25.544  5.178   26.585 0.95  0.00 ? 217 PHE A N    1  
ATOM   1625   C CA   C PHE A 1 217 ? 11.442  6.907   17.375 0.05  0.00 ? 217 PHE A CA   1  
ATOM   1626   C CA   O PHE A 1 217 ? 24.894  3.876   26.775 0.95  0.00 ? 217 PHE A CA   1  
ATOM   1627   C C    C PHE A 1 217 ? 10.397  5.842   17.002 0.05  0.00 ? 217 PHE A C    1  
ATOM   1628   C C    O PHE A 1 217 ? 24.047  3.512   25.544 0.95  0.00 ? 217 PHE A C    1  
ATOM   1629   O O    C PHE A 1 217 ? 10.749  4.675   16.732 0.05  0.00 ? 217 PHE A O    1  
ATOM   1630   O O    O PHE A 1 217 ? 24.031  2.342   25.109 0.95  0.00 ? 217 PHE A O    1  
ATOM   1631   H H    C PHE A 1 217 ? 10.830  8.948   17.312 0.05  0.00 ? 217 PHE A H    1  
ATOM   1632   H H    O PHE A 1 217 ? 25.271  5.944   27.131 0.95  0.00 ? 217 PHE A H    1  
ATOM   1633   N N    C ASN A 1 218 ? 9.151   6.198   17.044 0.05  0.00 ? 218 ASN A N    1  
ATOM   1634   N N    O ASN A 1 218 ? 23.315  4.452   25.033 0.95  0.00 ? 218 ASN A N    1  
ATOM   1635   C CA   C ASN A 1 218 ? 8.031   5.317   16.771 0.05  0.00 ? 218 ASN A CA   1  
ATOM   1636   C CA   O ASN A 1 218 ? 22.420  4.280   23.904 0.95  0.00 ? 218 ASN A CA   1  
ATOM   1637   C C    C ASN A 1 218 ? 7.914   4.886   15.317 0.05  0.00 ? 218 ASN A C    1  
ATOM   1638   C C    O ASN A 1 218 ? 23.124  4.033   22.579 0.95  0.00 ? 218 ASN A C    1  
ATOM   1639   O O    C ASN A 1 218 ? 7.279   3.846   15.030 0.05  0.00 ? 218 ASN A O    1  
ATOM   1640   O O    O ASN A 1 218 ? 22.504  3.477   21.644 0.95  0.00 ? 218 ASN A O    1  
ATOM   1641   H H    C ASN A 1 218 ? 8.951   7.120   17.308 0.05  0.00 ? 218 ASN A H    1  
ATOM   1642   H H    O ASN A 1 218 ? 23.347  5.334   25.458 0.95  0.00 ? 218 ASN A H    1  
ATOM   1643   N N    C LYS A 1 219 ? 8.521   5.605   14.418 0.05  0.00 ? 219 LYS A N    1  
ATOM   1644   N N    O LYS A 1 219 ? 24.374  4.380   22.480 0.95  0.00 ? 219 LYS A N    1  
ATOM   1645   C CA   C LYS A 1 219 ? 8.567   5.319   12.994 0.05  0.00 ? 219 LYS A CA   1  
ATOM   1646   C CA   O LYS A 1 219 ? 25.221  4.174   21.317 0.95  0.00 ? 219 LYS A CA   1  
ATOM   1647   C C    C LYS A 1 219 ? 9.841   4.590   12.621 0.05  0.00 ? 219 LYS A C    1  
ATOM   1648   C C    O LYS A 1 219 ? 26.050  2.914   21.458 0.95  0.00 ? 219 LYS A C    1  
ATOM   1649   O O    C LYS A 1 219 ? 10.131  4.289   11.449 0.05  0.00 ? 219 LYS A O    1  
ATOM   1650   O O    O LYS A 1 219 ? 26.892  2.559   20.613 0.95  0.00 ? 219 LYS A O    1  
ATOM   1651   H H    C LYS A 1 219 ? 9.019   6.388   14.733 0.05  0.00 ? 219 LYS A H    1  
ATOM   1652   H H    O LYS A 1 219 ? 24.790  4.785   23.270 0.95  0.00 ? 219 LYS A H    1  
ATOM   1653   N N    C GLY A 1 220 ? 10.637  4.279   13.624 0.05  0.00 ? 220 GLY A N    1  
ATOM   1654   N N    O GLY A 1 220 ? 25.820  2.196   22.539 0.95  0.00 ? 220 GLY A N    1  
ATOM   1655   C CA   C GLY A 1 220 ? 11.915  3.585   13.445 0.05  0.00 ? 220 GLY A CA   1  
ATOM   1656   C CA   O GLY A 1 220 ? 26.539  0.955   22.842 0.95  0.00 ? 220 GLY A CA   1  
ATOM   1657   C C    C GLY A 1 220 ? 12.947  4.376   12.688 0.05  0.00 ? 220 GLY A C    1  
ATOM   1658   C C    O GLY A 1 220 ? 28.008  1.141   23.106 0.95  0.00 ? 220 GLY A C    1  
ATOM   1659   O O    C GLY A 1 220 ? 13.930  3.804   12.188 0.05  0.00 ? 220 GLY A O    1  
ATOM   1660   O O    O GLY A 1 220 ? 28.781  0.170   23.049 0.95  0.00 ? 220 GLY A O    1  
ATOM   1661   H H    C GLY A 1 220 ? 10.364  4.530   14.533 0.05  0.00 ? 220 GLY A H    1  
ATOM   1662   H H    O GLY A 1 220 ? 25.142  2.511   23.174 0.95  0.00 ? 220 GLY A H    1  
ATOM   1663   N N    C GLU A 1 221 ? 12.776  5.695   12.614 0.05  0.00 ? 221 GLU A N    1  
ATOM   1664   N N    O GLU A 1 221 ? 28.424  2.364   23.432 0.95  0.00 ? 221 GLU A N    1  
ATOM   1665   C CA   C GLU A 1 221 ? 13.716  6.579   11.921 0.05  0.00 ? 221 GLU A CA   1  
ATOM   1666   C CA   O GLU A 1 221 ? 29.824  2.673   23.729 0.95  0.00 ? 221 GLU A CA   1  
ATOM   1667   C C    C GLU A 1 221 ? 14.947  6.895   12.735 0.05  0.00 ? 221 GLU A C    1  
ATOM   1668   C C    O GLU A 1 221 ? 30.238  2.280   25.126 0.95  0.00 ? 221 GLU A C    1  
ATOM   1669   O O    C GLU A 1 221 ? 16.027  7.142   12.200 0.05  0.00 ? 221 GLU A O    1  
ATOM   1670   O O    O GLU A 1 221 ? 31.397  1.964   25.390 0.95  0.00 ? 221 GLU A O    1  
ATOM   1671   H H    C GLU A 1 221 ? 11.993  6.093   13.051 0.05  0.00 ? 221 GLU A H    1  
ATOM   1672   H H    O GLU A 1 221 ? 27.762  3.086   23.486 0.95  0.00 ? 221 GLU A H    1  
ATOM   1673   N N    C THR A 1 222 ? 14.854  6.883   14.053 0.05  0.00 ? 222 THR A N    1  
ATOM   1674   N N    O THR A 1 222 ? 29.319  2.260   26.075 0.95  0.00 ? 222 THR A N    1  
ATOM   1675   C CA   C THR A 1 222 ? 15.992  7.191   14.914 0.05  0.00 ? 222 THR A CA   1  
ATOM   1676   C CA   O THR A 1 222 ? 29.637  1.905   27.455 0.95  0.00 ? 222 THR A CA   1  
ATOM   1677   C C    C THR A 1 222 ? 16.250  6.027   15.856 0.05  0.00 ? 222 THR A C    1  
ATOM   1678   C C    O THR A 1 222 ? 28.775  0.732   27.893 0.95  0.00 ? 222 THR A C    1  
ATOM   1679   O O    C THR A 1 222 ? 15.279  5.395   16.286 0.05  0.00 ? 222 THR A O    1  
ATOM   1680   O O    O THR A 1 222 ? 27.616  0.666   27.470 0.95  0.00 ? 222 THR A O    1  
ATOM   1681   H H    C THR A 1 222 ? 13.990  6.669   14.464 0.05  0.00 ? 222 THR A H    1  
ATOM   1682   H H    O THR A 1 222 ? 28.396  2.499   25.846 0.95  0.00 ? 222 THR A H    1  
ATOM   1683   N N    C ALA A 1 223 ? 17.488  5.756   16.230 0.05  0.00 ? 223 ALA A N    1  
ATOM   1684   N N    O ALA A 1 223 ? 29.264  -0.149  28.748 0.95  0.00 ? 223 ALA A N    1  
ATOM   1685   C CA   C ALA A 1 223 ? 17.808  4.629   17.069 0.05  0.00 ? 223 ALA A CA   1  
ATOM   1686   C CA   O ALA A 1 223 ? 28.524  -1.317  29.154 0.95  0.00 ? 223 ALA A CA   1  
ATOM   1687   C C    C ALA A 1 223 ? 17.491  4.781   18.565 0.05  0.00 ? 223 ALA A C    1  
ATOM   1688   C C    O ALA A 1 223 ? 27.400  -1.091  30.177 0.95  0.00 ? 223 ALA A C    1  
ATOM   1689   O O    C ALA A 1 223 ? 17.247  3.757   19.212 0.05  0.00 ? 223 ALA A O    1  
ATOM   1690   O O    O ALA A 1 223 ? 26.444  -1.874  30.170 0.95  0.00 ? 223 ALA A O    1  
ATOM   1691   H H    C ALA A 1 223 ? 18.217  6.315   15.890 0.05  0.00 ? 223 ALA A H    1  
ATOM   1692   H H    O ALA A 1 223 ? 30.176  -0.027  29.083 0.95  0.00 ? 223 ALA A H    1  
ATOM   1693   N N    C MET A 1 224 ? 17.543  5.989   19.057 0.05  0.00 ? 224 MET A N    1  
ATOM   1694   N N    O MET A 1 224 ? 27.558  -0.102  31.014 0.95  0.00 ? 224 MET A N    1  
ATOM   1695   C CA   C MET A 1 224 ? 17.327  6.225   20.499 0.05  0.00 ? 224 MET A CA   1  
ATOM   1696   C CA   O MET A 1 224 ? 26.567  0.148   32.081 0.95  0.00 ? 224 MET A CA   1  
ATOM   1697   C C    C MET A 1 224 ? 16.469  7.471   20.709 0.05  0.00 ? 224 MET A C    1  
ATOM   1698   C C    O MET A 1 224 ? 26.312  1.647   32.227 0.95  0.00 ? 224 MET A C    1  
ATOM   1699   O O    C MET A 1 224 ? 16.403  8.342   19.854 0.05  0.00 ? 224 MET A O    1  
ATOM   1700   O O    O MET A 1 224 ? 27.139  2.466   31.853 0.95  0.00 ? 224 MET A O    1  
ATOM   1701   H H    C MET A 1 224 ? 17.774  6.739   18.472 0.05  0.00 ? 224 MET A H    1  
ATOM   1702   H H    O MET A 1 224 ? 28.365  0.450   30.963 0.95  0.00 ? 224 MET A H    1  
ATOM   1703   N N    C THR A 1 225 ? 15.970  7.541   21.924 0.05  0.00 ? 225 THR A N    1  
ATOM   1704   N N    O THR A 1 225 ? 25.218  1.908   32.908 0.95  0.00 ? 225 THR A N    1  
ATOM   1705   C CA   C THR A 1 225 ? 15.185  8.624   22.477 0.05  0.00 ? 225 THR A CA   1  
ATOM   1706   C CA   O THR A 1 225 ? 24.730  3.215   33.296 0.95  0.00 ? 225 THR A CA   1  
ATOM   1707   C C    C THR A 1 225 ? 15.379  8.632   23.999 0.05  0.00 ? 225 THR A C    1  
ATOM   1708   C C    O THR A 1 225 ? 23.879  3.055   34.562 0.95  0.00 ? 225 THR A C    1  
ATOM   1709   O O    C THR A 1 225 ? 15.988  7.757   24.576 0.05  0.00 ? 225 THR A O    1  
ATOM   1710   O O    O THR A 1 225 ? 23.594  1.968   35.016 0.95  0.00 ? 225 THR A O    1  
ATOM   1711   H H    C THR A 1 225 ? 16.196  6.808   22.534 0.05  0.00 ? 225 THR A H    1  
ATOM   1712   H H    O THR A 1 225 ? 24.707  1.137   33.231 0.95  0.00 ? 225 THR A H    1  
ATOM   1713   N N    C ILE A 1 226 ? 15.000  9.770   24.583 0.05  0.00 ? 226 ILE A N    1  
ATOM   1714   N N    O ILE A 1 226 ? 23.663  4.200   35.212 0.95  0.00 ? 226 ILE A N    1  
ATOM   1715   C CA   C ILE A 1 226 ? 15.068  9.987   26.055 0.05  0.00 ? 226 ILE A CA   1  
ATOM   1716   C CA   O ILE A 1 226 ? 22.836  4.287   36.448 0.95  0.00 ? 226 ILE A CA   1  
ATOM   1717   C C    C ILE A 1 226 ? 13.654  10.300  26.455 0.05  0.00 ? 226 ILE A C    1  
ATOM   1718   C C    O ILE A 1 226 ? 21.745  5.261   36.103 0.95  0.00 ? 226 ILE A C    1  
ATOM   1719   O O    C ILE A 1 226 ? 13.087  11.273  25.915 0.05  0.00 ? 226 ILE A O    1  
ATOM   1720   O O    O ILE A 1 226 ? 22.069  6.409   35.736 0.95  0.00 ? 226 ILE A O    1  
ATOM   1721   H H    C ILE A 1 226 ? 14.641  10.487  24.020 0.05  0.00 ? 226 ILE A H    1  
ATOM   1722   H H    O ILE A 1 226 ? 24.049  5.024   34.848 0.95  0.00 ? 226 ILE A H    1  
ATOM   1723   N N    C ASN A 1 227 ? 13.067  9.416   27.272 0.05  0.00 ? 227 ASN A N    1  
ATOM   1724   N N    O ASN A 1 227 ? 20.501  4.765   36.091 0.95  0.00 ? 227 ASN A N    1  
ATOM   1725   C CA   C ASN A 1 227 ? 11.675  9.628   27.662 0.05  0.00 ? 227 ASN A CA   1  
ATOM   1726   C CA   O ASN A 1 227 ? 19.393  5.641   35.714 0.95  0.00 ? 227 ASN A CA   1  
ATOM   1727   C C    C ASN A 1 227 ? 11.421  8.869   28.984 0.05  0.00 ? 227 ASN A C    1  
ATOM   1728   C C    O ASN A 1 227 ? 18.092  5.061   36.311 0.95  0.00 ? 227 ASN A C    1  
ATOM   1729   O O    C ASN A 1 227 ? 12.335  8.223   29.505 0.05  0.00 ? 227 ASN A O    1  
ATOM   1730   O O    O ASN A 1 227 ? 18.131  4.017   36.968 0.95  0.00 ? 227 ASN A O    1  
ATOM   1731   H H    C ASN A 1 227 ? 13.553  8.622   27.576 0.05  0.00 ? 227 ASN A H    1  
ATOM   1732   H H    O ASN A 1 227 ? 20.340  3.822   36.299 0.95  0.00 ? 227 ASN A H    1  
ATOM   1733   N N    C GLY A 1 228 ? 10.232  9.050   29.484 0.05  0.00 ? 228 GLY A N    1  
ATOM   1734   N N    O GLY A 1 228 ? 17.038  5.802   36.116 0.95  0.00 ? 228 GLY A N    1  
ATOM   1735   C CA   C GLY A 1 228 ? 9.837   8.487   30.788 0.05  0.00 ? 228 GLY A CA   1  
ATOM   1736   C CA   O GLY A 1 228 ? 15.725  5.462   36.694 0.95  0.00 ? 228 GLY A CA   1  
ATOM   1737   C C    C GLY A 1 228 ? 8.800   7.414   30.619 0.05  0.00 ? 228 GLY A C    1  
ATOM   1738   C C    O GLY A 1 228 ? 14.748  5.078   35.620 0.95  0.00 ? 228 GLY A C    1  
ATOM   1739   O O    C GLY A 1 228 ? 8.353   7.202   29.494 0.05  0.00 ? 228 GLY A O    1  
ATOM   1740   O O    O GLY A 1 228 ? 15.098  5.174   34.446 0.95  0.00 ? 228 GLY A O    1  
ATOM   1741   H H    C GLY A 1 228 ? 9.602   9.631   29.010 0.05  0.00 ? 228 GLY A H    1  
ATOM   1742   H H    O GLY A 1 228 ? 17.135  6.643   35.624 0.95  0.00 ? 228 GLY A H    1  
ATOM   1743   N N    C PRO A 1 229 ? 8.390   6.835   31.761 0.05  0.00 ? 229 PRO A N    1  
ATOM   1744   N N    O PRO A 1 229 ? 13.523  4.740   36.060 0.95  0.00 ? 229 PRO A N    1  
ATOM   1745   C CA   C PRO A 1 229 ? 7.440   5.720   31.783 0.05  0.00 ? 229 PRO A CA   1  
ATOM   1746   C CA   O PRO A 1 229 ? 12.465  4.267   35.164 0.95  0.00 ? 229 PRO A CA   1  
ATOM   1747   C C    C PRO A 1 229 ? 6.133   6.001   31.160 0.05  0.00 ? 229 PRO A C    1  
ATOM   1748   C C    O PRO A 1 229 ? 12.095  5.203   34.086 0.95  0.00 ? 229 PRO A C    1  
ATOM   1749   O O    C PRO A 1 229 ? 5.426   5.100   30.634 0.05  0.00 ? 229 PRO A O    1  
ATOM   1750   O O    O PRO A 1 229 ? 11.633  4.814   32.981 0.95  0.00 ? 229 PRO A O    1  
ATOM   1751   N N    C TRP A 1 230 ? 5.725   7.276   31.147 0.05  0.00 ? 230 TRP A N    1  
ATOM   1752   N N    O TRP A 1 230 ? 12.297  6.507   34.315 0.95  0.00 ? 230 TRP A N    1  
ATOM   1753   C CA   C TRP A 1 230 ? 4.478   7.640   30.510 0.05  0.00 ? 230 TRP A CA   1  
ATOM   1754   C CA   O TRP A 1 230 ? 12.006  7.484   33.288 0.95  0.00 ? 230 TRP A CA   1  
ATOM   1755   C C    C TRP A 1 230 ? 4.462   7.398   29.005 0.05  0.00 ? 230 TRP A C    1  
ATOM   1756   C C    O TRP A 1 230 ? 12.880  7.351   32.047 0.95  0.00 ? 230 TRP A C    1  
ATOM   1757   O O    C TRP A 1 230 ? 3.369   7.409   28.384 0.05  0.00 ? 230 TRP A O    1  
ATOM   1758   O O    O TRP A 1 230 ? 12.553  7.946   30.988 0.95  0.00 ? 230 TRP A O    1  
ATOM   1759   H H    C TRP A 1 230 ? 6.291   7.973   31.541 0.05  0.00 ? 230 TRP A H    1  
ATOM   1760   H H    O TRP A 1 230 ? 12.675  6.799   35.171 0.95  0.00 ? 230 TRP A H    1  
ATOM   1761   N N    C ALA A 1 231 ? 5.603   7.260   28.369 0.05  0.00 ? 231 ALA A N    1  
ATOM   1762   N N    O ALA A 1 231 ? 14.005  6.678   32.128 0.95  0.00 ? 231 ALA A N    1  
ATOM   1763   C CA   C ALA A 1 231 ? 5.753   7.088   26.934 0.05  0.00 ? 231 ALA A CA   1  
ATOM   1764   C CA   O ALA A 1 231 ? 14.970  6.517   31.054 0.95  0.00 ? 231 ALA A CA   1  
ATOM   1765   C C    C ALA A 1 231 ? 5.697   5.644   26.432 0.05  0.00 ? 231 ALA A C    1  
ATOM   1766   C C    O ALA A 1 231 ? 14.730  5.327   30.122 0.95  0.00 ? 231 ALA A C    1  
ATOM   1767   O O    C ALA A 1 231 ? 5.468   5.469   25.211 0.05  0.00 ? 231 ALA A O    1  
ATOM   1768   O O    O ALA A 1 231 ? 15.302  5.348   29.005 0.95  0.00 ? 231 ALA A O    1  
ATOM   1769   H H    C ALA A 1 231 ? 6.423   7.318   28.903 0.05  0.00 ? 231 ALA A H    1  
ATOM   1770   H H    O ALA A 1 231 ? 14.230  6.285   32.997 0.95  0.00 ? 231 ALA A H    1  
ATOM   1771   N N    C TRP A 1 232 ? 5.882   4.697   27.296 0.05  0.00 ? 232 TRP A N    1  
ATOM   1772   N N    O TRP A 1 232 ? 13.949  4.382   30.539 0.95  0.00 ? 232 TRP A N    1  
ATOM   1773   C CA   C TRP A 1 232 ? 5.891   3.275   27.000 0.05  0.00 ? 232 TRP A CA   1  
ATOM   1774   C CA   O TRP A 1 232 ? 13.627  3.169   29.807 0.95  0.00 ? 232 TRP A CA   1  
ATOM   1775   C C    C TRP A 1 232 ? 4.662   2.826   26.241 0.05  0.00 ? 232 TRP A C    1  
ATOM   1776   C C    O TRP A 1 232 ? 13.131  3.445   28.405 0.95  0.00 ? 232 TRP A C    1  
ATOM   1777   O O    C TRP A 1 232 ? 4.894   2.176   25.183 0.05  0.00 ? 232 TRP A O    1  
ATOM   1778   O O    O TRP A 1 232 ? 13.733  2.815   27.490 0.95  0.00 ? 232 TRP A O    1  
ATOM   1779   H H    C TRP A 1 232 ? 6.047   4.963   28.225 0.05  0.00 ? 232 TRP A H    1  
ATOM   1780   H H    O TRP A 1 232 ? 13.556  4.485   31.431 0.95  0.00 ? 232 TRP A H    1  
ATOM   1781   N N    C SER A 1 233 ? 3.469   3.130   26.661 0.05  0.00 ? 233 SER A N    1  
ATOM   1782   N N    O SER A 1 233 ? 12.171  4.297   28.191 0.95  0.00 ? 233 SER A N    1  
ATOM   1783   C CA   C SER A 1 233 ? 2.254   2.672   25.967 0.05  0.00 ? 233 SER A CA   1  
ATOM   1784   C CA   O SER A 1 233 ? 11.639  4.554   26.843 0.95  0.00 ? 233 SER A CA   1  
ATOM   1785   C C    C SER A 1 233 ? 2.194   3.021   24.482 0.05  0.00 ? 233 SER A C    1  
ATOM   1786   C C    O SER A 1 233 ? 12.686  4.950   25.805 0.95  0.00 ? 233 SER A C    1  
ATOM   1787   O O    C SER A 1 233 ? 1.576   2.283   23.668 0.05  0.00 ? 233 SER A O    1  
ATOM   1788   O O    O SER A 1 233 ? 12.529  4.668   24.587 0.95  0.00 ? 233 SER A O    1  
ATOM   1789   H H    C SER A 1 233 ? 3.374   3.658   27.482 0.05  0.00 ? 233 SER A H    1  
ATOM   1790   H H    O SER A 1 233 ? 11.770  4.762   28.955 0.95  0.00 ? 233 SER A H    1  
ATOM   1791   N N    C ASN A 1 234 ? 2.808   4.108   24.080 0.05  0.00 ? 234 ASN A N    1  
ATOM   1792   N N    O ASN A 1 234 ? 13.754  5.588   26.221 0.95  0.00 ? 234 ASN A N    1  
ATOM   1793   C CA   C ASN A 1 234 ? 2.869   4.629   22.725 0.05  0.00 ? 234 ASN A CA   1  
ATOM   1794   C CA   O ASN A 1 234 ? 14.862  6.063   25.409 0.95  0.00 ? 234 ASN A CA   1  
ATOM   1795   C C    C ASN A 1 234 ? 3.850   3.823   21.866 0.05  0.00 ? 234 ASN A C    1  
ATOM   1796   C C    O ASN A 1 234 ? 15.780  4.908   24.994 0.95  0.00 ? 234 ASN A C    1  
ATOM   1797   O O    C ASN A 1 234 ? 3.560   3.711   20.684 0.05  0.00 ? 234 ASN A O    1  
ATOM   1798   O O    O ASN A 1 234 ? 16.309  5.012   23.897 0.95  0.00 ? 234 ASN A O    1  
ATOM   1799   H H    C ASN A 1 234 ? 3.268   4.630   24.770 0.05  0.00 ? 234 ASN A H    1  
ATOM   1800   H H    O ASN A 1 234 ? 13.807  5.770   27.182 0.95  0.00 ? 234 ASN A H    1  
ATOM   1801   N N    C ILE A 1 235 ? 4.930   3.374   22.439 0.05  0.00 ? 235 ILE A N    1  
ATOM   1802   N N    O ILE A 1 235 ? 15.968  3.946   25.851 0.95  0.00 ? 235 ILE A N    1  
ATOM   1803   C CA   C ILE A 1 235 ? 5.961   2.599   21.764 0.05  0.00 ? 235 ILE A CA   1  
ATOM   1804   C CA   O ILE A 1 235 ? 16.812  2.784   25.614 0.95  0.00 ? 235 ILE A CA   1  
ATOM   1805   C C    C ILE A 1 235 ? 5.463   1.186   21.475 0.05  0.00 ? 235 ILE A C    1  
ATOM   1806   C C    O ILE A 1 235 ? 16.149  1.837   24.617 0.95  0.00 ? 235 ILE A C    1  
ATOM   1807   O O    C ILE A 1 235 ? 5.663   0.661   20.386 0.05  0.00 ? 235 ILE A O    1  
ATOM   1808   O O    O ILE A 1 235 ? 16.796  1.332   23.706 0.95  0.00 ? 235 ILE A O    1  
ATOM   1809   H H    C ILE A 1 235 ? 5.058   3.575   23.391 0.05  0.00 ? 235 ILE A H    1  
ATOM   1810   H H    O ILE A 1 235 ? 15.512  4.011   26.717 0.95  0.00 ? 235 ILE A H    1  
ATOM   1811   N N    C ASP A 1 236 ? 4.785   0.611   22.451 0.05  0.00 ? 236 ASP A N    1  
ATOM   1812   N N    O ASP A 1 236 ? 14.855  1.647   24.788 0.95  0.00 ? 236 ASP A N    1  
ATOM   1813   C CA   C ASP A 1 236 ? 4.176   -0.713  22.390 0.05  0.00 ? 236 ASP A CA   1  
ATOM   1814   C CA   O ASP A 1 236 ? 14.003  0.824   23.937 0.95  0.00 ? 236 ASP A CA   1  
ATOM   1815   C C    C ASP A 1 236 ? 3.347   -0.769  21.093 0.05  0.00 ? 236 ASP A C    1  
ATOM   1816   C C    O ASP A 1 236 ? 14.265  1.256   22.482 0.95  0.00 ? 236 ASP A C    1  
ATOM   1817   O O    C ASP A 1 236 ? 3.526   -1.650  20.253 0.05  0.00 ? 236 ASP A O    1  
ATOM   1818   O O    O ASP A 1 236 ? 14.606  0.445   21.622 0.95  0.00 ? 236 ASP A O    1  
ATOM   1819   H H    C ASP A 1 236 ? 4.657   1.128   23.273 0.05  0.00 ? 236 ASP A H    1  
ATOM   1820   H H    O ASP A 1 236 ? 14.426  2.120   25.531 0.95  0.00 ? 236 ASP A H    1  
ATOM   1821   N N    C THR A 1 237 ? 2.440   0.161   20.967 0.05  0.00 ? 237 THR A N    1  
ATOM   1822   N N    O THR A 1 237 ? 14.079  2.523   22.232 0.95  0.00 ? 237 THR A N    1  
ATOM   1823   C CA   C THR A 1 237 ? 1.548   0.346   19.848 0.05  0.00 ? 237 THR A CA   1  
ATOM   1824   C CA   O THR A 1 237 ? 14.272  3.187   20.965 0.95  0.00 ? 237 THR A CA   1  
ATOM   1825   C C    C THR A 1 237 ? 2.286   0.371   18.502 0.05  0.00 ? 237 THR A C    1  
ATOM   1826   C C    O THR A 1 237 ? 15.646  2.891   20.347 0.95  0.00 ? 237 THR A C    1  
ATOM   1827   O O    C THR A 1 237 ? 1.864   -0.243  17.484 0.05  0.00 ? 237 THR A O    1  
ATOM   1828   O O    O THR A 1 237 ? 15.797  2.624   19.123 0.95  0.00 ? 237 THR A O    1  
ATOM   1829   H H    C THR A 1 237 ? 2.367   0.807   21.700 0.05  0.00 ? 237 THR A H    1  
ATOM   1830   H H    O THR A 1 237 ? 13.792  3.083   22.983 0.95  0.00 ? 237 THR A H    1  
ATOM   1831   N N    C SER A 1 238 ? 3.380   1.101   18.525 0.05  0.00 ? 238 SER A N    1  
ATOM   1832   N N    O SER A 1 238 ? 16.631  2.958   21.217 0.95  0.00 ? 238 SER A N    1  
ATOM   1833   C CA   C SER A 1 238 ? 4.245   1.339   17.382 0.05  0.00 ? 238 SER A CA   1  
ATOM   1834   C CA   O SER A 1 238 ? 18.036  2.771   20.898 0.95  0.00 ? 238 SER A CA   1  
ATOM   1835   C C    C SER A 1 238 ? 4.787   0.036   16.815 0.05  0.00 ? 238 SER A C    1  
ATOM   1836   C C    O SER A 1 238 ? 18.290  1.400   20.290 0.95  0.00 ? 238 SER A C    1  
ATOM   1837   O O    C SER A 1 238 ? 5.028   -0.068  15.591 0.05  0.00 ? 238 SER A O    1  
ATOM   1838   O O    O SER A 1 238 ? 19.204  1.242   19.450 0.95  0.00 ? 238 SER A O    1  
ATOM   1839   H H    C SER A 1 238 ? 3.613   1.543   19.369 0.05  0.00 ? 238 SER A H    1  
ATOM   1840   H H    O SER A 1 238 ? 16.402  3.181   22.144 0.95  0.00 ? 238 SER A H    1  
ATOM   1841   N N    C LYS A 1 239 ? 5.006   -0.936  17.664 0.05  0.00 ? 239 LYS A N    1  
ATOM   1842   N N    O LYS A 1 239 ? 17.532  0.416   20.705 0.95  0.00 ? 239 LYS A N    1  
ATOM   1843   C CA   C LYS A 1 239 ? 5.543   -2.244  17.286 0.05  0.00 ? 239 LYS A CA   1  
ATOM   1844   C CA   O LYS A 1 239 ? 17.659  -0.964  20.236 0.95  0.00 ? 239 LYS A CA   1  
ATOM   1845   C C    C LYS A 1 239 ? 7.059   -2.242  17.110 0.05  0.00 ? 239 LYS A C    1  
ATOM   1846   C C    O LYS A 1 239 ? 18.789  -1.729  20.920 0.95  0.00 ? 239 LYS A C    1  
ATOM   1847   O O    C LYS A 1 239 ? 7.641   -3.137  16.464 0.05  0.00 ? 239 LYS A O    1  
ATOM   1848   O O    O LYS A 1 239 ? 19.269  -2.766  20.420 0.95  0.00 ? 239 LYS A O    1  
ATOM   1849   H H    C LYS A 1 239 ? 4.809   -0.774  18.612 0.05  0.00 ? 239 LYS A H    1  
ATOM   1850   H H    O LYS A 1 239 ? 16.847  0.614   21.379 0.95  0.00 ? 239 LYS A H    1  
ATOM   1851   N N    C VAL A 1 240 ? 7.710   -1.258  17.701 0.05  0.00 ? 240 VAL A N    1  
ATOM   1852   N N    O VAL A 1 240 ? 19.202  -1.243  22.075 0.95  0.00 ? 240 VAL A N    1  
ATOM   1853   C CA   C VAL A 1 240 ? 9.164   -1.125  17.687 0.05  0.00 ? 240 VAL A CA   1  
ATOM   1854   C CA   O VAL A 1 240 ? 20.233  -1.870  22.896 0.95  0.00 ? 240 VAL A CA   1  
ATOM   1855   C C    C VAL A 1 240 ? 9.641   -2.091  18.785 0.05  0.00 ? 240 VAL A C    1  
ATOM   1856   C C    O VAL A 1 240 ? 19.490  -2.992  23.641 0.95  0.00 ? 240 VAL A C    1  
ATOM   1857   O O    C VAL A 1 240 ? 8.962   -2.211  19.811 0.05  0.00 ? 240 VAL A O    1  
ATOM   1858   O O    O VAL A 1 240 ? 18.329  -2.793  24.014 0.95  0.00 ? 240 VAL A O    1  
ATOM   1859   H H    C VAL A 1 240 ? 7.191   -0.599  18.207 0.05  0.00 ? 240 VAL A H    1  
ATOM   1860   H H    O VAL A 1 240 ? 18.768  -0.434  22.417 0.95  0.00 ? 240 VAL A H    1  
ATOM   1861   N N    C ASN A 1 241 ? 10.738  -2.749  18.531 0.05  0.00 ? 241 ASN A N    1  
ATOM   1862   N N    O ASN A 1 241 ? 20.149  -4.106  23.803 0.95  0.00 ? 241 ASN A N    1  
ATOM   1863   C CA   C ASN A 1 241 ? 11.361  -3.692  19.466 0.05  0.00 ? 241 ASN A CA   1  
ATOM   1864   C CA   O ASN A 1 241 ? 19.617  -5.275  24.512 0.95  0.00 ? 241 ASN A CA   1  
ATOM   1865   C C    C ASN A 1 241 ? 12.390  -2.846  20.255 0.05  0.00 ? 241 ASN A C    1  
ATOM   1866   C C    O ASN A 1 241 ? 20.105  -5.109  25.972 0.95  0.00 ? 241 ASN A C    1  
ATOM   1867   O O    C ASN A 1 241 ? 13.546  -2.714  19.863 0.05  0.00 ? 241 ASN A O    1  
ATOM   1868   O O    O ASN A 1 241 ? 21.181  -5.568  26.344 0.95  0.00 ? 241 ASN A O    1  
ATOM   1869   H H    C ASN A 1 241 ? 11.182  -2.591  17.673 0.05  0.00 ? 241 ASN A H    1  
ATOM   1870   H H    O ASN A 1 241 ? 21.059  -4.159  23.446 0.95  0.00 ? 241 ASN A H    1  
ATOM   1871   N N    C TYR A 1 242 ? 11.818  -2.328  21.341 0.05  0.00 ? 242 TYR A N    1  
ATOM   1872   N N    O TYR A 1 242 ? 19.209  -4.420  26.677 0.95  0.00 ? 242 TYR A N    1  
ATOM   1873   C CA   C TYR A 1 242 ? 12.594  -1.395  22.203 0.05  0.00 ? 242 TYR A CA   1  
ATOM   1874   C CA   O TYR A 1 242 ? 19.512  -4.053  28.087 0.95  0.00 ? 242 TYR A CA   1  
ATOM   1875   C C    C TYR A 1 242 ? 13.093  -1.931  23.501 0.05  0.00 ? 242 TYR A C    1  
ATOM   1876   C C    O TYR A 1 242 ? 18.812  -4.825  29.152 0.95  0.00 ? 242 TYR A C    1  
ATOM   1877   O O    C TYR A 1 242 ? 12.523  -2.896  24.034 0.05  0.00 ? 242 TYR A O    1  
ATOM   1878   O O    O TYR A 1 242 ? 17.733  -5.386  28.903 0.95  0.00 ? 242 TYR A O    1  
ATOM   1879   H H    C TYR A 1 242 ? 10.874  -2.509  21.534 0.05  0.00 ? 242 TYR A H    1  
ATOM   1880   H H    O TYR A 1 242 ? 18.386  -4.102  26.250 0.95  0.00 ? 242 TYR A H    1  
ATOM   1881   N N    C GLY A 1 243 ? 14.075  -1.297  24.092 0.05  0.00 ? 243 GLY A N    1  
ATOM   1882   N N    O GLY A 1 243 ? 19.319  -4.808  30.360 0.95  0.00 ? 243 GLY A N    1  
ATOM   1883   C CA   C GLY A 1 243 ? 14.682  -1.595  25.380 0.05  0.00 ? 243 GLY A CA   1  
ATOM   1884   C CA   O GLY A 1 243 ? 18.784  -5.431  31.560 0.95  0.00 ? 243 GLY A CA   1  
ATOM   1885   C C    C GLY A 1 243 ? 14.815  -0.199  26.113 0.05  0.00 ? 243 GLY A C    1  
ATOM   1886   C C    O GLY A 1 243 ? 18.909  -4.332  32.693 0.95  0.00 ? 243 GLY A C    1  
ATOM   1887   O O    C GLY A 1 243 ? 14.854  0.805   25.415 0.05  0.00 ? 243 GLY A O    1  
ATOM   1888   O O    O GLY A 1 243 ? 19.753  -3.459  32.543 0.95  0.00 ? 243 GLY A O    1  
ATOM   1889   H H    C GLY A 1 243 ? 14.418  -0.504  23.629 0.05  0.00 ? 243 GLY A H    1  
ATOM   1890   H H    O GLY A 1 243 ? 20.138  -4.282  30.477 0.95  0.00 ? 243 GLY A H    1  
ATOM   1891   N N    C VAL A 1 244 ? 14.827  -0.283  27.402 0.05  0.00 ? 244 VAL A N    1  
ATOM   1892   N N    O VAL A 1 244 ? 18.053  -4.467  33.651 0.95  0.00 ? 244 VAL A N    1  
ATOM   1893   C CA   C VAL A 1 244 ? 14.945  0.842   28.356 0.05  0.00 ? 244 VAL A CA   1  
ATOM   1894   C CA   O VAL A 1 244 ? 17.926  -3.603  34.845 0.95  0.00 ? 244 VAL A CA   1  
ATOM   1895   C C    C VAL A 1 244 ? 16.179  0.591   29.161 0.05  0.00 ? 244 VAL A C    1  
ATOM   1896   C C    O VAL A 1 244 ? 18.141  -4.485  36.033 0.95  0.00 ? 244 VAL A C    1  
ATOM   1897   O O    C VAL A 1 244 ? 16.322  -0.553  29.702 0.05  0.00 ? 244 VAL A O    1  
ATOM   1898   O O    O VAL A 1 244 ? 17.469  -5.564  36.111 0.95  0.00 ? 244 VAL A O    1  
ATOM   1899   H H    C VAL A 1 244 ? 14.754  -1.181  27.787 0.05  0.00 ? 244 VAL A H    1  
ATOM   1900   H H    O VAL A 1 244 ? 17.427  -5.218  33.581 0.95  0.00 ? 244 VAL A H    1  
ATOM   1901   N N    C THR A 1 245 ? 17.089  1.548   29.250 0.05  0.00 ? 245 THR A N    1  
ATOM   1902   N N    O THR A 1 245 ? 19.042  -4.132  36.936 0.95  0.00 ? 245 THR A N    1  
ATOM   1903   C CA   C THR A 1 245 ? 18.326  1.284   29.996 0.05  0.00 ? 245 THR A CA   1  
ATOM   1904   C CA   O THR A 1 245 ? 19.292  -5.023  38.076 0.95  0.00 ? 245 THR A CA   1  
ATOM   1905   C C    C THR A 1 245 ? 18.863  2.527   30.707 0.05  0.00 ? 245 THR A C    1  
ATOM   1906   C C    O THR A 1 245 ? 19.646  -4.261  39.354 0.95  0.00 ? 245 THR A C    1  
ATOM   1907   O O    C THR A 1 245 ? 18.265  3.614   30.607 0.05  0.00 ? 245 THR A O    1  
ATOM   1908   O O    O THR A 1 245 ? 19.707  -3.018  39.346 0.95  0.00 ? 245 THR A O    1  
ATOM   1909   H H    C THR A 1 245 ? 16.954  2.406   28.797 0.05  0.00 ? 245 THR A H    1  
ATOM   1910   H H    O THR A 1 245 ? 19.558  -3.306  36.827 0.95  0.00 ? 245 THR A H    1  
ATOM   1911   N N    C VAL A 1 246 ? 19.971  2.391   31.365 0.05  0.00 ? 246 VAL A N    1  
ATOM   1912   N N    O VAL A 1 246 ? 19.913  -4.973  40.403 0.95  0.00 ? 246 VAL A N    1  
ATOM   1913   C CA   C VAL A 1 246 ? 20.622  3.519   32.048 0.05  0.00 ? 246 VAL A CA   1  
ATOM   1914   C CA   O VAL A 1 246 ? 20.319  -4.367  41.680 0.95  0.00 ? 246 VAL A CA   1  
ATOM   1915   C C    C VAL A 1 246 ? 21.062  4.566   31.017 0.05  0.00 ? 246 VAL A C    1  
ATOM   1916   C C    O VAL A 1 246 ? 21.663  -3.647  41.508 0.95  0.00 ? 246 VAL A C    1  
ATOM   1917   O O    C VAL A 1 246 ? 21.559  4.217   29.943 0.05  0.00 ? 246 VAL A O    1  
ATOM   1918   O O    O VAL A 1 246 ? 22.563  -4.153  40.833 0.95  0.00 ? 246 VAL A O    1  
ATOM   1919   H H    C VAL A 1 246 ? 20.408  1.514   31.379 0.05  0.00 ? 246 VAL A H    1  
ATOM   1920   H H    O VAL A 1 246 ? 19.876  -5.949  40.334 0.95  0.00 ? 246 VAL A H    1  
ATOM   1921   N N    C LEU A 1 247 ? 20.893  5.847   31.343 0.05  0.00 ? 247 LEU A N    1  
ATOM   1922   N N    O LEU A 1 247 ? 21.807  -2.475  42.127 0.95  0.00 ? 247 LEU A N    1  
ATOM   1923   C CA   C LEU A 1 247 ? 21.345  6.944   30.473 0.05  0.00 ? 247 LEU A CA   1  
ATOM   1924   C CA   O LEU A 1 247 ? 23.073  -1.726  42.102 0.95  0.00 ? 247 LEU A CA   1  
ATOM   1925   C C    C LEU A 1 247 ? 22.864  6.859   30.354 0.05  0.00 ? 247 LEU A C    1  
ATOM   1926   C C    O LEU A 1 247 ? 24.136  -2.569  42.800 0.95  0.00 ? 247 LEU A C    1  
ATOM   1927   O O    C LEU A 1 247 ? 23.578  6.371   31.249 0.05  0.00 ? 247 LEU A O    1  
ATOM   1928   O O    O LEU A 1 247 ? 23.857  -3.392  43.691 0.95  0.00 ? 247 LEU A O    1  
ATOM   1929   H H    C LEU A 1 247 ? 20.501  6.066   32.214 0.05  0.00 ? 247 LEU A H    1  
ATOM   1930   H H    O LEU A 1 247 ? 21.061  -2.125  42.657 0.95  0.00 ? 247 LEU A H    1  
ATOM   1931   N N    C PRO A 1 248 ? 23.401  7.441   29.284 0.05  0.00 ? 248 PRO A N    1  
ATOM   1932   N N    O PRO A 1 248 ? 25.400  -2.297  42.484 0.95  0.00 ? 248 PRO A N    1  
ATOM   1933   C CA   C PRO A 1 248 ? 24.829  7.426   29.053 0.05  0.00 ? 248 PRO A CA   1  
ATOM   1934   C CA   O PRO A 1 248 ? 26.500  -3.029  43.072 0.95  0.00 ? 248 PRO A CA   1  
ATOM   1935   C C    C PRO A 1 248 ? 25.577  8.319   30.047 0.05  0.00 ? 248 PRO A C    1  
ATOM   1936   C C    O PRO A 1 248 ? 26.685  -2.688  44.554 0.95  0.00 ? 248 PRO A C    1  
ATOM   1937   O O    C PRO A 1 248 ? 24.968  9.252   30.583 0.05  0.00 ? 248 PRO A O    1  
ATOM   1938   O O    O PRO A 1 248 ? 26.271  -1.599  44.969 0.95  0.00 ? 248 PRO A O    1  
ATOM   1939   N N    C THR A 1 249 ? 26.846  8.054   30.262 0.05  0.00 ? 249 THR A N    1  
ATOM   1940   N N    O THR A 1 249 ? 27.299  -3.573  45.306 0.95  0.00 ? 249 THR A N    1  
ATOM   1941   C CA   C THR A 1 249 ? 27.691  8.858   31.131 0.05  0.00 ? 249 THR A CA   1  
ATOM   1942   C CA   O THR A 1 249 ? 27.597  -3.352  46.712 0.95  0.00 ? 249 THR A CA   1  
ATOM   1943   C C    C THR A 1 249 ? 28.285  9.996   30.310 0.05  0.00 ? 249 THR A C    1  
ATOM   1944   C C    O THR A 1 249 ? 28.941  -2.642  46.817 0.95  0.00 ? 249 THR A C    1  
ATOM   1945   O O    C THR A 1 249 ? 28.256  9.953   29.090 0.05  0.00 ? 249 THR A O    1  
ATOM   1946   O O    O THR A 1 249 ? 29.695  -2.611  45.856 0.95  0.00 ? 249 THR A O    1  
ATOM   1947   H H    C THR A 1 249 ? 27.252  7.302   29.783 0.05  0.00 ? 249 THR A H    1  
ATOM   1948   H H    O THR A 1 249 ? 27.606  -4.405  44.889 0.95  0.00 ? 249 THR A H    1  
ATOM   1949   N N    C PHE A 1 250 ? 28.742  11.044  30.988 0.05  0.00 ? 250 PHE A N    1  
ATOM   1950   N N    O PHE A 1 250 ? 29.192  -2.006  47.956 0.95  0.00 ? 250 PHE A N    1  
ATOM   1951   C CA   C PHE A 1 250 ? 29.390  12.188  30.318 0.05  0.00 ? 250 PHE A CA   1  
ATOM   1952   C CA   O PHE A 1 250 ? 30.477  -1.325  48.207 0.95  0.00 ? 250 PHE A CA   1  
ATOM   1953   C C    C PHE A 1 250 ? 30.602  12.551  31.209 0.05  0.00 ? 250 PHE A C    1  
ATOM   1954   C C    O PHE A 1 250 ? 30.845  -1.671  49.669 0.95  0.00 ? 250 PHE A C    1  
ATOM   1955   O O    C PHE A 1 250 ? 30.472  12.717  32.425 0.05  0.00 ? 250 PHE A O    1  
ATOM   1956   O O    O PHE A 1 250 ? 30.033  -1.516  50.585 0.95  0.00 ? 250 PHE A O    1  
ATOM   1957   H H    C PHE A 1 250 ? 28.678  11.040  31.965 0.05  0.00 ? 250 PHE A H    1  
ATOM   1958   H H    O PHE A 1 250 ? 28.516  -2.020  48.664 0.95  0.00 ? 250 PHE A H    1  
ATOM   1959   N N    C LYS A 1 251 ? 31.771  12.550  30.591 0.05  0.00 ? 251 LYS A N    1  
ATOM   1960   N N    O LYS A 1 251 ? 32.027  -2.242  49.828 0.95  0.00 ? 251 LYS A N    1  
ATOM   1961   C CA   C LYS A 1 251 ? 33.029  12.805  31.290 0.05  0.00 ? 251 LYS A CA   1  
ATOM   1962   C CA   O LYS A 1 251 ? 32.511  -2.697  51.131 0.95  0.00 ? 251 LYS A CA   1  
ATOM   1963   C C    C LYS A 1 251 ? 33.197  11.826  32.432 0.05  0.00 ? 251 LYS A C    1  
ATOM   1964   C C    O LYS A 1 251 ? 31.528  -3.673  51.739 0.95  0.00 ? 251 LYS A C    1  
ATOM   1965   O O    C LYS A 1 251 ? 33.799  12.104  33.458 0.05  0.00 ? 251 LYS A O    1  
ATOM   1966   O O    O LYS A 1 251 ? 31.369  -3.787  52.944 0.95  0.00 ? 251 LYS A O    1  
ATOM   1967   H H    C LYS A 1 251 ? 31.798  12.328  29.637 0.05  0.00 ? 251 LYS A H    1  
ATOM   1968   H H    O LYS A 1 251 ? 32.581  -2.405  49.037 0.95  0.00 ? 251 LYS A H    1  
ATOM   1969   N N    C GLY A 1 252 ? 32.658  10.641  32.173 0.05  0.00 ? 252 GLY A N    1  
ATOM   1970   N N    O GLY A 1 252 ? 30.901  -4.404  50.825 0.95  0.00 ? 252 GLY A N    1  
ATOM   1971   C CA   C GLY A 1 252 ? 32.631  9.501   33.060 0.05  0.00 ? 252 GLY A CA   1  
ATOM   1972   C CA   O GLY A 1 252 ? 29.907  -5.421  51.077 0.95  0.00 ? 252 GLY A CA   1  
ATOM   1973   C C    C GLY A 1 252 ? 31.575  9.629   34.154 0.05  0.00 ? 252 GLY A C    1  
ATOM   1974   C C    O GLY A 1 252 ? 28.544  -4.838  51.438 0.95  0.00 ? 252 GLY A C    1  
ATOM   1975   O O    C GLY A 1 252 ? 31.703  8.943   35.192 0.05  0.00 ? 252 GLY A O    1  
ATOM   1976   O O    O GLY A 1 252 ? 27.627  -5.622  51.768 0.95  0.00 ? 252 GLY A O    1  
ATOM   1977   H H    C GLY A 1 252 ? 32.238  10.529  31.296 0.05  0.00 ? 252 GLY A H    1  
ATOM   1978   H H    O GLY A 1 252 ? 31.136  -4.237  49.889 0.95  0.00 ? 252 GLY A H    1  
ATOM   1979   N N    C GLN A 1 253 ? 30.564  10.433  33.946 0.05  0.00 ? 253 GLN A N    1  
ATOM   1980   N N    O GLN A 1 253 ? 28.386  -3.542  51.359 0.95  0.00 ? 253 GLN A N    1  
ATOM   1981   C CA   C GLN A 1 253 ? 29.503  10.625  34.935 0.05  0.00 ? 253 GLN A CA   1  
ATOM   1982   C CA   O GLN A 1 253 ? 27.120  -2.888  51.694 0.95  0.00 ? 253 GLN A CA   1  
ATOM   1983   C C    C GLN A 1 253 ? 28.142  10.400  34.312 0.05  0.00 ? 253 GLN A C    1  
ATOM   1984   C C    O GLN A 1 253 ? 26.380  -2.478  50.439 0.95  0.00 ? 253 GLN A C    1  
ATOM   1985   O O    C GLN A 1 253 ? 27.893  10.812  33.186 0.05  0.00 ? 253 GLN A O    1  
ATOM   1986   O O    O GLN A 1 253 ? 26.979  -1.983  49.492 0.95  0.00 ? 253 GLN A O    1  
ATOM   1987   H H    C GLN A 1 253 ? 30.519  10.928  33.103 0.05  0.00 ? 253 GLN A H    1  
ATOM   1988   H H    O GLN A 1 253 ? 29.142  -2.990  51.073 0.95  0.00 ? 253 GLN A H    1  
ATOM   1989   N N    C PRO A 1 254 ? 27.230  9.837   35.108 0.05  0.00 ? 254 PRO A N    1  
ATOM   1990   N N    O PRO A 1 254 ? 25.051  -2.591  50.492 0.95  0.00 ? 254 PRO A N    1  
ATOM   1991   C CA   C PRO A 1 254 ? 25.868  9.627   34.650 0.05  0.00 ? 254 PRO A CA   1  
ATOM   1992   C CA   O PRO A 1 254 ? 24.225  -2.207  49.361 0.95  0.00 ? 254 PRO A CA   1  
ATOM   1993   C C    C PRO A 1 254 ? 25.095  10.922  34.595 0.05  0.00 ? 254 PRO A C    1  
ATOM   1994   C C    O PRO A 1 254 ? 24.350  -0.735  49.055 0.95  0.00 ? 254 PRO A C    1  
ATOM   1995   O O    C PRO A 1 254 ? 25.469  11.857  35.300 0.05  0.00 ? 254 PRO A O    1  
ATOM   1996   O O    O PRO A 1 254 ? 24.563  0.040   49.986 0.95  0.00 ? 254 PRO A O    1  
ATOM   1997   N N    C SER A 1 255 ? 24.068  11.003  33.780 0.05  0.00 ? 255 SER A N    1  
ATOM   1998   N N    O SER A 1 255 ? 24.247  -0.344  47.805 0.95  0.00 ? 255 SER A N    1  
ATOM   1999   C CA   C SER A 1 255 ? 23.188  12.178  33.628 0.05  0.00 ? 255 SER A CA   1  
ATOM   2000   C CA   O SER A 1 255 ? 24.233  1.059   47.346 0.95  0.00 ? 255 SER A CA   1  
ATOM   2001   C C    C SER A 1 255 ? 22.076  11.926  34.681 0.05  0.00 ? 255 SER A C    1  
ATOM   2002   C C    O SER A 1 255 ? 22.900  1.606   47.922 0.95  0.00 ? 255 SER A C    1  
ATOM   2003   O O    C SER A 1 255 ? 22.042  10.785  35.177 0.05  0.00 ? 255 SER A O    1  
ATOM   2004   O O    O SER A 1 255 ? 21.976  0.780   48.041 0.95  0.00 ? 255 SER A O    1  
ATOM   2005   H H    C SER A 1 255 ? 23.823  10.193  33.285 0.05  0.00 ? 255 SER A H    1  
ATOM   2006   H H    O SER A 1 255 ? 24.096  -1.038  47.129 0.95  0.00 ? 255 SER A H    1  
ATOM   2007   N N    C LYS A 1 256 ? 21.288  12.927  34.964 0.05  0.00 ? 256 LYS A N    1  
ATOM   2008   N N    O LYS A 1 256 ? 22.866  2.871   48.243 0.95  0.00 ? 256 LYS A N    1  
ATOM   2009   C CA   C LYS A 1 256 ? 20.222  12.797  35.970 0.05  0.00 ? 256 LYS A CA   1  
ATOM   2010   C CA   O LYS A 1 256 ? 21.671  3.469   48.858 0.95  0.00 ? 256 LYS A CA   1  
ATOM   2011   C C    C LYS A 1 256 ? 19.002  13.607  35.616 0.05  0.00 ? 256 LYS A C    1  
ATOM   2012   C C    O LYS A 1 256 ? 21.148  4.639   48.067 0.95  0.00 ? 256 LYS A C    1  
ATOM   2013   O O    C LYS A 1 256 ? 19.042  14.838  35.678 0.05  0.00 ? 256 LYS A O    1  
ATOM   2014   O O    O LYS A 1 256 ? 21.461  5.788   48.388 0.95  0.00 ? 256 LYS A O    1  
ATOM   2015   H H    C LYS A 1 256 ? 21.436  13.794  34.531 0.05  0.00 ? 256 LYS A H    1  
ATOM   2016   H H    O LYS A 1 256 ? 23.666  3.422   48.112 0.95  0.00 ? 256 LYS A H    1  
ATOM   2017   N N    C PRO A 1 257 ? 17.925  12.943  35.247 0.05  0.00 ? 257 PRO A N    1  
ATOM   2018   N N    O PRO A 1 257 ? 20.362  4.371   47.044 0.95  0.00 ? 257 PRO A N    1  
ATOM   2019   C CA   C PRO A 1 257 ? 16.707  13.627  34.900 0.05  0.00 ? 257 PRO A CA   1  
ATOM   2020   C CA   O PRO A 1 257 ? 19.790  5.422   46.244 0.95  0.00 ? 257 PRO A CA   1  
ATOM   2021   C C    C PRO A 1 257 ? 15.972  13.977  36.223 0.05  0.00 ? 257 PRO A C    1  
ATOM   2022   C C    O PRO A 1 257 ? 18.630  6.055   47.061 0.95  0.00 ? 257 PRO A C    1  
ATOM   2023   O O    C PRO A 1 257 ? 16.465  13.555  37.255 0.05  0.00 ? 257 PRO A O    1  
ATOM   2024   O O    O PRO A 1 257 ? 18.122  5.361   47.924 0.95  0.00 ? 257 PRO A O    1  
ATOM   2025   N N    C PHE A 1 258 ? 14.942  14.743  36.088 0.05  0.00 ? 258 PHE A N    1  
ATOM   2026   N N    O PHE A 1 258 ? 18.374  7.288   46.777 0.95  0.00 ? 258 PHE A N    1  
ATOM   2027   C CA   C PHE A 1 258 ? 14.124  15.170  37.252 0.05  0.00 ? 258 PHE A CA   1  
ATOM   2028   C CA   O PHE A 1 258 ? 17.253  8.023   47.417 0.95  0.00 ? 258 PHE A CA   1  
ATOM   2029   C C    C PHE A 1 258 ? 13.092  14.035  37.385 0.05  0.00 ? 258 PHE A C    1  
ATOM   2030   C C    O PHE A 1 258 ? 16.010  7.417   46.740 0.95  0.00 ? 258 PHE A C    1  
ATOM   2031   O O    C PHE A 1 258 ? 12.488  13.608  36.377 0.05  0.00 ? 258 PHE A O    1  
ATOM   2032   O O    O PHE A 1 258 ? 16.035  7.112   45.528 0.95  0.00 ? 258 PHE A O    1  
ATOM   2033   H H    C PHE A 1 258 ? 14.666  15.016  35.187 0.05  0.00 ? 258 PHE A H    1  
ATOM   2034   H H    O PHE A 1 258 ? 18.906  7.739   46.088 0.95  0.00 ? 258 PHE A H    1  
ATOM   2035   N N    C VAL A 1 259 ? 12.883  13.614  38.605 0.05  0.00 ? 259 VAL A N    1  
ATOM   2036   N N    O VAL A 1 259 ? 14.958  7.302   47.509 0.95  0.00 ? 259 VAL A N    1  
ATOM   2037   C CA   C VAL A 1 259 ? 11.939  12.520  38.978 0.05  0.00 ? 259 VAL A CA   1  
ATOM   2038   C CA   O VAL A 1 259 ? 13.641  6.752   47.074 0.95  0.00 ? 259 VAL A CA   1  
ATOM   2039   C C    C VAL A 1 259 ? 10.972  13.045  40.044 0.05  0.00 ? 259 VAL A C    1  
ATOM   2040   C C    O VAL A 1 259 ? 12.629  7.899   46.993 0.95  0.00 ? 259 VAL A C    1  
ATOM   2041   O O    C VAL A 1 259 ? 11.422  13.953  40.804 0.05  0.00 ? 259 VAL A O    1  
ATOM   2042   O O    O VAL A 1 259 ? 12.592  8.678   47.991 0.95  0.00 ? 259 VAL A O    1  
ATOM   2043   H H    C VAL A 1 259 ? 13.379  14.051  39.328 0.05  0.00 ? 259 VAL A H    1  
ATOM   2044   H H    O VAL A 1 259 ? 15.039  7.603   48.438 0.95  0.00 ? 259 VAL A H    1  
ATOM   2045   N N    C GLY A 1 260 ? 9.758   12.598  40.064 0.05  0.00 ? 260 GLY A N    1  
ATOM   2046   N N    O GLY A 1 260 ? 11.938  8.050   45.910 0.95  0.00 ? 260 GLY A N    1  
ATOM   2047   C CA   C GLY A 1 260 ? 8.740   13.024  41.045 0.05  0.00 ? 260 GLY A CA   1  
ATOM   2048   C CA   O GLY A 1 260 ? 10.891  9.077   45.738 0.95  0.00 ? 260 GLY A CA   1  
ATOM   2049   C C    C GLY A 1 260 ? 8.141   11.700  41.565 0.05  0.00 ? 260 GLY A C    1  
ATOM   2050   C C    O GLY A 1 260 ? 9.572   8.276   45.760 0.95  0.00 ? 260 GLY A C    1  
ATOM   2051   O O    C GLY A 1 260 ? 8.353   10.669  40.920 0.05  0.00 ? 260 GLY A O    1  
ATOM   2052   O O    O GLY A 1 260 ? 9.550   7.169   45.215 0.95  0.00 ? 260 GLY A O    1  
ATOM   2053   H H    C GLY A 1 260 ? 9.511   11.906  39.416 0.05  0.00 ? 260 GLY A H    1  
ATOM   2054   H H    O GLY A 1 260 ? 12.090  7.421   45.175 0.95  0.00 ? 260 GLY A H    1  
ATOM   2055   N N    C VAL A 1 261 ? 7.475   11.683  42.694 0.05  0.00 ? 261 VAL A N    1  
ATOM   2056   N N    O VAL A 1 261 ? 8.529   8.753   46.395 0.95  0.00 ? 261 VAL A N    1  
ATOM   2057   C CA   C VAL A 1 261 ? 6.899   10.455  43.264 0.05  0.00 ? 261 VAL A CA   1  
ATOM   2058   C CA   O VAL A 1 261 ? 7.250   8.031   46.488 0.95  0.00 ? 261 VAL A CA   1  
ATOM   2059   C C    C VAL A 1 261 ? 5.403   10.583  43.322 0.05  0.00 ? 261 VAL A C    1  
ATOM   2060   C C    O VAL A 1 261 ? 6.140   8.911   45.987 0.95  0.00 ? 261 VAL A C    1  
ATOM   2061   O O    C VAL A 1 261 ? 4.944   11.157  44.343 0.05  0.00 ? 261 VAL A O    1  
ATOM   2062   O O    O VAL A 1 261 ? 5.994   10.003  46.594 0.95  0.00 ? 261 VAL A O    1  
ATOM   2063   H H    C VAL A 1 261 ? 7.377   12.521  43.191 0.05  0.00 ? 261 VAL A H    1  
ATOM   2064   H H    O VAL A 1 261 ? 8.612   9.618   46.847 0.95  0.00 ? 261 VAL A H    1  
ATOM   2065   N N    C LEU A 1 262 ? 4.646   10.204  42.320 0.05  0.00 ? 262 LEU A N    1  
ATOM   2066   N N    O LEU A 1 262 ? 5.442   8.590   44.924 0.95  0.00 ? 262 LEU A N    1  
ATOM   2067   C CA   C LEU A 1 262 ? 3.224   10.283  42.202 0.05  0.00 ? 262 LEU A CA   1  
ATOM   2068   C CA   O LEU A 1 262 ? 4.322   9.275   44.357 0.95  0.00 ? 262 LEU A CA   1  
ATOM   2069   C C    C LEU A 1 262 ? 2.709   9.897   43.634 0.05  0.00 ? 262 LEU A C    1  
ATOM   2070   C C    O LEU A 1 262 ? 3.209   9.141   45.456 0.95  0.00 ? 262 LEU A C    1  
ATOM   2071   O O    C LEU A 1 262 ? 3.184   8.902   44.168 0.05  0.00 ? 262 LEU A O    1  
ATOM   2072   O O    O LEU A 1 262 ? 2.978   8.026   45.909 0.95  0.00 ? 262 LEU A O    1  
ATOM   2073   H H    C LEU A 1 262 ? 5.112   9.773   41.573 0.05  0.00 ? 262 LEU A H    1  
ATOM   2074   H H    O LEU A 1 262 ? 5.695   7.751   44.485 0.95  0.00 ? 262 LEU A H    1  
ATOM   2075   N N    C SER A 1 263 ? 1.926   10.818  44.183 0.05  0.00 ? 263 SER A N    1  
ATOM   2076   N N    O SER A 1 263 ? 2.758   10.308  45.900 0.95  0.00 ? 263 SER A N    1  
ATOM   2077   C CA   C SER A 1 263 ? 1.422   10.630  45.548 0.05  0.00 ? 263 SER A CA   1  
ATOM   2078   C CA   O SER A 1 263 ? 1.836   10.350  47.041 0.95  0.00 ? 263 SER A CA   1  
ATOM   2079   C C    C SER A 1 263 ? -0.002  11.059  45.724 0.05  0.00 ? 263 SER A C    1  
ATOM   2080   C C    O SER A 1 263 ? 0.570   11.098  46.759 0.95  0.00 ? 263 SER A C    1  
ATOM   2081   O O    C SER A 1 263 ? -0.656  11.499  44.801 0.05  0.00 ? 263 SER A O    1  
ATOM   2082   O O    O SER A 1 263 ? 0.499   11.924  45.873 0.95  0.00 ? 263 SER A O    1  
ATOM   2083   H H    C SER A 1 263 ? 1.775   11.669  43.721 0.05  0.00 ? 263 SER A H    1  
ATOM   2084   H H    O SER A 1 263 ? 3.125   11.142  45.539 0.95  0.00 ? 263 SER A H    1  
ATOM   2085   N N    C ALA A 1 264 ? -0.478  10.856  46.979 0.05  0.00 ? 264 ALA A N    1  
ATOM   2086   N N    O ALA A 1 264 ? -0.469  10.719  47.545 0.95  0.00 ? 264 ALA A N    1  
ATOM   2087   C CA   C ALA A 1 264 ? -1.892  11.218  47.268 0.05  0.00 ? 264 ALA A CA   1  
ATOM   2088   C CA   O ALA A 1 264 ? -1.783  11.392  47.356 0.95  0.00 ? 264 ALA A CA   1  
ATOM   2089   C C    C ALA A 1 264 ? -1.870  12.048  48.569 0.05  0.00 ? 264 ALA A C    1  
ATOM   2090   C C    O ALA A 1 264 ? -2.151  12.016  48.719 0.95  0.00 ? 264 ALA A C    1  
ATOM   2091   O O    C ALA A 1 264 ? -1.111  11.755  49.467 0.05  0.00 ? 264 ALA A O    1  
ATOM   2092   O O    O ALA A 1 264 ? -2.210  11.324  49.712 0.95  0.00 ? 264 ALA A O    1  
ATOM   2093   H H    C ALA A 1 264 ? 0.095   10.479  47.678 0.05  0.00 ? 264 ALA A H    1  
ATOM   2094   H H    O ALA A 1 264 ? -0.358  10.019  48.221 0.95  0.00 ? 264 ALA A H    1  
ATOM   2095   N N    C GLY A 1 265 ? -2.699  13.082  48.548 0.05  0.00 ? 265 GLY A N    1  
ATOM   2096   N N    O GLY A 1 265 ? -2.328  13.329  48.666 0.95  0.00 ? 265 GLY A N    1  
ATOM   2097   C CA   C GLY A 1 265 ? -2.743  13.976  49.752 0.05  0.00 ? 265 GLY A CA   1  
ATOM   2098   C CA   O GLY A 1 265 ? -2.651  14.049  49.942 0.95  0.00 ? 265 GLY A CA   1  
ATOM   2099   C C    C GLY A 1 265 ? -4.066  14.704  49.734 0.05  0.00 ? 265 GLY A C    1  
ATOM   2100   C C    O GLY A 1 265 ? -3.978  14.745  49.751 0.95  0.00 ? 265 GLY A C    1  
ATOM   2101   O O    C GLY A 1 265 ? -4.605  15.016  48.702 0.05  0.00 ? 265 GLY A O    1  
ATOM   2102   O O    O GLY A 1 265 ? -4.357  15.103  48.664 0.95  0.00 ? 265 GLY A O    1  
ATOM   2103   H H    C GLY A 1 265 ? -3.248  13.274  47.759 0.05  0.00 ? 265 GLY A H    1  
ATOM   2104   H H    O GLY A 1 265 ? -2.224  13.819  47.824 0.95  0.00 ? 265 GLY A H    1  
ATOM   2105   N N    . ILE A 1 266 ? -4.664  14.950  50.893 1.00  0.00 ? 266 ILE A N    1  
ATOM   2106   C CA   . ILE A 1 266 ? -6.000  15.608  50.923 1.00  0.00 ? 266 ILE A CA   1  
ATOM   2107   C C    . ILE A 1 266 ? -5.869  17.056  51.418 1.00  0.00 ? 266 ILE A C    1  
ATOM   2108   O O    . ILE A 1 266 ? -5.236  17.250  52.462 1.00  0.00 ? 266 ILE A O    1  
ATOM   2109   H H    . ILE A 1 266 ? -4.272  14.644  51.738 1.00  0.00 ? 266 ILE A H    1  
ATOM   2110   N N    . ASN A 1 267 ? -6.424  17.958  50.729 1.00  0.00 ? 267 ASN A N    1  
ATOM   2111   C CA   . ASN A 1 267 ? -6.423  19.406  51.068 1.00  0.00 ? 267 ASN A CA   1  
ATOM   2112   C C    . ASN A 1 267 ? -7.113  19.568  52.445 1.00  0.00 ? 267 ASN A C    1  
ATOM   2113   O O    . ASN A 1 267 ? -8.213  19.075  52.657 1.00  0.00 ? 267 ASN A O    1  
ATOM   2114   H H    . ASN A 1 267 ? -6.904  17.681  49.920 1.00  0.00 ? 267 ASN A H    1  
ATOM   2115   N N    . ALA A 1 268 ? -6.389  20.186  53.370 1.00  0.00 ? 268 ALA A N    1  
ATOM   2116   C CA   . ALA A 1 268 ? -6.910  20.442  54.724 1.00  0.00 ? 268 ALA A CA   1  
ATOM   2117   C C    . ALA A 1 268 ? -8.185  21.279  54.618 1.00  0.00 ? 268 ALA A C    1  
ATOM   2118   O O    . ALA A 1 268 ? -9.006  21.201  55.538 1.00  0.00 ? 268 ALA A O    1  
ATOM   2119   H H    . ALA A 1 268 ? -5.488  20.496  53.140 1.00  0.00 ? 268 ALA A H    1  
ATOM   2120   N N    . ALA A 1 269 ? -8.322  22.081  53.583 1.00  0.00 ? 269 ALA A N    1  
ATOM   2121   C CA   . ALA A 1 269 ? -9.459  22.931  53.315 1.00  0.00 ? 269 ALA A CA   1  
ATOM   2122   C C    . ALA A 1 269 ? -10.618 22.220  52.641 1.00  0.00 ? 269 ALA A C    1  
ATOM   2123   O O    . ALA A 1 269 ? -11.708 22.803  52.529 1.00  0.00 ? 269 ALA A O    1  
ATOM   2124   H H    . ALA A 1 269 ? -7.590  22.097  52.932 1.00  0.00 ? 269 ALA A H    1  
ATOM   2125   N N    . SER A 1 270 ? -10.471 20.961  52.231 1.00  0.00 ? 270 SER A N    1  
ATOM   2126   C CA   . SER A 1 270 ? -11.606 20.311  51.575 1.00  0.00 ? 270 SER A CA   1  
ATOM   2127   C C    . SER A 1 270 ? -12.736 19.922  52.527 1.00  0.00 ? 270 SER A C    1  
ATOM   2128   O O    . SER A 1 270 ? -12.517 19.304  53.577 1.00  0.00 ? 270 SER A O    1  
ATOM   2129   H H    . SER A 1 270 ? -9.623  20.486  52.358 1.00  0.00 ? 270 SER A H    1  
ATOM   2130   N N    . PRO A 1 271 ? -13.939 20.153  52.053 1.00  0.00 ? 271 PRO A N    1  
ATOM   2131   C CA   . PRO A 1 271 ? -15.166 19.740  52.765 1.00  0.00 ? 271 PRO A CA   1  
ATOM   2132   C C    . PRO A 1 271 ? -15.523 18.280  52.523 1.00  0.00 ? 271 PRO A C    1  
ATOM   2133   O O    . PRO A 1 271 ? -16.435 17.680  53.093 1.00  0.00 ? 271 PRO A O    1  
ATOM   2134   N N    . ASN A 1 272 ? -14.753 17.629  51.649 1.00  0.00 ? 272 ASN A N    1  
ATOM   2135   C CA   . ASN A 1 272 ? -14.964 16.249  51.210 1.00  0.00 ? 272 ASN A CA   1  
ATOM   2136   C C    . ASN A 1 272 ? -13.934 15.258  51.649 1.00  0.00 ? 272 ASN A C    1  
ATOM   2137   O O    . ASN A 1 272 ? -13.682 14.351  50.824 1.00  0.00 ? 272 ASN A O    1  
ATOM   2138   H H    . ASN A 1 272 ? -14.020 18.130  51.232 1.00  0.00 ? 272 ASN A H    1  
ATOM   2139   N N    . LYS A 1 273 ? -13.377 15.307  52.820 1.00  0.00 ? 273 LYS A N    1  
ATOM   2140   C CA   . LYS A 1 273 ? -12.347 14.393  53.230 1.00  0.00 ? 273 LYS A CA   1  
ATOM   2141   C C    . LYS A 1 273 ? -12.735 12.938  53.335 1.00  0.00 ? 273 LYS A C    1  
ATOM   2142   O O    . LYS A 1 273 ? -11.872 12.048  53.182 1.00  0.00 ? 273 LYS A O    1  
ATOM   2143   H H    . LYS A 1 273 ? -13.644 16.020  53.438 1.00  0.00 ? 273 LYS A H    1  
ATOM   2144   N N    . GLU A 1 274 ? -13.960 12.664  53.711 1.00  0.00 ? 274 GLU A N    1  
ATOM   2145   C CA   . GLU A 1 274 ? -14.477 11.307  53.865 1.00  0.00 ? 274 GLU A CA   1  
ATOM   2146   C C    . GLU A 1 274 ? -14.635 10.723  52.470 1.00  0.00 ? 274 GLU A C    1  
ATOM   2147   O O    . GLU A 1 274 ? -14.224 9.565   52.263 1.00  0.00 ? 274 GLU A O    1  
ATOM   2148   H H    . GLU A 1 274 ? -14.562 13.413  53.904 1.00  0.00 ? 274 GLU A H    1  
ATOM   2149   N N    . LEU A 1 275 ? -15.099 11.509  51.549 1.00  0.00 ? 275 LEU A N    1  
ATOM   2150   C CA   . LEU A 1 275 ? -15.226 11.065  50.156 1.00  0.00 ? 275 LEU A CA   1  
ATOM   2151   C C    . LEU A 1 275 ? -13.830 10.725  49.583 1.00  0.00 ? 275 LEU A C    1  
ATOM   2152   O O    . LEU A 1 275 ? -13.676 9.692   48.908 1.00  0.00 ? 275 LEU A O    1  
ATOM   2153   H H    . LEU A 1 275 ? -15.327 12.434  51.779 1.00  0.00 ? 275 LEU A H    1  
ATOM   2154   N N    . ALA A 1 276 ? -12.871 11.583  49.851 1.00  0.00 ? 276 ALA A N    1  
ATOM   2155   C CA   . ALA A 1 276 ? -11.476 11.420  49.395 1.00  0.00 ? 276 ALA A CA   1  
ATOM   2156   C C    . ALA A 1 276 ? -10.838 10.159  49.879 1.00  0.00 ? 276 ALA A C    1  
ATOM   2157   O O    . ALA A 1 276 ? -10.208 9.369   49.145 1.00  0.00 ? 276 ALA A O    1  
ATOM   2158   H H    . ALA A 1 276 ? -13.093 12.373  50.389 1.00  0.00 ? 276 ALA A H    1  
ATOM   2159   N N    . LYS A 1 277 ? -10.969 9.882   51.163 1.00  0.00 ? 277 LYS A N    1  
ATOM   2160   C CA   . LYS A 1 277 ? -10.413 8.709   51.799 1.00  0.00 ? 277 LYS A CA   1  
ATOM   2161   C C    . LYS A 1 277 ? -11.061 7.439   51.290 1.00  0.00 ? 277 LYS A C    1  
ATOM   2162   O O    . LYS A 1 277 ? -10.448 6.365   51.217 1.00  0.00 ? 277 LYS A O    1  
ATOM   2163   H H    . LYS A 1 277 ? -11.471 10.512  51.720 1.00  0.00 ? 277 LYS A H    1  
ATOM   2164   N N    . GLU A 1 278 ? -12.320 7.534   50.934 1.00  0.00 ? 278 GLU A N    1  
ATOM   2165   C CA   . GLU A 1 278 ? -13.042 6.371   50.418 1.00  0.00 ? 278 GLU A CA   1  
ATOM   2166   C C    . GLU A 1 278 ? -12.605 6.106   48.982 1.00  0.00 ? 278 GLU A C    1  
ATOM   2167   O O    . GLU A 1 278 ? -12.372 4.934   48.674 1.00  0.00 ? 278 GLU A O    1  
ATOM   2168   H H    . GLU A 1 278 ? -12.781 8.395   51.008 1.00  0.00 ? 278 GLU A H    1  
ATOM   2169   N N    . PHE A 1 279 ? -12.494 7.131   48.181 1.00  0.00 ? 279 PHE A N    1  
ATOM   2170   C CA   . PHE A 1 279 ? -12.017 7.041   46.807 1.00  0.00 ? 279 PHE A CA   1  
ATOM   2171   C C    . PHE A 1 279 ? -10.605 6.429   46.830 1.00  0.00 ? 279 PHE A C    1  
ATOM   2172   O O    . PHE A 1 279 ? -10.312 5.392   46.231 1.00  0.00 ? 279 PHE A O    1  
ATOM   2173   H H    . PHE A 1 279 ? -12.698 8.020   48.540 1.00  0.00 ? 279 PHE A H    1  
ATOM   2174   N N    . LEU A 1 280 ? -9.709  7.056   47.593 1.00  0.00 ? 280 LEU A N    1  
ATOM   2175   C CA   . LEU A 1 280 ? -8.350  6.606   47.715 1.00  0.00 ? 280 LEU A CA   1  
ATOM   2176   C C    . LEU A 1 280 ? -8.216  5.209   48.260 1.00  0.00 ? 280 LEU A C    1  
ATOM   2177   O O    . LEU A 1 280 ? -7.499  4.372   47.672 1.00  0.00 ? 280 LEU A O    1  
ATOM   2178   H H    . LEU A 1 280 ? -9.988  7.855   48.088 1.00  0.00 ? 280 LEU A H    1  
ATOM   2179   N N    . GLU A 1 281 ? -8.796  4.894   49.429 1.00  0.00 ? 281 GLU A N    1  
ATOM   2180   C CA   . GLU A 1 281 ? -8.572  3.584   49.986 1.00  0.00 ? 281 GLU A CA   1  
ATOM   2181   C C    . GLU A 1 281 ? -9.295  2.423   49.313 1.00  0.00 ? 281 GLU A C    1  
ATOM   2182   O O    . GLU A 1 281 ? -8.740  1.288   49.274 1.00  0.00 ? 281 GLU A O    1  
ATOM   2183   H H    . GLU A 1 281 ? -9.304  5.566   49.929 1.00  0.00 ? 281 GLU A H    1  
ATOM   2184   N N    . ASN A 1 282 ? -10.457 2.672   48.772 1.00  0.00 ? 282 ASN A N    1  
ATOM   2185   C CA   . ASN A 1 282 ? -11.273 1.571   48.213 1.00  0.00 ? 282 ASN A CA   1  
ATOM   2186   C C    . ASN A 1 282 ? -11.457 1.565   46.745 1.00  0.00 ? 282 ASN A C    1  
ATOM   2187   O O    . ASN A 1 282 ? -12.088 0.601   46.253 1.00  0.00 ? 282 ASN A O    1  
ATOM   2188   H H    . ASN A 1 282 ? -10.828 3.579   48.811 1.00  0.00 ? 282 ASN A H    1  
ATOM   2189   N N    . TYR A 1 283 ? -10.981 2.554   46.017 1.00  0.00 ? 283 TYR A N    1  
ATOM   2190   C CA   . TYR A 1 283 ? -11.149 2.552   44.556 1.00  0.00 ? 283 TYR A CA   1  
ATOM   2191   C C    . TYR A 1 283 ? -9.782  2.542   43.881 1.00  0.00 ? 283 TYR A C    1  
ATOM   2192   O O    . TYR A 1 283 ? -9.495  1.670   43.053 1.00  0.00 ? 283 TYR A O    1  
ATOM   2193   H H    . TYR A 1 283 ? -10.506 3.293   46.452 1.00  0.00 ? 283 TYR A H    1  
ATOM   2194   N N    . LEU A 1 284 ? -8.996  3.538   44.300 1.00  0.00 ? 284 LEU A N    1  
ATOM   2195   C CA   . LEU A 1 284 ? -7.666  3.707   43.740 1.00  0.00 ? 284 LEU A CA   1  
ATOM   2196   C C    . LEU A 1 284 ? -6.662  2.701   44.223 1.00  0.00 ? 284 LEU A C    1  
ATOM   2197   O O    . LEU A 1 284 ? -6.047  2.013   43.362 1.00  0.00 ? 284 LEU A O    1  
ATOM   2198   H H    . LEU A 1 284 ? -9.327  4.171   44.972 1.00  0.00 ? 284 LEU A H    1  
ATOM   2199   N N    . LEU A 1 285 ? -6.447  2.514   45.499 1.00  0.00 ? 285 LEU A N    1  
ATOM   2200   C CA   . LEU A 1 285 ? -5.492  1.613   46.052 1.00  0.00 ? 285 LEU A CA   1  
ATOM   2201   C C    . LEU A 1 285 ? -5.985  0.170   46.122 1.00  0.00 ? 285 LEU A C    1  
ATOM   2202   O O    . LEU A 1 285 ? -5.909  -0.450  47.163 1.00  0.00 ? 285 LEU A O    1  
ATOM   2203   H H    . LEU A 1 285 ? -6.970  3.056   46.127 1.00  0.00 ? 285 LEU A H    1  
ATOM   2204   N N    . THR A 1 286 ? -6.336  -0.265  44.931 1.00  0.00 ? 286 THR A N    1  
ATOM   2205   C CA   . THR A 1 286 ? -6.802  -1.642  44.679 1.00  0.00 ? 286 THR A CA   1  
ATOM   2206   C C    . THR A 1 286 ? -6.109  -2.127  43.385 1.00  0.00 ? 286 THR A C    1  
ATOM   2207   O O    . THR A 1 286 ? -5.722  -1.301  42.560 1.00  0.00 ? 286 THR A O    1  
ATOM   2208   H H    . THR A 1 286 ? -6.251  0.346   44.169 1.00  0.00 ? 286 THR A H    1  
ATOM   2209   N N    . ASP A 1 287 ? -6.085  -3.428  43.207 1.00  0.00 ? 287 ASP A N    1  
ATOM   2210   C CA   . ASP A 1 287 ? -5.470  -3.983  41.962 1.00  0.00 ? 287 ASP A CA   1  
ATOM   2211   C C    . ASP A 1 287 ? -6.108  -3.370  40.729 1.00  0.00 ? 287 ASP A C    1  
ATOM   2212   O O    . ASP A 1 287 ? -5.435  -3.070  39.725 1.00  0.00 ? 287 ASP A O    1  
ATOM   2213   H H    . ASP A 1 287 ? -6.488  -4.027  43.869 1.00  0.00 ? 287 ASP A H    1  
ATOM   2214   N N    . GLU A 1 288 ? -7.415  -3.186  40.754 1.00  0.00 ? 288 GLU A N    1  
ATOM   2215   C CA   . GLU A 1 288 ? -8.133  -2.644  39.601 1.00  0.00 ? 288 GLU A CA   1  
ATOM   2216   C C    . GLU A 1 288 ? -7.916  -1.165  39.397 1.00  0.00 ? 288 GLU A C    1  
ATOM   2217   O O    . GLU A 1 288 ? -7.935  -0.666  38.269 1.00  0.00 ? 288 GLU A O    1  
ATOM   2218   H H    . GLU A 1 288 ? -7.920  -3.446  41.553 1.00  0.00 ? 288 GLU A H    1  
ATOM   2219   N N    . GLY A 1 289 ? -7.729  -0.442  40.501 1.00  0.00 ? 289 GLY A N    1  
ATOM   2220   C CA   . GLY A 1 289 ? -7.510  1.022   40.407 1.00  0.00 ? 289 GLY A CA   1  
ATOM   2221   C C    . GLY A 1 289 ? -6.097  1.288   39.828 1.00  0.00 ? 289 GLY A C    1  
ATOM   2222   O O    . GLY A 1 289 ? -5.986  2.105   38.928 1.00  0.00 ? 289 GLY A O    1  
ATOM   2223   H H    . GLY A 1 289 ? -7.739  -0.879  41.378 1.00  0.00 ? 289 GLY A H    1  
ATOM   2224   N N    . LEU A 1 290 ? -5.098  0.646   40.382 1.00  0.00 ? 290 LEU A N    1  
ATOM   2225   C CA   . LEU A 1 290 ? -3.691  0.845   39.933 1.00  0.00 ? 290 LEU A CA   1  
ATOM   2226   C C    . LEU A 1 290 ? -3.571  0.397   38.484 1.00  0.00 ? 290 LEU A C    1  
ATOM   2227   O O    . LEU A 1 290 ? -2.862  1.005   37.674 1.00  0.00 ? 290 LEU A O    1  
ATOM   2228   H H    . LEU A 1 290 ? -5.279  0.034   41.126 1.00  0.00 ? 290 LEU A H    1  
ATOM   2229   N N    . GLU A 1 291 ? -4.303  -0.662  38.163 1.00  0.00 ? 291 GLU A N    1  
ATOM   2230   C CA   . GLU A 1 291 ? -4.301  -1.217  36.808 1.00  0.00 ? 291 GLU A CA   1  
ATOM   2231   C C    . GLU A 1 291 ? -4.854  -0.268  35.775 1.00  0.00 ? 291 GLU A C    1  
ATOM   2232   O O    . GLU A 1 291 ? -4.225  -0.131  34.699 1.00  0.00 ? 291 GLU A O    1  
ATOM   2233   H H    . GLU A 1 291 ? -4.862  -1.084  38.850 1.00  0.00 ? 291 GLU A H    1  
ATOM   2234   N N    . ALA A 1 292 ? -5.982  0.379   36.021 1.00  0.00 ? 292 ALA A N    1  
ATOM   2235   C CA   . ALA A 1 292 ? -6.566  1.347   35.089 1.00  0.00 ? 292 ALA A CA   1  
ATOM   2236   C C    . ALA A 1 292 ? -5.607  2.512   34.870 1.00  0.00 ? 292 ALA A C    1  
ATOM   2237   O O    . ALA A 1 292 ? -5.490  3.017   33.738 1.00  0.00 ? 292 ALA A O    1  
ATOM   2238   H H    . ALA A 1 292 ? -6.434  0.223   36.876 1.00  0.00 ? 292 ALA A H    1  
ATOM   2239   N N    . VAL A 1 293 ? -4.929  2.941   35.940 1.00  0.00 ? 293 VAL A N    1  
ATOM   2240   C CA   . VAL A 1 293 ? -3.981  4.055   35.831 1.00  0.00 ? 293 VAL A CA   1  
ATOM   2241   C C    . VAL A 1 293 ? -2.722  3.624   35.026 1.00  0.00 ? 293 VAL A C    1  
ATOM   2242   O O    . VAL A 1 293 ? -2.351  4.342   34.100 1.00  0.00 ? 293 VAL A O    1  
ATOM   2243   H H    . VAL A 1 293 ? -5.068  2.505   36.808 1.00  0.00 ? 293 VAL A H    1  
ATOM   2244   N N    . ASN A 1 294 ? -2.171  2.530   35.440 1.00  0.00 ? 294 ASN A N    1  
ATOM   2245   C CA   . ASN A 1 294 ? -0.977  1.898   34.842 1.00  0.00 ? 294 ASN A CA   1  
ATOM   2246   C C    . ASN A 1 294 ? -1.162  1.680   33.346 1.00  0.00 ? 294 ASN A C    1  
ATOM   2247   O O    . ASN A 1 294 ? -0.225  1.942   32.563 1.00  0.00 ? 294 ASN A O    1  
ATOM   2248   H H    . ASN A 1 294 ? -2.585  2.079   36.206 1.00  0.00 ? 294 ASN A H    1  
ATOM   2249   N N    . LYS A 1 295 ? -2.326  1.257   32.927 1.00  0.00 ? 295 LYS A N    1  
ATOM   2250   C CA   . LYS A 1 295 ? -2.692  1.040   31.527 1.00  0.00 ? 295 LYS A CA   1  
ATOM   2251   C C    . LYS A 1 295 ? -2.551  2.306   30.702 1.00  0.00 ? 295 LYS A C    1  
ATOM   2252   O O    . LYS A 1 295 ? -2.158  2.285   29.511 1.00  0.00 ? 295 LYS A O    1  
ATOM   2253   H H    . LYS A 1 295 ? -3.019  1.102   33.603 1.00  0.00 ? 295 LYS A H    1  
ATOM   2254   N N    . ASP A 1 296 ? -2.834  3.437   31.320 1.00  0.00 ? 296 ASP A N    1  
ATOM   2255   C CA   . ASP A 1 296 ? -2.740  4.752   30.696 1.00  0.00 ? 296 ASP A CA   1  
ATOM   2256   C C    . ASP A 1 296 ? -1.273  5.179   30.597 1.00  0.00 ? 296 ASP A C    1  
ATOM   2257   O O    . ASP A 1 296 ? -0.826  5.598   29.519 1.00  0.00 ? 296 ASP A O    1  
ATOM   2258   H H    . ASP A 1 296 ? -3.114  3.392   32.258 1.00  0.00 ? 296 ASP A H    1  
ATOM   2259   N N    . LYS A 1 297 ? -0.562  5.086   31.695 1.00  0.00 ? 297 LYS A N    1  
ATOM   2260   C CA   . LYS A 1 297 ? 0.868   5.441   31.823 1.00  0.00 ? 297 LYS A CA   1  
ATOM   2261   C C    . LYS A 1 297 ? 1.424   4.613   32.962 1.00  0.00 ? 297 LYS A C    1  
ATOM   2262   O O    . LYS A 1 297 ? 0.863   4.639   34.073 1.00  0.00 ? 297 LYS A O    1  
ATOM   2263   H H    . LYS A 1 297 ? -1.016  4.752   32.497 1.00  0.00 ? 297 LYS A H    1  
ATOM   2264   N N    . PRO A 1 298 ? 2.495   3.886   32.743 1.00  0.00 ? 298 PRO A N    1  
ATOM   2265   C CA   . PRO A 1 298 ? 3.082   3.030   33.791 1.00  0.00 ? 298 PRO A CA   1  
ATOM   2266   C C    . PRO A 1 298 ? 3.467   3.802   35.033 1.00  0.00 ? 298 PRO A C    1  
ATOM   2267   O O    . PRO A 1 298 ? 4.010   4.916   34.913 1.00  0.00 ? 298 PRO A O    1  
ATOM   2268   N N    . LEU A 1 299 ? 3.228   3.201   36.171 1.00  0.00 ? 299 LEU A N    1  
ATOM   2269   C CA   . LEU A 1 299 ? 3.561   3.791   37.476 1.00  0.00 ? 299 LEU A CA   1  
ATOM   2270   C C    . LEU A 1 299 ? 4.946   3.415   38.001 1.00  0.00 ? 299 LEU A C    1  
ATOM   2271   O O    . LEU A 1 299 ? 5.477   4.045   38.927 1.00  0.00 ? 299 LEU A O    1  
ATOM   2272   H H    . LEU A 1 299 ? 2.824   2.308   36.152 1.00  0.00 ? 299 LEU A H    1  
ATOM   2273   N N    . GLY A 1 300 ? 5.459   2.317   37.418 1.00  0.00 ? 300 GLY A N    1  
ATOM   2274   C CA   . GLY A 1 300 ? 6.738   1.747   37.840 1.00  0.00 ? 300 GLY A CA   1  
ATOM   2275   C C    . GLY A 1 300 ? 6.364   0.793   38.964 1.00  0.00 ? 300 GLY A C    1  
ATOM   2276   O O    . GLY A 1 300 ? 5.329   0.138   38.787 1.00  0.00 ? 300 GLY A O    1  
ATOM   2277   H H    . GLY A 1 300 ? 4.936   1.855   36.729 1.00  0.00 ? 300 GLY A H    1  
ATOM   2278   N N    . ALA A 1 301 ? 7.139   0.709   40.007 1.00  0.00 ? 301 ALA A N    1  
ATOM   2279   C CA   . ALA A 1 301 ? 6.877   -0.158  41.130 1.00  0.00 ? 301 ALA A CA   1  
ATOM   2280   C C    . ALA A 1 301 ? 5.736   0.550   41.930 1.00  0.00 ? 301 ALA A C    1  
ATOM   2281   O O    . ALA A 1 301 ? 5.704   1.774   41.898 1.00  0.00 ? 301 ALA A O    1  
ATOM   2282   H H    . ALA A 1 301 ? 7.943   1.269   40.032 1.00  0.00 ? 301 ALA A H    1  
ATOM   2283   N N    . VAL A 1 302 ? 4.900   -0.215  42.554 1.00  0.00 ? 302 VAL A N    1  
ATOM   2284   C CA   . VAL A 1 302 ? 3.761   0.391   43.306 1.00  0.00 ? 302 VAL A CA   1  
ATOM   2285   C C    . VAL A 1 302 ? 3.869   0.018   44.767 1.00  0.00 ? 302 VAL A C    1  
ATOM   2286   O O    . VAL A 1 302 ? 4.542   -0.955  45.088 1.00  0.00 ? 302 VAL A O    1  
ATOM   2287   H H    . VAL A 1 302 ? 5.000   -1.189  42.512 1.00  0.00 ? 302 VAL A H    1  
ATOM   2288   N N    . ALA A 1 303 ? 3.185   0.814   45.635 1.00  0.00 ? 303 ALA A N    1  
ATOM   2289   C CA   . ALA A 1 303 ? 3.248   0.555   47.065 1.00  0.00 ? 303 ALA A CA   1  
ATOM   2290   C C    . ALA A 1 303 ? 2.348   -0.583  47.531 1.00  0.00 ? 303 ALA A C    1  
ATOM   2291   O O    . ALA A 1 303 ? 2.674   -1.213  48.545 1.00  0.00 ? 303 ALA A O    1  
ATOM   2292   H H    . ALA A 1 303 ? 2.665   1.573   45.298 1.00  0.00 ? 303 ALA A H    1  
ATOM   2293   N N    . LEU A 1 304 ? 1.295   -0.855  46.812 1.00  0.00 ? 304 LEU A N    1  
ATOM   2294   C CA   . LEU A 1 304 ? 0.324   -1.935  47.126 1.00  0.00 ? 304 LEU A CA   1  
ATOM   2295   C C    . LEU A 1 304 ? 0.965   -3.302  46.851 1.00  0.00 ? 304 LEU A C    1  
ATOM   2296   O O    . LEU A 1 304 ? 1.156   -3.539  45.653 1.00  0.00 ? 304 LEU A O    1  
ATOM   2297   H H    . LEU A 1 304 ? 1.136   -0.315  46.010 1.00  0.00 ? 304 LEU A H    1  
ATOM   2298   N N    . LYS A 1 305 ? 1.260   -4.072  47.824 1.00  0.00 ? 305 LYS A N    1  
ATOM   2299   C CA   . LYS A 1 305 ? 1.897   -5.363  47.747 1.00  0.00 ? 305 LYS A CA   1  
ATOM   2300   C C    . LYS A 1 305 ? 1.311   -6.329  46.728 1.00  0.00 ? 305 LYS A C    1  
ATOM   2301   O O    . LYS A 1 305 ? 2.049   -7.009  46.018 1.00  0.00 ? 305 LYS A O    1  
ATOM   2302   H H    . LYS A 1 305 ? 1.055   -3.739  48.723 1.00  0.00 ? 305 LYS A H    1  
ATOM   2303   N N    . SER A 1 306 ? 0.013   -6.413  46.670 1.00  0.00 ? 306 SER A N    1  
ATOM   2304   C CA   . SER A 1 306 ? -0.722  -7.329  45.797 1.00  0.00 ? 306 SER A CA   1  
ATOM   2305   C C    . SER A 1 306 ? -0.495  -7.059  44.323 1.00  0.00 ? 306 SER A C    1  
ATOM   2306   O O    . SER A 1 306 ? -0.269  -7.985  43.501 1.00  0.00 ? 306 SER A O    1  
ATOM   2307   H H    . SER A 1 306 ? -0.508  -5.851  47.281 1.00  0.00 ? 306 SER A H    1  
ATOM   2308   N N    . TYR A 1 307 ? -0.571  -5.788  43.937 1.00  0.00 ? 307 TYR A N    1  
ATOM   2309   C CA   . TYR A 1 307 ? -0.398  -5.411  42.552 1.00  0.00 ? 307 TYR A CA   1  
ATOM   2310   C C    . TYR A 1 307 ? 1.104   -5.397  42.197 1.00  0.00 ? 307 TYR A C    1  
ATOM   2311   O O    . TYR A 1 307 ? 1.448   -5.679  41.054 1.00  0.00 ? 307 TYR A O    1  
ATOM   2312   H H    . TYR A 1 307 ? -0.765  -5.095  44.603 1.00  0.00 ? 307 TYR A H    1  
ATOM   2313   N N    . GLU A 1 308 ? 1.919   -5.088  43.167 1.00  0.00 ? 308 GLU A N    1  
ATOM   2314   C CA   . GLU A 1 308 ? 3.364   -5.034  42.904 1.00  0.00 ? 308 GLU A CA   1  
ATOM   2315   C C    . GLU A 1 308 ? 3.821   -6.446  42.489 1.00  0.00 ? 308 GLU A C    1  
ATOM   2316   O O    . GLU A 1 308 ? 4.657   -6.614  41.590 1.00  0.00 ? 308 GLU A O    1  
ATOM   2317   H H    . GLU A 1 308 ? 1.571   -4.882  44.060 1.00  0.00 ? 308 GLU A H    1  
ATOM   2318   N N    . GLU A 1 309 ? 3.253   -7.435  43.162 1.00  0.00 ? 309 GLU A N    1  
ATOM   2319   C CA   . GLU A 1 309 ? 3.573   -8.841  42.880 1.00  0.00 ? 309 GLU A CA   1  
ATOM   2320   C C    . GLU A 1 309 ? 3.214   -9.198  41.453 1.00  0.00 ? 309 GLU A C    1  
ATOM   2321   O O    . GLU A 1 309 ? 3.937   -10.027 40.867 1.00  0.00 ? 309 GLU A O    1  
ATOM   2322   H H    . GLU A 1 309 ? 2.598   -7.225  43.861 1.00  0.00 ? 309 GLU A H    1  
ATOM   2323   N N    . GLU A 1 310 ? 2.231   -8.581  40.864 1.00  0.00 ? 310 GLU A N    1  
ATOM   2324   C CA   . GLU A 1 310 ? 1.874   -8.848  39.474 1.00  0.00 ? 310 GLU A CA   1  
ATOM   2325   C C    . GLU A 1 310 ? 2.872   -8.155  38.553 1.00  0.00 ? 310 GLU A C    1  
ATOM   2326   O O    . GLU A 1 310 ? 3.404   -8.674  37.561 1.00  0.00 ? 310 GLU A O    1  
ATOM   2327   H H    . GLU A 1 310 ? 1.737   -7.893  41.357 1.00  0.00 ? 310 GLU A H    1  
ATOM   2328   N N    . LEU A 1 311 ? 3.159   -6.908  38.907 1.00  0.00 ? 311 LEU A N    1  
ATOM   2329   C CA   . LEU A 1 311 ? 4.063   -6.048  38.148 1.00  0.00 ? 311 LEU A CA   1  
ATOM   2330   C C    . LEU A 1 311 ? 5.508   -6.534  38.116 1.00  0.00 ? 311 LEU A C    1  
ATOM   2331   O O    . LEU A 1 311 ? 6.228   -6.269  37.138 1.00  0.00 ? 311 LEU A O    1  
ATOM   2332   H H    . LEU A 1 311 ? 2.725   -6.538  39.704 1.00  0.00 ? 311 LEU A H    1  
ATOM   2333   N N    . ALA A 1 312 ? 5.939   -7.127  39.182 1.00  0.00 ? 312 ALA A N    1  
ATOM   2334   C CA   . ALA A 1 312 ? 7.266   -7.639  39.394 1.00  0.00 ? 312 ALA A CA   1  
ATOM   2335   C C    . ALA A 1 312 ? 7.655   -8.777  38.430 1.00  0.00 ? 312 ALA A C    1  
ATOM   2336   O O    . ALA A 1 312 ? 8.815   -9.226  38.498 1.00  0.00 ? 312 ALA A O    1  
ATOM   2337   H H    . ALA A 1 312 ? 5.306   -7.219  39.924 1.00  0.00 ? 312 ALA A H    1  
ATOM   2338   N N    . LYS A 1 313 ? 6.801   -9.214  37.559 1.00  0.00 ? 313 LYS A N    1  
ATOM   2339   C CA   . LYS A 1 313 ? 7.067   -10.221 36.503 1.00  0.00 ? 313 LYS A CA   1  
ATOM   2340   C C    . LYS A 1 313 ? 7.921   -9.581  35.407 1.00  0.00 ? 313 LYS A C    1  
ATOM   2341   O O    . LYS A 1 313 ? 8.443   -10.191 34.466 1.00  0.00 ? 313 LYS A O    1  
ATOM   2342   H H    . LYS A 1 313 ? 5.917   -8.791  37.553 1.00  0.00 ? 313 LYS A H    1  
ATOM   2343   N N    C ASP A 1 314 ? 8.193   -8.307  35.501 0.05  0.00 ? 314 ASP A N    1  
ATOM   2344   N N    O ASP A 1 314 ? 8.001   -8.258  35.460 0.95  0.00 ? 314 ASP A N    1  
ATOM   2345   C CA   C ASP A 1 314 ? 9.076   -7.695  34.513 0.05  0.00 ? 314 ASP A CA   1  
ATOM   2346   C CA   O ASP A 1 314 ? 8.853   -7.435  34.608 0.95  0.00 ? 314 ASP A CA   1  
ATOM   2347   C C    C ASP A 1 314 ? 10.186  -7.149  35.424 0.05  0.00 ? 314 ASP A C    1  
ATOM   2348   C C    O ASP A 1 314 ? 10.094  -7.291  35.503 0.95  0.00 ? 314 ASP A C    1  
ATOM   2349   O O    C ASP A 1 314 ? 10.023  -5.998  35.893 0.05  0.00 ? 314 ASP A O    1  
ATOM   2350   O O    O ASP A 1 314 ? 9.935   -6.722  36.609 0.95  0.00 ? 314 ASP A O    1  
ATOM   2351   H H    C ASP A 1 314 ? 7.876   -7.738  36.234 0.05  0.00 ? 314 ASP A H    1  
ATOM   2352   H H    O ASP A 1 314 ? 7.514   -7.805  36.180 0.95  0.00 ? 314 ASP A H    1  
ATOM   2353   N N    C PRO A 1 315 ? 11.188  -7.939  35.743 0.05  0.00 ? 315 PRO A N    1  
ATOM   2354   N N    O PRO A 1 315 ? 11.220  -7.849  35.117 0.95  0.00 ? 315 PRO A N    1  
ATOM   2355   C CA   C PRO A 1 315 ? 12.243  -7.488  36.622 0.05  0.00 ? 315 PRO A CA   1  
ATOM   2356   C CA   O PRO A 1 315 ? 12.404  -7.792  35.945 0.95  0.00 ? 315 PRO A CA   1  
ATOM   2357   C C    C PRO A 1 315 ? 13.031  -6.331  36.026 0.05  0.00 ? 315 PRO A C    1  
ATOM   2358   C C    O PRO A 1 315 ? 12.898  -6.366  36.140 0.95  0.00 ? 315 PRO A C    1  
ATOM   2359   O O    C PRO A 1 315 ? 13.617  -5.600  36.856 0.05  0.00 ? 315 PRO A O    1  
ATOM   2360   O O    O PRO A 1 315 ? 13.588  -6.176  37.168 0.95  0.00 ? 315 PRO A O    1  
ATOM   2361   N N    C ARG A 1 316 ? 13.026  -6.120  34.772 0.05  0.00 ? 316 ARG A N    1  
ATOM   2362   N N    O ARG A 1 316 ? 12.567  -5.447  35.326 0.95  0.00 ? 316 ARG A N    1  
ATOM   2363   C CA   C ARG A 1 316 ? 13.738  -4.975  34.121 0.05  0.00 ? 316 ARG A CA   1  
ATOM   2364   C CA   O ARG A 1 316 ? 12.976  -4.015  35.482 0.95  0.00 ? 316 ARG A CA   1  
ATOM   2365   C C    C ARG A 1 316 ? 13.034  -3.654  34.488 0.05  0.00 ? 316 ARG A C    1  
ATOM   2366   C C    O ARG A 1 316 ? 12.248  -3.399  36.692 0.95  0.00 ? 316 ARG A C    1  
ATOM   2367   O O    C ARG A 1 316 ? 13.671  -2.599  34.744 0.05  0.00 ? 316 ARG A O    1  
ATOM   2368   O O    O ARG A 1 316 ? 12.814  -2.603  37.486 0.95  0.00 ? 316 ARG A O    1  
ATOM   2369   H H    C ARG A 1 316 ? 12.502  -6.723  34.202 0.05  0.00 ? 316 ARG A H    1  
ATOM   2370   H H    O ARG A 1 316 ? 11.987  -5.683  34.571 0.95  0.00 ? 316 ARG A H    1  
ATOM   2371   N N    C ILE A 1 317 ? 11.705  -3.768  34.523 0.05  0.00 ? 317 ILE A N    1  
ATOM   2372   N N    O ILE A 1 317 ? 10.987  -3.819  36.806 0.95  0.00 ? 317 ILE A N    1  
ATOM   2373   C CA   C ILE A 1 317 ? 10.880  -2.589  34.900 0.05  0.00 ? 317 ILE A CA   1  
ATOM   2374   C CA   O ILE A 1 317 ? 10.159  -3.345  37.947 0.95  0.00 ? 317 ILE A CA   1  
ATOM   2375   C C    C ILE A 1 317 ? 10.994  -2.313  36.375 0.05  0.00 ? 317 ILE A C    1  
ATOM   2376   C C    O ILE A 1 317 ? 10.597  -4.002  39.228 0.95  0.00 ? 317 ILE A C    1  
ATOM   2377   O O    C ILE A 1 317 ? 11.125  -1.113  36.785 0.05  0.00 ? 317 ILE A O    1  
ATOM   2378   O O    O ILE A 1 317 ? 10.697  -3.308  40.293 0.95  0.00 ? 317 ILE A O    1  
ATOM   2379   H H    C ILE A 1 317 ? 11.278  -4.628  34.327 0.05  0.00 ? 317 ILE A H    1  
ATOM   2380   H H    O ILE A 1 317 ? 10.617  -4.454  36.157 0.95  0.00 ? 317 ILE A H    1  
ATOM   2381   N N    C ALA A 1 318 ? 11.028  -3.331  37.223 0.05  0.00 ? 318 ALA A N    1  
ATOM   2382   N N    O ALA A 1 318 ? 10.942  -5.282  39.214 0.95  0.00 ? 318 ALA A N    1  
ATOM   2383   C CA   C ALA A 1 318 ? 11.164  -3.187  38.643 0.05  0.00 ? 318 ALA A CA   1  
ATOM   2384   C CA   O ALA A 1 318 ? 11.402  -6.001  40.365 0.95  0.00 ? 318 ALA A CA   1  
ATOM   2385   C C    C ALA A 1 318 ? 12.504  -2.509  38.989 0.05  0.00 ? 318 ALA A C    1  
ATOM   2386   C C    O ALA A 1 318 ? 12.708  -5.381  40.900 0.95  0.00 ? 318 ALA A C    1  
ATOM   2387   O O    C ALA A 1 318 ? 12.580  -1.772  39.995 0.05  0.00 ? 318 ALA A O    1  
ATOM   2388   O O    O ALA A 1 318 ? 12.948  -5.413  42.126 0.95  0.00 ? 318 ALA A O    1  
ATOM   2389   H H    C ALA A 1 318 ? 10.976  -4.238  36.855 0.05  0.00 ? 318 ALA A H    1  
ATOM   2390   H H    O ALA A 1 318 ? 10.898  -5.760  38.359 0.95  0.00 ? 318 ALA A H    1  
ATOM   2391   N N    C ALA A 1 319 ? 13.528  -2.929  38.255 0.05  0.00 ? 319 ALA A N    1  
ATOM   2392   N N    O ALA A 1 319 ? 13.561  -5.015  39.951 0.95  0.00 ? 319 ALA A N    1  
ATOM   2393   C CA   C ALA A 1 319 ? 14.873  -2.404  38.491 0.05  0.00 ? 319 ALA A CA   1  
ATOM   2394   C CA   O ALA A 1 319 ? 14.861  -4.443  40.305 0.95  0.00 ? 319 ALA A CA   1  
ATOM   2395   C C    C ALA A 1 319 ? 14.937  -0.896  38.114 0.05  0.00 ? 319 ALA A C    1  
ATOM   2396   C C    O ALA A 1 319 ? 14.673  -3.054  40.979 0.95  0.00 ? 319 ALA A C    1  
ATOM   2397   O O    C ALA A 1 319 ? 15.554  -0.161  38.886 0.05  0.00 ? 319 ALA A O    1  
ATOM   2398   O O    O ALA A 1 319 ? 15.379  -2.818  41.961 0.95  0.00 ? 319 ALA A O    1  
ATOM   2399   H H    C ALA A 1 319 ? 13.387  -3.614  37.567 0.05  0.00 ? 319 ALA A H    1  
ATOM   2400   H H    O ALA A 1 319 ? 13.330  -5.152  39.008 0.95  0.00 ? 319 ALA A H    1  
ATOM   2401   N N    C THR A 1 320 ? 14.346  -0.553  37.022 0.05  0.00 ? 320 THR A N    1  
ATOM   2402   N N    O THR A 1 320 ? 13.803  -2.270  40.442 0.95  0.00 ? 320 THR A N    1  
ATOM   2403   C CA   C THR A 1 320 ? 14.252  0.807   36.471 0.05  0.00 ? 320 THR A CA   1  
ATOM   2404   C CA   O THR A 1 320 ? 13.436  -0.925  40.909 0.95  0.00 ? 320 THR A CA   1  
ATOM   2405   C C    C THR A 1 320 ? 13.656  1.697   37.571 0.05  0.00 ? 320 THR A C    1  
ATOM   2406   C C    O THR A 1 320 ? 13.035  -1.055  42.385 0.95  0.00 ? 320 THR A C    1  
ATOM   2407   O O    C THR A 1 320 ? 14.242  2.723   37.940 0.05  0.00 ? 320 THR A O    1  
ATOM   2408   O O    O THR A 1 320 ? 13.582  -0.361  43.252 0.95  0.00 ? 320 THR A O    1  
ATOM   2409   H H    C THR A 1 320 ? 13.906  -1.268  36.515 0.05  0.00 ? 320 THR A H    1  
ATOM   2410   H H    O THR A 1 320 ? 13.330  -2.609  39.653 0.95  0.00 ? 320 THR A H    1  
ATOM   2411   N N    C MET A 1 321 ? 12.493  1.308   38.058 0.05  0.00 ? 321 MET A N    1  
ATOM   2412   N N    O MET A 1 321 ? 12.072  -1.918  42.645 0.95  0.00 ? 321 MET A N    1  
ATOM   2413   C CA   C MET A 1 321 ? 11.828  2.048   39.154 0.05  0.00 ? 321 MET A CA   1  
ATOM   2414   C CA   O MET A 1 321 ? 11.618  -2.177  44.030 0.95  0.00 ? 321 MET A CA   1  
ATOM   2415   C C    C MET A 1 321 ? 12.666  2.151   40.373 0.05  0.00 ? 321 MET A C    1  
ATOM   2416   C C    O MET A 1 321 ? 12.711  -2.641  44.919 0.95  0.00 ? 321 MET A C    1  
ATOM   2417   O O    C MET A 1 321 ? 12.763  3.212   41.028 0.05  0.00 ? 321 MET A O    1  
ATOM   2418   O O    O MET A 1 321 ? 12.852  -2.208  46.084 0.95  0.00 ? 321 MET A O    1  
ATOM   2419   H H    C MET A 1 321 ? 12.075  0.495   37.706 0.05  0.00 ? 321 MET A H    1  
ATOM   2420   H H    O MET A 1 321 ? 11.668  -2.421  41.907 0.95  0.00 ? 321 MET A H    1  
ATOM   2421   N N    C GLU A 1 322 ? 13.348  1.085   40.818 0.05  0.00 ? 322 GLU A N    1  
ATOM   2422   N N    O GLU A 1 322 ? 13.589  -3.560  44.490 0.95  0.00 ? 322 GLU A N    1  
ATOM   2423   C CA   C GLU A 1 322 ? 14.192  1.091   41.987 0.05  0.00 ? 322 GLU A CA   1  
ATOM   2424   C CA   O GLU A 1 322 ? 14.685  -4.066  45.277 0.95  0.00 ? 322 GLU A CA   1  
ATOM   2425   C C    C GLU A 1 322 ? 15.362  2.095   41.929 0.05  0.00 ? 322 GLU A C    1  
ATOM   2426   C C    O GLU A 1 322 ? 15.695  -2.993  45.736 0.95  0.00 ? 322 GLU A C    1  
ATOM   2427   O O    C GLU A 1 322 ? 15.661  2.759   42.917 0.05  0.00 ? 322 GLU A O    1  
ATOM   2428   O O    O GLU A 1 322 ? 16.153  -3.017  46.875 0.95  0.00 ? 322 GLU A O    1  
ATOM   2429   H H    C GLU A 1 322 ? 13.273  0.250   40.311 0.05  0.00 ? 322 GLU A H    1  
ATOM   2430   H H    O GLU A 1 322 ? 13.481  -3.905  43.579 0.95  0.00 ? 322 GLU A H    1  
ATOM   2431   N N    C ASN A 1 323 ? 15.979  2.124   40.779 0.05  0.00 ? 323 ASN A N    1  
ATOM   2432   N N    O ASN A 1 323 ? 16.008  -2.129  44.809 0.95  0.00 ? 323 ASN A N    1  
ATOM   2433   C CA   C ASN A 1 323 ? 17.110  2.997   40.472 0.05  0.00 ? 323 ASN A CA   1  
ATOM   2434   C CA   O ASN A 1 323 ? 16.933  -1.014  45.000 0.95  0.00 ? 323 ASN A CA   1  
ATOM   2435   C C    C ASN A 1 323 ? 16.595  4.482   40.468 0.05  0.00 ? 323 ASN A C    1  
ATOM   2436   C C    O ASN A 1 323 ? 16.280  -0.004  46.012 0.95  0.00 ? 323 ASN A C    1  
ATOM   2437   O O    C ASN A 1 323 ? 17.312  5.310   40.981 0.05  0.00 ? 323 ASN A O    1  
ATOM   2438   O O    O ASN A 1 323 ? 17.009  0.482   46.845 0.95  0.00 ? 323 ASN A O    1  
ATOM   2439   H H    C ASN A 1 323 ? 15.658  1.526   40.073 0.05  0.00 ? 323 ASN A H    1  
ATOM   2440   H H    O ASN A 1 323 ? 15.590  -2.231  43.929 0.95  0.00 ? 323 ASN A H    1  
ATOM   2441   N N    C ALA A 1 324 ? 15.460  4.644   39.856 0.05  0.00 ? 324 ALA A N    1  
ATOM   2442   N N    O ALA A 1 324 ? 15.020  0.223   45.789 0.95  0.00 ? 324 ALA A N    1  
ATOM   2443   C CA   C ALA A 1 324 ? 14.789  5.942   39.748 0.05  0.00 ? 324 ALA A CA   1  
ATOM   2444   C CA   O ALA A 1 324 ? 14.210  1.118   46.621 0.95  0.00 ? 324 ALA A CA   1  
ATOM   2445   C C    C ALA A 1 324 ? 14.428  6.450   41.131 0.05  0.00 ? 324 ALA A C    1  
ATOM   2446   C C    O ALA A 1 324 ? 14.144  0.581   48.038 0.95  0.00 ? 324 ALA A C    1  
ATOM   2447   O O    C ALA A 1 324 ? 14.618  7.641   41.407 0.05  0.00 ? 324 ALA A O    1  
ATOM   2448   O O    O ALA A 1 324 ? 14.270  1.364   48.988 0.95  0.00 ? 324 ALA A O    1  
ATOM   2449   H H    C ALA A 1 324 ? 15.028  3.858   39.458 0.05  0.00 ? 324 ALA A H    1  
ATOM   2450   H H    O ALA A 1 324 ? 14.589  -0.234  45.036 0.95  0.00 ? 324 ALA A H    1  
ATOM   2451   N N    C GLN A 1 325 ? 13.988  5.631   42.045 0.05  0.00 ? 325 GLN A N    1  
ATOM   2452   N N    O GLN A 1 325 ? 14.027  -0.699  48.258 0.95  0.00 ? 325 GLN A N    1  
ATOM   2453   C CA   C GLN A 1 325 ? 13.642  6.034   43.391 0.05  0.00 ? 325 GLN A CA   1  
ATOM   2454   C CA   O GLN A 1 325 ? 13.977  -1.289  49.578 0.95  0.00 ? 325 GLN A CA   1  
ATOM   2455   C C    C GLN A 1 325 ? 14.854  6.442   44.182 0.05  0.00 ? 325 GLN A C    1  
ATOM   2456   C C    O GLN A 1 325 ? 15.295  -1.174  50.293 0.95  0.00 ? 325 GLN A C    1  
ATOM   2457   O O    C GLN A 1 325 ? 14.733  7.160   45.184 0.05  0.00 ? 325 GLN A O    1  
ATOM   2458   O O    O GLN A 1 325 ? 15.346  -1.264  51.527 0.95  0.00 ? 325 GLN A O    1  
ATOM   2459   H H    C GLN A 1 325 ? 13.897  4.683   41.810 0.05  0.00 ? 325 GLN A H    1  
ATOM   2460   H H    O GLN A 1 325 ? 13.982  -1.298  47.483 0.95  0.00 ? 325 GLN A H    1  
ATOM   2461   N N    C LYS A 1 326 ? 16.010  5.959   43.832 0.05  0.00 ? 326 LYS A N    1  
ATOM   2462   N N    O LYS A 1 326 ? 16.376  -1.058  49.578 0.95  0.00 ? 326 LYS A N    1  
ATOM   2463   C CA   C LYS A 1 326 ? 17.278  6.273   44.474 0.05  0.00 ? 326 LYS A CA   1  
ATOM   2464   C CA   O LYS A 1 326 ? 17.722  -0.911  50.113 0.95  0.00 ? 326 LYS A CA   1  
ATOM   2465   C C    C LYS A 1 326 ? 18.048  7.391   43.756 0.05  0.00 ? 326 LYS A C    1  
ATOM   2466   C C    O LYS A 1 326 ? 18.173  0.555   50.193 0.95  0.00 ? 326 LYS A C    1  
ATOM   2467   O O    C LYS A 1 326 ? 19.028  7.878   44.332 0.05  0.00 ? 326 LYS A O    1  
ATOM   2468   O O    O LYS A 1 326 ? 19.207  0.806   50.824 0.95  0.00 ? 326 LYS A O    1  
ATOM   2469   H H    C LYS A 1 326 ? 16.032  5.349   43.064 0.05  0.00 ? 326 LYS A H    1  
ATOM   2470   H H    O LYS A 1 326 ? 16.275  -1.051  48.603 0.95  0.00 ? 326 LYS A H    1  
ATOM   2471   N N    C GLY A 1 327 ? 17.690  7.781   42.580 0.05  0.00 ? 327 GLY A N    1  
ATOM   2472   N N    O GLY A 1 327 ? 17.502  1.480   49.596 0.95  0.00 ? 327 GLY A N    1  
ATOM   2473   C CA   C GLY A 1 327 ? 18.316  8.785   41.745 0.05  0.00 ? 327 GLY A CA   1  
ATOM   2474   C CA   O GLY A 1 327 ? 17.807  2.894   49.518 0.95  0.00 ? 327 GLY A CA   1  
ATOM   2475   C C    C GLY A 1 327 ? 17.496  10.064  41.576 0.05  0.00 ? 327 GLY A C    1  
ATOM   2476   C C    O GLY A 1 327 ? 17.417  3.691   50.762 0.95  0.00 ? 327 GLY A C    1  
ATOM   2477   O O    C GLY A 1 327 ? 16.402  10.216  42.091 0.05  0.00 ? 327 GLY A O    1  
ATOM   2478   O O    O GLY A 1 327 ? 17.059  3.159   51.799 0.95  0.00 ? 327 GLY A O    1  
ATOM   2479   H H    C GLY A 1 327 ? 16.919  7.318   42.190 0.05  0.00 ? 327 GLY A H    1  
ATOM   2480   H H    O GLY A 1 327 ? 16.706  1.185   49.106 0.95  0.00 ? 327 GLY A H    1  
ATOM   2481   N N    C GLU A 1 328 ? 18.070  10.998  40.892 0.05  0.00 ? 328 GLU A N    1  
ATOM   2482   N N    O GLU A 1 328 ? 17.545  4.972   50.656 0.95  0.00 ? 328 GLU A N    1  
ATOM   2483   C CA   C GLU A 1 328 ? 17.552  12.326  40.560 0.05  0.00 ? 328 GLU A CA   1  
ATOM   2484   C CA   O GLU A 1 328 ? 17.272  5.997   51.665 0.95  0.00 ? 328 GLU A CA   1  
ATOM   2485   C C    C GLU A 1 328 ? 17.162  13.082  41.784 0.05  0.00 ? 328 GLU A C    1  
ATOM   2486   C C    O GLU A 1 328 ? 16.098  6.835   51.289 0.95  0.00 ? 328 GLU A C    1  
ATOM   2487   O O    C GLU A 1 328 ? 16.421  12.555  42.674 0.05  0.00 ? 328 GLU A O    1  
ATOM   2488   O O    O GLU A 1 328 ? 16.112  7.552   50.238 0.95  0.00 ? 328 GLU A O    1  
ATOM   2489   H H    C GLU A 1 328 ? 18.970  10.794  40.562 0.05  0.00 ? 328 GLU A H    1  
ATOM   2490   H H    O GLU A 1 328 ? 17.876  5.298   49.793 0.95  0.00 ? 328 GLU A H    1  
ATOM   2491   N N    C ILE A 1 329 ? 17.653  14.326  41.945 0.05  0.00 ? 329 ILE A N    1  
ATOM   2492   N N    O ILE A 1 329 ? 15.001  6.778   52.069 0.95  0.00 ? 329 ILE A N    1  
ATOM   2493   C CA   C ILE A 1 329 ? 17.243  15.078  43.166 0.05  0.00 ? 329 ILE A CA   1  
ATOM   2494   C CA   O ILE A 1 329 ? 13.847  7.647   51.702 0.95  0.00 ? 329 ILE A CA   1  
ATOM   2495   C C    C ILE A 1 329 ? 15.927  15.812  42.835 0.05  0.00 ? 329 ILE A C    1  
ATOM   2496   C C    O ILE A 1 329 ? 14.351  9.105   51.697 0.95  0.00 ? 329 ILE A C    1  
ATOM   2497   O O    C ILE A 1 329 ? 15.919  16.546  41.846 0.05  0.00 ? 329 ILE A O    1  
ATOM   2498   O O    O ILE A 1 329 ? 15.031  9.475   52.655 0.95  0.00 ? 329 ILE A O    1  
ATOM   2499   H H    C ILE A 1 329 ? 18.239  14.733  41.272 0.05  0.00 ? 329 ILE A H    1  
ATOM   2500   H H    O ILE A 1 329 ? 14.972  6.204   52.864 0.95  0.00 ? 329 ILE A H    1  
ATOM   2501   N N    C MET A 1 330 ? 14.896  15.629  43.583 0.05  0.00 ? 330 MET A N    1  
ATOM   2502   N N    O MET A 1 330 ? 14.058  9.872   50.705 0.95  0.00 ? 330 MET A N    1  
ATOM   2503   C CA   C MET A 1 330 ? 13.622  16.298  43.310 0.05  0.00 ? 330 MET A CA   1  
ATOM   2504   C CA   O MET A 1 330 ? 14.509  11.264  50.653 0.95  0.00 ? 330 MET A CA   1  
ATOM   2505   C C    C MET A 1 330 ? 13.609  17.679  44.035 0.05  0.00 ? 330 MET A C    1  
ATOM   2506   C C    O MET A 1 330 ? 13.763  12.081  51.752 0.95  0.00 ? 330 MET A C    1  
ATOM   2507   O O    C MET A 1 330 ? 14.079  17.724  45.176 0.05  0.00 ? 330 MET A O    1  
ATOM   2508   O O    O MET A 1 330 ? 12.530  12.118  51.691 0.95  0.00 ? 330 MET A O    1  
ATOM   2509   H H    C MET A 1 330 ? 14.964  15.029  44.354 0.05  0.00 ? 330 MET A H    1  
ATOM   2510   H H    O MET A 1 330 ? 13.520  9.517   49.968 0.95  0.00 ? 330 MET A H    1  
ATOM   2511   N N    C PRO A 1 331 ? 13.066  18.690  43.396 0.05  0.00 ? 331 PRO A N    1  
ATOM   2512   N N    O PRO A 1 331 ? 14.499  12.702  52.645 0.95  0.00 ? 331 PRO A N    1  
ATOM   2513   C CA   C PRO A 1 331 ? 12.952  20.053  43.986 0.05  0.00 ? 331 PRO A CA   1  
ATOM   2514   C CA   O PRO A 1 331 ? 13.919  13.565  53.712 0.95  0.00 ? 331 PRO A CA   1  
ATOM   2515   C C    C PRO A 1 331 ? 11.865  20.121  45.026 0.05  0.00 ? 331 PRO A C    1  
ATOM   2516   C C    O PRO A 1 331 ? 13.016  14.626  53.142 0.95  0.00 ? 331 PRO A C    1  
ATOM   2517   O O    C PRO A 1 331 ? 11.094  19.212  45.295 0.05  0.00 ? 331 PRO A O    1  
ATOM   2518   O O    O PRO A 1 331 ? 13.243  15.270  52.129 0.95  0.00 ? 331 PRO A O    1  
ATOM   2519   N N    C ASN A 1 332 ? 11.808  21.257  45.756 0.05  0.00 ? 332 ASN A N    1  
ATOM   2520   N N    O ASN A 1 332 ? 11.835  14.808  53.775 0.95  0.00 ? 332 ASN A N    1  
ATOM   2521   C CA   C ASN A 1 332 ? 10.836  21.445  46.836 0.05  0.00 ? 332 ASN A CA   1  
ATOM   2522   C CA   O ASN A 1 332 ? 10.837  15.773  53.307 0.95  0.00 ? 332 ASN A CA   1  
ATOM   2523   C C    C ASN A 1 332 ? 10.745  22.872  47.414 0.05  0.00 ? 332 ASN A C    1  
ATOM   2524   C C    O ASN A 1 332 ? 10.893  17.166  53.966 0.95  0.00 ? 332 ASN A C    1  
ATOM   2525   O O    C ASN A 1 332 ? 10.437  23.031  48.613 0.05  0.00 ? 332 ASN A O    1  
ATOM   2526   O O    O ASN A 1 332 ? 10.028  18.018  53.676 0.95  0.00 ? 332 ASN A O    1  
ATOM   2527   H H    C ASN A 1 332 ? 12.458  21.969  45.576 0.05  0.00 ? 332 ASN A H    1  
ATOM   2528   H H    O ASN A 1 332 ? 11.627  14.254  54.557 0.95  0.00 ? 332 ASN A H    1  
ATOM   2529   N N    C ILE A 1 333 ? 10.986  23.856  46.580 0.05  0.00 ? 333 ILE A N    1  
ATOM   2530   N N    O ILE A 1 333 ? 11.884  17.379  54.799 0.95  0.00 ? 333 ILE A N    1  
ATOM   2531   C CA   C ILE A 1 333 ? 10.974  25.289  46.891 0.05  0.00 ? 333 ILE A CA   1  
ATOM   2532   C CA   O ILE A 1 333 ? 12.137  18.605  55.562 0.95  0.00 ? 333 ILE A CA   1  
ATOM   2533   C C    C ILE A 1 333 ? 10.393  26.091  45.735 0.05  0.00 ? 333 ILE A C    1  
ATOM   2534   C C    O ILE A 1 333 ? 12.863  19.636  54.709 0.95  0.00 ? 333 ILE A C    1  
ATOM   2535   O O    C ILE A 1 333 ? 10.431  25.684  44.569 0.05  0.00 ? 333 ILE A O    1  
ATOM   2536   O O    O ILE A 1 333 ? 13.548  19.315  53.732 0.95  0.00 ? 333 ILE A O    1  
ATOM   2537   H H    C ILE A 1 333 ? 11.212  23.608  45.659 0.05  0.00 ? 333 ILE A H    1  
ATOM   2538   H H    O ILE A 1 333 ? 12.511  16.638  54.936 0.95  0.00 ? 333 ILE A H    1  
ATOM   2539   N N    C PRO A 1 334 ? 9.845   27.245  46.137 0.05  0.00 ? 334 PRO A N    1  
ATOM   2540   N N    O PRO A 1 334 ? 12.658  20.889  55.135 0.95  0.00 ? 334 PRO A N    1  
ATOM   2541   C CA   C PRO A 1 334 ? 9.281   28.225  45.223 0.05  0.00 ? 334 PRO A CA   1  
ATOM   2542   C CA   O PRO A 1 334 ? 13.229  22.059  54.487 0.95  0.00 ? 334 PRO A CA   1  
ATOM   2543   C C    C PRO A 1 334 ? 10.248  28.825  44.238 0.05  0.00 ? 334 PRO A C    1  
ATOM   2544   C C    O PRO A 1 334 ? 14.733  22.123  54.474 0.95  0.00 ? 334 PRO A C    1  
ATOM   2545   O O    C PRO A 1 334 ? 9.840   29.138  43.115 0.05  0.00 ? 334 PRO A O    1  
ATOM   2546   O O    O PRO A 1 334 ? 15.300  22.650  53.511 0.95  0.00 ? 334 PRO A O    1  
ATOM   2547   N N    C GLN A 1 335 ? 11.496  29.003  44.543 0.05  0.00 ? 335 GLN A N    1  
ATOM   2548   N N    O GLN A 1 335 ? 15.437  21.625  55.443 0.95  0.00 ? 335 GLN A N    1  
ATOM   2549   C CA   C GLN A 1 335 ? 12.522  29.534  43.657 0.05  0.00 ? 335 GLN A CA   1  
ATOM   2550   C CA   O GLN A 1 335 ? 16.890  21.596  55.512 0.95  0.00 ? 335 GLN A CA   1  
ATOM   2551   C C    C GLN A 1 335 ? 12.763  28.668  42.416 0.05  0.00 ? 335 GLN A C    1  
ATOM   2552   C C    O GLN A 1 335 ? 17.538  20.784  54.385 0.95  0.00 ? 335 GLN A C    1  
ATOM   2553   O O    C GLN A 1 335 ? 13.531  29.042  41.511 0.05  0.00 ? 335 GLN A O    1  
ATOM   2554   O O    O GLN A 1 335 ? 18.774  20.753  54.244 0.95  0.00 ? 335 GLN A O    1  
ATOM   2555   H H    C GLN A 1 335 ? 11.780  28.732  45.440 0.05  0.00 ? 335 GLN A H    1  
ATOM   2556   H H    O GLN A 1 335 ? 14.948  21.208  56.182 0.95  0.00 ? 335 GLN A H    1  
ATOM   2557   N N    C MET A 1 336 ? 12.191  27.481  42.398 0.05  0.00 ? 336 MET A N    1  
ATOM   2558   N N    O MET A 1 336 ? 16.733  20.058  53.636 0.95  0.00 ? 336 MET A N    1  
ATOM   2559   C CA   C MET A 1 336 ? 12.303  26.506  41.298 0.05  0.00 ? 336 MET A CA   1  
ATOM   2560   C CA   O MET A 1 336 ? 17.163  19.212  52.508 0.95  0.00 ? 336 MET A CA   1  
ATOM   2561   C C    C MET A 1 336 ? 11.612  27.092  40.077 0.05  0.00 ? 336 MET A C    1  
ATOM   2562   C C    O MET A 1 336 ? 17.704  20.122  51.417 0.95  0.00 ? 336 MET A C    1  
ATOM   2563   O O    C MET A 1 336 ? 11.981  26.750  38.944 0.05  0.00 ? 336 MET A O    1  
ATOM   2564   O O    O MET A 1 336 ? 18.558  19.690  50.630 0.95  0.00 ? 336 MET A O    1  
ATOM   2565   H H    C MET A 1 336 ? 11.649  27.226  43.174 0.05  0.00 ? 336 MET A H    1  
ATOM   2566   H H    O MET A 1 336 ? 15.775  20.081  53.844 0.95  0.00 ? 336 MET A H    1  
ATOM   2567   N N    C SER A 1 337 ? 10.643  27.972  40.292 0.05  0.00 ? 337 SER A N    1  
ATOM   2568   N N    O SER A 1 337 ? 17.237  21.363  51.375 0.95  0.00 ? 337 SER A N    1  
ATOM   2569   C CA   C SER A 1 337 ? 9.960   28.581  39.138 0.05  0.00 ? 337 SER A CA   1  
ATOM   2570   C CA   O SER A 1 337 ? 17.748  22.285  50.347 0.95  0.00 ? 337 SER A CA   1  
ATOM   2571   C C    C SER A 1 337 ? 10.948  29.454  38.353 0.05  0.00 ? 337 SER A C    1  
ATOM   2572   C C    O SER A 1 337 ? 19.236  22.565  50.595 0.95  0.00 ? 337 SER A C    1  
ATOM   2573   O O    C SER A 1 337 ? 10.884  29.575  37.115 0.05  0.00 ? 337 SER A O    1  
ATOM   2574   O O    O SER A 1 337 ? 20.038  22.756  49.662 0.95  0.00 ? 337 SER A O    1  
ATOM   2575   H H    C SER A 1 337 ? 10.394  28.224  41.205 0.05  0.00 ? 337 SER A H    1  
ATOM   2576   H H    O SER A 1 337 ? 16.572  21.666  52.027 0.95  0.00 ? 337 SER A H    1  
ATOM   2577   N N    C ALA A 1 338 ? 11.841  30.090  39.056 0.05  0.00 ? 338 ALA A N    1  
ATOM   2578   N N    O ALA A 1 338 ? 19.612  22.624  51.841 0.95  0.00 ? 338 ALA A N    1  
ATOM   2579   C CA   C ALA A 1 338 ? 12.858  30.943  38.443 0.05  0.00 ? 338 ALA A CA   1  
ATOM   2580   C CA   O ALA A 1 338 ? 21.001  22.864  52.229 0.95  0.00 ? 338 ALA A CA   1  
ATOM   2581   C C    C ALA A 1 338 ? 13.788  30.084  37.585 0.05  0.00 ? 338 ALA A C    1  
ATOM   2582   C C    O ALA A 1 338 ? 21.865  21.689  51.768 0.95  0.00 ? 338 ALA A C    1  
ATOM   2583   O O    C ALA A 1 338 ? 14.202  30.490  36.498 0.05  0.00 ? 338 ALA A O    1  
ATOM   2584   O O    O ALA A 1 338 ? 22.994  21.874  51.309 0.95  0.00 ? 338 ALA A O    1  
ATOM   2585   H H    C ALA A 1 338 ? 11.838  29.982  40.031 0.05  0.00 ? 338 ALA A H    1  
ATOM   2586   H H    O ALA A 1 338 ? 18.941  22.490  52.543 0.95  0.00 ? 338 ALA A H    1  
ATOM   2587   N N    C PHE A 1 339 ? 14.143  28.941  38.147 0.05  0.00 ? 339 PHE A N    1  
ATOM   2588   N N    O PHE A 1 339 ? 21.322  20.502  51.976 0.95  0.00 ? 339 PHE A N    1  
ATOM   2589   C CA   C PHE A 1 339 ? 15.032  27.978  37.474 0.05  0.00 ? 339 PHE A CA   1  
ATOM   2590   C CA   O PHE A 1 339 ? 22.001  19.250  51.596 0.95  0.00 ? 339 PHE A CA   1  
ATOM   2591   C C    C PHE A 1 339 ? 14.402  27.526  36.159 0.05  0.00 ? 339 PHE A C    1  
ATOM   2592   C C    O PHE A 1 339 ? 22.264  19.242  50.093 0.95  0.00 ? 339 PHE A C    1  
ATOM   2593   O O    C PHE A 1 339 ? 15.083  27.568  35.120 0.05  0.00 ? 339 PHE A O    1  
ATOM   2594   O O    O PHE A 1 339 ? 23.407  18.976  49.683 0.95  0.00 ? 339 PHE A O    1  
ATOM   2595   H H    C PHE A 1 339 ? 13.802  28.726  39.041 0.05  0.00 ? 339 PHE A H    1  
ATOM   2596   H H    O PHE A 1 339 ? 20.437  20.452  52.396 0.95  0.00 ? 339 PHE A H    1  
ATOM   2597   N N    C TRP A 1 340 ? 13.153  27.144  36.140 0.05  0.00 ? 340 TRP A N    1  
ATOM   2598   N N    O TRP A 1 340 ? 21.300  19.553  49.268 0.95  0.00 ? 340 TRP A N    1  
ATOM   2599   C CA   C TRP A 1 340 ? 12.540  26.667  34.905 0.05  0.00 ? 340 TRP A CA   1  
ATOM   2600   C CA   O TRP A 1 340 ? 21.514  19.510  47.825 0.95  0.00 ? 340 TRP A CA   1  
ATOM   2601   C C    C TRP A 1 340 ? 12.687  27.667  33.776 0.05  0.00 ? 340 TRP A C    1  
ATOM   2602   C C    O TRP A 1 340 ? 22.708  20.344  47.404 0.95  0.00 ? 340 TRP A C    1  
ATOM   2603   O O    C TRP A 1 340 ? 13.207  27.343  32.700 0.05  0.00 ? 340 TRP A O    1  
ATOM   2604   O O    O TRP A 1 340 ? 23.633  19.848  46.748 0.95  0.00 ? 340 TRP A O    1  
ATOM   2605   H H    C TRP A 1 340 ? 12.631  27.151  36.970 0.05  0.00 ? 340 TRP A H    1  
ATOM   2606   H H    O TRP A 1 340 ? 20.417  19.789  49.621 0.95  0.00 ? 340 TRP A H    1  
ATOM   2607   N N    C TYR A 1 341 ? 12.180  28.881  34.038 0.05  0.00 ? 341 TYR A N    1  
ATOM   2608   N N    O TYR A 1 341 ? 22.642  21.633  47.767 0.95  0.00 ? 341 TYR A N    1  
ATOM   2609   C CA   C TYR A 1 341 ? 12.218  29.939  33.005 0.05  0.00 ? 341 TYR A CA   1  
ATOM   2610   C CA   O TYR A 1 341 ? 23.722  22.568  47.381 0.95  0.00 ? 341 TYR A CA   1  
ATOM   2611   C C    C TYR A 1 341 ? 13.629  30.301  32.624 0.05  0.00 ? 341 TYR A C    1  
ATOM   2612   C C    O TYR A 1 341 ? 25.045  22.175  47.982 0.95  0.00 ? 341 TYR A C    1  
ATOM   2613   O O    C TYR A 1 341 ? 13.883  30.390  31.410 0.05  0.00 ? 341 TYR A O    1  
ATOM   2614   O O    O TYR A 1 341 ? 26.033  22.175  47.226 0.95  0.00 ? 341 TYR A O    1  
ATOM   2615   H H    C TYR A 1 341 ? 11.760  29.058  34.904 0.05  0.00 ? 341 TYR A H    1  
ATOM   2616   H H    O TYR A 1 341 ? 21.865  21.962  48.264 0.95  0.00 ? 341 TYR A H    1  
ATOM   2617   N N    C ALA A 1 342 ? 14.523  30.525  33.549 0.05  0.00 ? 342 ALA A N    1  
ATOM   2618   N N    O ALA A 1 342 ? 25.128  21.870  49.249 0.95  0.00 ? 342 ALA A N    1  
ATOM   2619   C CA   C ALA A 1 342 ? 15.887  30.898  33.262 0.05  0.00 ? 342 ALA A CA   1  
ATOM   2620   C CA   O ALA A 1 342 ? 26.363  21.506  49.900 0.95  0.00 ? 342 ALA A CA   1  
ATOM   2621   C C    C ALA A 1 342 ? 16.667  29.895  32.413 0.05  0.00 ? 342 ALA A C    1  
ATOM   2622   C C    O ALA A 1 342 ? 27.068  20.284  49.313 0.95  0.00 ? 342 ALA A C    1  
ATOM   2623   O O    C ALA A 1 342 ? 17.334  30.251  31.418 0.05  0.00 ? 342 ALA A O    1  
ATOM   2624   O O    O ALA A 1 342 ? 28.288  20.293  49.042 0.95  0.00 ? 342 ALA A O    1  
ATOM   2625   H H    C ALA A 1 342 ? 14.249  30.451  34.487 0.05  0.00 ? 342 ALA A H    1  
ATOM   2626   H H    O ALA A 1 342 ? 24.311  21.905  49.789 0.95  0.00 ? 342 ALA A H    1  
ATOM   2627   N N    C VAL A 1 343 ? 16.707  28.679  32.904 0.05  0.00 ? 343 VAL A N    1  
ATOM   2628   N N    O VAL A 1 343 ? 26.333  19.198  49.271 0.95  0.00 ? 343 VAL A N    1  
ATOM   2629   C CA   C VAL A 1 343 ? 17.415  27.570  32.212 0.05  0.00 ? 343 VAL A CA   1  
ATOM   2630   C CA   O VAL A 1 343 ? 26.850  17.915  48.727 0.95  0.00 ? 343 VAL A CA   1  
ATOM   2631   C C    C VAL A 1 343 ? 16.722  27.286  30.878 0.05  0.00 ? 343 VAL A C    1  
ATOM   2632   C C    O VAL A 1 343 ? 27.144  18.084  47.235 0.95  0.00 ? 343 VAL A C    1  
ATOM   2633   O O    C VAL A 1 343 ? 17.391  26.998  29.854 0.05  0.00 ? 343 VAL A O    1  
ATOM   2634   O O    O VAL A 1 343 ? 28.149  17.540  46.712 0.95  0.00 ? 343 VAL A O    1  
ATOM   2635   H H    C VAL A 1 343 ? 16.252  28.495  33.753 0.05  0.00 ? 343 VAL A H    1  
ATOM   2636   H H    O VAL A 1 343 ? 25.413  19.235  49.606 0.95  0.00 ? 343 VAL A H    1  
ATOM   2637   N N    C ARG A 1 344 ? 15.424  27.441  30.795 0.05  0.00 ? 344 ARG A N    1  
ATOM   2638   N N    O ARG A 1 344 ? 26.385  18.883  46.527 0.95  0.00 ? 344 ARG A N    1  
ATOM   2639   C CA   C ARG A 1 344 ? 14.723  27.212  29.516 0.05  0.00 ? 344 ARG A CA   1  
ATOM   2640   C CA   O ARG A 1 344 ? 26.659  19.101  45.093 0.95  0.00 ? 344 ARG A CA   1  
ATOM   2641   C C    C ARG A 1 344 ? 15.297  28.143  28.448 0.05  0.00 ? 344 ARG A C    1  
ATOM   2642   C C    O ARG A 1 344 ? 28.074  19.654  44.924 0.95  0.00 ? 344 ARG A C    1  
ATOM   2643   O O    C ARG A 1 344 ? 15.713  27.778  27.337 0.05  0.00 ? 344 ARG A O    1  
ATOM   2644   O O    O ARG A 1 344 ? 28.937  19.177  44.171 0.95  0.00 ? 344 ARG A O    1  
ATOM   2645   H H    C ARG A 1 344 ? 14.917  27.734  31.580 0.05  0.00 ? 344 ARG A H    1  
ATOM   2646   H H    O ARG A 1 344 ? 25.645  19.359  46.958 0.95  0.00 ? 344 ARG A H    1  
ATOM   2647   N N    C THR A 1 345 ? 15.385  29.405  28.860 0.05  0.00 ? 345 THR A N    1  
ATOM   2648   N N    O THR A 1 345 ? 28.328  20.674  45.739 0.95  0.00 ? 345 THR A N    1  
ATOM   2649   C CA   C THR A 1 345 ? 15.931  30.479  28.020 0.05  0.00 ? 345 THR A CA   1  
ATOM   2650   C CA   O THR A 1 345 ? 29.629  21.355  45.780 0.95  0.00 ? 345 THR A CA   1  
ATOM   2651   C C    C THR A 1 345 ? 17.383  30.256  27.726 0.05  0.00 ? 345 THR A C    1  
ATOM   2652   C C    O THR A 1 345 ? 30.710  20.435  46.259 0.95  0.00 ? 345 THR A C    1  
ATOM   2653   O O    C THR A 1 345 ? 17.757  30.332  26.540 0.05  0.00 ? 345 THR A O    1  
ATOM   2654   O O    O THR A 1 345 ? 31.755  20.361  45.584 0.95  0.00 ? 345 THR A O    1  
ATOM   2655   H H    C THR A 1 345 ? 15.091  29.623  29.768 0.05  0.00 ? 345 THR A H    1  
ATOM   2656   H H    O THR A 1 345 ? 27.623  20.972  46.351 0.95  0.00 ? 345 THR A H    1  
ATOM   2657   N N    C ALA A 1 346 ? 18.221  29.966  28.671 0.05  0.00 ? 346 ALA A N    1  
ATOM   2658   N N    O ALA A 1 346 ? 30.554  19.716  47.326 0.95  0.00 ? 346 ALA A N    1  
ATOM   2659   C CA   C ALA A 1 346 ? 19.637  29.737  28.442 0.05  0.00 ? 346 ALA A CA   1  
ATOM   2660   C CA   O ALA A 1 346 ? 31.567  18.807  47.832 0.95  0.00 ? 346 ALA A CA   1  
ATOM   2661   C C    C ALA A 1 346 ? 19.898  28.688  27.366 0.05  0.00 ? 346 ALA A C    1  
ATOM   2662   C C    O ALA A 1 346 ? 32.054  17.820  46.776 0.95  0.00 ? 346 ALA A C    1  
ATOM   2663   O O    C ALA A 1 346 ? 20.817  28.847  26.542 0.05  0.00 ? 346 ALA A O    1  
ATOM   2664   O O    O ALA A 1 346 ? 33.261  17.523  46.701 0.95  0.00 ? 346 ALA A O    1  
ATOM   2665   H H    C ALA A 1 346 ? 17.881  29.896  29.588 0.05  0.00 ? 346 ALA A H    1  
ATOM   2666   H H    O ALA A 1 346 ? 29.708  19.789  47.816 0.95  0.00 ? 346 ALA A H    1  
ATOM   2667   N N    C VAL A 1 347 ? 19.127  27.609  27.393 0.05  0.00 ? 347 VAL A N    1  
ATOM   2668   N N    O VAL A 1 347 ? 31.127  17.286  45.993 0.95  0.00 ? 347 VAL A N    1  
ATOM   2669   C CA   C VAL A 1 347 ? 19.366  26.511  26.441 0.05  0.00 ? 347 VAL A CA   1  
ATOM   2670   C CA   O VAL A 1 347 ? 31.501  16.263  45.002 0.95  0.00 ? 347 VAL A CA   1  
ATOM   2671   C C    C VAL A 1 347 ? 18.924  26.863  25.034 0.05  0.00 ? 347 VAL A C    1  
ATOM   2672   C C    O VAL A 1 347 ? 32.243  16.853  43.819 0.95  0.00 ? 347 VAL A C    1  
ATOM   2673   O O    C VAL A 1 347 ? 19.672  26.552  24.078 0.05  0.00 ? 347 VAL A O    1  
ATOM   2674   O O    O VAL A 1 347 ? 33.249  16.246  43.382 0.95  0.00 ? 347 VAL A O    1  
ATOM   2675   H H    C VAL A 1 347 ? 18.436  27.520  28.081 0.05  0.00 ? 347 VAL A H    1  
ATOM   2676   H H    O VAL A 1 347 ? 30.186  17.532  46.112 0.95  0.00 ? 347 VAL A H    1  
ATOM   2677   N N    C ILE A 1 348 ? 17.760  27.454  24.896 0.05  0.00 ? 348 ILE A N    1  
ATOM   2678   N N    O ILE A 1 348 ? 31.769  17.961  43.299 0.95  0.00 ? 348 ILE A N    1  
ATOM   2679   C CA   C ILE A 1 348 ? 17.257  27.815  23.549 0.05  0.00 ? 348 ILE A CA   1  
ATOM   2680   C CA   O ILE A 1 348 ? 32.434  18.587  42.131 0.95  0.00 ? 348 ILE A CA   1  
ATOM   2681   C C    C ILE A 1 348 ? 18.189  28.854  22.927 0.05  0.00 ? 348 ILE A C    1  
ATOM   2682   C C    O ILE A 1 348 ? 33.840  19.030  42.534 0.95  0.00 ? 348 ILE A C    1  
ATOM   2683   O O    C ILE A 1 348 ? 18.385  28.829  21.724 0.05  0.00 ? 348 ILE A O    1  
ATOM   2684   O O    O ILE A 1 348 ? 34.740  18.962  41.714 0.95  0.00 ? 348 ILE A O    1  
ATOM   2685   H H    C ILE A 1 348 ? 17.216  27.650  25.688 0.05  0.00 ? 348 ILE A H    1  
ATOM   2686   H H    O ILE A 1 348 ? 30.964  18.372  43.679 0.95  0.00 ? 348 ILE A H    1  
ATOM   2687   N N    C ASN A 1 349 ? 18.762  29.716  23.725 0.05  0.00 ? 349 ASN A N    1  
ATOM   2688   N N    O ASN A 1 349 ? 34.023  19.443  43.761 0.95  0.00 ? 349 ASN A N    1  
ATOM   2689   C CA   C ASN A 1 349 ? 19.640  30.789  23.322 0.05  0.00 ? 349 ASN A CA   1  
ATOM   2690   C CA   O ASN A 1 349 ? 35.263  19.934  44.313 0.95  0.00 ? 349 ASN A CA   1  
ATOM   2691   C C    C ASN A 1 349 ? 20.977  30.255  22.888 0.05  0.00 ? 349 ASN A C    1  
ATOM   2692   C C    O ASN A 1 349 ? 36.244  18.811  44.511 0.95  0.00 ? 349 ASN A C    1  
ATOM   2693   O O    C ASN A 1 349 ? 21.411  30.719  21.830 0.05  0.00 ? 349 ASN A O    1  
ATOM   2694   O O    O ASN A 1 349 ? 37.389  19.035  44.106 0.95  0.00 ? 349 ASN A O    1  
ATOM   2695   H H    C ASN A 1 349 ? 18.556  29.644  24.680 0.05  0.00 ? 349 ASN A H    1  
ATOM   2696   H H    O ASN A 1 349 ? 33.241  19.444  44.351 0.95  0.00 ? 349 ASN A H    1  
ATOM   2697   N N    C ALA A 1 350 ? 21.567  29.404  23.688 0.05  0.00 ? 350 ALA A N    1  
ATOM   2698   N N    O ALA A 1 350 ? 35.812  17.744  45.132 0.95  0.00 ? 350 ALA A N    1  
ATOM   2699   C CA   C ALA A 1 350 ? 22.853  28.806  23.359 0.05  0.00 ? 350 ALA A CA   1  
ATOM   2700   C CA   O ALA A 1 350 ? 36.667  16.588  45.360 0.95  0.00 ? 350 ALA A CA   1  
ATOM   2701   C C    C ALA A 1 350 ? 22.744  27.914  22.119 0.05  0.00 ? 350 ALA A C    1  
ATOM   2702   C C    O ALA A 1 350 ? 37.070  15.933  44.036 0.95  0.00 ? 350 ALA A C    1  
ATOM   2703   O O    C ALA A 1 350 ? 23.714  27.809  21.359 0.05  0.00 ? 350 ALA A O    1  
ATOM   2704   O O    O ALA A 1 350 ? 38.173  15.380  43.942 0.95  0.00 ? 350 ALA A O    1  
ATOM   2705   H H    C ALA A 1 350 ? 21.125  29.152  24.524 0.05  0.00 ? 350 ALA A H    1  
ATOM   2706   H H    O ALA A 1 350 ? 34.883  17.717  45.440 0.95  0.00 ? 350 ALA A H    1  
ATOM   2707   N N    C ALA A 1 351 ? 21.634  27.268  21.952 0.05  0.00 ? 351 ALA A N    1  
ATOM   2708   N N    O ALA A 1 351 ? 36.199  15.952  43.078 0.95  0.00 ? 351 ALA A N    1  
ATOM   2709   C CA   C ALA A 1 351 ? 21.314  26.324  20.895 0.05  0.00 ? 351 ALA A CA   1  
ATOM   2710   C CA   O ALA A 1 351 ? 36.323  15.352  41.761 0.95  0.00 ? 351 ALA A CA   1  
ATOM   2711   C C    C ALA A 1 351 ? 21.100  26.977  19.532 0.05  0.00 ? 351 ALA A C    1  
ATOM   2712   C C    O ALA A 1 351 ? 37.299  16.082  40.842 0.95  0.00 ? 351 ALA A C    1  
ATOM   2713   O O    C ALA A 1 351 ? 21.434  26.358  18.505 0.05  0.00 ? 351 ALA A O    1  
ATOM   2714   O O    O ALA A 1 351 ? 37.961  15.425  40.017 0.95  0.00 ? 351 ALA A O    1  
ATOM   2715   H H    C ALA A 1 351 ? 20.945  27.402  22.636 0.05  0.00 ? 351 ALA A H    1  
ATOM   2716   H H    O ALA A 1 351 ? 35.344  16.389  43.276 0.95  0.00 ? 351 ALA A H    1  
ATOM   2717   N N    C SER A 1 352 ? 20.496  28.131  19.568 0.05  0.00 ? 352 SER A N    1  
ATOM   2718   N N    O SER A 1 352 ? 37.293  17.379  40.959 0.95  0.00 ? 352 SER A N    1  
ATOM   2719   C CA   C SER A 1 352 ? 20.188  28.927  18.394 0.05  0.00 ? 352 SER A CA   1  
ATOM   2720   C CA   O SER A 1 352 ? 38.136  18.272  40.185 0.95  0.00 ? 352 SER A CA   1  
ATOM   2721   C C    C SER A 1 352 ? 21.289  29.917  18.068 0.05  0.00 ? 352 SER A C    1  
ATOM   2722   C C    O SER A 1 352 ? 39.446  18.574  40.886 0.95  0.00 ? 352 SER A C    1  
ATOM   2723   O O    C SER A 1 352 ? 21.066  30.743  17.162 0.05  0.00 ? 352 SER A O    1  
ATOM   2724   O O    O SER A 1 352 ? 40.184  19.437  40.373 0.95  0.00 ? 352 SER A O    1  
ATOM   2725   H H    C SER A 1 352 ? 20.234  28.484  20.444 0.05  0.00 ? 352 SER A H    1  
ATOM   2726   H H    O SER A 1 352 ? 36.680  17.778  41.612 0.95  0.00 ? 352 SER A H    1  
ATOM   2727   N N    C GLY A 1 353 ? 22.417  29.926  18.736 0.05  0.00 ? 353 GLY A N    1  
ATOM   2728   N N    O GLY A 1 353 ? 39.773  17.976  42.006 0.95  0.00 ? 353 GLY A N    1  
ATOM   2729   C CA   C GLY A 1 353 ? 23.528  30.820  18.507 0.05  0.00 ? 353 GLY A CA   1  
ATOM   2730   C CA   O GLY A 1 353 ? 40.992  18.186  42.752 0.95  0.00 ? 353 GLY A CA   1  
ATOM   2731   C C    C GLY A 1 353 ? 23.324  32.239  19.023 0.05  0.00 ? 353 GLY A C    1  
ATOM   2732   C C    O GLY A 1 353 ? 41.040  19.486  43.546 0.95  0.00 ? 353 GLY A C    1  
ATOM   2733   O O    C GLY A 1 353 ? 24.281  33.049  19.048 0.05  0.00 ? 353 GLY A O    1  
ATOM   2734   O O    O GLY A 1 353 ? 41.961  19.692  44.372 0.95  0.00 ? 353 GLY A O    1  
ATOM   2735   H H    C GLY A 1 353 ? 22.517  29.266  19.453 0.05  0.00 ? 353 GLY A H    1  
ATOM   2736   H H    O GLY A 1 353 ? 39.135  17.327  42.369 0.95  0.00 ? 353 GLY A H    1  
ATOM   2737   N N    C ARG A 1 354 ? 22.117  32.545  19.423 0.05  0.00 ? 354 ARG A N    1  
ATOM   2738   N N    O ARG A 1 354 ? 40.084  20.348  43.310 0.95  0.00 ? 354 ARG A N    1  
ATOM   2739   C CA   C ARG A 1 354 ? 21.716  33.860  19.965 0.05  0.00 ? 354 ARG A CA   1  
ATOM   2740   C CA   O ARG A 1 354 ? 39.946  21.658  43.979 0.95  0.00 ? 354 ARG A CA   1  
ATOM   2741   C C    C ARG A 1 354 ? 22.626  34.292  21.108 0.05  0.00 ? 354 ARG A C    1  
ATOM   2742   C C    O ARG A 1 354 ? 39.975  21.514  45.496 0.95  0.00 ? 354 ARG A C    1  
ATOM   2743   O O    C ARG A 1 354 ? 22.760  35.521  21.348 0.05  0.00 ? 354 ARG A O    1  
ATOM   2744   O O    O ARG A 1 354 ? 40.358  22.490  46.193 0.95  0.00 ? 354 ARG A O    1  
ATOM   2745   H H    C ARG A 1 354 ? 21.429  31.849  19.366 0.05  0.00 ? 354 ARG A H    1  
ATOM   2746   H H    O ARG A 1 354 ? 39.406  20.104  42.645 0.95  0.00 ? 354 ARG A H    1  
ATOM   2747   N N    C GLN A 1 355 ? 23.282  33.358  21.786 0.05  0.00 ? 355 GLN A N    1  
ATOM   2748   N N    O GLN A 1 355 ? 39.634  20.347  46.030 0.95  0.00 ? 355 GLN A N    1  
ATOM   2749   C CA   C GLN A 1 355 ? 24.205  33.710  22.898 0.05  0.00 ? 355 GLN A CA   1  
ATOM   2750   C CA   O GLN A 1 355 ? 39.662  20.129  47.501 0.95  0.00 ? 355 GLN A CA   1  
ATOM   2751   C C    C GLN A 1 355 ? 25.214  32.579  23.019 0.05  0.00 ? 355 GLN A C    1  
ATOM   2752   C C    O GLN A 1 355 ? 39.846  18.637  47.730 0.95  0.00 ? 355 GLN A C    1  
ATOM   2753   O O    C GLN A 1 355 ? 24.910  31.490  22.506 0.05  0.00 ? 355 GLN A O    1  
ATOM   2754   O O    O GLN A 1 355 ? 39.577  17.880  46.784 0.95  0.00 ? 355 GLN A O    1  
ATOM   2755   H H    C GLN A 1 355 ? 23.166  32.417  21.539 0.05  0.00 ? 355 GLN A H    1  
ATOM   2756   H H    O GLN A 1 355 ? 39.373  19.609  45.441 0.95  0.00 ? 355 GLN A H    1  
ATOM   2757   N N    C THR A 1 356 ? 26.357  32.801  23.613 0.05  0.00 ? 356 THR A N    1  
ATOM   2758   N N    O THR A 1 356 ? 40.309  18.218  48.879 0.95  0.00 ? 356 THR A N    1  
ATOM   2759   C CA   C THR A 1 356 ? 27.370  31.762  23.807 0.05  0.00 ? 356 THR A CA   1  
ATOM   2760   C CA   O THR A 1 356 ? 40.482  16.800  49.199 0.95  0.00 ? 356 THR A CA   1  
ATOM   2761   C C    C THR A 1 356 ? 26.988  30.983  25.082 0.05  0.00 ? 356 THR A C    1  
ATOM   2762   C C    O THR A 1 356 ? 39.118  16.270  49.684 0.95  0.00 ? 356 THR A C    1  
ATOM   2763   O O    C THR A 1 356 ? 26.085  31.424  25.819 0.05  0.00 ? 356 THR A O    1  
ATOM   2764   O O    O THR A 1 356 ? 38.198  17.077  49.917 0.95  0.00 ? 356 THR A O    1  
ATOM   2765   H H    C THR A 1 356 ? 26.534  33.698  23.965 0.05  0.00 ? 356 THR A H    1  
ATOM   2766   H H    O THR A 1 356 ? 40.528  18.882  49.565 0.95  0.00 ? 356 THR A H    1  
ATOM   2767   N N    C VAL A 1 357 ? 27.665  29.878  25.303 0.05  0.00 ? 357 VAL A N    1  
ATOM   2768   N N    O VAL A 1 357 ? 39.025  14.966  49.820 0.95  0.00 ? 357 VAL A N    1  
ATOM   2769   C CA   C VAL A 1 357 ? 27.413  29.003  26.450 0.05  0.00 ? 357 VAL A CA   1  
ATOM   2770   C CA   O VAL A 1 357 ? 37.795  14.292  50.243 0.95  0.00 ? 357 VAL A CA   1  
ATOM   2771   C C    C VAL A 1 357 ? 27.732  29.740  27.752 0.05  0.00 ? 357 VAL A C    1  
ATOM   2772   C C    O VAL A 1 357 ? 37.436  14.705  51.671 0.95  0.00 ? 357 VAL A C    1  
ATOM   2773   O O    C VAL A 1 357 ? 26.938  29.765  28.696 0.05  0.00 ? 357 VAL A O    1  
ATOM   2774   O O    O VAL A 1 357 ? 36.303  15.091  51.971 0.95  0.00 ? 357 VAL A O    1  
ATOM   2775   H H    C VAL A 1 357 ? 28.358  29.618  24.660 0.05  0.00 ? 357 VAL A H    1  
ATOM   2776   H H    O VAL A 1 357 ? 39.810  14.417  49.610 0.95  0.00 ? 357 VAL A H    1  
ATOM   2777   N N    C ASP A 1 358 ? 28.898  30.325  27.750 0.05  0.00 ? 358 ASP A N    1  
ATOM   2778   N N    O ASP A 1 358 ? 38.432  14.612  52.509 0.95  0.00 ? 358 ASP A N    1  
ATOM   2779   C CA   C ASP A 1 358 ? 29.388  31.116  28.881 0.05  0.00 ? 358 ASP A CA   1  
ATOM   2780   C CA   O ASP A 1 358 ? 38.318  14.991  53.919 0.95  0.00 ? 358 ASP A CA   1  
ATOM   2781   C C    C ASP A 1 358 ? 28.401  32.239  29.238 0.05  0.00 ? 358 ASP A C    1  
ATOM   2782   C C    O ASP A 1 358 ? 37.836  16.444  54.063 0.95  0.00 ? 358 ASP A C    1  
ATOM   2783   O O    C ASP A 1 358 ? 28.205  32.492  30.436 0.05  0.00 ? 358 ASP A O    1  
ATOM   2784   O O    O ASP A 1 358 ? 37.023  16.708  54.960 0.95  0.00 ? 358 ASP A O    1  
ATOM   2785   H H    C ASP A 1 358 ? 29.459  30.252  26.950 0.05  0.00 ? 358 ASP A H    1  
ATOM   2786   H H    O ASP A 1 358 ? 39.298  14.298  52.175 0.95  0.00 ? 358 ASP A H    1  
ATOM   2787   N N    C GLU A 1 359 ? 27.847  32.886  28.255 0.05  0.00 ? 359 GLU A N    1  
ATOM   2788   N N    O GLU A 1 359 ? 38.337  17.326  53.248 0.95  0.00 ? 359 GLU A N    1  
ATOM   2789   C CA   C GLU A 1 359 ? 26.915  33.994  28.350 0.05  0.00 ? 359 GLU A CA   1  
ATOM   2790   C CA   O GLU A 1 359 ? 38.056  18.749  53.217 0.95  0.00 ? 359 GLU A CA   1  
ATOM   2791   C C    C GLU A 1 359 ? 25.537  33.557  28.807 0.05  0.00 ? 359 GLU A C    1  
ATOM   2792   C C    O GLU A 1 359 ? 36.678  19.057  52.665 0.95  0.00 ? 359 GLU A C    1  
ATOM   2793   O O    C GLU A 1 359 ? 24.944  34.113  29.743 0.05  0.00 ? 359 GLU A O    1  
ATOM   2794   O O    O GLU A 1 359 ? 35.879  19.796  53.258 0.95  0.00 ? 359 GLU A O    1  
ATOM   2795   H H    C GLU A 1 359 ? 28.100  32.606  27.351 0.05  0.00 ? 359 GLU A H    1  
ATOM   2796   H H    O GLU A 1 359 ? 38.989  16.996  52.595 0.95  0.00 ? 359 GLU A H    1  
ATOM   2797   N N    C ALA A 1 360 ? 25.017  32.586  28.074 0.05  0.00 ? 360 ALA A N    1  
ATOM   2798   N N    O ALA A 1 360 ? 36.449  18.521  51.477 0.95  0.00 ? 360 ALA A N    1  
ATOM   2799   C CA   C ALA A 1 360 ? 23.696  32.001  28.334 0.05  0.00 ? 360 ALA A CA   1  
ATOM   2800   C CA   O ALA A 1 360 ? 35.182  18.682  50.752 0.95  0.00 ? 360 ALA A CA   1  
ATOM   2801   C C    C ALA A 1 360 ? 23.559  31.514  29.779 0.05  0.00 ? 360 ALA A C    1  
ATOM   2802   C C    O ALA A 1 360 ? 33.978  18.270  51.604 0.95  0.00 ? 360 ALA A C    1  
ATOM   2803   O O    C ALA A 1 360 ? 22.518  31.768  30.393 0.05  0.00 ? 360 ALA A O    1  
ATOM   2804   O O    O ALA A 1 360 ? 32.977  18.993  51.602 0.95  0.00 ? 360 ALA A O    1  
ATOM   2805   H H    C ALA A 1 360 ? 25.542  32.237  27.323 0.05  0.00 ? 360 ALA A H    1  
ATOM   2806   H H    O ALA A 1 360 ? 37.159  17.987  51.062 0.95  0.00 ? 360 ALA A H    1  
ATOM   2807   N N    C LEU A 1 361 ? 24.583  30.837  30.282 0.05  0.00 ? 361 LEU A N    1  
ATOM   2808   N N    O LEU A 1 361 ? 34.092  17.144  52.296 0.95  0.00 ? 361 LEU A N    1  
ATOM   2809   C CA   C LEU A 1 361 ? 24.526  30.303  31.639 0.05  0.00 ? 361 LEU A CA   1  
ATOM   2810   C CA   O LEU A 1 361 ? 32.981  16.655  53.106 0.95  0.00 ? 361 LEU A CA   1  
ATOM   2811   C C    C LEU A 1 361 ? 24.806  31.371  32.672 0.05  0.00 ? 361 LEU A C    1  
ATOM   2812   C C    O LEU A 1 361 ? 32.891  17.383  54.428 0.95  0.00 ? 361 LEU A C    1  
ATOM   2813   O O    C LEU A 1 361 ? 24.173  31.298  33.738 0.05  0.00 ? 361 LEU A O    1  
ATOM   2814   O O    O LEU A 1 361 ? 31.751  17.597  54.872 0.95  0.00 ? 361 LEU A O    1  
ATOM   2815   H H    C LEU A 1 361 ? 25.376  30.673  29.728 0.05  0.00 ? 361 LEU A H    1  
ATOM   2816   H H    O LEU A 1 361 ? 34.921  16.623  52.242 0.95  0.00 ? 361 LEU A H    1  
ATOM   2817   N N    C LYS A 1 362 ? 25.714  32.264  32.364 0.05  0.00 ? 362 LYS A N    1  
ATOM   2818   N N    O LYS A 1 362 ? 34.024  17.700  55.004 0.95  0.00 ? 362 LYS A N    1  
ATOM   2819   C CA   C LYS A 1 362 ? 26.028  33.363  33.322 0.05  0.00 ? 362 LYS A CA   1  
ATOM   2820   C CA   O LYS A 1 362 ? 34.017  18.441  56.298 0.95  0.00 ? 362 LYS A CA   1  
ATOM   2821   C C    C LYS A 1 362 ? 24.727  34.112  33.607 0.05  0.00 ? 362 LYS A C    1  
ATOM   2822   C C    O LYS A 1 362 ? 33.235  19.736  56.083 0.95  0.00 ? 362 LYS A C    1  
ATOM   2823   O O    C LYS A 1 362 ? 24.422  34.339  34.794 0.05  0.00 ? 362 LYS A O    1  
ATOM   2824   O O    O LYS A 1 362 ? 32.346  20.034  56.905 0.95  0.00 ? 362 LYS A O    1  
ATOM   2825   H H    C LYS A 1 362 ? 26.173  32.219  31.501 0.05  0.00 ? 362 LYS A H    1  
ATOM   2826   H H    O LYS A 1 362 ? 34.874  17.465  54.578 0.95  0.00 ? 362 LYS A H    1  
ATOM   2827   N N    C ASP A 1 363 ? 23.943  34.437  32.606 0.05  0.00 ? 363 ASP A N    1  
ATOM   2828   N N    O ASP A 1 363 ? 33.476  20.460  55.015 0.95  0.00 ? 363 ASP A N    1  
ATOM   2829   C CA   C ASP A 1 363 ? 22.684  35.125  32.697 0.05  0.00 ? 363 ASP A CA   1  
ATOM   2830   C CA   O ASP A 1 363 ? 32.825  21.690  54.653 0.95  0.00 ? 363 ASP A CA   1  
ATOM   2831   C C    C ASP A 1 363 ? 21.649  34.379  33.549 0.05  0.00 ? 363 ASP A C    1  
ATOM   2832   C C    O ASP A 1 363 ? 31.308  21.540  54.476 0.95  0.00 ? 363 ASP A C    1  
ATOM   2833   O O    C ASP A 1 363 ? 20.966  34.980  34.376 0.05  0.00 ? 363 ASP A O    1  
ATOM   2834   O O    O ASP A 1 363 ? 30.536  22.368  54.954 0.95  0.00 ? 363 ASP A O    1  
ATOM   2835   H H    C ASP A 1 363 ? 24.240  34.177  31.708 0.05  0.00 ? 363 ASP A H    1  
ATOM   2836   H H    O ASP A 1 363 ? 34.160  20.124  54.398 0.95  0.00 ? 363 ASP A H    1  
ATOM   2837   N N    C ALA A 1 364 ? 21.481  33.114  33.241 0.05  0.00 ? 364 ALA A N    1  
ATOM   2838   N N    O ALA A 1 364 ? 30.933  20.553  53.696 0.95  0.00 ? 364 ALA A N    1  
ATOM   2839   C CA   C ALA A 1 364 ? 20.517  32.258  33.947 0.05  0.00 ? 364 ALA A CA   1  
ATOM   2840   C CA   O ALA A 1 364 ? 29.518  20.280  53.406 0.95  0.00 ? 364 ALA A CA   1  
ATOM   2841   C C    C ALA A 1 364 ? 20.870  32.203  35.427 0.05  0.00 ? 364 ALA A C    1  
ATOM   2842   C C    O ALA A 1 364 ? 28.777  19.987  54.704 0.95  0.00 ? 364 ALA A C    1  
ATOM   2843   O O    C ALA A 1 364 ? 19.975  32.350  36.249 0.05  0.00 ? 364 ALA A O    1  
ATOM   2844   O O    O ALA A 1 364 ? 27.700  20.534  54.900 0.95  0.00 ? 364 ALA A O    1  
ATOM   2845   H H    C ALA A 1 364 ? 22.006  32.731  32.509 0.05  0.00 ? 364 ALA A H    1  
ATOM   2846   H H    O ALA A 1 364 ? 31.618  19.988  53.284 0.95  0.00 ? 364 ALA A H    1  
ATOM   2847   N N    C GLN A 1 365 ? 22.126  31.997  35.731 0.05  0.00 ? 365 GLN A N    1  
ATOM   2848   N N    O GLN A 1 365 ? 29.347  19.155  55.538 0.95  0.00 ? 365 GLN A N    1  
ATOM   2849   C CA   C GLN A 1 365 ? 22.632  31.956  37.106 0.05  0.00 ? 365 GLN A CA   1  
ATOM   2850   C CA   O GLN A 1 365 ? 28.782  18.801  56.844 0.95  0.00 ? 365 GLN A CA   1  
ATOM   2851   C C    C GLN A 1 365 ? 22.192  33.252  37.821 0.05  0.00 ? 365 GLN A C    1  
ATOM   2852   C C    O GLN A 1 365 ? 28.498  20.107  57.617 0.95  0.00 ? 365 GLN A C    1  
ATOM   2853   O O    C GLN A 1 365 ? 21.712  33.247  38.956 0.05  0.00 ? 365 GLN A O    1  
ATOM   2854   O O    O GLN A 1 365 ? 27.442  20.298  58.221 0.95  0.00 ? 365 GLN A O    1  
ATOM   2855   H H    C GLN A 1 365 ? 22.766  31.889  34.997 0.05  0.00 ? 365 GLN A H    1  
ATOM   2856   H H    O GLN A 1 365 ? 30.211  18.768  55.286 0.95  0.00 ? 365 GLN A H    1  
ATOM   2857   N N    C THR A 1 366 ? 22.384  34.348  37.124 0.05  0.00 ? 366 THR A N    1  
ATOM   2858   N N    O THR A 1 366 ? 29.478  20.980  57.584 0.95  0.00 ? 366 THR A N    1  
ATOM   2859   C CA   C THR A 1 366 ? 22.028  35.685  37.585 0.05  0.00 ? 366 THR A CA   1  
ATOM   2860   C CA   O THR A 1 366 ? 29.430  22.290  58.224 0.95  0.00 ? 366 THR A CA   1  
ATOM   2861   C C    C THR A 1 366 ? 20.557  35.803  37.903 0.05  0.00 ? 366 THR A C    1  
ATOM   2862   C C    O THR A 1 366 ? 28.282  23.129  57.716 0.95  0.00 ? 366 THR A C    1  
ATOM   2863   O O    C THR A 1 366 ? 20.265  36.266  39.021 0.05  0.00 ? 366 THR A O    1  
ATOM   2864   O O    O THR A 1 366 ? 27.533  23.626  58.576 0.95  0.00 ? 366 THR A O    1  
ATOM   2865   H H    C THR A 1 366 ? 22.781  34.261  36.233 0.05  0.00 ? 366 THR A H    1  
ATOM   2866   H H    O THR A 1 366 ? 30.288  20.742  57.088 0.95  0.00 ? 366 THR A H    1  
ATOM   2867   N N    C ARG A 1 367 ? 19.656  35.416  37.043 0.05  0.00 ? 367 ARG A N    1  
ATOM   2868   N N    O ARG A 1 367 ? 28.093  23.294  56.436 0.95  0.00 ? 367 ARG A N    1  
ATOM   2869   C CA   C ARG A 1 367 ? 18.231  35.502  37.274 0.05  0.00 ? 367 ARG A CA   1  
ATOM   2870   C CA   O ARG A 1 367 ? 27.021  24.086  55.875 0.95  0.00 ? 367 ARG A CA   1  
ATOM   2871   C C    C ARG A 1 367 ? 17.682  34.609  38.372 0.05  0.00 ? 367 ARG A C    1  
ATOM   2872   C C    O ARG A 1 367 ? 25.617  23.551  56.093 0.95  0.00 ? 367 ARG A C    1  
ATOM   2873   O O    C ARG A 1 367 ? 16.539  34.880  38.822 0.05  0.00 ? 367 ARG A O    1  
ATOM   2874   O O    O ARG A 1 367 ? 24.660  24.348  55.918 0.95  0.00 ? 367 ARG A O    1  
ATOM   2875   H H    C ARG A 1 367 ? 19.962  35.047  36.188 0.05  0.00 ? 367 ARG A H    1  
ATOM   2876   H H    O ARG A 1 367 ? 28.716  22.859  55.817 0.95  0.00 ? 367 ARG A H    1  
ATOM   2877   N N    C ILE A 1 368 ? 18.404  33.545  38.734 0.05  0.00 ? 368 ILE A N    1  
ATOM   2878   N N    O ILE A 1 368 ? 25.478  22.253  56.376 0.95  0.00 ? 368 ILE A N    1  
ATOM   2879   C CA   C ILE A 1 368 ? 17.971  32.580  39.744 0.05  0.00 ? 368 ILE A CA   1  
ATOM   2880   C CA   O ILE A 1 368 ? 24.183  21.601  56.565 0.95  0.00 ? 368 ILE A CA   1  
ATOM   2881   C C    C ILE A 1 368 ? 18.317  33.071  41.165 0.05  0.00 ? 368 ILE A C    1  
ATOM   2882   C C    O ILE A 1 368 ? 23.675  21.783  58.010 0.95  0.00 ? 368 ILE A C    1  
ATOM   2883   O O    C ILE A 1 368 ? 17.497  32.929  42.074 0.05  0.00 ? 368 ILE A O    1  
ATOM   2884   O O    O ILE A 1 368 ? 22.486  22.040  58.209 0.95  0.00 ? 368 ILE A O    1  
ATOM   2885   H H    C ILE A 1 368 ? 19.257  33.387  38.279 0.05  0.00 ? 368 ILE A H    1  
ATOM   2886   H H    O ILE A 1 368 ? 26.286  21.702  56.432 0.95  0.00 ? 368 ILE A H    1  
ATOM   2887   N N    C THR A 1 369 ? 19.531  33.544  41.304 0.05  0.00 ? 369 THR A N    1  
ATOM   2888   N N    O THR A 1 369 ? 24.571  21.563  58.940 0.95  0.00 ? 369 THR A N    1  
ATOM   2889   C CA   C THR A 1 369 ? 20.097  34.039  42.552 0.05  0.00 ? 369 THR A CA   1  
ATOM   2890   C CA   O THR A 1 369 ? 24.324  21.644  60.374 0.95  0.00 ? 369 THR A CA   1  
ATOM   2891   C C    C THR A 1 369 ? 19.797  35.534  42.749 0.05  0.00 ? 369 THR A C    1  
ATOM   2892   C C    O THR A 1 369 ? 24.542  23.072  60.900 0.95  0.00 ? 369 THR A C    1  
ATOM   2893   O O    C THR A 1 369 ? 20.369  36.136  43.668 0.05  0.00 ? 369 THR A O    1  
ATOM   2894   O O    O THR A 1 369 ? 24.551  23.257  62.125 0.95  0.00 ? 369 THR A O    1  
ATOM   2895   H H    C THR A 1 369 ? 20.108  33.548  40.511 0.05  0.00 ? 369 THR A H    1  
ATOM   2896   H H    O THR A 1 369 ? 25.471  21.307  58.649 0.95  0.00 ? 369 THR A H    1  
ATOM   2897   N N    C LYS A 1 370 ? 18.982  36.084  41.881 0.05  0.00 ? 370 LYS A N    1  
ATOM   2898   N N    O LYS A 1 370 ? 24.758  23.999  59.998 0.95  0.00 ? 370 LYS A N    1  
ATOM   2899   C CA   C LYS A 1 370 ? 18.520  37.482  41.854 0.05  0.00 ? 370 LYS A CA   1  
ATOM   2900   C CA   O LYS A 1 370 ? 24.977  25.437  60.231 0.95  0.00 ? 370 LYS A CA   1  
ATOM   2901   C C    C LYS A 1 370 ? 17.490  37.650  42.983 0.05  0.00 ? 370 LYS A C    1  
ATOM   2902   C C    O LYS A 1 370 ? 23.618  26.057  60.596 0.95  0.00 ? 370 LYS A C    1  
ATOM   2903   H H    C LYS A 1 370 ? 18.634  35.497  41.179 0.05  0.00 ? 370 LYS A H    1  
ATOM   2904   H H    O LYS A 1 370 ? 24.764  23.704  59.064 0.95  0.00 ? 370 LYS A H    1  
HETATM 2905   N N1   A MXT B 2 .   ? 2.603   28.646  36.364 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2906   N N1   B MXT B 2 .   ? -2.649  23.617  30.201 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2907   N N1   C MXT B 2 .   ? 5.501   22.654  33.291 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2908   N N1   D MXT B 2 .   ? 5.903   23.111  32.511 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2909   N N1   E MXT B 2 .   ? 4.753   22.305  30.796 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2910   N N1   F MXT B 2 .   ? 5.832   23.105  32.163 0.16  0.00 ? 500 MXT A N1   1  
HETATM 2911   N N1   U MXT B 2 .   ? -1.555  22.856  29.541 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2912   N N1   V MXT B 2 .   ? 4.268   21.322  32.603 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2913   N N1   W MXT B 2 .   ? 3.161   29.538  34.558 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2914   N N1   X MXT B 2 .   ? 4.451   21.207  32.321 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2915   N N1   Y MXT B 2 .   ? 5.136   22.138  34.508 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2916   N N1   Z MXT B 2 .   ? 4.486   21.344  33.270 0.010 0.00 ? 500 MXT A N1   1  
HETATM 2917   N N2   A MXT B 2 .   ? 5.772   29.869  39.060 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2918   N N2   B MXT B 2 .   ? -5.207  20.442  28.724 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2919   N N2   C MXT B 2 .   ? 9.416   21.895  34.990 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2920   N N2   D MXT B 2 .   ? 10.172  22.422  32.855 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2921   N N2   E MXT B 2 .   ? 7.312   19.462  28.752 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2922   N N2   F MXT B 2 .   ? 10.136  22.669  31.862 0.16  0.00 ? 500 MXT A N2   1  
HETATM 2923   N N2   U MXT B 2 .   ? -2.876  19.825  26.736 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2924   N N2   V MXT B 2 .   ? 5.442   17.177  33.097 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2925   N N2   W MXT B 2 .   ? 6.436   32.342  35.006 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2926   N N2   X MXT B 2 .   ? 5.727   17.429  30.615 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2927   N N2   Y MXT B 2 .   ? 8.547   20.243  36.401 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2928   N N2   Z MXT B 2 .   ? 5.359   17.151  33.951 0.010 0.00 ? 500 MXT A N2   1  
HETATM 2929   O O2   A MXT B 2 .   ? 6.539   30.058  39.995 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2930   O O2   B MXT B 2 .   ? -6.066  19.745  28.196 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2931   O O2   C MXT B 2 .   ? 10.475  21.905  35.607 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2932   O O2   D MXT B 2 .   ? 11.392  22.395  32.743 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2933   O O2   E MXT B 2 .   ? 7.811   18.602  28.037 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2934   O O2   F MXT B 2 .   ? 11.321  22.690  31.553 0.16  0.00 ? 500 MXT A O2   1  
HETATM 2935   O O2   U MXT B 2 .   ? -3.139  19.131  25.762 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2936   O O2   V MXT B 2 .   ? 5.627   16.021  33.459 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2937   O O2   W MXT B 2 .   ? 7.180   33.284  35.257 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2938   O O2   X MXT B 2 .   ? 5.847   16.368  30.013 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2939   O O2   Y MXT B 2 .   ? 9.548   19.951  37.043 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2940   O O2   Z MXT B 2 .   ? 5.477   16.008  34.375 0.010 0.00 ? 500 MXT A O2   1  
HETATM 2941   O O11  A MXT B 2 .   ? 1.549   30.729  36.245 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2942   O O11  B MXT B 2 .   ? -2.553  25.133  28.425 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2943   O O11  C MXT B 2 .   ? 6.192   21.554  31.347 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2944   O O11  D MXT B 2 .   ? 5.546   20.982  33.410 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2945   O O11  E MXT B 2 .   ? 6.141   24.020  30.028 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2946   O O11  F MXT B 2 .   ? 5.774   21.096  33.356 0.16  0.00 ? 500 MXT A O11  1  
HETATM 2947   O O11  U MXT B 2 .   ? -2.823  24.749  29.017 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2948   O O11  V MXT B 2 .   ? 6.272   21.703  31.463 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2949   O O11  W MXT B 2 .   ? 1.386   30.317  35.866 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2950   O O11  X MXT B 2 .   ? 6.714   21.794  32.250 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2951   O O11  Y MXT B 2 .   ? 3.758   20.591  35.588 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2952   O O11  Z MXT B 2 .   ? 5.967   21.216  31.467 0.010 0.00 ? 500 MXT A O11  1  
HETATM 2953   O O12  A MXT B 2 .   ? 3.232   26.447  35.902 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2954   O O12  B MXT B 2 .   ? -2.246  22.560  32.243 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2955   O O12  C MXT B 2 .   ? 4.166   23.692  34.899 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2956   O O12  D MXT B 2 .   ? 5.547   25.283  31.738 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2957   O O12  E MXT B 2 .   ? 3.058   21.150  31.912 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2958   O O12  F MXT B 2 .   ? 5.200   25.139  31.205 0.16  0.00 ? 500 MXT A O12  1  
HETATM 2959   O O12  U MXT B 2 .   ? -0.133  21.373  30.648 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2960   O O12  V MXT B 2 .   ? 2.122   21.604  33.477 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2961   O O12  W MXT B 2 .   ? 4.458   28.221  33.135 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2962   O O12  X MXT B 2 .   ? 2.146   21.288  32.673 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2963   O O12  Y MXT B 2 .   ? 5.878   23.869  33.129 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2964   O O12  Z MXT B 2 .   ? 2.881   22.126  34.777 0.010 0.00 ? 500 MXT A O12  1  
HETATM 2965   C C14  A MXT B 2 .   ? 1.686   29.598  35.808 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2966   C C14  B MXT B 2 .   ? -2.155  24.779  29.523 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2967   C C14  C MXT B 2 .   ? 5.292   22.054  32.005 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2968   C C14  D MXT B 2 .   ? 5.095   22.064  33.064 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2969   C C14  E MXT B 2 .   ? 5.201   23.663  30.721 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2970   C C14  F MXT B 2 .   ? 5.198   22.099  32.963 0.16  0.00 ? 500 MXT A C14  1  
HETATM 2971   C C14  U MXT B 2 .   ? -2.052  24.182  29.774 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2972   C C14  V MXT B 2 .   ? 5.169   22.099  31.803 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2973   C C14  W MXT B 2 .   ? 1.849   29.457  35.132 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2974   C C14  X MXT B 2 .   ? 5.563   22.084  32.544 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2975   C C14  Y MXT B 2 .   ? 3.883   21.502  34.784 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2976   C C14  Z MXT B 2 .   ? 5.142   21.854  32.102 0.010 0.00 ? 500 MXT A C14  1  
HETATM 2977   C C21  A MXT B 2 .   ? 3.501   28.963  37.504 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2978   C C21  B MXT B 2 .   ? -3.724  22.755  29.645 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2979   C C21  C MXT B 2 .   ? 6.827   22.686  33.959 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2980   C C21  D MXT B 2 .   ? 7.376   22.990  32.346 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2981   C C21  E MXT B 2 .   ? 5.368   21.207  30.005 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2982   C C21  F MXT B 2 .   ? 7.263   23.040  31.771 0.16  0.00 ? 500 MXT A C21  1  
HETATM 2983   C C21  U MXT B 2 .   ? -1.964  22.035  28.372 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2984   C C21  V MXT B 2 .   ? 4.580   19.944  33.061 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2985   C C21  W MXT B 2 .   ? 4.062   30.700  34.771 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2986   C C21  X MXT B 2 .   ? 4.592   19.876  31.673 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2987   C C21  Y MXT B 2 .   ? 6.397   21.773  35.206 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2988   C C21  Z MXT B 2 .   ? 4.721   19.973  33.793 0.010 0.00 ? 500 MXT A C21  1  
HETATM 2989   C C22  A MXT B 2 .   ? 3.761   30.481  37.646 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2990   C C22  B MXT B 2 .   ? -4.261  21.740  30.684 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2991   C C22  C MXT B 2 .   ? 7.991   22.432  32.967 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2992   C C22  D MXT B 2 .   ? 7.853   21.518  32.383 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2993   C C22  E MXT B 2 .   ? 6.186   20.232  30.887 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2994   C C22  F MXT B 2 .   ? 7.836   21.605  31.870 0.16  0.00 ? 500 MXT A C22  1  
HETATM 2995   C C22  U MXT B 2 .   ? -3.449  21.606  28.444 0.010 0.00 ? 500 MXT A C22  1  
HETATM 2996   C C22  V MXT B 2 .   ? 6.092   19.623  32.972 0.010 0.00 ? 500 MXT A C22  1  
HETATM 2997   C C22  W MXT B 2 .   ? 4.852   31.074  33.492 0.010 0.00 ? 500 MXT A C22  1  
HETATM 2998   C C22  X MXT B 2 .   ? 5.103   18.795  32.655 0.010 0.00 ? 500 MXT A C22  1  
HETATM 2999   C C22  Y MXT B 2 .   ? 7.377   21.003  34.287 0.010 0.00 ? 500 MXT A C22  1  
HETATM 3000   C C22  Z MXT B 2 .   ? 6.191   19.521  33.618 0.010 0.00 ? 500 MXT A C22  1  
HETATM 3001   C C23  A MXT B 2 .   ? 4.798   28.108  37.493 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3002   C C23  B MXT B 2 .   ? -3.323  22.109  28.291 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3003   C C23  C MXT B 2 .   ? 6.877   21.785  35.221 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3004   C C23  D MXT B 2 .   ? 8.159   23.924  33.310 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3005   C C23  E MXT B 2 .   ? 6.146   21.732  28.769 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3006   C C23  F MXT B 2 .   ? 8.126   24.108  32.498 0.16  0.00 ? 500 MXT A C23  1  
HETATM 3007   C C23  U MXT B 2 .   ? -0.987  20.858  28.104 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3008   C C23  V MXT B 2 .   ? 3.676   18.877  32.386 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3009   C C23  W MXT B 2 .   ? 4.956   30.533  36.029 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3010   C C23  X MXT B 2 .   ? 5.398   19.946  30.346 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3011   C C23  Y MXT B 2 .   ? 6.140   21.076  36.568 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3012   C C23  Z MXT B 2 .   ? 3.685   18.949  33.257 0.010 0.00 ? 500 MXT A C23  1  
HETATM 3013   C C24  A MXT B 2 .   ? 4.619   30.854  38.900 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3014   C C24  B MXT B 2 .   ? -5.464  20.887  30.160 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3015   C C24  C MXT B 2 .   ? 9.406   22.562  33.620 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3016   C C24  D MXT B 2 .   ? 9.384   21.352  32.110 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3017   C C24  E MXT B 2 .   ? 6.757   19.007  30.098 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3018   C C24  F MXT B 2 .   ? 9.311   21.486  31.364 0.16  0.00 ? 500 MXT A C24  1  
HETATM 3019   C C24  U MXT B 2 .   ? -3.935  20.829  27.177 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3020   C C24  V MXT B 2 .   ? 6.467   18.215  33.543 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3021   C C24  W MXT B 2 .   ? 5.732   32.357  33.655 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3022   C C24  X MXT B 2 .   ? 5.163   17.363  32.029 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3023   C C24  Y MXT B 2 .   ? 8.756   20.699  34.962 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3024   C C24  Z MXT B 2 .   ? 6.493   18.125  34.253 0.010 0.00 ? 500 MXT A C24  1  
HETATM 3025   C C25  A MXT B 2 .   ? 3.753   30.815  40.199 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3026   C C25  B MXT B 2 .   ? -6.787  21.716  30.190 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3027   C C25  C MXT B 2 .   ? 9.798   24.063  33.800 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3028   C C25  D MXT B 2 .   ? 9.693   21.483  30.584 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3029   C C25  E MXT B 2 .   ? 5.643   17.945  29.839 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3030   C C25  F MXT B 2 .   ? 9.366   21.469  29.804 0.16  0.00 ? 500 MXT A C25  1  
HETATM 3031   C C25  U MXT B 2 .   ? -4.209  21.810  25.993 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3032   C C25  V MXT B 2 .   ? 6.497   18.238  35.104 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3033   C C25  W MXT B 2 .   ? 4.854   33.645  33.570 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3034   C C25  X MXT B 2 .   ? 3.739   16.725  31.964 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3035   C C25  Y MXT B 2 .   ? 9.661   21.972  34.973 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3036   C C25  Z MXT B 2 .   ? 6.646   18.238  35.803 0.010 0.00 ? 500 MXT A C25  1  
HETATM 3037   C C26  A MXT B 2 .   ? 5.196   32.292  38.703 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3038   C C26  B MXT B 2 .   ? -5.618  19.627  31.067 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3039   C C26  C MXT B 2 .   ? 10.448  21.858  32.698 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3040   C C26  D MXT B 2 .   ? 9.833   19.942  32.610 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3041   C C26  E MXT B 2 .   ? 7.906   18.364  30.935 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3042   C C26  F MXT B 2 .   ? 9.927   20.164  31.920 0.16  0.00 ? 500 MXT A C26  1  
HETATM 3043   C C26  U MXT B 2 .   ? -5.250  20.063  27.533 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3044   C C26  V MXT B 2 .   ? 7.873   17.812  33.000 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3045   C C26  W MXT B 2 .   ? 6.799   32.378  32.518 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3046   C C26  X MXT B 2 .   ? 6.092   16.469  32.910 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3047   C C26  Y MXT B 2 .   ? 9.464   19.562  34.162 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3048   C C26  Z MXT B 2 .   ? 7.818   17.571  33.641 0.010 0.00 ? 500 MXT A C26  1  
HETATM 3049   C C27  A MXT B 2 .   ? 6.102   28.751  38.078 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3050   C C27  B MXT B 2 .   ? -3.918  20.697  27.952 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3051   C C27  C MXT B 2 .   ? 8.250   21.118  35.589 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3052   C C27  D MXT B 2 .   ? 9.563   23.439  33.812 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3053   C C27  E MXT B 2 .   ? 7.395   20.912  28.290 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3054   C C27  F MXT B 2 .   ? 9.622   23.751  32.806 0.16  0.00 ? 500 MXT A C27  1  
HETATM 3055   C C27  U MXT B 2 .   ? -1.579  19.545  27.485 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3056   C C27  V MXT B 2 .   ? 4.285   17.451  32.144 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3057   C C27  W MXT B 2 .   ? 6.380   31.193  36.005 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3058   C C27  X MXT B 2 .   ? 6.255   18.694  29.949 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3059   C C27  Y MXT B 2 .   ? 7.189   20.014  37.054 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3060   C C27  Z MXT B 2 .   ? 4.158   17.465  33.065 0.010 0.00 ? 500 MXT A C27  1  
HETATM 3061   C C28  A MXT B 2 .   ? 6.891   27.618  38.817 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3062   C C28  B MXT B 2 .   ? -4.211  20.669  26.414 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3063   C C28  C MXT B 2 .   ? 8.364   21.113  37.150 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3064   C C28  D MXT B 2 .   ? 10.487  24.700  33.899 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3065   C C28  E MXT B 2 .   ? 7.419   20.967  26.725 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3066   C C28  F MXT B 2 .   ? 10.462  25.058  32.615 0.16  0.00 ? 500 MXT A C28  1  
HETATM 3067   C C28  U MXT B 2 .   ? -0.511  18.973  26.493 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3068   C C28  V MXT B 2 .   ? 3.143   16.407  32.386 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3069   C C28  W MXT B 2 .   ? 6.669   31.731  37.446 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3070   C C28  X MXT B 2 .   ? 6.169   18.546  28.393 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3071   C C28  Y MXT B 2 .   ? 7.317   20.159  38.607 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3072   C C28  Z MXT B 2 .   ? 2.958   16.539  33.458 0.010 0.00 ? 500 MXT A C28  1  
HETATM 3073   C C29  A MXT B 2 .   ? 7.012   29.339  36.956 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3074   C C29  B MXT B 2 .   ? -2.914  19.550  28.286 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3075   C C29  C MXT B 2 .   ? 8.331   19.645  35.081 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3076   C C29  D MXT B 2 .   ? 9.482   22.787  35.228 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3077   C C29  E MXT B 2 .   ? 8.728   21.519  28.829 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3078   C C29  F MXT B 2 .   ? 9.808   23.249  34.271 0.16  0.00 ? 500 MXT A C29  1  
HETATM 3079   C C29  U MXT B 2 .   ? -1.869  18.470  28.577 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3080   C C29  V MXT B 2 .   ? 4.806   17.285  30.683 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3081   C C29  W MXT B 2 .   ? 7.489   30.162  35.629 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3082   C C29  X MXT B 2 .   ? 7.754   18.865  30.347 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3083   C C29  Y MXT B 2 .   ? 6.732   18.558  36.727 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3084   C C29  Z MXT B 2 .   ? 4.551   17.168  31.585 0.010 0.00 ? 500 MXT A C29  1  
HETATM 3085   C C11  A MXT B 2 .   ? 1.499   27.527  34.512 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3086   C C11  B MXT B 2 .   ? -0.971  24.595  31.660 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3087   C C11  C MXT B 2 .   ? 3.131   22.880  32.807 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3088   C C11  D MXT B 2 .   ? 3.629   23.959  32.562 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3089   C C11  E MXT B 2 .   ? 3.303   23.584  32.267 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3090   C C11  F MXT B 2 .   ? 3.538   23.837  32.490 0.16  0.00 ? 500 MXT A C11  1  
HETATM 3091   C C11  U MXT B 2 .   ? -0.556  23.603  31.626 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3092   C C11  V MXT B 2 .   ? 3.141   23.427  32.155 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3093   C C11  W MXT B 2 .   ? 2.201   27.447  33.780 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3094   C C11  X MXT B 2 .   ? 3.544   23.213  33.345 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3095   C C11  Y MXT B 2 .   ? 3.490   23.230  33.095 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3096   C C11  Z MXT B 2 .   ? 3.622   23.589  32.927 0.010 0.00 ? 500 MXT A C11  1  
HETATM 3097   C C12  A MXT B 2 .   ? 0.946   28.965  34.626 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3098   C C12  B MXT B 2 .   ? -1.086  25.457  30.383 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3099   C C12  C MXT B 2 .   ? 3.814   22.157  31.627 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3100   C C12  D MXT B 2 .   ? 3.638   22.523  33.129 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3101   C C12  E MXT B 2 .   ? 4.332   24.539  31.625 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3102   C C12  F MXT B 2 .   ? 3.741   22.487  33.215 0.16  0.00 ? 500 MXT A C12  1  
HETATM 3103   C C12  U MXT B 2 .   ? -1.466  24.725  31.079 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3104   C C12  V MXT B 2 .   ? 4.529   23.450  31.476 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3105   C C12  W MXT B 2 .   ? 1.175   28.159  34.687 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3106   C C12  X MXT B 2 .   ? 5.071   23.378  33.192 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3107   C C12  Y MXT B 2 .   ? 2.787   22.137  33.928 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3108   C C12  Z MXT B 2 .   ? 4.650   23.273  31.817 0.010 0.00 ? 500 MXT A C12  1  
HETATM 3109   C C13  A MXT B 2 .   ? 2.536   27.414  35.644 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3110   C C13  B MXT B 2 .   ? -1.992  23.460  31.460 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3111   C C13  C MXT B 2 .   ? 4.267   23.156  33.809 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3112   C C13  D MXT B 2 .   ? 5.097   24.249  32.199 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3113   C C13  E MXT B 2 .   ? 3.641   22.197  31.688 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3114   C C13  F MXT B 2 .   ? 4.905   24.150  31.856 0.16  0.00 ? 500 MXT A C13  1  
HETATM 3115   C C13  U MXT B 2 .   ? -0.674  22.465  30.596 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3116   C C13  V MXT B 2 .   ? 3.062   22.051  32.840 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3117   C C13  W MXT B 2 .   ? 3.421   28.386  33.755 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3118   C C13  X MXT B 2 .   ? 3.240   21.817  32.770 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3119   C C13  Y MXT B 2 .   ? 4.968   23.161  33.524 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3120   C C13  Z MXT B 2 .   ? 3.582   22.319  33.795 0.010 0.00 ? 500 MXT A C13  1  
HETATM 3121   H H21  A MXT B 2 .   ? 2.952   28.652  38.434 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3122   H H21  B MXT B 2 .   ? -4.583  23.438  29.404 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3123   H H21  C MXT B 2 .   ? 6.964   23.734  34.337 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3124   H H21  D MXT B 2 .   ? 7.609   23.369  31.315 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3125   H H21  E MXT B 2 .   ? 4.515   20.609  29.585 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3126   H H21  F MXT B 2 .   ? 7.304   23.318  30.683 0.16  0.00 ? 500 MXT A H21  1  
HETATM 3127   H H21  U MXT B 2 .   ? -1.875  22.703  27.473 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3128   H H21  V MXT B 2 .   ? 4.317   19.906  34.152 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3129   H H21  W MXT B 2 .   ? 3.397   31.576  34.995 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3130   H H21  X MXT B 2 .   ? 3.556   19.562  31.372 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3131   H H21  Y MXT B 2 .   ? 6.904   22.742  35.462 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3132   H H21  Z MXT B 2 .   ? 4.540   20.025  34.901 0.010 0.00 ? 500 MXT A H21  1  
HETATM 3133   H H121 A MXT B 2 .   ? -0.149  29.002  34.794 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3134   H H121 B MXT B 2 .   ? -0.133  25.537  29.823 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3135   H H121 C MXT B 2 .   ? 3.698   22.690  30.661 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3136   H H121 D MXT B 2 .   ? 2.987   21.825  32.563 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3137   H H121 E MXT B 2 .   ? 4.961   25.068  32.370 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3138   H H121 F MXT B 2 .   ? 3.059   21.691  32.853 0.16  0.00 ? 500 MXT A H121 1  
HETATM 3139   H H121 U MXT B 2 .   ? -0.925  25.675  30.892 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3140   H H121 V MXT B 2 .   ? 5.174   24.278  31.828 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3141   H H121 W MXT B 2 .   ? 0.877   27.555  35.568 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3142   H H121 X MXT B 2 .   ? 5.592   23.551  34.156 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3143   H H121 Y MXT B 2 .   ? 2.287   21.367  33.306 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3144   H H121 Z MXT B 2 .   ? 5.502   23.983  31.797 0.010 0.00 ? 500 MXT A H121 1  
HETATM 3145   H H122 A MXT B 2 .   ? 1.141   29.542  33.698 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3146   H H122 B MXT B 2 .   ? -1.396  26.496  30.632 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3147   H H122 C MXT B 2 .   ? 3.384   21.143  31.479 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3148   H H122 D MXT B 2 .   ? 3.278   22.507  34.180 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3149   H H122 E MXT B 2 .   ? 3.825   25.325  31.026 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3150   H H122 F MXT B 2 .   ? 3.554   22.591  34.306 0.16  0.00 ? 500 MXT A H122 1  
HETATM 3151   H H122 U MXT B 2 .   ? -2.280  24.964  31.796 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3152   H H122 V MXT B 2 .   ? 4.430   23.571  30.375 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3153   H H122 W MXT B 2 .   ? 0.240   28.383  34.129 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3154   H H122 X MXT B 2 .   ? 5.315   24.248  32.543 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3155   H H122 Y MXT B 2 .   ? 1.999   22.577  34.577 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3156   H H122 Z MXT B 2 .   ? 4.176   23.321  30.812 0.010 0.00 ? 500 MXT A H122 1  
HETATM 3157   H H221 A MXT B 2 .   ? 4.245   30.893  36.734 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3158   H H221 B MXT B 2 .   ? -3.454  21.059  31.034 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3159   H H221 C MXT B 2 .   ? 7.897   21.435  32.486 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3160   H H221 D MXT B 2 .   ? 7.599   21.038  33.351 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3161   H H221 E MXT B 2 .   ? 7.018   20.757  31.400 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3162   H H221 F MXT B 2 .   ? 7.771   21.219  32.910 0.16  0.00 ? 500 MXT A H221 1  
HETATM 3163   H H221 U MXT B 2 .   ? -3.646  20.992  29.349 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3164   H H221 V MXT B 2 .   ? 6.459   19.703  31.925 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3165   H H221 W MXT B 2 .   ? 5.490   30.230  33.154 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3166   H H221 X MXT B 2 .   ? 6.101   19.060  33.060 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3167   H H221 Y MXT B 2 .   ? 6.929   20.054  33.928 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3168   H H221 Z MXT B 2 .   ? 6.481   19.508  32.546 0.010 0.00 ? 500 MXT A H221 1  
HETATM 3169   H H222 A MXT B 2 .   ? 2.783   31.013  37.718 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3170   H H222 B MXT B 2 .   ? -4.588  22.292  31.595 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3171   H H222 C MXT B 2 .   ? 7.918   23.164  32.130 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3172   H H222 D MXT B 2 .   ? 7.292   20.936  31.616 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3173   H H222 E MXT B 2 .   ? 5.534   19.850  31.707 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3174   H H222 F MXT B 2 .   ? 7.200   20.917  31.267 0.16  0.00 ? 500 MXT A H222 1  
HETATM 3175   H H222 U MXT B 2 .   ? -4.085  22.514  28.567 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3176   H H222 V MXT B 2 .   ? 6.662   20.396  33.537 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3177   H H222 W MXT B 2 .   ? 4.131   31.242  32.659 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3178   H H222 X MXT B 2 .   ? 4.430   18.764  33.543 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3179   H H222 Y MXT B 2 .   ? 7.560   21.605  33.366 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3180   H H222 Z MXT B 2 .   ? 6.862   20.275  34.090 0.010 0.00 ? 500 MXT A H222 1  
HETATM 3181   H H231 A MXT B 2 .   ? 4.559   27.182  38.068 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3182   H H231 B MXT B 2 .   ? -3.638  22.834  27.501 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3183   H H231 C MXT B 2 .   ? 6.551   22.432  36.071 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3184   H H231 D MXT B 2 .   ? 8.280   24.890  32.767 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3185   H H231 E MXT B 2 .   ? 5.403   21.779  27.936 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3186   H H231 F MXT B 2 .   ? 8.095   25.017  31.850 0.16  0.00 ? 500 MXT A H231 1  
HETATM 3187   H H231 U MXT B 2 .   ? -0.203  21.262  27.420 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3188   H H231 V MXT B 2 .   ? 2.776   18.780  33.042 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3189   H H231 W MXT B 2 .   ? 4.372   30.963  36.878 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3190   H H231 X MXT B 2 .   ? 4.650   20.144  29.544 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3191   H H231 Y MXT B 2 .   ? 6.078   21.895  37.325 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3192   H H231 Z MXT B 2 .   ? 2.834   18.968  33.979 0.010 0.00 ? 500 MXT A H231 1  
HETATM 3193   H H232 A MXT B 2 .   ? 5.038   27.742  36.470 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3194   H H232 B MXT B 2 .   ? -2.219  22.039  28.180 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3195   H H232 C MXT B 2 .   ? 6.115   20.976  35.179 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3196   H H232 D MXT B 2 .   ? 7.557   24.184  34.209 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3197   H H232 E MXT B 2 .   ? 6.474   22.786  28.907 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3198   H H232 F MXT B 2 .   ? 7.658   24.431  33.453 0.16  0.00 ? 500 MXT A H232 1  
HETATM 3199   H H232 U MXT B 2 .   ? -0.430  20.571  29.023 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3200   H H232 V MXT B 2 .   ? 3.273   19.236  31.414 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3201   H H232 W MXT B 2 .   ? 5.090   29.462  36.298 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3202   H H232 X MXT B 2 .   ? 6.073   20.830  30.321 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3203   H H232 Y MXT B 2 .   ? 5.139   20.592  36.600 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3204   H H232 Z MXT B 2 .   ? 3.239   19.282  32.294 0.010 0.00 ? 500 MXT A H232 1  
HETATM 3205   H H251 A MXT B 2 .   ? 4.293   31.224  41.076 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3206   H H251 B MXT B 2 .   ? -7.678  21.093  29.974 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3207   H H251 C MXT B 2 .   ? 10.854  24.185  34.114 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3208   H H251 D MXT B 2 .   ? 10.741  21.214  30.342 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3209   H H251 E MXT B 2 .   ? 6.052   17.000  29.422 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3210   H H251 F MXT B 2 .   ? 10.377  21.231  29.420 0.16  0.00 ? 500 MXT A H251 1  
HETATM 3211   H H251 U MXT B 2 .   ? -4.702  21.308  25.137 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3212   H H251 V MXT B 2 .   ? 6.910   17.302  35.530 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3213   H H251 W MXT B 2 .   ? 5.468   34.568  33.526 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3214   H H251 X MXT B 2 .   ? 3.770   15.655  31.673 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3215   H H251 Y MXT B 2 .   ? 10.698  21.746  35.301 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3216   H H251 Z MXT B 2 .   ? 7.011   17.298  36.261 0.010 0.00 ? 500 MXT A H251 1  
HETATM 3217   H H252 A MXT B 2 .   ? 2.837   31.429  40.070 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3218   H H252 B MXT B 2 .   ? -6.941  22.160  31.195 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3219   H H252 C MXT B 2 .   ? 9.683   24.610  32.840 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3220   H H252 D MXT B 2 .   ? 9.044   20.798  29.999 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3221   H H252 E MXT B 2 .   ? 5.133   17.680  30.789 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3222   H H252 F MXT B 2 .   ? 8.678   20.695  29.403 0.16  0.00 ? 500 MXT A H252 1  
HETATM 3223   H H252 U MXT B 2 .   ? -4.886  22.628  26.319 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3224   H H252 V MXT B 2 .   ? 7.142   19.066  35.464 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3225   H H252 W MXT B 2 .   ? 4.231   33.630  32.651 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3226   H H252 X MXT B 2 .   ? 3.250   16.771  32.959 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3227   H H252 Y MXT B 2 .   ? 9.735   22.402  33.952 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3228   H H252 Z MXT B 2 .   ? 7.380   19.029  36.061 0.010 0.00 ? 500 MXT A H252 1  
HETATM 3229   H H253 A MXT B 2 .   ? 3.430   29.787  40.465 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3230   H H253 B MXT B 2 .   ? -6.785  22.549  29.456 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3231   H H253 C MXT B 2 .   ? 9.173   24.580  34.555 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3232   H H253 D MXT B 2 .   ? 9.523   22.509  30.201 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3233   H H253 E MXT B 2 .   ? 4.868   18.301  29.134 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3234   H H253 F MXT B 2 .   ? 9.070   22.441  29.356 0.16  0.00 ? 500 MXT A H253 1  
HETATM 3235   H H253 U MXT B 2 .   ? -3.281  22.280  25.606 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3236   H H253 V MXT B 2 .   ? 5.491   18.384  35.548 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3237   H H253 W MXT B 2 .   ? 4.169   33.753  34.435 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3238   H H253 X MXT B 2 .   ? 3.073   17.239  31.242 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3239   H H253 Y MXT B 2 .   ? 9.275   22.765  35.641 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3240   H H253 Z MXT B 2 .   ? 5.690   18.493  36.307 0.010 0.00 ? 500 MXT A H253 1  
HETATM 3241   H H261 A MXT B 2 .   ? 4.373   33.010  38.510 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3242   H H261 B MXT B 2 .   ? -5.730  19.935  32.130 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3243   H H261 C MXT B 2 .   ? 10.400  22.283  31.673 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3244   H H261 D MXT B 2 .   ? 9.214   19.152  32.133 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3245   H H261 E MXT B 2 .   ? 7.537   18.096  31.947 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3246   H H261 F MXT B 2 .   ? 9.294   19.299  31.630 0.16  0.00 ? 500 MXT A H261 1  
HETATM 3247   H H261 U MXT B 2 .   ? -6.008  20.771  27.927 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3248   H H261 V MXT B 2 .   ? 8.618   18.598  33.252 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3249   H H261 W MXT B 2 .   ? 6.303   32.312  31.527 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3250   H H261 X MXT B 2 .   ? 5.738   16.472  33.964 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3251   H H261 Y MXT B 2 .   ? 9.556   19.848  33.092 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3252   H H261 Z MXT B 2 .   ? 8.640   18.304  33.785 0.010 0.00 ? 500 MXT A H261 1  
HETATM 3253   H H262 A MXT B 2 .   ? 5.738   32.658  39.598 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3254   H H262 B MXT B 2 .   ? -6.514  19.026  30.812 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3255   H H262 C MXT B 2 .   ? 11.490  21.995  33.052 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3256   H H262 D MXT B 2 .   ? 10.890  19.718  32.360 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3257   H H262 E MXT B 2 .   ? 8.294   17.431  30.479 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3258   H H262 F MXT B 2 .   ? 10.943  19.967  31.522 0.16  0.00 ? 500 MXT A H262 1  
HETATM 3259   H H262 U MXT B 2 .   ? -5.704  19.567  26.651 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3260   H H262 V MXT B 2 .   ? 8.244   16.865  33.443 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3261   H H262 W MXT B 2 .   ? 7.399   33.311  32.515 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3262   H H262 X MXT B 2 .   ? 6.105   15.410  32.579 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3263   H H262 Y MXT B 2 .   ? 10.491  19.361  34.528 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3264   H H262 Z MXT B 2 .   ? 8.145   16.624  34.116 0.010 0.00 ? 500 MXT A H262 1  
HETATM 3265   H H263 A MXT B 2 .   ? 5.894   32.351  37.847 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3266   H H263 B MXT B 2 .   ? -4.742  18.955  31.010 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3267   H H263 C MXT B 2 .   ? 10.270  20.770  32.611 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3268   H H263 D MXT B 2 .   ? 9.721   19.829  33.705 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3269   H H263 E MXT B 2 .   ? 8.765   19.048  31.068 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3270   H H263 F MXT B 2 .   ? 9.998   20.162  33.023 0.16  0.00 ? 500 MXT A H263 1  
HETATM 3271   H H263 U MXT B 2 .   ? -5.090  19.287  28.303 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3272   H H263 V MXT B 2 .   ? 7.884   17.689  31.901 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3273   H H263 W MXT B 2 .   ? 7.508   31.531  32.588 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3274   H H263 X MXT B 2 .   ? 7.139   16.826  32.915 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3275   H H263 Y MXT B 2 .   ? 8.907   18.608  34.201 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3276   H H263 Z MXT B 2 .   ? 7.735   17.383  32.554 0.010 0.00 ? 500 MXT A H263 1  
HETATM 3277   H H281 A MXT B 2 .   ? 6.352   27.239  39.704 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3278   H H281 B MXT B 2 .   ? -5.010  21.378  26.127 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3279   H H281 C MXT B 2 .   ? 8.438   22.136  37.570 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3280   H H281 D MXT B 2 .   ? 10.691  25.142  32.905 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3281   H H281 E MXT B 2 .   ? 6.558   20.439  26.273 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3282   H H281 F MXT B 2 .   ? 10.475  25.401  31.563 0.16  0.00 ? 500 MXT A H281 1  
HETATM 3283   H H281 U MXT B 2 .   ? -0.348  19.635  25.623 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3284   H H281 V MXT B 2 .   ? 2.812   16.386  33.442 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3285   H H281 W MXT B 2 .   ? 5.991   32.560  37.731 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3286   H H281 X MXT B 2 .   ? 5.147   18.297  28.050 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3287   H H281 Y MXT B 2 .   ? 7.758   21.131  38.902 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3288   H H281 Z MXT B 2 .   ? 2.706   16.608  34.534 0.010 0.00 ? 500 MXT A H281 1  
HETATM 3289   H H282 A MXT B 2 .   ? 7.043   26.758  38.130 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3290   H H282 B MXT B 2 .   ? -3.296  20.955  25.852 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3291   H H282 C MXT B 2 .   ? 7.462   20.638  37.591 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3292   H H282 D MXT B 2 .   ? 9.998   25.483  34.515 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3293   H H282 E MXT B 2 .   ? 7.376   22.023  26.387 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3294   H H282 F MXT B 2 .   ? 10.026  25.877  33.225 0.16  0.00 ? 500 MXT A H282 1  
HETATM 3295   H H282 U MXT B 2 .   ? 0.464   18.864  27.014 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3296   H H282 V MXT B 2 .   ? 2.259   16.666  31.766 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3297   H H282 W MXT B 2 .   ? 6.526   30.916  38.187 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3298   H H282 X MXT B 2 .   ? 6.457   19.502  27.908 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3299   H H282 Y MXT B 2 .   ? 6.312   20.094  39.074 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3300   H H282 Z MXT B 2 .   ? 2.053   16.834  32.887 0.010 0.00 ? 500 MXT A H282 1  
HETATM 3301   H H283 A MXT B 2 .   ? 7.901   27.942  39.146 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3302   H H283 B MXT B 2 .   ? -4.503  19.662  26.051 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3303   H H283 C MXT B 2 .   ? 9.238   20.536  37.513 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3304   H H283 D MXT B 2 .   ? 11.465  24.483  34.378 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3305   H H283 E MXT B 2 .   ? 8.346   20.532  26.297 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3306   H H283 F MXT B 2 .   ? 11.515  24.943  32.946 0.16  0.00 ? 500 MXT A H283 1  
HETATM 3307   H H283 U MXT B 2 .   ? -0.778  17.966  26.109 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3308   H H283 V MXT B 2 .   ? 3.438   15.376  32.101 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3309   H H283 W MXT B 2 .   ? 7.710   32.092  37.566 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3310   H H283 X MXT B 2 .   ? 6.856   17.769  27.997 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3311   H H283 Y MXT B 2 .   ? 7.933   19.356  39.062 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3312   H H283 Z MXT B 2 .   ? 3.146   15.471  33.223 0.010 0.00 ? 500 MXT A H283 1  
HETATM 3313   H H291 A MXT B 2 .   ? 7.931   29.802  37.369 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3314   H H291 B MXT B 2 .   ? -3.334  18.551  28.055 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3315   H H291 C MXT B 2 .   ? 9.302   19.174  35.333 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3316   H H291 D MXT B 2 .   ? 10.471  22.439  35.581 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3317   H H291 E MXT B 2 .   ? 9.610   20.937  28.498 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3318   H H291 F MXT B 2 .   ? 10.864  22.990  34.488 0.16  0.00 ? 500 MXT A H291 1  
HETATM 3319   H H291 U MXT B 2 .   ? -2.295  17.544  28.143 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3320   H H291 V MXT B 2 .   ? 5.244   16.282  30.510 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3321   H H291 W MXT B 2 .   ? 8.495   30.627  35.605 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3322   H H291 X MXT B 2 .   ? 8.359   17.979  30.074 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3323   H H291 Y MXT B 2 .   ? 7.474   17.807  37.062 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3324   H H291 Z MXT B 2 .   ? 4.892   16.122  31.450 0.010 0.00 ? 500 MXT A H291 1  
HETATM 3325   H H292 A MXT B 2 .   ? 6.503   30.110  36.344 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3326   H H292 B MXT B 2 .   ? -2.606  19.538  29.351 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3327   H H292 C MXT B 2 .   ? 8.197   19.555  33.986 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3328   H H292 D MXT B 2 .   ? 8.795   21.918  35.265 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3329   H H292 E MXT B 2 .   ? 8.764   21.572  29.934 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3330   H H292 F MXT B 2 .   ? 9.196   22.357  34.505 0.16  0.00 ? 500 MXT A H292 1  
HETATM 3331   H H292 U MXT B 2 .   ? -2.574  18.821  29.356 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3332   H H292 V MXT B 2 .   ? 5.579   18.032  30.409 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3333   H H292 W MXT B 2 .   ? 7.323   29.686  34.643 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3334   H H292 X MXT B 2 .   ? 7.896   19.036  31.433 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3335   H H292 Y MXT B 2 .   ? 6.558   18.389  35.647 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3336   H H292 Z MXT B 2 .   ? 5.357   17.828  31.211 0.010 0.00 ? 500 MXT A H292 1  
HETATM 3337   H H293 A MXT B 2 .   ? 7.335   28.538  36.259 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3338   H H293 B MXT B 2 .   ? -1.987  19.660  27.685 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3339   H H293 C MXT B 2 .   ? 7.538   19.029  35.554 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3340   H H293 D MXT B 2 .   ? 9.109   23.523  35.971 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3341   H H293 E MXT B 2 .   ? 8.860   22.555  28.451 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3342   H H293 F MXT B 2 .   ? 9.514   24.042  34.990 0.16  0.00 ? 500 MXT A H293 1  
HETATM 3343   H H293 U MXT B 2 .   ? -0.931  18.184  29.099 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3344   H H293 V MXT B 2 .   ? 3.973   17.406  29.959 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3345   H H293 W MXT B 2 .   ? 7.527   29.344  36.378 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3346   H H293 X MXT B 2 .   ? 8.196   19.738  29.823 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3347   H H293 Y MXT B 2 .   ? 5.778   18.328  37.248 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3348   H H293 Z MXT B 2 .   ? 3.676   17.315  30.918 0.010 0.00 ? 500 MXT A H293 1  
HETATM 3349   N N1   A MXT C 2 .   ? 23.834  17.356  24.373 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3350   N N1   B MXT C 2 .   ? 19.719  17.202  30.697 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3351   N N1   C MXT C 2 .   ? 24.692  18.498  24.625 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3352   N N1   D MXT C 2 .   ? 21.345  15.731  23.875 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3353   N N1   E MXT C 2 .   ? 19.577  18.213  27.920 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3354   N N1   F MXT C 2 .   ? 22.815  18.578  25.574 0.16  0.00 ? 600 MXT A N1   1  
HETATM 3355   N N1   U MXT C 2 .   ? 4.164   19.461  16.198 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3356   N N1   V MXT C 2 .   ? 4.187   16.827  14.106 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3357   N N1   W MXT C 2 .   ? 1.597   12.868  18.499 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3358   N N1   X MXT C 2 .   ? 3.358   20.304  16.777 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3359   N N1   Y MXT C 2 .   ? 1.270   14.778  15.827 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3360   N N1   Z MXT C 2 .   ? 2.447   18.513  16.512 0.010 0.00 ? 600 MXT A N1   1  
HETATM 3361   N N2   A MXT C 2 .   ? 27.615  17.184  22.257 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3362   N N2   B MXT C 2 .   ? 16.699  17.635  33.779 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3363   N N2   C MXT C 2 .   ? 24.388  22.818  24.853 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3364   N N2   D MXT C 2 .   ? 17.594  14.320  22.224 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3365   N N2   E MXT C 2 .   ? 17.233  21.367  26.089 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3366   N N2   F MXT C 2 .   ? 19.316  20.888  26.682 0.16  0.00 ? 600 MXT A N2   1  
HETATM 3367   N N2   U MXT C 2 .   ? 6.167   23.275  16.691 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3368   N N2   V MXT C 2 .   ? 4.702   15.518  10.004 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3369   N N2   W MXT C 2 .   ? -0.487  9.079   18.826 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3370   N N2   X MXT C 2 .   ? -0.604  21.847  17.623 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3371   N N2   Y MXT C 2 .   ? -2.525  15.699  13.944 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3372   N N2   Z MXT C 2 .   ? -1.277  16.519  15.531 0.010 0.00 ? 600 MXT A N2   1  
HETATM 3373   O O2   A MXT C 2 .   ? 28.564  17.309  21.493 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3374   O O2   B MXT C 2 .   ? 15.972  17.986  34.700 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3375   O O2   C MXT C 2 .   ? 24.130  24.007  24.715 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3376   O O2   D MXT C 2 .   ? 16.690  13.823  21.564 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3377   O O2   E MXT C 2 .   ? 16.714  22.418  25.732 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3378   O O2   F MXT C 2 .   ? 18.359  21.650  26.752 0.16  0.00 ? 600 MXT A O2   1  
HETATM 3379   O O2   U MXT C 2 .   ? 6.550   24.438  16.654 0.010 0.00 ? 600 MXT A O2   1  
HETATM 3380   O O2   V MXT C 2 .   ? 5.024   15.349  8.834  0.010 0.00 ? 600 MXT A O2   1  
HETATM 3381   O O2   W MXT C 2 .   ? -1.245  8.149   19.072 0.010 0.00 ? 600 MXT A O2   1  
HETATM 3382   O O2   X MXT C 2 .   ? -1.746  22.289  17.597 0.010 0.00 ? 600 MXT A O2   1  
HETATM 3383   O O2   Y MXT C 2 .   ? -3.675  16.014  13.662 0.010 0.00 ? 600 MXT A O2   1  
HETATM 3384   O O2   Z MXT C 2 .   ? -2.372  16.174  15.105 0.010 0.00 ? 600 MXT A O2   1  
HETATM 3385   O O11  A MXT C 2 .   ? 23.941  19.578  25.085 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3386   O O11  B MXT C 2 .   ? 18.212  15.717  29.703 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3387   O O11  C MXT C 2 .   ? 25.546  18.052  22.496 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3388   O O11  D MXT C 2 .   ? 20.241  17.615  24.710 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3389   O O11  E MXT C 2 .   ? 18.593  16.817  26.325 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3390   O O11  F MXT C 2 .   ? 24.559  20.133  25.641 0.16  0.00 ? 600 MXT A O11  1  
HETATM 3391   O O11  U MXT C 2 .   ? 1.961   20.054  16.706 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3392   O O11  V MXT C 2 .   ? 5.067   18.982  14.319 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3393   O O11  W MXT C 2 .   ? 2.941   11.776  16.932 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3394   O O11  X MXT C 2 .   ? 4.550   22.235  16.214 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3395   O O11  Y MXT C 2 .   ? 1.691   13.244  14.116 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3396   O O11  Z MXT C 2 .   ? 1.794   20.318  17.847 0.010 0.00 ? 600 MXT A O11  1  
HETATM 3397   O O12  A MXT C 2 .   ? 23.151  15.139  24.105 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3398   O O12  B MXT C 2 .   ? 21.603  18.523  31.093 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3399   O O12  C MXT C 2 .   ? 23.994  18.239  26.837 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3400   O O12  D MXT C 2 .   ? 22.972  14.105  23.478 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3401   O O12  E MXT C 2 .   ? 20.921  18.993  29.661 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3402   O O12  F MXT C 2 .   ? 21.635  16.567  25.472 0.16  0.00 ? 600 MXT A O12  1  
HETATM 3403   O O12  U MXT C 2 .   ? 6.068   18.206  15.701 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3404   O O12  V MXT C 2 .   ? 3.134   14.799  14.587 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3405   O O12  W MXT C 2 .   ? 0.658   14.524  19.851 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3406   O O12  X MXT C 2 .   ? 2.843   18.105  17.368 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3407   O O12  Y MXT C 2 .   ? 1.553   16.180  17.671 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3408   O O12  Z MXT C 2 .   ? 3.751   16.906  15.434 0.010 0.00 ? 600 MXT A O12  1  
HETATM 3409   C C14  A MXT C 2 .   ? 23.396  18.487  25.136 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3410   C C14  B MXT C 2 .   ? 19.289  16.291  29.677 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3411   C C14  C MXT C 2 .   ? 25.249  17.652  23.610 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3412   C C14  D MXT C 2 .   ? 21.245  16.919  24.672 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3413   C C14  E MXT C 2 .   ? 19.379  16.961  27.247 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3414   C C14  F MXT C 2 .   ? 24.193  18.970  25.562 0.16  0.00 ? 600 MXT A C14  1  
HETATM 3415   C C14  U MXT C 2 .   ? 2.787   19.182  16.483 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3416   C C14  V MXT C 2 .   ? 4.498   18.027  14.826 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3417   C C14  W MXT C 2 .   ? 2.645   12.801  17.523 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3418   C C14  X MXT C 2 .   ? 4.553   21.048  16.503 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3419   C C14  Y MXT C 2 .   ? 2.093   13.870  15.083 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3420   C C14  Z MXT C 2 .   ? 2.685   19.612  17.401 0.010 0.00 ? 600 MXT A C14  1  
HETATM 3421   C C21  A MXT C 2 .   ? 24.971  17.418  23.418 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3422   C C21  B MXT C 2 .   ? 18.872  17.561  31.864 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3423   C C21  C MXT C 2 .   ? 24.466  19.953  24.426 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3424   C C21  D MXT C 2 .   ? 20.222  15.215  23.053 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3425   C C21  E MXT C 2 .   ? 18.870  19.459  27.528 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3426   C C21  F MXT C 2 .   ? 21.702  19.551  25.723 0.16  0.00 ? 600 MXT A C21  1  
HETATM 3427   C C21  U MXT C 2 .   ? 4.705   20.842  16.109 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3428   C C21  V MXT C 2 .   ? 4.493   16.650  12.663 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3429   C C21  W MXT C 2 .   ? 0.745   11.701  18.849 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3430   C C21  X MXT C 2 .   ? 2.007   20.921  16.775 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3431   C C21  Y MXT C 2 .   ? -0.140  15.070  15.464 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3432   C C21  Z MXT C 2 .   ? 1.084   18.107  16.081 0.010 0.00 ? 600 MXT A C21  1  
HETATM 3433   C C22  A MXT C 2 .   ? 25.518  16.014  23.061 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3434   C C22  B MXT C 2 .   ? 18.692  16.379  32.847 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3435   C C22  C MXT C 2 .   ? 25.790  20.756  24.402 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3436   C C22  D MXT C 2 .   ? 19.089  16.255  22.884 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3437   C C22  E MXT C 2 .   ? 17.331  19.291  27.536 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3438   C C22  F MXT C 2 .   ? 21.744  20.290  27.083 0.16  0.00 ? 600 MXT A C22  1  
HETATM 3439   C C22  U MXT C 2 .   ? 6.243   20.862  15.929 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3440   C C22  V MXT C 2 .   ? 3.215   16.501  11.803 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3441   C C22  W MXT C 2 .   ? 1.582   10.470  19.275 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3442   C C22  X MXT C 2 .   ? 1.910   22.131  17.735 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3443   C C22  Y MXT C 2 .   ? -0.742  13.997  14.525 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3444   C C22  Z MXT C 2 .   ? 0.218   17.607  17.263 0.010 0.00 ? 600 MXT A C22  1  
HETATM 3445   C C23  A MXT C 2 .   ? 26.069  18.418  23.869 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3446   C C23  B MXT C 2 .   ? 17.537  18.232  31.444 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3447   C C23  C MXT C 2 .   ? 23.405  20.527  25.403 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3448   C C23  D MXT C 2 .   ? 19.725  13.825  23.536 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3449   C C23  E MXT C 2 .   ? 19.424  20.065  26.211 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3450   C C23  F MXT C 2 .   ? 20.318  18.923  25.399 0.16  0.00 ? 600 MXT A C23  1  
HETATM 3451   C C23  U MXT C 2 .   ? 4.202   21.751  17.263 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3452   C C23  V MXT C 2 .   ? 5.546   15.538  12.412 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3453   C C23  W MXT C 2 .   ? -0.311  11.389  17.755 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3454   C C23  X MXT C 2 .   ? 0.878   19.873  16.978 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3455   C C23  Y MXT C 2 .   ? -0.331  16.524  14.953 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3456   C C23  Z MXT C 2 .   ? 1.111   17.131  14.873 0.010 0.00 ? 600 MXT A C23  1  
HETATM 3457   C C24  A MXT C 2 .   ? 26.646  16.041  21.979 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3458   C C24  B MXT C 2 .   ? 17.893  16.755  34.138 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3459   C C24  C MXT C 2 .   ? 25.592  22.276  24.090 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3460   C C24  D MXT C 2 .   ? 17.938  15.778  21.939 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3461   C C24  E MXT C 2 .   ? 16.557  20.615  27.231 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3462   C C24  F MXT C 2 .   ? 20.646  21.393  27.229 0.16  0.00 ? 600 MXT A C24  1  
HETATM 3463   C C24  U MXT C 2 .   ? 6.830   22.297  15.729 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3464   C C24  V MXT C 2 .   ? 3.500   16.419  10.268 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3465   C C24  W MXT C 2 .   ? 0.713   9.259   19.749 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3466   C C24  X MXT C 2 .   ? 0.530   22.865  17.679 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3467   C C24  Y MXT C 2 .   ? -2.257  14.222  14.209 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3468   C C24  Z MXT C 2 .   ? -1.254  17.269  16.858 0.010 0.00 ? 600 MXT A C24  1  
HETATM 3469   C C25  A MXT C 2 .   ? 26.044  16.241  20.552 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3470   C C25  B MXT C 2 .   ? 18.797  17.537  35.143 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3471   C C25  C MXT C 2 .   ? 25.350  22.503  22.564 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3472   C C25  D MXT C 2 .   ? 18.363  15.900  20.441 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3473   C C25  E MXT C 2 .   ? 16.528  21.544  28.486 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3474   C C25  F MXT C 2 .   ? 21.046  22.683  26.441 0.16  0.00 ? 600 MXT A C25  1  
HETATM 3475   C C25  U MXT C 2 .   ? 6.586   22.799  14.270 0.010 0.00 ? 600 MXT A C25  1  
HETATM 3476   C C25  V MXT C 2 .   ? 3.806   17.835  9.683  0.010 0.00 ? 600 MXT A C25  1  
HETATM 3477   C C25  W MXT C 2 .   ? 0.188   9.487   21.202 0.010 0.00 ? 600 MXT A C25  1  
HETATM 3478   C C25  X MXT C 2 .   ? 0.437   23.776  16.414 0.010 0.00 ? 600 MXT A C25  1  
HETATM 3479   C C25  Y MXT C 2 .   ? -3.147  13.766  15.408 0.010 0.00 ? 600 MXT A C25  1  
HETATM 3480   C C25  Z MXT C 2 .   ? -2.102  18.572  16.703 0.010 0.00 ? 600 MXT A C25  1  
HETATM 3481   C C26  A MXT C 2 .   ? 27.421  14.687  22.029 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3482   C C26  B MXT C 2 .   ? 17.380  15.444  34.812 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3483   C C26  C MXT C 2 .   ? 26.872  23.049  24.534 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3484   C C26  D MXT C 2 .   ? 16.678  16.663  22.196 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3485   C C26  E MXT C 2 .   ? 15.095  20.255  26.815 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3486   C C26  F MXT C 2 .   ? 20.481  21.740  28.741 0.16  0.00 ? 600 MXT A C26  1  
HETATM 3487   C C26  U MXT C 2 .   ? 8.364   22.256  16.013 0.010 0.00 ? 600 MXT A C26  1  
HETATM 3488   C C26  V MXT C 2 .   ? 2.246   15.822  9.555  0.010 0.00 ? 600 MXT A C26  1  
HETATM 3489   C C26  W MXT C 2 .   ? 1.589   7.968   19.710 0.010 0.00 ? 600 MXT A C26  1  
HETATM 3490   C C26  X MXT C 2 .   ? 0.374   23.739  18.962 0.010 0.00 ? 600 MXT A C26  1  
HETATM 3491   C C26  Y MXT C 2 .   ? -2.632  13.395  12.939 0.010 0.00 ? 600 MXT A C26  1  
HETATM 3492   C C26  Z MXT C 2 .   ? -1.885  16.369  17.967 0.010 0.00 ? 600 MXT A C26  1  
HETATM 3493   C C27  A MXT C 2 .   ? 27.554  18.100  23.475 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3494   C C27  B MXT C 2 .   ? 16.283  17.999  32.360 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3495   C C27  C MXT C 2 .   ? 23.566  22.020  25.859 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3496   C C27  D MXT C 2 .   ? 18.206  13.485  23.341 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3497   C C27  E MXT C 2 .   ? 18.423  20.850  25.292 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3498   C C27  F MXT C 2 .   ? 19.067  19.475  26.169 0.16  0.00 ? 600 MXT A C27  1  
HETATM 3499   C C27  U MXT C 2 .   ? 5.158   22.889  17.767 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3500   C C27  V MXT C 2 .   ? 5.446   14.727  11.072 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3501   C C27  W MXT C 2 .   ? -0.741  9.893   17.563 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3502   C C27  X MXT C 2 .   ? -0.423  20.338  17.720 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3503   C C27  Y MXT C 2 .   ? -1.453  16.780  13.887 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3504   C C27  Z MXT C 2 .   ? -0.039  16.069  14.766 0.010 0.00 ? 600 MXT A C27  1  
HETATM 3505   C C28  A MXT C 2 .   ? 28.253  19.462  23.147 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3506   C C28  B MXT C 2 .   ? 15.464  19.334  32.376 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3507   C C28  C MXT C 2 .   ? 22.128  22.631  25.967 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3508   C C28  D MXT C 2 .   ? 18.111  11.965  22.977 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3509   C C28  E MXT C 2 .   ? 19.206  22.056  24.672 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3510   C C28  F MXT C 2 .   ? 17.867  19.480  25.165 0.16  0.00 ? 600 MXT A C28  1  
HETATM 3511   C C28  U MXT C 2 .   ? 4.266   24.125  18.122 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3512   C C28  V MXT C 2 .   ? 6.908   14.437  10.592 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3513   C C28  W MXT C 2 .   ? -2.271  9.887   17.230 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3514   C C28  X MXT C 2 .   ? -1.633  19.616  17.038 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3515   C C28  Y MXT C 2 .   ? -2.093  18.173  14.208 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3516   C C28  Z MXT C 2 .   ? -0.384  15.907  13.248 0.010 0.00 ? 600 MXT A C28  1  
HETATM 3517   C C29  A MXT C 2 .   ? 28.328  17.413  24.642 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3518   C C29  B MXT C 2 .   ? 15.368  16.862  31.810 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3519   C C29  C MXT C 2 .   ? 24.259  22.129  27.253 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3520   C C29  D MXT C 2 .   ? 17.385  13.735  24.643 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3521   C C29  E MXT C 2 .   ? 17.884  19.959  24.131 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3522   C C29  F MXT C 2 .   ? 18.693  18.572  27.386 0.16  0.00 ? 600 MXT A C29  1  
HETATM 3523   C C29  U MXT C 2 .   ? 5.945   22.462  19.044 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3524   C C29  V MXT C 2 .   ? 4.711   13.365  11.273 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3525   C C29  W MXT C 2 .   ? 0.026   9.217   16.383 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3526   C C29  X MXT C 2 .   ? -0.399  19.945  19.230 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3527   C C29  Y MXT C 2 .   ? -0.877  16.821  12.438 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3528   C C29  Z MXT C 2 .   ? 0.404   14.680  15.326 0.010 0.00 ? 600 MXT A C29  1  
HETATM 3529   C C11  A MXT C 2 .   ? 21.922  16.606  25.670 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3530   C C11  B MXT C 2 .   ? 21.519  17.103  29.070 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3531   C C11  C MXT C 2 .   ? 24.859  16.279  25.602 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3532   C C11  D MXT C 2 .   ? 23.482  15.982  25.003 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3533   C C11  E MXT C 2 .   ? 21.060  16.617  28.995 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3534   C C11  F MXT C 2 .   ? 24.104  16.531  25.365 0.16  0.00 ? 600 MXT A C11  1  
HETATM 3535   C C11  U MXT C 2 .   ? 3.929   17.044  16.136 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3536   C C11  V MXT C 2 .   ? 3.377   16.493  16.372 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3537   C C11  W MXT C 2 .   ? 2.541   15.103  18.357 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3538   C C11  X MXT C 2 .   ? 5.203   18.740  17.000 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3539   C C11  Y MXT C 2 .   ? 3.453   14.802  16.894 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3540   C C11  Z MXT C 2 .   ? 4.849   18.602  16.857 0.010 0.00 ? 600 MXT A C11  1  
HETATM 3541   C C12  A MXT C 2 .   ? 22.186  18.094  25.985 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3542   C C12  B MXT C 2 .   ? 20.377  16.173  28.607 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3543   C C12  C MXT C 2 .   ? 25.386  16.228  24.151 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3544   C C12  D MXT C 2 .   ? 22.558  17.147  25.419 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3545   C C12  E MXT C 2 .   ? 20.285  15.897  27.869 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3546   C C12  F MXT C 2 .   ? 25.077  17.729  25.434 0.16  0.00 ? 600 MXT A C12  1  
HETATM 3547   C C12  U MXT C 2 .   ? 2.557   17.670  16.462 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3548   C C12  V MXT C 2 .   ? 4.017   17.895  16.272 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3549   C C12  W MXT C 2 .   ? 3.294   14.178  17.375 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3550   C C12  X MXT C 2 .   ? 5.767   20.128  16.625 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3551   C C12  Y MXT C 2 .   ? 3.494   13.829  15.695 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3552   C C12  Z MXT C 2 .   ? 4.186   19.735  17.671 0.010 0.00 ? 600 MXT A C12  1  
HETATM 3553   C C13  A MXT C 2 .   ? 23.005  16.224  24.645 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3554   C C13  B MXT C 2 .   ? 21.019  17.709  30.394 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3555   C C13  C MXT C 2 .   ? 24.445  17.747  25.816 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3556   C C13  D MXT C 2 .   ? 22.638  15.140  24.031 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3557   C C13  E MXT C 2 .   ? 20.554  18.069  28.954 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3558   C C13  F MXT C 2 .   ? 22.701  17.158  25.462 0.16  0.00 ? 600 MXT A C13  1  
HETATM 3559   C C13  U MXT C 2 .   ? 4.882   18.244  15.984 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3560   C C13  V MXT C 2 .   ? 3.528   15.891  14.962 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3561   C C13  W MXT C 2 .   ? 1.490   14.195  19.021 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3562   C C13  X MXT C 2 .   ? 3.680   18.944  17.076 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3563   C C13  Y MXT C 2 .   ? 2.017   15.356  16.901 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3564   C C13  Z MXT C 2 .   ? 3.679   17.882  16.161 0.010 0.00 ? 600 MXT A C13  1  
HETATM 3565   H H21  A MXT C 2 .   ? 24.558  17.844  22.463 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3566   H H21  B MXT C 2 .   ? 19.436  18.352  32.430 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3567   H H21  C MXT C 2 .   ? 24.015  20.064  23.402 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3568   H H21  D MXT C 2 .   ? 20.639  15.037  22.024 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3569   H H21  E MXT C 2 .   ? 19.105  20.217  28.325 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3570   H H21  F MXT C 2 .   ? 21.861  20.336  24.936 0.16  0.00 ? 600 MXT A H21  1  
HETATM 3571   H H21  U MXT C 2 .   ? 4.275   21.290  15.172 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3572   H H21  V MXT C 2 .   ? 4.984   17.604  12.327 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3573   H H21  W MXT C 2 .   ? 0.153   12.005  19.754 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3574   H H21  X MXT C 2 .   ? 1.848   21.329  15.741 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3575   H H21  Y MXT C 2 .   ? -0.729  15.014  16.420 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3576   H H21  Z MXT C 2 .   ? 0.584   19.037  15.699 0.010 0.00 ? 600 MXT A H21  1  
HETATM 3577   H H121 A MXT C 2 .   ? 22.391  18.283  27.059 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3578   H H121 B MXT C 2 .   ? 20.692  15.116  28.492 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3579   H H121 C MXT C 2 .   ? 24.828  15.515  23.509 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3580   H H121 D MXT C 2 .   ? 22.976  18.145  25.172 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3581   H H121 E MXT C 2 .   ? 19.680  15.042  28.234 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3582   H H121 F MXT C 2 .   ? 25.732  17.811  24.541 0.16  0.00 ? 600 MXT A H121 1  
HETATM 3583   H H121 U MXT C 2 .   ? 2.141   17.330  17.433 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3584   H H121 V MXT C 2 .   ? 4.862   18.041  16.974 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3585   H H121 W MXT C 2 .   ? 4.383   14.116  17.581 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3586   H H121 X MXT C 2 .   ? 6.345   20.123  15.677 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3587   H H121 Y MXT C 2 .   ? 3.758   12.791  15.986 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3588   H H121 Z MXT C 2 .   ? 4.548   20.745  17.389 0.010 0.00 ? 600 MXT A H121 1  
HETATM 3589   H H122 A MXT C 2 .   ? 21.308  18.720  25.716 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3590   H H122 B MXT C 2 .   ? 19.980  16.493  27.620 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3591   H H122 C MXT C 2 .   ? 26.449  15.908  24.126 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3592   H H122 D MXT C 2 .   ? 22.381  17.143  26.517 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3593   H H122 E MXT C 2 .   ? 20.980  15.490  27.105 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3594   H H122 F MXT C 2 .   ? 25.752  17.645  26.312 0.16  0.00 ? 600 MXT A H122 1  
HETATM 3595   H H122 U MXT C 2 .   ? 1.805   17.408  15.687 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3596   H H122 V MXT C 2 .   ? 3.274   18.688  16.503 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3597   H H122 W MXT C 2 .   ? 3.192   14.541  16.330 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3598   H H122 X MXT C 2 .   ? 6.457   20.504  17.412 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3599   H H122 Y MXT C 2 .   ? 4.250   14.150  14.948 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3600   H H122 Z MXT C 2 .   ? 4.392   19.619  18.757 0.010 0.00 ? 600 MXT A H122 1  
HETATM 3601   H H221 A MXT C 2 .   ? 25.888  15.486  23.965 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3602   H H221 B MXT C 2 .   ? 18.199  15.515  32.350 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3603   H H221 C MXT C 2 .   ? 26.343  20.647  25.360 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3604   H H221 D MXT C 2 .   ? 18.659  16.544  23.867 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3605   H H221 E MXT C 2 .   ? 17.010  18.503  26.822 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3606   H H221 F MXT C 2 .   ? 21.661  19.577  27.931 0.16  0.00 ? 600 MXT A H221 1  
HETATM 3607   H H221 U MXT C 2 .   ? 6.753   20.372  16.785 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3608   H H221 V MXT C 2 .   ? 2.623   15.613  12.114 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3609   H H221 W MXT C 2 .   ? 2.256   10.139  18.455 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3610   H H221 X MXT C 2 .   ? 2.123   21.831  18.783 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3611   H H221 Y MXT C 2 .   ? -0.172  13.933  13.572 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3612   H H221 Z MXT C 2 .   ? 0.676   16.720  17.751 0.010 0.00 ? 600 MXT A H221 1  
HETATM 3613   H H222 A MXT C 2 .   ? 24.680  15.384  22.681 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3614   H H222 B MXT C 2 .   ? 19.696  16.002  33.152 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3615   H H222 C MXT C 2 .   ? 26.464  20.322  23.628 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3616   H H222 D MXT C 2 .   ? 19.519  17.196  22.469 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3617   H H222 E MXT C 2 .   ? 17.012  18.918  28.538 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3618   H H222 F MXT C 2 .   ? 22.743  20.768  27.205 0.16  0.00 ? 600 MXT A H222 1  
HETATM 3619   H H222 U MXT C 2 .   ? 6.511   20.243  15.040 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3620   H H222 V MXT C 2 .   ? 2.546   17.373  11.991 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3621   H H222 W MXT C 2 .   ? 2.262   10.764  20.108 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3622   H H222 X MXT C 2 .   ? 2.710   22.864  17.476 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3623   H H222 Y MXT C 2 .   ? -0.624  12.994  14.998 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3624   H H222 Z MXT C 2 .   ? 0.195   18.392  18.053 0.010 0.00 ? 600 MXT A H222 1  
HETATM 3625   H H231 A MXT C 2 .   ? 25.781  19.405  23.433 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3626   H H231 B MXT C 2 .   ? 17.749  19.327  31.391 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3627   H H231 C MXT C 2 .   ? 22.421  20.408  24.889 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3628   H H231 D MXT C 2 .   ? 20.338  13.072  22.985 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3629   H H231 E MXT C 2 .   ? 20.251  20.751  26.515 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3630   H H231 F MXT C 2 .   ? 20.165  19.072  24.303 0.16  0.00 ? 600 MXT A H231 1  
HETATM 3631   H H231 U MXT C 2 .   ? 3.252   22.209  16.899 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3632   H H231 V MXT C 2 .   ? 6.541   16.044  12.456 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3633   H H231 W MXT C 2 .   ? -1.211  11.995  18.019 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3634   H H231 X MXT C 2 .   ? 0.604   19.517  15.956 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3635   H H231 Y MXT C 2 .   ? -0.543  17.141  15.859 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3636   H H231 Z MXT C 2 .   ? 1.096   17.775  13.960 0.010 0.00 ? 600 MXT A H231 1  
HETATM 3637   H H232 A MXT C 2 .   ? 26.045  18.585  24.969 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3638   H H232 B MXT C 2 .   ? 17.247  17.954  30.408 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3639   H H232 C MXT C 2 .   ? 23.316  19.907  26.321 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3640   H H232 D MXT C 2 .   ? 19.969  13.652  24.607 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3641   H H232 E MXT C 2 .   ? 19.920  19.295  25.582 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3642   H H232 F MXT C 2 .   ? 20.329  17.818  25.529 0.16  0.00 ? 600 MXT A H232 1  
HETATM 3643   H H232 U MXT C 2 .   ? 3.898   21.154  18.152 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3644   H H232 V MXT C 2 .   ? 5.571   14.802  13.245 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3645   H H232 W MXT C 2 .   ? 0.001   11.776  16.761 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3646   H H232 X MXT C 2 .   ? 1.251   18.964  17.498 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3647   H H232 Y MXT C 2 .   ? 0.615   16.943  14.547 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3648   H H232 Z MXT C 2 .   ? 2.078   16.584  14.809 0.010 0.00 ? 600 MXT A H232 1  
HETATM 3649   H H251 A MXT C 2 .   ? 26.801  16.107  19.754 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3650   H H251 B MXT C 2 .   ? 18.305  17.681  36.127 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3651   H H251 C MXT C 2 .   ? 25.363  23.578  22.292 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3652   H H251 D MXT C 2 .   ? 17.516  15.719  19.748 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3653   H H251 E MXT C 2 .   ? 15.855  22.415  28.347 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3654   H H251 F MXT C 2 .   ? 20.365  23.533  26.653 0.16  0.00 ? 600 MXT A H251 1  
HETATM 3655   H H251 U MXT C 2 .   ? 7.126   23.743  14.054 0.010 0.00 ? 600 MXT A H251 1  
HETATM 3656   H H251 V MXT C 2 .   ? 3.859   17.829  8.575  0.010 0.00 ? 600 MXT A H251 1  
HETATM 3657   H H251 W MXT C 2 .   ? -0.298  8.582   21.620 0.010 0.00 ? 600 MXT A H251 1  
HETATM 3658   H H251 X MXT C 2 .   ? -0.462  24.425  16.429 0.010 0.00 ? 600 MXT A H251 1  
HETATM 3659   H H251 Y MXT C 2 .   ? -4.227  13.767  15.153 0.010 0.00 ? 600 MXT A H251 1  
HETATM 3660   H H251 Z MXT C 2 .   ? -3.182  18.359  16.571 0.010 0.00 ? 600 MXT A H251 1  
HETATM 3661   H H252 A MXT C 2 .   ? 25.243  15.495  20.364 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3662   H H252 B MXT C 2 .   ? 19.737  16.977  35.331 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3663   H H252 C MXT C 2 .   ? 26.149  22.012  21.970 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3664   H H252 D MXT C 2 .   ? 18.736  16.924  20.228 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3665   H H252 E MXT C 2 .   ? 16.153  20.985  29.369 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3666   H H252 F MXT C 2 .   ? 22.066  23.009  26.729 0.16  0.00 ? 600 MXT A H252 1  
HETATM 3667   H H252 U MXT C 2 .   ? 6.949   22.047  13.538 0.010 0.00 ? 600 MXT A H252 1  
HETATM 3668   H H252 V MXT C 2 .   ? 3.004   18.549  9.963  0.010 0.00 ? 600 MXT A H252 1  
HETATM 3669   H H252 W MXT C 2 .   ? 1.029   9.743   21.880 0.010 0.00 ? 600 MXT A H252 1  
HETATM 3670   H H252 X MXT C 2 .   ? 1.317   24.450  16.358 0.010 0.00 ? 600 MXT A H252 1  
HETATM 3671   H H252 Y MXT C 2 .   ? -2.889  12.728  15.707 0.010 0.00 ? 600 MXT A H252 1  
HETATM 3672   H H252 Z MXT C 2 .   ? -2.008  19.203  17.611 0.010 0.00 ? 600 MXT A H252 1  
HETATM 3673   H H253 A MXT C 2 .   ? 25.599  17.248  20.414 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3674   H H253 B MXT C 2 .   ? 19.077  18.543  34.772 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3675   H H253 C MXT C 2 .   ? 24.380  22.092  22.219 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3676   H H253 D MXT C 2 .   ? 19.167  15.189  20.164 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3677   H H253 E MXT C 2 .   ? 17.528  21.944  28.745 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3678   H H253 F MXT C 2 .   ? 21.043  22.529  25.343 0.16  0.00 ? 600 MXT A H253 1  
HETATM 3679   H H253 U MXT C 2 .   ? 5.514   22.981  14.055 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3680   H H253 V MXT C 2 .   ? 4.766   18.250  10.050 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3681   H H253 W MXT C 2 .   ? -0.552  10.311  21.264 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3682   H H253 X MXT C 2 .   ? 0.402   23.196  15.470 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3683   H H253 Y MXT C 2 .   ? -3.024  14.410  16.301 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3684   H H253 Z MXT C 2 .   ? -1.784  19.187  15.836 0.010 0.00 ? 600 MXT A H253 1  
HETATM 3685   H H261 A MXT C 2 .   ? 26.717  13.838  21.905 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3686   H H261 B MXT C 2 .   ? 18.232  14.759  35.009 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3687   H H261 C MXT C 2 .   ? 27.769  22.618  24.044 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3688   H H261 D MXT C 2 .   ? 16.932  17.736  22.067 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3689   H H261 E MXT C 2 .   ? 14.614  19.640  27.604 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3690   H H261 F MXT C 2 .   ? 21.459  22.038  29.175 0.16  0.00 ? 600 MXT A H261 1  
HETATM 3691   H H261 U MXT C 2 .   ? 8.851   21.491  15.373 0.010 0.00 ? 600 MXT A H261 1  
HETATM 3692   H H261 V MXT C 2 .   ? 1.345   16.425  9.801  0.010 0.00 ? 600 MXT A H261 1  
HETATM 3693   H H261 W MXT C 2 .   ? 2.507   8.110   20.318 0.010 0.00 ? 600 MXT A H261 1  
HETATM 3694   H H261 X MXT C 2 .   ? 1.235   24.434  19.057 0.010 0.00 ? 600 MXT A H261 1  
HETATM 3695   H H261 Y MXT C 2 .   ? -2.370  12.326  13.088 0.010 0.00 ? 600 MXT A H261 1  
HETATM 3696   H H261 Z MXT C 2 .   ? -1.809  16.869  18.955 0.010 0.00 ? 600 MXT A H261 1  
HETATM 3697   H H262 A MXT C 2 .   ? 28.177  14.598  21.224 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3698   H H262 B MXT C 2 .   ? 16.885  15.630  35.785 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3699   H H262 C MXT C 2 .   ? 26.839  24.123  24.255 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3700   H H262 D MXT C 2 .   ? 15.851  16.441  21.490 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3701   H H262 E MXT C 2 .   ? 14.461  21.153  26.675 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3702   H H262 F MXT C 2 .   ? 19.783  22.586  28.910 0.16  0.00 ? 600 MXT A H262 1  
HETATM 3703   H H262 U MXT C 2 .   ? 8.864   23.221  15.798 0.010 0.00 ? 600 MXT A H262 1  
HETATM 3704   H H262 V MXT C 2 .   ? 2.342   15.823  8.452  0.010 0.00 ? 600 MXT A H262 1  
HETATM 3705   H H262 W MXT C 2 .   ? 1.063   7.084   20.125 0.010 0.00 ? 600 MXT A H262 1  
HETATM 3706   H H262 X MXT C 2 .   ? -0.543  24.363  18.943 0.010 0.00 ? 600 MXT A H262 1  
HETATM 3707   H H262 Y MXT C 2 .   ? -3.716  13.433  12.712 0.010 0.00 ? 600 MXT A H262 1  
HETATM 3708   H H262 Z MXT C 2 .   ? -2.963  16.169  17.790 0.010 0.00 ? 600 MXT A H262 1  
HETATM 3709   H H263 A MXT C 2 .   ? 27.947  14.539  22.992 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3710   H H263 B MXT C 2 .   ? 16.661  14.897  34.175 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3711   H H263 C MXT C 2 .   ? 27.039  22.999  25.627 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3712   H H263 D MXT C 2 .   ? 16.279  16.542  23.220 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3713   H H263 E MXT C 2 .   ? 15.055  19.672  25.875 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3714   H H263 F MXT C 2 .   ? 20.106  20.882  29.332 0.16  0.00 ? 600 MXT A H263 1  
HETATM 3715   H H263 U MXT C 2 .   ? 8.590   21.995  17.065 0.010 0.00 ? 600 MXT A H263 1  
HETATM 3716   H H263 V MXT C 2 .   ? 2.039   14.782  9.867  0.010 0.00 ? 600 MXT A H263 1  
HETATM 3717   H H263 W MXT C 2 .   ? 1.912   7.708   18.684 0.010 0.00 ? 600 MXT A H263 1  
HETATM 3718   H H263 X MXT C 2 .   ? 0.341   23.131  19.885 0.010 0.00 ? 600 MXT A H263 1  
HETATM 3719   H H263 Y MXT C 2 .   ? -2.093  13.742  12.036 0.010 0.00 ? 600 MXT A H263 1  
HETATM 3720   H H263 Z MXT C 2 .   ? -1.379  15.389  18.054 0.010 0.00 ? 600 MXT A H263 1  
HETATM 3721   H H281 A MXT C 2 .   ? 27.830  19.945  22.246 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3722   H H281 B MXT C 2 .   ? 16.012  20.158  32.871 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3723   H H281 C MXT C 2 .   ? 21.625  22.700  24.984 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3724   H H281 D MXT C 2 .   ? 18.568  11.739  21.994 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3725   H H281 E MXT C 2 .   ? 19.510  22.797  25.436 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3726   H H281 F MXT C 2 .   ? 18.015  20.199  24.336 0.16  0.00 ? 600 MXT A H281 1  
HETATM 3727   H H281 U MXT C 2 .   ? 3.773   24.558  17.231 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3728   H H281 V MXT C 2 .   ? 7.449   15.361  10.310 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3729   H H281 W MXT C 2 .   ? -2.887  10.239  18.079 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3730   H H281 X MXT C 2 .   ? -1.784  19.947  15.993 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3731   H H281 Y MXT C 2 .   ? -2.631  18.176  15.175 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3732   H H281 Z MXT C 2 .   ? -0.824  16.827  12.817 0.010 0.00 ? 600 MXT A H281 1  
HETATM 3733   H H282 A MXT C 2 .   ? 28.120  20.166  23.995 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3734   H H282 B MXT C 2 .   ? 15.249  19.656  31.336 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3735   H H282 C MXT C 2 .   ? 21.496  21.993  26.621 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3736   H H282 D MXT C 2 .   ? 18.646  11.361  23.740 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3737   H H282 E MXT C 2 .   ? 20.130  21.689  24.177 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3738   H H282 F MXT C 2 .   ? 17.749  18.473  24.712 0.16  0.00 ? 600 MXT A H282 1  
HETATM 3739   H H282 U MXT C 2 .   ? 3.465   23.821  18.829 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3740   H H282 V MXT C 2 .   ? 7.483   13.952  11.409 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3741   H H282 W MXT C 2 .   ? -2.473  10.561  16.371 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3742   H H282 X MXT C 2 .   ? -1.455  18.520  17.017 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3743   H H282 Y MXT C 2 .   ? -1.298  18.947  14.268 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3744   H H282 Z MXT C 2 .   ? 0.538   15.679  12.673 0.010 0.00 ? 600 MXT A H282 1  
HETATM 3745   H H283 A MXT C 2 .   ? 29.346  19.355  22.991 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3746   H H283 B MXT C 2 .   ? 14.483  19.227  32.885 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3747   H H283 C MXT C 2 .   ? 22.128  23.645  26.419 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3748   H H283 D MXT C 2 .   ? 17.065  11.595  22.956 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3749   H H283 E MXT C 2 .   ? 18.622  22.592  23.895 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3750   H H283 F MXT C 2 .   ? 16.900  19.722  25.654 0.16  0.00 ? 600 MXT A H283 1  
HETATM 3751   H H283 U MXT C 2 .   ? 4.837   24.936  18.619 0.010 0.00 ? 600 MXT A H283 1  
HETATM 3752   H H283 V MXT C 2 .   ? 6.944   13.747  9.724  0.010 0.00 ? 600 MXT A H283 1  
HETATM 3753   H H283 W MXT C 2 .   ? -2.642  8.882   16.939 0.010 0.00 ? 600 MXT A H283 1  
HETATM 3754   H H283 X MXT C 2 .   ? -2.587  19.772  17.583 0.010 0.00 ? 600 MXT A H283 1  
HETATM 3755   H H283 Y MXT C 2 .   ? -2.803  18.509  13.425 0.010 0.00 ? 600 MXT A H283 1  
HETATM 3756   H H283 Z MXT C 2 .   ? -1.091  15.072  13.056 0.010 0.00 ? 600 MXT A H283 1  
HETATM 3757   H H291 A MXT C 2 .   ? 29.375  17.179  24.362 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3758   H H291 B MXT C 2 .   ? 14.486  16.690  32.459 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3759   H H291 C MXT C 2 .   ? 24.379  23.183  27.573 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3760   H H291 D MXT C 2 .   ? 16.311  13.503  24.506 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3761   H H291 E MXT C 2 .   ? 17.170  20.508  23.484 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3762   H H291 F MXT C 2 .   ? 17.813  18.964  27.936 0.16  0.00 ? 600 MXT A H291 1  
HETATM 3763   H H291 U MXT C 2 .   ? 6.628   23.261  19.396 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3764   H H291 V MXT C 2 .   ? 4.632   12.794  10.327 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3765   H H291 W MXT C 2 .   ? -0.272  8.158   16.250 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3766   H H291 X MXT C 2 .   ? -1.314  20.278  19.759 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3767   H H291 Y MXT C 2 .   ? -1.669  16.995  11.682 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3768   H H291 Z MXT C 2 .   ? -0.410  13.929  15.258 0.010 0.00 ? 600 MXT A H291 1  
HETATM 3769   H H292 A MXT C 2 .   ? 27.860  16.466  24.975 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3770   H H292 B MXT C 2 .   ? 15.894  15.893  31.709 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3771   H H292 C MXT C 2 .   ? 25.262  21.662  27.275 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3772   H H292 D MXT C 2 .   ? 17.451  14.780  25.004 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3773   H H292 E MXT C 2 .   ? 17.367  19.047  24.488 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3774   H H292 F MXT C 2 .   ? 19.518  18.467  28.117 0.16  0.00 ? 600 MXT A H292 1  
HETATM 3775   H H292 U MXT C 2 .   ? 6.559   21.552  18.891 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3776   H H292 V MXT C 2 .   ? 3.685   13.482  11.673 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3777   H H292 W MXT C 2 .   ? 1.124   9.236   16.515 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3778   H H292 X MXT C 2 .   ? 0.467   20.369  19.775 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3779   H H292 Y MXT C 2 .   ? -0.351  15.889  12.153 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3780   H H292 Z MXT C 2 .   ? 0.725   14.722  16.384 0.010 0.00 ? 600 MXT A H292 1  
HETATM 3781   H H293 A MXT C 2 .   ? 28.368  18.083  25.526 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3782   H H293 B MXT C 2 .   ? 14.985  17.126  30.804 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3783   H H293 C MXT C 2 .   ? 23.648  21.620  28.028 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3784   H H293 D MXT C 2 .   ? 17.756  13.087  25.465 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3785   H H293 E MXT C 2 .   ? 18.719  19.622  23.483 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3786   H H293 F MXT C 2 .   ? 18.433  17.549  27.042 0.16  0.00 ? 600 MXT A H293 1  
HETATM 3787   H H293 U MXT C 2 .   ? 5.243   22.242  19.874 0.010 0.00 ? 600 MXT A H293 1  
HETATM 3788   H H293 V MXT C 2 .   ? 5.266   12.729  11.992 0.010 0.00 ? 600 MXT A H293 1  
HETATM 3789   H H293 W MXT C 2 .   ? -0.194  9.740   15.430 0.010 0.00 ? 600 MXT A H293 1  
HETATM 3790   H H293 X MXT C 2 .   ? -0.342  18.842  19.342 0.010 0.00 ? 600 MXT A H293 1  
HETATM 3791   H H293 Y MXT C 2 .   ? -0.144  17.647  12.337 0.010 0.00 ? 600 MXT A H293 1  
HETATM 3792   H H293 Z MXT C 2 .   ? 1.261   14.285  14.743 0.010 0.00 ? 600 MXT A H293 1  
ATOM   3793   N N    . GLY A 1 5   ? -19.436 18.281  47.658 1.00  0.00 ? 5   GLY A N    2  
ATOM   3794   C CA   . GLY A 1 5   ? -20.256 17.263  46.989 1.00  0.00 ? 5   GLY A CA   2  
ATOM   3795   C C    . GLY A 1 5   ? -19.681 16.619  45.734 1.00  0.00 ? 5   GLY A C    2  
ATOM   3796   O O    . GLY A 1 5   ? -20.381 15.911  44.984 1.00  0.00 ? 5   GLY A O    2  
ATOM   3797   N N    . LYS A 1 6   ? -18.410 16.871  45.483 1.00  0.00 ? 6   LYS A N    2  
ATOM   3798   C CA   . LYS A 1 6   ? -17.701 16.290  44.352 1.00  0.00 ? 6   LYS A CA   2  
ATOM   3799   C C    . LYS A 1 6   ? -16.238 16.160  44.725 1.00  0.00 ? 6   LYS A C    2  
ATOM   3800   O O    . LYS A 1 6   ? -15.856 16.416  45.876 1.00  0.00 ? 6   LYS A O    2  
ATOM   3801   H H    . LYS A 1 6   ? -17.914 17.447  46.103 1.00  0.00 ? 6   LYS A H    2  
ATOM   3802   N N    . LEU A 1 7   ? -15.448 15.679  43.787 1.00  0.00 ? 7   LEU A N    2  
ATOM   3803   C CA   . LEU A 1 7   ? -13.994 15.539  44.048 1.00  0.00 ? 7   LEU A CA   2  
ATOM   3804   C C    . LEU A 1 7   ? -13.247 16.164  42.881 1.00  0.00 ? 7   LEU A C    2  
ATOM   3805   O O    . LEU A 1 7   ? -13.594 16.051  41.722 1.00  0.00 ? 7   LEU A O    2  
ATOM   3806   H H    . LEU A 1 7   ? -15.816 15.432  42.914 1.00  0.00 ? 7   LEU A H    2  
ATOM   3807   N N    . VAL A 1 8   ? -12.240 16.944  43.210 1.00  0.00 ? 8   VAL A N    2  
ATOM   3808   C CA   . VAL A 1 8   ? -11.351 17.522  42.203 1.00  0.00 ? 8   VAL A CA   2  
ATOM   3809   C C    . VAL A 1 8   ? -9.954  17.034  42.623 1.00  0.00 ? 8   VAL A C    2  
ATOM   3810   O O    . VAL A 1 8   ? -9.566  17.009  43.781 1.00  0.00 ? 8   VAL A O    2  
ATOM   3811   H H    . VAL A 1 8   ? -12.032 17.076  44.159 1.00  0.00 ? 8   VAL A H    2  
ATOM   3812   N N    . ILE A 1 9   ? -9.302  16.490  41.606 1.00  0.00 ? 9   ILE A N    2  
ATOM   3813   C CA   . ILE A 1 9   ? -7.951  15.929  41.766 1.00  0.00 ? 9   ILE A CA   2  
ATOM   3814   C C    . ILE A 1 9   ? -6.985  16.595  40.789 1.00  0.00 ? 9   ILE A C    2  
ATOM   3815   O O    . ILE A 1 9   ? -7.370  16.900  39.660 1.00  0.00 ? 9   ILE A O    2  
ATOM   3816   H H    . ILE A 1 9   ? -9.736  16.446  40.729 1.00  0.00 ? 9   ILE A H    2  
ATOM   3817   N N    . TRP A 1 10  ? -5.792  16.784  41.289 1.00  0.00 ? 10  TRP A N    2  
ATOM   3818   C CA   . TRP A 1 10  ? -4.654  17.363  40.578 1.00  0.00 ? 10  TRP A CA   2  
ATOM   3819   C C    . TRP A 1 10  ? -3.522  16.342  40.531 1.00  0.00 ? 10  TRP A C    2  
ATOM   3820   O O    . TRP A 1 10  ? -3.092  15.793  41.548 1.00  0.00 ? 10  TRP A O    2  
ATOM   3821   H H    . TRP A 1 10  ? -5.641  16.490  42.212 1.00  0.00 ? 10  TRP A H    2  
ATOM   3822   N N    . ILE A 1 11  ? -3.062  16.105  39.325 1.00  0.00 ? 11  ILE A N    2  
ATOM   3823   C CA   . ILE A 1 11  ? -1.975  15.158  39.055 1.00  0.00 ? 11  ILE A CA   2  
ATOM   3824   C C    . ILE A 1 11  ? -1.195  15.730  37.888 1.00  0.00 ? 11  ILE A C    2  
ATOM   3825   O O    . ILE A 1 11  ? -1.783  16.434  37.066 1.00  0.00 ? 11  ILE A O    2  
ATOM   3826   H H    . ILE A 1 11  ? -3.463  16.584  38.569 1.00  0.00 ? 11  ILE A H    2  
ATOM   3827   N N    . ASN A 1 12  ? 0.072   15.467  37.812 1.00  0.00 ? 12  ASN A N    2  
ATOM   3828   C CA   . ASN A 1 12  ? 0.920   15.955  36.701 1.00  0.00 ? 12  ASN A CA   2  
ATOM   3829   C C    . ASN A 1 12  ? 0.487   15.306  35.373 1.00  0.00 ? 12  ASN A C    2  
ATOM   3830   O O    . ASN A 1 12  ? 0.082   14.148  35.323 1.00  0.00 ? 12  ASN A O    2  
ATOM   3831   H H    . ASN A 1 12  ? 0.481   14.910  38.507 1.00  0.00 ? 12  ASN A H    2  
ATOM   3832   N N    . GLY A 1 13  ? 0.640   16.082  34.315 1.00  0.00 ? 13  GLY A N    2  
ATOM   3833   C CA   . GLY A 1 13  ? 0.348   15.726  32.946 1.00  0.00 ? 13  GLY A CA   2  
ATOM   3834   C C    . GLY A 1 13  ? 1.094   14.523  32.386 1.00  0.00 ? 13  GLY A C    2  
ATOM   3835   O O    . GLY A 1 13  ? 0.583   13.875  31.441 1.00  0.00 ? 13  GLY A O    2  
ATOM   3836   H H    . GLY A 1 13  ? 1.005   16.978  34.472 1.00  0.00 ? 13  GLY A H    2  
ATOM   3837   N N    . ASP A 1 14  ? 2.190   14.156  32.951 1.00  0.00 ? 14  ASP A N    2  
ATOM   3838   C CA   . ASP A 1 14  ? 3.074   13.047  32.589 1.00  0.00 ? 14  ASP A CA   2  
ATOM   3839   C C    . ASP A 1 14  ? 2.699   11.718  33.251 1.00  0.00 ? 14  ASP A C    2  
ATOM   3840   O O    . ASP A 1 14  ? 3.467   10.726  33.217 1.00  0.00 ? 14  ASP A O    2  
ATOM   3841   H H    . ASP A 1 14  ? 2.472   14.692  33.721 1.00  0.00 ? 14  ASP A H    2  
ATOM   3842   N N    . LYS A 1 15  ? 1.550   11.692  33.888 1.00  0.00 ? 15  LYS A N    2  
ATOM   3843   C CA   . LYS A 1 15  ? 0.986   10.561  34.614 1.00  0.00 ? 15  LYS A CA   2  
ATOM   3844   C C    . LYS A 1 15  ? -0.299  10.094  33.936 1.00  0.00 ? 15  LYS A C    2  
ATOM   3845   O O    . LYS A 1 15  ? -0.859  10.787  33.108 1.00  0.00 ? 15  LYS A O    2  
ATOM   3846   H H    . LYS A 1 15  ? 1.027   12.521  33.888 1.00  0.00 ? 15  LYS A H    2  
ATOM   3847   N N    . GLY A 1 16  ? -0.750  8.945   34.379 1.00  0.00 ? 16  GLY A N    2  
ATOM   3848   C CA   . GLY A 1 16  ? -1.941  8.334   33.816 1.00  0.00 ? 16  GLY A CA   2  
ATOM   3849   C C    . GLY A 1 16  ? -3.210  8.947   34.367 1.00  0.00 ? 16  GLY A C    2  
ATOM   3850   O O    . GLY A 1 16  ? -3.973  8.236   35.038 1.00  0.00 ? 16  GLY A O    2  
ATOM   3851   H H    . GLY A 1 16  ? -0.258  8.476   35.084 1.00  0.00 ? 16  GLY A H    2  
ATOM   3852   N N    . TYR A 1 17  ? -3.414  10.206  34.041 1.00  0.00 ? 17  TYR A N    2  
ATOM   3853   C CA   . TYR A 1 17  ? -4.633  10.902  34.494 1.00  0.00 ? 17  TYR A CA   2  
ATOM   3854   C C    . TYR A 1 17  ? -5.889  10.477  33.771 1.00  0.00 ? 17  TYR A C    2  
ATOM   3855   O O    . TYR A 1 17  ? -7.020  10.829  34.172 1.00  0.00 ? 17  TYR A O    2  
ATOM   3856   H H    . TYR A 1 17  ? -2.763  10.676  33.479 1.00  0.00 ? 17  TYR A H    2  
ATOM   3857   N N    . ASN A 1 18  ? -5.764  9.742   32.675 1.00  0.00 ? 18  ASN A N    2  
ATOM   3858   C CA   . ASN A 1 18  ? -6.914  9.241   31.901 1.00  0.00 ? 18  ASN A CA   2  
ATOM   3859   C C    . ASN A 1 18  ? -7.367  7.963   32.612 1.00  0.00 ? 18  ASN A C    2  
ATOM   3860   O O    . ASN A 1 18  ? -8.562  7.662   32.656 1.00  0.00 ? 18  ASN A O    2  
ATOM   3861   H H    . ASN A 1 18  ? -4.863  9.503   32.375 1.00  0.00 ? 18  ASN A H    2  
ATOM   3862   N N    . GLY A 1 19  ? -6.402  7.253   33.115 1.00  0.00 ? 19  GLY A N    2  
ATOM   3863   C CA   . GLY A 1 19  ? -6.681  5.997   33.862 1.00  0.00 ? 19  GLY A CA   2  
ATOM   3864   C C    . GLY A 1 19  ? -7.287  6.388   35.208 1.00  0.00 ? 19  GLY A C    2  
ATOM   3865   O O    . GLY A 1 19  ? -8.183  5.705   35.721 1.00  0.00 ? 19  GLY A O    2  
ATOM   3866   H H    . GLY A 1 19  ? -5.476  7.559   33.016 1.00  0.00 ? 19  GLY A H    2  
ATOM   3867   N N    . LEU A 1 20  ? -6.741  7.455   35.789 1.00  0.00 ? 20  LEU A N    2  
ATOM   3868   C CA   . LEU A 1 20  ? -7.274  7.941   37.073 1.00  0.00 ? 20  LEU A CA   2  
ATOM   3869   C C    . LEU A 1 20  ? -8.708  8.448   36.858 1.00  0.00 ? 20  LEU A C    2  
ATOM   3870   O O    . LEU A 1 20  ? -9.542  8.187   37.752 1.00  0.00 ? 20  LEU A O    2  
ATOM   3871   H H    . LEU A 1 20  ? -6.003  7.930   35.352 1.00  0.00 ? 20  LEU A H    2  
ATOM   3872   N N    . ALA A 1 21  ? -9.002  9.116   35.762 1.00  0.00 ? 21  ALA A N    2  
ATOM   3873   C CA   . ALA A 1 21  ? -10.327 9.587   35.408 1.00  0.00 ? 21  ALA A CA   2  
ATOM   3874   C C    . ALA A 1 21  ? -11.287 8.402   35.234 1.00  0.00 ? 21  ALA A C    2  
ATOM   3875   O O    . ALA A 1 21  ? -12.493 8.630   35.396 1.00  0.00 ? 21  ALA A O    2  
ATOM   3876   H H    . ALA A 1 21  ? -8.280  9.268   35.118 1.00  0.00 ? 21  ALA A H    2  
ATOM   3877   N N    . GLU A 1 22  ? -10.822 7.220   34.910 1.00  0.00 ? 22  GLU A N    2  
ATOM   3878   C CA   . GLU A 1 22  ? -11.568 5.995   34.743 1.00  0.00 ? 22  GLU A CA   2  
ATOM   3879   C C    . GLU A 1 22  ? -11.933 5.325   36.064 1.00  0.00 ? 22  GLU A C    2  
ATOM   3880   O O    . GLU A 1 22  ? -12.943 4.591   36.176 1.00  0.00 ? 22  GLU A O    2  
ATOM   3881   H H    . GLU A 1 22  ? -9.852  7.156   34.790 1.00  0.00 ? 22  GLU A H    2  
ATOM   3882   N N    . VAL A 1 23  ? -11.090 5.531   37.072 1.00  0.00 ? 23  VAL A N    2  
ATOM   3883   C CA   . VAL A 1 23  ? -11.358 4.994   38.417 1.00  0.00 ? 23  VAL A CA   2  
ATOM   3884   C C    . VAL A 1 23  ? -12.497 5.865   38.989 1.00  0.00 ? 23  VAL A C    2  
ATOM   3885   O O    . VAL A 1 23  ? -13.354 5.398   39.733 1.00  0.00 ? 23  VAL A O    2  
ATOM   3886   H H    . VAL A 1 23  ? -10.296 6.087   36.927 1.00  0.00 ? 23  VAL A H    2  
ATOM   3887   N N    . GLY A 1 24  ? -12.446 7.101   38.578 1.00  0.00 ? 24  GLY A N    2  
ATOM   3888   C CA   . GLY A 1 24  ? -13.385 8.138   38.944 1.00  0.00 ? 24  GLY A CA   2  
ATOM   3889   C C    . GLY A 1 24  ? -14.791 7.925   38.412 1.00  0.00 ? 24  GLY A C    2  
ATOM   3890   O O    . GLY A 1 24  ? -15.758 8.309   39.073 1.00  0.00 ? 24  GLY A O    2  
ATOM   3891   H H    . GLY A 1 24  ? -11.717 7.345   37.969 1.00  0.00 ? 24  GLY A H    2  
ATOM   3892   N N    . LYS A 1 25  ? -14.898 7.359   37.218 1.00  0.00 ? 25  LYS A N    2  
ATOM   3893   C CA   . LYS A 1 25  ? -16.181 7.078   36.573 1.00  0.00 ? 25  LYS A CA   2  
ATOM   3894   C C    . LYS A 1 25  ? -16.842 5.933   37.321 1.00  0.00 ? 25  LYS A C    2  
ATOM   3895   O O    . LYS A 1 25  ? -18.057 5.921   37.592 1.00  0.00 ? 25  LYS A O    2  
ATOM   3896   H H    . LYS A 1 25  ? -14.076 7.111   36.745 1.00  0.00 ? 25  LYS A H    2  
ATOM   3897   N N    . LYS A 1 26  ? -16.050 4.980   37.719 1.00  0.00 ? 26  LYS A N    2  
ATOM   3898   C CA   . LYS A 1 26  ? -16.455 3.830   38.525 1.00  0.00 ? 26  LYS A CA   2  
ATOM   3899   C C    . LYS A 1 26  ? -16.947 4.321   39.888 1.00  0.00 ? 26  LYS A C    2  
ATOM   3900   O O    . LYS A 1 26  ? -17.947 3.802   40.445 1.00  0.00 ? 26  LYS A O    2  
ATOM   3901   H H    . LYS A 1 26  ? -15.097 5.068   37.507 1.00  0.00 ? 26  LYS A H    2  
ATOM   3902   N N    . PHE A 1 27  ? -16.262 5.315   40.463 1.00  0.00 ? 27  PHE A N    2  
ATOM   3903   C CA   . PHE A 1 27  ? -16.655 5.863   41.772 1.00  0.00 ? 27  PHE A CA   2  
ATOM   3904   C C    . PHE A 1 27  ? -18.006 6.568   41.605 1.00  0.00 ? 27  PHE A C    2  
ATOM   3905   O O    . PHE A 1 27  ? -18.891 6.370   42.453 1.00  0.00 ? 27  PHE A O    2  
ATOM   3906   H H    . PHE A 1 27  ? -15.482 5.689   40.002 1.00  0.00 ? 27  PHE A H    2  
ATOM   3907   N N    . GLU A 1 28  ? -18.140 7.348   40.581 1.00  0.00 ? 28  GLU A N    2  
ATOM   3908   C CA   . GLU A 1 28  ? -19.345 8.112   40.279 1.00  0.00 ? 28  GLU A CA   2  
ATOM   3909   C C    . GLU A 1 28  ? -20.545 7.208   40.027 1.00  0.00 ? 28  GLU A C    2  
ATOM   3910   O O    . GLU A 1 28  ? -21.692 7.652   40.114 1.00  0.00 ? 28  GLU A O    2  
ATOM   3911   H H    . GLU A 1 28  ? -17.376 7.441   39.975 1.00  0.00 ? 28  GLU A H    2  
ATOM   3912   N N    . LYS A 1 29  ? -20.264 5.957   39.730 1.00  0.00 ? 29  LYS A N    2  
ATOM   3913   C CA   . LYS A 1 29  ? -21.266 4.927   39.443 1.00  0.00 ? 29  LYS A CA   2  
ATOM   3914   C C    . LYS A 1 29  ? -21.932 4.416   40.707 1.00  0.00 ? 29  LYS A C    2  
ATOM   3915   O O    . LYS A 1 29  ? -23.182 4.332   40.749 1.00  0.00 ? 29  LYS A O    2  
ATOM   3916   H H    . LYS A 1 29  ? -19.319 5.699   39.692 1.00  0.00 ? 29  LYS A H    2  
ATOM   3917   N N    . ASP A 1 30  ? -21.135 4.075   41.705 1.00  0.00 ? 30  ASP A N    2  
ATOM   3918   C CA   . ASP A 1 30  ? -21.709 3.557   42.951 1.00  0.00 ? 30  ASP A CA   2  
ATOM   3919   C C    . ASP A 1 30  ? -21.927 4.665   43.986 1.00  0.00 ? 30  ASP A C    2  
ATOM   3920   O O    . ASP A 1 30  ? -22.221 4.303   45.147 1.00  0.00 ? 30  ASP A O    2  
ATOM   3921   H H    . ASP A 1 30  ? -20.163 4.157   41.608 1.00  0.00 ? 30  ASP A H    2  
ATOM   3922   N N    . THR A 1 31  ? -21.793 5.914   43.593 1.00  0.00 ? 31  THR A N    2  
ATOM   3923   C CA   . THR A 1 31  ? -21.916 7.014   44.567 1.00  0.00 ? 31  THR A CA   2  
ATOM   3924   C C    . THR A 1 31  ? -22.706 8.183   44.057 1.00  0.00 ? 31  THR A C    2  
ATOM   3925   O O    . THR A 1 31  ? -23.466 8.826   44.830 1.00  0.00 ? 31  THR A O    2  
ATOM   3926   H H    . THR A 1 31  ? -21.560 6.109   42.661 1.00  0.00 ? 31  THR A H    2  
ATOM   3927   N N    . GLY A 1 32  ? -22.552 8.507   42.805 1.00  0.00 ? 32  GLY A N    2  
ATOM   3928   C CA   . GLY A 1 32  ? -23.216 9.637   42.163 1.00  0.00 ? 32  GLY A CA   2  
ATOM   3929   C C    . GLY A 1 32  ? -22.359 10.889  42.239 1.00  0.00 ? 32  GLY A C    2  
ATOM   3930   O O    . GLY A 1 32  ? -22.683 11.943  41.683 1.00  0.00 ? 32  GLY A O    2  
ATOM   3931   H H    . GLY A 1 32  ? -21.933 7.972   42.266 1.00  0.00 ? 32  GLY A H    2  
ATOM   3932   N N    . ILE A 1 33  ? -21.253 10.726  42.978 1.00  0.00 ? 33  ILE A N    2  
ATOM   3933   C CA   . ILE A 1 33  ? -20.294 11.821  43.160 1.00  0.00 ? 33  ILE A CA   2  
ATOM   3934   C C    . ILE A 1 33  ? -19.358 11.828  41.934 1.00  0.00 ? 33  ILE A C    2  
ATOM   3935   O O    . ILE A 1 33  ? -18.732 10.801  41.662 1.00  0.00 ? 33  ILE A O    2  
ATOM   3936   H H    . ILE A 1 33  ? -21.078 9.858   43.398 1.00  0.00 ? 33  ILE A H    2  
ATOM   3937   N N    . LYS A 1 34  ? -19.348 12.971  41.299 1.00  0.00 ? 34  LYS A N    2  
ATOM   3938   C CA   . LYS A 1 34  ? -18.508 13.215  40.138 1.00  0.00 ? 34  LYS A CA   2  
ATOM   3939   C C    . LYS A 1 34  ? -17.085 13.536  40.599 1.00  0.00 ? 34  LYS A C    2  
ATOM   3940   O O    . LYS A 1 34  ? -16.910 14.344  41.538 1.00  0.00 ? 34  LYS A O    2  
ATOM   3941   H H    . LYS A 1 34  ? -19.910 13.700  41.635 1.00  0.00 ? 34  LYS A H    2  
ATOM   3942   N N    . VAL A 1 35  ? -16.121 12.927  39.948 1.00  0.00 ? 35  VAL A N    2  
ATOM   3943   C CA   . VAL A 1 35  ? -14.679 13.144  40.218 1.00  0.00 ? 35  VAL A CA   2  
ATOM   3944   C C    . VAL A 1 35  ? -14.171 13.961  39.031 1.00  0.00 ? 35  VAL A C    2  
ATOM   3945   O O    . VAL A 1 35  ? -14.693 13.751  37.934 1.00  0.00 ? 35  VAL A O    2  
ATOM   3946   H H    . VAL A 1 35  ? -16.368 12.316  39.222 1.00  0.00 ? 35  VAL A H    2  
ATOM   3947   N N    . THR A 1 36  ? -13.303 14.902  39.220 1.00  0.00 ? 36  THR A N    2  
ATOM   3948   C CA   . THR A 1 36  ? -12.728 15.751  38.197 1.00  0.00 ? 36  THR A CA   2  
ATOM   3949   C C    . THR A 1 36  ? -11.211 15.687  38.269 1.00  0.00 ? 36  THR A C    2  
ATOM   3950   O O    . THR A 1 36  ? -10.630 16.067  39.306 1.00  0.00 ? 36  THR A O    2  
ATOM   3951   H H    . THR A 1 36  ? -13.003 15.051  40.141 1.00  0.00 ? 36  THR A H    2  
ATOM   3952   N N    . VAL A 1 37  ? -10.620 15.219  37.191 1.00  0.00 ? 37  VAL A N    2  
ATOM   3953   C CA   . VAL A 1 37  ? -9.147  15.122  37.155 1.00  0.00 ? 37  VAL A CA   2  
ATOM   3954   C C    . VAL A 1 37  ? -8.645  16.241  36.249 1.00  0.00 ? 37  VAL A C    2  
ATOM   3955   O O    . VAL A 1 37  ? -9.170  16.490  35.172 1.00  0.00 ? 37  VAL A O    2  
ATOM   3956   H H    . VAL A 1 37  ? -11.153 14.942  36.416 1.00  0.00 ? 37  VAL A H    2  
ATOM   3957   N N    . GLU A 1 38  ? -7.633  16.906  36.741 1.00  0.00 ? 38  GLU A N    2  
ATOM   3958   C CA   . GLU A 1 38  ? -6.971  18.000  36.017 1.00  0.00 ? 38  GLU A CA   2  
ATOM   3959   C C    . GLU A 1 38  ? -5.466  17.862  36.240 1.00  0.00 ? 38  GLU A C    2  
ATOM   3960   O O    . GLU A 1 38  ? -5.055  17.206  37.196 1.00  0.00 ? 38  GLU A O    2  
ATOM   3961   H H    . GLU A 1 38  ? -7.286  16.649  37.621 1.00  0.00 ? 38  GLU A H    2  
ATOM   3962   N N    . HIS A 1 39  ? -4.741  18.458  35.326 1.00  0.00 ? 39  HIS A N    2  
ATOM   3963   C CA   . HIS A 1 39  ? -3.265  18.417  35.374 1.00  0.00 ? 39  HIS A CA   2  
ATOM   3964   C C    . HIS A 1 39  ? -2.706  19.784  34.997 1.00  0.00 ? 39  HIS A C    2  
ATOM   3965   O O    . HIS A 1 39  ? -2.105  19.936  33.913 1.00  0.00 ? 39  HIS A O    2  
ATOM   3966   H H    . HIS A 1 39  ? -5.185  18.932  34.592 1.00  0.00 ? 39  HIS A H    2  
ATOM   3967   N N    . PRO A 1 40  ? -2.905  20.761  35.875 1.00  0.00 ? 40  PRO A N    2  
ATOM   3968   C CA   . PRO A 1 40  ? -2.449  22.134  35.641 1.00  0.00 ? 40  PRO A CA   2  
ATOM   3969   C C    . PRO A 1 40  ? -0.939  22.221  35.643 1.00  0.00 ? 40  PRO A C    2  
ATOM   3970   O O    . PRO A 1 40  ? -0.232  21.409  36.230 1.00  0.00 ? 40  PRO A O    2  
ATOM   3971   N N    . CYS A 1 41  ? -0.475  23.259  34.950 1.00  0.00 ? 41  CYS A N    2  
ATOM   3972   C CA   . CYS A 1 41  ? 0.937   23.605  34.814 1.00  0.00 ? 41  CYS A CA   2  
ATOM   3973   C C    . CYS A 1 41  ? 1.533   23.979  36.151 1.00  0.00 ? 41  CYS A C    2  
ATOM   3974   O O    . CYS A 1 41  ? 0.873   24.800  36.833 1.00  0.00 ? 41  CYS A O    2  
ATOM   3975   C CB   . CYS A 1 41  ? 1.066   24.735  33.774 1.00  0.00 ? 41  CYS A CB   2  
ATOM   3976   S SG   A CYS A 1 41  ? 0.462   26.298  34.449 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3977   S SG   B CYS A 1 41  ? 1.880   24.137  32.277 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3978   S SG   C CYS A 1 41  ? 2.725   24.759  33.058 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3979   S SG   D CYS A 1 41  ? 2.708   24.727  33.020 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3980   S SG   E CYS A 1 41  ? 2.804   25.093  33.429 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3981   S SG   F CYS A 1 41  ? 2.804   25.100  33.437 0.16  0.00 ? 41  CYS A SG   2  
ATOM   3982   S SG   U CYS A 1 41  ? 0.611   24.145  32.129 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3983   S SG   V CYS A 1 41  ? 2.020   24.183  32.344 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3984   S SG   W CYS A 1 41  ? 2.074   26.088  34.421 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3985   S SG   X CYS A 1 41  ? 2.366   24.358  32.577 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3986   S SG   Y CYS A 1 41  ? 2.803   25.066  33.401 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3987   S SG   Z CYS A 1 41  ? 1.774   24.109  32.233 0.010 0.00 ? 41  CYS A SG   2  
ATOM   3988   H H    . CYS A 1 41  ? -1.148  23.856  34.490 1.00  0.00 ? 41  CYS A H    2  
ATOM   3989   N N    . LYS A 1 42  ? 2.697   23.477  36.464 1.00  0.00 ? 42  LYS A N    2  
ATOM   3990   C CA   . LYS A 1 42  ? 3.405   23.767  37.726 1.00  0.00 ? 42  LYS A CA   2  
ATOM   3991   C C    . LYS A 1 42  ? 2.412   23.691  38.892 1.00  0.00 ? 42  LYS A C    2  
ATOM   3992   O O    . LYS A 1 42  ? 2.393   24.619  39.704 1.00  0.00 ? 42  LYS A O    2  
ATOM   3993   H H    . LYS A 1 42  ? 3.122   22.877  35.816 1.00  0.00 ? 42  LYS A H    2  
ATOM   3994   N N    . LEU A 1 43  ? 1.630   22.626  38.925 1.00  0.00 ? 43  LEU A N    2  
ATOM   3995   C CA   . LEU A 1 43  ? 0.588   22.482  39.958 1.00  0.00 ? 43  LEU A CA   2  
ATOM   3996   C C    . LEU A 1 43  ? 1.187   22.430  41.355 1.00  0.00 ? 43  LEU A C    2  
ATOM   3997   O O    . LEU A 1 43  ? 0.477   22.767  42.337 1.00  0.00 ? 43  LEU A O    2  
ATOM   3998   H H    . LEU A 1 43  ? 1.712   21.946  38.225 1.00  0.00 ? 43  LEU A H    2  
ATOM   3999   N N    . GLU A 1 44  ? 2.438   22.006  41.459 1.00  0.00 ? 44  GLU A N    2  
ATOM   4000   C CA   . GLU A 1 44  ? 3.096   21.891  42.775 1.00  0.00 ? 44  GLU A CA   2  
ATOM   4001   C C    . GLU A 1 44  ? 3.489   23.281  43.292 1.00  0.00 ? 44  GLU A C    2  
ATOM   4002   O O    . GLU A 1 44  ? 3.788   23.464  44.470 1.00  0.00 ? 44  GLU A O    2  
ATOM   4003   H H    . GLU A 1 44  ? 2.926   21.745  40.650 1.00  0.00 ? 44  GLU A H    2  
ATOM   4004   N N    . GLU A 1 45  ? 3.466   24.244  42.398 1.00  0.00 ? 45  GLU A N    2  
ATOM   4005   C CA   . GLU A 1 45  ? 3.761   25.646  42.714 1.00  0.00 ? 45  GLU A CA   2  
ATOM   4006   C C    . GLU A 1 45  ? 2.436   26.350  43.014 1.00  0.00 ? 45  GLU A C    2  
ATOM   4007   O O    . GLU A 1 45  ? 2.342   27.161  43.934 1.00  0.00 ? 45  GLU A O    2  
ATOM   4008   H H    . GLU A 1 45  ? 3.205   24.020  41.480 1.00  0.00 ? 45  GLU A H    2  
ATOM   4009   N N    . LYS A 1 46  ? 1.457   25.997  42.206 1.00  0.00 ? 46  LYS A N    2  
ATOM   4010   C CA   . LYS A 1 46  ? 0.125   26.530  42.320 1.00  0.00 ? 46  LYS A CA   2  
ATOM   4011   C C    . LYS A 1 46  ? -0.585  26.038  43.568 1.00  0.00 ? 46  LYS A C    2  
ATOM   4012   O O    . LYS A 1 46  ? -1.383  26.828  44.103 1.00  0.00 ? 46  LYS A O    2  
ATOM   4013   H H    . LYS A 1 46  ? 1.641   25.340  41.502 1.00  0.00 ? 46  LYS A H    2  
ATOM   4014   N N    . PHE A 1 47  ? -0.367  24.812  43.980 1.00  0.00 ? 47  PHE A N    2  
ATOM   4015   C CA   . PHE A 1 47  ? -1.017  24.240  45.140 1.00  0.00 ? 47  PHE A CA   2  
ATOM   4016   C C    . PHE A 1 47  ? -0.884  25.155  46.373 1.00  0.00 ? 47  PHE A C    2  
ATOM   4017   O O    . PHE A 1 47  ? -1.882  25.552  46.977 1.00  0.00 ? 47  PHE A O    2  
ATOM   4018   H H    . PHE A 1 47  ? 0.251   24.250  43.467 1.00  0.00 ? 47  PHE A H    2  
ATOM   4019   N N    . PRO A 1 48  ? 0.340   25.403  46.790 1.00  0.00 ? 48  PRO A N    2  
ATOM   4020   C CA   . PRO A 1 48  ? 0.583   26.209  47.993 1.00  0.00 ? 48  PRO A CA   2  
ATOM   4021   C C    . PRO A 1 48  ? -0.133  27.532  47.978 1.00  0.00 ? 48  PRO A C    2  
ATOM   4022   O O    . PRO A 1 48  ? -0.637  27.980  49.044 1.00  0.00 ? 48  PRO A O    2  
ATOM   4023   N N    . GLN A 1 49  ? -0.291  28.164  46.852 1.00  0.00 ? 49  GLN A N    2  
ATOM   4024   C CA   . GLN A 1 49  ? -0.952  29.429  46.655 1.00  0.00 ? 49  GLN A CA   2  
ATOM   4025   C C    . GLN A 1 49  ? -2.465  29.342  46.867 1.00  0.00 ? 49  GLN A C    2  
ATOM   4026   O O    . GLN A 1 49  ? -2.996  30.166  47.633 1.00  0.00 ? 49  GLN A O    2  
ATOM   4027   H H    . GLN A 1 49  ? 0.075   27.732  46.052 1.00  0.00 ? 49  GLN A H    2  
ATOM   4028   N N    . VAL A 1 50  ? -3.124  28.474  46.145 1.00  0.00 ? 50  VAL A N    2  
ATOM   4029   C CA   . VAL A 1 50  ? -4.569  28.321  46.243 1.00  0.00 ? 50  VAL A CA   2  
ATOM   4030   C C    . VAL A 1 50  ? -4.988  27.675  47.540 1.00  0.00 ? 50  VAL A C    2  
ATOM   4031   O O    . VAL A 1 50  ? -6.085  28.043  48.012 1.00  0.00 ? 50  VAL A O    2  
ATOM   4032   H H    . VAL A 1 50  ? -2.632  27.920  45.504 1.00  0.00 ? 50  VAL A H    2  
ATOM   4033   N N    . ALA A 1 51  ? -4.250  26.743  48.091 1.00  0.00 ? 51  ALA A N    2  
ATOM   4034   C CA   . ALA A 1 51  ? -4.600  26.055  49.321 1.00  0.00 ? 51  ALA A CA   2  
ATOM   4035   C C    . ALA A 1 51  ? -4.510  27.033  50.515 1.00  0.00 ? 51  ALA A C    2  
ATOM   4036   O O    . ALA A 1 51  ? -5.339  26.897  51.428 1.00  0.00 ? 51  ALA A O    2  
ATOM   4037   H H    . ALA A 1 51  ? -3.422  26.482  47.636 1.00  0.00 ? 51  ALA A H    2  
ATOM   4038   N N    . ALA A 1 52  ? -3.521  27.930  50.470 1.00  0.00 ? 52  ALA A N    2  
ATOM   4039   C CA   . ALA A 1 52  ? -3.332  28.932  51.520 1.00  0.00 ? 52  ALA A CA   2  
ATOM   4040   C C    . ALA A 1 52  ? -4.578  29.819  51.661 1.00  0.00 ? 52  ALA A C    2  
ATOM   4041   O O    . ALA A 1 52  ? -4.826  30.428  52.714 1.00  0.00 ? 52  ALA A O    2  
ATOM   4042   H H    . ALA A 1 52  ? -2.913  27.928  49.701 1.00  0.00 ? 52  ALA A H    2  
ATOM   4043   N N    . THR A 1 53  ? -5.403  29.893  50.627 1.00  0.00 ? 53  THR A N    2  
ATOM   4044   C CA   . THR A 1 53  ? -6.623  30.672  50.627 1.00  0.00 ? 53  THR A CA   2  
ATOM   4045   C C    . THR A 1 53  ? -7.893  29.812  50.693 1.00  0.00 ? 53  THR A C    2  
ATOM   4046   O O    . THR A 1 53  ? -8.979  30.323  50.390 1.00  0.00 ? 53  THR A O    2  
ATOM   4047   H H    . THR A 1 53  ? -5.182  29.381  49.821 1.00  0.00 ? 53  THR A H    2  
ATOM   4048   N N    . GLY A 1 54  ? -7.747  28.565  51.077 1.00  0.00 ? 54  GLY A N    2  
ATOM   4049   C CA   . GLY A 1 54  ? -8.789  27.570  51.196 1.00  0.00 ? 54  GLY A CA   2  
ATOM   4050   C C    . GLY A 1 54  ? -9.410  27.192  49.862 1.00  0.00 ? 54  GLY A C    2  
ATOM   4051   O O    . GLY A 1 54  ? -10.615 26.896  49.731 1.00  0.00 ? 54  GLY A O    2  
ATOM   4052   H H    . GLY A 1 54  ? -6.837  28.276  51.294 1.00  0.00 ? 54  GLY A H    2  
ATOM   4053   N N    . ASP A 1 55  ? -8.605  27.199  48.821 1.00  0.00 ? 55  ASP A N    2  
ATOM   4054   C CA   . ASP A 1 55  ? -9.009  26.823  47.468 1.00  0.00 ? 55  ASP A CA   2  
ATOM   4055   C C    . ASP A 1 55  ? -8.147  25.604  47.059 1.00  0.00 ? 55  ASP A C    2  
ATOM   4056   O O    . ASP A 1 55  ? -7.446  25.018  47.892 1.00  0.00 ? 55  ASP A O    2  
ATOM   4057   H H    . ASP A 1 55  ? -7.668  27.445  48.968 1.00  0.00 ? 55  ASP A H    2  
ATOM   4058   N N    . GLY A 1 56  ? -8.250  25.277  45.788 1.00  0.00 ? 56  GLY A N    2  
ATOM   4059   C CA   . GLY A 1 56  ? -7.507  24.162  45.182 1.00  0.00 ? 56  GLY A CA   2  
ATOM   4060   C C    . GLY A 1 56  ? -8.349  22.882  45.094 1.00  0.00 ? 56  GLY A C    2  
ATOM   4061   O O    . GLY A 1 56  ? -9.586  22.928  45.258 1.00  0.00 ? 56  GLY A O    2  
ATOM   4062   H H    . GLY A 1 56  ? -8.842  25.808  45.216 1.00  0.00 ? 56  GLY A H    2  
ATOM   4063   N N    . PRO A 1 57  ? -7.654  21.783  44.805 1.00  0.00 ? 57  PRO A N    2  
ATOM   4064   C CA   . PRO A 1 57  ? -8.285  20.471  44.655 1.00  0.00 ? 57  PRO A CA   2  
ATOM   4065   C C    . PRO A 1 57  ? -8.430  19.819  46.002 1.00  0.00 ? 57  PRO A C    2  
ATOM   4066   O O    . PRO A 1 57  ? -7.719  20.203  46.944 1.00  0.00 ? 57  PRO A O    2  
ATOM   4067   N N    . ASP A 1 58  ? -9.279  18.832  46.094 1.00  0.00 ? 58  ASP A N    2  
ATOM   4068   C CA   . ASP A 1 58  ? -9.519  18.026  47.268 1.00  0.00 ? 58  ASP A CA   2  
ATOM   4069   C C    . ASP A 1 58  ? -8.310  17.144  47.546 1.00  0.00 ? 58  ASP A C    2  
ATOM   4070   O O    . ASP A 1 58  ? -7.885  16.865  48.675 1.00  0.00 ? 58  ASP A O    2  
ATOM   4071   H H    . ASP A 1 58  ? -9.765  18.586  45.280 1.00  0.00 ? 58  ASP A H    2  
ATOM   4072   N N    . ILE A 1 59  ? -7.778  16.705  46.380 1.00  0.00 ? 59  ILE A N    2  
ATOM   4073   C CA   . ILE A 1 59  ? -6.606  15.808  46.434 1.00  0.00 ? 59  ILE A CA   2  
ATOM   4074   C C    . ILE A 1 59  ? -5.561  16.162  45.409 1.00  0.00 ? 59  ILE A C    2  
ATOM   4075   O O    . ILE A 1 59  ? -5.836  16.569  44.297 1.00  0.00 ? 59  ILE A O    2  
ATOM   4076   H H    . ILE A 1 59  ? -8.173  16.962  45.521 1.00  0.00 ? 59  ILE A H    2  
ATOM   4077   N N    . ILE A 1 60  ? -4.323  16.025  45.844 1.00  0.00 ? 60  ILE A N    2  
ATOM   4078   C CA   . ILE A 1 60  ? -3.138  16.349  45.042 1.00  0.00 ? 60  ILE A CA   2  
ATOM   4079   C C    . ILE A 1 60  ? -2.187  15.165  45.002 1.00  0.00 ? 60  ILE A C    2  
ATOM   4080   O O    . ILE A 1 60  ? -1.924  14.551  46.026 1.00  0.00 ? 60  ILE A O    2  
ATOM   4081   H H    . ILE A 1 60  ? -4.188  15.715  46.764 1.00  0.00 ? 60  ILE A H    2  
ATOM   4082   N N    . PHE A 1 61  ? -1.617  14.925  43.823 1.00  0.00 ? 61  PHE A N    2  
ATOM   4083   C CA   . PHE A 1 61  ? -0.644  13.816  43.671 1.00  0.00 ? 61  PHE A CA   2  
ATOM   4084   C C    . PHE A 1 61  ? 0.733   14.459  43.395 1.00  0.00 ? 61  PHE A C    2  
ATOM   4085   O O    . PHE A 1 61  ? 0.750   15.295  42.506 1.00  0.00 ? 61  PHE A O    2  
ATOM   4086   H H    . PHE A 1 61  ? -1.824  15.499  43.056 1.00  0.00 ? 61  PHE A H    2  
ATOM   4087   N N    . TRP A 1 62  ? 1.715   14.094  44.108 1.00  0.00 ? 62  TRP A N    2  
ATOM   4088   C CA   . TRP A 1 62  ? 3.111   14.587  43.882 1.00  0.00 ? 62  TRP A CA   2  
ATOM   4089   C C    . TRP A 1 62  ? 4.036   13.702  44.637 1.00  0.00 ? 62  TRP A C    2  
ATOM   4090   O O    . TRP A 1 62  ? 3.670   12.938  45.549 1.00  0.00 ? 62  TRP A O    2  
ATOM   4091   H H    . TRP A 1 62  ? 1.563   13.422  44.806 1.00  0.00 ? 62  TRP A H    2  
ATOM   4092   N N    . ALA A 1 63  ? 5.328   13.772  44.282 1.00  0.00 ? 63  ALA A N    2  
ATOM   4093   C CA   . ALA A 1 63  ? 6.367   13.049  45.003 1.00  0.00 ? 63  ALA A CA   2  
ATOM   4094   C C    . ALA A 1 63  ? 6.266   13.521  46.477 1.00  0.00 ? 63  ALA A C    2  
ATOM   4095   O O    . ALA A 1 63  ? 6.055   14.722  46.714 1.00  0.00 ? 63  ALA A O    2  
ATOM   4096   H H    . ALA A 1 63  ? 5.589   14.384  43.563 1.00  0.00 ? 63  ALA A H    2  
ATOM   4097   N N    . HIS A 1 64  ? 6.514   12.642  47.398 1.00  0.00 ? 64  HIS A N    2  
ATOM   4098   C CA   . HIS A 1 64  ? 6.430   12.852  48.824 1.00  0.00 ? 64  HIS A CA   2  
ATOM   4099   C C    . HIS A 1 64  ? 7.278   13.991  49.392 1.00  0.00 ? 64  HIS A C    2  
ATOM   4100   O O    . HIS A 1 64  ? 6.896   14.594  50.418 1.00  0.00 ? 64  HIS A O    2  
ATOM   4101   H H    . HIS A 1 64  ? 6.750   11.740  47.097 1.00  0.00 ? 64  HIS A H    2  
ATOM   4102   N N    . ASP A 1 65  ? 8.442   14.212  48.800 1.00  0.00 ? 65  ASP A N    2  
ATOM   4103   C CA   . ASP A 1 65  ? 9.394   15.195  49.333 1.00  0.00 ? 65  ASP A CA   2  
ATOM   4104   C C    . ASP A 1 65  ? 8.800   16.588  49.431 1.00  0.00 ? 65  ASP A C    2  
ATOM   4105   O O    . ASP A 1 65  ? 9.086   17.351  50.368 1.00  0.00 ? 65  ASP A O    2  
ATOM   4106   H H    . ASP A 1 65  ? 8.706   13.653  48.040 1.00  0.00 ? 65  ASP A H    2  
ATOM   4107   N N    . ARG A 1 66  ? 7.958   16.977  48.537 1.00  0.00 ? 66  ARG A N    2  
ATOM   4108   C CA   . ARG A 1 66  ? 7.302   18.247  48.468 1.00  0.00 ? 66  ARG A CA   2  
ATOM   4109   C C    . ARG A 1 66  ? 6.227   18.405  49.548 1.00  0.00 ? 66  ARG A C    2  
ATOM   4110   O O    . ARG A 1 66  ? 5.935   19.567  49.832 1.00  0.00 ? 66  ARG A O    2  
ATOM   4111   H H    . ARG A 1 66  ? 7.745   16.335  47.828 1.00  0.00 ? 66  ARG A H    2  
ATOM   4112   N N    . PHE A 1 67  ? 5.702   17.320  50.057 1.00  0.00 ? 67  PHE A N    2  
ATOM   4113   C CA   . PHE A 1 67  ? 4.624   17.243  51.032 1.00  0.00 ? 67  PHE A CA   2  
ATOM   4114   C C    . PHE A 1 67  ? 5.040   17.781  52.393 1.00  0.00 ? 67  PHE A C    2  
ATOM   4115   O O    . PHE A 1 67  ? 4.176   18.254  53.134 1.00  0.00 ? 67  PHE A O    2  
ATOM   4116   H H    . PHE A 1 67  ? 6.039   16.468  49.710 1.00  0.00 ? 67  PHE A H    2  
ATOM   4117   N N    . GLY A 1 68  ? 6.318   17.714  52.667 1.00  0.00 ? 68  GLY A N    2  
ATOM   4118   C CA   . GLY A 1 68  ? 6.886   18.214  53.934 1.00  0.00 ? 68  GLY A CA   2  
ATOM   4119   C C    . GLY A 1 68  ? 6.626   19.724  54.110 1.00  0.00 ? 68  GLY A C    2  
ATOM   4120   O O    . GLY A 1 68  ? 6.197   20.138  55.203 1.00  0.00 ? 68  GLY A O    2  
ATOM   4121   H H    . GLY A 1 68  ? 6.923   17.331  51.999 1.00  0.00 ? 68  GLY A H    2  
ATOM   4122   N N    . GLY A 1 69  ? 6.888   20.497  53.105 1.00  0.00 ? 69  GLY A N    2  
ATOM   4123   C CA   . GLY A 1 69  ? 6.703   21.932  53.038 1.00  0.00 ? 69  GLY A CA   2  
ATOM   4124   C C    . GLY A 1 69  ? 5.233   22.297  53.078 1.00  0.00 ? 69  GLY A C    2  
ATOM   4125   O O    . GLY A 1 69  ? 4.826   23.271  53.692 1.00  0.00 ? 69  GLY A O    2  
ATOM   4126   H H    . GLY A 1 69  ? 7.236   20.063  52.299 1.00  0.00 ? 69  GLY A H    2  
ATOM   4127   N N    . TYR A 1 70  ? 4.398   21.511  52.399 1.00  0.00 ? 70  TYR A N    2  
ATOM   4128   C CA   . TYR A 1 70  ? 2.943   21.677  52.372 1.00  0.00 ? 70  TYR A CA   2  
ATOM   4129   C C    . TYR A 1 70  ? 2.339   21.452  53.785 1.00  0.00 ? 70  TYR A C    2  
ATOM   4130   O O    . TYR A 1 70  ? 1.476   22.229  54.230 1.00  0.00 ? 70  TYR A O    2  
ATOM   4131   H H    . TYR A 1 70  ? 4.780   20.749  51.915 1.00  0.00 ? 70  TYR A H    2  
ATOM   4132   N N    . ALA A 1 71  ? 2.719   20.401  54.453 1.00  0.00 ? 71  ALA A N    2  
ATOM   4133   C CA   . ALA A 1 71  ? 2.339   19.970  55.762 1.00  0.00 ? 71  ALA A CA   2  
ATOM   4134   C C    . ALA A 1 71  ? 2.748   21.028  56.826 1.00  0.00 ? 71  ALA A C    2  
ATOM   4135   O O    . ALA A 1 71  ? 2.025   21.267  57.798 1.00  0.00 ? 71  ALA A O    2  
ATOM   4136   H H    . ALA A 1 71  ? 3.369   19.827  53.996 1.00  0.00 ? 71  ALA A H    2  
ATOM   4137   N N    . GLN A 1 72  ? 3.913   21.572  56.609 1.00  0.00 ? 72  GLN A N    2  
ATOM   4138   C CA   . GLN A 1 72  ? 4.502   22.585  57.493 1.00  0.00 ? 72  GLN A CA   2  
ATOM   4139   C C    . GLN A 1 72  ? 3.503   23.747  57.555 1.00  0.00 ? 72  GLN A C    2  
ATOM   4140   O O    . GLN A 1 72  ? 3.267   24.149  58.688 1.00  0.00 ? 72  GLN A O    2  
ATOM   4141   H H    . GLN A 1 72  ? 4.423   21.285  55.823 1.00  0.00 ? 72  GLN A H    2  
ATOM   4142   N N    . SER A 1 73  ? 3.008   24.206  56.438 1.00  0.00 ? 73  SER A N    2  
ATOM   4143   C CA   . SER A 1 73  ? 2.052   25.278  56.346 1.00  0.00 ? 73  SER A CA   2  
ATOM   4144   C C    . SER A 1 73  ? 0.601   24.900  56.603 1.00  0.00 ? 73  SER A C    2  
ATOM   4145   O O    . SER A 1 73  ? -0.263  25.746  56.296 1.00  0.00 ? 73  SER A O    2  
ATOM   4146   H H    . SER A 1 73  ? 3.300   23.784  55.604 1.00  0.00 ? 73  SER A H    2  
ATOM   4147   N N    . GLY A 1 74  ? 0.366   23.692  57.033 1.00  0.00 ? 74  GLY A N    2  
ATOM   4148   C CA   . GLY A 1 74  ? -0.890  23.087  57.382 1.00  0.00 ? 74  GLY A CA   2  
ATOM   4149   C C    . GLY A 1 74  ? -1.859  22.924  56.228 1.00  0.00 ? 74  GLY A C    2  
ATOM   4150   O O    . GLY A 1 74  ? -3.074  23.007  56.421 1.00  0.00 ? 74  GLY A O    2  
ATOM   4151   H H    . GLY A 1 74  ? 1.156   23.125  57.154 1.00  0.00 ? 74  GLY A H    2  
ATOM   4152   N N    . LEU A 1 75  ? -1.314  22.645  55.054 1.00  0.00 ? 75  LEU A N    2  
ATOM   4153   C CA   . LEU A 1 75  ? -2.121  22.503  53.845 1.00  0.00 ? 75  LEU A CA   2  
ATOM   4154   C C    . LEU A 1 75  ? -2.714  21.111  53.645 1.00  0.00 ? 75  LEU A C    2  
ATOM   4155   O O    . LEU A 1 75  ? -3.631  20.978  52.825 1.00  0.00 ? 75  LEU A O    2  
ATOM   4156   H H    . LEU A 1 75  ? -0.340  22.559  54.989 1.00  0.00 ? 75  LEU A H    2  
ATOM   4157   N N    . LEU A 1 76  ? -2.263  20.130  54.347 1.00  0.00 ? 76  LEU A N    2  
ATOM   4158   C CA   . LEU A 1 76  ? -2.702  18.763  54.252 1.00  0.00 ? 76  LEU A CA   2  
ATOM   4159   C C    . LEU A 1 76  ? -3.419  18.224  55.488 1.00  0.00 ? 76  LEU A C    2  
ATOM   4160   O O    . LEU A 1 76  ? -2.936  18.389  56.628 1.00  0.00 ? 76  LEU A O    2  
ATOM   4161   H H    . LEU A 1 76  ? -1.548  20.328  54.988 1.00  0.00 ? 76  LEU A H    2  
ATOM   4162   N N    . ALA A 1 77  ? -4.491  17.484  55.205 1.00  0.00 ? 77  ALA A N    2  
ATOM   4163   C CA   . ALA A 1 77  ? -5.236  16.815  56.260 1.00  0.00 ? 77  ALA A CA   2  
ATOM   4164   C C    . ALA A 1 77  ? -4.446  15.589  56.695 1.00  0.00 ? 77  ALA A C    2  
ATOM   4165   O O    . ALA A 1 77  ? -3.725  14.910  55.924 1.00  0.00 ? 77  ALA A O    2  
ATOM   4166   H H    . ALA A 1 77  ? -4.743  17.337  54.270 1.00  0.00 ? 77  ALA A H    2  
ATOM   4167   N N    . GLU A 1 78  ? -4.579  15.346  57.988 1.00  0.00 ? 78  GLU A N    2  
ATOM   4168   C CA   . GLU A 1 78  ? -3.971  14.190  58.628 1.00  0.00 ? 78  GLU A CA   2  
ATOM   4169   C C    . GLU A 1 78  ? -4.844  13.002  58.166 1.00  0.00 ? 78  GLU A C    2  
ATOM   4170   O O    . GLU A 1 78  ? -6.066  13.171  58.027 1.00  0.00 ? 78  GLU A O    2  
ATOM   4171   H H    . GLU A 1 78  ? -5.142  15.941  58.525 1.00  0.00 ? 78  GLU A H    2  
ATOM   4172   N N    . ILE A 1 79  ? -4.186  11.911  57.874 1.00  0.00 ? 79  ILE A N    2  
ATOM   4173   C CA   . ILE A 1 79  ? -4.911  10.704  57.402 1.00  0.00 ? 79  ILE A CA   2  
ATOM   4174   C C    . ILE A 1 79  ? -4.855  9.648   58.468 1.00  0.00 ? 79  ILE A C    2  
ATOM   4175   O O    . ILE A 1 79  ? -3.956  9.516   59.281 1.00  0.00 ? 79  ILE A O    2  
ATOM   4176   H H    . ILE A 1 79  ? -3.210  11.893  57.957 1.00  0.00 ? 79  ILE A H    2  
ATOM   4177   N N    . THR A 1 80  ? -5.909  8.818   58.430 1.00  0.00 ? 80  THR A N    2  
ATOM   4178   C CA   . THR A 1 80  ? -5.962  7.735   59.414 1.00  0.00 ? 80  THR A CA   2  
ATOM   4179   C C    . THR A 1 80  ? -6.435  6.408   58.883 1.00  0.00 ? 80  THR A C    2  
ATOM   4180   O O    . THR A 1 80  ? -7.521  5.942   59.279 1.00  0.00 ? 80  THR A O    2  
ATOM   4181   H H    . THR A 1 80  ? -6.615  8.928   57.760 1.00  0.00 ? 80  THR A H    2  
ATOM   4182   N N    . PRO A 1 81  ? -5.613  5.804   58.038 1.00  0.00 ? 81  PRO A N    2  
ATOM   4183   C CA   . PRO A 1 81  ? -5.957  4.471   57.518 1.00  0.00 ? 81  PRO A CA   2  
ATOM   4184   C C    . PRO A 1 81  ? -5.850  3.575   58.737 1.00  0.00 ? 81  PRO A C    2  
ATOM   4185   O O    . PRO A 1 81  ? -4.960  3.843   59.582 1.00  0.00 ? 81  PRO A O    2  
ATOM   4186   N N    . ASP A 1 82  ? -6.644  2.541   58.830 1.00  0.00 ? 82  ASP A N    2  
ATOM   4187   C CA   . ASP A 1 82  ? -6.507  1.630   60.008 1.00  0.00 ? 82  ASP A CA   2  
ATOM   4188   C C    . ASP A 1 82  ? -5.395  0.624   59.690 1.00  0.00 ? 82  ASP A C    2  
ATOM   4189   O O    . ASP A 1 82  ? -4.920  0.528   58.540 1.00  0.00 ? 82  ASP A O    2  
ATOM   4190   H H    . ASP A 1 82  ? -7.296  2.349   58.124 1.00  0.00 ? 82  ASP A H    2  
ATOM   4191   N N    . LYS A 1 83  ? -4.995  -0.070  60.725 1.00  0.00 ? 83  LYS A N    2  
ATOM   4192   C CA   . LYS A 1 83  ? -3.918  -1.062  60.713 1.00  0.00 ? 83  LYS A CA   2  
ATOM   4193   C C    . LYS A 1 83  ? -3.953  -1.972  59.500 1.00  0.00 ? 83  LYS A C    2  
ATOM   4194   O O    . LYS A 1 83  ? -2.941  -2.235  58.851 1.00  0.00 ? 83  LYS A O    2  
ATOM   4195   H H    . LYS A 1 83  ? -5.431  0.111   61.583 1.00  0.00 ? 83  LYS A H    2  
ATOM   4196   N N    . ALA A 1 84  ? -5.132  -2.442  59.243 1.00  0.00 ? 84  ALA A N    2  
ATOM   4197   C CA   . ALA A 1 84  ? -5.494  -3.366  58.184 1.00  0.00 ? 84  ALA A CA   2  
ATOM   4198   C C    . ALA A 1 84  ? -5.217  -2.809  56.797 1.00  0.00 ? 84  ALA A C    2  
ATOM   4199   O O    . ALA A 1 84  ? -4.777  -3.567  55.927 1.00  0.00 ? 84  ALA A O    2  
ATOM   4200   H H    . ALA A 1 84  ? -5.853  -2.164  59.845 1.00  0.00 ? 84  ALA A H    2  
ATOM   4201   N N    . PHE A 1 85  ? -5.539  -1.531  56.626 1.00  0.00 ? 85  PHE A N    2  
ATOM   4202   C CA   . PHE A 1 85  ? -5.300  -0.898  55.338 1.00  0.00 ? 85  PHE A CA   2  
ATOM   4203   C C    . PHE A 1 85  ? -3.766  -0.718  55.216 1.00  0.00 ? 85  PHE A C    2  
ATOM   4204   O O    . PHE A 1 85  ? -3.206  -0.898  54.155 1.00  0.00 ? 85  PHE A O    2  
ATOM   4205   H H    . PHE A 1 85  ? -5.926  -1.016  57.365 1.00  0.00 ? 85  PHE A H    2  
ATOM   4206   N N    . GLN A 1 86  ? -3.158  -0.381  56.311 1.00  0.00 ? 86  GLN A N    2  
ATOM   4207   C CA   . GLN A 1 86  ? -1.736  -0.105  56.378 1.00  0.00 ? 86  GLN A CA   2  
ATOM   4208   C C    . GLN A 1 86  ? -0.880  -1.289  55.981 1.00  0.00 ? 86  GLN A C    2  
ATOM   4209   O O    . GLN A 1 86  ? 0.223   -1.106  55.426 1.00  0.00 ? 86  GLN A O    2  
ATOM   4210   H H    . GLN A 1 86  ? -3.693  -0.266  57.124 1.00  0.00 ? 86  GLN A H    2  
ATOM   4211   N N    . ASP A 1 87  ? -1.359  -2.460  56.316 1.00  0.00 ? 87  ASP A N    2  
ATOM   4212   C CA   . ASP A 1 87  ? -0.649  -3.724  56.040 1.00  0.00 ? 87  ASP A CA   2  
ATOM   4213   C C    . ASP A 1 87  ? -0.730  -4.122  54.579 1.00  0.00 ? 87  ASP A C    2  
ATOM   4214   O O    . ASP A 1 87  ? 0.006   -5.033  54.156 1.00  0.00 ? 87  ASP A O    2  
ATOM   4215   H H    . ASP A 1 87  ? -2.217  -2.498  56.788 1.00  0.00 ? 87  ASP A H    2  
ATOM   4216   N N    . LYS A 1 88  ? -1.528  -3.471  53.787 1.00  0.00 ? 88  LYS A N    2  
ATOM   4217   C CA   . LYS A 1 88  ? -1.674  -3.720  52.359 1.00  0.00 ? 88  LYS A CA   2  
ATOM   4218   C C    . LYS A 1 88  ? -0.520  -3.119  51.532 1.00  0.00 ? 88  LYS A C    2  
ATOM   4219   O O    . LYS A 1 88  ? -0.377  -3.482  50.371 1.00  0.00 ? 88  LYS A O    2  
ATOM   4220   H H    . LYS A 1 88  ? -2.054  -2.739  54.175 1.00  0.00 ? 88  LYS A H    2  
ATOM   4221   N N    . LEU A 1 89  ? 0.234   -2.213  52.091 1.00  0.00 ? 89  LEU A N    2  
ATOM   4222   C CA   . LEU A 1 89  ? 1.351   -1.527  51.476 1.00  0.00 ? 89  LEU A CA   2  
ATOM   4223   C C    . LEU A 1 89  ? 2.666   -1.866  52.182 1.00  0.00 ? 89  LEU A C    2  
ATOM   4224   O O    . LEU A 1 89  ? 2.712   -2.272  53.342 1.00  0.00 ? 89  LEU A O    2  
ATOM   4225   H H    . LEU A 1 89  ? 0.018   -1.967  53.014 1.00  0.00 ? 89  LEU A H    2  
ATOM   4226   N N    . TYR A 1 90  ? 3.754   -1.711  51.412 1.00  0.00 ? 90  TYR A N    2  
ATOM   4227   C CA   . TYR A 1 90  ? 5.116   -1.954  51.947 1.00  0.00 ? 90  TYR A CA   2  
ATOM   4228   C C    . TYR A 1 90  ? 5.327   -0.969  53.091 1.00  0.00 ? 90  TYR A C    2  
ATOM   4229   O O    . TYR A 1 90  ? 5.068   0.239   52.893 1.00  0.00 ? 90  TYR A O    2  
ATOM   4230   H H    . TYR A 1 90  ? 3.649   -1.404  50.487 1.00  0.00 ? 90  TYR A H    2  
ATOM   4231   N N    . PRO A 1 91  ? 5.756   -1.487  54.222 1.00  0.00 ? 91  PRO A N    2  
ATOM   4232   C CA   . PRO A 1 91  ? 5.959   -0.685  55.435 1.00  0.00 ? 91  PRO A CA   2  
ATOM   4233   C C    . PRO A 1 91  ? 6.783   0.575   55.251 1.00  0.00 ? 91  PRO A C    2  
ATOM   4234   O O    . PRO A 1 91  ? 6.424   1.685   55.699 1.00  0.00 ? 91  PRO A O    2  
ATOM   4235   N N    . PHE A 1 92  ? 7.884   0.429   54.517 1.00  0.00 ? 92  PHE A N    2  
ATOM   4236   C CA   . PHE A 1 92  ? 8.836   1.484   54.225 1.00  0.00 ? 92  PHE A CA   2  
ATOM   4237   C C    . PHE A 1 92  ? 8.161   2.624   53.506 1.00  0.00 ? 92  PHE A C    2  
ATOM   4238   O O    . PHE A 1 92  ? 8.649   3.766   53.612 1.00  0.00 ? 92  PHE A O    2  
ATOM   4239   H H    . PHE A 1 92  ? 8.073   -0.464  54.160 1.00  0.00 ? 92  PHE A H    2  
ATOM   4240   N N    . THR A 1 93  ? 7.085   2.394   52.794 1.00  0.00 ? 93  THR A N    2  
ATOM   4241   C CA   . THR A 1 93  ? 6.408   3.445   52.062 1.00  0.00 ? 93  THR A CA   2  
ATOM   4242   C C    . THR A 1 93  ? 5.663   4.410   53.010 1.00  0.00 ? 93  THR A C    2  
ATOM   4243   O O    . THR A 1 93  ? 5.554   5.589   52.630 1.00  0.00 ? 93  THR A O    2  
ATOM   4244   H H    . THR A 1 93  ? 6.737   1.479   52.742 1.00  0.00 ? 93  THR A H    2  
ATOM   4245   N N    . TRP A 1 94  ? 5.254   3.913   54.142 1.00  0.00 ? 94  TRP A N    2  
ATOM   4246   C CA   . TRP A 1 94  ? 4.545   4.762   55.137 1.00  0.00 ? 94  TRP A CA   2  
ATOM   4247   C C    . TRP A 1 94  ? 5.508   5.767   55.753 1.00  0.00 ? 94  TRP A C    2  
ATOM   4248   O O    . TRP A 1 94  ? 5.076   6.855   56.166 1.00  0.00 ? 94  TRP A O    2  
ATOM   4249   H H    . TRP A 1 94  ? 5.430   2.971   54.348 1.00  0.00 ? 94  TRP A H    2  
ATOM   4250   N N    . ASP A 1 95  ? 6.783   5.486   55.791 1.00  0.00 ? 95  ASP A N    2  
ATOM   4251   C CA   . ASP A 1 95  ? 7.816   6.362   56.303 1.00  0.00 ? 95  ASP A CA   2  
ATOM   4252   C C    . ASP A 1 95  ? 8.003   7.617   55.474 1.00  0.00 ? 95  ASP A C    2  
ATOM   4253   O O    . ASP A 1 95  ? 8.486   8.650   56.015 1.00  0.00 ? 95  ASP A O    2  
ATOM   4254   H H    . ASP A 1 95  ? 7.067   4.626   55.416 1.00  0.00 ? 95  ASP A H    2  
ATOM   4255   N N    . ALA A 1 96  ? 7.658   7.595   54.211 1.00  0.00 ? 96  ALA A N    2  
ATOM   4256   C CA   . ALA A 1 96  ? 7.795   8.669   53.276 1.00  0.00 ? 96  ALA A CA   2  
ATOM   4257   C C    . ALA A 1 96  ? 6.734   9.777   53.412 1.00  0.00 ? 96  ALA A C    2  
ATOM   4258   O O    . ALA A 1 96  ? 6.903   10.888  52.891 1.00  0.00 ? 96  ALA A O    2  
ATOM   4259   H H    . ALA A 1 96  ? 7.291   6.754   53.868 1.00  0.00 ? 96  ALA A H    2  
ATOM   4260   N N    . VAL A 1 97  ? 5.602   9.376   53.967 1.00  0.00 ? 97  VAL A N    2  
ATOM   4261   C CA   . VAL A 1 97  ? 4.439   10.266  54.095 1.00  0.00 ? 97  VAL A CA   2  
ATOM   4262   C C    . VAL A 1 97  ? 4.108   10.645  55.550 1.00  0.00 ? 97  VAL A C    2  
ATOM   4263   O O    . VAL A 1 97  ? 2.954   10.925  55.852 1.00  0.00 ? 97  VAL A O    2  
ATOM   4264   H H    . VAL A 1 97  ? 5.516   8.441   54.245 1.00  0.00 ? 97  VAL A H    2  
ATOM   4265   N N    . ARG A 1 98  ? 5.081   10.592  56.394 1.00  0.00 ? 98  ARG A N    2  
ATOM   4266   C CA   . ARG A 1 98  ? 5.028   10.963  57.803 1.00  0.00 ? 98  ARG A CA   2  
ATOM   4267   C C    . ARG A 1 98  ? 5.704   12.339  57.927 1.00  0.00 ? 98  ARG A C    2  
ATOM   4268   O O    . ARG A 1 98  ? 6.821   12.553  57.418 1.00  0.00 ? 98  ARG A O    2  
ATOM   4269   H H    . ARG A 1 98  ? 5.953   10.313  56.045 1.00  0.00 ? 98  ARG A H    2  
ATOM   4270   N N    . TYR A 1 99  ? 5.018   13.282  58.545 1.00  0.00 ? 99  TYR A N    2  
ATOM   4271   C CA   . TYR A 1 99  ? 5.548   14.631  58.772 1.00  0.00 ? 99  TYR A CA   2  
ATOM   4272   C C    . TYR A 1 99  ? 5.403   14.884  60.288 1.00  0.00 ? 99  TYR A C    2  
ATOM   4273   O O    . TYR A 1 99  ? 4.299   15.147  60.765 1.00  0.00 ? 99  TYR A O    2  
ATOM   4274   H H    . TYR A 1 99  ? 4.127   13.065  58.889 1.00  0.00 ? 99  TYR A H    2  
ATOM   4275   N N    . ASN A 1 100 ? 6.526   14.693  60.934 1.00  0.00 ? 100 ASN A N    2  
ATOM   4276   C CA   . ASN A 1 100 ? 6.701   14.831  62.375 1.00  0.00 ? 100 ASN A CA   2  
ATOM   4277   C C    . ASN A 1 100 ? 5.708   13.956  63.119 1.00  0.00 ? 100 ASN A C    2  
ATOM   4278   O O    . ASN A 1 100 ? 4.949   14.428  63.954 1.00  0.00 ? 100 ASN A O    2  
ATOM   4279   H H    . ASN A 1 100 ? 7.308   14.422  60.408 1.00  0.00 ? 100 ASN A H    2  
ATOM   4280   N N    . GLY A 1 101 ? 5.733   12.692  62.727 1.00  0.00 ? 101 GLY A N    2  
ATOM   4281   C CA   . GLY A 1 101 ? 4.893   11.662  63.297 1.00  0.00 ? 101 GLY A CA   2  
ATOM   4282   C C    . GLY A 1 101 ? 3.524   11.514  62.679 1.00  0.00 ? 101 GLY A C    2  
ATOM   4283   O O    . GLY A 1 101 ? 2.994   10.380  62.742 1.00  0.00 ? 101 GLY A O    2  
ATOM   4284   H H    . GLY A 1 101 ? 6.362   12.439  62.021 1.00  0.00 ? 101 GLY A H    2  
ATOM   4285   N N    . LYS A 1 102 ? 2.965   12.555  62.116 1.00  0.00 ? 102 LYS A N    2  
ATOM   4286   C CA   . LYS A 1 102 ? 1.635   12.543  61.501 1.00  0.00 ? 102 LYS A CA   2  
ATOM   4287   C C    . LYS A 1 102 ? 1.682   12.032  60.047 1.00  0.00 ? 102 LYS A C    2  
ATOM   4288   O O    . LYS A 1 102 ? 2.557   12.482  59.308 1.00  0.00 ? 102 LYS A O    2  
ATOM   4289   H H    . LYS A 1 102 ? 3.463   13.400  62.118 1.00  0.00 ? 102 LYS A H    2  
ATOM   4290   N N    . LEU A 1 103 ? 0.770   11.148  59.723 1.00  0.00 ? 103 LEU A N    2  
ATOM   4291   C CA   . LEU A 1 103 ? 0.595   10.600  58.362 1.00  0.00 ? 103 LEU A CA   2  
ATOM   4292   C C    . LEU A 1 103 ? -0.137  11.692  57.568 1.00  0.00 ? 103 LEU A C    2  
ATOM   4293   O O    . LEU A 1 103 ? -1.291  12.039  57.923 1.00  0.00 ? 103 LEU A O    2  
ATOM   4294   H H    . LEU A 1 103 ? 0.131   10.872  60.413 1.00  0.00 ? 103 LEU A H    2  
ATOM   4295   N N    . ILE A 1 104 ? 0.462   12.190  56.514 1.00  0.00 ? 104 ILE A N    2  
ATOM   4296   C CA   . ILE A 1 104 ? -0.110  13.250  55.697 1.00  0.00 ? 104 ILE A CA   2  
ATOM   4297   C C    . ILE A 1 104 ? -0.373  12.913  54.245 1.00  0.00 ? 104 ILE A C    2  
ATOM   4298   O O    . ILE A 1 104 ? -0.717  13.819  53.455 1.00  0.00 ? 104 ILE A O    2  
ATOM   4299   H H    . ILE A 1 104 ? 1.348   11.846  56.277 1.00  0.00 ? 104 ILE A H    2  
ATOM   4300   N N    . ALA A 1 105 ? -0.290  11.634  53.887 1.00  0.00 ? 105 ALA A N    2  
ATOM   4301   C CA   . ALA A 1 105 ? -0.579  11.239  52.481 1.00  0.00 ? 105 ALA A CA   2  
ATOM   4302   C C    . ALA A 1 105 ? -0.545  9.722   52.329 1.00  0.00 ? 105 ALA A C    2  
ATOM   4303   O O    . ALA A 1 105 ? -0.021  9.040   53.168 1.00  0.00 ? 105 ALA A O    2  
ATOM   4304   H H    . ALA A 1 105 ? -0.066  10.951  54.553 1.00  0.00 ? 105 ALA A H    2  
ATOM   4305   N N    C TYR A 1 106 ? -1.129  9.277   51.225 0.05  0.00 ? 106 TYR A N    2  
ATOM   4306   N N    O TYR A 1 106 ? -1.129  9.277   51.225 0.95  0.00 ? 106 TYR A N    2  
ATOM   4307   C CA   C TYR A 1 106 ? -1.013  7.817   50.879 0.05  0.00 ? 106 TYR A CA   2  
ATOM   4308   C CA   O TYR A 1 106 ? -1.092  7.802   50.927 0.95  0.00 ? 106 TYR A CA   2  
ATOM   4309   C C    C TYR A 1 106 ? -0.083  7.719   49.628 0.05  0.00 ? 106 TYR A C    2  
ATOM   4310   C C    O TYR A 1 106 ? -0.002  7.589   49.828 0.95  0.00 ? 106 TYR A C    2  
ATOM   4311   O O    C TYR A 1 106 ? -0.537  8.126   48.578 0.05  0.00 ? 106 TYR A O    2  
ATOM   4312   O O    O TYR A 1 106 ? -0.054  8.319   48.859 0.95  0.00 ? 106 TYR A O    2  
ATOM   4313   H H    C TYR A 1 106 ? -1.586  9.898   50.619 0.05  0.00 ? 106 TYR A H    2  
ATOM   4314   H H    O TYR A 1 106 ? -1.534  9.904   50.589 0.95  0.00 ? 106 TYR A H    2  
ATOM   4315   N N    C PRO A 1 107 ? 1.072   7.152   49.865 0.05  0.00 ? 107 PRO A N    2  
ATOM   4316   N N    O PRO A 1 107 ? 0.814   6.596   50.072 0.95  0.00 ? 107 PRO A N    2  
ATOM   4317   C CA   C PRO A 1 107 ? 2.124   7.017   48.808 0.05  0.00 ? 107 PRO A CA   2  
ATOM   4318   C CA   O PRO A 1 107 ? 1.916   6.221   49.130 0.95  0.00 ? 107 PRO A CA   2  
ATOM   4319   C C    C PRO A 1 107 ? 1.454   6.507   47.541 0.05  0.00 ? 107 PRO A C    2  
ATOM   4320   C C    O PRO A 1 107 ? 1.287   5.570   47.907 0.95  0.00 ? 107 PRO A C    2  
ATOM   4321   O O    C PRO A 1 107 ? 0.305   6.052   47.643 0.05  0.00 ? 107 PRO A O    2  
ATOM   4322   O O    O PRO A 1 107 ? 0.311   4.828   48.091 0.95  0.00 ? 107 PRO A O    2  
ATOM   4323   N N    C ILE A 1 108 ? 2.019   6.646   46.387 0.05  0.00 ? 108 ILE A N    2  
ATOM   4324   N N    O ILE A 1 108 ? 1.687   5.867   46.715 0.95  0.00 ? 108 ILE A N    2  
ATOM   4325   C CA   C ILE A 1 108 ? 1.431   6.213   45.111 0.05  0.00 ? 108 ILE A CA   2  
ATOM   4326   C CA   O ILE A 1 108 ? 1.128   5.299   45.480 0.95  0.00 ? 108 ILE A CA   2  
ATOM   4327   C C    C ILE A 1 108 ? 2.470   5.553   44.169 0.05  0.00 ? 108 ILE A C    2  
ATOM   4328   C C    O ILE A 1 108 ? 2.152   4.429   44.707 0.95  0.00 ? 108 ILE A C    2  
ATOM   4329   O O    C ILE A 1 108 ? 2.611   4.325   44.128 0.05  0.00 ? 108 ILE A O    2  
ATOM   4330   O O    O ILE A 1 108 ? 1.992   3.209   44.581 0.95  0.00 ? 108 ILE A O    2  
ATOM   4331   H H    C ILE A 1 108 ? 2.898   7.079   46.359 0.05  0.00 ? 108 ILE A H    2  
ATOM   4332   H H    O ILE A 1 108 ? 2.408   6.525   46.627 0.95  0.00 ? 108 ILE A H    2  
ATOM   4333   N N    C ALA A 1 109 ? 3.205   6.419   43.473 0.05  0.00 ? 109 ALA A N    2  
ATOM   4334   N N    O ALA A 1 109 ? 3.209   5.101   44.255 0.95  0.00 ? 109 ALA A N    2  
ATOM   4335   C CA   C ALA A 1 109 ? 4.247   5.971   42.487 0.05  0.00 ? 109 ALA A CA   2  
ATOM   4336   C CA   O ALA A 1 109 ? 4.301   4.435   43.466 0.95  0.00 ? 109 ALA A CA   2  
ATOM   4337   C C    C ALA A 1 109 ? 5.232   7.073   42.210 0.05  0.00 ? 109 ALA A C    2  
ATOM   4338   C C    O ALA A 1 109 ? 5.647   4.698   44.084 0.95  0.00 ? 109 ALA A C    2  
ATOM   4339   O O    C ALA A 1 109 ? 5.204   8.105   42.899 0.05  0.00 ? 109 ALA A O    2  
ATOM   4340   O O    O ALA A 1 109 ? 5.769   5.614   44.912 0.95  0.00 ? 109 ALA A O    2  
ATOM   4341   H H    C ALA A 1 109 ? 3.052   7.379   43.599 0.05  0.00 ? 109 ALA A H    2  
ATOM   4342   H H    O ALA A 1 109 ? 3.271   6.063   44.432 0.95  0.00 ? 109 ALA A H    2  
ATOM   4343   N N    C VAL A 1 110 ? 6.135   6.918   41.275 0.05  0.00 ? 110 VAL A N    2  
ATOM   4344   N N    O VAL A 1 110 ? 6.664   3.934   43.776 0.95  0.00 ? 110 VAL A N    2  
ATOM   4345   C CA   C VAL A 1 110 ? 7.196   7.866   40.904 0.05  0.00 ? 110 VAL A CA   2  
ATOM   4346   C CA   O VAL A 1 110 ? 8.035   4.034   44.297 0.95  0.00 ? 110 VAL A CA   2  
ATOM   4347   C C    C VAL A 1 110 ? 7.445   7.817   39.381 0.05  0.00 ? 110 VAL A C    2  
ATOM   4348   C C    O VAL A 1 110 ? 9.044   4.119   43.132 0.95  0.00 ? 110 VAL A C    2  
ATOM   4349   O O    C VAL A 1 110 ? 6.968   6.916   38.662 0.05  0.00 ? 110 VAL A O    2  
ATOM   4350   O O    O VAL A 1 110 ? 8.899   3.458   42.083 0.95  0.00 ? 110 VAL A O    2  
ATOM   4351   H H    C VAL A 1 110 ? 6.110   6.074   40.779 0.05  0.00 ? 110 VAL A H    2  
ATOM   4352   H H    O VAL A 1 110 ? 6.490   3.210   43.140 0.95  0.00 ? 110 VAL A H    2  
ATOM   4353   N N    C GLU A 1 111 ? 8.140   8.809   38.854 0.05  0.00 ? 111 GLU A N    2  
ATOM   4354   N N    O GLU A 1 111 ? 10.045  4.970   43.264 0.95  0.00 ? 111 GLU A N    2  
ATOM   4355   C CA   C GLU A 1 111 ? 8.432   8.906   37.409 0.05  0.00 ? 111 GLU A CA   2  
ATOM   4356   C CA   O GLU A 1 111 ? 11.075  5.166   42.224 0.95  0.00 ? 111 GLU A CA   2  
ATOM   4357   C C    C GLU A 1 111 ? 9.807   9.482   37.203 0.05  0.00 ? 111 GLU A C    2  
ATOM   4358   C C    O GLU A 1 111 ? 12.439  5.216   42.859 0.95  0.00 ? 111 GLU A C    2  
ATOM   4359   O O    C GLU A 1 111 ? 10.338  10.164  38.115 0.05  0.00 ? 111 GLU A O    2  
ATOM   4360   O O    O GLU A 1 111 ? 12.587  5.784   43.970 0.95  0.00 ? 111 GLU A O    2  
ATOM   4361   H H    C GLU A 1 111 ? 8.471   9.517   39.446 0.05  0.00 ? 111 GLU A H    2  
ATOM   4362   H H    O GLU A 1 111 ? 10.103  5.502   44.086 0.95  0.00 ? 111 GLU A H    2  
ATOM   4363   N N    C ALA A 1 112 ? 10.427  9.155   36.069 0.05  0.00 ? 112 ALA A N    2  
ATOM   4364   N N    O ALA A 1 112 ? 13.416  4.565   42.226 0.95  0.00 ? 112 ALA A N    2  
ATOM   4365   C CA   C ALA A 1 112 ? 11.784  9.587   35.761 0.05  0.00 ? 112 ALA A CA   2  
ATOM   4366   C CA   O ALA A 1 112 ? 14.787  4.531   42.718 0.95  0.00 ? 112 ALA A CA   2  
ATOM   4367   C C    C ALA A 1 112 ? 12.070  9.093   34.329 0.05  0.00 ? 112 ALA A C    2  
ATOM   4368   C C    O ALA A 1 112 ? 15.667  4.205   41.496 0.95  0.00 ? 112 ALA A C    2  
ATOM   4369   O O    C ALA A 1 112 ? 11.224  8.327   33.798 0.05  0.00 ? 112 ALA A O    2  
ATOM   4370   O O    O ALA A 1 112 ? 15.120  3.619   40.525 0.95  0.00 ? 112 ALA A O    2  
ATOM   4371   H H    C ALA A 1 112 ? 9.949   8.605   35.413 0.05  0.00 ? 112 ALA A H    2  
ATOM   4372   H H    O ALA A 1 112 ? 13.204  4.093   41.393 0.95  0.00 ? 112 ALA A H    2  
ATOM   4373   N N    C LEU A 1 113 ? 13.168  9.566   33.780 0.05  0.00 ? 113 LEU A N    2  
ATOM   4374   N N    O LEU A 1 113 ? 16.913  4.619   41.574 0.95  0.00 ? 113 LEU A N    2  
ATOM   4375   C CA   C LEU A 1 113 ? 13.562  9.166   32.397 0.05  0.00 ? 113 LEU A CA   2  
ATOM   4376   C CA   O LEU A 1 113 ? 17.885  4.322   40.480 0.95  0.00 ? 113 LEU A CA   2  
ATOM   4377   C C    C LEU A 1 113 ? 14.609  8.078   32.509 0.05  0.00 ? 113 LEU A C    2  
ATOM   4378   C C    O LEU A 1 113 ? 18.165  2.834   40.500 0.95  0.00 ? 113 LEU A C    2  
ATOM   4379   O O    C LEU A 1 113 ? 15.169  7.794   33.546 0.05  0.00 ? 113 LEU A O    2  
ATOM   4380   O O    O LEU A 1 113 ? 18.103  2.156   41.502 0.95  0.00 ? 113 LEU A O    2  
ATOM   4381   H H    C LEU A 1 113 ? 13.751  10.160  34.298 0.05  0.00 ? 113 LEU A H    2  
ATOM   4382   H H    O LEU A 1 113 ? 17.215  5.097   42.374 0.95  0.00 ? 113 LEU A H    2  
ATOM   4383   N N    C SER A 1 114 ? 14.960  7.536   31.330 0.05  0.00 ? 114 SER A N    2  
ATOM   4384   N N    O SER A 1 114 ? 18.616  2.349   39.330 0.95  0.00 ? 114 SER A N    2  
ATOM   4385   C CA   C SER A 1 114 ? 16.017  6.505   31.269 0.05  0.00 ? 114 SER A CA   2  
ATOM   4386   C CA   O SER A 1 114 ? 18.987  0.924   39.207 0.95  0.00 ? 114 SER A CA   2  
ATOM   4387   C C    C SER A 1 114 ? 16.484  6.435   29.770 0.05  0.00 ? 114 SER A C    2  
ATOM   4388   C C    O SER A 1 114 ? 20.256  0.873   38.282 0.95  0.00 ? 114 SER A C    2  
ATOM   4389   O O    C SER A 1 114 ? 15.882  7.153   29.005 0.05  0.00 ? 114 SER A O    2  
ATOM   4390   O O    O SER A 1 114 ? 20.509  1.897   37.690 0.95  0.00 ? 114 SER A O    2  
ATOM   4391   H H    C SER A 1 114 ? 14.538  7.853   30.504 0.05  0.00 ? 114 SER A H    2  
ATOM   4392   H H    O SER A 1 114 ? 18.734  2.952   38.566 0.95  0.00 ? 114 SER A H    2  
ATOM   4393   N N    C LEU A 1 115 ? 17.466  5.642   29.571 0.05  0.00 ? 115 LEU A N    2  
ATOM   4394   N N    O LEU A 1 115 ? 20.869  -0.248  38.307 0.95  0.00 ? 115 LEU A N    2  
ATOM   4395   C CA   C LEU A 1 115 ? 18.012  5.417   28.181 0.05  0.00 ? 115 LEU A CA   2  
ATOM   4396   C CA   O LEU A 1 115 ? 22.049  -0.507  37.401 0.95  0.00 ? 115 LEU A CA   2  
ATOM   4397   C C    C LEU A 1 115 ? 17.148  4.305   27.552 0.05  0.00 ? 115 LEU A C    2  
ATOM   4398   C C    O LEU A 1 115 ? 21.466  -0.998  36.060 0.95  0.00 ? 115 LEU A C    2  
ATOM   4399   O O    C LEU A 1 115 ? 17.077  3.259   28.204 0.05  0.00 ? 115 LEU A O    2  
ATOM   4400   O O    O LEU A 1 115 ? 20.710  -1.971  36.138 0.95  0.00 ? 115 LEU A O    2  
ATOM   4401   H H    C LEU A 1 115 ? 17.827  5.124   30.320 0.05  0.00 ? 115 LEU A H    2  
ATOM   4402   H H    O LEU A 1 115 ? 20.529  -0.971  38.874 0.95  0.00 ? 115 LEU A H    2  
ATOM   4403   N N    C ILE A 1 116 ? 16.510  4.563   26.464 0.05  0.00 ? 116 ILE A N    2  
ATOM   4404   N N    O ILE A 1 116 ? 21.730  -0.329  34.993 0.95  0.00 ? 116 ILE A N    2  
ATOM   4405   C CA   C ILE A 1 116 ? 15.639  3.603   25.742 0.05  0.00 ? 116 ILE A CA   2  
ATOM   4406   C CA   O ILE A 1 116 ? 21.242  -0.670  33.634 0.95  0.00 ? 116 ILE A CA   2  
ATOM   4407   C C    C ILE A 1 116 ? 16.419  3.193   24.483 0.05  0.00 ? 116 ILE A C    2  
ATOM   4408   C C    O ILE A 1 116 ? 22.461  -1.218  32.875 0.95  0.00 ? 116 ILE A C    2  
ATOM   4409   O O    C ILE A 1 116 ? 16.833  4.149   23.821 0.05  0.00 ? 116 ILE A O    2  
ATOM   4410   O O    O ILE A 1 116 ? 23.450  -0.480  32.924 0.95  0.00 ? 116 ILE A O    2  
ATOM   4411   H H    C ILE A 1 116 ? 16.606  5.462   26.085 0.05  0.00 ? 116 ILE A H    2  
ATOM   4412   H H    O ILE A 1 116 ? 22.295  0.467   35.085 0.95  0.00 ? 116 ILE A H    2  
ATOM   4413   N N    C TYR A 1 117 ? 16.562  1.927   24.155 0.05  0.00 ? 117 TYR A N    2  
ATOM   4414   N N    O TYR A 1 117 ? 22.394  -2.349  32.206 0.95  0.00 ? 117 TYR A N    2  
ATOM   4415   C CA   C TYR A 1 117 ? 17.372  1.596   22.951 0.05  0.00 ? 117 TYR A CA   2  
ATOM   4416   C CA   O TYR A 1 117 ? 23.625  -2.848  31.535 0.95  0.00 ? 117 TYR A CA   2  
ATOM   4417   C C    C TYR A 1 117 ? 16.709  0.474   22.170 0.05  0.00 ? 117 TYR A C    2  
ATOM   4418   C C    O TYR A 1 117 ? 23.279  -3.419  30.171 0.95  0.00 ? 117 TYR A C    2  
ATOM   4419   O O    C TYR A 1 117 ? 15.887  -0.227  22.728 0.05  0.00 ? 117 TYR A O    2  
ATOM   4420   O O    O TYR A 1 117 ? 22.127  -3.731  29.937 0.95  0.00 ? 117 TYR A O    2  
ATOM   4421   H H    C TYR A 1 117 ? 16.173  1.218   24.709 0.05  0.00 ? 117 TYR A H    2  
ATOM   4422   H H    O TYR A 1 117 ? 21.562  -2.867  32.179 0.95  0.00 ? 117 TYR A H    2  
ATOM   4423   N N    C ASN A 1 118 ? 17.061  0.388   20.927 0.05  0.00 ? 118 ASN A N    2  
ATOM   4424   N N    O ASN A 1 118 ? 24.268  -3.487  29.338 0.95  0.00 ? 118 ASN A N    2  
ATOM   4425   C CA   C ASN A 1 118 ? 16.510  -0.570  19.936 0.05  0.00 ? 118 ASN A CA   2  
ATOM   4426   C CA   O ASN A 1 118 ? 24.180  -3.937  27.926 0.95  0.00 ? 118 ASN A CA   2  
ATOM   4427   C C    C ASN A 1 118 ? 17.434  -1.789  19.977 0.05  0.00 ? 118 ASN A C    2  
ATOM   4428   C C    O ASN A 1 118 ? 24.479  -5.438  27.948 0.95  0.00 ? 118 ASN A C    2  
ATOM   4429   O O    C ASN A 1 118 ? 18.555  -1.632  19.550 0.05  0.00 ? 118 ASN A O    2  
ATOM   4430   O O    O ASN A 1 118 ? 25.613  -5.759  28.225 0.95  0.00 ? 118 ASN A O    2  
ATOM   4431   H H    C ASN A 1 118 ? 17.715  1.041   20.602 0.05  0.00 ? 118 ASN A H    2  
ATOM   4432   H H    O ASN A 1 118 ? 25.140  -3.172  29.653 0.95  0.00 ? 118 ASN A H    2  
ATOM   4433   N N    C LYS A 1 119 ? 16.928  -2.882  20.541 0.05  0.00 ? 119 LYS A N    2  
ATOM   4434   N N    O LYS A 1 119 ? 23.442  -6.240  27.725 0.95  0.00 ? 119 LYS A N    2  
ATOM   4435   C CA   C LYS A 1 119 ? 17.702  -4.116  20.733 0.05  0.00 ? 119 LYS A CA   2  
ATOM   4436   C CA   O LYS A 1 119 ? 23.535  -7.705  27.787 0.95  0.00 ? 119 LYS A CA   2  
ATOM   4437   C C    C LYS A 1 119 ? 18.136  -4.751  19.417 0.05  0.00 ? 119 LYS A C    2  
ATOM   4438   C C    O LYS A 1 119 ? 24.467  -8.282  26.728 0.95  0.00 ? 119 LYS A C    2  
ATOM   4439   O O    C LYS A 1 119 ? 19.158  -5.478  19.447 0.05  0.00 ? 119 LYS A O    2  
ATOM   4440   O O    O LYS A 1 119 ? 24.990  -9.395  26.977 0.95  0.00 ? 119 LYS A O    2  
ATOM   4441   H H    C LYS A 1 119 ? 16.013  -2.847  20.890 0.05  0.00 ? 119 LYS A H    2  
ATOM   4442   H H    O LYS A 1 119 ? 22.565  -5.835  27.562 0.95  0.00 ? 119 LYS A H    2  
ATOM   4443   N N    C ASP A 1 120 ? 17.418  -4.439  18.370 0.05  0.00 ? 120 ASP A N    2  
ATOM   4444   N N    O ASP A 1 120 ? 24.663  -7.534  25.673 0.95  0.00 ? 120 ASP A N    2  
ATOM   4445   C CA   C ASP A 1 120 ? 17.755  -4.942  17.014 0.05  0.00 ? 120 ASP A CA   2  
ATOM   4446   C CA   O ASP A 1 120 ? 25.587  -7.946  24.585 0.95  0.00 ? 120 ASP A CA   2  
ATOM   4447   C C    C ASP A 1 120 ? 18.882  -4.148  16.368 0.05  0.00 ? 120 ASP A C    2  
ATOM   4448   C C    O ASP A 1 120 ? 27.044  -7.681  24.935 0.95  0.00 ? 120 ASP A C    2  
ATOM   4449   O O    C ASP A 1 120 ? 19.582  -4.704  15.471 0.05  0.00 ? 120 ASP A O    2  
ATOM   4450   O O    O ASP A 1 120 ? 27.942  -8.368  24.365 0.95  0.00 ? 120 ASP A O    2  
ATOM   4451   H H    C ASP A 1 120 ? 16.657  -3.830  18.477 0.05  0.00 ? 120 ASP A H    2  
ATOM   4452   H H    O ASP A 1 120 ? 24.215  -6.664  25.615 0.95  0.00 ? 120 ASP A H    2  
ATOM   4453   N N    C LEU A 1 121 ? 19.142  -2.904  16.703 0.05  0.00 ? 121 LEU A N    2  
ATOM   4454   N N    O LEU A 1 121 ? 27.399  -6.756  25.799 0.95  0.00 ? 121 LEU A N    2  
ATOM   4455   C CA   C LEU A 1 121 ? 20.213  -2.104  16.099 0.05  0.00 ? 121 LEU A CA   2  
ATOM   4456   C CA   O LEU A 1 121 ? 28.792  -6.466  26.157 0.95  0.00 ? 121 LEU A CA   2  
ATOM   4457   C C    C LEU A 1 121 ? 21.453  -2.076  16.964 0.05  0.00 ? 121 LEU A C    2  
ATOM   4458   C C    O LEU A 1 121 ? 29.191  -7.131  27.455 0.95  0.00 ? 121 LEU A C    2  
ATOM   4459   O O    C LEU A 1 121 ? 22.566  -1.909  16.460 0.05  0.00 ? 121 LEU A O    2  
ATOM   4460   O O    O LEU A 1 121 ? 30.368  -7.429  27.671 0.95  0.00 ? 121 LEU A O    2  
ATOM   4461   H H    C LEU A 1 121 ? 18.586  -2.486  17.392 0.05  0.00 ? 121 LEU A H    2  
ATOM   4462   H H    O LEU A 1 121 ? 26.693  -6.227  26.225 0.95  0.00 ? 121 LEU A H    2  
ATOM   4463   N N    C LEU A 1 122 ? 21.180  -2.219  18.260 0.05  0.00 ? 122 LEU A N    2  
ATOM   4464   N N    O LEU A 1 122 ? 28.162  -7.308  28.281 0.95  0.00 ? 122 LEU A N    2  
ATOM   4465   C CA   C LEU A 1 122 ? 22.219  -2.111  19.281 0.05  0.00 ? 122 LEU A CA   2  
ATOM   4466   C CA   O LEU A 1 122 ? 28.342  -7.832  29.633 0.95  0.00 ? 122 LEU A CA   2  
ATOM   4467   C C    C LEU A 1 122 ? 22.101  -3.272  20.259 0.05  0.00 ? 122 LEU A C    2  
ATOM   4468   C C    O LEU A 1 122 ? 27.320  -8.929  29.899 0.95  0.00 ? 122 LEU A C    2  
ATOM   4469   O O    C LEU A 1 122 ? 21.136  -3.309  21.013 0.05  0.00 ? 122 LEU A O    2  
ATOM   4470   O O    O LEU A 1 122 ? 26.139  -8.619  30.001 0.95  0.00 ? 122 LEU A O    2  
ATOM   4471   H H    C LEU A 1 122 ? 20.249  -2.328  18.540 0.05  0.00 ? 122 LEU A H    2  
ATOM   4472   H H    O LEU A 1 122 ? 27.272  -7.012  28.001 0.95  0.00 ? 122 LEU A H    2  
ATOM   4473   N N    C PRO A 1 123 ? 23.105  -4.134  20.215 0.05  0.00 ? 123 PRO A N    2  
ATOM   4474   N N    O PRO A 1 123 ? 27.835  -10.142 30.030 0.95  0.00 ? 123 PRO A N    2  
ATOM   4475   C CA   C PRO A 1 123 ? 23.218  -5.320  21.057 0.05  0.00 ? 123 PRO A CA   2  
ATOM   4476   C CA   O PRO A 1 123 ? 27.059  -11.349 30.294 0.95  0.00 ? 123 PRO A CA   2  
ATOM   4477   C C    C PRO A 1 123 ? 23.234  -4.968  22.536 0.05  0.00 ? 123 PRO A C    2  
ATOM   4478   C C    O PRO A 1 123 ? 26.278  -11.249 31.594 0.95  0.00 ? 123 PRO A C    2  
ATOM   4479   O O    C PRO A 1 123 ? 22.460  -5.449  23.379 0.05  0.00 ? 123 PRO A O    2  
ATOM   4480   O O    O PRO A 1 123 ? 25.053  -11.429 31.691 0.95  0.00 ? 123 PRO A O    2  
ATOM   4481   N N    C ASN A 1 124 ? 24.204  -4.115  22.825 0.05  0.00 ? 124 ASN A N    2  
ATOM   4482   N N    O ASN A 1 124 ? 27.069  -10.988 32.622 0.95  0.00 ? 124 ASN A N    2  
ATOM   4483   C CA   C ASN A 1 124 ? 24.397  -3.618  24.202 0.05  0.00 ? 124 ASN A CA   2  
ATOM   4484   C CA   O ASN A 1 124 ? 26.523  -10.829 33.984 0.95  0.00 ? 124 ASN A CA   2  
ATOM   4485   C C    C ASN A 1 124 ? 24.470  -2.087  24.113 0.05  0.00 ? 124 ASN A C    2  
ATOM   4486   C C    O ASN A 1 124 ? 27.081  -9.509  34.533 0.95  0.00 ? 124 ASN A C    2  
ATOM   4487   O O    C ASN A 1 124 ? 25.187  -1.575  23.258 0.05  0.00 ? 124 ASN A O    2  
ATOM   4488   O O    O ASN A 1 124 ? 28.280  -9.274  34.411 0.95  0.00 ? 124 ASN A O    2  
ATOM   4489   H H    C ASN A 1 124 ? 24.796  -3.798  22.112 0.05  0.00 ? 124 ASN A H    2  
ATOM   4490   H H    O ASN A 1 124 ? 28.032  -10.886 32.475 0.95  0.00 ? 124 ASN A H    2  
ATOM   4491   N N    C PRO A 1 125 ? 23.707  -1.474  24.990 0.05  0.00 ? 125 PRO A N    2  
ATOM   4492   N N    O PRO A 1 125 ? 26.166  -8.739  35.078 0.95  0.00 ? 125 PRO A N    2  
ATOM   4493   C CA   C PRO A 1 125 ? 23.687  0.010   25.043 0.05  0.00 ? 125 PRO A CA   2  
ATOM   4494   C CA   O PRO A 1 125 ? 26.555  -7.436  35.675 0.95  0.00 ? 125 PRO A CA   2  
ATOM   4495   C C    C PRO A 1 125 ? 25.054  0.478   25.496 0.05  0.00 ? 125 PRO A C    2  
ATOM   4496   C C    O PRO A 1 125 ? 27.428  -7.718  36.880 0.95  0.00 ? 125 PRO A C    2  
ATOM   4497   O O    C PRO A 1 125 ? 25.726  -0.250  26.230 0.05  0.00 ? 125 PRO A O    2  
ATOM   4498   O O    O PRO A 1 125 ? 27.265  -8.766  37.508 0.95  0.00 ? 125 PRO A O    2  
ATOM   4499   N N    C PRO A 1 126 ? 25.423  1.694   25.108 0.05  0.00 ? 126 PRO A N    2  
ATOM   4500   N N    O PRO A 1 126 ? 28.293  -6.769  37.220 0.95  0.00 ? 126 PRO A N    2  
ATOM   4501   C CA   C PRO A 1 126 ? 26.713  2.274   25.501 0.05  0.00 ? 126 PRO A CA   2  
ATOM   4502   C CA   O PRO A 1 126 ? 29.179  -6.909  38.383 0.95  0.00 ? 126 PRO A CA   2  
ATOM   4503   C C    C PRO A 1 126 ? 26.668  2.579   26.999 0.05  0.00 ? 126 PRO A C    2  
ATOM   4504   C C    O PRO A 1 126 ? 28.326  -6.826  39.650 0.95  0.00 ? 126 PRO A C    2  
ATOM   4505   O O    C PRO A 1 126 ? 25.580  2.933   27.447 0.05  0.00 ? 126 PRO A O    2  
ATOM   4506   O O    O PRO A 1 126 ? 27.355  -6.075  39.601 0.95  0.00 ? 126 PRO A O    2  
ATOM   4507   N N    C LYS A 1 127 ? 27.776  2.422   27.663 0.05  0.00 ? 127 LYS A N    2  
ATOM   4508   N N    O LYS A 1 127 ? 28.696  -7.565  40.655 0.95  0.00 ? 127 LYS A N    2  
ATOM   4509   C CA   C LYS A 1 127 ? 27.848  2.678   29.065 0.05  0.00 ? 127 LYS A CA   2  
ATOM   4510   C CA   O LYS A 1 127 ? 27.974  -7.565  41.886 0.95  0.00 ? 127 LYS A CA   2  
ATOM   4511   C C    C LYS A 1 127 ? 28.209  4.126   29.367 0.05  0.00 ? 127 LYS A C    2  
ATOM   4512   C C    O LYS A 1 127 ? 28.484  -6.503  42.851 0.95  0.00 ? 127 LYS A C    2  
ATOM   4513   O O    C LYS A 1 127 ? 27.946  4.652   30.433 0.05  0.00 ? 127 LYS A O    2  
ATOM   4514   O O    O LYS A 1 127 ? 27.797  -6.067  43.757 0.95  0.00 ? 127 LYS A O    2  
ATOM   4515   H H    C LYS A 1 127 ? 28.579  2.123   27.189 0.05  0.00 ? 127 LYS A H    2  
ATOM   4516   H H    O LYS A 1 127 ? 29.489  -8.133  40.565 0.95  0.00 ? 127 LYS A H    2  
ATOM   4517   N N    C THR A 1 128 ? 28.749  4.736   28.365 0.05  0.00 ? 128 THR A N    2  
ATOM   4518   N N    O THR A 1 128 ? 29.669  -6.081  42.564 0.95  0.00 ? 128 THR A N    2  
ATOM   4519   C CA   C THR A 1 128 ? 29.312  6.093   28.361 0.05  0.00 ? 128 THR A CA   2  
ATOM   4520   C CA   O THR A 1 128 ? 30.486  -5.150  43.354 0.95  0.00 ? 128 THR A CA   2  
ATOM   4521   C C    C THR A 1 128 ? 28.760  7.002   27.304 0.05  0.00 ? 128 THR A C    2  
ATOM   4522   C C    O THR A 1 128 ? 30.987  -3.954  42.601 0.95  0.00 ? 128 THR A C    2  
ATOM   4523   O O    C THR A 1 128 ? 28.376  6.557   26.207 0.05  0.00 ? 128 THR A O    2  
ATOM   4524   O O    O THR A 1 128 ? 31.238  -4.017  41.383 0.95  0.00 ? 128 THR A O    2  
ATOM   4525   H H    C THR A 1 128 ? 28.860  4.214   27.543 0.05  0.00 ? 128 THR A H    2  
ATOM   4526   H H    O THR A 1 128 ? 30.097  -6.477  41.776 0.95  0.00 ? 128 THR A H    2  
ATOM   4527   N N    C TRP A 1 129 ? 28.739  8.315   27.617 0.05  0.00 ? 129 TRP A N    2  
ATOM   4528   N N    O TRP A 1 129 ? 31.168  -2.836  43.335 0.95  0.00 ? 129 TRP A N    2  
ATOM   4529   C CA   C TRP A 1 129 ? 28.335  9.336   26.665 0.05  0.00 ? 129 TRP A CA   2  
ATOM   4530   C CA   O TRP A 1 129 ? 31.747  -1.625  42.780 0.95  0.00 ? 129 TRP A CA   2  
ATOM   4531   C C    C TRP A 1 129 ? 29.515  9.536   25.650 0.05  0.00 ? 129 TRP A C    2  
ATOM   4532   C C    O TRP A 1 129 ? 33.293  -1.855  42.641 0.95  0.00 ? 129 TRP A C    2  
ATOM   4533   O O    C TRP A 1 129 ? 29.250  9.878   24.523 0.05  0.00 ? 129 TRP A O    2  
ATOM   4534   O O    O TRP A 1 129 ? 33.881  -1.278  41.758 0.95  0.00 ? 129 TRP A O    2  
ATOM   4535   H H    C TRP A 1 129 ? 29.075  8.596   28.494 0.05  0.00 ? 129 TRP A H    2  
ATOM   4536   H H    O TRP A 1 129 ? 30.967  -2.864  44.294 0.95  0.00 ? 129 TRP A H    2  
ATOM   4537   N N    C GLU A 1 130 ? 30.724  9.384   26.120 0.05  0.00 ? 130 GLU A N    2  
ATOM   4538   N N    O GLU A 1 130 ? 33.857  -2.610  43.545 0.95  0.00 ? 130 GLU A N    2  
ATOM   4539   C CA   C GLU A 1 130 ? 31.944  9.610   25.367 0.05  0.00 ? 130 GLU A CA   2  
ATOM   4540   C CA   O GLU A 1 130 ? 35.281  -2.871  43.641 0.95  0.00 ? 130 GLU A CA   2  
ATOM   4541   C C    C GLU A 1 130 ? 32.078  8.724   24.147 0.05  0.00 ? 130 GLU A C    2  
ATOM   4542   C C    O GLU A 1 130 ? 35.859  -3.543  42.414 0.95  0.00 ? 130 GLU A C    2  
ATOM   4543   O O    C GLU A 1 130 ? 32.722  9.114   23.159 0.05  0.00 ? 130 GLU A O    2  
ATOM   4544   O O    O GLU A 1 130 ? 37.049  -3.363  42.106 0.95  0.00 ? 130 GLU A O    2  
ATOM   4545   H H    C GLU A 1 130 ? 30.816  9.154   27.068 0.05  0.00 ? 130 GLU A H    2  
ATOM   4546   H H    O GLU A 1 130 ? 33.282  -2.983  44.245 0.95  0.00 ? 130 GLU A H    2  
ATOM   4547   N N    C GLU A 1 131 ? 31.394  7.602   24.177 0.05  0.00 ? 131 GLU A N    2  
ATOM   4548   N N    O GLU A 1 131 ? 35.006  -4.215  41.675 0.95  0.00 ? 131 GLU A N    2  
ATOM   4549   C CA   C GLU A 1 131 ? 31.448  6.647   23.059 0.05  0.00 ? 131 GLU A CA   2  
ATOM   4550   C CA   O GLU A 1 131 ? 35.443  -4.925  40.462 0.95  0.00 ? 131 GLU A CA   2  
ATOM   4551   C C    C GLU A 1 131 ? 30.326  6.823   22.096 0.05  0.00 ? 131 GLU A C    2  
ATOM   4552   C C    O GLU A 1 131 ? 35.250  -4.122  39.223 0.95  0.00 ? 131 GLU A C    2  
ATOM   4553   O O    C GLU A 1 131 ? 30.299  6.064   21.095 0.05  0.00 ? 131 GLU A O    2  
ATOM   4554   O O    O GLU A 1 131 ? 35.614  -4.638  38.137 0.95  0.00 ? 131 GLU A O    2  
ATOM   4555   H H    C GLU A 1 131 ? 30.845  7.395   24.962 0.05  0.00 ? 131 GLU A H    2  
ATOM   4556   H H    O GLU A 1 131 ? 34.063  -4.251  41.941 0.95  0.00 ? 131 GLU A H    2  
ATOM   4557   N N    C ILE A 1 132 ? 29.422  7.778   22.246 0.05  0.00 ? 132 ILE A N    2  
ATOM   4558   N N    O ILE A 1 132 ? 34.772  -2.888  39.260 0.95  0.00 ? 132 ILE A N    2  
ATOM   4559   C CA   C ILE A 1 132 ? 28.323  7.989   21.331 0.05  0.00 ? 132 ILE A CA   2  
ATOM   4560   C CA   O ILE A 1 132 ? 34.577  -2.071  38.083 0.95  0.00 ? 132 ILE A CA   2  
ATOM   4561   C C    C ILE A 1 132 ? 28.723  8.493   19.954 0.05  0.00 ? 132 ILE A C    2  
ATOM   4562   C C    O ILE A 1 132 ? 35.856  -1.625  37.393 0.95  0.00 ? 132 ILE A C    2  
ATOM   4563   O O    C ILE A 1 132 ? 28.191  8.003   18.930 0.05  0.00 ? 132 ILE A O    2  
ATOM   4564   O O    O ILE A 1 132 ? 35.940  -1.670  36.143 0.95  0.00 ? 132 ILE A O    2  
ATOM   4565   H H    C ILE A 1 132 ? 29.506  8.379   23.017 0.05  0.00 ? 132 ILE A H    2  
ATOM   4566   H H    O ILE A 1 132 ? 34.543  -2.505  40.133 0.95  0.00 ? 132 ILE A H    2  
ATOM   4567   N N    C PRO A 1 133 ? 29.594  9.469   19.874 0.05  0.00 ? 133 PRO A N    2  
ATOM   4568   N N    O PRO A 1 133 ? 36.835  -1.161  38.130 0.95  0.00 ? 133 PRO A N    2  
ATOM   4569   C CA   C PRO A 1 133 ? 30.066  9.988   18.590 0.05  0.00 ? 133 PRO A CA   2  
ATOM   4570   C CA   O PRO A 1 133 ? 38.115  -0.748  37.554 0.95  0.00 ? 133 PRO A CA   2  
ATOM   4571   C C    C PRO A 1 133 ? 30.554  8.891   17.633 0.05  0.00 ? 133 PRO A C    2  
ATOM   4572   C C    O PRO A 1 133 ? 38.733  -1.804  36.626 0.95  0.00 ? 133 PRO A C    2  
ATOM   4573   O O    C PRO A 1 133 ? 30.137  8.907   16.467 0.05  0.00 ? 133 PRO A O    2  
ATOM   4574   O O    O PRO A 1 133 ? 39.137  -1.438  35.514 0.95  0.00 ? 133 PRO A O    2  
ATOM   4575   N N    C ALA A 1 134 ? 31.388  7.996   18.052 0.05  0.00 ? 134 ALA A N    2  
ATOM   4576   N N    O ALA A 1 134 ? 38.832  -3.030  37.024 0.95  0.00 ? 134 ALA A N    2  
ATOM   4577   C CA   C ALA A 1 134 ? 31.966  6.864   17.350 0.05  0.00 ? 134 ALA A CA   2  
ATOM   4578   C CA   O ALA A 1 134 ? 39.352  -4.194  36.328 0.95  0.00 ? 134 ALA A CA   2  
ATOM   4579   C C    C ALA A 1 134 ? 30.912  5.865   16.898 0.05  0.00 ? 134 ALA A C    2  
ATOM   4580   C C    O ALA A 1 134 ? 38.554  -4.521  35.075 0.95  0.00 ? 134 ALA A C    2  
ATOM   4581   O O    C ALA A 1 134 ? 30.917  5.271   15.781 0.05  0.00 ? 134 ALA A O    2  
ATOM   4582   O O    O ALA A 1 134 ? 39.060  -4.892  33.977 0.95  0.00 ? 134 ALA A O    2  
ATOM   4583   H H    C ALA A 1 134 ? 31.661  8.089   18.989 0.05  0.00 ? 134 ALA A H    2  
ATOM   4584   H H    O ALA A 1 134 ? 38.493  -3.203  37.927 0.95  0.00 ? 134 ALA A H    2  
ATOM   4585   N N    C LEU A 1 135 ? 29.949  5.620   17.754 0.05  0.00 ? 135 LEU A N    2  
ATOM   4586   N N    O LEU A 1 135 ? 37.251  -4.409  35.179 0.95  0.00 ? 135 LEU A N    2  
ATOM   4587   C CA   C LEU A 1 135 ? 28.816  4.741   17.529 0.05  0.00 ? 135 LEU A CA   2  
ATOM   4588   C CA   O LEU A 1 135 ? 36.292  -4.627  34.111 0.95  0.00 ? 135 LEU A CA   2  
ATOM   4589   C C    C LEU A 1 135 ? 27.918  5.332   16.442 0.05  0.00 ? 135 LEU A C    2  
ATOM   4590   C C    O LEU A 1 135 ? 36.462  -3.546  33.043 0.95  0.00 ? 135 LEU A C    2  
ATOM   4591   O O    C LEU A 1 135 ? 27.379  4.597   15.617 0.05  0.00 ? 135 LEU A O    2  
ATOM   4592   O O    O LEU A 1 135 ? 36.348  -3.829  31.852 0.95  0.00 ? 135 LEU A O    2  
ATOM   4593   H H    C LEU A 1 135 ? 29.984  6.094   18.612 0.05  0.00 ? 135 LEU A H    2  
ATOM   4594   H H    O LEU A 1 135 ? 36.896  -4.127  36.048 0.95  0.00 ? 135 LEU A H    2  
ATOM   4595   N N    C ASP A 1 136 ? 27.762  6.648   16.503 0.05  0.00 ? 136 ASP A N    2  
ATOM   4596   N N    O ASP A 1 136 ? 36.697  -2.329  33.515 0.95  0.00 ? 136 ASP A N    2  
ATOM   4597   C CA   C ASP A 1 136 ? 26.939  7.355   15.529 0.05  0.00 ? 136 ASP A CA   2  
ATOM   4598   C CA   O ASP A 1 136 ? 36.887  -1.196  32.617 0.95  0.00 ? 136 ASP A CA   2  
ATOM   4599   C C    C ASP A 1 136 ? 27.579  7.212   14.114 0.05  0.00 ? 136 ASP A C    2  
ATOM   4600   C C    O ASP A 1 136 ? 38.176  -1.423  31.769 0.95  0.00 ? 136 ASP A C    2  
ATOM   4601   O O    C ASP A 1 136 ? 26.789  7.069   13.188 0.05  0.00 ? 136 ASP A O    2  
ATOM   4602   O O    O ASP A 1 136 ? 38.112  -1.058  30.601 0.95  0.00 ? 136 ASP A O    2  
ATOM   4603   H H    C ASP A 1 136 ? 28.211  7.153   17.211 0.05  0.00 ? 136 ASP A H    2  
ATOM   4604   H H    O ASP A 1 136 ? 36.747  -2.190  34.483 0.95  0.00 ? 136 ASP A H    2  
ATOM   4605   N N    C LYS A 1 137 ? 28.876  7.298   14.041 0.05  0.00 ? 137 LYS A N    2  
ATOM   4606   N N    O LYS A 1 137 ? 39.204  -1.936  32.382 0.95  0.00 ? 137 LYS A N    2  
ATOM   4607   C CA   C LYS A 1 137 ? 29.582  7.165   12.733 0.05  0.00 ? 137 LYS A CA   2  
ATOM   4608   C CA   O LYS A 1 137 ? 40.479  -2.199  31.654 0.95  0.00 ? 137 LYS A CA   2  
ATOM   4609   C C    C LYS A 1 137 ? 29.412  5.735   12.207 0.05  0.00 ? 137 LYS A C    2  
ATOM   4610   C C    O LYS A 1 137 ? 40.253  -3.303  30.614 0.95  0.00 ? 137 LYS A C    2  
ATOM   4611   O O    C LYS A 1 137 ? 29.111  5.549   11.009 0.05  0.00 ? 137 LYS A O    2  
ATOM   4612   O O    O LYS A 1 137 ? 40.702  -3.164  29.457 0.95  0.00 ? 137 LYS A O    2  
ATOM   4613   H H    C LYS A 1 137 ? 29.397  7.446   14.858 0.05  0.00 ? 137 LYS A H    2  
ATOM   4614   H H    O LYS A 1 137 ? 39.137  -2.158  33.334 0.95  0.00 ? 137 LYS A H    2  
ATOM   4615   N N    C GLU A 1 138 ? 29.415  4.728   13.056 0.05  0.00 ? 138 GLU A N    2  
ATOM   4616   N N    O GLU A 1 138 ? 39.444  -4.303  30.897 0.95  0.00 ? 138 GLU A N    2  
ATOM   4617   C CA   C GLU A 1 138 ? 29.201  3.342   12.648 0.05  0.00 ? 138 GLU A CA   2  
ATOM   4618   C CA   O GLU A 1 138 ? 39.125  -5.364  29.945 0.95  0.00 ? 138 GLU A CA   2  
ATOM   4619   C C    C GLU A 1 138 ? 27.789  3.077   12.189 0.05  0.00 ? 138 GLU A C    2  
ATOM   4620   C C    O GLU A 1 138 ? 38.283  -4.882  28.790 0.95  0.00 ? 138 GLU A C    2  
ATOM   4621   O O    C GLU A 1 138 ? 27.574  2.317   11.217 0.05  0.00 ? 138 GLU A O    2  
ATOM   4622   O O    O GLU A 1 138 ? 38.490  -5.317  27.634 0.95  0.00 ? 138 GLU A O    2  
ATOM   4623   H H    C GLU A 1 138 ? 29.528  4.923   14.010 0.05  0.00 ? 138 GLU A H    2  
ATOM   4624   H H    O GLU A 1 138 ? 39.006  -4.315  31.774 0.95  0.00 ? 138 GLU A H    2  
ATOM   4625   N N    C LEU A 1 139 ? 26.817  3.696   12.855 0.05  0.00 ? 139 LEU A N    2  
ATOM   4626   N N    O LEU A 1 139 ? 37.343  -3.983  29.070 0.95  0.00 ? 139 LEU A N    2  
ATOM   4627   C CA   C LEU A 1 139 ? 25.413  3.551   12.511 0.05  0.00 ? 139 LEU A CA   2  
ATOM   4628   C CA   O LEU A 1 139 ? 36.472  -3.415  28.055 0.95  0.00 ? 139 LEU A CA   2  
ATOM   4629   C C    C LEU A 1 139 ? 25.021  4.309   11.261 0.05  0.00 ? 139 LEU A C    2  
ATOM   4630   C C    O LEU A 1 139 ? 37.163  -2.399  27.172 0.95  0.00 ? 139 LEU A C    2  
ATOM   4631   O O    C LEU A 1 139 ? 24.100  3.936   10.532 0.05  0.00 ? 139 LEU A O    2  
ATOM   4632   O O    O LEU A 1 139 ? 36.815  -2.202  26.006 0.95  0.00 ? 139 LEU A O    2  
ATOM   4633   H H    C LEU A 1 139 ? 27.060  4.284   13.601 0.05  0.00 ? 139 LEU A H    2  
ATOM   4634   H H    O LEU A 1 139 ? 37.243  -3.681  29.997 0.95  0.00 ? 139 LEU A H    2  
ATOM   4635   N N    C LYS A 1 140 ? 25.688  5.407   11.019 0.05  0.00 ? 140 LYS A N    2  
ATOM   4636   N N    O LYS A 1 140 ? 38.125  -1.711  27.728 0.95  0.00 ? 140 LYS A N    2  
ATOM   4637   C CA   C LYS A 1 140 ? 25.501  6.300   9.886  0.05  0.00 ? 140 LYS A CA   2  
ATOM   4638   C CA   O LYS A 1 140 ? 38.937  -0.687  27.089 0.95  0.00 ? 140 LYS A CA   2  
ATOM   4639   C C    C LYS A 1 140 ? 25.898  5.559   8.578  0.05  0.00 ? 140 LYS A C    2  
ATOM   4640   C C    O LYS A 1 140 ? 39.806  -1.341  25.977 0.95  0.00 ? 140 LYS A C    2  
ATOM   4641   O O    C LYS A 1 140 ? 25.334  5.823   7.526  0.05  0.00 ? 140 LYS A O    2  
ATOM   4642   O O    O LYS A 1 140 ? 40.105  -0.706  24.976 0.95  0.00 ? 140 LYS A O    2  
ATOM   4643   H H    C LYS A 1 140 ? 26.384  5.650   11.663 0.05  0.00 ? 140 LYS A H    2  
ATOM   4644   H H    O LYS A 1 140 ? 38.321  -1.907  28.667 0.95  0.00 ? 140 LYS A H    2  
ATOM   4645   N N    C ALA A 1 141 ? 26.843  4.684   8.718  0.05  0.00 ? 141 ALA A N    2  
ATOM   4646   N N    O ALA A 1 141 ? 40.162  -2.563  26.218 0.95  0.00 ? 141 ALA A N    2  
ATOM   4647   C CA   C ALA A 1 141 ? 27.331  3.796   7.644  0.05  0.00 ? 141 ALA A CA   2  
ATOM   4648   C CA   O ALA A 1 141 ? 40.912  -3.420  25.279 0.95  0.00 ? 141 ALA A CA   2  
ATOM   4649   C C    C ALA A 1 141 ? 26.180  2.959   7.087  0.05  0.00 ? 141 ALA A C    2  
ATOM   4650   C C    O ALA A 1 141 ? 40.154  -3.547  23.958 0.95  0.00 ? 141 ALA A C    2  
ATOM   4651   O O    C ALA A 1 141 ? 26.285  2.527   5.934  0.05  0.00 ? 141 ALA A O    2  
ATOM   4652   O O    O ALA A 1 141 ? 40.804  -3.817  22.942 0.95  0.00 ? 141 ALA A O    2  
ATOM   4653   H H    C ALA A 1 141 ? 27.224  4.564   9.613  0.05  0.00 ? 141 ALA A H    2  
ATOM   4654   H H    O ALA A 1 141 ? 39.865  -2.966  27.061 0.95  0.00 ? 141 ALA A H    2  
ATOM   4655   N N    C LYS A 1 142 ? 25.124  2.726   7.839  0.05  0.00 ? 142 LYS A N    2  
ATOM   4656   N N    O LYS A 1 142 ? 38.849  -3.367  23.940 0.95  0.00 ? 142 LYS A N    2  
ATOM   4657   C CA   C LYS A 1 142 ? 23.940  1.981   7.474  0.05  0.00 ? 142 LYS A CA   2  
ATOM   4658   C CA   O LYS A 1 142 ? 37.977  -3.424  22.788 0.95  0.00 ? 142 LYS A CA   2  
ATOM   4659   C C    C LYS A 1 142 ? 22.672  2.824   7.351  0.05  0.00 ? 142 LYS A C    2  
ATOM   4660   C C    O LYS A 1 142 ? 37.363  -2.084  22.389 0.95  0.00 ? 142 LYS A C    2  
ATOM   4661   O O    C LYS A 1 142 ? 21.540  2.265   7.213  0.05  0.00 ? 142 LYS A O    2  
ATOM   4662   O O    O LYS A 1 142 ? 36.446  -2.033  21.512 0.95  0.00 ? 142 LYS A O    2  
ATOM   4663   H H    C LYS A 1 142 ? 25.136  3.113   8.739  0.05  0.00 ? 142 LYS A H    2  
ATOM   4664   H H    O LYS A 1 142 ? 38.426  -3.156  24.798 0.95  0.00 ? 142 LYS A H    2  
ATOM   4665   N N    C GLY A 1 143 ? 22.832  4.127   7.420  0.05  0.00 ? 143 GLY A N    2  
ATOM   4666   N N    O GLY A 1 143 ? 37.822  -1.025  23.018 0.95  0.00 ? 143 GLY A N    2  
ATOM   4667   C CA   C GLY A 1 143 ? 21.721  5.057   7.286  0.05  0.00 ? 143 GLY A CA   2  
ATOM   4668   C CA   O GLY A 1 143 ? 37.356  0.321   22.721 0.95  0.00 ? 143 GLY A CA   2  
ATOM   4669   C C    C GLY A 1 143 ? 20.940  5.234   8.608  0.05  0.00 ? 143 GLY A C    2  
ATOM   4670   C C    O GLY A 1 143 ? 36.029  0.656   23.440 0.95  0.00 ? 143 GLY A C    2  
ATOM   4671   O O    C GLY A 1 143 ? 19.833  5.743   8.536  0.05  0.00 ? 143 GLY A O    2  
ATOM   4672   O O    O GLY A 1 143 ? 35.405  1.623   23.033 0.95  0.00 ? 143 GLY A O    2  
ATOM   4673   H H    C GLY A 1 143 ? 23.736  4.485   7.544  0.05  0.00 ? 143 GLY A H    2  
ATOM   4674   H H    O GLY A 1 143 ? 38.520  -1.145  23.696 0.95  0.00 ? 143 GLY A H    2  
ATOM   4675   N N    C LYS A 1 144 ? 21.516  4.865   9.717  0.05  0.00 ? 144 LYS A N    2  
ATOM   4676   N N    O LYS A 1 144 ? 35.674  -0.085  24.451 0.95  0.00 ? 144 LYS A N    2  
ATOM   4677   C CA   C LYS A 1 144 ? 20.862  5.006   11.037 0.05  0.00 ? 144 LYS A CA   2  
ATOM   4678   C CA   O LYS A 1 144 ? 34.432  0.160   25.217 0.95  0.00 ? 144 LYS A CA   2  
ATOM   4679   C C    C LYS A 1 144 ? 21.694  5.962   11.890 0.05  0.00 ? 144 LYS A C    2  
ATOM   4680   C C    O LYS A 1 144 ? 34.810  0.498   26.658 0.95  0.00 ? 144 LYS A C    2  
ATOM   4681   O O    C LYS A 1 144 ? 22.908  6.098   11.651 0.05  0.00 ? 144 LYS A O    2  
ATOM   4682   O O    O LYS A 1 144 ? 35.892  0.090   27.119 0.95  0.00 ? 144 LYS A O    2  
ATOM   4683   H H    C LYS A 1 144 ? 22.421  4.489   9.677  0.05  0.00 ? 144 LYS A H    2  
ATOM   4684   H H    O LYS A 1 144 ? 36.256  -0.826  24.721 0.95  0.00 ? 144 LYS A H    2  
ATOM   4685   N N    C SER A 1 145 ? 21.075  6.578   12.906 0.05  0.00 ? 145 SER A N    2  
ATOM   4686   N N    O SER A 1 145 ? 33.918  1.185   27.384 0.95  0.00 ? 145 SER A N    2  
ATOM   4687   C CA   C SER A 1 145 ? 21.807  7.453   13.842 0.05  0.00 ? 145 SER A CA   2  
ATOM   4688   C CA   O SER A 1 145 ? 34.148  1.487   28.810 0.95  0.00 ? 145 SER A CA   2  
ATOM   4689   C C    C SER A 1 145 ? 21.812  6.749   15.220 0.05  0.00 ? 145 SER A C    2  
ATOM   4690   C C    O SER A 1 145 ? 33.109  0.679   29.624 0.95  0.00 ? 145 SER A C    2  
ATOM   4691   O O    C SER A 1 145 ? 20.983  5.889   15.511 0.05  0.00 ? 145 SER A O    2  
ATOM   4692   O O    O SER A 1 145 ? 32.067  0.267   29.117 0.95  0.00 ? 145 SER A O    2  
ATOM   4693   H H    C SER A 1 145 ? 20.124  6.398   13.065 0.05  0.00 ? 145 SER A H    2  
ATOM   4694   H H    O SER A 1 145 ? 33.066  1.444   26.973 0.95  0.00 ? 145 SER A H    2  
ATOM   4695   N N    C ALA A 1 146 ? 22.745  7.130   16.067 0.05  0.00 ? 146 ALA A N    2  
ATOM   4696   N N    O ALA A 1 146 ? 33.397  0.467   30.891 0.95  0.00 ? 146 ALA A N    2  
ATOM   4697   C CA   C ALA A 1 146 ? 22.908  6.575   17.394 0.05  0.00 ? 146 ALA A CA   2  
ATOM   4698   C CA   O ALA A 1 146 ? 32.549  -0.276  31.799 0.95  0.00 ? 146 ALA A CA   2  
ATOM   4699   C C    C ALA A 1 146 ? 21.815  7.024   18.363 0.05  0.00 ? 146 ALA A C    2  
ATOM   4700   C C    O ALA A 1 146 ? 31.286  0.489   32.192 0.95  0.00 ? 146 ALA A C    2  
ATOM   4701   O O    C ALA A 1 146 ? 21.127  6.173   18.960 0.05  0.00 ? 146 ALA A O    2  
ATOM   4702   O O    O ALA A 1 146 ? 30.165  -0.021  31.997 0.95  0.00 ? 146 ALA A O    2  
ATOM   4703   H H    C ALA A 1 146 ? 23.372  7.826   15.779 0.05  0.00 ? 146 ALA A H    2  
ATOM   4704   H H    O ALA A 1 146 ? 34.239  0.827   31.239 0.95  0.00 ? 146 ALA A H    2  
ATOM   4705   N N    C LEU A 1 147 ? 21.622  8.327   18.516 0.05  0.00 ? 147 LEU A N    2  
ATOM   4706   N N    O LEU A 1 147 ? 31.434  1.700   32.713 0.95  0.00 ? 147 LEU A N    2  
ATOM   4707   C CA   C LEU A 1 147 ? 20.668  8.873   19.489 0.05  0.00 ? 147 LEU A CA   2  
ATOM   4708   C CA   O LEU A 1 147 ? 30.299  2.485   33.214 0.95  0.00 ? 147 LEU A CA   2  
ATOM   4709   C C    C LEU A 1 147 ? 19.949  10.109  19.046 0.05  0.00 ? 147 LEU A C    2  
ATOM   4710   C C    O LEU A 1 147 ? 30.400  3.961   32.983 0.95  0.00 ? 147 LEU A C    2  
ATOM   4711   O O    C LEU A 1 147 ? 20.569  10.948  18.345 0.05  0.00 ? 147 LEU A O    2  
ATOM   4712   O O    O LEU A 1 147 ? 31.530  4.506   33.059 0.95  0.00 ? 147 LEU A O    2  
ATOM   4713   H H    C LEU A 1 147 ? 22.182  8.949   18.005 0.05  0.00 ? 147 LEU A H    2  
ATOM   4714   H H    O LEU A 1 147 ? 32.340  2.057   32.825 0.95  0.00 ? 147 LEU A H    2  
ATOM   4715   N N    C MET A 1 148 ? 18.699  10.249  19.415 0.05  0.00 ? 148 MET A N    2  
ATOM   4716   N N    O MET A 1 148 ? 29.294  4.610   32.712 0.95  0.00 ? 148 MET A N    2  
ATOM   4717   C CA   C MET A 1 148 ? 17.888  11.415  19.166 0.05  0.00 ? 148 MET A CA   2  
ATOM   4718   C CA   O MET A 1 148 ? 29.189  6.040   32.562 0.95  0.00 ? 148 MET A CA   2  
ATOM   4719   C C    C MET A 1 148 ? 16.991  11.651  20.405 0.05  0.00 ? 148 MET A C    2  
ATOM   4720   C C    O MET A 1 148 ? 27.844  6.491   33.181 0.95  0.00 ? 148 MET A C    2  
ATOM   4721   O O    C MET A 1 148 ? 16.254  10.719  20.770 0.05  0.00 ? 148 MET A O    2  
ATOM   4722   O O    O MET A 1 148 ? 26.804  5.964   32.750 0.95  0.00 ? 148 MET A O    2  
ATOM   4723   H H    C MET A 1 148 ? 18.307  9.535   19.960 0.05  0.00 ? 148 MET A H    2  
ATOM   4724   H H    O MET A 1 148 ? 28.464  4.090   32.674 0.95  0.00 ? 148 MET A H    2  
ATOM   4725   N N    C PHE A 1 149 ? 17.026  12.838  20.971 0.05  0.00 ? 149 PHE A N    2  
ATOM   4726   N N    O PHE A 1 149 ? 27.876  7.439   34.093 0.95  0.00 ? 149 PHE A N    2  
ATOM   4727   C CA   C PHE A 1 149 ? 16.170  13.188  22.117 0.05  0.00 ? 149 PHE A CA   2  
ATOM   4728   C CA   O PHE A 1 149 ? 26.651  7.984   34.703 0.95  0.00 ? 149 PHE A CA   2  
ATOM   4729   C C    C PHE A 1 149 ? 15.830  14.693  22.015 0.05  0.00 ? 149 PHE A C    2  
ATOM   4730   C C    O PHE A 1 149 ? 26.904  9.474   35.029 0.95  0.00 ? 149 PHE A C    2  
ATOM   4731   O O    C PHE A 1 149 ? 16.407  15.428  21.217 0.05  0.00 ? 149 PHE A O    2  
ATOM   4732   O O    O PHE A 1 149 ? 28.031  9.961   34.967 0.95  0.00 ? 149 PHE A O    2  
ATOM   4733   H H    C PHE A 1 149 ? 17.614  13.524  20.592 0.05  0.00 ? 149 PHE A H    2  
ATOM   4734   H H    O PHE A 1 149 ? 28.742  7.821   34.347 0.95  0.00 ? 149 PHE A H    2  
ATOM   4735   N N    C ASN A 1 150 ? 14.870  15.092  22.837 0.05  0.00 ? 150 ASN A N    2  
ATOM   4736   N N    O ASN A 1 150 ? 25.814  10.154  35.353 0.95  0.00 ? 150 ASN A N    2  
ATOM   4737   C CA   C ASN A 1 150 ? 14.398  16.475  22.897 0.05  0.00 ? 150 ASN A CA   2  
ATOM   4738   C CA   O ASN A 1 150 ? 25.835  11.576  35.694 0.95  0.00 ? 150 ASN A CA   2  
ATOM   4739   C C    C ASN A 1 150 ? 15.513  17.390  23.410 0.05  0.00 ? 150 ASN A C    2  
ATOM   4740   C C    O ASN A 1 150 ? 26.617  11.794  36.992 0.95  0.00 ? 150 ASN A C    2  
ATOM   4741   O O    C ASN A 1 150 ? 15.876  17.317  24.563 0.05  0.00 ? 150 ASN A O    2  
ATOM   4742   O O    O ASN A 1 150 ? 26.165  11.405  38.046 0.95  0.00 ? 150 ASN A O    2  
ATOM   4743   H H    C ASN A 1 150 ? 14.457  14.431  23.430 0.05  0.00 ? 150 ASN A H    2  
ATOM   4744   H H    O ASN A 1 150 ? 24.955  9.684   35.363 0.95  0.00 ? 150 ASN A H    2  
ATOM   4745   N N    C LEU A 1 151 ? 16.030  18.239  22.554 0.05  0.00 ? 151 LEU A N    2  
ATOM   4746   N N    O LEU A 1 151 ? 27.768  12.417  36.899 0.95  0.00 ? 151 LEU A N    2  
ATOM   4747   C CA   C LEU A 1 151 ? 17.070  19.182  22.894 0.05  0.00 ? 151 LEU A CA   2  
ATOM   4748   C CA   O LEU A 1 151 ? 28.607  12.718  38.036 0.95  0.00 ? 151 LEU A CA   2  
ATOM   4749   C C    C LEU A 1 151 ? 16.503  20.546  23.327 0.05  0.00 ? 151 LEU A C    2  
ATOM   4750   C C    O LEU A 1 151 ? 28.327  14.116  38.615 0.95  0.00 ? 151 LEU A C    2  
ATOM   4751   O O    C LEU A 1 151 ? 17.299  21.316  23.859 0.05  0.00 ? 151 LEU A O    2  
ATOM   4752   O O    O LEU A 1 151 ? 28.819  14.351  39.716 0.95  0.00 ? 151 LEU A O    2  
ATOM   4753   H H    C LEU A 1 151 ? 15.681  18.246  21.637 0.05  0.00 ? 151 LEU A H    2  
ATOM   4754   H H    O LEU A 1 151 ? 28.068  12.709  36.012 0.95  0.00 ? 151 LEU A H    2  
ATOM   4755   N N    C GLN A 1 152 ? 15.264  20.794  23.141 0.05  0.00 ? 152 GLN A N    2  
ATOM   4756   N N    O GLN A 1 152 ? 27.597  14.930  37.955 0.95  0.00 ? 152 GLN A N    2  
ATOM   4757   C CA   C GLN A 1 152 ? 14.580  22.054  23.389 0.05  0.00 ? 152 GLN A CA   2  
ATOM   4758   C CA   O GLN A 1 152 ? 27.312  16.317  38.292 0.95  0.00 ? 152 GLN A CA   2  
ATOM   4759   C C    C GLN A 1 152 ? 14.299  22.401  24.838 0.05  0.00 ? 152 GLN A C    2  
ATOM   4760   C C    O GLN A 1 152 ? 26.327  16.552  39.421 0.95  0.00 ? 152 GLN A C    2  
ATOM   4761   O O    C GLN A 1 152 ? 14.345  23.587  25.222 0.05  0.00 ? 152 GLN A O    2  
ATOM   4762   O O    O GLN A 1 152 ? 26.477  17.518  40.196 0.95  0.00 ? 152 GLN A O    2  
ATOM   4763   H H    C GLN A 1 152 ? 14.733  20.082  22.728 0.05  0.00 ? 152 GLN A H    2  
ATOM   4764   H H    O GLN A 1 152 ? 27.246  14.607  37.099 0.95  0.00 ? 152 GLN A H    2  
ATOM   4765   N N    C GLU A 1 153 ? 13.966  21.388  25.618 0.05  0.00 ? 153 GLU A N    2  
ATOM   4766   N N    O GLU A 1 153 ? 25.310  15.711  39.483 0.95  0.00 ? 153 GLU A N    2  
ATOM   4767   C CA   C GLU A 1 153 ? 13.645  21.574  27.030 0.05  0.00 ? 153 GLU A CA   2  
ATOM   4768   C CA   O GLU A 1 153 ? 24.272  15.829  40.502 0.95  0.00 ? 153 GLU A CA   2  
ATOM   4769   C C    C GLU A 1 153 ? 14.716  21.065  27.922 0.05  0.00 ? 153 GLU A C    2  
ATOM   4770   C C    O GLU A 1 153 ? 24.372  14.767  41.533 0.95  0.00 ? 153 GLU A C    2  
ATOM   4771   O O    C GLU A 1 153 ? 15.243  19.939  27.773 0.05  0.00 ? 153 GLU A O    2  
ATOM   4772   O O    O GLU A 1 153 ? 24.521  13.558  41.247 0.95  0.00 ? 153 GLU A O    2  
ATOM   4773   H H    C GLU A 1 153 ? 13.918  20.487  25.233 0.05  0.00 ? 153 GLU A H    2  
ATOM   4774   H H    O GLU A 1 153 ? 25.244  14.996  38.815 0.95  0.00 ? 153 GLU A H    2  
ATOM   4775   N N    C PRO A 1 154 ? 15.108  21.899  28.918 0.05  0.00 ? 154 PRO A N    2  
ATOM   4776   N N    O PRO A 1 154 ? 24.303  15.182  42.824 0.95  0.00 ? 154 PRO A N    2  
ATOM   4777   C CA   C PRO A 1 154 ? 16.147  21.546  29.861 0.05  0.00 ? 154 PRO A CA   2  
ATOM   4778   C CA   O PRO A 1 154 ? 24.395  14.264  43.939 0.95  0.00 ? 154 PRO A CA   2  
ATOM   4779   C C    C PRO A 1 154 ? 15.874  20.279  30.691 0.05  0.00 ? 154 PRO A C    2  
ATOM   4780   C C    O PRO A 1 154 ? 23.317  13.166  43.972 0.95  0.00 ? 154 PRO A C    2  
ATOM   4781   O O    C PRO A 1 154 ? 16.828  19.724  31.193 0.05  0.00 ? 154 PRO A O    2  
ATOM   4782   O O    O PRO A 1 154 ? 23.555  12.171  44.623 0.95  0.00 ? 154 PRO A O    2  
ATOM   4783   N N    C TYR A 1 155 ? 14.638  19.928  30.872 0.05  0.00 ? 155 TYR A N    2  
ATOM   4784   N N    O TYR A 1 155 ? 22.191  13.403  43.373 0.95  0.00 ? 155 TYR A N    2  
ATOM   4785   C CA   C TYR A 1 155 ? 14.265  18.701  31.609 0.05  0.00 ? 155 TYR A CA   2  
ATOM   4786   C CA   O TYR A 1 155 ? 21.108  12.399  43.300 0.95  0.00 ? 155 TYR A CA   2  
ATOM   4787   C C    C TYR A 1 155 ? 15.013  17.512  30.944 0.05  0.00 ? 155 TYR A C    2  
ATOM   4788   C C    O TYR A 1 155 ? 21.714  11.102  42.694 0.95  0.00 ? 155 TYR A C    2  
ATOM   4789   O O    C TYR A 1 155 ? 15.589  16.647  31.604 0.05  0.00 ? 155 TYR A O    2  
ATOM   4790   O O    O TYR A 1 155 ? 21.485  9.988   43.165 0.95  0.00 ? 155 TYR A O    2  
ATOM   4791   H H    C TYR A 1 155 ? 13.928  20.477  30.479 0.05  0.00 ? 155 TYR A H    2  
ATOM   4792   H H    O TYR A 1 155 ? 22.067  14.266  42.925 0.95  0.00 ? 155 TYR A H    2  
ATOM   4793   N N    C PHE A 1 156 ? 15.035  17.507  29.618 0.05  0.00 ? 156 PHE A N    2  
ATOM   4794   N N    O PHE A 1 156 ? 22.533  11.269  41.664 0.95  0.00 ? 156 PHE A N    2  
ATOM   4795   C CA   C PHE A 1 156 ? 15.725  16.480  28.832 0.05  0.00 ? 156 PHE A CA   2  
ATOM   4796   C CA   O PHE A 1 156 ? 23.218  10.158  40.997 0.95  0.00 ? 156 PHE A CA   2  
ATOM   4797   C C    C PHE A 1 156 ? 17.221  16.630  28.756 0.05  0.00 ? 156 PHE A C    2  
ATOM   4798   C C    O PHE A 1 156 ? 24.413  9.610   41.730 0.95  0.00 ? 156 PHE A C    2  
ATOM   4799   O O    C PHE A 1 156 ? 17.949  15.607  28.796 0.05  0.00 ? 156 PHE A O    2  
ATOM   4800   O O    O PHE A 1 156 ? 24.626  8.372   41.730 0.95  0.00 ? 156 PHE A O    2  
ATOM   4801   H H    C PHE A 1 156 ? 14.586  18.237  29.141 0.05  0.00 ? 156 PHE A H    2  
ATOM   4802   H H    O PHE A 1 156 ? 22.706  12.181  41.348 0.95  0.00 ? 156 PHE A H    2  
ATOM   4803   N N    C THR A 1 157 ? 17.809  17.823  28.732 0.05  0.00 ? 157 THR A N    2  
ATOM   4804   N N    O THR A 1 157 ? 25.213  10.388  42.454 0.95  0.00 ? 157 THR A N    2  
ATOM   4805   C CA   C THR A 1 157 ? 19.255  17.945  28.638 0.05  0.00 ? 157 THR A CA   2  
ATOM   4806   C CA   O THR A 1 157 ? 26.374  9.841   43.138 0.95  0.00 ? 157 THR A CA   2  
ATOM   4807   C C    C THR A 1 157 ? 19.966  17.964  29.955 0.05  0.00 ? 157 THR A C    2  
ATOM   4808   C C    O THR A 1 157 ? 26.106  9.350   44.526 0.95  0.00 ? 157 THR A C    2  
ATOM   4809   O O    C THR A 1 157 ? 21.156  17.674  30.028 0.05  0.00 ? 157 THR A O    2  
ATOM   4810   O O    O THR A 1 157 ? 26.856  8.537   45.058 0.95  0.00 ? 157 THR A O    2  
ATOM   4811   H H    C THR A 1 157 ? 17.258  18.633  28.764 0.05  0.00 ? 157 THR A H    2  
ATOM   4812   H H    O THR A 1 157 ? 25.025  11.348  42.517 0.95  0.00 ? 157 THR A H    2  
ATOM   4813   N N    C TRP A 1 158 ? 19.258  18.256  31.035 0.05  0.00 ? 158 TRP A N    2  
ATOM   4814   N N    O TRP A 1 158 ? 25.014  9.785   45.135 0.95  0.00 ? 158 TRP A N    2  
ATOM   4815   C CA   C TRP A 1 158 ? 19.860  18.294  32.373 0.05  0.00 ? 158 TRP A CA   2  
ATOM   4816   C CA   O TRP A 1 158 ? 24.658  9.358   46.494 0.95  0.00 ? 158 TRP A CA   2  
ATOM   4817   C C    C TRP A 1 158 ? 20.664  17.089  32.767 0.05  0.00 ? 158 TRP A C    2  
ATOM   4818   C C    O TRP A 1 158 ? 24.659  7.877   46.739 0.95  0.00 ? 158 TRP A C    2  
ATOM   4819   O O    C TRP A 1 158 ? 21.741  17.285  33.379 0.05  0.00 ? 158 TRP A O    2  
ATOM   4820   O O    O TRP A 1 158 ? 25.141  7.468   47.822 0.95  0.00 ? 158 TRP A O    2  
ATOM   4821   H H    C TRP A 1 158 ? 18.302  18.449  30.938 0.05  0.00 ? 158 TRP A H    2  
ATOM   4822   H H    O TRP A 1 158 ? 24.423  10.408  44.663 0.95  0.00 ? 158 TRP A H    2  
ATOM   4823   N N    C PRO A 1 159 ? 20.206  15.843  32.494 0.05  0.00 ? 159 PRO A N    2  
ATOM   4824   N N    O PRO A 1 159 ? 24.120  7.033   45.826 0.95  0.00 ? 159 PRO A N    2  
ATOM   4825   C CA   C PRO A 1 159 ? 20.998  14.667  32.892 0.05  0.00 ? 159 PRO A CA   2  
ATOM   4826   C CA   O PRO A 1 159 ? 24.118  5.582   46.079 0.95  0.00 ? 159 PRO A CA   2  
ATOM   4827   C C    C PRO A 1 159 ? 22.456  14.735  32.532 0.05  0.00 ? 159 PRO A C    2  
ATOM   4828   C C    O PRO A 1 159 ? 25.433  5.019   46.540 0.95  0.00 ? 159 PRO A C    2  
ATOM   4829   O O    C PRO A 1 159 ? 23.318  14.351  33.343 0.05  0.00 ? 159 PRO A O    2  
ATOM   4830   O O    O PRO A 1 159 ? 25.465  4.173   47.453 0.95  0.00 ? 159 PRO A O    2  
ATOM   4831   N N    C LEU A 1 160 ? 22.760  15.198  31.318 0.05  0.00 ? 160 LEU A N    2  
ATOM   4832   N N    O LEU A 1 160 ? 26.530  5.450   45.915 0.95  0.00 ? 160 LEU A N    2  
ATOM   4833   C CA   C LEU A 1 160 ? 24.126  15.335  30.806 0.05  0.00 ? 160 LEU A CA   2  
ATOM   4834   C CA   O LEU A 1 160 ? 27.890  5.010   46.237 0.95  0.00 ? 160 LEU A CA   2  
ATOM   4835   C C    C LEU A 1 160 ? 24.854  16.553  31.414 0.05  0.00 ? 160 LEU A C    2  
ATOM   4836   C C    O LEU A 1 160 ? 28.417  5.660   47.535 0.95  0.00 ? 160 LEU A C    2  
ATOM   4837   O O    C LEU A 1 160 ? 25.992  16.425  31.825 0.05  0.00 ? 160 LEU A O    2  
ATOM   4838   O O    O LEU A 1 160 ? 28.971  4.966   48.367 0.95  0.00 ? 160 LEU A O    2  
ATOM   4839   H H    C LEU A 1 160 ? 22.022  15.467  30.734 0.05  0.00 ? 160 LEU A H    2  
ATOM   4840   H H    O LEU A 1 160 ? 26.418  6.106   45.196 0.95  0.00 ? 160 LEU A H    2  
ATOM   4841   N N    C ILE A 1 161 ? 24.161  17.684  31.431 0.05  0.00 ? 161 ILE A N    2  
ATOM   4842   N N    O ILE A 1 161 ? 28.227  6.968   47.638 0.95  0.00 ? 161 ILE A N    2  
ATOM   4843   C CA   C ILE A 1 161 ? 24.710  18.944  31.973 0.05  0.00 ? 161 ILE A CA   2  
ATOM   4844   C CA   O ILE A 1 161 ? 28.675  7.746   48.812 0.95  0.00 ? 161 ILE A CA   2  
ATOM   4845   C C    C ILE A 1 161 ? 25.108  18.796  33.427 0.05  0.00 ? 161 ILE A C    2  
ATOM   4846   C C    O ILE A 1 161 ? 28.044  7.234   50.090 0.95  0.00 ? 161 ILE A C    2  
ATOM   4847   O O    C ILE A 1 161 ? 26.195  19.199  33.831 0.05  0.00 ? 161 ILE A O    2  
ATOM   4848   O O    O ILE A 1 161 ? 28.720  7.031   51.094 0.95  0.00 ? 161 ILE A O    2  
ATOM   4849   H H    C ILE A 1 161 ? 23.251  17.683  31.068 0.05  0.00 ? 161 ILE A H    2  
ATOM   4850   H H    O ILE A 1 161 ? 27.775  7.437   46.906 0.95  0.00 ? 161 ILE A H    2  
ATOM   4851   N N    C ALA A 1 162 ? 24.284  18.167  34.234 0.05  0.00 ? 162 ALA A N    2  
ATOM   4852   N N    O ALA A 1 162 ? 26.760  6.952   50.078 0.95  0.00 ? 162 ALA A N    2  
ATOM   4853   C CA   C ALA A 1 162 ? 24.504  17.915  35.646 0.05  0.00 ? 162 ALA A CA   2  
ATOM   4854   C CA   O ALA A 1 162 ? 25.993  6.437   51.196 0.95  0.00 ? 162 ALA A CA   2  
ATOM   4855   C C    C ALA A 1 162 ? 25.471  16.825  35.998 0.05  0.00 ? 162 ALA A C    2  
ATOM   4856   C C    O ALA A 1 162 ? 26.173  4.987   51.532 0.95  0.00 ? 162 ALA A C    2  
ATOM   4857   O O    C ALA A 1 162 ? 26.090  16.844  37.089 0.05  0.00 ? 162 ALA A O    2  
ATOM   4858   O O    O ALA A 1 162 ? 25.974  4.570   52.698 0.95  0.00 ? 162 ALA A O    2  
ATOM   4859   H H    C ALA A 1 162 ? 23.451  17.827  33.845 0.05  0.00 ? 162 ALA A H    2  
ATOM   4860   H H    O ALA A 1 162 ? 26.281  7.091   49.234 0.95  0.00 ? 162 ALA A H    2  
ATOM   4861   N N    C ALA A 1 163 ? 25.630  15.792  35.191 0.05  0.00 ? 163 ALA A N    2  
ATOM   4862   N N    O ALA A 1 163 ? 26.476  4.118   50.585 0.95  0.00 ? 163 ALA A N    2  
ATOM   4863   C CA   C ALA A 1 163 ? 26.486  14.635  35.389 0.05  0.00 ? 163 ALA A CA   2  
ATOM   4864   C CA   O ALA A 1 163 ? 26.648  2.682   50.721 0.95  0.00 ? 163 ALA A CA   2  
ATOM   4865   C C    C ALA A 1 163 ? 27.781  14.899  36.136 0.05  0.00 ? 163 ALA A C    2  
ATOM   4866   C C    O ALA A 1 163 ? 27.229  2.214   52.043 0.95  0.00 ? 163 ALA A C    2  
ATOM   4867   O O    C ALA A 1 163 ? 28.029  14.267  37.175 0.05  0.00 ? 163 ALA A O    2  
ATOM   4868   O O    O ALA A 1 163 ? 26.597  1.404   52.738 0.95  0.00 ? 163 ALA A O    2  
ATOM   4869   H H    C ALA A 1 163 ? 25.088  15.793  34.374 0.05  0.00 ? 163 ALA A H    2  
ATOM   4870   H H    O ALA A 1 163 ? 26.572  4.481   49.679 0.95  0.00 ? 163 ALA A H    2  
ATOM   4871   N N    C ASP A 1 164 ? 28.620  15.776  35.596 0.05  0.00 ? 164 ASP A N    2  
ATOM   4872   N N    O ASP A 1 164 ? 28.434  2.670   52.366 0.95  0.00 ? 164 ASP A N    2  
ATOM   4873   C CA   C ASP A 1 164 ? 29.905  16.109  36.173 0.05  0.00 ? 164 ASP A CA   2  
ATOM   4874   C CA   O ASP A 1 164 ? 29.132  2.291   53.577 0.95  0.00 ? 164 ASP A CA   2  
ATOM   4875   C C    C ASP A 1 164 ? 29.936  17.235  37.192 0.05  0.00 ? 164 ASP A C    2  
ATOM   4876   C C    O ASP A 1 164 ? 28.868  3.125   54.818 0.95  0.00 ? 164 ASP A C    2  
ATOM   4877   O O    C ASP A 1 164 ? 30.996  17.845  37.429 0.05  0.00 ? 164 ASP A O    2  
ATOM   4878   O O    O ASP A 1 164 ? 29.686  3.138   55.757 0.95  0.00 ? 164 ASP A O    2  
ATOM   4879   H H    C ASP A 1 164 ? 28.364  16.203  34.752 0.05  0.00 ? 164 ASP A H    2  
ATOM   4880   H H    O ASP A 1 164 ? 28.883  3.278   51.742 0.95  0.00 ? 164 ASP A H    2  
ATOM   4881   N N    C GLY A 1 165 ? 28.862  17.518  37.881 0.05  0.00 ? 165 GLY A N    2  
ATOM   4882   N N    O GLY A 1 165 ? 27.740  3.774   54.938 0.95  0.00 ? 165 GLY A N    2  
ATOM   4883   C CA   C GLY A 1 165 ? 28.875  18.573  38.914 0.05  0.00 ? 165 GLY A CA   2  
ATOM   4884   C CA   O GLY A 1 165 ? 27.433  4.552   56.155 0.95  0.00 ? 165 GLY A CA   2  
ATOM   4885   C C    C GLY A 1 165 ? 27.794  19.586  38.916 0.05  0.00 ? 165 GLY A C    2  
ATOM   4886   C C    O GLY A 1 165 ? 26.931  5.938   56.010 0.95  0.00 ? 165 GLY A C    2  
ATOM   4887   O O    C GLY A 1 165 ? 27.745  20.319  39.915 0.05  0.00 ? 165 GLY A O    2  
ATOM   4888   O O    O GLY A 1 165 ? 26.505  6.467   57.048 0.95  0.00 ? 165 GLY A O    2  
ATOM   4889   H H    C GLY A 1 165 ? 28.043  16.999  37.733 0.05  0.00 ? 165 GLY A H    2  
ATOM   4890   H H    O GLY A 1 165 ? 27.072  3.717   54.222 0.95  0.00 ? 165 GLY A H    2  
ATOM   4891   N N    C GLY A 1 166 ? 26.919  19.714  37.975 0.05  0.00 ? 166 GLY A N    2  
ATOM   4892   N N    O GLY A 1 166 ? 26.893  6.582   54.892 0.95  0.00 ? 166 GLY A N    2  
ATOM   4893   C CA   C GLY A 1 166 ? 25.843  20.717  37.983 0.05  0.00 ? 166 GLY A CA   2  
ATOM   4894   C CA   O GLY A 1 166 ? 26.388  7.957   54.751 0.95  0.00 ? 166 GLY A CA   2  
ATOM   4895   C C    C GLY A 1 166 ? 24.734  20.325  38.924 0.05  0.00 ? 166 GLY A C    2  
ATOM   4896   C C    O GLY A 1 166 ? 24.883  7.996   54.794 0.95  0.00 ? 166 GLY A C    2  
ATOM   4897   O O    C GLY A 1 166 ? 24.519  19.146  39.195 0.05  0.00 ? 166 GLY A O    2  
ATOM   4898   O O    O GLY A 1 166 ? 24.213  7.024   54.452 0.95  0.00 ? 166 GLY A O    2  
ATOM   4899   H H    C GLY A 1 166 ? 26.973  19.103  37.210 0.05  0.00 ? 166 GLY A H    2  
ATOM   4900   H H    O GLY A 1 166 ? 27.217  6.126   54.087 0.95  0.00 ? 166 GLY A H    2  
ATOM   4901   N N    C TYR A 1 167 ? 24.002  21.314  39.403 0.05  0.00 ? 167 TYR A N    2  
ATOM   4902   N N    O TYR A 1 167 ? 24.342  9.135   55.185 0.95  0.00 ? 167 TYR A N    2  
ATOM   4903   C CA   C TYR A 1 167 ? 22.833  21.142  40.299 0.05  0.00 ? 167 TYR A CA   2  
ATOM   4904   C CA   O TYR A 1 167 ? 22.885  9.401   55.247 0.95  0.00 ? 167 TYR A CA   2  
ATOM   4905   C C    C TYR A 1 167 ? 22.025  22.447  40.208 0.05  0.00 ? 167 TYR A C    2  
ATOM   4906   C C    O TYR A 1 167 ? 22.727  10.930  55.275 0.95  0.00 ? 167 TYR A C    2  
ATOM   4907   O O    C TYR A 1 167 ? 22.654  23.439  39.827 0.05  0.00 ? 167 TYR A O    2  
ATOM   4908   O O    O TYR A 1 167 ? 23.714  11.562  55.664 0.95  0.00 ? 167 TYR A O    2  
ATOM   4909   H H    C TYR A 1 167 ? 24.227  22.224  39.119 0.05  0.00 ? 167 TYR A H    2  
ATOM   4910   H H    O TYR A 1 167 ? 24.948  9.868   55.420 0.95  0.00 ? 167 TYR A H    2  
ATOM   4911   N N    C ALA A 1 168 ? 20.756  22.421  40.497 0.05  0.00 ? 168 ALA A N    2  
ATOM   4912   N N    O ALA A 1 168 ? 21.607  11.453  54.868 0.95  0.00 ? 168 ALA A N    2  
ATOM   4913   C CA   C ALA A 1 168 ? 19.892  23.596  40.422 0.05  0.00 ? 168 ALA A CA   2  
ATOM   4914   C CA   O ALA A 1 168 ? 21.359  12.892  54.832 0.95  0.00 ? 168 ALA A CA   2  
ATOM   4915   C C    C ALA A 1 168 ? 20.199  24.482  41.651 0.05  0.00 ? 168 ALA A C    2  
ATOM   4916   C C    O ALA A 1 168 ? 21.101  13.359  56.282 0.95  0.00 ? 168 ALA A C    2  
ATOM   4917   O O    C ALA A 1 168 ? 20.774  25.556  41.474 0.05  0.00 ? 168 ALA A O    2  
ATOM   4918   O O    O ALA A 1 168 ? 21.949  14.060  56.836 0.95  0.00 ? 168 ALA A O    2  
ATOM   4919   H H    C ALA A 1 168 ? 20.358  21.567  40.763 0.05  0.00 ? 168 ALA A H    2  
ATOM   4920   H H    O ALA A 1 168 ? 20.900  10.851  54.556 0.95  0.00 ? 168 ALA A H    2  
ATOM   4921   N N    C PHE A 1 169 ? 19.908  23.946  42.819 0.05  0.00 ? 169 PHE A N    2  
ATOM   4922   N N    O PHE A 1 169 ? 20.020  12.864  56.850 0.95  0.00 ? 169 PHE A N    2  
ATOM   4923   C CA   C PHE A 1 169 ? 20.102  24.594  44.125 0.05  0.00 ? 169 PHE A CA   2  
ATOM   4924   C CA   O PHE A 1 169 ? 19.562  13.164  58.215 0.95  0.00 ? 169 PHE A CA   2  
ATOM   4925   C C    C PHE A 1 169 ? 20.691  23.635  45.138 0.05  0.00 ? 169 PHE A C    2  
ATOM   4926   C C    O PHE A 1 169 ? 19.101  11.913  58.933 0.95  0.00 ? 169 PHE A C    2  
ATOM   4927   O O    C PHE A 1 169 ? 20.200  22.489  45.301 0.05  0.00 ? 169 PHE A O    2  
ATOM   4928   O O    O PHE A 1 169 ? 18.302  11.113  58.384 0.95  0.00 ? 169 PHE A O    2  
ATOM   4929   H H    C PHE A 1 169 ? 19.525  23.043  42.816 0.05  0.00 ? 169 PHE A H    2  
ATOM   4930   H H    O PHE A 1 169 ? 19.474  12.249  56.316 0.95  0.00 ? 169 PHE A H    2  
ATOM   4931   N N    C LYS A 1 170 ? 21.717  24.045  45.831 0.05  0.00 ? 170 LYS A N    2  
ATOM   4932   N N    O LYS A 1 170 ? 19.559  11.705  60.137 0.95  0.00 ? 170 LYS A N    2  
ATOM   4933   C CA   C LYS A 1 170 ? 22.350  23.198  46.842 0.05  0.00 ? 170 LYS A CA   2  
ATOM   4934   C CA   O LYS A 1 170 ? 19.164  10.532  60.917 0.95  0.00 ? 170 LYS A CA   2  
ATOM   4935   C C    C LYS A 1 170 ? 21.354  22.828  47.936 0.05  0.00 ? 170 LYS A C    2  
ATOM   4936   C C    O LYS A 1 170 ? 17.656  10.518  61.144 0.95  0.00 ? 170 LYS A C    2  
ATOM   4937   O O    C LYS A 1 170 ? 20.691  23.674  48.526 0.05  0.00 ? 170 LYS A O    2  
ATOM   4938   O O    O LYS A 1 170 ? 17.057  11.485  61.602 0.95  0.00 ? 170 LYS A O    2  
ATOM   4939   H H    C LYS A 1 170 ? 22.068  24.946  45.676 0.05  0.00 ? 170 LYS A H    2  
ATOM   4940   H H    O LYS A 1 170 ? 20.177  12.354  60.531 0.95  0.00 ? 170 LYS A H    2  
ATOM   4941   N N    C TYR A 1 171 ? 21.232  21.528  48.185 0.05  0.00 ? 171 TYR A N    2  
ATOM   4942   N N    O TYR A 1 171 ? 17.033  9.400   60.784 0.95  0.00 ? 171 TYR A N    2  
ATOM   4943   C CA   C TYR A 1 171 ? 20.301  21.028  49.219 0.05  0.00 ? 171 TYR A CA   2  
ATOM   4944   C CA   O TYR A 1 171 ? 15.571  9.250   60.946 0.95  0.00 ? 171 TYR A CA   2  
ATOM   4945   C C    C TYR A 1 171 ? 21.152  20.333  50.278 0.05  0.00 ? 171 TYR A C    2  
ATOM   4946   C C    O TYR A 1 171 ? 15.353  8.104   61.929 0.95  0.00 ? 171 TYR A C    2  
ATOM   4947   O O    C TYR A 1 171 ? 22.066  19.567  49.908 0.05  0.00 ? 171 TYR A O    2  
ATOM   4948   O O    O TYR A 1 171 ? 16.027  7.061   61.797 0.95  0.00 ? 171 TYR A O    2  
ATOM   4949   H H    C TYR A 1 171 ? 21.769  20.889  47.672 0.05  0.00 ? 171 TYR A H    2  
ATOM   4950   H H    O TYR A 1 171 ? 17.553  8.662   60.403 0.95  0.00 ? 171 TYR A H    2  
ATOM   4951   N N    C GLU A 1 172 ? 20.841  20.633  51.539 0.05  0.00 ? 172 GLU A N    2  
ATOM   4952   N N    O GLU A 1 172 ? 14.447  8.337   62.878 0.95  0.00 ? 172 GLU A N    2  
ATOM   4953   C CA   C GLU A 1 172 ? 21.649  19.980  52.595 0.05  0.00 ? 172 GLU A CA   2  
ATOM   4954   C CA   O GLU A 1 172 ? 14.211  7.248   63.854 0.95  0.00 ? 172 GLU A CA   2  
ATOM   4955   C C    C GLU A 1 172 ? 21.004  19.858  53.939 0.05  0.00 ? 172 GLU A C    2  
ATOM   4956   C C    O GLU A 1 172 ? 12.884  7.255   64.543 0.95  0.00 ? 172 GLU A C    2  
ATOM   4957   O O    C GLU A 1 172 ? 21.761  19.715  54.944 0.05  0.00 ? 172 GLU A O    2  
ATOM   4958   O O    O GLU A 1 172 ? 12.791  6.643   65.648 0.95  0.00 ? 172 GLU A O    2  
ATOM   4959   H H    C GLU A 1 172 ? 20.118  21.256  51.756 0.05  0.00 ? 172 GLU A H    2  
ATOM   4960   H H    O GLU A 1 172 ? 13.964  9.187   62.930 0.95  0.00 ? 172 GLU A H    2  
ATOM   4961   N N    C ASN A 1 173 ? 19.675  19.826  54.019 0.05  0.00 ? 173 ASN A N    2  
ATOM   4962   N N    O ASN A 1 173 ? 11.844  7.829   63.940 0.95  0.00 ? 173 ASN A N    2  
ATOM   4963   C CA   C ASN A 1 173 ? 19.014  19.745  55.335 0.05  0.00 ? 173 ASN A CA   2  
ATOM   4964   C CA   O ASN A 1 173 ? 10.534  7.883   64.615 0.95  0.00 ? 173 ASN A CA   2  
ATOM   4965   C C    C ASN A 1 173 ? 17.509  19.903  55.241 0.05  0.00 ? 173 ASN A C    2  
ATOM   4966   C C    O ASN A 1 173 ? 9.525   8.728   63.862 0.95  0.00 ? 173 ASN A C    2  
ATOM   4967   O O    C ASN A 1 173 ? 16.925  20.557  56.150 0.05  0.00 ? 173 ASN A O    2  
ATOM   4968   O O    O ASN A 1 173 ? 8.735   9.447   64.536 0.95  0.00 ? 173 ASN A O    2  
ATOM   4969   H H    C ASN A 1 173 ? 19.134  19.882  53.203 0.05  0.00 ? 173 ASN A H    2  
ATOM   4970   H H    O ASN A 1 173 ? 11.956  8.239   63.057 0.95  0.00 ? 173 ASN A H    2  
ATOM   4971   N N    C GLY A 1 174 ? 16.898  19.370  54.212 0.05  0.00 ? 174 GLY A N    2  
ATOM   4972   N N    O GLY A 1 174 ? 9.541   8.683   62.553 0.95  0.00 ? 174 GLY A N    2  
ATOM   4973   C CA   C GLY A 1 174 ? 15.429  19.521  54.047 0.05  0.00 ? 174 GLY A CA   2  
ATOM   4974   C CA   O GLY A 1 174 ? 8.601   9.515   61.759 0.95  0.00 ? 174 GLY A CA   2  
ATOM   4975   C C    C GLY A 1 174 ? 15.157  20.947  53.549 0.05  0.00 ? 174 GLY A C    2  
ATOM   4976   C C    O GLY A 1 174 ? 9.121   10.959  61.778 0.95  0.00 ? 174 GLY A C    2  
ATOM   4977   O O    C GLY A 1 174 ? 13.996  21.366  53.371 0.05  0.00 ? 174 GLY A O    2  
ATOM   4978   O O    O GLY A 1 174 ? 8.495   11.886  61.227 0.95  0.00 ? 174 GLY A O    2  
ATOM   4979   H H    C GLY A 1 174 ? 17.416  18.888  53.534 0.05  0.00 ? 174 GLY A H    2  
ATOM   4980   H H    O GLY A 1 174 ? 10.194  8.114   62.093 0.95  0.00 ? 174 GLY A H    2  
ATOM   4981   N N    C LYS A 1 175 ? 16.278  21.610  53.324 0.05  0.00 ? 175 LYS A N    2  
ATOM   4982   N N    O LYS A 1 175 ? 10.281  11.054  62.405 0.95  0.00 ? 175 LYS A N    2  
ATOM   4983   C CA   C LYS A 1 175 ? 16.326  23.002  52.888 0.05  0.00 ? 175 LYS A CA   2  
ATOM   4984   C CA   O LYS A 1 175 ? 10.990  12.312  62.617 0.95  0.00 ? 175 LYS A CA   2  
ATOM   4985   C C    C LYS A 1 175 ? 17.341  23.234  51.768 0.05  0.00 ? 175 LYS A C    2  
ATOM   4986   C C    O LYS A 1 175 ? 12.487  12.201  62.327 0.95  0.00 ? 175 LYS A C    2  
ATOM   4987   O O    C LYS A 1 175 ? 18.473  22.748  51.719 0.05  0.00 ? 175 LYS A O    2  
ATOM   4988   O O    O LYS A 1 175 ? 13.210  11.259  62.660 0.95  0.00 ? 175 LYS A O    2  
ATOM   4989   H H    C LYS A 1 175 ? 17.127  21.149  53.488 0.05  0.00 ? 175 LYS A H    2  
ATOM   4990   H H    O LYS A 1 175 ? 10.673  10.236  62.775 0.95  0.00 ? 175 LYS A H    2  
ATOM   4991   N N    C TYR A 1 176 ? 16.855  24.058  50.855 0.05  0.00 ? 176 TYR A N    2  
ATOM   4992   N N    O TYR A 1 176 ? 12.924  13.272  61.686 0.95  0.00 ? 176 TYR A N    2  
ATOM   4993   C CA   C TYR A 1 176 ? 17.546  24.512  49.665 0.05  0.00 ? 176 TYR A CA   2  
ATOM   4994   C CA   O TYR A 1 176 ? 14.289  13.514  61.267 0.95  0.00 ? 176 TYR A CA   2  
ATOM   4995   C C    C TYR A 1 176 ? 18.159  25.903  49.899 0.05  0.00 ? 176 TYR A C    2  
ATOM   4996   C C    O TYR A 1 176 ? 15.009  14.419  62.281 0.95  0.00 ? 176 TYR A C    2  
ATOM   4997   O O    C TYR A 1 176 ? 17.406  26.804  50.313 0.05  0.00 ? 176 TYR A O    2  
ATOM   4998   O O    O TYR A 1 176 ? 14.467  15.500  62.578 0.95  0.00 ? 176 TYR A O    2  
ATOM   4999   H H    C TYR A 1 176 ? 15.947  24.400  51.001 0.05  0.00 ? 176 TYR A H    2  
ATOM   5000   H H    O TYR A 1 176 ? 12.265  13.970  61.485 0.95  0.00 ? 176 TYR A H    2  
ATOM   5001   N N    C ASP A 1 177 ? 19.435  26.024  49.613 0.05  0.00 ? 177 ASP A N    2  
ATOM   5002   N N    O ASP A 1 177 ? 16.161  13.976  62.730 0.95  0.00 ? 177 ASP A N    2  
ATOM   5003   C CA   C ASP A 1 177 ? 20.184  27.295  49.702 0.05  0.00 ? 177 ASP A CA   2  
ATOM   5004   C CA   O ASP A 1 177 ? 17.034  14.733  63.652 0.95  0.00 ? 177 ASP A CA   2  
ATOM   5005   C C    C ASP A 1 177 ? 20.022  27.963  48.325 0.05  0.00 ? 177 ASP A C    2  
ATOM   5006   C C    O ASP A 1 177 ? 17.946  15.581  62.748 0.95  0.00 ? 177 ASP A C    2  
ATOM   5007   O O    C ASP A 1 177 ? 20.714  27.546  47.378 0.05  0.00 ? 177 ASP A O    2  
ATOM   5008   O O    O ASP A 1 177 ? 18.909  15.026  62.188 0.95  0.00 ? 177 ASP A O    2  
ATOM   5009   H H    C ASP A 1 177 ? 19.907  25.235  49.276 0.05  0.00 ? 177 ASP A H    2  
ATOM   5010   H H    O ASP A 1 177 ? 16.482  13.112  62.398 0.95  0.00 ? 177 ASP A H    2  
ATOM   5011   N N    C ILE A 1 178 ? 19.144  28.938  48.228 0.05  0.00 ? 178 ILE A N    2  
ATOM   5012   N N    O ILE A 1 178 ? 17.643  16.854  62.611 0.95  0.00 ? 178 ILE A N    2  
ATOM   5013   C CA   C ILE A 1 178 ? 18.869  29.578  46.947 0.05  0.00 ? 178 ILE A CA   2  
ATOM   5014   C CA   O ILE A 1 178 ? 18.405  17.717  61.717 0.95  0.00 ? 178 ILE A CA   2  
ATOM   5015   C C    C ILE A 1 178 ? 19.933  30.479  46.369 0.05  0.00 ? 178 ILE A C    2  
ATOM   5016   C C    O ILE A 1 178 ? 19.806  18.095  62.129 0.95  0.00 ? 178 ILE A C    2  
ATOM   5017   O O    C ILE A 1 178 ? 19.760  31.047  45.263 0.05  0.00 ? 178 ILE A O    2  
ATOM   5018   O O    O ILE A 1 178 ? 20.516  18.824  61.394 0.95  0.00 ? 178 ILE A O    2  
ATOM   5019   H H    C ILE A 1 178 ? 18.631  29.203  49.019 0.05  0.00 ? 178 ILE A H    2  
ATOM   5020   H H    O ILE A 1 178 ? 16.862  17.215  63.080 0.95  0.00 ? 178 ILE A H    2  
ATOM   5021   N N    C LYS A 1 179 ? 21.036  30.617  47.051 0.05  0.00 ? 179 LYS A N    2  
ATOM   5022   N N    O LYS A 1 179 ? 20.248  17.614  63.259 0.95  0.00 ? 179 LYS A N    2  
ATOM   5023   C CA   C LYS A 1 179 ? 22.161  31.429  46.612 0.05  0.00 ? 179 LYS A CA   2  
ATOM   5024   C CA   O LYS A 1 179 ? 21.584  17.868  63.777 0.95  0.00 ? 179 LYS A CA   2  
ATOM   5025   C C    C LYS A 1 179 ? 23.322  30.503  46.261 0.05  0.00 ? 179 LYS A C    2  
ATOM   5026   C C    O LYS A 1 179 ? 22.382  16.568  63.720 0.95  0.00 ? 179 LYS A C    2  
ATOM   5027   O O    C LYS A 1 179 ? 24.417  30.976  45.990 0.05  0.00 ? 179 LYS A O    2  
ATOM   5028   O O    O LYS A 1 179 ? 23.495  16.515  64.226 0.95  0.00 ? 179 LYS A O    2  
ATOM   5029   H H    C LYS A 1 179 ? 21.118  30.133  47.899 0.05  0.00 ? 179 LYS A H    2  
ATOM   5030   H H    O LYS A 1 179 ? 19.652  17.036  63.779 0.95  0.00 ? 179 LYS A H    2  
ATOM   5031   N N    C ASP A 1 180 ? 23.020  29.220  46.287 0.05  0.00 ? 180 ASP A N    2  
ATOM   5032   N N    O ASP A 1 180 ? 21.766  15.579  63.104 0.95  0.00 ? 180 ASP A N    2  
ATOM   5033   C CA   C ASP A 1 180 ? 23.972  28.158  45.921 0.05  0.00 ? 180 ASP A CA   2  
ATOM   5034   C CA   O ASP A 1 180 ? 22.379  14.259  62.881 0.95  0.00 ? 180 ASP A CA   2  
ATOM   5035   C C    C ASP A 1 180 ? 23.307  27.468  44.706 0.05  0.00 ? 180 ASP A C    2  
ATOM   5036   C C    O ASP A 1 180 ? 22.422  14.127  61.340 0.95  0.00 ? 180 ASP A C    2  
ATOM   5037   O O    C ASP A 1 180 ? 22.456  26.591  44.831 0.05  0.00 ? 180 ASP A O    2  
ATOM   5038   O O    O ASP A 1 180 ? 21.460  13.733  60.685 0.95  0.00 ? 180 ASP A O    2  
ATOM   5039   H H    C ASP A 1 180 ? 22.103  28.962  46.523 0.05  0.00 ? 180 ASP A H    2  
ATOM   5040   H H    O ASP A 1 180 ? 20.870  15.743  62.740 0.95  0.00 ? 180 ASP A H    2  
ATOM   5041   N N    C VAL A 1 181 ? 23.671  28.010  43.577 0.05  0.00 ? 181 VAL A N    2  
ATOM   5042   N N    O VAL A 1 181 ? 23.535  14.588  60.841 0.95  0.00 ? 181 VAL A N    2  
ATOM   5043   C CA   C VAL A 1 181 ? 23.190  27.576  42.234 0.05  0.00 ? 181 VAL A CA   2  
ATOM   5044   C CA   O VAL A 1 181 ? 23.867  14.613  59.387 0.95  0.00 ? 181 VAL A CA   2  
ATOM   5045   C C    C VAL A 1 181 ? 24.350  26.934  41.506 0.05  0.00 ? 181 VAL A C    2  
ATOM   5046   C C    O VAL A 1 181 ? 24.976  13.615  59.143 0.95  0.00 ? 181 VAL A C    2  
ATOM   5047   O O    C VAL A 1 181 ? 25.489  27.455  41.628 0.05  0.00 ? 181 VAL A O    2  
ATOM   5048   O O    O VAL A 1 181 ? 25.897  13.530  59.996 0.95  0.00 ? 181 VAL A O    2  
ATOM   5049   H H    C VAL A 1 181 ? 24.299  28.762  43.614 0.05  0.00 ? 181 VAL A H    2  
ATOM   5050   H H    O VAL A 1 181 ? 24.198  14.953  61.465 0.95  0.00 ? 181 VAL A H    2  
ATOM   5051   N N    C GLY A 1 182 ? 24.079  25.834  40.807 0.05  0.00 ? 182 GLY A N    2  
ATOM   5052   N N    O GLY A 1 182 ? 24.877  12.871  58.043 0.95  0.00 ? 182 GLY A N    2  
ATOM   5053   C CA   C GLY A 1 182 ? 25.152  25.123  40.101 0.05  0.00 ? 182 GLY A CA   2  
ATOM   5054   C CA   O GLY A 1 182 ? 25.889  11.849  57.747 0.95  0.00 ? 182 GLY A CA   2  
ATOM   5055   C C    C GLY A 1 182 ? 25.075  25.010  38.595 0.05  0.00 ? 182 GLY A C    2  
ATOM   5056   C C    O GLY A 1 182 ? 26.712  11.991  56.487 0.95  0.00 ? 182 GLY A C    2  
ATOM   5057   O O    C GLY A 1 182 ? 25.383  23.938  38.024 0.05  0.00 ? 182 GLY A O    2  
ATOM   5058   O O    O GLY A 1 182 ? 26.970  10.987  55.783 0.95  0.00 ? 182 GLY A O    2  
ATOM   5059   H H    C GLY A 1 182 ? 23.164  25.483  40.785 0.05  0.00 ? 182 GLY A H    2  
ATOM   5060   H H    O GLY A 1 182 ? 24.111  12.988  57.443 0.95  0.00 ? 182 GLY A H    2  
ATOM   5061   N N    C VAL A 1 183 ? 24.687  26.077  37.904 0.05  0.00 ? 183 VAL A N    2  
ATOM   5062   N N    O VAL A 1 183 ? 27.158  13.200  56.161 0.95  0.00 ? 183 VAL A N    2  
ATOM   5063   C CA   C VAL A 1 183 ? 24.587  26.025  36.447 0.05  0.00 ? 183 VAL A CA   2  
ATOM   5064   C CA   O VAL A 1 183 ? 27.952  13.400  54.951 0.95  0.00 ? 183 VAL A CA   2  
ATOM   5065   C C    C VAL A 1 183 ? 25.827  26.584  35.764 0.05  0.00 ? 183 VAL A C    2  
ATOM   5066   C C    O VAL A 1 183 ? 29.447  13.411  55.238 0.95  0.00 ? 183 VAL A C    2  
ATOM   5067   O O    C VAL A 1 183 ? 26.000  26.359  34.555 0.05  0.00 ? 183 VAL A O    2  
ATOM   5068   O O    O VAL A 1 183 ? 30.242  13.300  54.290 0.95  0.00 ? 183 VAL A O    2  
ATOM   5069   H H    C VAL A 1 183 ? 24.461  26.906  38.377 0.05  0.00 ? 183 VAL A H    2  
ATOM   5070   H H    O VAL A 1 183 ? 26.948  13.966  56.736 0.95  0.00 ? 183 VAL A H    2  
ATOM   5071   N N    C ASP A 1 184 ? 26.681  27.261  36.512 0.05  0.00 ? 184 ASP A N    2  
ATOM   5072   N N    O ASP A 1 184 ? 29.823  13.509  56.501 0.95  0.00 ? 184 ASP A N    2  
ATOM   5073   C CA   C ASP A 1 184 ? 27.866  27.881  35.913 0.05  0.00 ? 184 ASP A CA   2  
ATOM   5074   C CA   O ASP A 1 184 ? 31.244  13.588  56.851 0.95  0.00 ? 184 ASP A CA   2  
ATOM   5075   C C    C ASP A 1 184 ? 29.139  27.214  36.332 0.05  0.00 ? 184 ASP A C    2  
ATOM   5076   C C    O ASP A 1 184 ? 31.734  12.359  57.551 0.95  0.00 ? 184 ASP A C    2  
ATOM   5077   O O    C ASP A 1 184 ? 30.238  27.736  36.003 0.05  0.00 ? 184 ASP A O    2  
ATOM   5078   O O    O ASP A 1 184 ? 32.899  12.355  58.032 0.95  0.00 ? 184 ASP A O    2  
ATOM   5079   H H    C ASP A 1 184 ? 26.499  27.384  37.468 0.05  0.00 ? 184 ASP A H    2  
ATOM   5080   H H    O ASP A 1 184 ? 29.145  13.570  57.207 0.95  0.00 ? 184 ASP A H    2  
ATOM   5081   N N    C ASN A 1 185 ? 29.067  26.123  37.062 0.05  0.00 ? 185 ASN A N    2  
ATOM   5082   N N    O ASN A 1 185 ? 30.918  11.336  57.672 0.95  0.00 ? 185 ASN A N    2  
ATOM   5083   C CA   C ASN A 1 185 ? 30.361  25.490  37.464 0.05  0.00 ? 185 ASN A CA   2  
ATOM   5084   C CA   O ASN A 1 185 ? 31.444  10.129  58.382 0.95  0.00 ? 185 ASN A CA   2  
ATOM   5085   C C    C ASN A 1 185 ? 30.980  24.747  36.265 0.05  0.00 ? 185 ASN A C    2  
ATOM   5086   C C    O ASN A 1 185 ? 32.410  9.356   57.465 0.95  0.00 ? 185 ASN A C    2  
ATOM   5087   O O    C ASN A 1 185 ? 30.448  24.656  35.152 0.05  0.00 ? 185 ASN A O    2  
ATOM   5088   O O    O ASN A 1 185 ? 32.665  9.674   56.297 0.95  0.00 ? 185 ASN A O    2  
ATOM   5089   H H    C ASN A 1 185 ? 28.205  25.743  37.333 0.05  0.00 ? 185 ASN A H    2  
ATOM   5090   H H    O ASN A 1 185 ? 30.005  11.363  57.316 0.95  0.00 ? 185 ASN A H    2  
ATOM   5091   N N    C ALA A 1 186 ? 32.181  24.256  36.515 0.05  0.00 ? 186 ALA A N    2  
ATOM   5092   N N    O ALA A 1 186 ? 33.001  8.338   58.064 0.95  0.00 ? 186 ALA A N    2  
ATOM   5093   C CA   C ALA A 1 186 ? 32.991  23.542  35.538 0.05  0.00 ? 186 ALA A CA   2  
ATOM   5094   C CA   O ALA A 1 186 ? 33.982  7.472   57.425 0.95  0.00 ? 186 ALA A CA   2  
ATOM   5095   C C    C ALA A 1 186 ? 32.226  22.288  35.100 0.05  0.00 ? 186 ALA A C    2  
ATOM   5096   C C    O ALA A 1 186 ? 33.314  6.785   56.229 0.95  0.00 ? 186 ALA A C    2  
ATOM   5097   O O    C ALA A 1 186 ? 32.226  21.918  33.911 0.05  0.00 ? 186 ALA A O    2  
ATOM   5098   O O    O ALA A 1 186 ? 33.926  6.623   55.156 0.95  0.00 ? 186 ALA A O    2  
ATOM   5099   H H    C ALA A 1 186 ? 32.560  24.401  37.408 0.05  0.00 ? 186 ALA A H    2  
ATOM   5100   H H    O ALA A 1 186 ? 32.782  8.168   59.004 0.95  0.00 ? 186 ALA A H    2  
ATOM   5101   N N    C GLY A 1 187 ? 31.544  21.710  36.068 0.05  0.00 ? 187 GLY A N    2  
ATOM   5102   N N    O GLY A 1 187 ? 32.053  6.460   56.432 0.95  0.00 ? 187 GLY A N    2  
ATOM   5103   C CA   C GLY A 1 187 ? 30.723  20.511  35.904 0.05  0.00 ? 187 GLY A CA   2  
ATOM   5104   C CA   O GLY A 1 187 ? 31.193  5.810   55.443 0.95  0.00 ? 187 GLY A CA   2  
ATOM   5105   C C    C GLY A 1 187 ? 29.728  20.708  34.772 0.05  0.00 ? 187 GLY A C    2  
ATOM   5106   C C    O GLY A 1 187 ? 31.203  6.596   54.142 0.95  0.00 ? 187 GLY A C    2  
ATOM   5107   O O    C GLY A 1 187 ? 29.775  19.966  33.781 0.05  0.00 ? 187 GLY A O    2  
ATOM   5108   O O    O GLY A 1 187 ? 31.620  6.059   53.107 0.95  0.00 ? 187 GLY A O    2  
ATOM   5109   H H    C GLY A 1 187 ? 31.582  22.117  36.959 0.05  0.00 ? 187 GLY A H    2  
ATOM   5110   H H    O GLY A 1 187 ? 31.661  6.678   57.303 0.95  0.00 ? 187 GLY A H    2  
ATOM   5111   N N    C ALA A 1 188 ? 28.846  21.686  34.945 0.05  0.00 ? 188 ALA A N    2  
ATOM   5112   N N    O ALA A 1 188 ? 30.734  7.837   54.217 0.95  0.00 ? 188 ALA A N    2  
ATOM   5113   C CA   C ALA A 1 188 ? 27.820  22.023  33.969 0.05  0.00 ? 188 ALA A CA   2  
ATOM   5114   C CA   O ALA A 1 188 ? 30.667  8.739   53.076 0.95  0.00 ? 188 ALA A CA   2  
ATOM   5115   C C    C ALA A 1 188 ? 28.471  22.444  32.648 0.05  0.00 ? 188 ALA A C    2  
ATOM   5116   C C    O ALA A 1 188 ? 32.073  8.988   52.521 0.95  0.00 ? 188 ALA A C    2  
ATOM   5117   O O    C ALA A 1 188 ? 27.977  22.155  31.556 0.05  0.00 ? 188 ALA A O    2  
ATOM   5118   O O    O ALA A 1 188 ? 32.285  9.112   51.313 0.95  0.00 ? 188 ALA A O    2  
ATOM   5119   H H    C ALA A 1 188 ? 28.890  22.210  35.773 0.05  0.00 ? 188 ALA A H    2  
ATOM   5120   H H    O ALA A 1 188 ? 30.418  8.163   55.086 0.95  0.00 ? 188 ALA A H    2  
ATOM   5121   N N    C LYS A 1 189 ? 29.579  23.164  32.787 0.05  0.00 ? 189 LYS A N    2  
ATOM   5122   N N    O LYS A 1 189 ? 33.019  9.089   53.449 0.95  0.00 ? 189 LYS A N    2  
ATOM   5123   C CA   C LYS A 1 189 ? 30.337  23.635  31.633 0.05  0.00 ? 189 LYS A CA   2  
ATOM   5124   C CA   O LYS A 1 189 ? 34.417  9.311   53.097 0.95  0.00 ? 189 LYS A CA   2  
ATOM   5125   C C    C LYS A 1 189 ? 30.838  22.430  30.827 0.05  0.00 ? 189 LYS A C    2  
ATOM   5126   C C    O LYS A 1 189 ? 34.922  8.133   52.253 0.95  0.00 ? 189 LYS A C    2  
ATOM   5127   O O    C LYS A 1 189 ? 30.693  22.435  29.587 0.05  0.00 ? 189 LYS A O    2  
ATOM   5128   O O    O LYS A 1 189 ? 35.568  8.374   51.213 0.95  0.00 ? 189 LYS A O    2  
ATOM   5129   H H    C LYS A 1 189 ? 29.901  23.374  33.688 0.05  0.00 ? 189 LYS A H    2  
ATOM   5130   H H    O LYS A 1 189 ? 32.772  9.002   54.393 0.95  0.00 ? 189 LYS A H    2  
ATOM   5131   N N    C ALA A 1 190 ? 31.406  21.448  31.513 0.05  0.00 ? 190 ALA A N    2  
ATOM   5132   N N    O ALA A 1 190 ? 34.637  6.916   52.696 0.95  0.00 ? 190 ALA A N    2  
ATOM   5133   C CA   C ALA A 1 190 ? 31.895  20.236  30.809 0.05  0.00 ? 190 ALA A CA   2  
ATOM   5134   C CA   O ALA A 1 190 ? 35.068  5.725   51.924 0.95  0.00 ? 190 ALA A CA   2  
ATOM   5135   C C    C ALA A 1 190 ? 30.755  19.585  30.028 0.05  0.00 ? 190 ALA A C    2  
ATOM   5136   C C    O ALA A 1 190 ? 34.508  5.786   50.504 0.95  0.00 ? 190 ALA A C    2  
ATOM   5137   O O    C ALA A 1 190 ? 30.923  19.273  28.841 0.05  0.00 ? 190 ALA A O    2  
ATOM   5138   O O    O ALA A 1 190 ? 35.261  5.597   49.538 0.95  0.00 ? 190 ALA A O    2  
ATOM   5139   H H    C ALA A 1 190 ? 31.489  21.514  32.487 0.05  0.00 ? 190 ALA A H    2  
ATOM   5140   H H    O ALA A 1 190 ? 34.127  6.803   53.525 0.95  0.00 ? 190 ALA A H    2  
ATOM   5141   N N    C GLY A 1 191 ? 29.615  19.391  30.647 0.05  0.00 ? 191 GLY A N    2  
ATOM   5142   N N    O GLY A 1 191 ? 33.234  6.057   50.355 0.95  0.00 ? 191 GLY A N    2  
ATOM   5143   C CA   C GLY A 1 191 ? 28.431  18.784  30.073 0.05  0.00 ? 191 GLY A CA   2  
ATOM   5144   C CA   O GLY A 1 191 ? 32.529  6.149   49.092 0.95  0.00 ? 191 GLY A CA   2  
ATOM   5145   C C    C GLY A 1 191 ? 27.804  19.412  28.863 0.05  0.00 ? 191 GLY A C    2  
ATOM   5146   C C    O GLY A 1 191 ? 32.984  7.155   48.075 0.95  0.00 ? 191 GLY A C    2  
ATOM   5147   O O    C GLY A 1 191 ? 27.471  18.765  27.858 0.05  0.00 ? 191 GLY A O    2  
ATOM   5148   O O    O GLY A 1 191 ? 33.157  6.878   46.878 0.95  0.00 ? 191 GLY A O    2  
ATOM   5149   H H    C GLY A 1 191 ? 29.561  19.678  31.583 0.05  0.00 ? 191 GLY A H    2  
ATOM   5150   H H    O GLY A 1 191 ? 32.711  6.206   51.170 0.95  0.00 ? 191 GLY A H    2  
ATOM   5151   N N    C LEU A 1 192 ? 27.577  20.735  28.937 0.05  0.00 ? 192 LEU A N    2  
ATOM   5152   N N    O LEU A 1 192 ? 33.160  8.409   48.525 0.95  0.00 ? 192 LEU A N    2  
ATOM   5153   C CA   C LEU A 1 192 ? 26.989  21.530  27.873 0.05  0.00 ? 192 LEU A CA   2  
ATOM   5154   C CA   O LEU A 1 192 ? 33.605  9.522   47.705 0.95  0.00 ? 192 LEU A CA   2  
ATOM   5155   C C    C LEU A 1 192 ? 27.953  21.571  26.690 0.05  0.00 ? 192 LEU A C    2  
ATOM   5156   C C    O LEU A 1 192 ? 35.047  9.275   47.268 0.95  0.00 ? 192 LEU A C    2  
ATOM   5157   O O    C LEU A 1 192 ? 27.523  21.571  25.556 0.05  0.00 ? 192 LEU A O    2  
ATOM   5158   O O    O LEU A 1 192 ? 35.417  9.629   46.168 0.95  0.00 ? 192 LEU A O    2  
ATOM   5159   H H    C LEU A 1 192 ? 27.831  21.196  29.764 0.05  0.00 ? 192 LEU A H    2  
ATOM   5160   H H    O LEU A 1 192 ? 32.982  8.583   49.473 0.95  0.00 ? 192 LEU A H    2  
ATOM   5161   N N    C THR A 1 193 ? 29.220  21.636  27.001 0.05  0.00 ? 193 THR A N    2  
ATOM   5162   N N    O THR A 1 193 ? 35.814  8.706   48.159 0.95  0.00 ? 193 THR A N    2  
ATOM   5163   C CA   C THR A 1 193 ? 30.259  21.652  25.960 0.05  0.00 ? 193 THR A CA   2  
ATOM   5164   C CA   O THR A 1 193 ? 37.217  8.383   47.860 0.95  0.00 ? 193 THR A CA   2  
ATOM   5165   C C    C THR A 1 193 ? 30.143  20.331  25.188 0.05  0.00 ? 193 THR A C    2  
ATOM   5166   C C    O THR A 1 193 ? 37.211  7.384   46.696 0.95  0.00 ? 193 THR A C    2  
ATOM   5167   O O    C THR A 1 193 ? 30.121  20.376  23.967 0.05  0.00 ? 193 THR A O    2  
ATOM   5168   O O    O THR A 1 193 ? 37.948  7.600   45.746 0.95  0.00 ? 193 THR A O    2  
ATOM   5169   H H    C THR A 1 193 ? 29.484  21.656  27.945 0.05  0.00 ? 193 THR A H    2  
ATOM   5170   H H    O THR A 1 193 ? 35.442  8.473   49.036 0.95  0.00 ? 193 THR A H    2  
ATOM   5171   N N    C PHE A 1 194 ? 30.084  19.233  25.920 0.05  0.00 ? 194 PHE A N    2  
ATOM   5172   N N    O PHE A 1 194 ? 36.401  6.348   46.823 0.95  0.00 ? 194 PHE A N    2  
ATOM   5173   C CA   C PHE A 1 194 ? 29.951  17.910  25.239 0.05  0.00 ? 194 PHE A CA   2  
ATOM   5174   C CA   O PHE A 1 194 ? 36.327  5.343   45.720 0.95  0.00 ? 194 PHE A CA   2  
ATOM   5175   C C    C PHE A 1 194 ? 28.722  17.902  24.341 0.05  0.00 ? 194 PHE A C    2  
ATOM   5176   C C    O PHE A 1 194 ? 35.961  6.025   44.409 0.95  0.00 ? 194 PHE A C    2  
ATOM   5177   O O    C PHE A 1 194 ? 28.756  17.372  23.192 0.05  0.00 ? 194 PHE A O    2  
ATOM   5178   O O    O PHE A 1 194 ? 36.527  5.701   43.325 0.95  0.00 ? 194 PHE A O    2  
ATOM   5179   H H    C PHE A 1 194 ? 30.116  19.287  26.898 0.05  0.00 ? 194 PHE A H    2  
ATOM   5180   H H    O PHE A 1 194 ? 35.847  6.247   47.625 0.95  0.00 ? 194 PHE A H    2  
ATOM   5181   N N    C LEU A 1 195 ? 27.626  18.465  24.831 0.05  0.00 ? 195 LEU A N    2  
ATOM   5182   N N    O LEU A 1 195 ? 35.019  6.957   44.469 0.95  0.00 ? 195 LEU A N    2  
ATOM   5183   C CA   C LEU A 1 195 ? 26.380  18.500  24.068 0.05  0.00 ? 195 LEU A CA   2  
ATOM   5184   C CA   O LEU A 1 195 ? 34.572  7.667   43.272 0.95  0.00 ? 195 LEU A CA   2  
ATOM   5185   C C    C LEU A 1 195 ? 26.522  19.314  22.784 0.05  0.00 ? 195 LEU A C    2  
ATOM   5186   C C    O LEU A 1 195 ? 35.695  8.490   42.646 0.95  0.00 ? 195 LEU A C    2  
ATOM   5187   O O    C LEU A 1 195 ? 26.046  18.915  21.715 0.05  0.00 ? 195 LEU A O    2  
ATOM   5188   O O    O LEU A 1 195 ? 35.875  8.506   41.423 0.95  0.00 ? 195 LEU A O    2  
ATOM   5189   H H    C LEU A 1 195 ? 27.647  18.854  25.731 0.05  0.00 ? 195 LEU A H    2  
ATOM   5190   H H    O LEU A 1 195 ? 34.604  7.166   45.332 0.95  0.00 ? 195 LEU A H    2  
ATOM   5191   N N    C VAL A 1 196 ? 27.138  20.476  22.930 0.05  0.00 ? 196 VAL A N    2  
ATOM   5192   N N    O VAL A 1 196 ? 36.403  9.205   43.505 0.95  0.00 ? 196 VAL A N    2  
ATOM   5193   C CA   C VAL A 1 196 ? 27.334  21.420  21.833 0.05  0.00 ? 196 VAL A CA   2  
ATOM   5194   C CA   O VAL A 1 196 ? 37.491  10.092  43.102 0.95  0.00 ? 196 VAL A CA   2  
ATOM   5195   C C    C VAL A 1 196 ? 28.192  20.754  20.757 0.05  0.00 ? 196 VAL A C    2  
ATOM   5196   C C    O VAL A 1 196 ? 38.582  9.259   42.427 0.95  0.00 ? 196 VAL A C    2  
ATOM   5197   O O    C VAL A 1 196 ? 27.805  20.905  19.592 0.05  0.00 ? 196 VAL A O    2  
ATOM   5198   O O    O VAL A 1 196 ? 39.047  9.729   41.382 0.95  0.00 ? 196 VAL A O    2  
ATOM   5199   H H    C VAL A 1 196 ? 27.451  20.728  23.823 0.05  0.00 ? 196 VAL A H    2  
ATOM   5200   H H    O VAL A 1 196 ? 36.167  9.159   44.455 0.95  0.00 ? 196 VAL A H    2  
ATOM   5201   N N    C ASP A 1 197 ? 29.222  20.084  21.158 0.05  0.00 ? 197 ASP A N    2  
ATOM   5202   N N    O ASP A 1 197 ? 38.902  8.142   42.993 0.95  0.00 ? 197 ASP A N    2  
ATOM   5203   C CA   C ASP A 1 197 ? 30.144  19.356  20.276 0.05  0.00 ? 197 ASP A CA   2  
ATOM   5204   C CA   O ASP A 1 197 ? 39.904  7.200   42.478 0.95  0.00 ? 197 ASP A CA   2  
ATOM   5205   C C    C ASP A 1 197 ? 29.379  18.275  19.472 0.05  0.00 ? 197 ASP A C    2  
ATOM   5206   C C    O ASP A 1 197 ? 39.509  6.714   41.061 0.95  0.00 ? 197 ASP A C    2  
ATOM   5207   O O    C ASP A 1 197 ? 29.820  17.911  18.367 0.05  0.00 ? 197 ASP A O    2  
ATOM   5208   O O    O ASP A 1 197 ? 40.398  6.343   40.274 0.95  0.00 ? 197 ASP A O    2  
ATOM   5209   H H    C ASP A 1 197 ? 29.390  20.043  22.123 0.05  0.00 ? 197 ASP A H    2  
ATOM   5210   H H    O ASP A 1 197 ? 38.429  7.897   43.816 0.95  0.00 ? 197 ASP A H    2  
ATOM   5211   N N    C LEU A 1 198 ? 28.311  17.751  20.032 0.05  0.00 ? 198 LEU A N    2  
ATOM   5212   N N    O LEU A 1 198 ? 38.227  6.671   40.775 0.95  0.00 ? 198 LEU A N    2  
ATOM   5213   C CA   C LEU A 1 198 ? 27.513  16.733  19.397 0.05  0.00 ? 198 LEU A CA   2  
ATOM   5214   C CA   O LEU A 1 198 ? 37.723  6.233   39.498 0.95  0.00 ? 198 LEU A CA   2  
ATOM   5215   C C    C LEU A 1 198 ? 26.800  17.323  18.191 0.05  0.00 ? 198 LEU A C    2  
ATOM   5216   C C    O LEU A 1 198 ? 38.101  7.244   38.427 0.95  0.00 ? 198 LEU A C    2  
ATOM   5217   O O    C LEU A 1 198 ? 26.773  16.657  17.165 0.05  0.00 ? 198 LEU A O    2  
ATOM   5218   O O    O LEU A 1 198 ? 38.507  6.813   37.357 0.95  0.00 ? 198 LEU A O    2  
ATOM   5219   H H    C LEU A 1 198 ? 28.049  18.063  20.922 0.05  0.00 ? 198 LEU A H    2  
ATOM   5220   H H    O LEU A 1 198 ? 37.585  6.944   41.462 0.95  0.00 ? 198 LEU A H    2  
ATOM   5221   N N    C ILE A 1 199 ? 26.238  18.496  18.416 0.05  0.00 ? 199 ILE A N    2  
ATOM   5222   N N    O ILE A 1 199 ? 37.894  8.501   38.774 0.95  0.00 ? 199 ILE A N    2  
ATOM   5223   C CA   C ILE A 1 199 ? 25.471  19.199  17.409 0.05  0.00 ? 199 ILE A CA   2  
ATOM   5224   C CA   O ILE A 1 199 ? 38.145  9.608   37.875 0.95  0.00 ? 199 ILE A CA   2  
ATOM   5225   C C    C ILE A 1 199 ? 26.343  19.744  16.270 0.05  0.00 ? 199 ILE A C    2  
ATOM   5226   C C    O ILE A 1 199 ? 39.640  9.840   37.619 0.95  0.00 ? 199 ILE A C    2  
ATOM   5227   O O    C ILE A 1 199 ? 25.932  19.660  15.110 0.05  0.00 ? 199 ILE A O    2  
ATOM   5228   O O    O ILE A 1 199 ? 40.015  10.114  36.477 0.95  0.00 ? 199 ILE A O    2  
ATOM   5229   H H    C ILE A 1 199 ? 26.316  18.892  19.310 0.05  0.00 ? 199 ILE A H    2  
ATOM   5230   H H    O ILE A 1 199 ? 37.526  8.690   39.663 0.95  0.00 ? 199 ILE A H    2  
ATOM   5231   N N    C LYS A 1 200 ? 27.478  20.302  16.632 0.05  0.00 ? 200 LYS A N    2  
ATOM   5232   N N    O LYS A 1 200 ? 40.423  9.756   38.673 0.95  0.00 ? 200 LYS A N    2  
ATOM   5233   C CA   C LYS A 1 200 ? 28.365  20.894  15.610 0.05  0.00 ? 200 LYS A CA   2  
ATOM   5234   C CA   O LYS A 1 200 ? 41.872  10.006  38.534 0.95  0.00 ? 200 LYS A CA   2  
ATOM   5235   C C    C LYS A 1 200 ? 29.078  19.825  14.795 0.05  0.00 ? 200 LYS A C    2  
ATOM   5236   C C    O LYS A 1 200 ? 42.579  8.851   37.839 0.95  0.00 ? 200 LYS A C    2  
ATOM   5237   O O    C LYS A 1 200 ? 29.397  20.050  13.604 0.05  0.00 ? 200 LYS A O    2  
ATOM   5238   O O    O LYS A 1 200 ? 43.603  9.064   37.149 0.95  0.00 ? 200 LYS A O    2  
ATOM   5239   H H    C LYS A 1 200 ? 27.721  20.348  17.580 0.05  0.00 ? 200 LYS A H    2  
ATOM   5240   H H    O LYS A 1 200 ? 40.041  9.555   39.553 0.95  0.00 ? 200 LYS A H    2  
ATOM   5241   N N    C ASN A 1 201 ? 29.282  18.664  15.386 0.05  0.00 ? 201 ASN A N    2  
ATOM   5242   N N    O ASN A 1 201 ? 42.030  7.658   37.961 0.95  0.00 ? 201 ASN A N    2  
ATOM   5243   C CA   C ASN A 1 201 ? 29.919  17.517  14.735 0.05  0.00 ? 201 ASN A CA   2  
ATOM   5244   C CA   O ASN A 1 201 ? 42.558  6.448   37.328 0.95  0.00 ? 201 ASN A CA   2  
ATOM   5245   C C    C ASN A 1 201 ? 28.859  16.652  14.025 0.05  0.00 ? 201 ASN A C    2  
ATOM   5246   C C    O ASN A 1 201 ? 41.951  6.275   35.921 0.95  0.00 ? 201 ASN A C    2  
ATOM   5247   O O    C ASN A 1 201 ? 29.161  15.531  13.595 0.05  0.00 ? 201 ASN A O    2  
ATOM   5248   O O    O ASN A 1 201 ? 42.105  5.212   35.306 0.95  0.00 ? 201 ASN A O    2  
ATOM   5249   H H    C ASN A 1 201 ? 28.969  18.555  16.309 0.05  0.00 ? 201 ASN A H    2  
ATOM   5250   H H    O ASN A 1 201 ? 41.207  7.581   38.488 0.95  0.00 ? 201 ASN A H    2  
ATOM   5251   N N    C LYS A 1 202 ? 27.694  17.204  13.953 0.05  0.00 ? 202 LYS A N    2  
ATOM   5252   N N    O LYS A 1 202 ? 41.296  7.306   35.502 0.95  0.00 ? 202 LYS A N    2  
ATOM   5253   C CA   C LYS A 1 202 ? 26.542  16.685  13.282 0.05  0.00 ? 202 LYS A CA   2  
ATOM   5254   C CA   O LYS A 1 202 ? 40.700  7.474   34.213 0.95  0.00 ? 202 LYS A CA   2  
ATOM   5255   C C    C LYS A 1 202 ? 26.020  15.343  13.710 0.05  0.00 ? 202 LYS A C    2  
ATOM   5256   C C    O LYS A 1 202 ? 39.660  6.480   33.781 0.95  0.00 ? 202 LYS A C    2  
ATOM   5257   O O    C LYS A 1 202 ? 25.236  14.734  12.960 0.05  0.00 ? 202 LYS A O    2  
ATOM   5258   O O    O LYS A 1 202 ? 39.357  6.410   32.576 0.95  0.00 ? 202 LYS A O    2  
ATOM   5259   H H    C LYS A 1 202 ? 27.605  18.094  14.353 0.05  0.00 ? 202 LYS A H    2  
ATOM   5260   H H    O LYS A 1 202 ? 41.250  8.073   36.110 0.95  0.00 ? 202 LYS A H    2  
ATOM   5261   N N    C HIS A 1 203 ? 26.342  14.938  14.915 0.05  0.00 ? 203 HIS A N    2  
ATOM   5262   N N    O HIS A 1 203 ? 39.048  5.811   34.729 0.95  0.00 ? 203 HIS A N    2  
ATOM   5263   C CA   C HIS A 1 203 ? 25.878  13.685  15.510 0.05  0.00 ? 203 HIS A CA   2  
ATOM   5264   C CA   O HIS A 1 203 ? 37.976  4.846   34.490 0.95  0.00 ? 203 HIS A CA   2  
ATOM   5265   C C    C HIS A 1 203 ? 24.457  13.874  16.021 0.05  0.00 ? 203 HIS A C    2  
ATOM   5266   C C    O HIS A 1 203 ? 36.672  5.597   34.263 0.95  0.00 ? 203 HIS A C    2  
ATOM   5267   O O    C HIS A 1 203 ? 23.799  12.879  16.318 0.05  0.00 ? 203 HIS A O    2  
ATOM   5268   O O    O HIS A 1 203 ? 35.713  4.987   33.794 0.95  0.00 ? 203 HIS A O    2  
ATOM   5269   H H    C HIS A 1 203 ? 26.903  15.526  15.463 0.05  0.00 ? 203 HIS A H    2  
ATOM   5270   H H    O HIS A 1 203 ? 39.303  5.994   35.657 0.95  0.00 ? 203 HIS A H    2  
ATOM   5271   N N    C MET A 1 204 ? 24.072  15.116  16.058 0.05  0.00 ? 204 MET A N    2  
ATOM   5272   N N    O MET A 1 204 ? 36.730  6.858   34.576 0.95  0.00 ? 204 MET A N    2  
ATOM   5273   C CA   C MET A 1 204 ? 22.763  15.620  16.547 0.05  0.00 ? 204 MET A CA   2  
ATOM   5274   C CA   O MET A 1 204 ? 35.615  7.837   34.507 0.95  0.00 ? 204 MET A CA   2  
ATOM   5275   C C    C MET A 1 204 ? 22.407  16.956  15.903 0.05  0.00 ? 204 MET A C    2  
ATOM   5276   C C    O MET A 1 204 ? 36.135  9.260   34.336 0.95  0.00 ? 204 MET A C    2  
ATOM   5277   O O    C MET A 1 204 ? 23.292  17.758  15.627 0.05  0.00 ? 204 MET A O    2  
ATOM   5278   O O    O MET A 1 204 ? 37.192  9.593   34.860 0.95  0.00 ? 204 MET A O    2  
ATOM   5279   H H    C MET A 1 204 ? 24.721  15.787  15.760 0.05  0.00 ? 204 MET A H    2  
ATOM   5280   H H    O MET A 1 204 ? 37.588  7.188   34.917 0.95  0.00 ? 204 MET A H    2  
ATOM   5281   N N    C ASN A 1 205 ? 21.158  17.202  15.620 0.05  0.00 ? 205 ASN A N    2  
ATOM   5282   N N    O ASN A 1 205 ? 35.457  10.091  33.594 0.95  0.00 ? 205 ASN A N    2  
ATOM   5283   C CA   C ASN A 1 205 ? 20.550  18.385  15.045 0.05  0.00 ? 205 ASN A CA   2  
ATOM   5284   C CA   O ASN A 1 205 ? 35.704  11.487  33.295 0.95  0.00 ? 205 ASN A CA   2  
ATOM   5285   C C    C ASN A 1 205 ? 19.997  19.267  16.181 0.05  0.00 ? 205 ASN A C    2  
ATOM   5286   C C    O ASN A 1 205 ? 34.866  12.360  34.249 0.95  0.00 ? 205 ASN A C    2  
ATOM   5287   O O    C ASN A 1 205 ? 19.276  18.754  17.041 0.05  0.00 ? 205 ASN A O    2  
ATOM   5288   O O    O ASN A 1 205 ? 33.661  12.125  34.373 0.95  0.00 ? 205 ASN A O    2  
ATOM   5289   H H    C ASN A 1 205 ? 20.531  16.484  15.850 0.05  0.00 ? 205 ASN A H    2  
ATOM   5290   H H    O ASN A 1 205 ? 34.643  9.719   33.193 0.95  0.00 ? 205 ASN A H    2  
ATOM   5291   N N    C ALA A 1 206 ? 20.301  20.556  16.063 0.05  0.00 ? 206 ALA A N    2  
ATOM   5292   N N    O ALA A 1 206 ? 35.541  13.366  34.796 0.95  0.00 ? 206 ALA A N    2  
ATOM   5293   C CA   C ALA A 1 206 ? 19.858  21.486  17.117 0.05  0.00 ? 206 ALA A CA   2  
ATOM   5294   C CA   O ALA A 1 206 ? 34.848  14.241  35.758 0.95  0.00 ? 206 ALA A CA   2  
ATOM   5295   C C    C ALA A 1 206 ? 18.367  21.663  17.182 0.05  0.00 ? 206 ALA A C    2  
ATOM   5296   C C    O ALA A 1 206 ? 33.759  15.075  35.143 0.95  0.00 ? 206 ALA A C    2  
ATOM   5297   O O    C ALA A 1 206 ? 17.853  22.188  18.189 0.05  0.00 ? 206 ALA A O    2  
ATOM   5298   O O    O ALA A 1 206 ? 32.923  15.635  35.879 0.95  0.00 ? 206 ALA A O    2  
ATOM   5299   H H    C ALA A 1 206 ? 20.833  20.876  15.304 0.05  0.00 ? 206 ALA A H    2  
ATOM   5300   H H    O ALA A 1 206 ? 36.488  13.505  34.585 0.95  0.00 ? 206 ALA A H    2  
ATOM   5301   N N    C ASP A 1 207 ? 17.629  21.237  16.173 0.05  0.00 ? 207 ASP A N    2  
ATOM   5302   N N    O ASP A 1 207 ? 33.700  15.180  33.828 0.95  0.00 ? 207 ASP A N    2  
ATOM   5303   C CA   C ASP A 1 207 ? 16.171  21.428  16.194 0.05  0.00 ? 207 ASP A CA   2  
ATOM   5304   C CA   O ASP A 1 207 ? 32.667  16.017  33.201 0.95  0.00 ? 207 ASP A CA   2  
ATOM   5305   C C    C ASP A 1 207 ? 15.363  20.205  16.587 0.05  0.00 ? 207 ASP A C    2  
ATOM   5306   C C    O ASP A 1 207 ? 31.472  15.264  32.646 0.95  0.00 ? 207 ASP A C    2  
ATOM   5307   O O    C ASP A 1 207 ? 14.142  20.247  16.437 0.05  0.00 ? 207 ASP A O    2  
ATOM   5308   O O    O ASP A 1 207 ? 30.674  15.884  31.944 0.95  0.00 ? 207 ASP A O    2  
ATOM   5309   H H    C ASP A 1 207 ? 18.054  20.813  15.398 0.05  0.00 ? 207 ASP A H    2  
ATOM   5310   H H    O ASP A 1 207 ? 34.360  14.718  33.269 0.95  0.00 ? 207 ASP A H    2  
ATOM   5311   N N    C THR A 1 208 ? 16.018  19.197  17.117 0.05  0.00 ? 208 THR A N    2  
ATOM   5312   N N    O THR A 1 208 ? 31.338  14.006  32.999 0.95  0.00 ? 208 THR A N    2  
ATOM   5313   C CA   C THR A 1 208 ? 15.294  17.975  17.559 0.05  0.00 ? 208 THR A CA   2  
ATOM   5314   C CA   O THR A 1 208 ? 30.176  13.208  32.524 0.95  0.00 ? 208 THR A CA   2  
ATOM   5315   C C    C THR A 1 208 ? 14.440  18.290  18.794 0.05  0.00 ? 208 THR A C    2  
ATOM   5316   C C    O THR A 1 208 ? 28.889  13.709  33.192 0.95  0.00 ? 208 THR A C    2  
ATOM   5317   O O    C THR A 1 208 ? 14.936  18.732  19.822 0.05  0.00 ? 208 THR A O    2  
ATOM   5318   O O    O THR A 1 208 ? 28.762  13.727  34.409 0.95  0.00 ? 208 THR A O    2  
ATOM   5319   H H    C THR A 1 208 ? 16.987  19.259  17.242 0.05  0.00 ? 208 THR A H    2  
ATOM   5320   H H    O THR A 1 208 ? 31.997  13.596  33.597 0.95  0.00 ? 208 THR A H    2  
ATOM   5321   N N    C ASP A 1 209 ? 13.161  18.066  18.685 0.05  0.00 ? 209 ASP A N    2  
ATOM   5322   N N    O ASP A 1 209 ? 27.944  14.117  32.392 0.95  0.00 ? 209 ASP A N    2  
ATOM   5323   C CA   C ASP A 1 209 ? 12.196  18.287  19.762 0.05  0.00 ? 209 ASP A CA   2  
ATOM   5324   C CA   O ASP A 1 209 ? 26.643  14.608  32.846 0.95  0.00 ? 209 ASP A CA   2  
ATOM   5325   C C    C ASP A 1 209 ? 11.625  16.946  20.205 0.05  0.00 ? 209 ASP A C    2  
ATOM   5326   C C    O ASP A 1 209 ? 25.558  13.635  32.402 0.95  0.00 ? 209 ASP A C    2  
ATOM   5327   O O    C ASP A 1 209 ? 12.138  15.895  19.808 0.05  0.00 ? 209 ASP A O    2  
ATOM   5328   O O    O ASP A 1 209 ? 25.869  12.532  31.943 0.95  0.00 ? 209 ASP A O    2  
ATOM   5329   H H    C ASP A 1 209 ? 12.826  17.716  17.832 0.05  0.00 ? 209 ASP A H    2  
ATOM   5330   H H    O ASP A 1 209 ? 28.111  14.081  31.426 0.95  0.00 ? 209 ASP A H    2  
ATOM   5331   N N    C TYR A 1 210 ? 10.577  16.993  21.000 0.05  0.00 ? 210 TYR A N    2  
ATOM   5332   N N    O TYR A 1 210 ? 24.316  14.051  32.527 0.95  0.00 ? 210 TYR A N    2  
ATOM   5333   C CA   C TYR A 1 210 ? 9.924   15.802  21.546 0.05  0.00 ? 210 TYR A CA   2  
ATOM   5334   C CA   O TYR A 1 210 ? 23.152  13.234  32.180 0.95  0.00 ? 210 TYR A CA   2  
ATOM   5335   C C    C TYR A 1 210 ? 9.346   14.898  20.461 0.05  0.00 ? 210 TYR A C    2  
ATOM   5336   C C    O TYR A 1 210 ? 23.117  12.856  30.703 0.95  0.00 ? 210 TYR A C    2  
ATOM   5337   O O    C TYR A 1 210 ? 9.579   13.691  20.487 0.05  0.00 ? 210 TYR A O    2  
ATOM   5338   O O    O TYR A 1 210 ? 22.919  11.687  30.378 0.95  0.00 ? 210 TYR A O    2  
ATOM   5339   H H    C TYR A 1 210 ? 10.229  17.871  21.256 0.05  0.00 ? 210 TYR A H    2  
ATOM   5340   H H    O TYR A 1 210 ? 24.161  14.947  32.891 0.95  0.00 ? 210 TYR A H    2  
ATOM   5341   N N    C CYS A 1 211 ? 8.597   15.494  19.570 0.05  0.00 ? 211 CYS A N    2  
ATOM   5342   N N    O CYS A 1 211 ? 23.280  13.845  29.863 0.95  0.00 ? 211 CYS A N    2  
ATOM   5343   C CA   C CYS A 1 211 ? 7.908   14.821  18.473 0.05  0.00 ? 211 CYS A CA   2  
ATOM   5344   C CA   O CYS A 1 211 ? 23.238  13.723  28.409 0.95  0.00 ? 211 CYS A CA   2  
ATOM   5345   C C    C CYS A 1 211 ? 8.894   14.180  17.525 0.05  0.00 ? 211 CYS A C    2  
ATOM   5346   C C    O CYS A 1 211 ? 24.353  12.836  27.908 0.95  0.00 ? 211 CYS A C    2  
ATOM   5347   O O    C CYS A 1 211 ? 8.595   13.063  17.069 0.05  0.00 ? 211 CYS A O    2  
ATOM   5348   O O    O CYS A 1 211 ? 24.080  12.057  26.978 0.95  0.00 ? 211 CYS A O    2  
ATOM   5349   C CB   C CYS A 1 211 ? 6.994   15.842  17.769 0.05  0.00 ? 211 CYS A CB   2  
ATOM   5350   C CB   O CYS A 1 211 ? 23.290  15.136  27.797 0.95  0.00 ? 211 CYS A CB   2  
ATOM   5351   S SG   A CYS A 1 211 ? 22.617  15.132  26.121 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5352   S SG   B CYS A 1 211 ? 21.623  15.782  27.534 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5353   S SG   C CYS A 1 211 ? 22.394  15.187  26.227 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5354   S SG   D CYS A 1 211 ? 23.510  16.384  29.085 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5355   S SG   E CYS A 1 211 ? 21.669  15.620  27.163 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5356   S SG   F CYS A 1 211 ? 21.843  15.436  26.756 0.16  0.00 ? 211 CYS A SG   2  
ATOM   5357   S SG   U CYS A 1 211 ? 5.280   15.640  18.302 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5358   S SG   V CYS A 1 211 ? 7.434   15.999  16.024 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5359   S SG   W CYS A 1 211 ? 7.465   16.033  16.034 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5360   S SG   X CYS A 1 211 ? 5.292   15.690  18.356 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5361   S SG   Y CYS A 1 211 ? 5.999   15.039  16.493 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5362   S SG   Z CYS A 1 211 ? 5.614   15.009  16.951 0.010 0.00 ? 211 CYS A SG   2  
ATOM   5363   H H    C CYS A 1 211 ? 8.489   16.495  19.645 0.05  0.00 ? 211 CYS A H    2  
ATOM   5364   H H    O CYS A 1 211 ? 23.448  14.763  30.250 0.95  0.00 ? 211 CYS A H    2  
ATOM   5365   N N    C ILE A 1 212 ? 9.891   14.906  17.119 0.05  0.00 ? 212 ILE A N    2  
ATOM   5366   N N    O ILE A 1 212 ? 25.549  13.068  28.356 0.95  0.00 ? 212 ILE A N    2  
ATOM   5367   C CA   C ILE A 1 212 ? 10.882  14.447  16.159 0.05  0.00 ? 212 ILE A CA   2  
ATOM   5368   C CA   O ILE A 1 212 ? 26.728  12.340  27.916 0.95  0.00 ? 212 ILE A CA   2  
ATOM   5369   C C    C ILE A 1 212 ? 11.643  13.246  16.704 0.05  0.00 ? 212 ILE A C    2  
ATOM   5370   C C    O ILE A 1 212 ? 26.607  10.862  28.260 0.95  0.00 ? 212 ILE A C    2  
ATOM   5371   O O    C ILE A 1 212 ? 11.762  12.263  15.942 0.05  0.00 ? 212 ILE A O    2  
ATOM   5372   O O    O ILE A 1 212 ? 26.868  10.049  27.348 0.95  0.00 ? 212 ILE A O    2  
ATOM   5373   H H    C ILE A 1 212 ? 9.986   15.807  17.492 0.05  0.00 ? 212 ILE A H    2  
ATOM   5374   H H    O ILE A 1 212 ? 25.658  13.763  29.037 0.95  0.00 ? 212 ILE A H    2  
ATOM   5375   N N    C ALA A 1 213 ? 12.184  13.310  17.903 0.05  0.00 ? 213 ALA A N    2  
ATOM   5376   N N    O ALA A 1 213 ? 26.298  10.504  29.490 0.95  0.00 ? 213 ALA A N    2  
ATOM   5377   C CA   C ALA A 1 213 ? 12.945  12.181  18.450 0.05  0.00 ? 213 ALA A CA   2  
ATOM   5378   C CA   O ALA A 1 213 ? 26.197  9.089   29.863 0.95  0.00 ? 213 ALA A CA   2  
ATOM   5379   C C    C ALA A 1 213 ? 12.095  10.931  18.642 0.05  0.00 ? 213 ALA A C    2  
ATOM   5380   C C    O ALA A 1 213 ? 25.085  8.359   29.119 0.95  0.00 ? 213 ALA A C    2  
ATOM   5381   O O    C ALA A 1 213 ? 12.577  9.785   18.502 0.05  0.00 ? 213 ALA A O    2  
ATOM   5382   O O    O ALA A 1 213 ? 25.189  7.151   28.810 0.95  0.00 ? 213 ALA A O    2  
ATOM   5383   H H    C ALA A 1 213 ? 12.090  14.130  18.432 0.05  0.00 ? 213 ALA A H    2  
ATOM   5384   H H    O ALA A 1 213 ? 26.149  11.194  30.170 0.95  0.00 ? 213 ALA A H    2  
ATOM   5385   N N    C GLU A 1 214 ? 10.868  11.137  19.036 0.05  0.00 ? 214 GLU A N    2  
ATOM   5386   N N    O GLU A 1 214 ? 24.000  9.051   28.903 0.95  0.00 ? 214 GLU A N    2  
ATOM   5387   C CA   C GLU A 1 214 ? 9.911   10.109  19.306 0.05  0.00 ? 214 GLU A CA   2  
ATOM   5388   C CA   O GLU A 1 214 ? 22.827  8.554   28.253 0.95  0.00 ? 214 GLU A CA   2  
ATOM   5389   C C    C GLU A 1 214 ? 9.533   9.332   18.029 0.05  0.00 ? 214 GLU A C    2  
ATOM   5390   C C    O GLU A 1 214 ? 23.094  8.222   26.771 0.95  0.00 ? 214 GLU A C    2  
ATOM   5391   O O    C GLU A 1 214 ? 9.457   8.116   18.089 0.05  0.00 ? 214 GLU A O    2  
ATOM   5392   O O    O GLU A 1 214 ? 22.644  7.182   26.318 0.95  0.00 ? 214 GLU A O    2  
ATOM   5393   H H    C GLU A 1 214 ? 10.587  12.065  19.177 0.05  0.00 ? 214 GLU A H    2  
ATOM   5394   H H    O GLU A 1 214 ? 23.980  9.975   29.229 0.95  0.00 ? 214 GLU A H    2  
ATOM   5395   N N    C ALA A 1 215 ? 9.272   10.044  16.975 0.05  0.00 ? 215 ALA A N    2  
ATOM   5396   N N    O ALA A 1 215 ? 23.750  9.110   26.088 0.95  0.00 ? 215 ALA A N    2  
ATOM   5397   C CA   C ALA A 1 215 ? 8.890   9.469   15.688 0.05  0.00 ? 215 ALA A CA   2  
ATOM   5398   C CA   O ALA A 1 215 ? 24.079  8.958   24.673 0.95  0.00 ? 215 ALA A CA   2  
ATOM   5399   C C    C ALA A 1 215 ? 10.090  8.699   15.129 0.05  0.00 ? 215 ALA A C    2  
ATOM   5400   C C    O ALA A 1 215 ? 25.078  7.806   24.533 0.95  0.00 ? 215 ALA A C    2  
ATOM   5401   O O    C ALA A 1 215 ? 9.869   7.598   14.577 0.05  0.00 ? 215 ALA A O    2  
ATOM   5402   O O    O ALA A 1 215 ? 24.926  7.018   23.572 0.95  0.00 ? 215 ALA A O    2  
ATOM   5403   H H    C ALA A 1 215 ? 9.329   11.019  17.048 0.05  0.00 ? 215 ALA A H    2  
ATOM   5404   H H    O ALA A 1 215 ? 24.034  9.929   26.544 0.95  0.00 ? 215 ALA A H    2  
ATOM   5405   N N    C ALA A 1 216 ? 11.248  9.254   15.309 0.05  0.00 ? 216 ALA A N    2  
ATOM   5406   N N    O ALA A 1 216 ? 25.987  7.734   25.454 0.95  0.00 ? 216 ALA A N    2  
ATOM   5407   C CA   C ALA A 1 216 ? 12.505  8.690   14.833 0.05  0.00 ? 216 ALA A CA   2  
ATOM   5408   C CA   O ALA A 1 216 ? 27.039  6.725   25.485 0.95  0.00 ? 216 ALA A CA   2  
ATOM   5409   C C    C ALA A 1 216 ? 12.803  7.361   15.488 0.05  0.00 ? 216 ALA A C    2  
ATOM   5410   C C    O ALA A 1 216 ? 26.471  5.333   25.638 0.95  0.00 ? 216 ALA A C    2  
ATOM   5411   O O    C ALA A 1 216 ? 13.194  6.387   14.795 0.05  0.00 ? 216 ALA A O    2  
ATOM   5412   O O    O ALA A 1 216 ? 26.894  4.393   24.917 0.95  0.00 ? 216 ALA A O    2  
ATOM   5413   H H    C ALA A 1 216 ? 11.278  10.112  15.781 0.05  0.00 ? 216 ALA A H    2  
ATOM   5414   H H    O ALA A 1 216 ? 25.975  8.408   26.165 0.95  0.00 ? 216 ALA A H    2  
ATOM   5415   N N    C PHE A 1 217 ? 12.655  7.313   16.813 0.05  0.00 ? 217 PHE A N    2  
ATOM   5416   N N    O PHE A 1 217 ? 25.544  5.178   26.585 0.95  0.00 ? 217 PHE A N    2  
ATOM   5417   C CA   C PHE A 1 217 ? 12.869  6.052   17.534 0.05  0.00 ? 217 PHE A CA   2  
ATOM   5418   C CA   O PHE A 1 217 ? 24.894  3.876   26.775 0.95  0.00 ? 217 PHE A CA   2  
ATOM   5419   C C    C PHE A 1 217 ? 11.806  5.016   17.133 0.05  0.00 ? 217 PHE A C    2  
ATOM   5420   C C    O PHE A 1 217 ? 24.047  3.512   25.544 0.95  0.00 ? 217 PHE A C    2  
ATOM   5421   O O    C PHE A 1 217 ? 12.120  3.820   16.962 0.05  0.00 ? 217 PHE A O    2  
ATOM   5422   O O    O PHE A 1 217 ? 24.031  2.342   25.109 0.95  0.00 ? 217 PHE A O    2  
ATOM   5423   H H    C PHE A 1 217 ? 12.369  8.112   17.302 0.05  0.00 ? 217 PHE A H    2  
ATOM   5424   H H    O PHE A 1 217 ? 25.271  5.944   27.131 0.95  0.00 ? 217 PHE A H    2  
ATOM   5425   N N    C ASN A 1 218 ? 10.580  5.430   17.048 0.05  0.00 ? 218 ASN A N    2  
ATOM   5426   N N    O ASN A 1 218 ? 23.315  4.452   25.033 0.95  0.00 ? 218 ASN A N    2  
ATOM   5427   C CA   C ASN A 1 218 ? 9.443   4.587   16.730 0.05  0.00 ? 218 ASN A CA   2  
ATOM   5428   C CA   O ASN A 1 218 ? 22.420  4.280   23.904 0.95  0.00 ? 218 ASN A CA   2  
ATOM   5429   C C    C ASN A 1 218 ? 9.426   4.073   15.299 0.05  0.00 ? 218 ASN A C    2  
ATOM   5430   C C    O ASN A 1 218 ? 23.124  4.033   22.579 0.95  0.00 ? 218 ASN A C    2  
ATOM   5431   O O    C ASN A 1 218 ? 8.765   3.047   15.019 0.05  0.00 ? 218 ASN A O    2  
ATOM   5432   O O    O ASN A 1 218 ? 22.504  3.477   21.644 0.95  0.00 ? 218 ASN A O    2  
ATOM   5433   H H    C ASN A 1 218 ? 10.406  6.375   17.241 0.05  0.00 ? 218 ASN A H    2  
ATOM   5434   H H    O ASN A 1 218 ? 23.347  5.334   25.458 0.95  0.00 ? 218 ASN A H    2  
ATOM   5435   N N    C LYS A 1 219 ? 10.141  4.707   14.416 0.05  0.00 ? 219 LYS A N    2  
ATOM   5436   N N    O LYS A 1 219 ? 24.374  4.380   22.480 0.95  0.00 ? 219 LYS A N    2  
ATOM   5437   C CA   C LYS A 1 219 ? 10.290  4.333   13.020 0.05  0.00 ? 219 LYS A CA   2  
ATOM   5438   C CA   O LYS A 1 219 ? 25.221  4.174   21.317 0.95  0.00 ? 219 LYS A CA   2  
ATOM   5439   C C    C LYS A 1 219 ? 11.553  3.525   12.800 0.05  0.00 ? 219 LYS A C    2  
ATOM   5440   C C    O LYS A 1 219 ? 26.050  2.914   21.458 0.95  0.00 ? 219 LYS A C    2  
ATOM   5441   O O    C LYS A 1 219 ? 11.923  3.140   11.676 0.05  0.00 ? 219 LYS A O    2  
ATOM   5442   O O    O LYS A 1 219 ? 26.892  2.559   20.613 0.95  0.00 ? 219 LYS A O    2  
ATOM   5443   H H    C LYS A 1 219 ? 10.650  5.485   14.728 0.05  0.00 ? 219 LYS A H    2  
ATOM   5444   H H    O LYS A 1 219 ? 24.790  4.785   23.270 0.95  0.00 ? 219 LYS A H    2  
ATOM   5445   N N    C GLY A 1 220 ? 12.245  3.240   13.884 0.05  0.00 ? 220 GLY A N    2  
ATOM   5446   N N    O GLY A 1 220 ? 25.820  2.196   22.539 0.95  0.00 ? 220 GLY A N    2  
ATOM   5447   C CA   C GLY A 1 220 ? 13.497  2.478   13.855 0.05  0.00 ? 220 GLY A CA   2  
ATOM   5448   C CA   O GLY A 1 220 ? 26.539  0.955   22.842 0.95  0.00 ? 220 GLY A CA   2  
ATOM   5449   C C    C GLY A 1 220 ? 14.627  3.174   13.145 0.05  0.00 ? 220 GLY A C    2  
ATOM   5450   C C    O GLY A 1 220 ? 28.008  1.141   23.106 0.95  0.00 ? 220 GLY A C    2  
ATOM   5451   O O    C GLY A 1 220 ? 15.617  2.528   12.764 0.05  0.00 ? 220 GLY A O    2  
ATOM   5452   O O    O GLY A 1 220 ? 28.781  0.170   23.049 0.95  0.00 ? 220 GLY A O    2  
ATOM   5453   H H    C GLY A 1 220 ? 11.911  3.558   14.750 0.05  0.00 ? 220 GLY A H    2  
ATOM   5454   H H    O GLY A 1 220 ? 25.142  2.511   23.174 0.95  0.00 ? 220 GLY A H    2  
ATOM   5455   N N    C GLU A 1 221 ? 14.530  4.492   12.981 0.05  0.00 ? 221 GLU A N    2  
ATOM   5456   N N    O GLU A 1 221 ? 28.424  2.364   23.432 0.95  0.00 ? 221 GLU A N    2  
ATOM   5457   C CA   C GLU A 1 221 ? 15.568  5.288   12.323 0.05  0.00 ? 221 GLU A CA   2  
ATOM   5458   C CA   O GLU A 1 221 ? 29.824  2.673   23.729 0.95  0.00 ? 221 GLU A CA   2  
ATOM   5459   C C    C GLU A 1 221 ? 16.742  5.597   13.219 0.05  0.00 ? 221 GLU A C    2  
ATOM   5460   C C    O GLU A 1 221 ? 30.238  2.280   25.126 0.95  0.00 ? 221 GLU A C    2  
ATOM   5461   O O    C GLU A 1 221 ? 17.873  5.761   12.766 0.05  0.00 ? 221 GLU A O    2  
ATOM   5462   O O    O GLU A 1 221 ? 31.397  1.964   25.390 0.95  0.00 ? 221 GLU A O    2  
ATOM   5463   H H    C GLU A 1 221 ? 13.735  4.951   13.326 0.05  0.00 ? 221 GLU A H    2  
ATOM   5464   H H    O GLU A 1 221 ? 27.762  3.086   23.486 0.95  0.00 ? 221 GLU A H    2  
ATOM   5465   N N    C THR A 1 222 ? 16.539  5.670   14.523 0.05  0.00 ? 222 THR A N    2  
ATOM   5466   N N    O THR A 1 222 ? 29.319  2.260   26.075 0.95  0.00 ? 222 THR A N    2  
ATOM   5467   C CA   C THR A 1 222 ? 17.616  5.978   15.459 0.05  0.00 ? 222 THR A CA   2  
ATOM   5468   C CA   O THR A 1 222 ? 29.637  1.905   27.455 0.95  0.00 ? 222 THR A CA   2  
ATOM   5469   C C    C THR A 1 222 ? 17.735  4.862   16.485 0.05  0.00 ? 222 THR A C    2  
ATOM   5470   C C    O THR A 1 222 ? 28.775  0.732   27.893 0.95  0.00 ? 222 THR A C    2  
ATOM   5471   O O    C THR A 1 222 ? 16.701  4.303   16.866 0.05  0.00 ? 222 THR A O    2  
ATOM   5472   O O    O THR A 1 222 ? 27.616  0.666   27.470 0.95  0.00 ? 222 THR A O    2  
ATOM   5473   H H    C THR A 1 222 ? 15.634  5.521   14.871 0.05  0.00 ? 222 THR A H    2  
ATOM   5474   H H    O THR A 1 222 ? 28.396  2.499   25.846 0.95  0.00 ? 222 THR A H    2  
ATOM   5475   N N    C ALA A 1 223 ? 18.923  4.559   16.979 0.05  0.00 ? 223 ALA A N    2  
ATOM   5476   N N    O ALA A 1 223 ? 29.264  -0.149  28.748 0.95  0.00 ? 223 ALA A N    2  
ATOM   5477   C CA   C ALA A 1 223 ? 19.114  3.472   17.905 0.05  0.00 ? 223 ALA A CA   2  
ATOM   5478   C CA   O ALA A 1 223 ? 28.524  -1.317  29.154 0.95  0.00 ? 223 ALA A CA   2  
ATOM   5479   C C    C ALA A 1 223 ? 18.683  3.729   19.357 0.05  0.00 ? 223 ALA A C    2  
ATOM   5480   C C    O ALA A 1 223 ? 27.400  -1.091  30.177 0.95  0.00 ? 223 ALA A C    2  
ATOM   5481   O O    C ALA A 1 223 ? 18.334  2.759   20.039 0.05  0.00 ? 223 ALA A O    2  
ATOM   5482   O O    O ALA A 1 223 ? 26.444  -1.874  30.170 0.95  0.00 ? 223 ALA A O    2  
ATOM   5483   H H    C ALA A 1 223 ? 19.705  5.062   16.672 0.05  0.00 ? 223 ALA A H    2  
ATOM   5484   H H    O ALA A 1 223 ? 30.176  -0.027  29.083 0.95  0.00 ? 223 ALA A H    2  
ATOM   5485   N N    C MET A 1 224 ? 18.755  4.961   19.782 0.05  0.00 ? 224 MET A N    2  
ATOM   5486   N N    O MET A 1 224 ? 27.558  -0.102  31.014 0.95  0.00 ? 224 MET A N    2  
ATOM   5487   C CA   C MET A 1 224 ? 18.432  5.295   21.185 0.05  0.00 ? 224 MET A CA   2  
ATOM   5488   C CA   O MET A 1 224 ? 26.567  0.148   32.081 0.95  0.00 ? 224 MET A CA   2  
ATOM   5489   C C    C MET A 1 224 ? 17.624  6.590   21.249 0.05  0.00 ? 224 MET A C    2  
ATOM   5490   C C    O MET A 1 224 ? 26.312  1.647   32.227 0.95  0.00 ? 224 MET A C    2  
ATOM   5491   O O    C MET A 1 224 ? 17.674  7.409   20.342 0.05  0.00 ? 224 MET A O    2  
ATOM   5492   O O    O MET A 1 224 ? 27.139  2.466   31.853 0.95  0.00 ? 224 MET A O    2  
ATOM   5493   H H    C MET A 1 224 ? 19.071  5.663   19.177 0.05  0.00 ? 224 MET A H    2  
ATOM   5494   H H    O MET A 1 224 ? 28.365  0.450   30.963 0.95  0.00 ? 224 MET A H    2  
ATOM   5495   N N    C THR A 1 225 ? 17.030  6.756   22.410 0.05  0.00 ? 225 THR A N    2  
ATOM   5496   N N    O THR A 1 225 ? 25.218  1.908   32.908 0.95  0.00 ? 225 THR A N    2  
ATOM   5497   C CA   C THR A 1 225 ? 16.258  7.907   22.831 0.05  0.00 ? 225 THR A CA   2  
ATOM   5498   C CA   O THR A 1 225 ? 24.730  3.215   33.296 0.95  0.00 ? 225 THR A CA   2  
ATOM   5499   C C    C THR A 1 225 ? 16.325  7.998   24.361 0.05  0.00 ? 225 THR A C    2  
ATOM   5500   C C    O THR A 1 225 ? 23.879  3.055   34.562 0.95  0.00 ? 225 THR A C    2  
ATOM   5501   O O    C THR A 1 225 ? 16.839  7.134   25.038 0.05  0.00 ? 225 THR A O    2  
ATOM   5502   O O    O THR A 1 225 ? 23.594  1.968   35.016 0.95  0.00 ? 225 THR A O    2  
ATOM   5503   H H    C THR A 1 225 ? 17.167  6.053   23.078 0.05  0.00 ? 225 THR A H    2  
ATOM   5504   H H    O THR A 1 225 ? 24.707  1.137   33.231 0.95  0.00 ? 225 THR A H    2  
ATOM   5505   N N    C ILE A 1 226 ? 15.957  9.186   24.845 0.05  0.00 ? 226 ILE A N    2  
ATOM   5506   N N    O ILE A 1 226 ? 23.663  4.200   35.212 0.95  0.00 ? 226 ILE A N    2  
ATOM   5507   C CA   C ILE A 1 226 ? 15.914  9.489   26.303 0.05  0.00 ? 226 ILE A CA   2  
ATOM   5508   C CA   O ILE A 1 226 ? 22.836  4.287   36.448 0.95  0.00 ? 226 ILE A CA   2  
ATOM   5509   C C    C ILE A 1 226 ? 14.489  9.891   26.561 0.05  0.00 ? 226 ILE A C    2  
ATOM   5510   C C    O ILE A 1 226 ? 21.745  5.261   36.103 0.95  0.00 ? 226 ILE A C    2  
ATOM   5511   O O    C ILE A 1 226 ? 14.019  10.853  25.920 0.05  0.00 ? 226 ILE A O    2  
ATOM   5512   O O    O ILE A 1 226 ? 22.069  6.409   35.736 0.95  0.00 ? 226 ILE A O    2  
ATOM   5513   H H    C ILE A 1 226 ? 15.684  9.883   24.213 0.05  0.00 ? 226 ILE A H    2  
ATOM   5514   H H    O ILE A 1 226 ? 24.049  5.024   34.848 0.95  0.00 ? 226 ILE A H    2  
ATOM   5515   N N    C ASN A 1 227 ? 13.793  9.086   27.374 0.05  0.00 ? 227 ASN A N    2  
ATOM   5516   N N    O ASN A 1 227 ? 20.501  4.765   36.091 0.95  0.00 ? 227 ASN A N    2  
ATOM   5517   C CA   C ASN A 1 227 ? 12.385  9.385   27.631 0.05  0.00 ? 227 ASN A CA   2  
ATOM   5518   C CA   O ASN A 1 227 ? 19.393  5.641   35.714 0.95  0.00 ? 227 ASN A CA   2  
ATOM   5519   C C    C ASN A 1 227 ? 11.985  8.721   28.967 0.05  0.00 ? 227 ASN A C    2  
ATOM   5520   C C    O ASN A 1 227 ? 18.092  5.061   36.311 0.95  0.00 ? 227 ASN A C    2  
ATOM   5521   O O    C ASN A 1 227 ? 12.818  8.067   29.600 0.05  0.00 ? 227 ASN A O    2  
ATOM   5522   O O    O ASN A 1 227 ? 18.131  4.017   36.968 0.95  0.00 ? 227 ASN A O    2  
ATOM   5523   H H    C ASN A 1 227 ? 14.211  8.291   27.763 0.05  0.00 ? 227 ASN A H    2  
ATOM   5524   H H    O ASN A 1 227 ? 20.340  3.822   36.299 0.95  0.00 ? 227 ASN A H    2  
ATOM   5525   N N    C GLY A 1 228 ? 10.769  8.986   29.352 0.05  0.00 ? 228 GLY A N    2  
ATOM   5526   N N    O GLY A 1 228 ? 17.038  5.802   36.116 0.95  0.00 ? 228 GLY A N    2  
ATOM   5527   C CA   C GLY A 1 228 ? 10.240  8.522   30.647 0.05  0.00 ? 228 GLY A CA   2  
ATOM   5528   C CA   O GLY A 1 228 ? 15.725  5.462   36.694 0.95  0.00 ? 228 GLY A CA   2  
ATOM   5529   C C    C GLY A 1 228 ? 9.167   7.490   30.451 0.05  0.00 ? 228 GLY A C    2  
ATOM   5530   C C    O GLY A 1 228 ? 14.748  5.078   35.620 0.95  0.00 ? 228 GLY A C    2  
ATOM   5531   O O    C GLY A 1 228 ? 8.804   7.230   29.306 0.05  0.00 ? 228 GLY A O    2  
ATOM   5532   O O    O GLY A 1 228 ? 15.098  5.174   34.446 0.95  0.00 ? 228 GLY A O    2  
ATOM   5533   H H    C GLY A 1 228 ? 10.211  9.565   28.793 0.05  0.00 ? 228 GLY A H    2  
ATOM   5534   H H    O GLY A 1 228 ? 17.135  6.643   35.624 0.95  0.00 ? 228 GLY A H    2  
ATOM   5535   N N    C PRO A 1 229 ? 8.634   7.001   31.585 0.05  0.00 ? 229 PRO A N    2  
ATOM   5536   N N    O PRO A 1 229 ? 13.523  4.740   36.060 0.95  0.00 ? 229 PRO A N    2  
ATOM   5537   C CA   C PRO A 1 229 ? 7.630   5.934   31.589 0.05  0.00 ? 229 PRO A CA   2  
ATOM   5538   C CA   O PRO A 1 229 ? 12.465  4.267   35.164 0.95  0.00 ? 229 PRO A CA   2  
ATOM   5539   C C    C PRO A 1 229 ? 6.396   6.235   30.842 0.05  0.00 ? 229 PRO A C    2  
ATOM   5540   C C    O PRO A 1 229 ? 12.095  5.203   34.086 0.95  0.00 ? 229 PRO A C    2  
ATOM   5541   O O    C PRO A 1 229 ? 5.691   5.338   30.309 0.05  0.00 ? 229 PRO A O    2  
ATOM   5542   O O    O PRO A 1 229 ? 11.633  4.814   32.981 0.95  0.00 ? 229 PRO A O    2  
ATOM   5543   N N    C TRP A 1 230 ? 6.056   7.525   30.720 0.05  0.00 ? 230 TRP A N    2  
ATOM   5544   N N    O TRP A 1 230 ? 12.297  6.507   34.315 0.95  0.00 ? 230 TRP A N    2  
ATOM   5545   C CA   C TRP A 1 230 ? 4.886   7.905   29.959 0.05  0.00 ? 230 TRP A CA   2  
ATOM   5546   C CA   O TRP A 1 230 ? 12.006  7.484   33.288 0.95  0.00 ? 230 TRP A CA   2  
ATOM   5547   C C    C TRP A 1 230 ? 4.983   7.573   28.475 0.05  0.00 ? 230 TRP A C    2  
ATOM   5548   C C    O TRP A 1 230 ? 12.880  7.351   32.047 0.95  0.00 ? 230 TRP A C    2  
ATOM   5549   O O    C TRP A 1 230 ? 3.946   7.596   27.762 0.05  0.00 ? 230 TRP A O    2  
ATOM   5550   O O    O TRP A 1 230 ? 12.553  7.946   30.988 0.95  0.00 ? 230 TRP A O    2  
ATOM   5551   H H    C TRP A 1 230 ? 6.621   8.218   31.122 0.05  0.00 ? 230 TRP A H    2  
ATOM   5552   H H    O TRP A 1 230 ? 12.675  6.799   35.171 0.95  0.00 ? 230 TRP A H    2  
ATOM   5553   N N    C ALA A 1 231 ? 6.164   7.345   27.948 0.05  0.00 ? 231 ALA A N    2  
ATOM   5554   N N    O ALA A 1 231 ? 14.005  6.678   32.128 0.95  0.00 ? 231 ALA A N    2  
ATOM   5555   C CA   C ALA A 1 231 ? 6.423   7.079   26.544 0.05  0.00 ? 231 ALA A CA   2  
ATOM   5556   C CA   O ALA A 1 231 ? 14.970  6.517   31.054 0.95  0.00 ? 231 ALA A CA   2  
ATOM   5557   C C    C ALA A 1 231 ? 6.336   5.610   26.122 0.05  0.00 ? 231 ALA A C    2  
ATOM   5558   C C    O ALA A 1 231 ? 14.730  5.327   30.122 0.95  0.00 ? 231 ALA A C    2  
ATOM   5559   O O    C ALA A 1 231 ? 6.200   5.372   24.897 0.05  0.00 ? 231 ALA A O    2  
ATOM   5560   O O    O ALA A 1 231 ? 15.302  5.348   29.005 0.95  0.00 ? 231 ALA A O    2  
ATOM   5561   H H    C ALA A 1 231 ? 6.939   7.397   28.546 0.05  0.00 ? 231 ALA A H    2  
ATOM   5562   H H    O ALA A 1 231 ? 14.230  6.285   32.997 0.95  0.00 ? 231 ALA A H    2  
ATOM   5563   N N    C TRP A 1 232 ? 6.400   4.711   27.051 0.05  0.00 ? 232 TRP A N    2  
ATOM   5564   N N    O TRP A 1 232 ? 13.949  4.382   30.539 0.95  0.00 ? 232 TRP A N    2  
ATOM   5565   C CA   C TRP A 1 232 ? 6.362   3.274   26.839 0.05  0.00 ? 232 TRP A CA   2  
ATOM   5566   C CA   O TRP A 1 232 ? 13.627  3.169   29.807 0.95  0.00 ? 232 TRP A CA   2  
ATOM   5567   C C    C TRP A 1 232 ? 5.179   2.836   26.004 0.05  0.00 ? 232 TRP A C    2  
ATOM   5568   C C    O TRP A 1 232 ? 13.131  3.445   28.405 0.95  0.00 ? 232 TRP A C    2  
ATOM   5569   O O    C TRP A 1 232 ? 5.464   2.113   25.008 0.05  0.00 ? 232 TRP A O    2  
ATOM   5570   O O    O TRP A 1 232 ? 13.733  2.815   27.490 0.95  0.00 ? 232 TRP A O    2  
ATOM   5571   H H    C TRP A 1 232 ? 6.501   5.025   27.974 0.05  0.00 ? 232 TRP A H    2  
ATOM   5572   H H    O TRP A 1 232 ? 13.556  4.485   31.431 0.95  0.00 ? 232 TRP A H    2  
ATOM   5573   N N    C SER A 1 233 ? 3.972   3.220   26.302 0.05  0.00 ? 233 SER A N    2  
ATOM   5574   N N    O SER A 1 233 ? 12.171  4.297   28.191 0.95  0.00 ? 233 SER A N    2  
ATOM   5575   C CA   C SER A 1 233 ? 2.798   2.776   25.534 0.05  0.00 ? 233 SER A CA   2  
ATOM   5576   C CA   O SER A 1 233 ? 11.639  4.554   26.843 0.95  0.00 ? 233 SER A CA   2  
ATOM   5577   C C    C SER A 1 233 ? 2.878   3.036   24.031 0.05  0.00 ? 233 SER A C    2  
ATOM   5578   C C    O SER A 1 233 ? 12.686  4.950   25.805 0.95  0.00 ? 233 SER A C    2  
ATOM   5579   O O    C SER A 1 233 ? 2.293   2.279   23.211 0.05  0.00 ? 233 SER A O    2  
ATOM   5580   O O    O SER A 1 233 ? 12.529  4.668   24.587 0.95  0.00 ? 233 SER A O    2  
ATOM   5581   H H    C SER A 1 233 ? 3.837   3.800   27.080 0.05  0.00 ? 233 SER A H    2  
ATOM   5582   H H    O SER A 1 233 ? 11.770  4.762   28.955 0.95  0.00 ? 233 SER A H    2  
ATOM   5583   N N    C ASN A 1 234 ? 3.577   4.067   23.622 0.05  0.00 ? 234 ASN A N    2  
ATOM   5584   N N    O ASN A 1 234 ? 13.754  5.588   26.221 0.95  0.00 ? 234 ASN A N    2  
ATOM   5585   C CA   C ASN A 1 234 ? 3.778   4.500   22.250 0.05  0.00 ? 234 ASN A CA   2  
ATOM   5586   C CA   O ASN A 1 234 ? 14.862  6.063   25.409 0.95  0.00 ? 234 ASN A CA   2  
ATOM   5587   C C    C ASN A 1 234 ? 4.784   3.600   21.526 0.05  0.00 ? 234 ASN A C    2  
ATOM   5588   C C    O ASN A 1 234 ? 15.780  4.908   24.994 0.95  0.00 ? 234 ASN A C    2  
ATOM   5589   O O    C ASN A 1 234 ? 4.588   3.429   20.331 0.05  0.00 ? 234 ASN A O    2  
ATOM   5590   O O    O ASN A 1 234 ? 16.309  5.012   23.897 0.95  0.00 ? 234 ASN A O    2  
ATOM   5591   H H    C ASN A 1 234 ? 4.005   4.608   24.318 0.05  0.00 ? 234 ASN A H    2  
ATOM   5592   H H    O ASN A 1 234 ? 13.807  5.770   27.182 0.95  0.00 ? 234 ASN A H    2  
ATOM   5593   N N    C ILE A 1 235 ? 5.788   3.138   22.214 0.05  0.00 ? 235 ILE A N    2  
ATOM   5594   N N    O ILE A 1 235 ? 15.968  3.946   25.851 0.95  0.00 ? 235 ILE A N    2  
ATOM   5595   C CA   C ILE A 1 235 ? 6.831   2.277   21.675 0.05  0.00 ? 235 ILE A CA   2  
ATOM   5596   C CA   O ILE A 1 235 ? 16.812  2.784   25.614 0.95  0.00 ? 235 ILE A CA   2  
ATOM   5597   C C    C ILE A 1 235 ? 6.288   0.872   21.426 0.05  0.00 ? 235 ILE A C    2  
ATOM   5598   C C    O ILE A 1 235 ? 16.149  1.837   24.617 0.95  0.00 ? 235 ILE A C    2  
ATOM   5599   O O    C ILE A 1 235 ? 6.551   0.273   20.389 0.05  0.00 ? 235 ILE A O    2  
ATOM   5600   O O    O ILE A 1 235 ? 16.796  1.332   23.706 0.95  0.00 ? 235 ILE A O    2  
ATOM   5601   H H    C ILE A 1 235 ? 5.847   3.390   23.160 0.05  0.00 ? 235 ILE A H    2  
ATOM   5602   H H    O ILE A 1 235 ? 15.512  4.011   26.717 0.95  0.00 ? 235 ILE A H    2  
ATOM   5603   N N    C ASP A 1 236 ? 5.504   0.390   22.371 0.05  0.00 ? 236 ASP A N    2  
ATOM   5604   N N    O ASP A 1 236 ? 14.855  1.647   24.788 0.95  0.00 ? 236 ASP A N    2  
ATOM   5605   C CA   C ASP A 1 236 ? 4.835   -0.906  22.333 0.05  0.00 ? 236 ASP A CA   2  
ATOM   5606   C CA   O ASP A 1 236 ? 14.003  0.824   23.937 0.95  0.00 ? 236 ASP A CA   2  
ATOM   5607   C C    C ASP A 1 236 ? 4.114   -1.004  20.976 0.05  0.00 ? 236 ASP A C    2  
ATOM   5608   C C    O ASP A 1 236 ? 14.265  1.256   22.482 0.95  0.00 ? 236 ASP A C    2  
ATOM   5609   O O    C ASP A 1 236 ? 4.318   -1.942  20.206 0.05  0.00 ? 236 ASP A O    2  
ATOM   5610   O O    O ASP A 1 236 ? 14.606  0.445   21.622 0.95  0.00 ? 236 ASP A O    2  
ATOM   5611   H H    C ASP A 1 236 ? 5.334   0.962   23.148 0.05  0.00 ? 236 ASP A H    2  
ATOM   5612   H H    O ASP A 1 236 ? 14.426  2.120   25.531 0.95  0.00 ? 236 ASP A H    2  
ATOM   5613   N N    C THR A 1 237 ? 3.270   -0.043  20.720 0.05  0.00 ? 237 THR A N    2  
ATOM   5614   N N    O THR A 1 237 ? 14.079  2.523   22.232 0.95  0.00 ? 237 THR A N    2  
ATOM   5615   C CA   C THR A 1 237 ? 2.484   0.114   19.519 0.05  0.00 ? 237 THR A CA   2  
ATOM   5616   C CA   O THR A 1 237 ? 14.272  3.187   20.965 0.95  0.00 ? 237 THR A CA   2  
ATOM   5617   C C    C THR A 1 237 ? 3.331   0.023   18.243 0.05  0.00 ? 237 THR A C    2  
ATOM   5618   C C    O THR A 1 237 ? 15.646  2.891   20.347 0.95  0.00 ? 237 THR A C    2  
ATOM   5619   O O    C THR A 1 237 ? 2.964   -0.632  17.229 0.05  0.00 ? 237 THR A O    2  
ATOM   5620   O O    O THR A 1 237 ? 15.797  2.624   19.123 0.95  0.00 ? 237 THR A O    2  
ATOM   5621   H H    C THR A 1 237 ? 3.169   0.650   21.405 0.05  0.00 ? 237 THR A H    2  
ATOM   5622   H H    O THR A 1 237 ? 13.792  3.083   22.983 0.95  0.00 ? 237 THR A H    2  
ATOM   5623   N N    C SER A 1 238 ? 4.456   0.703   18.317 0.05  0.00 ? 238 SER A N    2  
ATOM   5624   N N    O SER A 1 238 ? 16.631  2.958   21.217 0.95  0.00 ? 238 SER A N    2  
ATOM   5625   C CA   C SER A 1 238 ? 5.423   0.831   17.241 0.05  0.00 ? 238 SER A CA   2  
ATOM   5626   C CA   O SER A 1 238 ? 18.036  2.771   20.898 0.95  0.00 ? 238 SER A CA   2  
ATOM   5627   C C    C SER A 1 238 ? 5.944   -0.528  16.798 0.05  0.00 ? 238 SER A C    2  
ATOM   5628   C C    O SER A 1 238 ? 18.290  1.400   20.290 0.95  0.00 ? 238 SER A C    2  
ATOM   5629   O O    C SER A 1 238 ? 6.279   -0.718  15.607 0.05  0.00 ? 238 SER A O    2  
ATOM   5630   O O    O SER A 1 238 ? 19.204  1.242   19.450 0.95  0.00 ? 238 SER A O    2  
ATOM   5631   H H    C SER A 1 238 ? 4.639   1.184   19.152 0.05  0.00 ? 238 SER A H    2  
ATOM   5632   H H    O SER A 1 238 ? 16.402  3.181   22.144 0.95  0.00 ? 238 SER A H    2  
ATOM   5633   N N    C LYS A 1 239 ? 6.042   -1.456  17.717 0.05  0.00 ? 239 LYS A N    2  
ATOM   5634   N N    O LYS A 1 239 ? 17.532  0.416   20.705 0.95  0.00 ? 239 LYS A N    2  
ATOM   5635   C CA   C LYS A 1 239 ? 6.541   -2.807  17.461 0.05  0.00 ? 239 LYS A CA   2  
ATOM   5636   C CA   O LYS A 1 239 ? 17.659  -0.964  20.236 0.95  0.00 ? 239 LYS A CA   2  
ATOM   5637   C C    C LYS A 1 239 ? 8.065   -2.885  17.416 0.05  0.00 ? 239 LYS A C    2  
ATOM   5638   C C    O LYS A 1 239 ? 18.789  -1.729  20.920 0.95  0.00 ? 239 LYS A C    2  
ATOM   5639   O O    C LYS A 1 239 ? 8.652   -3.843  16.875 0.05  0.00 ? 239 LYS A O    2  
ATOM   5640   O O    O LYS A 1 239 ? 19.269  -2.766  20.420 0.95  0.00 ? 239 LYS A O    2  
ATOM   5641   H H    C LYS A 1 239 ? 5.776   -1.227  18.634 0.05  0.00 ? 239 LYS A H    2  
ATOM   5642   H H    O LYS A 1 239 ? 16.847  0.614   21.379 0.95  0.00 ? 239 LYS A H    2  
ATOM   5643   N N    C VAL A 1 240 ? 8.714   -1.898  18.004 0.05  0.00 ? 240 VAL A N    2  
ATOM   5644   N N    O VAL A 1 240 ? 19.202  -1.243  22.075 0.95  0.00 ? 240 VAL A N    2  
ATOM   5645   C CA   C VAL A 1 240 ? 10.168  -1.832  18.108 0.05  0.00 ? 240 VAL A CA   2  
ATOM   5646   C CA   O VAL A 1 240 ? 20.233  -1.870  22.896 0.95  0.00 ? 240 VAL A CA   2  
ATOM   5647   C C    C VAL A 1 240 ? 10.503  -2.751  19.295 0.05  0.00 ? 240 VAL A C    2  
ATOM   5648   C C    O VAL A 1 240 ? 19.490  -2.992  23.641 0.95  0.00 ? 240 VAL A C    2  
ATOM   5649   O O    C VAL A 1 240 ? 9.737   -2.776  20.264 0.05  0.00 ? 240 VAL A O    2  
ATOM   5650   O O    O VAL A 1 240 ? 18.329  -2.793  24.014 0.95  0.00 ? 240 VAL A O    2  
ATOM   5651   H H    C VAL A 1 240 ? 8.188   -1.186  18.425 0.05  0.00 ? 240 VAL A H    2  
ATOM   5652   H H    O VAL A 1 240 ? 18.768  -0.434  22.417 0.95  0.00 ? 240 VAL A H    2  
ATOM   5653   N N    C ASN A 1 241 ? 11.583  -3.472  19.174 0.05  0.00 ? 241 ASN A N    2  
ATOM   5654   N N    O ASN A 1 241 ? 20.149  -4.106  23.803 0.95  0.00 ? 241 ASN A N    2  
ATOM   5655   C CA   C ASN A 1 241 ? 12.078  -4.384  20.212 0.05  0.00 ? 241 ASN A CA   2  
ATOM   5656   C CA   O ASN A 1 241 ? 19.617  -5.275  24.512 0.95  0.00 ? 241 ASN A CA   2  
ATOM   5657   C C    C ASN A 1 241 ? 13.079  -3.539  21.037 0.05  0.00 ? 241 ASN A C    2  
ATOM   5658   C C    O ASN A 1 241 ? 20.105  -5.109  25.972 0.95  0.00 ? 241 ASN A C    2  
ATOM   5659   O O    C ASN A 1 241 ? 14.269  -3.483  20.739 0.05  0.00 ? 241 ASN A O    2  
ATOM   5660   O O    O ASN A 1 241 ? 21.181  -5.568  26.344 0.95  0.00 ? 241 ASN A O    2  
ATOM   5661   H H    C ASN A 1 241 ? 12.104  -3.387  18.350 0.05  0.00 ? 241 ASN A H    2  
ATOM   5662   H H    O ASN A 1 241 ? 21.059  -4.159  23.446 0.95  0.00 ? 241 ASN A H    2  
ATOM   5663   N N    C TYR A 1 242 ? 12.446  -2.930  22.039 0.05  0.00 ? 242 TYR A N    2  
ATOM   5664   N N    O TYR A 1 242 ? 19.209  -4.420  26.677 0.95  0.00 ? 242 TYR A N    2  
ATOM   5665   C CA   C TYR A 1 242 ? 13.194  -1.982  22.909 0.05  0.00 ? 242 TYR A CA   2  
ATOM   5666   C CA   O TYR A 1 242 ? 19.512  -4.053  28.087 0.95  0.00 ? 242 TYR A CA   2  
ATOM   5667   C C    C TYR A 1 242 ? 13.556  -2.460  24.273 0.05  0.00 ? 242 TYR A C    2  
ATOM   5668   C C    O TYR A 1 242 ? 18.812  -4.825  29.152 0.95  0.00 ? 242 TYR A C    2  
ATOM   5669   O O    C TYR A 1 242 ? 12.896  -3.364  24.809 0.05  0.00 ? 242 TYR A O    2  
ATOM   5670   O O    O TYR A 1 242 ? 17.733  -5.386  28.903 0.95  0.00 ? 242 TYR A O    2  
ATOM   5671   H H    C TYR A 1 242 ? 11.482  -3.056  22.160 0.05  0.00 ? 242 TYR A H    2  
ATOM   5672   H H    O TYR A 1 242 ? 18.386  -4.102  26.250 0.95  0.00 ? 242 TYR A H    2  
ATOM   5673   N N    C GLY A 1 243 ? 14.517  -1.836  24.910 0.05  0.00 ? 243 GLY A N    2  
ATOM   5674   N N    O GLY A 1 243 ? 19.319  -4.808  30.360 0.95  0.00 ? 243 GLY A N    2  
ATOM   5675   C CA   C GLY A 1 243 ? 14.999  -2.083  26.259 0.05  0.00 ? 243 GLY A CA   2  
ATOM   5676   C CA   O GLY A 1 243 ? 18.784  -5.431  31.560 0.95  0.00 ? 243 GLY A CA   2  
ATOM   5677   C C    C GLY A 1 243 ? 15.141  -0.651  26.921 0.05  0.00 ? 243 GLY A C    2  
ATOM   5678   C C    O GLY A 1 243 ? 18.909  -4.332  32.693 0.95  0.00 ? 243 GLY A C    2  
ATOM   5679   O O    C GLY A 1 243 ? 15.289  0.305   26.172 0.05  0.00 ? 243 GLY A O    2  
ATOM   5680   O O    O GLY A 1 243 ? 19.753  -3.459  32.543 0.95  0.00 ? 243 GLY A O    2  
ATOM   5681   H H    C GLY A 1 243 ? 14.937  -1.090  24.433 0.05  0.00 ? 243 GLY A H    2  
ATOM   5682   H H    O GLY A 1 243 ? 20.138  -4.282  30.477 0.95  0.00 ? 243 GLY A H    2  
ATOM   5683   N N    C VAL A 1 244 ? 15.042  -0.657  28.209 0.05  0.00 ? 244 VAL A N    2  
ATOM   5684   N N    O VAL A 1 244 ? 18.053  -4.467  33.651 0.95  0.00 ? 244 VAL A N    2  
ATOM   5685   C CA   C VAL A 1 244 ? 15.137  0.518   29.103 0.05  0.00 ? 244 VAL A CA   2  
ATOM   5686   C CA   O VAL A 1 244 ? 17.926  -3.603  34.845 0.95  0.00 ? 244 VAL A CA   2  
ATOM   5687   C C    C VAL A 1 244 ? 16.286  0.260   30.023 0.05  0.00 ? 244 VAL A C    2  
ATOM   5688   C C    O VAL A 1 244 ? 18.141  -4.485  36.033 0.95  0.00 ? 244 VAL A C    2  
ATOM   5689   O O    C VAL A 1 244 ? 16.326  -0.854  30.639 0.05  0.00 ? 244 VAL A O    2  
ATOM   5690   O O    O VAL A 1 244 ? 17.469  -5.564  36.111 0.95  0.00 ? 244 VAL A O    2  
ATOM   5691   H H    C VAL A 1 244 ? 14.892  -1.526  28.636 0.05  0.00 ? 244 VAL A H    2  
ATOM   5692   H H    O VAL A 1 244 ? 17.427  -5.218  33.581 0.95  0.00 ? 244 VAL A H    2  
ATOM   5693   N N    C THR A 1 245 ? 17.233  1.178   30.136 0.05  0.00 ? 245 THR A N    2  
ATOM   5694   N N    O THR A 1 245 ? 19.042  -4.132  36.936 0.95  0.00 ? 245 THR A N    2  
ATOM   5695   C CA   C THR A 1 245 ? 18.389  0.904   30.999 0.05  0.00 ? 245 THR A CA   2  
ATOM   5696   C CA   O THR A 1 245 ? 19.292  -5.023  38.076 0.95  0.00 ? 245 THR A CA   2  
ATOM   5697   C C    C THR A 1 245 ? 18.927  2.163   31.681 0.05  0.00 ? 245 THR A C    2  
ATOM   5698   C C    O THR A 1 245 ? 19.646  -4.261  39.354 0.95  0.00 ? 245 THR A C    2  
ATOM   5699   O O    C THR A 1 245 ? 18.395  3.267   31.468 0.05  0.00 ? 245 THR A O    2  
ATOM   5700   O O    O THR A 1 245 ? 19.707  -3.018  39.346 0.95  0.00 ? 245 THR A O    2  
ATOM   5701   H H    C THR A 1 245 ? 17.180  2.012   29.625 0.05  0.00 ? 245 THR A H    2  
ATOM   5702   H H    O THR A 1 245 ? 19.558  -3.306  36.827 0.95  0.00 ? 245 THR A H    2  
ATOM   5703   N N    C VAL A 1 246 ? 19.969  2.016   32.438 0.05  0.00 ? 246 VAL A N    2  
ATOM   5704   N N    O VAL A 1 246 ? 19.913  -4.973  40.403 0.95  0.00 ? 246 VAL A N    2  
ATOM   5705   C CA   C VAL A 1 246 ? 20.617  3.153   33.109 0.05  0.00 ? 246 VAL A CA   2  
ATOM   5706   C CA   O VAL A 1 246 ? 20.319  -4.367  41.680 0.95  0.00 ? 246 VAL A CA   2  
ATOM   5707   C C    C VAL A 1 246 ? 21.193  4.114   32.061 0.05  0.00 ? 246 VAL A C    2  
ATOM   5708   C C    O VAL A 1 246 ? 21.663  -3.647  41.508 0.95  0.00 ? 246 VAL A C    2  
ATOM   5709   O O    C VAL A 1 246 ? 21.760  3.678   31.056 0.05  0.00 ? 246 VAL A O    2  
ATOM   5710   O O    O VAL A 1 246 ? 22.563  -4.153  40.833 0.95  0.00 ? 246 VAL A O    2  
ATOM   5711   H H    C VAL A 1 246 ? 20.357  1.123   32.540 0.05  0.00 ? 246 VAL A H    2  
ATOM   5712   H H    O VAL A 1 246 ? 19.876  -5.949  40.334 0.95  0.00 ? 246 VAL A H    2  
ATOM   5713   N N    C LEU A 1 247 ? 21.063  5.419   32.299 0.05  0.00 ? 247 LEU A N    2  
ATOM   5714   N N    O LEU A 1 247 ? 21.807  -2.475  42.127 0.95  0.00 ? 247 LEU A N    2  
ATOM   5715   C CA   C LEU A 1 247 ? 21.641  6.439   31.409 0.05  0.00 ? 247 LEU A CA   2  
ATOM   5716   C CA   O LEU A 1 247 ? 23.073  -1.726  42.102 0.95  0.00 ? 247 LEU A CA   2  
ATOM   5717   C C    C LEU A 1 247 ? 23.158  6.278   31.426 0.05  0.00 ? 247 LEU A C    2  
ATOM   5718   C C    O LEU A 1 247 ? 24.136  -2.569  42.800 0.95  0.00 ? 247 LEU A C    2  
ATOM   5719   O O    C LEU A 1 247 ? 23.769  5.813   32.406 0.05  0.00 ? 247 LEU A O    2  
ATOM   5720   O O    O LEU A 1 247 ? 23.857  -3.392  43.691 0.95  0.00 ? 247 LEU A O    2  
ATOM   5721   H H    C LEU A 1 247 ? 20.611  5.709   33.118 0.05  0.00 ? 247 LEU A H    2  
ATOM   5722   H H    O LEU A 1 247 ? 21.061  -2.125  42.657 0.95  0.00 ? 247 LEU A H    2  
ATOM   5723   N N    C PRO A 1 248 ? 23.811  6.768   30.375 0.05  0.00 ? 248 PRO A N    2  
ATOM   5724   N N    O PRO A 1 248 ? 25.400  -2.297  42.484 0.95  0.00 ? 248 PRO A N    2  
ATOM   5725   C CA   C PRO A 1 248 ? 25.250  6.673   30.268 0.05  0.00 ? 248 PRO A CA   2  
ATOM   5726   C CA   O PRO A 1 248 ? 26.500  -3.029  43.072 0.95  0.00 ? 248 PRO A CA   2  
ATOM   5727   C C    C PRO A 1 248 ? 25.958  7.590   31.270 0.05  0.00 ? 248 PRO A C    2  
ATOM   5728   C C    O PRO A 1 248 ? 26.685  -2.688  44.554 0.95  0.00 ? 248 PRO A C    2  
ATOM   5729   O O    C PRO A 1 248 ? 25.354  8.582   31.698 0.05  0.00 ? 248 PRO A O    2  
ATOM   5730   O O    O PRO A 1 248 ? 26.271  -1.599  44.969 0.95  0.00 ? 248 PRO A O    2  
ATOM   5731   N N    C THR A 1 249 ? 27.190  7.281   31.608 0.05  0.00 ? 249 THR A N    2  
ATOM   5732   N N    O THR A 1 249 ? 27.299  -3.573  45.306 0.95  0.00 ? 249 THR A N    2  
ATOM   5733   C CA   C THR A 1 249 ? 27.999  8.098   32.498 0.05  0.00 ? 249 THR A CA   2  
ATOM   5734   C CA   O THR A 1 249 ? 27.597  -3.352  46.712 0.95  0.00 ? 249 THR A CA   2  
ATOM   5735   C C    C THR A 1 249 ? 28.716  9.155   31.668 0.05  0.00 ? 249 THR A C    2  
ATOM   5736   C C    O THR A 1 249 ? 28.941  -2.642  46.817 0.95  0.00 ? 249 THR A C    2  
ATOM   5737   O O    C THR A 1 249 ? 28.786  9.039   30.454 0.05  0.00 ? 249 THR A O    2  
ATOM   5738   O O    O THR A 1 249 ? 29.695  -2.611  45.856 0.95  0.00 ? 249 THR A O    2  
ATOM   5739   H H    C THR A 1 249 ? 27.595  6.483   31.209 0.05  0.00 ? 249 THR A H    2  
ATOM   5740   H H    O THR A 1 249 ? 27.606  -4.405  44.889 0.95  0.00 ? 249 THR A H    2  
ATOM   5741   N N    C PHE A 1 250 ? 29.168  10.220  32.321 0.05  0.00 ? 250 PHE A N    2  
ATOM   5742   N N    O PHE A 1 250 ? 29.192  -2.006  47.956 0.95  0.00 ? 250 PHE A N    2  
ATOM   5743   C CA   C PHE A 1 250 ? 29.927  11.291  31.646 0.05  0.00 ? 250 PHE A CA   2  
ATOM   5744   C CA   O PHE A 1 250 ? 30.477  -1.325  48.207 0.95  0.00 ? 250 PHE A CA   2  
ATOM   5745   C C    C PHE A 1 250 ? 31.077  11.652  32.615 0.05  0.00 ? 250 PHE A C    2  
ATOM   5746   C C    O PHE A 1 250 ? 30.845  -1.671  49.669 0.95  0.00 ? 250 PHE A C    2  
ATOM   5747   O O    C PHE A 1 250 ? 30.856  11.898  33.804 0.05  0.00 ? 250 PHE A O    2  
ATOM   5748   O O    O PHE A 1 250 ? 30.033  -1.516  50.585 0.95  0.00 ? 250 PHE A O    2  
ATOM   5749   H H    C PHE A 1 250 ? 29.023  10.279  33.288 0.05  0.00 ? 250 PHE A H    2  
ATOM   5750   H H    O PHE A 1 250 ? 28.516  -2.020  48.664 0.95  0.00 ? 250 PHE A H    2  
ATOM   5751   N N    C LYS A 1 251 ? 32.291  11.559  32.100 0.05  0.00 ? 251 LYS A N    2  
ATOM   5752   N N    O LYS A 1 251 ? 32.027  -2.242  49.828 0.95  0.00 ? 251 LYS A N    2  
ATOM   5753   C CA   C LYS A 1 251 ? 33.499  11.799  32.890 0.05  0.00 ? 251 LYS A CA   2  
ATOM   5754   C CA   O LYS A 1 251 ? 32.511  -2.697  51.131 0.95  0.00 ? 251 LYS A CA   2  
ATOM   5755   C C    C LYS A 1 251 ? 33.522  10.885  34.095 0.05  0.00 ? 251 LYS A C    2  
ATOM   5756   C C    O LYS A 1 251 ? 31.528  -3.673  51.739 0.95  0.00 ? 251 LYS A C    2  
ATOM   5757   O O    C LYS A 1 251 ? 34.049  11.197  35.151 0.05  0.00 ? 251 LYS A O    2  
ATOM   5758   O O    O LYS A 1 251 ? 31.369  -3.787  52.944 0.95  0.00 ? 251 LYS A O    2  
ATOM   5759   H H    C LYS A 1 251 ? 32.387  11.278  31.167 0.05  0.00 ? 251 LYS A H    2  
ATOM   5760   H H    O LYS A 1 251 ? 32.581  -2.405  49.037 0.95  0.00 ? 251 LYS A H    2  
ATOM   5761   N N    C GLY A 1 252 ? 32.947  9.712   33.860 0.05  0.00 ? 252 GLY A N    2  
ATOM   5762   N N    O GLY A 1 252 ? 30.901  -4.404  50.825 0.95  0.00 ? 252 GLY A N    2  
ATOM   5763   C CA   C GLY A 1 252 ? 32.794  8.629   34.802 0.05  0.00 ? 252 GLY A CA   2  
ATOM   5764   C CA   O GLY A 1 252 ? 29.907  -5.421  51.077 0.95  0.00 ? 252 GLY A CA   2  
ATOM   5765   C C    C GLY A 1 252 ? 31.660  8.865   35.795 0.05  0.00 ? 252 GLY A C    2  
ATOM   5766   C C    O GLY A 1 252 ? 28.544  -4.838  51.438 0.95  0.00 ? 252 GLY A C    2  
ATOM   5767   O O    C GLY A 1 252 ? 31.665  8.227   36.871 0.05  0.00 ? 252 GLY A O    2  
ATOM   5768   O O    O GLY A 1 252 ? 27.627  -5.622  51.768 0.95  0.00 ? 252 GLY A O    2  
ATOM   5769   H H    C GLY A 1 252 ? 32.591  9.568   32.958 0.05  0.00 ? 252 GLY A H    2  
ATOM   5770   H H    O GLY A 1 252 ? 31.136  -4.237  49.889 0.95  0.00 ? 252 GLY A H    2  
ATOM   5771   N N    C GLN A 1 253 ? 30.714  9.706   35.464 0.05  0.00 ? 253 GLN A N    2  
ATOM   5772   N N    O GLN A 1 253 ? 28.386  -3.542  51.359 0.95  0.00 ? 253 GLN A N    2  
ATOM   5773   C CA   C GLN A 1 253 ? 29.585  9.999   36.348 0.05  0.00 ? 253 GLN A CA   2  
ATOM   5774   C CA   O GLN A 1 253 ? 27.120  -2.888  51.694 0.95  0.00 ? 253 GLN A CA   2  
ATOM   5775   C C    C GLN A 1 253 ? 28.272  9.817   35.618 0.05  0.00 ? 253 GLN A C    2  
ATOM   5776   C C    O GLN A 1 253 ? 26.380  -2.478  50.439 0.95  0.00 ? 253 GLN A C    2  
ATOM   5777   O O    C GLN A 1 253 ? 28.100  10.304  34.507 0.05  0.00 ? 253 GLN A O    2  
ATOM   5778   O O    O GLN A 1 253 ? 26.979  -1.983  49.492 0.95  0.00 ? 253 GLN A O    2  
ATOM   5779   H H    C GLN A 1 253 ? 30.767  10.160  34.598 0.05  0.00 ? 253 GLN A H    2  
ATOM   5780   H H    O GLN A 1 253 ? 29.142  -2.990  51.073 0.95  0.00 ? 253 GLN A H    2  
ATOM   5781   N N    C PRO A 1 254 ? 27.310  9.201   36.309 0.05  0.00 ? 254 PRO A N    2  
ATOM   5782   N N    O PRO A 1 254 ? 25.051  -2.591  50.492 0.95  0.00 ? 254 PRO A N    2  
ATOM   5783   C CA   C PRO A 1 254 ? 25.984  9.023   35.744 0.05  0.00 ? 254 PRO A CA   2  
ATOM   5784   C CA   O PRO A 1 254 ? 24.225  -2.207  49.361 0.95  0.00 ? 254 PRO A CA   2  
ATOM   5785   C C    C PRO A 1 254 ? 25.226  10.326  35.682 0.05  0.00 ? 254 PRO A C    2  
ATOM   5786   C C    O PRO A 1 254 ? 24.350  -0.735  49.055 0.95  0.00 ? 254 PRO A C    2  
ATOM   5787   O O    C PRO A 1 254 ? 25.506  11.204  36.496 0.05  0.00 ? 254 PRO A O    2  
ATOM   5788   O O    O PRO A 1 254 ? 24.563  0.040   49.986 0.95  0.00 ? 254 PRO A O    2  
ATOM   5789   N N    C SER A 1 255 ? 24.314  10.476  34.749 0.05  0.00 ? 255 SER A N    2  
ATOM   5790   N N    O SER A 1 255 ? 24.247  -0.344  47.805 0.95  0.00 ? 255 SER A N    2  
ATOM   5791   C CA   C SER A 1 255 ? 23.461  11.668  34.570 0.05  0.00 ? 255 SER A CA   2  
ATOM   5792   C CA   O SER A 1 255 ? 24.233  1.059   47.346 0.95  0.00 ? 255 SER A CA   2  
ATOM   5793   C C    C SER A 1 255 ? 22.243  11.372  35.485 0.05  0.00 ? 255 SER A C    2  
ATOM   5794   C C    O SER A 1 255 ? 22.900  1.606   47.922 0.95  0.00 ? 255 SER A C    2  
ATOM   5795   O O    C SER A 1 255 ? 22.137  10.200  35.892 0.05  0.00 ? 255 SER A O    2  
ATOM   5796   O O    O SER A 1 255 ? 21.976  0.780   48.041 0.95  0.00 ? 255 SER A O    2  
ATOM   5797   H H    C SER A 1 255 ? 24.135  9.707   34.168 0.05  0.00 ? 255 SER A H    2  
ATOM   5798   H H    O SER A 1 255 ? 24.096  -1.038  47.129 0.95  0.00 ? 255 SER A H    2  
ATOM   5799   N N    C LYS A 1 256 ? 21.449  12.371  35.759 0.05  0.00 ? 256 LYS A N    2  
ATOM   5800   N N    O LYS A 1 256 ? 22.866  2.871   48.243 0.95  0.00 ? 256 LYS A N    2  
ATOM   5801   C CA   C LYS A 1 256 ? 20.287  12.200  36.645 0.05  0.00 ? 256 LYS A CA   2  
ATOM   5802   C CA   O LYS A 1 256 ? 21.671  3.469   48.858 0.95  0.00 ? 256 LYS A CA   2  
ATOM   5803   C C    C LYS A 1 256 ? 19.117  13.047  36.220 0.05  0.00 ? 256 LYS A C    2  
ATOM   5804   C C    O LYS A 1 256 ? 21.148  4.639   48.067 0.95  0.00 ? 256 LYS A C    2  
ATOM   5805   O O    C LYS A 1 256 ? 19.159  14.271  36.363 0.05  0.00 ? 256 LYS A O    2  
ATOM   5806   O O    O LYS A 1 256 ? 21.461  5.788   48.388 0.95  0.00 ? 256 LYS A O    2  
ATOM   5807   H H    C LYS A 1 256 ? 21.655  13.261  35.403 0.05  0.00 ? 256 LYS A H    2  
ATOM   5808   H H    O LYS A 1 256 ? 23.666  3.422   48.112 0.95  0.00 ? 256 LYS A H    2  
ATOM   5809   N N    C PRO A 1 257 ? 18.078  12.422  35.702 0.05  0.00 ? 257 PRO A N    2  
ATOM   5810   N N    O PRO A 1 257 ? 20.362  4.371   47.044 0.95  0.00 ? 257 PRO A N    2  
ATOM   5811   C CA   C PRO A 1 257 ? 16.909  13.143  35.272 0.05  0.00 ? 257 PRO A CA   2  
ATOM   5812   C CA   O PRO A 1 257 ? 19.790  5.422   46.244 0.95  0.00 ? 257 PRO A CA   2  
ATOM   5813   C C    C PRO A 1 257 ? 16.085  13.500  36.540 0.05  0.00 ? 257 PRO A C    2  
ATOM   5814   C C    O PRO A 1 257 ? 18.630  6.055   47.061 0.95  0.00 ? 257 PRO A C    2  
ATOM   5815   O O    C PRO A 1 257 ? 16.449  13.002  37.591 0.05  0.00 ? 257 PRO A O    2  
ATOM   5816   O O    O PRO A 1 257 ? 18.122  5.361   47.924 0.95  0.00 ? 257 PRO A O    2  
ATOM   5817   N N    C PHE A 1 258 ? 15.133  14.350  36.349 0.05  0.00 ? 258 PHE A N    2  
ATOM   5818   N N    O PHE A 1 258 ? 18.374  7.288   46.777 0.95  0.00 ? 258 PHE A N    2  
ATOM   5819   C CA   C PHE A 1 258 ? 14.256  14.807  37.458 0.05  0.00 ? 258 PHE A CA   2  
ATOM   5820   C CA   O PHE A 1 258 ? 17.253  8.023   47.417 0.95  0.00 ? 258 PHE A CA   2  
ATOM   5821   C C    C PHE A 1 258 ? 13.244  13.655  37.596 0.05  0.00 ? 258 PHE A C    2  
ATOM   5822   C C    O PHE A 1 258 ? 16.010  7.417   46.740 0.95  0.00 ? 258 PHE A C    2  
ATOM   5823   O O    C PHE A 1 258 ? 12.820  13.060  36.582 0.05  0.00 ? 258 PHE A O    2  
ATOM   5824   O O    O PHE A 1 258 ? 16.035  7.112   45.528 0.95  0.00 ? 258 PHE A O    2  
ATOM   5825   H H    C PHE A 1 258 ? 14.955  14.670  35.440 0.05  0.00 ? 258 PHE A H    2  
ATOM   5826   H H    O PHE A 1 258 ? 18.906  7.739   46.088 0.95  0.00 ? 258 PHE A H    2  
ATOM   5827   N N    C VAL A 1 259 ? 12.852  13.402  38.818 0.05  0.00 ? 259 VAL A N    2  
ATOM   5828   N N    O VAL A 1 259 ? 14.958  7.302   47.509 0.95  0.00 ? 259 VAL A N    2  
ATOM   5829   C CA   C VAL A 1 259 ? 11.899  12.320  39.201 0.05  0.00 ? 259 VAL A CA   2  
ATOM   5830   C CA   O VAL A 1 259 ? 13.641  6.752   47.074 0.95  0.00 ? 259 VAL A CA   2  
ATOM   5831   C C    C VAL A 1 259 ? 10.797  12.921  40.080 0.05  0.00 ? 259 VAL A C    2  
ATOM   5832   C C    O VAL A 1 259 ? 12.629  7.899   46.993 0.95  0.00 ? 259 VAL A C    2  
ATOM   5833   O O    C VAL A 1 259 ? 11.122  13.940  40.758 0.05  0.00 ? 259 VAL A O    2  
ATOM   5834   O O    O VAL A 1 259 ? 12.592  8.678   47.991 0.95  0.00 ? 259 VAL A O    2  
ATOM   5835   H H    C VAL A 1 259 ? 13.208  13.968  39.536 0.05  0.00 ? 259 VAL A H    2  
ATOM   5836   H H    O VAL A 1 259 ? 15.039  7.603   48.438 0.95  0.00 ? 259 VAL A H    2  
ATOM   5837   N N    C GLY A 1 260 ? 9.608   12.414  40.028 0.05  0.00 ? 260 GLY A N    2  
ATOM   5838   N N    O GLY A 1 260 ? 11.938  8.050   45.910 0.95  0.00 ? 260 GLY A N    2  
ATOM   5839   C CA   C GLY A 1 260 ? 8.471   12.898  40.836 0.05  0.00 ? 260 GLY A CA   2  
ATOM   5840   C CA   O GLY A 1 260 ? 10.891  9.077   45.738 0.95  0.00 ? 260 GLY A CA   2  
ATOM   5841   C C    C GLY A 1 260 ? 7.842   11.610  41.409 0.05  0.00 ? 260 GLY A C    2  
ATOM   5842   C C    O GLY A 1 260 ? 9.572   8.276   45.760 0.95  0.00 ? 260 GLY A C    2  
ATOM   5843   O O    C GLY A 1 260 ? 7.700   10.643  40.656 0.05  0.00 ? 260 GLY A O    2  
ATOM   5844   O O    O GLY A 1 260 ? 9.550   7.169   45.215 0.95  0.00 ? 260 GLY A O    2  
ATOM   5845   H H    C GLY A 1 260 ? 9.463   11.638  39.449 0.05  0.00 ? 260 GLY A H    2  
ATOM   5846   H H    O GLY A 1 260 ? 12.090  7.421   45.175 0.95  0.00 ? 260 GLY A H    2  
ATOM   5847   N N    C VAL A 1 261 ? 7.525   11.548  42.680 0.05  0.00 ? 261 VAL A N    2  
ATOM   5848   N N    O VAL A 1 261 ? 8.529   8.753   46.395 0.95  0.00 ? 261 VAL A N    2  
ATOM   5849   C CA   C VAL A 1 261 ? 6.938   10.350  43.300 0.05  0.00 ? 261 VAL A CA   2  
ATOM   5850   C CA   O VAL A 1 261 ? 7.250   8.031   46.488 0.95  0.00 ? 261 VAL A CA   2  
ATOM   5851   C C    C VAL A 1 261 ? 5.444   10.496  43.358 0.05  0.00 ? 261 VAL A C    2  
ATOM   5852   C C    O VAL A 1 261 ? 6.140   8.911   45.987 0.95  0.00 ? 261 VAL A C    2  
ATOM   5853   O O    C VAL A 1 261 ? 4.995   11.116  44.356 0.05  0.00 ? 261 VAL A O    2  
ATOM   5854   O O    O VAL A 1 261 ? 5.994   10.003  46.594 0.95  0.00 ? 261 VAL A O    2  
ATOM   5855   H H    C VAL A 1 261 ? 7.708   12.326  43.246 0.05  0.00 ? 261 VAL A H    2  
ATOM   5856   H H    O VAL A 1 261 ? 8.612   9.618   46.847 0.95  0.00 ? 261 VAL A H    2  
ATOM   5857   N N    C LEU A 1 262 ? 4.679   10.084  42.375 0.05  0.00 ? 262 LEU A N    2  
ATOM   5858   N N    O LEU A 1 262 ? 5.442   8.590   44.924 0.95  0.00 ? 262 LEU A N    2  
ATOM   5859   C CA   C LEU A 1 262 ? 3.257   10.180  42.256 0.05  0.00 ? 262 LEU A CA   2  
ATOM   5860   C CA   O LEU A 1 262 ? 4.322   9.275   44.357 0.95  0.00 ? 262 LEU A CA   2  
ATOM   5861   C C    C LEU A 1 262 ? 2.739   9.822   43.694 0.05  0.00 ? 262 LEU A C    2  
ATOM   5862   C C    O LEU A 1 262 ? 3.209   9.141   45.456 0.95  0.00 ? 262 LEU A C    2  
ATOM   5863   O O    C LEU A 1 262 ? 3.222   8.845   44.254 0.05  0.00 ? 262 LEU A O    2  
ATOM   5864   O O    O LEU A 1 262 ? 2.978   8.026   45.909 0.95  0.00 ? 262 LEU A O    2  
ATOM   5865   H H    C LEU A 1 262 ? 5.137   9.614   41.647 0.05  0.00 ? 262 LEU A H    2  
ATOM   5866   H H    O LEU A 1 262 ? 5.695   7.751   44.485 0.95  0.00 ? 262 LEU A H    2  
ATOM   5867   N N    C SER A 1 263 ? 1.942   10.746  44.217 0.05  0.00 ? 263 SER A N    2  
ATOM   5868   N N    O SER A 1 263 ? 2.758   10.308  45.900 0.95  0.00 ? 263 SER A N    2  
ATOM   5869   C CA   C SER A 1 263 ? 1.431   10.584  45.583 0.05  0.00 ? 263 SER A CA   2  
ATOM   5870   C CA   O SER A 1 263 ? 1.836   10.350  47.041 0.95  0.00 ? 263 SER A CA   2  
ATOM   5871   C C    C SER A 1 263 ? 0.010   11.027  45.746 0.05  0.00 ? 263 SER A C    2  
ATOM   5872   C C    O SER A 1 263 ? 0.570   11.098  46.759 0.95  0.00 ? 263 SER A C    2  
ATOM   5873   O O    C SER A 1 263 ? -0.634  11.466  44.815 0.05  0.00 ? 263 SER A O    2  
ATOM   5874   O O    O SER A 1 263 ? 0.499   11.924  45.873 0.95  0.00 ? 263 SER A O    2  
ATOM   5875   H H    C SER A 1 263 ? 1.785   11.584  43.734 0.05  0.00 ? 263 SER A H    2  
ATOM   5876   H H    O SER A 1 263 ? 3.125   11.142  45.539 0.95  0.00 ? 263 SER A H    2  
ATOM   5877   N N    C ALA A 1 264 ? -0.476  10.837  46.998 0.05  0.00 ? 264 ALA A N    2  
ATOM   5878   N N    O ALA A 1 264 ? -0.469  10.719  47.545 0.95  0.00 ? 264 ALA A N    2  
ATOM   5879   C CA   C ALA A 1 264 ? -1.889  11.214  47.275 0.05  0.00 ? 264 ALA A CA   2  
ATOM   5880   C CA   O ALA A 1 264 ? -1.783  11.392  47.356 0.95  0.00 ? 264 ALA A CA   2  
ATOM   5881   C C    C ALA A 1 264 ? -1.869  12.048  48.574 0.05  0.00 ? 264 ALA A C    2  
ATOM   5882   C C    O ALA A 1 264 ? -2.151  12.016  48.719 0.95  0.00 ? 264 ALA A C    2  
ATOM   5883   O O    C ALA A 1 264 ? -1.111  11.759  49.474 0.05  0.00 ? 264 ALA A O    2  
ATOM   5884   O O    O ALA A 1 264 ? -2.210  11.324  49.712 0.95  0.00 ? 264 ALA A O    2  
ATOM   5885   H H    C ALA A 1 264 ? 0.089   10.460  47.704 0.05  0.00 ? 264 ALA A H    2  
ATOM   5886   H H    O ALA A 1 264 ? -0.358  10.019  48.221 0.95  0.00 ? 264 ALA A H    2  
ATOM   5887   N N    C GLY A 1 265 ? -2.699  13.082  48.548 0.05  0.00 ? 265 GLY A N    2  
ATOM   5888   N N    O GLY A 1 265 ? -2.328  13.329  48.666 0.95  0.00 ? 265 GLY A N    2  
ATOM   5889   C CA   C GLY A 1 265 ? -2.743  13.980  49.749 0.05  0.00 ? 265 GLY A CA   2  
ATOM   5890   C CA   O GLY A 1 265 ? -2.651  14.049  49.942 0.95  0.00 ? 265 GLY A CA   2  
ATOM   5891   C C    C GLY A 1 265 ? -4.068  14.705  49.729 0.05  0.00 ? 265 GLY A C    2  
ATOM   5892   C C    O GLY A 1 265 ? -3.978  14.745  49.751 0.95  0.00 ? 265 GLY A C    2  
ATOM   5893   O O    C GLY A 1 265 ? -4.605  15.020  48.696 0.05  0.00 ? 265 GLY A O    2  
ATOM   5894   O O    O GLY A 1 265 ? -4.357  15.103  48.664 0.95  0.00 ? 265 GLY A O    2  
ATOM   5895   H H    C GLY A 1 265 ? -3.246  13.271  47.758 0.05  0.00 ? 265 GLY A H    2  
ATOM   5896   H H    O GLY A 1 265 ? -2.224  13.819  47.824 0.95  0.00 ? 265 GLY A H    2  
ATOM   5897   N N    . ILE A 1 266 ? -4.664  14.950  50.893 1.00  0.00 ? 266 ILE A N    2  
ATOM   5898   C CA   . ILE A 1 266 ? -6.000  15.608  50.923 1.00  0.00 ? 266 ILE A CA   2  
ATOM   5899   C C    . ILE A 1 266 ? -5.869  17.056  51.418 1.00  0.00 ? 266 ILE A C    2  
ATOM   5900   O O    . ILE A 1 266 ? -5.236  17.250  52.462 1.00  0.00 ? 266 ILE A O    2  
ATOM   5901   H H    . ILE A 1 266 ? -4.272  14.644  51.738 1.00  0.00 ? 266 ILE A H    2  
ATOM   5902   N N    . ASN A 1 267 ? -6.424  17.958  50.729 1.00  0.00 ? 267 ASN A N    2  
ATOM   5903   C CA   . ASN A 1 267 ? -6.423  19.406  51.068 1.00  0.00 ? 267 ASN A CA   2  
ATOM   5904   C C    . ASN A 1 267 ? -7.113  19.568  52.445 1.00  0.00 ? 267 ASN A C    2  
ATOM   5905   O O    . ASN A 1 267 ? -8.213  19.075  52.657 1.00  0.00 ? 267 ASN A O    2  
ATOM   5906   H H    . ASN A 1 267 ? -6.904  17.681  49.920 1.00  0.00 ? 267 ASN A H    2  
ATOM   5907   N N    . ALA A 1 268 ? -6.389  20.186  53.370 1.00  0.00 ? 268 ALA A N    2  
ATOM   5908   C CA   . ALA A 1 268 ? -6.910  20.442  54.724 1.00  0.00 ? 268 ALA A CA   2  
ATOM   5909   C C    . ALA A 1 268 ? -8.185  21.279  54.618 1.00  0.00 ? 268 ALA A C    2  
ATOM   5910   O O    . ALA A 1 268 ? -9.006  21.201  55.538 1.00  0.00 ? 268 ALA A O    2  
ATOM   5911   H H    . ALA A 1 268 ? -5.488  20.496  53.140 1.00  0.00 ? 268 ALA A H    2  
ATOM   5912   N N    . ALA A 1 269 ? -8.322  22.081  53.583 1.00  0.00 ? 269 ALA A N    2  
ATOM   5913   C CA   . ALA A 1 269 ? -9.459  22.931  53.315 1.00  0.00 ? 269 ALA A CA   2  
ATOM   5914   C C    . ALA A 1 269 ? -10.618 22.220  52.641 1.00  0.00 ? 269 ALA A C    2  
ATOM   5915   O O    . ALA A 1 269 ? -11.708 22.803  52.529 1.00  0.00 ? 269 ALA A O    2  
ATOM   5916   H H    . ALA A 1 269 ? -7.590  22.097  52.932 1.00  0.00 ? 269 ALA A H    2  
ATOM   5917   N N    . SER A 1 270 ? -10.471 20.961  52.231 1.00  0.00 ? 270 SER A N    2  
ATOM   5918   C CA   . SER A 1 270 ? -11.606 20.311  51.575 1.00  0.00 ? 270 SER A CA   2  
ATOM   5919   C C    . SER A 1 270 ? -12.736 19.922  52.527 1.00  0.00 ? 270 SER A C    2  
ATOM   5920   O O    . SER A 1 270 ? -12.517 19.304  53.577 1.00  0.00 ? 270 SER A O    2  
ATOM   5921   H H    . SER A 1 270 ? -9.623  20.486  52.358 1.00  0.00 ? 270 SER A H    2  
ATOM   5922   N N    . PRO A 1 271 ? -13.939 20.153  52.053 1.00  0.00 ? 271 PRO A N    2  
ATOM   5923   C CA   . PRO A 1 271 ? -15.166 19.740  52.765 1.00  0.00 ? 271 PRO A CA   2  
ATOM   5924   C C    . PRO A 1 271 ? -15.523 18.280  52.523 1.00  0.00 ? 271 PRO A C    2  
ATOM   5925   O O    . PRO A 1 271 ? -16.435 17.680  53.093 1.00  0.00 ? 271 PRO A O    2  
ATOM   5926   N N    . ASN A 1 272 ? -14.753 17.629  51.649 1.00  0.00 ? 272 ASN A N    2  
ATOM   5927   C CA   . ASN A 1 272 ? -14.964 16.249  51.210 1.00  0.00 ? 272 ASN A CA   2  
ATOM   5928   C C    . ASN A 1 272 ? -13.934 15.258  51.649 1.00  0.00 ? 272 ASN A C    2  
ATOM   5929   O O    . ASN A 1 272 ? -13.682 14.351  50.824 1.00  0.00 ? 272 ASN A O    2  
ATOM   5930   H H    . ASN A 1 272 ? -14.020 18.130  51.232 1.00  0.00 ? 272 ASN A H    2  
ATOM   5931   N N    . LYS A 1 273 ? -13.377 15.307  52.820 1.00  0.00 ? 273 LYS A N    2  
ATOM   5932   C CA   . LYS A 1 273 ? -12.347 14.393  53.230 1.00  0.00 ? 273 LYS A CA   2  
ATOM   5933   C C    . LYS A 1 273 ? -12.735 12.938  53.335 1.00  0.00 ? 273 LYS A C    2  
ATOM   5934   O O    . LYS A 1 273 ? -11.872 12.048  53.182 1.00  0.00 ? 273 LYS A O    2  
ATOM   5935   H H    . LYS A 1 273 ? -13.644 16.020  53.438 1.00  0.00 ? 273 LYS A H    2  
ATOM   5936   N N    . GLU A 1 274 ? -13.960 12.664  53.711 1.00  0.00 ? 274 GLU A N    2  
ATOM   5937   C CA   . GLU A 1 274 ? -14.477 11.307  53.865 1.00  0.00 ? 274 GLU A CA   2  
ATOM   5938   C C    . GLU A 1 274 ? -14.635 10.723  52.470 1.00  0.00 ? 274 GLU A C    2  
ATOM   5939   O O    . GLU A 1 274 ? -14.224 9.565   52.263 1.00  0.00 ? 274 GLU A O    2  
ATOM   5940   H H    . GLU A 1 274 ? -14.562 13.413  53.904 1.00  0.00 ? 274 GLU A H    2  
ATOM   5941   N N    . LEU A 1 275 ? -15.099 11.509  51.549 1.00  0.00 ? 275 LEU A N    2  
ATOM   5942   C CA   . LEU A 1 275 ? -15.226 11.065  50.156 1.00  0.00 ? 275 LEU A CA   2  
ATOM   5943   C C    . LEU A 1 275 ? -13.830 10.725  49.583 1.00  0.00 ? 275 LEU A C    2  
ATOM   5944   O O    . LEU A 1 275 ? -13.676 9.692   48.908 1.00  0.00 ? 275 LEU A O    2  
ATOM   5945   H H    . LEU A 1 275 ? -15.327 12.434  51.779 1.00  0.00 ? 275 LEU A H    2  
ATOM   5946   N N    . ALA A 1 276 ? -12.871 11.583  49.851 1.00  0.00 ? 276 ALA A N    2  
ATOM   5947   C CA   . ALA A 1 276 ? -11.476 11.420  49.395 1.00  0.00 ? 276 ALA A CA   2  
ATOM   5948   C C    . ALA A 1 276 ? -10.838 10.159  49.879 1.00  0.00 ? 276 ALA A C    2  
ATOM   5949   O O    . ALA A 1 276 ? -10.208 9.369   49.145 1.00  0.00 ? 276 ALA A O    2  
ATOM   5950   H H    . ALA A 1 276 ? -13.093 12.373  50.389 1.00  0.00 ? 276 ALA A H    2  
ATOM   5951   N N    . LYS A 1 277 ? -10.969 9.882   51.163 1.00  0.00 ? 277 LYS A N    2  
ATOM   5952   C CA   . LYS A 1 277 ? -10.413 8.709   51.799 1.00  0.00 ? 277 LYS A CA   2  
ATOM   5953   C C    . LYS A 1 277 ? -11.061 7.439   51.290 1.00  0.00 ? 277 LYS A C    2  
ATOM   5954   O O    . LYS A 1 277 ? -10.448 6.365   51.217 1.00  0.00 ? 277 LYS A O    2  
ATOM   5955   H H    . LYS A 1 277 ? -11.471 10.512  51.720 1.00  0.00 ? 277 LYS A H    2  
ATOM   5956   N N    . GLU A 1 278 ? -12.320 7.534   50.934 1.00  0.00 ? 278 GLU A N    2  
ATOM   5957   C CA   . GLU A 1 278 ? -13.042 6.371   50.418 1.00  0.00 ? 278 GLU A CA   2  
ATOM   5958   C C    . GLU A 1 278 ? -12.605 6.106   48.982 1.00  0.00 ? 278 GLU A C    2  
ATOM   5959   O O    . GLU A 1 278 ? -12.372 4.934   48.674 1.00  0.00 ? 278 GLU A O    2  
ATOM   5960   H H    . GLU A 1 278 ? -12.781 8.395   51.008 1.00  0.00 ? 278 GLU A H    2  
ATOM   5961   N N    . PHE A 1 279 ? -12.494 7.131   48.181 1.00  0.00 ? 279 PHE A N    2  
ATOM   5962   C CA   . PHE A 1 279 ? -12.017 7.041   46.807 1.00  0.00 ? 279 PHE A CA   2  
ATOM   5963   C C    . PHE A 1 279 ? -10.605 6.429   46.830 1.00  0.00 ? 279 PHE A C    2  
ATOM   5964   O O    . PHE A 1 279 ? -10.312 5.392   46.231 1.00  0.00 ? 279 PHE A O    2  
ATOM   5965   H H    . PHE A 1 279 ? -12.698 8.020   48.540 1.00  0.00 ? 279 PHE A H    2  
ATOM   5966   N N    . LEU A 1 280 ? -9.709  7.056   47.593 1.00  0.00 ? 280 LEU A N    2  
ATOM   5967   C CA   . LEU A 1 280 ? -8.350  6.606   47.715 1.00  0.00 ? 280 LEU A CA   2  
ATOM   5968   C C    . LEU A 1 280 ? -8.216  5.209   48.260 1.00  0.00 ? 280 LEU A C    2  
ATOM   5969   O O    . LEU A 1 280 ? -7.499  4.372   47.672 1.00  0.00 ? 280 LEU A O    2  
ATOM   5970   H H    . LEU A 1 280 ? -9.988  7.855   48.088 1.00  0.00 ? 280 LEU A H    2  
ATOM   5971   N N    . GLU A 1 281 ? -8.796  4.894   49.429 1.00  0.00 ? 281 GLU A N    2  
ATOM   5972   C CA   . GLU A 1 281 ? -8.572  3.584   49.986 1.00  0.00 ? 281 GLU A CA   2  
ATOM   5973   C C    . GLU A 1 281 ? -9.295  2.423   49.313 1.00  0.00 ? 281 GLU A C    2  
ATOM   5974   O O    . GLU A 1 281 ? -8.740  1.288   49.274 1.00  0.00 ? 281 GLU A O    2  
ATOM   5975   H H    . GLU A 1 281 ? -9.304  5.566   49.929 1.00  0.00 ? 281 GLU A H    2  
ATOM   5976   N N    . ASN A 1 282 ? -10.457 2.672   48.772 1.00  0.00 ? 282 ASN A N    2  
ATOM   5977   C CA   . ASN A 1 282 ? -11.273 1.571   48.213 1.00  0.00 ? 282 ASN A CA   2  
ATOM   5978   C C    . ASN A 1 282 ? -11.457 1.565   46.745 1.00  0.00 ? 282 ASN A C    2  
ATOM   5979   O O    . ASN A 1 282 ? -12.088 0.601   46.253 1.00  0.00 ? 282 ASN A O    2  
ATOM   5980   H H    . ASN A 1 282 ? -10.828 3.579   48.811 1.00  0.00 ? 282 ASN A H    2  
ATOM   5981   N N    . TYR A 1 283 ? -10.981 2.554   46.017 1.00  0.00 ? 283 TYR A N    2  
ATOM   5982   C CA   . TYR A 1 283 ? -11.149 2.552   44.556 1.00  0.00 ? 283 TYR A CA   2  
ATOM   5983   C C    . TYR A 1 283 ? -9.782  2.542   43.881 1.00  0.00 ? 283 TYR A C    2  
ATOM   5984   O O    . TYR A 1 283 ? -9.495  1.670   43.053 1.00  0.00 ? 283 TYR A O    2  
ATOM   5985   H H    . TYR A 1 283 ? -10.506 3.293   46.452 1.00  0.00 ? 283 TYR A H    2  
ATOM   5986   N N    . LEU A 1 284 ? -8.996  3.538   44.300 1.00  0.00 ? 284 LEU A N    2  
ATOM   5987   C CA   . LEU A 1 284 ? -7.666  3.707   43.740 1.00  0.00 ? 284 LEU A CA   2  
ATOM   5988   C C    . LEU A 1 284 ? -6.662  2.701   44.223 1.00  0.00 ? 284 LEU A C    2  
ATOM   5989   O O    . LEU A 1 284 ? -6.047  2.013   43.362 1.00  0.00 ? 284 LEU A O    2  
ATOM   5990   H H    . LEU A 1 284 ? -9.327  4.171   44.972 1.00  0.00 ? 284 LEU A H    2  
ATOM   5991   N N    . LEU A 1 285 ? -6.447  2.514   45.499 1.00  0.00 ? 285 LEU A N    2  
ATOM   5992   C CA   . LEU A 1 285 ? -5.492  1.613   46.052 1.00  0.00 ? 285 LEU A CA   2  
ATOM   5993   C C    . LEU A 1 285 ? -5.985  0.170   46.122 1.00  0.00 ? 285 LEU A C    2  
ATOM   5994   O O    . LEU A 1 285 ? -5.909  -0.450  47.163 1.00  0.00 ? 285 LEU A O    2  
ATOM   5995   H H    . LEU A 1 285 ? -6.970  3.056   46.127 1.00  0.00 ? 285 LEU A H    2  
ATOM   5996   N N    . THR A 1 286 ? -6.336  -0.265  44.931 1.00  0.00 ? 286 THR A N    2  
ATOM   5997   C CA   . THR A 1 286 ? -6.802  -1.642  44.679 1.00  0.00 ? 286 THR A CA   2  
ATOM   5998   C C    . THR A 1 286 ? -6.109  -2.127  43.385 1.00  0.00 ? 286 THR A C    2  
ATOM   5999   O O    . THR A 1 286 ? -5.722  -1.301  42.560 1.00  0.00 ? 286 THR A O    2  
ATOM   6000   H H    . THR A 1 286 ? -6.251  0.346   44.169 1.00  0.00 ? 286 THR A H    2  
ATOM   6001   N N    . ASP A 1 287 ? -6.085  -3.428  43.207 1.00  0.00 ? 287 ASP A N    2  
ATOM   6002   C CA   . ASP A 1 287 ? -5.470  -3.983  41.962 1.00  0.00 ? 287 ASP A CA   2  
ATOM   6003   C C    . ASP A 1 287 ? -6.108  -3.370  40.729 1.00  0.00 ? 287 ASP A C    2  
ATOM   6004   O O    . ASP A 1 287 ? -5.435  -3.070  39.725 1.00  0.00 ? 287 ASP A O    2  
ATOM   6005   H H    . ASP A 1 287 ? -6.488  -4.027  43.869 1.00  0.00 ? 287 ASP A H    2  
ATOM   6006   N N    . GLU A 1 288 ? -7.415  -3.186  40.754 1.00  0.00 ? 288 GLU A N    2  
ATOM   6007   C CA   . GLU A 1 288 ? -8.133  -2.644  39.601 1.00  0.00 ? 288 GLU A CA   2  
ATOM   6008   C C    . GLU A 1 288 ? -7.916  -1.165  39.397 1.00  0.00 ? 288 GLU A C    2  
ATOM   6009   O O    . GLU A 1 288 ? -7.935  -0.666  38.269 1.00  0.00 ? 288 GLU A O    2  
ATOM   6010   H H    . GLU A 1 288 ? -7.920  -3.446  41.553 1.00  0.00 ? 288 GLU A H    2  
ATOM   6011   N N    . GLY A 1 289 ? -7.729  -0.442  40.501 1.00  0.00 ? 289 GLY A N    2  
ATOM   6012   C CA   . GLY A 1 289 ? -7.510  1.022   40.407 1.00  0.00 ? 289 GLY A CA   2  
ATOM   6013   C C    . GLY A 1 289 ? -6.097  1.288   39.828 1.00  0.00 ? 289 GLY A C    2  
ATOM   6014   O O    . GLY A 1 289 ? -5.986  2.105   38.928 1.00  0.00 ? 289 GLY A O    2  
ATOM   6015   H H    . GLY A 1 289 ? -7.739  -0.879  41.378 1.00  0.00 ? 289 GLY A H    2  
ATOM   6016   N N    . LEU A 1 290 ? -5.098  0.646   40.382 1.00  0.00 ? 290 LEU A N    2  
ATOM   6017   C CA   . LEU A 1 290 ? -3.691  0.845   39.933 1.00  0.00 ? 290 LEU A CA   2  
ATOM   6018   C C    . LEU A 1 290 ? -3.571  0.397   38.484 1.00  0.00 ? 290 LEU A C    2  
ATOM   6019   O O    . LEU A 1 290 ? -2.862  1.005   37.674 1.00  0.00 ? 290 LEU A O    2  
ATOM   6020   H H    . LEU A 1 290 ? -5.279  0.034   41.126 1.00  0.00 ? 290 LEU A H    2  
ATOM   6021   N N    . GLU A 1 291 ? -4.303  -0.662  38.163 1.00  0.00 ? 291 GLU A N    2  
ATOM   6022   C CA   . GLU A 1 291 ? -4.301  -1.217  36.808 1.00  0.00 ? 291 GLU A CA   2  
ATOM   6023   C C    . GLU A 1 291 ? -4.854  -0.268  35.775 1.00  0.00 ? 291 GLU A C    2  
ATOM   6024   O O    . GLU A 1 291 ? -4.225  -0.131  34.699 1.00  0.00 ? 291 GLU A O    2  
ATOM   6025   H H    . GLU A 1 291 ? -4.862  -1.084  38.850 1.00  0.00 ? 291 GLU A H    2  
ATOM   6026   N N    . ALA A 1 292 ? -5.982  0.379   36.021 1.00  0.00 ? 292 ALA A N    2  
ATOM   6027   C CA   . ALA A 1 292 ? -6.566  1.347   35.089 1.00  0.00 ? 292 ALA A CA   2  
ATOM   6028   C C    . ALA A 1 292 ? -5.607  2.512   34.870 1.00  0.00 ? 292 ALA A C    2  
ATOM   6029   O O    . ALA A 1 292 ? -5.490  3.017   33.738 1.00  0.00 ? 292 ALA A O    2  
ATOM   6030   H H    . ALA A 1 292 ? -6.434  0.223   36.876 1.00  0.00 ? 292 ALA A H    2  
ATOM   6031   N N    . VAL A 1 293 ? -4.929  2.941   35.940 1.00  0.00 ? 293 VAL A N    2  
ATOM   6032   C CA   . VAL A 1 293 ? -3.981  4.055   35.831 1.00  0.00 ? 293 VAL A CA   2  
ATOM   6033   C C    . VAL A 1 293 ? -2.722  3.624   35.026 1.00  0.00 ? 293 VAL A C    2  
ATOM   6034   O O    . VAL A 1 293 ? -2.351  4.342   34.100 1.00  0.00 ? 293 VAL A O    2  
ATOM   6035   H H    . VAL A 1 293 ? -5.068  2.505   36.808 1.00  0.00 ? 293 VAL A H    2  
ATOM   6036   N N    . ASN A 1 294 ? -2.171  2.530   35.440 1.00  0.00 ? 294 ASN A N    2  
ATOM   6037   C CA   . ASN A 1 294 ? -0.977  1.898   34.842 1.00  0.00 ? 294 ASN A CA   2  
ATOM   6038   C C    . ASN A 1 294 ? -1.162  1.680   33.346 1.00  0.00 ? 294 ASN A C    2  
ATOM   6039   O O    . ASN A 1 294 ? -0.225  1.942   32.563 1.00  0.00 ? 294 ASN A O    2  
ATOM   6040   H H    . ASN A 1 294 ? -2.585  2.079   36.206 1.00  0.00 ? 294 ASN A H    2  
ATOM   6041   N N    . LYS A 1 295 ? -2.326  1.257   32.927 1.00  0.00 ? 295 LYS A N    2  
ATOM   6042   C CA   . LYS A 1 295 ? -2.692  1.040   31.527 1.00  0.00 ? 295 LYS A CA   2  
ATOM   6043   C C    . LYS A 1 295 ? -2.551  2.306   30.702 1.00  0.00 ? 295 LYS A C    2  
ATOM   6044   O O    . LYS A 1 295 ? -2.158  2.285   29.511 1.00  0.00 ? 295 LYS A O    2  
ATOM   6045   H H    . LYS A 1 295 ? -3.019  1.102   33.603 1.00  0.00 ? 295 LYS A H    2  
ATOM   6046   N N    . ASP A 1 296 ? -2.834  3.437   31.320 1.00  0.00 ? 296 ASP A N    2  
ATOM   6047   C CA   . ASP A 1 296 ? -2.740  4.752   30.696 1.00  0.00 ? 296 ASP A CA   2  
ATOM   6048   C C    . ASP A 1 296 ? -1.273  5.179   30.597 1.00  0.00 ? 296 ASP A C    2  
ATOM   6049   O O    . ASP A 1 296 ? -0.826  5.598   29.519 1.00  0.00 ? 296 ASP A O    2  
ATOM   6050   H H    . ASP A 1 296 ? -3.114  3.392   32.258 1.00  0.00 ? 296 ASP A H    2  
ATOM   6051   N N    . LYS A 1 297 ? -0.562  5.086   31.695 1.00  0.00 ? 297 LYS A N    2  
ATOM   6052   C CA   . LYS A 1 297 ? 0.868   5.441   31.823 1.00  0.00 ? 297 LYS A CA   2  
ATOM   6053   C C    . LYS A 1 297 ? 1.424   4.613   32.962 1.00  0.00 ? 297 LYS A C    2  
ATOM   6054   O O    . LYS A 1 297 ? 0.863   4.639   34.073 1.00  0.00 ? 297 LYS A O    2  
ATOM   6055   H H    . LYS A 1 297 ? -1.016  4.752   32.497 1.00  0.00 ? 297 LYS A H    2  
ATOM   6056   N N    . PRO A 1 298 ? 2.495   3.886   32.743 1.00  0.00 ? 298 PRO A N    2  
ATOM   6057   C CA   . PRO A 1 298 ? 3.082   3.030   33.791 1.00  0.00 ? 298 PRO A CA   2  
ATOM   6058   C C    . PRO A 1 298 ? 3.467   3.802   35.033 1.00  0.00 ? 298 PRO A C    2  
ATOM   6059   O O    . PRO A 1 298 ? 4.010   4.916   34.913 1.00  0.00 ? 298 PRO A O    2  
ATOM   6060   N N    . LEU A 1 299 ? 3.228   3.201   36.171 1.00  0.00 ? 299 LEU A N    2  
ATOM   6061   C CA   . LEU A 1 299 ? 3.561   3.791   37.476 1.00  0.00 ? 299 LEU A CA   2  
ATOM   6062   C C    . LEU A 1 299 ? 4.946   3.415   38.001 1.00  0.00 ? 299 LEU A C    2  
ATOM   6063   O O    . LEU A 1 299 ? 5.477   4.045   38.927 1.00  0.00 ? 299 LEU A O    2  
ATOM   6064   H H    . LEU A 1 299 ? 2.824   2.308   36.152 1.00  0.00 ? 299 LEU A H    2  
ATOM   6065   N N    . GLY A 1 300 ? 5.459   2.317   37.418 1.00  0.00 ? 300 GLY A N    2  
ATOM   6066   C CA   . GLY A 1 300 ? 6.738   1.747   37.840 1.00  0.00 ? 300 GLY A CA   2  
ATOM   6067   C C    . GLY A 1 300 ? 6.364   0.793   38.964 1.00  0.00 ? 300 GLY A C    2  
ATOM   6068   O O    . GLY A 1 300 ? 5.329   0.138   38.787 1.00  0.00 ? 300 GLY A O    2  
ATOM   6069   H H    . GLY A 1 300 ? 4.936   1.855   36.729 1.00  0.00 ? 300 GLY A H    2  
ATOM   6070   N N    . ALA A 1 301 ? 7.139   0.709   40.007 1.00  0.00 ? 301 ALA A N    2  
ATOM   6071   C CA   . ALA A 1 301 ? 6.877   -0.158  41.130 1.00  0.00 ? 301 ALA A CA   2  
ATOM   6072   C C    . ALA A 1 301 ? 5.736   0.550   41.930 1.00  0.00 ? 301 ALA A C    2  
ATOM   6073   O O    . ALA A 1 301 ? 5.704   1.774   41.898 1.00  0.00 ? 301 ALA A O    2  
ATOM   6074   H H    . ALA A 1 301 ? 7.943   1.269   40.032 1.00  0.00 ? 301 ALA A H    2  
ATOM   6075   N N    . VAL A 1 302 ? 4.900   -0.215  42.554 1.00  0.00 ? 302 VAL A N    2  
ATOM   6076   C CA   . VAL A 1 302 ? 3.761   0.391   43.306 1.00  0.00 ? 302 VAL A CA   2  
ATOM   6077   C C    . VAL A 1 302 ? 3.869   0.018   44.767 1.00  0.00 ? 302 VAL A C    2  
ATOM   6078   O O    . VAL A 1 302 ? 4.542   -0.955  45.088 1.00  0.00 ? 302 VAL A O    2  
ATOM   6079   H H    . VAL A 1 302 ? 5.000   -1.189  42.512 1.00  0.00 ? 302 VAL A H    2  
ATOM   6080   N N    . ALA A 1 303 ? 3.185   0.814   45.635 1.00  0.00 ? 303 ALA A N    2  
ATOM   6081   C CA   . ALA A 1 303 ? 3.248   0.555   47.065 1.00  0.00 ? 303 ALA A CA   2  
ATOM   6082   C C    . ALA A 1 303 ? 2.348   -0.583  47.531 1.00  0.00 ? 303 ALA A C    2  
ATOM   6083   O O    . ALA A 1 303 ? 2.674   -1.213  48.545 1.00  0.00 ? 303 ALA A O    2  
ATOM   6084   H H    . ALA A 1 303 ? 2.665   1.573   45.298 1.00  0.00 ? 303 ALA A H    2  
ATOM   6085   N N    . LEU A 1 304 ? 1.295   -0.855  46.812 1.00  0.00 ? 304 LEU A N    2  
ATOM   6086   C CA   . LEU A 1 304 ? 0.324   -1.935  47.126 1.00  0.00 ? 304 LEU A CA   2  
ATOM   6087   C C    . LEU A 1 304 ? 0.965   -3.302  46.851 1.00  0.00 ? 304 LEU A C    2  
ATOM   6088   O O    . LEU A 1 304 ? 1.156   -3.539  45.653 1.00  0.00 ? 304 LEU A O    2  
ATOM   6089   H H    . LEU A 1 304 ? 1.136   -0.315  46.010 1.00  0.00 ? 304 LEU A H    2  
ATOM   6090   N N    . LYS A 1 305 ? 1.260   -4.072  47.824 1.00  0.00 ? 305 LYS A N    2  
ATOM   6091   C CA   . LYS A 1 305 ? 1.897   -5.363  47.747 1.00  0.00 ? 305 LYS A CA   2  
ATOM   6092   C C    . LYS A 1 305 ? 1.311   -6.329  46.728 1.00  0.00 ? 305 LYS A C    2  
ATOM   6093   O O    . LYS A 1 305 ? 2.049   -7.009  46.018 1.00  0.00 ? 305 LYS A O    2  
ATOM   6094   H H    . LYS A 1 305 ? 1.055   -3.739  48.723 1.00  0.00 ? 305 LYS A H    2  
ATOM   6095   N N    . SER A 1 306 ? 0.013   -6.413  46.670 1.00  0.00 ? 306 SER A N    2  
ATOM   6096   C CA   . SER A 1 306 ? -0.722  -7.329  45.797 1.00  0.00 ? 306 SER A CA   2  
ATOM   6097   C C    . SER A 1 306 ? -0.495  -7.059  44.323 1.00  0.00 ? 306 SER A C    2  
ATOM   6098   O O    . SER A 1 306 ? -0.269  -7.985  43.501 1.00  0.00 ? 306 SER A O    2  
ATOM   6099   H H    . SER A 1 306 ? -0.508  -5.851  47.281 1.00  0.00 ? 306 SER A H    2  
ATOM   6100   N N    . TYR A 1 307 ? -0.571  -5.788  43.937 1.00  0.00 ? 307 TYR A N    2  
ATOM   6101   C CA   . TYR A 1 307 ? -0.398  -5.411  42.552 1.00  0.00 ? 307 TYR A CA   2  
ATOM   6102   C C    . TYR A 1 307 ? 1.104   -5.397  42.197 1.00  0.00 ? 307 TYR A C    2  
ATOM   6103   O O    . TYR A 1 307 ? 1.448   -5.679  41.054 1.00  0.00 ? 307 TYR A O    2  
ATOM   6104   H H    . TYR A 1 307 ? -0.765  -5.095  44.603 1.00  0.00 ? 307 TYR A H    2  
ATOM   6105   N N    . GLU A 1 308 ? 1.919   -5.088  43.167 1.00  0.00 ? 308 GLU A N    2  
ATOM   6106   C CA   . GLU A 1 308 ? 3.364   -5.034  42.904 1.00  0.00 ? 308 GLU A CA   2  
ATOM   6107   C C    . GLU A 1 308 ? 3.821   -6.446  42.489 1.00  0.00 ? 308 GLU A C    2  
ATOM   6108   O O    . GLU A 1 308 ? 4.657   -6.614  41.590 1.00  0.00 ? 308 GLU A O    2  
ATOM   6109   H H    . GLU A 1 308 ? 1.571   -4.882  44.060 1.00  0.00 ? 308 GLU A H    2  
ATOM   6110   N N    . GLU A 1 309 ? 3.253   -7.435  43.162 1.00  0.00 ? 309 GLU A N    2  
ATOM   6111   C CA   . GLU A 1 309 ? 3.573   -8.841  42.880 1.00  0.00 ? 309 GLU A CA   2  
ATOM   6112   C C    . GLU A 1 309 ? 3.214   -9.198  41.453 1.00  0.00 ? 309 GLU A C    2  
ATOM   6113   O O    . GLU A 1 309 ? 3.937   -10.027 40.867 1.00  0.00 ? 309 GLU A O    2  
ATOM   6114   H H    . GLU A 1 309 ? 2.598   -7.225  43.861 1.00  0.00 ? 309 GLU A H    2  
ATOM   6115   N N    . GLU A 1 310 ? 2.231   -8.581  40.864 1.00  0.00 ? 310 GLU A N    2  
ATOM   6116   C CA   . GLU A 1 310 ? 1.874   -8.848  39.474 1.00  0.00 ? 310 GLU A CA   2  
ATOM   6117   C C    . GLU A 1 310 ? 2.872   -8.155  38.553 1.00  0.00 ? 310 GLU A C    2  
ATOM   6118   O O    . GLU A 1 310 ? 3.404   -8.674  37.561 1.00  0.00 ? 310 GLU A O    2  
ATOM   6119   H H    . GLU A 1 310 ? 1.737   -7.893  41.357 1.00  0.00 ? 310 GLU A H    2  
ATOM   6120   N N    . LEU A 1 311 ? 3.159   -6.908  38.907 1.00  0.00 ? 311 LEU A N    2  
ATOM   6121   C CA   . LEU A 1 311 ? 4.063   -6.048  38.148 1.00  0.00 ? 311 LEU A CA   2  
ATOM   6122   C C    . LEU A 1 311 ? 5.508   -6.534  38.116 1.00  0.00 ? 311 LEU A C    2  
ATOM   6123   O O    . LEU A 1 311 ? 6.228   -6.269  37.138 1.00  0.00 ? 311 LEU A O    2  
ATOM   6124   H H    . LEU A 1 311 ? 2.725   -6.538  39.704 1.00  0.00 ? 311 LEU A H    2  
ATOM   6125   N N    . ALA A 1 312 ? 5.939   -7.127  39.182 1.00  0.00 ? 312 ALA A N    2  
ATOM   6126   C CA   . ALA A 1 312 ? 7.266   -7.639  39.394 1.00  0.00 ? 312 ALA A CA   2  
ATOM   6127   C C    . ALA A 1 312 ? 7.655   -8.777  38.430 1.00  0.00 ? 312 ALA A C    2  
ATOM   6128   O O    . ALA A 1 312 ? 8.815   -9.226  38.498 1.00  0.00 ? 312 ALA A O    2  
ATOM   6129   H H    . ALA A 1 312 ? 5.306   -7.219  39.924 1.00  0.00 ? 312 ALA A H    2  
ATOM   6130   N N    . LYS A 1 313 ? 6.801   -9.214  37.559 1.00  0.00 ? 313 LYS A N    2  
ATOM   6131   C CA   . LYS A 1 313 ? 7.067   -10.221 36.503 1.00  0.00 ? 313 LYS A CA   2  
ATOM   6132   C C    . LYS A 1 313 ? 7.921   -9.581  35.407 1.00  0.00 ? 313 LYS A C    2  
ATOM   6133   O O    . LYS A 1 313 ? 8.443   -10.191 34.466 1.00  0.00 ? 313 LYS A O    2  
ATOM   6134   H H    . LYS A 1 313 ? 5.917   -8.791  37.553 1.00  0.00 ? 313 LYS A H    2  
ATOM   6135   N N    C ASP A 1 314 ? 8.094   -8.248  35.495 0.05  0.00 ? 314 ASP A N    2  
ATOM   6136   N N    O ASP A 1 314 ? 8.001   -8.258  35.460 0.95  0.00 ? 314 ASP A N    2  
ATOM   6137   C CA   C ASP A 1 314 ? 8.854   -7.527  34.479 0.05  0.00 ? 314 ASP A CA   2  
ATOM   6138   C CA   O ASP A 1 314 ? 8.853   -7.435  34.608 0.95  0.00 ? 314 ASP A CA   2  
ATOM   6139   C C    C ASP A 1 314 ? 9.955   -6.894  35.345 0.05  0.00 ? 314 ASP A C    2  
ATOM   6140   C C    O ASP A 1 314 ? 10.094  -7.291  35.503 0.95  0.00 ? 314 ASP A C    2  
ATOM   6141   O O    C ASP A 1 314 ? 9.685   -5.803  35.902 0.05  0.00 ? 314 ASP A O    2  
ATOM   6142   O O    O ASP A 1 314 ? 9.935   -6.722  36.609 0.95  0.00 ? 314 ASP A O    2  
ATOM   6143   H H    C ASP A 1 314 ? 7.701   -7.720  36.221 0.05  0.00 ? 314 ASP A H    2  
ATOM   6144   H H    O ASP A 1 314 ? 7.514   -7.805  36.180 0.95  0.00 ? 314 ASP A H    2  
ATOM   6145   N N    C PRO A 1 315 ? 11.070  -7.562  35.537 0.05  0.00 ? 315 PRO A N    2  
ATOM   6146   N N    O PRO A 1 315 ? 11.220  -7.849  35.117 0.95  0.00 ? 315 PRO A N    2  
ATOM   6147   C CA   C PRO A 1 315 ? 12.151  -7.003  36.318 0.05  0.00 ? 315 PRO A CA   2  
ATOM   6148   C CA   O PRO A 1 315 ? 12.404  -7.792  35.945 0.95  0.00 ? 315 PRO A CA   2  
ATOM   6149   C C    C PRO A 1 315 ? 12.730  -5.749  35.680 0.05  0.00 ? 315 PRO A C    2  
ATOM   6150   C C    O PRO A 1 315 ? 12.898  -6.366  36.140 0.95  0.00 ? 315 PRO A C    2  
ATOM   6151   O O    C PRO A 1 315 ? 13.309  -4.967  36.469 0.05  0.00 ? 315 PRO A O    2  
ATOM   6152   O O    O PRO A 1 315 ? 13.588  -6.176  37.168 0.95  0.00 ? 315 PRO A O    2  
ATOM   6153   N N    C ARG A 1 316 ? 12.570  -5.519  34.440 0.05  0.00 ? 316 ARG A N    2  
ATOM   6154   N N    O ARG A 1 316 ? 12.567  -5.447  35.326 0.95  0.00 ? 316 ARG A N    2  
ATOM   6155   C CA   C ARG A 1 316 ? 13.070  -4.284  33.755 0.05  0.00 ? 316 ARG A CA   2  
ATOM   6156   C CA   O ARG A 1 316 ? 12.976  -4.015  35.482 0.95  0.00 ? 316 ARG A CA   2  
ATOM   6157   C C    C ARG A 1 316 ? 12.257  -3.065  34.231 0.05  0.00 ? 316 ARG A C    2  
ATOM   6158   C C    O ARG A 1 316 ? 12.248  -3.399  36.692 0.95  0.00 ? 316 ARG A C    2  
ATOM   6159   O O    C ARG A 1 316 ? 12.788  -1.946  34.453 0.05  0.00 ? 316 ARG A O    2  
ATOM   6160   O O    O ARG A 1 316 ? 12.814  -2.603  37.486 0.95  0.00 ? 316 ARG A O    2  
ATOM   6161   H H    C ARG A 1 316 ? 12.065  -6.170  33.908 0.05  0.00 ? 316 ARG A H    2  
ATOM   6162   H H    O ARG A 1 316 ? 11.987  -5.683  34.571 0.95  0.00 ? 316 ARG A H    2  
ATOM   6163   N N    C ILE A 1 317 ? 10.962  -3.339  34.397 0.05  0.00 ? 317 ILE A N    2  
ATOM   6164   N N    O ILE A 1 317 ? 10.987  -3.819  36.806 0.95  0.00 ? 317 ILE A N    2  
ATOM   6165   C CA   C ILE A 1 317 ? 10.047  -2.275  34.890 0.05  0.00 ? 317 ILE A CA   2  
ATOM   6166   C CA   O ILE A 1 317 ? 10.159  -3.345  37.947 0.95  0.00 ? 317 ILE A CA   2  
ATOM   6167   C C    C ILE A 1 317 ? 10.280  -2.013  36.353 0.05  0.00 ? 317 ILE A C    2  
ATOM   6168   C C    O ILE A 1 317 ? 10.597  -4.002  39.228 0.95  0.00 ? 317 ILE A C    2  
ATOM   6169   O O    C ILE A 1 317 ? 10.310  -0.813  36.784 0.05  0.00 ? 317 ILE A O    2  
ATOM   6170   O O    O ILE A 1 317 ? 10.697  -3.308  40.293 0.95  0.00 ? 317 ILE A O    2  
ATOM   6171   H H    C ILE A 1 317 ? 10.621  -4.241  34.219 0.05  0.00 ? 317 ILE A H    2  
ATOM   6172   H H    O ILE A 1 317 ? 10.617  -4.454  36.157 0.95  0.00 ? 317 ILE A H    2  
ATOM   6173   N N    C ALA A 1 318 ? 10.522  -3.034  37.163 0.05  0.00 ? 318 ALA A N    2  
ATOM   6174   N N    O ALA A 1 318 ? 10.942  -5.282  39.214 0.95  0.00 ? 318 ALA A N    2  
ATOM   6175   C CA   C ALA A 1 318 ? 10.786  -2.900  38.565 0.05  0.00 ? 318 ALA A CA   2  
ATOM   6176   C CA   O ALA A 1 318 ? 11.402  -6.001  40.365 0.95  0.00 ? 318 ALA A CA   2  
ATOM   6177   C C    C ALA A 1 318 ? 12.066  -2.072  38.794 0.05  0.00 ? 318 ALA A C    2  
ATOM   6178   C C    O ALA A 1 318 ? 12.708  -5.381  40.900 0.95  0.00 ? 318 ALA A C    2  
ATOM   6179   O O    C ALA A 1 318 ? 12.159  -1.349  39.809 0.05  0.00 ? 318 ALA A O    2  
ATOM   6180   O O    O ALA A 1 318 ? 12.948  -5.413  42.126 0.95  0.00 ? 318 ALA A O    2  
ATOM   6181   H H    C ALA A 1 318 ? 10.540  -3.934  36.775 0.05  0.00 ? 318 ALA A H    2  
ATOM   6182   H H    O ALA A 1 318 ? 10.898  -5.760  38.359 0.95  0.00 ? 318 ALA A H    2  
ATOM   6183   N N    C ALA A 1 319 ? 13.050  -2.352  37.948 0.05  0.00 ? 319 ALA A N    2  
ATOM   6184   N N    O ALA A 1 319 ? 13.561  -5.015  39.951 0.95  0.00 ? 319 ALA A N    2  
ATOM   6185   C CA   C ALA A 1 319 ? 14.341  -1.672  38.063 0.05  0.00 ? 319 ALA A CA   2  
ATOM   6186   C CA   O ALA A 1 319 ? 14.861  -4.443  40.305 0.95  0.00 ? 319 ALA A CA   2  
ATOM   6187   C C    C ALA A 1 319 ? 14.186  -0.162  37.727 0.05  0.00 ? 319 ALA A C    2  
ATOM   6188   C C    O ALA A 1 319 ? 14.673  -3.054  40.979 0.95  0.00 ? 319 ALA A C    2  
ATOM   6189   O O    C ALA A 1 319 ? 14.790  0.629   38.454 0.05  0.00 ? 319 ALA A O    2  
ATOM   6190   O O    O ALA A 1 319 ? 15.379  -2.818  41.961 0.95  0.00 ? 319 ALA A O    2  
ATOM   6191   H H    C ALA A 1 319 ? 12.920  -3.037  37.258 0.05  0.00 ? 319 ALA A H    2  
ATOM   6192   H H    O ALA A 1 319 ? 13.330  -5.152  39.008 0.95  0.00 ? 319 ALA A H    2  
ATOM   6193   N N    C THR A 1 320 ? 13.450  0.126   36.710 0.05  0.00 ? 320 THR A N    2  
ATOM   6194   N N    O THR A 1 320 ? 13.803  -2.270  40.442 0.95  0.00 ? 320 THR A N    2  
ATOM   6195   C CA   C THR A 1 320 ? 13.138  1.475   36.213 0.05  0.00 ? 320 THR A CA   2  
ATOM   6196   C CA   O THR A 1 320 ? 13.436  -0.925  40.909 0.95  0.00 ? 320 THR A CA   2  
ATOM   6197   C C    C THR A 1 320 ? 12.559  2.267   37.394 0.05  0.00 ? 320 THR A C    2  
ATOM   6198   C C    O THR A 1 320 ? 13.035  -1.055  42.385 0.95  0.00 ? 320 THR A C    2  
ATOM   6199   O O    C THR A 1 320 ? 13.055  3.350   37.732 0.05  0.00 ? 320 THR A O    2  
ATOM   6200   O O    O THR A 1 320 ? 13.582  -0.361  43.252 0.95  0.00 ? 320 THR A O    2  
ATOM   6201   H H    C THR A 1 320 ? 13.046  -0.627  36.229 0.05  0.00 ? 320 THR A H    2  
ATOM   6202   H H    O THR A 1 320 ? 13.330  -2.609  39.653 0.95  0.00 ? 320 THR A H    2  
ATOM   6203   N N    C MET A 1 321 ? 11.507  1.733   37.984 0.05  0.00 ? 321 MET A N    2  
ATOM   6204   N N    O MET A 1 321 ? 12.072  -1.918  42.645 0.95  0.00 ? 321 MET A N    2  
ATOM   6205   C CA   C MET A 1 321 ? 10.876  2.367   39.163 0.05  0.00 ? 321 MET A CA   2  
ATOM   6206   C CA   O MET A 1 321 ? 11.618  -2.177  44.030 0.95  0.00 ? 321 MET A CA   2  
ATOM   6207   C C    C MET A 1 321 ? 11.818  2.549   40.294 0.05  0.00 ? 321 MET A C    2  
ATOM   6208   C C    O MET A 1 321 ? 12.711  -2.641  44.919 0.95  0.00 ? 321 MET A C    2  
ATOM   6209   O O    C MET A 1 321 ? 11.857  3.603   40.967 0.05  0.00 ? 321 MET A O    2  
ATOM   6210   O O    O MET A 1 321 ? 12.852  -2.208  46.084 0.95  0.00 ? 321 MET A O    2  
ATOM   6211   H H    C MET A 1 321 ? 11.153  0.881   37.651 0.05  0.00 ? 321 MET A H    2  
ATOM   6212   H H    O MET A 1 321 ? 11.668  -2.421  41.907 0.95  0.00 ? 321 MET A H    2  
ATOM   6213   N N    C GLU A 1 322 ? 12.665  1.566   40.636 0.05  0.00 ? 322 GLU A N    2  
ATOM   6214   N N    O GLU A 1 322 ? 13.589  -3.560  44.490 0.95  0.00 ? 322 GLU A N    2  
ATOM   6215   C CA   C GLU A 1 322 ? 13.618  1.652   41.713 0.05  0.00 ? 322 GLU A CA   2  
ATOM   6216   C CA   O GLU A 1 322 ? 14.685  -4.066  45.277 0.95  0.00 ? 322 GLU A CA   2  
ATOM   6217   C C    C GLU A 1 322 ? 14.650  2.791   41.567 0.05  0.00 ? 322 GLU A C    2  
ATOM   6218   C C    O GLU A 1 322 ? 15.695  -2.993  45.736 0.95  0.00 ? 322 GLU A C    2  
ATOM   6219   O O    C GLU A 1 322 ? 14.969  3.469   42.540 0.05  0.00 ? 322 GLU A O    2  
ATOM   6220   O O    O GLU A 1 322 ? 16.153  -3.017  46.875 0.95  0.00 ? 322 GLU A O    2  
ATOM   6221   H H    C GLU A 1 322 ? 12.637  0.736   40.114 0.05  0.00 ? 322 GLU A H    2  
ATOM   6222   H H    O GLU A 1 322 ? 13.481  -3.905  43.579 0.95  0.00 ? 322 GLU A H    2  
ATOM   6223   N N    C ASN A 1 323 ? 15.136  2.915   40.362 0.05  0.00 ? 323 ASN A N    2  
ATOM   6224   N N    O ASN A 1 323 ? 16.008  -2.129  44.809 0.95  0.00 ? 323 ASN A N    2  
ATOM   6225   C CA   C ASN A 1 323 ? 16.118  3.923   39.968 0.05  0.00 ? 323 ASN A CA   2  
ATOM   6226   C CA   O ASN A 1 323 ? 16.933  -1.014  45.000 0.95  0.00 ? 323 ASN A CA   2  
ATOM   6227   C C    C ASN A 1 323 ? 15.433  5.335   40.061 0.05  0.00 ? 323 ASN A C    2  
ATOM   6228   C C    O ASN A 1 323 ? 16.280  -0.004  46.012 0.95  0.00 ? 323 ASN A C    2  
ATOM   6229   O O    C ASN A 1 323 ? 16.096  6.234   40.524 0.05  0.00 ? 323 ASN A O    2  
ATOM   6230   O O    O ASN A 1 323 ? 17.009  0.482   46.845 0.95  0.00 ? 323 ASN A O    2  
ATOM   6231   H H    C ASN A 1 323 ? 14.816  2.295   39.674 0.05  0.00 ? 323 ASN A H    2  
ATOM   6232   H H    O ASN A 1 323 ? 15.590  -2.231  43.929 0.95  0.00 ? 323 ASN A H    2  
ATOM   6233   N N    C ALA A 1 324 ? 14.230  5.369   39.572 0.05  0.00 ? 324 ALA A N    2  
ATOM   6234   N N    O ALA A 1 324 ? 15.020  0.223   45.789 0.95  0.00 ? 324 ALA A N    2  
ATOM   6235   C CA   C ALA A 1 324 ? 13.402  6.579   39.571 0.05  0.00 ? 324 ALA A CA   2  
ATOM   6236   C CA   O ALA A 1 324 ? 14.210  1.118   46.621 0.95  0.00 ? 324 ALA A CA   2  
ATOM   6237   C C    C ALA A 1 324 ? 13.129  7.015   40.998 0.05  0.00 ? 324 ALA A C    2  
ATOM   6238   C C    O ALA A 1 324 ? 14.144  0.581   48.038 0.95  0.00 ? 324 ALA A C    2  
ATOM   6239   O O    C ALA A 1 324 ? 13.205  8.216   41.289 0.05  0.00 ? 324 ALA A O    2  
ATOM   6240   O O    O ALA A 1 324 ? 14.270  1.364   48.988 0.95  0.00 ? 324 ALA A O    2  
ATOM   6241   H H    C ALA A 1 324 ? 13.854  4.545   39.197 0.05  0.00 ? 324 ALA A H    2  
ATOM   6242   H H    O ALA A 1 324 ? 14.589  -0.234  45.036 0.95  0.00 ? 324 ALA A H    2  
ATOM   6243   N N    C GLN A 1 325 ? 12.886  6.133   41.927 0.05  0.00 ? 325 GLN A N    2  
ATOM   6244   N N    O GLN A 1 325 ? 14.027  -0.699  48.258 0.95  0.00 ? 325 GLN A N    2  
ATOM   6245   C CA   C GLN A 1 325 ? 12.637  6.468   43.312 0.05  0.00 ? 325 GLN A CA   2  
ATOM   6246   C CA   O GLN A 1 325 ? 13.977  -1.289  49.578 0.95  0.00 ? 325 GLN A CA   2  
ATOM   6247   C C    C GLN A 1 325 ? 13.868  7.005   43.989 0.05  0.00 ? 325 GLN A C    2  
ATOM   6248   C C    O GLN A 1 325 ? 15.295  -1.174  50.293 0.95  0.00 ? 325 GLN A C    2  
ATOM   6249   O O    C GLN A 1 325 ? 13.767  7.685   45.019 0.05  0.00 ? 325 GLN A O    2  
ATOM   6250   O O    O GLN A 1 325 ? 15.346  -1.264  51.527 0.95  0.00 ? 325 GLN A O    2  
ATOM   6251   H H    C GLN A 1 325 ? 12.885  5.185   41.674 0.05  0.00 ? 325 GLN A H    2  
ATOM   6252   H H    O GLN A 1 325 ? 13.982  -1.298  47.483 0.95  0.00 ? 325 GLN A H    2  
ATOM   6253   N N    C LYS A 1 326 ? 15.030  6.671   43.509 0.05  0.00 ? 326 LYS A N    2  
ATOM   6254   N N    O LYS A 1 326 ? 16.376  -1.058  49.578 0.95  0.00 ? 326 LYS A N    2  
ATOM   6255   C CA   C LYS A 1 326 ? 16.312  7.124   44.029 0.05  0.00 ? 326 LYS A CA   2  
ATOM   6256   C CA   O LYS A 1 326 ? 17.722  -0.911  50.113 0.95  0.00 ? 326 LYS A CA   2  
ATOM   6257   C C    C LYS A 1 326 ? 16.865  8.339   43.271 0.05  0.00 ? 326 LYS A C    2  
ATOM   6258   C C    O LYS A 1 326 ? 18.173  0.555   50.193 0.95  0.00 ? 326 LYS A C    2  
ATOM   6259   O O    C LYS A 1 326 ? 17.835  8.931   43.759 0.05  0.00 ? 326 LYS A O    2  
ATOM   6260   O O    O LYS A 1 326 ? 19.207  0.806   50.824 0.95  0.00 ? 326 LYS A O    2  
ATOM   6261   H H    C LYS A 1 326 ? 15.044  6.082   42.726 0.05  0.00 ? 326 LYS A H    2  
ATOM   6262   H H    O LYS A 1 326 ? 16.275  -1.051  48.603 0.95  0.00 ? 326 LYS A H    2  
ATOM   6263   N N    C GLY A 1 327 ? 16.343  8.704   42.149 0.05  0.00 ? 327 GLY A N    2  
ATOM   6264   N N    O GLY A 1 327 ? 17.502  1.480   49.596 0.95  0.00 ? 327 GLY A N    2  
ATOM   6265   C CA   C GLY A 1 327 ? 16.739  9.808   41.299 0.05  0.00 ? 327 GLY A CA   2  
ATOM   6266   C CA   O GLY A 1 327 ? 17.807  2.894   49.518 0.95  0.00 ? 327 GLY A CA   2  
ATOM   6267   C C    C GLY A 1 327 ? 16.545  11.187  41.928 0.05  0.00 ? 327 GLY A C    2  
ATOM   6268   C C    O GLY A 1 327 ? 17.417  3.691   50.762 0.95  0.00 ? 327 GLY A C    2  
ATOM   6269   O O    C GLY A 1 327 ? 16.115  11.340  43.059 0.05  0.00 ? 327 GLY A O    2  
ATOM   6270   O O    O GLY A 1 327 ? 17.059  3.159   51.799 0.95  0.00 ? 327 GLY A O    2  
ATOM   6271   H H    C GLY A 1 327 ? 15.611  8.145   41.814 0.05  0.00 ? 327 GLY A H    2  
ATOM   6272   H H    O GLY A 1 327 ? 16.706  1.185   49.106 0.95  0.00 ? 327 GLY A H    2  
ATOM   6273   N N    C GLU A 1 328 ? 16.920  12.183  41.196 0.05  0.00 ? 328 GLU A N    2  
ATOM   6274   N N    O GLU A 1 328 ? 17.545  4.972   50.656 0.95  0.00 ? 328 GLU A N    2  
ATOM   6275   C CA   C GLU A 1 328 ? 16.893  13.610  41.523 0.05  0.00 ? 328 GLU A CA   2  
ATOM   6276   C CA   O GLU A 1 328 ? 17.272  5.997   51.665 0.95  0.00 ? 328 GLU A CA   2  
ATOM   6277   C C    C GLU A 1 328 ? 15.510  14.161  41.450 0.05  0.00 ? 328 GLU A C    2  
ATOM   6278   C C    O GLU A 1 328 ? 16.098  6.835   51.289 0.95  0.00 ? 328 GLU A C    2  
ATOM   6279   O O    C GLU A 1 328 ? 14.923  14.317  40.332 0.05  0.00 ? 328 GLU A O    2  
ATOM   6280   O O    O GLU A 1 328 ? 16.112  7.552   50.238 0.95  0.00 ? 328 GLU A O    2  
ATOM   6281   H H    C GLU A 1 328 ? 17.277  11.952  40.313 0.05  0.00 ? 328 GLU A H    2  
ATOM   6282   H H    O GLU A 1 328 ? 17.876  5.298   49.793 0.95  0.00 ? 328 GLU A H    2  
ATOM   6283   N N    C ILE A 1 329 ? 14.880  14.448  42.605 0.05  0.00 ? 329 ILE A N    2  
ATOM   6284   N N    O ILE A 1 329 ? 15.001  6.778   52.069 0.95  0.00 ? 329 ILE A N    2  
ATOM   6285   C CA   C ILE A 1 329 ? 13.501  15.007  42.519 0.05  0.00 ? 329 ILE A CA   2  
ATOM   6286   C CA   O ILE A 1 329 ? 13.847  7.647   51.702 0.95  0.00 ? 329 ILE A CA   2  
ATOM   6287   C C    C ILE A 1 329 ? 13.632  16.535  42.355 0.05  0.00 ? 329 ILE A C    2  
ATOM   6288   C C    O ILE A 1 329 ? 14.351  9.105   51.697 0.95  0.00 ? 329 ILE A C    2  
ATOM   6289   O O    C ILE A 1 329 ? 14.501  17.105  43.016 0.05  0.00 ? 329 ILE A O    2  
ATOM   6290   O O    O ILE A 1 329 ? 15.031  9.475   52.655 0.95  0.00 ? 329 ILE A O    2  
ATOM   6291   H H    C ILE A 1 329 ? 15.321  14.317  43.472 0.05  0.00 ? 329 ILE A H    2  
ATOM   6292   H H    O ILE A 1 329 ? 14.972  6.204   52.864 0.95  0.00 ? 329 ILE A H    2  
ATOM   6293   N N    C MET A 1 330 ? 12.850  17.154  41.540 0.05  0.00 ? 330 MET A N    2  
ATOM   6294   N N    O MET A 1 330 ? 14.058  9.872   50.705 0.95  0.00 ? 330 MET A N    2  
ATOM   6295   C CA   C MET A 1 330 ? 12.935  18.602  41.347 0.05  0.00 ? 330 MET A CA   2  
ATOM   6296   C CA   O MET A 1 330 ? 14.509  11.264  50.653 0.95  0.00 ? 330 MET A CA   2  
ATOM   6297   C C    C MET A 1 330 ? 13.008  19.298  42.741 0.05  0.00 ? 330 MET A C    2  
ATOM   6298   C C    O MET A 1 330 ? 13.763  12.081  51.752 0.95  0.00 ? 330 MET A C    2  
ATOM   6299   O O    C MET A 1 330 ? 12.378  18.777  43.667 0.05  0.00 ? 330 MET A O    2  
ATOM   6300   O O    O MET A 1 330 ? 12.530  12.118  51.691 0.95  0.00 ? 330 MET A O    2  
ATOM   6301   H H    C MET A 1 330 ? 12.181  16.644  41.039 0.05  0.00 ? 330 MET A H    2  
ATOM   6302   H H    O MET A 1 330 ? 13.520  9.517   49.968 0.95  0.00 ? 330 MET A H    2  
ATOM   6303   N N    C PRO A 1 331 ? 13.705  20.408  42.825 0.05  0.00 ? 331 PRO A N    2  
ATOM   6304   N N    O PRO A 1 331 ? 14.499  12.702  52.645 0.95  0.00 ? 331 PRO A N    2  
ATOM   6305   C CA   C PRO A 1 331 ? 13.842  21.182  44.090 0.05  0.00 ? 331 PRO A CA   2  
ATOM   6306   C CA   O PRO A 1 331 ? 13.919  13.565  53.712 0.95  0.00 ? 331 PRO A CA   2  
ATOM   6307   C C    C PRO A 1 331 ? 12.555  21.209  44.870 0.05  0.00 ? 331 PRO A C    2  
ATOM   6308   C C    O PRO A 1 331 ? 13.016  14.626  53.142 0.95  0.00 ? 331 PRO A C    2  
ATOM   6309   O O    C PRO A 1 331 ? 12.248  20.413  45.744 0.05  0.00 ? 331 PRO A O    2  
ATOM   6310   O O    O PRO A 1 331 ? 13.243  15.270  52.129 0.95  0.00 ? 331 PRO A O    2  
ATOM   6311   N N    C ASN A 1 332 ? 11.725  22.247  44.618 0.05  0.00 ? 332 ASN A N    2  
ATOM   6312   N N    O ASN A 1 332 ? 11.835  14.808  53.775 0.95  0.00 ? 332 ASN A N    2  
ATOM   6313   C CA   C ASN A 1 332 ? 10.453  22.421  45.323 0.05  0.00 ? 332 ASN A CA   2  
ATOM   6314   C CA   O ASN A 1 332 ? 10.837  15.773  53.307 0.95  0.00 ? 332 ASN A CA   2  
ATOM   6315   C C    C ASN A 1 332 ? 10.064  23.876  45.652 0.05  0.00 ? 332 ASN A C    2  
ATOM   6316   C C    O ASN A 1 332 ? 10.893  17.166  53.966 0.95  0.00 ? 332 ASN A C    2  
ATOM   6317   O O    C ASN A 1 332 ? 8.892   24.137  45.993 0.05  0.00 ? 332 ASN A O    2  
ATOM   6318   O O    O ASN A 1 332 ? 10.028  18.018  53.676 0.95  0.00 ? 332 ASN A O    2  
ATOM   6319   H H    C ASN A 1 332 ? 11.998  22.922  43.961 0.05  0.00 ? 332 ASN A H    2  
ATOM   6320   H H    O ASN A 1 332 ? 11.627  14.254  54.557 0.95  0.00 ? 332 ASN A H    2  
ATOM   6321   N N    C ILE A 1 333 ? 11.012  24.776  45.532 0.05  0.00 ? 333 ILE A N    2  
ATOM   6322   N N    O ILE A 1 333 ? 11.884  17.379  54.799 0.95  0.00 ? 333 ILE A N    2  
ATOM   6323   C CA   C ILE A 1 333 ? 10.894  26.212  45.802 0.05  0.00 ? 333 ILE A CA   2  
ATOM   6324   C CA   O ILE A 1 333 ? 12.137  18.605  55.562 0.95  0.00 ? 333 ILE A CA   2  
ATOM   6325   C C    C ILE A 1 333 ? 10.445  26.964  44.557 0.05  0.00 ? 333 ILE A C    2  
ATOM   6326   C C    O ILE A 1 333 ? 12.863  19.636  54.709 0.95  0.00 ? 333 ILE A C    2  
ATOM   6327   O O    C ILE A 1 333 ? 10.555  26.484  43.424 0.05  0.00 ? 333 ILE A O    2  
ATOM   6328   O O    O ILE A 1 333 ? 13.548  19.315  53.732 0.95  0.00 ? 333 ILE A O    2  
ATOM   6329   H H    C ILE A 1 333 ? 11.892  24.452  45.245 0.05  0.00 ? 333 ILE A H    2  
ATOM   6330   H H    O ILE A 1 333 ? 12.511  16.638  54.936 0.95  0.00 ? 333 ILE A H    2  
ATOM   6331   N N    C PRO A 1 334 ? 9.926   28.165  44.844 0.05  0.00 ? 334 PRO A N    2  
ATOM   6332   N N    O PRO A 1 334 ? 12.658  20.889  55.135 0.95  0.00 ? 334 PRO A N    2  
ATOM   6333   C CA   C PRO A 1 334 ? 9.489   29.112  43.830 0.05  0.00 ? 334 PRO A CA   2  
ATOM   6334   C CA   O PRO A 1 334 ? 13.229  22.059  54.487 0.95  0.00 ? 334 PRO A CA   2  
ATOM   6335   C C    C PRO A 1 334 ? 10.565  29.605  42.899 0.05  0.00 ? 334 PRO A C    2  
ATOM   6336   C C    O PRO A 1 334 ? 14.733  22.123  54.474 0.95  0.00 ? 334 PRO A C    2  
ATOM   6337   O O    C PRO A 1 334 ? 10.267  29.867  41.729 0.05  0.00 ? 334 PRO A O    2  
ATOM   6338   O O    O PRO A 1 334 ? 15.300  22.650  53.511 0.95  0.00 ? 334 PRO A O    2  
ATOM   6339   N N    C GLN A 1 335 ? 11.791  29.744  43.299 0.05  0.00 ? 335 GLN A N    2  
ATOM   6340   N N    O GLN A 1 335 ? 15.437  21.625  55.443 0.95  0.00 ? 335 GLN A N    2  
ATOM   6341   C CA   C GLN A 1 335 ? 12.911  30.172  42.476 0.05  0.00 ? 335 GLN A CA   2  
ATOM   6342   C CA   O GLN A 1 335 ? 16.890  21.596  55.512 0.95  0.00 ? 335 GLN A CA   2  
ATOM   6343   C C    C GLN A 1 335 ? 13.210  29.222  41.311 0.05  0.00 ? 335 GLN A C    2  
ATOM   6344   C C    O GLN A 1 335 ? 17.538  20.784  54.385 0.95  0.00 ? 335 GLN A C    2  
ATOM   6345   O O    C GLN A 1 335 ? 14.068  29.505  40.455 0.05  0.00 ? 335 GLN A O    2  
ATOM   6346   O O    O GLN A 1 335 ? 18.774  20.753  54.244 0.95  0.00 ? 335 GLN A O    2  
ATOM   6347   H H    C GLN A 1 335 ? 11.985  29.516  44.232 0.05  0.00 ? 335 GLN A H    2  
ATOM   6348   H H    O GLN A 1 335 ? 14.948  21.208  56.182 0.95  0.00 ? 335 GLN A H    2  
ATOM   6349   N N    C MET A 1 336 ? 12.582  28.064  41.312 0.05  0.00 ? 336 MET A N    2  
ATOM   6350   N N    O MET A 1 336 ? 16.733  20.058  53.636 0.95  0.00 ? 336 MET A N    2  
ATOM   6351   C CA   C MET A 1 336 ? 12.736  27.019  40.283 0.05  0.00 ? 336 MET A CA   2  
ATOM   6352   C CA   O MET A 1 336 ? 17.163  19.212  52.508 0.95  0.00 ? 336 MET A CA   2  
ATOM   6353   C C    C MET A 1 336 ? 12.179  27.561  38.976 0.05  0.00 ? 336 MET A C    2  
ATOM   6354   C C    O MET A 1 336 ? 17.704  20.122  51.417 0.95  0.00 ? 336 MET A C    2  
ATOM   6355   O O    C MET A 1 336 ? 12.622  27.134  37.901 0.05  0.00 ? 336 MET A O    2  
ATOM   6356   O O    O MET A 1 336 ? 18.558  19.690  50.630 0.95  0.00 ? 336 MET A O    2  
ATOM   6357   H H    C MET A 1 336 ? 11.966  27.881  42.053 0.05  0.00 ? 336 MET A H    2  
ATOM   6358   H H    O MET A 1 336 ? 15.775  20.081  53.844 0.95  0.00 ? 336 MET A H    2  
ATOM   6359   N N    C SER A 1 337 ? 11.241  28.496  39.057 0.05  0.00 ? 337 SER A N    2  
ATOM   6360   N N    O SER A 1 337 ? 17.237  21.363  51.375 0.95  0.00 ? 337 SER A N    2  
ATOM   6361   C CA   C SER A 1 337 ? 10.688  29.063  37.816 0.05  0.00 ? 337 SER A CA   2  
ATOM   6362   C CA   O SER A 1 337 ? 17.748  22.285  50.347 0.95  0.00 ? 337 SER A CA   2  
ATOM   6363   C C    C SER A 1 337 ? 11.780  29.840  37.070 0.05  0.00 ? 337 SER A C    2  
ATOM   6364   C C    O SER A 1 337 ? 19.236  22.565  50.595 0.95  0.00 ? 337 SER A C    2  
ATOM   6365   O O    C SER A 1 337 ? 11.826  29.888  35.826 0.05  0.00 ? 337 SER A O    2  
ATOM   6366   O O    O SER A 1 337 ? 20.038  22.756  49.662 0.95  0.00 ? 337 SER A O    2  
ATOM   6367   H H    C SER A 1 337 ? 10.931  28.814  39.930 0.05  0.00 ? 337 SER A H    2  
ATOM   6368   H H    O SER A 1 337 ? 16.572  21.666  52.027 0.95  0.00 ? 337 SER A H    2  
ATOM   6369   N N    C ALA A 1 338 ? 12.643  30.477  37.809 0.05  0.00 ? 338 ALA A N    2  
ATOM   6370   N N    O ALA A 1 338 ? 19.612  22.624  51.841 0.95  0.00 ? 338 ALA A N    2  
ATOM   6371   C CA   C ALA A 1 338 ? 13.750  31.243  37.238 0.05  0.00 ? 338 ALA A CA   2  
ATOM   6372   C CA   O ALA A 1 338 ? 21.001  22.864  52.229 0.95  0.00 ? 338 ALA A CA   2  
ATOM   6373   C C    C ALA A 1 338 ? 14.703  30.292  36.514 0.05  0.00 ? 338 ALA A C    2  
ATOM   6374   C C    O ALA A 1 338 ? 21.865  21.689  51.768 0.95  0.00 ? 338 ALA A C    2  
ATOM   6375   O O    C ALA A 1 338 ? 15.226  30.611  35.444 0.05  0.00 ? 338 ALA A O    2  
ATOM   6376   O O    O ALA A 1 338 ? 22.994  21.874  51.309 0.95  0.00 ? 338 ALA A O    2  
ATOM   6377   H H    C ALA A 1 338 ? 12.555  30.429  38.784 0.05  0.00 ? 338 ALA A H    2  
ATOM   6378   H H    O ALA A 1 338 ? 18.941  22.490  52.543 0.95  0.00 ? 338 ALA A H    2  
ATOM   6379   N N    C PHE A 1 339 ? 14.952  29.170  37.168 0.05  0.00 ? 339 PHE A N    2  
ATOM   6380   N N    O PHE A 1 339 ? 21.322  20.502  51.976 0.95  0.00 ? 339 PHE A N    2  
ATOM   6381   C CA   C PHE A 1 339 ? 15.844  28.128  36.630 0.05  0.00 ? 339 PHE A CA   2  
ATOM   6382   C CA   O PHE A 1 339 ? 22.001  19.250  51.596 0.95  0.00 ? 339 PHE A CA   2  
ATOM   6383   C C    C PHE A 1 339 ? 15.303  27.626  35.294 0.05  0.00 ? 339 PHE A C    2  
ATOM   6384   C C    O PHE A 1 339 ? 22.264  19.242  50.093 0.95  0.00 ? 339 PHE A C    2  
ATOM   6385   O O    C PHE A 1 339 ? 16.068  27.573  34.316 0.05  0.00 ? 339 PHE A O    2  
ATOM   6386   O O    O PHE A 1 339 ? 23.407  18.976  49.683 0.95  0.00 ? 339 PHE A O    2  
ATOM   6387   H H    C PHE A 1 339 ? 14.527  29.026  38.040 0.05  0.00 ? 339 PHE A H    2  
ATOM   6388   H H    O PHE A 1 339 ? 20.437  20.452  52.396 0.95  0.00 ? 339 PHE A H    2  
ATOM   6389   N N    C TRP A 1 340 ? 14.042  27.301  35.190 0.05  0.00 ? 340 TRP A N    2  
ATOM   6390   N N    O TRP A 1 340 ? 21.300  19.553  49.268 0.95  0.00 ? 340 TRP A N    2  
ATOM   6391   C CA   C TRP A 1 340 ? 13.510  26.777  33.936 0.05  0.00 ? 340 TRP A CA   2  
ATOM   6392   C CA   O TRP A 1 340 ? 21.514  19.510  47.825 0.95  0.00 ? 340 TRP A CA   2  
ATOM   6393   C C    C TRP A 1 340 ? 13.801  27.699  32.768 0.05  0.00 ? 340 TRP A C    2  
ATOM   6394   C C    O TRP A 1 340 ? 22.708  20.344  47.404 0.95  0.00 ? 340 TRP A C    2  
ATOM   6395   O O    C TRP A 1 340 ? 14.390  27.287  31.761 0.05  0.00 ? 340 TRP A O    2  
ATOM   6396   O O    O TRP A 1 340 ? 23.633  19.848  46.748 0.95  0.00 ? 340 TRP A O    2  
ATOM   6397   H H    C TRP A 1 340 ? 13.454  27.383  35.970 0.05  0.00 ? 340 TRP A H    2  
ATOM   6398   H H    O TRP A 1 340 ? 20.417  19.789  49.621 0.95  0.00 ? 340 TRP A H    2  
ATOM   6399   N N    C TYR A 1 341 ? 13.336  28.948  32.916 0.05  0.00 ? 341 TYR A N    2  
ATOM   6400   N N    O TYR A 1 341 ? 22.642  21.633  47.767 0.95  0.00 ? 341 TYR A N    2  
ATOM   6401   C CA   C TYR A 1 341 ? 13.513  29.939  31.831 0.05  0.00 ? 341 TYR A CA   2  
ATOM   6402   C CA   O TYR A 1 341 ? 23.722  22.568  47.381 0.95  0.00 ? 341 TYR A CA   2  
ATOM   6403   C C    C TYR A 1 341 ? 14.967  30.212  31.553 0.05  0.00 ? 341 TYR A C    2  
ATOM   6404   C C    O TYR A 1 341 ? 25.045  22.175  47.982 0.95  0.00 ? 341 TYR A C    2  
ATOM   6405   O O    C TYR A 1 341 ? 15.325  30.215  30.362 0.05  0.00 ? 341 TYR A O    2  
ATOM   6406   O O    O TYR A 1 341 ? 26.033  22.175  47.226 0.95  0.00 ? 341 TYR A O    2  
ATOM   6407   H H    C TYR A 1 341 ? 12.855  29.197  33.732 0.05  0.00 ? 341 TYR A H    2  
ATOM   6408   H H    O TYR A 1 341 ? 21.865  21.962  48.264 0.95  0.00 ? 341 TYR A H    2  
ATOM   6409   N N    C ALA A 1 342 ? 15.792  30.451  32.537 0.05  0.00 ? 342 ALA A N    2  
ATOM   6410   N N    O ALA A 1 342 ? 25.128  21.870  49.249 0.95  0.00 ? 342 ALA A N    2  
ATOM   6411   C CA   C ALA A 1 342 ? 17.192  30.743  32.347 0.05  0.00 ? 342 ALA A CA   2  
ATOM   6412   C CA   O ALA A 1 342 ? 26.363  21.506  49.900 0.95  0.00 ? 342 ALA A CA   2  
ATOM   6413   C C    C ALA A 1 342 ? 17.988  29.655  31.627 0.05  0.00 ? 342 ALA A C    2  
ATOM   6414   C C    O ALA A 1 342 ? 27.068  20.284  49.313 0.95  0.00 ? 342 ALA A C    2  
ATOM   6415   O O    C ALA A 1 342 ? 18.752  29.919  30.674 0.05  0.00 ? 342 ALA A O    2  
ATOM   6416   O O    O ALA A 1 342 ? 28.288  20.293  49.042 0.95  0.00 ? 342 ALA A O    2  
ATOM   6417   H H    C ALA A 1 342 ? 15.438  30.447  33.450 0.05  0.00 ? 342 ALA A H    2  
ATOM   6418   H H    O ALA A 1 342 ? 24.311  21.905  49.789 0.95  0.00 ? 342 ALA A H    2  
ATOM   6419   N N    C VAL A 1 343 ? 17.925  28.471  32.188 0.05  0.00 ? 343 VAL A N    2  
ATOM   6420   N N    O VAL A 1 343 ? 26.333  19.198  49.271 0.95  0.00 ? 343 VAL A N    2  
ATOM   6421   C CA   C VAL A 1 343 ? 18.631  27.291  31.624 0.05  0.00 ? 343 VAL A CA   2  
ATOM   6422   C CA   O VAL A 1 343 ? 26.850  17.915  48.727 0.95  0.00 ? 343 VAL A CA   2  
ATOM   6423   C C    C VAL A 1 343 ? 18.037  26.958  30.254 0.05  0.00 ? 343 VAL A C    2  
ATOM   6424   C C    O VAL A 1 343 ? 27.144  18.084  47.235 0.95  0.00 ? 343 VAL A C    2  
ATOM   6425   O O    C VAL A 1 343 ? 18.773  26.577  29.309 0.05  0.00 ? 343 VAL A O    2  
ATOM   6426   O O    O VAL A 1 343 ? 28.149  17.540  46.712 0.95  0.00 ? 343 VAL A O    2  
ATOM   6427   H H    C VAL A 1 343 ? 17.393  28.360  33.004 0.05  0.00 ? 343 VAL A H    2  
ATOM   6428   H H    O VAL A 1 343 ? 25.413  19.235  49.606 0.95  0.00 ? 343 VAL A H    2  
ATOM   6429   N N    C ARG A 1 344 ? 16.760  27.166  30.050 0.05  0.00 ? 344 ARG A N    2  
ATOM   6430   N N    O ARG A 1 344 ? 26.385  18.883  46.527 0.95  0.00 ? 344 ARG A N    2  
ATOM   6431   C CA   C ARG A 1 344 ? 16.157  26.892  28.731 0.05  0.00 ? 344 ARG A CA   2  
ATOM   6432   C CA   O ARG A 1 344 ? 26.659  19.101  45.093 0.95  0.00 ? 344 ARG A CA   2  
ATOM   6433   C C    C ARG A 1 344 ? 16.864  27.728  27.665 0.05  0.00 ? 344 ARG A C    2  
ATOM   6434   C C    O ARG A 1 344 ? 28.074  19.654  44.924 0.95  0.00 ? 344 ARG A C    2  
ATOM   6435   O O    C ARG A 1 344 ? 17.351  27.277  26.617 0.05  0.00 ? 344 ARG A O    2  
ATOM   6436   O O    O ARG A 1 344 ? 28.937  19.177  44.171 0.95  0.00 ? 344 ARG A O    2  
ATOM   6437   H H    C ARG A 1 344 ? 16.205  27.530  30.772 0.05  0.00 ? 344 ARG A H    2  
ATOM   6438   H H    O ARG A 1 344 ? 25.645  19.359  46.958 0.95  0.00 ? 344 ARG A H    2  
ATOM   6439   N N    C THR A 1 345 ? 16.982  29.007  28.010 0.05  0.00 ? 345 THR A N    2  
ATOM   6440   N N    O THR A 1 345 ? 28.328  20.674  45.739 0.95  0.00 ? 345 THR A N    2  
ATOM   6441   C CA   C THR A 1 345 ? 17.649  30.003  27.160 0.05  0.00 ? 345 THR A CA   2  
ATOM   6442   C CA   O THR A 1 345 ? 29.629  21.355  45.780 0.95  0.00 ? 345 THR A CA   2  
ATOM   6443   C C    C THR A 1 345 ? 19.107  29.696  27.005 0.05  0.00 ? 345 THR A C    2  
ATOM   6444   C C    O THR A 1 345 ? 30.710  20.435  46.259 0.95  0.00 ? 345 THR A C    2  
ATOM   6445   O O    C THR A 1 345 ? 19.582  29.682  25.853 0.05  0.00 ? 345 THR A O    2  
ATOM   6446   O O    O THR A 1 345 ? 31.755  20.361  45.584 0.95  0.00 ? 345 THR A O    2  
ATOM   6447   H H    C THR A 1 345 ? 16.625  29.294  28.876 0.05  0.00 ? 345 THR A H    2  
ATOM   6448   H H    O THR A 1 345 ? 27.623  20.972  46.351 0.95  0.00 ? 345 THR A H    2  
ATOM   6449   N N    C ALA A 1 346 ? 19.848  29.426  28.034 0.05  0.00 ? 346 ALA A N    2  
ATOM   6450   N N    O ALA A 1 346 ? 30.554  19.716  47.326 0.95  0.00 ? 346 ALA A N    2  
ATOM   6451   C CA   C ALA A 1 346 ? 21.264  29.119  27.940 0.05  0.00 ? 346 ALA A CA   2  
ATOM   6452   C CA   O ALA A 1 346 ? 31.567  18.807  47.832 0.95  0.00 ? 346 ALA A CA   2  
ATOM   6453   C C    C ALA A 1 346 ? 21.560  27.995  26.953 0.05  0.00 ? 346 ALA A C    2  
ATOM   6454   C C    O ALA A 1 346 ? 32.054  17.820  46.776 0.95  0.00 ? 346 ALA A C    2  
ATOM   6455   O O    C ALA A 1 346 ? 22.552  28.061  26.202 0.05  0.00 ? 346 ALA A O    2  
ATOM   6456   O O    O ALA A 1 346 ? 33.261  17.523  46.701 0.95  0.00 ? 346 ALA A O    2  
ATOM   6457   H H    C ALA A 1 346 ? 19.430  29.428  28.921 0.05  0.00 ? 346 ALA A H    2  
ATOM   6458   H H    O ALA A 1 346 ? 29.708  19.789  47.816 0.95  0.00 ? 346 ALA A H    2  
ATOM   6459   N N    C VAL A 1 347 ? 20.737  26.957  26.974 0.05  0.00 ? 347 VAL A N    2  
ATOM   6460   N N    O VAL A 1 347 ? 31.127  17.286  45.993 0.95  0.00 ? 347 VAL A N    2  
ATOM   6461   C CA   C VAL A 1 347 ? 20.998  25.792  26.111 0.05  0.00 ? 347 VAL A CA   2  
ATOM   6462   C CA   O VAL A 1 347 ? 31.501  16.263  45.002 0.95  0.00 ? 347 VAL A CA   2  
ATOM   6463   C C    C VAL A 1 347 ? 20.692  26.078  24.654 0.05  0.00 ? 347 VAL A C    2  
ATOM   6464   C C    O VAL A 1 347 ? 32.243  16.853  43.819 0.95  0.00 ? 347 VAL A C    2  
ATOM   6465   O O    C VAL A 1 347 ? 21.500  25.675  23.784 0.05  0.00 ? 347 VAL A O    2  
ATOM   6466   O O    O VAL A 1 347 ? 33.249  16.246  43.382 0.95  0.00 ? 347 VAL A O    2  
ATOM   6467   H H    C VAL A 1 347 ? 19.987  26.941  27.605 0.05  0.00 ? 347 VAL A H    2  
ATOM   6468   H H    O VAL A 1 347 ? 30.186  17.532  46.112 0.95  0.00 ? 347 VAL A H    2  
ATOM   6469   N N    C ILE A 1 348 ? 19.575  26.712  24.383 0.05  0.00 ? 348 ILE A N    2  
ATOM   6470   N N    O ILE A 1 348 ? 31.769  17.961  43.299 0.95  0.00 ? 348 ILE A N    2  
ATOM   6471   C CA   C ILE A 1 348 ? 19.204  27.012  22.979 0.05  0.00 ? 348 ILE A CA   2  
ATOM   6472   C CA   O ILE A 1 348 ? 32.434  18.587  42.131 0.95  0.00 ? 348 ILE A CA   2  
ATOM   6473   C C    C ILE A 1 348 ? 20.236  27.967  22.381 0.05  0.00 ? 348 ILE A C    2  
ATOM   6474   C C    O ILE A 1 348 ? 33.840  19.030  42.534 0.95  0.00 ? 348 ILE A C    2  
ATOM   6475   O O    C ILE A 1 348 ? 20.529  27.860  21.203 0.05  0.00 ? 348 ILE A O    2  
ATOM   6476   O O    O ILE A 1 348 ? 34.740  18.962  41.714 0.95  0.00 ? 348 ILE A O    2  
ATOM   6477   H H    C ILE A 1 348 ? 18.978  26.980  25.112 0.05  0.00 ? 348 ILE A H    2  
ATOM   6478   H H    O ILE A 1 348 ? 30.964  18.372  43.679 0.95  0.00 ? 348 ILE A H    2  
ATOM   6479   N N    C ASN A 1 349 ? 20.784  28.850  23.175 0.05  0.00 ? 349 ASN A N    2  
ATOM   6480   N N    O ASN A 1 349 ? 34.023  19.443  43.761 0.95  0.00 ? 349 ASN A N    2  
ATOM   6481   C CA   C ASN A 1 349 ? 21.745  29.855  22.788 0.05  0.00 ? 349 ASN A CA   2  
ATOM   6482   C CA   O ASN A 1 349 ? 35.263  19.934  44.313 0.95  0.00 ? 349 ASN A CA   2  
ATOM   6483   C C    C ASN A 1 349 ? 23.085  29.234  22.502 0.05  0.00 ? 349 ASN A C    2  
ATOM   6484   C C    O ASN A 1 349 ? 36.244  18.811  44.511 0.95  0.00 ? 349 ASN A C    2  
ATOM   6485   O O    C ASN A 1 349 ? 23.629  29.613  21.460 0.05  0.00 ? 349 ASN A O    2  
ATOM   6486   O O    O ASN A 1 349 ? 37.389  19.035  44.106 0.95  0.00 ? 349 ASN A O    2  
ATOM   6487   H H    C ASN A 1 349 ? 20.496  28.845  24.111 0.05  0.00 ? 349 ASN A H    2  
ATOM   6488   H H    O ASN A 1 349 ? 33.241  19.444  44.351 0.95  0.00 ? 349 ASN A H    2  
ATOM   6489   N N    C ALA A 1 350 ? 23.563  28.408  23.396 0.05  0.00 ? 350 ALA A N    2  
ATOM   6490   N N    O ALA A 1 350 ? 35.812  17.744  45.132 0.95  0.00 ? 350 ALA A N    2  
ATOM   6491   C CA   C ALA A 1 350 ? 24.840  27.733  23.214 0.05  0.00 ? 350 ALA A CA   2  
ATOM   6492   C CA   O ALA A 1 350 ? 36.667  16.588  45.360 0.95  0.00 ? 350 ALA A CA   2  
ATOM   6493   C C    C ALA A 1 350 ? 24.789  26.773  22.022 0.05  0.00 ? 350 ALA A C    2  
ATOM   6494   C C    O ALA A 1 350 ? 37.070  15.933  44.036 0.95  0.00 ? 350 ALA A C    2  
ATOM   6495   O O    C ALA A 1 350 ? 25.813  26.577  21.355 0.05  0.00 ? 350 ALA A O    2  
ATOM   6496   O O    O ALA A 1 350 ? 38.173  15.380  43.942 0.95  0.00 ? 350 ALA A O    2  
ATOM   6497   H H    C ALA A 1 350 ? 23.041  28.228  24.204 0.05  0.00 ? 350 ALA A H    2  
ATOM   6498   H H    O ALA A 1 350 ? 34.883  17.717  45.440 0.95  0.00 ? 350 ALA A H    2  
ATOM   6499   N N    C ALA A 1 351 ? 23.666  26.169  21.797 0.05  0.00 ? 351 ALA A N    2  
ATOM   6500   N N    O ALA A 1 351 ? 36.199  15.952  43.078 0.95  0.00 ? 351 ALA A N    2  
ATOM   6501   C CA   C ALA A 1 351 ? 23.387  25.178  20.773 0.05  0.00 ? 351 ALA A CA   2  
ATOM   6502   C CA   O ALA A 1 351 ? 36.323  15.352  41.761 0.95  0.00 ? 351 ALA A CA   2  
ATOM   6503   C C    C ALA A 1 351 ? 23.319  25.755  19.361 0.05  0.00 ? 351 ALA A C    2  
ATOM   6504   C C    O ALA A 1 351 ? 37.299  16.082  40.842 0.95  0.00 ? 351 ALA A C    2  
ATOM   6505   O O    C ALA A 1 351 ? 23.706  25.060  18.403 0.05  0.00 ? 351 ALA A O    2  
ATOM   6506   O O    O ALA A 1 351 ? 37.961  15.425  40.017 0.95  0.00 ? 351 ALA A O    2  
ATOM   6507   H H    C ALA A 1 351 ? 22.930  26.376  22.411 0.05  0.00 ? 351 ALA A H    2  
ATOM   6508   H H    O ALA A 1 351 ? 35.344  16.389  43.276 0.95  0.00 ? 351 ALA A H    2  
ATOM   6509   N N    C SER A 1 352 ? 22.774  26.935  19.279 0.05  0.00 ? 352 SER A N    2  
ATOM   6510   N N    O SER A 1 352 ? 37.293  17.379  40.959 0.95  0.00 ? 352 SER A N    2  
ATOM   6511   C CA   C SER A 1 352 ? 22.605  27.671  18.040 0.05  0.00 ? 352 SER A CA   2  
ATOM   6512   C CA   O SER A 1 352 ? 38.136  18.272  40.185 0.95  0.00 ? 352 SER A CA   2  
ATOM   6513   C C    C SER A 1 352 ? 23.778  28.588  17.753 0.05  0.00 ? 352 SER A C    2  
ATOM   6514   C C    O SER A 1 352 ? 39.446  18.574  40.886 0.95  0.00 ? 352 SER A C    2  
ATOM   6515   O O    C SER A 1 352 ? 23.673  29.366  16.786 0.05  0.00 ? 352 SER A O    2  
ATOM   6516   O O    O SER A 1 352 ? 40.184  19.437  40.373 0.95  0.00 ? 352 SER A O    2  
ATOM   6517   H H    C SER A 1 352 ? 22.458  27.353  20.108 0.05  0.00 ? 352 SER A H    2  
ATOM   6518   H H    O SER A 1 352 ? 36.680  17.778  41.612 0.95  0.00 ? 352 SER A H    2  
ATOM   6519   N N    C GLY A 1 353 ? 24.846  28.586  18.514 0.05  0.00 ? 353 GLY A N    2  
ATOM   6520   N N    O GLY A 1 353 ? 39.773  17.976  42.006 0.95  0.00 ? 353 GLY A N    2  
ATOM   6521   C CA   C GLY A 1 353 ? 26.016  29.413  18.330 0.05  0.00 ? 353 GLY A CA   2  
ATOM   6522   C CA   O GLY A 1 353 ? 40.992  18.186  42.752 0.95  0.00 ? 353 GLY A CA   2  
ATOM   6523   C C    C GLY A 1 353 ? 25.842  30.869  18.745 0.05  0.00 ? 353 GLY A C    2  
ATOM   6524   C C    O GLY A 1 353 ? 41.040  19.486  43.546 0.95  0.00 ? 353 GLY A C    2  
ATOM   6525   O O    C GLY A 1 353 ? 26.834  31.634  18.805 0.05  0.00 ? 353 GLY A O    2  
ATOM   6526   O O    O GLY A 1 353 ? 41.961  19.692  44.372 0.95  0.00 ? 353 GLY A O    2  
ATOM   6527   H H    C GLY A 1 353 ? 24.852  27.968  19.274 0.05  0.00 ? 353 GLY A H    2  
ATOM   6528   H H    O GLY A 1 353 ? 39.135  17.327  42.369 0.95  0.00 ? 353 GLY A H    2  
ATOM   6529   N N    C ARG A 1 354 ? 24.623  31.254  19.022 0.05  0.00 ? 354 ARG A N    2  
ATOM   6530   N N    O ARG A 1 354 ? 40.084  20.348  43.310 0.95  0.00 ? 354 ARG A N    2  
ATOM   6531   C CA   C ARG A 1 354 ? 24.246  32.616  19.451 0.05  0.00 ? 354 ARG A CA   2  
ATOM   6532   C CA   O ARG A 1 354 ? 39.946  21.658  43.979 0.95  0.00 ? 354 ARG A CA   2  
ATOM   6533   C C    C ARG A 1 354 ? 25.079  33.076  20.641 0.05  0.00 ? 354 ARG A C    2  
ATOM   6534   C C    O ARG A 1 354 ? 39.975  21.514  45.496 0.95  0.00 ? 354 ARG A C    2  
ATOM   6535   O O    C ARG A 1 354 ? 25.255  34.309  20.822 0.05  0.00 ? 354 ARG A O    2  
ATOM   6536   O O    O ARG A 1 354 ? 40.358  22.490  46.193 0.95  0.00 ? 354 ARG A O    2  
ATOM   6537   H H    C ARG A 1 354 ? 23.907  30.587  18.946 0.05  0.00 ? 354 ARG A H    2  
ATOM   6538   H H    O ARG A 1 354 ? 39.406  20.104  42.645 0.95  0.00 ? 354 ARG A H    2  
ATOM   6539   N N    C GLN A 1 355 ? 25.628  32.156  21.426 0.05  0.00 ? 355 GLN A N    2  
ATOM   6540   N N    O GLN A 1 355 ? 39.634  20.347  46.030 0.95  0.00 ? 355 GLN A N    2  
ATOM   6541   C CA   C GLN A 1 355 ? 26.472  32.533  22.591 0.05  0.00 ? 355 GLN A CA   2  
ATOM   6542   C CA   O GLN A 1 355 ? 39.662  20.129  47.501 0.95  0.00 ? 355 GLN A CA   2  
ATOM   6543   C C    C GLN A 1 355 ? 27.409  31.366  22.862 0.05  0.00 ? 355 GLN A C    2  
ATOM   6544   C C    O GLN A 1 355 ? 39.846  18.637  47.730 0.95  0.00 ? 355 GLN A C    2  
ATOM   6545   O O    C GLN A 1 355 ? 27.094  30.263  22.388 0.05  0.00 ? 355 GLN A O    2  
ATOM   6546   O O    O GLN A 1 355 ? 39.577  17.880  46.784 0.95  0.00 ? 355 GLN A O    2  
ATOM   6547   H H    C GLN A 1 355 ? 25.486  31.208  21.224 0.05  0.00 ? 355 GLN A H    2  
ATOM   6548   H H    O GLN A 1 355 ? 39.373  19.609  45.441 0.95  0.00 ? 355 GLN A H    2  
ATOM   6549   N N    C THR A 1 356 ? 28.509  31.572  23.539 0.05  0.00 ? 356 THR A N    2  
ATOM   6550   N N    O THR A 1 356 ? 40.309  18.218  48.879 0.95  0.00 ? 356 THR A N    2  
ATOM   6551   C CA   C THR A 1 356 ? 29.448  30.501  23.878 0.05  0.00 ? 356 THR A CA   2  
ATOM   6552   C CA   O THR A 1 356 ? 40.482  16.800  49.199 0.95  0.00 ? 356 THR A CA   2  
ATOM   6553   C C    C THR A 1 356 ? 28.923  29.820  25.158 0.05  0.00 ? 356 THR A C    2  
ATOM   6554   C C    O THR A 1 356 ? 39.118  16.270  49.684 0.95  0.00 ? 356 THR A C    2  
ATOM   6555   O O    C THR A 1 356 ? 27.986  30.346  25.788 0.05  0.00 ? 356 THR A O    2  
ATOM   6556   O O    O THR A 1 356 ? 38.198  17.077  49.917 0.95  0.00 ? 356 THR A O    2  
ATOM   6557   H H    C THR A 1 356 ? 28.702  32.479  23.853 0.05  0.00 ? 356 THR A H    2  
ATOM   6558   H H    O THR A 1 356 ? 40.528  18.882  49.565 0.95  0.00 ? 356 THR A H    2  
ATOM   6559   N N    C VAL A 1 357 ? 29.522  28.701  25.499 0.05  0.00 ? 357 VAL A N    2  
ATOM   6560   N N    O VAL A 1 357 ? 39.025  14.966  49.820 0.95  0.00 ? 357 VAL A N    2  
ATOM   6561   C CA   C VAL A 1 357 ? 29.132  27.910  26.668 0.05  0.00 ? 357 VAL A CA   2  
ATOM   6562   C CA   O VAL A 1 357 ? 37.795  14.292  50.243 0.95  0.00 ? 357 VAL A CA   2  
ATOM   6563   C C    C VAL A 1 357 ? 29.379  28.710  27.948 0.05  0.00 ? 357 VAL A C    2  
ATOM   6564   C C    O VAL A 1 357 ? 37.436  14.705  51.671 0.95  0.00 ? 357 VAL A C    2  
ATOM   6565   O O    C VAL A 1 357 ? 28.511  28.829  28.818 0.05  0.00 ? 357 VAL A O    2  
ATOM   6566   O O    O VAL A 1 357 ? 36.303  15.091  51.971 0.95  0.00 ? 357 VAL A O    2  
ATOM   6567   H H    C VAL A 1 357 ? 30.252  28.371  24.933 0.05  0.00 ? 357 VAL A H    2  
ATOM   6568   H H    O VAL A 1 357 ? 39.810  14.417  49.610 0.95  0.00 ? 357 VAL A H    2  
ATOM   6569   N N    C ASP A 1 358 ? 30.569  29.240  28.013 0.05  0.00 ? 358 ASP A N    2  
ATOM   6570   N N    O ASP A 1 358 ? 38.432  14.612  52.509 0.95  0.00 ? 358 ASP A N    2  
ATOM   6571   C CA   C ASP A 1 358 ? 31.003  30.075  29.135 0.05  0.00 ? 358 ASP A CA   2  
ATOM   6572   C CA   O ASP A 1 358 ? 38.318  14.991  53.919 0.95  0.00 ? 358 ASP A CA   2  
ATOM   6573   C C    C ASP A 1 358 ? 30.048  31.262  29.342 0.05  0.00 ? 358 ASP A C    2  
ATOM   6574   C C    O ASP A 1 358 ? 37.836  16.444  54.063 0.95  0.00 ? 358 ASP A C    2  
ATOM   6575   O O    C ASP A 1 358 ? 29.767  31.596  30.501 0.05  0.00 ? 358 ASP A O    2  
ATOM   6576   O O    O ASP A 1 358 ? 37.023  16.708  54.960 0.95  0.00 ? 358 ASP A O    2  
ATOM   6577   H H    C ASP A 1 358 ? 31.190  29.092  27.269 0.05  0.00 ? 358 ASP A H    2  
ATOM   6578   H H    O ASP A 1 358 ? 39.298  14.298  52.175 0.95  0.00 ? 358 ASP A H    2  
ATOM   6579   N N    C GLU A 1 359 ? 29.611  31.873  28.279 0.05  0.00 ? 359 GLU A N    2  
ATOM   6580   N N    O GLU A 1 359 ? 38.337  17.326  53.248 0.95  0.00 ? 359 GLU A N    2  
ATOM   6581   C CA   C GLU A 1 359 ? 28.732  33.026  28.231 0.05  0.00 ? 359 GLU A CA   2  
ATOM   6582   C CA   O GLU A 1 359 ? 38.056  18.749  53.217 0.95  0.00 ? 359 GLU A CA   2  
ATOM   6583   C C    C GLU A 1 359 ? 27.301  32.681  28.592 0.05  0.00 ? 359 GLU A C    2  
ATOM   6584   C C    O GLU A 1 359 ? 36.678  19.057  52.665 0.95  0.00 ? 359 GLU A C    2  
ATOM   6585   O O    C GLU A 1 359 ? 26.661  33.319  29.440 0.05  0.00 ? 359 GLU A O    2  
ATOM   6586   O O    O GLU A 1 359 ? 35.879  19.796  53.258 0.95  0.00 ? 359 GLU A O    2  
ATOM   6587   H H    C GLU A 1 359 ? 29.924  31.527  27.417 0.05  0.00 ? 359 GLU A H    2  
ATOM   6588   H H    O GLU A 1 359 ? 38.989  16.996  52.595 0.95  0.00 ? 359 GLU A H    2  
ATOM   6589   N N    C ALA A 1 360 ? 26.795  31.691  27.873 0.05  0.00 ? 360 ALA A N    2  
ATOM   6590   N N    O ALA A 1 360 ? 36.449  18.521  51.477 0.95  0.00 ? 360 ALA A N    2  
ATOM   6591   C CA   C ALA A 1 360 ? 25.428  31.184  28.052 0.05  0.00 ? 360 ALA A CA   2  
ATOM   6592   C CA   O ALA A 1 360 ? 35.182  18.682  50.752 0.95  0.00 ? 360 ALA A CA   2  
ATOM   6593   C C    C ALA A 1 360 ? 25.147  30.793  29.506 0.05  0.00 ? 360 ALA A C    2  
ATOM   6594   C C    O ALA A 1 360 ? 33.978  18.270  51.604 0.95  0.00 ? 360 ALA A C    2  
ATOM   6595   O O    C ALA A 1 360 ? 24.073  31.132  30.013 0.05  0.00 ? 360 ALA A O    2  
ATOM   6596   O O    O ALA A 1 360 ? 32.977  18.993  51.602 0.95  0.00 ? 360 ALA A O    2  
ATOM   6597   H H    C ALA A 1 360 ? 27.361  31.274  27.191 0.05  0.00 ? 360 ALA A H    2  
ATOM   6598   H H    O ALA A 1 360 ? 37.159  17.987  51.062 0.95  0.00 ? 360 ALA A H    2  
ATOM   6599   N N    C LEU A 1 361 ? 26.091  30.103  30.133 0.05  0.00 ? 361 LEU A N    2  
ATOM   6600   N N    O LEU A 1 361 ? 34.092  17.144  52.296 0.95  0.00 ? 361 LEU A N    2  
ATOM   6601   C CA   C LEU A 1 361 ? 25.894  29.656  31.508 0.05  0.00 ? 361 LEU A CA   2  
ATOM   6602   C CA   O LEU A 1 361 ? 32.981  16.655  53.106 0.95  0.00 ? 361 LEU A CA   2  
ATOM   6603   C C    C LEU A 1 361 ? 26.142  30.771  32.498 0.05  0.00 ? 361 LEU A C    2  
ATOM   6604   C C    O LEU A 1 361 ? 32.891  17.383  54.428 0.95  0.00 ? 361 LEU A C    2  
ATOM   6605   O O    C LEU A 1 361 ? 25.419  30.792  33.508 0.05  0.00 ? 361 LEU A O    2  
ATOM   6606   O O    O LEU A 1 361 ? 31.751  17.597  54.872 0.95  0.00 ? 361 LEU A O    2  
ATOM   6607   H H    C LEU A 1 361 ? 26.917  29.869  29.659 0.05  0.00 ? 361 LEU A H    2  
ATOM   6608   H H    O LEU A 1 361 ? 34.921  16.623  52.242 0.95  0.00 ? 361 LEU A H    2  
ATOM   6609   N N    C LYS A 1 362 ? 27.116  31.601  32.219 0.05  0.00 ? 362 LYS A N    2  
ATOM   6610   N N    O LYS A 1 362 ? 34.024  17.700  55.004 0.95  0.00 ? 362 LYS A N    2  
ATOM   6611   C CA   C LYS A 1 362 ? 27.405  32.741  33.135 0.05  0.00 ? 362 LYS A CA   2  
ATOM   6612   C CA   O LYS A 1 362 ? 34.017  18.441  56.298 0.95  0.00 ? 362 LYS A CA   2  
ATOM   6613   C C    C LYS A 1 362 ? 26.124  33.565  33.264 0.05  0.00 ? 362 LYS A C    2  
ATOM   6614   C C    O LYS A 1 362 ? 33.235  19.736  56.083 0.95  0.00 ? 362 LYS A C    2  
ATOM   6615   O O    C LYS A 1 362 ? 25.734  33.877  34.407 0.05  0.00 ? 362 LYS A O    2  
ATOM   6616   O O    O LYS A 1 362 ? 32.346  20.034  56.905 0.95  0.00 ? 362 LYS A O    2  
ATOM   6617   H H    C LYS A 1 362 ? 27.642  31.483  31.402 0.05  0.00 ? 362 LYS A H    2  
ATOM   6618   H H    O LYS A 1 362 ? 34.874  17.465  54.578 0.95  0.00 ? 362 LYS A H    2  
ATOM   6619   N N    C ASP A 1 363 ? 25.443  33.864  32.183 0.05  0.00 ? 363 ASP A N    2  
ATOM   6620   N N    O ASP A 1 363 ? 33.476  20.460  55.015 0.95  0.00 ? 363 ASP A N    2  
ATOM   6621   C CA   C ASP A 1 363 ? 24.217  34.613  32.126 0.05  0.00 ? 363 ASP A CA   2  
ATOM   6622   C CA   O ASP A 1 363 ? 32.825  21.690  54.653 0.95  0.00 ? 363 ASP A CA   2  
ATOM   6623   C C    C ASP A 1 363 ? 23.079  33.968  32.928 0.05  0.00 ? 363 ASP A C    2  
ATOM   6624   C C    O ASP A 1 363 ? 31.308  21.540  54.476 0.95  0.00 ? 363 ASP A C    2  
ATOM   6625   O O    C ASP A 1 363 ? 22.362  34.649  33.657 0.05  0.00 ? 363 ASP A O    2  
ATOM   6626   O O    O ASP A 1 363 ? 30.536  22.368  54.954 0.95  0.00 ? 363 ASP A O    2  
ATOM   6627   H H    C ASP A 1 363 ? 25.800  33.535  31.331 0.05  0.00 ? 363 ASP A H    2  
ATOM   6628   H H    O ASP A 1 363 ? 34.160  20.124  54.398 0.95  0.00 ? 363 ASP A H    2  
ATOM   6629   N N    C ALA A 1 364 ? 22.874  32.696  32.679 0.05  0.00 ? 364 ALA A N    2  
ATOM   6630   N N    O ALA A 1 364 ? 30.933  20.553  53.696 0.95  0.00 ? 364 ALA A N    2  
ATOM   6631   C CA   C ALA A 1 364 ? 21.812  31.930  33.348 0.05  0.00 ? 364 ALA A CA   2  
ATOM   6632   C CA   O ALA A 1 364 ? 29.518  20.280  53.406 0.95  0.00 ? 364 ALA A CA   2  
ATOM   6633   C C    C ALA A 1 364 ? 22.037  31.949  34.854 0.05  0.00 ? 364 ALA A C    2  
ATOM   6634   C C    O ALA A 1 364 ? 28.777  19.987  54.704 0.95  0.00 ? 364 ALA A C    2  
ATOM   6635   O O    C ALA A 1 364 ? 21.086  32.187  35.586 0.05  0.00 ? 364 ALA A O    2  
ATOM   6636   O O    O ALA A 1 364 ? 27.700  20.534  54.900 0.95  0.00 ? 364 ALA A O    2  
ATOM   6637   H H    C ALA A 1 364 ? 23.438  32.245  32.018 0.05  0.00 ? 364 ALA A H    2  
ATOM   6638   H H    O ALA A 1 364 ? 31.618  19.988  53.284 0.95  0.00 ? 364 ALA A H    2  
ATOM   6639   N N    C GLN A 1 365 ? 23.252  31.705  35.275 0.05  0.00 ? 365 GLN A N    2  
ATOM   6640   N N    O GLN A 1 365 ? 29.347  19.155  55.538 0.95  0.00 ? 365 GLN A N    2  
ATOM   6641   C CA   C GLN A 1 365 ? 23.640  31.725  36.689 0.05  0.00 ? 365 GLN A CA   2  
ATOM   6642   C CA   O GLN A 1 365 ? 28.782  18.801  56.844 0.95  0.00 ? 365 GLN A CA   2  
ATOM   6643   C C    C GLN A 1 365 ? 23.208  33.081  37.288 0.05  0.00 ? 365 GLN A C    2  
ATOM   6644   C C    O GLN A 1 365 ? 28.498  20.107  57.617 0.95  0.00 ? 365 GLN A C    2  
ATOM   6645   O O    C GLN A 1 365 ? 22.637  33.168  38.376 0.05  0.00 ? 365 GLN A O    2  
ATOM   6646   O O    O GLN A 1 365 ? 27.442  20.298  58.221 0.95  0.00 ? 365 GLN A O    2  
ATOM   6647   H H    C GLN A 1 365 ? 23.945  31.523  34.606 0.05  0.00 ? 365 GLN A H    2  
ATOM   6648   H H    O GLN A 1 365 ? 30.211  18.768  55.286 0.95  0.00 ? 365 GLN A H    2  
ATOM   6649   N N    C THR A 1 366 ? 23.513  34.122  36.549 0.05  0.00 ? 366 THR A N    2  
ATOM   6650   N N    O THR A 1 366 ? 29.478  20.980  57.584 0.95  0.00 ? 366 THR A N    2  
ATOM   6651   C CA   C THR A 1 366 ? 23.188  35.500  36.900 0.05  0.00 ? 366 THR A CA   2  
ATOM   6652   C CA   O THR A 1 366 ? 29.430  22.290  58.224 0.95  0.00 ? 366 THR A CA   2  
ATOM   6653   C C    C THR A 1 366 ? 21.703  35.705  37.084 0.05  0.00 ? 366 THR A C    2  
ATOM   6654   C C    O THR A 1 366 ? 28.282  23.129  57.716 0.95  0.00 ? 366 THR A C    2  
ATOM   6655   O O    C THR A 1 366 ? 21.344  36.247  38.144 0.05  0.00 ? 366 THR A O    2  
ATOM   6656   O O    O THR A 1 366 ? 27.533  23.626  58.576 0.95  0.00 ? 366 THR A O    2  
ATOM   6657   H H    C THR A 1 366 ? 23.977  33.963  35.701 0.05  0.00 ? 366 THR A H    2  
ATOM   6658   H H    O THR A 1 366 ? 30.288  20.742  57.088 0.95  0.00 ? 366 THR A H    2  
ATOM   6659   N N    C ARG A 1 367 ? 20.859  35.307  36.173 0.05  0.00 ? 367 ARG A N    2  
ATOM   6660   N N    O ARG A 1 367 ? 28.093  23.294  56.436 0.95  0.00 ? 367 ARG A N    2  
ATOM   6661   C CA   C ARG A 1 367 ? 19.426  35.472  36.276 0.05  0.00 ? 367 ARG A CA   2  
ATOM   6662   C CA   O ARG A 1 367 ? 27.021  24.086  55.875 0.95  0.00 ? 367 ARG A CA   2  
ATOM   6663   C C    C ARG A 1 367 ? 18.742  34.673  37.371 0.05  0.00 ? 367 ARG A C    2  
ATOM   6664   C C    O ARG A 1 367 ? 25.617  23.551  56.093 0.95  0.00 ? 367 ARG A C    2  
ATOM   6665   O O    C ARG A 1 367 ? 17.582  35.024  37.706 0.05  0.00 ? 367 ARG A O    2  
ATOM   6666   O O    O ARG A 1 367 ? 24.660  24.348  55.918 0.95  0.00 ? 367 ARG A O    2  
ATOM   6667   H H    C ARG A 1 367 ? 21.215  34.873  35.370 0.05  0.00 ? 367 ARG A H    2  
ATOM   6668   H H    O ARG A 1 367 ? 28.716  22.859  55.817 0.95  0.00 ? 367 ARG A H    2  
ATOM   6669   N N    C ILE A 1 368 ? 19.377  33.602  37.855 0.05  0.00 ? 368 ILE A N    2  
ATOM   6670   N N    O ILE A 1 368 ? 25.478  22.253  56.376 0.95  0.00 ? 368 ILE A N    2  
ATOM   6671   C CA   C ILE A 1 368 ? 18.814  32.722  38.877 0.05  0.00 ? 368 ILE A CA   2  
ATOM   6672   C CA   O ILE A 1 368 ? 24.183  21.601  56.565 0.95  0.00 ? 368 ILE A CA   2  
ATOM   6673   C C    C ILE A 1 368 ? 19.065  33.282  40.292 0.05  0.00 ? 368 ILE A C    2  
ATOM   6674   C C    O ILE A 1 368 ? 23.675  21.783  58.010 0.95  0.00 ? 368 ILE A C    2  
ATOM   6675   O O    C ILE A 1 368 ? 18.166  33.233  41.134 0.05  0.00 ? 368 ILE A O    2  
ATOM   6676   O O    O ILE A 1 368 ? 22.486  22.040  58.209 0.95  0.00 ? 368 ILE A O    2  
ATOM   6677   H H    C ILE A 1 368 ? 20.256  33.378  37.484 0.05  0.00 ? 368 ILE A H    2  
ATOM   6678   H H    O ILE A 1 368 ? 26.286  21.702  56.432 0.95  0.00 ? 368 ILE A H    2  
ATOM   6679   N N    C THR A 1 369 ? 20.286  33.706  40.507 0.05  0.00 ? 369 THR A N    2  
ATOM   6680   N N    O THR A 1 369 ? 24.571  21.563  58.940 0.95  0.00 ? 369 THR A N    2  
ATOM   6681   C CA   C THR A 1 369 ? 20.771  34.251  41.769 0.05  0.00 ? 369 THR A CA   2  
ATOM   6682   C CA   O THR A 1 369 ? 24.324  21.644  60.374 0.95  0.00 ? 369 THR A CA   2  
ATOM   6683   C C    C THR A 1 369 ? 20.532  35.767  41.854 0.05  0.00 ? 369 THR A C    2  
ATOM   6684   C C    O THR A 1 369 ? 24.542  23.072  60.900 0.95  0.00 ? 369 THR A C    2  
ATOM   6685   O O    C THR A 1 369 ? 21.056  36.398  42.783 0.05  0.00 ? 369 THR A O    2  
ATOM   6686   O O    O THR A 1 369 ? 24.551  23.257  62.125 0.95  0.00 ? 369 THR A O    2  
ATOM   6687   H H    C THR A 1 369 ? 20.926  33.636  39.768 0.05  0.00 ? 369 THR A H    2  
ATOM   6688   H H    O THR A 1 369 ? 25.471  21.307  58.649 0.95  0.00 ? 369 THR A H    2  
ATOM   6689   N N    C LYS A 1 370 ? 19.821  36.300  40.890 0.05  0.00 ? 370 LYS A N    2  
ATOM   6690   N N    O LYS A 1 370 ? 24.758  23.999  59.998 0.95  0.00 ? 370 LYS A N    2  
ATOM   6691   C CA   C LYS A 1 370 ? 19.434  37.714  40.743 0.05  0.00 ? 370 LYS A CA   2  
ATOM   6692   C CA   O LYS A 1 370 ? 24.977  25.437  60.231 0.95  0.00 ? 370 LYS A CA   2  
ATOM   6693   C C    C LYS A 1 370 ? 18.324  37.997  41.768 0.05  0.00 ? 370 LYS A C    2  
ATOM   6694   C C    O LYS A 1 370 ? 23.618  26.057  60.596 0.95  0.00 ? 370 LYS A C    2  
ATOM   6695   H H    C LYS A 1 370 ? 19.502  35.687  40.195 0.05  0.00 ? 370 LYS A H    2  
ATOM   6696   H H    O LYS A 1 370 ? 24.764  23.704  59.064 0.95  0.00 ? 370 LYS A H    2  
HETATM 6697   N N1   A MXT B 2 .   ? 2.895   28.442  36.497 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6698   N N1   B MXT B 2 .   ? -0.480  21.256  31.314 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6699   N N1   C MXT B 2 .   ? 5.506   22.114  33.273 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6700   N N1   D MXT B 2 .   ? 4.741   21.865  31.449 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6701   N N1   E MXT B 2 .   ? 5.918   23.238  32.145 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6702   N N1   F MXT B 2 .   ? 5.830   22.839  32.802 0.16  0.00 ? 500 MXT A N1   2  
HETATM 6703   N N1   U MXT B 2 .   ? -2.393  22.514  30.388 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6704   N N1   V MXT B 2 .   ? 5.369   22.502  33.215 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6705   N N1   W MXT B 2 .   ? 4.963   28.134  32.923 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6706   N N1   X MXT B 2 .   ? 4.725   21.419  31.808 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6707   N N1   Y MXT B 2 .   ? 4.170   21.472  33.373 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6708   N N1   Z MXT B 2 .   ? 4.528   21.449  32.144 0.010 0.00 ? 500 MXT A N1   2  
HETATM 6709   N N2   A MXT B 2 .   ? 6.145   29.226  39.259 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6710   N N2   B MXT B 2 .   ? -4.020  20.442  28.947 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6711   N N2   C MXT B 2 .   ? 9.376   20.782  34.702 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6712   N N2   D MXT B 2 .   ? 6.815   19.664  28.340 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6713   N N2   E MXT B 2 .   ? 9.696   22.430  30.175 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6714   N N2   F MXT B 2 .   ? 10.060  22.768  31.850 0.16  0.00 ? 500 MXT A N2   2  
HETATM 6715   N N2   U MXT B 2 .   ? -3.844  19.225  27.963 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6716   N N2   V MXT B 2 .   ? 9.198   21.558  35.018 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6717   N N2   W MXT B 2 .   ? 7.076   31.889  33.395 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6718   N N2   X MXT B 2 .   ? 6.097   17.857  29.749 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6719   N N2   Y MXT B 2 .   ? 6.445   18.003  34.635 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6720   N N2   Z MXT B 2 .   ? 5.582   17.451  33.451 0.010 0.00 ? 500 MXT A N2   2  
HETATM 6721   O O2   A MXT B 2 .   ? 6.901   29.330  40.216 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6722   O O2   B MXT B 2 .   ? -4.987  19.963  28.367 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6723   O O2   C MXT B 2 .   ? 10.330  20.201  35.206 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6724   O O2   D MXT B 2 .   ? 7.178   19.089  27.320 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6725   O O2   E MXT B 2 .   ? 10.725  22.446  29.512 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6726   O O2   F MXT B 2 .   ? 11.258  22.537  31.745 0.16  0.00 ? 500 MXT A O2   2  
HETATM 6727   O O2   U MXT B 2 .   ? -4.271  18.483  27.088 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6728   O O2   V MXT B 2 .   ? 10.248  21.528  35.649 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6729   O O2   W MXT B 2 .   ? 7.833   32.852  33.338 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6730   O O2   X MXT B 2 .   ? 6.600   17.026  29.001 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6731   O O2   Y MXT B 2 .   ? 6.911   17.018  35.193 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6732   O O2   Z MXT B 2 .   ? 6.018   16.315  33.590 0.010 0.00 ? 500 MXT A O2   2  
HETATM 6733   O O11  A MXT B 2 .   ? 2.026   30.610  36.400 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6734   O O11  B MXT B 2 .   ? -0.956  20.172  33.329 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6735   O O11  C MXT B 2 .   ? 6.296   21.893  31.083 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6736   O O11  D MXT B 2 .   ? 6.823   21.936  32.511 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6737   O O11  E MXT B 2 .   ? 6.875   22.271  34.044 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6738   O O11  F MXT B 2 .   ? 5.327   20.840  33.902 0.16  0.00 ? 500 MXT A O11  2  
HETATM 6739   O O11  U MXT B 2 .   ? -4.005  24.202  30.247 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6740   O O11  V MXT B 2 .   ? 6.059   21.476  31.232 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6741   O O11  W MXT B 2 .   ? 4.576   28.121  30.617 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6742   O O11  X MXT B 2 .   ? 6.783   22.024  32.739 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6743   O O11  Y MXT B 2 .   ? 2.584   20.229  32.190 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6744   O O11  Z MXT B 2 .   ? 5.755   21.918  30.211 0.010 0.00 ? 500 MXT A O11  2  
HETATM 6745   O O12  A MXT B 2 .   ? 3.341   26.204  36.004 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6746   O O12  B MXT B 2 .   ? 0.561   22.576  29.695 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6747   O O12  C MXT B 2 .   ? 4.146   22.610  35.102 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6748   O O12  D MXT B 2 .   ? 2.484   22.204  30.961 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6749   O O12  E MXT B 2 .   ? 4.392   24.252  30.697 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6750   O O12  F MXT B 2 .   ? 5.614   24.931  31.785 0.16  0.00 ? 500 MXT A O12  2  
HETATM 6751   O O12  U MXT B 2 .   ? -0.530  21.273  31.048 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6752   O O12  V MXT B 2 .   ? 4.037   23.496  34.854 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6753   O O12  W MXT B 2 .   ? 4.911   27.566  35.185 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6754   O O12  X MXT B 2 .   ? 2.445   21.347  31.318 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6755   O O12  Y MXT B 2 .   ? 5.401   23.261  34.230 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6756   O O12  Z MXT B 2 .   ? 3.071   21.661  33.958 0.010 0.00 ? 500 MXT A O12  2  
HETATM 6757   C C14  A MXT B 2 .   ? 2.073   29.479  35.944 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6758   C C14  B MXT B 2 .   ? -0.238  20.922  32.687 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6759   C C14  C MXT B 2 .   ? 5.415   22.254  31.848 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6760   C C14  D MXT B 2 .   ? 5.641   22.247  32.497 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6761   C C14  E MXT B 2 .   ? 5.904   22.772  33.499 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6762   C C14  F MXT B 2 .   ? 4.947   21.896  33.421 0.16  0.00 ? 500 MXT A C14  2  
HETATM 6763   C C14  U MXT B 2 .   ? -2.985  23.768  30.757 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6764   C C14  V MXT B 2 .   ? 5.164   21.965  31.901 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6765   C C14  W MXT B 2 .   ? 4.372   27.630  31.717 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6766   C C14  X MXT B 2 .   ? 5.572   22.182  32.676 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6767   C C14  Y MXT B 2 .   ? 3.064   21.315  32.476 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6768   C C14  Z MXT B 2 .   ? 4.963   22.286  31.065 0.010 0.00 ? 500 MXT A C14  2  
HETATM 6769   C C21  A MXT B 2 .   ? 3.798   28.661  37.656 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6770   C C21  B MXT B 2 .   ? -1.607  20.686  30.532 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6771   C C21  C MXT B 2 .   ? 6.668   21.479  33.946 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6772   C C21  D MXT B 2 .   ? 5.174   21.087  30.259 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6773   C C21  E MXT B 2 .   ? 7.130   23.188  31.287 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6774   C C21  F MXT B 2 .   ? 7.299   22.637  32.721 0.16  0.00 ? 500 MXT A C21  2  
HETATM 6775   C C21  U MXT B 2 .   ? -2.991  21.608  29.374 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6776   C C21  V MXT B 2 .   ? 6.687   22.476  33.900 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6777   C C21  W MXT B 2 .   ? 5.912   29.277  32.938 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6778   C C21  X MXT B 2 .   ? 5.248   20.390  30.871 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6779   C C21  Y MXT B 2 .   ? 4.812   20.328  34.071 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6780   C C21  Z MXT B 2 .   ? 4.971   20.040  32.301 0.010 0.00 ? 500 MXT A C21  2  
HETATM 6781   C C22  A MXT B 2 .   ? 4.339   30.108  37.718 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6782   C C22  B MXT B 2 .   ? -1.589  21.147  29.054 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6783   C C22  C MXT B 2 .   ? 7.517   22.500  34.744 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6784   C C22  D MXT B 2 .   ? 5.753   19.704  30.640 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6785   C C22  E MXT B 2 .   ? 7.254   21.851  30.517 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6786   C C22  F MXT B 2 .   ? 8.085   23.958  32.902 0.16  0.00 ? 500 MXT A C22  2  
HETATM 6787   C C22  U MXT B 2 .   ? -4.155  20.767  29.948 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6788   C C22  V MXT B 2 .   ? 7.838   22.076  32.944 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6789   C C22  W MXT B 2 .   ? 6.325   29.680  34.376 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6790   C C22  X MXT B 2 .   ? 4.181   19.333  30.503 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6791   C C22  Y MXT B 2 .   ? 6.347   20.494  34.187 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6792   C C22  Z MXT B 2 .   ? 3.808   19.100  32.704 0.010 0.00 ? 500 MXT A C22  2  
HETATM 6793   C C23  A MXT B 2 .   ? 4.905   27.577  37.758 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6794   C C23  B MXT B 2 .   ? -2.977  20.890  31.232 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6795   C C23  C MXT B 2 .   ? 7.502   20.596  32.980 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6796   C C23  D MXT B 2 .   ? 6.094   21.910  29.315 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6797   C C23  E MXT B 2 .   ? 8.417   23.587  32.057 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6798   C C23  F MXT B 2 .   ? 7.718   21.829  31.463 0.16  0.00 ? 500 MXT A C23  2  
HETATM 6799   C C23  U MXT B 2 .   ? -1.921  20.764  28.628 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6800   C C23  V MXT B 2 .   ? 6.655   21.653  35.216 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6801   C C23  W MXT B 2 .   ? 5.418   30.468  32.075 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6802   C C23  X MXT B 2 .   ? 6.592   19.778  31.355 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6803   C C23  Y MXT B 2 .   ? 4.374   18.958  33.488 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6804   C C23  Z MXT B 2 .   ? 6.222   19.910  33.212 0.010 0.00 ? 500 MXT A C23  2  
HETATM 6805   C C24  A MXT B 2 .   ? 5.209   30.397  38.985 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6806   C C24  B MXT B 2 .   ? -2.703  20.483  28.179 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6807   C C24  C MXT B 2 .   ? 8.686   21.846  35.550 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6808   C C24  D MXT B 2 .   ? 6.123   18.820  29.403 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6809   C C24  E MXT B 2 .   ? 8.463   21.811  29.525 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6810   C C24  F MXT B 2 .   ? 9.637   23.762  32.927 0.16  0.00 ? 500 MXT A C24  2  
HETATM 6811   C C24  U MXT B 2 .   ? -4.872  19.879  28.879 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6812   C C24  V MXT B 2 .   ? 9.253   22.140  33.609 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6813   C C24  W MXT B 2 .   ? 7.403   30.811  34.422 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6814   C C24  X MXT B 2 .   ? 4.672   18.296  29.439 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6815   C C24  Y MXT B 2 .   ? 7.037   19.357  35.012 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6816   C C24  Z MXT B 2 .   ? 4.221   17.593  32.775 0.010 0.00 ? 500 MXT A C24  2  
HETATM 6817   C C25  A MXT B 2 .   ? 4.307   30.612  40.242 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6818   C C25  B MXT B 2 .   ? -2.311  19.021  27.795 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6819   C C25  C MXT B 2 .   ? 8.154   21.169  36.852 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6820   C C25  D MXT B 2 .   ? 4.843   18.184  28.772 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6821   C C25  E MXT B 2 .   ? 8.138   22.608  28.222 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6822   C C25  F MXT B 2 .   ? 10.108  23.218  34.312 0.16  0.00 ? 500 MXT A C25  2  
HETATM 6823   C C25  U MXT B 2 .   ? -5.839  20.736  28.002 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6824   C C25  V MXT B 2 .   ? 9.757   23.615  33.704 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6825   C C25  W MXT B 2 .   ? 8.821   30.240  34.103 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6826   C C25  X MXT B 2 .   ? 4.646   18.917  28.006 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6827   C C25  Y MXT B 2 .   ? 6.829   19.577  36.544 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6828   C C25  Z MXT B 2 .   ? 4.314   16.972  31.346 0.010 0.00 ? 500 MXT A C25  2  
HETATM 6829   C C26  A MXT B 2 .   ? 6.058   31.683  38.728 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6830   C C26  B MXT B 2 .   ? -2.893  21.329  26.881 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6831   C C26  C MXT B 2 .   ? 9.718   22.955  35.923 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6832   C C26  D MXT B 2 .   ? 7.090   17.686  29.868 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6833   C C26  E MXT B 2 .   ? 8.766   20.324  29.165 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6834   C C26  F MXT B 2 .   ? 10.321  25.138  32.650 0.16  0.00 ? 500 MXT A C26  2  
HETATM 6835   C C26  U MXT B 2 .   ? -5.686  18.766  29.614 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6836   C C26  V MXT B 2 .   ? 10.250  21.303  32.749 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6837   C C26  W MXT B 2 .   ? 7.404   31.443  35.848 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6838   C C26  X MXT B 2 .   ? 3.730   17.051  29.481 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6839   C C26  Y MXT B 2 .   ? 8.562   19.359  34.686 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6840   C C26  Z MXT B 2 .   ? 3.153   16.819  33.610 0.010 0.00 ? 500 MXT A C26  2  
HETATM 6841   C C27  A MXT B 2 .   ? 6.288   28.000  38.363 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6842   C C27  B MXT B 2 .   ? -4.244  21.058  30.322 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6843   C C27  C MXT B 2 .   ? 9.045   20.479  33.246 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6844   C C27  D MXT B 2 .   ? 7.189   21.133  28.505 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6845   C C27  E MXT B 2 .   ? 9.767   22.918  31.616 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6846   C C27  F MXT B 2 .   ? 9.117   22.142  30.828 0.16  0.00 ? 500 MXT A C27  2  
HETATM 6847   C C27  U MXT B 2 .   ? -2.333  19.334  28.135 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6848   C C27  V MXT B 2 .   ? 7.969   20.910  35.644 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6849   C C27  W MXT B 2 .   ? 5.823   31.916  32.529 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6850   C C27  X MXT B 2 .   ? 6.889   18.285  30.979 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6851   C C27  Y MXT B 2 .   ? 5.410   17.779  33.539 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6852   C C27  Z MXT B 2 .   ? 6.371   18.602  34.064 0.010 0.00 ? 500 MXT A C27  2  
HETATM 6853   C C28  A MXT B 2 .   ? 6.818   26.792  39.206 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6854   C C28  B MXT B 2 .   ? -5.433  20.333  31.038 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6855   C C28  C MXT B 2 .   ? 9.469   19.013  32.903 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6856   C C28  D MXT B 2 .   ? 7.296   21.810  27.098 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6857   C C28  E MXT B 2 .   ? 10.891  24.000  31.754 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6858   C C28  F MXT B 2 .   ? 9.715   20.786  30.322 0.16  0.00 ? 500 MXT A C28  2  
HETATM 6859   C C28  U MXT B 2 .   ? -1.628  19.095  26.757 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6860   C C28  V MXT B 2 .   ? 8.066   20.993  37.205 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6861   C C28  W MXT B 2 .   ? 6.093   32.752  31.234 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6862   C C28  X MXT B 2 .   ? 8.422   18.176  30.682 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6863   C C28  Y MXT B 2 .   ? 4.609   16.465  33.828 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6864   C C28  Z MXT B 2 .   ? 7.894   18.237  34.096 0.010 0.00 ? 500 MXT A C28  2  
HETATM 6865   C C29  A MXT B 2 .   ? 7.332   28.327  37.252 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6866   C C29  B MXT B 2 .   ? -4.624  22.559  30.129 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6867   C C29  C MXT B 2 .   ? 9.863   21.456  32.345 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6868   C C29  D MXT B 2 .   ? 8.585   21.205  29.197 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6869   C C29  E MXT B 2 .   ? 10.135  21.703  32.524 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6870   C C29  F MXT B 2 .   ? 8.998   23.115  29.613 0.16  0.00 ? 500 MXT A C29  2  
HETATM 6871   C C29  U MXT B 2 .   ? -1.873  18.223  29.128 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6872   C C29  V MXT B 2 .   ? 7.945   19.407  35.229 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6873   C C29  W MXT B 2 .   ? 4.683   32.608  33.338 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6874   C C29  X MXT B 2 .   ? 6.540   17.311  32.147 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6875   C C29  Y MXT B 2 .   ? 6.165   17.613  32.183 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6876   C C29  Z MXT B 2 .   ? 5.878   18.806  35.530 0.010 0.00 ? 500 MXT A C29  2  
HETATM 6877   C C11  A MXT B 2 .   ? 1.731   27.454  34.607 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6878   C C11  B MXT B 2 .   ? 1.525   22.462  31.968 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6879   C C11  C MXT B 2 .   ? 3.361   23.163  32.824 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6880   C C11  D MXT B 2 .   ? 3.431   23.152  33.037 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6881   C C11  E MXT B 2 .   ? 3.679   23.658  32.989 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6882   C C11  F MXT B 2 .   ? 3.599   23.791  32.652 0.16  0.00 ? 500 MXT A C11  2  
HETATM 6883   C C11  U MXT B 2 .   ? -0.970  23.456  32.117 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6884   C C11  V MXT B 2 .   ? 3.010   22.801  32.716 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6885   C C11  W MXT B 2 .   ? 3.580   26.246  33.574 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6886   C C11  X MXT B 2 .   ? 3.270   22.945  33.012 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6887   C C11  Y MXT B 2 .   ? 3.565   23.707  32.635 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6888   C C11  Z MXT B 2 .   ? 3.399   23.582  32.436 0.010 0.00 ? 500 MXT A C11  2  
HETATM 6889   C C12  A MXT B 2 .   ? 1.302   28.932  34.739 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6890   C C12  B MXT B 2 .   ? 1.017   21.648  33.178 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6891   C C12  C MXT B 2 .   ? 4.083   22.911  31.484 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6892   C C12  D MXT B 2 .   ? 4.887   23.066  33.545 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6893   C C12  E MXT B 2 .   ? 4.519   23.004  34.106 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6894   C C12  F MXT B 2 .   ? 3.513   22.424  33.367 0.16  0.00 ? 500 MXT A C12  2  
HETATM 6895   C C12  U MXT B 2 .   ? -2.141  24.428  31.851 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6896   C C12  V MXT B 2 .   ? 3.692   22.117  31.511 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6897   C C12  W MXT B 2 .   ? 3.480   26.433  32.046 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6898   C C12  X MXT B 2 .   ? 4.725   23.173  33.476 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6899   C C12  Y MXT B 2 .   ? 2.621   22.686  31.964 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6900   C C12  Z MXT B 2 .   ? 4.293   23.656  31.178 0.010 0.00 ? 500 MXT A C12  2  
HETATM 6901   C C13  A MXT B 2 .   ? 2.735   27.233  35.752 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6902   C C13  B MXT B 2 .   ? 0.524   22.155  30.840 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6903   C C13  C MXT B 2 .   ? 4.330   22.631  33.898 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6904   C C13  D MXT B 2 .   ? 3.430   22.370  31.711 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6905   C C13  E MXT B 2 .   ? 4.639   23.769  31.789 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6906   C C13  F MXT B 2 .   ? 5.094   23.972  32.332 0.16  0.00 ? 500 MXT A C13  2  
HETATM 6907   C C13  U MXT B 2 .   ? -1.210  22.280  31.154 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6908   C C13  V MXT B 2 .   ? 4.140   23.006  33.742 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6909   C C13  W MXT B 2 .   ? 4.534   27.360  34.045 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6910   C C13  X MXT B 2 .   ? 3.363   21.825  31.960 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6911   C C13  Y MXT B 2 .   ? 4.508   22.855  33.505 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6912   C C13  Z MXT B 2 .   ? 3.608   22.157  32.980 0.010 0.00 ? 500 MXT A C13  2  
HETATM 6913   H H21  A MXT B 2 .   ? 3.167   28.524  38.576 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6914   H H21  B MXT B 2 .   ? -1.447  19.574  30.513 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6915   H H21  C MXT B 2 .   ? 6.242   20.768  34.703 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6916   H H21  D MXT B 2 .   ? 4.245   20.884  29.661 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6917   H H21  E MXT B 2 .   ? 6.994   23.987  30.508 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6918   H H21  F MXT B 2 .   ? 7.575   21.988  33.596 0.16  0.00 ? 500 MXT A H21  2  
HETATM 6919   H H21  U MXT B 2 .   ? -3.444  22.271  28.587 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6920   H H21  V MXT B 2 .   ? 6.899   23.533  34.217 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6921   H H21  W MXT B 2 .   ? 6.848   28.915  32.434 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6922   H H21  X MXT B 2 .   ? 5.497   20.930  29.918 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6923   H H21  Y MXT B 2 .   ? 4.415   20.342  35.122 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6924   H H21  Z MXT B 2 .   ? 5.308   19.701  31.285 0.010 0.00 ? 500 MXT A H21  2  
HETATM 6925   H H121 A MXT B 2 .   ? 0.211   29.060  34.890 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6926   H H121 B MXT B 2 .   ? 0.780   22.276  34.059 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6927   H H121 C MXT B 2 .   ? 4.255   23.838  30.899 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6928   H H121 D MXT B 2 .   ? 4.975   22.592  34.544 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6929   H H121 E MXT B 2 .   ? 4.092   22.047  34.470 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6930   H H121 F MXT B 2 .   ? 2.852   21.701  32.848 0.16  0.00 ? 500 MXT A H121 2  
HETATM 6931   H H121 U MXT B 2 .   ? -1.810  25.435  31.526 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6932   H H121 V MXT B 2 .   ? 3.600   22.696  30.571 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6933   H H121 W MXT B 2 .   ? 2.444   26.613  31.694 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6934   H H121 X MXT B 2 .   ? 4.867   23.013  34.565 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6935   H H121 Y MXT B 2 .   ? 2.661   22.716  30.856 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6936   H H121 Z MXT B 2 .   ? 5.057   24.458  31.233 0.010 0.00 ? 500 MXT A H121 2  
HETATM 6937   H H122 A MXT B 2 .   ? 1.562   29.506  33.825 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6938   H H122 B MXT B 2 .   ? 1.780   20.911  33.510 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6939   H H122 C MXT B 2 .   ? 3.487   22.236  30.833 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6940   H H122 D MXT B 2 .   ? 5.337   24.078  33.637 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6941   H H122 E MXT B 2 .   ? 4.594   23.672  34.991 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6942   H H122 F MXT B 2 .   ? 3.107   22.540  34.396 0.16  0.00 ? 500 MXT A H122 2  
HETATM 6943   H H122 U MXT B 2 .   ? -2.751  24.579  32.767 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6944   H H122 V MXT B 2 .   ? 3.243   21.119  31.314 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6945   H H122 W MXT B 2 .   ? 3.840   25.528  31.511 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6946   H H122 X MXT B 2 .   ? 5.053   24.214  33.265 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6947   H H122 Y MXT B 2 .   ? 1.563   22.878  32.246 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6948   H H122 Z MXT B 2 .   ? 3.685   23.862  30.270 0.010 0.00 ? 500 MXT A H122 2  
HETATM 6949   H H221 A MXT B 2 .   ? 4.924   30.357  36.806 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6950   H H221 B MXT B 2 .   ? -1.674  22.253  28.978 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6951   H H221 C MXT B 2 .   ? 7.924   23.290  34.078 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6952   H H221 D MXT B 2 .   ? 6.643   19.807  31.294 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6953   H H221 E MXT B 2 .   ? 7.325   20.992  31.215 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6954   H H221 F MXT B 2 .   ? 7.820   24.693  32.113 0.16  0.00 ? 500 MXT A H221 2  
HETATM 6955   H H221 U MXT B 2 .   ? -3.810  20.124  30.787 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6956   H H221 V MXT B 2 .   ? 7.676   21.060  32.524 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6957   H H221 W MXT B 2 .   ? 5.442   29.987  34.975 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6958   H H221 X MXT B 2 .   ? 3.824   18.792  31.403 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6959   H H221 Y MXT B 2 .   ? 6.820   20.559  33.186 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6960   H H221 Z MXT B 2 .   ? 3.364   19.406  33.675 0.010 0.00 ? 500 MXT A H221 2  
HETATM 6961   H H222 A MXT B 2 .   ? 3.479   30.819  37.710 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6962   H H222 B MXT B 2 .   ? -0.597  20.903  28.609 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6963   H H222 C MXT B 2 .   ? 6.853   23.040  35.460 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6964   H H222 D MXT B 2 .   ? 5.004   19.154  31.255 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6965   H H222 E MXT B 2 .   ? 6.316   21.677  29.938 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6966   H H222 F MXT B 2 .   ? 7.776   24.438  33.859 0.16  0.00 ? 500 MXT A H222 2  
HETATM 6967   H H222 U MXT B 2 .   ? -4.910  21.451  30.402 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6968   H H222 V MXT B 2 .   ? 7.831   22.757  32.062 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6969   H H222 W MXT B 2 .   ? 6.730   28.782  34.900 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6970   H H222 X MXT B 2 .   ? 3.280   19.851  30.101 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6971   H H222 Y MXT B 2 .   ? 6.570   21.471  34.678 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6972   H H222 Z MXT B 2 .   ? 2.983   19.204  31.963 0.010 0.00 ? 500 MXT A H222 2  
HETATM 6973   H H231 A MXT B 2 .   ? 4.473   26.754  38.377 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6974   H H231 B MXT B 2 .   ? -3.120  20.000  31.892 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6975   H H231 C MXT B 2 .   ? 7.049   19.577  33.030 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6976   H H231 D MXT B 2 .   ? 5.413   22.429  28.601 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6977   H H231 E MXT B 2 .   ? 8.510   24.694  31.949 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6978   H H231 F MXT B 2 .   ? 7.690   20.755  31.767 0.16  0.00 ? 500 MXT A H231 2  
HETATM 6979   H H231 U MXT B 2 .   ? -1.606  21.376  27.750 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6980   H H231 V MXT B 2 .   ? 6.367   22.374  36.020 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6981   H H231 W MXT B 2 .   ? 5.816   30.287  31.048 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6982   H H231 X MXT B 2 .   ? 7.394   20.427  30.929 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6983   H H231 Y MXT B 2 .   ? 3.460   18.660  34.056 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6984   H H231 Z MXT B 2 .   ? 7.104   20.004  32.533 0.010 0.00 ? 500 MXT A H231 2  
HETATM 6985   H H232 A MXT B 2 .   ? 5.106   27.103  36.772 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6986   H H232 B MXT B 2 .   ? -2.955  21.753  31.934 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6987   H H232 C MXT B 2 .   ? 7.370   20.908  31.921 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6988   H H232 D MXT B 2 .   ? 6.607   22.735  29.858 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6989   H H232 E MXT B 2 .   ? 8.308   23.423  33.152 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6990   H H232 F MXT B 2 .   ? 6.961   21.908  30.654 0.16  0.00 ? 500 MXT A H232 2  
HETATM 6991   H H232 U MXT B 2 .   ? -0.994  20.653  29.233 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6992   H H232 V MXT B 2 .   ? 5.835   20.902  35.210 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6993   H H232 W MXT B 2 .   ? 4.312   30.456  31.952 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6994   H H232 X MXT B 2 .   ? 6.714   19.873  32.456 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6995   H H232 Y MXT B 2 .   ? 4.029   19.051  32.436 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6996   H H232 Z MXT B 2 .   ? 6.314   20.772  33.907 0.010 0.00 ? 500 MXT A H232 2  
HETATM 6997   H H251 A MXT B 2 .   ? 4.884   30.971  41.117 0.16  0.00 ? 500 MXT A H251 2  
HETATM 6998   H H251 B MXT B 2 .   ? -3.004  18.582  27.050 0.16  0.00 ? 500 MXT A H251 2  
HETATM 6999   H H251 C MXT B 2 .   ? 8.975   20.835  37.517 0.16  0.00 ? 500 MXT A H251 2  
HETATM 7000   H H251 D MXT B 2 .   ? 5.086   17.431  27.995 0.16  0.00 ? 500 MXT A H251 2  
HETATM 7001   H H251 E MXT B 2 .   ? 8.913   22.466  27.439 0.16  0.00 ? 500 MXT A H251 2  
HETATM 7002   H H251 F MXT B 2 .   ? 11.211  23.216  34.412 0.16  0.00 ? 500 MXT A H251 2  
HETATM 7003   H H251 U MXT B 2 .   ? -6.474  20.112  27.343 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7004   H H251 V MXT B 2 .   ? 10.815  23.677  34.026 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7005   H H251 W MXT B 2 .   ? 9.622   30.985  34.280 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7006   H H251 X MXT B 2 .   ? 4.837   18.161  27.217 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7007   H H251 Y MXT B 2 .   ? 7.437   18.877  37.154 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7008   H H251 Z MXT B 2 .   ? 4.452   15.873  31.371 0.010 0.00 ? 500 MXT A H251 2  
HETATM 7009   H H252 A MXT B 2 .   ? 3.530   31.379  40.033 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7010   H H252 B MXT B 2 .   ? -1.298  19.001  27.343 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7011   H H252 C MXT B 2 .   ? 7.539   21.886  37.436 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7012   H H252 D MXT B 2 .   ? 4.249   17.660  29.550 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7013   H H252 E MXT B 2 .   ? 7.177   22.262  27.787 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7014   H H252 F MXT B 2 .   ? 9.711   23.853  35.132 0.16  0.00 ? 500 MXT A H252 2  
HETATM 7015   H H252 U MXT B 2 .   ? -6.526  21.324  28.647 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7016   H H252 V MXT B 2 .   ? 9.693   24.108  32.712 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7017   H H252 W MXT B 2 .   ? 9.042   29.369  34.754 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7018   H H252 X MXT B 2 .   ? 3.650   19.357  27.793 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7019   H H252 Y MXT B 2 .   ? 7.138   20.604  36.831 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7020   H H252 Z MXT B 2 .   ? 3.378   17.166  30.780 0.010 0.00 ? 500 MXT A H252 2  
HETATM 7021   H H253 A MXT B 2 .   ? 3.783   29.685  40.554 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7022   H H253 B MXT B 2 .   ? -2.297  18.339  28.670 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7023   H H253 C MXT B 2 .   ? 7.522   20.282  36.645 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7024   H H253 D MXT B 2 .   ? 4.181   18.937  28.300 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7025   H H253 E MXT B 2 .   ? 8.051   23.698  28.397 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7026   H H253 F MXT B 2 .   ? 9.764   22.179  34.501 0.16  0.00 ? 500 MXT A H253 2  
HETATM 7027   H H253 U MXT B 2 .   ? -5.300  21.455  27.350 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7028   H H253 V MXT B 2 .   ? 9.163   24.224  34.416 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7029   H H253 W MXT B 2 .   ? 8.919   29.903  33.051 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7030   H H253 X MXT B 2 .   ? 5.399   19.720  27.876 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7031   H H253 Y MXT B 2 .   ? 5.775   19.448  36.855 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7032   H H253 Z MXT B 2 .   ? 5.154   17.390  30.753 0.010 0.00 ? 500 MXT A H253 2  
HETATM 7033   H H261 A MXT B 2 .   ? 5.394   32.528  38.453 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7034   H H261 B MXT B 2 .   ? -1.923  21.433  26.349 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7035   H H261 C MXT B 2 .   ? 9.213   23.775  36.475 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7036   H H261 D MXT B 2 .   ? 6.630   17.108  30.697 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7037   H H261 E MXT B 2 .   ? 7.855   19.836  28.760 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7038   H H261 F MXT B 2 .   ? 9.964   25.894  33.380 0.16  0.00 ? 500 MXT A H261 2  
HETATM 7039   H H261 U MXT B 2 .   ? -6.387  19.225  30.340 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7040   H H261 V MXT B 2 .   ? 10.244  21.666  31.698 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7041   H H261 W MXT B 2 .   ? 7.566   30.655  36.614 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7042   H H261 X MXT B 2 .   ? 2.675   17.364  29.333 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7043   H H261 Y MXT B 2 .   ? 8.994   20.363  34.884 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7044   H H261 Z MXT B 2 .   ? 2.144   16.975  33.174 0.010 0.00 ? 500 MXT A H261 2  
HETATM 7045   H H262 A MXT B 2 .   ? 6.628   32.001  39.624 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7046   H H262 B MXT B 2 .   ? -3.601  20.861  26.168 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7047   H H262 C MXT B 2 .   ? 10.529  22.577  36.578 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7048   H H262 D MXT B 2 .   ? 7.319   16.962  29.059 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7049   H H262 E MXT B 2 .   ? 9.552   20.226  28.389 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7050   H H262 F MXT B 2 .   ? 11.424  25.092  32.747 0.16  0.00 ? 500 MXT A H262 2  
HETATM 7051   H H262 U MXT B 2 .   ? -6.297  18.158  28.918 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7052   H H262 V MXT B 2 .   ? 11.295  21.383  33.110 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7053   H H262 W MXT B 2 .   ? 8.213   32.190  35.981 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7054   H H262 X MXT B 2 .   ? 3.962   16.314  28.685 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7055   H H262 Y MXT B 2 .   ? 9.131   18.639  35.309 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7056   H H262 Z MXT B 2 .   ? 3.332   15.725  33.622 0.010 0.00 ? 500 MXT A H262 2  
HETATM 7057   H H263 A MXT B 2 .   ? 6.783   31.550  37.904 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7058   H H263 B MXT B 2 .   ? -3.262  22.350  27.093 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7059   H H263 C MXT B 2 .   ? 10.196  23.404  35.033 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7060   H H263 D MXT B 2 .   ? 8.055   18.081  30.239 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7061   H H263 E MXT B 2 .   ? 9.093   19.735  30.042 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7062   H H263 F MXT B 2 .   ? 10.094  25.526  31.640 0.16  0.00 ? 500 MXT A H263 2  
HETATM 7063   H H263 U MXT B 2 .   ? -5.035  18.072  30.176 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7064   H H263 V MXT B 2 .   ? 9.990   20.228  32.726 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7065   H H263 W MXT B 2 .   ? 6.449   31.944  36.089 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7066   H H263 X MXT B 2 .   ? 3.781   16.517  30.449 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7067   H H263 Y MXT B 2 .   ? 8.769   19.114  33.628 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7068   H H263 Z MXT B 2 .   ? 3.112   17.158  34.662 0.010 0.00 ? 500 MXT A H263 2  
HETATM 7069   H H281 A MXT B 2 .   ? 6.186   26.584  40.089 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7070   H H281 B MXT B 2 .   ? -5.283  19.238  31.096 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7071   H H281 C MXT B 2 .   ? 9.018   18.271  33.591 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7072   H H281 D MXT B 2 .   ? 6.374   21.686  26.499 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7073   H H281 E MXT B 2 .   ? 10.757  24.836  31.041 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7074   H H281 F MXT B 2 .   ? 9.943   20.091  31.153 0.16  0.00 ? 500 MXT A H281 2  
HETATM 7075   H H281 U MXT B 2 .   ? -2.002  19.774  25.969 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7076   H H281 V MXT B 2 .   ? 8.211   22.030  37.561 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7077   H H281 W MXT B 2 .   ? 6.976   32.387  30.673 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7078   H H281 X MXT B 2 .   ? 8.719   18.747  29.783 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7079   H H281 Y MXT B 2 .   ? 4.151   16.467  34.835 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7080   H H281 Z MXT B 2 .   ? 8.281   17.958  33.098 0.010 0.00 ? 500 MXT A H281 2  
HETATM 7081   H H282 A MXT B 2 .   ? 6.827   25.874  38.582 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7082   H H282 B MXT B 2 .   ? -5.533  20.710  32.078 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7083   H H282 C MXT B 2 .   ? 9.135   18.756  31.875 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7084   H H282 D MXT B 2 .   ? 7.468   22.901  27.218 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7085   H H282 E MXT B 2 .   ? 10.876  24.429  32.777 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7086   H H282 F MXT B 2 .   ? 8.985   20.279  29.657 0.16  0.00 ? 500 MXT A H282 2  
HETATM 7087   H H282 U MXT B 2 .   ? -0.537  19.274  26.858 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7088   H H282 V MXT B 2 .   ? 7.126   20.614  37.661 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7089   H H282 W MXT B 2 .   ? 5.217   32.686  30.554 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7090   H H282 X MXT B 2 .   ? 9.001   18.582  31.538 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7091   H H282 Y MXT B 2 .   ? 3.789   16.356  33.088 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7092   H H282 Z MXT B 2 .   ? 8.482   19.111  34.447 0.010 0.00 ? 500 MXT A H282 2  
HETATM 7093   H H283 A MXT B 2 .   ? 7.860   26.941  39.562 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7094   H H283 B MXT B 2 .   ? -6.409  20.516  30.541 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7095   H H283 C MXT B 2 .   ? 10.568  18.869  32.926 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7096   H H283 D MXT B 2 .   ? 8.144   21.420  26.497 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7097   H H283 E MXT B 2 .   ? 11.908  23.582  31.598 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7098   H H283 F MXT B 2 .   ? 10.643  20.921  29.730 0.16  0.00 ? 500 MXT A H283 2  
HETATM 7099   H H283 U MXT B 2 .   ? -1.744  18.053  26.391 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7100   H H283 V MXT B 2 .   ? 8.889   20.374  37.617 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7101   H H283 W MXT B 2 .   ? 6.251   33.829  31.446 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7102   H H283 X MXT B 2 .   ? 8.758   17.127  30.541 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7103   H H283 Y MXT B 2 .   ? 5.239   15.555  33.744 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7104   H H283 Z MXT B 2 .   ? 8.120   17.404  34.793 0.010 0.00 ? 500 MXT A H283 2  
HETATM 7105   H H291 A MXT B 2 .   ? 8.308   28.635  37.679 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7106   H H291 B MXT B 2 .   ? -5.514  22.682  29.481 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7107   H H291 C MXT B 2 .   ? 10.952  21.381  32.536 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7108   H H291 D MXT B 2 .   ? 9.358   20.651  28.630 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7109   H H291 E MXT B 2 .   ? 11.083  21.226  32.210 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7110   H H291 F MXT B 2 .   ? 9.987   23.343  29.167 0.16  0.00 ? 500 MXT A H291 2  
HETATM 7111   H H291 U MXT B 2 .   ? -2.171  17.212  28.784 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7112   H H291 V MXT B 2 .   ? 8.875   18.880  35.523 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7113   H H291 W MXT B 2 .   ? 4.969   33.628  33.666 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7114   H H291 X MXT B 2 .   ? 6.743   16.256  31.881 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7115   H H291 Y MXT B 2 .   ? 6.901   16.788  32.219 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7116   H H291 Z MXT B 2 .   ? 5.977   17.880  36.132 0.010 0.00 ? 500 MXT A H291 2  
HETATM 7117   H H292 A MXT B 2 .   ? 7.002   29.136  36.571 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7118   H H292 B MXT B 2 .   ? -3.807  23.160  29.682 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7119   H H292 C MXT B 2 .   ? 9.577   22.517  32.484 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7120   H H292 D MXT B 2 .   ? 8.579   20.797  30.228 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7121   H H292 E MXT B 2 .   ? 9.357   20.915  32.530 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7122   H H292 F MXT B 2 .   ? 8.526   24.080  29.878 0.16  0.00 ? 500 MXT A H292 2  
HETATM 7123   H H292 U MXT B 2 .   ? -2.283  18.357  30.148 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7124   H H292 V MXT B 2 .   ? 7.816   19.259  34.138 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7125   H H292 W MXT B 2 .   ? 4.388   32.043  34.243 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7126   H H292 X MXT B 2 .   ? 5.479   17.373  32.459 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7127   H H292 Y MXT B 2 .   ? 6.710   18.527  31.875 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7128   H H292 Z MXT B 2 .   ? 4.821   19.126  35.590 0.010 0.00 ? 500 MXT A H292 2  
HETATM 7129   H H293 A MXT B 2 .   ? 7.519   27.433  36.621 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7130   H H293 B MXT B 2 .   ? -4.867  23.026  31.107 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7131   H H293 C MXT B 2 .   ? 9.703   21.218  31.273 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7132   H H293 D MXT B 2 .   ? 8.926   22.259  29.270 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7133   H H293 E MXT B 2 .   ? 10.269  22.034  33.576 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7134   H H293 F MXT B 2 .   ? 8.378   22.658  28.814 0.16  0.00 ? 500 MXT A H293 2  
HETATM 7135   H H293 U MXT B 2 .   ? -0.767  18.222  29.224 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7136   H H293 V MXT B 2 .   ? 7.103   18.881  35.725 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7137   H H293 W MXT B 2 .   ? 3.772   32.711  32.712 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7138   H H293 X MXT B 2 .   ? 7.153   17.546  33.042 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7139   H H293 Y MXT B 2 .   ? 5.447   17.375  31.369 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7140   H H293 Z MXT B 2 .   ? 6.483   19.588  36.035 0.010 0.00 ? 500 MXT A H293 2  
HETATM 7141   N N1   A MXT C 2 .   ? 18.968  16.234  26.607 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7142   N N1   B MXT C 2 .   ? 23.290  19.236  27.415 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7143   N N1   C MXT C 2 .   ? 19.039  16.691  25.096 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7144   N N1   D MXT C 2 .   ? 22.306  20.036  29.343 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7145   N N1   E MXT C 2 .   ? 23.269  15.423  23.664 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7146   N N1   F MXT C 2 .   ? 19.652  17.131  29.434 0.16  0.00 ? 600 MXT A N1   2  
HETATM 7147   N N1   U MXT C 2 .   ? 3.554   18.173  15.984 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7148   N N1   V MXT C 2 .   ? 6.809   14.072  12.764 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7149   N N1   W MXT C 2 .   ? 5.980   13.175  13.930 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7150   N N1   X MXT C 2 .   ? 2.247   16.594  16.174 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7151   N N1   Y MXT C 2 .   ? 3.586   13.193  18.863 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7152   N N1   Z MXT C 2 .   ? 6.314   17.476  14.075 0.010 0.00 ? 600 MXT A N1   2  
HETATM 7153   N N2   A MXT C 2 .   ? 16.430  19.748  26.492 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7154   N N2   B MXT C 2 .   ? 25.724  22.085  25.232 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7155   N N2   C MXT C 2 .   ? 15.953  16.669  22.049 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7156   N N2   D MXT C 2 .   ? 21.589  23.955  31.053 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7157   N N2   E MXT C 2 .   ? 26.262  14.631  20.630 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7158   N N2   F MXT C 2 .   ? 17.213  17.556  32.995 0.16  0.00 ? 600 MXT A N2   2  
HETATM 7159   N N2   U MXT C 2 .   ? 1.659   18.442  12.093 0.010 0.00 ? 600 MXT A N2   2  
HETATM 7160   N N2   V MXT C 2 .   ? 7.055   13.964  8.436  0.010 0.00 ? 600 MXT A N2   2  
HETATM 7161   N N2   W MXT C 2 .   ? 4.213   9.270   13.272 0.010 0.00 ? 600 MXT A N2   2  
HETATM 7162   N N2   X MXT C 2 .   ? -1.521  18.713  16.503 0.010 0.00 ? 600 MXT A N2   2  
HETATM 7163   N N2   Y MXT C 2 .   ? 2.073   10.319  21.734 0.010 0.00 ? 600 MXT A N2   2  
HETATM 7164   N N2   Z MXT C 2 .   ? 8.183   20.808  12.021 0.010 0.00 ? 600 MXT A N2   2  
HETATM 7165   O O2   A MXT C 2 .   ? 15.515  20.563  26.499 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7166   O O2   B MXT C 2 .   ? 26.604  22.808  24.781 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7167   O O2   C MXT C 2 .   ? 15.160  16.915  21.149 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7168   O O2   D MXT C 2 .   ? 21.650  25.089  31.510 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7169   O O2   E MXT C 2 .   ? 27.278  14.499  19.958 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7170   O O2   F MXT C 2 .   ? 16.434  17.433  33.932 0.16  0.00 ? 600 MXT A O2   2  
HETATM 7171   O O2   U MXT C 2 .   ? 1.096   18.777  11.058 0.010 0.00 ? 600 MXT A O2   2  
HETATM 7172   O O2   V MXT C 2 .   ? 7.217   13.687  7.254  0.010 0.00 ? 600 MXT A O2   2  
HETATM 7173   O O2   W MXT C 2 .   ? 3.959   8.078   13.150 0.010 0.00 ? 600 MXT A O2   2  
HETATM 7174   O O2   X MXT C 2 .   ? -2.665  19.139  16.409 0.010 0.00 ? 600 MXT A O2   2  
HETATM 7175   O O2   Y MXT C 2 .   ? 1.852   9.358   22.461 0.010 0.00 ? 600 MXT A O2   2  
HETATM 7176   O O2   Z MXT C 2 .   ? 8.657   21.881  11.668 0.010 0.00 ? 600 MXT A O2   2  
HETATM 7177   O O11  A MXT C 2 .   ? 18.300  15.253  28.620 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7178   O O11  B MXT C 2 .   ? 23.317  19.964  29.636 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7179   O O11  C MXT C 2 .   ? 18.862  18.710  26.259 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7180   O O11  D MXT C 2 .   ? 22.155  20.782  27.132 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7181   O O11  E MXT C 2 .   ? 21.946  13.905  22.479 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7182   O O11  F MXT C 2 .   ? 21.030  18.738  30.425 0.16  0.00 ? 600 MXT A O11  2  
HETATM 7183   O O11  U MXT C 2 .   ? 4.915   20.071  16.037 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7184   O O11  V MXT C 2 .   ? 4.493   13.768  12.685 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7185   O O11  W MXT C 2 .   ? 6.500   13.723  11.719 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7186   O O11  X MXT C 2 .   ? 3.152   17.436  14.190 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7187   O O11  Y MXT C 2 .   ? 2.854   14.822  20.369 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7188   O O11  Z MXT C 2 .   ? 7.205   16.171  12.352 0.010 0.00 ? 600 MXT A O11  2  
HETATM 7189   O O12  A MXT C 2 .   ? 20.139  16.691  24.640 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7190   O O12  B MXT C 2 .   ? 22.741  18.082  25.461 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7191   O O12  C MXT C 2 .   ? 19.689  14.539  24.469 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7192   O O12  D MXT C 2 .   ? 22.464  18.646  31.212 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7193   O O12  E MXT C 2 .   ? 24.003  16.939  25.279 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7194   O O12  F MXT C 2 .   ? 18.795  15.556  27.939 0.16  0.00 ? 600 MXT A O12  2  
HETATM 7195   O O12  U MXT C 2 .   ? 2.552   16.142  16.551 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7196   O O12  V MXT C 2 .   ? 8.972   14.470  13.547 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7197   O O12  W MXT C 2 .   ? 5.584   13.339  16.225 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7198   O O12  X MXT C 2 .   ? 2.023   15.501  18.225 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7199   O O12  Y MXT C 2 .   ? 4.511   12.161  16.985 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7200   O O12  Z MXT C 2 .   ? 5.222   18.125  16.033 0.010 0.00 ? 600 MXT A O12  2  
HETATM 7201   C C14  A MXT C 2 .   ? 19.076  15.288  27.678 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7202   C C14  B MXT C 2 .   ? 22.858  19.222  28.782 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7203   C C14  C MXT C 2 .   ? 19.372  17.607  26.148 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7204   C C14  D MXT C 2 .   ? 22.222  19.853  27.923 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7205   C C14  E MXT C 2 .   ? 22.077  14.661  23.428 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7206   C C14  F MXT C 2 .   ? 20.799  17.986  29.490 0.16  0.00 ? 600 MXT A C14  2  
HETATM 7207   C C14  U MXT C 2 .   ? 4.571   19.015  16.543 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7208   C C14  V MXT C 2 .   ? 5.495   14.015  13.336 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7209   C C14  W MXT C 2 .   ? 6.366   14.072  12.881 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7210   C C14  X MXT C 2 .   ? 3.297   16.793  15.218 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7211   C C14  Y MXT C 2 .   ? 3.367   14.542  19.298 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7212   C C14  Z MXT C 2 .   ? 6.577   16.242  13.398 0.010 0.00 ? 600 MXT A C14  2  
HETATM 7213   C C21  A MXT C 2 .   ? 17.874  17.236  26.524 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7214   C C21  B MXT C 2 .   ? 24.313  20.186  26.904 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7215   C C21  C MXT C 2 .   ? 18.008  16.986  24.067 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7216   C C21  D MXT C 2 .   ? 22.361  21.376  29.981 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7217   C C21  E MXT C 2 .   ? 24.469  15.333  22.795 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7218   C C21  F MXT C 2 .   ? 18.654  17.049  30.532 0.16  0.00 ? 600 MXT A C21  2  
HETATM 7219   C C21  U MXT C 2 .   ? 2.796   18.529  14.757 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7220   C C21  V MXT C 2 .   ? 7.075   13.797  11.328 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7221   C C21  W MXT C 2 .   ? 5.664   11.743  13.690 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7222   C C21  X MXT C 2 .   ? 0.894   17.186  16.020 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7223   C C21  Y MXT C 2 .   ? 3.242   12.012  19.694 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7224   C C21  Z MXT C 2 .   ? 6.818   18.786  13.586 0.010 0.00 ? 600 MXT A C21  2  
HETATM 7225   C C22  A MXT C 2 .   ? 18.037  18.186  25.312 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7226   C C22  B MXT C 2 .   ? 23.762  21.626  26.767 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7227   C C22  C MXT C 2 .   ? 16.599  16.509  24.494 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7228   C C22  D MXT C 2 .   ? 21.552  21.434  31.299 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7229   C C22  E MXT C 2 .   ? 24.225  15.931  21.388 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7230   C C22  F MXT C 2 .   ? 17.819  18.346  30.666 0.16  0.00 ? 600 MXT A C22  2  
HETATM 7231   C C22  U MXT C 2 .   ? 1.661   17.521  14.452 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7232   C C22  V MXT C 2 .   ? 7.823   14.960  10.634 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7233   C C22  W MXT C 2 .   ? 4.919   11.522  12.351 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7234   C C22  X MXT C 2 .   ? 0.937   18.728  15.892 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7235   C C22  Y MXT C 2 .   ? 1.744   11.638  19.597 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7236   C C22  Z MXT C 2 .   ? 6.293   19.128  12.170 0.010 0.00 ? 600 MXT A C22  2  
HETATM 7237   C C23  A MXT C 2 .   ? 17.646  17.976  27.869 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7238   C C23  B MXT C 2 .   ? 25.018  19.664  25.624 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7239   C C23  C MXT C 2 .   ? 18.428  16.505  22.652 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7240   C C23  D MXT C 2 .   ? 22.016  22.520  28.987 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7241   C C23  E MXT C 2 .   ? 25.074  13.903  22.768 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7242   C C23  F MXT C 2 .   ? 19.282  16.572  31.870 0.16  0.00 ? 600 MXT A C23  2  
HETATM 7243   C C23  U MXT C 2 .   ? 3.726   18.804  13.545 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7244   C C23  V MXT C 2 .   ? 5.804   13.331  10.569 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7245   C C23  W MXT C 2 .   ? 4.968   11.078  14.908 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7246   C C23  X MXT C 2 .   ? -0.102  16.678  17.098 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7247   C C23  Y MXT C 2 .   ? 3.758   12.144  21.153 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7248   C C23  Z MXT C 2 .   ? 8.360   18.919  13.727 0.010 0.00 ? 600 MXT A C23  2  
HETATM 7249   C C24  A MXT C 2 .   ? 16.847  19.185  25.138 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7250   C C24  B MXT C 2 .   ? 24.842  22.669  26.331 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7251   C C24  C MXT C 2 .   ? 15.474  16.898  23.478 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7252   C C24  D MXT C 2 .   ? 21.674  22.802  32.047 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7253   C C24  E MXT C 2 .   ? 25.502  15.945  20.485 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7254   C C24  F MXT C 2 .   ? 16.690  18.253  31.744 0.16  0.00 ? 600 MXT A C24  2  
HETATM 7255   C C24  U MXT C 2 .   ? 0.780   17.925  13.226 0.010 0.00 ? 600 MXT A C24  2  
HETATM 7256   C C24  V MXT C 2 .   ? 8.211   14.657  9.150  0.010 0.00 ? 600 MXT A C24  2  
HETATM 7257   C C24  W MXT C 2 .   ? 4.665   10.014  12.020 0.010 0.00 ? 600 MXT A C24  2  
HETATM 7258   C C24  X MXT C 2 .   ? -0.463  19.373  15.626 0.010 0.00 ? 600 MXT A C24  2  
HETATM 7259   C C24  Y MXT C 2 .   ? 1.372   10.336  20.379 0.010 0.00 ? 600 MXT A C24  2  
HETATM 7260   C C24  Z MXT C 2 .   ? 6.722   20.546  11.671 0.010 0.00 ? 600 MXT A C24  2  
HETATM 7261   C C25  A MXT C 2 .   ? 15.613  18.473  24.498 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7262   C C25  B MXT C 2 .   ? 25.754  23.063  27.537 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7263   C C25  C MXT C 2 .   ? 15.083  18.402  23.631 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7264   C C25  D MXT C 2 .   ? 23.038  22.902  32.802 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7265   C C25  E MXT C 2 .   ? 26.455  17.114  20.888 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7266   C C25  F MXT C 2 .   ? 15.468  17.445  31.203 0.16  0.00 ? 600 MXT A C25  2  
HETATM 7267   C C25  U MXT C 2 .   ? -0.233  19.048  13.615 0.010 0.00 ? 600 MXT A C25  2  
HETATM 7268   C C25  V MXT C 2 .   ? 9.462   13.726  9.081  0.010 0.00 ? 600 MXT A C25  2  
HETATM 7269   C C25  W MXT C 2 .   ? 5.965   9.335   11.485 0.010 0.00 ? 600 MXT A C25  2  
HETATM 7270   C C25  X MXT C 2 .   ? -0.880  19.195  14.132 0.010 0.00 ? 600 MXT A C25  2  
HETATM 7271   C C25  Y MXT C 2 .   ? 1.809   9.065   19.582 0.010 0.00 ? 600 MXT A C25  2  
HETATM 7272   C C25  Z MXT C 2 .   ? 5.848   21.658  12.334 0.010 0.00 ? 600 MXT A C25  2  
HETATM 7273   C C26  A MXT C 2 .   ? 17.306  20.356  24.215 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7274   C C26  B MXT C 2 .   ? 24.122  23.942  25.788 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7275   C C26  C MXT C 2 .   ? 14.223  16.006  23.750 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7276   C C26  D MXT C 2 .   ? 20.502  22.919  33.072 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7277   C C26  E MXT C 2 .   ? 25.061  16.122  18.997 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7278   C C26  F MXT C 2 .   ? 16.232  19.699  32.116 0.16  0.00 ? 600 MXT A C26  2  
HETATM 7279   C C26  U MXT C 2 .   ? -0.004  16.668  12.735 0.010 0.00 ? 600 MXT A C26  2  
HETATM 7280   C C26  V MXT C 2 .   ? 8.525   16.004  8.427  0.010 0.00 ? 600 MXT A C26  2  
HETATM 7281   C C26  W MXT C 2 .   ? 3.546   9.921   10.936 0.010 0.00 ? 600 MXT A C26  2  
HETATM 7282   C C26  X MXT C 2 .   ? -0.388  20.894  15.968 0.010 0.00 ? 600 MXT A C26  2  
HETATM 7283   C C26  Y MXT C 2 .   ? -0.173  10.307  20.599 0.010 0.00 ? 600 MXT A C26  2  
HETATM 7284   C C26  Z MXT C 2 .   ? 6.548   20.606  10.121 0.010 0.00 ? 600 MXT A C26  2  
HETATM 7285   C C27  A MXT C 2 .   ? 17.141  19.461  27.809 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7286   C C27  B MXT C 2 .   ? 25.511  20.725  24.578 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7287   C C27  C MXT C 2 .   ? 17.292  16.046  21.672 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7288   C C27  D MXT C 2 .   ? 21.314  23.799  29.563 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7289   C C27  E MXT C 2 .   ? 25.788  13.438  21.450 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7290   C C27  F MXT C 2 .   ? 18.656  17.112  33.204 0.16  0.00 ? 600 MXT A C27  2  
HETATM 7291   C C27  U MXT C 2 .   ? 3.183   18.459  12.114 0.010 0.00 ? 600 MXT A C27  2  
HETATM 7292   C C27  V MXT C 2 .   ? 5.684   13.706  9.049  0.010 0.00 ? 600 MXT A C27  2  
HETATM 7293   C C27  W MXT C 2 .   ? 3.944   9.924   14.622 0.010 0.00 ? 600 MXT A C27  2  
HETATM 7294   C C27  X MXT C 2 .   ? -1.236  17.656  17.563 0.010 0.00 ? 600 MXT A C27  2  
HETATM 7295   C C27  Y MXT C 2 .   ? 2.921   11.456  22.287 0.010 0.00 ? 600 MXT A C27  2  
HETATM 7296   C C27  Z MXT C 2 .   ? 9.117   19.793  12.667 0.010 0.00 ? 600 MXT A C27  2  
HETATM 7297   C C28  A MXT C 2 .   ? 16.147  19.665  29.002 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7298   C C28  B MXT C 2 .   ? 26.866  20.205  23.988 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7299   C C28  C MXT C 2 .   ? 17.703  16.512  20.234 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7300   C C28  D MXT C 2 .   ? 21.886  25.033  28.788 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7301   C C28  E MXT C 2 .   ? 27.018  12.564  21.870 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7302   C C28  F MXT C 2 .   ? 18.705  15.946  34.247 0.16  0.00 ? 600 MXT A C28  2  
HETATM 7303   C C28  U MXT C 2 .   ? 3.713   19.560  11.135 0.010 0.00 ? 600 MXT A C28  2  
HETATM 7304   C C28  V MXT C 2 .   ? 5.000   12.498  8.324  0.010 0.00 ? 600 MXT A C28  2  
HETATM 7305   C C28  W MXT C 2 .   ? 4.106   8.864   15.763 0.010 0.00 ? 600 MXT A C28  2  
HETATM 7306   C C28  X MXT C 2 .   ? -2.520  16.798  17.812 0.010 0.00 ? 600 MXT A C28  2  
HETATM 7307   C C28  Y MXT C 2 .   ? 3.936   10.892  23.339 0.010 0.00 ? 600 MXT A C28  2  
HETATM 7308   C C28  Z MXT C 2 .   ? 10.271  20.538  13.417 0.010 0.00 ? 600 MXT A C28  2  
HETATM 7309   C C29  A MXT C 2 .   ? 18.314  20.478  27.962 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7310   C C29  B MXT C 2 .   ? 24.495  20.899  23.407 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7311   C C29  C MXT C 2 .   ? 17.126  14.495  21.662 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7312   C C29  D MXT C 2 .   ? 19.769  23.754  29.353 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7313   C C29  E MXT C 2 .   ? 24.846  12.573  20.557 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7314   C C29  F MXT C 2 .   ? 19.462  18.322  33.773 0.16  0.00 ? 600 MXT A C29  2  
HETATM 7315   C C29  U MXT C 2 .   ? 3.694   17.069  11.621 0.010 0.00 ? 600 MXT A C29  2  
HETATM 7316   C C29  V MXT C 2 .   ? 4.804   14.976  8.834  0.010 0.00 ? 600 MXT A C29  2  
HETATM 7317   C C29  W MXT C 2 .   ? 2.472   10.440  14.630 0.010 0.00 ? 600 MXT A C29  2  
HETATM 7318   C C29  X MXT C 2 .   ? -0.863  18.386  18.891 0.010 0.00 ? 600 MXT A C29  2  
HETATM 7319   C C29  Y MXT C 2 .   ? 1.975   12.468  23.004 0.010 0.00 ? 600 MXT A C29  2  
HETATM 7320   C C29  Z MXT C 2 .   ? 9.744   18.917  11.537 0.010 0.00 ? 600 MXT A C29  2  
HETATM 7321   C C11  A MXT C 2 .   ? 20.912  14.863  26.114 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7322   C C11  B MXT C 2 .   ? 21.583  17.515  27.572 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7323   C C11  C MXT C 2 .   ? 20.726  15.587  26.453 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7324   C C11  D MXT C 2 .   ? 22.316  17.637  28.960 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7325   C C11  E MXT C 2 .   ? 21.732  15.982  25.461 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7326   C C11  F MXT C 2 .   ? 20.889  16.744  27.381 0.16  0.00 ? 600 MXT A C11  2  
HETATM 7327   C C11  U MXT C 2 .   ? 4.341   17.054  17.992 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7328   C C11  V MXT C 2 .   ? 7.073   14.557  15.130 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7329   C C11  W MXT C 2 .   ? 6.283   15.351  14.969 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7330   C C11  X MXT C 2 .   ? 4.192   15.424  17.040 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7331   C C11  Y MXT C 2 .   ? 4.413   14.628  17.085 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7332   C C11  Z MXT C 2 .   ? 5.277   15.734  15.410 0.010 0.00 ? 600 MXT A C11  2  
HETATM 7333   C C12  A MXT C 2 .   ? 20.286  14.381  27.440 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7334   C C12  B MXT C 2 .   ? 21.776  18.156  28.964 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7335   C C12  C MXT C 2 .   ? 20.435  16.982  27.051 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7336   C C12  D MXT C 2 .   ? 22.224  18.359  27.599 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7337   C C12  E MXT C 2 .   ? 21.053  14.957  24.525 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7338   C C12  F MXT C 2 .   ? 21.638  17.801  28.224 0.16  0.00 ? 600 MXT A C12  2  
HETATM 7339   C C12  U MXT C 2 .   ? 5.120   18.375  17.819 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7340   C C12  V MXT C 2 .   ? 5.578   14.312  14.835 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7341   C C12  W MXT C 2 .   ? 6.578   15.472  13.458 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7342   C C12  X MXT C 2 .   ? 4.564   16.084  15.695 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7343   C C12  Y MXT C 2 .   ? 3.866   15.513  18.228 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7344   C C12  Z MXT C 2 .   ? 5.953   15.086  14.181 0.010 0.00 ? 600 MXT A C12  2  
HETATM 7345   C C13  A MXT C 2 .   ? 20.019  16.031  25.659 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7346   C C13  B MXT C 2 .   ? 22.577  18.256  26.658 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7347   C C13  C MXT C 2 .   ? 19.801  15.489  25.226 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7348   C C13  D MXT C 2 .   ? 22.365  18.769  30.002 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7349   C C13  E MXT C 2 .   ? 23.122  16.216  24.846 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7350   C C13  F MXT C 2 .   ? 19.652  16.377  28.221 0.16  0.00 ? 600 MXT A C13  2  
HETATM 7351   C C13  U MXT C 2 .   ? 3.375   17.008  16.794 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7352   C C13  V MXT C 2 .   ? 7.775   14.386  13.769 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7353   C C13  W MXT C 2 .   ? 5.913   13.871  15.177 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7354   C C13  X MXT C 2 .   ? 2.716   15.797  17.264 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7355   C C13  Y MXT C 2 .   ? 4.199   13.184  17.571 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7356   C C13  Z MXT C 2 .   ? 5.557   17.241  15.263 0.010 0.00 ? 600 MXT A C13  2  
HETATM 7357   H H21  A MXT C 2 .   ? 16.929  16.656  26.342 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7358   H H21  B MXT C 2 .   ? 25.117  20.234  27.687 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7359   H H21  C MXT C 2 .   ? 17.950  18.106  23.993 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7360   H H21  D MXT C 2 .   ? 23.434  21.547  30.265 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7361   H H21  E MXT C 2 .   ? 25.255  15.978  23.276 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7362   H H21  F MXT C 2 .   ? 17.930  16.241  30.241 0.16  0.00 ? 600 MXT A H21  2  
HETATM 7363   H H21  U MXT C 2 .   ? 2.292   19.511  14.971 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7364   H H21  V MXT C 2 .   ? 7.775   12.918  11.302 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7365   H H21  W MXT C 2 .   ? 6.651   11.216  13.590 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7366   H H21  X MXT C 2 .   ? 0.491   16.803  15.043 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7367   H H21  Y MXT C 2 .   ? 3.809   11.145  19.258 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7368   H H21  Z MXT C 2 .   ? 6.391   19.565  14.274 0.010 0.00 ? 600 MXT A H21  2  
HETATM 7369   H H121 A MXT C 2 .   ? 20.985  14.437  28.300 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7370   H H121 B MXT C 2 .   ? 22.078  17.428  29.743 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7371   H H121 C MXT C 2 .   ? 21.333  17.632  27.099 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7372   H H121 D MXT C 2 .   ? 21.316  18.088  27.021 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7373   H H121 E MXT C 2 .   ? 20.109  15.333  24.080 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7374   H H121 F MXT C 2 .   ? 21.764  18.769  27.698 0.16  0.00 ? 600 MXT A H121 2  
HETATM 7375   H H121 U MXT C 2 .   ? 6.217   18.228  17.735 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7376   H H121 V MXT C 2 .   ? 4.933   15.176  15.093 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7377   H H121 W MXT C 2 .   ? 7.607   15.828  13.241 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7378   H H121 X MXT C 2 .   ? 4.910   15.356  14.932 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7379   H H121 Y MXT C 2 .   ? 3.045   16.185  17.903 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7380   H H121 Z MXT C 2 .   ? 5.244   14.522  13.541 0.010 0.00 ? 600 MXT A H121 2  
HETATM 7381   H H122 A MXT C 2 .   ? 19.961  13.321  27.365 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7382   H H122 B MXT C 2 .   ? 20.832  18.624  29.319 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7383   H H122 C MXT C 2 .   ? 20.054  16.896  28.092 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7384   H H122 D MXT C 2 .   ? 23.094  18.107  26.954 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7385   H H122 E MXT C 2 .   ? 20.796  14.026  25.073 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7386   H H122 F MXT C 2 .   ? 22.659  17.450  28.487 0.16  0.00 ? 600 MXT A H122 2  
HETATM 7387   H H122 U MXT C 2 .   ? 4.958   19.051  18.687 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7388   H H122 V MXT C 2 .   ? 5.195   13.447  15.418 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7389   H H122 W MXT C 2 .   ? 5.887   16.196  12.975 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7390   H H122 X MXT C 2 .   ? 5.390   16.818  15.826 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7391   H H122 Y MXT C 2 .   ? 4.664   16.166  18.642 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7392   H H122 Z MXT C 2 .   ? 6.738   14.364  14.493 0.010 0.00 ? 600 MXT A H122 2  
HETATM 7393   H H221 A MXT C 2 .   ? 18.989  18.755  25.374 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7394   H H221 B MXT C 2 .   ? 22.908  21.664  26.056 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7395   H H221 C MXT C 2 .   ? 16.579  15.410  24.659 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7396   H H221 D MXT C 2 .   ? 20.479  21.208  31.122 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7397   H H221 E MXT C 2 .   ? 23.407  15.394  20.861 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7398   H H221 F MXT C 2 .   ? 18.467  19.220  30.888 0.16  0.00 ? 600 MXT A H221 2  
HETATM 7399   H H221 U MXT C 2 .   ? 2.065   16.498  14.294 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7400   H H221 V MXT C 2 .   ? 7.230   15.900  10.674 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7401   H H221 W MXT C 2 .   ? 3.952   12.069  12.333 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7402   H H221 X MXT C 2 .   ? 1.389   19.193  16.794 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7403   H H221 Y MXT C 2 .   ? 1.099   12.473  19.945 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7404   H H221 Z MXT C 2 .   ? 6.613   18.366  11.429 0.010 0.00 ? 600 MXT A H221 2  
HETATM 7405   H H222 A MXT C 2 .   ? 18.125  17.576  24.382 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7406   H H222 B MXT C 2 .   ? 23.337  21.948  27.746 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7407   H H222 C MXT C 2 .   ? 16.349  16.955  25.485 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7408   H H222 D MXT C 2 .   ? 21.909  20.627  31.980 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7409   H H222 E MXT C 2 .   ? 23.858  16.978  21.497 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7410   H H222 F MXT C 2 .   ? 17.349  18.578  29.683 0.16  0.00 ? 600 MXT A H222 2  
HETATM 7411   H H222 U MXT C 2 .   ? 1.002   17.435  15.348 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7412   H H222 V MXT C 2 .   ? 8.756   15.184  11.203 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7413   H H222 W MXT C 2 .   ? 5.519   11.968  11.524 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7414   H H222 X MXT C 2 .   ? 1.618   19.004  15.053 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7415   H H222 Y MXT C 2 .   ? 1.474   11.495  18.524 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7416   H H222 Z MXT C 2 .   ? 5.180   19.077  12.175 0.010 0.00 ? 600 MXT A H222 2  
HETATM 7417   H H231 A MXT C 2 .   ? 16.902  17.363  28.433 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7418   H H231 B MXT C 2 .   ? 25.896  19.071  25.980 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7419   H H231 C MXT C 2 .   ? 18.984  17.357  22.192 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7420   H H231 D MXT C 2 .   ? 22.984  22.817  28.517 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7421   H H231 E MXT C 2 .   ? 25.807  13.866  23.610 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7422   H H231 F MXT C 2 .   ? 19.210  15.457  31.861 0.16  0.00 ? 600 MXT A H231 2  
HETATM 7423   H H231 U MXT C 2 .   ? 3.970   19.893  13.588 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7424   H H231 V MXT C 2 .   ? 5.777   12.219  10.671 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7425   H H231 W MXT C 2 .   ? 5.791   10.682  15.551 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7426   H H231 X MXT C 2 .   ? -0.569  15.757  16.673 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7427   H H231 Y MXT C 2 .   ? 4.789   11.716  21.152 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7428   H H231 Z MXT C 2 .   ? 8.538   19.346  14.744 0.010 0.00 ? 600 MXT A H231 2  
HETATM 7429   H H232 A MXT C 2 .   ? 18.557  17.960  28.507 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7430   H H232 B MXT C 2 .   ? 24.388  18.928  25.079 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7431   H H232 C MXT C 2 .   ? 19.174  15.682  22.704 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7432   H H232 D MXT C 2 .   ? 21.397  22.152  28.140 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7433   H H232 E MXT C 2 .   ? 24.316  13.133  23.026 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7434   H H232 F MXT C 2 .   ? 20.374  16.779  31.907 0.16  0.00 ? 600 MXT A H232 2  
HETATM 7435   H H232 U MXT C 2 .   ? 4.710   18.297  13.660 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7436   H H232 V MXT C 2 .   ? 4.876   13.679  11.071 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7437   H H232 W MXT C 2 .   ? 4.453   11.828  15.547 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7438   H H232 X MXT C 2 .   ? 0.428   16.325  18.010 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7439   H H232 Y MXT C 2 .   ? 3.900   13.208  21.442 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7440   H H232 Z MXT C 2 .   ? 8.856   17.923  13.755 0.010 0.00 ? 600 MXT A H232 2  
HETATM 7441   H H251 A MXT C 2 .   ? 14.813  19.189  24.219 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7442   H H251 B MXT C 2 .   ? 26.426  23.912  27.296 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7443   H H251 C MXT C 2 .   ? 14.185  18.666  23.036 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7444   H H251 D MXT C 2 .   ? 23.086  23.789  33.466 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7445   H H251 E MXT C 2 .   ? 27.288  17.244  20.168 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7446   H H251 F MXT C 2 .   ? 14.594  17.496  31.885 0.16  0.00 ? 600 MXT A H251 2  
HETATM 7447   H H251 U MXT C 2 .   ? -0.973  19.244  12.813 0.010 0.00 ? 600 MXT A H251 2  
HETATM 7448   H H251 V MXT C 2 .   ? 9.852   13.620  8.048  0.010 0.00 ? 600 MXT A H251 2  
HETATM 7449   H H251 W MXT C 2 .   ? 5.777   8.314   11.097 0.010 0.00 ? 600 MXT A H251 2  
HETATM 7450   H H251 X MXT C 2 .   ? -1.791  19.775  13.878 0.010 0.00 ? 600 MXT A H251 2  
HETATM 7451   H H251 Y MXT C 2 .   ? 1.420   8.131   20.036 0.010 0.00 ? 600 MXT A H251 2  
HETATM 7452   H H251 Z MXT C 2 .   ? 6.024   22.656  11.884 0.010 0.00 ? 600 MXT A H251 2  
HETATM 7453   H H252 A MXT C 2 .   ? 15.911  17.946  23.567 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7454   H H252 B MXT C 2 .   ? 25.134  23.378  28.402 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7455   H H252 C MXT C 2 .   ? 14.845  18.633  24.691 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7456   H H252 D MXT C 2 .   ? 23.188  22.012  33.448 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7457   H H252 E MXT C 2 .   ? 25.897  18.074  20.912 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7458   H H252 F MXT C 2 .   ? 15.138  17.854  30.226 0.16  0.00 ? 600 MXT A H252 2  
HETATM 7459   H H252 U MXT C 2 .   ? -0.809  18.753  14.518 0.010 0.00 ? 600 MXT A H252 2  
HETATM 7460   H H252 V MXT C 2 .   ? 10.287  14.143  9.695  0.010 0.00 ? 600 MXT A H252 2  
HETATM 7461   H H252 W MXT C 2 .   ? 6.390   9.925   10.646 0.010 0.00 ? 600 MXT A H252 2  
HETATM 7462   H H252 X MXT C 2 .   ? -0.074  19.556  13.460 0.010 0.00 ? 600 MXT A H252 2  
HETATM 7463   H H252 Y MXT C 2 .   ? 1.414   9.108   18.545 0.010 0.00 ? 600 MXT A H252 2  
HETATM 7464   H H252 Z MXT C 2 .   ? 4.771   21.431  12.202 0.010 0.00 ? 600 MXT A H252 2  
HETATM 7465   H H253 A MXT C 2 .   ? 15.156  17.721  25.174 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7466   H H253 B MXT C 2 .   ? 26.398  22.227  27.876 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7467   H H253 C MXT C 2 .   ? 15.895  19.089  23.316 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7468   H H253 D MXT C 2 .   ? 23.904  22.964  32.114 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7469   H H253 E MXT C 2 .   ? 26.910  16.969  21.888 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7470   H H253 F MXT C 2 .   ? 15.700  16.370  31.052 0.16  0.00 ? 600 MXT A H253 2  
HETATM 7471   H H253 U MXT C 2 .   ? 0.265   20.013  13.840 0.010 0.00 ? 600 MXT A H253 2  
HETATM 7472   H H253 V MXT C 2 .   ? 9.254   12.703  9.454  0.010 0.00 ? 600 MXT A H253 2  
HETATM 7473   H H253 W MXT C 2 .   ? 6.752   9.248   12.261 0.010 0.00 ? 600 MXT A H253 2  
HETATM 7474   H H253 X MXT C 2 .   ? -1.085  18.138  13.867 0.010 0.00 ? 600 MXT A H253 2  
HETATM 7475   H H253 Y MXT C 2 .   ? 2.909   8.960   19.514 0.010 0.00 ? 600 MXT A H253 2  
HETATM 7476   H H253 Z MXT C 2 .   ? 6.036   21.755  13.423 0.010 0.00 ? 600 MXT A H253 2  
HETATM 7477   H H261 A MXT C 2 .   ? 17.686  19.957  23.251 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7478   H H261 B MXT C 2 .   ? 23.417  24.336  26.551 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7479   H H261 C MXT C 2 .   ? 13.906  16.104  24.809 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7480   H H261 D MXT C 2 .   ? 20.505  22.045  33.756 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7481   H H261 E MXT C 2 .   ? 24.440  17.036  18.890 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7482   H H261 F MXT C 2 .   ? 15.919  20.248  31.203 0.16  0.00 ? 600 MXT A H261 2  
HETATM 7483   H H261 U MXT C 2 .   ? -0.591  16.233  13.570 0.010 0.00 ? 600 MXT A H261 2  
HETATM 7484   H H261 V MXT C 2 .   ? 9.313   16.559  8.980  0.010 0.00 ? 600 MXT A H261 2  
HETATM 7485   H H261 W MXT C 2 .   ? 3.826   10.521  10.046 0.010 0.00 ? 600 MXT A H261 2  
HETATM 7486   H H261 X MXT C 2 .   ? 0.431   21.374  15.392 0.010 0.00 ? 600 MXT A H261 2  
HETATM 7487   H H261 Y MXT C 2 .   ? -0.699  10.396  19.625 0.010 0.00 ? 600 MXT A H261 2  
HETATM 7488   H H261 Z MXT C 2 .   ? 5.506   20.342  9.842  0.010 0.00 ? 600 MXT A H261 2  
HETATM 7489   H H262 A MXT C 2 .   ? 16.482  21.055  23.970 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7490   H H262 B MXT C 2 .   ? 24.827  24.762  25.548 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7491   H H262 C MXT C 2 .   ? 13.351  16.293  23.126 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7492   H H262 D MXT C 2 .   ? 20.582  23.826  33.707 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7493   H H262 E MXT C 2 .   ? 25.923  16.235  18.310 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7494   H H262 F MXT C 2 .   ? 15.365  19.705  32.809 0.16  0.00 ? 600 MXT A H262 2  
HETATM 7495   H H262 U MXT C 2 .   ? -0.723  16.903  11.925 0.010 0.00 ? 600 MXT A H262 2  
HETATM 7496   H H262 V MXT C 2 .   ? 8.900   15.857  7.395  0.010 0.00 ? 600 MXT A H262 2  
HETATM 7497   H H262 W MXT C 2 .   ? 3.380   8.882   10.584 0.010 0.00 ? 600 MXT A H262 2  
HETATM 7498   H H262 X MXT C 2 .   ? -1.322  21.434  15.711 0.010 0.00 ? 600 MXT A H262 2  
HETATM 7499   H H262 Y MXT C 2 .   ? -0.518  9.363   21.065 0.010 0.00 ? 600 MXT A H262 2  
HETATM 7500   H H262 Z MXT C 2 .   ? 6.746   21.617  9.709  0.010 0.00 ? 600 MXT A H262 2  
HETATM 7501   H H263 A MXT C 2 .   ? 18.122  20.954  24.666 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7502   H H263 B MXT C 2 .   ? 23.533  23.736  24.875 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7503   H H263 C MXT C 2 .   ? 14.421  14.933  23.565 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7504   H H263 D MXT C 2 .   ? 19.513  22.947  32.580 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7505   H H263 E MXT C 2 .   ? 24.457  15.269  18.632 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7506   H H263 F MXT C 2 .   ? 17.039  20.287  32.594 0.16  0.00 ? 600 MXT A H263 2  
HETATM 7507   H H263 U MXT C 2 .   ? 0.669   15.873  12.358 0.010 0.00 ? 600 MXT A H263 2  
HETATM 7508   H H263 V MXT C 2 .   ? 7.642   16.666  8.367  0.010 0.00 ? 600 MXT A H263 2  
HETATM 7509   H H263 W MXT C 2 .   ? 2.574   10.305  11.298 0.010 0.00 ? 600 MXT A H263 2  
HETATM 7510   H H263 X MXT C 2 .   ? -0.185  21.076  17.039 0.010 0.00 ? 600 MXT A H263 2  
HETATM 7511   H H263 Y MXT C 2 .   ? -0.524  11.139  21.239 0.010 0.00 ? 600 MXT A H263 2  
HETATM 7512   H H263 Z MXT C 2 .   ? 7.218   19.900  9.593  0.010 0.00 ? 600 MXT A H263 2  
HETATM 7513   H H281 A MXT C 2 .   ? 15.227  19.061  28.890 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7514   H H281 B MXT C 2 .   ? 27.671  20.178  24.747 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7515   H H281 C MXT C 2 .   ? 17.717  17.614  20.136 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7516   H H281 D MXT C 2 .   ? 22.961  25.197  28.995 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7517   H H281 E MXT C 2 .   ? 27.790  13.152  22.403 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7518   H H281 F MXT C 2 .   ? 18.050  15.100  33.964 0.16  0.00 ? 600 MXT A H281 2  
HETATM 7519   H H281 U MXT C 2 .   ? 3.287   20.557  11.354 0.010 0.00 ? 600 MXT A H281 2  
HETATM 7520   H H281 V MXT C 2 .   ? 5.634   11.590  8.330  0.010 0.00 ? 600 MXT A H281 2  
HETATM 7521   H H281 W MXT C 2 .   ? 5.093   8.364   15.736 0.010 0.00 ? 600 MXT A H281 2  
HETATM 7522   H H281 X MXT C 2 .   ? -2.914  16.350  16.878 0.010 0.00 ? 600 MXT A H281 2  
HETATM 7523   H H281 Y MXT C 2 .   ? 4.558   10.075  22.927 0.010 0.00 ? 600 MXT A H281 2  
HETATM 7524   H H281 Z MXT C 2 .   ? 9.890   21.273  14.152 0.010 0.00 ? 600 MXT A H281 2  
HETATM 7525   H H282 A MXT C 2 .   ? 16.632  19.359  29.953 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7526   H H282 B MXT C 2 .   ? 26.736  19.172  23.603 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7527   H H282 C MXT C 2 .   ? 18.723  16.143  19.995 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7528   H H282 D MXT C 2 .   ? 21.777  24.874  27.694 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7529   H H282 E MXT C 2 .   ? 26.688  11.753  22.552 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7530   H H282 F MXT C 2 .   ? 19.740  15.553  34.325 0.16  0.00 ? 600 MXT A H282 2  
HETATM 7531   H H282 U MXT C 2 .   ? 4.817   19.644  11.225 0.010 0.00 ? 600 MXT A H282 2  
HETATM 7532   H H282 V MXT C 2 .   ? 4.048   12.242  8.835  0.010 0.00 ? 600 MXT A H282 2  
HETATM 7533   H H282 W MXT C 2 .   ? 4.011   9.358   16.753 0.010 0.00 ? 600 MXT A H282 2  
HETATM 7534   H H282 X MXT C 2 .   ? -2.288  15.964  18.508 0.010 0.00 ? 600 MXT A H282 2  
HETATM 7535   H H282 Y MXT C 2 .   ? 4.623   11.700  23.669 0.010 0.00 ? 600 MXT A H282 2  
HETATM 7536   H H282 Z MXT C 2 .   ? 10.894  19.806  13.973 0.010 0.00 ? 600 MXT A H282 2  
HETATM 7537   H H283 A MXT C 2 .   ? 15.842  20.724  29.127 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7538   H H283 B MXT C 2 .   ? 27.225  20.819  23.136 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7539   H H283 C MXT C 2 .   ? 17.030  16.113  19.446 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7540   H H283 D MXT C 2 .   ? 21.348  25.974  29.027 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7541   H H283 E MXT C 2 .   ? 27.507  12.071  21.004 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7542   H H283 F MXT C 2 .   ? 18.413  16.272  35.268 0.16  0.00 ? 600 MXT A H283 2  
HETATM 7543   H H283 U MXT C 2 .   ? 3.497   19.326  10.072 0.010 0.00 ? 600 MXT A H283 2  
HETATM 7544   H H283 V MXT C 2 .   ? 4.743   12.723  7.268  0.010 0.00 ? 600 MXT A H283 2  
HETATM 7545   H H283 W MXT C 2 .   ? 3.327   8.074   15.727 0.010 0.00 ? 600 MXT A H283 2  
HETATM 7546   H H283 X MXT C 2 .   ? -3.341  17.380  18.278 0.010 0.00 ? 600 MXT A H283 2  
HETATM 7547   H H283 Y MXT C 2 .   ? 3.436   10.509  24.253 0.010 0.00 ? 600 MXT A H283 2  
HETATM 7548   H H283 Z MXT C 2 .   ? 10.955  21.075  12.726 0.010 0.00 ? 600 MXT A H283 2  
HETATM 7549   H H291 A MXT C 2 .   ? 17.961  21.527  27.912 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7550   H H291 B MXT C 2 .   ? 24.836  21.654  22.671 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7551   H H291 C MXT C 2 .   ? 16.320  14.170  20.975 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7552   H H291 D MXT C 2 .   ? 19.269  24.653  29.765 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7553   H H291 E MXT C 2 .   ? 25.346  12.250  19.621 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7554   H H291 F MXT C 2 .   ? 19.017  18.710  34.711 0.16  0.00 ? 600 MXT A H291 2  
HETATM 7555   H H291 U MXT C 2 .   ? 3.305   16.820  10.613 0.010 0.00 ? 600 MXT A H291 2  
HETATM 7556   H H291 V MXT C 2 .   ? 4.724   15.247  7.762  0.010 0.00 ? 600 MXT A H291 2  
HETATM 7557   H H291 W MXT C 2 .   ? 1.747   9.628   14.422 0.010 0.00 ? 600 MXT A H291 2  
HETATM 7558   H H291 X MXT C 2 .   ? -1.659  19.083  19.218 0.010 0.00 ? 600 MXT A H291 2  
HETATM 7559   H H291 Y MXT C 2 .   ? 1.377   11.983  23.801 0.010 0.00 ? 600 MXT A H291 2  
HETATM 7560   H H291 Z MXT C 2 .   ? 10.274  19.534  10.783 0.010 0.00 ? 600 MXT A H291 2  
HETATM 7561   H H292 A MXT C 2 .   ? 19.096  20.358  27.187 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7562   H H292 B MXT C 2 .   ? 23.488  21.208  23.750 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7563   H H292 C MXT C 2 .   ? 16.894  14.079  22.661 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7564   H H292 D MXT C 2 .   ? 19.292  22.870  29.822 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7565   H H292 E MXT C 2 .   ? 23.918  13.102  20.266 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7566   H H292 F MXT C 2 .   ? 19.527  19.171  33.064 0.16  0.00 ? 600 MXT A H292 2  
HETATM 7567   H H292 U MXT C 2 .   ? 3.411   16.239  12.296 0.010 0.00 ? 600 MXT A H292 2  
HETATM 7568   H H292 V MXT C 2 .   ? 5.189   15.866  9.369  0.010 0.00 ? 600 MXT A H292 2  
HETATM 7569   H H292 W MXT C 2 .   ? 2.291   11.241  13.888 0.010 0.00 ? 600 MXT A H292 2  
HETATM 7570   H H292 X MXT C 2 .   ? 0.075   18.971  18.817 0.010 0.00 ? 600 MXT A H292 2  
HETATM 7571   H H292 Y MXT C 2 .   ? 1.263   12.959  22.313 0.010 0.00 ? 600 MXT A H292 2  
HETATM 7572   H H292 Z MXT C 2 .   ? 8.995   18.307  10.996 0.010 0.00 ? 600 MXT A H292 2  
HETATM 7573   H H293 A MXT C 2 .   ? 18.812  20.348  28.945 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7574   H H293 B MXT C 2 .   ? 24.369  19.943  22.859 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7575   H H293 C MXT C 2 .   ? 18.062  14.008  21.319 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7576   H H293 D MXT C 2 .   ? 19.526  23.714  28.270 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7577   H H293 E MXT C 2 .   ? 24.538  11.655  21.097 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7578   H H293 F MXT C 2 .   ? 20.503  18.016  34.007 0.16  0.00 ? 600 MXT A H293 2  
HETATM 7579   H H293 U MXT C 2 .   ? 4.802   17.067  11.553 0.010 0.00 ? 600 MXT A H293 2  
HETATM 7580   H H293 V MXT C 2 .   ? 3.773   14.800  9.203  0.010 0.00 ? 600 MXT A H293 2  
HETATM 7581   H H293 W MXT C 2 .   ? 2.214   10.859  15.625 0.010 0.00 ? 600 MXT A H293 2  
HETATM 7582   H H293 X MXT C 2 .   ? -0.718  17.649  19.710 0.010 0.00 ? 600 MXT A H293 2  
HETATM 7583   H H293 Y MXT C 2 .   ? 2.565   13.274  23.484 0.010 0.00 ? 600 MXT A H293 2  
HETATM 7584   H H293 Z MXT C 2 .   ? 10.488  18.212  11.963 0.010 0.00 ? 600 MXT A H293 2  
ATOM   7585   N N    . GLY A 1 5   ? -19.436 18.281  47.658 1.00  0.00 ? 5   GLY A N    3  
ATOM   7586   C CA   . GLY A 1 5   ? -20.256 17.263  46.989 1.00  0.00 ? 5   GLY A CA   3  
ATOM   7587   C C    . GLY A 1 5   ? -19.681 16.619  45.734 1.00  0.00 ? 5   GLY A C    3  
ATOM   7588   O O    . GLY A 1 5   ? -20.381 15.911  44.984 1.00  0.00 ? 5   GLY A O    3  
ATOM   7589   N N    . LYS A 1 6   ? -18.410 16.871  45.483 1.00  0.00 ? 6   LYS A N    3  
ATOM   7590   C CA   . LYS A 1 6   ? -17.701 16.290  44.352 1.00  0.00 ? 6   LYS A CA   3  
ATOM   7591   C C    . LYS A 1 6   ? -16.238 16.160  44.725 1.00  0.00 ? 6   LYS A C    3  
ATOM   7592   O O    . LYS A 1 6   ? -15.856 16.416  45.876 1.00  0.00 ? 6   LYS A O    3  
ATOM   7593   H H    . LYS A 1 6   ? -17.914 17.447  46.103 1.00  0.00 ? 6   LYS A H    3  
ATOM   7594   N N    . LEU A 1 7   ? -15.448 15.679  43.787 1.00  0.00 ? 7   LEU A N    3  
ATOM   7595   C CA   . LEU A 1 7   ? -13.994 15.539  44.048 1.00  0.00 ? 7   LEU A CA   3  
ATOM   7596   C C    . LEU A 1 7   ? -13.247 16.164  42.881 1.00  0.00 ? 7   LEU A C    3  
ATOM   7597   O O    . LEU A 1 7   ? -13.594 16.051  41.722 1.00  0.00 ? 7   LEU A O    3  
ATOM   7598   H H    . LEU A 1 7   ? -15.816 15.432  42.914 1.00  0.00 ? 7   LEU A H    3  
ATOM   7599   N N    . VAL A 1 8   ? -12.240 16.944  43.210 1.00  0.00 ? 8   VAL A N    3  
ATOM   7600   C CA   . VAL A 1 8   ? -11.351 17.522  42.203 1.00  0.00 ? 8   VAL A CA   3  
ATOM   7601   C C    . VAL A 1 8   ? -9.954  17.034  42.623 1.00  0.00 ? 8   VAL A C    3  
ATOM   7602   O O    . VAL A 1 8   ? -9.566  17.009  43.781 1.00  0.00 ? 8   VAL A O    3  
ATOM   7603   H H    . VAL A 1 8   ? -12.032 17.076  44.159 1.00  0.00 ? 8   VAL A H    3  
ATOM   7604   N N    . ILE A 1 9   ? -9.302  16.490  41.606 1.00  0.00 ? 9   ILE A N    3  
ATOM   7605   C CA   . ILE A 1 9   ? -7.951  15.929  41.766 1.00  0.00 ? 9   ILE A CA   3  
ATOM   7606   C C    . ILE A 1 9   ? -6.985  16.595  40.789 1.00  0.00 ? 9   ILE A C    3  
ATOM   7607   O O    . ILE A 1 9   ? -7.370  16.900  39.660 1.00  0.00 ? 9   ILE A O    3  
ATOM   7608   H H    . ILE A 1 9   ? -9.736  16.446  40.729 1.00  0.00 ? 9   ILE A H    3  
ATOM   7609   N N    . TRP A 1 10  ? -5.792  16.784  41.289 1.00  0.00 ? 10  TRP A N    3  
ATOM   7610   C CA   . TRP A 1 10  ? -4.654  17.363  40.578 1.00  0.00 ? 10  TRP A CA   3  
ATOM   7611   C C    . TRP A 1 10  ? -3.522  16.342  40.531 1.00  0.00 ? 10  TRP A C    3  
ATOM   7612   O O    . TRP A 1 10  ? -3.092  15.793  41.548 1.00  0.00 ? 10  TRP A O    3  
ATOM   7613   H H    . TRP A 1 10  ? -5.641  16.490  42.212 1.00  0.00 ? 10  TRP A H    3  
ATOM   7614   N N    . ILE A 1 11  ? -3.062  16.105  39.325 1.00  0.00 ? 11  ILE A N    3  
ATOM   7615   C CA   . ILE A 1 11  ? -1.975  15.158  39.055 1.00  0.00 ? 11  ILE A CA   3  
ATOM   7616   C C    . ILE A 1 11  ? -1.195  15.730  37.888 1.00  0.00 ? 11  ILE A C    3  
ATOM   7617   O O    . ILE A 1 11  ? -1.783  16.434  37.066 1.00  0.00 ? 11  ILE A O    3  
ATOM   7618   H H    . ILE A 1 11  ? -3.463  16.584  38.569 1.00  0.00 ? 11  ILE A H    3  
ATOM   7619   N N    . ASN A 1 12  ? 0.072   15.467  37.812 1.00  0.00 ? 12  ASN A N    3  
ATOM   7620   C CA   . ASN A 1 12  ? 0.920   15.955  36.701 1.00  0.00 ? 12  ASN A CA   3  
ATOM   7621   C C    . ASN A 1 12  ? 0.487   15.306  35.373 1.00  0.00 ? 12  ASN A C    3  
ATOM   7622   O O    . ASN A 1 12  ? 0.082   14.148  35.323 1.00  0.00 ? 12  ASN A O    3  
ATOM   7623   H H    . ASN A 1 12  ? 0.481   14.910  38.507 1.00  0.00 ? 12  ASN A H    3  
ATOM   7624   N N    . GLY A 1 13  ? 0.640   16.082  34.315 1.00  0.00 ? 13  GLY A N    3  
ATOM   7625   C CA   . GLY A 1 13  ? 0.348   15.726  32.946 1.00  0.00 ? 13  GLY A CA   3  
ATOM   7626   C C    . GLY A 1 13  ? 1.094   14.523  32.386 1.00  0.00 ? 13  GLY A C    3  
ATOM   7627   O O    . GLY A 1 13  ? 0.583   13.875  31.441 1.00  0.00 ? 13  GLY A O    3  
ATOM   7628   H H    . GLY A 1 13  ? 1.005   16.978  34.472 1.00  0.00 ? 13  GLY A H    3  
ATOM   7629   N N    . ASP A 1 14  ? 2.190   14.156  32.951 1.00  0.00 ? 14  ASP A N    3  
ATOM   7630   C CA   . ASP A 1 14  ? 3.074   13.047  32.589 1.00  0.00 ? 14  ASP A CA   3  
ATOM   7631   C C    . ASP A 1 14  ? 2.699   11.718  33.251 1.00  0.00 ? 14  ASP A C    3  
ATOM   7632   O O    . ASP A 1 14  ? 3.467   10.726  33.217 1.00  0.00 ? 14  ASP A O    3  
ATOM   7633   H H    . ASP A 1 14  ? 2.472   14.692  33.721 1.00  0.00 ? 14  ASP A H    3  
ATOM   7634   N N    . LYS A 1 15  ? 1.550   11.692  33.888 1.00  0.00 ? 15  LYS A N    3  
ATOM   7635   C CA   . LYS A 1 15  ? 0.986   10.561  34.614 1.00  0.00 ? 15  LYS A CA   3  
ATOM   7636   C C    . LYS A 1 15  ? -0.299  10.094  33.936 1.00  0.00 ? 15  LYS A C    3  
ATOM   7637   O O    . LYS A 1 15  ? -0.859  10.787  33.108 1.00  0.00 ? 15  LYS A O    3  
ATOM   7638   H H    . LYS A 1 15  ? 1.027   12.521  33.888 1.00  0.00 ? 15  LYS A H    3  
ATOM   7639   N N    . GLY A 1 16  ? -0.750  8.945   34.379 1.00  0.00 ? 16  GLY A N    3  
ATOM   7640   C CA   . GLY A 1 16  ? -1.941  8.334   33.816 1.00  0.00 ? 16  GLY A CA   3  
ATOM   7641   C C    . GLY A 1 16  ? -3.210  8.947   34.367 1.00  0.00 ? 16  GLY A C    3  
ATOM   7642   O O    . GLY A 1 16  ? -3.973  8.236   35.038 1.00  0.00 ? 16  GLY A O    3  
ATOM   7643   H H    . GLY A 1 16  ? -0.258  8.476   35.084 1.00  0.00 ? 16  GLY A H    3  
ATOM   7644   N N    . TYR A 1 17  ? -3.414  10.206  34.041 1.00  0.00 ? 17  TYR A N    3  
ATOM   7645   C CA   . TYR A 1 17  ? -4.633  10.902  34.494 1.00  0.00 ? 17  TYR A CA   3  
ATOM   7646   C C    . TYR A 1 17  ? -5.889  10.477  33.771 1.00  0.00 ? 17  TYR A C    3  
ATOM   7647   O O    . TYR A 1 17  ? -7.020  10.829  34.172 1.00  0.00 ? 17  TYR A O    3  
ATOM   7648   H H    . TYR A 1 17  ? -2.763  10.676  33.479 1.00  0.00 ? 17  TYR A H    3  
ATOM   7649   N N    . ASN A 1 18  ? -5.764  9.742   32.675 1.00  0.00 ? 18  ASN A N    3  
ATOM   7650   C CA   . ASN A 1 18  ? -6.914  9.241   31.901 1.00  0.00 ? 18  ASN A CA   3  
ATOM   7651   C C    . ASN A 1 18  ? -7.367  7.963   32.612 1.00  0.00 ? 18  ASN A C    3  
ATOM   7652   O O    . ASN A 1 18  ? -8.562  7.662   32.656 1.00  0.00 ? 18  ASN A O    3  
ATOM   7653   H H    . ASN A 1 18  ? -4.863  9.503   32.375 1.00  0.00 ? 18  ASN A H    3  
ATOM   7654   N N    . GLY A 1 19  ? -6.402  7.253   33.115 1.00  0.00 ? 19  GLY A N    3  
ATOM   7655   C CA   . GLY A 1 19  ? -6.681  5.997   33.862 1.00  0.00 ? 19  GLY A CA   3  
ATOM   7656   C C    . GLY A 1 19  ? -7.287  6.388   35.208 1.00  0.00 ? 19  GLY A C    3  
ATOM   7657   O O    . GLY A 1 19  ? -8.183  5.705   35.721 1.00  0.00 ? 19  GLY A O    3  
ATOM   7658   H H    . GLY A 1 19  ? -5.476  7.559   33.016 1.00  0.00 ? 19  GLY A H    3  
ATOM   7659   N N    . LEU A 1 20  ? -6.741  7.455   35.789 1.00  0.00 ? 20  LEU A N    3  
ATOM   7660   C CA   . LEU A 1 20  ? -7.274  7.941   37.073 1.00  0.00 ? 20  LEU A CA   3  
ATOM   7661   C C    . LEU A 1 20  ? -8.708  8.448   36.858 1.00  0.00 ? 20  LEU A C    3  
ATOM   7662   O O    . LEU A 1 20  ? -9.542  8.187   37.752 1.00  0.00 ? 20  LEU A O    3  
ATOM   7663   H H    . LEU A 1 20  ? -6.003  7.930   35.352 1.00  0.00 ? 20  LEU A H    3  
ATOM   7664   N N    . ALA A 1 21  ? -9.002  9.116   35.762 1.00  0.00 ? 21  ALA A N    3  
ATOM   7665   C CA   . ALA A 1 21  ? -10.327 9.587   35.408 1.00  0.00 ? 21  ALA A CA   3  
ATOM   7666   C C    . ALA A 1 21  ? -11.287 8.402   35.234 1.00  0.00 ? 21  ALA A C    3  
ATOM   7667   O O    . ALA A 1 21  ? -12.493 8.630   35.396 1.00  0.00 ? 21  ALA A O    3  
ATOM   7668   H H    . ALA A 1 21  ? -8.280  9.268   35.118 1.00  0.00 ? 21  ALA A H    3  
ATOM   7669   N N    . GLU A 1 22  ? -10.822 7.220   34.910 1.00  0.00 ? 22  GLU A N    3  
ATOM   7670   C CA   . GLU A 1 22  ? -11.568 5.995   34.743 1.00  0.00 ? 22  GLU A CA   3  
ATOM   7671   C C    . GLU A 1 22  ? -11.933 5.325   36.064 1.00  0.00 ? 22  GLU A C    3  
ATOM   7672   O O    . GLU A 1 22  ? -12.943 4.591   36.176 1.00  0.00 ? 22  GLU A O    3  
ATOM   7673   H H    . GLU A 1 22  ? -9.852  7.156   34.790 1.00  0.00 ? 22  GLU A H    3  
ATOM   7674   N N    . VAL A 1 23  ? -11.090 5.531   37.072 1.00  0.00 ? 23  VAL A N    3  
ATOM   7675   C CA   . VAL A 1 23  ? -11.358 4.994   38.417 1.00  0.00 ? 23  VAL A CA   3  
ATOM   7676   C C    . VAL A 1 23  ? -12.497 5.865   38.989 1.00  0.00 ? 23  VAL A C    3  
ATOM   7677   O O    . VAL A 1 23  ? -13.354 5.398   39.733 1.00  0.00 ? 23  VAL A O    3  
ATOM   7678   H H    . VAL A 1 23  ? -10.296 6.087   36.927 1.00  0.00 ? 23  VAL A H    3  
ATOM   7679   N N    . GLY A 1 24  ? -12.446 7.101   38.578 1.00  0.00 ? 24  GLY A N    3  
ATOM   7680   C CA   . GLY A 1 24  ? -13.385 8.138   38.944 1.00  0.00 ? 24  GLY A CA   3  
ATOM   7681   C C    . GLY A 1 24  ? -14.791 7.925   38.412 1.00  0.00 ? 24  GLY A C    3  
ATOM   7682   O O    . GLY A 1 24  ? -15.758 8.309   39.073 1.00  0.00 ? 24  GLY A O    3  
ATOM   7683   H H    . GLY A 1 24  ? -11.717 7.345   37.969 1.00  0.00 ? 24  GLY A H    3  
ATOM   7684   N N    . LYS A 1 25  ? -14.898 7.359   37.218 1.00  0.00 ? 25  LYS A N    3  
ATOM   7685   C CA   . LYS A 1 25  ? -16.181 7.078   36.573 1.00  0.00 ? 25  LYS A CA   3  
ATOM   7686   C C    . LYS A 1 25  ? -16.842 5.933   37.321 1.00  0.00 ? 25  LYS A C    3  
ATOM   7687   O O    . LYS A 1 25  ? -18.057 5.921   37.592 1.00  0.00 ? 25  LYS A O    3  
ATOM   7688   H H    . LYS A 1 25  ? -14.076 7.111   36.745 1.00  0.00 ? 25  LYS A H    3  
ATOM   7689   N N    . LYS A 1 26  ? -16.050 4.980   37.719 1.00  0.00 ? 26  LYS A N    3  
ATOM   7690   C CA   . LYS A 1 26  ? -16.455 3.830   38.525 1.00  0.00 ? 26  LYS A CA   3  
ATOM   7691   C C    . LYS A 1 26  ? -16.947 4.321   39.888 1.00  0.00 ? 26  LYS A C    3  
ATOM   7692   O O    . LYS A 1 26  ? -17.947 3.802   40.445 1.00  0.00 ? 26  LYS A O    3  
ATOM   7693   H H    . LYS A 1 26  ? -15.097 5.068   37.507 1.00  0.00 ? 26  LYS A H    3  
ATOM   7694   N N    . PHE A 1 27  ? -16.262 5.315   40.463 1.00  0.00 ? 27  PHE A N    3  
ATOM   7695   C CA   . PHE A 1 27  ? -16.655 5.863   41.772 1.00  0.00 ? 27  PHE A CA   3  
ATOM   7696   C C    . PHE A 1 27  ? -18.006 6.568   41.605 1.00  0.00 ? 27  PHE A C    3  
ATOM   7697   O O    . PHE A 1 27  ? -18.891 6.370   42.453 1.00  0.00 ? 27  PHE A O    3  
ATOM   7698   H H    . PHE A 1 27  ? -15.482 5.689   40.002 1.00  0.00 ? 27  PHE A H    3  
ATOM   7699   N N    . GLU A 1 28  ? -18.140 7.348   40.581 1.00  0.00 ? 28  GLU A N    3  
ATOM   7700   C CA   . GLU A 1 28  ? -19.345 8.112   40.279 1.00  0.00 ? 28  GLU A CA   3  
ATOM   7701   C C    . GLU A 1 28  ? -20.545 7.208   40.027 1.00  0.00 ? 28  GLU A C    3  
ATOM   7702   O O    . GLU A 1 28  ? -21.692 7.652   40.114 1.00  0.00 ? 28  GLU A O    3  
ATOM   7703   H H    . GLU A 1 28  ? -17.376 7.441   39.975 1.00  0.00 ? 28  GLU A H    3  
ATOM   7704   N N    . LYS A 1 29  ? -20.264 5.957   39.730 1.00  0.00 ? 29  LYS A N    3  
ATOM   7705   C CA   . LYS A 1 29  ? -21.266 4.927   39.443 1.00  0.00 ? 29  LYS A CA   3  
ATOM   7706   C C    . LYS A 1 29  ? -21.932 4.416   40.707 1.00  0.00 ? 29  LYS A C    3  
ATOM   7707   O O    . LYS A 1 29  ? -23.182 4.332   40.749 1.00  0.00 ? 29  LYS A O    3  
ATOM   7708   H H    . LYS A 1 29  ? -19.319 5.699   39.692 1.00  0.00 ? 29  LYS A H    3  
ATOM   7709   N N    . ASP A 1 30  ? -21.135 4.075   41.705 1.00  0.00 ? 30  ASP A N    3  
ATOM   7710   C CA   . ASP A 1 30  ? -21.709 3.557   42.951 1.00  0.00 ? 30  ASP A CA   3  
ATOM   7711   C C    . ASP A 1 30  ? -21.927 4.665   43.986 1.00  0.00 ? 30  ASP A C    3  
ATOM   7712   O O    . ASP A 1 30  ? -22.221 4.303   45.147 1.00  0.00 ? 30  ASP A O    3  
ATOM   7713   H H    . ASP A 1 30  ? -20.163 4.157   41.608 1.00  0.00 ? 30  ASP A H    3  
ATOM   7714   N N    . THR A 1 31  ? -21.793 5.914   43.593 1.00  0.00 ? 31  THR A N    3  
ATOM   7715   C CA   . THR A 1 31  ? -21.916 7.014   44.567 1.00  0.00 ? 31  THR A CA   3  
ATOM   7716   C C    . THR A 1 31  ? -22.706 8.183   44.057 1.00  0.00 ? 31  THR A C    3  
ATOM   7717   O O    . THR A 1 31  ? -23.466 8.826   44.830 1.00  0.00 ? 31  THR A O    3  
ATOM   7718   H H    . THR A 1 31  ? -21.560 6.109   42.661 1.00  0.00 ? 31  THR A H    3  
ATOM   7719   N N    . GLY A 1 32  ? -22.552 8.507   42.805 1.00  0.00 ? 32  GLY A N    3  
ATOM   7720   C CA   . GLY A 1 32  ? -23.216 9.637   42.163 1.00  0.00 ? 32  GLY A CA   3  
ATOM   7721   C C    . GLY A 1 32  ? -22.359 10.889  42.239 1.00  0.00 ? 32  GLY A C    3  
ATOM   7722   O O    . GLY A 1 32  ? -22.683 11.943  41.683 1.00  0.00 ? 32  GLY A O    3  
ATOM   7723   H H    . GLY A 1 32  ? -21.933 7.972   42.266 1.00  0.00 ? 32  GLY A H    3  
ATOM   7724   N N    . ILE A 1 33  ? -21.253 10.726  42.978 1.00  0.00 ? 33  ILE A N    3  
ATOM   7725   C CA   . ILE A 1 33  ? -20.294 11.821  43.160 1.00  0.00 ? 33  ILE A CA   3  
ATOM   7726   C C    . ILE A 1 33  ? -19.358 11.828  41.934 1.00  0.00 ? 33  ILE A C    3  
ATOM   7727   O O    . ILE A 1 33  ? -18.732 10.801  41.662 1.00  0.00 ? 33  ILE A O    3  
ATOM   7728   H H    . ILE A 1 33  ? -21.078 9.858   43.398 1.00  0.00 ? 33  ILE A H    3  
ATOM   7729   N N    . LYS A 1 34  ? -19.348 12.971  41.299 1.00  0.00 ? 34  LYS A N    3  
ATOM   7730   C CA   . LYS A 1 34  ? -18.508 13.215  40.138 1.00  0.00 ? 34  LYS A CA   3  
ATOM   7731   C C    . LYS A 1 34  ? -17.085 13.536  40.599 1.00  0.00 ? 34  LYS A C    3  
ATOM   7732   O O    . LYS A 1 34  ? -16.910 14.344  41.538 1.00  0.00 ? 34  LYS A O    3  
ATOM   7733   H H    . LYS A 1 34  ? -19.910 13.700  41.635 1.00  0.00 ? 34  LYS A H    3  
ATOM   7734   N N    . VAL A 1 35  ? -16.121 12.927  39.948 1.00  0.00 ? 35  VAL A N    3  
ATOM   7735   C CA   . VAL A 1 35  ? -14.679 13.144  40.218 1.00  0.00 ? 35  VAL A CA   3  
ATOM   7736   C C    . VAL A 1 35  ? -14.171 13.961  39.031 1.00  0.00 ? 35  VAL A C    3  
ATOM   7737   O O    . VAL A 1 35  ? -14.693 13.751  37.934 1.00  0.00 ? 35  VAL A O    3  
ATOM   7738   H H    . VAL A 1 35  ? -16.368 12.316  39.222 1.00  0.00 ? 35  VAL A H    3  
ATOM   7739   N N    . THR A 1 36  ? -13.303 14.902  39.220 1.00  0.00 ? 36  THR A N    3  
ATOM   7740   C CA   . THR A 1 36  ? -12.728 15.751  38.197 1.00  0.00 ? 36  THR A CA   3  
ATOM   7741   C C    . THR A 1 36  ? -11.211 15.687  38.269 1.00  0.00 ? 36  THR A C    3  
ATOM   7742   O O    . THR A 1 36  ? -10.630 16.067  39.306 1.00  0.00 ? 36  THR A O    3  
ATOM   7743   H H    . THR A 1 36  ? -13.003 15.051  40.141 1.00  0.00 ? 36  THR A H    3  
ATOM   7744   N N    . VAL A 1 37  ? -10.620 15.219  37.191 1.00  0.00 ? 37  VAL A N    3  
ATOM   7745   C CA   . VAL A 1 37  ? -9.147  15.122  37.155 1.00  0.00 ? 37  VAL A CA   3  
ATOM   7746   C C    . VAL A 1 37  ? -8.645  16.241  36.249 1.00  0.00 ? 37  VAL A C    3  
ATOM   7747   O O    . VAL A 1 37  ? -9.170  16.490  35.172 1.00  0.00 ? 37  VAL A O    3  
ATOM   7748   H H    . VAL A 1 37  ? -11.153 14.942  36.416 1.00  0.00 ? 37  VAL A H    3  
ATOM   7749   N N    . GLU A 1 38  ? -7.633  16.906  36.741 1.00  0.00 ? 38  GLU A N    3  
ATOM   7750   C CA   . GLU A 1 38  ? -6.971  18.000  36.017 1.00  0.00 ? 38  GLU A CA   3  
ATOM   7751   C C    . GLU A 1 38  ? -5.466  17.862  36.240 1.00  0.00 ? 38  GLU A C    3  
ATOM   7752   O O    . GLU A 1 38  ? -5.055  17.206  37.196 1.00  0.00 ? 38  GLU A O    3  
ATOM   7753   H H    . GLU A 1 38  ? -7.286  16.649  37.621 1.00  0.00 ? 38  GLU A H    3  
ATOM   7754   N N    . HIS A 1 39  ? -4.741  18.458  35.326 1.00  0.00 ? 39  HIS A N    3  
ATOM   7755   C CA   . HIS A 1 39  ? -3.265  18.417  35.374 1.00  0.00 ? 39  HIS A CA   3  
ATOM   7756   C C    . HIS A 1 39  ? -2.706  19.784  34.997 1.00  0.00 ? 39  HIS A C    3  
ATOM   7757   O O    . HIS A 1 39  ? -2.105  19.936  33.913 1.00  0.00 ? 39  HIS A O    3  
ATOM   7758   H H    . HIS A 1 39  ? -5.185  18.932  34.592 1.00  0.00 ? 39  HIS A H    3  
ATOM   7759   N N    . PRO A 1 40  ? -2.905  20.761  35.875 1.00  0.00 ? 40  PRO A N    3  
ATOM   7760   C CA   . PRO A 1 40  ? -2.449  22.134  35.641 1.00  0.00 ? 40  PRO A CA   3  
ATOM   7761   C C    . PRO A 1 40  ? -0.939  22.221  35.643 1.00  0.00 ? 40  PRO A C    3  
ATOM   7762   O O    . PRO A 1 40  ? -0.232  21.409  36.230 1.00  0.00 ? 40  PRO A O    3  
ATOM   7763   N N    . CYS A 1 41  ? -0.475  23.259  34.950 1.00  0.00 ? 41  CYS A N    3  
ATOM   7764   C CA   . CYS A 1 41  ? 0.937   23.605  34.814 1.00  0.00 ? 41  CYS A CA   3  
ATOM   7765   C C    . CYS A 1 41  ? 1.533   23.979  36.151 1.00  0.00 ? 41  CYS A C    3  
ATOM   7766   O O    . CYS A 1 41  ? 0.873   24.800  36.833 1.00  0.00 ? 41  CYS A O    3  
ATOM   7767   C CB   . CYS A 1 41  ? 1.066   24.735  33.774 1.00  0.00 ? 41  CYS A CB   3  
ATOM   7768   S SG   A CYS A 1 41  ? -0.110  26.061  34.121 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7769   S SG   B CYS A 1 41  ? 2.465   24.434  32.672 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7770   S SG   C CYS A 1 41  ? 2.751   25.389  33.745 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7771   S SG   D CYS A 1 41  ? 2.685   24.685  32.972 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7772   S SG   E CYS A 1 41  ? 2.700   24.711  33.002 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7773   S SG   F CYS A 1 41  ? 2.769   25.333  33.686 0.16  0.00 ? 41  CYS A SG   3  
ATOM   7774   S SG   U CYS A 1 41  ? 0.093   26.174  34.269 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7775   S SG   V CYS A 1 41  ? 2.587   25.673  34.034 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7776   S SG   W CYS A 1 41  ? 2.533   24.494  32.746 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7777   S SG   X CYS A 1 41  ? 2.380   24.367  32.589 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7778   S SG   Y CYS A 1 41  ? 2.658   24.643  32.923 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7779   S SG   Z CYS A 1 41  ? 1.540   24.070  32.161 0.010 0.00 ? 41  CYS A SG   3  
ATOM   7780   H H    . CYS A 1 41  ? -1.148  23.856  34.490 1.00  0.00 ? 41  CYS A H    3  
ATOM   7781   N N    . LYS A 1 42  ? 2.697   23.477  36.464 1.00  0.00 ? 42  LYS A N    3  
ATOM   7782   C CA   . LYS A 1 42  ? 3.405   23.767  37.726 1.00  0.00 ? 42  LYS A CA   3  
ATOM   7783   C C    . LYS A 1 42  ? 2.412   23.691  38.892 1.00  0.00 ? 42  LYS A C    3  
ATOM   7784   O O    . LYS A 1 42  ? 2.393   24.619  39.704 1.00  0.00 ? 42  LYS A O    3  
ATOM   7785   H H    . LYS A 1 42  ? 3.122   22.877  35.816 1.00  0.00 ? 42  LYS A H    3  
ATOM   7786   N N    . LEU A 1 43  ? 1.630   22.626  38.925 1.00  0.00 ? 43  LEU A N    3  
ATOM   7787   C CA   . LEU A 1 43  ? 0.588   22.482  39.958 1.00  0.00 ? 43  LEU A CA   3  
ATOM   7788   C C    . LEU A 1 43  ? 1.187   22.430  41.355 1.00  0.00 ? 43  LEU A C    3  
ATOM   7789   O O    . LEU A 1 43  ? 0.477   22.767  42.337 1.00  0.00 ? 43  LEU A O    3  
ATOM   7790   H H    . LEU A 1 43  ? 1.712   21.946  38.225 1.00  0.00 ? 43  LEU A H    3  
ATOM   7791   N N    . GLU A 1 44  ? 2.438   22.006  41.459 1.00  0.00 ? 44  GLU A N    3  
ATOM   7792   C CA   . GLU A 1 44  ? 3.096   21.891  42.775 1.00  0.00 ? 44  GLU A CA   3  
ATOM   7793   C C    . GLU A 1 44  ? 3.489   23.281  43.292 1.00  0.00 ? 44  GLU A C    3  
ATOM   7794   O O    . GLU A 1 44  ? 3.788   23.464  44.470 1.00  0.00 ? 44  GLU A O    3  
ATOM   7795   H H    . GLU A 1 44  ? 2.926   21.745  40.650 1.00  0.00 ? 44  GLU A H    3  
ATOM   7796   N N    . GLU A 1 45  ? 3.466   24.244  42.398 1.00  0.00 ? 45  GLU A N    3  
ATOM   7797   C CA   . GLU A 1 45  ? 3.761   25.646  42.714 1.00  0.00 ? 45  GLU A CA   3  
ATOM   7798   C C    . GLU A 1 45  ? 2.436   26.350  43.014 1.00  0.00 ? 45  GLU A C    3  
ATOM   7799   O O    . GLU A 1 45  ? 2.342   27.161  43.934 1.00  0.00 ? 45  GLU A O    3  
ATOM   7800   H H    . GLU A 1 45  ? 3.205   24.020  41.480 1.00  0.00 ? 45  GLU A H    3  
ATOM   7801   N N    . LYS A 1 46  ? 1.457   25.997  42.206 1.00  0.00 ? 46  LYS A N    3  
ATOM   7802   C CA   . LYS A 1 46  ? 0.125   26.530  42.320 1.00  0.00 ? 46  LYS A CA   3  
ATOM   7803   C C    . LYS A 1 46  ? -0.585  26.038  43.568 1.00  0.00 ? 46  LYS A C    3  
ATOM   7804   O O    . LYS A 1 46  ? -1.383  26.828  44.103 1.00  0.00 ? 46  LYS A O    3  
ATOM   7805   H H    . LYS A 1 46  ? 1.641   25.340  41.502 1.00  0.00 ? 46  LYS A H    3  
ATOM   7806   N N    . PHE A 1 47  ? -0.367  24.812  43.980 1.00  0.00 ? 47  PHE A N    3  
ATOM   7807   C CA   . PHE A 1 47  ? -1.017  24.240  45.140 1.00  0.00 ? 47  PHE A CA   3  
ATOM   7808   C C    . PHE A 1 47  ? -0.884  25.155  46.373 1.00  0.00 ? 47  PHE A C    3  
ATOM   7809   O O    . PHE A 1 47  ? -1.882  25.552  46.977 1.00  0.00 ? 47  PHE A O    3  
ATOM   7810   H H    . PHE A 1 47  ? 0.251   24.250  43.467 1.00  0.00 ? 47  PHE A H    3  
ATOM   7811   N N    . PRO A 1 48  ? 0.340   25.403  46.790 1.00  0.00 ? 48  PRO A N    3  
ATOM   7812   C CA   . PRO A 1 48  ? 0.583   26.209  47.993 1.00  0.00 ? 48  PRO A CA   3  
ATOM   7813   C C    . PRO A 1 48  ? -0.133  27.532  47.978 1.00  0.00 ? 48  PRO A C    3  
ATOM   7814   O O    . PRO A 1 48  ? -0.637  27.980  49.044 1.00  0.00 ? 48  PRO A O    3  
ATOM   7815   N N    . GLN A 1 49  ? -0.291  28.164  46.852 1.00  0.00 ? 49  GLN A N    3  
ATOM   7816   C CA   . GLN A 1 49  ? -0.952  29.429  46.655 1.00  0.00 ? 49  GLN A CA   3  
ATOM   7817   C C    . GLN A 1 49  ? -2.465  29.342  46.867 1.00  0.00 ? 49  GLN A C    3  
ATOM   7818   O O    . GLN A 1 49  ? -2.996  30.166  47.633 1.00  0.00 ? 49  GLN A O    3  
ATOM   7819   H H    . GLN A 1 49  ? 0.075   27.732  46.052 1.00  0.00 ? 49  GLN A H    3  
ATOM   7820   N N    . VAL A 1 50  ? -3.124  28.474  46.145 1.00  0.00 ? 50  VAL A N    3  
ATOM   7821   C CA   . VAL A 1 50  ? -4.569  28.321  46.243 1.00  0.00 ? 50  VAL A CA   3  
ATOM   7822   C C    . VAL A 1 50  ? -4.988  27.675  47.540 1.00  0.00 ? 50  VAL A C    3  
ATOM   7823   O O    . VAL A 1 50  ? -6.085  28.043  48.012 1.00  0.00 ? 50  VAL A O    3  
ATOM   7824   H H    . VAL A 1 50  ? -2.632  27.920  45.504 1.00  0.00 ? 50  VAL A H    3  
ATOM   7825   N N    . ALA A 1 51  ? -4.250  26.743  48.091 1.00  0.00 ? 51  ALA A N    3  
ATOM   7826   C CA   . ALA A 1 51  ? -4.600  26.055  49.321 1.00  0.00 ? 51  ALA A CA   3  
ATOM   7827   C C    . ALA A 1 51  ? -4.510  27.033  50.515 1.00  0.00 ? 51  ALA A C    3  
ATOM   7828   O O    . ALA A 1 51  ? -5.339  26.897  51.428 1.00  0.00 ? 51  ALA A O    3  
ATOM   7829   H H    . ALA A 1 51  ? -3.422  26.482  47.636 1.00  0.00 ? 51  ALA A H    3  
ATOM   7830   N N    . ALA A 1 52  ? -3.521  27.930  50.470 1.00  0.00 ? 52  ALA A N    3  
ATOM   7831   C CA   . ALA A 1 52  ? -3.332  28.932  51.520 1.00  0.00 ? 52  ALA A CA   3  
ATOM   7832   C C    . ALA A 1 52  ? -4.578  29.819  51.661 1.00  0.00 ? 52  ALA A C    3  
ATOM   7833   O O    . ALA A 1 52  ? -4.826  30.428  52.714 1.00  0.00 ? 52  ALA A O    3  
ATOM   7834   H H    . ALA A 1 52  ? -2.913  27.928  49.701 1.00  0.00 ? 52  ALA A H    3  
ATOM   7835   N N    . THR A 1 53  ? -5.403  29.893  50.627 1.00  0.00 ? 53  THR A N    3  
ATOM   7836   C CA   . THR A 1 53  ? -6.623  30.672  50.627 1.00  0.00 ? 53  THR A CA   3  
ATOM   7837   C C    . THR A 1 53  ? -7.893  29.812  50.693 1.00  0.00 ? 53  THR A C    3  
ATOM   7838   O O    . THR A 1 53  ? -8.979  30.323  50.390 1.00  0.00 ? 53  THR A O    3  
ATOM   7839   H H    . THR A 1 53  ? -5.182  29.381  49.821 1.00  0.00 ? 53  THR A H    3  
ATOM   7840   N N    . GLY A 1 54  ? -7.747  28.565  51.077 1.00  0.00 ? 54  GLY A N    3  
ATOM   7841   C CA   . GLY A 1 54  ? -8.789  27.570  51.196 1.00  0.00 ? 54  GLY A CA   3  
ATOM   7842   C C    . GLY A 1 54  ? -9.410  27.192  49.862 1.00  0.00 ? 54  GLY A C    3  
ATOM   7843   O O    . GLY A 1 54  ? -10.615 26.896  49.731 1.00  0.00 ? 54  GLY A O    3  
ATOM   7844   H H    . GLY A 1 54  ? -6.837  28.276  51.294 1.00  0.00 ? 54  GLY A H    3  
ATOM   7845   N N    . ASP A 1 55  ? -8.605  27.199  48.821 1.00  0.00 ? 55  ASP A N    3  
ATOM   7846   C CA   . ASP A 1 55  ? -9.009  26.823  47.468 1.00  0.00 ? 55  ASP A CA   3  
ATOM   7847   C C    . ASP A 1 55  ? -8.147  25.604  47.059 1.00  0.00 ? 55  ASP A C    3  
ATOM   7848   O O    . ASP A 1 55  ? -7.446  25.018  47.892 1.00  0.00 ? 55  ASP A O    3  
ATOM   7849   H H    . ASP A 1 55  ? -7.668  27.445  48.968 1.00  0.00 ? 55  ASP A H    3  
ATOM   7850   N N    . GLY A 1 56  ? -8.250  25.277  45.788 1.00  0.00 ? 56  GLY A N    3  
ATOM   7851   C CA   . GLY A 1 56  ? -7.507  24.162  45.182 1.00  0.00 ? 56  GLY A CA   3  
ATOM   7852   C C    . GLY A 1 56  ? -8.349  22.882  45.094 1.00  0.00 ? 56  GLY A C    3  
ATOM   7853   O O    . GLY A 1 56  ? -9.586  22.928  45.258 1.00  0.00 ? 56  GLY A O    3  
ATOM   7854   H H    . GLY A 1 56  ? -8.842  25.808  45.216 1.00  0.00 ? 56  GLY A H    3  
ATOM   7855   N N    . PRO A 1 57  ? -7.654  21.783  44.805 1.00  0.00 ? 57  PRO A N    3  
ATOM   7856   C CA   . PRO A 1 57  ? -8.285  20.471  44.655 1.00  0.00 ? 57  PRO A CA   3  
ATOM   7857   C C    . PRO A 1 57  ? -8.430  19.819  46.002 1.00  0.00 ? 57  PRO A C    3  
ATOM   7858   O O    . PRO A 1 57  ? -7.719  20.203  46.944 1.00  0.00 ? 57  PRO A O    3  
ATOM   7859   N N    . ASP A 1 58  ? -9.279  18.832  46.094 1.00  0.00 ? 58  ASP A N    3  
ATOM   7860   C CA   . ASP A 1 58  ? -9.519  18.026  47.268 1.00  0.00 ? 58  ASP A CA   3  
ATOM   7861   C C    . ASP A 1 58  ? -8.310  17.144  47.546 1.00  0.00 ? 58  ASP A C    3  
ATOM   7862   O O    . ASP A 1 58  ? -7.885  16.865  48.675 1.00  0.00 ? 58  ASP A O    3  
ATOM   7863   H H    . ASP A 1 58  ? -9.765  18.586  45.280 1.00  0.00 ? 58  ASP A H    3  
ATOM   7864   N N    . ILE A 1 59  ? -7.778  16.705  46.380 1.00  0.00 ? 59  ILE A N    3  
ATOM   7865   C CA   . ILE A 1 59  ? -6.606  15.808  46.434 1.00  0.00 ? 59  ILE A CA   3  
ATOM   7866   C C    . ILE A 1 59  ? -5.561  16.162  45.409 1.00  0.00 ? 59  ILE A C    3  
ATOM   7867   O O    . ILE A 1 59  ? -5.836  16.569  44.297 1.00  0.00 ? 59  ILE A O    3  
ATOM   7868   H H    . ILE A 1 59  ? -8.173  16.962  45.521 1.00  0.00 ? 59  ILE A H    3  
ATOM   7869   N N    . ILE A 1 60  ? -4.323  16.025  45.844 1.00  0.00 ? 60  ILE A N    3  
ATOM   7870   C CA   . ILE A 1 60  ? -3.138  16.349  45.042 1.00  0.00 ? 60  ILE A CA   3  
ATOM   7871   C C    . ILE A 1 60  ? -2.187  15.165  45.002 1.00  0.00 ? 60  ILE A C    3  
ATOM   7872   O O    . ILE A 1 60  ? -1.924  14.551  46.026 1.00  0.00 ? 60  ILE A O    3  
ATOM   7873   H H    . ILE A 1 60  ? -4.188  15.715  46.764 1.00  0.00 ? 60  ILE A H    3  
ATOM   7874   N N    . PHE A 1 61  ? -1.617  14.925  43.823 1.00  0.00 ? 61  PHE A N    3  
ATOM   7875   C CA   . PHE A 1 61  ? -0.644  13.816  43.671 1.00  0.00 ? 61  PHE A CA   3  
ATOM   7876   C C    . PHE A 1 61  ? 0.733   14.459  43.395 1.00  0.00 ? 61  PHE A C    3  
ATOM   7877   O O    . PHE A 1 61  ? 0.750   15.295  42.506 1.00  0.00 ? 61  PHE A O    3  
ATOM   7878   H H    . PHE A 1 61  ? -1.824  15.499  43.056 1.00  0.00 ? 61  PHE A H    3  
ATOM   7879   N N    . TRP A 1 62  ? 1.715   14.094  44.108 1.00  0.00 ? 62  TRP A N    3  
ATOM   7880   C CA   . TRP A 1 62  ? 3.111   14.587  43.882 1.00  0.00 ? 62  TRP A CA   3  
ATOM   7881   C C    . TRP A 1 62  ? 4.036   13.702  44.637 1.00  0.00 ? 62  TRP A C    3  
ATOM   7882   O O    . TRP A 1 62  ? 3.670   12.938  45.549 1.00  0.00 ? 62  TRP A O    3  
ATOM   7883   H H    . TRP A 1 62  ? 1.563   13.422  44.806 1.00  0.00 ? 62  TRP A H    3  
ATOM   7884   N N    . ALA A 1 63  ? 5.328   13.772  44.282 1.00  0.00 ? 63  ALA A N    3  
ATOM   7885   C CA   . ALA A 1 63  ? 6.367   13.049  45.003 1.00  0.00 ? 63  ALA A CA   3  
ATOM   7886   C C    . ALA A 1 63  ? 6.266   13.521  46.477 1.00  0.00 ? 63  ALA A C    3  
ATOM   7887   O O    . ALA A 1 63  ? 6.055   14.722  46.714 1.00  0.00 ? 63  ALA A O    3  
ATOM   7888   H H    . ALA A 1 63  ? 5.589   14.384  43.563 1.00  0.00 ? 63  ALA A H    3  
ATOM   7889   N N    . HIS A 1 64  ? 6.514   12.642  47.398 1.00  0.00 ? 64  HIS A N    3  
ATOM   7890   C CA   . HIS A 1 64  ? 6.430   12.852  48.824 1.00  0.00 ? 64  HIS A CA   3  
ATOM   7891   C C    . HIS A 1 64  ? 7.278   13.991  49.392 1.00  0.00 ? 64  HIS A C    3  
ATOM   7892   O O    . HIS A 1 64  ? 6.896   14.594  50.418 1.00  0.00 ? 64  HIS A O    3  
ATOM   7893   H H    . HIS A 1 64  ? 6.750   11.740  47.097 1.00  0.00 ? 64  HIS A H    3  
ATOM   7894   N N    . ASP A 1 65  ? 8.442   14.212  48.800 1.00  0.00 ? 65  ASP A N    3  
ATOM   7895   C CA   . ASP A 1 65  ? 9.394   15.195  49.333 1.00  0.00 ? 65  ASP A CA   3  
ATOM   7896   C C    . ASP A 1 65  ? 8.800   16.588  49.431 1.00  0.00 ? 65  ASP A C    3  
ATOM   7897   O O    . ASP A 1 65  ? 9.086   17.351  50.368 1.00  0.00 ? 65  ASP A O    3  
ATOM   7898   H H    . ASP A 1 65  ? 8.706   13.653  48.040 1.00  0.00 ? 65  ASP A H    3  
ATOM   7899   N N    . ARG A 1 66  ? 7.958   16.977  48.537 1.00  0.00 ? 66  ARG A N    3  
ATOM   7900   C CA   . ARG A 1 66  ? 7.302   18.247  48.468 1.00  0.00 ? 66  ARG A CA   3  
ATOM   7901   C C    . ARG A 1 66  ? 6.227   18.405  49.548 1.00  0.00 ? 66  ARG A C    3  
ATOM   7902   O O    . ARG A 1 66  ? 5.935   19.567  49.832 1.00  0.00 ? 66  ARG A O    3  
ATOM   7903   H H    . ARG A 1 66  ? 7.745   16.335  47.828 1.00  0.00 ? 66  ARG A H    3  
ATOM   7904   N N    . PHE A 1 67  ? 5.702   17.320  50.057 1.00  0.00 ? 67  PHE A N    3  
ATOM   7905   C CA   . PHE A 1 67  ? 4.624   17.243  51.032 1.00  0.00 ? 67  PHE A CA   3  
ATOM   7906   C C    . PHE A 1 67  ? 5.040   17.781  52.393 1.00  0.00 ? 67  PHE A C    3  
ATOM   7907   O O    . PHE A 1 67  ? 4.176   18.254  53.134 1.00  0.00 ? 67  PHE A O    3  
ATOM   7908   H H    . PHE A 1 67  ? 6.039   16.468  49.710 1.00  0.00 ? 67  PHE A H    3  
ATOM   7909   N N    . GLY A 1 68  ? 6.318   17.714  52.667 1.00  0.00 ? 68  GLY A N    3  
ATOM   7910   C CA   . GLY A 1 68  ? 6.886   18.214  53.934 1.00  0.00 ? 68  GLY A CA   3  
ATOM   7911   C C    . GLY A 1 68  ? 6.626   19.724  54.110 1.00  0.00 ? 68  GLY A C    3  
ATOM   7912   O O    . GLY A 1 68  ? 6.197   20.138  55.203 1.00  0.00 ? 68  GLY A O    3  
ATOM   7913   H H    . GLY A 1 68  ? 6.923   17.331  51.999 1.00  0.00 ? 68  GLY A H    3  
ATOM   7914   N N    . GLY A 1 69  ? 6.888   20.497  53.105 1.00  0.00 ? 69  GLY A N    3  
ATOM   7915   C CA   . GLY A 1 69  ? 6.703   21.932  53.038 1.00  0.00 ? 69  GLY A CA   3  
ATOM   7916   C C    . GLY A 1 69  ? 5.233   22.297  53.078 1.00  0.00 ? 69  GLY A C    3  
ATOM   7917   O O    . GLY A 1 69  ? 4.826   23.271  53.692 1.00  0.00 ? 69  GLY A O    3  
ATOM   7918   H H    . GLY A 1 69  ? 7.236   20.063  52.299 1.00  0.00 ? 69  GLY A H    3  
ATOM   7919   N N    . TYR A 1 70  ? 4.398   21.511  52.399 1.00  0.00 ? 70  TYR A N    3  
ATOM   7920   C CA   . TYR A 1 70  ? 2.943   21.677  52.372 1.00  0.00 ? 70  TYR A CA   3  
ATOM   7921   C C    . TYR A 1 70  ? 2.339   21.452  53.785 1.00  0.00 ? 70  TYR A C    3  
ATOM   7922   O O    . TYR A 1 70  ? 1.476   22.229  54.230 1.00  0.00 ? 70  TYR A O    3  
ATOM   7923   H H    . TYR A 1 70  ? 4.780   20.749  51.915 1.00  0.00 ? 70  TYR A H    3  
ATOM   7924   N N    . ALA A 1 71  ? 2.719   20.401  54.453 1.00  0.00 ? 71  ALA A N    3  
ATOM   7925   C CA   . ALA A 1 71  ? 2.339   19.970  55.762 1.00  0.00 ? 71  ALA A CA   3  
ATOM   7926   C C    . ALA A 1 71  ? 2.748   21.028  56.826 1.00  0.00 ? 71  ALA A C    3  
ATOM   7927   O O    . ALA A 1 71  ? 2.025   21.267  57.798 1.00  0.00 ? 71  ALA A O    3  
ATOM   7928   H H    . ALA A 1 71  ? 3.369   19.827  53.996 1.00  0.00 ? 71  ALA A H    3  
ATOM   7929   N N    . GLN A 1 72  ? 3.913   21.572  56.609 1.00  0.00 ? 72  GLN A N    3  
ATOM   7930   C CA   . GLN A 1 72  ? 4.502   22.585  57.493 1.00  0.00 ? 72  GLN A CA   3  
ATOM   7931   C C    . GLN A 1 72  ? 3.503   23.747  57.555 1.00  0.00 ? 72  GLN A C    3  
ATOM   7932   O O    . GLN A 1 72  ? 3.267   24.149  58.688 1.00  0.00 ? 72  GLN A O    3  
ATOM   7933   H H    . GLN A 1 72  ? 4.423   21.285  55.823 1.00  0.00 ? 72  GLN A H    3  
ATOM   7934   N N    . SER A 1 73  ? 3.008   24.206  56.438 1.00  0.00 ? 73  SER A N    3  
ATOM   7935   C CA   . SER A 1 73  ? 2.052   25.278  56.346 1.00  0.00 ? 73  SER A CA   3  
ATOM   7936   C C    . SER A 1 73  ? 0.601   24.900  56.603 1.00  0.00 ? 73  SER A C    3  
ATOM   7937   O O    . SER A 1 73  ? -0.263  25.746  56.296 1.00  0.00 ? 73  SER A O    3  
ATOM   7938   H H    . SER A 1 73  ? 3.300   23.784  55.604 1.00  0.00 ? 73  SER A H    3  
ATOM   7939   N N    . GLY A 1 74  ? 0.366   23.692  57.033 1.00  0.00 ? 74  GLY A N    3  
ATOM   7940   C CA   . GLY A 1 74  ? -0.890  23.087  57.382 1.00  0.00 ? 74  GLY A CA   3  
ATOM   7941   C C    . GLY A 1 74  ? -1.859  22.924  56.228 1.00  0.00 ? 74  GLY A C    3  
ATOM   7942   O O    . GLY A 1 74  ? -3.074  23.007  56.421 1.00  0.00 ? 74  GLY A O    3  
ATOM   7943   H H    . GLY A 1 74  ? 1.156   23.125  57.154 1.00  0.00 ? 74  GLY A H    3  
ATOM   7944   N N    . LEU A 1 75  ? -1.314  22.645  55.054 1.00  0.00 ? 75  LEU A N    3  
ATOM   7945   C CA   . LEU A 1 75  ? -2.121  22.503  53.845 1.00  0.00 ? 75  LEU A CA   3  
ATOM   7946   C C    . LEU A 1 75  ? -2.714  21.111  53.645 1.00  0.00 ? 75  LEU A C    3  
ATOM   7947   O O    . LEU A 1 75  ? -3.631  20.978  52.825 1.00  0.00 ? 75  LEU A O    3  
ATOM   7948   H H    . LEU A 1 75  ? -0.340  22.559  54.989 1.00  0.00 ? 75  LEU A H    3  
ATOM   7949   N N    . LEU A 1 76  ? -2.263  20.130  54.347 1.00  0.00 ? 76  LEU A N    3  
ATOM   7950   C CA   . LEU A 1 76  ? -2.702  18.763  54.252 1.00  0.00 ? 76  LEU A CA   3  
ATOM   7951   C C    . LEU A 1 76  ? -3.419  18.224  55.488 1.00  0.00 ? 76  LEU A C    3  
ATOM   7952   O O    . LEU A 1 76  ? -2.936  18.389  56.628 1.00  0.00 ? 76  LEU A O    3  
ATOM   7953   H H    . LEU A 1 76  ? -1.548  20.328  54.988 1.00  0.00 ? 76  LEU A H    3  
ATOM   7954   N N    . ALA A 1 77  ? -4.491  17.484  55.205 1.00  0.00 ? 77  ALA A N    3  
ATOM   7955   C CA   . ALA A 1 77  ? -5.236  16.815  56.260 1.00  0.00 ? 77  ALA A CA   3  
ATOM   7956   C C    . ALA A 1 77  ? -4.446  15.589  56.695 1.00  0.00 ? 77  ALA A C    3  
ATOM   7957   O O    . ALA A 1 77  ? -3.725  14.910  55.924 1.00  0.00 ? 77  ALA A O    3  
ATOM   7958   H H    . ALA A 1 77  ? -4.743  17.337  54.270 1.00  0.00 ? 77  ALA A H    3  
ATOM   7959   N N    . GLU A 1 78  ? -4.579  15.346  57.988 1.00  0.00 ? 78  GLU A N    3  
ATOM   7960   C CA   . GLU A 1 78  ? -3.971  14.190  58.628 1.00  0.00 ? 78  GLU A CA   3  
ATOM   7961   C C    . GLU A 1 78  ? -4.844  13.002  58.166 1.00  0.00 ? 78  GLU A C    3  
ATOM   7962   O O    . GLU A 1 78  ? -6.066  13.171  58.027 1.00  0.00 ? 78  GLU A O    3  
ATOM   7963   H H    . GLU A 1 78  ? -5.142  15.941  58.525 1.00  0.00 ? 78  GLU A H    3  
ATOM   7964   N N    . ILE A 1 79  ? -4.186  11.911  57.874 1.00  0.00 ? 79  ILE A N    3  
ATOM   7965   C CA   . ILE A 1 79  ? -4.911  10.704  57.402 1.00  0.00 ? 79  ILE A CA   3  
ATOM   7966   C C    . ILE A 1 79  ? -4.855  9.648   58.468 1.00  0.00 ? 79  ILE A C    3  
ATOM   7967   O O    . ILE A 1 79  ? -3.956  9.516   59.281 1.00  0.00 ? 79  ILE A O    3  
ATOM   7968   H H    . ILE A 1 79  ? -3.210  11.893  57.957 1.00  0.00 ? 79  ILE A H    3  
ATOM   7969   N N    . THR A 1 80  ? -5.909  8.818   58.430 1.00  0.00 ? 80  THR A N    3  
ATOM   7970   C CA   . THR A 1 80  ? -5.962  7.735   59.414 1.00  0.00 ? 80  THR A CA   3  
ATOM   7971   C C    . THR A 1 80  ? -6.435  6.408   58.883 1.00  0.00 ? 80  THR A C    3  
ATOM   7972   O O    . THR A 1 80  ? -7.521  5.942   59.279 1.00  0.00 ? 80  THR A O    3  
ATOM   7973   H H    . THR A 1 80  ? -6.615  8.928   57.760 1.00  0.00 ? 80  THR A H    3  
ATOM   7974   N N    . PRO A 1 81  ? -5.613  5.804   58.038 1.00  0.00 ? 81  PRO A N    3  
ATOM   7975   C CA   . PRO A 1 81  ? -5.957  4.471   57.518 1.00  0.00 ? 81  PRO A CA   3  
ATOM   7976   C C    . PRO A 1 81  ? -5.850  3.575   58.737 1.00  0.00 ? 81  PRO A C    3  
ATOM   7977   O O    . PRO A 1 81  ? -4.960  3.843   59.582 1.00  0.00 ? 81  PRO A O    3  
ATOM   7978   N N    . ASP A 1 82  ? -6.644  2.541   58.830 1.00  0.00 ? 82  ASP A N    3  
ATOM   7979   C CA   . ASP A 1 82  ? -6.507  1.630   60.008 1.00  0.00 ? 82  ASP A CA   3  
ATOM   7980   C C    . ASP A 1 82  ? -5.395  0.624   59.690 1.00  0.00 ? 82  ASP A C    3  
ATOM   7981   O O    . ASP A 1 82  ? -4.920  0.528   58.540 1.00  0.00 ? 82  ASP A O    3  
ATOM   7982   H H    . ASP A 1 82  ? -7.296  2.349   58.124 1.00  0.00 ? 82  ASP A H    3  
ATOM   7983   N N    . LYS A 1 83  ? -4.995  -0.070  60.725 1.00  0.00 ? 83  LYS A N    3  
ATOM   7984   C CA   . LYS A 1 83  ? -3.918  -1.062  60.713 1.00  0.00 ? 83  LYS A CA   3  
ATOM   7985   C C    . LYS A 1 83  ? -3.953  -1.972  59.500 1.00  0.00 ? 83  LYS A C    3  
ATOM   7986   O O    . LYS A 1 83  ? -2.941  -2.235  58.851 1.00  0.00 ? 83  LYS A O    3  
ATOM   7987   H H    . LYS A 1 83  ? -5.431  0.111   61.583 1.00  0.00 ? 83  LYS A H    3  
ATOM   7988   N N    . ALA A 1 84  ? -5.132  -2.442  59.243 1.00  0.00 ? 84  ALA A N    3  
ATOM   7989   C CA   . ALA A 1 84  ? -5.494  -3.366  58.184 1.00  0.00 ? 84  ALA A CA   3  
ATOM   7990   C C    . ALA A 1 84  ? -5.217  -2.809  56.797 1.00  0.00 ? 84  ALA A C    3  
ATOM   7991   O O    . ALA A 1 84  ? -4.777  -3.567  55.927 1.00  0.00 ? 84  ALA A O    3  
ATOM   7992   H H    . ALA A 1 84  ? -5.853  -2.164  59.845 1.00  0.00 ? 84  ALA A H    3  
ATOM   7993   N N    . PHE A 1 85  ? -5.539  -1.531  56.626 1.00  0.00 ? 85  PHE A N    3  
ATOM   7994   C CA   . PHE A 1 85  ? -5.300  -0.898  55.338 1.00  0.00 ? 85  PHE A CA   3  
ATOM   7995   C C    . PHE A 1 85  ? -3.766  -0.718  55.216 1.00  0.00 ? 85  PHE A C    3  
ATOM   7996   O O    . PHE A 1 85  ? -3.206  -0.898  54.155 1.00  0.00 ? 85  PHE A O    3  
ATOM   7997   H H    . PHE A 1 85  ? -5.926  -1.016  57.365 1.00  0.00 ? 85  PHE A H    3  
ATOM   7998   N N    . GLN A 1 86  ? -3.158  -0.381  56.311 1.00  0.00 ? 86  GLN A N    3  
ATOM   7999   C CA   . GLN A 1 86  ? -1.736  -0.105  56.378 1.00  0.00 ? 86  GLN A CA   3  
ATOM   8000   C C    . GLN A 1 86  ? -0.880  -1.289  55.981 1.00  0.00 ? 86  GLN A C    3  
ATOM   8001   O O    . GLN A 1 86  ? 0.223   -1.106  55.426 1.00  0.00 ? 86  GLN A O    3  
ATOM   8002   H H    . GLN A 1 86  ? -3.693  -0.266  57.124 1.00  0.00 ? 86  GLN A H    3  
ATOM   8003   N N    . ASP A 1 87  ? -1.359  -2.460  56.316 1.00  0.00 ? 87  ASP A N    3  
ATOM   8004   C CA   . ASP A 1 87  ? -0.649  -3.724  56.040 1.00  0.00 ? 87  ASP A CA   3  
ATOM   8005   C C    . ASP A 1 87  ? -0.730  -4.122  54.579 1.00  0.00 ? 87  ASP A C    3  
ATOM   8006   O O    . ASP A 1 87  ? 0.006   -5.033  54.156 1.00  0.00 ? 87  ASP A O    3  
ATOM   8007   H H    . ASP A 1 87  ? -2.217  -2.498  56.788 1.00  0.00 ? 87  ASP A H    3  
ATOM   8008   N N    . LYS A 1 88  ? -1.528  -3.471  53.787 1.00  0.00 ? 88  LYS A N    3  
ATOM   8009   C CA   . LYS A 1 88  ? -1.674  -3.720  52.359 1.00  0.00 ? 88  LYS A CA   3  
ATOM   8010   C C    . LYS A 1 88  ? -0.520  -3.119  51.532 1.00  0.00 ? 88  LYS A C    3  
ATOM   8011   O O    . LYS A 1 88  ? -0.377  -3.482  50.371 1.00  0.00 ? 88  LYS A O    3  
ATOM   8012   H H    . LYS A 1 88  ? -2.054  -2.739  54.175 1.00  0.00 ? 88  LYS A H    3  
ATOM   8013   N N    . LEU A 1 89  ? 0.234   -2.213  52.091 1.00  0.00 ? 89  LEU A N    3  
ATOM   8014   C CA   . LEU A 1 89  ? 1.351   -1.527  51.476 1.00  0.00 ? 89  LEU A CA   3  
ATOM   8015   C C    . LEU A 1 89  ? 2.666   -1.866  52.182 1.00  0.00 ? 89  LEU A C    3  
ATOM   8016   O O    . LEU A 1 89  ? 2.712   -2.272  53.342 1.00  0.00 ? 89  LEU A O    3  
ATOM   8017   H H    . LEU A 1 89  ? 0.018   -1.967  53.014 1.00  0.00 ? 89  LEU A H    3  
ATOM   8018   N N    . TYR A 1 90  ? 3.754   -1.711  51.412 1.00  0.00 ? 90  TYR A N    3  
ATOM   8019   C CA   . TYR A 1 90  ? 5.116   -1.954  51.947 1.00  0.00 ? 90  TYR A CA   3  
ATOM   8020   C C    . TYR A 1 90  ? 5.327   -0.969  53.091 1.00  0.00 ? 90  TYR A C    3  
ATOM   8021   O O    . TYR A 1 90  ? 5.068   0.239   52.893 1.00  0.00 ? 90  TYR A O    3  
ATOM   8022   H H    . TYR A 1 90  ? 3.649   -1.404  50.487 1.00  0.00 ? 90  TYR A H    3  
ATOM   8023   N N    . PRO A 1 91  ? 5.756   -1.487  54.222 1.00  0.00 ? 91  PRO A N    3  
ATOM   8024   C CA   . PRO A 1 91  ? 5.959   -0.685  55.435 1.00  0.00 ? 91  PRO A CA   3  
ATOM   8025   C C    . PRO A 1 91  ? 6.783   0.575   55.251 1.00  0.00 ? 91  PRO A C    3  
ATOM   8026   O O    . PRO A 1 91  ? 6.424   1.685   55.699 1.00  0.00 ? 91  PRO A O    3  
ATOM   8027   N N    . PHE A 1 92  ? 7.884   0.429   54.517 1.00  0.00 ? 92  PHE A N    3  
ATOM   8028   C CA   . PHE A 1 92  ? 8.836   1.484   54.225 1.00  0.00 ? 92  PHE A CA   3  
ATOM   8029   C C    . PHE A 1 92  ? 8.161   2.624   53.506 1.00  0.00 ? 92  PHE A C    3  
ATOM   8030   O O    . PHE A 1 92  ? 8.649   3.766   53.612 1.00  0.00 ? 92  PHE A O    3  
ATOM   8031   H H    . PHE A 1 92  ? 8.073   -0.464  54.160 1.00  0.00 ? 92  PHE A H    3  
ATOM   8032   N N    . THR A 1 93  ? 7.085   2.394   52.794 1.00  0.00 ? 93  THR A N    3  
ATOM   8033   C CA   . THR A 1 93  ? 6.408   3.445   52.062 1.00  0.00 ? 93  THR A CA   3  
ATOM   8034   C C    . THR A 1 93  ? 5.663   4.410   53.010 1.00  0.00 ? 93  THR A C    3  
ATOM   8035   O O    . THR A 1 93  ? 5.554   5.589   52.630 1.00  0.00 ? 93  THR A O    3  
ATOM   8036   H H    . THR A 1 93  ? 6.737   1.479   52.742 1.00  0.00 ? 93  THR A H    3  
ATOM   8037   N N    . TRP A 1 94  ? 5.254   3.913   54.142 1.00  0.00 ? 94  TRP A N    3  
ATOM   8038   C CA   . TRP A 1 94  ? 4.545   4.762   55.137 1.00  0.00 ? 94  TRP A CA   3  
ATOM   8039   C C    . TRP A 1 94  ? 5.508   5.767   55.753 1.00  0.00 ? 94  TRP A C    3  
ATOM   8040   O O    . TRP A 1 94  ? 5.076   6.855   56.166 1.00  0.00 ? 94  TRP A O    3  
ATOM   8041   H H    . TRP A 1 94  ? 5.430   2.971   54.348 1.00  0.00 ? 94  TRP A H    3  
ATOM   8042   N N    . ASP A 1 95  ? 6.783   5.486   55.791 1.00  0.00 ? 95  ASP A N    3  
ATOM   8043   C CA   . ASP A 1 95  ? 7.816   6.362   56.303 1.00  0.00 ? 95  ASP A CA   3  
ATOM   8044   C C    . ASP A 1 95  ? 8.003   7.617   55.474 1.00  0.00 ? 95  ASP A C    3  
ATOM   8045   O O    . ASP A 1 95  ? 8.486   8.650   56.015 1.00  0.00 ? 95  ASP A O    3  
ATOM   8046   H H    . ASP A 1 95  ? 7.067   4.626   55.416 1.00  0.00 ? 95  ASP A H    3  
ATOM   8047   N N    . ALA A 1 96  ? 7.658   7.595   54.211 1.00  0.00 ? 96  ALA A N    3  
ATOM   8048   C CA   . ALA A 1 96  ? 7.795   8.669   53.276 1.00  0.00 ? 96  ALA A CA   3  
ATOM   8049   C C    . ALA A 1 96  ? 6.734   9.777   53.412 1.00  0.00 ? 96  ALA A C    3  
ATOM   8050   O O    . ALA A 1 96  ? 6.903   10.888  52.891 1.00  0.00 ? 96  ALA A O    3  
ATOM   8051   H H    . ALA A 1 96  ? 7.291   6.754   53.868 1.00  0.00 ? 96  ALA A H    3  
ATOM   8052   N N    . VAL A 1 97  ? 5.602   9.376   53.967 1.00  0.00 ? 97  VAL A N    3  
ATOM   8053   C CA   . VAL A 1 97  ? 4.439   10.266  54.095 1.00  0.00 ? 97  VAL A CA   3  
ATOM   8054   C C    . VAL A 1 97  ? 4.108   10.645  55.550 1.00  0.00 ? 97  VAL A C    3  
ATOM   8055   O O    . VAL A 1 97  ? 2.954   10.925  55.852 1.00  0.00 ? 97  VAL A O    3  
ATOM   8056   H H    . VAL A 1 97  ? 5.516   8.441   54.245 1.00  0.00 ? 97  VAL A H    3  
ATOM   8057   N N    . ARG A 1 98  ? 5.081   10.592  56.394 1.00  0.00 ? 98  ARG A N    3  
ATOM   8058   C CA   . ARG A 1 98  ? 5.028   10.963  57.803 1.00  0.00 ? 98  ARG A CA   3  
ATOM   8059   C C    . ARG A 1 98  ? 5.704   12.339  57.927 1.00  0.00 ? 98  ARG A C    3  
ATOM   8060   O O    . ARG A 1 98  ? 6.821   12.553  57.418 1.00  0.00 ? 98  ARG A O    3  
ATOM   8061   H H    . ARG A 1 98  ? 5.953   10.313  56.045 1.00  0.00 ? 98  ARG A H    3  
ATOM   8062   N N    . TYR A 1 99  ? 5.018   13.282  58.545 1.00  0.00 ? 99  TYR A N    3  
ATOM   8063   C CA   . TYR A 1 99  ? 5.548   14.631  58.772 1.00  0.00 ? 99  TYR A CA   3  
ATOM   8064   C C    . TYR A 1 99  ? 5.403   14.884  60.288 1.00  0.00 ? 99  TYR A C    3  
ATOM   8065   O O    . TYR A 1 99  ? 4.299   15.147  60.765 1.00  0.00 ? 99  TYR A O    3  
ATOM   8066   H H    . TYR A 1 99  ? 4.127   13.065  58.889 1.00  0.00 ? 99  TYR A H    3  
ATOM   8067   N N    . ASN A 1 100 ? 6.526   14.693  60.934 1.00  0.00 ? 100 ASN A N    3  
ATOM   8068   C CA   . ASN A 1 100 ? 6.701   14.831  62.375 1.00  0.00 ? 100 ASN A CA   3  
ATOM   8069   C C    . ASN A 1 100 ? 5.708   13.956  63.119 1.00  0.00 ? 100 ASN A C    3  
ATOM   8070   O O    . ASN A 1 100 ? 4.949   14.428  63.954 1.00  0.00 ? 100 ASN A O    3  
ATOM   8071   H H    . ASN A 1 100 ? 7.308   14.422  60.408 1.00  0.00 ? 100 ASN A H    3  
ATOM   8072   N N    . GLY A 1 101 ? 5.733   12.692  62.727 1.00  0.00 ? 101 GLY A N    3  
ATOM   8073   C CA   . GLY A 1 101 ? 4.893   11.662  63.297 1.00  0.00 ? 101 GLY A CA   3  
ATOM   8074   C C    . GLY A 1 101 ? 3.524   11.514  62.679 1.00  0.00 ? 101 GLY A C    3  
ATOM   8075   O O    . GLY A 1 101 ? 2.994   10.380  62.742 1.00  0.00 ? 101 GLY A O    3  
ATOM   8076   H H    . GLY A 1 101 ? 6.362   12.439  62.021 1.00  0.00 ? 101 GLY A H    3  
ATOM   8077   N N    . LYS A 1 102 ? 2.965   12.555  62.116 1.00  0.00 ? 102 LYS A N    3  
ATOM   8078   C CA   . LYS A 1 102 ? 1.635   12.543  61.501 1.00  0.00 ? 102 LYS A CA   3  
ATOM   8079   C C    . LYS A 1 102 ? 1.682   12.032  60.047 1.00  0.00 ? 102 LYS A C    3  
ATOM   8080   O O    . LYS A 1 102 ? 2.557   12.482  59.308 1.00  0.00 ? 102 LYS A O    3  
ATOM   8081   H H    . LYS A 1 102 ? 3.463   13.400  62.118 1.00  0.00 ? 102 LYS A H    3  
ATOM   8082   N N    . LEU A 1 103 ? 0.770   11.148  59.723 1.00  0.00 ? 103 LEU A N    3  
ATOM   8083   C CA   . LEU A 1 103 ? 0.595   10.600  58.362 1.00  0.00 ? 103 LEU A CA   3  
ATOM   8084   C C    . LEU A 1 103 ? -0.137  11.692  57.568 1.00  0.00 ? 103 LEU A C    3  
ATOM   8085   O O    . LEU A 1 103 ? -1.291  12.039  57.923 1.00  0.00 ? 103 LEU A O    3  
ATOM   8086   H H    . LEU A 1 103 ? 0.131   10.872  60.413 1.00  0.00 ? 103 LEU A H    3  
ATOM   8087   N N    . ILE A 1 104 ? 0.462   12.190  56.514 1.00  0.00 ? 104 ILE A N    3  
ATOM   8088   C CA   . ILE A 1 104 ? -0.110  13.250  55.697 1.00  0.00 ? 104 ILE A CA   3  
ATOM   8089   C C    . ILE A 1 104 ? -0.373  12.913  54.245 1.00  0.00 ? 104 ILE A C    3  
ATOM   8090   O O    . ILE A 1 104 ? -0.717  13.819  53.455 1.00  0.00 ? 104 ILE A O    3  
ATOM   8091   H H    . ILE A 1 104 ? 1.348   11.846  56.277 1.00  0.00 ? 104 ILE A H    3  
ATOM   8092   N N    . ALA A 1 105 ? -0.290  11.634  53.887 1.00  0.00 ? 105 ALA A N    3  
ATOM   8093   C CA   . ALA A 1 105 ? -0.579  11.239  52.481 1.00  0.00 ? 105 ALA A CA   3  
ATOM   8094   C C    . ALA A 1 105 ? -0.545  9.722   52.329 1.00  0.00 ? 105 ALA A C    3  
ATOM   8095   O O    . ALA A 1 105 ? -0.021  9.040   53.168 1.00  0.00 ? 105 ALA A O    3  
ATOM   8096   H H    . ALA A 1 105 ? -0.066  10.951  54.553 1.00  0.00 ? 105 ALA A H    3  
ATOM   8097   N N    C TYR A 1 106 ? -1.129  9.277   51.225 0.05  0.00 ? 106 TYR A N    3  
ATOM   8098   N N    O TYR A 1 106 ? -1.129  9.277   51.225 0.95  0.00 ? 106 TYR A N    3  
ATOM   8099   C CA   C TYR A 1 106 ? -0.948  7.834   50.838 0.05  0.00 ? 106 TYR A CA   3  
ATOM   8100   C CA   O TYR A 1 106 ? -1.092  7.802   50.927 0.95  0.00 ? 106 TYR A CA   3  
ATOM   8101   C C    C TYR A 1 106 ? -0.042  7.816   49.565 0.05  0.00 ? 106 TYR A C    3  
ATOM   8102   C C    O TYR A 1 106 ? -0.002  7.589   49.828 0.95  0.00 ? 106 TYR A C    3  
ATOM   8103   O O    C TYR A 1 106 ? -0.532  8.245   48.540 0.05  0.00 ? 106 TYR A O    3  
ATOM   8104   O O    O TYR A 1 106 ? -0.054  8.319   48.859 0.95  0.00 ? 106 TYR A O    3  
ATOM   8105   H H    C TYR A 1 106 ? -1.628  9.890   50.645 0.05  0.00 ? 106 TYR A H    3  
ATOM   8106   H H    O TYR A 1 106 ? -1.534  9.904   50.589 0.95  0.00 ? 106 TYR A H    3  
ATOM   8107   N N    C PRO A 1 107 ? 1.137   7.282   49.757 0.05  0.00 ? 107 PRO A N    3  
ATOM   8108   N N    O PRO A 1 107 ? 0.814   6.596   50.072 0.95  0.00 ? 107 PRO A N    3  
ATOM   8109   C CA   C PRO A 1 107 ? 2.185   7.262   48.688 0.05  0.00 ? 107 PRO A CA   3  
ATOM   8110   C CA   O PRO A 1 107 ? 1.916   6.221   49.130 0.95  0.00 ? 107 PRO A CA   3  
ATOM   8111   C C    C PRO A 1 107 ? 1.548   6.722   47.416 0.05  0.00 ? 107 PRO A C    3  
ATOM   8112   C C    O PRO A 1 107 ? 1.287   5.570   47.907 0.95  0.00 ? 107 PRO A C    3  
ATOM   8113   O O    C PRO A 1 107 ? 0.425   6.206   47.511 0.05  0.00 ? 107 PRO A O    3  
ATOM   8114   O O    O PRO A 1 107 ? 0.311   4.828   48.091 0.95  0.00 ? 107 PRO A O    3  
ATOM   8115   N N    C ILE A 1 108 ? 2.110   6.895   46.265 0.05  0.00 ? 108 ILE A N    3  
ATOM   8116   N N    O ILE A 1 108 ? 1.687   5.867   46.715 0.95  0.00 ? 108 ILE A N    3  
ATOM   8117   C CA   C ILE A 1 108 ? 1.548   6.444   44.984 0.05  0.00 ? 108 ILE A CA   3  
ATOM   8118   C CA   O ILE A 1 108 ? 1.128   5.299   45.480 0.95  0.00 ? 108 ILE A CA   3  
ATOM   8119   C C    C ILE A 1 108 ? 2.615   5.813   44.054 0.05  0.00 ? 108 ILE A C    3  
ATOM   8120   C C    O ILE A 1 108 ? 2.152   4.429   44.707 0.95  0.00 ? 108 ILE A C    3  
ATOM   8121   O O    C ILE A 1 108 ? 2.855   4.600   44.083 0.05  0.00 ? 108 ILE A O    3  
ATOM   8122   O O    O ILE A 1 108 ? 1.992   3.209   44.581 0.95  0.00 ? 108 ILE A O    3  
ATOM   8123   H H    C ILE A 1 108 ? 2.967   7.370   46.243 0.05  0.00 ? 108 ILE A H    3  
ATOM   8124   H H    O ILE A 1 108 ? 2.408   6.525   46.627 0.95  0.00 ? 108 ILE A H    3  
ATOM   8125   N N    C ALA A 1 109 ? 3.259   6.690   43.287 0.05  0.00 ? 109 ALA A N    3  
ATOM   8126   N N    O ALA A 1 109 ? 3.209   5.101   44.255 0.95  0.00 ? 109 ALA A N    3  
ATOM   8127   C CA   C ALA A 1 109 ? 4.289   6.265   42.279 0.05  0.00 ? 109 ALA A CA   3  
ATOM   8128   C CA   O ALA A 1 109 ? 4.301   4.435   43.466 0.95  0.00 ? 109 ALA A CA   3  
ATOM   8129   C C    C ALA A 1 109 ? 5.123   7.436   41.836 0.05  0.00 ? 109 ALA A C    3  
ATOM   8130   C C    O ALA A 1 109 ? 5.647   4.698   44.084 0.95  0.00 ? 109 ALA A C    3  
ATOM   8131   O O    C ALA A 1 109 ? 5.088   8.491   42.488 0.05  0.00 ? 109 ALA A O    3  
ATOM   8132   O O    O ALA A 1 109 ? 5.769   5.614   44.912 0.95  0.00 ? 109 ALA A O    3  
ATOM   8133   H H    C ALA A 1 109 ? 3.047   7.643   43.375 0.05  0.00 ? 109 ALA A H    3  
ATOM   8134   H H    O ALA A 1 109 ? 3.271   6.063   44.432 0.95  0.00 ? 109 ALA A H    3  
ATOM   8135   N N    C VAL A 1 110 ? 5.907   7.318   40.794 0.05  0.00 ? 110 VAL A N    3  
ATOM   8136   N N    O VAL A 1 110 ? 6.664   3.934   43.776 0.95  0.00 ? 110 VAL A N    3  
ATOM   8137   C CA   C VAL A 1 110 ? 6.820   8.336   40.256 0.05  0.00 ? 110 VAL A CA   3  
ATOM   8138   C CA   O VAL A 1 110 ? 8.035   4.034   44.297 0.95  0.00 ? 110 VAL A CA   3  
ATOM   8139   C C    C VAL A 1 110 ? 6.898   8.224   38.718 0.05  0.00 ? 110 VAL A C    3  
ATOM   8140   C C    O VAL A 1 110 ? 9.044   4.119   43.132 0.95  0.00 ? 110 VAL A C    3  
ATOM   8141   O O    C VAL A 1 110 ? 6.423   7.248   38.102 0.05  0.00 ? 110 VAL A O    3  
ATOM   8142   O O    O VAL A 1 110 ? 8.899   3.458   42.083 0.95  0.00 ? 110 VAL A O    3  
ATOM   8143   H H    C VAL A 1 110 ? 5.893   6.455   40.332 0.05  0.00 ? 110 VAL A H    3  
ATOM   8144   H H    O VAL A 1 110 ? 6.490   3.210   43.140 0.95  0.00 ? 110 VAL A H    3  
ATOM   8145   N N    C GLU A 1 111 ? 7.440   9.238   38.068 0.05  0.00 ? 111 GLU A N    3  
ATOM   8146   N N    O GLU A 1 111 ? 10.045  4.970   43.264 0.95  0.00 ? 111 GLU A N    3  
ATOM   8147   C CA   C GLU A 1 111 ? 7.600   9.257   36.600 0.05  0.00 ? 111 GLU A CA   3  
ATOM   8148   C CA   O GLU A 1 111 ? 11.075  5.166   42.224 0.95  0.00 ? 111 GLU A CA   3  
ATOM   8149   C C    C GLU A 1 111 ? 8.856   10.000  36.232 0.05  0.00 ? 111 GLU A C    3  
ATOM   8150   C C    O GLU A 1 111 ? 12.439  5.216   42.859 0.95  0.00 ? 111 GLU A C    3  
ATOM   8151   O O    C GLU A 1 111 ? 9.524   10.573  37.129 0.05  0.00 ? 111 GLU A O    3  
ATOM   8152   O O    O GLU A 1 111 ? 12.587  5.784   43.970 0.95  0.00 ? 111 GLU A O    3  
ATOM   8153   H H    C GLU A 1 111 ? 7.743   10.017  38.581 0.05  0.00 ? 111 GLU A H    3  
ATOM   8154   H H    O GLU A 1 111 ? 10.103  5.502   44.086 0.95  0.00 ? 111 GLU A H    3  
ATOM   8155   N N    C ALA A 1 112 ? 9.238   9.931   34.956 0.05  0.00 ? 112 ALA A N    3  
ATOM   8156   N N    O ALA A 1 112 ? 13.416  4.565   42.226 0.95  0.00 ? 112 ALA A N    3  
ATOM   8157   C CA   C ALA A 1 112 ? 10.462  10.551  34.466 0.05  0.00 ? 112 ALA A CA   3  
ATOM   8158   C CA   O ALA A 1 112 ? 14.787  4.531   42.718 0.95  0.00 ? 112 ALA A CA   3  
ATOM   8159   C C    C ALA A 1 112 ? 10.480  10.308  32.945 0.05  0.00 ? 112 ALA A C    3  
ATOM   8160   C C    O ALA A 1 112 ? 15.667  4.205   41.496 0.95  0.00 ? 112 ALA A C    3  
ATOM   8161   O O    C ALA A 1 112 ? 9.561   9.598   32.458 0.05  0.00 ? 112 ALA A O    3  
ATOM   8162   O O    O ALA A 1 112 ? 15.120  3.619   40.525 0.95  0.00 ? 112 ALA A O    3  
ATOM   8163   H H    C ALA A 1 112 ? 8.670   9.447   34.320 0.05  0.00 ? 112 ALA A H    3  
ATOM   8164   H H    O ALA A 1 112 ? 13.204  4.093   41.393 0.95  0.00 ? 112 ALA A H    3  
ATOM   8165   N N    C LEU A 1 113 ? 11.446  10.914  32.290 0.05  0.00 ? 113 LEU A N    3  
ATOM   8166   N N    O LEU A 1 113 ? 16.913  4.619   41.574 0.95  0.00 ? 113 LEU A N    3  
ATOM   8167   C CA   C LEU A 1 113 ? 11.586  10.749  30.812 0.05  0.00 ? 113 LEU A CA   3  
ATOM   8168   C CA   O LEU A 1 113 ? 17.885  4.322   40.480 0.95  0.00 ? 113 LEU A CA   3  
ATOM   8169   C C    C LEU A 1 113 ? 11.944  9.303   30.539 0.05  0.00 ? 113 LEU A C    3  
ATOM   8170   C C    O LEU A 1 113 ? 18.165  2.834   40.500 0.95  0.00 ? 113 LEU A C    3  
ATOM   8171   O O    C LEU A 1 113 ? 12.191  8.500   31.412 0.05  0.00 ? 113 LEU A O    3  
ATOM   8172   O O    O LEU A 1 113 ? 18.103  2.156   41.502 0.95  0.00 ? 113 LEU A O    3  
ATOM   8173   H H    C LEU A 1 113 ? 12.101  11.451  32.782 0.05  0.00 ? 113 LEU A H    3  
ATOM   8174   H H    O LEU A 1 113 ? 17.215  5.097   42.374 0.95  0.00 ? 113 LEU A H    3  
ATOM   8175   N N    C SER A 1 114 ? 12.091  9.016   29.234 0.05  0.00 ? 114 SER A N    3  
ATOM   8176   N N    O SER A 1 114 ? 18.616  2.349   39.330 0.95  0.00 ? 114 SER A N    3  
ATOM   8177   C CA   C SER A 1 114 ? 12.462  7.650   28.809 0.05  0.00 ? 114 SER A CA   3  
ATOM   8178   C CA   O SER A 1 114 ? 18.987  0.924   39.207 0.95  0.00 ? 114 SER A CA   3  
ATOM   8179   C C    C SER A 1 114 ? 13.088  7.786   27.374 0.05  0.00 ? 114 SER A C    3  
ATOM   8180   C C    O SER A 1 114 ? 20.256  0.873   38.282 0.95  0.00 ? 114 SER A C    3  
ATOM   8181   O O    C SER A 1 114 ? 12.865  8.831   26.807 0.05  0.00 ? 114 SER A O    3  
ATOM   8182   O O    O SER A 1 114 ? 20.509  1.897   37.690 0.95  0.00 ? 114 SER A O    3  
ATOM   8183   H H    C SER A 1 114 ? 11.988  9.725   28.565 0.05  0.00 ? 114 SER A H    3  
ATOM   8184   H H    O SER A 1 114 ? 18.734  2.952   38.566 0.95  0.00 ? 114 SER A H    3  
ATOM   8185   N N    C LEU A 1 115 ? 13.779  6.773   27.013 0.05  0.00 ? 115 LEU A N    3  
ATOM   8186   N N    O LEU A 1 115 ? 20.869  -0.248  38.307 0.95  0.00 ? 115 LEU A N    3  
ATOM   8187   C CA   C LEU A 1 115 ? 14.386  6.701   25.632 0.05  0.00 ? 115 LEU A CA   3  
ATOM   8188   C CA   O LEU A 1 115 ? 22.049  -0.507  37.401 0.95  0.00 ? 115 LEU A CA   3  
ATOM   8189   C C    C LEU A 1 115 ? 13.292  6.127   24.708 0.05  0.00 ? 115 LEU A C    3  
ATOM   8190   C C    O LEU A 1 115 ? 21.466  -0.998  36.060 0.95  0.00 ? 115 LEU A C    3  
ATOM   8191   O O    C LEU A 1 115 ? 12.810  5.049   25.067 0.05  0.00 ? 115 LEU A O    3  
ATOM   8192   O O    O LEU A 1 115 ? 20.710  -1.971  36.138 0.95  0.00 ? 115 LEU A O    3  
ATOM   8193   H H    C LEU A 1 115 ? 13.860  6.006   27.617 0.05  0.00 ? 115 LEU A H    3  
ATOM   8194   H H    O LEU A 1 115 ? 20.529  -0.971  38.874 0.95  0.00 ? 115 LEU A H    3  
ATOM   8195   N N    C ILE A 1 116 ? 12.907  6.830   23.701 0.05  0.00 ? 116 ILE A N    3  
ATOM   8196   N N    O ILE A 1 116 ? 21.730  -0.329  34.993 0.95  0.00 ? 116 ILE A N    3  
ATOM   8197   C CA   C ILE A 1 116 ? 11.867  6.420   22.727 0.05  0.00 ? 116 ILE A CA   3  
ATOM   8198   C CA   O ILE A 1 116 ? 21.242  -0.670  33.634 0.95  0.00 ? 116 ILE A CA   3  
ATOM   8199   C C    C ILE A 1 116 ? 12.618  6.067   21.433 0.05  0.00 ? 116 ILE A C    3  
ATOM   8200   C C    O ILE A 1 116 ? 22.461  -1.218  32.875 0.95  0.00 ? 116 ILE A C    3  
ATOM   8201   O O    C ILE A 1 116 ? 13.396  6.949   21.054 0.05  0.00 ? 116 ILE A O    3  
ATOM   8202   O O    O ILE A 1 116 ? 23.450  -0.480  32.924 0.95  0.00 ? 116 ILE A O    3  
ATOM   8203   H H    C ILE A 1 116 ? 13.333  7.704   23.569 0.05  0.00 ? 116 ILE A H    3  
ATOM   8204   H H    O ILE A 1 116 ? 22.295  0.467   35.085 0.95  0.00 ? 116 ILE A H    3  
ATOM   8205   N N    C TYR A 1 117 ? 12.384  4.940   20.796 0.05  0.00 ? 117 TYR A N    3  
ATOM   8206   N N    O TYR A 1 117 ? 22.394  -2.349  32.206 0.95  0.00 ? 117 TYR A N    3  
ATOM   8207   C CA   C TYR A 1 117 ? 13.183  4.638   19.577 0.05  0.00 ? 117 TYR A CA   3  
ATOM   8208   C CA   O TYR A 1 117 ? 23.625  -2.848  31.535 0.95  0.00 ? 117 TYR A CA   3  
ATOM   8209   C C    C TYR A 1 117 ? 12.293  4.022   18.511 0.05  0.00 ? 117 TYR A C    3  
ATOM   8210   C C    O TYR A 1 117 ? 23.279  -3.419  30.171 0.95  0.00 ? 117 TYR A C    3  
ATOM   8211   O O    C TYR A 1 117 ? 11.228  3.536   18.841 0.05  0.00 ? 117 TYR A O    3  
ATOM   8212   O O    O TYR A 1 117 ? 22.127  -3.731  29.937 0.95  0.00 ? 117 TYR A O    3  
ATOM   8213   H H    C TYR A 1 117 ? 11.724  4.300   21.135 0.05  0.00 ? 117 TYR A H    3  
ATOM   8214   H H    O TYR A 1 117 ? 21.562  -2.867  32.179 0.95  0.00 ? 117 TYR A H    3  
ATOM   8215   N N    C ASN A 1 118 ? 12.746  4.109   17.301 0.05  0.00 ? 118 ASN A N    3  
ATOM   8216   N N    O ASN A 1 118 ? 24.268  -3.487  29.338 0.95  0.00 ? 118 ASN A N    3  
ATOM   8217   C CA   C ASN A 1 118 ? 12.039  3.652   16.078 0.05  0.00 ? 118 ASN A CA   3  
ATOM   8218   C CA   O ASN A 1 118 ? 24.180  -3.937  27.926 0.95  0.00 ? 118 ASN A CA   3  
ATOM   8219   C C    C ASN A 1 118 ? 12.508  2.215   15.838 0.05  0.00 ? 118 ASN A C    3  
ATOM   8220   C C    O ASN A 1 118 ? 24.479  -5.438  27.948 0.95  0.00 ? 118 ASN A C    3  
ATOM   8221   O O    C ASN A 1 118 ? 13.664  2.073   15.506 0.05  0.00 ? 118 ASN A O    3  
ATOM   8222   O O    O ASN A 1 118 ? 25.613  -5.759  28.225 0.95  0.00 ? 118 ASN A O    3  
ATOM   8223   H H    C ASN A 1 118 ? 13.609  4.554   17.178 0.05  0.00 ? 118 ASN A H    3  
ATOM   8224   H H    O ASN A 1 118 ? 25.140  -3.172  29.653 0.95  0.00 ? 118 ASN A H    3  
ATOM   8225   N N    C LYS A 1 119 ? 11.613  1.263   16.084 0.05  0.00 ? 119 LYS A N    3  
ATOM   8226   N N    O LYS A 1 119 ? 23.442  -6.240  27.725 0.95  0.00 ? 119 LYS A N    3  
ATOM   8227   C CA   C LYS A 1 119 ? 11.920  -0.170  15.980 0.05  0.00 ? 119 LYS A CA   3  
ATOM   8228   C CA   O LYS A 1 119 ? 23.535  -7.705  27.787 0.95  0.00 ? 119 LYS A CA   3  
ATOM   8229   C C    C LYS A 1 119 ? 12.281  -0.595  14.562 0.05  0.00 ? 119 LYS A C    3  
ATOM   8230   C C    O LYS A 1 119 ? 24.467  -8.282  26.728 0.95  0.00 ? 119 LYS A C    3  
ATOM   8231   O O    C LYS A 1 119 ? 13.002  -1.614  14.441 0.05  0.00 ? 119 LYS A O    3  
ATOM   8232   O O    O LYS A 1 119 ? 24.990  -9.395  26.977 0.95  0.00 ? 119 LYS A O    3  
ATOM   8233   H H    C LYS A 1 119 ? 10.723  1.528   16.397 0.05  0.00 ? 119 LYS A H    3  
ATOM   8234   H H    O LYS A 1 119 ? 22.565  -5.835  27.562 0.95  0.00 ? 119 LYS A H    3  
ATOM   8235   N N    C ASP A 1 120 ? 11.833  0.176   13.605 0.05  0.00 ? 120 ASP A N    3  
ATOM   8236   N N    O ASP A 1 120 ? 24.663  -7.534  25.673 0.95  0.00 ? 120 ASP A N    3  
ATOM   8237   C CA   C ASP A 1 120 ? 12.151  -0.088  12.178 0.05  0.00 ? 120 ASP A CA   3  
ATOM   8238   C CA   O ASP A 1 120 ? 25.587  -7.946  24.585 0.95  0.00 ? 120 ASP A CA   3  
ATOM   8239   C C    C ASP A 1 120 ? 13.542  0.399   11.798 0.05  0.00 ? 120 ASP A C    3  
ATOM   8240   C C    O ASP A 1 120 ? 27.044  -7.681  24.935 0.95  0.00 ? 120 ASP A C    3  
ATOM   8241   O O    C ASP A 1 120 ? 14.128  -0.141  10.814 0.05  0.00 ? 120 ASP A O    3  
ATOM   8242   O O    O ASP A 1 120 ? 27.942  -8.368  24.365 0.95  0.00 ? 120 ASP A O    3  
ATOM   8243   H H    C ASP A 1 120 ? 11.302  0.966   13.838 0.05  0.00 ? 120 ASP A H    3  
ATOM   8244   H H    O ASP A 1 120 ? 24.215  -6.664  25.615 0.95  0.00 ? 120 ASP A H    3  
ATOM   8245   N N    C LEU A 1 121 ? 14.147  1.366   12.450 0.05  0.00 ? 121 LEU A N    3  
ATOM   8246   N N    O LEU A 1 121 ? 27.399  -6.756  25.799 0.95  0.00 ? 121 LEU A N    3  
ATOM   8247   C CA   C LEU A 1 121 ? 15.483  1.867   12.111 0.05  0.00 ? 121 LEU A CA   3  
ATOM   8248   C CA   O LEU A 1 121 ? 28.792  -6.466  26.157 0.95  0.00 ? 121 LEU A CA   3  
ATOM   8249   C C    C LEU A 1 121 ? 16.552  1.270   12.998 0.05  0.00 ? 121 LEU A C    3  
ATOM   8250   C C    O LEU A 1 121 ? 29.191  -7.131  27.455 0.95  0.00 ? 121 LEU A C    3  
ATOM   8251   O O    C LEU A 1 121 ? 17.712  1.157   12.594 0.05  0.00 ? 121 LEU A O    3  
ATOM   8252   O O    O LEU A 1 121 ? 30.368  -7.429  27.671 0.95  0.00 ? 121 LEU A O    3  
ATOM   8253   H H    C LEU A 1 121 ? 13.677  1.780   13.204 0.05  0.00 ? 121 LEU A H    3  
ATOM   8254   H H    O LEU A 1 121 ? 26.693  -6.227  26.225 0.95  0.00 ? 121 LEU A H    3  
ATOM   8255   N N    C LEU A 1 122 ? 16.094  0.936   14.203 0.05  0.00 ? 122 LEU A N    3  
ATOM   8256   N N    O LEU A 1 122 ? 28.162  -7.308  28.281 0.95  0.00 ? 122 LEU A N    3  
ATOM   8257   C CA   C LEU A 1 122 ? 16.982  0.444   15.254 0.05  0.00 ? 122 LEU A CA   3  
ATOM   8258   C CA   O LEU A 1 122 ? 28.342  -7.832  29.633 0.95  0.00 ? 122 LEU A CA   3  
ATOM   8259   C C    C LEU A 1 122 ? 16.379  -0.798  15.896 0.05  0.00 ? 122 LEU A C    3  
ATOM   8260   C C    O LEU A 1 122 ? 27.320  -8.929  29.899 0.95  0.00 ? 122 LEU A C    3  
ATOM   8261   O O    C LEU A 1 122 ? 15.370  -0.674  16.580 0.05  0.00 ? 122 LEU A O    3  
ATOM   8262   O O    O LEU A 1 122 ? 26.139  -8.619  30.001 0.95  0.00 ? 122 LEU A O    3  
ATOM   8263   H H    C LEU A 1 122 ? 15.151  1.091   14.412 0.05  0.00 ? 122 LEU A H    3  
ATOM   8264   H H    O LEU A 1 122 ? 27.272  -7.012  28.001 0.95  0.00 ? 122 LEU A H    3  
ATOM   8265   N N    C PRO A 1 123 ? 17.049  -1.917  15.668 0.05  0.00 ? 123 PRO A N    3  
ATOM   8266   N N    O PRO A 1 123 ? 27.835  -10.142 30.030 0.95  0.00 ? 123 PRO A N    3  
ATOM   8267   C CA   C PRO A 1 123 ? 16.671  -3.230  16.181 0.05  0.00 ? 123 PRO A CA   3  
ATOM   8268   C CA   O PRO A 1 123 ? 27.059  -11.349 30.294 0.95  0.00 ? 123 PRO A CA   3  
ATOM   8269   C C    C PRO A 1 123 ? 16.622  -3.253  17.700 0.05  0.00 ? 123 PRO A C    3  
ATOM   8270   C C    O PRO A 1 123 ? 26.278  -11.249 31.594 0.95  0.00 ? 123 PRO A C    3  
ATOM   8271   O O    C PRO A 1 123 ? 15.639  -3.620  18.364 0.05  0.00 ? 123 PRO A O    3  
ATOM   8272   O O    O PRO A 1 123 ? 25.053  -11.429 31.691 0.95  0.00 ? 123 PRO A O    3  
ATOM   8273   N N    C ASN A 1 124 ? 17.772  -2.874  18.234 0.05  0.00 ? 124 ASN A N    3  
ATOM   8274   N N    O ASN A 1 124 ? 27.069  -10.988 32.622 0.95  0.00 ? 124 ASN A N    3  
ATOM   8275   C CA   C ASN A 1 124 ? 17.948  -2.803  19.697 0.05  0.00 ? 124 ASN A CA   3  
ATOM   8276   C CA   O ASN A 1 124 ? 26.523  -10.829 33.984 0.95  0.00 ? 124 ASN A CA   3  
ATOM   8277   C C    C ASN A 1 124 ? 18.521  -1.413  20.007 0.05  0.00 ? 124 ASN A C    3  
ATOM   8278   C C    O ASN A 1 124 ? 27.081  -9.509  34.533 0.95  0.00 ? 124 ASN A C    3  
ATOM   8279   O O    C ASN A 1 124 ? 19.462  -0.996  19.339 0.05  0.00 ? 124 ASN A O    3  
ATOM   8280   O O    O ASN A 1 124 ? 28.280  -9.274  34.411 0.95  0.00 ? 124 ASN A O    3  
ATOM   8281   H H    C ASN A 1 124 ? 18.516  -2.625  17.647 0.05  0.00 ? 124 ASN A H    3  
ATOM   8282   H H    O ASN A 1 124 ? 28.032  -10.886 32.475 0.95  0.00 ? 124 ASN A H    3  
ATOM   8283   N N    C PRO A 1 125 ? 17.897  -0.795  20.984 0.05  0.00 ? 125 PRO A N    3  
ATOM   8284   N N    O PRO A 1 125 ? 26.166  -8.739  35.078 0.95  0.00 ? 125 PRO A N    3  
ATOM   8285   C CA   C PRO A 1 125 ? 18.350  0.552   21.416 0.05  0.00 ? 125 PRO A CA   3  
ATOM   8286   C CA   O PRO A 1 125 ? 26.555  -7.436  35.675 0.95  0.00 ? 125 PRO A CA   3  
ATOM   8287   C C    C PRO A 1 125 ? 19.730  0.407   22.023 0.05  0.00 ? 125 PRO A C    3  
ATOM   8288   C C    O PRO A 1 125 ? 27.428  -7.718  36.880 0.95  0.00 ? 125 PRO A C    3  
ATOM   8289   O O    C PRO A 1 125 ? 20.037  -0.655  22.569 0.05  0.00 ? 125 PRO A O    3  
ATOM   8290   O O    O PRO A 1 125 ? 27.265  -8.766  37.508 0.95  0.00 ? 125 PRO A O    3  
ATOM   8291   N N    C PRO A 1 126 ? 20.514  1.477   21.973 0.05  0.00 ? 126 PRO A N    3  
ATOM   8292   N N    O PRO A 1 126 ? 28.293  -6.769  37.220 0.95  0.00 ? 126 PRO A N    3  
ATOM   8293   C CA   C PRO A 1 126 ? 21.866  1.474   22.547 0.05  0.00 ? 126 PRO A CA   3  
ATOM   8294   C CA   O PRO A 1 126 ? 29.179  -6.909  38.383 0.95  0.00 ? 126 PRO A CA   3  
ATOM   8295   C C    C PRO A 1 126 ? 21.741  1.423   24.071 0.05  0.00 ? 126 PRO A C    3  
ATOM   8296   C C    O PRO A 1 126 ? 28.326  -6.826  39.650 0.95  0.00 ? 126 PRO A C    3  
ATOM   8297   O O    C PRO A 1 126 ? 20.780  2.015   24.556 0.05  0.00 ? 126 PRO A O    3  
ATOM   8298   O O    O PRO A 1 126 ? 27.355  -6.075  39.601 0.95  0.00 ? 126 PRO A O    3  
ATOM   8299   N N    C LYS A 1 127 ? 22.651  0.749   24.712 0.05  0.00 ? 127 LYS A N    3  
ATOM   8300   N N    O LYS A 1 127 ? 28.696  -7.565  40.655 0.95  0.00 ? 127 LYS A N    3  
ATOM   8301   C CA   C LYS A 1 127 ? 22.632  0.636   26.134 0.05  0.00 ? 127 LYS A CA   3  
ATOM   8302   C CA   O LYS A 1 127 ? 27.974  -7.565  41.886 0.95  0.00 ? 127 LYS A CA   3  
ATOM   8303   C C    C LYS A 1 127 ? 23.402  1.763   26.810 0.05  0.00 ? 127 LYS A C    3  
ATOM   8304   C C    O LYS A 1 127 ? 28.484  -6.503  42.851 0.95  0.00 ? 127 LYS A C    3  
ATOM   8305   O O    C LYS A 1 127 ? 23.196  2.086   27.966 0.05  0.00 ? 127 LYS A O    3  
ATOM   8306   O O    O LYS A 1 127 ? 27.797  -6.067  43.757 0.95  0.00 ? 127 LYS A O    3  
ATOM   8307   H H    C LYS A 1 127 ? 23.366  0.310   24.206 0.05  0.00 ? 127 LYS A H    3  
ATOM   8308   H H    O LYS A 1 127 ? 29.489  -8.133  40.565 0.95  0.00 ? 127 LYS A H    3  
ATOM   8309   N N    C THR A 1 128 ? 24.226  2.363   26.019 0.05  0.00 ? 128 THR A N    3  
ATOM   8310   N N    O THR A 1 128 ? 29.669  -6.081  42.564 0.95  0.00 ? 128 THR A N    3  
ATOM   8311   C CA   C THR A 1 128 ? 25.192  3.408   26.383 0.05  0.00 ? 128 THR A CA   3  
ATOM   8312   C CA   O THR A 1 128 ? 30.486  -5.150  43.354 0.95  0.00 ? 128 THR A CA   3  
ATOM   8313   C C    C THR A 1 128 ? 25.094  4.668   25.576 0.05  0.00 ? 128 THR A C    3  
ATOM   8314   C C    O THR A 1 128 ? 30.987  -3.954  42.601 0.95  0.00 ? 128 THR A C    3  
ATOM   8315   O O    C THR A 1 128 ? 24.722  4.646   24.388 0.05  0.00 ? 128 THR A O    3  
ATOM   8316   O O    O THR A 1 128 ? 31.238  -4.017  41.383 0.95  0.00 ? 128 THR A O    3  
ATOM   8317   H H    C THR A 1 128 ? 24.261  2.039   25.094 0.05  0.00 ? 128 THR A H    3  
ATOM   8318   H H    O THR A 1 128 ? 30.097  -6.477  41.776 0.95  0.00 ? 128 THR A H    3  
ATOM   8319   N N    C TRP A 1 129 ? 25.460  5.799   26.214 0.05  0.00 ? 129 TRP A N    3  
ATOM   8320   N N    O TRP A 1 129 ? 31.168  -2.836  43.335 0.95  0.00 ? 129 TRP A N    3  
ATOM   8321   C CA   C TRP A 1 129 ? 25.525  7.086   25.543 0.05  0.00 ? 129 TRP A CA   3  
ATOM   8322   C CA   O TRP A 1 129 ? 31.747  -1.625  42.780 0.95  0.00 ? 129 TRP A CA   3  
ATOM   8323   C C    C TRP A 1 129 ? 26.819  7.098   24.656 0.05  0.00 ? 129 TRP A C    3  
ATOM   8324   C C    O TRP A 1 129 ? 33.293  -1.855  42.641 0.95  0.00 ? 129 TRP A C    3  
ATOM   8325   O O    C TRP A 1 129 ? 26.816  7.759   23.646 0.05  0.00 ? 129 TRP A O    3  
ATOM   8326   O O    O TRP A 1 129 ? 33.881  -1.278  41.758 0.95  0.00 ? 129 TRP A O    3  
ATOM   8327   H H    C TRP A 1 129 ? 25.761  5.740   27.145 0.05  0.00 ? 129 TRP A H    3  
ATOM   8328   H H    O TRP A 1 129 ? 30.967  -2.864  44.294 0.95  0.00 ? 129 TRP A H    3  
ATOM   8329   N N    C GLU A 1 130 ? 27.849  6.437   25.113 0.05  0.00 ? 130 GLU A N    3  
ATOM   8330   N N    O GLU A 1 130 ? 33.857  -2.610  43.545 0.95  0.00 ? 130 GLU A N    3  
ATOM   8331   C CA   C GLU A 1 130 ? 29.158  6.399   24.488 0.05  0.00 ? 130 GLU A CA   3  
ATOM   8332   C CA   O GLU A 1 130 ? 35.281  -2.871  43.641 0.95  0.00 ? 130 GLU A CA   3  
ATOM   8333   C C    C GLU A 1 130 ? 29.144  5.826   23.087 0.05  0.00 ? 130 GLU A C    3  
ATOM   8334   C C    O GLU A 1 130 ? 35.859  -3.543  42.414 0.95  0.00 ? 130 GLU A C    3  
ATOM   8335   O O    C GLU A 1 130 ? 29.995  6.188   22.256 0.05  0.00 ? 130 GLU A O    3  
ATOM   8336   O O    O GLU A 1 130 ? 37.049  -3.363  42.106 0.95  0.00 ? 130 GLU A O    3  
ATOM   8337   H H    C GLU A 1 130 ? 27.747  5.979   25.973 0.05  0.00 ? 130 GLU A H    3  
ATOM   8338   H H    O GLU A 1 130 ? 33.282  -2.983  44.245 0.95  0.00 ? 130 GLU A H    3  
ATOM   8339   N N    C GLU A 1 131 ? 28.138  5.031   22.804 0.05  0.00 ? 131 GLU A N    3  
ATOM   8340   N N    O GLU A 1 131 ? 35.006  -4.215  41.675 0.95  0.00 ? 131 GLU A N    3  
ATOM   8341   C CA   C GLU A 1 131 ? 28.015  4.399   21.481 0.05  0.00 ? 131 GLU A CA   3  
ATOM   8342   C CA   O GLU A 1 131 ? 35.443  -4.925  40.462 0.95  0.00 ? 131 GLU A CA   3  
ATOM   8343   C C    C GLU A 1 131 ? 27.134  5.164   20.556 0.05  0.00 ? 131 GLU A C    3  
ATOM   8344   C C    O GLU A 1 131 ? 35.250  -4.122  39.223 0.95  0.00 ? 131 GLU A C    3  
ATOM   8345   O O    C GLU A 1 131 ? 26.985  4.712   19.393 0.05  0.00 ? 131 GLU A O    3  
ATOM   8346   O O    O GLU A 1 131 ? 35.614  -4.638  38.137 0.95  0.00 ? 131 GLU A O    3  
ATOM   8347   H H    C GLU A 1 131 ? 27.460  4.850   23.490 0.05  0.00 ? 131 GLU A H    3  
ATOM   8348   H H    O GLU A 1 131 ? 34.063  -4.251  41.941 0.95  0.00 ? 131 GLU A H    3  
ATOM   8349   N N    C ILE A 1 132 ? 26.575  6.309   20.914 0.05  0.00 ? 132 ILE A N    3  
ATOM   8350   N N    O ILE A 1 132 ? 34.772  -2.888  39.260 0.95  0.00 ? 132 ILE A N    3  
ATOM   8351   C CA   C ILE A 1 132 ? 25.721  7.088   20.045 0.05  0.00 ? 132 ILE A CA   3  
ATOM   8352   C CA   O ILE A 1 132 ? 34.577  -2.071  38.083 0.95  0.00 ? 132 ILE A CA   3  
ATOM   8353   C C    C ILE A 1 132 ? 26.425  7.727   18.858 0.05  0.00 ? 132 ILE A C    3  
ATOM   8354   C C    O ILE A 1 132 ? 35.856  -1.625  37.393 0.95  0.00 ? 132 ILE A C    3  
ATOM   8355   O O    C ILE A 1 132 ? 25.891  7.697   17.725 0.05  0.00 ? 132 ILE A O    3  
ATOM   8356   O O    O ILE A 1 132 ? 35.940  -1.670  36.143 0.95  0.00 ? 132 ILE A O    3  
ATOM   8357   H H    C ILE A 1 132 ? 26.754  6.651   21.815 0.05  0.00 ? 132 ILE A H    3  
ATOM   8358   H H    O ILE A 1 132 ? 34.543  -2.505  40.133 0.95  0.00 ? 132 ILE A H    3  
ATOM   8359   N N    C PRO A 1 133 ? 27.567  8.335   19.063 0.05  0.00 ? 133 PRO A N    3  
ATOM   8360   N N    O PRO A 1 133 ? 36.835  -1.161  38.130 0.95  0.00 ? 133 PRO A N    3  
ATOM   8361   C CA   C PRO A 1 133 ? 28.332  8.942   17.973 0.05  0.00 ? 133 PRO A CA   3  
ATOM   8362   C CA   O PRO A 1 133 ? 38.115  -0.748  37.554 0.95  0.00 ? 133 PRO A CA   3  
ATOM   8363   C C    C PRO A 1 133 ? 28.551  7.995   16.784 0.05  0.00 ? 133 PRO A C    3  
ATOM   8364   C C    O PRO A 1 133 ? 38.733  -1.804  36.626 0.95  0.00 ? 133 PRO A C    3  
ATOM   8365   O O    C PRO A 1 133 ? 28.306  8.420   15.647 0.05  0.00 ? 133 PRO A O    3  
ATOM   8366   O O    O PRO A 1 133 ? 39.137  -1.438  35.514 0.95  0.00 ? 133 PRO A O    3  
ATOM   8367   N N    C ALA A 1 134 ? 28.996  6.798   16.989 0.05  0.00 ? 134 ALA A N    3  
ATOM   8368   N N    O ALA A 1 134 ? 38.832  -3.030  37.024 0.95  0.00 ? 134 ALA A N    3  
ATOM   8369   C CA   C ALA A 1 134 ? 29.259  5.729   16.041 0.05  0.00 ? 134 ALA A CA   3  
ATOM   8370   C CA   O ALA A 1 134 ? 39.352  -4.194  36.328 0.95  0.00 ? 134 ALA A CA   3  
ATOM   8371   C C    C ALA A 1 134 ? 28.001  5.285   15.310 0.05  0.00 ? 134 ALA A C    3  
ATOM   8372   C C    O ALA A 1 134 ? 38.554  -4.521  35.075 0.95  0.00 ? 134 ALA A C    3  
ATOM   8373   O O    C ALA A 1 134 ? 27.949  4.997   14.080 0.05  0.00 ? 134 ALA A O    3  
ATOM   8374   O O    O ALA A 1 134 ? 39.060  -4.892  33.977 0.95  0.00 ? 134 ALA A O    3  
ATOM   8375   H H    C ALA A 1 134 ? 29.170  6.574   17.927 0.05  0.00 ? 134 ALA A H    3  
ATOM   8376   H H    O ALA A 1 134 ? 38.493  -3.203  37.927 0.95  0.00 ? 134 ALA A H    3  
ATOM   8377   N N    C LEU A 1 135 ? 26.915  5.194   16.040 0.05  0.00 ? 135 LEU A N    3  
ATOM   8378   N N    O LEU A 1 135 ? 37.251  -4.409  35.179 0.95  0.00 ? 135 LEU A N    3  
ATOM   8379   C CA   C LEU A 1 135 ? 25.595  4.832   15.556 0.05  0.00 ? 135 LEU A CA   3  
ATOM   8380   C CA   O LEU A 1 135 ? 36.292  -4.627  34.111 0.95  0.00 ? 135 LEU A CA   3  
ATOM   8381   C C    C LEU A 1 135 ? 25.073  5.928   14.626 0.05  0.00 ? 135 LEU A C    3  
ATOM   8382   C C    O LEU A 1 135 ? 36.462  -3.546  33.043 0.95  0.00 ? 135 LEU A C    3  
ATOM   8383   O O    C LEU A 1 135 ? 24.429  5.632   13.621 0.05  0.00 ? 135 LEU A O    3  
ATOM   8384   O O    O LEU A 1 135 ? 36.348  -3.829  31.852 0.95  0.00 ? 135 LEU A O    3  
ATOM   8385   H H    C LEU A 1 135 ? 26.997  5.417   16.991 0.05  0.00 ? 135 LEU A H    3  
ATOM   8386   H H    O LEU A 1 135 ? 36.896  -4.127  36.048 0.95  0.00 ? 135 LEU A H    3  
ATOM   8387   N N    C ASP A 1 136 ? 25.344  7.166   15.017 0.05  0.00 ? 136 ASP A N    3  
ATOM   8388   N N    O ASP A 1 136 ? 36.697  -2.329  33.515 0.95  0.00 ? 136 ASP A N    3  
ATOM   8389   C CA   C ASP A 1 136 ? 24.916  8.316   14.229 0.05  0.00 ? 136 ASP A CA   3  
ATOM   8390   C CA   O ASP A 1 136 ? 36.887  -1.196  32.617 0.95  0.00 ? 136 ASP A CA   3  
ATOM   8391   C C    C ASP A 1 136 ? 25.641  8.291   12.849 0.05  0.00 ? 136 ASP A C    3  
ATOM   8392   C C    O ASP A 1 136 ? 38.176  -1.423  31.769 0.95  0.00 ? 136 ASP A C    3  
ATOM   8393   O O    C ASP A 1 136 ? 24.965  8.643   11.889 0.05  0.00 ? 136 ASP A O    3  
ATOM   8394   O O    O ASP A 1 136 ? 38.112  -1.058  30.601 0.95  0.00 ? 136 ASP A O    3  
ATOM   8395   H H    C ASP A 1 136 ? 25.842  7.310   15.847 0.05  0.00 ? 136 ASP A H    3  
ATOM   8396   H H    O ASP A 1 136 ? 36.747  -2.190  34.483 0.95  0.00 ? 136 ASP A H    3  
ATOM   8397   N N    C LYS A 1 137 ? 26.896  7.942   12.846 0.05  0.00 ? 137 LYS A N    3  
ATOM   8398   N N    O LYS A 1 137 ? 39.204  -1.936  32.382 0.95  0.00 ? 137 LYS A N    3  
ATOM   8399   C CA   C LYS A 1 137 ? 27.672  7.880   11.574 0.05  0.00 ? 137 LYS A CA   3  
ATOM   8400   C CA   O LYS A 1 137 ? 40.479  -2.199  31.654 0.95  0.00 ? 137 LYS A CA   3  
ATOM   8401   C C    C LYS A 1 137 ? 27.116  6.756   10.692 0.05  0.00 ? 137 LYS A C    3  
ATOM   8402   C C    O LYS A 1 137 ? 40.253  -3.303  30.614 0.95  0.00 ? 137 LYS A C    3  
ATOM   8403   O O    C LYS A 1 137 ? 26.917  6.964   9.477  0.05  0.00 ? 137 LYS A O    3  
ATOM   8404   O O    O LYS A 1 137 ? 40.702  -3.164  29.457 0.95  0.00 ? 137 LYS A O    3  
ATOM   8405   H H    C LYS A 1 137 ? 27.334  7.711   13.691 0.05  0.00 ? 137 LYS A H    3  
ATOM   8406   H H    O LYS A 1 137 ? 39.137  -2.158  33.334 0.95  0.00 ? 137 LYS A H    3  
ATOM   8407   N N    C GLU A 1 138 ? 26.692  5.642   11.254 0.05  0.00 ? 138 GLU A N    3  
ATOM   8408   N N    O GLU A 1 138 ? 39.444  -4.303  30.897 0.95  0.00 ? 138 GLU A N    3  
ATOM   8409   C CA   C GLU A 1 138 ? 26.093  4.546   10.497 0.05  0.00 ? 138 GLU A CA   3  
ATOM   8410   C CA   O GLU A 1 138 ? 39.125  -5.364  29.945 0.95  0.00 ? 138 GLU A CA   3  
ATOM   8411   C C    C GLU A 1 138 ? 24.737  4.894   9.935  0.05  0.00 ? 138 GLU A C    3  
ATOM   8412   C C    O GLU A 1 138 ? 38.283  -4.882  28.790 0.95  0.00 ? 138 GLU A C    3  
ATOM   8413   O O    C GLU A 1 138 ? 24.407  4.497   8.793  0.05  0.00 ? 138 GLU A O    3  
ATOM   8414   O O    O GLU A 1 138 ? 38.490  -5.317  27.634 0.95  0.00 ? 138 GLU A O    3  
ATOM   8415   H H    C GLU A 1 138 ? 26.746  5.562   12.230 0.05  0.00 ? 138 GLU A H    3  
ATOM   8416   H H    O GLU A 1 138 ? 39.006  -4.315  31.774 0.95  0.00 ? 138 GLU A H    3  
ATOM   8417   N N    C LEU A 1 139 ? 23.944  5.637   10.702 0.05  0.00 ? 139 LEU A N    3  
ATOM   8418   N N    O LEU A 1 139 ? 37.343  -3.983  29.070 0.95  0.00 ? 139 LEU A N    3  
ATOM   8419   C CA   C LEU A 1 139 ? 22.620  6.065   10.283 0.05  0.00 ? 139 LEU A CA   3  
ATOM   8420   C CA   O LEU A 1 139 ? 36.472  -3.415  28.055 0.95  0.00 ? 139 LEU A CA   3  
ATOM   8421   C C    C LEU A 1 139 ? 22.647  7.176   9.256  0.05  0.00 ? 139 LEU A C    3  
ATOM   8422   C C    O LEU A 1 139 ? 37.163  -2.399  27.172 0.95  0.00 ? 139 LEU A C    3  
ATOM   8423   O O    C LEU A 1 139 ? 21.749  7.319   8.423  0.05  0.00 ? 139 LEU A O    3  
ATOM   8424   O O    O LEU A 1 139 ? 36.815  -2.202  26.006 0.95  0.00 ? 139 LEU A O    3  
ATOM   8425   H H    C LEU A 1 139 ? 24.272  5.918   11.582 0.05  0.00 ? 139 LEU A H    3  
ATOM   8426   H H    O LEU A 1 139 ? 37.243  -3.681  29.997 0.95  0.00 ? 139 LEU A H    3  
ATOM   8427   N N    C LYS A 1 140 ? 23.656  8.004   9.328  0.05  0.00 ? 140 LYS A N    3  
ATOM   8428   N N    O LYS A 1 140 ? 38.125  -1.711  27.728 0.95  0.00 ? 140 LYS A N    3  
ATOM   8429   C CA   C LYS A 1 140 ? 23.905  9.142   8.457  0.05  0.00 ? 140 LYS A CA   3  
ATOM   8430   C CA   O LYS A 1 140 ? 38.937  -0.687  27.089 0.95  0.00 ? 140 LYS A CA   3  
ATOM   8431   C C    C LYS A 1 140 ? 24.196  8.631   7.017  0.05  0.00 ? 140 LYS A C    3  
ATOM   8432   C C    O LYS A 1 140 ? 39.806  -1.341  25.977 0.95  0.00 ? 140 LYS A C    3  
ATOM   8433   O O    C LYS A 1 140 ? 23.878  9.306   6.048  0.05  0.00 ? 140 LYS A O    3  
ATOM   8434   O O    O LYS A 1 140 ? 40.105  -0.706  24.976 0.95  0.00 ? 140 LYS A O    3  
ATOM   8435   H H    C LYS A 1 140 ? 24.311  7.839   10.037 0.05  0.00 ? 140 LYS A H    3  
ATOM   8436   H H    O LYS A 1 140 ? 38.321  -1.907  28.667 0.95  0.00 ? 140 LYS A H    3  
ATOM   8437   N N    C ALA A 1 141 ? 24.785  7.478   6.961  0.05  0.00 ? 141 ALA A N    3  
ATOM   8438   N N    O ALA A 1 141 ? 40.162  -2.563  26.218 0.95  0.00 ? 141 ALA A N    3  
ATOM   8439   C CA   C ALA A 1 141 ? 25.086  6.748   5.714  0.05  0.00 ? 141 ALA A CA   3  
ATOM   8440   C CA   O ALA A 1 141 ? 40.912  -3.420  25.279 0.95  0.00 ? 141 ALA A CA   3  
ATOM   8441   C C    C ALA A 1 141 ? 23.802  6.507   4.919  0.05  0.00 ? 141 ALA A C    3  
ATOM   8442   C C    O ALA A 1 141 ? 40.154  -3.547  23.958 0.95  0.00 ? 141 ALA A C    3  
ATOM   8443   O O    C ALA A 1 141 ? 23.901  6.342   3.698  0.05  0.00 ? 141 ALA A O    3  
ATOM   8444   O O    O ALA A 1 141 ? 40.804  -3.817  22.942 0.95  0.00 ? 141 ALA A O    3  
ATOM   8445   H H    C ALA A 1 141 ? 24.996  7.033   7.809  0.05  0.00 ? 141 ALA A H    3  
ATOM   8446   H H    O ALA A 1 141 ? 39.865  -2.966  27.061 0.95  0.00 ? 141 ALA A H    3  
ATOM   8447   N N    C LYS A 1 142 ? 22.645  6.484   5.549  0.05  0.00 ? 142 LYS A N    3  
ATOM   8448   N N    O LYS A 1 142 ? 38.849  -3.367  23.940 0.95  0.00 ? 142 LYS A N    3  
ATOM   8449   C CA   C LYS A 1 142 ? 21.337  6.294   4.962  0.05  0.00 ? 142 LYS A CA   3  
ATOM   8450   C CA   O LYS A 1 142 ? 37.977  -3.424  22.788 0.95  0.00 ? 142 LYS A CA   3  
ATOM   8451   C C    C LYS A 1 142 ? 20.434  7.524   5.014  0.05  0.00 ? 142 LYS A C    3  
ATOM   8452   C C    O LYS A 1 142 ? 37.363  -2.084  22.389 0.95  0.00 ? 142 LYS A C    3  
ATOM   8453   O O    C LYS A 1 142 ? 19.207  7.434   4.697  0.05  0.00 ? 142 LYS A O    3  
ATOM   8454   O O    O LYS A 1 142 ? 36.446  -2.033  21.512 0.95  0.00 ? 142 LYS A O    3  
ATOM   8455   H H    C LYS A 1 142 ? 22.673  6.626   6.518  0.05  0.00 ? 142 LYS A H    3  
ATOM   8456   H H    O LYS A 1 142 ? 38.426  -3.156  24.798 0.95  0.00 ? 142 LYS A H    3  
ATOM   8457   N N    C GLY A 1 143 ? 20.995  8.641   5.422  0.05  0.00 ? 143 GLY A N    3  
ATOM   8458   N N    O GLY A 1 143 ? 37.822  -1.025  23.018 0.95  0.00 ? 143 GLY A N    3  
ATOM   8459   C CA   C GLY A 1 143 ? 20.268  9.899   5.491  0.05  0.00 ? 143 GLY A CA   3  
ATOM   8460   C CA   O GLY A 1 143 ? 37.356  0.321   22.721 0.95  0.00 ? 143 GLY A CA   3  
ATOM   8461   C C    C GLY A 1 143 ? 19.432  10.024  6.786  0.05  0.00 ? 143 GLY A C    3  
ATOM   8462   C C    O GLY A 1 143 ? 36.029  0.656   23.440 0.95  0.00 ? 143 GLY A C    3  
ATOM   8463   O O    C GLY A 1 143 ? 18.566  10.884  6.807  0.05  0.00 ? 143 GLY A O    3  
ATOM   8464   O O    O GLY A 1 143 ? 35.405  1.623   23.033 0.95  0.00 ? 143 GLY A O    3  
ATOM   8465   H H    C GLY A 1 143 ? 21.945  8.629   5.666  0.05  0.00 ? 143 GLY A H    3  
ATOM   8466   H H    O GLY A 1 143 ? 38.520  -1.145  23.696 0.95  0.00 ? 143 GLY A H    3  
ATOM   8467   N N    C LYS A 1 144 ? 19.721  9.236   7.782  0.05  0.00 ? 144 LYS A N    3  
ATOM   8468   N N    O LYS A 1 144 ? 35.674  -0.085  24.451 0.95  0.00 ? 144 LYS A N    3  
ATOM   8469   C CA   C LYS A 1 144 ? 18.994  9.286   9.070  0.05  0.00 ? 144 LYS A CA   3  
ATOM   8470   C CA   O LYS A 1 144 ? 34.432  0.160   25.217 0.95  0.00 ? 144 LYS A CA   3  
ATOM   8471   C C    C LYS A 1 144 ? 19.980  9.676   10.169 0.05  0.00 ? 144 LYS A C    3  
ATOM   8472   C C    O LYS A 1 144 ? 34.810  0.498   26.658 0.95  0.00 ? 144 LYS A C    3  
ATOM   8473   O O    C LYS A 1 144 ? 21.193  9.439   10.016 0.05  0.00 ? 144 LYS A O    3  
ATOM   8474   O O    O LYS A 1 144 ? 35.892  0.090   27.119 0.95  0.00 ? 144 LYS A O    3  
ATOM   8475   H H    C LYS A 1 144 ? 20.454  8.593   7.679  0.05  0.00 ? 144 LYS A H    3  
ATOM   8476   H H    O LYS A 1 144 ? 36.256  -0.826  24.721 0.95  0.00 ? 144 LYS A H    3  
ATOM   8477   N N    C SER A 1 145 ? 19.475  10.216  11.286 0.05  0.00 ? 145 SER A N    3  
ATOM   8478   N N    O SER A 1 145 ? 33.918  1.185   27.384 0.95  0.00 ? 145 SER A N    3  
ATOM   8479   C CA   C SER A 1 145 ? 20.332  10.548  12.441 0.05  0.00 ? 145 SER A CA   3  
ATOM   8480   C CA   O SER A 1 145 ? 34.148  1.487   28.810 0.95  0.00 ? 145 SER A CA   3  
ATOM   8481   C C    C SER A 1 145 ? 19.944  9.589   13.592 0.05  0.00 ? 145 SER A C    3  
ATOM   8482   C C    O SER A 1 145 ? 33.109  0.679   29.624 0.95  0.00 ? 145 SER A C    3  
ATOM   8483   O O    C SER A 1 145 ? 18.853  9.022   13.622 0.05  0.00 ? 145 SER A O    3  
ATOM   8484   O O    O SER A 1 145 ? 32.067  0.267   29.117 0.95  0.00 ? 145 SER A O    3  
ATOM   8485   H H    C SER A 1 145 ? 18.505  10.341  11.360 0.05  0.00 ? 145 SER A H    3  
ATOM   8486   H H    O SER A 1 145 ? 33.066  1.444   26.973 0.95  0.00 ? 145 SER A H    3  
ATOM   8487   N N    C ALA A 1 146 ? 20.841  9.422   14.541 0.05  0.00 ? 146 ALA A N    3  
ATOM   8488   N N    O ALA A 1 146 ? 33.397  0.467   30.891 0.95  0.00 ? 146 ALA A N    3  
ATOM   8489   C CA   C ALA A 1 146 ? 20.655  8.556   15.686 0.05  0.00 ? 146 ALA A CA   3  
ATOM   8490   C CA   O ALA A 1 146 ? 32.549  -0.276  31.799 0.95  0.00 ? 146 ALA A CA   3  
ATOM   8491   C C    C ALA A 1 146 ? 19.657  9.117   16.698 0.05  0.00 ? 146 ALA A C    3  
ATOM   8492   C C    O ALA A 1 146 ? 31.286  0.489   32.192 0.95  0.00 ? 146 ALA A C    3  
ATOM   8493   O O    C ALA A 1 146 ? 18.664  8.440   17.031 0.05  0.00 ? 146 ALA A O    3  
ATOM   8494   O O    O ALA A 1 146 ? 30.165  -0.021  31.997 0.95  0.00 ? 146 ALA A O    3  
ATOM   8495   H H    C ALA A 1 146 ? 21.689  9.907   14.464 0.05  0.00 ? 146 ALA A H    3  
ATOM   8496   H H    O ALA A 1 146 ? 34.239  0.827   31.239 0.95  0.00 ? 146 ALA A H    3  
ATOM   8497   N N    C LEU A 1 147 ? 19.878  10.335  17.173 0.05  0.00 ? 147 LEU A N    3  
ATOM   8498   N N    O LEU A 1 147 ? 31.434  1.700   32.713 0.95  0.00 ? 147 LEU A N    3  
ATOM   8499   C CA   C LEU A 1 147 ? 19.040  10.935  18.220 0.05  0.00 ? 147 LEU A CA   3  
ATOM   8500   C CA   O LEU A 1 147 ? 30.299  2.485   33.214 0.95  0.00 ? 147 LEU A CA   3  
ATOM   8501   C C    C LEU A 1 147 ? 18.816  12.409  18.082 0.05  0.00 ? 147 LEU A C    3  
ATOM   8502   C C    O LEU A 1 147 ? 30.400  3.961   32.983 0.95  0.00 ? 147 LEU A C    3  
ATOM   8503   O O    C LEU A 1 147 ? 19.754  13.122  17.644 0.05  0.00 ? 147 LEU A O    3  
ATOM   8504   O O    O LEU A 1 147 ? 31.530  4.506   33.059 0.95  0.00 ? 147 LEU A O    3  
ATOM   8505   H H    C LEU A 1 147 ? 20.665  10.828  16.860 0.05  0.00 ? 147 LEU A H    3  
ATOM   8506   H H    O LEU A 1 147 ? 32.340  2.057   32.825 0.95  0.00 ? 147 LEU A H    3  
ATOM   8507   N N    C MET A 1 148 ? 17.644  12.880  18.431 0.05  0.00 ? 148 MET A N    3  
ATOM   8508   N N    O MET A 1 148 ? 29.294  4.610   32.712 0.95  0.00 ? 148 MET A N    3  
ATOM   8509   C CA   C MET A 1 148 ? 17.289  14.277  18.461 0.05  0.00 ? 148 MET A CA   3  
ATOM   8510   C CA   O MET A 1 148 ? 29.189  6.040   32.562 0.95  0.00 ? 148 MET A CA   3  
ATOM   8511   C C    C MET A 1 148 ? 16.373  14.514  19.686 0.05  0.00 ? 148 MET A C    3  
ATOM   8512   C C    O MET A 1 148 ? 27.844  6.491   33.181 0.95  0.00 ? 148 MET A C    3  
ATOM   8513   O O    C MET A 1 148 ? 15.336  13.834  19.773 0.05  0.00 ? 148 MET A O    3  
ATOM   8514   O O    O MET A 1 148 ? 26.804  5.964   32.750 0.95  0.00 ? 148 MET A O    3  
ATOM   8515   H H    C MET A 1 148 ? 16.980  12.238  18.760 0.05  0.00 ? 148 MET A H    3  
ATOM   8516   H H    O MET A 1 148 ? 28.464  4.090   32.674 0.95  0.00 ? 148 MET A H    3  
ATOM   8517   N N    C PHE A 1 149 ? 16.720  15.455  20.538 0.05  0.00 ? 149 PHE A N    3  
ATOM   8518   N N    O PHE A 1 149 ? 27.876  7.439   34.093 0.95  0.00 ? 149 PHE A N    3  
ATOM   8519   C CA   C PHE A 1 149 ? 15.891  15.803  21.704 0.05  0.00 ? 149 PHE A CA   3  
ATOM   8520   C CA   O PHE A 1 149 ? 26.651  7.984   34.703 0.95  0.00 ? 149 PHE A CA   3  
ATOM   8521   C C    C PHE A 1 149 ? 16.069  17.314  21.980 0.05  0.00 ? 149 PHE A C    3  
ATOM   8522   C C    O PHE A 1 149 ? 26.904  9.474   35.029 0.95  0.00 ? 149 PHE A C    3  
ATOM   8523   O O    C PHE A 1 149 ? 16.944  17.969  21.418 0.05  0.00 ? 149 PHE A O    3  
ATOM   8524   O O    O PHE A 1 149 ? 28.031  9.961   34.967 0.95  0.00 ? 149 PHE A O    3  
ATOM   8525   H H    C PHE A 1 149 ? 17.540  15.965  20.370 0.05  0.00 ? 149 PHE A H    3  
ATOM   8526   H H    O PHE A 1 149 ? 28.742  7.821   34.347 0.95  0.00 ? 149 PHE A H    3  
ATOM   8527   N N    C ASN A 1 150 ? 15.198  17.817  22.842 0.05  0.00 ? 150 ASN A N    3  
ATOM   8528   N N    O ASN A 1 150 ? 25.814  10.154  35.353 0.95  0.00 ? 150 ASN A N    3  
ATOM   8529   C CA   C ASN A 1 150 ? 15.192  19.225  23.239 0.05  0.00 ? 150 ASN A CA   3  
ATOM   8530   C CA   O ASN A 1 150 ? 25.835  11.576  35.694 0.95  0.00 ? 150 ASN A CA   3  
ATOM   8531   C C    C ASN A 1 150 ? 16.473  19.560  24.008 0.05  0.00 ? 150 ASN A C    3  
ATOM   8532   C C    O ASN A 1 150 ? 26.617  11.794  36.992 0.95  0.00 ? 150 ASN A C    3  
ATOM   8533   O O    C ASN A 1 150 ? 16.652  19.104  25.116 0.05  0.00 ? 150 ASN A O    3  
ATOM   8534   O O    O ASN A 1 150 ? 26.165  11.405  38.046 0.95  0.00 ? 150 ASN A O    3  
ATOM   8535   H H    C ASN A 1 150 ? 14.526  17.221  23.231 0.05  0.00 ? 150 ASN A H    3  
ATOM   8536   H H    O ASN A 1 150 ? 24.955  9.684   35.363 0.95  0.00 ? 150 ASN A H    3  
ATOM   8537   N N    C LEU A 1 151 ? 17.335  20.353  23.418 0.05  0.00 ? 151 LEU A N    3  
ATOM   8538   N N    O LEU A 1 151 ? 27.768  12.417  36.899 0.95  0.00 ? 151 LEU A N    3  
ATOM   8539   C CA   C LEU A 1 151 ? 18.575  20.778  24.026 0.05  0.00 ? 151 LEU A CA   3  
ATOM   8540   C CA   O LEU A 1 151 ? 28.607  12.718  38.036 0.95  0.00 ? 151 LEU A CA   3  
ATOM   8541   C C    C LEU A 1 151 ? 18.430  22.116  24.774 0.05  0.00 ? 151 LEU A C    3  
ATOM   8542   C C    O LEU A 1 151 ? 28.327  14.116  38.615 0.95  0.00 ? 151 LEU A C    3  
ATOM   8543   O O    C LEU A 1 151 ? 19.362  22.423  25.514 0.05  0.00 ? 151 LEU A O    3  
ATOM   8544   O O    O LEU A 1 151 ? 28.819  14.351  39.716 0.95  0.00 ? 151 LEU A O    3  
ATOM   8545   H H    C LEU A 1 151 ? 17.120  20.689  22.522 0.05  0.00 ? 151 LEU A H    3  
ATOM   8546   H H    O LEU A 1 151 ? 28.068  12.709  36.012 0.95  0.00 ? 151 LEU A H    3  
ATOM   8547   N N    C GLN A 1 152 ? 17.369  22.808  24.614 0.05  0.00 ? 152 GLN A N    3  
ATOM   8548   N N    O GLN A 1 152 ? 27.597  14.930  37.955 0.95  0.00 ? 152 GLN A N    3  
ATOM   8549   C CA   C GLN A 1 152 ? 17.103  24.134  25.152 0.05  0.00 ? 152 GLN A CA   3  
ATOM   8550   C CA   O GLN A 1 152 ? 27.312  16.317  38.292 0.95  0.00 ? 152 GLN A CA   3  
ATOM   8551   C C    C GLN A 1 152 ? 16.776  24.213  26.631 0.05  0.00 ? 152 GLN A C    3  
ATOM   8552   C C    O GLN A 1 152 ? 26.327  16.552  39.421 0.95  0.00 ? 152 GLN A C    3  
ATOM   8553   O O    C GLN A 1 152 ? 17.155  25.190  27.308 0.05  0.00 ? 152 GLN A O    3  
ATOM   8554   O O    O GLN A 1 152 ? 26.477  17.518  40.196 0.95  0.00 ? 152 GLN A O    3  
ATOM   8555   H H    C GLN A 1 152 ? 16.690  22.436  24.013 0.05  0.00 ? 152 GLN A H    3  
ATOM   8556   H H    O GLN A 1 152 ? 27.246  14.607  37.099 0.95  0.00 ? 152 GLN A H    3  
ATOM   8557   N N    C GLU A 1 153 ? 16.043  23.225  27.113 0.05  0.00 ? 153 GLU A N    3  
ATOM   8558   N N    O GLU A 1 153 ? 25.310  15.711  39.483 0.95  0.00 ? 153 GLU A N    3  
ATOM   8559   C CA   C GLU A 1 153 ? 15.632  23.180  28.512 0.05  0.00 ? 153 GLU A CA   3  
ATOM   8560   C CA   O GLU A 1 153 ? 24.272  15.829  40.502 0.95  0.00 ? 153 GLU A CA   3  
ATOM   8561   C C    C GLU A 1 153 ? 16.366  22.145  29.281 0.05  0.00 ? 153 GLU A C    3  
ATOM   8562   C C    O GLU A 1 153 ? 24.372  14.767  41.533 0.95  0.00 ? 153 GLU A C    3  
ATOM   8563   O O    C GLU A 1 153 ? 16.516  20.974  28.867 0.05  0.00 ? 153 GLU A O    3  
ATOM   8564   O O    O GLU A 1 153 ? 24.521  13.558  41.247 0.95  0.00 ? 153 GLU A O    3  
ATOM   8565   H H    C GLU A 1 153 ? 15.754  22.509  26.508 0.05  0.00 ? 153 GLU A H    3  
ATOM   8566   H H    O GLU A 1 153 ? 25.244  14.996  38.815 0.95  0.00 ? 153 GLU A H    3  
ATOM   8567   N N    C PRO A 1 154 ? 16.883  22.543  30.472 0.05  0.00 ? 154 PRO A N    3  
ATOM   8568   N N    O PRO A 1 154 ? 24.303  15.182  42.824 0.95  0.00 ? 154 PRO A N    3  
ATOM   8569   C CA   C PRO A 1 154 ? 17.632  21.649  31.329 0.05  0.00 ? 154 PRO A CA   3  
ATOM   8570   C CA   O PRO A 1 154 ? 24.395  14.264  43.939 0.95  0.00 ? 154 PRO A CA   3  
ATOM   8571   C C    C PRO A 1 154 ? 16.866  20.397  31.795 0.05  0.00 ? 154 PRO A C    3  
ATOM   8572   C C    O PRO A 1 154 ? 23.317  13.166  43.972 0.95  0.00 ? 154 PRO A C    3  
ATOM   8573   O O    C PRO A 1 154 ? 17.523  19.450  32.171 0.05  0.00 ? 154 PRO A O    3  
ATOM   8574   O O    O PRO A 1 154 ? 23.555  12.171  44.623 0.95  0.00 ? 154 PRO A O    3  
ATOM   8575   N N    C TYR A 1 155 ? 15.571  20.459  31.836 0.05  0.00 ? 155 TYR A N    3  
ATOM   8576   N N    O TYR A 1 155 ? 22.191  13.403  43.373 0.95  0.00 ? 155 TYR A N    3  
ATOM   8577   C CA   C TYR A 1 155 ? 14.737  19.300  32.220 0.05  0.00 ? 155 TYR A CA   3  
ATOM   8578   C CA   O TYR A 1 155 ? 21.108  12.399  43.300 0.95  0.00 ? 155 TYR A CA   3  
ATOM   8579   C C    C TYR A 1 155 ? 15.136  18.112  31.299 0.05  0.00 ? 155 TYR A C    3  
ATOM   8580   C C    O TYR A 1 155 ? 21.714  11.102  42.694 0.95  0.00 ? 155 TYR A C    3  
ATOM   8581   O O    C TYR A 1 155 ? 15.318  16.976  31.735 0.05  0.00 ? 155 TYR A O    3  
ATOM   8582   O O    O TYR A 1 155 ? 21.485  9.988   43.165 0.95  0.00 ? 155 TYR A O    3  
ATOM   8583   H H    C TYR A 1 155 ? 15.129  21.293  31.572 0.05  0.00 ? 155 TYR A H    3  
ATOM   8584   H H    O TYR A 1 155 ? 22.067  14.266  42.925 0.95  0.00 ? 155 TYR A H    3  
ATOM   8585   N N    C PHE A 1 156 ? 15.314  18.405  30.017 0.05  0.00 ? 156 PHE A N    3  
ATOM   8586   N N    O PHE A 1 156 ? 22.533  11.269  41.664 0.95  0.00 ? 156 PHE A N    3  
ATOM   8587   C CA   C PHE A 1 156 ? 15.726  17.414  29.019 0.05  0.00 ? 156 PHE A CA   3  
ATOM   8588   C CA   O PHE A 1 156 ? 23.218  10.158  40.997 0.95  0.00 ? 156 PHE A CA   3  
ATOM   8589   C C    C PHE A 1 156 ? 17.188  17.056  29.038 0.05  0.00 ? 156 PHE A C    3  
ATOM   8590   C C    O PHE A 1 156 ? 24.413  9.610   41.730 0.95  0.00 ? 156 PHE A C    3  
ATOM   8591   O O    C PHE A 1 156 ? 17.537  15.866  28.840 0.05  0.00 ? 156 PHE A O    3  
ATOM   8592   O O    O PHE A 1 156 ? 24.626  8.372   41.730 0.95  0.00 ? 156 PHE A O    3  
ATOM   8593   H H    C PHE A 1 156 ? 15.186  19.333  29.728 0.05  0.00 ? 156 PHE A H    3  
ATOM   8594   H H    O PHE A 1 156 ? 22.706  12.181  41.348 0.95  0.00 ? 156 PHE A H    3  
ATOM   8595   N N    C THR A 1 157 ? 18.128  17.947  29.342 0.05  0.00 ? 157 THR A N    3  
ATOM   8596   N N    O THR A 1 157 ? 25.213  10.388  42.454 0.95  0.00 ? 157 THR A N    3  
ATOM   8597   C CA   C THR A 1 157 ? 19.536  17.585  29.334 0.05  0.00 ? 157 THR A CA   3  
ATOM   8598   C CA   O THR A 1 157 ? 26.374  9.841   43.138 0.95  0.00 ? 157 THR A CA   3  
ATOM   8599   C C    C THR A 1 157 ? 20.051  17.057  30.636 0.05  0.00 ? 157 THR A C    3  
ATOM   8600   C C    O THR A 1 157 ? 26.106  9.350   44.526 0.95  0.00 ? 157 THR A C    3  
ATOM   8601   O O    C THR A 1 157 ? 21.067  16.369  30.675 0.05  0.00 ? 157 THR A O    3  
ATOM   8602   O O    O THR A 1 157 ? 26.856  8.537   45.058 0.95  0.00 ? 157 THR A O    3  
ATOM   8603   H H    C THR A 1 157 ? 17.868  18.867  29.561 0.05  0.00 ? 157 THR A H    3  
ATOM   8604   H H    O THR A 1 157 ? 25.025  11.348  42.517 0.95  0.00 ? 157 THR A H    3  
ATOM   8605   N N    C TRP A 1 158 ? 19.351  17.317  31.729 0.05  0.00 ? 158 TRP A N    3  
ATOM   8606   N N    O TRP A 1 158 ? 25.014  9.785   45.135 0.95  0.00 ? 158 TRP A N    3  
ATOM   8607   C CA   C TRP A 1 158 ? 19.767  16.839  33.053 0.05  0.00 ? 158 TRP A CA   3  
ATOM   8608   C CA   O TRP A 1 158 ? 24.658  9.358   46.494 0.95  0.00 ? 158 TRP A CA   3  
ATOM   8609   C C    C TRP A 1 158 ? 20.086  15.376  33.153 0.05  0.00 ? 158 TRP A C    3  
ATOM   8610   C C    O TRP A 1 158 ? 24.659  7.877   46.739 0.95  0.00 ? 158 TRP A C    3  
ATOM   8611   O O    C TRP A 1 158 ? 21.087  15.044  33.832 0.05  0.00 ? 158 TRP A O    3  
ATOM   8612   O O    O TRP A 1 158 ? 25.141  7.468   47.822 0.95  0.00 ? 158 TRP A O    3  
ATOM   8613   H H    C TRP A 1 158 ? 18.527  17.842  31.651 0.05  0.00 ? 158 TRP A H    3  
ATOM   8614   H H    O TRP A 1 158 ? 24.423  10.408  44.663 0.95  0.00 ? 158 TRP A H    3  
ATOM   8615   N N    C PRO A 1 159 ? 19.288  14.460  32.553 0.05  0.00 ? 159 PRO A N    3  
ATOM   8616   N N    O PRO A 1 159 ? 24.120  7.033   45.826 0.95  0.00 ? 159 PRO A N    3  
ATOM   8617   C CA   C PRO A 1 159 ? 19.604  13.025  32.663 0.05  0.00 ? 159 PRO A CA   3  
ATOM   8618   C CA   O PRO A 1 159 ? 24.118  5.582   46.079 0.95  0.00 ? 159 PRO A CA   3  
ATOM   8619   C C    C PRO A 1 159 ? 21.038  12.671  32.386 0.05  0.00 ? 159 PRO A C    3  
ATOM   8620   C C    O PRO A 1 159 ? 25.433  5.019   46.540 0.95  0.00 ? 159 PRO A C    3  
ATOM   8621   O O    C PRO A 1 159 ? 21.626  11.839  33.101 0.05  0.00 ? 159 PRO A O    3  
ATOM   8622   O O    O PRO A 1 159 ? 25.465  4.173   47.453 0.95  0.00 ? 159 PRO A O    3  
ATOM   8623   N N    C LEU A 1 160 ? 21.619  13.267  31.343 0.05  0.00 ? 160 LEU A N    3  
ATOM   8624   N N    O LEU A 1 160 ? 26.530  5.450   45.915 0.95  0.00 ? 160 LEU A N    3  
ATOM   8625   C CA   C LEU A 1 160 ? 23.007  13.042  30.932 0.05  0.00 ? 160 LEU A CA   3  
ATOM   8626   C CA   O LEU A 1 160 ? 27.890  5.010   46.237 0.95  0.00 ? 160 LEU A CA   3  
ATOM   8627   C C    C LEU A 1 160 ? 24.010  13.764  31.858 0.05  0.00 ? 160 LEU A C    3  
ATOM   8628   C C    O LEU A 1 160 ? 28.417  5.660   47.535 0.95  0.00 ? 160 LEU A C    3  
ATOM   8629   O O    C LEU A 1 160 ? 24.988  13.163  32.262 0.05  0.00 ? 160 LEU A O    3  
ATOM   8630   O O    O LEU A 1 160 ? 28.971  4.966   48.367 0.95  0.00 ? 160 LEU A O    3  
ATOM   8631   H H    C LEU A 1 160 ? 21.083  13.899  30.821 0.05  0.00 ? 160 LEU A H    3  
ATOM   8632   H H    O LEU A 1 160 ? 26.418  6.106   45.196 0.95  0.00 ? 160 LEU A H    3  
ATOM   8633   N N    C ILE A 1 161 ? 23.722  15.027  32.140 0.05  0.00 ? 161 ILE A N    3  
ATOM   8634   N N    O ILE A 1 161 ? 28.227  6.968   47.638 0.95  0.00 ? 161 ILE A N    3  
ATOM   8635   C CA   C ILE A 1 161 ? 24.579  15.863  33.006 0.05  0.00 ? 161 ILE A CA   3  
ATOM   8636   C CA   O ILE A 1 161 ? 28.675  7.746   48.812 0.95  0.00 ? 161 ILE A CA   3  
ATOM   8637   C C    C ILE A 1 161 ? 24.730  15.258  34.387 0.05  0.00 ? 161 ILE A C    3  
ATOM   8638   C C    O ILE A 1 161 ? 28.044  7.234   50.090 0.95  0.00 ? 161 ILE A C    3  
ATOM   8639   O O    C ILE A 1 161 ? 25.831  15.161  34.919 0.05  0.00 ? 161 ILE A O    3  
ATOM   8640   O O    O ILE A 1 161 ? 28.720  7.031   51.094 0.95  0.00 ? 161 ILE A O    3  
ATOM   8641   H H    C ILE A 1 161 ? 22.911  15.421  31.757 0.05  0.00 ? 161 ILE A H    3  
ATOM   8642   H H    O ILE A 1 161 ? 27.775  7.437   46.906 0.95  0.00 ? 161 ILE A H    3  
ATOM   8643   N N    C ALA A 1 162 ? 23.656  14.782  34.976 0.05  0.00 ? 162 ALA A N    3  
ATOM   8644   N N    O ALA A 1 162 ? 26.760  6.952   50.078 0.95  0.00 ? 162 ALA A N    3  
ATOM   8645   C CA   C ALA A 1 162 ? 23.612  14.153  36.282 0.05  0.00 ? 162 ALA A CA   3  
ATOM   8646   C CA   O ALA A 1 162 ? 25.993  6.437   51.196 0.95  0.00 ? 162 ALA A CA   3  
ATOM   8647   C C    C ALA A 1 162 ? 24.126  12.748  36.377 0.05  0.00 ? 162 ALA A C    3  
ATOM   8648   C C    O ALA A 1 162 ? 26.173  4.987   51.532 0.95  0.00 ? 162 ALA A C    3  
ATOM   8649   O O    C ALA A 1 162 ? 24.581  12.304  37.458 0.05  0.00 ? 162 ALA A O    3  
ATOM   8650   O O    O ALA A 1 162 ? 25.974  4.570   52.698 0.95  0.00 ? 162 ALA A O    3  
ATOM   8651   H H    C ALA A 1 162 ? 22.811  14.846  34.483 0.05  0.00 ? 162 ALA A H    3  
ATOM   8652   H H    O ALA A 1 162 ? 26.281  7.091   49.234 0.95  0.00 ? 162 ALA A H    3  
ATOM   8653   N N    C ALA A 1 163 ? 24.039  11.937  35.338 0.05  0.00 ? 163 ALA A N    3  
ATOM   8654   N N    O ALA A 1 163 ? 26.476  4.118   50.585 0.95  0.00 ? 163 ALA A N    3  
ATOM   8655   C CA   C ALA A 1 163 ? 24.446  10.545  35.263 0.05  0.00 ? 163 ALA A CA   3  
ATOM   8656   C CA   O ALA A 1 163 ? 26.648  2.682   50.721 0.95  0.00 ? 163 ALA A CA   3  
ATOM   8657   C C    C ALA A 1 163 ? 25.657  10.170  36.099 0.05  0.00 ? 163 ALA A C    3  
ATOM   8658   C C    O ALA A 1 163 ? 27.229  2.214   52.043 0.95  0.00 ? 163 ALA A C    3  
ATOM   8659   O O    C ALA A 1 163 ? 25.562  9.272   36.948 0.05  0.00 ? 163 ALA A O    3  
ATOM   8660   O O    O ALA A 1 163 ? 26.597  1.404   52.738 0.95  0.00 ? 163 ALA A O    3  
ATOM   8661   H H    C ALA A 1 163 ? 23.629  12.312  34.530 0.05  0.00 ? 163 ALA A H    3  
ATOM   8662   H H    O ALA A 1 163 ? 26.572  4.481   49.679 0.95  0.00 ? 163 ALA A H    3  
ATOM   8663   N N    C ASP A 1 164 ? 26.792  10.807  35.832 0.05  0.00 ? 164 ASP A N    3  
ATOM   8664   N N    O ASP A 1 164 ? 28.434  2.670   52.366 0.95  0.00 ? 164 ASP A N    3  
ATOM   8665   C CA   C ASP A 1 164 ? 28.038  10.538  36.521 0.05  0.00 ? 164 ASP A CA   3  
ATOM   8666   C CA   O ASP A 1 164 ? 29.132  2.291   53.577 0.95  0.00 ? 164 ASP A CA   3  
ATOM   8667   C C    C ASP A 1 164 ? 28.307  11.320  37.794 0.05  0.00 ? 164 ASP A C    3  
ATOM   8668   C C    O ASP A 1 164 ? 28.868  3.125   54.818 0.95  0.00 ? 164 ASP A C    3  
ATOM   8669   O O    C ASP A 1 164 ? 29.470  11.458  38.218 0.05  0.00 ? 164 ASP A O    3  
ATOM   8670   O O    O ASP A 1 164 ? 29.686  3.138   55.757 0.95  0.00 ? 164 ASP A O    3  
ATOM   8671   H H    C ASP A 1 164 ? 26.792  11.477  35.117 0.05  0.00 ? 164 ASP A H    3  
ATOM   8672   H H    O ASP A 1 164 ? 28.883  3.278   51.742 0.95  0.00 ? 164 ASP A H    3  
ATOM   8673   N N    C GLY A 1 165 ? 27.307  11.787  38.495 0.05  0.00 ? 165 GLY A N    3  
ATOM   8674   N N    O GLY A 1 165 ? 27.740  3.774   54.938 0.95  0.00 ? 165 GLY A N    3  
ATOM   8675   C CA   C GLY A 1 165 ? 27.534  12.507  39.764 0.05  0.00 ? 165 GLY A CA   3  
ATOM   8676   C CA   O GLY A 1 165 ? 27.433  4.552   56.155 0.95  0.00 ? 165 GLY A CA   3  
ATOM   8677   C C    C GLY A 1 165 ? 26.845  13.799  39.987 0.05  0.00 ? 165 GLY A C    3  
ATOM   8678   C C    O GLY A 1 165 ? 26.931  5.938   56.010 0.95  0.00 ? 165 GLY A C    3  
ATOM   8679   O O    C GLY A 1 165 ? 26.916  14.255  41.138 0.05  0.00 ? 165 GLY A O    3  
ATOM   8680   O O    O GLY A 1 165 ? 26.505  6.467   57.048 0.95  0.00 ? 165 GLY A O    3  
ATOM   8681   H H    C GLY A 1 165 ? 26.388  11.629  38.189 0.05  0.00 ? 165 GLY A H    3  
ATOM   8682   H H    O GLY A 1 165 ? 27.072  3.717   54.222 0.95  0.00 ? 165 GLY A H    3  
ATOM   8683   N N    C GLY A 1 166 ? 26.179  14.431  39.080 0.05  0.00 ? 166 GLY A N    3  
ATOM   8684   N N    O GLY A 1 166 ? 26.893  6.582   54.892 0.95  0.00 ? 166 GLY A N    3  
ATOM   8685   C CA   C GLY A 1 166 ? 25.490  15.712  39.307 0.05  0.00 ? 166 GLY A CA   3  
ATOM   8686   C CA   O GLY A 1 166 ? 26.388  7.957   54.751 0.95  0.00 ? 166 GLY A CA   3  
ATOM   8687   C C    C GLY A 1 166 ? 24.210  15.518  40.075 0.05  0.00 ? 166 GLY A C    3  
ATOM   8688   C C    O GLY A 1 166 ? 24.883  7.996   54.794 0.95  0.00 ? 166 GLY A C    3  
ATOM   8689   O O    C GLY A 1 166 ? 23.595  14.454  40.027 0.05  0.00 ? 166 GLY A O    3  
ATOM   8690   O O    O GLY A 1 166 ? 24.213  7.024   54.452 0.95  0.00 ? 166 GLY A O    3  
ATOM   8691   H H    C GLY A 1 166 ? 26.124  14.031  38.186 0.05  0.00 ? 166 GLY A H    3  
ATOM   8692   H H    O GLY A 1 166 ? 27.217  6.126   54.087 0.95  0.00 ? 166 GLY A H    3  
ATOM   8693   N N    C TYR A 1 167 ? 23.783  16.559  40.765 0.05  0.00 ? 167 TYR A N    3  
ATOM   8694   N N    O TYR A 1 167 ? 24.342  9.135   55.185 0.95  0.00 ? 167 TYR A N    3  
ATOM   8695   C CA   C TYR A 1 167 ? 22.522  16.597  41.545 0.05  0.00 ? 167 TYR A CA   3  
ATOM   8696   C CA   O TYR A 1 167 ? 22.885  9.401   55.247 0.95  0.00 ? 167 TYR A CA   3  
ATOM   8697   C C    C TYR A 1 167 ? 22.195  18.083  41.763 0.05  0.00 ? 167 TYR A C    3  
ATOM   8698   C C    O TYR A 1 167 ? 22.727  10.930  55.275 0.95  0.00 ? 167 TYR A C    3  
ATOM   8699   O O    C TYR A 1 167 ? 23.151  18.860  41.673 0.05  0.00 ? 167 TYR A O    3  
ATOM   8700   O O    O TYR A 1 167 ? 23.714  11.562  55.664 0.95  0.00 ? 167 TYR A O    3  
ATOM   8701   H H    C TYR A 1 167 ? 24.322  17.377  40.733 0.05  0.00 ? 167 TYR A H    3  
ATOM   8702   H H    O TYR A 1 167 ? 24.948  9.868   55.420 0.95  0.00 ? 167 TYR A H    3  
ATOM   8703   N N    C ALA A 1 168 ? 20.961  18.428  41.990 0.05  0.00 ? 168 ALA A N    3  
ATOM   8704   N N    O ALA A 1 168 ? 21.607  11.453  54.868 0.95  0.00 ? 168 ALA A N    3  
ATOM   8705   C CA   C ALA A 1 168 ? 20.537  19.811  42.189 0.05  0.00 ? 168 ALA A CA   3  
ATOM   8706   C CA   O ALA A 1 168 ? 21.359  12.892  54.832 0.95  0.00 ? 168 ALA A CA   3  
ATOM   8707   C C    C ALA A 1 168 ? 20.963  20.231  43.614 0.05  0.00 ? 168 ALA A C    3  
ATOM   8708   C C    O ALA A 1 168 ? 21.101  13.359  56.282 0.95  0.00 ? 168 ALA A C    3  
ATOM   8709   O O    C ALA A 1 168 ? 21.871  21.054  43.740 0.05  0.00 ? 168 ALA A O    3  
ATOM   8710   O O    O ALA A 1 168 ? 21.949  14.060  56.836 0.95  0.00 ? 168 ALA A O    3  
ATOM   8711   H H    C ALA A 1 168 ? 20.280  17.724  42.014 0.05  0.00 ? 168 ALA A H    3  
ATOM   8712   H H    O ALA A 1 168 ? 20.900  10.851  54.556 0.95  0.00 ? 168 ALA A H    3  
ATOM   8713   N N    C PHE A 1 169 ? 20.376  19.575  44.594 0.05  0.00 ? 169 PHE A N    3  
ATOM   8714   N N    O PHE A 1 169 ? 20.020  12.864  56.850 0.95  0.00 ? 169 PHE A N    3  
ATOM   8715   C CA   C PHE A 1 169 ? 20.610  19.799  46.029 0.05  0.00 ? 169 PHE A CA   3  
ATOM   8716   C CA   O PHE A 1 169 ? 19.562  13.164  58.215 0.95  0.00 ? 169 PHE A CA   3  
ATOM   8717   C C    C PHE A 1 169 ? 20.732  18.491  46.782 0.05  0.00 ? 169 PHE A C    3  
ATOM   8718   C C    O PHE A 1 169 ? 19.101  11.913  58.933 0.95  0.00 ? 169 PHE A C    3  
ATOM   8719   O O    C PHE A 1 169 ? 19.882  17.577  46.629 0.05  0.00 ? 169 PHE A O    3  
ATOM   8720   O O    O PHE A 1 169 ? 18.302  11.113  58.384 0.95  0.00 ? 169 PHE A O    3  
ATOM   8721   H H    C PHE A 1 169 ? 19.726  18.883  44.346 0.05  0.00 ? 169 PHE A H    3  
ATOM   8722   H H    O PHE A 1 169 ? 19.474  12.249  56.316 0.95  0.00 ? 169 PHE A H    3  
ATOM   8723   N N    C LYS A 1 170 ? 21.745  18.354  47.594 0.05  0.00 ? 170 LYS A N    3  
ATOM   8724   N N    O LYS A 1 170 ? 19.559  11.705  60.137 0.95  0.00 ? 170 LYS A N    3  
ATOM   8725   C CA   C LYS A 1 170 ? 21.944  17.133  48.375 0.05  0.00 ? 170 LYS A CA   3  
ATOM   8726   C CA   O LYS A 1 170 ? 19.164  10.532  60.917 0.95  0.00 ? 170 LYS A CA   3  
ATOM   8727   C C    C LYS A 1 170 ? 20.758  16.887  49.302 0.05  0.00 ? 170 LYS A C    3  
ATOM   8728   C C    O LYS A 1 170 ? 17.656  10.518  61.144 0.95  0.00 ? 170 LYS A C    3  
ATOM   8729   O O    C LYS A 1 170 ? 20.337  17.749  50.065 0.05  0.00 ? 170 LYS A O    3  
ATOM   8730   O O    O LYS A 1 170 ? 17.057  11.485  61.602 0.95  0.00 ? 170 LYS A O    3  
ATOM   8731   H H    C LYS A 1 170 ? 22.383  19.090  47.688 0.05  0.00 ? 170 LYS A H    3  
ATOM   8732   H H    O LYS A 1 170 ? 20.177  12.354  60.531 0.95  0.00 ? 170 LYS A H    3  
ATOM   8733   N N    C TYR A 1 171 ? 20.194  15.686  49.203 0.05  0.00 ? 171 TYR A N    3  
ATOM   8734   N N    O TYR A 1 171 ? 17.033  9.400   60.784 0.95  0.00 ? 171 TYR A N    3  
ATOM   8735   C CA   C TYR A 1 171 ? 19.034  15.312  50.041 0.05  0.00 ? 171 TYR A CA   3  
ATOM   8736   C CA   O TYR A 1 171 ? 15.571  9.250   60.946 0.95  0.00 ? 171 TYR A CA   3  
ATOM   8737   C C    C TYR A 1 171 ? 19.482  14.145  50.915 0.05  0.00 ? 171 TYR A C    3  
ATOM   8738   C C    O TYR A 1 171 ? 15.353  8.104   61.929 0.95  0.00 ? 171 TYR A C    3  
ATOM   8739   O O    C TYR A 1 171 ? 20.137  13.219  50.394 0.05  0.00 ? 171 TYR A O    3  
ATOM   8740   O O    O TYR A 1 171 ? 16.027  7.061   61.797 0.95  0.00 ? 171 TYR A O    3  
ATOM   8741   H H    C TYR A 1 171 ? 20.555  15.038  48.563 0.05  0.00 ? 171 TYR A H    3  
ATOM   8742   H H    O TYR A 1 171 ? 17.553  8.662   60.403 0.95  0.00 ? 171 TYR A H    3  
ATOM   8743   N N    C GLU A 1 172 ? 19.135  14.234  52.199 0.05  0.00 ? 172 GLU A N    3  
ATOM   8744   N N    O GLU A 1 172 ? 14.447  8.337   62.878 0.95  0.00 ? 172 GLU A N    3  
ATOM   8745   C CA   C GLU A 1 172 ? 19.556  13.121  53.080 0.05  0.00 ? 172 GLU A CA   3  
ATOM   8746   C CA   O GLU A 1 172 ? 14.211  7.248   63.854 0.95  0.00 ? 172 GLU A CA   3  
ATOM   8747   C C    C GLU A 1 172 ? 18.749  12.922  54.324 0.05  0.00 ? 172 GLU A C    3  
ATOM   8748   C C    O GLU A 1 172 ? 12.884  7.255   64.543 0.95  0.00 ? 172 GLU A C    3  
ATOM   8749   O O    C GLU A 1 172 ? 19.293  12.302  55.285 0.05  0.00 ? 172 GLU A O    3  
ATOM   8750   O O    O GLU A 1 172 ? 12.791  6.643   65.648 0.95  0.00 ? 172 GLU A O    3  
ATOM   8751   H H    C GLU A 1 172 ? 18.631  15.000  52.543 0.05  0.00 ? 172 GLU A H    3  
ATOM   8752   H H    O GLU A 1 172 ? 13.964  9.187   62.930 0.95  0.00 ? 172 GLU A H    3  
ATOM   8753   N N    C ASN A 1 173 ? 17.481  13.329  54.345 0.05  0.00 ? 173 ASN A N    3  
ATOM   8754   N N    O ASN A 1 173 ? 11.844  7.829   63.940 0.95  0.00 ? 173 ASN A N    3  
ATOM   8755   C CA   C ASN A 1 173 ? 16.676  13.180  55.572 0.05  0.00 ? 173 ASN A CA   3  
ATOM   8756   C CA   O ASN A 1 173 ? 10.534  7.883   64.615 0.95  0.00 ? 173 ASN A CA   3  
ATOM   8757   C C    C ASN A 1 173 ? 15.325  13.860  55.468 0.05  0.00 ? 173 ASN A C    3  
ATOM   8758   C C    O ASN A 1 173 ? 9.525   8.728   63.862 0.95  0.00 ? 173 ASN A C    3  
ATOM   8759   O O    C ASN A 1 173 ? 14.878  14.448  56.493 0.05  0.00 ? 173 ASN A O    3  
ATOM   8760   O O    O ASN A 1 173 ? 8.735   9.447   64.536 0.95  0.00 ? 173 ASN A O    3  
ATOM   8761   H H    C ASN A 1 173 ? 17.090  13.753  53.553 0.05  0.00 ? 173 ASN A H    3  
ATOM   8762   H H    O ASN A 1 173 ? 11.956  8.239   63.057 0.95  0.00 ? 173 ASN A H    3  
ATOM   8763   N N    C GLY A 1 174 ? 14.703  13.820  54.316 0.05  0.00 ? 174 GLY A N    3  
ATOM   8764   N N    O GLY A 1 174 ? 9.541   8.683   62.553 0.95  0.00 ? 174 GLY A N    3  
ATOM   8765   C CA   C GLY A 1 174 ? 13.393  14.497  54.143 0.05  0.00 ? 174 GLY A CA   3  
ATOM   8766   C CA   O GLY A 1 174 ? 8.601   9.515   61.759 0.95  0.00 ? 174 GLY A CA   3  
ATOM   8767   C C    C GLY A 1 174 ? 13.657  16.004  54.018 0.05  0.00 ? 174 GLY A C    3  
ATOM   8768   C C    O GLY A 1 174 ? 9.121   10.959  61.778 0.95  0.00 ? 174 GLY A C    3  
ATOM   8769   O O    C GLY A 1 174 ? 12.724  16.824  53.912 0.05  0.00 ? 174 GLY A O    3  
ATOM   8770   O O    O GLY A 1 174 ? 8.495   11.886  61.227 0.95  0.00 ? 174 GLY A O    3  
ATOM   8771   H H    C GLY A 1 174 ? 15.117  13.359  53.555 0.05  0.00 ? 174 GLY A H    3  
ATOM   8772   H H    O GLY A 1 174 ? 10.194  8.114   62.093 0.95  0.00 ? 174 GLY A H    3  
ATOM   8773   N N    C LYS A 1 175 ? 14.951  16.277  54.011 0.05  0.00 ? 175 LYS A N    3  
ATOM   8774   N N    O LYS A 1 175 ? 10.281  11.054  62.405 0.95  0.00 ? 175 LYS A N    3  
ATOM   8775   C CA   C LYS A 1 175 ? 15.497  17.629  53.949 0.05  0.00 ? 175 LYS A CA   3  
ATOM   8776   C CA   O LYS A 1 175 ? 10.990  12.312  62.617 0.95  0.00 ? 175 LYS A CA   3  
ATOM   8777   C C    C LYS A 1 175 ? 16.659  17.750  52.963 0.05  0.00 ? 175 LYS A C    3  
ATOM   8778   C C    O LYS A 1 175 ? 12.487  12.201  62.327 0.95  0.00 ? 175 LYS A C    3  
ATOM   8779   O O    C LYS A 1 175 ? 17.571  16.931  52.831 0.05  0.00 ? 175 LYS A O    3  
ATOM   8780   O O    O LYS A 1 175 ? 13.210  11.259  62.660 0.95  0.00 ? 175 LYS A O    3  
ATOM   8781   H H    C LYS A 1 175 ? 15.579  15.528  54.081 0.05  0.00 ? 175 LYS A H    3  
ATOM   8782   H H    O LYS A 1 175 ? 10.673  10.236  62.775 0.95  0.00 ? 175 LYS A H    3  
ATOM   8783   N N    C TYR A 1 176 ? 16.578  18.877  52.275 0.05  0.00 ? 176 TYR A N    3  
ATOM   8784   N N    O TYR A 1 176 ? 12.924  13.272  61.686 0.95  0.00 ? 176 TYR A N    3  
ATOM   8785   C CA   C TYR A 1 176 ? 17.516  19.327  51.268 0.05  0.00 ? 176 TYR A CA   3  
ATOM   8786   C CA   O TYR A 1 176 ? 14.289  13.514  61.267 0.95  0.00 ? 176 TYR A CA   3  
ATOM   8787   C C    C TYR A 1 176 ? 18.512  20.331  51.873 0.05  0.00 ? 176 TYR A C    3  
ATOM   8788   C C    O TYR A 1 176 ? 15.009  14.419  62.281 0.95  0.00 ? 176 TYR A C    3  
ATOM   8789   O O    C TYR A 1 176 ? 18.046  21.315  52.477 0.05  0.00 ? 176 TYR A O    3  
ATOM   8790   O O    O TYR A 1 176 ? 14.467  15.500  62.578 0.95  0.00 ? 176 TYR A O    3  
ATOM   8791   H H    C TYR A 1 176 ? 15.819  19.465  52.472 0.05  0.00 ? 176 TYR A H    3  
ATOM   8792   H H    O TYR A 1 176 ? 12.265  13.970  61.485 0.95  0.00 ? 176 TYR A H    3  
ATOM   8793   N N    C ASP A 1 177 ? 19.784  20.070  51.673 0.05  0.00 ? 177 ASP A N    3  
ATOM   8794   N N    O ASP A 1 177 ? 16.161  13.976  62.730 0.95  0.00 ? 177 ASP A N    3  
ATOM   8795   C CA   C ASP A 1 177 ? 20.886  20.952  52.112 0.05  0.00 ? 177 ASP A CA   3  
ATOM   8796   C CA   O ASP A 1 177 ? 17.034  14.733  63.652 0.95  0.00 ? 177 ASP A CA   3  
ATOM   8797   C C    C ASP A 1 177 ? 21.115  21.932  50.948 0.05  0.00 ? 177 ASP A C    3  
ATOM   8798   C C    O ASP A 1 177 ? 17.946  15.581  62.748 0.95  0.00 ? 177 ASP A C    3  
ATOM   8799   O O    C ASP A 1 177 ? 21.745  21.533  49.951 0.05  0.00 ? 177 ASP A O    3  
ATOM   8800   O O    O ASP A 1 177 ? 18.909  15.026  62.188 0.95  0.00 ? 177 ASP A O    3  
ATOM   8801   H H    C ASP A 1 177 ? 20.013  19.267  51.162 0.05  0.00 ? 177 ASP A H    3  
ATOM   8802   H H    O ASP A 1 177 ? 16.482  13.112  62.398 0.95  0.00 ? 177 ASP A H    3  
ATOM   8803   N N    C ILE A 1 178 ? 20.617  23.143  51.072 0.05  0.00 ? 178 ILE A N    3  
ATOM   8804   N N    O ILE A 1 178 ? 17.643  16.854  62.611 0.95  0.00 ? 178 ILE A N    3  
ATOM   8805   C CA   C ILE A 1 178 ? 20.719  24.114  49.990 0.05  0.00 ? 178 ILE A CA   3  
ATOM   8806   C CA   O ILE A 1 178 ? 18.405  17.717  61.717 0.95  0.00 ? 178 ILE A CA   3  
ATOM   8807   C C    C ILE A 1 178 ? 22.078  24.703  49.701 0.05  0.00 ? 178 ILE A C    3  
ATOM   8808   C C    O ILE A 1 178 ? 19.806  18.095  62.129 0.95  0.00 ? 178 ILE A C    3  
ATOM   8809   O O    C ILE A 1 178 ? 22.231  25.534  48.772 0.05  0.00 ? 178 ILE A O    3  
ATOM   8810   O O    O ILE A 1 178 ? 20.516  18.824  61.394 0.95  0.00 ? 178 ILE A O    3  
ATOM   8811   H H    C ILE A 1 178 ? 20.125  23.378  51.887 0.05  0.00 ? 178 ILE A H    3  
ATOM   8812   H H    O ILE A 1 178 ? 16.862  17.215  63.080 0.95  0.00 ? 178 ILE A H    3  
ATOM   8813   N N    C LYS A 1 179 ? 23.076  24.295  50.435 0.05  0.00 ? 179 LYS A N    3  
ATOM   8814   N N    O LYS A 1 179 ? 20.248  17.614  63.259 0.95  0.00 ? 179 LYS A N    3  
ATOM   8815   C CA   C LYS A 1 179 ? 24.447  24.751  50.260 0.05  0.00 ? 179 LYS A CA   3  
ATOM   8816   C CA   O LYS A 1 179 ? 21.584  17.868  63.777 0.95  0.00 ? 179 LYS A CA   3  
ATOM   8817   C C    C LYS A 1 179 ? 25.281  23.590  49.724 0.05  0.00 ? 179 LYS A C    3  
ATOM   8818   C C    O LYS A 1 179 ? 22.382  16.568  63.720 0.95  0.00 ? 179 LYS A C    3  
ATOM   8819   O O    C LYS A 1 179 ? 26.494  23.709  49.622 0.05  0.00 ? 179 LYS A O    3  
ATOM   8820   O O    O LYS A 1 179 ? 23.495  16.515  64.226 0.95  0.00 ? 179 LYS A O    3  
ATOM   8821   H H    C LYS A 1 179 ? 22.895  23.631  51.132 0.05  0.00 ? 179 LYS A H    3  
ATOM   8822   H H    O LYS A 1 179 ? 19.652  17.036  63.779 0.95  0.00 ? 179 LYS A H    3  
ATOM   8823   N N    C ASP A 1 180 ? 24.581  22.519  49.409 0.05  0.00 ? 180 ASP A N    3  
ATOM   8824   N N    O ASP A 1 180 ? 21.766  15.579  63.104 0.95  0.00 ? 180 ASP A N    3  
ATOM   8825   C CA   C ASP A 1 180 ? 25.176  21.309  48.817 0.05  0.00 ? 180 ASP A CA   3  
ATOM   8826   C CA   O ASP A 1 180 ? 22.379  14.259  62.881 0.95  0.00 ? 180 ASP A CA   3  
ATOM   8827   C C    C ASP A 1 180 ? 24.476  21.188  47.443 0.05  0.00 ? 180 ASP A C    3  
ATOM   8828   C C    O ASP A 1 180 ? 22.422  14.127  61.340 0.95  0.00 ? 180 ASP A C    3  
ATOM   8829   O O    C ASP A 1 180 ? 23.379  20.651  47.307 0.05  0.00 ? 180 ASP A O    3  
ATOM   8830   O O    O ASP A 1 180 ? 21.460  13.733  60.685 0.95  0.00 ? 180 ASP A O    3  
ATOM   8831   H H    C ASP A 1 180 ? 23.608  22.543  49.538 0.05  0.00 ? 180 ASP A H    3  
ATOM   8832   H H    O ASP A 1 180 ? 20.870  15.743  62.740 0.95  0.00 ? 180 ASP A H    3  
ATOM   8833   N N    C VAL A 1 181 ? 25.128  21.815  46.505 0.05  0.00 ? 181 VAL A N    3  
ATOM   8834   N N    O VAL A 1 181 ? 23.535  14.588  60.841 0.95  0.00 ? 181 VAL A N    3  
ATOM   8835   C CA   C VAL A 1 181 ? 24.699  21.893  45.078 0.05  0.00 ? 181 VAL A CA   3  
ATOM   8836   C CA   O VAL A 1 181 ? 23.867  14.613  59.387 0.95  0.00 ? 181 VAL A CA   3  
ATOM   8837   C C    C VAL A 1 181 ? 25.668  21.078  44.252 0.05  0.00 ? 181 VAL A C    3  
ATOM   8838   C C    O VAL A 1 181 ? 24.976  13.615  59.143 0.95  0.00 ? 181 VAL A C    3  
ATOM   8839   O O    C VAL A 1 181 ? 26.891  21.136  44.544 0.05  0.00 ? 181 VAL A O    3  
ATOM   8840   O O    O VAL A 1 181 ? 25.897  13.530  59.996 0.95  0.00 ? 181 VAL A O    3  
ATOM   8841   H H    C VAL A 1 181 ? 25.956  22.278  46.756 0.05  0.00 ? 181 VAL A H    3  
ATOM   8842   H H    O VAL A 1 181 ? 24.198  14.953  61.465 0.95  0.00 ? 181 VAL A H    3  
ATOM   8843   N N    C GLY A 1 182 ? 25.143  20.329  43.284 0.05  0.00 ? 182 GLY A N    3  
ATOM   8844   N N    O GLY A 1 182 ? 24.877  12.871  58.043 0.95  0.00 ? 182 GLY A N    3  
ATOM   8845   C CA   C GLY A 1 182 ? 26.007  19.476  42.458 0.05  0.00 ? 182 GLY A CA   3  
ATOM   8846   C CA   O GLY A 1 182 ? 25.889  11.849  57.747 0.95  0.00 ? 182 GLY A CA   3  
ATOM   8847   C C    C GLY A 1 182 ? 26.080  19.745  40.972 0.05  0.00 ? 182 GLY A C    3  
ATOM   8848   C C    O GLY A 1 182 ? 26.712  11.991  56.487 0.95  0.00 ? 182 GLY A C    3  
ATOM   8849   O O    C GLY A 1 182 ? 26.091  18.794  40.157 0.05  0.00 ? 182 GLY A O    3  
ATOM   8850   O O    O GLY A 1 182 ? 26.970  10.987  55.783 0.95  0.00 ? 182 GLY A O    3  
ATOM   8851   H H    C GLY A 1 182 ? 24.174  20.328  43.141 0.05  0.00 ? 182 GLY A H    3  
ATOM   8852   H H    O GLY A 1 182 ? 24.111  12.988  57.443 0.95  0.00 ? 182 GLY A H    3  
ATOM   8853   N N    C VAL A 1 183 ? 26.142  21.009  40.565 0.05  0.00 ? 183 VAL A N    3  
ATOM   8854   N N    O VAL A 1 183 ? 27.158  13.200  56.161 0.95  0.00 ? 183 VAL A N    3  
ATOM   8855   C CA   C VAL A 1 183 ? 26.207  21.330  39.141 0.05  0.00 ? 183 VAL A CA   3  
ATOM   8856   C CA   O VAL A 1 183 ? 27.952  13.400  54.951 0.95  0.00 ? 183 VAL A CA   3  
ATOM   8857   C C    C VAL A 1 183 ? 27.633  21.572  38.669 0.05  0.00 ? 183 VAL A C    3  
ATOM   8858   C C    O VAL A 1 183 ? 29.447  13.411  55.238 0.95  0.00 ? 183 VAL A C    3  
ATOM   8859   O O    C VAL A 1 183 ? 27.869  21.586  37.449 0.05  0.00 ? 183 VAL A O    3  
ATOM   8860   O O    O VAL A 1 183 ? 30.242  13.300  54.290 0.95  0.00 ? 183 VAL A O    3  
ATOM   8861   H H    C VAL A 1 183 ? 26.140  21.733  41.227 0.05  0.00 ? 183 VAL A H    3  
ATOM   8862   H H    O VAL A 1 183 ? 26.948  13.966  56.736 0.95  0.00 ? 183 VAL A H    3  
ATOM   8863   N N    C ASP A 1 184 ? 28.563  21.725  39.596 0.05  0.00 ? 184 ASP A N    3  
ATOM   8864   N N    O ASP A 1 184 ? 29.823  13.509  56.501 0.95  0.00 ? 184 ASP A N    3  
ATOM   8865   C CA   C ASP A 1 184 ? 29.948  22.022  39.219 0.05  0.00 ? 184 ASP A CA   3  
ATOM   8866   C CA   O ASP A 1 184 ? 31.244  13.588  56.851 0.95  0.00 ? 184 ASP A CA   3  
ATOM   8867   C C    C ASP A 1 184 ? 30.878  20.882  39.498 0.05  0.00 ? 184 ASP A C    3  
ATOM   8868   C C    O ASP A 1 184 ? 31.734  12.359  57.551 0.95  0.00 ? 184 ASP A C    3  
ATOM   8869   O O    C ASP A 1 184 ? 32.117  21.058  39.353 0.05  0.00 ? 184 ASP A O    3  
ATOM   8870   O O    O ASP A 1 184 ? 32.899  12.355  58.032 0.95  0.00 ? 184 ASP A O    3  
ATOM   8871   H H    C ASP A 1 184 ? 28.317  21.680  40.544 0.05  0.00 ? 184 ASP A H    3  
ATOM   8872   H H    O ASP A 1 184 ? 29.145  13.570  57.207 0.95  0.00 ? 184 ASP A H    3  
ATOM   8873   N N    C ASN A 1 185 ? 30.371  19.746  39.920 0.05  0.00 ? 185 ASN A N    3  
ATOM   8874   N N    O ASN A 1 185 ? 30.918  11.336  57.672 0.95  0.00 ? 185 ASN A N    3  
ATOM   8875   C CA   C ASN A 1 185 ? 31.334  18.633  40.192 0.05  0.00 ? 185 ASN A CA   3  
ATOM   8876   C CA   O ASN A 1 185 ? 31.444  10.129  58.382 0.95  0.00 ? 185 ASN A CA   3  
ATOM   8877   C C    C ASN A 1 185 ? 31.820  18.020  38.866 0.05  0.00 ? 185 ASN A C    3  
ATOM   8878   C C    O ASN A 1 185 ? 32.410  9.356   57.465 0.95  0.00 ? 185 ASN A C    3  
ATOM   8879   O O    C ASN A 1 185 ? 31.425  18.375  37.748 0.05  0.00 ? 185 ASN A O    3  
ATOM   8880   O O    O ASN A 1 185 ? 32.665  9.674   56.297 0.95  0.00 ? 185 ASN A O    3  
ATOM   8881   H H    C ASN A 1 185 ? 29.407  19.632  40.053 0.05  0.00 ? 185 ASN A H    3  
ATOM   8882   H H    O ASN A 1 185 ? 30.005  11.363  57.316 0.95  0.00 ? 185 ASN A H    3  
ATOM   8883   N N    C ALA A 1 186 ? 32.759  17.104  39.024 0.05  0.00 ? 186 ALA A N    3  
ATOM   8884   N N    O ALA A 1 186 ? 33.001  8.338   58.064 0.95  0.00 ? 186 ALA A N    3  
ATOM   8885   C CA   C ALA A 1 186 ? 33.407  16.401  37.926 0.05  0.00 ? 186 ALA A CA   3  
ATOM   8886   C CA   O ALA A 1 186 ? 33.982  7.472   57.425 0.95  0.00 ? 186 ALA A CA   3  
ATOM   8887   C C    C ALA A 1 186 ? 32.337  15.621  37.154 0.05  0.00 ? 186 ALA A C    3  
ATOM   8888   C C    O ALA A 1 186 ? 33.314  6.785   56.229 0.95  0.00 ? 186 ALA A C    3  
ATOM   8889   O O    C ALA A 1 186 ? 32.361  15.556  35.910 0.05  0.00 ? 186 ALA A O    3  
ATOM   8890   O O    O ALA A 1 186 ? 33.926  6.623   55.156 0.95  0.00 ? 186 ALA A O    3  
ATOM   8891   H H    C ALA A 1 186 ? 33.054  16.902  39.936 0.05  0.00 ? 186 ALA A H    3  
ATOM   8892   H H    O ALA A 1 186 ? 32.782  8.168   59.004 0.95  0.00 ? 186 ALA A H    3  
ATOM   8893   N N    C GLY A 1 187 ? 31.394  15.105  37.916 0.05  0.00 ? 187 GLY A N    3  
ATOM   8894   N N    O GLY A 1 187 ? 32.053  6.460   56.432 0.95  0.00 ? 187 GLY A N    3  
ATOM   8895   C CA   C GLY A 1 187 ? 30.256  14.331  37.420 0.05  0.00 ? 187 GLY A CA   3  
ATOM   8896   C CA   O GLY A 1 187 ? 31.193  5.810   55.443 0.95  0.00 ? 187 GLY A CA   3  
ATOM   8897   C C    C GLY A 1 187 ? 29.522  15.111  36.341 0.05  0.00 ? 187 GLY A C    3  
ATOM   8898   C C    O GLY A 1 187 ? 31.203  6.596   54.142 0.95  0.00 ? 187 GLY A C    3  
ATOM   8899   O O    C GLY A 1 187 ? 29.446  14.646  35.196 0.05  0.00 ? 187 GLY A O    3  
ATOM   8900   O O    O GLY A 1 187 ? 31.620  6.059   53.107 0.95  0.00 ? 187 GLY A O    3  
ATOM   8901   H H    C GLY A 1 187 ? 31.454  15.258  38.882 0.05  0.00 ? 187 GLY A H    3  
ATOM   8902   H H    O GLY A 1 187 ? 31.661  6.678   57.303 0.95  0.00 ? 187 GLY A H    3  
ATOM   8903   N N    C ALA A 1 188 ? 28.988  16.264  36.729 0.05  0.00 ? 188 ALA A N    3  
ATOM   8904   N N    O ALA A 1 188 ? 30.734  7.837   54.217 0.95  0.00 ? 188 ALA A N    3  
ATOM   8905   C CA   C ALA A 1 188 ? 28.251  17.147  35.836 0.05  0.00 ? 188 ALA A CA   3  
ATOM   8906   C CA   O ALA A 1 188 ? 30.667  8.739   53.076 0.95  0.00 ? 188 ALA A CA   3  
ATOM   8907   C C    C ALA A 1 188 ? 29.157  17.610  34.691 0.05  0.00 ? 188 ALA A C    3  
ATOM   8908   C C    O ALA A 1 188 ? 32.073  8.988   52.521 0.95  0.00 ? 188 ALA A C    3  
ATOM   8909   O O    C ALA A 1 188 ? 28.731  17.767  33.544 0.05  0.00 ? 188 ALA A O    3  
ATOM   8910   O O    O ALA A 1 188 ? 32.285  9.112   51.313 0.95  0.00 ? 188 ALA A O    3  
ATOM   8911   H H    C ALA A 1 188 ? 29.098  16.537  37.664 0.05  0.00 ? 188 ALA A H    3  
ATOM   8912   H H    O ALA A 1 188 ? 30.418  8.163   55.086 0.95  0.00 ? 188 ALA A H    3  
ATOM   8913   N N    C LYS A 1 189 ? 30.413  17.855  35.050 0.05  0.00 ? 189 LYS A N    3  
ATOM   8914   N N    O LYS A 1 189 ? 33.019  9.089   53.449 0.95  0.00 ? 189 LYS A N    3  
ATOM   8915   C CA   C LYS A 1 189 ? 31.415  18.290  34.083 0.05  0.00 ? 189 LYS A CA   3  
ATOM   8916   C CA   O LYS A 1 189 ? 34.417  9.311   53.097 0.95  0.00 ? 189 LYS A CA   3  
ATOM   8917   C C    C LYS A 1 189 ? 31.594  17.205  33.013 0.05  0.00 ? 189 LYS A C    3  
ATOM   8918   C C    O LYS A 1 189 ? 34.922  8.133   52.253 0.95  0.00 ? 189 LYS A C    3  
ATOM   8919   O O    C LYS A 1 189 ? 31.609  17.545  31.812 0.05  0.00 ? 189 LYS A O    3  
ATOM   8920   O O    O LYS A 1 189 ? 35.568  8.374   51.213 0.95  0.00 ? 189 LYS A O    3  
ATOM   8921   H H    C LYS A 1 189 ? 30.674  17.730  35.985 0.05  0.00 ? 189 LYS A H    3  
ATOM   8922   H H    O LYS A 1 189 ? 32.772  9.002   54.393 0.95  0.00 ? 189 LYS A H    3  
ATOM   8923   N N    C ALA A 1 190 ? 31.729  15.959  33.444 0.05  0.00 ? 190 ALA A N    3  
ATOM   8924   N N    O ALA A 1 190 ? 34.637  6.916   52.696 0.95  0.00 ? 190 ALA A N    3  
ATOM   8925   C CA   C ALA A 1 190 ? 31.881  14.849  32.471 0.05  0.00 ? 190 ALA A CA   3  
ATOM   8926   C CA   O ALA A 1 190 ? 35.068  5.725   51.924 0.95  0.00 ? 190 ALA A CA   3  
ATOM   8927   C C    C ALA A 1 190 ? 30.695  14.825  31.508 0.05  0.00 ? 190 ALA A C    3  
ATOM   8928   C C    O ALA A 1 190 ? 34.508  5.786   50.504 0.95  0.00 ? 190 ALA A C    3  
ATOM   8929   O O    C ALA A 1 190 ? 30.896  14.755  30.287 0.05  0.00 ? 190 ALA A O    3  
ATOM   8930   O O    O ALA A 1 190 ? 35.261  5.597   49.538 0.95  0.00 ? 190 ALA A O    3  
ATOM   8931   H H    C ALA A 1 190 ? 31.711  15.767  34.404 0.05  0.00 ? 190 ALA A H    3  
ATOM   8932   H H    O ALA A 1 190 ? 34.127  6.803   53.525 0.95  0.00 ? 190 ALA A H    3  
ATOM   8933   N N    C GLY A 1 191 ? 29.488  14.896  32.016 0.05  0.00 ? 191 GLY A N    3  
ATOM   8934   N N    O GLY A 1 191 ? 33.234  6.057   50.355 0.95  0.00 ? 191 GLY A N    3  
ATOM   8935   C CA   C GLY A 1 191 ? 28.250  14.880  31.263 0.05  0.00 ? 191 GLY A CA   3  
ATOM   8936   C CA   O GLY A 1 191 ? 32.529  6.149   49.092 0.95  0.00 ? 191 GLY A CA   3  
ATOM   8937   C C    C GLY A 1 191 ? 28.009  15.945  30.233 0.05  0.00 ? 191 GLY A C    3  
ATOM   8938   C C    O GLY A 1 191 ? 32.984  7.155   48.075 0.95  0.00 ? 191 GLY A C    3  
ATOM   8939   O O    C GLY A 1 191 ? 27.608  15.700  29.085 0.05  0.00 ? 191 GLY A O    3  
ATOM   8940   O O    O GLY A 1 191 ? 33.157  6.878   46.878 0.95  0.00 ? 191 GLY A O    3  
ATOM   8941   H H    C GLY A 1 191 ? 29.417  14.962  32.991 0.05  0.00 ? 191 GLY A H    3  
ATOM   8942   H H    O GLY A 1 191 ? 32.711  6.206   51.170 0.95  0.00 ? 191 GLY A H    3  
ATOM   8943   N N    C LEU A 1 192 ? 28.213  17.211  30.637 0.05  0.00 ? 192 LEU A N    3  
ATOM   8944   N N    O LEU A 1 192 ? 33.160  8.409   48.525 0.95  0.00 ? 192 LEU A N    3  
ATOM   8945   C CA   C LEU A 1 192 ? 28.045  18.380  29.792 0.05  0.00 ? 192 LEU A CA   3  
ATOM   8946   C CA   O LEU A 1 192 ? 33.605  9.522   47.705 0.95  0.00 ? 192 LEU A CA   3  
ATOM   8947   C C    C LEU A 1 192 ? 29.106  18.359  28.694 0.05  0.00 ? 192 LEU A C    3  
ATOM   8948   C C    O LEU A 1 192 ? 35.047  9.275   47.268 0.95  0.00 ? 192 LEU A C    3  
ATOM   8949   O O    C LEU A 1 192 ? 28.839  18.767  27.583 0.05  0.00 ? 192 LEU A O    3  
ATOM   8950   O O    O LEU A 1 192 ? 35.417  9.629   46.168 0.95  0.00 ? 192 LEU A O    3  
ATOM   8951   H H    C LEU A 1 192 ? 28.501  17.354  31.563 0.05  0.00 ? 192 LEU A H    3  
ATOM   8952   H H    O LEU A 1 192 ? 32.982  8.583   49.473 0.95  0.00 ? 192 LEU A H    3  
ATOM   8953   N N    C THR A 1 193 ? 30.280  17.914  29.056 0.05  0.00 ? 193 THR A N    3  
ATOM   8954   N N    O THR A 1 193 ? 35.814  8.706   48.159 0.95  0.00 ? 193 THR A N    3  
ATOM   8955   C CA   C THR A 1 193 ? 31.385  17.812  28.092 0.05  0.00 ? 193 THR A CA   3  
ATOM   8956   C CA   O THR A 1 193 ? 37.217  8.383   47.860 0.95  0.00 ? 193 THR A CA   3  
ATOM   8957   C C    C THR A 1 193 ? 30.944  16.825  27.003 0.05  0.00 ? 193 THR A C    3  
ATOM   8958   C C    O THR A 1 193 ? 37.211  7.384   46.696 0.95  0.00 ? 193 THR A C    3  
ATOM   8959   O O    C THR A 1 193 ? 31.084  17.154  25.835 0.05  0.00 ? 193 THR A O    3  
ATOM   8960   O O    O THR A 1 193 ? 37.948  7.600   45.746 0.95  0.00 ? 193 THR A O    3  
ATOM   8961   H H    C THR A 1 193 ? 30.420  17.626  29.983 0.05  0.00 ? 193 THR A H    3  
ATOM   8962   H H    O THR A 1 193 ? 35.442  8.473   49.036 0.95  0.00 ? 193 THR A H    3  
ATOM   8963   N N    C PHE A 1 194 ? 30.447  15.677  27.427 0.05  0.00 ? 194 PHE A N    3  
ATOM   8964   N N    O PHE A 1 194 ? 36.401  6.348   46.823 0.95  0.00 ? 194 PHE A N    3  
ATOM   8965   C CA   C PHE A 1 194 ? 29.977  14.674  26.424 0.05  0.00 ? 194 PHE A CA   3  
ATOM   8966   C CA   O PHE A 1 194 ? 36.327  5.343   45.720 0.95  0.00 ? 194 PHE A CA   3  
ATOM   8967   C C    C PHE A 1 194 ? 28.928  15.293  25.510 0.05  0.00 ? 194 PHE A C    3  
ATOM   8968   C C    O PHE A 1 194 ? 35.961  6.025   44.409 0.95  0.00 ? 194 PHE A C    3  
ATOM   8969   O O    C PHE A 1 194 ? 28.928  15.061  24.267 0.05  0.00 ? 194 PHE A O    3  
ATOM   8970   O O    O PHE A 1 194 ? 36.527  5.701   43.325 0.95  0.00 ? 194 PHE A O    3  
ATOM   8971   H H    C PHE A 1 194 ? 30.376  15.490  28.386 0.05  0.00 ? 194 PHE A H    3  
ATOM   8972   H H    O PHE A 1 194 ? 35.847  6.247   47.625 0.95  0.00 ? 194 PHE A H    3  
ATOM   8973   N N    C LEU A 1 195 ? 28.021  16.068  26.090 0.05  0.00 ? 195 LEU A N    3  
ATOM   8974   N N    O LEU A 1 195 ? 35.019  6.957   44.469 0.95  0.00 ? 195 LEU A N    3  
ATOM   8975   C CA   C LEU A 1 195 ? 26.955  16.702  25.317 0.05  0.00 ? 195 LEU A CA   3  
ATOM   8976   C CA   O LEU A 1 195 ? 34.572  7.667   43.272 0.95  0.00 ? 195 LEU A CA   3  
ATOM   8977   C C    C LEU A 1 195 ? 27.505  17.689  24.291 0.05  0.00 ? 195 LEU A C    3  
ATOM   8978   C C    O LEU A 1 195 ? 35.695  8.490   42.646 0.95  0.00 ? 195 LEU A C    3  
ATOM   8979   O O    C LEU A 1 195 ? 27.059  17.734  23.139 0.05  0.00 ? 195 LEU A O    3  
ATOM   8980   O O    O LEU A 1 195 ? 35.875  8.506   41.423 0.95  0.00 ? 195 LEU A O    3  
ATOM   8981   H H    C LEU A 1 195 ? 28.059  16.209  27.059 0.05  0.00 ? 195 LEU A H    3  
ATOM   8982   H H    O LEU A 1 195 ? 34.604  7.166   45.332 0.95  0.00 ? 195 LEU A H    3  
ATOM   8983   N N    C VAL A 1 196 ? 28.440  18.504  24.752 0.05  0.00 ? 196 VAL A N    3  
ATOM   8984   N N    O VAL A 1 196 ? 36.403  9.205   43.505 0.95  0.00 ? 196 VAL A N    3  
ATOM   8985   C CA   C VAL A 1 196 ? 29.061  19.549  23.942 0.05  0.00 ? 196 VAL A CA   3  
ATOM   8986   C CA   O VAL A 1 196 ? 37.491  10.092  43.102 0.95  0.00 ? 196 VAL A CA   3  
ATOM   8987   C C    C VAL A 1 196 ? 29.782  18.895  22.762 0.05  0.00 ? 196 VAL A C    3  
ATOM   8988   C C    O VAL A 1 196 ? 38.582  9.259   42.427 0.95  0.00 ? 196 VAL A C    3  
ATOM   8989   O O    C VAL A 1 196 ? 29.607  19.432  21.662 0.05  0.00 ? 196 VAL A O    3  
ATOM   8990   O O    O VAL A 1 196 ? 39.047  9.729   41.382 0.95  0.00 ? 196 VAL A O    3  
ATOM   8991   H H    C VAL A 1 196 ? 28.709  18.421  25.691 0.05  0.00 ? 196 VAL A H    3  
ATOM   8992   H H    O VAL A 1 196 ? 36.167  9.159   44.455 0.95  0.00 ? 196 VAL A H    3  
ATOM   8993   N N    C ASP A 1 197 ? 30.484  17.840  23.015 0.05  0.00 ? 197 ASP A N    3  
ATOM   8994   N N    O ASP A 1 197 ? 38.902  8.142   42.993 0.95  0.00 ? 197 ASP A N    3  
ATOM   8995   C CA   C ASP A 1 197 ? 31.221  17.064  22.009 0.05  0.00 ? 197 ASP A CA   3  
ATOM   8996   C CA   O ASP A 1 197 ? 39.904  7.200   42.478 0.95  0.00 ? 197 ASP A CA   3  
ATOM   8997   C C    C ASP A 1 197 ? 30.252  16.525  20.928 0.05  0.00 ? 197 ASP A C    3  
ATOM   8998   C C    O ASP A 1 197 ? 39.509  6.714   41.061 0.95  0.00 ? 197 ASP A C    3  
ATOM   8999   O O    C ASP A 1 197 ? 30.682  16.297  19.783 0.05  0.00 ? 197 ASP A O    3  
ATOM   9000   O O    O ASP A 1 197 ? 40.398  6.343   40.274 0.95  0.00 ? 197 ASP A O    3  
ATOM   9001   H H    C ASP A 1 197 ? 30.513  17.524  23.943 0.05  0.00 ? 197 ASP A H    3  
ATOM   9002   H H    O ASP A 1 197 ? 38.429  7.897   43.816 0.95  0.00 ? 197 ASP A H    3  
ATOM   9003   N N    C LEU A 1 198 ? 29.013  16.285  21.295 0.05  0.00 ? 198 LEU A N    3  
ATOM   9004   N N    O LEU A 1 198 ? 38.227  6.671   40.775 0.95  0.00 ? 198 LEU A N    3  
ATOM   9005   C CA   C LEU A 1 198 ? 28.012  15.776  20.392 0.05  0.00 ? 198 LEU A CA   3  
ATOM   9006   C CA   O LEU A 1 198 ? 37.723  6.233   39.498 0.95  0.00 ? 198 LEU A CA   3  
ATOM   9007   C C    C LEU A 1 198 ? 27.678  16.835  19.353 0.05  0.00 ? 198 LEU A C    3  
ATOM   9008   C C    O LEU A 1 198 ? 38.101  7.244   38.427 0.95  0.00 ? 198 LEU A C    3  
ATOM   9009   O O    C LEU A 1 198 ? 27.561  16.473  18.191 0.05  0.00 ? 198 LEU A O    3  
ATOM   9010   O O    O LEU A 1 198 ? 38.507  6.813   37.357 0.95  0.00 ? 198 LEU A O    3  
ATOM   9011   H H    C LEU A 1 198 ? 28.760  16.455  22.226 0.05  0.00 ? 198 LEU A H    3  
ATOM   9012   H H    O LEU A 1 198 ? 37.585  6.944   41.462 0.95  0.00 ? 198 LEU A H    3  
ATOM   9013   N N    C ILE A 1 199 ? 27.501  18.044  19.852 0.05  0.00 ? 199 ILE A N    3  
ATOM   9014   N N    O ILE A 1 199 ? 37.894  8.501   38.774 0.95  0.00 ? 199 ILE A N    3  
ATOM   9015   C CA   C ILE A 1 199 ? 27.128  19.178  19.032 0.05  0.00 ? 199 ILE A CA   3  
ATOM   9016   C CA   O ILE A 1 199 ? 38.145  9.608   37.875 0.95  0.00 ? 199 ILE A CA   3  
ATOM   9017   C C    C ILE A 1 199 ? 28.260  19.638  18.103 0.05  0.00 ? 199 ILE A C    3  
ATOM   9018   C C    O ILE A 1 199 ? 39.640  9.840   37.619 0.95  0.00 ? 199 ILE A C    3  
ATOM   9019   O O    C ILE A 1 199 ? 27.987  19.968  16.947 0.05  0.00 ? 199 ILE A O    3  
ATOM   9020   O O    O ILE A 1 199 ? 40.015  10.114  36.477 0.95  0.00 ? 199 ILE A O    3  
ATOM   9021   H H    C ILE A 1 199 ? 27.594  18.173  20.820 0.05  0.00 ? 199 ILE A H    3  
ATOM   9022   H H    O ILE A 1 199 ? 37.526  8.690   39.663 0.95  0.00 ? 199 ILE A H    3  
ATOM   9023   N N    C LYS A 1 200 ? 29.462  19.675  18.637 0.05  0.00 ? 200 LYS A N    3  
ATOM   9024   N N    O LYS A 1 200 ? 40.423  9.756   38.673 0.95  0.00 ? 200 LYS A N    3  
ATOM   9025   C CA   C LYS A 1 200 ? 30.609  20.145  17.834 0.05  0.00 ? 200 LYS A CA   3  
ATOM   9026   C CA   O LYS A 1 200 ? 41.872  10.006  38.534 0.95  0.00 ? 200 LYS A CA   3  
ATOM   9027   C C    C LYS A 1 200 ? 31.032  19.114  16.797 0.05  0.00 ? 200 LYS A C    3  
ATOM   9028   C C    O LYS A 1 200 ? 42.579  8.851   37.839 0.95  0.00 ? 200 LYS A C    3  
ATOM   9029   O O    C LYS A 1 200 ? 31.547  19.483  15.716 0.05  0.00 ? 200 LYS A O    3  
ATOM   9030   O O    O LYS A 1 200 ? 43.603  9.064   37.149 0.95  0.00 ? 200 LYS A O    3  
ATOM   9031   H H    C LYS A 1 200 ? 29.591  19.416  19.573 0.05  0.00 ? 200 LYS A H    3  
ATOM   9032   H H    O LYS A 1 200 ? 40.041  9.555   39.553 0.95  0.00 ? 200 LYS A H    3  
ATOM   9033   N N    C ASN A 1 201 ? 30.778  17.851  17.078 0.05  0.00 ? 201 ASN A N    3  
ATOM   9034   N N    O ASN A 1 201 ? 42.030  7.658   37.961 0.95  0.00 ? 201 ASN A N    3  
ATOM   9035   C CA   C ASN A 1 201 ? 31.085  16.737  16.178 0.05  0.00 ? 201 ASN A CA   3  
ATOM   9036   C CA   O ASN A 1 201 ? 42.558  6.448   37.328 0.95  0.00 ? 201 ASN A CA   3  
ATOM   9037   C C    C ASN A 1 201 ? 29.896  16.474  15.231 0.05  0.00 ? 201 ASN A C    3  
ATOM   9038   C C    O ASN A 1 201 ? 41.951  6.275   35.921 0.95  0.00 ? 201 ASN A C    3  
ATOM   9039   O O    C ASN A 1 201 ? 29.870  15.449  14.539 0.05  0.00 ? 201 ASN A O    3  
ATOM   9040   O O    O ASN A 1 201 ? 42.105  5.212   35.306 0.95  0.00 ? 201 ASN A O    3  
ATOM   9041   H H    C ASN A 1 201 ? 30.338  17.647  17.929 0.05  0.00 ? 201 ASN A H    3  
ATOM   9042   H H    O ASN A 1 201 ? 41.207  7.581   38.488 0.95  0.00 ? 201 ASN A H    3  
ATOM   9043   N N    C LYS A 1 202 ? 28.988  17.393  15.262 0.05  0.00 ? 202 LYS A N    3  
ATOM   9044   N N    O LYS A 1 202 ? 41.296  7.306   35.502 0.95  0.00 ? 202 LYS A N    3  
ATOM   9045   C CA   C LYS A 1 202 ? 27.821  17.468  14.440 0.05  0.00 ? 202 LYS A CA   3  
ATOM   9046   C CA   O LYS A 1 202 ? 40.700  7.474   34.213 0.95  0.00 ? 202 LYS A CA   3  
ATOM   9047   C C    C LYS A 1 202 ? 26.847  16.326  14.490 0.05  0.00 ? 202 LYS A C    3  
ATOM   9048   C C    O LYS A 1 202 ? 39.660  6.480   33.781 0.95  0.00 ? 202 LYS A C    3  
ATOM   9049   O O    C LYS A 1 202 ? 26.005  16.212  13.581 0.05  0.00 ? 202 LYS A O    3  
ATOM   9050   O O    O LYS A 1 202 ? 39.357  6.410   32.576 0.95  0.00 ? 202 LYS A O    3  
ATOM   9051   H H    C LYS A 1 202 ? 29.144  18.142  15.873 0.05  0.00 ? 202 LYS A H    3  
ATOM   9052   H H    O LYS A 1 202 ? 41.250  8.073   36.110 0.95  0.00 ? 202 LYS A H    3  
ATOM   9053   N N    C HIS A 1 203 ? 26.874  15.569  15.562 0.05  0.00 ? 203 HIS A N    3  
ATOM   9054   N N    O HIS A 1 203 ? 39.048  5.811   34.729 0.95  0.00 ? 203 HIS A N    3  
ATOM   9055   C CA   C HIS A 1 203 ? 25.962  14.451  15.798 0.05  0.00 ? 203 HIS A CA   3  
ATOM   9056   C CA   O HIS A 1 203 ? 37.976  4.846   34.490 0.95  0.00 ? 203 HIS A CA   3  
ATOM   9057   C C    C HIS A 1 203 ? 24.627  14.992  16.289 0.05  0.00 ? 203 HIS A C    3  
ATOM   9058   C C    O HIS A 1 203 ? 36.672  5.597   34.263 0.95  0.00 ? 203 HIS A C    3  
ATOM   9059   O O    C HIS A 1 203 ? 23.653  14.242  16.297 0.05  0.00 ? 203 HIS A O    3  
ATOM   9060   O O    O HIS A 1 203 ? 35.713  4.987   33.794 0.95  0.00 ? 203 HIS A O    3  
ATOM   9061   H H    C HIS A 1 203 ? 27.523  15.788  16.261 0.05  0.00 ? 203 HIS A H    3  
ATOM   9062   H H    O HIS A 1 203 ? 39.303  5.994   35.657 0.95  0.00 ? 203 HIS A H    3  
ATOM   9063   N N    C MET A 1 204 ? 24.662  16.246  16.630 0.05  0.00 ? 204 MET A N    3  
ATOM   9064   N N    O MET A 1 204 ? 36.730  6.858   34.576 0.95  0.00 ? 204 MET A N    3  
ATOM   9065   C CA   C MET A 1 204 ? 23.536  17.042  17.185 0.05  0.00 ? 204 MET A CA   3  
ATOM   9066   C CA   O MET A 1 204 ? 35.615  7.837   34.507 0.95  0.00 ? 204 MET A CA   3  
ATOM   9067   C C    C MET A 1 204 ? 23.710  18.528  16.893 0.05  0.00 ? 204 MET A C    3  
ATOM   9068   C C    O MET A 1 204 ? 36.135  9.260   34.336 0.95  0.00 ? 204 MET A C    3  
ATOM   9069   O O    C MET A 1 204 ? 24.832  19.020  16.864 0.05  0.00 ? 204 MET A O    3  
ATOM   9070   O O    O MET A 1 204 ? 37.192  9.593   34.860 0.95  0.00 ? 204 MET A O    3  
ATOM   9071   H H    C MET A 1 204 ? 25.524  16.704  16.537 0.05  0.00 ? 204 MET A H    3  
ATOM   9072   H H    O MET A 1 204 ? 37.588  7.188   34.917 0.95  0.00 ? 204 MET A H    3  
ATOM   9073   N N    C ASN A 1 205 ? 22.651  19.245  16.638 0.05  0.00 ? 205 ASN A N    3  
ATOM   9074   N N    O ASN A 1 205 ? 35.457  10.091  33.594 0.95  0.00 ? 205 ASN A N    3  
ATOM   9075   C CA   C ASN A 1 205 ? 22.530  20.663  16.365 0.05  0.00 ? 205 ASN A CA   3  
ATOM   9076   C CA   O ASN A 1 205 ? 35.704  11.487  33.295 0.95  0.00 ? 205 ASN A CA   3  
ATOM   9077   C C    C ASN A 1 205 ? 22.159  21.395  17.669 0.05  0.00 ? 205 ASN A C    3  
ATOM   9078   C C    O ASN A 1 205 ? 34.866  12.360  34.249 0.95  0.00 ? 205 ASN A C    3  
ATOM   9079   O O    C ASN A 1 205 ? 21.213  20.977  18.342 0.05  0.00 ? 205 ASN A O    3  
ATOM   9080   O O    O ASN A 1 205 ? 33.661  12.125  34.373 0.95  0.00 ? 205 ASN A O    3  
ATOM   9081   H H    C ASN A 1 205 ? 21.803  18.753  16.654 0.05  0.00 ? 205 ASN A H    3  
ATOM   9082   H H    O ASN A 1 205 ? 34.643  9.719   33.193 0.95  0.00 ? 205 ASN A H    3  
ATOM   9083   N N    C ALA A 1 206 ? 22.874  22.493  17.896 0.05  0.00 ? 206 ALA A N    3  
ATOM   9084   N N    O ALA A 1 206 ? 35.541  13.366  34.796 0.95  0.00 ? 206 ALA A N    3  
ATOM   9085   C CA   C ALA A 1 206 ? 22.631  23.249  19.137 0.05  0.00 ? 206 ALA A CA   3  
ATOM   9086   C CA   O ALA A 1 206 ? 34.848  14.241  35.758 0.95  0.00 ? 206 ALA A CA   3  
ATOM   9087   C C    C ALA A 1 206 ? 21.280  23.906  19.192 0.05  0.00 ? 206 ALA A C    3  
ATOM   9088   C C    O ALA A 1 206 ? 33.759  15.075  35.143 0.95  0.00 ? 206 ALA A C    3  
ATOM   9089   O O    C ALA A 1 206 ? 20.845  24.329  20.281 0.05  0.00 ? 206 ALA A O    3  
ATOM   9090   O O    O ALA A 1 206 ? 32.923  15.635  35.879 0.95  0.00 ? 206 ALA A O    3  
ATOM   9091   H H    C ALA A 1 206 ? 23.567  22.776  17.265 0.05  0.00 ? 206 ALA A H    3  
ATOM   9092   H H    O ALA A 1 206 ? 36.488  13.505  34.585 0.95  0.00 ? 206 ALA A H    3  
ATOM   9093   N N    C ASP A 1 207 ? 20.570  24.002  18.082 0.05  0.00 ? 207 ASP A N    3  
ATOM   9094   N N    O ASP A 1 207 ? 33.700  15.180  33.828 0.95  0.00 ? 207 ASP A N    3  
ATOM   9095   C CA   C ASP A 1 207 ? 19.261  24.670  18.100 0.05  0.00 ? 207 ASP A CA   3  
ATOM   9096   C CA   O ASP A 1 207 ? 32.667  16.017  33.201 0.95  0.00 ? 207 ASP A CA   3  
ATOM   9097   C C    C ASP A 1 207 ? 18.061  23.743  18.136 0.05  0.00 ? 207 ASP A C    3  
ATOM   9098   C C    O ASP A 1 207 ? 31.472  15.264  32.646 0.95  0.00 ? 207 ASP A C    3  
ATOM   9099   O O    C ASP A 1 207 ? 16.947  24.233  17.958 0.05  0.00 ? 207 ASP A O    3  
ATOM   9100   O O    O ASP A 1 207 ? 30.674  15.884  31.944 0.95  0.00 ? 207 ASP A O    3  
ATOM   9101   H H    C ASP A 1 207 ? 20.927  23.648  17.240 0.05  0.00 ? 207 ASP A H    3  
ATOM   9102   H H    O ASP A 1 207 ? 34.360  14.718  33.269 0.95  0.00 ? 207 ASP A H    3  
ATOM   9103   N N    C THR A 1 208 ? 18.287  22.479  18.413 0.05  0.00 ? 208 THR A N    3  
ATOM   9104   N N    O THR A 1 208 ? 31.338  14.006  32.999 0.95  0.00 ? 208 THR A N    3  
ATOM   9105   C CA   C THR A 1 208 ? 17.160  21.511  18.500 0.05  0.00 ? 208 THR A CA   3  
ATOM   9106   C CA   O THR A 1 208 ? 30.176  13.208  32.524 0.95  0.00 ? 208 THR A CA   3  
ATOM   9107   C C    C THR A 1 208 ? 16.312  21.807  19.743 0.05  0.00 ? 208 THR A C    3  
ATOM   9108   C C    O THR A 1 208 ? 28.889  13.709  33.192 0.95  0.00 ? 208 THR A C    3  
ATOM   9109   O O    C THR A 1 208 ? 16.796  21.804  20.867 0.05  0.00 ? 208 THR A O    3  
ATOM   9110   O O    O THR A 1 208 ? 28.762  13.727  34.409 0.95  0.00 ? 208 THR A O    3  
ATOM   9111   H H    C THR A 1 208 ? 19.202  22.175  18.584 0.05  0.00 ? 208 THR A H    3  
ATOM   9112   H H    O THR A 1 208 ? 31.997  13.596  33.597 0.95  0.00 ? 208 THR A H    3  
ATOM   9113   N N    C ASP A 1 209 ? 15.051  22.065  19.534 0.05  0.00 ? 209 ASP A N    3  
ATOM   9114   N N    O ASP A 1 209 ? 27.944  14.117  32.392 0.95  0.00 ? 209 ASP A N    3  
ATOM   9115   C CA   C ASP A 1 209 ? 14.087  22.349  20.597 0.05  0.00 ? 209 ASP A CA   3  
ATOM   9116   C CA   O ASP A 1 209 ? 26.643  14.608  32.846 0.95  0.00 ? 209 ASP A CA   3  
ATOM   9117   C C    C ASP A 1 209 ? 13.065  21.221  20.661 0.05  0.00 ? 209 ASP A C    3  
ATOM   9118   C C    O ASP A 1 209 ? 25.558  13.635  32.402 0.95  0.00 ? 209 ASP A C    3  
ATOM   9119   O O    C ASP A 1 209 ? 13.256  20.180  20.025 0.05  0.00 ? 209 ASP A O    3  
ATOM   9120   O O    O ASP A 1 209 ? 25.869  12.532  31.943 0.95  0.00 ? 209 ASP A O    3  
ATOM   9121   H H    C ASP A 1 209 ? 14.726  22.057  18.609 0.05  0.00 ? 209 ASP A H    3  
ATOM   9122   H H    O ASP A 1 209 ? 28.111  14.081  31.426 0.95  0.00 ? 209 ASP A H    3  
ATOM   9123   N N    C TYR A 1 210 ? 12.001  21.440  21.403 0.05  0.00 ? 210 TYR A N    3  
ATOM   9124   N N    O TYR A 1 210 ? 24.316  14.051  32.527 0.95  0.00 ? 210 TYR A N    3  
ATOM   9125   C CA   C TYR A 1 210 ? 10.938  20.454  21.601 0.05  0.00 ? 210 TYR A CA   3  
ATOM   9126   C CA   O TYR A 1 210 ? 23.152  13.234  32.180 0.95  0.00 ? 210 TYR A CA   3  
ATOM   9127   C C    C TYR A 1 210 ? 10.234  20.077  20.301 0.05  0.00 ? 210 TYR A C    3  
ATOM   9128   C C    O TYR A 1 210 ? 23.117  12.856  30.703 0.95  0.00 ? 210 TYR A C    3  
ATOM   9129   O O    C TYR A 1 210 ? 10.061  18.891  20.024 0.05  0.00 ? 210 TYR A O    3  
ATOM   9130   O O    O TYR A 1 210 ? 22.919  11.687  30.378 0.95  0.00 ? 210 TYR A O    3  
ATOM   9131   H H    C TYR A 1 210 ? 11.926  22.301  21.864 0.05  0.00 ? 210 TYR A H    3  
ATOM   9132   H H    O TYR A 1 210 ? 24.161  14.947  32.891 0.95  0.00 ? 210 TYR A H    3  
ATOM   9133   N N    C CYS A 1 211 ? 9.831   21.080  19.566 0.05  0.00 ? 211 CYS A N    3  
ATOM   9134   N N    O CYS A 1 211 ? 23.280  13.845  29.863 0.95  0.00 ? 211 CYS A N    3  
ATOM   9135   C CA   C CYS A 1 211 ? 9.099   20.955  18.309 0.05  0.00 ? 211 CYS A CA   3  
ATOM   9136   C CA   O CYS A 1 211 ? 23.238  13.723  28.409 0.95  0.00 ? 211 CYS A CA   3  
ATOM   9137   C C    C CYS A 1 211 ? 9.932   20.251  17.265 0.05  0.00 ? 211 CYS A C    3  
ATOM   9138   C C    O CYS A 1 211 ? 24.353  12.836  27.908 0.95  0.00 ? 211 CYS A C    3  
ATOM   9139   O O    C CYS A 1 211 ? 9.346   19.440  16.527 0.05  0.00 ? 211 CYS A O    3  
ATOM   9140   O O    O CYS A 1 211 ? 24.080  12.057  26.978 0.95  0.00 ? 211 CYS A O    3  
ATOM   9141   C CB   C CYS A 1 211 ? 8.654   22.360  17.859 0.05  0.00 ? 211 CYS A CB   3  
ATOM   9142   C CB   O CYS A 1 211 ? 23.290  15.136  27.797 0.95  0.00 ? 211 CYS A CB   3  
ATOM   9143   S SG   A CYS A 1 211 ? 21.725  16.002  28.052 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9144   S SG   B CYS A 1 211 ? 21.674  15.610  27.143 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9145   S SG   C CYS A 1 211 ? 24.292  15.145  26.292 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9146   S SG   D CYS A 1 211 ? 21.773  15.494  26.883 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9147   S SG   E CYS A 1 211 ? 24.851  15.951  28.199 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9148   S SG   F CYS A 1 211 ? 24.381  15.170  26.356 0.16  0.00 ? 211 CYS A SG   3  
ATOM   9149   S SG   U CYS A 1 211 ? 7.587   22.257  16.405 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9150   S SG   V CYS A 1 211 ? 9.677   22.947  16.490 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9151   S SG   W CYS A 1 211 ? 8.837   22.546  16.070 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9152   S SG   X CYS A 1 211 ? 8.721   23.525  19.238 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9153   S SG   Y CYS A 1 211 ? 7.885   23.257  19.225 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9154   S SG   Z CYS A 1 211 ? 9.875   23.602  18.340 0.010 0.00 ? 211 CYS A SG   3  
ATOM   9155   H H    C CYS A 1 211 ? 10.042  22.012  19.892 0.05  0.00 ? 211 CYS A H    3  
ATOM   9156   H H    O CYS A 1 211 ? 23.448  14.763  30.250 0.95  0.00 ? 211 CYS A H    3  
ATOM   9157   N N    C ILE A 1 212 ? 11.151  20.664  17.094 0.05  0.00 ? 212 ILE A N    3  
ATOM   9158   N N    O ILE A 1 212 ? 25.549  13.068  28.356 0.95  0.00 ? 212 ILE A N    3  
ATOM   9159   C CA   C ILE A 1 212 ? 12.049  20.127  16.085 0.05  0.00 ? 212 ILE A CA   3  
ATOM   9160   C CA   O ILE A 1 212 ? 26.728  12.340  27.916 0.95  0.00 ? 212 ILE A CA   3  
ATOM   9161   C C    C ILE A 1 212 ? 12.311  18.648  16.330 0.05  0.00 ? 212 ILE A C    3  
ATOM   9162   C C    O ILE A 1 212 ? 26.607  10.862  28.260 0.95  0.00 ? 212 ILE A C    3  
ATOM   9163   O O    C ILE A 1 212 ? 12.198  17.886  15.346 0.05  0.00 ? 212 ILE A O    3  
ATOM   9164   O O    O ILE A 1 212 ? 26.868  10.049  27.348 0.95  0.00 ? 212 ILE A O    3  
ATOM   9165   H H    C ILE A 1 212 ? 11.486  21.367  17.689 0.05  0.00 ? 212 ILE A H    3  
ATOM   9166   H H    O ILE A 1 212 ? 25.658  13.763  29.037 0.95  0.00 ? 212 ILE A H    3  
ATOM   9167   N N    C ALA A 1 213 ? 12.695  18.245  17.524 0.05  0.00 ? 213 ALA A N    3  
ATOM   9168   N N    O ALA A 1 213 ? 26.298  10.504  29.490 0.95  0.00 ? 213 ALA A N    3  
ATOM   9169   C CA   C ALA A 1 213 ? 12.981  16.831  17.790 0.05  0.00 ? 213 ALA A CA   3  
ATOM   9170   C CA   O ALA A 1 213 ? 26.197  9.089   29.863 0.95  0.00 ? 213 ALA A CA   3  
ATOM   9171   C C    C ALA A 1 213 ? 11.756  15.939  17.623 0.05  0.00 ? 213 ALA A C    3  
ATOM   9172   C C    O ALA A 1 213 ? 25.085  8.359   29.119 0.95  0.00 ? 213 ALA A C    3  
ATOM   9173   O O    C ALA A 1 213 ? 11.856  14.762  17.211 0.05  0.00 ? 213 ALA A O    3  
ATOM   9174   O O    O ALA A 1 213 ? 25.189  7.151   28.810 0.95  0.00 ? 213 ALA A O    3  
ATOM   9175   H H    C ALA A 1 213 ? 12.808  18.903  18.242 0.05  0.00 ? 213 ALA A H    3  
ATOM   9176   H H    O ALA A 1 213 ? 26.149  11.194  30.170 0.95  0.00 ? 213 ALA A H    3  
ATOM   9177   N N    C GLU A 1 214 ? 10.623  16.456  18.013 0.05  0.00 ? 214 GLU A N    3  
ATOM   9178   N N    O GLU A 1 214 ? 24.000  9.051   28.903 0.95  0.00 ? 214 GLU A N    3  
ATOM   9179   C CA   C GLU A 1 214 ? 9.360   15.784  17.976 0.05  0.00 ? 214 GLU A CA   3  
ATOM   9180   C CA   O GLU A 1 214 ? 22.827  8.554   28.253 0.95  0.00 ? 214 GLU A CA   3  
ATOM   9181   C C    C GLU A 1 214 ? 8.909   15.499  16.529 0.05  0.00 ? 214 GLU A C    3  
ATOM   9182   C C    O GLU A 1 214 ? 23.094  8.222   26.771 0.95  0.00 ? 214 GLU A C    3  
ATOM   9183   O O    C GLU A 1 214 ? 8.438   14.403  16.272 0.05  0.00 ? 214 GLU A O    3  
ATOM   9184   O O    O GLU A 1 214 ? 22.644  7.182   26.318 0.95  0.00 ? 214 GLU A O    3  
ATOM   9185   H H    C GLU A 1 214 ? 10.641  17.365  18.378 0.05  0.00 ? 214 GLU A H    3  
ATOM   9186   H H    O GLU A 1 214 ? 23.980  9.975   29.229 0.95  0.00 ? 214 GLU A H    3  
ATOM   9187   N N    C ALA A 1 215 ? 9.020   16.479  15.684 0.05  0.00 ? 215 ALA A N    3  
ATOM   9188   N N    O ALA A 1 215 ? 23.750  9.110   26.088 0.95  0.00 ? 215 ALA A N    3  
ATOM   9189   C CA   C ALA A 1 215 ? 8.631   16.381  14.280 0.05  0.00 ? 215 ALA A CA   3  
ATOM   9190   C CA   O ALA A 1 215 ? 24.079  8.958   24.673 0.95  0.00 ? 215 ALA A CA   3  
ATOM   9191   C C    C ALA A 1 215 ? 9.577   15.397  13.586 0.05  0.00 ? 215 ALA A C    3  
ATOM   9192   C C    O ALA A 1 215 ? 25.078  7.806   24.533 0.95  0.00 ? 215 ALA A C    3  
ATOM   9193   O O    C ALA A 1 215 ? 9.081   14.596  12.762 0.05  0.00 ? 215 ALA A O    3  
ATOM   9194   O O    O ALA A 1 215 ? 24.926  7.018   23.572 0.95  0.00 ? 215 ALA A O    3  
ATOM   9195   H H    C ALA A 1 215 ? 9.379   17.331  16.007 0.05  0.00 ? 215 ALA A H    3  
ATOM   9196   H H    O ALA A 1 215 ? 24.034  9.929   26.544 0.95  0.00 ? 215 ALA A H    3  
ATOM   9197   N N    C ALA A 1 216 ? 10.821  15.465  13.944 0.05  0.00 ? 216 ALA A N    3  
ATOM   9198   N N    O ALA A 1 216 ? 25.987  7.734   25.454 0.95  0.00 ? 216 ALA A N    3  
ATOM   9199   C CA   C ALA A 1 216 ? 11.877  14.631  13.384 0.05  0.00 ? 216 ALA A CA   3  
ATOM   9200   C CA   O ALA A 1 216 ? 27.039  6.725   25.485 0.95  0.00 ? 216 ALA A CA   3  
ATOM   9201   C C    C ALA A 1 216 ? 11.650  13.168  13.686 0.05  0.00 ? 216 ALA A C    3  
ATOM   9202   C C    O ALA A 1 216 ? 26.471  5.333   25.638 0.95  0.00 ? 216 ALA A C    3  
ATOM   9203   O O    C ALA A 1 216 ? 11.787  12.305  12.781 0.05  0.00 ? 216 ALA A O    3  
ATOM   9204   O O    O ALA A 1 216 ? 26.894  4.393   24.917 0.95  0.00 ? 216 ALA A O    3  
ATOM   9205   H H    C ALA A 1 216 ? 11.069  16.129  14.621 0.05  0.00 ? 216 ALA A H    3  
ATOM   9206   H H    O ALA A 1 216 ? 25.975  8.408   26.165 0.95  0.00 ? 216 ALA A H    3  
ATOM   9207   N N    C PHE A 1 217 ? 11.336  12.870  14.948 0.05  0.00 ? 217 PHE A N    3  
ATOM   9208   N N    O PHE A 1 217 ? 25.544  5.178   26.585 0.95  0.00 ? 217 PHE A N    3  
ATOM   9209   C CA   C PHE A 1 217 ? 11.043  11.483  15.328 0.05  0.00 ? 217 PHE A CA   3  
ATOM   9210   C CA   O PHE A 1 217 ? 24.894  3.876   26.775 0.95  0.00 ? 217 PHE A CA   3  
ATOM   9211   C C    C PHE A 1 217 ? 9.759   10.994  14.637 0.05  0.00 ? 217 PHE A C    3  
ATOM   9212   C C    O PHE A 1 217 ? 24.047  3.512   25.544 0.95  0.00 ? 217 PHE A C    3  
ATOM   9213   O O    C PHE A 1 217 ? 9.689   9.836   14.176 0.05  0.00 ? 217 PHE A O    3  
ATOM   9214   O O    O PHE A 1 217 ? 24.031  2.342   25.109 0.95  0.00 ? 217 PHE A O    3  
ATOM   9215   H H    C PHE A 1 217 ? 11.266  13.584  15.615 0.05  0.00 ? 217 PHE A H    3  
ATOM   9216   H H    O PHE A 1 217 ? 25.271  5.944   27.131 0.95  0.00 ? 217 PHE A H    3  
ATOM   9217   N N    C ASN A 1 218 ? 8.753   11.811  14.618 0.05  0.00 ? 218 ASN A N    3  
ATOM   9218   N N    O ASN A 1 218 ? 23.315  4.452   25.033 0.95  0.00 ? 218 ASN A N    3  
ATOM   9219   C CA   C ASN A 1 218 ? 7.451   11.504  14.054 0.05  0.00 ? 218 ASN A CA   3  
ATOM   9220   C CA   O ASN A 1 218 ? 22.420  4.280   23.904 0.95  0.00 ? 218 ASN A CA   3  
ATOM   9221   C C    C ASN A 1 218 ? 7.442   11.370  12.539 0.05  0.00 ? 218 ASN A C    3  
ATOM   9222   C C    O ASN A 1 218 ? 23.124  4.033   22.579 0.95  0.00 ? 218 ASN A C    3  
ATOM   9223   O O    C ASN A 1 218 ? 6.524   10.726  11.981 0.05  0.00 ? 218 ASN A O    3  
ATOM   9224   O O    O ASN A 1 218 ? 22.504  3.477   21.644 0.95  0.00 ? 218 ASN A O    3  
ATOM   9225   H H    C ASN A 1 218 ? 8.870   12.687  15.041 0.05  0.00 ? 218 ASN A H    3  
ATOM   9226   H H    O ASN A 1 218 ? 23.347  5.334   25.458 0.95  0.00 ? 218 ASN A H    3  
ATOM   9227   N N    C LYS A 1 219 ? 8.424   11.906  11.875 0.05  0.00 ? 219 LYS A N    3  
ATOM   9228   N N    O LYS A 1 219 ? 24.374  4.380   22.480 0.95  0.00 ? 219 LYS A N    3  
ATOM   9229   C CA   C LYS A 1 219 ? 8.611   11.835  10.435 0.05  0.00 ? 219 LYS A CA   3  
ATOM   9230   C CA   O LYS A 1 219 ? 25.221  4.174   21.317 0.95  0.00 ? 219 LYS A CA   3  
ATOM   9231   C C    C LYS A 1 219 ? 9.563   10.718  10.060 0.05  0.00 ? 219 LYS A C    3  
ATOM   9232   C C    O LYS A 1 219 ? 26.050  2.914   21.458 0.95  0.00 ? 219 LYS A C    3  
ATOM   9233   O O    C LYS A 1 219 ? 9.922   10.498  8.889  0.05  0.00 ? 219 LYS A O    3  
ATOM   9234   O O    O LYS A 1 219 ? 26.892  2.559   20.613 0.95  0.00 ? 219 LYS A O    3  
ATOM   9235   H H    C LYS A 1 219 ? 9.115   12.370  12.393 0.05  0.00 ? 219 LYS A H    3  
ATOM   9236   H H    O LYS A 1 219 ? 24.790  4.785   23.270 0.95  0.00 ? 219 LYS A H    3  
ATOM   9237   N N    C GLY A 1 220 ? 9.991   9.971   11.059 0.05  0.00 ? 220 GLY A N    3  
ATOM   9238   N N    O GLY A 1 220 ? 25.820  2.196   22.539 0.95  0.00 ? 220 GLY A N    3  
ATOM   9239   C CA   C GLY A 1 220 ? 10.925  8.856   10.880 0.05  0.00 ? 220 GLY A CA   3  
ATOM   9240   C CA   O GLY A 1 220 ? 26.539  0.955   22.842 0.95  0.00 ? 220 GLY A CA   3  
ATOM   9241   C C    C GLY A 1 220 ? 12.294  9.266   10.413 0.05  0.00 ? 220 GLY A C    3  
ATOM   9242   C C    O GLY A 1 220 ? 28.008  1.141   23.106 0.95  0.00 ? 220 GLY A C    3  
ATOM   9243   O O    C GLY A 1 220 ? 13.062  8.426   9.915  0.05  0.00 ? 220 GLY A O    3  
ATOM   9244   O O    O GLY A 1 220 ? 28.781  0.170   23.049 0.95  0.00 ? 220 GLY A O    3  
ATOM   9245   H H    C GLY A 1 220 ? 9.676   10.177  11.965 0.05  0.00 ? 220 GLY A H    3  
ATOM   9246   H H    O GLY A 1 220 ? 25.142  2.511   23.174 0.95  0.00 ? 220 GLY A H    3  
ATOM   9247   N N    C GLU A 1 221 ? 12.649  10.538  10.590 0.05  0.00 ? 221 GLU A N    3  
ATOM   9248   N N    O GLU A 1 221 ? 28.424  2.364   23.432 0.95  0.00 ? 221 GLU A N    3  
ATOM   9249   C CA   C GLU A 1 221 ? 13.959  11.059  10.195 0.05  0.00 ? 221 GLU A CA   3  
ATOM   9250   C CA   O GLU A 1 221 ? 29.824  2.673   23.729 0.95  0.00 ? 221 GLU A CA   3  
ATOM   9251   C C    C GLU A 1 221 ? 15.053  10.733  11.183 0.05  0.00 ? 221 GLU A C    3  
ATOM   9252   C C    O GLU A 1 221 ? 30.238  2.280   25.126 0.95  0.00 ? 221 GLU A C    3  
ATOM   9253   O O    C GLU A 1 221 ? 16.223  10.599  10.828 0.05  0.00 ? 221 GLU A O    3  
ATOM   9254   O O    O GLU A 1 221 ? 31.397  1.964   25.390 0.95  0.00 ? 221 GLU A O    3  
ATOM   9255   H H    C GLU A 1 221 ? 12.008  11.149  11.013 0.05  0.00 ? 221 GLU A H    3  
ATOM   9256   H H    O GLU A 1 221 ? 27.762  3.086   23.486 0.95  0.00 ? 221 GLU A H    3  
ATOM   9257   N N    C THR A 1 222 ? 14.729  10.570  12.453 0.05  0.00 ? 222 THR A N    3  
ATOM   9258   N N    O THR A 1 222 ? 29.319  2.260   26.075 0.95  0.00 ? 222 THR A N    3  
ATOM   9259   C CA   C THR A 1 222 ? 15.726  10.267  13.475 0.05  0.00 ? 222 THR A CA   3  
ATOM   9260   C CA   O THR A 1 222 ? 29.637  1.905   27.455 0.95  0.00 ? 222 THR A CA   3  
ATOM   9261   C C    C THR A 1 222 ? 15.355  8.974   14.184 0.05  0.00 ? 222 THR A C    3  
ATOM   9262   C C    O THR A 1 222 ? 28.775  0.732   27.893 0.95  0.00 ? 222 THR A C    3  
ATOM   9263   O O    C THR A 1 222 ? 14.159  8.731   14.371 0.05  0.00 ? 222 THR A O    3  
ATOM   9264   O O    O THR A 1 222 ? 27.616  0.666   27.470 0.95  0.00 ? 222 THR A O    3  
ATOM   9265   H H    C THR A 1 222 ? 13.789  10.664  12.718 0.05  0.00 ? 222 THR A H    3  
ATOM   9266   H H    O THR A 1 222 ? 28.396  2.499   25.846 0.95  0.00 ? 222 THR A H    3  
ATOM   9267   N N    C ALA A 1 223 ? 16.313  8.178   14.625 0.05  0.00 ? 223 ALA A N    3  
ATOM   9268   N N    O ALA A 1 223 ? 29.264  -0.149  28.748 0.95  0.00 ? 223 ALA A N    3  
ATOM   9269   C CA   C ALA A 1 223 ? 16.031  6.910   15.248 0.05  0.00 ? 223 ALA A CA   3  
ATOM   9270   C CA   O ALA A 1 223 ? 28.524  -1.317  29.154 0.95  0.00 ? 223 ALA A CA   3  
ATOM   9271   C C    C ALA A 1 223 ? 15.534  6.958   16.701 0.05  0.00 ? 223 ALA A C    3  
ATOM   9272   C C    O ALA A 1 223 ? 27.400  -1.091  30.177 0.95  0.00 ? 223 ALA A C    3  
ATOM   9273   O O    C ALA A 1 223 ? 14.812  6.037   17.097 0.05  0.00 ? 223 ALA A O    3  
ATOM   9274   O O    O ALA A 1 223 ? 26.444  -1.874  30.170 0.95  0.00 ? 223 ALA A O    3  
ATOM   9275   H H    C ALA A 1 223 ? 17.247  8.439   14.485 0.05  0.00 ? 223 ALA A H    3  
ATOM   9276   H H    O ALA A 1 223 ? 30.176  -0.027  29.083 0.95  0.00 ? 223 ALA A H    3  
ATOM   9277   N N    C MET A 1 224 ? 15.948  7.959   17.430 0.05  0.00 ? 224 MET A N    3  
ATOM   9278   N N    O MET A 1 224 ? 27.558  -0.102  31.014 0.95  0.00 ? 224 MET A N    3  
ATOM   9279   C CA   C MET A 1 224 ? 15.583  8.052   18.859 0.05  0.00 ? 224 MET A CA   3  
ATOM   9280   C CA   O MET A 1 224 ? 26.567  0.148   32.081 0.95  0.00 ? 224 MET A CA   3  
ATOM   9281   C C    C MET A 1 224 ? 15.235  9.493   19.224 0.05  0.00 ? 224 MET A C    3  
ATOM   9282   C C    O MET A 1 224 ? 26.312  1.647   32.227 0.95  0.00 ? 224 MET A C    3  
ATOM   9283   O O    C MET A 1 224 ? 15.654  10.430  18.561 0.05  0.00 ? 224 MET A O    3  
ATOM   9284   O O    O MET A 1 224 ? 27.139  2.466   31.853 0.95  0.00 ? 224 MET A O    3  
ATOM   9285   H H    C MET A 1 224 ? 16.544  8.629   17.037 0.05  0.00 ? 224 MET A H    3  
ATOM   9286   H H    O MET A 1 224 ? 28.365  0.450   30.963 0.95  0.00 ? 224 MET A H    3  
ATOM   9287   N N    C THR A 1 225 ? 14.591  9.581   20.367 0.05  0.00 ? 225 THR A N    3  
ATOM   9288   N N    O THR A 1 225 ? 25.218  1.908   32.908 0.95  0.00 ? 225 THR A N    3  
ATOM   9289   C CA   C THR A 1 225 ? 14.186  10.797  21.042 0.05  0.00 ? 225 THR A CA   3  
ATOM   9290   C CA   O THR A 1 225 ? 24.730  3.215   33.296 0.95  0.00 ? 225 THR A CA   3  
ATOM   9291   C C    C THR A 1 225 ? 14.094  10.506  22.545 0.05  0.00 ? 225 THR A C    3  
ATOM   9292   C C    O THR A 1 225 ? 23.879  3.055   34.562 0.95  0.00 ? 225 THR A C    3  
ATOM   9293   O O    C THR A 1 225 ? 14.217  9.387   22.995 0.05  0.00 ? 225 THR A O    3  
ATOM   9294   O O    O THR A 1 225 ? 23.594  1.968   35.016 0.95  0.00 ? 225 THR A O    3  
ATOM   9295   H H    C THR A 1 225 ? 14.412  8.740   20.837 0.05  0.00 ? 225 THR A H    3  
ATOM   9296   H H    O THR A 1 225 ? 24.707  1.137   33.231 0.95  0.00 ? 225 THR A H    3  
ATOM   9297   N N    C ILE A 1 226 ? 14.073  11.603  23.304 0.05  0.00 ? 226 ILE A N    3  
ATOM   9298   N N    O ILE A 1 226 ? 23.663  4.200   35.212 0.95  0.00 ? 226 ILE A N    3  
ATOM   9299   C CA   C ILE A 1 226 ? 13.955  11.560  24.788 0.05  0.00 ? 226 ILE A CA   3  
ATOM   9300   C CA   O ILE A 1 226 ? 22.836  4.287   36.448 0.95  0.00 ? 226 ILE A CA   3  
ATOM   9301   C C    C ILE A 1 226 ? 12.715  12.354  25.090 0.05  0.00 ? 226 ILE A C    3  
ATOM   9302   C C    O ILE A 1 226 ? 21.745  5.261   36.103 0.95  0.00 ? 226 ILE A C    3  
ATOM   9303   O O    C ILE A 1 226 ? 12.661  13.539  24.702 0.05  0.00 ? 226 ILE A O    3  
ATOM   9304   O O    O ILE A 1 226 ? 22.069  6.409   35.736 0.95  0.00 ? 226 ILE A O    3  
ATOM   9305   H H    C ILE A 1 226 ? 14.117  12.477  22.863 0.05  0.00 ? 226 ILE A H    3  
ATOM   9306   H H    O ILE A 1 226 ? 24.049  5.024   34.848 0.95  0.00 ? 226 ILE A H    3  
ATOM   9307   N N    C ASN A 1 227 ? 11.704  11.672  25.644 0.05  0.00 ? 227 ASN A N    3  
ATOM   9308   N N    O ASN A 1 227 ? 20.501  4.765   36.091 0.95  0.00 ? 227 ASN A N    3  
ATOM   9309   C CA   C ASN A 1 227 ? 10.448  12.367  25.918 0.05  0.00 ? 227 ASN A CA   3  
ATOM   9310   C CA   O ASN A 1 227 ? 19.393  5.641   35.714 0.95  0.00 ? 227 ASN A CA   3  
ATOM   9311   C C    C ASN A 1 227 ? 9.697   11.593  27.024 0.05  0.00 ? 227 ASN A C    3  
ATOM   9312   C C    O ASN A 1 227 ? 18.092  5.061   36.311 0.95  0.00 ? 227 ASN A C    3  
ATOM   9313   O O    C ASN A 1 227 ? 10.193  10.566  27.498 0.05  0.00 ? 227 ASN A O    3  
ATOM   9314   O O    O ASN A 1 227 ? 18.131  4.017   36.968 0.95  0.00 ? 227 ASN A O    3  
ATOM   9315   H H    C ASN A 1 227 ? 11.794  10.715  25.831 0.05  0.00 ? 227 ASN A H    3  
ATOM   9316   H H    O ASN A 1 227 ? 20.340  3.822   36.299 0.95  0.00 ? 227 ASN A H    3  
ATOM   9317   N N    C GLY A 1 228 ? 8.595   12.162  27.421 0.05  0.00 ? 228 GLY A N    3  
ATOM   9318   N N    O GLY A 1 228 ? 17.038  5.802   36.116 0.95  0.00 ? 228 GLY A N    3  
ATOM   9319   C CA   C GLY A 1 228 ? 7.792   11.623  28.534 0.05  0.00 ? 228 GLY A CA   3  
ATOM   9320   C CA   O GLY A 1 228 ? 15.725  5.462   36.694 0.95  0.00 ? 228 GLY A CA   3  
ATOM   9321   C C    C GLY A 1 228 ? 6.476   11.094  28.041 0.05  0.00 ? 228 GLY A C    3  
ATOM   9322   C C    O GLY A 1 228 ? 14.748  5.078   35.620 0.95  0.00 ? 228 GLY A C    3  
ATOM   9323   O O    C GLY A 1 228 ? 6.190   11.245  26.856 0.05  0.00 ? 228 GLY A O    3  
ATOM   9324   O O    O GLY A 1 228 ? 15.098  5.174   34.446 0.95  0.00 ? 228 GLY A O    3  
ATOM   9325   H H    C GLY A 1 228 ? 8.325   13.009  27.009 0.05  0.00 ? 228 GLY A H    3  
ATOM   9326   H H    O GLY A 1 228 ? 17.135  6.643   35.624 0.95  0.00 ? 228 GLY A H    3  
ATOM   9327   N N    C PRO A 1 229 ? 5.682   10.571  28.991 0.05  0.00 ? 229 PRO A N    3  
ATOM   9328   N N    O PRO A 1 229 ? 13.523  4.740   36.060 0.95  0.00 ? 229 PRO A N    3  
ATOM   9329   C CA   C PRO A 1 229 ? 4.395   9.941   28.686 0.05  0.00 ? 229 PRO A CA   3  
ATOM   9330   C CA   O PRO A 1 229 ? 12.465  4.267   35.164 0.95  0.00 ? 229 PRO A CA   3  
ATOM   9331   C C    C PRO A 1 229 ? 3.422   10.810  27.997 0.05  0.00 ? 229 PRO A C    3  
ATOM   9332   C C    O PRO A 1 229 ? 12.095  5.203   34.086 0.95  0.00 ? 229 PRO A C    3  
ATOM   9333   O O    C PRO A 1 229 ? 2.535   10.356  27.228 0.05  0.00 ? 229 PRO A O    3  
ATOM   9334   O O    O PRO A 1 229 ? 11.633  4.814   32.981 0.95  0.00 ? 229 PRO A O    3  
ATOM   9335   N N    C TRP A 1 230 ? 3.534   12.130  28.199 0.05  0.00 ? 230 TRP A N    3  
ATOM   9336   N N    O TRP A 1 230 ? 12.297  6.507   34.315 0.95  0.00 ? 230 TRP A N    3  
ATOM   9337   C CA   C TRP A 1 230 ? 2.649   13.051  27.519 0.05  0.00 ? 230 TRP A CA   3  
ATOM   9338   C CA   O TRP A 1 230 ? 12.006  7.484   33.288 0.95  0.00 ? 230 TRP A CA   3  
ATOM   9339   C C    C TRP A 1 230 ? 2.812   13.056  26.004 0.05  0.00 ? 230 TRP A C    3  
ATOM   9340   C C    O TRP A 1 230 ? 12.880  7.351   32.047 0.95  0.00 ? 230 TRP A C    3  
ATOM   9341   O O    C TRP A 1 230 ? 1.932   13.595  25.285 0.05  0.00 ? 230 TRP A O    3  
ATOM   9342   O O    O TRP A 1 230 ? 12.553  7.946   30.988 0.95  0.00 ? 230 TRP A O    3  
ATOM   9343   H H    C TRP A 1 230 ? 4.240   12.475  28.785 0.05  0.00 ? 230 TRP A H    3  
ATOM   9344   H H    O TRP A 1 230 ? 12.675  6.799   35.171 0.95  0.00 ? 230 TRP A H    3  
ATOM   9345   N N    C ALA A 1 231 ? 3.911   12.565  25.479 0.05  0.00 ? 231 ALA A N    3  
ATOM   9346   N N    O ALA A 1 231 ? 14.005  6.678   32.128 0.95  0.00 ? 231 ALA A N    3  
ATOM   9347   C CA   C ALA A 1 231 ? 4.237   12.556  24.063 0.05  0.00 ? 231 ALA A CA   3  
ATOM   9348   C CA   O ALA A 1 231 ? 14.970  6.517   31.054 0.95  0.00 ? 231 ALA A CA   3  
ATOM   9349   C C    C ALA A 1 231 ? 3.734   11.344  23.276 0.05  0.00 ? 231 ALA A C    3  
ATOM   9350   C C    O ALA A 1 231 ? 14.730  5.327   30.122 0.95  0.00 ? 231 ALA A C    3  
ATOM   9351   O O    C ALA A 1 231 ? 3.676   11.455  22.027 0.05  0.00 ? 231 ALA A O    3  
ATOM   9352   O O    O ALA A 1 231 ? 15.302  5.348   29.005 0.95  0.00 ? 231 ALA A O    3  
ATOM   9353   H H    C ALA A 1 231 ? 4.583   12.210  26.098 0.05  0.00 ? 231 ALA A H    3  
ATOM   9354   H H    O ALA A 1 231 ? 14.230  6.285   32.997 0.95  0.00 ? 231 ALA A H    3  
ATOM   9355   N N    C TRP A 1 232 ? 3.392   10.290  23.945 0.05  0.00 ? 232 TRP A N    3  
ATOM   9356   N N    O TRP A 1 232 ? 13.949  4.382   30.539 0.95  0.00 ? 232 TRP A N    3  
ATOM   9357   C CA   C TRP A 1 232 ? 2.918   9.042   23.370 0.05  0.00 ? 232 TRP A CA   3  
ATOM   9358   C CA   O TRP A 1 232 ? 13.627  3.169   29.807 0.95  0.00 ? 232 TRP A CA   3  
ATOM   9359   C C    C TRP A 1 232 ? 1.767   9.240   22.409 0.05  0.00 ? 232 TRP A C    3  
ATOM   9360   C C    O TRP A 1 232 ? 13.131  3.445   28.405 0.95  0.00 ? 232 TRP A C    3  
ATOM   9361   O O    C TRP A 1 232 ? 1.922   8.712   21.271 0.05  0.00 ? 232 TRP A O    3  
ATOM   9362   O O    O TRP A 1 232 ? 13.733  2.815   27.490 0.95  0.00 ? 232 TRP A O    3  
ATOM   9363   H H    C TRP A 1 232 ? 3.476   10.330  24.921 0.05  0.00 ? 232 TRP A H    3  
ATOM   9364   H H    O TRP A 1 232 ? 13.556  4.485   31.431 0.95  0.00 ? 232 TRP A H    3  
ATOM   9365   N N    C SER A 1 233 ? 0.721   9.934   22.752 0.05  0.00 ? 233 SER A N    3  
ATOM   9366   N N    O SER A 1 233 ? 12.171  4.297   28.191 0.95  0.00 ? 233 SER A N    3  
ATOM   9367   C CA   C SER A 1 233 ? -0.432  10.108  21.854 0.05  0.00 ? 233 SER A CA   3  
ATOM   9368   C CA   O SER A 1 233 ? 11.639  4.554   26.843 0.95  0.00 ? 233 SER A CA   3  
ATOM   9369   C C    C SER A 1 233 ? -0.092  10.662  20.473 0.05  0.00 ? 233 SER A C    3  
ATOM   9370   C C    O SER A 1 233 ? 12.686  4.950   25.805 0.95  0.00 ? 233 SER A C    3  
ATOM   9371   O O    C SER A 1 233 ? -0.786  10.360  19.465 0.05  0.00 ? 233 SER A O    3  
ATOM   9372   O O    O SER A 1 233 ? 12.529  4.668   24.587 0.95  0.00 ? 233 SER A O    3  
ATOM   9373   H H    C SER A 1 233 ? 0.688   10.331  23.648 0.05  0.00 ? 233 SER A H    3  
ATOM   9374   H H    O SER A 1 233 ? 11.770  4.762   28.955 0.95  0.00 ? 233 SER A H    3  
ATOM   9375   N N    C ASN A 1 234 ? 0.947   11.456  20.368 0.05  0.00 ? 234 ASN A N    3  
ATOM   9376   N N    O ASN A 1 234 ? 13.754  5.588   26.221 0.95  0.00 ? 234 ASN A N    3  
ATOM   9377   C CA   C ASN A 1 234 ? 1.440   12.098  19.160 0.05  0.00 ? 234 ASN A CA   3  
ATOM   9378   C CA   O ASN A 1 234 ? 14.862  6.063   25.409 0.95  0.00 ? 234 ASN A CA   3  
ATOM   9379   C C    C ASN A 1 234 ? 2.182   11.099  18.265 0.05  0.00 ? 234 ASN A C    3  
ATOM   9380   C C    O ASN A 1 234 ? 15.780  4.908   24.994 0.95  0.00 ? 234 ASN A C    3  
ATOM   9381   O O    C ASN A 1 234 ? 2.086   11.284  17.061 0.05  0.00 ? 234 ASN A O    3  
ATOM   9382   O O    O ASN A 1 234 ? 16.309  5.012   23.897 0.95  0.00 ? 234 ASN A O    3  
ATOM   9383   H H    C ASN A 1 234 ? 1.439   11.643  21.194 0.05  0.00 ? 234 ASN A H    3  
ATOM   9384   H H    O ASN A 1 234 ? 13.807  5.770   27.182 0.95  0.00 ? 234 ASN A H    3  
ATOM   9385   N N    C ILE A 1 235 ? 2.892   10.176  18.848 0.05  0.00 ? 235 ILE A N    3  
ATOM   9386   N N    O ILE A 1 235 ? 15.968  3.946   25.851 0.95  0.00 ? 235 ILE A N    3  
ATOM   9387   C CA   C ILE A 1 235 ? 3.659   9.159   18.144 0.05  0.00 ? 235 ILE A CA   3  
ATOM   9388   C CA   O ILE A 1 235 ? 16.812  2.784   25.614 0.95  0.00 ? 235 ILE A CA   3  
ATOM   9389   C C    C ILE A 1 235 ? 2.726   8.122   17.523 0.05  0.00 ? 235 ILE A C    3  
ATOM   9390   C C    O ILE A 1 235 ? 16.149  1.837   24.617 0.95  0.00 ? 235 ILE A C    3  
ATOM   9391   O O    C ILE A 1 235 ? 2.905   7.724   16.377 0.05  0.00 ? 235 ILE A O    3  
ATOM   9392   O O    O ILE A 1 235 ? 16.796  1.332   23.706 0.95  0.00 ? 235 ILE A O    3  
ATOM   9393   H H    C ILE A 1 235 ? 2.915   10.169  19.828 0.05  0.00 ? 235 ILE A H    3  
ATOM   9394   H H    O ILE A 1 235 ? 15.512  4.011   26.717 0.95  0.00 ? 235 ILE A H    3  
ATOM   9395   N N    C ASP A 1 236 ? 1.721   7.734   18.283 0.05  0.00 ? 236 ASP A N    3  
ATOM   9396   N N    O ASP A 1 236 ? 14.855  1.647   24.788 0.95  0.00 ? 236 ASP A N    3  
ATOM   9397   C CA   C ASP A 1 236 ? 0.680   6.791   17.891 0.05  0.00 ? 236 ASP A CA   3  
ATOM   9398   C CA   O ASP A 1 236 ? 14.003  0.824   23.937 0.95  0.00 ? 236 ASP A CA   3  
ATOM   9399   C C    C ASP A 1 236 ? 0.135   7.260   16.529 0.05  0.00 ? 236 ASP A C    3  
ATOM   9400   C C    O ASP A 1 236 ? 14.265  1.256   22.482 0.95  0.00 ? 236 ASP A C    3  
ATOM   9401   O O    C ASP A 1 236 ? 0.116   6.512   15.552 0.05  0.00 ? 236 ASP A O    3  
ATOM   9402   O O    O ASP A 1 236 ? 14.606  0.445   21.622 0.95  0.00 ? 236 ASP A O    3  
ATOM   9403   H H    C ASP A 1 236 ? 1.652   8.134   19.175 0.05  0.00 ? 236 ASP A H    3  
ATOM   9404   H H    O ASP A 1 236 ? 14.426  2.120   25.531 0.95  0.00 ? 236 ASP A H    3  
ATOM   9405   N N    C THR A 1 237 ? -0.317  8.483   16.498 0.05  0.00 ? 237 THR A N    3  
ATOM   9406   N N    O THR A 1 237 ? 14.079  2.523   22.232 0.95  0.00 ? 237 THR A N    3  
ATOM   9407   C CA   C THR A 1 237 ? -0.861  9.170   15.351 0.05  0.00 ? 237 THR A CA   3  
ATOM   9408   C CA   O THR A 1 237 ? 14.272  3.187   20.965 0.95  0.00 ? 237 THR A CA   3  
ATOM   9409   C C    C THR A 1 237 ? 0.060   9.091   14.125 0.05  0.00 ? 237 THR A C    3  
ATOM   9410   C C    O THR A 1 237 ? 15.646  2.891   20.347 0.95  0.00 ? 237 THR A C    3  
ATOM   9411   O O    C THR A 1 237 ? -0.374  8.852   12.964 0.05  0.00 ? 237 THR A O    3  
ATOM   9412   O O    O THR A 1 237 ? 15.797  2.624   19.123 0.95  0.00 ? 237 THR A O    3  
ATOM   9413   H H    C THR A 1 237 ? -0.272  8.991   17.334 0.05  0.00 ? 237 THR A H    3  
ATOM   9414   H H    O THR A 1 237 ? 13.792  3.083   22.983 0.95  0.00 ? 237 THR A H    3  
ATOM   9415   N N    C SER A 1 238 ? 1.325   9.308   14.411 0.05  0.00 ? 238 SER A N    3  
ATOM   9416   N N    O SER A 1 238 ? 16.631  2.958   21.217 0.95  0.00 ? 238 SER A N    3  
ATOM   9417   C CA   C SER A 1 238 ? 2.404   9.340   13.439 0.05  0.00 ? 238 SER A CA   3  
ATOM   9418   C CA   O SER A 1 238 ? 18.036  2.771   20.898 0.95  0.00 ? 238 SER A CA   3  
ATOM   9419   C C    C SER A 1 238 ? 2.509   8.026   12.681 0.05  0.00 ? 238 SER A C    3  
ATOM   9420   C C    O SER A 1 238 ? 18.290  1.400   20.290 0.95  0.00 ? 238 SER A C    3  
ATOM   9421   O O    C SER A 1 238 ? 2.906   8.012   11.494 0.05  0.00 ? 238 SER A O    3  
ATOM   9422   O O    O SER A 1 238 ? 19.204  1.242   19.450 0.95  0.00 ? 238 SER A O    3  
ATOM   9423   H H    C SER A 1 238 ? 1.552   9.492   15.347 0.05  0.00 ? 238 SER A H    3  
ATOM   9424   H H    O SER A 1 238 ? 16.402  3.181   22.144 0.95  0.00 ? 238 SER A H    3  
ATOM   9425   N N    C LYS A 1 239 ? 2.191   6.936   13.334 0.05  0.00 ? 239 LYS A N    3  
ATOM   9426   N N    O LYS A 1 239 ? 17.532  0.416   20.705 0.95  0.00 ? 239 LYS A N    3  
ATOM   9427   C CA   C LYS A 1 239 ? 2.256   5.593   12.758 0.05  0.00 ? 239 LYS A CA   3  
ATOM   9428   C CA   O LYS A 1 239 ? 17.659  -0.964  20.236 0.95  0.00 ? 239 LYS A CA   3  
ATOM   9429   C C    C LYS A 1 239 ? 3.667   5.010   12.749 0.05  0.00 ? 239 LYS A C    3  
ATOM   9430   C C    O LYS A 1 239 ? 18.789  -1.729  20.920 0.95  0.00 ? 239 LYS A C    3  
ATOM   9431   O O    C LYS A 1 239 ? 3.974   4.061   12.001 0.05  0.00 ? 239 LYS A O    3  
ATOM   9432   O O    O LYS A 1 239 ? 19.269  -2.766  20.420 0.95  0.00 ? 239 LYS A O    3  
ATOM   9433   H H    C LYS A 1 239 ? 1.905   7.025   14.268 0.05  0.00 ? 239 LYS A H    3  
ATOM   9434   H H    O LYS A 1 239 ? 16.847  0.614   21.379 0.95  0.00 ? 239 LYS A H    3  
ATOM   9435   N N    C VAL A 1 240 ? 4.523   5.553   13.593 0.05  0.00 ? 240 VAL A N    3  
ATOM   9436   N N    O VAL A 1 240 ? 19.202  -1.243  22.075 0.95  0.00 ? 240 VAL A N    3  
ATOM   9437   C CA   C VAL A 1 240 ? 5.897   5.092   13.762 0.05  0.00 ? 240 VAL A CA   3  
ATOM   9438   C CA   O VAL A 1 240 ? 20.233  -1.870  22.896 0.95  0.00 ? 240 VAL A CA   3  
ATOM   9439   C C    C VAL A 1 240 ? 5.773   3.867   14.685 0.05  0.00 ? 240 VAL A C    3  
ATOM   9440   C C    O VAL A 1 240 ? 19.490  -2.992  23.641 0.95  0.00 ? 240 VAL A C    3  
ATOM   9441   O O    C VAL A 1 240 ? 4.929   3.884   15.587 0.05  0.00 ? 240 VAL A O    3  
ATOM   9442   O O    O VAL A 1 240 ? 18.329  -2.793  24.014 0.95  0.00 ? 240 VAL A O    3  
ATOM   9443   H H    C VAL A 1 240 ? 4.208   6.285   14.163 0.05  0.00 ? 240 VAL A H    3  
ATOM   9444   H H    O VAL A 1 240 ? 18.768  -0.434  22.417 0.95  0.00 ? 240 VAL A H    3  
ATOM   9445   N N    C ASN A 1 241 ? 6.569   2.868   14.422 0.05  0.00 ? 241 ASN A N    3  
ATOM   9446   N N    O ASN A 1 241 ? 20.149  -4.106  23.803 0.95  0.00 ? 241 ASN A N    3  
ATOM   9447   C CA   C ASN A 1 241 ? 6.615   1.630   15.208 0.05  0.00 ? 241 ASN A CA   3  
ATOM   9448   C CA   O ASN A 1 241 ? 19.617  -5.275  24.512 0.95  0.00 ? 241 ASN A CA   3  
ATOM   9449   C C    C ASN A 1 241 ? 7.728   1.868   16.257 0.05  0.00 ? 241 ASN A C    3  
ATOM   9450   C C    O ASN A 1 241 ? 20.105  -5.109  25.972 0.95  0.00 ? 241 ASN A C    3  
ATOM   9451   O O    C ASN A 1 241 ? 8.899   1.580   16.025 0.05  0.00 ? 241 ASN A O    3  
ATOM   9452   O O    O ASN A 1 241 ? 21.181  -5.568  26.344 0.95  0.00 ? 241 ASN A O    3  
ATOM   9453   H H    C ASN A 1 241 ? 7.185   2.957   13.666 0.05  0.00 ? 241 ASN A H    3  
ATOM   9454   H H    O ASN A 1 241 ? 21.059  -4.159  23.446 0.95  0.00 ? 241 ASN A H    3  
ATOM   9455   N N    C TYR A 1 242 ? 7.209   2.409   17.358 0.05  0.00 ? 242 TYR A N    3  
ATOM   9456   N N    O TYR A 1 242 ? 19.209  -4.420  26.677 0.95  0.00 ? 242 TYR A N    3  
ATOM   9457   C CA   C TYR A 1 242 ? 8.112   2.817   18.469 0.05  0.00 ? 242 TYR A CA   3  
ATOM   9458   C CA   O TYR A 1 242 ? 19.512  -4.053  28.087 0.95  0.00 ? 242 TYR A CA   3  
ATOM   9459   C C    C TYR A 1 242 ? 8.134   1.945   19.677 0.05  0.00 ? 242 TYR A C    3  
ATOM   9460   C C    O TYR A 1 242 ? 18.812  -4.825  29.152 0.95  0.00 ? 242 TYR A C    3  
ATOM   9461   O O    C TYR A 1 242 ? 7.158   1.225   19.939 0.05  0.00 ? 242 TYR A O    3  
ATOM   9462   O O    O TYR A 1 242 ? 17.733  -5.386  28.903 0.95  0.00 ? 242 TYR A O    3  
ATOM   9463   H H    C TYR A 1 242 ? 6.249   2.597   17.408 0.05  0.00 ? 242 TYR A H    3  
ATOM   9464   H H    O TYR A 1 242 ? 18.386  -4.102  26.250 0.95  0.00 ? 242 TYR A H    3  
ATOM   9465   N N    C GLY A 1 243 ? 9.161   2.039   20.486 0.05  0.00 ? 243 GLY A N    3  
ATOM   9466   N N    O GLY A 1 243 ? 19.319  -4.808  30.360 0.95  0.00 ? 243 GLY A N    3  
ATOM   9467   C CA   C GLY A 1 243 ? 9.371   1.339   21.743 0.05  0.00 ? 243 GLY A CA   3  
ATOM   9468   C CA   O GLY A 1 243 ? 18.784  -5.431  31.560 0.95  0.00 ? 243 GLY A CA   3  
ATOM   9469   C C    C GLY A 1 243 ? 9.887   2.443   22.754 0.05  0.00 ? 243 GLY A C    3  
ATOM   9470   C C    O GLY A 1 243 ? 18.909  -4.332  32.693 0.95  0.00 ? 243 GLY A C    3  
ATOM   9471   O O    C GLY A 1 243 ? 10.423  3.436   22.282 0.05  0.00 ? 243 GLY A O    3  
ATOM   9472   O O    O GLY A 1 243 ? 19.753  -3.459  32.543 0.95  0.00 ? 243 GLY A O    3  
ATOM   9473   H H    C GLY A 1 243 ? 9.853   2.684   20.232 0.05  0.00 ? 243 GLY A H    3  
ATOM   9474   H H    O GLY A 1 243 ? 20.138  -4.282  30.477 0.95  0.00 ? 243 GLY A H    3  
ATOM   9475   N N    C VAL A 1 244 ? 9.637   2.176   23.993 0.05  0.00 ? 244 VAL A N    3  
ATOM   9476   N N    O VAL A 1 244 ? 18.053  -4.467  33.651 0.95  0.00 ? 244 VAL A N    3  
ATOM   9477   C CA   C VAL A 1 244 ? 9.997   3.009   25.162 0.05  0.00 ? 244 VAL A CA   3  
ATOM   9478   C CA   O VAL A 1 244 ? 17.926  -3.603  34.845 0.95  0.00 ? 244 VAL A CA   3  
ATOM   9479   C C    C VAL A 1 244 ? 10.882  2.169   26.026 0.05  0.00 ? 244 VAL A C    3  
ATOM   9480   C C    O VAL A 1 244 ? 18.141  -4.485  36.033 0.95  0.00 ? 244 VAL A C    3  
ATOM   9481   O O    C VAL A 1 244 ? 10.486  0.999   26.336 0.05  0.00 ? 244 VAL A O    3  
ATOM   9482   O O    O VAL A 1 244 ? 17.469  -5.564  36.111 0.95  0.00 ? 244 VAL A O    3  
ATOM   9483   H H    C VAL A 1 244 ? 9.164   1.338   24.178 0.05  0.00 ? 244 VAL A H    3  
ATOM   9484   H H    O VAL A 1 244 ? 17.427  -5.218  33.581 0.95  0.00 ? 244 VAL A H    3  
ATOM   9485   N N    C THR A 1 245 ? 12.053  2.656   26.404 0.05  0.00 ? 245 THR A N    3  
ATOM   9486   N N    O THR A 1 245 ? 19.042  -4.132  36.936 0.95  0.00 ? 245 THR A N    3  
ATOM   9487   C CA   C THR A 1 245 ? 12.946  1.812   27.209 0.05  0.00 ? 245 THR A CA   3  
ATOM   9488   C CA   O THR A 1 245 ? 19.292  -5.023  38.076 0.95  0.00 ? 245 THR A CA   3  
ATOM   9489   C C    C THR A 1 245 ? 13.775  2.618   28.210 0.05  0.00 ? 245 THR A C    3  
ATOM   9490   C C    O THR A 1 245 ? 19.646  -4.261  39.354 0.95  0.00 ? 245 THR A C    3  
ATOM   9491   O O    C THR A 1 245 ? 13.658  3.856   28.269 0.05  0.00 ? 245 THR A O    3  
ATOM   9492   O O    O THR A 1 245 ? 19.707  -3.018  39.346 0.95  0.00 ? 245 THR A O    3  
ATOM   9493   H H    C THR A 1 245 ? 12.334  3.552   26.123 0.05  0.00 ? 245 THR A H    3  
ATOM   9494   H H    O THR A 1 245 ? 19.558  -3.306  36.827 0.95  0.00 ? 245 THR A H    3  
ATOM   9495   N N    C VAL A 1 246 ? 14.615  1.955   28.941 0.05  0.00 ? 246 VAL A N    3  
ATOM   9496   N N    O VAL A 1 246 ? 19.913  -4.973  40.403 0.95  0.00 ? 246 VAL A N    3  
ATOM   9497   C CA   C VAL A 1 246 ? 15.509  2.615   29.904 0.05  0.00 ? 246 VAL A CA   3  
ATOM   9498   C CA   O VAL A 1 246 ? 20.319  -4.367  41.680 0.95  0.00 ? 246 VAL A CA   3  
ATOM   9499   C C    C VAL A 1 246 ? 16.486  3.534   29.159 0.05  0.00 ? 246 VAL A C    3  
ATOM   9500   C C    O VAL A 1 246 ? 21.663  -3.647  41.508 0.95  0.00 ? 246 VAL A C    3  
ATOM   9501   O O    C VAL A 1 246 ? 16.998  3.173   28.096 0.05  0.00 ? 246 VAL A O    3  
ATOM   9502   O O    O VAL A 1 246 ? 22.563  -4.153  40.833 0.95  0.00 ? 246 VAL A O    3  
ATOM   9503   H H    C VAL A 1 246 ? 14.680  0.985   28.824 0.05  0.00 ? 246 VAL A H    3  
ATOM   9504   H H    O VAL A 1 246 ? 19.876  -5.949  40.334 0.95  0.00 ? 246 VAL A H    3  
ATOM   9505   N N    C LEU A 1 247 ? 16.756  4.713   29.719 0.05  0.00 ? 247 LEU A N    3  
ATOM   9506   N N    O LEU A 1 247 ? 21.807  -2.475  42.127 0.95  0.00 ? 247 LEU A N    3  
ATOM   9507   C CA   C LEU A 1 247 ? 17.734  5.649   29.142 0.05  0.00 ? 247 LEU A CA   3  
ATOM   9508   C CA   O LEU A 1 247 ? 23.073  -1.726  42.102 0.95  0.00 ? 247 LEU A CA   3  
ATOM   9509   C C    C LEU A 1 247 ? 19.105  4.979   29.171 0.05  0.00 ? 247 LEU A C    3  
ATOM   9510   C C    O LEU A 1 247 ? 24.136  -2.569  42.800 0.95  0.00 ? 247 LEU A C    3  
ATOM   9511   O O    C LEU A 1 247 ? 19.411  4.122   30.020 0.05  0.00 ? 247 LEU A O    3  
ATOM   9512   O O    O LEU A 1 247 ? 23.857  -3.392  43.691 0.95  0.00 ? 247 LEU A O    3  
ATOM   9513   H H    C LEU A 1 247 ? 16.327  4.943   30.568 0.05  0.00 ? 247 LEU A H    3  
ATOM   9514   H H    O LEU A 1 247 ? 21.061  -2.125  42.657 0.95  0.00 ? 247 LEU A H    3  
ATOM   9515   N N    C PRO A 1 248 ? 20.002  5.443   28.305 0.05  0.00 ? 248 PRO A N    3  
ATOM   9516   N N    O PRO A 1 248 ? 25.400  -2.297  42.484 0.95  0.00 ? 248 PRO A N    3  
ATOM   9517   C CA   C PRO A 1 248 ? 21.336  4.889   28.229 0.05  0.00 ? 248 PRO A CA   3  
ATOM   9518   C CA   O PRO A 1 248 ? 26.500  -3.029  43.072 0.95  0.00 ? 248 PRO A CA   3  
ATOM   9519   C C    C PRO A 1 248 ? 22.176  5.252   29.458 0.05  0.00 ? 248 PRO A C    3  
ATOM   9520   C C    O PRO A 1 248 ? 26.685  -2.688  44.554 0.95  0.00 ? 248 PRO A C    3  
ATOM   9521   O O    C PRO A 1 248 ? 21.877  6.264   30.103 0.05  0.00 ? 248 PRO A O    3  
ATOM   9522   O O    O PRO A 1 248 ? 26.271  -1.599  44.969 0.95  0.00 ? 248 PRO A O    3  
ATOM   9523   N N    C THR A 1 249 ? 23.192  4.472   29.748 0.05  0.00 ? 249 THR A N    3  
ATOM   9524   N N    O THR A 1 249 ? 27.299  -3.573  45.306 0.95  0.00 ? 249 THR A N    3  
ATOM   9525   C CA   C THR A 1 249 ? 24.108  4.734   30.847 0.05  0.00 ? 249 THR A CA   3  
ATOM   9526   C CA   O THR A 1 249 ? 27.597  -3.352  46.712 0.95  0.00 ? 249 THR A CA   3  
ATOM   9527   C C    C THR A 1 249 ? 25.222  5.643   30.342 0.05  0.00 ? 249 THR A C    3  
ATOM   9528   C C    O THR A 1 249 ? 28.941  -2.642  46.817 0.95  0.00 ? 249 THR A C    3  
ATOM   9529   O O    C THR A 1 249 ? 25.396  5.791   29.142 0.05  0.00 ? 249 THR A O    3  
ATOM   9530   O O    O THR A 1 249 ? 29.695  -2.611  45.856 0.95  0.00 ? 249 THR A O    3  
ATOM   9531   H H    C THR A 1 249 ? 23.363  3.698   29.172 0.05  0.00 ? 249 THR A H    3  
ATOM   9532   H H    O THR A 1 249 ? 27.606  -4.405  44.889 0.95  0.00 ? 249 THR A H    3  
ATOM   9533   N N    C PHE A 1 250 ? 25.911  6.309   31.262 0.05  0.00 ? 250 PHE A N    3  
ATOM   9534   N N    O PHE A 1 250 ? 29.192  -2.006  47.956 0.95  0.00 ? 250 PHE A N    3  
ATOM   9535   C CA   C PHE A 1 250 ? 27.050  7.180   30.912 0.05  0.00 ? 250 PHE A CA   3  
ATOM   9536   C CA   O PHE A 1 250 ? 30.477  -1.325  48.207 0.95  0.00 ? 250 PHE A CA   3  
ATOM   9537   C C    C PHE A 1 250 ? 28.129  6.893   31.981 0.05  0.00 ? 250 PHE A C    3  
ATOM   9538   C C    O PHE A 1 250 ? 30.845  -1.671  49.669 0.95  0.00 ? 250 PHE A C    3  
ATOM   9539   O O    C PHE A 1 250 ? 27.858  6.920   33.185 0.05  0.00 ? 250 PHE A O    3  
ATOM   9540   O O    O PHE A 1 250 ? 30.033  -1.516  50.585 0.95  0.00 ? 250 PHE A O    3  
ATOM   9541   H H    C PHE A 1 250 ? 25.677  6.190   32.206 0.05  0.00 ? 250 PHE A H    3  
ATOM   9542   H H    O PHE A 1 250 ? 28.516  -2.020  48.664 0.95  0.00 ? 250 PHE A H    3  
ATOM   9543   N N    C LYS A 1 251 ? 29.302  6.511   31.504 0.05  0.00 ? 251 LYS A N    3  
ATOM   9544   N N    O LYS A 1 251 ? 32.027  -2.242  49.828 0.95  0.00 ? 251 LYS A N    3  
ATOM   9545   C CA   C LYS A 1 251 ? 30.418  6.135   32.371 0.05  0.00 ? 251 LYS A CA   3  
ATOM   9546   C CA   O LYS A 1 251 ? 32.511  -2.697  51.131 0.95  0.00 ? 251 LYS A CA   3  
ATOM   9547   C C    C LYS A 1 251 ? 30.000  5.018   33.302 0.05  0.00 ? 251 LYS A C    3  
ATOM   9548   C C    O LYS A 1 251 ? 31.528  -3.673  51.739 0.95  0.00 ? 251 LYS A C    3  
ATOM   9549   O O    C LYS A 1 251 ? 30.469  4.879   34.421 0.05  0.00 ? 251 LYS A O    3  
ATOM   9550   O O    O LYS A 1 251 ? 31.369  -3.787  52.944 0.95  0.00 ? 251 LYS A O    3  
ATOM   9551   H H    C LYS A 1 251 ? 29.413  6.436   30.534 0.05  0.00 ? 251 LYS A H    3  
ATOM   9552   H H    O LYS A 1 251 ? 32.581  -2.405  49.037 0.95  0.00 ? 251 LYS A H    3  
ATOM   9553   N N    C GLY A 1 252 ? 29.110  4.200   32.753 0.05  0.00 ? 252 GLY A N    3  
ATOM   9554   N N    O GLY A 1 252 ? 30.901  -4.404  50.825 0.95  0.00 ? 252 GLY A N    3  
ATOM   9555   C CA   C GLY A 1 252 ? 28.524  3.034   33.370 0.05  0.00 ? 252 GLY A CA   3  
ATOM   9556   C CA   O GLY A 1 252 ? 29.907  -5.421  51.077 0.95  0.00 ? 252 GLY A CA   3  
ATOM   9557   C C    C GLY A 1 252 ? 27.552  3.385   34.493 0.05  0.00 ? 252 GLY A C    3  
ATOM   9558   C C    O GLY A 1 252 ? 28.544  -4.838  51.438 0.95  0.00 ? 252 GLY A C    3  
ATOM   9559   O O    C GLY A 1 252 ? 27.271  2.507   35.338 0.05  0.00 ? 252 GLY A O    3  
ATOM   9560   O O    O GLY A 1 252 ? 27.627  -5.622  51.768 0.95  0.00 ? 252 GLY A O    3  
ATOM   9561   H H    C GLY A 1 252 ? 28.824  4.408   31.839 0.05  0.00 ? 252 GLY A H    3  
ATOM   9562   H H    O GLY A 1 252 ? 31.136  -4.237  49.889 0.95  0.00 ? 252 GLY A H    3  
ATOM   9563   N N    C GLN A 1 253 ? 27.032  4.585   34.506 0.05  0.00 ? 253 GLN A N    3  
ATOM   9564   N N    O GLN A 1 253 ? 28.386  -3.542  51.359 0.95  0.00 ? 253 GLN A N    3  
ATOM   9565   C CA   C GLN A 1 253 ? 26.086  5.015   35.538 0.05  0.00 ? 253 GLN A CA   3  
ATOM   9566   C CA   O GLN A 1 253 ? 27.120  -2.888  51.694 0.95  0.00 ? 253 GLN A CA   3  
ATOM   9567   C C    C GLN A 1 253 ? 24.785  5.473   34.914 0.05  0.00 ? 253 GLN A C    3  
ATOM   9568   C C    O GLN A 1 253 ? 26.380  -2.478  50.439 0.95  0.00 ? 253 GLN A C    3  
ATOM   9569   O O    C GLN A 1 253 ? 24.784  6.220   33.944 0.05  0.00 ? 253 GLN A O    3  
ATOM   9570   O O    O GLN A 1 253 ? 26.979  -1.983  49.492 0.95  0.00 ? 253 GLN A O    3  
ATOM   9571   H H    C GLN A 1 253 ? 27.289  5.220   33.807 0.05  0.00 ? 253 GLN A H    3  
ATOM   9572   H H    O GLN A 1 253 ? 29.142  -2.990  51.073 0.95  0.00 ? 253 GLN A H    3  
ATOM   9573   N N    C PRO A 1 254 ? 23.676  5.100   35.558 0.05  0.00 ? 254 PRO A N    3  
ATOM   9574   N N    O PRO A 1 254 ? 25.051  -2.591  50.492 0.95  0.00 ? 254 PRO A N    3  
ATOM   9575   C CA   C PRO A 1 254 ? 22.368  5.530   35.098 0.05  0.00 ? 254 PRO A CA   3  
ATOM   9576   C CA   O PRO A 1 254 ? 24.225  -2.207  49.361 0.95  0.00 ? 254 PRO A CA   3  
ATOM   9577   C C    C PRO A 1 254 ? 22.266  7.034   35.040 0.05  0.00 ? 254 PRO A C    3  
ATOM   9578   C C    O PRO A 1 254 ? 24.350  -0.735  49.055 0.95  0.00 ? 254 PRO A C    3  
ATOM   9579   O O    C PRO A 1 254 ? 22.872  7.695   35.882 0.05  0.00 ? 254 PRO A O    3  
ATOM   9580   O O    O PRO A 1 254 ? 24.563  0.040   49.986 0.95  0.00 ? 254 PRO A O    3  
ATOM   9581   N N    C SER A 1 255 ? 21.551  7.577   34.081 0.05  0.00 ? 255 SER A N    3  
ATOM   9582   N N    O SER A 1 255 ? 24.247  -0.344  47.805 0.95  0.00 ? 255 SER A N    3  
ATOM   9583   C CA   C SER A 1 255 ? 21.325  9.024   33.897 0.05  0.00 ? 255 SER A CA   3  
ATOM   9584   C CA   O SER A 1 255 ? 24.233  1.059   47.346 0.95  0.00 ? 255 SER A CA   3  
ATOM   9585   C C    C SER A 1 255 ? 20.286  9.363   34.999 0.05  0.00 ? 255 SER A C    3  
ATOM   9586   C C    O SER A 1 255 ? 22.900  1.606   47.922 0.95  0.00 ? 255 SER A C    3  
ATOM   9587   O O    C SER A 1 255 ? 19.539  8.431   35.350 0.05  0.00 ? 255 SER A O    3  
ATOM   9588   O O    O SER A 1 255 ? 21.976  0.780   48.041 0.95  0.00 ? 255 SER A O    3  
ATOM   9589   H H    C SER A 1 255 ? 21.071  6.969   33.480 0.05  0.00 ? 255 SER A H    3  
ATOM   9590   H H    O SER A 1 255 ? 24.096  -1.038  47.129 0.95  0.00 ? 255 SER A H    3  
ATOM   9591   N N    C LYS A 1 256 ? 20.294  10.581  35.469 0.05  0.00 ? 256 LYS A N    3  
ATOM   9592   N N    O LYS A 1 256 ? 22.866  2.871   48.243 0.95  0.00 ? 256 LYS A N    3  
ATOM   9593   C CA   C LYS A 1 256 ? 19.366  10.992  36.534 0.05  0.00 ? 256 LYS A CA   3  
ATOM   9594   C CA   O LYS A 1 256 ? 21.671  3.469   48.858 0.95  0.00 ? 256 LYS A CA   3  
ATOM   9595   C C    C LYS A 1 256 ? 18.343  11.983  36.046 0.05  0.00 ? 256 LYS A C    3  
ATOM   9596   C C    O LYS A 1 256 ? 21.148  4.639   48.067 0.95  0.00 ? 256 LYS A C    3  
ATOM   9597   O O    C LYS A 1 256 ? 18.497  13.187  36.267 0.05  0.00 ? 256 LYS A O    3  
ATOM   9598   O O    O LYS A 1 256 ? 21.461  5.788   48.388 0.95  0.00 ? 256 LYS A O    3  
ATOM   9599   H H    C LYS A 1 256 ? 20.959  11.220  35.138 0.05  0.00 ? 256 LYS A H    3  
ATOM   9600   H H    O LYS A 1 256 ? 23.666  3.422   48.112 0.95  0.00 ? 256 LYS A H    3  
ATOM   9601   N N    C PRO A 1 257 ? 17.306  11.504  35.389 0.05  0.00 ? 257 PRO A N    3  
ATOM   9602   N N    O PRO A 1 257 ? 20.362  4.371   47.044 0.95  0.00 ? 257 PRO A N    3  
ATOM   9603   C CA   C PRO A 1 257 ? 16.276  12.371  34.880 0.05  0.00 ? 257 PRO A CA   3  
ATOM   9604   C CA   O PRO A 1 257 ? 19.790  5.422   46.244 0.95  0.00 ? 257 PRO A CA   3  
ATOM   9605   C C    C PRO A 1 257 ? 15.414  12.834  36.088 0.05  0.00 ? 257 PRO A C    3  
ATOM   9606   C C    O PRO A 1 257 ? 18.630  6.055   47.061 0.95  0.00 ? 257 PRO A C    3  
ATOM   9607   O O    C PRO A 1 257 ? 15.438  12.131  37.082 0.05  0.00 ? 257 PRO A O    3  
ATOM   9608   O O    O PRO A 1 257 ? 18.122  5.361   47.924 0.95  0.00 ? 257 PRO A O    3  
ATOM   9609   N N    C PHE A 1 258 ? 14.814  13.965  35.925 0.05  0.00 ? 258 PHE A N    3  
ATOM   9610   N N    O PHE A 1 258 ? 18.374  7.288   46.777 0.95  0.00 ? 258 PHE A N    3  
ATOM   9611   C CA   C PHE A 1 258 ? 13.951  14.553  36.982 0.05  0.00 ? 258 PHE A CA   3  
ATOM   9612   C CA   O PHE A 1 258 ? 17.253  8.023   47.417 0.95  0.00 ? 258 PHE A CA   3  
ATOM   9613   C C    C PHE A 1 258 ? 12.783  13.554  37.071 0.05  0.00 ? 258 PHE A C    3  
ATOM   9614   C C    O PHE A 1 258 ? 16.010  7.417   46.740 0.95  0.00 ? 258 PHE A C    3  
ATOM   9615   O O    C PHE A 1 258 ? 12.035  13.366  36.088 0.05  0.00 ? 258 PHE A O    3  
ATOM   9616   O O    O PHE A 1 258 ? 16.035  7.112   45.528 0.95  0.00 ? 258 PHE A O    3  
ATOM   9617   H H    C PHE A 1 258 ? 14.893  14.428  35.065 0.05  0.00 ? 258 PHE A H    3  
ATOM   9618   H H    O PHE A 1 258 ? 18.906  7.739   46.088 0.95  0.00 ? 258 PHE A H    3  
ATOM   9619   N N    C VAL A 1 259 ? 12.627  12.983  38.238 0.05  0.00 ? 259 VAL A N    3  
ATOM   9620   N N    O VAL A 1 259 ? 14.958  7.302   47.509 0.95  0.00 ? 259 VAL A N    3  
ATOM   9621   C CA   C VAL A 1 259 ? 11.568  11.983  38.562 0.05  0.00 ? 259 VAL A CA   3  
ATOM   9622   C CA   O VAL A 1 259 ? 13.641  6.752   47.074 0.95  0.00 ? 259 VAL A CA   3  
ATOM   9623   C C    C VAL A 1 259 ? 10.679  12.547  39.675 0.05  0.00 ? 259 VAL A C    3  
ATOM   9624   C C    O VAL A 1 259 ? 12.629  7.899   46.993 0.95  0.00 ? 259 VAL A C    3  
ATOM   9625   O O    C VAL A 1 259 ? 11.284  13.007  40.688 0.05  0.00 ? 259 VAL A O    3  
ATOM   9626   O O    O VAL A 1 259 ? 12.592  8.678   47.991 0.95  0.00 ? 259 VAL A O    3  
ATOM   9627   H H    C VAL A 1 259 ? 13.248  13.233  38.953 0.05  0.00 ? 259 VAL A H    3  
ATOM   9628   H H    O VAL A 1 259 ? 15.039  7.603   48.438 0.95  0.00 ? 259 VAL A H    3  
ATOM   9629   N N    C GLY A 1 260 ? 9.399   12.590  39.494 0.05  0.00 ? 260 GLY A N    3  
ATOM   9630   N N    O GLY A 1 260 ? 11.938  8.050   45.910 0.95  0.00 ? 260 GLY A N    3  
ATOM   9631   C CA   C GLY A 1 260 ? 8.444   13.118  40.488 0.05  0.00 ? 260 GLY A CA   3  
ATOM   9632   C CA   O GLY A 1 260 ? 10.891  9.077   45.738 0.95  0.00 ? 260 GLY A CA   3  
ATOM   9633   C C    C GLY A 1 260 ? 7.747   11.860  41.045 0.05  0.00 ? 260 GLY A C    3  
ATOM   9634   C C    O GLY A 1 260 ? 9.572   8.276   45.760 0.95  0.00 ? 260 GLY A C    3  
ATOM   9635   O O    C GLY A 1 260 ? 7.465   10.950  40.260 0.05  0.00 ? 260 GLY A O    3  
ATOM   9636   O O    O GLY A 1 260 ? 9.550   7.169   45.215 0.95  0.00 ? 260 GLY A O    3  
ATOM   9637   H H    C GLY A 1 260 ? 9.038   12.213  38.665 0.05  0.00 ? 260 GLY A H    3  
ATOM   9638   H H    O GLY A 1 260 ? 12.090  7.421   45.175 0.95  0.00 ? 260 GLY A H    3  
ATOM   9639   N N    C VAL A 1 261 ? 7.519   11.755  42.332 0.05  0.00 ? 261 VAL A N    3  
ATOM   9640   N N    O VAL A 1 261 ? 8.529   8.753   46.395 0.95  0.00 ? 261 VAL A N    3  
ATOM   9641   C CA   C VAL A 1 261 ? 6.913   10.560  42.942 0.05  0.00 ? 261 VAL A CA   3  
ATOM   9642   C CA   O VAL A 1 261 ? 7.250   8.031   46.488 0.95  0.00 ? 261 VAL A CA   3  
ATOM   9643   C C    C VAL A 1 261 ? 5.428   10.755  43.059 0.05  0.00 ? 261 VAL A C    3  
ATOM   9644   C C    O VAL A 1 261 ? 6.140   8.911   45.987 0.95  0.00 ? 261 VAL A C    3  
ATOM   9645   O O    C VAL A 1 261 ? 5.038   11.368  44.086 0.05  0.00 ? 261 VAL A O    3  
ATOM   9646   O O    O VAL A 1 261 ? 5.994   10.003  46.594 0.95  0.00 ? 261 VAL A O    3  
ATOM   9647   H H    C VAL A 1 261 ? 7.784   12.495  42.916 0.05  0.00 ? 261 VAL A H    3  
ATOM   9648   H H    O VAL A 1 261 ? 8.612   9.618   46.847 0.95  0.00 ? 261 VAL A H    3  
ATOM   9649   N N    C LEU A 1 262 ? 4.615   10.391  42.097 0.05  0.00 ? 262 LEU A N    3  
ATOM   9650   N N    O LEU A 1 262 ? 5.442   8.590   44.924 0.95  0.00 ? 262 LEU A N    3  
ATOM   9651   C CA   C LEU A 1 262 ? 3.189   10.499  42.051 0.05  0.00 ? 262 LEU A CA   3  
ATOM   9652   C CA   O LEU A 1 262 ? 4.322   9.275   44.357 0.95  0.00 ? 262 LEU A CA   3  
ATOM   9653   C C    C LEU A 1 262 ? 2.738   10.086  43.496 0.05  0.00 ? 262 LEU A C    3  
ATOM   9654   C C    O LEU A 1 262 ? 3.209   9.141   45.456 0.95  0.00 ? 262 LEU A C    3  
ATOM   9655   O O    C LEU A 1 262 ? 3.307   9.141   44.030 0.05  0.00 ? 262 LEU A O    3  
ATOM   9656   O O    O LEU A 1 262 ? 2.978   8.026   45.909 0.95  0.00 ? 262 LEU A O    3  
ATOM   9657   H H    C LEU A 1 262 ? 5.034   9.950   41.328 0.05  0.00 ? 262 LEU A H    3  
ATOM   9658   H H    O LEU A 1 262 ? 5.695   7.751   44.485 0.95  0.00 ? 262 LEU A H    3  
ATOM   9659   N N    C SER A 1 263 ? 1.888   10.941  44.052 0.05  0.00 ? 263 SER A N    3  
ATOM   9660   N N    O SER A 1 263 ? 2.758   10.308  45.900 0.95  0.00 ? 263 SER A N    3  
ATOM   9661   C CA   C SER A 1 263 ? 1.409   10.712  45.420 0.05  0.00 ? 263 SER A CA   3  
ATOM   9662   C CA   O SER A 1 263 ? 1.836   10.350  47.041 0.95  0.00 ? 263 SER A CA   3  
ATOM   9663   C C    C SER A 1 263 ? -0.014  11.127  45.633 0.05  0.00 ? 263 SER A C    3  
ATOM   9664   C C    O SER A 1 263 ? 0.570   11.098  46.759 0.95  0.00 ? 263 SER A C    3  
ATOM   9665   O O    C SER A 1 263 ? -0.694  11.566  44.729 0.05  0.00 ? 263 SER A O    3  
ATOM   9666   O O    O SER A 1 263 ? 0.499   11.924  45.873 0.95  0.00 ? 263 SER A O    3  
ATOM   9667   H H    C SER A 1 263 ? 1.667   11.778  43.592 0.05  0.00 ? 263 SER A H    3  
ATOM   9668   H H    O SER A 1 263 ? 3.125   11.142  45.539 0.95  0.00 ? 263 SER A H    3  
ATOM   9669   N N    C ALA A 1 264 ? -0.457  10.911  46.897 0.05  0.00 ? 264 ALA A N    3  
ATOM   9670   N N    O ALA A 1 264 ? -0.469  10.719  47.545 0.95  0.00 ? 264 ALA A N    3  
ATOM   9671   C CA   C ALA A 1 264 ? -1.870  11.249  47.220 0.05  0.00 ? 264 ALA A CA   3  
ATOM   9672   C CA   O ALA A 1 264 ? -1.783  11.392  47.356 0.95  0.00 ? 264 ALA A CA   3  
ATOM   9673   C C    C ALA A 1 264 ? -1.831  12.081  48.519 0.05  0.00 ? 264 ALA A C    3  
ATOM   9674   C C    O ALA A 1 264 ? -2.151  12.016  48.719 0.95  0.00 ? 264 ALA A C    3  
ATOM   9675   O O    C ALA A 1 264 ? -1.022  11.827  49.384 0.05  0.00 ? 264 ALA A O    3  
ATOM   9676   O O    O ALA A 1 264 ? -2.210  11.324  49.712 0.95  0.00 ? 264 ALA A O    3  
ATOM   9677   H H    C ALA A 1 264 ? 0.138   10.541  47.582 0.05  0.00 ? 264 ALA A H    3  
ATOM   9678   H H    O ALA A 1 264 ? -0.358  10.019  48.221 0.95  0.00 ? 264 ALA A H    3  
ATOM   9679   N N    C GLY A 1 265 ? -2.707  13.077  48.533 0.05  0.00 ? 265 GLY A N    3  
ATOM   9680   N N    O GLY A 1 265 ? -2.328  13.329  48.666 0.95  0.00 ? 265 GLY A N    3  
ATOM   9681   C CA   C GLY A 1 265 ? -2.744  13.967  49.740 0.05  0.00 ? 265 GLY A CA   3  
ATOM   9682   C CA   O GLY A 1 265 ? -2.651  14.049  49.942 0.95  0.00 ? 265 GLY A CA   3  
ATOM   9683   C C    C GLY A 1 265 ? -4.066  14.698  49.729 0.05  0.00 ? 265 GLY A C    3  
ATOM   9684   C C    O GLY A 1 265 ? -3.978  14.745  49.751 0.95  0.00 ? 265 GLY A C    3  
ATOM   9685   O O    C GLY A 1 265 ? -4.612  15.007  48.700 0.05  0.00 ? 265 GLY A O    3  
ATOM   9686   O O    O GLY A 1 265 ? -4.357  15.103  48.664 0.95  0.00 ? 265 GLY A O    3  
ATOM   9687   H H    C GLY A 1 265 ? -3.294  13.243  47.767 0.05  0.00 ? 265 GLY A H    3  
ATOM   9688   H H    O GLY A 1 265 ? -2.224  13.819  47.824 0.95  0.00 ? 265 GLY A H    3  
ATOM   9689   N N    . ILE A 1 266 ? -4.664  14.950  50.893 1.00  0.00 ? 266 ILE A N    3  
ATOM   9690   C CA   . ILE A 1 266 ? -6.000  15.608  50.923 1.00  0.00 ? 266 ILE A CA   3  
ATOM   9691   C C    . ILE A 1 266 ? -5.869  17.056  51.418 1.00  0.00 ? 266 ILE A C    3  
ATOM   9692   O O    . ILE A 1 266 ? -5.236  17.250  52.462 1.00  0.00 ? 266 ILE A O    3  
ATOM   9693   H H    . ILE A 1 266 ? -4.272  14.644  51.738 1.00  0.00 ? 266 ILE A H    3  
ATOM   9694   N N    . ASN A 1 267 ? -6.424  17.958  50.729 1.00  0.00 ? 267 ASN A N    3  
ATOM   9695   C CA   . ASN A 1 267 ? -6.423  19.406  51.068 1.00  0.00 ? 267 ASN A CA   3  
ATOM   9696   C C    . ASN A 1 267 ? -7.113  19.568  52.445 1.00  0.00 ? 267 ASN A C    3  
ATOM   9697   O O    . ASN A 1 267 ? -8.213  19.075  52.657 1.00  0.00 ? 267 ASN A O    3  
ATOM   9698   H H    . ASN A 1 267 ? -6.904  17.681  49.920 1.00  0.00 ? 267 ASN A H    3  
ATOM   9699   N N    . ALA A 1 268 ? -6.389  20.186  53.370 1.00  0.00 ? 268 ALA A N    3  
ATOM   9700   C CA   . ALA A 1 268 ? -6.910  20.442  54.724 1.00  0.00 ? 268 ALA A CA   3  
ATOM   9701   C C    . ALA A 1 268 ? -8.185  21.279  54.618 1.00  0.00 ? 268 ALA A C    3  
ATOM   9702   O O    . ALA A 1 268 ? -9.006  21.201  55.538 1.00  0.00 ? 268 ALA A O    3  
ATOM   9703   H H    . ALA A 1 268 ? -5.488  20.496  53.140 1.00  0.00 ? 268 ALA A H    3  
ATOM   9704   N N    . ALA A 1 269 ? -8.322  22.081  53.583 1.00  0.00 ? 269 ALA A N    3  
ATOM   9705   C CA   . ALA A 1 269 ? -9.459  22.931  53.315 1.00  0.00 ? 269 ALA A CA   3  
ATOM   9706   C C    . ALA A 1 269 ? -10.618 22.220  52.641 1.00  0.00 ? 269 ALA A C    3  
ATOM   9707   O O    . ALA A 1 269 ? -11.708 22.803  52.529 1.00  0.00 ? 269 ALA A O    3  
ATOM   9708   H H    . ALA A 1 269 ? -7.590  22.097  52.932 1.00  0.00 ? 269 ALA A H    3  
ATOM   9709   N N    . SER A 1 270 ? -10.471 20.961  52.231 1.00  0.00 ? 270 SER A N    3  
ATOM   9710   C CA   . SER A 1 270 ? -11.606 20.311  51.575 1.00  0.00 ? 270 SER A CA   3  
ATOM   9711   C C    . SER A 1 270 ? -12.736 19.922  52.527 1.00  0.00 ? 270 SER A C    3  
ATOM   9712   O O    . SER A 1 270 ? -12.517 19.304  53.577 1.00  0.00 ? 270 SER A O    3  
ATOM   9713   H H    . SER A 1 270 ? -9.623  20.486  52.358 1.00  0.00 ? 270 SER A H    3  
ATOM   9714   N N    . PRO A 1 271 ? -13.939 20.153  52.053 1.00  0.00 ? 271 PRO A N    3  
ATOM   9715   C CA   . PRO A 1 271 ? -15.166 19.740  52.765 1.00  0.00 ? 271 PRO A CA   3  
ATOM   9716   C C    . PRO A 1 271 ? -15.523 18.280  52.523 1.00  0.00 ? 271 PRO A C    3  
ATOM   9717   O O    . PRO A 1 271 ? -16.435 17.680  53.093 1.00  0.00 ? 271 PRO A O    3  
ATOM   9718   N N    . ASN A 1 272 ? -14.753 17.629  51.649 1.00  0.00 ? 272 ASN A N    3  
ATOM   9719   C CA   . ASN A 1 272 ? -14.964 16.249  51.210 1.00  0.00 ? 272 ASN A CA   3  
ATOM   9720   C C    . ASN A 1 272 ? -13.934 15.258  51.649 1.00  0.00 ? 272 ASN A C    3  
ATOM   9721   O O    . ASN A 1 272 ? -13.682 14.351  50.824 1.00  0.00 ? 272 ASN A O    3  
ATOM   9722   H H    . ASN A 1 272 ? -14.020 18.130  51.232 1.00  0.00 ? 272 ASN A H    3  
ATOM   9723   N N    . LYS A 1 273 ? -13.377 15.307  52.820 1.00  0.00 ? 273 LYS A N    3  
ATOM   9724   C CA   . LYS A 1 273 ? -12.347 14.393  53.230 1.00  0.00 ? 273 LYS A CA   3  
ATOM   9725   C C    . LYS A 1 273 ? -12.735 12.938  53.335 1.00  0.00 ? 273 LYS A C    3  
ATOM   9726   O O    . LYS A 1 273 ? -11.872 12.048  53.182 1.00  0.00 ? 273 LYS A O    3  
ATOM   9727   H H    . LYS A 1 273 ? -13.644 16.020  53.438 1.00  0.00 ? 273 LYS A H    3  
ATOM   9728   N N    . GLU A 1 274 ? -13.960 12.664  53.711 1.00  0.00 ? 274 GLU A N    3  
ATOM   9729   C CA   . GLU A 1 274 ? -14.477 11.307  53.865 1.00  0.00 ? 274 GLU A CA   3  
ATOM   9730   C C    . GLU A 1 274 ? -14.635 10.723  52.470 1.00  0.00 ? 274 GLU A C    3  
ATOM   9731   O O    . GLU A 1 274 ? -14.224 9.565   52.263 1.00  0.00 ? 274 GLU A O    3  
ATOM   9732   H H    . GLU A 1 274 ? -14.562 13.413  53.904 1.00  0.00 ? 274 GLU A H    3  
ATOM   9733   N N    . LEU A 1 275 ? -15.099 11.509  51.549 1.00  0.00 ? 275 LEU A N    3  
ATOM   9734   C CA   . LEU A 1 275 ? -15.226 11.065  50.156 1.00  0.00 ? 275 LEU A CA   3  
ATOM   9735   C C    . LEU A 1 275 ? -13.830 10.725  49.583 1.00  0.00 ? 275 LEU A C    3  
ATOM   9736   O O    . LEU A 1 275 ? -13.676 9.692   48.908 1.00  0.00 ? 275 LEU A O    3  
ATOM   9737   H H    . LEU A 1 275 ? -15.327 12.434  51.779 1.00  0.00 ? 275 LEU A H    3  
ATOM   9738   N N    . ALA A 1 276 ? -12.871 11.583  49.851 1.00  0.00 ? 276 ALA A N    3  
ATOM   9739   C CA   . ALA A 1 276 ? -11.476 11.420  49.395 1.00  0.00 ? 276 ALA A CA   3  
ATOM   9740   C C    . ALA A 1 276 ? -10.838 10.159  49.879 1.00  0.00 ? 276 ALA A C    3  
ATOM   9741   O O    . ALA A 1 276 ? -10.208 9.369   49.145 1.00  0.00 ? 276 ALA A O    3  
ATOM   9742   H H    . ALA A 1 276 ? -13.093 12.373  50.389 1.00  0.00 ? 276 ALA A H    3  
ATOM   9743   N N    . LYS A 1 277 ? -10.969 9.882   51.163 1.00  0.00 ? 277 LYS A N    3  
ATOM   9744   C CA   . LYS A 1 277 ? -10.413 8.709   51.799 1.00  0.00 ? 277 LYS A CA   3  
ATOM   9745   C C    . LYS A 1 277 ? -11.061 7.439   51.290 1.00  0.00 ? 277 LYS A C    3  
ATOM   9746   O O    . LYS A 1 277 ? -10.448 6.365   51.217 1.00  0.00 ? 277 LYS A O    3  
ATOM   9747   H H    . LYS A 1 277 ? -11.471 10.512  51.720 1.00  0.00 ? 277 LYS A H    3  
ATOM   9748   N N    . GLU A 1 278 ? -12.320 7.534   50.934 1.00  0.00 ? 278 GLU A N    3  
ATOM   9749   C CA   . GLU A 1 278 ? -13.042 6.371   50.418 1.00  0.00 ? 278 GLU A CA   3  
ATOM   9750   C C    . GLU A 1 278 ? -12.605 6.106   48.982 1.00  0.00 ? 278 GLU A C    3  
ATOM   9751   O O    . GLU A 1 278 ? -12.372 4.934   48.674 1.00  0.00 ? 278 GLU A O    3  
ATOM   9752   H H    . GLU A 1 278 ? -12.781 8.395   51.008 1.00  0.00 ? 278 GLU A H    3  
ATOM   9753   N N    . PHE A 1 279 ? -12.494 7.131   48.181 1.00  0.00 ? 279 PHE A N    3  
ATOM   9754   C CA   . PHE A 1 279 ? -12.017 7.041   46.807 1.00  0.00 ? 279 PHE A CA   3  
ATOM   9755   C C    . PHE A 1 279 ? -10.605 6.429   46.830 1.00  0.00 ? 279 PHE A C    3  
ATOM   9756   O O    . PHE A 1 279 ? -10.312 5.392   46.231 1.00  0.00 ? 279 PHE A O    3  
ATOM   9757   H H    . PHE A 1 279 ? -12.698 8.020   48.540 1.00  0.00 ? 279 PHE A H    3  
ATOM   9758   N N    . LEU A 1 280 ? -9.709  7.056   47.593 1.00  0.00 ? 280 LEU A N    3  
ATOM   9759   C CA   . LEU A 1 280 ? -8.350  6.606   47.715 1.00  0.00 ? 280 LEU A CA   3  
ATOM   9760   C C    . LEU A 1 280 ? -8.216  5.209   48.260 1.00  0.00 ? 280 LEU A C    3  
ATOM   9761   O O    . LEU A 1 280 ? -7.499  4.372   47.672 1.00  0.00 ? 280 LEU A O    3  
ATOM   9762   H H    . LEU A 1 280 ? -9.988  7.855   48.088 1.00  0.00 ? 280 LEU A H    3  
ATOM   9763   N N    . GLU A 1 281 ? -8.796  4.894   49.429 1.00  0.00 ? 281 GLU A N    3  
ATOM   9764   C CA   . GLU A 1 281 ? -8.572  3.584   49.986 1.00  0.00 ? 281 GLU A CA   3  
ATOM   9765   C C    . GLU A 1 281 ? -9.295  2.423   49.313 1.00  0.00 ? 281 GLU A C    3  
ATOM   9766   O O    . GLU A 1 281 ? -8.740  1.288   49.274 1.00  0.00 ? 281 GLU A O    3  
ATOM   9767   H H    . GLU A 1 281 ? -9.304  5.566   49.929 1.00  0.00 ? 281 GLU A H    3  
ATOM   9768   N N    . ASN A 1 282 ? -10.457 2.672   48.772 1.00  0.00 ? 282 ASN A N    3  
ATOM   9769   C CA   . ASN A 1 282 ? -11.273 1.571   48.213 1.00  0.00 ? 282 ASN A CA   3  
ATOM   9770   C C    . ASN A 1 282 ? -11.457 1.565   46.745 1.00  0.00 ? 282 ASN A C    3  
ATOM   9771   O O    . ASN A 1 282 ? -12.088 0.601   46.253 1.00  0.00 ? 282 ASN A O    3  
ATOM   9772   H H    . ASN A 1 282 ? -10.828 3.579   48.811 1.00  0.00 ? 282 ASN A H    3  
ATOM   9773   N N    . TYR A 1 283 ? -10.981 2.554   46.017 1.00  0.00 ? 283 TYR A N    3  
ATOM   9774   C CA   . TYR A 1 283 ? -11.149 2.552   44.556 1.00  0.00 ? 283 TYR A CA   3  
ATOM   9775   C C    . TYR A 1 283 ? -9.782  2.542   43.881 1.00  0.00 ? 283 TYR A C    3  
ATOM   9776   O O    . TYR A 1 283 ? -9.495  1.670   43.053 1.00  0.00 ? 283 TYR A O    3  
ATOM   9777   H H    . TYR A 1 283 ? -10.506 3.293   46.452 1.00  0.00 ? 283 TYR A H    3  
ATOM   9778   N N    . LEU A 1 284 ? -8.996  3.538   44.300 1.00  0.00 ? 284 LEU A N    3  
ATOM   9779   C CA   . LEU A 1 284 ? -7.666  3.707   43.740 1.00  0.00 ? 284 LEU A CA   3  
ATOM   9780   C C    . LEU A 1 284 ? -6.662  2.701   44.223 1.00  0.00 ? 284 LEU A C    3  
ATOM   9781   O O    . LEU A 1 284 ? -6.047  2.013   43.362 1.00  0.00 ? 284 LEU A O    3  
ATOM   9782   H H    . LEU A 1 284 ? -9.327  4.171   44.972 1.00  0.00 ? 284 LEU A H    3  
ATOM   9783   N N    . LEU A 1 285 ? -6.447  2.514   45.499 1.00  0.00 ? 285 LEU A N    3  
ATOM   9784   C CA   . LEU A 1 285 ? -5.492  1.613   46.052 1.00  0.00 ? 285 LEU A CA   3  
ATOM   9785   C C    . LEU A 1 285 ? -5.985  0.170   46.122 1.00  0.00 ? 285 LEU A C    3  
ATOM   9786   O O    . LEU A 1 285 ? -5.909  -0.450  47.163 1.00  0.00 ? 285 LEU A O    3  
ATOM   9787   H H    . LEU A 1 285 ? -6.970  3.056   46.127 1.00  0.00 ? 285 LEU A H    3  
ATOM   9788   N N    . THR A 1 286 ? -6.336  -0.265  44.931 1.00  0.00 ? 286 THR A N    3  
ATOM   9789   C CA   . THR A 1 286 ? -6.802  -1.642  44.679 1.00  0.00 ? 286 THR A CA   3  
ATOM   9790   C C    . THR A 1 286 ? -6.109  -2.127  43.385 1.00  0.00 ? 286 THR A C    3  
ATOM   9791   O O    . THR A 1 286 ? -5.722  -1.301  42.560 1.00  0.00 ? 286 THR A O    3  
ATOM   9792   H H    . THR A 1 286 ? -6.251  0.346   44.169 1.00  0.00 ? 286 THR A H    3  
ATOM   9793   N N    . ASP A 1 287 ? -6.085  -3.428  43.207 1.00  0.00 ? 287 ASP A N    3  
ATOM   9794   C CA   . ASP A 1 287 ? -5.470  -3.983  41.962 1.00  0.00 ? 287 ASP A CA   3  
ATOM   9795   C C    . ASP A 1 287 ? -6.108  -3.370  40.729 1.00  0.00 ? 287 ASP A C    3  
ATOM   9796   O O    . ASP A 1 287 ? -5.435  -3.070  39.725 1.00  0.00 ? 287 ASP A O    3  
ATOM   9797   H H    . ASP A 1 287 ? -6.488  -4.027  43.869 1.00  0.00 ? 287 ASP A H    3  
ATOM   9798   N N    . GLU A 1 288 ? -7.415  -3.186  40.754 1.00  0.00 ? 288 GLU A N    3  
ATOM   9799   C CA   . GLU A 1 288 ? -8.133  -2.644  39.601 1.00  0.00 ? 288 GLU A CA   3  
ATOM   9800   C C    . GLU A 1 288 ? -7.916  -1.165  39.397 1.00  0.00 ? 288 GLU A C    3  
ATOM   9801   O O    . GLU A 1 288 ? -7.935  -0.666  38.269 1.00  0.00 ? 288 GLU A O    3  
ATOM   9802   H H    . GLU A 1 288 ? -7.920  -3.446  41.553 1.00  0.00 ? 288 GLU A H    3  
ATOM   9803   N N    . GLY A 1 289 ? -7.729  -0.442  40.501 1.00  0.00 ? 289 GLY A N    3  
ATOM   9804   C CA   . GLY A 1 289 ? -7.510  1.022   40.407 1.00  0.00 ? 289 GLY A CA   3  
ATOM   9805   C C    . GLY A 1 289 ? -6.097  1.288   39.828 1.00  0.00 ? 289 GLY A C    3  
ATOM   9806   O O    . GLY A 1 289 ? -5.986  2.105   38.928 1.00  0.00 ? 289 GLY A O    3  
ATOM   9807   H H    . GLY A 1 289 ? -7.739  -0.879  41.378 1.00  0.00 ? 289 GLY A H    3  
ATOM   9808   N N    . LEU A 1 290 ? -5.098  0.646   40.382 1.00  0.00 ? 290 LEU A N    3  
ATOM   9809   C CA   . LEU A 1 290 ? -3.691  0.845   39.933 1.00  0.00 ? 290 LEU A CA   3  
ATOM   9810   C C    . LEU A 1 290 ? -3.571  0.397   38.484 1.00  0.00 ? 290 LEU A C    3  
ATOM   9811   O O    . LEU A 1 290 ? -2.862  1.005   37.674 1.00  0.00 ? 290 LEU A O    3  
ATOM   9812   H H    . LEU A 1 290 ? -5.279  0.034   41.126 1.00  0.00 ? 290 LEU A H    3  
ATOM   9813   N N    . GLU A 1 291 ? -4.303  -0.662  38.163 1.00  0.00 ? 291 GLU A N    3  
ATOM   9814   C CA   . GLU A 1 291 ? -4.301  -1.217  36.808 1.00  0.00 ? 291 GLU A CA   3  
ATOM   9815   C C    . GLU A 1 291 ? -4.854  -0.268  35.775 1.00  0.00 ? 291 GLU A C    3  
ATOM   9816   O O    . GLU A 1 291 ? -4.225  -0.131  34.699 1.00  0.00 ? 291 GLU A O    3  
ATOM   9817   H H    . GLU A 1 291 ? -4.862  -1.084  38.850 1.00  0.00 ? 291 GLU A H    3  
ATOM   9818   N N    . ALA A 1 292 ? -5.982  0.379   36.021 1.00  0.00 ? 292 ALA A N    3  
ATOM   9819   C CA   . ALA A 1 292 ? -6.566  1.347   35.089 1.00  0.00 ? 292 ALA A CA   3  
ATOM   9820   C C    . ALA A 1 292 ? -5.607  2.512   34.870 1.00  0.00 ? 292 ALA A C    3  
ATOM   9821   O O    . ALA A 1 292 ? -5.490  3.017   33.738 1.00  0.00 ? 292 ALA A O    3  
ATOM   9822   H H    . ALA A 1 292 ? -6.434  0.223   36.876 1.00  0.00 ? 292 ALA A H    3  
ATOM   9823   N N    . VAL A 1 293 ? -4.929  2.941   35.940 1.00  0.00 ? 293 VAL A N    3  
ATOM   9824   C CA   . VAL A 1 293 ? -3.981  4.055   35.831 1.00  0.00 ? 293 VAL A CA   3  
ATOM   9825   C C    . VAL A 1 293 ? -2.722  3.624   35.026 1.00  0.00 ? 293 VAL A C    3  
ATOM   9826   O O    . VAL A 1 293 ? -2.351  4.342   34.100 1.00  0.00 ? 293 VAL A O    3  
ATOM   9827   H H    . VAL A 1 293 ? -5.068  2.505   36.808 1.00  0.00 ? 293 VAL A H    3  
ATOM   9828   N N    . ASN A 1 294 ? -2.171  2.530   35.440 1.00  0.00 ? 294 ASN A N    3  
ATOM   9829   C CA   . ASN A 1 294 ? -0.977  1.898   34.842 1.00  0.00 ? 294 ASN A CA   3  
ATOM   9830   C C    . ASN A 1 294 ? -1.162  1.680   33.346 1.00  0.00 ? 294 ASN A C    3  
ATOM   9831   O O    . ASN A 1 294 ? -0.225  1.942   32.563 1.00  0.00 ? 294 ASN A O    3  
ATOM   9832   H H    . ASN A 1 294 ? -2.585  2.079   36.206 1.00  0.00 ? 294 ASN A H    3  
ATOM   9833   N N    . LYS A 1 295 ? -2.326  1.257   32.927 1.00  0.00 ? 295 LYS A N    3  
ATOM   9834   C CA   . LYS A 1 295 ? -2.692  1.040   31.527 1.00  0.00 ? 295 LYS A CA   3  
ATOM   9835   C C    . LYS A 1 295 ? -2.551  2.306   30.702 1.00  0.00 ? 295 LYS A C    3  
ATOM   9836   O O    . LYS A 1 295 ? -2.158  2.285   29.511 1.00  0.00 ? 295 LYS A O    3  
ATOM   9837   H H    . LYS A 1 295 ? -3.019  1.102   33.603 1.00  0.00 ? 295 LYS A H    3  
ATOM   9838   N N    . ASP A 1 296 ? -2.834  3.437   31.320 1.00  0.00 ? 296 ASP A N    3  
ATOM   9839   C CA   . ASP A 1 296 ? -2.740  4.752   30.696 1.00  0.00 ? 296 ASP A CA   3  
ATOM   9840   C C    . ASP A 1 296 ? -1.273  5.179   30.597 1.00  0.00 ? 296 ASP A C    3  
ATOM   9841   O O    . ASP A 1 296 ? -0.826  5.598   29.519 1.00  0.00 ? 296 ASP A O    3  
ATOM   9842   H H    . ASP A 1 296 ? -3.114  3.392   32.258 1.00  0.00 ? 296 ASP A H    3  
ATOM   9843   N N    . LYS A 1 297 ? -0.562  5.086   31.695 1.00  0.00 ? 297 LYS A N    3  
ATOM   9844   C CA   . LYS A 1 297 ? 0.868   5.441   31.823 1.00  0.00 ? 297 LYS A CA   3  
ATOM   9845   C C    . LYS A 1 297 ? 1.424   4.613   32.962 1.00  0.00 ? 297 LYS A C    3  
ATOM   9846   O O    . LYS A 1 297 ? 0.863   4.639   34.073 1.00  0.00 ? 297 LYS A O    3  
ATOM   9847   H H    . LYS A 1 297 ? -1.016  4.752   32.497 1.00  0.00 ? 297 LYS A H    3  
ATOM   9848   N N    . PRO A 1 298 ? 2.495   3.886   32.743 1.00  0.00 ? 298 PRO A N    3  
ATOM   9849   C CA   . PRO A 1 298 ? 3.082   3.030   33.791 1.00  0.00 ? 298 PRO A CA   3  
ATOM   9850   C C    . PRO A 1 298 ? 3.467   3.802   35.033 1.00  0.00 ? 298 PRO A C    3  
ATOM   9851   O O    . PRO A 1 298 ? 4.010   4.916   34.913 1.00  0.00 ? 298 PRO A O    3  
ATOM   9852   N N    . LEU A 1 299 ? 3.228   3.201   36.171 1.00  0.00 ? 299 LEU A N    3  
ATOM   9853   C CA   . LEU A 1 299 ? 3.561   3.791   37.476 1.00  0.00 ? 299 LEU A CA   3  
ATOM   9854   C C    . LEU A 1 299 ? 4.946   3.415   38.001 1.00  0.00 ? 299 LEU A C    3  
ATOM   9855   O O    . LEU A 1 299 ? 5.477   4.045   38.927 1.00  0.00 ? 299 LEU A O    3  
ATOM   9856   H H    . LEU A 1 299 ? 2.824   2.308   36.152 1.00  0.00 ? 299 LEU A H    3  
ATOM   9857   N N    . GLY A 1 300 ? 5.459   2.317   37.418 1.00  0.00 ? 300 GLY A N    3  
ATOM   9858   C CA   . GLY A 1 300 ? 6.738   1.747   37.840 1.00  0.00 ? 300 GLY A CA   3  
ATOM   9859   C C    . GLY A 1 300 ? 6.364   0.793   38.964 1.00  0.00 ? 300 GLY A C    3  
ATOM   9860   O O    . GLY A 1 300 ? 5.329   0.138   38.787 1.00  0.00 ? 300 GLY A O    3  
ATOM   9861   H H    . GLY A 1 300 ? 4.936   1.855   36.729 1.00  0.00 ? 300 GLY A H    3  
ATOM   9862   N N    . ALA A 1 301 ? 7.139   0.709   40.007 1.00  0.00 ? 301 ALA A N    3  
ATOM   9863   C CA   . ALA A 1 301 ? 6.877   -0.158  41.130 1.00  0.00 ? 301 ALA A CA   3  
ATOM   9864   C C    . ALA A 1 301 ? 5.736   0.550   41.930 1.00  0.00 ? 301 ALA A C    3  
ATOM   9865   O O    . ALA A 1 301 ? 5.704   1.774   41.898 1.00  0.00 ? 301 ALA A O    3  
ATOM   9866   H H    . ALA A 1 301 ? 7.943   1.269   40.032 1.00  0.00 ? 301 ALA A H    3  
ATOM   9867   N N    . VAL A 1 302 ? 4.900   -0.215  42.554 1.00  0.00 ? 302 VAL A N    3  
ATOM   9868   C CA   . VAL A 1 302 ? 3.761   0.391   43.306 1.00  0.00 ? 302 VAL A CA   3  
ATOM   9869   C C    . VAL A 1 302 ? 3.869   0.018   44.767 1.00  0.00 ? 302 VAL A C    3  
ATOM   9870   O O    . VAL A 1 302 ? 4.542   -0.955  45.088 1.00  0.00 ? 302 VAL A O    3  
ATOM   9871   H H    . VAL A 1 302 ? 5.000   -1.189  42.512 1.00  0.00 ? 302 VAL A H    3  
ATOM   9872   N N    . ALA A 1 303 ? 3.185   0.814   45.635 1.00  0.00 ? 303 ALA A N    3  
ATOM   9873   C CA   . ALA A 1 303 ? 3.248   0.555   47.065 1.00  0.00 ? 303 ALA A CA   3  
ATOM   9874   C C    . ALA A 1 303 ? 2.348   -0.583  47.531 1.00  0.00 ? 303 ALA A C    3  
ATOM   9875   O O    . ALA A 1 303 ? 2.674   -1.213  48.545 1.00  0.00 ? 303 ALA A O    3  
ATOM   9876   H H    . ALA A 1 303 ? 2.665   1.573   45.298 1.00  0.00 ? 303 ALA A H    3  
ATOM   9877   N N    . LEU A 1 304 ? 1.295   -0.855  46.812 1.00  0.00 ? 304 LEU A N    3  
ATOM   9878   C CA   . LEU A 1 304 ? 0.324   -1.935  47.126 1.00  0.00 ? 304 LEU A CA   3  
ATOM   9879   C C    . LEU A 1 304 ? 0.965   -3.302  46.851 1.00  0.00 ? 304 LEU A C    3  
ATOM   9880   O O    . LEU A 1 304 ? 1.156   -3.539  45.653 1.00  0.00 ? 304 LEU A O    3  
ATOM   9881   H H    . LEU A 1 304 ? 1.136   -0.315  46.010 1.00  0.00 ? 304 LEU A H    3  
ATOM   9882   N N    . LYS A 1 305 ? 1.260   -4.072  47.824 1.00  0.00 ? 305 LYS A N    3  
ATOM   9883   C CA   . LYS A 1 305 ? 1.897   -5.363  47.747 1.00  0.00 ? 305 LYS A CA   3  
ATOM   9884   C C    . LYS A 1 305 ? 1.311   -6.329  46.728 1.00  0.00 ? 305 LYS A C    3  
ATOM   9885   O O    . LYS A 1 305 ? 2.049   -7.009  46.018 1.00  0.00 ? 305 LYS A O    3  
ATOM   9886   H H    . LYS A 1 305 ? 1.055   -3.739  48.723 1.00  0.00 ? 305 LYS A H    3  
ATOM   9887   N N    . SER A 1 306 ? 0.013   -6.413  46.670 1.00  0.00 ? 306 SER A N    3  
ATOM   9888   C CA   . SER A 1 306 ? -0.722  -7.329  45.797 1.00  0.00 ? 306 SER A CA   3  
ATOM   9889   C C    . SER A 1 306 ? -0.495  -7.059  44.323 1.00  0.00 ? 306 SER A C    3  
ATOM   9890   O O    . SER A 1 306 ? -0.269  -7.985  43.501 1.00  0.00 ? 306 SER A O    3  
ATOM   9891   H H    . SER A 1 306 ? -0.508  -5.851  47.281 1.00  0.00 ? 306 SER A H    3  
ATOM   9892   N N    . TYR A 1 307 ? -0.571  -5.788  43.937 1.00  0.00 ? 307 TYR A N    3  
ATOM   9893   C CA   . TYR A 1 307 ? -0.398  -5.411  42.552 1.00  0.00 ? 307 TYR A CA   3  
ATOM   9894   C C    . TYR A 1 307 ? 1.104   -5.397  42.197 1.00  0.00 ? 307 TYR A C    3  
ATOM   9895   O O    . TYR A 1 307 ? 1.448   -5.679  41.054 1.00  0.00 ? 307 TYR A O    3  
ATOM   9896   H H    . TYR A 1 307 ? -0.765  -5.095  44.603 1.00  0.00 ? 307 TYR A H    3  
ATOM   9897   N N    . GLU A 1 308 ? 1.919   -5.088  43.167 1.00  0.00 ? 308 GLU A N    3  
ATOM   9898   C CA   . GLU A 1 308 ? 3.364   -5.034  42.904 1.00  0.00 ? 308 GLU A CA   3  
ATOM   9899   C C    . GLU A 1 308 ? 3.821   -6.446  42.489 1.00  0.00 ? 308 GLU A C    3  
ATOM   9900   O O    . GLU A 1 308 ? 4.657   -6.614  41.590 1.00  0.00 ? 308 GLU A O    3  
ATOM   9901   H H    . GLU A 1 308 ? 1.571   -4.882  44.060 1.00  0.00 ? 308 GLU A H    3  
ATOM   9902   N N    . GLU A 1 309 ? 3.253   -7.435  43.162 1.00  0.00 ? 309 GLU A N    3  
ATOM   9903   C CA   . GLU A 1 309 ? 3.573   -8.841  42.880 1.00  0.00 ? 309 GLU A CA   3  
ATOM   9904   C C    . GLU A 1 309 ? 3.214   -9.198  41.453 1.00  0.00 ? 309 GLU A C    3  
ATOM   9905   O O    . GLU A 1 309 ? 3.937   -10.027 40.867 1.00  0.00 ? 309 GLU A O    3  
ATOM   9906   H H    . GLU A 1 309 ? 2.598   -7.225  43.861 1.00  0.00 ? 309 GLU A H    3  
ATOM   9907   N N    . GLU A 1 310 ? 2.231   -8.581  40.864 1.00  0.00 ? 310 GLU A N    3  
ATOM   9908   C CA   . GLU A 1 310 ? 1.874   -8.848  39.474 1.00  0.00 ? 310 GLU A CA   3  
ATOM   9909   C C    . GLU A 1 310 ? 2.872   -8.155  38.553 1.00  0.00 ? 310 GLU A C    3  
ATOM   9910   O O    . GLU A 1 310 ? 3.404   -8.674  37.561 1.00  0.00 ? 310 GLU A O    3  
ATOM   9911   H H    . GLU A 1 310 ? 1.737   -7.893  41.357 1.00  0.00 ? 310 GLU A H    3  
ATOM   9912   N N    . LEU A 1 311 ? 3.159   -6.908  38.907 1.00  0.00 ? 311 LEU A N    3  
ATOM   9913   C CA   . LEU A 1 311 ? 4.063   -6.048  38.148 1.00  0.00 ? 311 LEU A CA   3  
ATOM   9914   C C    . LEU A 1 311 ? 5.508   -6.534  38.116 1.00  0.00 ? 311 LEU A C    3  
ATOM   9915   O O    . LEU A 1 311 ? 6.228   -6.269  37.138 1.00  0.00 ? 311 LEU A O    3  
ATOM   9916   H H    . LEU A 1 311 ? 2.725   -6.538  39.704 1.00  0.00 ? 311 LEU A H    3  
ATOM   9917   N N    . ALA A 1 312 ? 5.939   -7.127  39.182 1.00  0.00 ? 312 ALA A N    3  
ATOM   9918   C CA   . ALA A 1 312 ? 7.266   -7.639  39.394 1.00  0.00 ? 312 ALA A CA   3  
ATOM   9919   C C    . ALA A 1 312 ? 7.655   -8.777  38.430 1.00  0.00 ? 312 ALA A C    3  
ATOM   9920   O O    . ALA A 1 312 ? 8.815   -9.226  38.498 1.00  0.00 ? 312 ALA A O    3  
ATOM   9921   H H    . ALA A 1 312 ? 5.306   -7.219  39.924 1.00  0.00 ? 312 ALA A H    3  
ATOM   9922   N N    . LYS A 1 313 ? 6.801   -9.214  37.559 1.00  0.00 ? 313 LYS A N    3  
ATOM   9923   C CA   . LYS A 1 313 ? 7.067   -10.221 36.503 1.00  0.00 ? 313 LYS A CA   3  
ATOM   9924   C C    . LYS A 1 313 ? 7.921   -9.581  35.407 1.00  0.00 ? 313 LYS A C    3  
ATOM   9925   O O    . LYS A 1 313 ? 8.443   -10.191 34.466 1.00  0.00 ? 313 LYS A O    3  
ATOM   9926   H H    . LYS A 1 313 ? 5.917   -8.791  37.553 1.00  0.00 ? 313 LYS A H    3  
ATOM   9927   N N    C ASP A 1 314 ? 8.004   -8.269  35.406 0.05  0.00 ? 314 ASP A N    3  
ATOM   9928   N N    O ASP A 1 314 ? 8.001   -8.258  35.460 0.95  0.00 ? 314 ASP A N    3  
ATOM   9929   C CA   C ASP A 1 314 ? 8.689   -7.592  34.309 0.05  0.00 ? 314 ASP A CA   3  
ATOM   9930   C CA   O ASP A 1 314 ? 8.853   -7.435  34.608 0.95  0.00 ? 314 ASP A CA   3  
ATOM   9931   C C    C ASP A 1 314 ? 9.888   -6.986  35.055 0.05  0.00 ? 314 ASP A C    3  
ATOM   9932   C C    O ASP A 1 314 ? 10.094  -7.291  35.503 0.95  0.00 ? 314 ASP A C    3  
ATOM   9933   O O    C ASP A 1 314 ? 9.690   -5.912  35.672 0.05  0.00 ? 314 ASP A O    3  
ATOM   9934   O O    O ASP A 1 314 ? 9.935   -6.722  36.609 0.95  0.00 ? 314 ASP A O    3  
ATOM   9935   H H    C ASP A 1 314 ? 7.548   -7.706  36.066 0.05  0.00 ? 314 ASP A H    3  
ATOM   9936   H H    O ASP A 1 314 ? 7.514   -7.805  36.180 0.95  0.00 ? 314 ASP A H    3  
ATOM   9937   N N    C PRO A 1 315 ? 11.016  -7.660  35.093 0.05  0.00 ? 315 PRO A N    3  
ATOM   9938   N N    O PRO A 1 315 ? 11.220  -7.849  35.117 0.95  0.00 ? 315 PRO A N    3  
ATOM   9939   C CA   C PRO A 1 315 ? 12.185  -7.123  35.752 0.05  0.00 ? 315 PRO A CA   3  
ATOM   9940   C CA   O PRO A 1 315 ? 12.404  -7.792  35.945 0.95  0.00 ? 315 PRO A CA   3  
ATOM   9941   C C    C PRO A 1 315 ? 12.688  -5.853  35.080 0.05  0.00 ? 315 PRO A C    3  
ATOM   9942   C C    O PRO A 1 315 ? 12.898  -6.366  36.140 0.95  0.00 ? 315 PRO A C    3  
ATOM   9943   O O    C PRO A 1 315 ? 13.361  -5.093  35.813 0.05  0.00 ? 315 PRO A O    3  
ATOM   9944   O O    O PRO A 1 315 ? 13.588  -6.176  37.168 0.95  0.00 ? 315 PRO A O    3  
ATOM   9945   N N    C ARG A 1 316 ? 12.379  -5.590  33.875 0.05  0.00 ? 316 ARG A N    3  
ATOM   9946   N N    O ARG A 1 316 ? 12.567  -5.447  35.326 0.95  0.00 ? 316 ARG A N    3  
ATOM   9947   C CA   C ARG A 1 316 ? 12.798  -4.339  33.167 0.05  0.00 ? 316 ARG A CA   3  
ATOM   9948   C CA   O ARG A 1 316 ? 12.976  -4.015  35.482 0.95  0.00 ? 316 ARG A CA   3  
ATOM   9949   C C    C ARG A 1 316 ? 12.054  -3.132  33.768 0.05  0.00 ? 316 ARG A C    3  
ATOM   9950   C C    O ARG A 1 316 ? 12.248  -3.399  36.692 0.95  0.00 ? 316 ARG A C    3  
ATOM   9951   O O    C ARG A 1 316 ? 12.613  -2.019  33.953 0.05  0.00 ? 316 ARG A O    3  
ATOM   9952   O O    O ARG A 1 316 ? 12.814  -2.603  37.486 0.95  0.00 ? 316 ARG A O    3  
ATOM   9953   H H    C ARG A 1 316 ? 11.811  -6.227  33.392 0.05  0.00 ? 316 ARG A H    3  
ATOM   9954   H H    O ARG A 1 316 ? 11.987  -5.683  34.571 0.95  0.00 ? 316 ARG A H    3  
ATOM   9955   N N    C ILE A 1 317 ? 10.788  -3.409  34.083 0.05  0.00 ? 317 ILE A N    3  
ATOM   9956   N N    O ILE A 1 317 ? 10.987  -3.819  36.806 0.95  0.00 ? 317 ILE A N    3  
ATOM   9957   C CA   C ILE A 1 317 ? 9.944   -2.357  34.711 0.05  0.00 ? 317 ILE A CA   3  
ATOM   9958   C CA   O ILE A 1 317 ? 10.159  -3.345  37.947 0.95  0.00 ? 317 ILE A CA   3  
ATOM   9959   C C    C ILE A 1 317 ? 10.353  -2.133  36.141 0.05  0.00 ? 317 ILE A C    3  
ATOM   9960   C C    O ILE A 1 317 ? 10.597  -4.002  39.228 0.95  0.00 ? 317 ILE A C    3  
ATOM   9961   O O    C ILE A 1 317 ? 10.440  -0.945  36.596 0.05  0.00 ? 317 ILE A O    3  
ATOM   9962   O O    O ILE A 1 317 ? 10.697  -3.308  40.293 0.95  0.00 ? 317 ILE A O    3  
ATOM   9963   H H    C ILE A 1 317 ? 10.424  -4.305  33.925 0.05  0.00 ? 317 ILE A H    3  
ATOM   9964   H H    O ILE A 1 317 ? 10.617  -4.454  36.157 0.95  0.00 ? 317 ILE A H    3  
ATOM   9965   N N    C ALA A 1 318 ? 10.687  -3.175  36.890 0.05  0.00 ? 318 ALA A N    3  
ATOM   9966   N N    O ALA A 1 318 ? 10.942  -5.282  39.214 0.95  0.00 ? 318 ALA A N    3  
ATOM   9967   C CA   C ALA A 1 318 ? 11.121  -3.078  38.252 0.05  0.00 ? 318 ALA A CA   3  
ATOM   9968   C CA   O ALA A 1 318 ? 11.402  -6.001  40.365 0.95  0.00 ? 318 ALA A CA   3  
ATOM   9969   C C    C ALA A 1 318 ? 12.422  -2.257  38.345 0.05  0.00 ? 318 ALA A C    3  
ATOM   9970   C C    O ALA A 1 318 ? 12.708  -5.381  40.900 0.95  0.00 ? 318 ALA A C    3  
ATOM   9971   O O    C ALA A 1 318 ? 12.640  -1.561  39.360 0.05  0.00 ? 318 ALA A O    3  
ATOM   9972   O O    O ALA A 1 318 ? 12.948  -5.413  42.126 0.95  0.00 ? 318 ALA A O    3  
ATOM   9973   H H    C ALA A 1 318 ? 10.654  -4.065  36.479 0.05  0.00 ? 318 ALA A H    3  
ATOM   9974   H H    O ALA A 1 318 ? 10.898  -5.760  38.359 0.95  0.00 ? 318 ALA A H    3  
ATOM   9975   N N    C ALA A 1 319 ? 13.295  -2.517  37.379 0.05  0.00 ? 319 ALA A N    3  
ATOM   9976   N N    O ALA A 1 319 ? 13.561  -5.015  39.951 0.95  0.00 ? 319 ALA A N    3  
ATOM   9977   C CA   C ALA A 1 319 ? 14.594  -1.841  37.354 0.05  0.00 ? 319 ALA A CA   3  
ATOM   9978   C CA   O ALA A 1 319 ? 14.861  -4.443  40.305 0.95  0.00 ? 319 ALA A CA   3  
ATOM   9979   C C    C ALA A 1 319 ? 14.406  -0.322  37.078 0.05  0.00 ? 319 ALA A C    3  
ATOM   9980   C C    O ALA A 1 319 ? 14.673  -3.054  40.979 0.95  0.00 ? 319 ALA A C    3  
ATOM   9981   O O    C ALA A 1 319 ? 15.096  0.449   37.747 0.05  0.00 ? 319 ALA A O    3  
ATOM   9982   O O    O ALA A 1 319 ? 15.379  -2.818  41.961 0.95  0.00 ? 319 ALA A O    3  
ATOM   9983   H H    C ALA A 1 319 ? 13.080  -3.183  36.693 0.05  0.00 ? 319 ALA A H    3  
ATOM   9984   H H    O ALA A 1 319 ? 13.330  -5.152  39.008 0.95  0.00 ? 319 ALA A H    3  
ATOM   9985   N N    C THR A 1 320 ? 13.552  -0.007  36.166 0.05  0.00 ? 320 THR A N    3  
ATOM   9986   N N    O THR A 1 320 ? 13.803  -2.270  40.442 0.95  0.00 ? 320 THR A N    3  
ATOM   9987   C CA   C THR A 1 320 ? 13.189  1.354   35.745 0.05  0.00 ? 320 THR A CA   3  
ATOM   9988   C CA   O THR A 1 320 ? 13.436  -0.925  40.909 0.95  0.00 ? 320 THR A CA   3  
ATOM   9989   C C    C THR A 1 320 ? 12.760  2.116   37.007 0.05  0.00 ? 320 THR A C    3  
ATOM   9990   C C    O THR A 1 320 ? 13.035  -1.055  42.385 0.95  0.00 ? 320 THR A C    3  
ATOM   9991   O O    C THR A 1 320 ? 13.298  3.189   37.310 0.05  0.00 ? 320 THR A O    3  
ATOM   9992   O O    O THR A 1 320 ? 13.582  -0.361  43.252 0.95  0.00 ? 320 THR A O    3  
ATOM   9993   H H    C THR A 1 320 ? 13.090  -0.747  35.718 0.05  0.00 ? 320 THR A H    3  
ATOM   9994   H H    O THR A 1 320 ? 13.330  -2.609  39.653 0.95  0.00 ? 320 THR A H    3  
ATOM   9995   N N    C MET A 1 321 ? 11.786  1.567   37.706 0.05  0.00 ? 321 MET A N    3  
ATOM   9996   N N    O MET A 1 321 ? 12.072  -1.918  42.645 0.95  0.00 ? 321 MET A N    3  
ATOM   9997   C CA   C MET A 1 321 ? 11.305  2.171   38.970 0.05  0.00 ? 321 MET A CA   3  
ATOM   9998   C CA   O MET A 1 321 ? 11.618  -2.177  44.030 0.95  0.00 ? 321 MET A CA   3  
ATOM   9999   C C    C MET A 1 321 ? 12.378  2.323   39.982 0.05  0.00 ? 321 MET A C    3  
ATOM   10000  C C    O MET A 1 321 ? 12.711  -2.641  44.919 0.95  0.00 ? 321 MET A C    3  
ATOM   10001  O O    C MET A 1 321 ? 12.502  3.359   40.672 0.05  0.00 ? 321 MET A O    3  
ATOM   10002  O O    O MET A 1 321 ? 12.852  -2.208  46.084 0.95  0.00 ? 321 MET A O    3  
ATOM   10003  H H    C MET A 1 321 ? 11.390  0.725   37.398 0.05  0.00 ? 321 MET A H    3  
ATOM   10004  H H    O MET A 1 321 ? 11.668  -2.421  41.907 0.95  0.00 ? 321 MET A H    3  
ATOM   10005  N N    C GLU A 1 322 ? 13.256  1.330   40.193 0.05  0.00 ? 322 GLU A N    3  
ATOM   10006  N N    O GLU A 1 322 ? 13.589  -3.560  44.490 0.95  0.00 ? 322 GLU A N    3  
ATOM   10007  C CA   C GLU A 1 322 ? 14.333  1.388   41.148 0.05  0.00 ? 322 GLU A CA   3  
ATOM   10008  C CA   O GLU A 1 322 ? 14.685  -4.066  45.277 0.95  0.00 ? 322 GLU A CA   3  
ATOM   10009  C C    C GLU A 1 322 ? 15.344  2.529   40.908 0.05  0.00 ? 322 GLU A C    3  
ATOM   10010  C C    O GLU A 1 322 ? 15.695  -2.993  45.736 0.95  0.00 ? 322 GLU A C    3  
ATOM   10011  O O    C GLU A 1 322 ? 15.782  3.181   41.852 0.05  0.00 ? 322 GLU A O    3  
ATOM   10012  O O    O GLU A 1 322 ? 16.153  -3.017  46.875 0.95  0.00 ? 322 GLU A O    3  
ATOM   10013  H H    C GLU A 1 322 ? 13.161  0.515   39.658 0.05  0.00 ? 322 GLU A H    3  
ATOM   10014  H H    O GLU A 1 322 ? 13.481  -3.905  43.579 0.95  0.00 ? 322 GLU A H    3  
ATOM   10015  N N    C ASN A 1 323 ? 15.681  2.683   39.656 0.05  0.00 ? 323 ASN A N    3  
ATOM   10016  N N    O ASN A 1 323 ? 16.008  -2.129  44.809 0.95  0.00 ? 323 ASN A N    3  
ATOM   10017  C CA   C ASN A 1 323 ? 16.612  3.701   39.173 0.05  0.00 ? 323 ASN A CA   3  
ATOM   10018  C CA   O ASN A 1 323 ? 16.933  -1.014  45.000 0.95  0.00 ? 323 ASN A CA   3  
ATOM   10019  C C    C ASN A 1 323 ? 15.950  5.110   39.384 0.05  0.00 ? 323 ASN A C    3  
ATOM   10020  C C    O ASN A 1 323 ? 16.280  -0.004  46.012 0.95  0.00 ? 323 ASN A C    3  
ATOM   10021  O O    C ASN A 1 323 ? 16.668  5.996   39.786 0.05  0.00 ? 323 ASN A O    3  
ATOM   10022  O O    O ASN A 1 323 ? 17.009  0.482   46.845 0.95  0.00 ? 323 ASN A O    3  
ATOM   10023  H H    C ASN A 1 323 ? 15.278  2.082   38.997 0.05  0.00 ? 323 ASN A H    3  
ATOM   10024  H H    O ASN A 1 323 ? 15.590  -2.231  43.929 0.95  0.00 ? 323 ASN A H    3  
ATOM   10025  N N    C ALA A 1 324 ? 14.696  5.159   39.046 0.05  0.00 ? 324 ALA A N    3  
ATOM   10026  N N    O ALA A 1 324 ? 15.020  0.223   45.789 0.95  0.00 ? 324 ALA A N    3  
ATOM   10027  C CA   C ALA A 1 324 ? 13.879  6.369   39.176 0.05  0.00 ? 324 ALA A CA   3  
ATOM   10028  C CA   O ALA A 1 324 ? 14.210  1.118   46.621 0.95  0.00 ? 324 ALA A CA   3  
ATOM   10029  C C    C ALA A 1 324 ? 13.784  6.768   40.636 0.05  0.00 ? 324 ALA A C    3  
ATOM   10030  C C    O ALA A 1 324 ? 14.144  0.581   48.038 0.95  0.00 ? 324 ALA A C    3  
ATOM   10031  O O    C ALA A 1 324 ? 13.899  7.961   40.946 0.05  0.00 ? 324 ALA A O    3  
ATOM   10032  O O    O ALA A 1 324 ? 14.270  1.364   48.988 0.95  0.00 ? 324 ALA A O    3  
ATOM   10033  H H    C ALA A 1 324 ? 14.274  4.344   38.697 0.05  0.00 ? 324 ALA A H    3  
ATOM   10034  H H    O ALA A 1 324 ? 14.589  -0.234  45.036 0.95  0.00 ? 324 ALA A H    3  
ATOM   10035  N N    C GLN A 1 325 ? 13.652  5.862   41.565 0.05  0.00 ? 325 GLN A N    3  
ATOM   10036  N N    O GLN A 1 325 ? 14.027  -0.699  48.258 0.95  0.00 ? 325 GLN A N    3  
ATOM   10037  C CA   C GLN A 1 325 ? 13.573  6.161   42.978 0.05  0.00 ? 325 GLN A CA   3  
ATOM   10038  C CA   O GLN A 1 325 ? 13.977  -1.289  49.578 0.95  0.00 ? 325 GLN A CA   3  
ATOM   10039  C C    C GLN A 1 325 ? 14.879  6.680   43.514 0.05  0.00 ? 325 GLN A C    3  
ATOM   10040  C C    O GLN A 1 325 ? 15.295  -1.174  50.293 0.95  0.00 ? 325 GLN A C    3  
ATOM   10041  O O    C GLN A 1 325 ? 14.908  7.333   44.566 0.05  0.00 ? 325 GLN A O    3  
ATOM   10042  O O    O GLN A 1 325 ? 15.346  -1.264  51.527 0.95  0.00 ? 325 GLN A O    3  
ATOM   10043  H H    C GLN A 1 325 ? 13.615  4.922   41.290 0.05  0.00 ? 325 GLN A H    3  
ATOM   10044  H H    O GLN A 1 325 ? 13.982  -1.298  47.483 0.95  0.00 ? 325 GLN A H    3  
ATOM   10045  N N    C LYS A 1 326 ? 15.974  6.356   42.889 0.05  0.00 ? 326 LYS A N    3  
ATOM   10046  N N    O LYS A 1 326 ? 16.376  -1.058  49.578 0.95  0.00 ? 326 LYS A N    3  
ATOM   10047  C CA   C LYS A 1 326 ? 17.311  6.795   43.261 0.05  0.00 ? 326 LYS A CA   3  
ATOM   10048  C CA   O LYS A 1 326 ? 17.722  -0.911  50.113 0.95  0.00 ? 326 LYS A CA   3  
ATOM   10049  C C    C LYS A 1 326 ? 17.773  8.029   42.472 0.05  0.00 ? 326 LYS A C    3  
ATOM   10050  C C    O LYS A 1 326 ? 18.173  0.555   50.193 0.95  0.00 ? 326 LYS A C    3  
ATOM   10051  O O    C LYS A 1 326 ? 18.798  8.606   42.854 0.05  0.00 ? 326 LYS A O    3  
ATOM   10052  O O    O LYS A 1 326 ? 19.207  0.806   50.824 0.95  0.00 ? 326 LYS A O    3  
ATOM   10053  H H    C LYS A 1 326 ? 15.890  5.788   42.094 0.05  0.00 ? 326 LYS A H    3  
ATOM   10054  H H    O LYS A 1 326 ? 16.275  -1.051  48.603 0.95  0.00 ? 326 LYS A H    3  
ATOM   10055  N N    C GLY A 1 327 ? 17.121  8.423   41.432 0.05  0.00 ? 327 GLY A N    3  
ATOM   10056  N N    O GLY A 1 327 ? 17.502  1.480   49.596 0.95  0.00 ? 327 GLY A N    3  
ATOM   10057  C CA   C GLY A 1 327 ? 17.427  9.536   40.557 0.05  0.00 ? 327 GLY A CA   3  
ATOM   10058  C CA   O GLY A 1 327 ? 17.807  2.894   49.518 0.95  0.00 ? 327 GLY A CA   3  
ATOM   10059  C C    C GLY A 1 327 ? 17.247  10.910  41.200 0.05  0.00 ? 327 GLY A C    3  
ATOM   10060  C C    O GLY A 1 327 ? 17.417  3.691   50.762 0.95  0.00 ? 327 GLY A C    3  
ATOM   10061  O O    C GLY A 1 327 ? 17.031  11.056  42.391 0.05  0.00 ? 327 GLY A O    3  
ATOM   10062  O O    O GLY A 1 327 ? 17.059  3.159   51.799 0.95  0.00 ? 327 GLY A O    3  
ATOM   10063  H H    C GLY A 1 327 ? 16.342  7.883   41.183 0.05  0.00 ? 327 GLY A H    3  
ATOM   10064  H H    O GLY A 1 327 ? 16.706  1.185   49.106 0.95  0.00 ? 327 GLY A H    3  
ATOM   10065  N N    C GLU A 1 328 ? 17.393  11.914  40.401 0.05  0.00 ? 328 GLU A N    3  
ATOM   10066  N N    O GLU A 1 328 ? 17.545  4.972   50.656 0.95  0.00 ? 328 GLU A N    3  
ATOM   10067  C CA   C GLU A 1 328 ? 17.311  13.342  40.714 0.05  0.00 ? 328 GLU A CA   3  
ATOM   10068  C CA   O GLU A 1 328 ? 17.272  5.997   51.665 0.95  0.00 ? 328 GLU A CA   3  
ATOM   10069  C C    C GLU A 1 328 ? 15.896  13.810  40.765 0.05  0.00 ? 328 GLU A C    3  
ATOM   10070  C C    O GLU A 1 328 ? 16.098  6.835   51.289 0.95  0.00 ? 328 GLU A C    3  
ATOM   10071  O O    C GLU A 1 328 ? 15.379  14.447  39.792 0.05  0.00 ? 328 GLU A O    3  
ATOM   10072  O O    O GLU A 1 328 ? 16.112  7.552   50.238 0.95  0.00 ? 328 GLU A O    3  
ATOM   10073  H H    C GLU A 1 328 ? 17.594  11.692  39.468 0.05  0.00 ? 328 GLU A H    3  
ATOM   10074  H H    O GLU A 1 328 ? 17.876  5.298   49.793 0.95  0.00 ? 328 GLU A H    3  
ATOM   10075  N N    C ILE A 1 329 ? 15.163  13.500  41.852 0.05  0.00 ? 329 ILE A N    3  
ATOM   10076  N N    O ILE A 1 329 ? 15.001  6.778   52.069 0.95  0.00 ? 329 ILE A N    3  
ATOM   10077  C CA   C ILE A 1 329 ? 13.752  13.979  41.893 0.05  0.00 ? 329 ILE A CA   3  
ATOM   10078  C CA   O ILE A 1 329 ? 13.847  7.647   51.702 0.95  0.00 ? 329 ILE A CA   3  
ATOM   10079  C C    C ILE A 1 329 ? 13.790  15.501  42.140 0.05  0.00 ? 329 ILE A C    3  
ATOM   10080  C C    O ILE A 1 329 ? 14.351  9.105   51.697 0.95  0.00 ? 329 ILE A C    3  
ATOM   10081  O O    C ILE A 1 329 ? 14.628  15.928  42.935 0.05  0.00 ? 329 ILE A O    3  
ATOM   10082  O O    O ILE A 1 329 ? 15.031  9.475   52.655 0.95  0.00 ? 329 ILE A O    3  
ATOM   10083  H H    C ILE A 1 329 ? 15.551  12.998  42.601 0.05  0.00 ? 329 ILE A H    3  
ATOM   10084  H H    O ILE A 1 329 ? 14.972  6.204   52.864 0.95  0.00 ? 329 ILE A H    3  
ATOM   10085  N N    C MET A 1 330 ? 12.964  16.264  41.511 0.05  0.00 ? 330 MET A N    3  
ATOM   10086  N N    O MET A 1 330 ? 14.058  9.872   50.705 0.95  0.00 ? 330 MET A N    3  
ATOM   10087  C CA   C MET A 1 330 ? 12.962  17.715  41.706 0.05  0.00 ? 330 MET A CA   3  
ATOM   10088  C CA   O MET A 1 330 ? 14.509  11.264  50.653 0.95  0.00 ? 330 MET A CA   3  
ATOM   10089  C C    C MET A 1 330 ? 13.065  18.024  43.231 0.05  0.00 ? 330 MET A C    3  
ATOM   10090  C C    O MET A 1 330 ? 13.763  12.081  51.752 0.95  0.00 ? 330 MET A C    3  
ATOM   10091  O O    C MET A 1 330 ? 12.187  17.557  43.963 0.05  0.00 ? 330 MET A O    3  
ATOM   10092  O O    O MET A 1 330 ? 12.530  12.118  51.691 0.95  0.00 ? 330 MET A O    3  
ATOM   10093  H H    C MET A 1 330 ? 12.322  15.865  40.889 0.05  0.00 ? 330 MET A H    3  
ATOM   10094  H H    O MET A 1 330 ? 13.520  9.517   49.968 0.95  0.00 ? 330 MET A H    3  
ATOM   10095  N N    C PRO A 1 331 ? 14.058  18.787  43.625 0.05  0.00 ? 331 PRO A N    3  
ATOM   10096  N N    O PRO A 1 331 ? 14.499  12.702  52.645 0.95  0.00 ? 331 PRO A N    3  
ATOM   10097  C CA   C PRO A 1 331 ? 14.275  19.158  45.052 0.05  0.00 ? 331 PRO A CA   3  
ATOM   10098  C CA   O PRO A 1 331 ? 13.919  13.565  53.712 0.95  0.00 ? 331 PRO A CA   3  
ATOM   10099  C C    C PRO A 1 331 ? 12.974  19.296  45.797 0.05  0.00 ? 331 PRO A C    3  
ATOM   10100  C C    O PRO A 1 331 ? 13.016  14.626  53.142 0.95  0.00 ? 331 PRO A C    3  
ATOM   10101  O O    C PRO A 1 331 ? 12.560  18.511  46.636 0.05  0.00 ? 331 PRO A O    3  
ATOM   10102  O O    O PRO A 1 331 ? 13.243  15.270  52.129 0.95  0.00 ? 331 PRO A O    3  
ATOM   10103  N N    C ASN A 1 332 ? 12.265  20.422  45.556 0.05  0.00 ? 332 ASN A N    3  
ATOM   10104  N N    O ASN A 1 332 ? 11.835  14.808  53.775 0.95  0.00 ? 332 ASN A N    3  
ATOM   10105  C CA   C ASN A 1 332 ? 11.010  20.720  46.250 0.05  0.00 ? 332 ASN A CA   3  
ATOM   10106  C CA   O ASN A 1 332 ? 10.837  15.773  53.307 0.95  0.00 ? 332 ASN A CA   3  
ATOM   10107  C C    C ASN A 1 332 ? 10.940  22.094  46.946 0.05  0.00 ? 332 ASN A C    3  
ATOM   10108  C C    O ASN A 1 332 ? 10.893  17.166  53.966 0.95  0.00 ? 332 ASN A C    3  
ATOM   10109  O O    C ASN A 1 332 ? 9.835   22.537  47.322 0.05  0.00 ? 332 ASN A O    3  
ATOM   10110  O O    O ASN A 1 332 ? 10.028  18.018  53.676 0.95  0.00 ? 332 ASN A O    3  
ATOM   10111  H H    C ASN A 1 332 ? 12.619  21.076  44.916 0.05  0.00 ? 332 ASN A H    3  
ATOM   10112  H H    O ASN A 1 332 ? 11.627  14.254  54.557 0.95  0.00 ? 332 ASN A H    3  
ATOM   10113  N N    C ILE A 1 333 ? 12.075  22.737  47.086 0.05  0.00 ? 333 ILE A N    3  
ATOM   10114  N N    O ILE A 1 333 ? 11.884  17.379  54.799 0.95  0.00 ? 333 ILE A N    3  
ATOM   10115  C CA   C ILE A 1 333 ? 12.269  24.037  47.734 0.05  0.00 ? 333 ILE A CA   3  
ATOM   10116  C CA   O ILE A 1 333 ? 12.137  18.605  55.562 0.95  0.00 ? 333 ILE A CA   3  
ATOM   10117  C C    C ILE A 1 333 ? 12.255  25.164  46.710 0.05  0.00 ? 333 ILE A C    3  
ATOM   10118  C C    O ILE A 1 333 ? 12.863  19.636  54.709 0.95  0.00 ? 333 ILE A C    3  
ATOM   10119  O O    C ILE A 1 333 ? 12.349  24.949  45.497 0.05  0.00 ? 333 ILE A O    3  
ATOM   10120  O O    O ILE A 1 333 ? 13.548  19.315  53.732 0.95  0.00 ? 333 ILE A O    3  
ATOM   10121  H H    C ILE A 1 333 ? 12.877  22.297  46.733 0.05  0.00 ? 333 ILE A H    3  
ATOM   10122  H H    O ILE A 1 333 ? 12.511  16.638  54.936 0.95  0.00 ? 333 ILE A H    3  
ATOM   10123  N N    C PRO A 1 334 ? 12.119  26.369  47.277 0.05  0.00 ? 334 PRO A N    3  
ATOM   10124  N N    O PRO A 1 334 ? 12.658  20.889  55.135 0.95  0.00 ? 334 PRO A N    3  
ATOM   10125  C CA   C PRO A 1 334 ? 12.137  27.614  46.525 0.05  0.00 ? 334 PRO A CA   3  
ATOM   10126  C CA   O PRO A 1 334 ? 13.229  22.059  54.487 0.95  0.00 ? 334 PRO A CA   3  
ATOM   10127  C C    C PRO A 1 334 ? 13.418  27.910  45.791 0.05  0.00 ? 334 PRO A C    3  
ATOM   10128  C C    O PRO A 1 334 ? 14.733  22.123  54.474 0.95  0.00 ? 334 PRO A C    3  
ATOM   10129  O O    C PRO A 1 334 ? 13.364  28.519  44.718 0.05  0.00 ? 334 PRO A O    3  
ATOM   10130  O O    O PRO A 1 334 ? 15.300  22.650  53.511 0.95  0.00 ? 334 PRO A O    3  
ATOM   10131  N N    C GLN A 1 335 ? 14.566  27.525  46.257 0.05  0.00 ? 335 GLN A N    3  
ATOM   10132  N N    O GLN A 1 335 ? 15.437  21.625  55.443 0.95  0.00 ? 335 GLN A N    3  
ATOM   10133  C CA   C GLN A 1 335 ? 15.855  27.721  45.612 0.05  0.00 ? 335 GLN A CA   3  
ATOM   10134  C CA   O GLN A 1 335 ? 16.890  21.596  55.512 0.95  0.00 ? 335 GLN A CA   3  
ATOM   10135  C C    C GLN A 1 335 ? 15.970  27.020  44.253 0.05  0.00 ? 335 GLN A C    3  
ATOM   10136  C C    O GLN A 1 335 ? 17.538  20.784  54.385 0.95  0.00 ? 335 GLN A C    3  
ATOM   10137  O O    C GLN A 1 335 ? 16.969  27.180  43.530 0.05  0.00 ? 335 GLN A O    3  
ATOM   10138  O O    O GLN A 1 335 ? 18.774  20.753  54.244 0.95  0.00 ? 335 GLN A O    3  
ATOM   10139  H H    C GLN A 1 335 ? 14.562  27.037  47.106 0.05  0.00 ? 335 GLN A H    3  
ATOM   10140  H H    O GLN A 1 335 ? 14.948  21.208  56.182 0.95  0.00 ? 335 GLN A H    3  
ATOM   10141  N N    C MET A 1 336 ? 15.006  26.179  43.934 0.05  0.00 ? 336 MET A N    3  
ATOM   10142  N N    O MET A 1 336 ? 16.733  20.058  53.636 0.95  0.00 ? 336 MET A N    3  
ATOM   10143  C CA   C MET A 1 336 ? 14.937  25.411  42.678 0.05  0.00 ? 336 MET A CA   3  
ATOM   10144  C CA   O MET A 1 336 ? 17.163  19.212  52.508 0.95  0.00 ? 336 MET A CA   3  
ATOM   10145  C C    C MET A 1 336 ? 14.747  26.395  41.535 0.05  0.00 ? 336 MET A C    3  
ATOM   10146  C C    O MET A 1 336 ? 17.704  20.122  51.417 0.95  0.00 ? 336 MET A C    3  
ATOM   10147  O O    C MET A 1 336 ? 15.155  26.101  40.403 0.05  0.00 ? 336 MET A O    3  
ATOM   10148  O O    O MET A 1 336 ? 18.558  19.690  50.630 0.95  0.00 ? 336 MET A O    3  
ATOM   10149  H H    C MET A 1 336 ? 14.280  26.054  44.581 0.05  0.00 ? 336 MET A H    3  
ATOM   10150  H H    O MET A 1 336 ? 15.775  20.081  53.844 0.95  0.00 ? 336 MET A H    3  
ATOM   10151  N N    C SER A 1 337 ? 14.158  27.549  41.820 0.05  0.00 ? 337 SER A N    3  
ATOM   10152  N N    O SER A 1 337 ? 17.237  21.363  51.375 0.95  0.00 ? 337 SER A N    3  
ATOM   10153  C CA   C SER A 1 337 ? 13.971  28.540  40.747 0.05  0.00 ? 337 SER A CA   3  
ATOM   10154  C CA   O SER A 1 337 ? 17.748  22.285  50.347 0.95  0.00 ? 337 SER A CA   3  
ATOM   10155  C C    C SER A 1 337 ? 15.337  29.046  40.264 0.05  0.00 ? 337 SER A C    3  
ATOM   10156  C C    O SER A 1 337 ? 19.236  22.565  50.595 0.95  0.00 ? 337 SER A C    3  
ATOM   10157  O O    C SER A 1 337 ? 15.545  29.360  39.078 0.05  0.00 ? 337 SER A O    3  
ATOM   10158  O O    O SER A 1 337 ? 20.038  22.756  49.662 0.95  0.00 ? 337 SER A O    3  
ATOM   10159  H H    C SER A 1 337 ? 13.864  27.745  42.733 0.05  0.00 ? 337 SER A H    3  
ATOM   10160  H H    O SER A 1 337 ? 16.572  21.666  52.027 0.95  0.00 ? 337 SER A H    3  
ATOM   10161  N N    C ALA A 1 338 ? 16.263  29.161  41.173 0.05  0.00 ? 338 ALA A N    3  
ATOM   10162  N N    O ALA A 1 338 ? 19.612  22.624  51.841 0.95  0.00 ? 338 ALA A N    3  
ATOM   10163  C CA   C ALA A 1 338 ? 17.618  29.612  40.858 0.05  0.00 ? 338 ALA A CA   3  
ATOM   10164  C CA   O ALA A 1 338 ? 21.001  22.864  52.229 0.95  0.00 ? 338 ALA A CA   3  
ATOM   10165  C C    C ALA A 1 338 ? 18.294  28.585  39.948 0.05  0.00 ? 338 ALA A C    3  
ATOM   10166  C C    O ALA A 1 338 ? 21.865  21.689  51.768 0.95  0.00 ? 338 ALA A C    3  
ATOM   10167  O O    C ALA A 1 338 ? 19.016  28.942  39.015 0.05  0.00 ? 338 ALA A O    3  
ATOM   10168  O O    O ALA A 1 338 ? 22.994  21.874  51.309 0.95  0.00 ? 338 ALA A O    3  
ATOM   10169  H H    C ALA A 1 338 ? 16.047  28.924  42.100 0.05  0.00 ? 338 ALA A H    3  
ATOM   10170  H H    O ALA A 1 338 ? 18.941  22.490  52.543 0.95  0.00 ? 338 ALA A H    3  
ATOM   10171  N N    C PHE A 1 339 ? 18.087  27.328  40.301 0.05  0.00 ? 339 PHE A N    3  
ATOM   10172  N N    O PHE A 1 339 ? 21.322  20.502  51.976 0.95  0.00 ? 339 PHE A N    3  
ATOM   10173  C CA   C PHE A 1 339 ? 18.653  26.196  39.545 0.05  0.00 ? 339 PHE A CA   3  
ATOM   10174  C CA   O PHE A 1 339 ? 22.001  19.250  51.596 0.95  0.00 ? 339 PHE A CA   3  
ATOM   10175  C C    C PHE A 1 339 ? 18.144  26.231  38.107 0.05  0.00 ? 339 PHE A C    3  
ATOM   10176  C C    O PHE A 1 339 ? 22.264  19.242  50.093 0.95  0.00 ? 339 PHE A C    3  
ATOM   10177  O O    C PHE A 1 339 ? 18.964  26.145  37.176 0.05  0.00 ? 339 PHE A O    3  
ATOM   10178  O O    O PHE A 1 339 ? 23.407  18.976  49.683 0.95  0.00 ? 339 PHE A O    3  
ATOM   10179  H H    C PHE A 1 339 ? 17.537  27.141  41.091 0.05  0.00 ? 339 PHE A H    3  
ATOM   10180  H H    O PHE A 1 339 ? 20.437  20.452  52.396 0.95  0.00 ? 339 PHE A H    3  
ATOM   10181  N N    C TRP A 1 340 ? 16.868  26.390  37.878 0.05  0.00 ? 340 TRP A N    3  
ATOM   10182  N N    O TRP A 1 340 ? 21.300  19.553  49.268 0.95  0.00 ? 340 TRP A N    3  
ATOM   10183  C CA   C TRP A 1 340 ? 16.351  26.383  36.513 0.05  0.00 ? 340 TRP A CA   3  
ATOM   10184  C CA   O TRP A 1 340 ? 21.514  19.510  47.825 0.95  0.00 ? 340 TRP A CA   3  
ATOM   10185  C C    C TRP A 1 340 ? 17.062  27.391  35.632 0.05  0.00 ? 340 TRP A C    3  
ATOM   10186  C C    O TRP A 1 340 ? 22.708  20.344  47.404 0.95  0.00 ? 340 TRP A C    3  
ATOM   10187  O O    C TRP A 1 340 ? 17.604  27.045  34.575 0.05  0.00 ? 340 TRP A O    3  
ATOM   10188  O O    O TRP A 1 340 ? 23.633  19.848  46.748 0.95  0.00 ? 340 TRP A O    3  
ATOM   10189  H H    C TRP A 1 340 ? 16.249  26.487  38.631 0.05  0.00 ? 340 TRP A H    3  
ATOM   10190  H H    O TRP A 1 340 ? 20.417  19.789  49.621 0.95  0.00 ? 340 TRP A H    3  
ATOM   10191  N N    C TYR A 1 341 ? 17.010  28.654  36.079 0.05  0.00 ? 341 TYR A N    3  
ATOM   10192  N N    O TYR A 1 341 ? 22.642  21.633  47.767 0.95  0.00 ? 341 TYR A N    3  
ATOM   10193  C CA   C TYR A 1 341 ? 17.626  29.745  35.292 0.05  0.00 ? 341 TYR A CA   3  
ATOM   10194  C CA   O TYR A 1 341 ? 23.722  22.568  47.381 0.95  0.00 ? 341 TYR A CA   3  
ATOM   10195  C C    C TYR A 1 341 ? 19.113  29.560  35.146 0.05  0.00 ? 341 TYR A C    3  
ATOM   10196  C C    O TYR A 1 341 ? 25.045  22.175  47.982 0.95  0.00 ? 341 TYR A C    3  
ATOM   10197  O O    C TYR A 1 341 ? 19.593  29.714  34.008 0.05  0.00 ? 341 TYR A O    3  
ATOM   10198  O O    O TYR A 1 341 ? 26.033  22.175  47.226 0.95  0.00 ? 341 TYR A O    3  
ATOM   10199  H H    C TYR A 1 341 ? 16.540  28.859  36.914 0.05  0.00 ? 341 TYR A H    3  
ATOM   10200  H H    O TYR A 1 341 ? 21.865  21.962  48.264 0.95  0.00 ? 341 TYR A H    3  
ATOM   10201  N N    C ALA A 1 342 ? 19.846  29.270  36.187 0.05  0.00 ? 342 ALA A N    3  
ATOM   10202  N N    O ALA A 1 342 ? 25.128  21.870  49.249 0.95  0.00 ? 342 ALA A N    3  
ATOM   10203  C CA   C ALA A 1 342 ? 21.277  29.100  36.129 0.05  0.00 ? 342 ALA A CA   3  
ATOM   10204  C CA   O ALA A 1 342 ? 26.363  21.506  49.900 0.95  0.00 ? 342 ALA A CA   3  
ATOM   10205  C C    C ALA A 1 342 ? 21.761  28.003  35.182 0.05  0.00 ? 342 ALA A C    3  
ATOM   10206  C C    O ALA A 1 342 ? 27.068  20.284  49.313 0.95  0.00 ? 342 ALA A C    3  
ATOM   10207  O O    C ALA A 1 342 ? 22.678  28.200  34.356 0.05  0.00 ? 342 ALA A O    3  
ATOM   10208  O O    O ALA A 1 342 ? 28.288  20.293  49.042 0.95  0.00 ? 342 ALA A O    3  
ATOM   10209  H H    C ALA A 1 342 ? 19.402  29.178  37.055 0.05  0.00 ? 342 ALA A H    3  
ATOM   10210  H H    O ALA A 1 342 ? 24.311  21.905  49.789 0.95  0.00 ? 342 ALA A H    3  
ATOM   10211  N N    C VAL A 1 343 ? 21.253  26.816  35.418 0.05  0.00 ? 343 VAL A N    3  
ATOM   10212  N N    O VAL A 1 343 ? 26.333  19.198  49.271 0.95  0.00 ? 343 VAL A N    3  
ATOM   10213  C CA   C VAL A 1 343 ? 21.603  25.629  34.595 0.05  0.00 ? 343 VAL A CA   3  
ATOM   10214  C CA   O VAL A 1 343 ? 26.850  17.915  48.727 0.95  0.00 ? 343 VAL A CA   3  
ATOM   10215  C C    C VAL A 1 343 ? 21.103  25.843  33.165 0.05  0.00 ? 343 VAL A C    3  
ATOM   10216  C C    O VAL A 1 343 ? 27.144  18.084  47.235 0.95  0.00 ? 343 VAL A C    3  
ATOM   10217  O O    C VAL A 1 343 ? 21.785  25.461  32.181 0.05  0.00 ? 343 VAL A O    3  
ATOM   10218  O O    O VAL A 1 343 ? 28.149  17.540  46.712 0.95  0.00 ? 343 VAL A O    3  
ATOM   10219  H H    C VAL A 1 343 ? 20.619  26.710  36.158 0.05  0.00 ? 343 VAL A H    3  
ATOM   10220  H H    O VAL A 1 343 ? 25.413  19.235  49.606 0.95  0.00 ? 343 VAL A H    3  
ATOM   10221  N N    C ARG A 1 344 ? 19.995  26.516  32.976 0.05  0.00 ? 344 ARG A N    3  
ATOM   10222  N N    O ARG A 1 344 ? 26.385  18.883  46.527 0.95  0.00 ? 344 ARG A N    3  
ATOM   10223  C CA   C ARG A 1 344 ? 19.499  26.776  31.610 0.05  0.00 ? 344 ARG A CA   3  
ATOM   10224  C CA   O ARG A 1 344 ? 26.659  19.101  45.093 0.95  0.00 ? 344 ARG A CA   3  
ATOM   10225  C C    C ARG A 1 344 ? 20.561  27.541  30.821 0.05  0.00 ? 344 ARG A C    3  
ATOM   10226  C C    O ARG A 1 344 ? 28.074  19.654  44.924 0.95  0.00 ? 344 ARG A C    3  
ATOM   10227  O O    C ARG A 1 344 ? 21.000  27.203  29.710 0.05  0.00 ? 344 ARG A O    3  
ATOM   10228  O O    O ARG A 1 344 ? 28.937  19.177  44.171 0.95  0.00 ? 344 ARG A O    3  
ATOM   10229  H H    C ARG A 1 344 ? 19.505  26.872  33.747 0.05  0.00 ? 344 ARG A H    3  
ATOM   10230  H H    O ARG A 1 344 ? 25.645  19.359  46.958 0.95  0.00 ? 344 ARG A H    3  
ATOM   10231  N N    C THR A 1 345 ? 21.043  28.587  31.486 0.05  0.00 ? 345 THR A N    3  
ATOM   10232  N N    O THR A 1 345 ? 28.328  20.674  45.739 0.95  0.00 ? 345 THR A N    3  
ATOM   10233  C CA   C THR A 1 345 ? 22.092  29.460  30.945 0.05  0.00 ? 345 THR A CA   3  
ATOM   10234  C CA   O THR A 1 345 ? 29.629  21.355  45.780 0.95  0.00 ? 345 THR A CA   3  
ATOM   10235  C C    C THR A 1 345 ? 23.382  28.717  30.769 0.05  0.00 ? 345 THR A C    3  
ATOM   10236  C C    O THR A 1 345 ? 30.710  20.435  46.259 0.95  0.00 ? 345 THR A C    3  
ATOM   10237  O O    C THR A 1 345 ? 23.961  28.806  29.669 0.05  0.00 ? 345 THR A O    3  
ATOM   10238  O O    O THR A 1 345 ? 31.755  20.361  45.584 0.95  0.00 ? 345 THR A O    3  
ATOM   10239  H H    C THR A 1 345 ? 20.696  28.772  32.384 0.05  0.00 ? 345 THR A H    3  
ATOM   10240  H H    O THR A 1 345 ? 27.623  20.972  46.351 0.95  0.00 ? 345 THR A H    3  
ATOM   10241  N N    C ALA A 1 346 ? 23.866  27.982  31.719 0.05  0.00 ? 346 ALA A N    3  
ATOM   10242  N N    O ALA A 1 346 ? 30.554  19.716  47.326 0.95  0.00 ? 346 ALA A N    3  
ATOM   10243  C CA   C ALA A 1 346 ? 25.108  27.239  31.601 0.05  0.00 ? 346 ALA A CA   3  
ATOM   10244  C CA   O ALA A 1 346 ? 31.567  18.807  47.832 0.95  0.00 ? 346 ALA A CA   3  
ATOM   10245  C C    C ALA A 1 346 ? 25.143  26.341  30.369 0.05  0.00 ? 346 ALA A C    3  
ATOM   10246  C C    O ALA A 1 346 ? 32.054  17.820  46.776 0.95  0.00 ? 346 ALA A C    3  
ATOM   10247  O O    C ALA A 1 346 ? 26.186  26.233  29.696 0.05  0.00 ? 346 ALA A O    3  
ATOM   10248  O O    O ALA A 1 346 ? 33.261  17.523  46.701 0.95  0.00 ? 346 ALA A O    3  
ATOM   10249  H H    C ALA A 1 346 ? 23.368  27.923  32.561 0.05  0.00 ? 346 ALA A H    3  
ATOM   10250  H H    O ALA A 1 346 ? 29.708  19.789  47.816 0.95  0.00 ? 346 ALA A H    3  
ATOM   10251  N N    C VAL A 1 347 ? 24.032  25.671  30.094 0.05  0.00 ? 347 VAL A N    3  
ATOM   10252  N N    O VAL A 1 347 ? 31.127  17.286  45.993 0.95  0.00 ? 347 VAL A N    3  
ATOM   10253  C CA   C VAL A 1 347 ? 24.006  24.719  28.970 0.05  0.00 ? 347 VAL A CA   3  
ATOM   10254  C CA   O VAL A 1 347 ? 31.501  16.263  45.002 0.95  0.00 ? 347 VAL A CA   3  
ATOM   10255  C C    C VAL A 1 347 ? 23.986  25.418  27.625 0.05  0.00 ? 347 VAL A C    3  
ATOM   10256  C C    O VAL A 1 347 ? 32.243  16.853  43.819 0.95  0.00 ? 347 VAL A C    3  
ATOM   10257  O O    C VAL A 1 347 ? 24.720  24.974  26.711 0.05  0.00 ? 347 VAL A O    3  
ATOM   10258  O O    O VAL A 1 347 ? 33.249  16.246  43.382 0.95  0.00 ? 347 VAL A O    3  
ATOM   10259  H H    C VAL A 1 347 ? 23.247  25.769  30.672 0.05  0.00 ? 347 VAL A H    3  
ATOM   10260  H H    O VAL A 1 347 ? 30.186  17.532  46.112 0.95  0.00 ? 347 VAL A H    3  
ATOM   10261  N N    C ILE A 1 348 ? 23.175  26.440  27.486 0.05  0.00 ? 348 ILE A N    3  
ATOM   10262  N N    O ILE A 1 348 ? 31.769  17.961  43.299 0.95  0.00 ? 348 ILE A N    3  
ATOM   10263  C CA   C ILE A 1 348 ? 23.092  27.163  26.194 0.05  0.00 ? 348 ILE A CA   3  
ATOM   10264  C CA   O ILE A 1 348 ? 32.434  18.587  42.131 0.95  0.00 ? 348 ILE A CA   3  
ATOM   10265  C C    C ILE A 1 348 ? 24.441  27.817  25.899 0.05  0.00 ? 348 ILE A C    3  
ATOM   10266  C C    O ILE A 1 348 ? 33.840  19.030  42.534 0.95  0.00 ? 348 ILE A C    3  
ATOM   10267  O O    C ILE A 1 348 ? 24.823  27.890  24.744 0.05  0.00 ? 348 ILE A O    3  
ATOM   10268  O O    O ILE A 1 348 ? 34.740  18.962  41.714 0.95  0.00 ? 348 ILE A O    3  
ATOM   10269  H H    C ILE A 1 348 ? 22.613  26.722  28.239 0.05  0.00 ? 348 ILE A H    3  
ATOM   10270  H H    O ILE A 1 348 ? 30.964  18.372  43.679 0.95  0.00 ? 348 ILE A H    3  
ATOM   10271  N N    C ASN A 1 349 ? 25.144  28.252  26.912 0.05  0.00 ? 349 ASN A N    3  
ATOM   10272  N N    O ASN A 1 349 ? 34.023  19.443  43.761 0.95  0.00 ? 349 ASN A N    3  
ATOM   10273  C CA   C ASN A 1 349 ? 26.417  28.927  26.831 0.05  0.00 ? 349 ASN A CA   3  
ATOM   10274  C CA   O ASN A 1 349 ? 35.263  19.934  44.313 0.95  0.00 ? 349 ASN A CA   3  
ATOM   10275  C C    C ASN A 1 349 ? 27.510  27.969  26.443 0.05  0.00 ? 349 ASN A C    3  
ATOM   10276  C C    O ASN A 1 349 ? 36.244  18.811  44.511 0.95  0.00 ? 349 ASN A C    3  
ATOM   10277  O O    C ASN A 1 349 ? 28.268  28.368  25.553 0.05  0.00 ? 349 ASN A O    3  
ATOM   10278  O O    O ASN A 1 349 ? 37.389  19.035  44.106 0.95  0.00 ? 349 ASN A O    3  
ATOM   10279  H H    C ASN A 1 349 ? 24.760  28.131  27.805 0.05  0.00 ? 349 ASN A H    3  
ATOM   10280  H H    O ASN A 1 349 ? 33.241  19.444  44.351 0.95  0.00 ? 349 ASN A H    3  
ATOM   10281  N N    C ALA A 1 350 ? 27.585  26.847  27.111 0.05  0.00 ? 350 ALA A N    3  
ATOM   10282  N N    O ALA A 1 350 ? 35.812  17.744  45.132 0.95  0.00 ? 350 ALA A N    3  
ATOM   10283  C CA   C ALA A 1 350 ? 28.588  25.837  26.808 0.05  0.00 ? 350 ALA A CA   3  
ATOM   10284  C CA   O ALA A 1 350 ? 36.667  16.588  45.360 0.95  0.00 ? 350 ALA A CA   3  
ATOM   10285  C C    C ALA A 1 350 ? 28.374  25.254  25.408 0.05  0.00 ? 350 ALA A C    3  
ATOM   10286  C C    O ALA A 1 350 ? 37.070  15.933  44.036 0.95  0.00 ? 350 ALA A C    3  
ATOM   10287  O O    C ALA A 1 350 ? 29.352  24.878  24.750 0.05  0.00 ? 350 ALA A O    3  
ATOM   10288  O O    O ALA A 1 350 ? 38.173  15.380  43.942 0.95  0.00 ? 350 ALA A O    3  
ATOM   10289  H H    C ALA A 1 350 ? 26.939  26.677  27.827 0.05  0.00 ? 350 ALA A H    3  
ATOM   10290  H H    O ALA A 1 350 ? 34.883  17.717  45.440 0.95  0.00 ? 350 ALA A H    3  
ATOM   10291  N N    C ALA A 1 351 ? 27.152  25.139  24.996 0.05  0.00 ? 351 ALA A N    3  
ATOM   10292  N N    O ALA A 1 351 ? 36.199  15.952  43.078 0.95  0.00 ? 351 ALA A N    3  
ATOM   10293  C CA   C ALA A 1 351 ? 26.694  24.567  23.742 0.05  0.00 ? 351 ALA A CA   3  
ATOM   10294  C CA   O ALA A 1 351 ? 36.323  15.352  41.761 0.95  0.00 ? 351 ALA A CA   3  
ATOM   10295  C C    C ALA A 1 351 ? 26.986  25.440  22.524 0.05  0.00 ? 351 ALA A C    3  
ATOM   10296  C C    O ALA A 1 351 ? 37.299  16.082  40.842 0.95  0.00 ? 351 ALA A C    3  
ATOM   10297  O O    C ALA A 1 351 ? 27.240  24.894  21.434 0.05  0.00 ? 351 ALA A O    3  
ATOM   10298  O O    O ALA A 1 351 ? 37.961  15.425  40.017 0.95  0.00 ? 351 ALA A O    3  
ATOM   10299  H H    C ALA A 1 351 ? 26.454  25.439  25.616 0.05  0.00 ? 351 ALA A H    3  
ATOM   10300  H H    O ALA A 1 351 ? 35.344  16.389  43.276 0.95  0.00 ? 351 ALA A H    3  
ATOM   10301  N N    C SER A 1 352 ? 26.865  26.720  22.729 0.05  0.00 ? 352 SER A N    3  
ATOM   10302  N N    O SER A 1 352 ? 37.293  17.379  40.959 0.95  0.00 ? 352 SER A N    3  
ATOM   10303  C CA   C SER A 1 352 ? 27.092  27.734  21.714 0.05  0.00 ? 352 SER A CA   3  
ATOM   10304  C CA   O SER A 1 352 ? 38.136  18.272  40.185 0.95  0.00 ? 352 SER A CA   3  
ATOM   10305  C C    C SER A 1 352 ? 28.524  28.233  21.715 0.05  0.00 ? 352 SER A C    3  
ATOM   10306  C C    O SER A 1 352 ? 39.446  18.574  40.886 0.95  0.00 ? 352 SER A C    3  
ATOM   10307  O O    C SER A 1 352 ? 28.792  29.201  20.977 0.05  0.00 ? 352 SER A O    3  
ATOM   10308  O O    O SER A 1 352 ? 40.184  19.437  40.373 0.95  0.00 ? 352 SER A O    3  
ATOM   10309  H H    C SER A 1 352 ? 26.603  27.019  23.625 0.05  0.00 ? 352 SER A H    3  
ATOM   10310  H H    O SER A 1 352 ? 36.680  17.778  41.612 0.95  0.00 ? 352 SER A H    3  
ATOM   10311  N N    C GLY A 1 353 ? 29.434  27.692  22.487 0.05  0.00 ? 353 GLY A N    3  
ATOM   10312  N N    O GLY A 1 353 ? 39.773  17.976  42.006 0.95  0.00 ? 353 GLY A N    3  
ATOM   10313  C CA   C GLY A 1 353 ? 30.821  28.086  22.564 0.05  0.00 ? 353 GLY A CA   3  
ATOM   10314  C CA   O GLY A 1 353 ? 40.992  18.186  42.752 0.95  0.00 ? 353 GLY A CA   3  
ATOM   10315  C C    C GLY A 1 353 ? 31.078  29.377  23.332 0.05  0.00 ? 353 GLY A C    3  
ATOM   10316  C C    O GLY A 1 353 ? 41.040  19.486  43.546 0.95  0.00 ? 353 GLY A C    3  
ATOM   10317  O O    C GLY A 1 353 ? 32.248  29.722  23.622 0.05  0.00 ? 353 GLY A O    3  
ATOM   10318  O O    O GLY A 1 353 ? 41.961  19.692  44.372 0.95  0.00 ? 353 GLY A O    3  
ATOM   10319  H H    C GLY A 1 353 ? 29.149  26.952  23.062 0.05  0.00 ? 353 GLY A H    3  
ATOM   10320  H H    O GLY A 1 353 ? 39.135  17.327  42.369 0.95  0.00 ? 353 GLY A H    3  
ATOM   10321  N N    C ARG A 1 354 ? 30.023  30.082  23.655 0.05  0.00 ? 354 ARG A N    3  
ATOM   10322  N N    O ARG A 1 354 ? 40.084  20.348  43.310 0.95  0.00 ? 354 ARG A N    3  
ATOM   10323  C CA   C ARG A 1 354 ? 30.057  31.354  24.406 0.05  0.00 ? 354 ARG A CA   3  
ATOM   10324  C CA   O ARG A 1 354 ? 39.946  21.658  43.979 0.95  0.00 ? 354 ARG A CA   3  
ATOM   10325  C C    C ARG A 1 354 ? 30.844  31.214  25.703 0.05  0.00 ? 354 ARG A C    3  
ATOM   10326  C C    O ARG A 1 354 ? 39.975  21.514  45.496 0.95  0.00 ? 354 ARG A C    3  
ATOM   10327  O O    C ARG A 1 354 ? 31.385  32.237  26.200 0.05  0.00 ? 354 ARG A O    3  
ATOM   10328  O O    O ARG A 1 354 ? 40.358  22.490  46.193 0.95  0.00 ? 354 ARG A O    3  
ATOM   10329  H H    C ARG A 1 354 ? 29.146  29.737  23.385 0.05  0.00 ? 354 ARG A H    3  
ATOM   10330  H H    O ARG A 1 354 ? 39.406  20.104  42.645 0.95  0.00 ? 354 ARG A H    3  
ATOM   10331  N N    C GLN A 1 355 ? 30.968  30.008  26.244 0.05  0.00 ? 355 GLN A N    3  
ATOM   10332  N N    O GLN A 1 355 ? 39.634  20.347  46.030 0.95  0.00 ? 355 GLN A N    3  
ATOM   10333  C CA   C GLN A 1 355 ? 31.742  29.795  27.496 0.05  0.00 ? 355 GLN A CA   3  
ATOM   10334  C CA   O GLN A 1 355 ? 39.662  20.129  47.501 0.95  0.00 ? 355 GLN A CA   3  
ATOM   10335  C C    C GLN A 1 355 ? 32.213  28.349  27.492 0.05  0.00 ? 355 GLN A C    3  
ATOM   10336  C C    O GLN A 1 355 ? 39.846  18.637  47.730 0.95  0.00 ? 355 GLN A C    3  
ATOM   10337  O O    C GLN A 1 355 ? 31.619  27.561  26.740 0.05  0.00 ? 355 GLN A O    3  
ATOM   10338  O O    O GLN A 1 355 ? 39.577  17.880  46.784 0.95  0.00 ? 355 GLN A O    3  
ATOM   10339  H H    C GLN A 1 355 ? 30.554  29.239  25.800 0.05  0.00 ? 355 GLN A H    3  
ATOM   10340  H H    O GLN A 1 355 ? 39.373  19.609  45.441 0.95  0.00 ? 355 GLN A H    3  
ATOM   10341  N N    C THR A 1 356 ? 33.231  28.005  28.238 0.05  0.00 ? 356 THR A N    3  
ATOM   10342  N N    O THR A 1 356 ? 40.309  18.218  48.879 0.95  0.00 ? 356 THR A N    3  
ATOM   10343  C CA   C THR A 1 356 ? 33.726  26.630  28.324 0.05  0.00 ? 356 THR A CA   3  
ATOM   10344  C CA   O THR A 1 356 ? 40.482  16.800  49.199 0.95  0.00 ? 356 THR A CA   3  
ATOM   10345  C C    C THR A 1 356 ? 32.860  25.896  29.367 0.05  0.00 ? 356 THR A C    3  
ATOM   10346  C C    O THR A 1 356 ? 39.118  16.270  49.684 0.95  0.00 ? 356 THR A C    3  
ATOM   10347  O O    C THR A 1 356 ? 32.074  26.551  30.077 0.05  0.00 ? 356 THR A O    3  
ATOM   10348  O O    O THR A 1 356 ? 38.198  17.077  49.917 0.95  0.00 ? 356 THR A O    3  
ATOM   10349  H H    C THR A 1 356 ? 33.667  28.694  28.781 0.05  0.00 ? 356 THR A H    3  
ATOM   10350  H H    O THR A 1 356 ? 40.528  18.882  49.565 0.95  0.00 ? 356 THR A H    3  
ATOM   10351  N N    C VAL A 1 357 ? 33.021  24.593  29.430 0.05  0.00 ? 357 VAL A N    3  
ATOM   10352  N N    O VAL A 1 357 ? 39.025  14.966  49.820 0.95  0.00 ? 357 VAL A N    3  
ATOM   10353  C CA   C VAL A 1 357 ? 32.259  23.736  30.342 0.05  0.00 ? 357 VAL A CA   3  
ATOM   10354  C CA   O VAL A 1 357 ? 37.795  14.292  50.243 0.95  0.00 ? 357 VAL A CA   3  
ATOM   10355  C C    C VAL A 1 357 ? 32.594  24.087  31.793 0.05  0.00 ? 357 VAL A C    3  
ATOM   10356  C C    O VAL A 1 357 ? 37.436  14.705  51.671 0.95  0.00 ? 357 VAL A C    3  
ATOM   10357  O O    C VAL A 1 357 ? 31.714  24.294  32.632 0.05  0.00 ? 357 VAL A O    3  
ATOM   10358  O O    O VAL A 1 357 ? 36.303  15.091  51.971 0.95  0.00 ? 357 VAL A O    3  
ATOM   10359  H H    C VAL A 1 357 ? 33.668  24.172  28.825 0.05  0.00 ? 357 VAL A H    3  
ATOM   10360  H H    O VAL A 1 357 ? 39.810  14.417  49.610 0.95  0.00 ? 357 VAL A H    3  
ATOM   10361  N N    C ASP A 1 358 ? 33.875  24.148  32.034 0.05  0.00 ? 358 ASP A N    3  
ATOM   10362  N N    O ASP A 1 358 ? 38.432  14.612  52.509 0.95  0.00 ? 358 ASP A N    3  
ATOM   10363  C CA   C ASP A 1 358 ? 34.417  24.503  33.348 0.05  0.00 ? 358 ASP A CA   3  
ATOM   10364  C CA   O ASP A 1 358 ? 38.318  14.991  53.919 0.95  0.00 ? 358 ASP A CA   3  
ATOM   10365  C C    C ASP A 1 358 ? 33.878  25.864  33.818 0.05  0.00 ? 358 ASP A C    3  
ATOM   10366  C C    O ASP A 1 358 ? 37.836  16.444  54.063 0.95  0.00 ? 358 ASP A C    3  
ATOM   10367  O O    C ASP A 1 358 ? 33.582  25.999  35.013 0.05  0.00 ? 358 ASP A O    3  
ATOM   10368  O O    O ASP A 1 358 ? 37.023  16.708  54.960 0.95  0.00 ? 358 ASP A O    3  
ATOM   10369  H H    C ASP A 1 358 ? 34.500  23.972  31.300 0.05  0.00 ? 358 ASP A H    3  
ATOM   10370  H H    O ASP A 1 358 ? 39.298  14.298  52.175 0.95  0.00 ? 358 ASP A H    3  
ATOM   10371  N N    C GLU A 1 359 ? 33.792  26.814  32.932 0.05  0.00 ? 359 GLU A N    3  
ATOM   10372  N N    O GLU A 1 359 ? 38.337  17.326  53.248 0.95  0.00 ? 359 GLU A N    3  
ATOM   10373  C CA   C GLU A 1 359 ? 33.344  28.177  33.150 0.05  0.00 ? 359 GLU A CA   3  
ATOM   10374  C CA   O GLU A 1 359 ? 38.056  18.749  53.217 0.95  0.00 ? 359 GLU A CA   3  
ATOM   10375  C C    C GLU A 1 359 ? 31.846  28.269  33.360 0.05  0.00 ? 359 GLU A C    3  
ATOM   10376  C C    O GLU A 1 359 ? 36.678  19.057  52.665 0.95  0.00 ? 359 GLU A C    3  
ATOM   10377  O O    C GLU A 1 359 ? 31.349  28.875  34.320 0.05  0.00 ? 359 GLU A O    3  
ATOM   10378  O O    O GLU A 1 359 ? 35.879  19.796  53.258 0.95  0.00 ? 359 GLU A O    3  
ATOM   10379  H H    C GLU A 1 359 ? 34.078  26.589  32.022 0.05  0.00 ? 359 GLU A H    3  
ATOM   10380  H H    O GLU A 1 359 ? 38.989  16.996  52.595 0.95  0.00 ? 359 GLU A H    3  
ATOM   10381  N N    C ALA A 1 360 ? 31.138  27.706  32.394 0.05  0.00 ? 360 ALA A N    3  
ATOM   10382  N N    O ALA A 1 360 ? 36.449  18.521  51.477 0.95  0.00 ? 360 ALA A N    3  
ATOM   10383  C CA   C ALA A 1 360 ? 29.670  27.670  32.387 0.05  0.00 ? 360 ALA A CA   3  
ATOM   10384  C CA   O ALA A 1 360 ? 35.182  18.682  50.752 0.95  0.00 ? 360 ALA A CA   3  
ATOM   10385  C C    C ALA A 1 360 ? 29.105  27.076  33.681 0.05  0.00 ? 360 ALA A C    3  
ATOM   10386  C C    O ALA A 1 360 ? 33.978  18.270  51.604 0.95  0.00 ? 360 ALA A C    3  
ATOM   10387  O O    C ALA A 1 360 ? 28.145  27.636  34.219 0.05  0.00 ? 360 ALA A O    3  
ATOM   10388  O O    O ALA A 1 360 ? 32.977  18.993  51.602 0.95  0.00 ? 360 ALA A O    3  
ATOM   10389  H H    C ALA A 1 360 ? 31.618  27.288  31.647 0.05  0.00 ? 360 ALA A H    3  
ATOM   10390  H H    O ALA A 1 360 ? 37.159  17.987  51.062 0.95  0.00 ? 360 ALA A H    3  
ATOM   10391  N N    C LEU A 1 361 ? 29.693  25.980  34.143 0.05  0.00 ? 361 LEU A N    3  
ATOM   10392  N N    O LEU A 1 361 ? 34.092  17.144  52.296 0.95  0.00 ? 361 LEU A N    3  
ATOM   10393  C CA   C LEU A 1 361 ? 29.199  25.325  35.349 0.05  0.00 ? 361 LEU A CA   3  
ATOM   10394  C CA   O LEU A 1 361 ? 32.981  16.655  53.106 0.95  0.00 ? 361 LEU A CA   3  
ATOM   10395  C C    C LEU A 1 361 ? 29.671  26.029  36.601 0.05  0.00 ? 361 LEU A C    3  
ATOM   10396  C C    O LEU A 1 361 ? 32.891  17.383  54.428 0.95  0.00 ? 361 LEU A C    3  
ATOM   10397  O O    C LEU A 1 361 ? 28.878  26.064  37.556 0.05  0.00 ? 361 LEU A O    3  
ATOM   10398  O O    O LEU A 1 361 ? 31.751  17.597  54.872 0.95  0.00 ? 361 LEU A O    3  
ATOM   10399  H H    C LEU A 1 361 ? 30.451  25.594  33.655 0.05  0.00 ? 361 LEU A H    3  
ATOM   10400  H H    O LEU A 1 361 ? 34.921  16.623  52.242 0.95  0.00 ? 361 LEU A H    3  
ATOM   10401  N N    C LYS A 1 362 ? 30.887  26.516  36.579 0.05  0.00 ? 362 LYS A N    3  
ATOM   10402  N N    O LYS A 1 362 ? 34.024  17.700  55.004 0.95  0.00 ? 362 LYS A N    3  
ATOM   10403  C CA   C LYS A 1 362 ? 31.416  27.245  37.767 0.05  0.00 ? 362 LYS A CA   3  
ATOM   10404  C CA   O LYS A 1 362 ? 34.017  18.441  56.298 0.95  0.00 ? 362 LYS A CA   3  
ATOM   10405  C C    C LYS A 1 362 ? 30.463  28.404  38.057 0.05  0.00 ? 362 LYS A C    3  
ATOM   10406  C C    O LYS A 1 362 ? 33.235  19.736  56.083 0.95  0.00 ? 362 LYS A C    3  
ATOM   10407  O O    C LYS A 1 362 ? 30.060  28.561  39.227 0.05  0.00 ? 362 LYS A O    3  
ATOM   10408  O O    O LYS A 1 362 ? 32.346  20.034  56.905 0.95  0.00 ? 362 LYS A O    3  
ATOM   10409  H H    C LYS A 1 362 ? 31.442  26.415  35.778 0.05  0.00 ? 362 LYS A H    3  
ATOM   10410  H H    O LYS A 1 362 ? 34.874  17.465  54.578 0.95  0.00 ? 362 LYS A H    3  
ATOM   10411  N N    C ASP A 1 363 ? 30.051  29.158  37.065 0.05  0.00 ? 363 ASP A N    3  
ATOM   10412  N N    O ASP A 1 363 ? 33.476  20.460  55.015 0.95  0.00 ? 363 ASP A N    3  
ATOM   10413  C CA   C ASP A 1 363 ? 29.148  30.274  37.159 0.05  0.00 ? 363 ASP A CA   3  
ATOM   10414  C CA   O ASP A 1 363 ? 32.825  21.690  54.653 0.95  0.00 ? 363 ASP A CA   3  
ATOM   10415  C C    C ASP A 1 363 ? 27.774  29.891  37.727 0.05  0.00 ? 363 ASP A C    3  
ATOM   10416  C C    O ASP A 1 363 ? 31.308  21.540  54.476 0.95  0.00 ? 363 ASP A C    3  
ATOM   10417  O O    C ASP A 1 363 ? 27.233  30.590  38.581 0.05  0.00 ? 363 ASP A O    3  
ATOM   10418  O O    O ASP A 1 363 ? 30.536  22.368  54.954 0.95  0.00 ? 363 ASP A O    3  
ATOM   10419  H H    C ASP A 1 363 ? 30.383  28.933  36.171 0.05  0.00 ? 363 ASP A H    3  
ATOM   10420  H H    O ASP A 1 363 ? 34.160  20.124  54.398 0.95  0.00 ? 363 ASP A H    3  
ATOM   10421  N N    C ALA A 1 364 ? 27.202  28.859  37.153 0.05  0.00 ? 364 ALA A N    3  
ATOM   10422  N N    O ALA A 1 364 ? 30.933  20.553  53.696 0.95  0.00 ? 364 ALA A N    3  
ATOM   10423  C CA   C ALA A 1 364 ? 25.877  28.372  37.564 0.05  0.00 ? 364 ALA A CA   3  
ATOM   10424  C CA   O ALA A 1 364 ? 29.518  20.280  53.406 0.95  0.00 ? 364 ALA A CA   3  
ATOM   10425  C C    C ALA A 1 364 ? 25.914  27.966  39.032 0.05  0.00 ? 364 ALA A C    3  
ATOM   10426  C C    O ALA A 1 364 ? 28.777  19.987  54.704 0.95  0.00 ? 364 ALA A C    3  
ATOM   10427  O O    C ALA A 1 364 ? 25.009  28.340  39.766 0.05  0.00 ? 364 ALA A O    3  
ATOM   10428  O O    O ALA A 1 364 ? 27.700  20.534  54.900 0.95  0.00 ? 364 ALA A O    3  
ATOM   10429  H H    C ALA A 1 364 ? 27.665  28.407  36.419 0.05  0.00 ? 364 ALA A H    3  
ATOM   10430  H H    O ALA A 1 364 ? 31.618  19.988  53.284 0.95  0.00 ? 364 ALA A H    3  
ATOM   10431  N N    C GLN A 1 365 ? 26.925  27.231  39.419 0.05  0.00 ? 365 GLN A N    3  
ATOM   10432  N N    O GLN A 1 365 ? 29.347  19.155  55.538 0.95  0.00 ? 365 GLN A N    3  
ATOM   10433  C CA   C GLN A 1 365 ? 27.126  26.793  40.804 0.05  0.00 ? 365 GLN A CA   3  
ATOM   10434  C CA   O GLN A 1 365 ? 28.782  18.801  56.844 0.95  0.00 ? 365 GLN A CA   3  
ATOM   10435  C C    C GLN A 1 365 ? 27.085  28.038  41.715 0.05  0.00 ? 365 GLN A C    3  
ATOM   10436  C C    O GLN A 1 365 ? 28.498  20.107  57.617 0.95  0.00 ? 365 GLN A C    3  
ATOM   10437  O O    C GLN A 1 365 ? 26.445  28.063  42.768 0.05  0.00 ? 365 GLN A O    3  
ATOM   10438  O O    O GLN A 1 365 ? 27.442  20.298  58.221 0.95  0.00 ? 365 GLN A O    3  
ATOM   10439  H H    C GLN A 1 365 ? 27.598  26.982  38.752 0.05  0.00 ? 365 GLN A H    3  
ATOM   10440  H H    O GLN A 1 365 ? 30.211  18.768  55.286 0.95  0.00 ? 365 GLN A H    3  
ATOM   10441  N N    C THR A 1 366 ? 27.796  29.052  41.279 0.05  0.00 ? 366 THR A N    3  
ATOM   10442  N N    O THR A 1 366 ? 29.478  20.980  57.584 0.95  0.00 ? 366 THR A N    3  
ATOM   10443  C CA   C THR A 1 366 ? 27.893  30.338  41.961 0.05  0.00 ? 366 THR A CA   3  
ATOM   10444  C CA   O THR A 1 366 ? 29.430  22.290  58.224 0.95  0.00 ? 366 THR A CA   3  
ATOM   10445  C C    C THR A 1 366 ? 26.542  30.990  42.138 0.05  0.00 ? 366 THR A C    3  
ATOM   10446  C C    O THR A 1 366 ? 28.282  23.129  57.716 0.95  0.00 ? 366 THR A C    3  
ATOM   10447  O O    C THR A 1 366 ? 26.252  31.365  43.288 0.05  0.00 ? 366 THR A O    3  
ATOM   10448  O O    O THR A 1 366 ? 27.533  23.626  58.576 0.95  0.00 ? 366 THR A O    3  
ATOM   10449  H H    C THR A 1 366 ? 28.282  28.942  40.437 0.05  0.00 ? 366 THR A H    3  
ATOM   10450  H H    O THR A 1 366 ? 30.288  20.742  57.088 0.95  0.00 ? 366 THR A H    3  
ATOM   10451  N N    C ARG A 1 367 ? 25.730  31.126  41.126 0.05  0.00 ? 367 ARG A N    3  
ATOM   10452  N N    O ARG A 1 367 ? 28.093  23.294  56.436 0.95  0.00 ? 367 ARG A N    3  
ATOM   10453  C CA   C ARG A 1 367 ? 24.426  31.744  41.217 0.05  0.00 ? 367 ARG A CA   3  
ATOM   10454  C CA   O ARG A 1 367 ? 27.021  24.086  55.875 0.95  0.00 ? 367 ARG A CA   3  
ATOM   10455  C C    C ARG A 1 367 ? 23.395  30.998  42.045 0.05  0.00 ? 367 ARG A C    3  
ATOM   10456  C C    O ARG A 1 367 ? 25.617  23.551  56.093 0.95  0.00 ? 367 ARG A C    3  
ATOM   10457  O O    C ARG A 1 367 ? 22.378  31.638  42.417 0.05  0.00 ? 367 ARG A O    3  
ATOM   10458  O O    O ARG A 1 367 ? 24.660  24.348  55.918 0.95  0.00 ? 367 ARG A O    3  
ATOM   10459  H H    C ARG A 1 367 ? 26.022  30.793  40.252 0.05  0.00 ? 367 ARG A H    3  
ATOM   10460  H H    O ARG A 1 367 ? 28.716  22.859  55.817 0.95  0.00 ? 367 ARG A H    3  
ATOM   10461  N N    C ILE A 1 368 ? 23.588  29.694  42.260 0.05  0.00 ? 368 ILE A N    3  
ATOM   10462  N N    O ILE A 1 368 ? 25.478  22.253  56.376 0.95  0.00 ? 368 ILE A N    3  
ATOM   10463  C CA   C ILE A 1 368 ? 22.652  28.850  43.001 0.05  0.00 ? 368 ILE A CA   3  
ATOM   10464  C CA   O ILE A 1 368 ? 24.183  21.601  56.565 0.95  0.00 ? 368 ILE A CA   3  
ATOM   10465  C C    C ILE A 1 368 ? 22.898  28.949  44.520 0.05  0.00 ? 368 ILE A C    3  
ATOM   10466  C C    O ILE A 1 368 ? 23.675  21.783  58.010 0.95  0.00 ? 368 ILE A C    3  
ATOM   10467  O O    C ILE A 1 368 ? 21.937  29.019  45.289 0.05  0.00 ? 368 ILE A O    3  
ATOM   10468  O O    O ILE A 1 368 ? 22.486  22.040  58.209 0.95  0.00 ? 368 ILE A O    3  
ATOM   10469  H H    C ILE A 1 368 ? 24.385  29.274  41.875 0.05  0.00 ? 368 ILE A H    3  
ATOM   10470  H H    O ILE A 1 368 ? 26.286  21.702  56.432 0.95  0.00 ? 368 ILE A H    3  
ATOM   10471  N N    C THR A 1 369 ? 24.155  28.869  44.881 0.05  0.00 ? 369 THR A N    3  
ATOM   10472  N N    O THR A 1 369 ? 24.571  21.563  58.940 0.95  0.00 ? 369 THR A N    3  
ATOM   10473  C CA   C THR A 1 369 ? 24.634  28.909  46.257 0.05  0.00 ? 369 THR A CA   3  
ATOM   10474  C CA   O THR A 1 369 ? 24.324  21.644  60.374 0.95  0.00 ? 369 THR A CA   3  
ATOM   10475  C C    C THR A 1 369 ? 24.888  30.353  46.719 0.05  0.00 ? 369 THR A C    3  
ATOM   10476  C C    O THR A 1 369 ? 24.542  23.072  60.900 0.95  0.00 ? 369 THR A C    3  
ATOM   10477  O O    C THR A 1 369 ? 25.472  30.536  47.797 0.05  0.00 ? 369 THR A O    3  
ATOM   10478  O O    O THR A 1 369 ? 24.551  23.257  62.125 0.95  0.00 ? 369 THR A O    3  
ATOM   10479  H H    C THR A 1 369 ? 24.822  28.755  44.172 0.05  0.00 ? 369 THR A H    3  
ATOM   10480  H H    O THR A 1 369 ? 25.471  21.307  58.649 0.95  0.00 ? 369 THR A H    3  
ATOM   10481  N N    C LYS A 1 370 ? 24.508  31.303  45.899 0.05  0.00 ? 370 LYS A N    3  
ATOM   10482  N N    O LYS A 1 370 ? 24.758  23.999  59.998 0.95  0.00 ? 370 LYS A N    3  
ATOM   10483  C CA   C LYS A 1 370 ? 24.619  32.758  46.107 0.05  0.00 ? 370 LYS A CA   3  
ATOM   10484  C CA   O LYS A 1 370 ? 24.977  25.437  60.231 0.95  0.00 ? 370 LYS A CA   3  
ATOM   10485  C C    C LYS A 1 370 ? 23.544  33.160  47.130 0.05  0.00 ? 370 LYS A C    3  
ATOM   10486  C C    O LYS A 1 370 ? 23.618  26.057  60.596 0.95  0.00 ? 370 LYS A C    3  
ATOM   10487  H H    C LYS A 1 370 ? 24.095  31.014  45.060 0.05  0.00 ? 370 LYS A H    3  
ATOM   10488  H H    O LYS A 1 370 ? 24.764  23.704  59.064 0.95  0.00 ? 370 LYS A H    3  
HETATM 10489  N N1   A MXT B 2 .   ? 1.941   28.916  35.656 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10490  N N1   B MXT B 2 .   ? 0.113   22.852  30.071 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10491  N N1   C MXT B 2 .   ? 5.883   23.325  32.907 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10492  N N1   D MXT B 2 .   ? 5.613   27.055  32.195 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10493  N N1   E MXT B 2 .   ? 4.484   22.973  30.072 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10494  N N1   F MXT B 2 .   ? 4.495   22.264  32.179 0.16  0.00 ? 500 MXT A N1   3  
HETATM 10495  N N1   U MXT B 2 .   ? 2.374   29.029  35.432 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10496  N N1   V MXT B 2 .   ? 5.949   26.256  32.257 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10497  N N1   W MXT B 2 .   ? 0.226   22.763  30.205 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10498  N N1   X MXT B 2 .   ? 5.724   22.797  33.655 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10499  N N1   Y MXT B 2 .   ? 4.483   22.243  30.536 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10500  N N1   Z MXT B 2 .   ? 4.318   21.449  32.434 0.010 0.00 ? 500 MXT A N1   3  
HETATM 10501  N N2   A MXT B 2 .   ? 5.274   29.565  38.352 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10502  N N2   B MXT B 2 .   ? -3.506  20.799  28.850 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10503  N N2   C MXT B 2 .   ? 9.212   20.990  34.410 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10504  N N2   D MXT B 2 .   ? 9.881   27.658  32.669 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10505  N N2   E MXT B 2 .   ? 7.298   22.123  26.884 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10506  N N2   F MXT B 2 .   ? 7.262   18.926  32.091 0.16  0.00 ? 500 MXT A N2   3  
HETATM 10507  N N2   U MXT B 2 .   ? 5.747   29.760  38.057 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10508  N N2   V MXT B 2 .   ? 10.202  26.401  33.088 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10509  N N2   W MXT B 2 .   ? -3.487  20.982  28.851 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10510  N N2   X MXT B 2 .   ? 8.434   19.983  35.539 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10511  N N2   Y MXT B 2 .   ? 7.360   20.610  27.733 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10512  N N2   Z MXT B 2 .   ? 6.607   17.962  33.621 0.010 0.00 ? 500 MXT A N2   3  
HETATM 10513  O O2   A MXT B 2 .   ? 6.125   29.999  39.118 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10514  O O2   B MXT B 2 .   ? -4.588  20.453  28.390 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10515  O O2   C MXT B 2 .   ? 10.105  20.177  34.621 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10516  O O2   D MXT B 2 .   ? 11.069  27.943  32.560 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10517  O O2   E MXT B 2 .   ? 8.201   22.118  26.057 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10518  O O2   F MXT B 2 .   ? 7.836   17.847  32.169 0.16  0.00 ? 500 MXT A O2   3  
HETATM 10519  O O2   U MXT B 2 .   ? 6.639   30.224  38.757 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10520  O O2   V MXT B 2 .   ? 11.421  26.520  33.069 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10521  O O2   W MXT B 2 .   ? -4.560  20.705  28.328 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10522  O O2   X MXT B 2 .   ? 9.134   19.030  35.864 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10523  O O2   Y MXT B 2 .   ? 8.309   20.374  26.995 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10524  O O2   Z MXT B 2 .   ? 7.019   16.893  34.055 0.010 0.00 ? 500 MXT A O2   3  
HETATM 10525  O O11  A MXT B 2 .   ? 0.384   30.590  36.145 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10526  O O11  B MXT B 2 .   ? 1.297   21.023  29.226 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10527  O O11  C MXT B 2 .   ? 7.298   24.808  31.782 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10528  O O11  D MXT B 2 .   ? 4.935   28.271  30.316 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10529  O O11  E MXT B 2 .   ? 4.827   20.775  30.787 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10530  O O11  F MXT B 2 .   ? 3.054   21.533  30.491 0.16  0.00 ? 500 MXT A O11  3  
HETATM 10531  O O11  U MXT B 2 .   ? 0.954   30.864  35.722 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10532  O O11  V MXT B 2 .   ? 5.581   28.097  30.865 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10533  O O11  W MXT B 2 .   ? 1.195   20.666  29.844 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10534  O O11  X MXT B 2 .   ? 7.299   23.610  32.129 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10535  O O11  Y MXT B 2 .   ? 4.612   20.218  31.693 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10536  O O11  Z MXT B 2 .   ? 4.965   21.026  30.228 0.010 0.00 ? 500 MXT A O11  3  
HETATM 10537  O O12  A MXT B 2 .   ? 2.958   27.033  34.724 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10538  O O12  B MXT B 2 .   ? -0.396  24.882  31.105 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10539  O O12  C MXT B 2 .   ? 3.978   22.339  33.825 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10540  O O12  D MXT B 2 .   ? 5.576   25.702  34.096 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10541  O O12  E MXT B 2 .   ? 3.670   25.155  29.911 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10542  O O12  F MXT B 2 .   ? 5.531   23.597  33.793 0.16  0.00 ? 500 MXT A O12  3  
HETATM 10543  O O12  U MXT B 2 .   ? 3.233   26.976  34.731 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10544  O O12  V MXT B 2 .   ? 5.590   24.389  33.611 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10545  O O12  W MXT B 2 .   ? -0.066  25.001  30.796 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10546  O O12  X MXT B 2 .   ? 3.773   22.541  34.909 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10547  O O12  Y MXT B 2 .   ? 3.850   24.395  29.888 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10548  O O12  Z MXT B 2 .   ? 3.382   22.458  34.320 0.010 0.00 ? 500 MXT A O12  3  
HETATM 10549  C C14  A MXT B 2 .   ? 0.673   29.575  35.532 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10550  C C14  B MXT B 2 .   ? 1.301   22.090  29.818 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10551  C C14  C MXT B 2 .   ? 6.175   24.519  32.168 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10552  C C14  D MXT B 2 .   ? 4.644   27.563  31.269 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10553  C C14  E MXT B 2 .   ? 4.235   21.837  30.909 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10554  C C14  F MXT B 2 .   ? 3.418   22.420  31.247 0.16  0.00 ? 500 MXT A C14  3  
HETATM 10555  C C14  U MXT B 2 .   ? 1.157   29.763  35.236 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10556  C C14  V MXT B 2 .   ? 5.128   27.179  31.529 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10557  C C14  W MXT B 2 .   ? 1.305   21.818  30.236 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10558  C C14  X MXT B 2 .   ? 6.198   23.705  32.652 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10559  C C14  Y MXT B 2 .   ? 4.097   21.317  31.558 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10560  C C14  Z MXT B 2 .   ? 4.406   21.752  31.036 0.010 0.00 ? 500 MXT A C14  3  
HETATM 10561  C C21  A MXT B 2 .   ? 3.037   29.432  36.516 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10562  C C21  B MXT B 2 .   ? -1.231  22.430  29.600 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10563  C C21  C MXT B 2 .   ? 6.916   22.309  33.236 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10564  C C21  D MXT B 2 .   ? 7.071   27.308  32.056 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10565  C C21  E MXT B 2 .   ? 5.515   22.977  29.001 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10566  C C21  F MXT B 2 .   ? 5.245   20.992  32.340 0.16  0.00 ? 500 MXT A C21  3  
HETATM 10567  C C21  U MXT B 2 .   ? 3.518   29.561  36.216 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10568  C C21  V MXT B 2 .   ? 7.433   26.309  32.238 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10569  C C21  W MXT B 2 .   ? -1.114  22.437  29.654 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10570  C C21  X MXT B 2 .   ? 6.515   21.627  34.121 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10571  C C21  Y MXT B 2 .   ? 5.576   21.967  29.567 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10572  C C21  Z MXT B 2 .   ? 4.866   20.200  33.024 0.010 0.00 ? 500 MXT A C21  3  
HETATM 10573  C C22  A MXT B 2 .   ? 4.432   28.961  36.041 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10574  C C22  B MXT B 2 .   ? -2.045  21.715  30.706 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10575  C C22  C MXT B 2 .   ? 6.860   21.873  34.723 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10576  C C22  D MXT B 2 .   ? 7.921   26.072  32.430 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10577  C C22  E MXT B 2 .   ? 4.925   22.624  27.614 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10578  C C22  F MXT B 2 .   ? 6.628   21.205  33.002 0.16  0.00 ? 500 MXT A C22  3  
HETATM 10579  C C22  U MXT B 2 .   ? 4.851   28.859  35.866 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10580  C C22  V MXT B 2 .   ? 8.075   25.043  32.857 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10581  C C22  W MXT B 2 .   ? -2.086  21.914  30.743 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10582  C C22  X MXT B 2 .   ? 6.285   21.322  35.620 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10583  C C22  Y MXT B 2 .   ? 5.039   21.517  28.186 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10584  C C22  Z MXT B 2 .   ? 6.170   20.450  33.821 0.010 0.00 ? 500 MXT A C22  3  
HETATM 10585  C C23  A MXT B 2 .   ? 2.774   29.178  38.026 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10586  C C23  B MXT B 2 .   ? -1.170  21.643  28.263 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10587  C C23  C MXT B 2 .   ? 8.332   22.730  32.763 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10588  C C23  D MXT B 2 .   ? 7.516   28.613  32.773 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10589  C C23  E MXT B 2 .   ? 6.765   22.139  29.380 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10590  C C23  F MXT B 2 .   ? 5.302   20.167  31.025 0.16  0.00 ? 500 MXT A C23  3  
HETATM 10591  C C23  U MXT B 2 .   ? 3.221   29.608  37.740 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10592  C C23  V MXT B 2 .   ? 7.986   27.637  32.823 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10593  C C23  W MXT B 2 .   ? -1.034  21.525  28.402 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10594  C C23  X MXT B 2 .   ? 8.016   21.732  33.729 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10595  C C23  Y MXT B 2 .   ? 6.662   21.026  30.152 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10596  C C23  Z MXT B 2 .   ? 4.981   19.053  31.984 0.010 0.00 ? 500 MXT A C23  3  
HETATM 10597  C C24  A MXT B 2 .   ? 5.611   29.572  36.866 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10598  C C24  B MXT B 2 .   ? -3.503  21.350  30.272 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10599  C C24  C MXT B 2 .   ? 7.866   20.729  35.075 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10600  C C24  D MXT B 2 .   ? 9.455   26.275  32.196 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10601  C C24  E MXT B 2 .   ? 5.966   22.724  26.450 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10602  C C24  F MXT B 2 .   ? 7.397   19.872  33.280 0.16  0.00 ? 500 MXT A C24  3  
HETATM 10603  C C24  U MXT B 2 .   ? 6.090   29.468  36.601 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10604  C C24  V MXT B 2 .   ? 9.637   25.023  32.759 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10605  C C24  W MXT B 2 .   ? -3.536  21.661  30.215 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10606  C C24  X MXT B 2 .   ? 7.025   20.035  36.115 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10607  C C24  Y MXT B 2 .   ? 6.162   21.322  27.114 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10608  C C24  Z MXT B 2 .   ? 6.714   19.173  34.542 0.010 0.00 ? 500 MXT A C24  3  
HETATM 10609  C C25  A MXT B 2 .   ? 5.890   31.046  36.431 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10610  C C25  B MXT B 2 .   ? -4.427  22.608  30.316 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10611  C C25  C MXT B 2 .   ? 7.331   19.348  34.581 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10612  C C25  D MXT B 2 .   ? 9.807   26.139  30.680 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10613  C C25  E MXT B 2 .   ? 6.204   24.213  26.045 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10614  C C25  F MXT B 2 .   ? 6.830   19.155  34.546 0.16  0.00 ? 500 MXT A C25  3  
HETATM 10615  C C25  U MXT B 2 .   ? 6.539   30.801  35.923 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10616  C C25  V MXT B 2 .   ? 10.098  24.633  31.318 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10617  C C25  W MXT B 2 .   ? -4.316  23.006  30.069 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10618  C C25  X MXT B 2 .   ? 6.260   18.748  35.667 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10619  C C25  Y MXT B 2 .   ? 6.641   22.699  26.554 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10620  C C25  Z MXT B 2 .   ? 5.901   18.877  35.841 0.010 0.00 ? 500 MXT A C25  3  
HETATM 10621  C C26  A MXT B 2 .   ? 6.891   28.709  36.626 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10622  C C26  B MXT B 2 .   ? -4.058  20.263  31.244 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10623  C C26  C MXT B 2 .   ? 8.056   20.691  36.623 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10624  C C26  D MXT B 2 .   ? 10.234  25.192  33.008 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10625  C C26  E MXT B 2 .   ? 5.421   21.930  25.223 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10626  C C26  F MXT B 2 .   ? 8.907   20.201  33.503 0.16  0.00 ? 500 MXT A C26  3  
HETATM 10627  C C26  U MXT B 2 .   ? 7.262   28.437  36.546 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10628  C C26  V MXT B 2 .   ? 10.190  23.984  33.782 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10629  C C26  W MXT B 2 .   ? -4.280  20.734  31.224 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10630  C C26  X MXT B 2 .   ? 7.108   20.072  37.673 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10631  C C26  Y MXT B 2 .   ? 5.596   20.454  25.948 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10632  C C26  Z MXT B 2 .   ? 8.213   19.405  34.910 0.010 0.00 ? 500 MXT A C26  3  
HETATM 10633  C C27  A MXT B 2 .   ? 4.016   28.950  38.955 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10634  C C27  B MXT B 2 .   ? -2.258  20.540  28.015 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10635  C C27  C MXT B 2 .   ? 9.561   22.238  33.610 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10636  C C27  D MXT B 2 .   ? 8.967   28.658  33.367 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10637  C C27  E MXT B 2 .   ? 7.548   21.430  28.218 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10638  C C27  F MXT B 2 .   ? 6.569   19.276  30.778 0.16  0.00 ? 500 MXT A C27  3  
HETATM 10639  C C27  U MXT B 2 .   ? 4.423   29.408  38.726 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10640  C C27  V MXT B 2 .   ? 9.374   27.592  33.553 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10641  C C27  W MXT B 2 .   ? -2.214  20.518  28.154 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10642  C C27  X MXT B 2 .   ? 9.067   21.079  34.691 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10643  C C27  Y MXT B 2 .   ? 7.413   20.072  29.157 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10644  C C27  Z MXT B 2 .   ? 6.139   18.012  32.170 0.010 0.00 ? 500 MXT A C27  3  
HETATM 10645  C C28  A MXT B 2 .   ? 3.703   29.633  40.329 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10646  C C28  B MXT B 2 .   ? -2.624  20.577  26.494 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10647  C C28  C MXT B 2 .   ? 10.719  21.917  32.608 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10648  C C28  D MXT B 2 .   ? 9.512   30.109  33.155 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10649  C C28  E MXT B 2 .   ? 9.071   21.497  28.572 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10650  C C28  F MXT B 2 .   ? 6.086   17.964  30.072 0.16  0.00 ? 500 MXT A C28  3  
HETATM 10651  C C28  U MXT B 2 .   ? 4.185   30.352  39.951 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10652  C C28  V MXT B 2 .   ? 10.125  28.922  33.212 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10653  C C28  W MXT B 2 .   ? -2.452  20.448  26.609 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10654  C C28  X MXT B 2 .   ? 10.199  20.469  33.799 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10655  C C28  Y MXT B 2 .   ? 8.902   19.980  29.633 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10656  C C28  Z MXT B 2 .   ? 5.581   16.611  31.748 0.010 0.00 ? 500 MXT A C28  3  
HETATM 10657  C C29  A MXT B 2 .   ? 4.284   27.434  39.203 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10658  C C29  B MXT B 2 .   ? -1.727  19.115  28.362 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10659  C C29  C MXT B 2 .   ? 10.054  23.335  34.604 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10660  C C29  D MXT B 2 .   ? 8.979   28.343  34.896 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10661  C C29  E MXT B 2 .   ? 7.137   19.932  28.073 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10662  C C29  F MXT B 2 .   ? 7.605   19.986  29.853 0.16  0.00 ? 500 MXT A C29  3  
HETATM 10663  C C29  U MXT B 2 .   ? 4.513   27.939  39.240 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10664  C C29  V MXT B 2 .   ? 9.210   27.499  35.102 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10665  C C29  W MXT B 2 .   ? -1.869  19.086  28.668 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10666  C C29  X MXT B 2 .   ? 9.706   22.130  35.652 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10667  C C29  Y MXT B 2 .   ? 6.802   18.636  29.158 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10668  C C29  Z MXT B 2 .   ? 7.370   18.348  31.272 0.010 0.00 ? 500 MXT A C29  3  
HETATM 10669  C C11  A MXT B 2 .   ? 0.647   27.610  34.069 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10670  C C11  B MXT B 2 .   ? 1.951   24.110  31.042 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10671  C C11  C MXT B 2 .   ? 3.777   24.509  32.659 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10672  C C11  D MXT B 2 .   ? 3.454   26.238  32.949 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10673  C C11  E MXT B 2 .   ? 2.747   23.642  31.634 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10674  C C11  F MXT B 2 .   ? 3.673   24.534  32.458 0.16  0.00 ? 500 MXT A C11  3  
HETATM 10675  C C11  U MXT B 2 .   ? 0.962   27.643  34.023 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10676  C C11  V MXT B 2 .   ? 3.648   25.586  32.658 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10677  C C11  W MXT B 2 .   ? 2.133   23.931  31.155 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10678  C C11  X MXT B 2 .   ? 3.952   24.421  33.314 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10679  C C11  Y MXT B 2 .   ? 2.709   23.320  31.799 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10680  C C11  Z MXT B 2 .   ? 3.188   23.578  32.124 0.010 0.00 ? 500 MXT A C11  3  
HETATM 10681  C C12  A MXT B 2 .   ? -0.207  28.808  34.541 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10682  C C12  B MXT B 2 .   ? 2.512   22.821  30.403 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10683  C C12  C MXT B 2 .   ? 4.891   25.324  31.970 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10684  C C12  D MXT B 2 .   ? 3.249   27.091  31.678 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10685  C C12  E MXT B 2 .   ? 3.147   22.180  31.926 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10686  C C12  F MXT B 2 .   ? 2.842   23.832  31.361 0.16  0.00 ? 500 MXT A C12  3  
HETATM 10687  C C12  U MXT B 2 .   ? 0.208   28.951  34.351 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10688  C C12  V MXT B 2 .   ? 3.653   26.822  31.732 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10689  C C12  W MXT B 2 .   ? 2.549   22.482  30.826 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10690  C C12  X MXT B 2 .   ? 5.132   24.767  32.380 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10691  C C12  Y MXT B 2 .   ? 2.976   21.924  32.402 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10692  C C12  Z MXT B 2 .   ? 3.714   23.086  30.757 0.010 0.00 ? 500 MXT A C12  3  
HETATM 10693  C C13  A MXT B 2 .   ? 1.982   27.758  34.820 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10694  C C13  B MXT B 2 .   ? 0.434   24.047  30.785 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10695  C C13  C MXT B 2 .   ? 4.491   23.266  33.222 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10696  C C13  D MXT B 2 .   ? 4.972   26.268  33.201 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10697  C C13  E MXT B 2 .   ? 3.640   24.063  30.451 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10698  C C13  F MXT B 2 .   ? 4.689   23.473  32.918 0.16  0.00 ? 500 MXT A C13  3  
HETATM 10699  C C13  U MXT B 2 .   ? 2.316   27.779  34.743 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10700  C C13  V MXT B 2 .   ? 5.135   25.299  32.937 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10701  C C13  W MXT B 2 .   ? 0.654   24.020  30.732 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10702  C C13  X MXT B 2 .   ? 4.411   23.166  34.079 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10703  C C13  Y MXT B 2 .   ? 3.703   23.438  30.628 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10704  C C13  Z MXT B 2 .   ? 3.613   22.485  33.122 0.010 0.00 ? 500 MXT A C13  3  
HETATM 10705  H H21  A MXT B 2 .   ? 3.028   30.550  36.400 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10706  H H21  B MXT B 2 .   ? -1.792  23.374  29.361 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10707  H H21  C MXT B 2 .   ? 6.661   21.396  32.634 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10708  H H21  D MXT B 2 .   ? 7.254   27.496  30.964 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10709  H H21  E MXT B 2 .   ? 5.882   24.036  28.925 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10710  H H21  F MXT B 2 .   ? 4.649   20.365  33.057 0.16  0.00 ? 500 MXT A H21  3  
HETATM 10711  H H21  U MXT B 2 .   ? 3.640   30.635  35.907 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10712  H H21  V MXT B 2 .   ? 7.735   26.315  31.156 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10713  H H21  W MXT B 2 .   ? -1.548  23.406  29.288 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10714  H H21  X MXT B 2 .   ? 6.125   20.739  33.556 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10715  H H21  Y MXT B 2 .   ? 6.097   22.948  29.396 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10716  H H21  Z MXT B 2 .   ? 4.106   19.847  33.773 0.010 0.00 ? 500 MXT A H21  3  
HETATM 10717  H H121 A MXT B 2 .   ? -1.158  28.505  35.025 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10718  H H121 B MXT B 2 .   ? 3.043   22.170  31.126 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10719  H H121 C MXT B 2 .   ? 5.006   26.346  32.385 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10720  H H121 D MXT B 2 .   ? 2.577   27.959  31.838 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10721  H H121 E MXT B 2 .   ? 2.300   21.469  31.840 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10722  H H121 F MXT B 2 .   ? 2.888   24.350  30.381 0.16  0.00 ? 500 MXT A H121 3  
HETATM 10723  H H121 U MXT B 2 .   ? -0.756  28.782  34.873 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10724  H H121 V MXT B 2 .   ? 3.102   27.685  32.153 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10725  H H121 W MXT B 2 .   ? 2.907   21.917  31.711 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10726  H H121 X MXT B 2 .   ? 5.544   25.783  32.553 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10727  H H121 Y MXT B 2 .   ? 2.084   21.265  32.393 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10728  H H121 Z MXT B 2 .   ? 4.419   23.797  30.280 0.010 0.00 ? 500 MXT A H121 3  
HETATM 10729  H H122 A MXT B 2 .   ? -0.484  29.462  33.687 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10730  H H122 B MXT B 2 .   ? 3.240   23.061  29.597 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10731  H H122 C MXT B 2 .   ? 4.679   25.449  30.886 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10732  H H122 D MXT B 2 .   ? 2.794   26.488  30.863 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10733  H H122 E MXT B 2 .   ? 3.541   22.075  32.961 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10734  H H122 F MXT B 2 .   ? 1.768   23.788  31.644 0.16  0.00 ? 500 MXT A H122 3  
HETATM 10735  H H122 U MXT B 2 .   ? -0.032  29.516  33.425 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10736  H H122 V MXT B 2 .   ? 3.178   26.588  30.754 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10737  H H122 W MXT B 2 .   ? 3.380   22.466  30.087 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10738  H H122 X MXT B 2 .   ? 4.820   24.732  31.314 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10739  H H122 Y MXT B 2 .   ? 3.296   22.005  33.464 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10740  H H122 Z MXT B 2 .   ? 2.877   22.942  30.039 0.010 0.00 ? 500 MXT A H122 3  
HETATM 10741  H H221 A MXT B 2 .   ? 4.508   27.852  36.058 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10742  H H221 B MXT B 2 .   ? -1.525  20.796  31.055 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10743  H H221 C MXT B 2 .   ? 7.031   22.737  35.400 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10744  H H221 D MXT B 2 .   ? 7.749   25.770  33.484 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10745  H H221 E MXT B 2 .   ? 4.474   21.610  27.616 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10746  H H221 F MXT B 2 .   ? 7.266   21.876  32.389 0.16  0.00 ? 500 MXT A H221 3  
HETATM 10747  H H221 U MXT B 2 .   ? 4.799   27.769  36.077 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10748  H H221 V MXT B 2 .   ? 7.773   24.918  33.919 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10749  H H221 W MXT B 2 .   ? -1.698  20.987  31.215 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10750  H H221 X MXT B 2 .   ? 6.582   22.181  36.256 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10751  H H221 Y MXT B 2 .   ? 4.448   20.583  28.271 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10752  H H221 Z MXT B 2 .   ? 6.964   20.870  33.168 0.010 0.00 ? 500 MXT A H221 3  
HETATM 10753  H H222 A MXT B 2 .   ? 4.566   29.243  34.970 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10754  H H222 B MXT B 2 .   ? -2.097  22.375  31.603 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10755  H H222 C MXT B 2 .   ? 5.828   21.523  34.957 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10756  H H222 D MXT B 2 .   ? 7.583   25.201  31.822 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10757  H H222 E MXT B 2 .   ? 4.079   23.317  27.392 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10758  H H222 F MXT B 2 .   ? 6.490   21.740  33.969 0.16  0.00 ? 500 MXT A H222 3  
HETATM 10759  H H222 U MXT B 2 .   ? 5.023   28.931  34.766 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10760  H H222 V MXT B 2 .   ? 7.677   24.142  32.336 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10761  H H222 W MXT B 2 .   ? -2.135  22.660  31.570 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10762  H H222 X MXT B 2 .   ? 5.193   21.192  35.801 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10763  H H222 Y MXT B 2 .   ? 4.321   22.283  27.809 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10764  H H222 Z MXT B 2 .   ? 5.982   21.235  34.590 0.010 0.00 ? 500 MXT A H222 3  
HETATM 10765  H H231 A MXT B 2 .   ? 2.204   30.066  38.391 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10766  H H231 B MXT B 2 .   ? -1.240  22.409  27.453 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10767  H H231 C MXT B 2 .   ? 8.434   22.343  31.721 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10768  H H231 D MXT B 2 .   ? 7.406   29.428  32.020 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10769  H H231 E MXT B 2 .   ? 7.456   22.839  29.908 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10770  H H231 F MXT B 2 .   ? 4.396   19.515  31.035 0.16  0.00 ? 500 MXT A H231 3  
HETATM 10771  H H231 U MXT B 2 .   ? 2.756   30.605  37.931 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10772  H H231 V MXT B 2 .   ? 8.052   28.347  31.962 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10773  H H231 W MXT B 2 .   ? -0.958  22.214  27.526 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10774  H H231 X MXT B 2 .   ? 8.101   21.260  32.722 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10775  H H231 Y MXT B 2 .   ? 7.408   21.690  30.650 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10776  H H231 Z MXT B 2 .   ? 4.002   18.516  32.014 0.010 0.00 ? 500 MXT A H231 3  
HETATM 10777  H H232 A MXT B 2 .   ? 2.081   28.322  38.182 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10778  H H232 B MXT B 2 .   ? -0.176  21.169  28.111 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10779  H H232 C MXT B 2 .   ? 8.420   23.834  32.660 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10780  H H232 D MXT B 2 .   ? 6.815   28.893  33.590 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10781  H H232 E MXT B 2 .   ? 6.524   21.362  30.139 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10782  H H232 F MXT B 2 .   ? 5.171   20.813  30.131 0.16  0.00 ? 500 MXT A H232 3  
HETATM 10783  H H232 U MXT B 2 .   ? 2.432   28.877  38.026 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10784  H H232 V MXT B 2 .   ? 7.260   28.113  33.518 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10785  H H232 W MXT B 2 .   ? -0.088  20.940  28.378 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10786  H H232 X MXT B 2 .   ? 8.325   22.789  33.567 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10787  H H232 Y MXT B 2 .   ? 6.259   20.396  30.975 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10788  H H232 Z MXT B 2 .   ? 5.051   19.446  30.947 0.010 0.00 ? 500 MXT A H232 3  
HETATM 10789  H H251 A MXT B 2 .   ? 6.816   31.451  36.885 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10790  H H251 B MXT B 2 .   ? -5.494  22.351  30.166 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10791  H H251 C MXT B 2 .   ? 7.945   18.503  34.953 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10792  H H251 D MXT B 2 .   ? 10.901  26.122  30.502 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10793  H H251 E MXT B 2 .   ? 6.815   24.304  25.122 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10794  H H251 F MXT B 2 .   ? 7.452   18.292  34.857 0.16  0.00 ? 500 MXT A H251 3  
HETATM 10795  H H251 U MXT B 2 .   ? 7.504   31.172  36.322 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10796  H H251 V MXT B 2 .   ? 11.191  24.459  31.260 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10797  H H251 W MXT B 2 .   ? -5.390  22.845  29.847 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10798  H H251 X MXT B 2 .   ? 6.671   17.830  36.134 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10799  H H251 Y MXT B 2 .   ? 7.322   22.585  25.684 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10800  H H251 Z MXT B 2 .   ? 6.358   18.074  36.452 0.010 0.00 ? 500 MXT A H251 3  
HETATM 10801  H H252 A MXT B 2 .   ? 6.020   31.105  35.329 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10802  H H252 B MXT B 2 .   ? -4.353  23.107  31.304 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10803  H H252 C MXT B 2 .   ? 6.297   19.180  34.949 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10804  H H252 D MXT B 2 .   ? 9.401   25.190  30.273 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10805  H H252 E MXT B 2 .   ? 5.236   24.716  25.839 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10806  H H252 F MXT B 2 .   ? 6.800   19.857  35.406 0.16  0.00 ? 500 MXT A H252 3  
HETATM 10807  H H252 U MXT B 2 .   ? 6.680   30.651  34.831 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10808  H H252 V MXT B 2 .   ? 9.605   23.692  30.998 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10809  H H252 W MXT B 2 .   ? -4.267  23.586  31.014 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10810  H H252 X MXT B 2 .   ? 5.193   18.810  35.967 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10811  H H252 Y MXT B 2 .   ? 5.773   23.297  26.205 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10812  H H252 Z MXT B 2 .   ? 5.855   19.783  36.482 0.010 0.00 ? 500 MXT A H252 3  
HETATM 10813  H H253 A MXT B 2 .   ? 5.064   31.735  36.705 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10814  H H253 B MXT B 2 .   ? -4.161  23.360  29.545 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10815  H H253 C MXT B 2 .   ? 7.307   19.270  33.475 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10816  H H253 D MXT B 2 .   ? 9.392   26.967  30.070 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10817  H H253 E MXT B 2 .   ? 6.720   24.793  26.833 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10818  H H253 F MXT B 2 .   ? 5.799   18.772  34.394 0.16  0.00 ? 500 MXT A H253 3  
HETATM 10819  H H253 U MXT B 2 .   ? 5.797   31.617  36.052 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10820  H H253 V MXT B 2 .   ? 9.851   25.410  30.566 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10821  H H253 W MXT B 2 .   ? -3.911  23.649  29.262 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10822  H H253 X MXT B 2 .   ? 6.288   18.595  34.569 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10823  H H253 Y MXT B 2 .   ? 7.179   23.304  27.309 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10824  H H253 Z MXT B 2 .   ? 4.856   18.567  35.629 0.010 0.00 ? 500 MXT A H253 3  
HETATM 10825  H H261 A MXT B 2 .   ? 7.107   28.643  35.540 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10826  H H261 B MXT B 2 .   ? -3.991  20.620  32.294 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10827  H H261 C MXT B 2 .   ? 7.072   20.577  37.125 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10828  H H261 D MXT B 2 .   ? 9.879   24.176  32.729 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10829  H H261 E MXT B 2 .   ? 4.415   22.305  24.941 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10830  H H261 F MXT B 2 .   ? 9.018   20.947  34.317 0.16  0.00 ? 500 MXT A H261 3  
HETATM 10831  H H261 U MXT B 2 .   ? 7.474   28.157  35.494 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10832  H H261 V MXT B 2 .   ? 9.728   22.989  33.603 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10833  H H261 W MXT B 2 .   ? -4.258  21.181  32.241 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10834  H H261 X MXT B 2 .   ? 6.092   20.188  38.108 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10835  H H261 Y MXT B 2 .   ? 4.677   20.921  25.536 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10836  H H261 Z MXT B 2 .   ? 8.318   20.328  35.518 0.010 0.00 ? 500 MXT A H261 3  
HETATM 10837  H H262 A MXT B 2 .   ? 7.792   29.142  37.106 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10838  H H262 B MXT B 2 .   ? -5.124  20.026  31.053 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10839  H H262 C MXT B 2 .   ? 8.685   19.839  36.953 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10840  H H262 D MXT B 2 .   ? 11.325  25.216  32.812 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10841  H H262 E MXT B 2 .   ? 6.065   22.037  24.326 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10842  H H262 F MXT B 2 .   ? 9.498   19.311  33.800 0.16  0.00 ? 500 MXT A H262 3  
HETATM 10843  H H262 U MXT B 2 .   ? 8.205   28.843  36.966 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10844  H H262 V MXT B 2 .   ? 11.287  23.847  33.699 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10845  H H262 W MXT B 2 .   ? -5.348  20.589  30.961 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10846  H H262 X MXT B 2 .   ? 7.536   19.142  38.100 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10847  H H262 Y MXT B 2 .   ? 6.310   20.355  25.106 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10848  H H262 Z MXT B 2 .   ? 8.638   18.575  35.509 0.010 0.00 ? 500 MXT A H262 3  
HETATM 10849  H H263 A MXT B 2 .   ? 6.779   27.677  37.004 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10850  H H263 B MXT B 2 .   ? -3.493  19.314  31.183 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10851  H H263 C MXT B 2 .   ? 8.521   21.614  37.015 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10852  H H263 D MXT B 2 .   ? 10.092  25.301  34.100 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10853  H H263 E MXT B 2 .   ? 5.323   20.848  25.429 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10854  H H263 F MXT B 2 .   ? 9.384   20.626  32.600 0.16  0.00 ? 500 MXT A H263 3  
HETATM 10855  H H263 U MXT B 2 .   ? 7.029   27.507  37.096 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10856  H H263 V MXT B 2 .   ? 9.971   24.264  34.830 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10857  H H263 W MXT B 2 .   ? -3.820  19.731  31.296 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10858  H H263 X MXT B 2 .   ? 7.721   20.917  38.042 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10859  H H263 Y MXT B 2 .   ? 5.328   19.432  26.275 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10860  H H263 Z MXT B 2 .   ? 8.853   19.527  34.016 0.010 0.00 ? 500 MXT A H263 3  
HETATM 10861  H H281 A MXT B 2 .   ? 3.624   30.732  40.245 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10862  H H281 B MXT B 2 .   ? -3.123  21.521  26.206 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10863  H H281 C MXT B 2 .   ? 10.482  21.058  31.950 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10864  H H281 D MXT B 2 .   ? 9.649   30.356  32.085 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10865  H H281 E MXT B 2 .   ? 9.458   22.535  28.567 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10866  H H281 F MXT B 2 .   ? 5.442   17.347  30.727 0.16  0.00 ? 500 MXT A H281 3  
HETATM 10867  H H281 U MXT B 2 .   ? 4.234   31.421  39.675 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10868  H H281 V MXT B 2 .   ? 10.385  28.994  32.139 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10869  H H281 W MXT B 2 .   ? -2.823  21.407  26.196 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10870  H H281 X MXT B 2 .   ? 9.839   19.627  33.179 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10871  H H281 Y MXT B 2 .   ? 9.434   20.946  29.537 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10872  H H281 Z MXT B 2 .   ? 4.782   16.255  32.427 0.010 0.00 ? 500 MXT A H281 3  
HETATM 10873  H H282 A MXT B 2 .   ? 2.733   29.260  40.721 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10874  H H282 B MXT B 2 .   ? -1.701  20.490  25.882 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10875  H H282 C MXT B 2 .   ? 10.904  22.795  31.953 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10876  H H282 D MXT B 2 .   ? 8.796   30.846  33.575 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10877  H H282 E MXT B 2 .   ? 9.238   21.085  29.589 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10878  H H282 F MXT B 2 .   ? 5.492   18.220  29.170 0.16  0.00 ? 500 MXT A H282 3  
HETATM 10879  H H282 U MXT B 2 .   ? 3.177   30.166  40.378 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10880  H H282 V MXT B 2 .   ? 9.480   29.793  33.456 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10881  H H282 W MXT B 2 .   ? -1.499  20.211  26.092 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10882  H H282 X MXT B 2 .   ? 10.593  21.244  33.109 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10883  H H282 Y MXT B 2 .   ? 8.937   19.686  30.703 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10884  H H282 Z MXT B 2 .   ? 5.146   16.673  30.729 0.010 0.00 ? 500 MXT A H282 3  
HETATM 10885  H H283 A MXT B 2 .   ? 4.465   29.406  41.104 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10886  H H283 B MXT B 2 .   ? -3.284  19.737  26.191 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10887  H H283 C MXT B 2 .   ? 11.677  21.695  33.119 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10888  H H283 D MXT B 2 .   ? 10.482  30.283  33.667 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10889  H H283 E MXT B 2 .   ? 9.698   20.899  27.878 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10890  H H283 F MXT B 2 .   ? 6.927   17.328  29.728 0.16  0.00 ? 500 MXT A H283 3  
HETATM 10891  H H283 U MXT B 2 .   ? 4.912   30.180  40.773 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10892  H H283 V MXT B 2 .   ? 11.061  29.049  33.797 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10893  H H283 W MXT B 2 .   ? -3.175  19.657  26.324 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10894  H H283 X MXT B 2 .   ? 11.064  20.104  34.392 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10895  H H283 Y MXT B 2 .   ? 9.483   19.216  29.074 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10896  H H283 Z MXT B 2 .   ? 6.367   15.830  31.711 0.010 0.00 ? 500 MXT A H283 3  
HETATM 10897  H H291 A MXT B 2 .   ? 5.167   27.271  39.853 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10898  H H291 B MXT B 2 .   ? -2.495  18.333  28.196 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10899  H H291 C MXT B 2 .   ? 10.916  22.988  35.207 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10900  H H291 D MXT B 2 .   ? 10.003  28.368  35.315 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10901  H H291 E MXT B 2 .   ? 7.683   19.432  27.249 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10902  H H291 F MXT B 2 .   ? 8.504   19.359  29.683 0.16  0.00 ? 500 MXT A H291 3  
HETATM 10903  H H291 U MXT B 2 .   ? 5.368   27.793  39.930 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10904  H H291 V MXT B 2 .   ? 10.188  27.459  35.621 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10905  H H291 W MXT B 2 .   ? -2.703  18.375  28.502 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10906  H H291 X MXT B 2 .   ? 10.444  21.669  36.337 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10907  H H291 Y MXT B 2 .   ? 7.326   17.964  28.452 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10908  H H291 Z MXT B 2 .   ? 8.192   17.617  31.407 0.010 0.00 ? 500 MXT A H291 3  
HETATM 10909  H H292 A MXT B 2 .   ? 4.456   26.865  38.268 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10910  H H292 B MXT B 2 .   ? -1.387  19.021  29.413 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10911  H H292 C MXT B 2 .   ? 9.269   23.664  35.311 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10912  H H292 D MXT B 2 .   ? 8.550   27.350  35.137 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10913  H H292 E MXT B 2 .   ? 6.055   19.795  27.881 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10914  H H292 F MXT B 2 .   ? 7.952   20.956  30.256 0.16  0.00 ? 500 MXT A H292 3  
HETATM 10915  H H292 U MXT B 2 .   ? 4.622   27.198  38.423 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10916  H H292 V MXT B 2 .   ? 8.631   26.610  35.425 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10917  H H292 W MXT B 2 .   ? -1.625  19.059  29.748 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10918  H H292 X MXT B 2 .   ? 8.958   22.654  36.280 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10919  H H292 Y MXT B 2 .   ? 5.728   18.622  28.890 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10920  H H292 Z MXT B 2 .   ? 7.788   19.353  31.468 0.010 0.00 ? 500 MXT A H292 3  
HETATM 10921  H H293 A MXT B 2 .   ? 3.415   26.964  39.710 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10922  H H293 B MXT B 2 .   ? -0.858  18.858  27.720 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10923  H H293 C MXT B 2 .   ? 10.386  24.238  34.050 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10924  H H293 D MXT B 2 .   ? 8.380   29.096  35.450 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10925  H H293 E MXT B 2 .   ? 7.373   19.375  29.005 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10926  H H293 F MXT B 2 .   ? 7.157   20.189  28.858 0.16  0.00 ? 500 MXT A H293 3  
HETATM 10927  H H293 U MXT B 2 .   ? 3.593   27.666  39.799 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10928  H H293 V MXT B 2 .   ? 8.673   28.390  35.489 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10929  H H293 W MXT B 2 .   ? -0.986  18.684  28.130 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10930  H H293 X MXT B 2 .   ? 10.242  22.910  35.071 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10931  H H293 Y MXT B 2 .   ? 6.889   18.181  30.167 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10932  H H293 Z MXT B 2 .   ? 7.083   18.320  30.200 0.010 0.00 ? 500 MXT A H293 3  
HETATM 10933  N N1   A MXT C 2 .   ? 19.947  17.870  30.900 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10934  N N1   B MXT C 2 .   ? 23.510  16.822  23.998 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10935  N N1   C MXT C 2 .   ? 25.608  18.713  25.713 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10936  N N1   D MXT C 2 .   ? 20.869  15.469  23.137 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10937  N N1   E MXT C 2 .   ? 22.707  19.110  28.717 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10938  N N1   F MXT C 2 .   ? 21.410  16.582  24.350 0.16  0.00 ? 600 MXT A N1   3  
HETATM 10939  N N1   U MXT C 2 .   ? 4.536   20.178  15.341 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10940  N N1   V MXT C 2 .   ? 10.033  26.040  14.248 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10941  N N1   W MXT C 2 .   ? 8.987   26.319  16.805 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10942  N N1   X MXT C 2 .   ? 6.504   26.652  18.836 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10943  N N1   Y MXT C 2 .   ? 4.676   23.460  17.104 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10944  N N1   Z MXT C 2 .   ? 8.953   25.262  14.987 0.010 0.00 ? 600 MXT A N1   3  
HETATM 10945  N N2   A MXT C 2 .   ? 16.996  17.971  34.076 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10946  N N2   B MXT C 2 .   ? 27.423  16.662  22.135 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10947  N N2   C MXT C 2 .   ? 25.397  22.972  26.502 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10948  N N2   D MXT C 2 .   ? 17.591  15.656  20.306 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10949  N N2   E MXT C 2 .   ? 19.257  21.078  26.980 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10950  N N2   F MXT C 2 .   ? 17.223  17.543  24.950 0.16  0.00 ? 600 MXT A N2   3  
HETATM 10951  N N2   U MXT C 2 .   ? 2.842   16.675  13.428 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10952  N N2   V MXT C 2 .   ? 11.330  27.158  10.264 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10953  N N2   W MXT C 2 .   ? 10.066  29.093  19.959 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10954  N N2   X MXT C 2 .   ? 2.325   27.806  18.796 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10955  N N2   Y MXT C 2 .   ? 3.395   24.696  13.151 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10956  N N2   Z MXT C 2 .   ? 7.454   24.148  11.073 0.010 0.00 ? 600 MXT A N2   3  
HETATM 10957  O O2   A MXT C 2 .   ? 16.004  18.101  34.782 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10958  O O2   B MXT C 2 .   ? 28.427  16.804  21.448 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10959  O O2   C MXT C 2 .   ? 25.188  24.179  26.503 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10960  O O2   D MXT C 2 .   ? 16.843  15.835  19.353 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10961  O O2   E MXT C 2 .   ? 18.413  21.858  26.555 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10962  O O2   F MXT C 2 .   ? 16.028  17.793  24.853 0.16  0.00 ? 600 MXT A O2   3  
HETATM 10963  O O2   U MXT C 2 .   ? 2.354   15.844  12.671 0.010 0.00 ? 600 MXT A O2   3  
HETATM 10964  O O2   V MXT C 2 .   ? 11.674  27.723  9.232  0.010 0.00 ? 600 MXT A O2   3  
HETATM 10965  O O2   W MXT C 2 .   ? 10.271  30.060  20.682 0.010 0.00 ? 600 MXT A O2   3  
HETATM 10966  O O2   X MXT C 2 .   ? 1.219   28.284  18.578 0.010 0.00 ? 600 MXT A O2   3  
HETATM 10967  O O2   Y MXT C 2 .   ? 2.814   25.130  12.164 0.010 0.00 ? 600 MXT A O2   3  
HETATM 10968  O O2   Z MXT C 2 .   ? 7.173   24.045  9.885  0.010 0.00 ? 600 MXT A O2   3  
HETATM 10969  O O11  A MXT C 2 .   ? 20.517  20.117  30.603 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10970  O O11  B MXT C 2 .   ? 22.775  19.018  23.686 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10971  O O11  C MXT C 2 .   ? 26.962  18.555  23.816 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10972  O O11  D MXT C 2 .   ? 22.795  16.218  22.044 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10973  O O11  E MXT C 2 .   ? 22.143  19.092  30.985 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10974  O O11  F MXT C 2 .   ? 22.279  18.405  23.172 0.16  0.00 ? 600 MXT A O11  3  
HETATM 10975  O O11  U MXT C 2 .   ? 2.708   21.614  15.580 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10976  O O11  V MXT C 2 .   ? 10.912  27.694  15.645 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10977  O O11  W MXT C 2 .   ? 6.990   27.178  15.951 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10978  O O11  X MXT C 2 .   ? 7.319   28.179  20.406 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10979  O O11  Y MXT C 2 .   ? 3.727   21.328  17.238 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10980  O O11  Z MXT C 2 .   ? 7.614   27.091  15.559 0.010 0.00 ? 600 MXT A O11  3  
HETATM 10981  O O12  A MXT C 2 .   ? 19.970  15.539  30.784 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10982  O O12  B MXT C 2 .   ? 23.632  14.597  24.698 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10983  O O12  C MXT C 2 .   ? 24.379  18.156  27.618 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10984  O O12  D MXT C 2 .   ? 19.426  14.626  24.767 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10985  O O12  E MXT C 2 .   ? 23.767  18.650  26.690 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10986  O O12  F MXT C 2 .   ? 21.249  14.612  25.590 0.16  0.00 ? 600 MXT A O12  3  
HETATM 10987  O O12  U MXT C 2 .   ? 6.658   19.228  15.557 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10988  O O12  V MXT C 2 .   ? 8.967   24.105  13.492 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10989  O O12  W MXT C 2 .   ? 10.814  24.920  17.202 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10990  O O12  X MXT C 2 .   ? 6.336   24.818  17.401 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10991  O O12  Y MXT C 2 .   ? 5.988   25.338  17.549 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10992  O O12  Z MXT C 2 .   ? 10.455  23.480  15.122 0.010 0.00 ? 600 MXT A O12  3  
HETATM 10993  C C14  A MXT C 2 .   ? 20.745  18.939  30.375 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10994  C C14  B MXT C 2 .   ? 22.608  17.919  24.191 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10995  C C14  C MXT C 2 .   ? 26.395  18.005  24.747 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10996  C C14  D MXT C 2 .   ? 22.271  15.755  23.046 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10997  C C14  E MXT C 2 .   ? 22.863  18.697  30.082 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10998  C C14  F MXT C 2 .   ? 22.468  17.370  23.793 0.16  0.00 ? 600 MXT A C14  3  
HETATM 10999  C C14  U MXT C 2 .   ? 3.868   21.341  15.848 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11000  C C14  V MXT C 2 .   ? 10.331  26.627  15.521 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11001  C C14  W MXT C 2 .   ? 7.815   26.279  15.981 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11002  C C14  X MXT C 2 .   ? 7.488   27.168  19.743 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11003  C C14  Y MXT C 2 .   ? 4.499   22.161  17.686 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11004  C C14  Z MXT C 2 .   ? 8.427   26.242  15.890 0.010 0.00 ? 600 MXT A C14  3  
HETATM 11005  C C21  A MXT C 2 .   ? 18.788  18.097  31.803 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11006  C C21  B MXT C 2 .   ? 24.713  16.910  23.130 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11007  C C21  C MXT C 2 .   ? 25.445  20.191  25.694 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11008  C C21  D MXT C 2 .   ? 19.916  15.748  22.032 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11009  C C21  E MXT C 2 .   ? 21.628  20.027  28.271 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11010  C C21  F MXT C 2 .   ? 19.979  16.974  24.257 0.16  0.00 ? 600 MXT A C21  3  
HETATM 11011  C C21  U MXT C 2 .   ? 3.865   19.176  14.473 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11012  C C21  V MXT C 2 .   ? 10.371  26.697  12.958 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11013  C C21  W MXT C 2 .   ? 9.327   27.480  17.668 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11014  C C21  X MXT C 2 .   ? 5.171   27.279  18.650 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11015  C C21  Y MXT C 2 .   ? 3.962   23.897  15.878 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11016  C C21  Z MXT C 2 .   ? 8.525   25.162  13.568 0.010 0.00 ? 600 MXT A C21  3  
HETATM 11017  C C22  A MXT C 2 .   ? 19.201  18.779  33.130 0.16  0.00 ? 600 MXT A C22  3  
HETATM 11018  C C22  B MXT C 2 .   ? 25.236  15.517  22.705 0.16  0.00 ? 600 MXT A C22  3  
HE