data_2V9W
# 
_entry.id   2V9W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2V9W         
PDBE  EBI-33605    
WWPDB D_1290033605 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2ASL unspecified 'OXOG-MODIFIED POSTINSERTION BINARY COMPLEX' 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 2JEG unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 2J6T unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 2ATL unspecified 'UNMODIFIED INSERTION TERNARY COMPLEX' 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2VA2 unspecified 
;COMPLEX STRUCTURE OF SULFOLOBUS SOLFATARICUS DPO4 AND DNA DUPLEX CONTAINING A HYDROPHOBIC THYMINE ISOSTERE 2,4-DIFLUOROTOLUENE NUCLEOTIDE IN THE TEMPLATE STRAND
;
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2JEJ unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2ASJ unspecified 'OXOG-MODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2ASD unspecified 'OXOG-MODIFIED INSERTION TERNARY COMPLEX' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2UVU unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2J6U unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DGTP.' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2C2R unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2JEF unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOTIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2UVW unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2JEI unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2AU0 unspecified 'UNMODIFIED PREINSERTION BINARY COMPLEX' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 2UVV unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2J6S unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2UVR unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2VA3 unspecified 
;COMPLEX STRUCTURE OF SULFOLOBUS SOLFATARICUS DPO4 AND DNA DUPLEX CONTAINING A HYDROPHOBIC THYMINE ISOSTERE 2,4-DIFLUOROTOLUENE NUCLEOTIDE IN THE TEMPLATE STRAND
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2V9W 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Irimia, A.'   1 
'Pallan, P.S.' 2 
'Egli, M.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Structure and Activity of Y-Class DNA Polymerase Dpo4 from Sulfolobus Solfataricus with Templates Containing the Hydrophobic Thymine Analog 2,4-Difluorotoluene.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                36421 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17951245 
_citation.pdbx_database_id_DOI      10.1074/JBC.M707267200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Irimia, A.'       1 
primary 'Eoff, R.L.'       2 
primary 'Pallan, P.S.'     3 
primary 'Guengerich, F.P.' 4 
primary 'Egli, M.'         5 
# 
_cell.entry_id           2V9W 
_cell.length_a           52.704 
_cell.length_b           186.744 
_cell.length_c           52.730 
_cell.angle_alpha        90.00 
_cell.angle_beta         110.06 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2V9W 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                 41086.754 2   2.7.7.7 ? ? DPO4              
2 polymer     syn 
;5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP *CP*TP*G)-3'
;
4121.684  2   ?       ? ? '13-MER PRIMER'   
3 polymer     syn 
;5'-D(*TP*TP*CP*AP*GP*DFTP*AP*GP*TP*CP*CP *TP*TP*CP*CP*CP*CP*C)-3'
;
5380.484  2   ?       ? ? '18-MER TEMPLATE' 
4 non-polymer syn 'CALCIUM ION'                                                       40.078    4   ?       ? ? ?                 
5 non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   2   ?       ? ? ?                 
6 water       nat water                                                               18.015    157 ?       ? ? ?                 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'POL IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A,B ? 
2 polydeoxyribonucleotide no no  '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DC)(DT)(DG)' GGGGGAAGGACTG C,E ? 
3 polydeoxyribonucleotide no yes '(DT)(DT)(DC)(DA)(DG)(DFT)(DA)(DG)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TTCAGNAGTCCTTCCCCC 
D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 ARG n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
3 1   DT  n 
3 2   DT  n 
3 3   DC  n 
3 4   DA  n 
3 5   DG  n 
3 6   DFT n 
3 7   DA  n 
3 8   DG  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B-DPO4-NHIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2V9W        1 ? ? 2V9W   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2V9W        2 ? ? 2V9W   ? 
4 PDB 2V9W        3 ? ? 2V9W   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2V9W A 1 ? 6   ? 2V9W   -5 ? 0   ? -5 0   
2 2 2V9W A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 1 2V9W B 1 ? 6   ? 2V9W   -5 ? 0   ? -5 0   
4 2 2V9W B 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
5 3 2V9W C 1 ? 13  ? 2V9W   1  ? 13  ? 1  13  
6 4 2V9W D 1 ? 18  ? 2V9W   1  ? 18  ? 1  18  
7 3 2V9W E 1 ? 13  ? 2V9W   1  ? 13  ? 1  13  
8 4 2V9W F 1 ? 18  ? 2V9W   1  ? 18  ? 1  18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                          ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                                                            ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                 ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                      ? 'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'       n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
? 'C9 H16 N3 O12 P3' 451.158 
DFT 'DNA linking'       . "1-[2-DEOXYRIBOFURANOSYL]-2,4-DIFLUORO-5-METHYL-BENZENE-5'MONOPHOSPHATE" ? 'C12 H15 F2 O6 P'  324.214 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                             ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                               ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2V9W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   52.05 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'30 MM NACL, 2%GLYCEROL, 10 MM TRIS PH 7.5, 2.5 MM CACL2, 0.5 MM DDCTP, 6% PEG 3350, 0.05 CALCIUM ACETATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-06-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2V9W 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             49.51 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   16865 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.5 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.2 
_reflns.B_iso_Wilson_estimate        75.3 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.19 
_reflns_shell.percent_possible_all   81.0 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        2.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2V9W 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16763 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1112496.09 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.51 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    87.5 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.290 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  813 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               58.2 
_refine.aniso_B[1][1]                            -8.17 
_refine.aniso_B[2][2]                            14.99 
_refine.aniso_B[3][3]                            -6.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            6.91 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.297845 
_refine.solvent_model_param_bsol                 34.2083 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2BQ3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2V9W 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.55 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.52 
_refine_analyze.Luzzati_sigma_a_free            0.80 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5511 
_refine_hist.pdbx_number_atoms_nucleic_acid   1224 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             157 
_refine_hist.number_atoms_total               6950 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        49.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.07  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.34  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.37  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.55  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             2464 
_refine_ls_shell.R_factor_R_work                  0.358 
_refine_ls_shell.percent_reflns_obs               80.9 
_refine_ls_shell.R_factor_R_free                  0.465 
_refine_ls_shell.R_factor_R_free_error            0.045 
_refine_ls_shell.percent_reflns_R_free            4.2 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP     
'X-RAY DIFFRACTION' 2 DNA_RNA_NEW.PARAM DNA_RNA_NEW.TOP 
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER.TOP       
'X-RAY DIFFRACTION' 4 DDCTP.PARAM       DDCTP.TOP       
'X-RAY DIFFRACTION' 5 ION.PARAM         ION.TOP         
# 
_struct.entry_id                  2V9W 
_struct.title                     
;Complex structure of Sulfolobus solfataricus DPO4 and DNA duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand
;
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2V9W 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;DNA-DIRECTED DNA POLYMERASE, P2 DNA POLYMERASE IV, NUCLEOTIDYLTRANSFERASE, MUTATOR PROTEIN, DNA REPLICATION, 4-DIFLUOROTOLUENE, DNA REPAIR, DNA-BINDING, TRANSFERASE, METAL-BINDING, TRANSLESION DNA POLYMERASE, DDCTP, CYTOPLASM, MAGNESIUM, DNA DAMAGE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P3  3  PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P4  4  ARG A 83  ? SER A 102 ? ARG A 77  SER A 96  1 ? 20 
HELX_P HELX_P5  5  SER A 118 ? VAL A 121 ? SER A 112 VAL A 115 5 ? 4  
HELX_P HELX_P6  6  ASP A 123 ? GLU A 140 ? ASP A 117 GLU A 134 1 ? 18 
HELX_P HELX_P7  7  ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP A 173 ? LEU A 184 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  GLY A 193 ? LYS A 201 ? GLY A 187 LYS A 195 1 ? 9  
HELX_P HELX_P10 10 LYS A 202 ? GLY A 204 ? LYS A 196 GLY A 198 5 ? 3  
HELX_P HELX_P11 11 VAL A 209 ? ILE A 214 ? VAL A 203 ILE A 208 5 ? 6  
HELX_P HELX_P12 12 GLU A 215 ? GLY A 224 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 13 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN A 263 ? GLU A 266 ? ASN A 257 GLU A 260 5 ? 4  
HELX_P HELX_P15 15 ILE A 267 ? LEU A 282 ? ILE A 261 LEU A 276 1 ? 16 
HELX_P HELX_P16 16 SER A 313 ? GLU A 330 ? SER A 307 GLU A 324 1 ? 18 
HELX_P HELX_P17 17 TYR B 16  ? ASN B 26  ? TYR B 10  ASN B 20  1 ? 11 
HELX_P HELX_P18 18 PRO B 27  ? LYS B 30  ? PRO B 21  LYS B 24  5 ? 4  
HELX_P HELX_P19 19 ASN B 53  ? LYS B 58  ? ASN B 47  LYS B 52  1 ? 6  
HELX_P HELX_P20 20 PRO B 66  ? LEU B 74  ? PRO B 60  LEU B 68  1 ? 9  
HELX_P HELX_P21 21 ARG B 83  ? ARG B 99  ? ARG B 77  ARG B 93  1 ? 17 
HELX_P HELX_P22 22 SER B 118 ? VAL B 121 ? SER B 112 VAL B 115 5 ? 4  
HELX_P HELX_P23 23 ASP B 123 ? GLU B 140 ? ASP B 117 GLU B 134 1 ? 18 
HELX_P HELX_P24 24 ASN B 153 ? LYS B 165 ? ASN B 147 LYS B 159 1 ? 13 
HELX_P HELX_P25 25 ASP B 173 ? LEU B 184 ? ASP B 167 LEU B 178 1 ? 12 
HELX_P HELX_P26 26 GLY B 193 ? LYS B 202 ? GLY B 187 LYS B 196 1 ? 10 
HELX_P HELX_P27 27 LEU B 208 ? ILE B 214 ? LEU B 202 ILE B 208 5 ? 7  
HELX_P HELX_P28 28 GLU B 215 ? GLY B 224 ? GLU B 209 GLY B 218 1 ? 10 
HELX_P HELX_P29 29 GLY B 224 ? ARG B 236 ? GLY B 218 ARG B 230 1 ? 13 
HELX_P HELX_P30 30 ASN B 263 ? LEU B 282 ? ASN B 257 LEU B 276 1 ? 20 
HELX_P HELX_P31 31 SER B 313 ? ASP B 332 ? SER B 307 ASP B 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G CA  .  CA    ? ? ? 1_555 A ASP 13  OD1 ? ? A CA  1345 A ASP 7    1_555 ? ? ? ? ? ? ?            2.718 ? 
metalc2  metalc ? ? G CA  .  CA    ? ? ? 1_555 A ASP 13  OD2 ? ? A CA  1345 A ASP 7    1_555 ? ? ? ? ? ? ?            2.919 ? 
metalc3  metalc ? ? G CA  .  CA    ? ? ? 1_555 I DCT .   O1A ? ? A CA  1345 A DCT 1347 1_555 ? ? ? ? ? ? ?            2.779 ? 
metalc4  metalc ? ? G CA  .  CA    ? ? ? 1_555 I DCT .   O1G ? ? A CA  1345 A DCT 1347 1_555 ? ? ? ? ? ? ?            3.110 ? 
metalc5  metalc ? ? G CA  .  CA    ? ? ? 1_555 A PHE 14  O   ? ? A CA  1345 A PHE 8    1_555 ? ? ? ? ? ? ?            2.523 ? 
metalc6  metalc ? ? G CA  .  CA    ? ? ? 1_555 A ASP 111 OD2 ? ? A CA  1345 A ASP 105  1_555 ? ? ? ? ? ? ?            2.499 ? 
metalc7  metalc ? ? G CA  .  CA    ? ? ? 1_555 I DCT .   O3B ? ? A CA  1345 A DCT 1347 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc8  metalc ? ? H CA  .  CA    ? ? ? 1_555 A ASP 13  OD2 ? ? A CA  1346 A ASP 7    1_555 ? ? ? ? ? ? ?            2.836 ? 
metalc9  metalc ? ? H CA  .  CA    ? ? ? 1_555 I DCT .   O1A ? ? A CA  1346 A DCT 1347 1_555 ? ? ? ? ? ? ?            2.587 ? 
metalc10 metalc ? ? H CA  .  CA    ? ? ? 1_555 M HOH .   O   ? ? A CA  1346 A HOH 2059 1_555 ? ? ? ? ? ? ?            3.105 ? 
metalc11 metalc ? ? H CA  .  CA    ? ? ? 1_555 A GLU 112 OE1 ? ? A CA  1346 A GLU 106  1_555 ? ? ? ? ? ? ?            2.612 ? 
metalc12 metalc ? ? J CA  .  CA    ? ? ? 1_555 L DCT .   O3B ? ? B CA  1344 B DCT 1346 1_555 ? ? ? ? ? ? ?            2.485 ? 
metalc13 metalc ? ? J CA  .  CA    ? ? ? 1_555 L DCT .   O2B ? ? B CA  1344 B DCT 1346 1_555 ? ? ? ? ? ? ?            2.831 ? 
metalc14 metalc ? ? J CA  .  CA    ? ? ? 1_555 L DCT .   O1A ? ? B CA  1344 B DCT 1346 1_555 ? ? ? ? ? ? ?            2.964 ? 
metalc15 metalc ? ? J CA  .  CA    ? ? ? 1_555 B ASP 111 OD2 ? ? B CA  1344 B ASP 105  1_555 ? ? ? ? ? ? ?            2.603 ? 
metalc16 metalc ? ? J CA  .  CA    ? ? ? 1_555 L DCT .   O1G ? ? B CA  1344 B DCT 1346 1_555 ? ? ? ? ? ? ?            2.714 ? 
metalc17 metalc ? ? J CA  .  CA    ? ? ? 1_555 B ASP 13  OD2 ? ? B CA  1344 B ASP 7    1_555 ? ? ? ? ? ? ?            2.997 ? 
metalc18 metalc ? ? J CA  .  CA    ? ? ? 1_555 B PHE 14  O   ? ? B CA  1344 B PHE 8    1_555 ? ? ? ? ? ? ?            2.504 ? 
metalc19 metalc ? ? K CA  .  CA    ? ? ? 1_555 L DCT .   O1A ? ? B CA  1345 B DCT 1346 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc20 metalc ? ? K CA  .  CA    ? ? ? 1_555 B GLU 112 OE1 ? ? B CA  1345 B GLU 106  1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc21 metalc ? ? K CA  .  CA    ? ? ? 1_555 N HOH .   O   ? ? B CA  1345 B HOH 2011 1_555 ? ? ? ? ? ? ?            3.049 ? 
metalc22 metalc ? ? K CA  .  CA    ? ? ? 1_555 B GLU 112 OE2 ? ? B CA  1345 B GLU 106  1_555 ? ? ? ? ? ? ?            2.702 ? 
covale1  covale ? ? D DG  5  "O3'" ? ? ? 1_555 D DFT 6   P   ? ? D DG  5    D DFT 6    1_555 ? ? ? ? ? ? ?            1.604 ? 
covale2  covale ? ? D DFT 6  "O3'" ? ? ? 1_555 D DA  7   P   ? ? D DFT 6    D DA  7    1_555 ? ? ? ? ? ? ?            1.614 ? 
covale3  covale ? ? F DG  5  "O3'" ? ? ? 1_555 F DFT 6   P   ? ? F DG  5    F DFT 6    1_555 ? ? ? ? ? ? ?            1.525 ? 
covale4  covale ? ? F DFT 6  "O3'" ? ? ? 1_555 F DA  7   P   ? ? F DFT 6    F DA  7    1_555 ? ? ? ? ? ? ?            1.604 ? 
hydrog1  hydrog ? ? C DG  1  N1    ? ? ? 1_555 D DC  18  N3  ? ? C DG  1    D DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  1  N2    ? ? ? 1_555 D DC  18  O2  ? ? C DG  1    D DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  1  O6    ? ? ? 1_555 D DC  18  N4  ? ? C DG  1    D DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DG  2  N1    ? ? ? 1_555 D DC  17  N3  ? ? C DG  2    D DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DG  2  N2    ? ? ? 1_555 D DC  17  O2  ? ? C DG  2    D DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  2  O6    ? ? ? 1_555 D DC  17  N4  ? ? C DG  2    D DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  3  N1    ? ? ? 1_555 D DC  16  N3  ? ? C DG  3    D DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  3  N2    ? ? ? 1_555 D DC  16  O2  ? ? C DG  3    D DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG  3  O6    ? ? ? 1_555 D DC  16  N4  ? ? C DG  3    D DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG  4  N1    ? ? ? 1_555 D DC  15  N3  ? ? C DG  4    D DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DG  4  N2    ? ? ? 1_555 D DC  15  O2  ? ? C DG  4    D DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DG  4  O6    ? ? ? 1_555 D DC  15  N4  ? ? C DG  4    D DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  5  N1    ? ? ? 1_555 D DC  14  N3  ? ? C DG  5    D DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  5  N2    ? ? ? 1_555 D DC  14  O2  ? ? C DG  5    D DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  5  O6    ? ? ? 1_555 D DC  14  N4  ? ? C DG  5    D DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DA  6  N1    ? ? ? 1_555 D DT  13  N3  ? ? C DA  6    D DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DA  6  N6    ? ? ? 1_555 D DT  13  O4  ? ? C DA  6    D DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DA  7  N1    ? ? ? 1_555 D DT  12  N3  ? ? C DA  7    D DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  7  N6    ? ? ? 1_555 D DT  12  O4  ? ? C DA  7    D DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  8  N1    ? ? ? 1_555 D DC  11  N3  ? ? C DG  8    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DG  8  N2    ? ? ? 1_555 D DC  11  O2  ? ? C DG  8    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DG  8  O6    ? ? ? 1_555 D DC  11  N4  ? ? C DG  8    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DG  9  N1    ? ? ? 1_555 D DC  10  N3  ? ? C DG  9    D DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG  9  N2    ? ? ? 1_555 D DC  10  O2  ? ? C DG  9    D DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DG  9  O6    ? ? ? 1_555 D DC  10  N4  ? ? C DG  9    D DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DG  9  N1    ? ? ? 1_555 D DC  11  N3  ? ? C DG  9    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DG  9  N2    ? ? ? 1_555 D DC  11  O2  ? ? C DG  9    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DG  9  O6    ? ? ? 1_555 D DC  11  N4  ? ? C DG  9    D DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DA  10 N1    ? ? ? 1_555 D DT  9   N3  ? ? C DA  10   D DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DA  10 N6    ? ? ? 1_555 D DT  9   O4  ? ? C DA  10   D DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  11 N3    ? ? ? 1_555 D DG  8   N1  ? ? C DC  11   D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DC  11 N4    ? ? ? 1_555 D DG  8   O6  ? ? C DC  11   D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DC  11 O2    ? ? ? 1_555 D DG  8   N2  ? ? C DC  11   D DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DT  12 N3    ? ? ? 1_555 D DA  7   N1  ? ? C DT  12   D DA  7    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog35 hydrog ? ? E DG  1  N1    ? ? ? 1_555 F DC  18  N3  ? ? E DG  1    F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  1  N2    ? ? ? 1_555 F DC  18  O2  ? ? E DG  1    F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  1  O6    ? ? ? 1_555 F DC  18  N4  ? ? E DG  1    F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  2  N1    ? ? ? 1_555 F DC  17  N3  ? ? E DG  2    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  2  N2    ? ? ? 1_555 F DC  17  O2  ? ? E DG  2    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  2  O6    ? ? ? 1_555 F DC  17  N4  ? ? E DG  2    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  3  N1    ? ? ? 1_555 F DC  16  N3  ? ? E DG  3    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DG  3  N2    ? ? ? 1_555 F DC  16  O2  ? ? E DG  3    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DG  3  O6    ? ? ? 1_555 F DC  16  N4  ? ? E DG  3    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DG  4  N1    ? ? ? 1_555 F DC  15  N3  ? ? E DG  4    F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DG  4  N2    ? ? ? 1_555 F DC  15  O2  ? ? E DG  4    F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DG  4  O6    ? ? ? 1_555 F DC  15  N4  ? ? E DG  4    F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  5  N1    ? ? ? 1_555 F DC  14  N3  ? ? E DG  5    F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  5  N2    ? ? ? 1_555 F DC  14  O2  ? ? E DG  5    F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  5  O6    ? ? ? 1_555 F DC  14  N4  ? ? E DG  5    F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DA  6  N1    ? ? ? 1_555 F DT  13  N3  ? ? E DA  6    F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DA  6  N6    ? ? ? 1_555 F DT  13  O4  ? ? E DA  6    F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DA  7  N1    ? ? ? 1_555 F DT  12  N3  ? ? E DA  7    F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DA  7  N6    ? ? ? 1_555 F DT  12  O4  ? ? E DA  7    F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DG  8  N1    ? ? ? 1_555 F DC  11  N3  ? ? E DG  8    F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DG  8  N2    ? ? ? 1_555 F DC  11  O2  ? ? E DG  8    F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DG  8  O6    ? ? ? 1_555 F DC  11  N4  ? ? E DG  8    F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DG  9  N2    ? ? ? 1_555 F DC  10  O2  ? ? E DG  9    F DC  10   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog58 hydrog ? ? E DG  9  N2    ? ? ? 1_555 F DC  11  O2  ? ? E DG  9    F DC  11   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog59 hydrog ? ? E DA  10 N1    ? ? ? 1_555 F DT  9   N3  ? ? E DA  10   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DA  10 N6    ? ? ? 1_555 F DT  9   O4  ? ? E DA  10   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DC  11 N3    ? ? ? 1_555 F DG  8   N1  ? ? E DC  11   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DC  11 N4    ? ? ? 1_555 F DG  8   O6  ? ? E DC  11   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DC  11 O2    ? ? ? 1_555 F DG  8   N2  ? ? E DC  11   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DT  12 N3    ? ? ? 1_555 F DA  7   N1  ? ? E DT  12   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? E DT  12 O4    ? ? ? 1_555 F DA  7   N6  ? ? E DT  12   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 165 A . ? LYS 159 A PRO 166 A ? PRO 160 A 1 0.03 
2 LYS 165 B . ? LYS 159 B PRO 166 B ? PRO 160 B 1 0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 4 ? 
BA ? 5 ? 
BB ? 3 ? 
BC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 105 ? GLU A 106 ? ILE A 99  GLU A 100 
AA 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA 5 ILE A 169 ? VAL A 171 ? ILE A 163 VAL A 165 
AB 1 GLY A 47  ? VAL A 49  ? GLY A 41  VAL A 43  
AB 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AB 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AC 1 GLY A 252 ? ILE A 254 ? GLY A 246 ILE A 248 
AC 2 ARG A 338 ? PHE A 346 ? ARG A 332 PHE A 340 
AC 3 PRO A 287 ? VAL A 295 ? PRO A 281 VAL A 289 
AC 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
BA 1 ILE B 105 ? SER B 109 ? ILE B 99  SER B 103 
BA 2 GLU B 112 ? ASP B 116 ? GLU B 106 ASP B 110 
BA 3 VAL B 9   ? PHE B 14  ? VAL B 3   PHE B 8   
BA 4 VAL B 146 ? SER B 151 ? VAL B 140 SER B 145 
BA 5 ILE B 169 ? VAL B 171 ? ILE B 163 VAL B 165 
BB 1 GLY B 47  ? ALA B 52  ? GLY B 41  ALA B 46  
BB 2 VAL B 34  ? PHE B 39  ? VAL B 28  PHE B 33  
BB 3 VAL B 78  ? PRO B 81  ? VAL B 72  PRO B 75  
BC 1 ILE B 251 ? SER B 261 ? ILE B 245 SER B 255 
BC 2 ILE B 336 ? PHE B 343 ? ILE B 330 PHE B 337 
BC 3 ALA B 289 ? THR B 296 ? ALA B 283 THR B 290 
BC 4 ILE B 301 ? THR B 307 ? ILE B 295 THR B 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 106 ? N GLU A 100 O TYR A 114 ? O TYR A 108 
AA 2 3 N LEU A 115 ? N LEU A 109 O LEU A 10  ? O LEU A 4   
AA 3 4 N ASP A 13  ? N ASP A 7   O THR A 147 ? O THR A 141 
AA 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AB 1 2 N ALA A 48  ? N ALA A 42  O VAL A 38  ? O VAL A 32  
AB 2 3 N VAL A 35  ? N VAL A 29  O VAL A 78  ? O VAL A 72  
AC 1 2 N ARG A 253 ? N ARG A 247 O VAL A 341 ? O VAL A 335 
AC 2 3 O SER A 344 ? O SER A 338 N LYS A 288 ? N LYS A 282 
AC 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
BA 1 2 N ALA B 108 ? N ALA B 102 O GLU B 112 ? O GLU B 106 
BA 2 3 N LEU B 115 ? N LEU B 109 O LEU B 10  ? O LEU B 4   
BA 3 4 N ASP B 13  ? N ASP B 7   O THR B 147 ? O THR B 141 
BA 4 5 N ILE B 150 ? N ILE B 144 O LYS B 170 ? O LYS B 164 
BB 1 2 N ALA B 50  ? N ALA B 44  O VAL B 36  ? O VAL B 30  
BB 2 3 N VAL B 35  ? N VAL B 29  O VAL B 78  ? O VAL B 72  
BC 1 2 N SER B 261 ? N SER B 255 O ILE B 336 ? O ILE B 330 
BC 2 3 N ARG B 342 ? N ARG B 336 O HIS B 291 ? O HIS B 285 
BC 3 4 N ALA B 294 ? N ALA B 288 O VAL B 302 ? O VAL B 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A1345'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A1346'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B1344'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B1345'  
AC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE DCT A1347' 
AC6 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE DCT B1346' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 13  ? ASP A 7    . ? 1_555 ? 
2  AC1 4  PHE A 14  ? PHE A 8    . ? 1_555 ? 
3  AC1 4  ASP A 111 ? ASP A 105  . ? 1_555 ? 
4  AC1 4  DCT I .   ? DCT A 1347 . ? 1_555 ? 
5  AC2 5  ASP A 13  ? ASP A 7    . ? 1_555 ? 
6  AC2 5  ASP A 111 ? ASP A 105  . ? 1_555 ? 
7  AC2 5  GLU A 112 ? GLU A 106  . ? 1_555 ? 
8  AC2 5  DCT I .   ? DCT A 1347 . ? 1_555 ? 
9  AC2 5  DG  C 13  ? DG  C 13   . ? 1_555 ? 
10 AC3 4  ASP B 13  ? ASP B 7    . ? 1_555 ? 
11 AC3 4  PHE B 14  ? PHE B 8    . ? 1_555 ? 
12 AC3 4  ASP B 111 ? ASP B 105  . ? 1_555 ? 
13 AC3 4  DCT L .   ? DCT B 1346 . ? 1_555 ? 
14 AC4 6  ASP B 13  ? ASP B 7    . ? 1_555 ? 
15 AC4 6  ASP B 111 ? ASP B 105  . ? 1_555 ? 
16 AC4 6  GLU B 112 ? GLU B 106  . ? 1_555 ? 
17 AC4 6  DCT L .   ? DCT B 1346 . ? 1_555 ? 
18 AC4 6  HOH N .   ? HOH B 2011 . ? 1_555 ? 
19 AC4 6  DG  E 13  ? DG  E 13   . ? 1_555 ? 
20 AC5 14 ASP A 13  ? ASP A 7    . ? 1_555 ? 
21 AC5 14 PHE A 14  ? PHE A 8    . ? 1_555 ? 
22 AC5 14 ASP A 15  ? ASP A 9    . ? 1_555 ? 
23 AC5 14 TYR A 16  ? TYR A 10   . ? 1_555 ? 
24 AC5 14 THR A 51  ? THR A 45   . ? 1_555 ? 
25 AC5 14 TYR A 54  ? TYR A 48   . ? 1_555 ? 
26 AC5 14 ARG A 57  ? ARG A 51   . ? 1_555 ? 
27 AC5 14 ASP A 111 ? ASP A 105  . ? 1_555 ? 
28 AC5 14 LYS A 165 ? LYS A 159  . ? 1_555 ? 
29 AC5 14 CA  G .   ? CA  A 1345 . ? 1_555 ? 
30 AC5 14 CA  H .   ? CA  A 1346 . ? 1_555 ? 
31 AC5 14 HOH M .   ? HOH A 2059 . ? 1_555 ? 
32 AC5 14 DG  C 13  ? DG  C 13   . ? 1_555 ? 
33 AC5 14 DG  D 5   ? DG  D 5    . ? 1_555 ? 
34 AC6 16 ASP B 13  ? ASP B 7    . ? 1_555 ? 
35 AC6 16 PHE B 14  ? PHE B 8    . ? 1_555 ? 
36 AC6 16 TYR B 16  ? TYR B 10   . ? 1_555 ? 
37 AC6 16 TYR B 18  ? TYR B 12   . ? 1_555 ? 
38 AC6 16 ALA B 50  ? ALA B 44   . ? 1_555 ? 
39 AC6 16 THR B 51  ? THR B 45   . ? 1_555 ? 
40 AC6 16 TYR B 54  ? TYR B 48   . ? 1_555 ? 
41 AC6 16 ARG B 57  ? ARG B 51   . ? 1_555 ? 
42 AC6 16 ASP B 111 ? ASP B 105  . ? 1_555 ? 
43 AC6 16 LYS B 165 ? LYS B 159  . ? 1_555 ? 
44 AC6 16 CA  J .   ? CA  B 1344 . ? 1_555 ? 
45 AC6 16 CA  K .   ? CA  B 1345 . ? 1_555 ? 
46 AC6 16 HOH N .   ? HOH B 2005 . ? 1_555 ? 
47 AC6 16 HOH N .   ? HOH B 2048 . ? 1_555 ? 
48 AC6 16 DG  E 13  ? DG  E 13   . ? 1_555 ? 
49 AC6 16 DG  F 5   ? DG  F 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2V9W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2V9W 
_atom_sites.fract_transf_matrix[1][1]   0.018974 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006928 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005355 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020189 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 7   ? -18.632 28.960  -0.212  1.00 60.99  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 7   ? -17.851 30.064  0.425   1.00 60.73  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 7   ? -16.811 30.677  -0.509  1.00 58.81  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 7   ? -15.826 30.038  -0.872  1.00 57.86  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 7   ? -17.154 29.554  1.686   1.00 63.58  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 7   ? -16.502 30.642  2.521   1.00 66.28  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 7   ? -14.704 30.626  2.448   1.00 71.38  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 7   ? -14.300 29.857  4.030   1.00 70.14  ? 1    MET A CE    1 
ATOM   9    N  N     . ILE A 1 8   ? -17.046 31.923  -0.900  1.00 57.47  ? 2    ILE A N     1 
ATOM   10   C  CA    . ILE A 1 8   ? -16.137 32.625  -1.799  1.00 56.91  ? 2    ILE A CA    1 
ATOM   11   C  C     . ILE A 1 8   ? -15.642 33.928  -1.176  1.00 54.44  ? 2    ILE A C     1 
ATOM   12   O  O     . ILE A 1 8   ? -16.418 34.694  -0.613  1.00 53.30  ? 2    ILE A O     1 
ATOM   13   C  CB    . ILE A 1 8   ? -16.814 32.900  -3.186  1.00 58.22  ? 2    ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 8   ? -16.049 33.995  -3.927  1.00 58.24  ? 2    ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 8   ? -18.289 33.237  -3.007  1.00 57.22  ? 2    ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 8   ? -16.574 34.243  -5.304  1.00 59.36  ? 2    ILE A CD1   1 
ATOM   17   N  N     . VAL A 1 9   ? -14.339 34.165  -1.277  1.00 52.47  ? 3    VAL A N     1 
ATOM   18   C  CA    . VAL A 1 9   ? -13.724 35.355  -0.698  1.00 50.31  ? 3    VAL A CA    1 
ATOM   19   C  C     . VAL A 1 9   ? -13.383 36.426  -1.725  1.00 48.04  ? 3    VAL A C     1 
ATOM   20   O  O     . VAL A 1 9   ? -13.231 36.150  -2.915  1.00 46.98  ? 3    VAL A O     1 
ATOM   21   C  CB    . VAL A 1 9   ? -12.432 34.985  0.073   1.00 50.82  ? 3    VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 9   ? -11.759 36.238  0.607   1.00 50.81  ? 3    VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 9   ? -12.765 34.032  1.207   1.00 50.28  ? 3    VAL A CG2   1 
ATOM   24   N  N     . LEU A 1 10  ? -13.262 37.657  -1.242  1.00 45.86  ? 4    LEU A N     1 
ATOM   25   C  CA    . LEU A 1 10  ? -12.938 38.805  -2.086  1.00 43.76  ? 4    LEU A CA    1 
ATOM   26   C  C     . LEU A 1 10  ? -11.792 39.596  -1.471  1.00 43.04  ? 4    LEU A C     1 
ATOM   27   O  O     . LEU A 1 10  ? -11.998 40.417  -0.584  1.00 44.37  ? 4    LEU A O     1 
ATOM   28   C  CB    . LEU A 1 10  ? -14.167 39.713  -2.243  1.00 40.98  ? 4    LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 10  ? -13.978 41.032  -2.982  1.00 37.26  ? 4    LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 10  ? -13.373 40.766  -4.308  1.00 36.00  ? 4    LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 10  ? -15.307 41.732  -3.143  1.00 37.25  ? 4    LEU A CD2   1 
ATOM   32   N  N     . PHE A 1 11  ? -10.584 39.347  -1.951  1.00 40.91  ? 5    PHE A N     1 
ATOM   33   C  CA    . PHE A 1 11  ? -9.408  40.031  -1.439  1.00 40.72  ? 5    PHE A CA    1 
ATOM   34   C  C     . PHE A 1 11  ? -9.139  41.388  -2.113  1.00 41.38  ? 5    PHE A C     1 
ATOM   35   O  O     . PHE A 1 11  ? -9.176  41.506  -3.338  1.00 42.27  ? 5    PHE A O     1 
ATOM   36   C  CB    . PHE A 1 11  ? -8.186  39.122  -1.611  1.00 38.81  ? 5    PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 11  ? -6.925  39.688  -1.034  1.00 36.21  ? 5    PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 11  ? -6.784  39.824  0.342   1.00 35.42  ? 5    PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 11  ? -5.890  40.096  -1.863  1.00 33.89  ? 5    PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 11  ? -5.637  40.356  0.888   1.00 35.44  ? 5    PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 11  ? -4.725  40.635  -1.334  1.00 34.31  ? 5    PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 11  ? -4.595  40.767  0.044   1.00 35.66  ? 5    PHE A CZ    1 
ATOM   43   N  N     . VAL A 1 12  ? -8.851  42.410  -1.318  1.00 41.37  ? 6    VAL A N     1 
ATOM   44   C  CA    . VAL A 1 12  ? -8.567  43.732  -1.883  1.00 43.00  ? 6    VAL A CA    1 
ATOM   45   C  C     . VAL A 1 12  ? -7.155  44.167  -1.503  1.00 45.64  ? 6    VAL A C     1 
ATOM   46   O  O     . VAL A 1 12  ? -6.775  44.077  -0.334  1.00 48.50  ? 6    VAL A O     1 
ATOM   47   C  CB    . VAL A 1 12  ? -9.564  44.799  -1.361  1.00 40.59  ? 6    VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 12  ? -9.253  46.143  -1.958  1.00 35.32  ? 6    VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 12  ? -10.973 44.378  -1.681  1.00 39.55  ? 6    VAL A CG2   1 
ATOM   50   N  N     . ASP A 1 13  ? -6.388  44.648  -2.471  1.00 45.71  ? 7    ASP A N     1 
ATOM   51   C  CA    . ASP A 1 13  ? -5.024  45.069  -2.217  1.00 47.29  ? 7    ASP A CA    1 
ATOM   52   C  C     . ASP A 1 13  ? -4.743  46.397  -2.949  1.00 48.20  ? 7    ASP A C     1 
ATOM   53   O  O     . ASP A 1 13  ? -4.823  46.483  -4.164  1.00 50.20  ? 7    ASP A O     1 
ATOM   54   C  CB    . ASP A 1 13  ? -4.074  43.950  -2.653  1.00 48.12  ? 7    ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 13  ? -2.624  44.324  -2.556  1.00 49.09  ? 7    ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 13  ? -2.099  44.878  -3.545  1.00 50.77  ? 7    ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 13  ? -2.020  44.073  -1.495  1.00 47.15  ? 7    ASP A OD2   1 
ATOM   58   N  N     . PHE A 1 14  ? -4.400  47.416  -2.189  1.00 47.74  ? 8    PHE A N     1 
ATOM   59   C  CA    . PHE A 1 14  ? -4.143  48.749  -2.765  1.00 46.70  ? 8    PHE A CA    1 
ATOM   60   C  C     . PHE A 1 14  ? -2.958  48.698  -3.649  1.00 47.91  ? 8    PHE A C     1 
ATOM   61   O  O     . PHE A 1 14  ? -1.823  48.546  -3.237  1.00 46.16  ? 8    PHE A O     1 
ATOM   62   C  CB    . PHE A 1 14  ? -3.988  49.813  -1.682  1.00 43.43  ? 8    PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 14  ? -5.110  49.816  -0.699  1.00 38.10  ? 8    PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 14  ? -6.062  48.821  -0.758  1.00 36.97  ? 8    PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 14  ? -5.192  50.759  0.283   1.00 35.47  ? 8    PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 14  ? -7.077  48.756  0.142   1.00 36.10  ? 8    PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 14  ? -6.209  50.705  1.196   1.00 35.78  ? 8    PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 14  ? -7.162  49.695  1.128   1.00 36.07  ? 8    PHE A CZ    1 
ATOM   69   N  N     . ASP A 1 15  ? -3.276  48.852  -4.914  1.00 52.18  ? 9    ASP A N     1 
ATOM   70   C  CA    . ASP A 1 15  ? -2.304  48.744  -5.924  1.00 55.03  ? 9    ASP A CA    1 
ATOM   71   C  C     . ASP A 1 15  ? -0.963  49.061  -5.516  1.00 55.46  ? 9    ASP A C     1 
ATOM   72   O  O     . ASP A 1 15  ? -0.057  48.204  -5.752  1.00 58.45  ? 9    ASP A O     1 
ATOM   73   C  CB    . ASP A 1 15  ? -2.667  49.478  -7.188  1.00 55.52  ? 9    ASP A CB    1 
ATOM   74   C  CG    . ASP A 1 15  ? -3.029  48.550  -8.232  1.00 54.99  ? 9    ASP A CG    1 
ATOM   75   O  OD1   . ASP A 1 15  ? -3.958  47.784  -7.960  1.00 53.75  ? 9    ASP A OD1   1 
ATOM   76   O  OD2   . ASP A 1 15  ? -2.395  48.582  -9.299  1.00 55.94  ? 9    ASP A OD2   1 
ATOM   77   N  N     . TYR A 1 16  ? -0.709  50.197  -4.894  1.00 52.98  ? 10   TYR A N     1 
ATOM   78   C  CA    . TYR A 1 16  ? 0.678   50.255  -4.633  1.00 52.13  ? 10   TYR A CA    1 
ATOM   79   C  C     . TYR A 1 16  ? 0.947   51.455  -3.883  1.00 49.90  ? 10   TYR A C     1 
ATOM   80   O  O     . TYR A 1 16  ? 1.840   52.203  -4.040  1.00 49.60  ? 10   TYR A O     1 
ATOM   81   C  CB    . TYR A 1 16  ? 1.412   50.152  -5.946  1.00 53.90  ? 10   TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 16  ? 1.020   51.104  -7.008  1.00 57.66  ? 10   TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 16  ? 2.021   51.748  -7.675  1.00 59.52  ? 10   TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 16  ? -0.308  51.403  -7.334  1.00 59.26  ? 10   TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 16  ? 1.776   52.675  -8.626  1.00 60.56  ? 10   TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 16  ? -0.583  52.371  -8.343  1.00 61.75  ? 10   TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 16  ? 0.489   53.003  -8.972  1.00 61.90  ? 10   TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 16  ? 0.301   54.003  -9.895  1.00 64.86  ? 10   TYR A OH    1 
ATOM   89   N  N     . PHE A 1 17  ? 0.034   51.526  -2.962  1.00 48.13  ? 11   PHE A N     1 
ATOM   90   C  CA    . PHE A 1 17  ? -0.229  52.515  -1.952  1.00 46.23  ? 11   PHE A CA    1 
ATOM   91   C  C     . PHE A 1 17  ? 0.514   53.792  -1.794  1.00 44.94  ? 11   PHE A C     1 
ATOM   92   O  O     . PHE A 1 17  ? 0.466   54.664  -2.710  1.00 43.51  ? 11   PHE A O     1 
ATOM   93   C  CB    . PHE A 1 17  ? -0.349  51.792  -0.670  1.00 45.74  ? 11   PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 17  ? -1.345  52.415  0.274   1.00 45.10  ? 11   PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 17  ? -2.495  53.008  -0.244  1.00 44.75  ? 11   PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 17  ? -1.166  52.393  1.656   1.00 43.73  ? 11   PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 17  ? -3.453  53.567  0.615   1.00 46.91  ? 11   PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 17  ? -2.113  52.945  2.526   1.00 44.84  ? 11   PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 17  ? -3.266  53.532  2.006   1.00 46.39  ? 11   PHE A CZ    1 
ATOM   100  N  N     . TYR A 1 18  ? 1.408   53.788  -0.812  1.00 45.60  ? 12   TYR A N     1 
ATOM   101  C  CA    . TYR A 1 18  ? 2.141   54.979  -0.586  1.00 46.19  ? 12   TYR A CA    1 
ATOM   102  C  C     . TYR A 1 18  ? 2.447   55.757  -1.857  1.00 46.20  ? 12   TYR A C     1 
ATOM   103  O  O     . TYR A 1 18  ? 1.670   56.639  -2.238  1.00 46.16  ? 12   TYR A O     1 
ATOM   104  C  CB    . TYR A 1 18  ? 3.420   54.647  0.174   1.00 45.46  ? 12   TYR A CB    1 
ATOM   105  C  CG    . TYR A 1 18  ? 3.168   53.976  1.489   1.00 45.71  ? 12   TYR A CG    1 
ATOM   106  C  CD1   . TYR A 1 18  ? 1.897   53.989  2.085   1.00 44.87  ? 12   TYR A CD1   1 
ATOM   107  C  CD2   . TYR A 1 18  ? 4.202   53.335  2.151   1.00 46.62  ? 12   TYR A CD2   1 
ATOM   108  C  CE1   . TYR A 1 18  ? 1.680   53.370  3.317   1.00 45.42  ? 12   TYR A CE1   1 
ATOM   109  C  CE2   . TYR A 1 18  ? 4.003   52.714  3.380   1.00 45.82  ? 12   TYR A CE2   1 
ATOM   110  C  CZ    . TYR A 1 18  ? 2.739   52.734  3.960   1.00 45.87  ? 12   TYR A CZ    1 
ATOM   111  O  OH    . TYR A 1 18  ? 2.523   52.127  5.180   1.00 46.18  ? 12   TYR A OH    1 
ATOM   112  N  N     . ALA A 1 19  ? 3.567   55.440  -2.506  1.00 45.02  ? 13   ALA A N     1 
ATOM   113  C  CA    . ALA A 1 19  ? 3.988   56.163  -3.677  1.00 44.29  ? 13   ALA A CA    1 
ATOM   114  C  C     . ALA A 1 19  ? 2.826   56.582  -4.543  1.00 45.03  ? 13   ALA A C     1 
ATOM   115  O  O     . ALA A 1 19  ? 2.883   57.617  -5.184  1.00 45.50  ? 13   ALA A O     1 
ATOM   116  C  CB    . ALA A 1 19  ? 4.945   55.331  -4.455  1.00 44.66  ? 13   ALA A CB    1 
ATOM   117  N  N     . GLN A 1 20  ? 1.765   55.788  -4.557  1.00 46.02  ? 14   GLN A N     1 
ATOM   118  C  CA    . GLN A 1 20  ? 0.606   56.115  -5.372  1.00 46.37  ? 14   GLN A CA    1 
ATOM   119  C  C     . GLN A 1 20  ? -0.118  57.329  -4.782  1.00 45.04  ? 14   GLN A C     1 
ATOM   120  O  O     . GLN A 1 20  ? -0.339  58.312  -5.477  1.00 45.38  ? 14   GLN A O     1 
ATOM   121  C  CB    . GLN A 1 20  ? -0.342  54.915  -5.451  1.00 47.68  ? 14   GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 20  ? -1.269  54.935  -6.651  1.00 50.49  ? 14   GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 20  ? -2.547  54.158  -6.397  1.00 53.09  ? 14   GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 20  ? -2.511  53.027  -5.890  1.00 52.55  ? 14   GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 20  ? -3.691  54.760  -6.747  1.00 54.76  ? 14   GLN A NE2   1 
ATOM   126  N  N     . VAL A 1 21  ? -0.473  57.260  -3.502  1.00 43.28  ? 15   VAL A N     1 
ATOM   127  C  CA    . VAL A 1 21  ? -1.160  58.359  -2.833  1.00 41.77  ? 15   VAL A CA    1 
ATOM   128  C  C     . VAL A 1 21  ? -0.310  59.619  -2.958  1.00 43.39  ? 15   VAL A C     1 
ATOM   129  O  O     . VAL A 1 21  ? -0.828  60.714  -3.132  1.00 43.63  ? 15   VAL A O     1 
ATOM   130  C  CB    . VAL A 1 21  ? -1.360  58.061  -1.340  1.00 39.54  ? 15   VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 21  ? -2.420  58.942  -0.763  1.00 37.60  ? 15   VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 21  ? -1.719  56.617  -1.152  1.00 41.34  ? 15   VAL A CG2   1 
ATOM   133  N  N     . GLU A 1 22  ? 1.004   59.460  -2.878  1.00 44.70  ? 16   GLU A N     1 
ATOM   134  C  CA    . GLU A 1 22  ? 1.889   60.602  -2.979  1.00 46.54  ? 16   GLU A CA    1 
ATOM   135  C  C     . GLU A 1 22  ? 1.720   61.278  -4.328  1.00 48.51  ? 16   GLU A C     1 
ATOM   136  O  O     . GLU A 1 22  ? 1.898   62.500  -4.452  1.00 51.01  ? 16   GLU A O     1 
ATOM   137  C  CB    . GLU A 1 22  ? 3.345   60.176  -2.775  1.00 46.98  ? 16   GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 22  ? 3.705   59.837  -1.320  1.00 47.41  ? 16   GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 22  ? 3.423   60.988  -0.356  1.00 47.96  ? 16   GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 22  ? 3.313   62.133  -0.831  1.00 48.78  ? 16   GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 22  ? 3.325   60.761  0.873   1.00 46.30  ? 16   GLU A OE2   1 
ATOM   142  N  N     . GLU A 1 23  ? 1.358   60.488  -5.333  1.00 48.27  ? 17   GLU A N     1 
ATOM   143  C  CA    . GLU A 1 23  ? 1.161   61.024  -6.673  1.00 47.95  ? 17   GLU A CA    1 
ATOM   144  C  C     . GLU A 1 23  ? -0.227  61.597  -6.840  1.00 46.24  ? 17   GLU A C     1 
ATOM   145  O  O     . GLU A 1 23  ? -0.450  62.510  -7.614  1.00 45.98  ? 17   GLU A O     1 
ATOM   146  C  CB    . GLU A 1 23  ? 1.395   59.936  -7.705  1.00 49.44  ? 17   GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 23  ? 2.805   59.405  -7.669  1.00 53.89  ? 17   GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 23  ? 3.026   58.304  -8.674  1.00 56.08  ? 17   GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 23  ? 3.119   58.627  -9.876  1.00 58.32  ? 17   GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 23  ? 3.093   57.118  -8.266  1.00 56.57  ? 17   GLU A OE2   1 
ATOM   151  N  N     . VAL A 1 24  ? -1.163  61.064  -6.092  1.00 46.39  ? 18   VAL A N     1 
ATOM   152  C  CA    . VAL A 1 24  ? -2.512  61.547  -6.186  1.00 48.81  ? 18   VAL A CA    1 
ATOM   153  C  C     . VAL A 1 24  ? -2.626  62.958  -5.645  1.00 51.52  ? 18   VAL A C     1 
ATOM   154  O  O     . VAL A 1 24  ? -3.418  63.757  -6.152  1.00 53.75  ? 18   VAL A O     1 
ATOM   155  C  CB    . VAL A 1 24  ? -3.453  60.650  -5.411  1.00 47.46  ? 18   VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 24  ? -4.879  61.172  -5.526  1.00 47.87  ? 18   VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 24  ? -3.351  59.236  -5.952  1.00 48.68  ? 18   VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 25  ? -1.837  63.265  -4.619  1.00 53.24  ? 19   LEU A N     1 
ATOM   159  C  CA    . LEU A 1 25  ? -1.877  64.587  -4.007  1.00 54.73  ? 19   LEU A CA    1 
ATOM   160  C  C     . LEU A 1 25  ? -1.047  65.602  -4.773  1.00 57.59  ? 19   LEU A C     1 
ATOM   161  O  O     . LEU A 1 25  ? -1.461  66.761  -4.953  1.00 58.87  ? 19   LEU A O     1 
ATOM   162  C  CB    . LEU A 1 25  ? -1.398  64.517  -2.558  1.00 52.64  ? 19   LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 25  ? -2.445  64.178  -1.487  1.00 50.60  ? 19   LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 25  ? -2.776  62.708  -1.476  1.00 48.82  ? 19   LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 25  ? -1.894  64.576  -0.146  1.00 50.96  ? 19   LEU A CD2   1 
ATOM   166  N  N     . ASN A 1 26  ? 0.124   65.161  -5.219  1.00 59.22  ? 20   ASN A N     1 
ATOM   167  C  CA    . ASN A 1 26  ? 1.015   66.015  -5.977  1.00 61.00  ? 20   ASN A CA    1 
ATOM   168  C  C     . ASN A 1 26  ? 0.969   65.571  -7.429  1.00 62.64  ? 20   ASN A C     1 
ATOM   169  O  O     . ASN A 1 26  ? 1.728   64.709  -7.853  1.00 62.74  ? 20   ASN A O     1 
ATOM   170  C  CB    . ASN A 1 26  ? 2.423   65.904  -5.412  1.00 61.95  ? 20   ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 26  ? 3.386   66.846  -6.086  1.00 62.43  ? 20   ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 26  ? 4.512   67.044  -5.621  1.00 60.22  ? 20   ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 26  ? 2.950   67.431  -7.201  1.00 62.32  ? 20   ASN A ND2   1 
ATOM   174  N  N     . PRO A 1 27  ? 0.066   66.166  -8.213  1.00 65.14  ? 21   PRO A N     1 
ATOM   175  C  CA    . PRO A 1 27  ? -0.109  65.839  -9.631  1.00 67.07  ? 21   PRO A CA    1 
ATOM   176  C  C     . PRO A 1 27  ? 1.124   65.974  -10.508 1.00 68.44  ? 21   PRO A C     1 
ATOM   177  O  O     . PRO A 1 27  ? 1.205   65.339  -11.562 1.00 69.12  ? 21   PRO A O     1 
ATOM   178  C  CB    . PRO A 1 27  ? -1.236  66.775  -10.064 1.00 66.98  ? 21   PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 27  ? -1.031  67.973  -9.183  1.00 67.02  ? 21   PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 27  ? -0.761  67.327  -7.840  1.00 66.47  ? 21   PRO A CD    1 
ATOM   181  N  N     . SER A 1 28  ? 2.085   66.788  -10.080 1.00 69.30  ? 22   SER A N     1 
ATOM   182  C  CA    . SER A 1 28  ? 3.295   66.988  -10.875 1.00 70.80  ? 22   SER A CA    1 
ATOM   183  C  C     . SER A 1 28  ? 4.314   65.862  -10.745 1.00 71.85  ? 22   SER A C     1 
ATOM   184  O  O     . SER A 1 28  ? 5.455   65.983  -11.210 1.00 71.05  ? 22   SER A O     1 
ATOM   185  C  CB    . SER A 1 28  ? 3.942   68.324  -10.513 1.00 70.20  ? 22   SER A CB    1 
ATOM   186  O  OG    . SER A 1 28  ? 3.861   68.547  -9.125  1.00 69.06  ? 22   SER A OG    1 
ATOM   187  N  N     . LEU A 1 29  ? 3.876   64.761  -10.139 1.00 73.68  ? 23   LEU A N     1 
ATOM   188  C  CA    . LEU A 1 29  ? 4.722   63.596  -9.912  1.00 74.75  ? 23   LEU A CA    1 
ATOM   189  C  C     . LEU A 1 29  ? 4.585   62.525  -10.973 1.00 75.67  ? 23   LEU A C     1 
ATOM   190  O  O     . LEU A 1 29  ? 5.577   62.096  -11.559 1.00 75.58  ? 23   LEU A O     1 
ATOM   191  C  CB    . LEU A 1 29  ? 4.406   62.974  -8.555  1.00 74.20  ? 23   LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 29  ? 4.811   63.772  -7.320  1.00 74.18  ? 23   LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 29  ? 4.343   63.009  -6.087  1.00 73.95  ? 23   LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 29  ? 6.331   63.999  -7.304  1.00 72.92  ? 23   LEU A CD2   1 
ATOM   195  N  N     . LYS A 1 30  ? 3.355   62.079  -11.199 1.00 77.33  ? 24   LYS A N     1 
ATOM   196  C  CA    . LYS A 1 30  ? 3.089   61.036  -12.187 1.00 78.99  ? 24   LYS A CA    1 
ATOM   197  C  C     . LYS A 1 30  ? 3.931   61.195  -13.456 1.00 79.34  ? 24   LYS A C     1 
ATOM   198  O  O     . LYS A 1 30  ? 4.399   62.296  -13.784 1.00 80.60  ? 24   LYS A O     1 
ATOM   199  C  CB    . LYS A 1 30  ? 1.608   61.021  -12.555 1.00 79.39  ? 24   LYS A CB    1 
ATOM   200  C  CG    . LYS A 1 30  ? 1.261   59.984  -13.601 1.00 81.83  ? 24   LYS A CG    1 
ATOM   201  C  CD    . LYS A 1 30  ? 1.722   58.575  -13.197 1.00 84.37  ? 24   LYS A CD    1 
ATOM   202  C  CE    . LYS A 1 30  ? 1.056   58.080  -11.895 1.00 85.65  ? 24   LYS A CE    1 
ATOM   203  N  NZ    . LYS A 1 30  ? 1.444   56.676  -11.520 1.00 84.52  ? 24   LYS A NZ    1 
ATOM   204  N  N     . GLY A 1 31  ? 4.113   60.094  -14.177 1.00 77.45  ? 25   GLY A N     1 
ATOM   205  C  CA    . GLY A 1 31  ? 4.917   60.162  -15.375 1.00 75.24  ? 25   GLY A CA    1 
ATOM   206  C  C     . GLY A 1 31  ? 6.373   60.231  -14.962 1.00 73.75  ? 25   GLY A C     1 
ATOM   207  O  O     . GLY A 1 31  ? 7.223   60.693  -15.720 1.00 74.97  ? 25   GLY A O     1 
ATOM   208  N  N     . LYS A 1 32  ? 6.658   59.782  -13.744 1.00 71.42  ? 26   LYS A N     1 
ATOM   209  C  CA    . LYS A 1 32  ? 8.020   59.765  -13.222 1.00 68.47  ? 26   LYS A CA    1 
ATOM   210  C  C     . LYS A 1 32  ? 8.134   58.670  -12.172 1.00 66.21  ? 26   LYS A C     1 
ATOM   211  O  O     . LYS A 1 32  ? 7.144   58.283  -11.550 1.00 65.92  ? 26   LYS A O     1 
ATOM   212  C  CB    . LYS A 1 32  ? 8.377   61.106  -12.573 1.00 68.90  ? 26   LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 32  ? 8.214   62.308  -13.480 1.00 70.04  ? 26   LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 32  ? 8.763   63.587  -12.857 1.00 68.33  ? 26   LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 32  ? 10.258  63.490  -12.644 1.00 67.42  ? 26   LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 32  ? 10.834  64.786  -12.209 1.00 67.22  ? 26   LYS A NZ    1 
ATOM   217  N  N     . PRO A 1 33  ? 9.348   58.153  -11.962 1.00 63.54  ? 27   PRO A N     1 
ATOM   218  C  CA    . PRO A 1 33  ? 9.574   57.100  -10.974 1.00 61.55  ? 27   PRO A CA    1 
ATOM   219  C  C     . PRO A 1 33  ? 9.715   57.690  -9.576  1.00 59.83  ? 27   PRO A C     1 
ATOM   220  O  O     . PRO A 1 33  ? 10.727  58.301  -9.268  1.00 59.59  ? 27   PRO A O     1 
ATOM   221  C  CB    . PRO A 1 33  ? 10.860  56.452  -11.464 1.00 61.48  ? 27   PRO A CB    1 
ATOM   222  C  CG    . PRO A 1 33  ? 11.613  57.620  -11.985 1.00 63.26  ? 27   PRO A CG    1 
ATOM   223  C  CD    . PRO A 1 33  ? 10.561  58.394  -12.760 1.00 63.26  ? 27   PRO A CD    1 
ATOM   224  N  N     . VAL A 1 34  ? 8.688   57.505  -8.747  1.00 58.56  ? 28   VAL A N     1 
ATOM   225  C  CA    . VAL A 1 34  ? 8.653   58.003  -7.367  1.00 56.83  ? 28   VAL A CA    1 
ATOM   226  C  C     . VAL A 1 34  ? 9.096   56.963  -6.333  1.00 55.57  ? 28   VAL A C     1 
ATOM   227  O  O     . VAL A 1 34  ? 8.708   55.803  -6.405  1.00 55.49  ? 28   VAL A O     1 
ATOM   228  C  CB    . VAL A 1 34  ? 7.230   58.471  -7.002  1.00 57.13  ? 28   VAL A CB    1 
ATOM   229  C  CG1   . VAL A 1 34  ? 7.107   58.711  -5.500  1.00 58.16  ? 28   VAL A CG1   1 
ATOM   230  C  CG2   . VAL A 1 34  ? 6.910   59.730  -7.757  1.00 57.19  ? 28   VAL A CG2   1 
ATOM   231  N  N     . VAL A 1 35  ? 9.895   57.392  -5.360  1.00 53.73  ? 29   VAL A N     1 
ATOM   232  C  CA    . VAL A 1 35  ? 10.386  56.496  -4.325  1.00 51.24  ? 29   VAL A CA    1 
ATOM   233  C  C     . VAL A 1 35  ? 10.111  57.003  -2.921  1.00 49.76  ? 29   VAL A C     1 
ATOM   234  O  O     . VAL A 1 35  ? 10.835  57.847  -2.413  1.00 49.75  ? 29   VAL A O     1 
ATOM   235  C  CB    . VAL A 1 35  ? 11.887  56.295  -4.451  1.00 50.69  ? 29   VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 35  ? 12.363  55.369  -3.371  1.00 49.80  ? 29   VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 35  ? 12.214  55.744  -5.811  1.00 50.71  ? 29   VAL A CG2   1 
ATOM   238  N  N     . VAL A 1 36  ? 9.060   56.493  -2.298  1.00 48.00  ? 30   VAL A N     1 
ATOM   239  C  CA    . VAL A 1 36  ? 8.738   56.889  -0.936  1.00 46.99  ? 30   VAL A CA    1 
ATOM   240  C  C     . VAL A 1 36  ? 9.654   56.113  0.001   1.00 48.24  ? 30   VAL A C     1 
ATOM   241  O  O     . VAL A 1 36  ? 9.683   54.883  -0.035  1.00 49.45  ? 30   VAL A O     1 
ATOM   242  C  CB    . VAL A 1 36  ? 7.300   56.525  -0.573  1.00 45.32  ? 30   VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 36  ? 7.083   56.690  0.915   1.00 43.10  ? 30   VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 36  ? 6.349   57.388  -1.338  1.00 44.92  ? 30   VAL A CG2   1 
ATOM   245  N  N     . CYS A 1 37  ? 10.406  56.814  0.838   1.00 48.49  ? 31   CYS A N     1 
ATOM   246  C  CA    . CYS A 1 37  ? 11.288  56.116  1.763   1.00 47.73  ? 31   CYS A CA    1 
ATOM   247  C  C     . CYS A 1 37  ? 11.362  56.783  3.129   1.00 47.87  ? 31   CYS A C     1 
ATOM   248  O  O     . CYS A 1 37  ? 10.790  57.865  3.325   1.00 47.28  ? 31   CYS A O     1 
ATOM   249  C  CB    . CYS A 1 37  ? 12.681  55.982  1.159   1.00 45.56  ? 31   CYS A CB    1 
ATOM   250  S  SG    . CYS A 1 37  ? 13.176  57.406  0.300   1.00 43.69  ? 31   CYS A SG    1 
ATOM   251  N  N     . VAL A 1 38  ? 12.053  56.107  4.061   1.00 47.72  ? 32   VAL A N     1 
ATOM   252  C  CA    . VAL A 1 38  ? 12.257  56.553  5.448   1.00 46.09  ? 32   VAL A CA    1 
ATOM   253  C  C     . VAL A 1 38  ? 13.687  57.015  5.709   1.00 46.07  ? 32   VAL A C     1 
ATOM   254  O  O     . VAL A 1 38  ? 14.645  56.309  5.404   1.00 44.65  ? 32   VAL A O     1 
ATOM   255  C  CB    . VAL A 1 38  ? 11.985  55.428  6.475   1.00 44.50  ? 32   VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 38  ? 12.200  55.963  7.860   1.00 45.33  ? 32   VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 38  ? 10.581  54.896  6.344   1.00 43.92  ? 32   VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 39  ? 13.824  58.200  6.290   1.00 47.92  ? 33   PHE A N     1 
ATOM   259  C  CA    . PHE A 1 39  ? 15.141  58.750  6.616   1.00 49.71  ? 33   PHE A CA    1 
ATOM   260  C  C     . PHE A 1 39  ? 15.383  58.651  8.129   1.00 50.30  ? 33   PHE A C     1 
ATOM   261  O  O     . PHE A 1 39  ? 14.429  58.543  8.906   1.00 48.93  ? 33   PHE A O     1 
ATOM   262  C  CB    . PHE A 1 39  ? 15.231  60.224  6.181   1.00 49.09  ? 33   PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 39  ? 15.088  60.433  4.705   1.00 47.85  ? 33   PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 39  ? 13.863  60.758  4.153   1.00 48.86  ? 33   PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 39  ? 16.174  60.247  3.859   1.00 48.31  ? 33   PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 39  ? 13.718  60.889  2.762   1.00 50.99  ? 33   PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 39  ? 16.047  60.372  2.475   1.00 48.06  ? 33   PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 39  ? 14.816  60.692  1.920   1.00 49.10  ? 33   PHE A CZ    1 
ATOM   269  N  N     . SER A 1 40  ? 16.647  58.666  8.537   1.00 52.42  ? 34   SER A N     1 
ATOM   270  C  CA    . SER A 1 40  ? 16.972  58.605  9.951   1.00 55.04  ? 34   SER A CA    1 
ATOM   271  C  C     . SER A 1 40  ? 17.648  59.899  10.399  1.00 56.84  ? 34   SER A C     1 
ATOM   272  O  O     . SER A 1 40  ? 17.455  60.345  11.543  1.00 57.34  ? 34   SER A O     1 
ATOM   273  C  CB    . SER A 1 40  ? 17.882  57.392  10.237  1.00 54.92  ? 34   SER A CB    1 
ATOM   274  O  OG    . SER A 1 40  ? 19.153  57.577  9.659   1.00 54.85  ? 34   SER A OG    1 
ATOM   275  N  N     . GLY A 1 41  ? 18.393  60.519  9.485   1.00 59.19  ? 35   GLY A N     1 
ATOM   276  C  CA    . GLY A 1 41  ? 19.114  61.755  9.794   1.00 62.24  ? 35   GLY A CA    1 
ATOM   277  C  C     . GLY A 1 41  ? 20.616  61.684  10.035  1.00 64.19  ? 35   GLY A C     1 
ATOM   278  O  O     . GLY A 1 41  ? 21.236  62.658  10.511  1.00 63.68  ? 35   GLY A O     1 
ATOM   279  N  N     . ARG A 1 42  ? 21.201  60.566  9.624   1.00 65.95  ? 36   ARG A N     1 
ATOM   280  C  CA    . ARG A 1 42  ? 22.594  60.305  9.845   1.00 68.79  ? 36   ARG A CA    1 
ATOM   281  C  C     . ARG A 1 42  ? 23.657  60.509  8.787   1.00 70.09  ? 36   ARG A C     1 
ATOM   282  O  O     . ARG A 1 42  ? 24.311  61.545  8.684   1.00 70.06  ? 36   ARG A O     1 
ATOM   283  C  CB    . ARG A 1 42  ? 22.745  58.866  10.320  1.00 69.94  ? 36   ARG A CB    1 
ATOM   284  C  CG    . ARG A 1 42  ? 22.189  58.510  11.641  1.00 72.48  ? 36   ARG A CG    1 
ATOM   285  C  CD    . ARG A 1 42  ? 22.610  57.061  11.888  1.00 74.62  ? 36   ARG A CD    1 
ATOM   286  N  NE    . ARG A 1 42  ? 22.354  56.589  13.244  1.00 77.10  ? 36   ARG A NE    1 
ATOM   287  C  CZ    . ARG A 1 42  ? 22.808  55.434  13.737  1.00 77.60  ? 36   ARG A CZ    1 
ATOM   288  N  NH1   . ARG A 1 42  ? 23.548  54.639  12.967  1.00 77.26  ? 36   ARG A NH1   1 
ATOM   289  N  NH2   . ARG A 1 42  ? 22.519  55.078  14.989  1.00 76.07  ? 36   ARG A NH2   1 
ATOM   290  N  N     . PHE A 1 43  ? 23.893  59.355  8.159   1.00 72.08  ? 37   PHE A N     1 
ATOM   291  C  CA    . PHE A 1 43  ? 24.862  59.091  7.115   1.00 72.11  ? 37   PHE A CA    1 
ATOM   292  C  C     . PHE A 1 43  ? 24.956  60.304  6.228   1.00 71.60  ? 37   PHE A C     1 
ATOM   293  O  O     . PHE A 1 43  ? 25.993  60.634  5.671   1.00 72.69  ? 37   PHE A O     1 
ATOM   294  C  CB    . PHE A 1 43  ? 24.356  57.935  6.278   1.00 74.17  ? 37   PHE A CB    1 
ATOM   295  C  CG    . PHE A 1 43  ? 25.427  57.049  5.788   1.00 76.79  ? 37   PHE A CG    1 
ATOM   296  C  CD1   . PHE A 1 43  ? 26.757  57.267  6.153   1.00 78.31  ? 37   PHE A CD1   1 
ATOM   297  C  CD2   . PHE A 1 43  ? 25.109  55.982  4.982   1.00 77.87  ? 37   PHE A CD2   1 
ATOM   298  C  CE1   . PHE A 1 43  ? 27.763  56.401  5.699   1.00 78.29  ? 37   PHE A CE1   1 
ATOM   299  C  CE2   . PHE A 1 43  ? 26.092  55.117  4.523   1.00 78.34  ? 37   PHE A CE2   1 
ATOM   300  C  CZ    . PHE A 1 43  ? 27.422  55.320  4.879   1.00 78.49  ? 37   PHE A CZ    1 
ATOM   301  N  N     . GLU A 1 44  ? 23.764  60.889  6.111   1.00 69.75  ? 38   GLU A N     1 
ATOM   302  C  CA    . GLU A 1 44  ? 23.389  62.049  5.338   1.00 67.94  ? 38   GLU A CA    1 
ATOM   303  C  C     . GLU A 1 44  ? 22.053  61.605  4.670   1.00 67.91  ? 38   GLU A C     1 
ATOM   304  O  O     . GLU A 1 44  ? 20.995  62.233  4.861   1.00 68.67  ? 38   GLU A O     1 
ATOM   305  C  CB    A GLU A 1 44  ? 24.430  62.389  4.265   0.50 66.78  ? 38   GLU A CB    1 
ATOM   306  C  CG    A GLU A 1 44  ? 24.217  63.727  3.678   0.50 65.03  ? 38   GLU A CG    1 
ATOM   307  C  CD    A GLU A 1 44  ? 22.979  63.793  2.849   0.50 64.54  ? 38   GLU A CD    1 
ATOM   308  O  OE1   A GLU A 1 44  ? 22.522  64.914  2.573   0.50 63.73  ? 38   GLU A OE1   1 
ATOM   309  O  OE2   A GLU A 1 44  ? 22.454  62.736  2.444   0.50 63.79  ? 38   GLU A OE2   1 
ATOM   310  N  N     . ASP A 1 45  ? 22.136  60.541  3.859   1.00 65.37  ? 39   ASP A N     1 
ATOM   311  C  CA    A ASP A 1 45  ? 20.997  59.954  3.157   0.50 61.98  ? 39   ASP A CA    1 
ATOM   312  C  C     . ASP A 1 45  ? 20.625  58.613  3.798   1.00 60.32  ? 39   ASP A C     1 
ATOM   313  O  O     . ASP A 1 45  ? 20.155  57.691  3.128   1.00 60.69  ? 39   ASP A O     1 
ATOM   314  C  CB    A ASP A 1 45  ? 21.368  59.735  1.697   0.50 61.27  ? 39   ASP A CB    1 
ATOM   315  C  CG    A ASP A 1 45  ? 20.454  60.464  0.753   0.50 60.69  ? 39   ASP A CG    1 
ATOM   316  O  OD1   A ASP A 1 45  ? 20.514  60.188  -0.464  0.50 60.27  ? 39   ASP A OD1   1 
ATOM   317  O  OD2   A ASP A 1 45  ? 19.680  61.316  1.226   0.50 60.12  ? 39   ASP A OD2   1 
ATOM   318  N  N     . SER A 1 46  ? 20.858  58.524  5.102   1.00 57.34  ? 40   SER A N     1 
ATOM   319  C  CA    . SER A 1 46  ? 20.565  57.329  5.876   1.00 54.24  ? 40   SER A CA    1 
ATOM   320  C  C     . SER A 1 46  ? 19.084  56.977  5.855   1.00 52.17  ? 40   SER A C     1 
ATOM   321  O  O     . SER A 1 46  ? 18.222  57.859  5.854   1.00 51.32  ? 40   SER A O     1 
ATOM   322  C  CB    . SER A 1 46  ? 21.003  57.531  7.323   1.00 53.39  ? 40   SER A CB    1 
ATOM   323  O  OG    . SER A 1 46  ? 20.497  56.497  8.146   1.00 54.31  ? 40   SER A OG    1 
ATOM   324  N  N     . GLY A 1 47  ? 18.799  55.680  5.860   1.00 49.46  ? 41   GLY A N     1 
ATOM   325  C  CA    . GLY A 1 47  ? 17.424  55.233  5.847   1.00 46.74  ? 41   GLY A CA    1 
ATOM   326  C  C     . GLY A 1 47  ? 17.241  54.056  4.915   1.00 45.74  ? 41   GLY A C     1 
ATOM   327  O  O     . GLY A 1 47  ? 18.207  53.475  4.426   1.00 45.56  ? 41   GLY A O     1 
ATOM   328  N  N     . ALA A 1 48  ? 15.983  53.720  4.660   1.00 45.06  ? 42   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 48  ? 15.620  52.604  3.794   1.00 43.58  ? 42   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 48  ? 14.490  53.049  2.869   1.00 43.14  ? 42   ALA A C     1 
ATOM   331  O  O     . ALA A 1 48  ? 14.016  54.174  2.979   1.00 44.68  ? 42   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 48  ? 15.166  51.442  4.643   1.00 41.10  ? 42   ALA A CB    1 
ATOM   333  N  N     . VAL A 1 49  ? 14.063  52.174  1.961   1.00 42.19  ? 43   VAL A N     1 
ATOM   334  C  CA    . VAL A 1 49  ? 12.976  52.487  1.028   1.00 39.99  ? 43   VAL A CA    1 
ATOM   335  C  C     . VAL A 1 49  ? 11.673  51.870  1.515   1.00 40.57  ? 43   VAL A C     1 
ATOM   336  O  O     . VAL A 1 49  ? 11.618  50.672  1.779   1.00 41.34  ? 43   VAL A O     1 
ATOM   337  C  CB    . VAL A 1 49  ? 13.251  51.930  -0.350  1.00 38.04  ? 43   VAL A CB    1 
ATOM   338  C  CG1   . VAL A 1 49  ? 12.076  52.210  -1.233  1.00 40.02  ? 43   VAL A CG1   1 
ATOM   339  C  CG2   . VAL A 1 49  ? 14.508  52.541  -0.918  1.00 38.40  ? 43   VAL A CG2   1 
ATOM   340  N  N     . ALA A 1 50  ? 10.621  52.668  1.634   1.00 40.54  ? 44   ALA A N     1 
ATOM   341  C  CA    . ALA A 1 50  ? 9.367   52.116  2.122   1.00 42.02  ? 44   ALA A CA    1 
ATOM   342  C  C     . ALA A 1 50  ? 8.500   51.585  0.995   1.00 44.21  ? 44   ALA A C     1 
ATOM   343  O  O     . ALA A 1 50  ? 7.759   50.614  1.175   1.00 44.72  ? 44   ALA A O     1 
ATOM   344  C  CB    . ALA A 1 50  ? 8.616   53.157  2.910   1.00 41.91  ? 44   ALA A CB    1 
ATOM   345  N  N     . THR A 1 51  ? 8.600   52.227  -0.167  1.00 45.33  ? 45   THR A N     1 
ATOM   346  C  CA    . THR A 1 51  ? 7.829   51.836  -1.334  1.00 45.53  ? 45   THR A CA    1 
ATOM   347  C  C     . THR A 1 51  ? 8.354   52.591  -2.538  1.00 46.29  ? 45   THR A C     1 
ATOM   348  O  O     . THR A 1 51  ? 9.331   53.342  -2.437  1.00 45.34  ? 45   THR A O     1 
ATOM   349  C  CB    . THR A 1 51  ? 6.323   52.163  -1.152  1.00 46.12  ? 45   THR A CB    1 
ATOM   350  O  OG1   . THR A 1 51  ? 5.806   51.463  -0.011  1.00 47.58  ? 45   THR A OG1   1 
ATOM   351  C  CG2   . THR A 1 51  ? 5.527   51.743  -2.378  1.00 44.65  ? 45   THR A CG2   1 
ATOM   352  N  N     . ALA A 1 52  ? 7.693   52.372  -3.676  1.00 47.30  ? 46   ALA A N     1 
ATOM   353  C  CA    . ALA A 1 52  ? 8.033   53.006  -4.949  1.00 46.68  ? 46   ALA A CA    1 
ATOM   354  C  C     . ALA A 1 52  ? 7.014   52.571  -6.003  1.00 46.40  ? 46   ALA A C     1 
ATOM   355  O  O     . ALA A 1 52  ? 6.521   51.450  -5.951  1.00 47.25  ? 46   ALA A O     1 
ATOM   356  C  CB    . ALA A 1 52  ? 9.444   52.601  -5.372  1.00 45.15  ? 46   ALA A CB    1 
ATOM   357  N  N     . ASN A 1 53  ? 6.683   53.451  -6.947  1.00 45.41  ? 47   ASN A N     1 
ATOM   358  C  CA    . ASN A 1 53  ? 5.721   53.088  -7.981  1.00 44.64  ? 47   ASN A CA    1 
ATOM   359  C  C     . ASN A 1 53  ? 6.363   52.092  -8.955  1.00 45.03  ? 47   ASN A C     1 
ATOM   360  O  O     . ASN A 1 53  ? 7.587   51.921  -8.946  1.00 44.15  ? 47   ASN A O     1 
ATOM   361  C  CB    . ASN A 1 53  ? 5.224   54.335  -8.722  1.00 42.88  ? 47   ASN A CB    1 
ATOM   362  C  CG    . ASN A 1 53  ? 6.347   55.189  -9.235  1.00 40.59  ? 47   ASN A CG    1 
ATOM   363  O  OD1   . ASN A 1 53  ? 7.430   54.690  -9.531  1.00 40.19  ? 47   ASN A OD1   1 
ATOM   364  N  ND2   . ASN A 1 53  ? 6.094   56.484  -9.366  1.00 39.39  ? 47   ASN A ND2   1 
ATOM   365  N  N     . TYR A 1 54  ? 5.546   51.432  -9.784  1.00 45.36  ? 48   TYR A N     1 
ATOM   366  C  CA    . TYR A 1 54  ? 6.077   50.444  -10.726 1.00 44.62  ? 48   TYR A CA    1 
ATOM   367  C  C     . TYR A 1 54  ? 7.064   51.071  -11.681 1.00 43.57  ? 48   TYR A C     1 
ATOM   368  O  O     . TYR A 1 54  ? 7.982   50.415  -12.171 1.00 42.15  ? 48   TYR A O     1 
ATOM   369  C  CB    . TYR A 1 54  ? 4.952   49.753  -11.495 1.00 44.05  ? 48   TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 54  ? 4.132   48.801  -10.643 1.00 43.89  ? 48   TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 54  ? 3.151   49.277  -9.774  1.00 42.90  ? 48   TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 54  ? 4.338   47.420  -10.714 1.00 43.55  ? 48   TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 54  ? 2.396   48.401  -9.004  1.00 44.47  ? 48   TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 54  ? 3.587   46.525  -9.940  1.00 43.07  ? 48   TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 54  ? 2.617   47.018  -9.089  1.00 44.49  ? 48   TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 54  ? 1.858   46.151  -8.323  1.00 43.24  ? 48   TYR A OH    1 
ATOM   377  N  N     . GLU A 1 55  ? 6.886   52.362  -11.914 1.00 44.37  ? 49   GLU A N     1 
ATOM   378  C  CA    . GLU A 1 55  ? 7.784   53.100  -12.782 1.00 46.02  ? 49   GLU A CA    1 
ATOM   379  C  C     . GLU A 1 55  ? 9.195   53.096  -12.161 1.00 47.20  ? 49   GLU A C     1 
ATOM   380  O  O     . GLU A 1 55  ? 10.195  53.238  -12.869 1.00 49.14  ? 49   GLU A O     1 
ATOM   381  C  CB    . GLU A 1 55  ? 7.294   54.544  -12.943 1.00 45.09  ? 49   GLU A CB    1 
ATOM   382  C  CG    A GLU A 1 55  ? 5.794   54.695  -13.157 0.50 46.57  ? 49   GLU A CG    1 
ATOM   383  C  CD    A GLU A 1 55  ? 5.256   53.883  -14.333 0.50 47.64  ? 49   GLU A CD    1 
ATOM   384  O  OE1   A GLU A 1 55  ? 5.879   53.900  -15.420 0.50 47.69  ? 49   GLU A OE1   1 
ATOM   385  O  OE2   A GLU A 1 55  ? 4.195   53.237  -14.171 0.50 48.03  ? 49   GLU A OE2   1 
ATOM   386  N  N     . ALA A 1 56  ? 9.275   52.932  -10.839 1.00 46.75  ? 50   ALA A N     1 
ATOM   387  C  CA    . ALA A 1 56  ? 10.560  52.918  -10.142 1.00 44.90  ? 50   ALA A CA    1 
ATOM   388  C  C     . ALA A 1 56  ? 11.077  51.515  -9.844  1.00 44.72  ? 50   ALA A C     1 
ATOM   389  O  O     . ALA A 1 56  ? 12.267  51.337  -9.602  1.00 44.12  ? 50   ALA A O     1 
ATOM   390  C  CB    . ALA A 1 56  ? 10.447  53.700  -8.859  1.00 45.88  ? 50   ALA A CB    1 
ATOM   391  N  N     . ARG A 1 57  ? 10.178  50.529  -9.851  1.00 45.15  ? 51   ARG A N     1 
ATOM   392  C  CA    . ARG A 1 57  ? 10.541  49.134  -9.596  1.00 44.48  ? 51   ARG A CA    1 
ATOM   393  C  C     . ARG A 1 57  ? 11.339  48.555  -10.755 1.00 43.79  ? 51   ARG A C     1 
ATOM   394  O  O     . ARG A 1 57  ? 12.321  47.844  -10.551 1.00 41.93  ? 51   ARG A O     1 
ATOM   395  C  CB    . ARG A 1 57  ? 9.296   48.277  -9.386  1.00 44.96  ? 51   ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 57  ? 8.680   48.347  -8.000  1.00 46.13  ? 51   ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 57  ? 7.902   47.054  -7.717  1.00 47.81  ? 51   ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 57  ? 7.105   47.125  -6.495  1.00 48.22  ? 51   ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 57  ? 6.194   48.062  -6.253  1.00 48.65  ? 51   ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 57  ? 5.973   49.009  -7.157  1.00 48.67  ? 51   ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 57  ? 5.502   48.052  -5.114  1.00 47.95  ? 51   ARG A NH2   1 
ATOM   402  N  N     . LYS A 1 58  ? 10.897  48.863  -11.970 1.00 43.62  ? 52   LYS A N     1 
ATOM   403  C  CA    . LYS A 1 58  ? 11.564  48.401  -13.174 1.00 43.79  ? 52   LYS A CA    1 
ATOM   404  C  C     . LYS A 1 58  ? 13.076  48.393  -13.014 1.00 43.89  ? 52   LYS A C     1 
ATOM   405  O  O     . LYS A 1 58  ? 13.734  47.417  -13.350 1.00 44.45  ? 52   LYS A O     1 
ATOM   406  C  CB    . LYS A 1 58  ? 11.184  49.290  -14.355 1.00 43.38  ? 52   LYS A CB    1 
ATOM   407  C  CG    . LYS A 1 58  ? 9.706   49.252  -14.687 1.00 44.39  ? 52   LYS A CG    1 
ATOM   408  C  CD    . LYS A 1 58  ? 9.462   49.379  -16.190 1.00 46.65  ? 52   LYS A CD    1 
ATOM   409  C  CE    . LYS A 1 58  ? 9.698   50.798  -16.733 1.00 48.84  ? 52   LYS A CE    1 
ATOM   410  N  NZ    . LYS A 1 58  ? 8.526   51.749  -16.551 1.00 49.07  ? 52   LYS A NZ    1 
ATOM   411  N  N     . PHE A 1 59  ? 13.636  49.468  -12.482 1.00 43.41  ? 53   PHE A N     1 
ATOM   412  C  CA    . PHE A 1 59  ? 15.072  49.511  -12.326 1.00 42.96  ? 53   PHE A CA    1 
ATOM   413  C  C     . PHE A 1 59  ? 15.587  48.892  -11.048 1.00 42.79  ? 53   PHE A C     1 
ATOM   414  O  O     . PHE A 1 59  ? 16.742  49.063  -10.712 1.00 42.32  ? 53   PHE A O     1 
ATOM   415  C  CB    . PHE A 1 59  ? 15.568  50.933  -12.428 1.00 43.25  ? 53   PHE A CB    1 
ATOM   416  C  CG    . PHE A 1 59  ? 14.989  51.673  -13.569 1.00 42.49  ? 53   PHE A CG    1 
ATOM   417  C  CD1   . PHE A 1 59  ? 13.686  52.153  -13.502 1.00 42.01  ? 53   PHE A CD1   1 
ATOM   418  C  CD2   . PHE A 1 59  ? 15.730  51.885  -14.716 1.00 42.44  ? 53   PHE A CD2   1 
ATOM   419  C  CE1   . PHE A 1 59  ? 13.124  52.840  -14.562 1.00 42.50  ? 53   PHE A CE1   1 
ATOM   420  C  CE2   . PHE A 1 59  ? 15.179  52.571  -15.788 1.00 44.07  ? 53   PHE A CE2   1 
ATOM   421  C  CZ    . PHE A 1 59  ? 13.867  53.051  -15.709 1.00 42.92  ? 53   PHE A CZ    1 
ATOM   422  N  N     . GLY A 1 60  ? 14.741  48.177  -10.325 1.00 43.07  ? 54   GLY A N     1 
ATOM   423  C  CA    . GLY A 1 60  ? 15.226  47.523  -9.126  1.00 44.23  ? 54   GLY A CA    1 
ATOM   424  C  C     . GLY A 1 60  ? 14.880  48.162  -7.798  1.00 46.37  ? 54   GLY A C     1 
ATOM   425  O  O     . GLY A 1 60  ? 14.747  47.466  -6.798  1.00 46.78  ? 54   GLY A O     1 
ATOM   426  N  N     . VAL A 1 61  ? 14.749  49.479  -7.761  1.00 47.80  ? 55   VAL A N     1 
ATOM   427  C  CA    . VAL A 1 61  ? 14.415  50.138  -6.511  1.00 49.39  ? 55   VAL A CA    1 
ATOM   428  C  C     . VAL A 1 61  ? 13.200  49.475  -5.867  1.00 51.00  ? 55   VAL A C     1 
ATOM   429  O  O     . VAL A 1 61  ? 12.073  49.894  -6.094  1.00 52.90  ? 55   VAL A O     1 
ATOM   430  C  CB    . VAL A 1 61  ? 14.119  51.627  -6.750  1.00 49.53  ? 55   VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 61  ? 13.500  52.264  -5.504  1.00 49.78  ? 55   VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 61  ? 15.403  52.336  -7.115  1.00 50.27  ? 55   VAL A CG2   1 
ATOM   433  N  N     . LYS A 1 62  ? 13.427  48.438  -5.068  1.00 51.45  ? 56   LYS A N     1 
ATOM   434  C  CA    . LYS A 1 62  ? 12.328  47.743  -4.398  1.00 52.69  ? 56   LYS A CA    1 
ATOM   435  C  C     . LYS A 1 62  ? 12.291  48.111  -2.905  1.00 52.18  ? 56   LYS A C     1 
ATOM   436  O  O     . LYS A 1 62  ? 13.330  48.328  -2.289  1.00 52.81  ? 56   LYS A O     1 
ATOM   437  C  CB    . LYS A 1 62  ? 12.488  46.223  -4.554  1.00 56.15  ? 56   LYS A CB    1 
ATOM   438  C  CG    . LYS A 1 62  ? 13.090  45.505  -3.331  1.00 59.19  ? 56   LYS A CG    1 
ATOM   439  C  CD    . LYS A 1 62  ? 14.421  44.880  -3.657  1.00 60.25  ? 56   LYS A CD    1 
ATOM   440  C  CE    . LYS A 1 62  ? 15.222  44.635  -2.377  1.00 62.30  ? 56   LYS A CE    1 
ATOM   441  N  NZ    . LYS A 1 62  ? 14.711  45.455  -1.207  1.00 60.53  ? 56   LYS A NZ    1 
ATOM   442  N  N     . ALA A 1 63  ? 11.102  48.149  -2.316  1.00 51.60  ? 57   ALA A N     1 
ATOM   443  C  CA    . ALA A 1 63  ? 10.979  48.515  -0.909  1.00 51.29  ? 57   ALA A CA    1 
ATOM   444  C  C     . ALA A 1 63  ? 11.872  47.704  0.019   1.00 51.49  ? 57   ALA A C     1 
ATOM   445  O  O     . ALA A 1 63  ? 12.010  46.495  -0.123  1.00 51.79  ? 57   ALA A O     1 
ATOM   446  C  CB    . ALA A 1 63  ? 9.528   48.410  -0.459  1.00 51.69  ? 57   ALA A CB    1 
ATOM   447  N  N     . GLY A 1 64  ? 12.482  48.401  0.973   1.00 51.97  ? 58   GLY A N     1 
ATOM   448  C  CA    . GLY A 1 64  ? 13.353  47.761  1.936   1.00 50.92  ? 58   GLY A CA    1 
ATOM   449  C  C     . GLY A 1 64  ? 14.850  47.956  1.743   1.00 50.57  ? 58   GLY A C     1 
ATOM   450  O  O     . GLY A 1 64  ? 15.628  47.711  2.675   1.00 51.34  ? 58   GLY A O     1 
ATOM   451  N  N     . ILE A 1 65  ? 15.273  48.400  0.562   1.00 48.58  ? 59   ILE A N     1 
ATOM   452  C  CA    . ILE A 1 65  ? 16.704  48.567  0.332   1.00 48.25  ? 59   ILE A CA    1 
ATOM   453  C  C     . ILE A 1 65  ? 17.277  49.897  0.806   1.00 47.85  ? 59   ILE A C     1 
ATOM   454  O  O     . ILE A 1 65  ? 16.575  50.897  0.904   1.00 47.37  ? 59   ILE A O     1 
ATOM   455  C  CB    . ILE A 1 65  ? 17.099  48.412  -1.159  1.00 48.66  ? 59   ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 65  ? 16.758  49.676  -1.942  1.00 47.77  ? 59   ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 65  ? 16.414  47.256  -1.756  1.00 49.10  ? 59   ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 65  ? 17.795  50.003  -3.002  1.00 45.18  ? 59   ILE A CD1   1 
ATOM   459  N  N     . PRO A 1 66  ? 18.585  49.921  1.097   1.00 48.17  ? 60   PRO A N     1 
ATOM   460  C  CA    . PRO A 1 66  ? 19.231  51.152  1.557   1.00 48.44  ? 60   PRO A CA    1 
ATOM   461  C  C     . PRO A 1 66  ? 19.078  52.296  0.567   1.00 48.25  ? 60   PRO A C     1 
ATOM   462  O  O     . PRO A 1 66  ? 19.373  52.145  -0.614  1.00 47.52  ? 60   PRO A O     1 
ATOM   463  C  CB    . PRO A 1 66  ? 20.690  50.732  1.718   1.00 49.39  ? 60   PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 66  ? 20.591  49.269  2.076   1.00 49.06  ? 60   PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 66  ? 19.518  48.778  1.145   1.00 47.94  ? 60   PRO A CD    1 
ATOM   466  N  N     . ILE A 1 67  ? 18.627  53.444  1.053   1.00 48.76  ? 61   ILE A N     1 
ATOM   467  C  CA    . ILE A 1 67  ? 18.456  54.619  0.194   1.00 49.61  ? 61   ILE A CA    1 
ATOM   468  C  C     . ILE A 1 67  ? 19.720  54.919  -0.630  1.00 50.43  ? 61   ILE A C     1 
ATOM   469  O  O     . ILE A 1 67  ? 19.657  55.490  -1.714  1.00 49.94  ? 61   ILE A O     1 
ATOM   470  C  CB    . ILE A 1 67  ? 18.097  55.879  1.048   1.00 49.03  ? 61   ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 67  ? 16.642  55.792  1.508   1.00 48.69  ? 61   ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 67  ? 18.362  57.162  0.268   1.00 47.26  ? 61   ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 67  ? 16.230  56.903  2.435   1.00 48.15  ? 61   ILE A CD1   1 
ATOM   474  N  N     . VAL A 1 68  ? 20.874  54.530  -0.114  1.00 52.03  ? 62   VAL A N     1 
ATOM   475  C  CA    . VAL A 1 68  ? 22.112  54.799  -0.818  1.00 52.26  ? 62   VAL A CA    1 
ATOM   476  C  C     . VAL A 1 68  ? 22.216  53.908  -2.041  1.00 53.12  ? 62   VAL A C     1 
ATOM   477  O  O     . VAL A 1 68  ? 22.831  54.279  -3.033  1.00 54.01  ? 62   VAL A O     1 
ATOM   478  C  CB    . VAL A 1 68  ? 23.317  54.585  0.114   1.00 51.98  ? 62   VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 68  ? 23.287  53.167  0.679   1.00 52.60  ? 62   VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 68  ? 24.606  54.879  -0.628  1.00 50.95  ? 62   VAL A CG2   1 
ATOM   481  N  N     . GLU A 1 69  ? 21.610  52.729  -1.975  1.00 53.04  ? 63   GLU A N     1 
ATOM   482  C  CA    . GLU A 1 69  ? 21.649  51.838  -3.114  1.00 53.78  ? 63   GLU A CA    1 
ATOM   483  C  C     . GLU A 1 69  ? 20.658  52.305  -4.153  1.00 52.54  ? 63   GLU A C     1 
ATOM   484  O  O     . GLU A 1 69  ? 20.970  52.332  -5.335  1.00 52.74  ? 63   GLU A O     1 
ATOM   485  C  CB    . GLU A 1 69  ? 21.335  50.414  -2.689  1.00 57.77  ? 63   GLU A CB    1 
ATOM   486  C  CG    . GLU A 1 69  ? 22.511  49.749  -2.005  1.00 64.46  ? 63   GLU A CG    1 
ATOM   487  C  CD    . GLU A 1 69  ? 23.850  50.125  -2.651  1.00 68.53  ? 63   GLU A CD    1 
ATOM   488  O  OE1   . GLU A 1 69  ? 23.913  50.202  -3.906  1.00 69.83  ? 63   GLU A OE1   1 
ATOM   489  O  OE2   . GLU A 1 69  ? 24.837  50.334  -1.898  1.00 70.04  ? 63   GLU A OE2   1 
ATOM   490  N  N     . ALA A 1 70  ? 19.466  52.685  -3.702  1.00 50.73  ? 64   ALA A N     1 
ATOM   491  C  CA    . ALA A 1 70  ? 18.423  53.172  -4.592  1.00 48.10  ? 64   ALA A CA    1 
ATOM   492  C  C     . ALA A 1 70  ? 18.992  54.237  -5.487  1.00 48.04  ? 64   ALA A C     1 
ATOM   493  O  O     . ALA A 1 70  ? 18.842  54.157  -6.693  1.00 48.95  ? 64   ALA A O     1 
ATOM   494  C  CB    . ALA A 1 70  ? 17.272  53.737  -3.798  1.00 46.80  ? 64   ALA A CB    1 
ATOM   495  N  N     . LYS A 1 71  ? 19.654  55.228  -4.899  1.00 49.18  ? 65   LYS A N     1 
ATOM   496  C  CA    . LYS A 1 71  ? 20.242  56.317  -5.671  1.00 50.35  ? 65   LYS A CA    1 
ATOM   497  C  C     . LYS A 1 71  ? 21.440  55.862  -6.480  1.00 51.68  ? 65   LYS A C     1 
ATOM   498  O  O     . LYS A 1 71  ? 22.101  56.666  -7.128  1.00 52.01  ? 65   LYS A O     1 
ATOM   499  C  CB    . LYS A 1 71  ? 20.627  57.466  -4.746  1.00 50.67  ? 65   LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 71  ? 19.473  58.428  -4.455  1.00 51.43  ? 65   LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 71  ? 19.684  59.180  -3.139  1.00 52.75  ? 65   LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 71  ? 18.798  60.416  -3.008  1.00 53.85  ? 65   LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 71  ? 19.203  61.549  -3.916  1.00 53.04  ? 65   LYS A NZ    1 
ATOM   504  N  N     . LYS A 1 72  ? 21.708  54.560  -6.440  1.00 52.98  ? 66   LYS A N     1 
ATOM   505  C  CA    . LYS A 1 72  ? 22.804  53.967  -7.199  1.00 54.90  ? 66   LYS A CA    1 
ATOM   506  C  C     . LYS A 1 72  ? 22.271  53.467  -8.544  1.00 56.02  ? 66   LYS A C     1 
ATOM   507  O  O     . LYS A 1 72  ? 22.993  53.420  -9.544  1.00 56.36  ? 66   LYS A O     1 
ATOM   508  C  CB    . LYS A 1 72  ? 23.428  52.809  -6.412  1.00 54.98  ? 66   LYS A CB    1 
ATOM   509  C  CG    . LYS A 1 72  ? 24.786  53.128  -5.788  1.00 55.81  ? 66   LYS A CG    1 
ATOM   510  C  CD    . LYS A 1 72  ? 24.722  54.260  -4.761  1.00 55.12  ? 66   LYS A CD    1 
ATOM   511  C  CE    . LYS A 1 72  ? 24.511  55.639  -5.392  1.00 54.82  ? 66   LYS A CE    1 
ATOM   512  N  NZ    . LYS A 1 72  ? 24.301  56.687  -4.363  1.00 53.94  ? 66   LYS A NZ    1 
ATOM   513  N  N     . ILE A 1 73  ? 20.993  53.101  -8.561  1.00 56.58  ? 67   ILE A N     1 
ATOM   514  C  CA    . ILE A 1 73  ? 20.343  52.623  -9.776  1.00 55.92  ? 67   ILE A CA    1 
ATOM   515  C  C     . ILE A 1 73  ? 19.511  53.758  -10.369 1.00 55.63  ? 67   ILE A C     1 
ATOM   516  O  O     . ILE A 1 73  ? 19.779  54.216  -11.470 1.00 56.36  ? 67   ILE A O     1 
ATOM   517  C  CB    . ILE A 1 73  ? 19.398  51.456  -9.490  1.00 55.06  ? 67   ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 73  ? 19.967  50.569  -8.396  1.00 52.43  ? 67   ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 73  ? 19.225  50.625  -10.746 1.00 56.66  ? 67   ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 73  ? 18.958  49.601  -7.876  1.00 50.76  ? 67   ILE A CD1   1 
ATOM   521  N  N     . LEU A 1 74  ? 18.491  54.194  -9.640  1.00 54.64  ? 68   LEU A N     1 
ATOM   522  C  CA    . LEU A 1 74  ? 17.644  55.287  -10.093 1.00 55.22  ? 68   LEU A CA    1 
ATOM   523  C  C     . LEU A 1 74  ? 17.989  56.581  -9.355  1.00 54.85  ? 68   LEU A C     1 
ATOM   524  O  O     . LEU A 1 74  ? 17.310  56.971  -8.403  1.00 55.32  ? 68   LEU A O     1 
ATOM   525  C  CB    . LEU A 1 74  ? 16.169  54.947  -9.867  1.00 56.08  ? 68   LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 74  ? 15.440  54.150  -10.943 1.00 57.10  ? 68   LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 74  ? 14.069  53.716  -10.427 1.00 57.69  ? 68   LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 74  ? 15.305  55.012  -12.198 1.00 57.88  ? 68   LEU A CD2   1 
ATOM   529  N  N     . PRO A 1 75  ? 19.051  57.270  -9.787  1.00 53.95  ? 69   PRO A N     1 
ATOM   530  C  CA    . PRO A 1 75  ? 19.465  58.519  -9.152  1.00 53.58  ? 69   PRO A CA    1 
ATOM   531  C  C     . PRO A 1 75  ? 18.559  59.708  -9.491  1.00 52.87  ? 69   PRO A C     1 
ATOM   532  O  O     . PRO A 1 75  ? 18.351  60.595  -8.660  1.00 52.66  ? 69   PRO A O     1 
ATOM   533  C  CB    . PRO A 1 75  ? 20.870  58.714  -9.695  1.00 53.37  ? 69   PRO A CB    1 
ATOM   534  C  CG    . PRO A 1 75  ? 20.724  58.247  -11.078 1.00 53.25  ? 69   PRO A CG    1 
ATOM   535  C  CD    . PRO A 1 75  ? 19.945  56.953  -10.910 1.00 54.20  ? 69   PRO A CD    1 
ATOM   536  N  N     . ASN A 1 76  ? 18.035  59.721  -10.716 1.00 52.59  ? 70   ASN A N     1 
ATOM   537  C  CA    . ASN A 1 76  ? 17.168  60.798  -11.188 1.00 50.42  ? 70   ASN A CA    1 
ATOM   538  C  C     . ASN A 1 76  ? 15.748  60.688  -10.671 1.00 48.15  ? 70   ASN A C     1 
ATOM   539  O  O     . ASN A 1 76  ? 15.009  61.663  -10.722 1.00 47.57  ? 70   ASN A O     1 
ATOM   540  C  CB    A ASN A 1 76  ? 17.133  60.827  -12.720 0.50 52.70  ? 70   ASN A CB    1 
ATOM   541  C  CG    A ASN A 1 76  ? 16.186  61.893  -13.266 0.50 54.72  ? 70   ASN A CG    1 
ATOM   542  O  OD1   A ASN A 1 76  ? 16.442  63.093  -13.141 0.50 56.20  ? 70   ASN A OD1   1 
ATOM   543  N  ND2   A ASN A 1 76  ? 15.083  61.455  -13.870 0.50 55.36  ? 70   ASN A ND2   1 
ATOM   544  N  N     . ALA A 1 77  ? 15.371  59.505  -10.185 1.00 46.12  ? 71   ALA A N     1 
ATOM   545  C  CA    . ALA A 1 77  ? 14.027  59.261  -9.654  1.00 44.11  ? 71   ALA A CA    1 
ATOM   546  C  C     . ALA A 1 77  ? 13.562  60.392  -8.737  1.00 43.04  ? 71   ALA A C     1 
ATOM   547  O  O     . ALA A 1 77  ? 14.235  61.395  -8.602  1.00 44.81  ? 71   ALA A O     1 
ATOM   548  C  CB    . ALA A 1 77  ? 14.000  57.943  -8.911  1.00 42.83  ? 71   ALA A CB    1 
ATOM   549  N  N     . VAL A 1 78  ? 12.409  60.239  -8.104  1.00 42.39  ? 72   VAL A N     1 
ATOM   550  C  CA    . VAL A 1 78  ? 11.904  61.282  -7.215  1.00 40.98  ? 72   VAL A CA    1 
ATOM   551  C  C     . VAL A 1 78  ? 11.776  60.727  -5.809  1.00 41.85  ? 72   VAL A C     1 
ATOM   552  O  O     . VAL A 1 78  ? 10.837  59.980  -5.539  1.00 41.34  ? 72   VAL A O     1 
ATOM   553  C  CB    . VAL A 1 78  ? 10.522  61.736  -7.642  1.00 40.03  ? 72   VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 78  ? 10.337  63.206  -7.310  1.00 39.62  ? 72   VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 78  ? 10.330  61.462  -9.121  1.00 40.87  ? 72   VAL A CG2   1 
ATOM   556  N  N     . TYR A 1 79  ? 12.703  61.087  -4.915  1.00 42.76  ? 73   TYR A N     1 
ATOM   557  C  CA    . TYR A 1 79  ? 12.657  60.588  -3.538  1.00 41.77  ? 73   TYR A CA    1 
ATOM   558  C  C     . TYR A 1 79  ? 11.846  61.484  -2.621  1.00 42.09  ? 73   TYR A C     1 
ATOM   559  O  O     . TYR A 1 79  ? 12.123  62.667  -2.461  1.00 42.65  ? 73   TYR A O     1 
ATOM   560  C  CB    . TYR A 1 79  ? 14.068  60.394  -2.980  1.00 40.67  ? 73   TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 79  ? 14.853  59.335  -3.719  1.00 41.10  ? 73   TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 79  ? 15.744  59.683  -4.722  1.00 40.22  ? 73   TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 79  ? 14.630  57.976  -3.484  1.00 41.65  ? 73   TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 79  ? 16.385  58.713  -5.478  1.00 41.37  ? 73   TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 79  ? 15.266  57.001  -4.241  1.00 41.21  ? 73   TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 79  ? 16.137  57.384  -5.239  1.00 41.35  ? 73   TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 79  ? 16.715  56.454  -6.054  1.00 41.78  ? 73   TYR A OH    1 
ATOM   568  N  N     . LEU A 1 80  ? 10.816  60.901  -2.033  1.00 42.89  ? 74   LEU A N     1 
ATOM   569  C  CA    . LEU A 1 80  ? 9.943   61.644  -1.155  1.00 43.44  ? 74   LEU A CA    1 
ATOM   570  C  C     . LEU A 1 80  ? 9.905   60.999  0.203   1.00 42.89  ? 74   LEU A C     1 
ATOM   571  O  O     . LEU A 1 80  ? 9.819   59.778  0.324   1.00 43.05  ? 74   LEU A O     1 
ATOM   572  C  CB    . LEU A 1 80  ? 8.534   61.695  -1.734  1.00 46.18  ? 74   LEU A CB    1 
ATOM   573  C  CG    . LEU A 1 80  ? 8.360   62.440  -3.066  1.00 48.31  ? 74   LEU A CG    1 
ATOM   574  C  CD1   . LEU A 1 80  ? 6.877   62.504  -3.413  1.00 49.93  ? 74   LEU A CD1   1 
ATOM   575  C  CD2   . LEU A 1 80  ? 8.935   63.857  -2.959  1.00 48.82  ? 74   LEU A CD2   1 
ATOM   576  N  N     . PRO A 1 81  ? 9.966   61.820  1.252   1.00 42.33  ? 75   PRO A N     1 
ATOM   577  C  CA    . PRO A 1 81  ? 9.940   61.341  2.630   1.00 41.83  ? 75   PRO A CA    1 
ATOM   578  C  C     . PRO A 1 81  ? 8.636   60.618  2.937   1.00 42.41  ? 75   PRO A C     1 
ATOM   579  O  O     . PRO A 1 81  ? 7.594   60.948  2.377   1.00 42.12  ? 75   PRO A O     1 
ATOM   580  C  CB    . PRO A 1 81  ? 10.094  62.625  3.419   1.00 41.37  ? 75   PRO A CB    1 
ATOM   581  C  CG    . PRO A 1 81  ? 9.376   63.605  2.565   1.00 38.79  ? 75   PRO A CG    1 
ATOM   582  C  CD    . PRO A 1 81  ? 9.931   63.291  1.220   1.00 40.43  ? 75   PRO A CD    1 
ATOM   583  N  N     . MET A 1 82  ? 8.704   59.627  3.820   1.00 43.12  ? 76   MET A N     1 
ATOM   584  C  CA    . MET A 1 82  ? 7.526   58.847  4.191   1.00 44.00  ? 76   MET A CA    1 
ATOM   585  C  C     . MET A 1 82  ? 6.626   59.618  5.145   1.00 42.88  ? 76   MET A C     1 
ATOM   586  O  O     . MET A 1 82  ? 7.117   60.348  5.981   1.00 44.64  ? 76   MET A O     1 
ATOM   587  C  CB    . MET A 1 82  ? 7.957   57.523  4.820   1.00 44.47  ? 76   MET A CB    1 
ATOM   588  C  CG    . MET A 1 82  ? 7.201   56.337  4.263   1.00 47.82  ? 76   MET A CG    1 
ATOM   589  S  SD    . MET A 1 82  ? 6.471   55.316  5.551   1.00 49.98  ? 76   MET A SD    1 
ATOM   590  C  CE    . MET A 1 82  ? 5.459   56.519  6.309   1.00 49.55  ? 76   MET A CE    1 
ATOM   591  N  N     . ARG A 1 83  ? 5.311   59.460  5.010   1.00 43.30  ? 77   ARG A N     1 
ATOM   592  C  CA    . ARG A 1 83  ? 4.341   60.170  5.855   1.00 43.14  ? 77   ARG A CA    1 
ATOM   593  C  C     . ARG A 1 83  ? 3.178   59.259  6.225   1.00 42.60  ? 77   ARG A C     1 
ATOM   594  O  O     . ARG A 1 83  ? 2.078   59.407  5.717   1.00 42.72  ? 77   ARG A O     1 
ATOM   595  C  CB    . ARG A 1 83  ? 3.802   61.394  5.119   1.00 43.41  ? 77   ARG A CB    1 
ATOM   596  C  CG    . ARG A 1 83  ? 4.885   62.255  4.547   1.00 46.16  ? 77   ARG A CG    1 
ATOM   597  C  CD    . ARG A 1 83  ? 4.365   63.585  4.042   1.00 49.82  ? 77   ARG A CD    1 
ATOM   598  N  NE    . ARG A 1 83  ? 3.592   63.496  2.807   1.00 52.59  ? 77   ARG A NE    1 
ATOM   599  C  CZ    . ARG A 1 83  ? 3.017   64.543  2.217   1.00 53.71  ? 77   ARG A CZ    1 
ATOM   600  N  NH1   . ARG A 1 83  ? 3.126   65.754  2.750   1.00 53.12  ? 77   ARG A NH1   1 
ATOM   601  N  NH2   . ARG A 1 83  ? 2.332   64.386  1.093   1.00 54.63  ? 77   ARG A NH2   1 
ATOM   602  N  N     . LYS A 1 84  ? 3.441   58.324  7.124   1.00 42.79  ? 78   LYS A N     1 
ATOM   603  C  CA    . LYS A 1 84  ? 2.464   57.342  7.583   1.00 43.15  ? 78   LYS A CA    1 
ATOM   604  C  C     . LYS A 1 84  ? 1.165   57.958  8.049   1.00 41.75  ? 78   LYS A C     1 
ATOM   605  O  O     . LYS A 1 84  ? 0.132   57.307  8.069   1.00 41.20  ? 78   LYS A O     1 
ATOM   606  C  CB    . LYS A 1 84  ? 3.090   56.513  8.713   1.00 45.98  ? 78   LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 84  ? 2.247   55.375  9.290   1.00 47.85  ? 78   LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 84  ? 1.902   54.341  8.234   1.00 49.95  ? 78   LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 84  ? 1.877   52.960  8.832   1.00 49.78  ? 78   LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 84  ? 2.863   52.116  8.117   1.00 52.96  ? 78   LYS A NZ    1 
ATOM   611  N  N     . GLU A 1 85  ? 1.221   59.221  8.425   1.00 41.45  ? 79   GLU A N     1 
ATOM   612  C  CA    . GLU A 1 85  ? 0.036   59.914  8.893   1.00 42.30  ? 79   GLU A CA    1 
ATOM   613  C  C     . GLU A 1 85  ? -0.929  60.133  7.720   1.00 41.37  ? 79   GLU A C     1 
ATOM   614  O  O     . GLU A 1 85  ? -2.124  59.869  7.824   1.00 40.38  ? 79   GLU A O     1 
ATOM   615  C  CB    . GLU A 1 85  ? 0.430   61.267  9.488   1.00 45.47  ? 79   GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 85  ? 1.783   61.308  10.231  1.00 49.95  ? 79   GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 85  ? 3.013   61.492  9.316   1.00 51.67  ? 79   GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 85  ? 2.993   62.349  8.404   1.00 52.01  ? 79   GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 85  ? 4.021   60.787  9.534   1.00 52.78  ? 79   GLU A OE2   1 
ATOM   620  N  N     . VAL A 1 86  ? -0.396  60.629  6.605   1.00 40.56  ? 80   VAL A N     1 
ATOM   621  C  CA    . VAL A 1 86  ? -1.181  60.906  5.400   1.00 38.70  ? 80   VAL A CA    1 
ATOM   622  C  C     . VAL A 1 86  ? -1.858  59.667  4.833   1.00 38.12  ? 80   VAL A C     1 
ATOM   623  O  O     . VAL A 1 86  ? -3.043  59.698  4.497   1.00 37.86  ? 80   VAL A O     1 
ATOM   624  C  CB    . VAL A 1 86  ? -0.299  61.510  4.292   1.00 38.63  ? 80   VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 86  ? -1.078  61.595  2.993   1.00 35.75  ? 80   VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 86  ? 0.209   62.878  4.727   1.00 38.37  ? 80   VAL A CG2   1 
ATOM   627  N  N     . TYR A 1 87  ? -1.095  58.585  4.723   1.00 36.06  ? 81   TYR A N     1 
ATOM   628  C  CA    . TYR A 1 87  ? -1.612  57.340  4.192   1.00 34.63  ? 81   TYR A CA    1 
ATOM   629  C  C     . TYR A 1 87  ? -2.628  56.741  5.147   1.00 34.48  ? 81   TYR A C     1 
ATOM   630  O  O     . TYR A 1 87  ? -3.728  56.390  4.762   1.00 33.98  ? 81   TYR A O     1 
ATOM   631  C  CB    . TYR A 1 87  ? -0.476  56.358  3.975   1.00 33.79  ? 81   TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 87  ? 0.794   56.993  3.469   1.00 35.17  ? 81   TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 87  ? 0.765   58.023  2.540   1.00 34.61  ? 81   TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 87  ? 2.039   56.541  3.910   1.00 36.68  ? 81   TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 87  ? 1.945   58.589  2.065   1.00 37.19  ? 81   TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 87  ? 3.232   57.096  3.438   1.00 36.23  ? 81   TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 87  ? 3.179   58.121  2.517   1.00 38.13  ? 81   TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 87  ? 4.353   58.682  2.048   1.00 40.44  ? 81   TYR A OH    1 
ATOM   639  N  N     . GLN A 1 88  ? -2.256  56.618  6.407   1.00 35.41  ? 82   GLN A N     1 
ATOM   640  C  CA    . GLN A 1 88  ? -3.171  56.061  7.392   1.00 36.06  ? 82   GLN A CA    1 
ATOM   641  C  C     . GLN A 1 88  ? -4.626  56.535  7.173   1.00 36.25  ? 82   GLN A C     1 
ATOM   642  O  O     . GLN A 1 88  ? -5.557  55.713  7.139   1.00 35.63  ? 82   GLN A O     1 
ATOM   643  C  CB    . GLN A 1 88  ? -2.679  56.434  8.800   1.00 35.56  ? 82   GLN A CB    1 
ATOM   644  C  CG    A GLN A 1 88  ? -3.616  56.057  9.914   0.50 34.64  ? 82   GLN A CG    1 
ATOM   645  C  CD    A GLN A 1 88  ? -3.831  54.573  9.972   0.50 34.78  ? 82   GLN A CD    1 
ATOM   646  O  OE1   A GLN A 1 88  ? -2.883  53.805  10.136  0.50 35.05  ? 82   GLN A OE1   1 
ATOM   647  N  NE2   A GLN A 1 88  ? -5.081  54.153  9.828   0.50 34.41  ? 82   GLN A NE2   1 
ATOM   648  N  N     . GLN A 1 89  ? -4.808  57.850  7.016   1.00 35.59  ? 83   GLN A N     1 
ATOM   649  C  CA    . GLN A 1 89  ? -6.129  58.434  6.823   1.00 35.55  ? 83   GLN A CA    1 
ATOM   650  C  C     . GLN A 1 89  ? -6.797  57.943  5.540   1.00 34.67  ? 83   GLN A C     1 
ATOM   651  O  O     . GLN A 1 89  ? -7.962  57.528  5.553   1.00 35.29  ? 83   GLN A O     1 
ATOM   652  C  CB    . GLN A 1 89  ? -6.046  59.962  6.817   1.00 37.97  ? 83   GLN A CB    1 
ATOM   653  C  CG    . GLN A 1 89  ? -5.875  60.608  8.192   1.00 41.51  ? 83   GLN A CG    1 
ATOM   654  C  CD    . GLN A 1 89  ? -6.940  60.190  9.218   1.00 43.87  ? 83   GLN A CD    1 
ATOM   655  O  OE1   . GLN A 1 89  ? -8.138  60.350  8.992   1.00 45.03  ? 83   GLN A OE1   1 
ATOM   656  N  NE2   . GLN A 1 89  ? -6.493  59.664  10.356  1.00 44.85  ? 83   GLN A NE2   1 
ATOM   657  N  N     . VAL A 1 90  ? -6.076  58.008  4.425   1.00 31.73  ? 84   VAL A N     1 
ATOM   658  C  CA    . VAL A 1 90  ? -6.618  57.512  3.166   1.00 28.12  ? 84   VAL A CA    1 
ATOM   659  C  C     . VAL A 1 90  ? -7.156  56.096  3.455   1.00 28.76  ? 84   VAL A C     1 
ATOM   660  O  O     . VAL A 1 90  ? -8.367  55.873  3.486   1.00 28.48  ? 84   VAL A O     1 
ATOM   661  C  CB    . VAL A 1 90  ? -5.526  57.399  2.113   1.00 25.75  ? 84   VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 90  ? -6.103  56.919  0.843   1.00 25.50  ? 84   VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 90  ? -4.846  58.698  1.937   1.00 24.50  ? 84   VAL A CG2   1 
ATOM   664  N  N     . SER A 1 91  ? -6.241  55.156  3.690   1.00 27.11  ? 85   SER A N     1 
ATOM   665  C  CA    . SER A 1 91  ? -6.595  53.783  3.995   1.00 27.05  ? 85   SER A CA    1 
ATOM   666  C  C     . SER A 1 91  ? -7.798  53.711  4.878   1.00 27.85  ? 85   SER A C     1 
ATOM   667  O  O     . SER A 1 91  ? -8.726  52.958  4.626   1.00 25.59  ? 85   SER A O     1 
ATOM   668  C  CB    . SER A 1 91  ? -5.461  53.083  4.725   1.00 28.71  ? 85   SER A CB    1 
ATOM   669  O  OG    . SER A 1 91  ? -5.965  51.983  5.468   1.00 27.32  ? 85   SER A OG    1 
ATOM   670  N  N     . SER A 1 92  ? -7.761  54.491  5.947   1.00 31.63  ? 86   SER A N     1 
ATOM   671  C  CA    . SER A 1 92  ? -8.857  54.507  6.904   1.00 35.35  ? 86   SER A CA    1 
ATOM   672  C  C     . SER A 1 92  ? -10.194 54.791  6.201   1.00 35.21  ? 86   SER A C     1 
ATOM   673  O  O     . SER A 1 92  ? -11.263 54.352  6.647   1.00 35.01  ? 86   SER A O     1 
ATOM   674  C  CB    . SER A 1 92  ? -8.580  55.552  7.990   1.00 35.52  ? 86   SER A CB    1 
ATOM   675  O  OG    . SER A 1 92  ? -9.290  55.219  9.169   1.00 38.35  ? 86   SER A OG    1 
ATOM   676  N  N     . ARG A 1 93  ? -10.123 55.505  5.082   1.00 34.61  ? 87   ARG A N     1 
ATOM   677  C  CA    . ARG A 1 93  ? -11.326 55.843  4.328   1.00 34.59  ? 87   ARG A CA    1 
ATOM   678  C  C     . ARG A 1 93  ? -11.827 54.713  3.428   1.00 33.31  ? 87   ARG A C     1 
ATOM   679  O  O     . ARG A 1 93  ? -13.015 54.381  3.424   1.00 32.74  ? 87   ARG A O     1 
ATOM   680  C  CB    . ARG A 1 93  ? -11.087 57.117  3.510   1.00 33.58  ? 87   ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 93  ? -11.180 58.363  4.339   1.00 32.76  ? 87   ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 93  ? -11.216 59.558  3.482   1.00 36.39  ? 87   ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 93  ? -9.928  59.875  2.862   1.00 40.12  ? 87   ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 93  ? -8.973  60.604  3.436   1.00 40.48  ? 87   ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 93  ? -9.139  61.092  4.654   1.00 41.20  ? 87   ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 93  ? -7.863  60.877  2.777   1.00 41.01  ? 87   ARG A NH2   1 
ATOM   687  N  N     . ILE A 1 94  ? -10.902 54.134  2.673   1.00 32.30  ? 88   ILE A N     1 
ATOM   688  C  CA    . ILE A 1 94  ? -11.196 53.030  1.769   1.00 32.35  ? 88   ILE A CA    1 
ATOM   689  C  C     . ILE A 1 94  ? -11.752 51.821  2.529   1.00 34.74  ? 88   ILE A C     1 
ATOM   690  O  O     . ILE A 1 94  ? -12.666 51.158  2.081   1.00 36.14  ? 88   ILE A O     1 
ATOM   691  C  CB    . ILE A 1 94  ? -9.921  52.574  1.005   1.00 28.18  ? 88   ILE A CB    1 
ATOM   692  C  CG1   . ILE A 1 94  ? -9.291  53.764  0.262   1.00 24.33  ? 88   ILE A CG1   1 
ATOM   693  C  CG2   . ILE A 1 94  ? -10.268 51.439  0.082   1.00 27.83  ? 88   ILE A CG2   1 
ATOM   694  C  CD1   . ILE A 1 94  ? -8.313  53.415  -0.821  1.00 15.21  ? 88   ILE A CD1   1 
ATOM   695  N  N     . MET A 1 95  ? -11.188 51.525  3.683   1.00 37.99  ? 89   MET A N     1 
ATOM   696  C  CA    . MET A 1 95  ? -11.652 50.394  4.452   1.00 41.10  ? 89   MET A CA    1 
ATOM   697  C  C     . MET A 1 95  ? -13.136 50.542  4.761   1.00 43.99  ? 89   MET A C     1 
ATOM   698  O  O     . MET A 1 95  ? -13.895 49.566  4.739   1.00 44.79  ? 89   MET A O     1 
ATOM   699  C  CB    . MET A 1 95  ? -10.832 50.298  5.742   1.00 40.71  ? 89   MET A CB    1 
ATOM   700  C  CG    . MET A 1 95  ? -10.071 48.973  5.911   1.00 41.85  ? 89   MET A CG    1 
ATOM   701  S  SD    . MET A 1 95  ? -9.113  48.400  4.481   1.00 42.61  ? 89   MET A SD    1 
ATOM   702  C  CE    . MET A 1 95  ? -7.529  48.860  4.930   1.00 42.59  ? 89   MET A CE    1 
ATOM   703  N  N     . ASN A 1 96  ? -13.549 51.778  5.031   1.00 47.29  ? 90   ASN A N     1 
ATOM   704  C  CA    . ASN A 1 96  ? -14.939 52.054  5.382   1.00 49.77  ? 90   ASN A CA    1 
ATOM   705  C  C     . ASN A 1 96  ? -15.926 51.753  4.251   1.00 49.81  ? 90   ASN A C     1 
ATOM   706  O  O     . ASN A 1 96  ? -17.018 51.246  4.496   1.00 51.24  ? 90   ASN A O     1 
ATOM   707  C  CB    . ASN A 1 96  ? -15.087 53.500  5.890   1.00 51.77  ? 90   ASN A CB    1 
ATOM   708  C  CG    . ASN A 1 96  ? -15.348 53.570  7.413   1.00 54.99  ? 90   ASN A CG    1 
ATOM   709  O  OD1   . ASN A 1 96  ? -14.438 53.387  8.241   1.00 54.05  ? 90   ASN A OD1   1 
ATOM   710  N  ND2   . ASN A 1 96  ? -16.605 53.824  7.778   1.00 56.39  ? 90   ASN A ND2   1 
ATOM   711  N  N     . LEU A 1 97  ? -15.555 52.049  3.014   1.00 48.72  ? 91   LEU A N     1 
ATOM   712  C  CA    . LEU A 1 97  ? -16.449 51.741  1.911   1.00 48.37  ? 91   LEU A CA    1 
ATOM   713  C  C     . LEU A 1 97  ? -16.733 50.239  1.919   1.00 49.40  ? 91   LEU A C     1 
ATOM   714  O  O     . LEU A 1 97  ? -17.872 49.826  2.158   1.00 50.00  ? 91   LEU A O     1 
ATOM   715  C  CB    . LEU A 1 97  ? -15.825 52.152  0.576   1.00 48.42  ? 91   LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 97  ? -15.874 53.643  0.208   1.00 49.92  ? 91   LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 97  ? -15.037 53.904  -1.039  1.00 49.95  ? 91   LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 97  ? -17.325 54.058  -0.033  1.00 49.20  ? 91   LEU A CD2   1 
ATOM   719  N  N     . LEU A 1 98  ? -15.687 49.435  1.686   1.00 49.12  ? 92   LEU A N     1 
ATOM   720  C  CA    . LEU A 1 98  ? -15.783 47.971  1.640   1.00 47.36  ? 92   LEU A CA    1 
ATOM   721  C  C     . LEU A 1 98  ? -16.657 47.487  2.765   1.00 49.10  ? 92   LEU A C     1 
ATOM   722  O  O     . LEU A 1 98  ? -17.329 46.471  2.659   1.00 48.35  ? 92   LEU A O     1 
ATOM   723  C  CB    . LEU A 1 98  ? -14.409 47.345  1.803   1.00 43.88  ? 92   LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 98  ? -13.265 48.051  1.099   1.00 42.43  ? 92   LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 98  ? -12.021 47.910  1.954   1.00 43.55  ? 92   LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 98  ? -13.039 47.479  -0.272  1.00 40.77  ? 92   LEU A CD2   1 
ATOM   727  N  N     . ARG A 1 99  ? -16.629 48.238  3.852   1.00 52.79  ? 93   ARG A N     1 
ATOM   728  C  CA    . ARG A 1 99  ? -17.404 47.913  5.024   1.00 57.81  ? 93   ARG A CA    1 
ATOM   729  C  C     . ARG A 1 99  ? -18.899 47.924  4.746   1.00 59.09  ? 93   ARG A C     1 
ATOM   730  O  O     . ARG A 1 99  ? -19.670 47.352  5.519   1.00 59.36  ? 93   ARG A O     1 
ATOM   731  C  CB    . ARG A 1 99  ? -17.075 48.895  6.141   1.00 61.84  ? 93   ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 99  ? -17.714 48.560  7.484   1.00 68.21  ? 93   ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 99  ? -16.638 48.400  8.556   1.00 72.43  ? 93   ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 99  ? -15.771 49.576  8.618   1.00 76.30  ? 93   ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 99  ? -14.556 49.585  9.156   1.00 77.21  ? 93   ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 99  ? -14.057 48.473  9.681   1.00 76.72  ? 93   ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 99  ? -13.839 50.705  9.162   1.00 78.45  ? 93   ARG A NH2   1 
ATOM   738  N  N     . GLU A 1 100 ? -19.315 48.568  3.654   1.00 60.93  ? 94   GLU A N     1 
ATOM   739  C  CA    . GLU A 1 100 ? -20.742 48.624  3.297   1.00 62.68  ? 94   GLU A CA    1 
ATOM   740  C  C     . GLU A 1 100 ? -21.161 47.469  2.384   1.00 62.77  ? 94   GLU A C     1 
ATOM   741  O  O     . GLU A 1 100 ? -22.336 47.093  2.326   1.00 61.70  ? 94   GLU A O     1 
ATOM   742  C  CB    A GLU A 1 100 ? -21.081 49.947  2.609   0.50 62.60  ? 94   GLU A CB    1 
ATOM   743  C  CG    A GLU A 1 100 ? -22.577 50.161  2.365   0.50 63.34  ? 94   GLU A CG    1 
ATOM   744  C  CD    A GLU A 1 100 ? -23.362 50.364  3.650   0.50 63.94  ? 94   GLU A CD    1 
ATOM   745  O  OE1   A GLU A 1 100 ? -22.728 50.652  4.688   0.50 63.80  ? 94   GLU A OE1   1 
ATOM   746  O  OE2   A GLU A 1 100 ? -24.610 50.253  3.618   0.50 64.39  ? 94   GLU A OE2   1 
ATOM   747  N  N     . TYR A 1 101 ? -20.184 46.910  1.678   1.00 64.12  ? 95   TYR A N     1 
ATOM   748  C  CA    . TYR A 1 101 ? -20.430 45.796  0.776   1.00 65.39  ? 95   TYR A CA    1 
ATOM   749  C  C     . TYR A 1 101 ? -20.561 44.466  1.520   1.00 65.80  ? 95   TYR A C     1 
ATOM   750  O  O     . TYR A 1 101 ? -21.278 43.569  1.068   1.00 66.53  ? 95   TYR A O     1 
ATOM   751  C  CB    . TYR A 1 101 ? -19.322 45.708  -0.280  1.00 65.15  ? 95   TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 101 ? -19.268 46.916  -1.181  1.00 65.46  ? 95   TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 101 ? -18.730 48.117  -0.731  1.00 66.53  ? 95   TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 101 ? -19.787 46.870  -2.472  1.00 65.68  ? 95   TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 101 ? -18.706 49.253  -1.550  1.00 66.90  ? 95   TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 101 ? -19.771 47.998  -3.299  1.00 66.02  ? 95   TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 101 ? -19.228 49.184  -2.832  1.00 66.14  ? 95   TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 101 ? -19.190 50.294  -3.641  1.00 64.19  ? 95   TYR A OH    1 
ATOM   759  N  N     . SER A 1 102 ? -19.874 44.316  2.649   1.00 65.13  ? 96   SER A N     1 
ATOM   760  C  CA    . SER A 1 102 ? -20.008 43.070  3.401   1.00 65.26  ? 96   SER A CA    1 
ATOM   761  C  C     . SER A 1 102 ? -19.747 43.262  4.884   1.00 64.24  ? 96   SER A C     1 
ATOM   762  O  O     . SER A 1 102 ? -18.728 43.817  5.282   1.00 65.29  ? 96   SER A O     1 
ATOM   763  C  CB    . SER A 1 102 ? -19.086 41.969  2.838   1.00 65.26  ? 96   SER A CB    1 
ATOM   764  O  OG    . SER A 1 102 ? -17.731 42.156  3.202   1.00 65.80  ? 96   SER A OG    1 
ATOM   765  N  N     . GLU A 1 103 ? -20.686 42.810  5.702   1.00 62.42  ? 97   GLU A N     1 
ATOM   766  C  CA    . GLU A 1 103 ? -20.548 42.922  7.142   1.00 61.97  ? 97   GLU A CA    1 
ATOM   767  C  C     . GLU A 1 103 ? -19.263 42.245  7.609   1.00 61.68  ? 97   GLU A C     1 
ATOM   768  O  O     . GLU A 1 103 ? -18.489 42.840  8.354   1.00 62.13  ? 97   GLU A O     1 
ATOM   769  C  CB    A GLU A 1 103 ? -21.754 42.285  7.838   0.50 61.32  ? 97   GLU A CB    1 
ATOM   770  C  CG    A GLU A 1 103 ? -22.226 40.997  7.182   0.50 61.01  ? 97   GLU A CG    1 
ATOM   771  C  CD    A GLU A 1 103 ? -23.031 41.235  5.912   0.50 60.73  ? 97   GLU A CD    1 
ATOM   772  O  OE1   A GLU A 1 103 ? -22.954 42.348  5.342   0.50 60.32  ? 97   GLU A OE1   1 
ATOM   773  O  OE2   A GLU A 1 103 ? -23.739 40.298  5.481   0.50 59.98  ? 97   GLU A OE2   1 
ATOM   774  N  N     . LYS A 1 104 ? -19.046 41.009  7.146   1.00 61.17  ? 98   LYS A N     1 
ATOM   775  C  CA    . LYS A 1 104 ? -17.877 40.182  7.492   1.00 58.87  ? 98   LYS A CA    1 
ATOM   776  C  C     . LYS A 1 104 ? -16.624 40.680  6.775   1.00 56.94  ? 98   LYS A C     1 
ATOM   777  O  O     . LYS A 1 104 ? -16.341 40.260  5.652   1.00 57.97  ? 98   LYS A O     1 
ATOM   778  C  CB    . LYS A 1 104 ? -18.139 38.724  7.091   1.00 58.91  ? 98   LYS A CB    1 
ATOM   779  C  CG    . LYS A 1 104 ? -19.447 38.140  7.636   1.00 59.38  ? 98   LYS A CG    1 
ATOM   780  C  CD    . LYS A 1 104 ? -19.790 36.784  7.010   1.00 59.03  ? 98   LYS A CD    1 
ATOM   781  C  CE    . LYS A 1 104 ? -20.959 36.106  7.728   1.00 58.91  ? 98   LYS A CE    1 
ATOM   782  N  NZ    . LYS A 1 104 ? -22.224 36.893  7.684   1.00 58.08  ? 98   LYS A NZ    1 
ATOM   783  N  N     . ILE A 1 105 ? -15.875 41.564  7.432   1.00 52.98  ? 99   ILE A N     1 
ATOM   784  C  CA    . ILE A 1 105 ? -14.667 42.138  6.849   1.00 48.19  ? 99   ILE A CA    1 
ATOM   785  C  C     . ILE A 1 105 ? -13.488 41.912  7.795   1.00 46.01  ? 99   ILE A C     1 
ATOM   786  O  O     . ILE A 1 105 ? -13.676 41.806  9.013   1.00 45.81  ? 99   ILE A O     1 
ATOM   787  C  CB    . ILE A 1 105 ? -14.894 43.668  6.569   1.00 47.86  ? 99   ILE A CB    1 
ATOM   788  C  CG1   . ILE A 1 105 ? -13.610 44.361  6.107   1.00 46.04  ? 99   ILE A CG1   1 
ATOM   789  C  CG2   . ILE A 1 105 ? -15.420 44.346  7.806   1.00 47.60  ? 99   ILE A CG2   1 
ATOM   790  C  CD1   . ILE A 1 105 ? -13.266 44.147  4.669   1.00 44.40  ? 99   ILE A CD1   1 
ATOM   791  N  N     . GLU A 1 106 ? -12.285 41.826  7.227   1.00 42.69  ? 100  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 106 ? -11.070 41.610  8.004   1.00 41.08  ? 100  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 106 ? -9.905  42.378  7.432   1.00 39.87  ? 100  GLU A C     1 
ATOM   794  O  O     . GLU A 1 106 ? -9.335  41.978  6.416   1.00 38.75  ? 100  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 106 ? -10.695 40.134  8.005   1.00 43.17  ? 100  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 106 ? -9.288  39.850  8.526   1.00 45.10  ? 100  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 106 ? -8.831  38.432  8.248   1.00 46.70  ? 100  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 106 ? -8.142  38.206  7.233   1.00 46.78  ? 100  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 106 ? -9.169  37.532  9.042   1.00 49.52  ? 100  GLU A OE2   1 
ATOM   800  N  N     . ILE A 1 107 ? -9.523  43.459  8.096   1.00 38.98  ? 101  ILE A N     1 
ATOM   801  C  CA    . ILE A 1 107 ? -8.406  44.278  7.622   1.00 39.19  ? 101  ILE A CA    1 
ATOM   802  C  C     . ILE A 1 107 ? -7.055  43.705  8.068   1.00 38.08  ? 101  ILE A C     1 
ATOM   803  O  O     . ILE A 1 107 ? -6.791  43.599  9.253   1.00 39.36  ? 101  ILE A O     1 
ATOM   804  C  CB    . ILE A 1 107 ? -8.530  45.700  8.159   1.00 39.17  ? 101  ILE A CB    1 
ATOM   805  C  CG1   . ILE A 1 107 ? -9.981  46.162  8.068   1.00 37.89  ? 101  ILE A CG1   1 
ATOM   806  C  CG2   . ILE A 1 107 ? -7.643  46.608  7.370   1.00 40.37  ? 101  ILE A CG2   1 
ATOM   807  C  CD1   . ILE A 1 107 ? -10.237 47.436  8.817   1.00 40.78  ? 101  ILE A CD1   1 
ATOM   808  N  N     . ALA A 1 108 ? -6.195  43.339  7.133   1.00 36.43  ? 102  ALA A N     1 
ATOM   809  C  CA    . ALA A 1 108 ? -4.908  42.766  7.516   1.00 36.51  ? 102  ALA A CA    1 
ATOM   810  C  C     . ALA A 1 108 ? -3.896  43.841  7.815   1.00 36.58  ? 102  ALA A C     1 
ATOM   811  O  O     . ALA A 1 108 ? -3.512  44.035  8.961   1.00 39.35  ? 102  ALA A O     1 
ATOM   812  C  CB    . ALA A 1 108 ? -4.373  41.849  6.417   1.00 36.10  ? 102  ALA A CB    1 
ATOM   813  N  N     . SER A 1 109 ? -3.433  44.508  6.770   1.00 35.97  ? 103  SER A N     1 
ATOM   814  C  CA    . SER A 1 109 ? -2.474  45.575  6.936   1.00 37.43  ? 103  SER A CA    1 
ATOM   815  C  C     . SER A 1 109 ? -3.119  46.918  6.597   1.00 39.75  ? 103  SER A C     1 
ATOM   816  O  O     . SER A 1 109 ? -4.351  47.048  6.551   1.00 38.43  ? 103  SER A O     1 
ATOM   817  C  CB    . SER A 1 109 ? -1.239  45.344  6.056   1.00 37.09  ? 103  SER A CB    1 
ATOM   818  O  OG    . SER A 1 109 ? -1.531  45.473  4.683   1.00 33.17  ? 103  SER A OG    1 
ATOM   819  N  N     . ILE A 1 110 ? -2.276  47.918  6.361   1.00 41.61  ? 104  ILE A N     1 
ATOM   820  C  CA    . ILE A 1 110 ? -2.768  49.238  6.041   1.00 41.99  ? 104  ILE A CA    1 
ATOM   821  C  C     . ILE A 1 110 ? -3.267  49.300  4.597   1.00 44.58  ? 104  ILE A C     1 
ATOM   822  O  O     . ILE A 1 110 ? -3.979  50.236  4.243   1.00 46.74  ? 104  ILE A O     1 
ATOM   823  C  CB    . ILE A 1 110 ? -1.680  50.307  6.264   1.00 39.85  ? 104  ILE A CB    1 
ATOM   824  C  CG1   . ILE A 1 110 ? -2.304  51.703  6.206   1.00 40.31  ? 104  ILE A CG1   1 
ATOM   825  C  CG2   . ILE A 1 110 ? -0.599  50.175  5.229   1.00 38.33  ? 104  ILE A CG2   1 
ATOM   826  C  CD1   . ILE A 1 110 ? -1.312  52.838  6.402   1.00 42.27  ? 104  ILE A CD1   1 
ATOM   827  N  N     . ASP A 1 111 ? -2.928  48.303  3.775   1.00 45.23  ? 105  ASP A N     1 
ATOM   828  C  CA    . ASP A 1 111 ? -3.355  48.293  2.368   1.00 45.85  ? 105  ASP A CA    1 
ATOM   829  C  C     . ASP A 1 111 ? -3.921  46.963  1.896   1.00 47.04  ? 105  ASP A C     1 
ATOM   830  O  O     . ASP A 1 111 ? -3.663  46.546  0.762   1.00 47.34  ? 105  ASP A O     1 
ATOM   831  C  CB    . ASP A 1 111 ? -2.183  48.645  1.467   1.00 47.21  ? 105  ASP A CB    1 
ATOM   832  C  CG    . ASP A 1 111 ? -1.186  47.516  1.344   1.00 49.23  ? 105  ASP A CG    1 
ATOM   833  O  OD1   . ASP A 1 111 ? -1.101  46.658  2.251   1.00 52.21  ? 105  ASP A OD1   1 
ATOM   834  O  OD2   . ASP A 1 111 ? -0.464  47.496  0.336   1.00 49.48  ? 105  ASP A OD2   1 
ATOM   835  N  N     . GLU A 1 112 ? -4.704  46.319  2.755   1.00 46.95  ? 106  GLU A N     1 
ATOM   836  C  CA    . GLU A 1 112 ? -5.287  45.022  2.452   1.00 48.42  ? 106  GLU A CA    1 
ATOM   837  C  C     . GLU A 1 112 ? -6.562  44.821  3.245   1.00 48.88  ? 106  GLU A C     1 
ATOM   838  O  O     . GLU A 1 112 ? -6.761  45.461  4.269   1.00 49.28  ? 106  GLU A O     1 
ATOM   839  C  CB    . GLU A 1 112 ? -4.314  43.923  2.840   1.00 50.39  ? 106  GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 112 ? -3.429  43.396  1.744   1.00 55.27  ? 106  GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 112 ? -2.390  42.436  2.305   1.00 59.63  ? 106  GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 112 ? -1.315  42.913  2.751   1.00 62.89  ? 106  GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 112 ? -2.656  41.209  2.335   1.00 60.92  ? 106  GLU A OE2   1 
ATOM   844  N  N     . ALA A 1 113 ? -7.417  43.918  2.777   1.00 49.04  ? 107  ALA A N     1 
ATOM   845  C  CA    . ALA A 1 113 ? -8.675  43.624  3.456   1.00 49.70  ? 107  ALA A CA    1 
ATOM   846  C  C     . ALA A 1 113 ? -9.366  42.448  2.778   1.00 50.70  ? 107  ALA A C     1 
ATOM   847  O  O     . ALA A 1 113 ? -9.420  42.375  1.551   1.00 50.21  ? 107  ALA A O     1 
ATOM   848  C  CB    . ALA A 1 113 ? -9.580  44.838  3.436   1.00 49.70  ? 107  ALA A CB    1 
ATOM   849  N  N     . TYR A 1 114 ? -9.879  41.522  3.582   1.00 51.23  ? 108  TYR A N     1 
ATOM   850  C  CA    . TYR A 1 114 ? -10.550 40.357  3.041   1.00 52.42  ? 108  TYR A CA    1 
ATOM   851  C  C     . TYR A 1 114 ? -12.038 40.529  3.161   1.00 54.17  ? 108  TYR A C     1 
ATOM   852  O  O     . TYR A 1 114 ? -12.534 40.967  4.191   1.00 55.71  ? 108  TYR A O     1 
ATOM   853  C  CB    . TYR A 1 114 ? -10.152 39.093  3.790   1.00 52.77  ? 108  TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 114 ? -8.759  38.603  3.510   1.00 54.45  ? 108  TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 114 ? -7.693  38.929  4.354   1.00 56.35  ? 108  TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 114 ? -8.510  37.777  2.428   1.00 54.76  ? 108  TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 114 ? -6.406  38.427  4.125   1.00 57.84  ? 108  TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 114 ? -7.238  37.274  2.187   1.00 57.81  ? 108  TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 114 ? -6.186  37.595  3.037   1.00 58.53  ? 108  TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 114 ? -4.935  37.060  2.802   1.00 58.88  ? 108  TYR A OH    1 
ATOM   861  N  N     . LEU A 1 115 ? -12.750 40.173  2.101   1.00 55.28  ? 109  LEU A N     1 
ATOM   862  C  CA    . LEU A 1 115 ? -14.201 40.271  2.086   1.00 56.19  ? 109  LEU A CA    1 
ATOM   863  C  C     . LEU A 1 115 ? -14.853 38.887  1.930   1.00 57.54  ? 109  LEU A C     1 
ATOM   864  O  O     . LEU A 1 115 ? -14.388 38.029  1.166   1.00 57.38  ? 109  LEU A O     1 
ATOM   865  C  CB    . LEU A 1 115 ? -14.654 41.191  0.943   1.00 55.67  ? 109  LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 115 ? -14.560 42.720  1.038   1.00 55.05  ? 109  LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 115 ? -15.729 43.258  1.821   1.00 53.89  ? 109  LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 115 ? -13.246 43.130  1.664   1.00 55.08  ? 109  LEU A CD2   1 
ATOM   869  N  N     . ASP A 1 116 ? -15.929 38.674  2.674   1.00 57.92  ? 110  ASP A N     1 
ATOM   870  C  CA    . ASP A 1 116 ? -16.660 37.426  2.602   1.00 58.53  ? 110  ASP A CA    1 
ATOM   871  C  C     . ASP A 1 116 ? -18.007 37.767  2.018   1.00 59.09  ? 110  ASP A C     1 
ATOM   872  O  O     . ASP A 1 116 ? -18.775 38.508  2.636   1.00 58.96  ? 110  ASP A O     1 
ATOM   873  C  CB    . ASP A 1 116 ? -16.868 36.840  3.983   1.00 59.57  ? 110  ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 116 ? -17.685 35.562  3.951   1.00 61.30  ? 110  ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 116 ? -18.845 35.585  3.474   1.00 61.17  ? 110  ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 116 ? -17.159 34.525  4.406   1.00 63.45  ? 110  ASP A OD2   1 
ATOM   877  N  N     . ILE A 1 117 ? -18.289 37.226  0.836   1.00 59.79  ? 111  ILE A N     1 
ATOM   878  C  CA    . ILE A 1 117 ? -19.550 37.479  0.140   1.00 60.23  ? 111  ILE A CA    1 
ATOM   879  C  C     . ILE A 1 117 ? -20.365 36.196  -0.044  1.00 62.56  ? 111  ILE A C     1 
ATOM   880  O  O     . ILE A 1 117 ? -21.374 36.176  -0.746  1.00 62.45  ? 111  ILE A O     1 
ATOM   881  C  CB    . ILE A 1 117 ? -19.278 38.134  -1.242  1.00 57.25  ? 111  ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 117 ? -18.367 37.241  -2.072  1.00 55.34  ? 111  ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 117 ? -18.590 39.487  -1.064  1.00 56.47  ? 111  ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 117 ? -17.772 37.928  -3.280  1.00 52.36  ? 111  ILE A CD1   1 
ATOM   885  N  N     . SER A 1 118 ? -19.924 35.135  0.619   1.00 64.90  ? 112  SER A N     1 
ATOM   886  C  CA    . SER A 1 118 ? -20.571 33.839  0.538   1.00 67.30  ? 112  SER A CA    1 
ATOM   887  C  C     . SER A 1 118 ? -22.070 33.880  0.280   1.00 68.59  ? 112  SER A C     1 
ATOM   888  O  O     . SER A 1 118 ? -22.553 33.360  -0.735  1.00 69.68  ? 112  SER A O     1 
ATOM   889  C  CB    . SER A 1 118 ? -20.306 33.068  1.821   1.00 68.36  ? 112  SER A CB    1 
ATOM   890  O  OG    . SER A 1 118 ? -18.916 32.979  2.056   1.00 70.66  ? 112  SER A OG    1 
ATOM   891  N  N     . ASP A 1 119 ? -22.807 34.494  1.199   1.00 69.19  ? 113  ASP A N     1 
ATOM   892  C  CA    A ASP A 1 119 ? -24.257 34.566  1.070   0.50 70.01  ? 113  ASP A CA    1 
ATOM   893  C  C     . ASP A 1 119 ? -24.765 35.933  0.624   1.00 70.72  ? 113  ASP A C     1 
ATOM   894  O  O     . ASP A 1 119 ? -25.761 36.435  1.139   1.00 71.37  ? 113  ASP A O     1 
ATOM   895  C  CB    A ASP A 1 119 ? -24.924 34.152  2.392   0.50 69.45  ? 113  ASP A CB    1 
ATOM   896  C  CG    A ASP A 1 119 ? -25.117 32.641  2.509   0.50 68.69  ? 113  ASP A CG    1 
ATOM   897  O  OD1   A ASP A 1 119 ? -24.176 31.879  2.197   0.50 67.19  ? 113  ASP A OD1   1 
ATOM   898  O  OD2   A ASP A 1 119 ? -26.215 32.217  2.925   0.50 68.12  ? 113  ASP A OD2   1 
ATOM   899  N  N     . LYS A 1 120 ? -24.061 36.531  -0.332  1.00 71.20  ? 114  LYS A N     1 
ATOM   900  C  CA    . LYS A 1 120 ? -24.431 37.825  -0.903  1.00 71.33  ? 114  LYS A CA    1 
ATOM   901  C  C     . LYS A 1 120 ? -23.928 37.836  -2.334  1.00 71.27  ? 114  LYS A C     1 
ATOM   902  O  O     . LYS A 1 120 ? -23.780 38.883  -2.941  1.00 72.32  ? 114  LYS A O     1 
ATOM   903  C  CB    . LYS A 1 120 ? -23.796 38.985  -0.136  1.00 72.41  ? 114  LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 120 ? -24.287 39.137  1.290   1.00 75.16  ? 114  LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 120 ? -25.752 39.548  1.356   1.00 77.09  ? 114  LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 120 ? -26.218 39.687  2.811   1.00 79.09  ? 114  LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 120 ? -27.615 40.216  2.952   1.00 79.90  ? 114  LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 121 ? -23.655 36.644  -2.853  1.00 71.21  ? 115  VAL A N     1 
ATOM   909  C  CA    . VAL A 1 121 ? -23.178 36.440  -4.218  1.00 71.23  ? 115  VAL A CA    1 
ATOM   910  C  C     . VAL A 1 121 ? -23.566 35.016  -4.679  1.00 72.01  ? 115  VAL A C     1 
ATOM   911  O  O     . VAL A 1 121 ? -23.350 34.029  -3.967  1.00 72.04  ? 115  VAL A O     1 
ATOM   912  C  CB    . VAL A 1 121 ? -21.649 36.627  -4.300  1.00 70.12  ? 115  VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 121 ? -21.123 36.137  -5.629  1.00 70.47  ? 115  VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 121 ? -21.315 38.076  -4.151  1.00 70.67  ? 115  VAL A CG2   1 
ATOM   915  N  N     . ARG A 1 122 ? -24.138 34.920  -5.873  1.00 71.60  ? 116  ARG A N     1 
ATOM   916  C  CA    . ARG A 1 122 ? -24.583 33.644  -6.400  1.00 71.83  ? 116  ARG A CA    1 
ATOM   917  C  C     . ARG A 1 122 ? -23.476 32.776  -6.992  1.00 71.45  ? 116  ARG A C     1 
ATOM   918  O  O     . ARG A 1 122 ? -23.482 31.553  -6.838  1.00 70.91  ? 116  ARG A O     1 
ATOM   919  C  CB    . ARG A 1 122 ? -25.689 33.897  -7.436  1.00 73.26  ? 116  ARG A CB    1 
ATOM   920  C  CG    . ARG A 1 122 ? -26.332 32.650  -8.033  1.00 75.12  ? 116  ARG A CG    1 
ATOM   921  C  CD    . ARG A 1 122 ? -26.649 31.636  -6.952  1.00 76.41  ? 116  ARG A CD    1 
ATOM   922  N  NE    . ARG A 1 122 ? -27.261 30.420  -7.473  1.00 77.01  ? 116  ARG A NE    1 
ATOM   923  C  CZ    . ARG A 1 122 ? -26.755 29.671  -8.447  1.00 77.42  ? 116  ARG A CZ    1 
ATOM   924  N  NH1   . ARG A 1 122 ? -25.612 30.003  -9.036  1.00 76.60  ? 116  ARG A NH1   1 
ATOM   925  N  NH2   . ARG A 1 122 ? -27.395 28.574  -8.817  1.00 77.70  ? 116  ARG A NH2   1 
ATOM   926  N  N     . ASP A 1 123 ? -22.518 33.405  -7.654  1.00 71.20  ? 117  ASP A N     1 
ATOM   927  C  CA    . ASP A 1 123 ? -21.441 32.659  -8.281  1.00 72.07  ? 117  ASP A CA    1 
ATOM   928  C  C     . ASP A 1 123 ? -20.251 33.550  -8.597  1.00 71.53  ? 117  ASP A C     1 
ATOM   929  O  O     . ASP A 1 123 ? -20.273 34.739  -8.324  1.00 71.12  ? 117  ASP A O     1 
ATOM   930  C  CB    . ASP A 1 123 ? -21.965 32.004  -9.564  1.00 74.43  ? 117  ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 123 ? -22.629 33.006  -10.516 1.00 76.97  ? 117  ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 123 ? -23.386 33.881  -10.035 1.00 78.47  ? 117  ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 123 ? -22.408 32.905  -11.747 1.00 77.79  ? 117  ASP A OD2   1 
ATOM   934  N  N     . TYR A 1 124 ? -19.211 32.974  -9.181  1.00 71.78  ? 118  TYR A N     1 
ATOM   935  C  CA    . TYR A 1 124 ? -18.027 33.746  -9.521  1.00 71.99  ? 118  TYR A CA    1 
ATOM   936  C  C     . TYR A 1 124 ? -18.333 34.754  -10.625 1.00 71.78  ? 118  TYR A C     1 
ATOM   937  O  O     . TYR A 1 124 ? -17.502 35.601  -10.955 1.00 72.51  ? 118  TYR A O     1 
ATOM   938  C  CB    . TYR A 1 124 ? -16.887 32.822  -9.971  1.00 72.87  ? 118  TYR A CB    1 
ATOM   939  C  CG    . TYR A 1 124 ? -16.209 32.029  -8.868  1.00 73.27  ? 118  TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1 124 ? -14.959 31.458  -9.073  1.00 74.39  ? 118  TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1 124 ? -16.805 31.865  -7.618  1.00 75.00  ? 118  TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1 124 ? -14.307 30.745  -8.060  1.00 76.08  ? 118  TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1 124 ? -16.163 31.152  -6.590  1.00 75.83  ? 118  TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1 124 ? -14.914 30.597  -6.822  1.00 76.38  ? 118  TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1 124 ? -14.270 29.898  -5.823  1.00 76.93  ? 118  TYR A OH    1 
ATOM   946  N  N     . ARG A 1 125 ? -19.530 34.668  -11.192 1.00 71.46  ? 119  ARG A N     1 
ATOM   947  C  CA    . ARG A 1 125 ? -19.925 35.577  -12.264 1.00 70.83  ? 119  ARG A CA    1 
ATOM   948  C  C     . ARG A 1 125 ? -20.211 36.955  -11.690 1.00 69.42  ? 119  ARG A C     1 
ATOM   949  O  O     . ARG A 1 125 ? -19.592 37.958  -12.076 1.00 67.86  ? 119  ARG A O     1 
ATOM   950  C  CB    . ARG A 1 125 ? -21.178 35.050  -12.972 1.00 71.98  ? 119  ARG A CB    1 
ATOM   951  C  CG    . ARG A 1 125 ? -21.429 35.649  -14.348 1.00 74.07  ? 119  ARG A CG    1 
ATOM   952  C  CD    . ARG A 1 125 ? -22.760 35.192  -14.921 1.00 75.50  ? 119  ARG A CD    1 
ATOM   953  N  NE    . ARG A 1 125 ? -23.896 35.717  -14.164 1.00 77.84  ? 119  ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1 125 ? -24.156 37.014  -14.001 1.00 79.86  ? 119  ARG A CZ    1 
ATOM   955  N  NH1   . ARG A 1 125 ? -23.359 37.932  -14.538 1.00 80.35  ? 119  ARG A NH1   1 
ATOM   956  N  NH2   . ARG A 1 125 ? -25.218 37.399  -13.302 1.00 80.63  ? 119  ARG A NH2   1 
ATOM   957  N  N     . GLU A 1 126 ? -21.159 36.992  -10.762 1.00 68.16  ? 120  GLU A N     1 
ATOM   958  C  CA    . GLU A 1 126 ? -21.539 38.240  -10.135 1.00 68.46  ? 120  GLU A CA    1 
ATOM   959  C  C     . GLU A 1 126 ? -20.564 38.672  -9.041  1.00 67.29  ? 120  GLU A C     1 
ATOM   960  O  O     . GLU A 1 126 ? -20.757 39.699  -8.388  1.00 68.89  ? 120  GLU A O     1 
ATOM   961  C  CB    . GLU A 1 126 ? -22.970 38.139  -9.592  1.00 69.06  ? 120  GLU A CB    1 
ATOM   962  C  CG    . GLU A 1 126 ? -23.363 36.765  -9.095  1.00 70.62  ? 120  GLU A CG    1 
ATOM   963  C  CD    . GLU A 1 126 ? -24.834 36.681  -8.696  1.00 71.85  ? 120  GLU A CD    1 
ATOM   964  O  OE1   . GLU A 1 126 ? -25.243 37.326  -7.701  1.00 71.67  ? 120  GLU A OE1   1 
ATOM   965  O  OE2   . GLU A 1 126 ? -25.587 35.965  -9.388  1.00 73.17  ? 120  GLU A OE2   1 
ATOM   966  N  N     . ALA A 1 127 ? -19.509 37.892  -8.851  1.00 64.48  ? 121  ALA A N     1 
ATOM   967  C  CA    . ALA A 1 127 ? -18.506 38.213  -7.850  1.00 61.14  ? 121  ALA A CA    1 
ATOM   968  C  C     . ALA A 1 127 ? -17.473 39.071  -8.547  1.00 58.86  ? 121  ALA A C     1 
ATOM   969  O  O     . ALA A 1 127 ? -16.936 40.016  -7.980  1.00 57.97  ? 121  ALA A O     1 
ATOM   970  C  CB    . ALA A 1 127 ? -17.861 36.939  -7.334  1.00 61.93  ? 121  ALA A CB    1 
ATOM   971  N  N     . TYR A 1 128 ? -17.194 38.708  -9.790  1.00 56.67  ? 122  TYR A N     1 
ATOM   972  C  CA    . TYR A 1 128 ? -16.246 39.430  -10.612 1.00 54.74  ? 122  TYR A CA    1 
ATOM   973  C  C     . TYR A 1 128 ? -16.868 40.786  -10.926 1.00 54.57  ? 122  TYR A C     1 
ATOM   974  O  O     . TYR A 1 128 ? -16.172 41.779  -11.092 1.00 55.97  ? 122  TYR A O     1 
ATOM   975  C  CB    . TYR A 1 128 ? -16.006 38.659  -11.904 1.00 53.55  ? 122  TYR A CB    1 
ATOM   976  C  CG    . TYR A 1 128 ? -15.072 39.331  -12.887 1.00 51.82  ? 122  TYR A CG    1 
ATOM   977  C  CD1   . TYR A 1 128 ? -13.742 38.913  -13.013 1.00 50.65  ? 122  TYR A CD1   1 
ATOM   978  C  CD2   . TYR A 1 128 ? -15.534 40.331  -13.747 1.00 50.14  ? 122  TYR A CD2   1 
ATOM   979  C  CE1   . TYR A 1 128 ? -12.901 39.461  -13.977 1.00 49.19  ? 122  TYR A CE1   1 
ATOM   980  C  CE2   . TYR A 1 128 ? -14.701 40.886  -14.710 1.00 49.22  ? 122  TYR A CE2   1 
ATOM   981  C  CZ    . TYR A 1 128 ? -13.389 40.443  -14.826 1.00 49.43  ? 122  TYR A CZ    1 
ATOM   982  O  OH    . TYR A 1 128 ? -12.579 40.955  -15.815 1.00 48.48  ? 122  TYR A OH    1 
ATOM   983  N  N     . ASN A 1 129 ? -18.188 40.820  -11.019 1.00 53.71  ? 123  ASN A N     1 
ATOM   984  C  CA    . ASN A 1 129 ? -18.886 42.060  -11.306 1.00 53.42  ? 123  ASN A CA    1 
ATOM   985  C  C     . ASN A 1 129 ? -18.839 42.955  -10.085 1.00 53.09  ? 123  ASN A C     1 
ATOM   986  O  O     . ASN A 1 129 ? -18.858 44.179  -10.192 1.00 53.71  ? 123  ASN A O     1 
ATOM   987  C  CB    A ASN A 1 129 ? -20.338 41.770  -11.687 0.50 53.88  ? 123  ASN A CB    1 
ATOM   988  C  CG    A ASN A 1 129 ? -20.504 41.482  -13.169 0.50 54.01  ? 123  ASN A CG    1 
ATOM   989  O  OD1   A ASN A 1 129 ? -20.440 42.396  -13.995 0.50 53.65  ? 123  ASN A OD1   1 
ATOM   990  N  ND2   A ASN A 1 129 ? -20.704 40.209  -13.515 0.50 53.21  ? 123  ASN A ND2   1 
ATOM   991  N  N     . LEU A 1 130 ? -18.779 42.330  -8.917  1.00 52.28  ? 124  LEU A N     1 
ATOM   992  C  CA    . LEU A 1 130 ? -18.723 43.063  -7.660  1.00 50.34  ? 124  LEU A CA    1 
ATOM   993  C  C     . LEU A 1 130 ? -17.313 43.597  -7.428  1.00 48.66  ? 124  LEU A C     1 
ATOM   994  O  O     . LEU A 1 130 ? -17.144 44.669  -6.878  1.00 47.45  ? 124  LEU A O     1 
ATOM   995  C  CB    . LEU A 1 130 ? -19.143 42.146  -6.512  1.00 50.97  ? 124  LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 130 ? -19.604 42.759  -5.185  1.00 50.83  ? 124  LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 130 ? -20.450 43.994  -5.425  1.00 51.09  ? 124  LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 130 ? -20.407 41.714  -4.416  1.00 49.47  ? 124  LEU A CD2   1 
ATOM   999  N  N     . GLY A 1 131 ? -16.305 42.847  -7.855  1.00 47.97  ? 125  GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 131 ? -14.944 43.304  -7.687  1.00 47.71  ? 125  GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 131 ? -14.816 44.631  -8.399  1.00 49.23  ? 125  GLY A C     1 
ATOM   1002 O  O     . GLY A 1 131 ? -14.146 45.552  -7.914  1.00 50.76  ? 125  GLY A O     1 
ATOM   1003 N  N     . LEU A 1 132 ? -15.473 44.723  -9.555  1.00 48.52  ? 126  LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 132 ? -15.476 45.931  -10.389 1.00 46.07  ? 126  LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 132 ? -16.234 47.067  -9.689  1.00 44.81  ? 126  LEU A C     1 
ATOM   1006 O  O     . LEU A 1 132 ? -15.703 48.142  -9.441  1.00 41.62  ? 126  LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 132 ? -16.155 45.614  -11.726 1.00 46.81  ? 126  LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 132 ? -15.470 44.702  -12.741 1.00 46.73  ? 126  LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 132 ? -16.492 44.146  -13.730 1.00 45.63  ? 126  LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 132 ? -14.390 45.511  -13.443 1.00 46.61  ? 126  LEU A CD2   1 
ATOM   1011 N  N     . GLU A 1 133 ? -17.493 46.802  -9.378  1.00 44.93  ? 127  GLU A N     1 
ATOM   1012 C  CA    . GLU A 1 133 ? -18.340 47.768  -8.718  1.00 46.42  ? 127  GLU A CA    1 
ATOM   1013 C  C     . GLU A 1 133 ? -17.580 48.379  -7.540  1.00 47.26  ? 127  GLU A C     1 
ATOM   1014 O  O     . GLU A 1 133 ? -17.805 49.532  -7.173  1.00 49.45  ? 127  GLU A O     1 
ATOM   1015 C  CB    . GLU A 1 133 ? -19.610 47.064  -8.229  1.00 47.28  ? 127  GLU A CB    1 
ATOM   1016 C  CG    A GLU A 1 133 ? -20.685 47.972  -7.643  0.50 47.76  ? 127  GLU A CG    1 
ATOM   1017 C  CD    A GLU A 1 133 ? -21.774 47.189  -6.934  0.50 48.60  ? 127  GLU A CD    1 
ATOM   1018 O  OE1   A GLU A 1 133 ? -22.138 46.094  -7.414  0.50 48.61  ? 127  GLU A OE1   1 
ATOM   1019 O  OE2   A GLU A 1 133 ? -22.275 47.669  -5.897  0.50 50.36  ? 127  GLU A OE2   1 
ATOM   1020 N  N     . ILE A 1 134 ? -16.682 47.590  -6.949  1.00 46.60  ? 128  ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 134 ? -15.862 48.009  -5.798  1.00 43.33  ? 128  ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 134 ? -14.617 48.684  -6.328  1.00 42.77  ? 128  ILE A C     1 
ATOM   1023 O  O     . ILE A 1 134 ? -14.427 49.884  -6.164  1.00 43.39  ? 128  ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 134 ? -15.424 46.781  -4.925  1.00 40.93  ? 128  ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 134 ? -16.610 46.260  -4.121  1.00 38.48  ? 128  ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 134 ? -14.264 47.138  -4.032  1.00 36.40  ? 128  ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 134 ? -16.269 45.078  -3.272  1.00 37.45  ? 128  ILE A CD1   1 
ATOM   1028 N  N     . LYS A 1 135 ? -13.775 47.891  -6.972  1.00 41.57  ? 129  LYS A N     1 
ATOM   1029 C  CA    . LYS A 1 135 ? -12.537 48.374  -7.547  1.00 41.68  ? 129  LYS A CA    1 
ATOM   1030 C  C     . LYS A 1 135 ? -12.698 49.764  -8.133  1.00 42.35  ? 129  LYS A C     1 
ATOM   1031 O  O     . LYS A 1 135 ? -11.710 50.450  -8.356  1.00 44.57  ? 129  LYS A O     1 
ATOM   1032 C  CB    . LYS A 1 135 ? -12.066 47.413  -8.640  1.00 39.55  ? 129  LYS A CB    1 
ATOM   1033 C  CG    . LYS A 1 135 ? -10.695 47.711  -9.192  1.00 38.22  ? 129  LYS A CG    1 
ATOM   1034 C  CD    . LYS A 1 135 ? -10.388 46.808  -10.356 1.00 38.48  ? 129  LYS A CD    1 
ATOM   1035 C  CE    . LYS A 1 135 ? -8.893  46.730  -10.665 1.00 39.36  ? 129  LYS A CE    1 
ATOM   1036 N  NZ    . LYS A 1 135 ? -8.249  48.004  -11.057 1.00 40.56  ? 129  LYS A NZ    1 
ATOM   1037 N  N     . ASN A 1 136 ? -13.936 50.175  -8.389  1.00 42.61  ? 130  ASN A N     1 
ATOM   1038 C  CA    . ASN A 1 136 ? -14.206 51.494  -8.957  1.00 43.54  ? 130  ASN A CA    1 
ATOM   1039 C  C     . ASN A 1 136 ? -14.606 52.523  -7.917  1.00 41.79  ? 130  ASN A C     1 
ATOM   1040 O  O     . ASN A 1 136 ? -13.980 53.565  -7.812  1.00 41.36  ? 130  ASN A O     1 
ATOM   1041 C  CB    . ASN A 1 136 ? -15.303 51.404  -10.015 1.00 46.84  ? 130  ASN A CB    1 
ATOM   1042 C  CG    . ASN A 1 136 ? -14.799 50.850  -11.332 1.00 49.85  ? 130  ASN A CG    1 
ATOM   1043 O  OD1   . ASN A 1 136 ? -15.595 50.481  -12.214 1.00 52.08  ? 130  ASN A OD1   1 
ATOM   1044 N  ND2   . ASN A 1 136 ? -13.469 50.795  -11.484 1.00 48.82  ? 130  ASN A ND2   1 
ATOM   1045 N  N     . LYS A 1 137 ? -15.662 52.245  -7.166  1.00 40.29  ? 131  LYS A N     1 
ATOM   1046 C  CA    . LYS A 1 137 ? -16.103 53.162  -6.137  1.00 40.01  ? 131  LYS A CA    1 
ATOM   1047 C  C     . LYS A 1 137 ? -14.841 53.756  -5.515  1.00 41.67  ? 131  LYS A C     1 
ATOM   1048 O  O     . LYS A 1 137 ? -14.790 54.933  -5.144  1.00 42.92  ? 131  LYS A O     1 
ATOM   1049 C  CB    . LYS A 1 137 ? -16.883 52.387  -5.094  1.00 38.80  ? 131  LYS A CB    1 
ATOM   1050 C  CG    . LYS A 1 137 ? -17.588 53.230  -4.057  1.00 39.16  ? 131  LYS A CG    1 
ATOM   1051 C  CD    . LYS A 1 137 ? -19.003 53.569  -4.492  1.00 39.74  ? 131  LYS A CD    1 
ATOM   1052 C  CE    . LYS A 1 137 ? -19.840 54.177  -3.358  1.00 40.16  ? 131  LYS A CE    1 
ATOM   1053 N  NZ    . LYS A 1 137 ? -20.278 53.215  -2.311  1.00 40.01  ? 131  LYS A NZ    1 
ATOM   1054 N  N     . ILE A 1 138 ? -13.810 52.922  -5.447  1.00 43.16  ? 132  ILE A N     1 
ATOM   1055 C  CA    . ILE A 1 138 ? -12.508 53.278  -4.885  1.00 44.33  ? 132  ILE A CA    1 
ATOM   1056 C  C     . ILE A 1 138 ? -11.713 54.275  -5.731  1.00 45.05  ? 132  ILE A C     1 
ATOM   1057 O  O     . ILE A 1 138 ? -11.392 55.366  -5.258  1.00 44.46  ? 132  ILE A O     1 
ATOM   1058 C  CB    . ILE A 1 138 ? -11.661 51.980  -4.652  1.00 43.47  ? 132  ILE A CB    1 
ATOM   1059 C  CG1   . ILE A 1 138 ? -11.599 51.670  -3.166  1.00 43.46  ? 132  ILE A CG1   1 
ATOM   1060 C  CG2   . ILE A 1 138 ? -10.262 52.112  -5.200  1.00 41.23  ? 132  ILE A CG2   1 
ATOM   1061 C  CD1   . ILE A 1 138 ? -10.753 50.463  -2.874  1.00 44.67  ? 132  ILE A CD1   1 
ATOM   1062 N  N     . LEU A 1 139 ? -11.405 53.883  -6.972  1.00 45.90  ? 133  LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 139 ? -10.628 54.699  -7.924  1.00 46.09  ? 133  LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 139 ? -11.133 56.113  -8.119  1.00 47.61  ? 133  LEU A C     1 
ATOM   1065 O  O     . LEU A 1 139 ? -10.417 56.966  -8.624  1.00 49.07  ? 133  LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 139 ? -10.563 54.035  -9.305  1.00 43.25  ? 133  LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 139 ? -9.607  54.667  -10.323 1.00 39.58  ? 133  LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 139 ? -8.176  54.548  -9.840  1.00 37.34  ? 133  LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 139 ? -9.763  53.948  -11.657 1.00 40.00  ? 133  LEU A CD2   1 
ATOM   1070 N  N     . GLU A 1 140 ? -12.379 56.360  -7.754  1.00 49.12  ? 134  GLU A N     1 
ATOM   1071 C  CA    . GLU A 1 140 ? -12.914 57.691  -7.886  1.00 51.01  ? 134  GLU A CA    1 
ATOM   1072 C  C     . GLU A 1 140 ? -13.878 58.009  -6.778  1.00 51.04  ? 134  GLU A C     1 
ATOM   1073 O  O     . GLU A 1 140 ? -15.097 57.937  -6.912  1.00 50.28  ? 134  GLU A O     1 
ATOM   1074 C  CB    . GLU A 1 140 ? -13.540 57.878  -9.257  1.00 55.40  ? 134  GLU A CB    1 
ATOM   1075 C  CG    . GLU A 1 140 ? -12.470 58.219  -10.296 1.00 59.11  ? 134  GLU A CG    1 
ATOM   1076 C  CD    . GLU A 1 140 ? -11.644 59.441  -9.882  1.00 59.90  ? 134  GLU A CD    1 
ATOM   1077 O  OE1   . GLU A 1 140 ? -10.477 59.541  -10.327 1.00 60.49  ? 134  GLU A OE1   1 
ATOM   1078 O  OE2   . GLU A 1 140 ? -12.168 60.295  -9.121  1.00 58.98  ? 134  GLU A OE2   1 
ATOM   1079 N  N     . LYS A 1 141 ? -13.263 58.358  -5.664  1.00 51.40  ? 135  LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 141 ? -13.925 58.717  -4.439  1.00 50.29  ? 135  LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 141 ? -12.727 58.911  -3.544  1.00 49.38  ? 135  LYS A C     1 
ATOM   1082 O  O     . LYS A 1 141 ? -12.808 59.574  -2.524  1.00 50.18  ? 135  LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 141 ? -14.780 57.567  -3.941  1.00 50.09  ? 135  LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 141 ? -15.712 57.970  -2.840  1.00 51.79  ? 135  LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 141 ? -16.802 56.930  -2.656  1.00 54.32  ? 135  LYS A CD    1 
ATOM   1086 C  CE    . LYS A 1 141 ? -17.851 57.396  -1.657  1.00 56.21  ? 135  LYS A CE    1 
ATOM   1087 N  NZ    . LYS A 1 141 ? -19.016 56.474  -1.615  1.00 59.01  ? 135  LYS A NZ    1 
ATOM   1088 N  N     . GLU A 1 142 ? -11.610 58.322  -3.969  1.00 47.90  ? 136  GLU A N     1 
ATOM   1089 C  CA    . GLU A 1 142 ? -10.331 58.391  -3.272  1.00 46.68  ? 136  GLU A CA    1 
ATOM   1090 C  C     . GLU A 1 142 ? -9.232  58.393  -4.344  1.00 45.79  ? 136  GLU A C     1 
ATOM   1091 O  O     . GLU A 1 142 ? -8.046  58.513  -4.050  1.00 47.02  ? 136  GLU A O     1 
ATOM   1092 C  CB    . GLU A 1 142 ? -10.150 57.181  -2.353  1.00 46.54  ? 136  GLU A CB    1 
ATOM   1093 C  CG    . GLU A 1 142 ? -11.288 56.912  -1.363  1.00 47.95  ? 136  GLU A CG    1 
ATOM   1094 C  CD    . GLU A 1 142 ? -11.453 57.999  -0.300  1.00 48.94  ? 136  GLU A CD    1 
ATOM   1095 O  OE1   . GLU A 1 142 ? -10.443 58.666  0.039   1.00 49.17  ? 136  GLU A OE1   1 
ATOM   1096 O  OE2   . GLU A 1 142 ? -12.594 58.171  0.205   1.00 48.07  ? 136  GLU A OE2   1 
ATOM   1097 N  N     . LYS A 1 143 ? -9.645  58.255  -5.595  1.00 43.72  ? 137  LYS A N     1 
ATOM   1098 C  CA    . LYS A 1 143 ? -8.726  58.259  -6.723  1.00 41.13  ? 137  LYS A CA    1 
ATOM   1099 C  C     . LYS A 1 143 ? -7.598  57.276  -6.587  1.00 39.00  ? 137  LYS A C     1 
ATOM   1100 O  O     . LYS A 1 143 ? -6.495  57.527  -7.076  1.00 37.81  ? 137  LYS A O     1 
ATOM   1101 C  CB    . LYS A 1 143 ? -8.160  59.660  -6.928  1.00 42.64  ? 137  LYS A CB    1 
ATOM   1102 C  CG    . LYS A 1 143 ? -9.255  60.709  -7.031  1.00 46.17  ? 137  LYS A CG    1 
ATOM   1103 C  CD    . LYS A 1 143 ? -8.703  62.109  -7.108  1.00 47.05  ? 137  LYS A CD    1 
ATOM   1104 C  CE    . LYS A 1 143 ? -9.784  63.141  -7.274  1.00 47.20  ? 137  LYS A CE    1 
ATOM   1105 N  NZ    . LYS A 1 143 ? -9.180  64.480  -7.510  1.00 49.14  ? 137  LYS A NZ    1 
ATOM   1106 N  N     . ILE A 1 144 ? -7.882  56.147  -5.940  1.00 37.14  ? 138  ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 144 ? -6.874  55.107  -5.745  1.00 35.76  ? 138  ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 144 ? -7.164  53.818  -6.500  1.00 33.04  ? 138  ILE A C     1 
ATOM   1109 O  O     . ILE A 1 144 ? -8.263  53.288  -6.422  1.00 32.51  ? 138  ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 144 ? -6.708  54.768  -4.243  1.00 36.42  ? 138  ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 144 ? -5.950  55.894  -3.540  1.00 36.08  ? 138  ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 144 ? -5.928  53.471  -4.077  1.00 36.94  ? 138  ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 144 ? -4.599  56.170  -4.168  1.00 36.02  ? 138  ILE A CD1   1 
ATOM   1114 N  N     . THR A 1 145 ? -6.171  53.325  -7.227  1.00 30.86  ? 139  THR A N     1 
ATOM   1115 C  CA    . THR A 1 145 ? -6.300  52.071  -7.981  1.00 32.53  ? 139  THR A CA    1 
ATOM   1116 C  C     . THR A 1 145 ? -6.089  50.867  -7.055  1.00 32.03  ? 139  THR A C     1 
ATOM   1117 O  O     . THR A 1 145 ? -5.349  50.968  -6.090  1.00 35.13  ? 139  THR A O     1 
ATOM   1118 C  CB    . THR A 1 145 ? -5.230  51.975  -9.084  1.00 33.15  ? 139  THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 145 ? -4.301  50.930  -8.770  1.00 26.69  ? 139  THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 145 ? -4.462  53.270  -9.176  1.00 34.71  ? 139  THR A CG2   1 
ATOM   1121 N  N     . VAL A 1 146 ? -6.710  49.728  -7.336  1.00 29.30  ? 140  VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 146 ? -6.512  48.569  -6.474  1.00 26.92  ? 140  VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 146 ? -6.581  47.263  -7.251  1.00 28.32  ? 140  VAL A C     1 
ATOM   1124 O  O     . VAL A 1 146 ? -7.119  47.213  -8.355  1.00 28.92  ? 140  VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 146 ? -7.567  48.505  -5.379  1.00 24.47  ? 140  VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 146 ? -7.563  49.755  -4.579  1.00 21.17  ? 140  VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 146 ? -8.926  48.268  -5.997  1.00 25.32  ? 140  VAL A CG2   1 
ATOM   1128 N  N     . THR A 1 147 ? -6.025  46.208  -6.672  1.00 27.95  ? 141  THR A N     1 
ATOM   1129 C  CA    . THR A 1 147 ? -6.054  44.882  -7.292  1.00 30.38  ? 141  THR A CA    1 
ATOM   1130 C  C     . THR A 1 147 ? -6.959  43.922  -6.517  1.00 32.28  ? 141  THR A C     1 
ATOM   1131 O  O     . THR A 1 147 ? -6.775  43.732  -5.327  1.00 35.72  ? 141  THR A O     1 
ATOM   1132 C  CB    . THR A 1 147 ? -4.666  44.281  -7.349  1.00 29.88  ? 141  THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 147 ? -3.994  44.759  -8.520  1.00 30.13  ? 141  THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 147 ? -4.747  42.767  -7.334  1.00 27.30  ? 141  THR A CG2   1 
ATOM   1135 N  N     . VAL A 1 148 ? -7.924  43.302  -7.182  1.00 32.99  ? 142  VAL A N     1 
ATOM   1136 C  CA    . VAL A 1 148 ? -8.841  42.404  -6.484  1.00 34.29  ? 142  VAL A CA    1 
ATOM   1137 C  C     . VAL A 1 148 ? -8.600  40.912  -6.742  1.00 35.59  ? 142  VAL A C     1 
ATOM   1138 O  O     . VAL A 1 148 ? -8.253  40.504  -7.843  1.00 37.11  ? 142  VAL A O     1 
ATOM   1139 C  CB    . VAL A 1 148 ? -10.310 42.733  -6.851  1.00 34.66  ? 142  VAL A CB    1 
ATOM   1140 C  CG1   . VAL A 1 148 ? -11.225 41.657  -6.298  1.00 34.45  ? 142  VAL A CG1   1 
ATOM   1141 C  CG2   . VAL A 1 148 ? -10.709 44.114  -6.311  1.00 30.01  ? 142  VAL A CG2   1 
ATOM   1142 N  N     . GLY A 1 149 ? -8.796  40.087  -5.728  1.00 34.88  ? 143  GLY A N     1 
ATOM   1143 C  CA    . GLY A 1 149 ? -8.580  38.668  -5.923  1.00 34.30  ? 143  GLY A CA    1 
ATOM   1144 C  C     . GLY A 1 149 ? -9.786  37.913  -5.421  1.00 34.13  ? 143  GLY A C     1 
ATOM   1145 O  O     . GLY A 1 149 ? -10.392 38.290  -4.425  1.00 34.19  ? 143  GLY A O     1 
ATOM   1146 N  N     . ILE A 1 150 ? -10.162 36.848  -6.110  1.00 34.23  ? 144  ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 150 ? -11.311 36.083  -5.666  1.00 34.51  ? 144  ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 150 ? -11.114 34.570  -5.766  1.00 34.12  ? 144  ILE A C     1 
ATOM   1149 O  O     . ILE A 1 150 ? -10.485 34.066  -6.695  1.00 34.41  ? 144  ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 150 ? -12.570 36.501  -6.440  1.00 34.06  ? 144  ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 150 ? -12.690 38.027  -6.417  1.00 34.31  ? 144  ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 150 ? -13.801 35.858  -5.813  1.00 33.56  ? 144  ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 150 ? -14.027 38.594  -6.889  1.00 34.21  ? 144  ILE A CD1   1 
ATOM   1154 N  N     . SER A 1 151 ? -11.646 33.858  -4.782  1.00 33.40  ? 145  SER A N     1 
ATOM   1155 C  CA    . SER A 1 151 ? -11.546 32.414  -4.740  1.00 34.61  ? 145  SER A CA    1 
ATOM   1156 C  C     . SER A 1 151 ? -12.420 31.794  -3.663  1.00 36.10  ? 145  SER A C     1 
ATOM   1157 O  O     . SER A 1 151 ? -13.410 32.382  -3.227  1.00 35.84  ? 145  SER A O     1 
ATOM   1158 C  CB    . SER A 1 151 ? -10.102 31.985  -4.519  1.00 34.85  ? 145  SER A CB    1 
ATOM   1159 O  OG    . SER A 1 151 ? -10.031 30.601  -4.244  1.00 33.05  ? 145  SER A OG    1 
ATOM   1160 N  N     . LYS A 1 152 ? -12.044 30.592  -3.242  1.00 36.60  ? 146  LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 152 ? -12.792 29.865  -2.240  1.00 38.35  ? 146  LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 152 ? -12.233 30.108  -0.844  1.00 40.06  ? 146  LYS A C     1 
ATOM   1163 O  O     . LYS A 1 152 ? -12.829 29.701  0.154   1.00 41.84  ? 146  LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 152 ? -12.768 28.377  -2.583  1.00 37.81  ? 146  LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 152 ? -14.158 27.748  -2.814  1.00 41.25  ? 146  LYS A CG    1 
ATOM   1166 C  CD    . LYS A 1 152 ? -14.758 27.162  -1.509  1.00 41.29  ? 146  LYS A CD    1 
ATOM   1167 C  CE    . LYS A 1 152 ? -16.077 26.424  -1.754  1.00 40.03  ? 146  LYS A CE    1 
ATOM   1168 N  NZ    . LYS A 1 152 ? -16.511 25.650  -0.546  1.00 38.80  ? 146  LYS A NZ    1 
ATOM   1169 N  N     . ASN A 1 153 ? -11.094 30.791  -0.770  1.00 40.03  ? 147  ASN A N     1 
ATOM   1170 C  CA    . ASN A 1 153 ? -10.480 31.078  0.522   1.00 37.63  ? 147  ASN A CA    1 
ATOM   1171 C  C     . ASN A 1 153 ? -9.524  32.266  0.460   1.00 36.06  ? 147  ASN A C     1 
ATOM   1172 O  O     . ASN A 1 153 ? -9.114  32.707  -0.607  1.00 35.36  ? 147  ASN A O     1 
ATOM   1173 C  CB    . ASN A 1 153 ? -9.700  29.874  0.986   1.00 35.78  ? 147  ASN A CB    1 
ATOM   1174 C  CG    . ASN A 1 153 ? -8.609  29.523  0.020   1.00 35.37  ? 147  ASN A CG    1 
ATOM   1175 O  OD1   . ASN A 1 153 ? -7.880  30.400  -0.455  1.00 35.16  ? 147  ASN A OD1   1 
ATOM   1176 N  ND2   . ASN A 1 153 ? -8.489  28.245  -0.291  1.00 35.22  ? 147  ASN A ND2   1 
ATOM   1177 N  N     . LYS A 1 154 ? -9.133  32.726  1.638   1.00 34.80  ? 148  LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 154 ? -8.260  33.861  1.782   1.00 34.04  ? 148  LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 154 ? -6.922  33.732  1.090   1.00 34.45  ? 148  LYS A C     1 
ATOM   1180 O  O     . LYS A 1 154 ? -6.459  34.677  0.455   1.00 34.78  ? 148  LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 154 ? -8.054  34.146  3.264   1.00 33.28  ? 148  LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 154 ? -9.353  34.109  4.049   1.00 34.63  ? 148  LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 154 ? -9.316  34.928  5.348   1.00 36.99  ? 148  LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 154 ? -8.310  34.415  6.381   1.00 36.66  ? 148  LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 154 ? -8.562  34.981  7.743   1.00 36.41  ? 148  LYS A NZ    1 
ATOM   1186 N  N     . VAL A 1 155 ? -6.302  32.567  1.185   1.00 34.70  ? 149  VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 155 ? -4.987  32.395  0.580   1.00 36.20  ? 149  VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 155 ? -5.003  32.463  -0.934  1.00 36.51  ? 149  VAL A C     1 
ATOM   1189 O  O     . VAL A 1 155 ? -4.214  33.190  -1.542  1.00 35.62  ? 149  VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 155 ? -4.342  31.078  1.022   1.00 35.97  ? 149  VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 155 ? -2.935  30.959  0.449   1.00 36.14  ? 149  VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 155 ? -4.297  31.031  2.523   1.00 37.63  ? 149  VAL A CG2   1 
ATOM   1193 N  N     . PHE A 1 156 ? -5.908  31.711  -1.546  1.00 36.81  ? 150  PHE A N     1 
ATOM   1194 C  CA    . PHE A 1 156 ? -5.988  31.717  -2.990  1.00 36.61  ? 150  PHE A CA    1 
ATOM   1195 C  C     . PHE A 1 156 ? -6.535  33.046  -3.487  1.00 35.85  ? 150  PHE A C     1 
ATOM   1196 O  O     . PHE A 1 156 ? -6.170  33.514  -4.564  1.00 36.39  ? 150  PHE A O     1 
ATOM   1197 C  CB    . PHE A 1 156 ? -6.843  30.562  -3.473  1.00 37.50  ? 150  PHE A CB    1 
ATOM   1198 C  CG    . PHE A 1 156 ? -6.177  29.227  -3.340  1.00 38.66  ? 150  PHE A CG    1 
ATOM   1199 C  CD1   . PHE A 1 156 ? -6.463  28.389  -2.265  1.00 38.47  ? 150  PHE A CD1   1 
ATOM   1200 C  CD2   . PHE A 1 156 ? -5.273  28.798  -4.308  1.00 41.21  ? 150  PHE A CD2   1 
ATOM   1201 C  CE1   . PHE A 1 156 ? -5.866  27.138  -2.154  1.00 39.13  ? 150  PHE A CE1   1 
ATOM   1202 C  CE2   . PHE A 1 156 ? -4.662  27.545  -4.215  1.00 41.11  ? 150  PHE A CE2   1 
ATOM   1203 C  CZ    . PHE A 1 156 ? -4.964  26.712  -3.131  1.00 41.23  ? 150  PHE A CZ    1 
ATOM   1204 N  N     . ALA A 1 157 ? -7.401  33.664  -2.693  1.00 34.32  ? 151  ALA A N     1 
ATOM   1205 C  CA    . ALA A 1 157 ? -7.944  34.967  -3.058  1.00 33.58  ? 151  ALA A CA    1 
ATOM   1206 C  C     . ALA A 1 157 ? -6.773  35.956  -3.134  1.00 34.09  ? 151  ALA A C     1 
ATOM   1207 O  O     . ALA A 1 157 ? -6.703  36.804  -4.022  1.00 34.39  ? 151  ALA A O     1 
ATOM   1208 C  CB    . ALA A 1 157 ? -8.944  35.430  -2.013  1.00 31.70  ? 151  ALA A CB    1 
ATOM   1209 N  N     . LYS A 1 158 ? -5.842  35.827  -2.199  1.00 33.53  ? 152  LYS A N     1 
ATOM   1210 C  CA    . LYS A 1 158 ? -4.692  36.706  -2.155  1.00 32.45  ? 152  LYS A CA    1 
ATOM   1211 C  C     . LYS A 1 158 ? -3.701  36.441  -3.280  1.00 32.46  ? 152  LYS A C     1 
ATOM   1212 O  O     . LYS A 1 158 ? -2.917  37.322  -3.626  1.00 31.00  ? 152  LYS A O     1 
ATOM   1213 C  CB    . LYS A 1 158 ? -3.991  36.563  -0.804  1.00 32.34  ? 152  LYS A CB    1 
ATOM   1214 C  CG    . LYS A 1 158 ? -2.866  37.537  -0.624  1.00 34.62  ? 152  LYS A CG    1 
ATOM   1215 C  CD    . LYS A 1 158 ? -2.248  37.461  0.747   1.00 38.68  ? 152  LYS A CD    1 
ATOM   1216 C  CE    . LYS A 1 158 ? -1.534  38.775  1.113   1.00 40.43  ? 152  LYS A CE    1 
ATOM   1217 N  NZ    . LYS A 1 158 ? -0.643  39.325  0.030   1.00 42.53  ? 152  LYS A NZ    1 
ATOM   1218 N  N     . ILE A 1 159 ? -3.726  35.235  -3.850  1.00 32.48  ? 153  ILE A N     1 
ATOM   1219 C  CA    . ILE A 1 159 ? -2.790  34.901  -4.916  1.00 32.35  ? 153  ILE A CA    1 
ATOM   1220 C  C     . ILE A 1 159 ? -3.254  35.433  -6.244  1.00 34.60  ? 153  ILE A C     1 
ATOM   1221 O  O     . ILE A 1 159 ? -2.461  35.928  -7.046  1.00 32.96  ? 153  ILE A O     1 
ATOM   1222 C  CB    . ILE A 1 159 ? -2.591  33.413  -5.024  1.00 31.05  ? 153  ILE A CB    1 
ATOM   1223 C  CG1   . ILE A 1 159 ? -2.148  32.873  -3.667  1.00 33.62  ? 153  ILE A CG1   1 
ATOM   1224 C  CG2   . ILE A 1 159 ? -1.525  33.120  -6.044  1.00 31.52  ? 153  ILE A CG2   1 
ATOM   1225 C  CD1   . ILE A 1 159 ? -1.524  31.483  -3.702  1.00 33.26  ? 153  ILE A CD1   1 
ATOM   1226 N  N     . ALA A 1 160 ? -4.561  35.343  -6.449  1.00 37.84  ? 154  ALA A N     1 
ATOM   1227 C  CA    . ALA A 1 160 ? -5.205  35.822  -7.657  1.00 41.27  ? 154  ALA A CA    1 
ATOM   1228 C  C     . ALA A 1 160 ? -4.973  37.324  -7.781  1.00 43.52  ? 154  ALA A C     1 
ATOM   1229 O  O     . ALA A 1 160 ? -4.931  37.873  -8.885  1.00 44.23  ? 154  ALA A O     1 
ATOM   1230 C  CB    . ALA A 1 160 ? -6.684  35.523  -7.587  1.00 41.54  ? 154  ALA A CB    1 
ATOM   1231 N  N     . ALA A 1 161 ? -4.831  37.986  -6.637  1.00 46.34  ? 155  ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 161 ? -4.572  39.421  -6.616  1.00 48.86  ? 155  ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 161 ? -3.102  39.685  -6.922  1.00 50.47  ? 155  ALA A C     1 
ATOM   1234 O  O     . ALA A 1 161 ? -2.747  40.723  -7.476  1.00 50.07  ? 155  ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 161 ? -4.922  39.999  -5.268  1.00 48.54  ? 155  ALA A CB    1 
ATOM   1236 N  N     . ASP A 1 162 ? -2.248  38.735  -6.561  1.00 52.72  ? 156  ASP A N     1 
ATOM   1237 C  CA    . ASP A 1 162 ? -0.823  38.879  -6.803  1.00 54.88  ? 156  ASP A CA    1 
ATOM   1238 C  C     . ASP A 1 162 ? -0.504  38.776  -8.275  1.00 54.57  ? 156  ASP A C     1 
ATOM   1239 O  O     . ASP A 1 162 ? 0.310   39.529  -8.805  1.00 53.08  ? 156  ASP A O     1 
ATOM   1240 C  CB    . ASP A 1 162 ? -0.052  37.814  -6.031  1.00 57.54  ? 156  ASP A CB    1 
ATOM   1241 C  CG    . ASP A 1 162 ? 0.504   38.347  -4.722  1.00 61.28  ? 156  ASP A CG    1 
ATOM   1242 O  OD1   . ASP A 1 162 ? 1.410   39.220  -4.776  1.00 62.29  ? 156  ASP A OD1   1 
ATOM   1243 O  OD2   . ASP A 1 162 ? 0.029   37.905  -3.647  1.00 63.08  ? 156  ASP A OD2   1 
ATOM   1244 N  N     . MET A 1 163 ? -1.166  37.832  -8.927  1.00 55.14  ? 157  MET A N     1 
ATOM   1245 C  CA    . MET A 1 163 ? -0.979  37.585  -10.343 1.00 55.45  ? 157  MET A CA    1 
ATOM   1246 C  C     . MET A 1 163 ? -1.487  38.719  -11.202 1.00 55.49  ? 157  MET A C     1 
ATOM   1247 O  O     . MET A 1 163 ? -0.794  39.176  -12.106 1.00 54.82  ? 157  MET A O     1 
ATOM   1248 C  CB    . MET A 1 163 ? -1.712  36.315  -10.727 1.00 56.29  ? 157  MET A CB    1 
ATOM   1249 C  CG    . MET A 1 163 ? -1.241  35.100  -9.967  1.00 57.18  ? 157  MET A CG    1 
ATOM   1250 S  SD    . MET A 1 163 ? -2.284  33.694  -10.310 1.00 58.37  ? 157  MET A SD    1 
ATOM   1251 C  CE    . MET A 1 163 ? -1.595  33.156  -11.888 1.00 57.45  ? 157  MET A CE    1 
ATOM   1252 N  N     . ALA A 1 164 ? -2.698  39.172  -10.893 1.00 55.80  ? 158  ALA A N     1 
ATOM   1253 C  CA    . ALA A 1 164 ? -3.367  40.232  -11.637 1.00 56.21  ? 158  ALA A CA    1 
ATOM   1254 C  C     . ALA A 1 164 ? -2.911  41.670  -11.434 1.00 55.73  ? 158  ALA A C     1 
ATOM   1255 O  O     . ALA A 1 164 ? -3.392  42.547  -12.149 1.00 56.77  ? 158  ALA A O     1 
ATOM   1256 C  CB    . ALA A 1 164 ? -4.875  40.151  -11.388 1.00 55.75  ? 158  ALA A CB    1 
ATOM   1257 N  N     . LYS A 1 165 ? -2.013  41.934  -10.486 1.00 55.31  ? 159  LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 165 ? -1.576  43.318  -10.255 1.00 54.39  ? 159  LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 165 ? -0.597  43.779  -11.315 1.00 53.78  ? 159  LYS A C     1 
ATOM   1260 O  O     . LYS A 1 165 ? 0.107   42.962  -11.902 1.00 53.46  ? 159  LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 165 ? -0.924  43.493  -8.874  1.00 54.13  ? 159  LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 165 ? 0.589   43.263  -8.834  1.00 53.02  ? 159  LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 165 ? 1.176   43.581  -7.453  1.00 52.29  ? 159  LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 165 ? 0.471   42.823  -6.308  1.00 50.77  ? 159  LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 165 ? 1.173   42.907  -4.984  1.00 48.68  ? 159  LYS A NZ    1 
ATOM   1266 N  N     . PRO A 1 166 ? -0.516  45.103  -11.549 1.00 53.58  ? 160  PRO A N     1 
ATOM   1267 C  CA    . PRO A 1 166 ? -1.307  46.122  -10.850 1.00 53.37  ? 160  PRO A CA    1 
ATOM   1268 C  C     . PRO A 1 166 ? -2.577  46.517  -11.578 1.00 53.51  ? 160  PRO A C     1 
ATOM   1269 O  O     . PRO A 1 166 ? -2.779  46.159  -12.739 1.00 53.48  ? 160  PRO A O     1 
ATOM   1270 C  CB    . PRO A 1 166 ? -0.342  47.288  -10.760 1.00 53.32  ? 160  PRO A CB    1 
ATOM   1271 C  CG    . PRO A 1 166 ? 0.324   47.223  -12.092 1.00 53.19  ? 160  PRO A CG    1 
ATOM   1272 C  CD    . PRO A 1 166 ? 0.590   45.734  -12.293 1.00 53.15  ? 160  PRO A CD    1 
ATOM   1273 N  N     . ASN A 1 167 ? -3.419  47.266  -10.875 1.00 54.05  ? 161  ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 167 ? -4.676  47.779  -11.407 1.00 54.34  ? 161  ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 167 ? -5.501  46.711  -12.072 1.00 54.10  ? 161  ASN A C     1 
ATOM   1276 O  O     . ASN A 1 167 ? -6.108  46.968  -13.110 1.00 56.25  ? 161  ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 167 ? -4.401  48.900  -12.412 1.00 55.25  ? 161  ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 167 ? -5.611  49.785  -12.643 1.00 57.36  ? 161  ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 167 ? -6.715  49.473  -12.196 1.00 57.08  ? 161  ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 167 ? -5.408  50.901  -13.346 1.00 58.73  ? 161  ASN A ND2   1 
ATOM   1281 N  N     . GLY A 1 168 ? -5.502  45.510  -11.495 1.00 51.94  ? 162  GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 168 ? -6.280  44.413  -12.077 1.00 49.22  ? 162  GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 168 ? -7.254  43.748  -11.144 1.00 47.82  ? 162  GLY A C     1 
ATOM   1284 O  O     . GLY A 1 168 ? -7.612  44.366  -10.107 1.00 47.23  ? 162  GLY A O     1 
ATOM   1285 N  N     . ILE A 1 169 ? -7.712  42.543  -11.527 1.00 47.12  ? 163  ILE A N     1 
ATOM   1286 C  CA    . ILE A 1 169 ? -8.638  41.728  -10.742 1.00 46.39  ? 163  ILE A CA    1 
ATOM   1287 C  C     . ILE A 1 169 ? -8.560  40.408  -11.478 1.00 47.51  ? 163  ILE A C     1 
ATOM   1288 O  O     . ILE A 1 169 ? -8.373  40.421  -12.698 1.00 46.50  ? 163  ILE A O     1 
ATOM   1289 C  CB    . ILE A 1 169 ? -10.111 42.196  -10.790 1.00 44.38  ? 163  ILE A CB    1 
ATOM   1290 C  CG1   . ILE A 1 169 ? -11.031 40.976  -10.778 1.00 42.84  ? 163  ILE A CG1   1 
ATOM   1291 C  CG2   . ILE A 1 169 ? -10.376 42.955  -12.041 1.00 45.79  ? 163  ILE A CG2   1 
ATOM   1292 C  CD1   . ILE A 1 169 ? -12.488 41.305  -10.950 1.00 42.90  ? 163  ILE A CD1   1 
ATOM   1293 N  N     . LYS A 1 170 ? -8.657  39.297  -10.733 1.00 48.37  ? 164  LYS A N     1 
ATOM   1294 C  CA    . LYS A 1 170 ? -8.596  37.929  -11.267 1.00 48.42  ? 164  LYS A CA    1 
ATOM   1295 C  C     . LYS A 1 170 ? -9.516  37.037  -10.460 1.00 49.57  ? 164  LYS A C     1 
ATOM   1296 O  O     . LYS A 1 170 ? -9.993  37.440  -9.417  1.00 51.31  ? 164  LYS A O     1 
ATOM   1297 C  CB    . LYS A 1 170 ? -7.189  37.356  -11.179 1.00 47.53  ? 164  LYS A CB    1 
ATOM   1298 C  CG    . LYS A 1 170 ? -7.060  36.013  -11.885 1.00 49.49  ? 164  LYS A CG    1 
ATOM   1299 C  CD    . LYS A 1 170 ? -5.646  35.476  -11.797 1.00 51.38  ? 164  LYS A CD    1 
ATOM   1300 C  CE    . LYS A 1 170 ? -5.236  34.800  -13.104 1.00 54.20  ? 164  LYS A CE    1 
ATOM   1301 N  NZ    . LYS A 1 170 ? -4.952  35.801  -14.220 1.00 56.81  ? 164  LYS A NZ    1 
ATOM   1302 N  N     . VAL A 1 171 ? -9.776  35.826  -10.933 1.00 50.59  ? 165  VAL A N     1 
ATOM   1303 C  CA    . VAL A 1 171 ? -10.646 34.900  -10.217 1.00 51.61  ? 165  VAL A CA    1 
ATOM   1304 C  C     . VAL A 1 171 ? -10.102 33.499  -10.335 1.00 54.51  ? 165  VAL A C     1 
ATOM   1305 O  O     . VAL A 1 171 ? -9.952  32.976  -11.429 1.00 56.34  ? 165  VAL A O     1 
ATOM   1306 C  CB    . VAL A 1 171 ? -12.077 34.924  -10.776 1.00 49.90  ? 165  VAL A CB    1 
ATOM   1307 C  CG1   . VAL A 1 171 ? -12.853 33.721  -10.280 1.00 47.25  ? 165  VAL A CG1   1 
ATOM   1308 C  CG2   . VAL A 1 171 ? -12.762 36.212  -10.357 1.00 48.17  ? 165  VAL A CG2   1 
ATOM   1309 N  N     . ILE A 1 172 ? -9.803  32.890  -9.201  1.00 58.12  ? 166  ILE A N     1 
ATOM   1310 C  CA    . ILE A 1 172 ? -9.265  31.547  -9.206  1.00 61.94  ? 166  ILE A CA    1 
ATOM   1311 C  C     . ILE A 1 172 ? -10.362 30.552  -8.914  1.00 64.48  ? 166  ILE A C     1 
ATOM   1312 O  O     . ILE A 1 172 ? -10.676 30.284  -7.758  1.00 64.78  ? 166  ILE A O     1 
ATOM   1313 C  CB    . ILE A 1 172 ? -8.132  31.416  -8.173  1.00 62.07  ? 166  ILE A CB    1 
ATOM   1314 C  CG1   . ILE A 1 172 ? -6.882  32.101  -8.723  1.00 62.00  ? 166  ILE A CG1   1 
ATOM   1315 C  CG2   . ILE A 1 172 ? -7.842  29.963  -7.870  1.00 61.98  ? 166  ILE A CG2   1 
ATOM   1316 C  CD1   . ILE A 1 172 ? -5.751  32.155  -7.764  1.00 62.79  ? 166  ILE A CD1   1 
ATOM   1317 N  N     . ASP A 1 173 ? -10.950 30.018  -9.977  1.00 67.58  ? 167  ASP A N     1 
ATOM   1318 C  CA    . ASP A 1 173 ? -12.020 29.040  -9.848  1.00 71.10  ? 167  ASP A CA    1 
ATOM   1319 C  C     . ASP A 1 173 ? -11.472 27.694  -9.390  1.00 72.06  ? 167  ASP A C     1 
ATOM   1320 O  O     . ASP A 1 173 ? -10.264 27.465  -9.399  1.00 72.75  ? 167  ASP A O     1 
ATOM   1321 C  CB    . ASP A 1 173 ? -12.741 28.887  -11.187 1.00 73.33  ? 167  ASP A CB    1 
ATOM   1322 C  CG    . ASP A 1 173 ? -11.785 28.944  -12.367 1.00 76.37  ? 167  ASP A CG    1 
ATOM   1323 O  OD1   . ASP A 1 173 ? -11.076 29.975  -12.503 1.00 76.69  ? 167  ASP A OD1   1 
ATOM   1324 O  OD2   . ASP A 1 173 ? -11.744 27.963  -13.151 1.00 77.54  ? 167  ASP A OD2   1 
ATOM   1325 N  N     . ASP A 1 174 ? -12.377 26.809  -8.997  1.00 72.44  ? 168  ASP A N     1 
ATOM   1326 C  CA    . ASP A 1 174 ? -12.027 25.479  -8.522  1.00 73.00  ? 168  ASP A CA    1 
ATOM   1327 C  C     . ASP A 1 174 ? -11.239 24.673  -9.542  1.00 72.91  ? 168  ASP A C     1 
ATOM   1328 O  O     . ASP A 1 174 ? -10.227 24.052  -9.212  1.00 72.48  ? 168  ASP A O     1 
ATOM   1329 C  CB    . ASP A 1 174 ? -13.306 24.742  -8.140  1.00 74.32  ? 168  ASP A CB    1 
ATOM   1330 C  CG    . ASP A 1 174 ? -14.117 25.501  -7.096  1.00 77.57  ? 168  ASP A CG    1 
ATOM   1331 O  OD1   . ASP A 1 174 ? -14.180 26.753  -7.181  1.00 79.40  ? 168  ASP A OD1   1 
ATOM   1332 O  OD2   . ASP A 1 174 ? -14.696 24.852  -6.196  1.00 78.77  ? 168  ASP A OD2   1 
ATOM   1333 N  N     . GLU A 1 175 ? -11.703 24.676  -10.783 1.00 73.04  ? 169  GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 175 ? -11.013 23.936  -11.820 1.00 73.89  ? 169  GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 175 ? -9.618  24.517  -11.997 1.00 73.86  ? 169  GLU A C     1 
ATOM   1336 O  O     . GLU A 1 175 ? -8.678  23.800  -12.344 1.00 73.71  ? 169  GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 175 ? -11.798 24.008  -13.132 1.00 75.23  ? 169  GLU A CB    1 
ATOM   1338 C  CG    . GLU A 1 175 ? -11.141 23.280  -14.312 1.00 76.90  ? 169  GLU A CG    1 
ATOM   1339 C  CD    . GLU A 1 175 ? -10.323 24.204  -15.211 1.00 77.62  ? 169  GLU A CD    1 
ATOM   1340 O  OE1   . GLU A 1 175 ? -10.920 25.144  -15.793 1.00 77.05  ? 169  GLU A OE1   1 
ATOM   1341 O  OE2   . GLU A 1 175 ? -9.092  23.986  -15.333 1.00 77.53  ? 169  GLU A OE2   1 
ATOM   1342 N  N     . GLU A 1 176 ? -9.491  25.819  -11.749 1.00 73.48  ? 170  GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 176 ? -8.212  26.512  -11.874 1.00 73.12  ? 170  GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 176 ? -7.323  26.258  -10.665 1.00 71.94  ? 170  GLU A C     1 
ATOM   1345 O  O     . GLU A 1 176 ? -6.104  26.141  -10.787 1.00 71.00  ? 170  GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 176 ? -8.431  28.017  -12.015 1.00 74.55  ? 170  GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 176 ? -8.228  28.554  -13.417 1.00 78.27  ? 170  GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 176 ? -7.419  29.839  -13.417 1.00 80.68  ? 170  GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 176 ? -7.762  30.745  -12.625 1.00 82.52  ? 170  GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 176 ? -6.447  29.946  -14.204 1.00 81.65  ? 170  GLU A OE2   1 
ATOM   1351 N  N     . VAL A 1 177 ? -7.940  26.185  -9.494  1.00 70.76  ? 171  VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 177 ? -7.197  25.950  -8.267  1.00 70.07  ? 171  VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 177 ? -6.328  24.717  -8.398  1.00 70.06  ? 171  VAL A C     1 
ATOM   1354 O  O     . VAL A 1 177 ? -5.107  24.784  -8.256  1.00 70.64  ? 171  VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 177 ? -8.130  25.734  -7.077  1.00 69.93  ? 171  VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 177 ? -7.327  25.275  -5.886  1.00 68.64  ? 171  VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 177 ? -8.878  27.019  -6.760  1.00 70.82  ? 171  VAL A CG2   1 
ATOM   1358 N  N     . LYS A 1 178 ? -6.965  23.584  -8.661  1.00 69.46  ? 172  LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 178 ? -6.233  22.339  -8.808  1.00 67.79  ? 172  LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 178 ? -5.072  22.559  -9.766  1.00 66.46  ? 172  LYS A C     1 
ATOM   1361 O  O     . LYS A 1 178 ? -4.016  21.953  -9.623  1.00 66.25  ? 172  LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 178 ? -7.156  21.232  -9.328  1.00 68.15  ? 172  LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 178 ? -8.230  20.792  -8.329  1.00 68.63  ? 172  LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 178 ? -9.000  19.563  -8.801  1.00 69.94  ? 172  LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 178 ? -9.694  19.797  -10.141 1.00 70.65  ? 172  LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 178 ? -10.624 20.960  -10.099 1.00 70.70  ? 172  LYS A NZ    1 
ATOM   1367 N  N     . ARG A 1 179 ? -5.268  23.447  -10.733 1.00 65.15  ? 173  ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 179 ? -4.225  23.747  -11.706 1.00 63.84  ? 173  ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 179 ? -3.098  24.513  -11.014 1.00 62.19  ? 173  ARG A C     1 
ATOM   1370 O  O     . ARG A 1 179 ? -1.933  24.168  -11.159 1.00 61.25  ? 173  ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 179 ? -4.798  24.578  -12.857 1.00 65.60  ? 173  ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 179 ? -3.973  24.556  -14.149 1.00 67.15  ? 173  ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 179 ? -4.435  25.658  -15.121 1.00 69.02  ? 173  ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 179 ? -5.871  25.602  -15.407 1.00 70.11  ? 173  ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 179 ? -6.580  26.637  -15.853 1.00 70.69  ? 173  ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 179 ? -5.989  27.807  -16.065 1.00 70.11  ? 173  ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 179 ? -7.879  26.507  -16.084 1.00 71.73  ? 173  ARG A NH2   1 
ATOM   1378 N  N     . LEU A 1 180 ? -3.442  25.549  -10.253 1.00 60.11  ? 174  LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 180 ? -2.426  26.324  -9.543  1.00 58.44  ? 174  LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 180 ? -1.615  25.484  -8.575  1.00 57.27  ? 174  LEU A C     1 
ATOM   1381 O  O     . LEU A 1 180 ? -0.400  25.626  -8.494  1.00 56.44  ? 174  LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 180 ? -3.060  27.473  -8.769  1.00 59.13  ? 174  LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 180 ? -3.047  28.818  -9.488  1.00 59.43  ? 174  LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 180 ? -3.652  29.874  -8.594  1.00 59.36  ? 174  LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 180 ? -1.625  29.178  -9.863  1.00 59.07  ? 174  LEU A CD2   1 
ATOM   1386 N  N     . ILE A 1 181 ? -2.290  24.616  -7.830  1.00 55.70  ? 175  ILE A N     1 
ATOM   1387 C  CA    . ILE A 1 181 ? -1.608  23.757  -6.879  1.00 55.10  ? 175  ILE A CA    1 
ATOM   1388 C  C     . ILE A 1 181 ? -0.502  22.938  -7.556  1.00 55.92  ? 175  ILE A C     1 
ATOM   1389 O  O     . ILE A 1 181 ? 0.304   22.307  -6.894  1.00 54.92  ? 175  ILE A O     1 
ATOM   1390 C  CB    . ILE A 1 181 ? -2.612  22.821  -6.186  1.00 55.03  ? 175  ILE A CB    1 
ATOM   1391 C  CG1   . ILE A 1 181 ? -3.649  23.662  -5.437  1.00 53.88  ? 175  ILE A CG1   1 
ATOM   1392 C  CG2   . ILE A 1 181 ? -1.892  21.870  -5.243  1.00 55.56  ? 175  ILE A CG2   1 
ATOM   1393 C  CD1   . ILE A 1 181 ? -4.481  22.900  -4.433  1.00 51.48  ? 175  ILE A CD1   1 
ATOM   1394 N  N     . ARG A 1 182 ? -0.449  22.958  -8.879  1.00 57.82  ? 176  ARG A N     1 
ATOM   1395 C  CA    . ARG A 1 182 ? 0.583   22.222  -9.595  1.00 59.91  ? 176  ARG A CA    1 
ATOM   1396 C  C     . ARG A 1 182 ? 1.594   23.192  -10.204 1.00 60.97  ? 176  ARG A C     1 
ATOM   1397 O  O     . ARG A 1 182 ? 2.799   22.991  -10.105 1.00 59.84  ? 176  ARG A O     1 
ATOM   1398 C  CB    . ARG A 1 182 ? -0.041  21.375  -10.706 1.00 61.69  ? 176  ARG A CB    1 
ATOM   1399 C  CG    . ARG A 1 182 ? -1.390  20.735  -10.356 1.00 63.50  ? 176  ARG A CG    1 
ATOM   1400 C  CD    . ARG A 1 182 ? -1.767  19.568  -11.294 1.00 64.86  ? 176  ARG A CD    1 
ATOM   1401 N  NE    . ARG A 1 182 ? -1.756  19.914  -12.717 1.00 66.00  ? 176  ARG A NE    1 
ATOM   1402 C  CZ    . ARG A 1 182 ? -0.662  19.983  -13.476 1.00 66.65  ? 176  ARG A CZ    1 
ATOM   1403 N  NH1   . ARG A 1 182 ? 0.535   19.724  -12.957 1.00 66.58  ? 176  ARG A NH1   1 
ATOM   1404 N  NH2   . ARG A 1 182 ? -0.764  20.328  -14.756 1.00 66.77  ? 176  ARG A NH2   1 
ATOM   1405 N  N     . GLU A 1 183 ? 1.093   24.246  -10.841 1.00 63.47  ? 177  GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 183 ? 1.957   25.249  -11.466 1.00 65.77  ? 177  GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 183 ? 2.502   26.254  -10.452 1.00 65.55  ? 177  GLU A C     1 
ATOM   1408 O  O     . GLU A 1 183 ? 3.688   26.600  -10.502 1.00 64.28  ? 177  GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 183 ? 1.211   25.999  -12.583 1.00 67.42  ? 177  GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 183 ? 1.058   25.207  -13.875 1.00 71.03  ? 177  GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 183 ? -0.124  24.262  -13.844 1.00 74.42  ? 177  GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 183 ? -0.371  23.679  -12.772 1.00 75.58  ? 177  GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 183 ? -0.797  24.088  -14.886 1.00 76.40  ? 177  GLU A OE2   1 
ATOM   1414 N  N     . LEU A 1 184 ? 1.634   26.725  -9.549  1.00 65.86  ? 178  LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 184 ? 2.035   27.680  -8.510  1.00 65.59  ? 178  LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 184 ? 3.234   27.061  -7.823  1.00 65.11  ? 178  LEU A C     1 
ATOM   1417 O  O     . LEU A 1 184 ? 3.191   25.886  -7.449  1.00 65.64  ? 178  LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 184 ? 0.904   27.917  -7.493  1.00 64.77  ? 178  LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 184 ? 1.203   28.797  -6.264  1.00 62.82  ? 178  LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 184 ? 1.913   30.068  -6.673  1.00 61.70  ? 178  LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 184 ? -0.092  29.116  -5.551  1.00 62.21  ? 178  LEU A CD2   1 
ATOM   1422 N  N     . ASP A 1 185 ? 4.288   27.849  -7.636  1.00 64.29  ? 179  ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 185 ? 5.504   27.315  -7.061  1.00 63.94  ? 179  ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 185 ? 6.048   27.830  -5.743  1.00 64.33  ? 179  ASP A C     1 
ATOM   1425 O  O     . ASP A 1 185 ? 5.317   28.155  -4.807  1.00 63.50  ? 179  ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 185 ? 6.624   27.391  -8.110  1.00 64.44  ? 179  ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 185 ? 7.148   28.805  -8.325  1.00 62.88  ? 179  ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 185 ? 6.585   29.745  -7.730  1.00 60.17  ? 179  ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 185 ? 8.127   28.962  -9.094  1.00 63.14  ? 179  ASP A OD2   1 
ATOM   1430 N  N     . ILE A 1 186 ? 7.377   27.848  -5.718  1.00 65.66  ? 180  ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 186 ? 8.236   28.257  -4.616  1.00 67.16  ? 180  ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 186 ? 7.688   29.267  -3.605  1.00 67.22  ? 180  ILE A C     1 
ATOM   1433 O  O     . ILE A 1 186 ? 6.621   29.078  -3.021  1.00 66.23  ? 180  ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 186 ? 9.609   28.750  -5.215  1.00 68.10  ? 180  ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 186 ? 10.292  27.586  -5.943  1.00 70.02  ? 180  ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 186 ? 10.571  29.232  -4.128  1.00 67.63  ? 180  ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 186 ? 11.521  27.978  -6.772  1.00 70.48  ? 180  ILE A CD1   1 
ATOM   1438 N  N     . ALA A 1 187 ? 8.440   30.342  -3.410  1.00 67.43  ? 181  ALA A N     1 
ATOM   1439 C  CA    . ALA A 1 187 ? 8.105   31.373  -2.450  1.00 67.72  ? 181  ALA A CA    1 
ATOM   1440 C  C     . ALA A 1 187 ? 6.911   32.228  -2.838  1.00 67.64  ? 181  ALA A C     1 
ATOM   1441 O  O     . ALA A 1 187 ? 6.483   33.076  -2.052  1.00 69.55  ? 181  ALA A O     1 
ATOM   1442 C  CB    . ALA A 1 187 ? 9.335   32.262  -2.194  1.00 68.13  ? 181  ALA A CB    1 
ATOM   1443 N  N     . ASP A 1 188 ? 6.365   32.028  -4.033  1.00 65.94  ? 182  ASP A N     1 
ATOM   1444 C  CA    . ASP A 1 188 ? 5.213   32.830  -4.433  1.00 64.89  ? 182  ASP A CA    1 
ATOM   1445 C  C     . ASP A 1 188 ? 4.006   32.430  -3.573  1.00 63.64  ? 182  ASP A C     1 
ATOM   1446 O  O     . ASP A 1 188 ? 2.866   32.759  -3.890  1.00 64.46  ? 182  ASP A O     1 
ATOM   1447 C  CB    . ASP A 1 188 ? 4.906   32.655  -5.941  1.00 66.18  ? 182  ASP A CB    1 
ATOM   1448 C  CG    . ASP A 1 188 ? 5.907   33.412  -6.866  1.00 68.75  ? 182  ASP A CG    1 
ATOM   1449 O  OD1   . ASP A 1 188 ? 6.012   34.662  -6.788  1.00 69.53  ? 182  ASP A OD1   1 
ATOM   1450 O  OD2   . ASP A 1 188 ? 6.588   32.760  -7.693  1.00 68.81  ? 182  ASP A OD2   1 
ATOM   1451 N  N     . VAL A 1 189 ? 4.278   31.738  -2.467  1.00 61.89  ? 183  VAL A N     1 
ATOM   1452 C  CA    . VAL A 1 189 ? 3.237   31.280  -1.554  1.00 60.43  ? 183  VAL A CA    1 
ATOM   1453 C  C     . VAL A 1 189 ? 3.120   32.164  -0.307  1.00 59.60  ? 183  VAL A C     1 
ATOM   1454 O  O     . VAL A 1 189 ? 4.043   32.249  0.506   1.00 60.26  ? 183  VAL A O     1 
ATOM   1455 C  CB    . VAL A 1 189 ? 3.509   29.828  -1.102  1.00 60.76  ? 183  VAL A CB    1 
ATOM   1456 C  CG1   . VAL A 1 189 ? 2.248   29.235  -0.470  1.00 60.36  ? 183  VAL A CG1   1 
ATOM   1457 C  CG2   . VAL A 1 189 ? 3.972   28.989  -2.287  1.00 59.93  ? 183  VAL A CG2   1 
ATOM   1458 N  N     . PRO A 1 190 ? 1.972   32.828  -0.138  1.00 58.04  ? 184  PRO A N     1 
ATOM   1459 C  CA    . PRO A 1 190 ? 1.720   33.708  1.004   1.00 57.13  ? 184  PRO A CA    1 
ATOM   1460 C  C     . PRO A 1 190 ? 2.010   33.051  2.346   1.00 56.66  ? 184  PRO A C     1 
ATOM   1461 O  O     . PRO A 1 190 ? 1.334   32.103  2.743   1.00 56.03  ? 184  PRO A O     1 
ATOM   1462 C  CB    . PRO A 1 190 ? 0.245   34.060  0.843   1.00 56.79  ? 184  PRO A CB    1 
ATOM   1463 C  CG    . PRO A 1 190 ? 0.089   34.095  -0.627  1.00 57.56  ? 184  PRO A CG    1 
ATOM   1464 C  CD    . PRO A 1 190 ? 0.830   32.843  -1.063  1.00 57.89  ? 184  PRO A CD    1 
ATOM   1465 N  N     . GLY A 1 191 ? 3.027   33.563  3.033   1.00 56.57  ? 185  GLY A N     1 
ATOM   1466 C  CA    . GLY A 1 191 ? 3.401   33.040  4.335   1.00 56.65  ? 185  GLY A CA    1 
ATOM   1467 C  C     . GLY A 1 191 ? 4.780   32.407  4.366   1.00 56.63  ? 185  GLY A C     1 
ATOM   1468 O  O     . GLY A 1 191 ? 5.426   32.336  5.410   1.00 56.44  ? 185  GLY A O     1 
ATOM   1469 N  N     . ILE A 1 192 ? 5.233   31.946  3.209   1.00 56.90  ? 186  ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 192 ? 6.533   31.305  3.095   1.00 56.76  ? 186  ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 192 ? 7.558   32.339  2.662   1.00 58.63  ? 186  ILE A C     1 
ATOM   1472 O  O     . ILE A 1 192 ? 7.500   32.858  1.537   1.00 59.82  ? 186  ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 192 ? 6.467   30.183  2.058   1.00 54.26  ? 186  ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 192 ? 5.307   29.262  2.407   1.00 53.69  ? 186  ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 192 ? 7.759   29.431  2.010   1.00 53.39  ? 186  ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 192 ? 5.202   28.970  3.887   1.00 51.38  ? 186  ILE A CD1   1 
ATOM   1477 N  N     . GLY A 1 193 ? 8.496   32.647  3.550   1.00 58.59  ? 187  GLY A N     1 
ATOM   1478 C  CA    . GLY A 1 193 ? 9.494   33.645  3.217   1.00 59.93  ? 187  GLY A CA    1 
ATOM   1479 C  C     . GLY A 1 193 ? 10.720  33.105  2.510   1.00 60.63  ? 187  GLY A C     1 
ATOM   1480 O  O     . GLY A 1 193 ? 10.896  31.901  2.373   1.00 60.56  ? 187  GLY A O     1 
ATOM   1481 N  N     . ASN A 1 194 ? 11.577  34.014  2.068   1.00 61.31  ? 188  ASN A N     1 
ATOM   1482 C  CA    . ASN A 1 194 ? 12.793  33.652  1.364   1.00 61.55  ? 188  ASN A CA    1 
ATOM   1483 C  C     . ASN A 1 194 ? 13.556  32.494  1.981   1.00 60.19  ? 188  ASN A C     1 
ATOM   1484 O  O     . ASN A 1 194 ? 13.940  31.574  1.270   1.00 60.29  ? 188  ASN A O     1 
ATOM   1485 C  CB    . ASN A 1 194 ? 13.704  34.879  1.243   1.00 64.64  ? 188  ASN A CB    1 
ATOM   1486 C  CG    . ASN A 1 194 ? 13.890  35.608  2.565   1.00 67.00  ? 188  ASN A CG    1 
ATOM   1487 O  OD1   . ASN A 1 194 ? 14.598  35.130  3.465   1.00 67.13  ? 188  ASN A OD1   1 
ATOM   1488 N  ND2   . ASN A 1 194 ? 13.241  36.772  2.695   1.00 67.36  ? 188  ASN A ND2   1 
ATOM   1489 N  N     . ILE A 1 195 ? 13.787  32.535  3.291   1.00 59.91  ? 189  ILE A N     1 
ATOM   1490 C  CA    . ILE A 1 195 ? 14.523  31.457  3.962   1.00 60.27  ? 189  ILE A CA    1 
ATOM   1491 C  C     . ILE A 1 195 ? 13.893  30.090  3.711   1.00 60.86  ? 189  ILE A C     1 
ATOM   1492 O  O     . ILE A 1 195 ? 14.545  29.182  3.185   1.00 61.88  ? 189  ILE A O     1 
ATOM   1493 C  CB    . ILE A 1 195 ? 14.607  31.682  5.482   1.00 59.80  ? 189  ILE A CB    1 
ATOM   1494 C  CG1   . ILE A 1 195 ? 15.599  32.812  5.788   1.00 59.88  ? 189  ILE A CG1   1 
ATOM   1495 C  CG2   . ILE A 1 195 ? 14.966  30.381  6.176   1.00 59.25  ? 189  ILE A CG2   1 
ATOM   1496 C  CD1   . ILE A 1 195 ? 16.979  32.633  5.170   1.00 59.27  ? 189  ILE A CD1   1 
ATOM   1497 N  N     . THR A 1 196 ? 12.627  29.944  4.089   1.00 60.18  ? 190  THR A N     1 
ATOM   1498 C  CA    . THR A 1 196 ? 11.920  28.690  3.875   1.00 60.01  ? 190  THR A CA    1 
ATOM   1499 C  C     . THR A 1 196 ? 12.014  28.231  2.413   1.00 59.83  ? 190  THR A C     1 
ATOM   1500 O  O     . THR A 1 196 ? 11.952  27.043  2.123   1.00 60.15  ? 190  THR A O     1 
ATOM   1501 C  CB    . THR A 1 196 ? 10.437  28.817  4.269   1.00 59.55  ? 190  THR A CB    1 
ATOM   1502 O  OG1   . THR A 1 196 ? 10.345  29.178  5.651   1.00 60.93  ? 190  THR A OG1   1 
ATOM   1503 C  CG2   . THR A 1 196 ? 9.715   27.488  4.083   1.00 60.42  ? 190  THR A CG2   1 
ATOM   1504 N  N     . ALA A 1 197 ? 12.190  29.175  1.499   1.00 59.70  ? 191  ALA A N     1 
ATOM   1505 C  CA    . ALA A 1 197 ? 12.275  28.869  0.078   1.00 59.18  ? 191  ALA A CA    1 
ATOM   1506 C  C     . ALA A 1 197 ? 13.657  28.405  -0.351  1.00 59.62  ? 191  ALA A C     1 
ATOM   1507 O  O     . ALA A 1 197 ? 13.796  27.436  -1.107  1.00 57.86  ? 191  ALA A O     1 
ATOM   1508 C  CB    . ALA A 1 197 ? 11.869  30.095  -0.728  1.00 59.75  ? 191  ALA A CB    1 
ATOM   1509 N  N     . GLU A 1 198 ? 14.677  29.112  0.123   1.00 61.18  ? 192  GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 198 ? 16.049  28.779  -0.225  1.00 63.12  ? 192  GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 198 ? 16.406  27.410  0.354   1.00 63.33  ? 192  GLU A C     1 
ATOM   1512 O  O     . GLU A 1 198 ? 17.448  26.841  0.047   1.00 62.76  ? 192  GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 198 ? 17.014  29.883  0.268   1.00 64.39  ? 192  GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 198 ? 17.239  29.982  1.774   1.00 66.20  ? 192  GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 198 ? 18.363  29.073  2.263   1.00 67.45  ? 192  GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 198 ? 19.509  29.218  1.769   1.00 68.10  ? 192  GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 198 ? 18.103  28.219  3.142   1.00 66.64  ? 192  GLU A OE2   1 
ATOM   1518 N  N     . LYS A 1 199 ? 15.522  26.873  1.184   1.00 63.40  ? 193  LYS A N     1 
ATOM   1519 C  CA    . LYS A 1 199 ? 15.758  25.564  1.769   1.00 64.10  ? 193  LYS A CA    1 
ATOM   1520 C  C     . LYS A 1 199 ? 15.031  24.504  0.942   1.00 64.27  ? 193  LYS A C     1 
ATOM   1521 O  O     . LYS A 1 199 ? 15.644  23.559  0.453   1.00 64.60  ? 193  LYS A O     1 
ATOM   1522 C  CB    . LYS A 1 199 ? 15.276  25.538  3.224   1.00 64.26  ? 193  LYS A CB    1 
ATOM   1523 C  CG    . LYS A 1 199 ? 16.147  26.344  4.196   1.00 65.19  ? 193  LYS A CG    1 
ATOM   1524 C  CD    . LYS A 1 199 ? 17.176  25.485  4.924   1.00 65.47  ? 193  LYS A CD    1 
ATOM   1525 C  CE    . LYS A 1 199 ? 18.622  25.754  4.478   1.00 65.38  ? 193  LYS A CE    1 
ATOM   1526 N  NZ    . LYS A 1 199 ? 18.952  25.214  3.122   1.00 66.09  ? 193  LYS A NZ    1 
ATOM   1527 N  N     . LEU A 1 200 ? 13.723  24.678  0.785   1.00 64.42  ? 194  LEU A N     1 
ATOM   1528 C  CA    . LEU A 1 200 ? 12.891  23.758  0.017   1.00 63.63  ? 194  LEU A CA    1 
ATOM   1529 C  C     . LEU A 1 200 ? 13.418  23.563  -1.392  1.00 63.94  ? 194  LEU A C     1 
ATOM   1530 O  O     . LEU A 1 200 ? 13.498  22.444  -1.890  1.00 63.65  ? 194  LEU A O     1 
ATOM   1531 C  CB    . LEU A 1 200 ? 11.457  24.288  -0.072  1.00 62.00  ? 194  LEU A CB    1 
ATOM   1532 C  CG    . LEU A 1 200 ? 10.629  24.196  1.209   1.00 62.37  ? 194  LEU A CG    1 
ATOM   1533 C  CD1   . LEU A 1 200 ? 9.304   24.916  1.056   1.00 61.71  ? 194  LEU A CD1   1 
ATOM   1534 C  CD2   . LEU A 1 200 ? 10.397  22.736  1.532   1.00 63.11  ? 194  LEU A CD2   1 
ATOM   1535 N  N     . LYS A 1 201 ? 13.781  24.658  -2.040  1.00 64.58  ? 195  LYS A N     1 
ATOM   1536 C  CA    . LYS A 1 201 ? 14.268  24.569  -3.403  1.00 65.78  ? 195  LYS A CA    1 
ATOM   1537 C  C     . LYS A 1 201 ? 15.430  23.612  -3.514  1.00 66.22  ? 195  LYS A C     1 
ATOM   1538 O  O     . LYS A 1 201 ? 15.413  22.706  -4.338  1.00 66.79  ? 195  LYS A O     1 
ATOM   1539 C  CB    . LYS A 1 201 ? 14.710  25.934  -3.902  1.00 66.00  ? 195  LYS A CB    1 
ATOM   1540 C  CG    . LYS A 1 201 ? 14.673  26.052  -5.407  1.00 66.57  ? 195  LYS A CG    1 
ATOM   1541 C  CD    . LYS A 1 201 ? 15.580  27.170  -5.887  1.00 67.52  ? 195  LYS A CD    1 
ATOM   1542 C  CE    . LYS A 1 201 ? 15.239  27.606  -7.312  1.00 68.19  ? 195  LYS A CE    1 
ATOM   1543 N  NZ    . LYS A 1 201 ? 16.348  28.382  -7.966  1.00 67.22  ? 195  LYS A NZ    1 
ATOM   1544 N  N     . LYS A 1 202 ? 16.439  23.825  -2.679  1.00 67.34  ? 196  LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 202 ? 17.639  22.995  -2.676  1.00 68.15  ? 196  LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 202 ? 17.327  21.506  -2.689  1.00 67.78  ? 196  LYS A C     1 
ATOM   1547 O  O     . LYS A 1 202 ? 18.129  20.694  -3.157  1.00 67.64  ? 196  LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 202 ? 18.483  23.321  -1.446  1.00 69.52  ? 196  LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 202 ? 19.009  24.753  -1.407  1.00 71.69  ? 196  LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 202 ? 19.843  24.995  -0.144  1.00 73.24  ? 196  LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 202 ? 20.359  26.424  -0.064  1.00 74.01  ? 196  LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 202 ? 21.029  26.694  1.233   1.00 74.31  ? 196  LYS A NZ    1 
ATOM   1553 N  N     . LEU A 1 203 ? 16.146  21.162  -2.188  1.00 67.13  ? 197  LEU A N     1 
ATOM   1554 C  CA    . LEU A 1 203 ? 15.715  19.775  -2.100  1.00 66.14  ? 197  LEU A CA    1 
ATOM   1555 C  C     . LEU A 1 203 ? 14.728  19.383  -3.203  1.00 65.58  ? 197  LEU A C     1 
ATOM   1556 O  O     . LEU A 1 203 ? 14.056  18.359  -3.120  1.00 65.75  ? 197  LEU A O     1 
ATOM   1557 C  CB    . LEU A 1 203 ? 15.094  19.529  -0.721  1.00 65.91  ? 197  LEU A CB    1 
ATOM   1558 C  CG    . LEU A 1 203 ? 15.566  20.471  0.394   1.00 65.35  ? 197  LEU A CG    1 
ATOM   1559 C  CD1   . LEU A 1 203 ? 14.971  20.048  1.714   1.00 64.16  ? 197  LEU A CD1   1 
ATOM   1560 C  CD2   . LEU A 1 203 ? 17.080  20.464  0.468   1.00 65.44  ? 197  LEU A CD2   1 
ATOM   1561 N  N     . GLY A 1 204 ? 14.637  20.198  -4.242  1.00 65.05  ? 198  GLY A N     1 
ATOM   1562 C  CA    . GLY A 1 204 ? 13.737  19.869  -5.331  1.00 64.44  ? 198  GLY A CA    1 
ATOM   1563 C  C     . GLY A 1 204 ? 12.322  20.398  -5.216  1.00 63.58  ? 198  GLY A C     1 
ATOM   1564 O  O     . GLY A 1 204 ? 11.664  20.627  -6.229  1.00 64.34  ? 198  GLY A O     1 
ATOM   1565 N  N     . ILE A 1 205 ? 11.838  20.589  -3.998  1.00 61.90  ? 199  ILE A N     1 
ATOM   1566 C  CA    . ILE A 1 205 ? 10.487  21.096  -3.825  1.00 60.95  ? 199  ILE A CA    1 
ATOM   1567 C  C     . ILE A 1 205 ? 10.375  22.496  -4.443  1.00 60.71  ? 199  ILE A C     1 
ATOM   1568 O  O     . ILE A 1 205 ? 10.956  23.460  -3.950  1.00 60.62  ? 199  ILE A O     1 
ATOM   1569 C  CB    . ILE A 1 205 ? 10.101  21.158  -2.333  1.00 61.01  ? 199  ILE A CB    1 
ATOM   1570 C  CG1   . ILE A 1 205 ? 10.409  19.820  -1.651  1.00 61.44  ? 199  ILE A CG1   1 
ATOM   1571 C  CG2   . ILE A 1 205 ? 8.623   21.482  -2.191  1.00 58.78  ? 199  ILE A CG2   1 
ATOM   1572 C  CD1   . ILE A 1 205 ? 11.890  19.578  -1.377  1.00 60.97  ? 199  ILE A CD1   1 
ATOM   1573 N  N     . ASN A 1 206 ? 9.628   22.596  -5.537  1.00 60.19  ? 200  ASN A N     1 
ATOM   1574 C  CA    . ASN A 1 206 ? 9.437   23.862  -6.232  1.00 58.00  ? 200  ASN A CA    1 
ATOM   1575 C  C     . ASN A 1 206 ? 7.978   24.266  -6.202  1.00 55.88  ? 200  ASN A C     1 
ATOM   1576 O  O     . ASN A 1 206 ? 7.638   25.310  -5.671  1.00 55.86  ? 200  ASN A O     1 
ATOM   1577 C  CB    . ASN A 1 206 ? 9.902   23.737  -7.677  1.00 59.43  ? 200  ASN A CB    1 
ATOM   1578 C  CG    . ASN A 1 206 ? 11.344  23.314  -7.775  1.00 61.13  ? 200  ASN A CG    1 
ATOM   1579 O  OD1   . ASN A 1 206 ? 12.224  23.998  -7.263  1.00 63.56  ? 200  ASN A OD1   1 
ATOM   1580 N  ND2   . ASN A 1 206 ? 11.598  22.177  -8.422  1.00 61.73  ? 200  ASN A ND2   1 
ATOM   1581 N  N     . LYS A 1 207 ? 7.114   23.436  -6.769  1.00 52.83  ? 201  LYS A N     1 
ATOM   1582 C  CA    . LYS A 1 207 ? 5.693   23.740  -6.790  1.00 50.54  ? 201  LYS A CA    1 
ATOM   1583 C  C     . LYS A 1 207 ? 5.009   23.342  -5.484  1.00 49.29  ? 201  LYS A C     1 
ATOM   1584 O  O     . LYS A 1 207 ? 5.515   22.512  -4.744  1.00 47.79  ? 201  LYS A O     1 
ATOM   1585 C  CB    . LYS A 1 207 ? 5.035   23.037  -7.973  1.00 49.38  ? 201  LYS A CB    1 
ATOM   1586 C  CG    . LYS A 1 207 ? 5.797   23.197  -9.268  1.00 45.70  ? 201  LYS A CG    1 
ATOM   1587 C  CD    . LYS A 1 207 ? 5.915   24.619  -9.661  1.00 43.54  ? 201  LYS A CD    1 
ATOM   1588 C  CE    . LYS A 1 207 ? 6.815   24.767  -10.856 1.00 44.60  ? 201  LYS A CE    1 
ATOM   1589 N  NZ    . LYS A 1 207 ? 7.193   26.201  -11.054 1.00 44.36  ? 201  LYS A NZ    1 
ATOM   1590 N  N     . LEU A 1 208 ? 3.855   23.939  -5.212  1.00 49.61  ? 202  LEU A N     1 
ATOM   1591 C  CA    . LEU A 1 208 ? 3.115   23.670  -3.981  1.00 51.09  ? 202  LEU A CA    1 
ATOM   1592 C  C     . LEU A 1 208 ? 2.727   22.199  -3.865  1.00 52.73  ? 202  LEU A C     1 
ATOM   1593 O  O     . LEU A 1 208 ? 2.296   21.717  -2.817  1.00 52.72  ? 202  LEU A O     1 
ATOM   1594 C  CB    . LEU A 1 208 ? 1.858   24.554  -3.924  1.00 49.70  ? 202  LEU A CB    1 
ATOM   1595 C  CG    . LEU A 1 208 ? 0.924   24.412  -2.720  1.00 48.42  ? 202  LEU A CG    1 
ATOM   1596 C  CD1   . LEU A 1 208 ? 1.729   24.600  -1.476  1.00 49.14  ? 202  LEU A CD1   1 
ATOM   1597 C  CD2   . LEU A 1 208 ? -0.198  25.423  -2.765  1.00 47.12  ? 202  LEU A CD2   1 
ATOM   1598 N  N     . VAL A 1 209 ? 2.892   21.475  -4.954  1.00 54.62  ? 203  VAL A N     1 
ATOM   1599 C  CA    . VAL A 1 209 ? 2.527   20.079  -4.950  1.00 55.41  ? 203  VAL A CA    1 
ATOM   1600 C  C     . VAL A 1 209 ? 3.688   19.225  -4.492  1.00 55.24  ? 203  VAL A C     1 
ATOM   1601 O  O     . VAL A 1 209 ? 3.490   18.291  -3.715  1.00 55.27  ? 203  VAL A O     1 
ATOM   1602 C  CB    . VAL A 1 209 ? 2.088   19.636  -6.357  1.00 56.76  ? 203  VAL A CB    1 
ATOM   1603 C  CG1   . VAL A 1 209 ? 3.297   19.668  -7.316  1.00 56.59  ? 203  VAL A CG1   1 
ATOM   1604 C  CG2   . VAL A 1 209 ? 1.424   18.259  -6.289  1.00 56.12  ? 203  VAL A CG2   1 
ATOM   1605 N  N     . ASP A 1 210 ? 4.888   19.541  -4.979  1.00 54.36  ? 204  ASP A N     1 
ATOM   1606 C  CA    . ASP A 1 210 ? 6.068   18.781  -4.609  1.00 54.63  ? 204  ASP A CA    1 
ATOM   1607 C  C     . ASP A 1 210 ? 5.983   18.406  -3.132  1.00 55.21  ? 204  ASP A C     1 
ATOM   1608 O  O     . ASP A 1 210 ? 6.479   17.366  -2.727  1.00 56.60  ? 204  ASP A O     1 
ATOM   1609 C  CB    . ASP A 1 210 ? 7.341   19.591  -4.852  1.00 55.79  ? 204  ASP A CB    1 
ATOM   1610 C  CG    . ASP A 1 210 ? 7.694   19.719  -6.321  1.00 56.73  ? 204  ASP A CG    1 
ATOM   1611 O  OD1   . ASP A 1 210 ? 7.827   18.687  -7.002  1.00 58.96  ? 204  ASP A OD1   1 
ATOM   1612 O  OD2   . ASP A 1 210 ? 7.861   20.856  -6.801  1.00 55.60  ? 204  ASP A OD2   1 
ATOM   1613 N  N     . THR A 1 211 ? 5.332   19.240  -2.327  1.00 55.00  ? 205  THR A N     1 
ATOM   1614 C  CA    . THR A 1 211 ? 5.210   18.962  -0.900  1.00 54.40  ? 205  THR A CA    1 
ATOM   1615 C  C     . THR A 1 211 ? 4.419   17.687  -0.608  1.00 54.74  ? 205  THR A C     1 
ATOM   1616 O  O     . THR A 1 211 ? 4.696   16.992  0.356   1.00 55.28  ? 205  THR A O     1 
ATOM   1617 C  CB    . THR A 1 211 ? 4.547   20.138  -0.156  1.00 52.63  ? 205  THR A CB    1 
ATOM   1618 O  OG1   . THR A 1 211 ? 3.126   19.994  -0.195  1.00 52.55  ? 205  THR A OG1   1 
ATOM   1619 C  CG2   . THR A 1 211 ? 4.918   21.437  -0.808  1.00 50.19  ? 205  THR A CG2   1 
ATOM   1620 N  N     . LEU A 1 212 ? 3.436   17.378  -1.440  1.00 56.28  ? 206  LEU A N     1 
ATOM   1621 C  CA    . LEU A 1 212 ? 2.627   16.183  -1.241  1.00 57.98  ? 206  LEU A CA    1 
ATOM   1622 C  C     . LEU A 1 212 ? 3.405   14.889  -1.428  1.00 60.49  ? 206  LEU A C     1 
ATOM   1623 O  O     . LEU A 1 212 ? 3.000   13.853  -0.927  1.00 62.37  ? 206  LEU A O     1 
ATOM   1624 C  CB    . LEU A 1 212 ? 1.441   16.179  -2.199  1.00 55.78  ? 206  LEU A CB    1 
ATOM   1625 C  CG    . LEU A 1 212 ? 0.264   17.055  -1.790  1.00 54.12  ? 206  LEU A CG    1 
ATOM   1626 C  CD1   . LEU A 1 212 ? -0.841  16.990  -2.841  1.00 52.91  ? 206  LEU A CD1   1 
ATOM   1627 C  CD2   . LEU A 1 212 ? -0.232  16.593  -0.447  1.00 51.32  ? 206  LEU A CD2   1 
ATOM   1628 N  N     . SER A 1 213 ? 4.515   14.936  -2.155  1.00 62.08  ? 207  SER A N     1 
ATOM   1629 C  CA    . SER A 1 213 ? 5.310   13.738  -2.384  1.00 62.67  ? 207  SER A CA    1 
ATOM   1630 C  C     . SER A 1 213 ? 6.338   13.547  -1.289  1.00 63.59  ? 207  SER A C     1 
ATOM   1631 O  O     . SER A 1 213 ? 7.360   12.904  -1.497  1.00 65.12  ? 207  SER A O     1 
ATOM   1632 C  CB    . SER A 1 213 ? 6.036   13.838  -3.718  1.00 63.87  ? 207  SER A CB    1 
ATOM   1633 O  OG    . SER A 1 213 ? 7.088   14.784  -3.651  1.00 63.99  ? 207  SER A OG    1 
ATOM   1634 N  N     . ILE A 1 214 ? 6.075   14.120  -0.125  1.00 64.54  ? 208  ILE A N     1 
ATOM   1635 C  CA    . ILE A 1 214 ? 6.989   13.999  1.001   1.00 65.27  ? 208  ILE A CA    1 
ATOM   1636 C  C     . ILE A 1 214 ? 6.217   13.393  2.162   1.00 66.45  ? 208  ILE A C     1 
ATOM   1637 O  O     . ILE A 1 214 ? 5.070   12.946  2.002   1.00 65.98  ? 208  ILE A O     1 
ATOM   1638 C  CB    . ILE A 1 214 ? 7.530   15.378  1.456   1.00 64.71  ? 208  ILE A CB    1 
ATOM   1639 C  CG1   . ILE A 1 214 ? 8.014   16.181  0.258   1.00 64.85  ? 208  ILE A CG1   1 
ATOM   1640 C  CG2   . ILE A 1 214 ? 8.722   15.194  2.376   1.00 64.99  ? 208  ILE A CG2   1 
ATOM   1641 C  CD1   . ILE A 1 214 ? 9.167   15.540  -0.462  1.00 65.65  ? 208  ILE A CD1   1 
ATOM   1642 N  N     . GLU A 1 215 ? 6.858   13.367  3.329   1.00 67.22  ? 209  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 215 ? 6.227   12.846  4.529   1.00 67.90  ? 209  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 215 ? 6.185   13.913  5.595   1.00 67.26  ? 209  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 215 ? 7.217   14.296  6.123   1.00 67.54  ? 209  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 215 ? 6.960   11.610  5.065   1.00 69.50  ? 209  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 215 ? 6.271   10.287  4.695   1.00 70.43  ? 209  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 215 ? 4.746   10.383  4.752   1.00 70.91  ? 209  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 215 ? 4.179   10.515  5.864   1.00 70.55  ? 209  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 215 ? 4.122   10.338  3.669   1.00 71.58  ? 209  GLU A OE2   1 
ATOM   1651 N  N     . PHE A 1 216 ? 4.975   14.382  5.887   1.00 66.71  ? 210  PHE A N     1 
ATOM   1652 C  CA    . PHE A 1 216 ? 4.703   15.410  6.888   1.00 66.04  ? 210  PHE A CA    1 
ATOM   1653 C  C     . PHE A 1 216 ? 5.819   15.650  7.898   1.00 66.41  ? 210  PHE A C     1 
ATOM   1654 O  O     . PHE A 1 216 ? 6.073   16.790  8.298   1.00 66.35  ? 210  PHE A O     1 
ATOM   1655 C  CB    A PHE A 1 216 ? 3.423   15.052  7.642   0.50 65.32  ? 210  PHE A CB    1 
ATOM   1656 C  CG    A PHE A 1 216 ? 3.044   16.045  8.700   0.50 64.59  ? 210  PHE A CG    1 
ATOM   1657 C  CD1   A PHE A 1 216 ? 2.634   17.326  8.352   0.50 64.21  ? 210  PHE A CD1   1 
ATOM   1658 C  CD2   A PHE A 1 216 ? 3.092   15.699  10.047  0.50 64.09  ? 210  PHE A CD2   1 
ATOM   1659 C  CE1   A PHE A 1 216 ? 2.274   18.247  9.328   0.50 64.00  ? 210  PHE A CE1   1 
ATOM   1660 C  CE2   A PHE A 1 216 ? 2.734   16.611  11.031  0.50 63.89  ? 210  PHE A CE2   1 
ATOM   1661 C  CZ    A PHE A 1 216 ? 2.324   17.889  10.671  0.50 64.26  ? 210  PHE A CZ    1 
ATOM   1662 N  N     . ASP A 1 217 ? 6.476   14.574  8.319   1.00 66.34  ? 211  ASP A N     1 
ATOM   1663 C  CA    . ASP A 1 217 ? 7.553   14.680  9.294   1.00 65.79  ? 211  ASP A CA    1 
ATOM   1664 C  C     . ASP A 1 217 ? 8.860   15.210  8.672   1.00 65.16  ? 211  ASP A C     1 
ATOM   1665 O  O     . ASP A 1 217 ? 9.534   16.057  9.263   1.00 64.61  ? 211  ASP A O     1 
ATOM   1666 C  CB    . ASP A 1 217 ? 7.773   13.317  9.969   1.00 66.00  ? 211  ASP A CB    1 
ATOM   1667 C  CG    . ASP A 1 217 ? 6.447   12.618  10.359  1.00 67.47  ? 211  ASP A CG    1 
ATOM   1668 O  OD1   . ASP A 1 217 ? 5.742   12.110  9.455   1.00 67.75  ? 211  ASP A OD1   1 
ATOM   1669 O  OD2   . ASP A 1 217 ? 6.102   12.570  11.565  1.00 66.62  ? 211  ASP A OD2   1 
ATOM   1670 N  N     . LYS A 1 218 ? 9.211   14.724  7.482   1.00 64.07  ? 212  LYS A N     1 
ATOM   1671 C  CA    . LYS A 1 218 ? 10.429  15.166  6.792   1.00 63.25  ? 212  LYS A CA    1 
ATOM   1672 C  C     . LYS A 1 218 ? 10.298  16.626  6.366   1.00 62.47  ? 212  LYS A C     1 
ATOM   1673 O  O     . LYS A 1 218 ? 11.278  17.282  5.994   1.00 62.74  ? 212  LYS A O     1 
ATOM   1674 C  CB    . LYS A 1 218 ? 10.706  14.288  5.557   1.00 63.70  ? 212  LYS A CB    1 
ATOM   1675 C  CG    . LYS A 1 218 ? 11.836  13.270  5.741   1.00 64.24  ? 212  LYS A CG    1 
ATOM   1676 C  CD    . LYS A 1 218 ? 13.174  13.974  5.958   1.00 65.07  ? 212  LYS A CD    1 
ATOM   1677 C  CE    . LYS A 1 218 ? 14.299  13.009  6.315   1.00 65.00  ? 212  LYS A CE    1 
ATOM   1678 N  NZ    . LYS A 1 218 ? 15.597  13.731  6.529   1.00 65.01  ? 212  LYS A NZ    1 
ATOM   1679 N  N     . LEU A 1 219 ? 9.073   17.128  6.417   1.00 59.92  ? 213  LEU A N     1 
ATOM   1680 C  CA    . LEU A 1 219 ? 8.812   18.501  6.048   1.00 57.32  ? 213  LEU A CA    1 
ATOM   1681 C  C     . LEU A 1 219 ? 8.936   19.317  7.326   1.00 56.60  ? 213  LEU A C     1 
ATOM   1682 O  O     . LEU A 1 219 ? 9.494   20.409  7.329   1.00 55.64  ? 213  LEU A O     1 
ATOM   1683 C  CB    . LEU A 1 219 ? 7.411   18.603  5.465   1.00 56.14  ? 213  LEU A CB    1 
ATOM   1684 C  CG    . LEU A 1 219 ? 6.998   19.926  4.847   1.00 54.04  ? 213  LEU A CG    1 
ATOM   1685 C  CD1   . LEU A 1 219 ? 7.875   20.264  3.660   1.00 53.81  ? 213  LEU A CD1   1 
ATOM   1686 C  CD2   . LEU A 1 219 ? 5.561   19.810  4.436   1.00 52.97  ? 213  LEU A CD2   1 
ATOM   1687 N  N     . LYS A 1 220 ? 8.420   18.768  8.419   1.00 56.45  ? 214  LYS A N     1 
ATOM   1688 C  CA    . LYS A 1 220 ? 8.501   19.424  9.721   1.00 57.33  ? 214  LYS A CA    1 
ATOM   1689 C  C     . LYS A 1 220 ? 9.963   19.654  10.119  1.00 58.44  ? 214  LYS A C     1 
ATOM   1690 O  O     . LYS A 1 220 ? 10.323  20.709  10.634  1.00 58.93  ? 214  LYS A O     1 
ATOM   1691 C  CB    . LYS A 1 220 ? 7.811   18.561  10.783  1.00 55.48  ? 214  LYS A CB    1 
ATOM   1692 C  CG    A LYS A 1 220 ? 8.091   18.985  12.216  0.50 53.28  ? 214  LYS A CG    1 
ATOM   1693 C  CD    A LYS A 1 220 ? 7.324   18.126  13.204  0.50 51.44  ? 214  LYS A CD    1 
ATOM   1694 C  CE    A LYS A 1 220 ? 5.824   18.235  12.971  0.50 50.49  ? 214  LYS A CE    1 
ATOM   1695 N  NZ    A LYS A 1 220 ? 5.014   17.375  13.875  0.50 48.46  ? 214  LYS A NZ    1 
ATOM   1696 N  N     . GLY A 1 221 ? 10.804  18.657  9.882   1.00 59.12  ? 215  GLY A N     1 
ATOM   1697 C  CA    . GLY A 1 221 ? 12.199  18.801  10.226  1.00 59.60  ? 215  GLY A CA    1 
ATOM   1698 C  C     . GLY A 1 221 ? 12.950  19.666  9.235   1.00 60.56  ? 215  GLY A C     1 
ATOM   1699 O  O     . GLY A 1 221 ? 13.849  19.174  8.544   1.00 61.57  ? 215  GLY A O     1 
ATOM   1700 N  N     . MET A 1 222 ? 12.580  20.944  9.154   1.00 60.17  ? 216  MET A N     1 
ATOM   1701 C  CA    . MET A 1 222 ? 13.241  21.892  8.261   1.00 60.03  ? 216  MET A CA    1 
ATOM   1702 C  C     . MET A 1 222 ? 12.490  23.208  8.136   1.00 58.37  ? 216  MET A C     1 
ATOM   1703 O  O     . MET A 1 222 ? 13.101  24.236  7.842   1.00 60.16  ? 216  MET A O     1 
ATOM   1704 C  CB    . MET A 1 222 ? 13.448  21.296  6.865   1.00 61.91  ? 216  MET A CB    1 
ATOM   1705 C  CG    . MET A 1 222 ? 12.172  20.887  6.166   1.00 66.56  ? 216  MET A CG    1 
ATOM   1706 S  SD    . MET A 1 222 ? 12.497  19.885  4.688   1.00 71.49  ? 216  MET A SD    1 
ATOM   1707 C  CE    . MET A 1 222 ? 12.435  21.155  3.393   1.00 70.42  ? 216  MET A CE    1 
ATOM   1708 N  N     . ILE A 1 223 ? 11.176  23.191  8.350   1.00 55.18  ? 217  ILE A N     1 
ATOM   1709 C  CA    . ILE A 1 223 ? 10.403  24.430  8.254   1.00 51.61  ? 217  ILE A CA    1 
ATOM   1710 C  C     . ILE A 1 223 ? 9.469   24.636  9.438   1.00 48.87  ? 217  ILE A C     1 
ATOM   1711 O  O     . ILE A 1 223 ? 9.132   25.765  9.782   1.00 48.29  ? 217  ILE A O     1 
ATOM   1712 C  CB    . ILE A 1 223 ? 9.572   24.490  6.965   1.00 51.53  ? 217  ILE A CB    1 
ATOM   1713 C  CG1   . ILE A 1 223 ? 8.402   23.512  7.065   1.00 51.42  ? 217  ILE A CG1   1 
ATOM   1714 C  CG2   . ILE A 1 223 ? 10.473  24.214  5.759   1.00 49.85  ? 217  ILE A CG2   1 
ATOM   1715 C  CD1   . ILE A 1 223 ? 7.442   23.573  5.896   1.00 51.84  ? 217  ILE A CD1   1 
ATOM   1716 N  N     . GLY A 1 224 ? 9.055   23.546  10.064  1.00 46.46  ? 218  GLY A N     1 
ATOM   1717 C  CA    . GLY A 1 224 ? 8.182   23.673  11.213  1.00 45.51  ? 218  GLY A CA    1 
ATOM   1718 C  C     . GLY A 1 224 ? 6.864   22.964  11.031  1.00 43.89  ? 218  GLY A C     1 
ATOM   1719 O  O     . GLY A 1 224 ? 6.454   22.717  9.911   1.00 44.45  ? 218  GLY A O     1 
ATOM   1720 N  N     . GLU A 1 225 ? 6.195   22.639  12.130  1.00 43.48  ? 219  GLU A N     1 
ATOM   1721 C  CA    . GLU A 1 225 ? 4.910   21.943  12.066  1.00 43.69  ? 219  GLU A CA    1 
ATOM   1722 C  C     . GLU A 1 225 ? 3.832   22.869  11.507  1.00 43.79  ? 219  GLU A C     1 
ATOM   1723 O  O     . GLU A 1 225 ? 2.999   22.436  10.722  1.00 45.18  ? 219  GLU A O     1 
ATOM   1724 C  CB    . GLU A 1 225 ? 4.492   21.450  13.463  1.00 42.84  ? 219  GLU A CB    1 
ATOM   1725 C  CG    A GLU A 1 225 ? 3.423   20.367  13.477  0.50 41.16  ? 219  GLU A CG    1 
ATOM   1726 C  CD    A GLU A 1 225 ? 3.118   19.875  14.883  0.50 41.07  ? 219  GLU A CD    1 
ATOM   1727 O  OE1   A GLU A 1 225 ? 2.555   18.769  15.034  0.50 39.68  ? 219  GLU A OE1   1 
ATOM   1728 O  OE2   A GLU A 1 225 ? 3.437   20.606  15.841  0.50 40.88  ? 219  GLU A OE2   1 
ATOM   1729 N  N     . ALA A 1 226 ? 3.857   24.139  11.910  1.00 42.51  ? 220  ALA A N     1 
ATOM   1730 C  CA    . ALA A 1 226 ? 2.873   25.116  11.450  1.00 39.83  ? 220  ALA A CA    1 
ATOM   1731 C  C     . ALA A 1 226 ? 3.073   25.407  9.978   1.00 38.82  ? 220  ALA A C     1 
ATOM   1732 O  O     . ALA A 1 226 ? 2.151   25.353  9.174   1.00 38.29  ? 220  ALA A O     1 
ATOM   1733 C  CB    . ALA A 1 226 ? 3.004   26.402  12.246  1.00 37.83  ? 220  ALA A CB    1 
ATOM   1734 N  N     . LYS A 1 227 ? 4.296   25.737  9.626   1.00 38.78  ? 221  LYS A N     1 
ATOM   1735 C  CA    . LYS A 1 227 ? 4.595   26.041  8.251   1.00 38.55  ? 221  LYS A CA    1 
ATOM   1736 C  C     . LYS A 1 227 ? 4.098   24.877  7.393   1.00 39.23  ? 221  LYS A C     1 
ATOM   1737 O  O     . LYS A 1 227 ? 3.232   25.055  6.544   1.00 39.65  ? 221  LYS A O     1 
ATOM   1738 C  CB    . LYS A 1 227 ? 6.098   26.239  8.106   1.00 38.36  ? 221  LYS A CB    1 
ATOM   1739 C  CG    . LYS A 1 227 ? 6.533   26.858  6.803   1.00 38.71  ? 221  LYS A CG    1 
ATOM   1740 C  CD    . LYS A 1 227 ? 7.063   28.261  7.012   1.00 37.55  ? 221  LYS A CD    1 
ATOM   1741 C  CE    . LYS A 1 227 ? 6.063   29.122  7.724   1.00 33.44  ? 221  LYS A CE    1 
ATOM   1742 N  NZ    . LYS A 1 227 ? 6.505   30.507  7.592   1.00 36.21  ? 221  LYS A NZ    1 
ATOM   1743 N  N     . ALA A 1 228 ? 4.634   23.683  7.639   1.00 40.35  ? 222  ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 228 ? 4.257   22.471  6.901   1.00 40.40  ? 222  ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 228 ? 2.742   22.220  6.868   1.00 40.67  ? 222  ALA A C     1 
ATOM   1746 O  O     . ALA A 1 228 ? 2.132   22.285  5.798   1.00 40.23  ? 222  ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 228 ? 4.982   21.254  7.487   1.00 39.39  ? 222  ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 229 ? 2.144   21.928  8.027   1.00 40.56  ? 223  LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 229 ? 0.701   21.689  8.109   1.00 40.96  ? 223  LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 229 ? -0.053  22.658  7.198   1.00 41.22  ? 223  LYS A C     1 
ATOM   1751 O  O     . LYS A 1 229 ? -0.954  22.262  6.457   1.00 40.82  ? 223  LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 229 ? 0.197   21.857  9.550   1.00 40.50  ? 223  LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 229 ? 0.700   20.804  10.520  1.00 43.37  ? 223  LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 229 ? -0.206  20.647  11.760  1.00 44.37  ? 223  LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 229 ? -1.550  19.999  11.401  1.00 45.02  ? 223  LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 229 ? -2.307  19.453  12.568  1.00 44.18  ? 223  LYS A NZ    1 
ATOM   1757 N  N     . TYR A 1 230 ? 0.341   23.928  7.266   1.00 42.36  ? 224  TYR A N     1 
ATOM   1758 C  CA    . TYR A 1 230 ? -0.251  25.000  6.476   1.00 42.35  ? 224  TYR A CA    1 
ATOM   1759 C  C     . TYR A 1 230 ? -0.135  24.651  4.998   1.00 41.87  ? 224  TYR A C     1 
ATOM   1760 O  O     . TYR A 1 230 ? -1.147  24.514  4.312   1.00 41.07  ? 224  TYR A O     1 
ATOM   1761 C  CB    . TYR A 1 230 ? 0.478   26.325  6.777   1.00 43.53  ? 224  TYR A CB    1 
ATOM   1762 C  CG    . TYR A 1 230 ? 0.143   27.477  5.840   1.00 44.82  ? 224  TYR A CG    1 
ATOM   1763 C  CD1   . TYR A 1 230 ? -1.076  28.152  5.923   1.00 45.30  ? 224  TYR A CD1   1 
ATOM   1764 C  CD2   . TYR A 1 230 ? 1.031   27.860  4.844   1.00 46.03  ? 224  TYR A CD2   1 
ATOM   1765 C  CE1   . TYR A 1 230 ? -1.402  29.179  5.031   1.00 45.37  ? 224  TYR A CE1   1 
ATOM   1766 C  CE2   . TYR A 1 230 ? 0.717   28.876  3.948   1.00 47.50  ? 224  TYR A CE2   1 
ATOM   1767 C  CZ    . TYR A 1 230 ? -0.501  29.534  4.044   1.00 47.26  ? 224  TYR A CZ    1 
ATOM   1768 O  OH    . TYR A 1 230 ? -0.806  30.542  3.148   1.00 46.40  ? 224  TYR A OH    1 
ATOM   1769 N  N     . LEU A 1 231 ? 1.101   24.496  4.522   1.00 41.70  ? 225  LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 231 ? 1.361   24.171  3.123   1.00 42.39  ? 225  LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 231 ? 0.664   22.892  2.664   1.00 44.00  ? 225  LEU A C     1 
ATOM   1772 O  O     . LEU A 1 231 ? 0.059   22.851  1.598   1.00 45.10  ? 225  LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 231 ? 2.868   24.038  2.865   1.00 40.23  ? 225  LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 231 ? 3.724   25.287  3.034   1.00 40.02  ? 225  LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 231 ? 5.023   25.129  2.283   1.00 37.28  ? 225  LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 231 ? 2.957   26.482  2.474   1.00 41.93  ? 225  LEU A CD2   1 
ATOM   1777 N  N     . ILE A 1 232 ? 0.752   21.836  3.457   1.00 44.75  ? 226  ILE A N     1 
ATOM   1778 C  CA    . ILE A 1 232 ? 0.116   20.599  3.062   1.00 44.71  ? 226  ILE A CA    1 
ATOM   1779 C  C     . ILE A 1 232 ? -1.386  20.782  3.090   1.00 45.01  ? 226  ILE A C     1 
ATOM   1780 O  O     . ILE A 1 232 ? -2.107  20.049  2.422   1.00 45.73  ? 226  ILE A O     1 
ATOM   1781 C  CB    . ILE A 1 232 ? 0.552   19.437  3.972   1.00 44.36  ? 226  ILE A CB    1 
ATOM   1782 C  CG1   . ILE A 1 232 ? 2.028   19.159  3.741   1.00 43.57  ? 226  ILE A CG1   1 
ATOM   1783 C  CG2   . ILE A 1 232 ? -0.199  18.178  3.645   1.00 42.27  ? 226  ILE A CG2   1 
ATOM   1784 C  CD1   . ILE A 1 232 ? 2.518   17.997  4.527   1.00 47.29  ? 226  ILE A CD1   1 
ATOM   1785 N  N     . SER A 1 233 ? -1.862  21.773  3.838   1.00 45.18  ? 227  SER A N     1 
ATOM   1786 C  CA    . SER A 1 233 ? -3.301  22.028  3.893   1.00 45.97  ? 227  SER A CA    1 
ATOM   1787 C  C     . SER A 1 233 ? -3.777  22.689  2.590   1.00 48.15  ? 227  SER A C     1 
ATOM   1788 O  O     . SER A 1 233 ? -4.951  22.603  2.217   1.00 47.35  ? 227  SER A O     1 
ATOM   1789 C  CB    . SER A 1 233 ? -3.644  22.931  5.076   1.00 44.39  ? 227  SER A CB    1 
ATOM   1790 O  OG    . SER A 1 233 ? -5.043  22.969  5.273   1.00 37.81  ? 227  SER A OG    1 
ATOM   1791 N  N     . LEU A 1 234 ? -2.850  23.348  1.901   1.00 50.08  ? 228  LEU A N     1 
ATOM   1792 C  CA    . LEU A 1 234 ? -3.156  24.020  0.646   1.00 52.22  ? 228  LEU A CA    1 
ATOM   1793 C  C     . LEU A 1 234 ? -3.223  23.036  -0.512  1.00 53.18  ? 228  LEU A C     1 
ATOM   1794 O  O     . LEU A 1 234 ? -4.246  22.928  -1.180  1.00 52.87  ? 228  LEU A O     1 
ATOM   1795 C  CB    . LEU A 1 234 ? -2.103  25.097  0.348   1.00 52.53  ? 228  LEU A CB    1 
ATOM   1796 C  CG    . LEU A 1 234 ? -2.061  26.296  1.305   1.00 53.28  ? 228  LEU A CG    1 
ATOM   1797 C  CD1   . LEU A 1 234 ? -0.920  27.212  0.904   1.00 53.07  ? 228  LEU A CD1   1 
ATOM   1798 C  CD2   . LEU A 1 234 ? -3.391  27.044  1.284   1.00 51.04  ? 228  LEU A CD2   1 
ATOM   1799 N  N     . ALA A 1 235 ? -2.116  22.338  -0.745  1.00 55.23  ? 229  ALA A N     1 
ATOM   1800 C  CA    . ALA A 1 235 ? -2.007  21.358  -1.813  1.00 57.41  ? 229  ALA A CA    1 
ATOM   1801 C  C     . ALA A 1 235 ? -3.116  20.327  -1.676  1.00 59.54  ? 229  ALA A C     1 
ATOM   1802 O  O     . ALA A 1 235 ? -3.705  19.887  -2.659  1.00 59.43  ? 229  ALA A O     1 
ATOM   1803 C  CB    . ALA A 1 235 ? -0.640  20.682  -1.749  1.00 56.75  ? 229  ALA A CB    1 
ATOM   1804 N  N     . ARG A 1 236 ? -3.394  19.940  -0.442  1.00 62.73  ? 230  ARG A N     1 
ATOM   1805 C  CA    . ARG A 1 236 ? -4.441  18.968  -0.177  1.00 66.84  ? 230  ARG A CA    1 
ATOM   1806 C  C     . ARG A 1 236 ? -5.774  19.640  -0.501  1.00 67.87  ? 230  ARG A C     1 
ATOM   1807 O  O     . ARG A 1 236 ? -6.767  18.975  -0.777  1.00 68.54  ? 230  ARG A O     1 
ATOM   1808 C  CB    . ARG A 1 236 ? -4.369  18.542  1.295   1.00 69.45  ? 230  ARG A CB    1 
ATOM   1809 C  CG    . ARG A 1 236 ? -5.102  17.264  1.663   1.00 72.38  ? 230  ARG A CG    1 
ATOM   1810 C  CD    . ARG A 1 236 ? -4.461  16.619  2.897   1.00 73.64  ? 230  ARG A CD    1 
ATOM   1811 N  NE    . ARG A 1 236 ? -5.211  15.448  3.348   1.00 77.27  ? 230  ARG A NE    1 
ATOM   1812 C  CZ    . ARG A 1 236 ? -6.303  15.499  4.110   1.00 78.52  ? 230  ARG A CZ    1 
ATOM   1813 N  NH1   . ARG A 1 236 ? -6.778  16.671  4.521   1.00 78.39  ? 230  ARG A NH1   1 
ATOM   1814 N  NH2   . ARG A 1 236 ? -6.931  14.376  4.449   1.00 78.88  ? 230  ARG A NH2   1 
ATOM   1815 N  N     . ASP A 1 237 ? -5.779  20.969  -0.463  1.00 69.36  ? 231  ASP A N     1 
ATOM   1816 C  CA    . ASP A 1 237 ? -6.962  21.773  -0.775  1.00 69.63  ? 231  ASP A CA    1 
ATOM   1817 C  C     . ASP A 1 237 ? -8.057  21.781  0.289   1.00 69.99  ? 231  ASP A C     1 
ATOM   1818 O  O     . ASP A 1 237 ? -9.246  21.791  -0.044  1.00 69.89  ? 231  ASP A O     1 
ATOM   1819 C  CB    . ASP A 1 237 ? -7.570  21.312  -2.094  1.00 69.12  ? 231  ASP A CB    1 
ATOM   1820 C  CG    . ASP A 1 237 ? -8.349  22.399  -2.771  1.00 69.10  ? 231  ASP A CG    1 
ATOM   1821 O  OD1   . ASP A 1 237 ? -9.119  23.098  -2.077  1.00 68.54  ? 231  ASP A OD1   1 
ATOM   1822 O  OD2   . ASP A 1 237 ? -8.186  22.549  -4.001  1.00 70.04  ? 231  ASP A OD2   1 
ATOM   1823 N  N     . GLU A 1 238 ? -7.658  21.772  1.560   1.00 70.15  ? 232  GLU A N     1 
ATOM   1824 C  CA    . GLU A 1 238 ? -8.611  21.798  2.666   1.00 69.30  ? 232  GLU A CA    1 
ATOM   1825 C  C     A GLU A 1 238 ? -8.334  22.913  3.668   0.50 69.77  ? 232  GLU A C     1 
ATOM   1826 O  O     . GLU A 1 238 ? -8.455  22.702  4.871   1.00 70.09  ? 232  GLU A O     1 
ATOM   1827 C  CB    A GLU A 1 238 ? -8.636  20.449  3.392   0.50 68.20  ? 232  GLU A CB    1 
ATOM   1828 C  CG    A GLU A 1 238 ? -9.760  19.543  2.923   0.50 67.37  ? 232  GLU A CG    1 
ATOM   1829 C  CD    A GLU A 1 238 ? -9.957  18.329  3.807   0.50 66.44  ? 232  GLU A CD    1 
ATOM   1830 O  OE1   A GLU A 1 238 ? -9.091  17.431  3.790   0.50 65.71  ? 232  GLU A OE1   1 
ATOM   1831 O  OE2   A GLU A 1 238 ? -10.981 18.279  4.521   0.50 65.61  ? 232  GLU A OE2   1 
ATOM   1832 N  N     . TYR A 1 239 ? -7.974  24.096  3.166   1.00 70.42  ? 233  TYR A N     1 
ATOM   1833 C  CA    . TYR A 1 239 ? -7.692  25.247  4.017   1.00 69.99  ? 233  TYR A CA    1 
ATOM   1834 C  C     . TYR A 1 239 ? -9.011  25.757  4.601   1.00 69.72  ? 233  TYR A C     1 
ATOM   1835 O  O     . TYR A 1 239 ? -10.040 25.753  3.934   1.00 69.61  ? 233  TYR A O     1 
ATOM   1836 C  CB    . TYR A 1 239 ? -7.000  26.346  3.209   1.00 70.51  ? 233  TYR A CB    1 
ATOM   1837 C  CG    . TYR A 1 239 ? -6.183  27.290  4.058   1.00 73.70  ? 233  TYR A CG    1 
ATOM   1838 C  CD1   . TYR A 1 239 ? -5.083  26.821  4.786   1.00 75.18  ? 233  TYR A CD1   1 
ATOM   1839 C  CD2   . TYR A 1 239 ? -6.519  28.649  4.164   1.00 74.55  ? 233  TYR A CD2   1 
ATOM   1840 C  CE1   . TYR A 1 239 ? -4.336  27.674  5.603   1.00 75.53  ? 233  TYR A CE1   1 
ATOM   1841 C  CE2   . TYR A 1 239 ? -5.775  29.517  4.980   1.00 75.44  ? 233  TYR A CE2   1 
ATOM   1842 C  CZ    . TYR A 1 239 ? -4.685  29.017  5.696   1.00 76.27  ? 233  TYR A CZ    1 
ATOM   1843 O  OH    . TYR A 1 239 ? -3.948  29.846  6.514   1.00 78.25  ? 233  TYR A OH    1 
ATOM   1844 N  N     . ASN A 1 240 ? -8.974  26.179  5.859   1.00 70.09  ? 234  ASN A N     1 
ATOM   1845 C  CA    . ASN A 1 240 ? -10.165 26.667  6.556   1.00 70.31  ? 234  ASN A CA    1 
ATOM   1846 C  C     . ASN A 1 240 ? -10.157 28.183  6.757   1.00 70.30  ? 234  ASN A C     1 
ATOM   1847 O  O     . ASN A 1 240 ? -10.774 28.919  5.991   1.00 71.82  ? 234  ASN A O     1 
ATOM   1848 C  CB    . ASN A 1 240 ? -10.287 25.964  7.917   1.00 69.85  ? 234  ASN A CB    1 
ATOM   1849 C  CG    . ASN A 1 240 ? -8.956  25.400  8.407   1.00 69.11  ? 234  ASN A CG    1 
ATOM   1850 O  OD1   . ASN A 1 240 ? -8.520  24.335  7.964   1.00 68.94  ? 234  ASN A OD1   1 
ATOM   1851 N  ND2   . ASN A 1 240 ? -8.300  26.123  9.308   1.00 67.72  ? 234  ASN A ND2   1 
ATOM   1852 N  N     . GLU A 1 241 ? -9.469  28.630  7.805   1.00 69.25  ? 235  GLU A N     1 
ATOM   1853 C  CA    . GLU A 1 241 ? -9.341  30.046  8.143   1.00 67.58  ? 235  GLU A CA    1 
ATOM   1854 C  C     . GLU A 1 241 ? -10.460 30.957  7.635   1.00 65.72  ? 235  GLU A C     1 
ATOM   1855 O  O     . GLU A 1 241 ? -10.528 31.281  6.449   1.00 64.84  ? 235  GLU A O     1 
ATOM   1856 C  CB    . GLU A 1 241 ? -8.004  30.588  7.630   1.00 69.46  ? 235  GLU A CB    1 
ATOM   1857 C  CG    . GLU A 1 241 ? -6.789  29.766  8.012   1.00 71.41  ? 235  GLU A CG    1 
ATOM   1858 C  CD    . GLU A 1 241 ? -6.575  29.672  9.503   1.00 72.91  ? 235  GLU A CD    1 
ATOM   1859 O  OE1   . GLU A 1 241 ? -6.377  30.729  10.144  1.00 72.64  ? 235  GLU A OE1   1 
ATOM   1860 O  OE2   . GLU A 1 241 ? -6.605  28.533  10.029  1.00 74.67  ? 235  GLU A OE2   1 
ATOM   1861 N  N     . PRO A 1 242 ? -11.347 31.391  8.539   1.00 64.19  ? 236  PRO A N     1 
ATOM   1862 C  CA    . PRO A 1 242 ? -12.466 32.274  8.205   1.00 62.14  ? 236  PRO A CA    1 
ATOM   1863 C  C     . PRO A 1 242 ? -12.102 33.763  8.326   1.00 60.92  ? 236  PRO A C     1 
ATOM   1864 O  O     . PRO A 1 242 ? -11.039 34.123  8.848   1.00 59.84  ? 236  PRO A O     1 
ATOM   1865 C  CB    . PRO A 1 242 ? -13.521 31.864  9.218   1.00 61.93  ? 236  PRO A CB    1 
ATOM   1866 C  CG    . PRO A 1 242 ? -12.692 31.623  10.432  1.00 62.64  ? 236  PRO A CG    1 
ATOM   1867 C  CD    . PRO A 1 242 ? -11.506 30.840  9.899   1.00 63.73  ? 236  PRO A CD    1 
ATOM   1868 N  N     . ILE A 1 243 ? -12.990 34.621  7.825   1.00 59.74  ? 237  ILE A N     1 
ATOM   1869 C  CA    . ILE A 1 243 ? -12.783 36.062  7.887   1.00 57.96  ? 237  ILE A CA    1 
ATOM   1870 C  C     . ILE A 1 243 ? -13.408 36.622  9.156   1.00 58.09  ? 237  ILE A C     1 
ATOM   1871 O  O     . ILE A 1 243 ? -14.616 36.865  9.215   1.00 58.89  ? 237  ILE A O     1 
ATOM   1872 C  CB    . ILE A 1 243 ? -13.402 36.805  6.675   1.00 56.23  ? 237  ILE A CB    1 
ATOM   1873 C  CG1   . ILE A 1 243 ? -12.456 36.749  5.470   1.00 55.18  ? 237  ILE A CG1   1 
ATOM   1874 C  CG2   . ILE A 1 243 ? -13.685 38.258  7.038   1.00 54.27  ? 237  ILE A CG2   1 
ATOM   1875 C  CD1   . ILE A 1 243 ? -12.499 35.456  4.698   1.00 53.79  ? 237  ILE A CD1   1 
ATOM   1876 N  N     . ARG A 1 244 ? -12.571 36.820  10.169  1.00 57.00  ? 238  ARG A N     1 
ATOM   1877 C  CA    . ARG A 1 244 ? -13.022 37.362  11.438  1.00 54.64  ? 238  ARG A CA    1 
ATOM   1878 C  C     . ARG A 1 244 ? -12.431 38.751  11.603  1.00 53.36  ? 238  ARG A C     1 
ATOM   1879 O  O     . ARG A 1 244 ? -11.412 39.058  10.999  1.00 51.54  ? 238  ARG A O     1 
ATOM   1880 C  CB    A ARG A 1 244 ? -12.576 36.444  12.575  0.50 53.83  ? 238  ARG A CB    1 
ATOM   1881 C  CG    A ARG A 1 244 ? -11.076 36.260  12.679  0.50 53.16  ? 238  ARG A CG    1 
ATOM   1882 C  CD    A ARG A 1 244 ? -10.730 34.984  13.438  0.50 52.99  ? 238  ARG A CD    1 
ATOM   1883 N  NE    A ARG A 1 244 ? -9.331  34.942  13.861  0.50 52.62  ? 238  ARG A NE    1 
ATOM   1884 C  CZ    A ARG A 1 244 ? -8.554  33.866  13.776  0.50 52.59  ? 238  ARG A CZ    1 
ATOM   1885 N  NH1   A ARG A 1 244 ? -9.034  32.734  13.274  0.50 52.23  ? 238  ARG A NH1   1 
ATOM   1886 N  NH2   A ARG A 1 244 ? -7.299  33.922  14.205  0.50 51.78  ? 238  ARG A NH2   1 
ATOM   1887 N  N     . THR A 1 245 ? -13.094 39.587  12.398  1.00 53.84  ? 239  THR A N     1 
ATOM   1888 C  CA    . THR A 1 245 ? -12.646 40.958  12.679  1.00 54.87  ? 239  THR A CA    1 
ATOM   1889 C  C     . THR A 1 245 ? -11.253 40.949  13.329  1.00 55.65  ? 239  THR A C     1 
ATOM   1890 O  O     . THR A 1 245 ? -11.026 40.237  14.319  1.00 57.62  ? 239  THR A O     1 
ATOM   1891 C  CB    . THR A 1 245 ? -13.625 41.661  13.641  1.00 54.04  ? 239  THR A CB    1 
ATOM   1892 O  OG1   . THR A 1 245 ? -14.910 41.757  13.022  1.00 53.63  ? 239  THR A OG1   1 
ATOM   1893 C  CG2   . THR A 1 245 ? -13.124 43.050  14.012  1.00 54.16  ? 239  THR A CG2   1 
ATOM   1894 N  N     . ARG A 1 246 ? -10.327 41.743  12.795  1.00 54.54  ? 240  ARG A N     1 
ATOM   1895 C  CA    . ARG A 1 246 ? -8.977  41.765  13.345  1.00 54.34  ? 240  ARG A CA    1 
ATOM   1896 C  C     . ARG A 1 246 ? -8.893  42.615  14.598  1.00 54.66  ? 240  ARG A C     1 
ATOM   1897 O  O     . ARG A 1 246 ? -9.776  43.421  14.862  1.00 56.61  ? 240  ARG A O     1 
ATOM   1898 C  CB    A ARG A 1 246 ? -7.988  42.260  12.295  0.50 53.56  ? 240  ARG A CB    1 
ATOM   1899 C  CG    A ARG A 1 246 ? -6.540  41.991  12.659  0.50 52.57  ? 240  ARG A CG    1 
ATOM   1900 C  CD    A ARG A 1 246 ? -5.710  41.644  11.432  0.50 51.83  ? 240  ARG A CD    1 
ATOM   1901 N  NE    A ARG A 1 246 ? -6.215  40.456  10.744  0.50 49.97  ? 240  ARG A NE    1 
ATOM   1902 C  CZ    A ARG A 1 246 ? -5.573  39.832  9.761   0.50 49.42  ? 240  ARG A CZ    1 
ATOM   1903 N  NH1   A ARG A 1 246 ? -4.397  40.276  9.343   0.50 49.86  ? 240  ARG A NH1   1 
ATOM   1904 N  NH2   A ARG A 1 246 ? -6.103  38.762  9.194   0.50 48.90  ? 240  ARG A NH2   1 
ATOM   1905 N  N     . VAL A 1 247 ? -7.837  42.426  15.379  1.00 54.25  ? 241  VAL A N     1 
ATOM   1906 C  CA    . VAL A 1 247 ? -7.673  43.173  16.622  1.00 53.91  ? 241  VAL A CA    1 
ATOM   1907 C  C     . VAL A 1 247 ? -6.213  43.457  16.932  1.00 53.71  ? 241  VAL A C     1 
ATOM   1908 O  O     . VAL A 1 247 ? -5.376  42.561  16.902  1.00 52.15  ? 241  VAL A O     1 
ATOM   1909 C  CB    . VAL A 1 247 ? -8.270  42.406  17.826  1.00 53.73  ? 241  VAL A CB    1 
ATOM   1910 C  CG1   . VAL A 1 247 ? -8.185  43.262  19.074  1.00 52.55  ? 241  VAL A CG1   1 
ATOM   1911 C  CG2   . VAL A 1 247 ? -9.715  42.005  17.533  1.00 53.29  ? 241  VAL A CG2   1 
ATOM   1912 N  N     . ARG A 1 248 ? -5.919  44.717  17.226  1.00 54.64  ? 242  ARG A N     1 
ATOM   1913 C  CA    . ARG A 1 248 ? -4.564  45.124  17.559  1.00 55.72  ? 242  ARG A CA    1 
ATOM   1914 C  C     . ARG A 1 248 ? -4.093  44.313  18.772  1.00 54.41  ? 242  ARG A C     1 
ATOM   1915 O  O     . ARG A 1 248 ? -4.746  44.286  19.814  1.00 54.01  ? 242  ARG A O     1 
ATOM   1916 C  CB    . ARG A 1 248 ? -4.532  46.622  17.888  1.00 59.08  ? 242  ARG A CB    1 
ATOM   1917 C  CG    . ARG A 1 248 ? -4.704  47.572  16.699  1.00 65.18  ? 242  ARG A CG    1 
ATOM   1918 C  CD    . ARG A 1 248 ? -5.700  47.080  15.642  1.00 69.79  ? 242  ARG A CD    1 
ATOM   1919 N  NE    . ARG A 1 248 ? -5.104  46.040  14.800  1.00 74.26  ? 242  ARG A NE    1 
ATOM   1920 C  CZ    . ARG A 1 248 ? -5.633  45.581  13.666  1.00 76.28  ? 242  ARG A CZ    1 
ATOM   1921 N  NH1   . ARG A 1 248 ? -6.786  46.073  13.223  1.00 76.66  ? 242  ARG A NH1   1 
ATOM   1922 N  NH2   . ARG A 1 248 ? -5.008  44.627  12.976  1.00 77.36  ? 242  ARG A NH2   1 
ATOM   1923 N  N     . LYS A 1 249 ? -2.962  43.640  18.636  1.00 51.79  ? 243  LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 249 ? -2.450  42.863  19.736  1.00 49.97  ? 243  LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 249 ? -1.246  43.501  20.397  1.00 49.85  ? 243  LYS A C     1 
ATOM   1926 O  O     . LYS A 1 249 ? -1.070  43.385  21.614  1.00 49.66  ? 243  LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 249 ? -2.093  41.472  19.260  1.00 50.63  ? 243  LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 249 ? -3.285  40.564  19.206  1.00 51.51  ? 243  LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 249 ? -2.847  39.152  18.960  1.00 52.36  ? 243  LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 249 ? -4.000  38.210  19.190  1.00 54.30  ? 243  LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 249 ? -4.520  38.307  20.586  1.00 55.02  ? 243  LYS A NZ    1 
ATOM   1932 N  N     . SER A 1 250 ? -0.425  44.180  19.598  1.00 48.10  ? 244  SER A N     1 
ATOM   1933 C  CA    . SER A 1 250 ? 0.774   44.834  20.111  1.00 45.69  ? 244  SER A CA    1 
ATOM   1934 C  C     . SER A 1 250 ? 1.101   46.173  19.444  1.00 43.50  ? 244  SER A C     1 
ATOM   1935 O  O     . SER A 1 250 ? 1.669   46.220  18.370  1.00 42.81  ? 244  SER A O     1 
ATOM   1936 C  CB    . SER A 1 250 ? 1.966   43.869  20.001  1.00 45.81  ? 244  SER A CB    1 
ATOM   1937 O  OG    . SER A 1 250 ? 2.006   43.237  18.731  1.00 46.51  ? 244  SER A OG    1 
ATOM   1938 N  N     . ILE A 1 251 ? 0.750   47.267  20.101  1.00 42.50  ? 245  ILE A N     1 
ATOM   1939 C  CA    . ILE A 1 251 ? 1.023   48.597  19.561  1.00 42.61  ? 245  ILE A CA    1 
ATOM   1940 C  C     . ILE A 1 251 ? 2.385   49.070  20.063  1.00 41.22  ? 245  ILE A C     1 
ATOM   1941 O  O     . ILE A 1 251 ? 2.559   49.259  21.249  1.00 42.02  ? 245  ILE A O     1 
ATOM   1942 C  CB    . ILE A 1 251 ? -0.076  49.618  20.013  1.00 42.76  ? 245  ILE A CB    1 
ATOM   1943 C  CG1   . ILE A 1 251 ? -1.468  49.075  19.663  1.00 43.09  ? 245  ILE A CG1   1 
ATOM   1944 C  CG2   . ILE A 1 251 ? 0.131   50.962  19.339  1.00 42.35  ? 245  ILE A CG2   1 
ATOM   1945 C  CD1   . ILE A 1 251 ? -2.588  50.019  19.966  1.00 40.27  ? 245  ILE A CD1   1 
ATOM   1946 N  N     . GLY A 1 252 ? 3.344   49.271  19.168  1.00 40.05  ? 246  GLY A N     1 
ATOM   1947 C  CA    . GLY A 1 252 ? 4.665   49.710  19.594  1.00 38.43  ? 246  GLY A CA    1 
ATOM   1948 C  C     . GLY A 1 252 ? 5.305   50.739  18.684  1.00 38.33  ? 246  GLY A C     1 
ATOM   1949 O  O     . GLY A 1 252 ? 4.824   51.012  17.594  1.00 39.81  ? 246  GLY A O     1 
ATOM   1950 N  N     . ARG A 1 253 ? 6.418   51.307  19.118  1.00 38.21  ? 247  ARG A N     1 
ATOM   1951 C  CA    . ARG A 1 253 ? 7.096   52.349  18.337  1.00 36.84  ? 247  ARG A CA    1 
ATOM   1952 C  C     . ARG A 1 253 ? 8.604   52.254  18.517  1.00 34.41  ? 247  ARG A C     1 
ATOM   1953 O  O     . ARG A 1 253 ? 9.084   51.976  19.599  1.00 34.86  ? 247  ARG A O     1 
ATOM   1954 C  CB    . ARG A 1 253 ? 6.594   53.744  18.784  1.00 39.22  ? 247  ARG A CB    1 
ATOM   1955 C  CG    . ARG A 1 253 ? 7.495   54.938  18.433  1.00 42.21  ? 247  ARG A CG    1 
ATOM   1956 C  CD    . ARG A 1 253 ? 7.358   55.347  16.987  1.00 46.26  ? 247  ARG A CD    1 
ATOM   1957 N  NE    . ARG A 1 253 ? 8.569   55.972  16.463  1.00 49.66  ? 247  ARG A NE    1 
ATOM   1958 C  CZ    . ARG A 1 253 ? 8.690   56.439  15.222  1.00 52.12  ? 247  ARG A CZ    1 
ATOM   1959 N  NH1   . ARG A 1 253 ? 7.663   56.350  14.391  1.00 53.10  ? 247  ARG A NH1   1 
ATOM   1960 N  NH2   . ARG A 1 253 ? 9.836   56.975  14.797  1.00 53.92  ? 247  ARG A NH2   1 
ATOM   1961 N  N     . ILE A 1 254 ? 9.348   52.464  17.449  1.00 33.33  ? 248  ILE A N     1 
ATOM   1962 C  CA    . ILE A 1 254 ? 10.790  52.426  17.543  1.00 33.74  ? 248  ILE A CA    1 
ATOM   1963 C  C     . ILE A 1 254 ? 11.361  53.621  16.784  1.00 35.98  ? 248  ILE A C     1 
ATOM   1964 O  O     . ILE A 1 254 ? 10.754  54.107  15.829  1.00 36.46  ? 248  ILE A O     1 
ATOM   1965 C  CB    . ILE A 1 254 ? 11.352  51.156  16.942  1.00 30.67  ? 248  ILE A CB    1 
ATOM   1966 C  CG1   . ILE A 1 254 ? 12.845  51.097  17.238  1.00 30.57  ? 248  ILE A CG1   1 
ATOM   1967 C  CG2   . ILE A 1 254 ? 11.121  51.146  15.432  1.00 31.19  ? 248  ILE A CG2   1 
ATOM   1968 C  CD1   . ILE A 1 254 ? 13.563  49.906  16.644  1.00 32.00  ? 248  ILE A CD1   1 
ATOM   1969 N  N     . VAL A 1 255 ? 12.517  54.109  17.212  1.00 36.91  ? 249  VAL A N     1 
ATOM   1970 C  CA    . VAL A 1 255 ? 13.132  55.238  16.541  1.00 38.67  ? 249  VAL A CA    1 
ATOM   1971 C  C     . VAL A 1 255 ? 14.549  54.879  16.177  1.00 40.58  ? 249  VAL A C     1 
ATOM   1972 O  O     . VAL A 1 255 ? 14.900  53.704  16.133  1.00 40.78  ? 249  VAL A O     1 
ATOM   1973 C  CB    . VAL A 1 255 ? 13.163  56.453  17.431  1.00 38.13  ? 249  VAL A CB    1 
ATOM   1974 C  CG1   . VAL A 1 255 ? 11.772  56.805  17.853  1.00 37.90  ? 249  VAL A CG1   1 
ATOM   1975 C  CG2   . VAL A 1 255 ? 14.006  56.167  18.649  1.00 40.66  ? 249  VAL A CG2   1 
ATOM   1976 N  N     . THR A 1 256 ? 15.361  55.891  15.900  1.00 43.35  ? 250  THR A N     1 
ATOM   1977 C  CA    . THR A 1 256 ? 16.750  55.658  15.543  1.00 47.21  ? 250  THR A CA    1 
ATOM   1978 C  C     . THR A 1 256 ? 17.634  56.774  16.023  1.00 50.90  ? 250  THR A C     1 
ATOM   1979 O  O     . THR A 1 256 ? 17.381  57.956  15.767  1.00 51.61  ? 250  THR A O     1 
ATOM   1980 C  CB    . THR A 1 256 ? 16.947  55.529  14.046  1.00 45.96  ? 250  THR A CB    1 
ATOM   1981 O  OG1   . THR A 1 256 ? 16.226  54.390  13.582  1.00 47.02  ? 250  THR A OG1   1 
ATOM   1982 C  CG2   . THR A 1 256 ? 18.418  55.337  13.722  1.00 45.85  ? 250  THR A CG2   1 
ATOM   1983 N  N     . MET A 1 257 ? 18.692  56.374  16.711  1.00 54.32  ? 251  MET A N     1 
ATOM   1984 C  CA    . MET A 1 257 ? 19.640  57.308  17.266  1.00 56.73  ? 251  MET A CA    1 
ATOM   1985 C  C     . MET A 1 257 ? 20.632  57.754  16.217  1.00 57.86  ? 251  MET A C     1 
ATOM   1986 O  O     . MET A 1 257 ? 21.248  56.929  15.563  1.00 56.85  ? 251  MET A O     1 
ATOM   1987 C  CB    . MET A 1 257 ? 20.388  56.634  18.401  1.00 57.70  ? 251  MET A CB    1 
ATOM   1988 C  CG    . MET A 1 257 ? 19.520  55.819  19.305  1.00 56.08  ? 251  MET A CG    1 
ATOM   1989 S  SD    . MET A 1 257 ? 20.588  55.216  20.553  1.00 57.29  ? 251  MET A SD    1 
ATOM   1990 C  CE    . MET A 1 257 ? 21.304  53.817  19.737  1.00 54.16  ? 251  MET A CE    1 
ATOM   1991 N  N     . LYS A 1 258 ? 20.805  59.058  16.057  1.00 60.45  ? 252  LYS A N     1 
ATOM   1992 C  CA    . LYS A 1 258 ? 21.775  59.523  15.080  1.00 64.11  ? 252  LYS A CA    1 
ATOM   1993 C  C     . LYS A 1 258 ? 23.098  58.965  15.574  1.00 66.04  ? 252  LYS A C     1 
ATOM   1994 O  O     . LYS A 1 258 ? 24.119  59.050  14.892  1.00 65.91  ? 252  LYS A O     1 
ATOM   1995 C  CB    . LYS A 1 258 ? 21.854  61.052  15.066  1.00 64.54  ? 252  LYS A CB    1 
ATOM   1996 C  CG    . LYS A 1 258 ? 20.549  61.777  15.335  1.00 64.88  ? 252  LYS A CG    1 
ATOM   1997 C  CD    . LYS A 1 258 ? 20.334  61.982  16.821  1.00 65.56  ? 252  LYS A CD    1 
ATOM   1998 C  CE    . LYS A 1 258 ? 19.072  62.820  17.098  1.00 67.63  ? 252  LYS A CE    1 
ATOM   1999 N  NZ    . LYS A 1 258 ? 18.813  63.111  18.551  1.00 66.27  ? 252  LYS A NZ    1 
ATOM   2000 N  N     . ARG A 1 259 ? 23.042  58.377  16.769  1.00 68.63  ? 253  ARG A N     1 
ATOM   2001 C  CA    . ARG A 1 259 ? 24.196  57.823  17.465  1.00 70.46  ? 253  ARG A CA    1 
ATOM   2002 C  C     . ARG A 1 259 ? 24.762  56.475  17.059  1.00 70.63  ? 253  ARG A C     1 
ATOM   2003 O  O     . ARG A 1 259 ? 25.286  56.296  15.963  1.00 70.61  ? 253  ARG A O     1 
ATOM   2004 C  CB    . ARG A 1 259 ? 23.912  57.782  18.973  1.00 71.72  ? 253  ARG A CB    1 
ATOM   2005 C  CG    . ARG A 1 259 ? 23.661  59.149  19.613  1.00 74.67  ? 253  ARG A CG    1 
ATOM   2006 C  CD    . ARG A 1 259 ? 24.919  60.033  19.698  1.00 76.03  ? 253  ARG A CD    1 
ATOM   2007 N  NE    . ARG A 1 259 ? 25.525  60.349  18.400  1.00 78.10  ? 253  ARG A NE    1 
ATOM   2008 C  CZ    . ARG A 1 259 ? 26.459  59.613  17.790  1.00 78.79  ? 253  ARG A CZ    1 
ATOM   2009 N  NH1   . ARG A 1 259 ? 26.911  58.498  18.356  1.00 79.07  ? 253  ARG A NH1   1 
ATOM   2010 N  NH2   . ARG A 1 259 ? 26.948  59.996  16.612  1.00 79.01  ? 253  ARG A NH2   1 
ATOM   2011 N  N     . ASN A 1 260 ? 24.659  55.548  18.003  1.00 70.94  ? 254  ASN A N     1 
ATOM   2012 C  CA    . ASN A 1 260 ? 25.171  54.184  17.923  1.00 70.73  ? 254  ASN A CA    1 
ATOM   2013 C  C     . ASN A 1 260 ? 25.833  54.134  19.299  1.00 70.97  ? 254  ASN A C     1 
ATOM   2014 O  O     . ASN A 1 260 ? 27.045  53.982  19.423  1.00 71.04  ? 254  ASN A O     1 
ATOM   2015 C  CB    . ASN A 1 260 ? 26.227  54.045  16.826  1.00 69.74  ? 254  ASN A CB    1 
ATOM   2016 C  CG    . ASN A 1 260 ? 25.855  53.026  15.790  1.00 68.98  ? 254  ASN A CG    1 
ATOM   2017 O  OD1   . ASN A 1 260 ? 24.678  52.806  15.509  1.00 68.65  ? 254  ASN A OD1   1 
ATOM   2018 N  ND2   . ASN A 1 260 ? 26.860  52.411  15.192  1.00 69.02  ? 254  ASN A ND2   1 
ATOM   2019 N  N     . SER A 1 261 ? 25.006  54.291  20.329  1.00 70.73  ? 255  SER A N     1 
ATOM   2020 C  CA    . SER A 1 261 ? 25.464  54.331  21.711  1.00 70.21  ? 255  SER A CA    1 
ATOM   2021 C  C     . SER A 1 261 ? 25.257  53.091  22.594  1.00 70.59  ? 255  SER A C     1 
ATOM   2022 O  O     . SER A 1 261 ? 24.842  52.015  22.121  1.00 70.36  ? 255  SER A O     1 
ATOM   2023 C  CB    . SER A 1 261 ? 24.825  55.539  22.397  1.00 70.20  ? 255  SER A CB    1 
ATOM   2024 O  OG    . SER A 1 261 ? 25.274  55.688  23.733  1.00 69.34  ? 255  SER A OG    1 
ATOM   2025 N  N     . ARG A 1 262 ? 25.582  53.291  23.884  1.00 69.87  ? 256  ARG A N     1 
ATOM   2026 C  CA    . ARG A 1 262 ? 25.494  52.300  24.967  1.00 67.55  ? 256  ARG A CA    1 
ATOM   2027 C  C     . ARG A 1 262 ? 25.321  52.982  26.340  1.00 66.06  ? 256  ARG A C     1 
ATOM   2028 O  O     . ARG A 1 262 ? 25.004  52.310  27.343  1.00 65.54  ? 256  ARG A O     1 
ATOM   2029 C  CB    . ARG A 1 262 ? 26.749  51.394  24.973  1.00 65.62  ? 256  ARG A CB    1 
ATOM   2030 C  CG    . ARG A 1 262 ? 26.643  50.198  25.920  1.00 65.65  ? 256  ARG A CG    1 
ATOM   2031 C  CD    . ARG A 1 262 ? 28.002  49.572  26.229  1.00 64.76  ? 256  ARG A CD    1 
ATOM   2032 N  NE    . ARG A 1 262 ? 28.406  48.514  25.298  1.00 64.56  ? 256  ARG A NE    1 
ATOM   2033 C  CZ    . ARG A 1 262 ? 28.019  47.238  25.375  1.00 64.30  ? 256  ARG A CZ    1 
ATOM   2034 N  NH1   . ARG A 1 262 ? 27.201  46.838  26.338  1.00 64.23  ? 256  ARG A NH1   1 
ATOM   2035 N  NH2   . ARG A 1 262 ? 28.473  46.345  24.503  1.00 63.05  ? 256  ARG A NH2   1 
ATOM   2036 N  N     . ASN A 1 263 ? 25.511  54.310  26.373  1.00 64.93  ? 257  ASN A N     1 
ATOM   2037 C  CA    . ASN A 1 263 ? 25.389  55.138  27.585  1.00 64.66  ? 257  ASN A CA    1 
ATOM   2038 C  C     . ASN A 1 263 ? 23.912  55.545  27.840  1.00 64.80  ? 257  ASN A C     1 
ATOM   2039 O  O     . ASN A 1 263 ? 23.342  56.251  27.017  1.00 65.14  ? 257  ASN A O     1 
ATOM   2040 C  CB    A ASN A 1 263 ? 26.260  56.417  27.437  0.50 64.13  ? 257  ASN A CB    1 
ATOM   2041 C  CG    A ASN A 1 263 ? 27.621  56.310  28.134  0.50 64.11  ? 257  ASN A CG    1 
ATOM   2042 O  OD1   A ASN A 1 263 ? 27.734  55.756  29.233  0.50 63.69  ? 257  ASN A OD1   1 
ATOM   2043 N  ND2   A ASN A 1 263 ? 28.647  56.888  27.508  0.50 64.33  ? 257  ASN A ND2   1 
ATOM   2044 N  N     . LEU A 1 264 ? 23.308  55.124  28.965  1.00 64.05  ? 258  LEU A N     1 
ATOM   2045 C  CA    . LEU A 1 264 ? 21.907  55.448  29.256  1.00 63.49  ? 258  LEU A CA    1 
ATOM   2046 C  C     . LEU A 1 264 ? 21.473  56.827  28.990  1.00 64.21  ? 258  LEU A C     1 
ATOM   2047 O  O     . LEU A 1 264 ? 20.427  56.989  28.337  1.00 65.20  ? 258  LEU A O     1 
ATOM   2048 C  CB    . LEU A 1 264 ? 21.482  55.071  30.683  1.00 62.69  ? 258  LEU A CB    1 
ATOM   2049 C  CG    . LEU A 1 264 ? 20.200  55.636  31.332  1.00 62.67  ? 258  LEU A CG    1 
ATOM   2050 C  CD1   . LEU A 1 264 ? 19.035  55.555  30.375  1.00 62.28  ? 258  LEU A CD1   1 
ATOM   2051 C  CD2   . LEU A 1 264 ? 19.901  54.867  32.621  1.00 61.76  ? 258  LEU A CD2   1 
ATOM   2052 N  N     . GLU A 1 265 ? 22.156  57.863  29.456  1.00 65.39  ? 259  GLU A N     1 
ATOM   2053 C  CA    . GLU A 1 265 ? 21.527  59.080  29.081  1.00 67.54  ? 259  GLU A CA    1 
ATOM   2054 C  C     . GLU A 1 265 ? 21.702  59.316  27.574  1.00 67.63  ? 259  GLU A C     1 
ATOM   2055 O  O     . GLU A 1 265 ? 21.134  60.271  27.031  1.00 67.97  ? 259  GLU A O     1 
ATOM   2056 C  CB    . GLU A 1 265 ? 21.938  60.247  29.980  1.00 69.83  ? 259  GLU A CB    1 
ATOM   2057 C  CG    . GLU A 1 265 ? 21.827  59.875  31.498  1.00 73.35  ? 259  GLU A CG    1 
ATOM   2058 C  CD    . GLU A 1 265 ? 20.420  59.850  32.075  1.00 75.68  ? 259  GLU A CD    1 
ATOM   2059 O  OE1   . GLU A 1 265 ? 19.655  60.821  31.858  1.00 78.19  ? 259  GLU A OE1   1 
ATOM   2060 O  OE2   . GLU A 1 265 ? 20.083  58.873  32.785  1.00 75.61  ? 259  GLU A OE2   1 
ATOM   2061 N  N     . GLU A 1 266 ? 22.420  58.415  26.881  1.00 66.89  ? 260  GLU A N     1 
ATOM   2062 C  CA    . GLU A 1 266 ? 22.582  58.544  25.418  1.00 65.42  ? 260  GLU A CA    1 
ATOM   2063 C  C     . GLU A 1 266 ? 21.615  57.599  24.727  1.00 63.66  ? 260  GLU A C     1 
ATOM   2064 O  O     . GLU A 1 266 ? 21.830  57.196  23.583  1.00 63.80  ? 260  GLU A O     1 
ATOM   2065 C  CB    . GLU A 1 266 ? 24.008  58.229  24.948  1.00 66.25  ? 260  GLU A CB    1 
ATOM   2066 C  CG    . GLU A 1 266 ? 24.269  58.539  23.454  1.00 67.75  ? 260  GLU A CG    1 
ATOM   2067 C  CD    . GLU A 1 266 ? 24.290  60.017  23.126  1.00 70.09  ? 260  GLU A CD    1 
ATOM   2068 O  OE1   . GLU A 1 266 ? 23.298  60.724  23.395  1.00 70.65  ? 260  GLU A OE1   1 
ATOM   2069 O  OE2   . GLU A 1 266 ? 25.308  60.489  22.582  1.00 70.64  ? 260  GLU A OE2   1 
ATOM   2070 N  N     . ILE A 1 267 ? 20.544  57.255  25.434  1.00 60.92  ? 261  ILE A N     1 
ATOM   2071 C  CA    . ILE A 1 267 ? 19.528  56.359  24.911  1.00 58.20  ? 261  ILE A CA    1 
ATOM   2072 C  C     . ILE A 1 267 ? 18.212  56.598  25.648  1.00 56.86  ? 261  ILE A C     1 
ATOM   2073 O  O     . ILE A 1 267 ? 17.137  56.363  25.120  1.00 55.98  ? 261  ILE A O     1 
ATOM   2074 C  CB    . ILE A 1 267 ? 19.947  54.879  25.097  1.00 58.00  ? 261  ILE A CB    1 
ATOM   2075 C  CG1   . ILE A 1 267 ? 21.270  54.600  24.369  1.00 56.94  ? 261  ILE A CG1   1 
ATOM   2076 C  CG2   . ILE A 1 267 ? 18.845  53.966  24.585  1.00 58.09  ? 261  ILE A CG2   1 
ATOM   2077 C  CD1   . ILE A 1 267 ? 21.702  53.147  24.367  1.00 55.40  ? 261  ILE A CD1   1 
ATOM   2078 N  N     . LYS A 1 268 ? 18.315  57.069  26.879  1.00 56.52  ? 262  LYS A N     1 
ATOM   2079 C  CA    . LYS A 1 268 ? 17.150  57.342  27.711  1.00 57.24  ? 262  LYS A CA    1 
ATOM   2080 C  C     . LYS A 1 268 ? 16.203  58.314  27.027  1.00 56.87  ? 262  LYS A C     1 
ATOM   2081 O  O     . LYS A 1 268 ? 14.999  58.087  26.955  1.00 56.33  ? 262  LYS A O     1 
ATOM   2082 C  CB    . LYS A 1 268 ? 17.584  57.951  29.057  1.00 59.57  ? 262  LYS A CB    1 
ATOM   2083 C  CG    . LYS A 1 268 ? 16.440  58.234  30.045  1.00 61.75  ? 262  LYS A CG    1 
ATOM   2084 C  CD    . LYS A 1 268 ? 16.059  56.929  30.741  1.00 65.22  ? 262  LYS A CD    1 
ATOM   2085 C  CE    . LYS A 1 268 ? 14.815  57.022  31.502  1.00 65.38  ? 262  LYS A CE    1 
ATOM   2086 N  NZ    . LYS A 1 268 ? 14.177  55.744  31.950  1.00 66.36  ? 262  LYS A NZ    1 
ATOM   2087 N  N     . PRO A 1 269 ? 16.733  59.437  26.536  1.00 56.91  ? 263  PRO A N     1 
ATOM   2088 C  CA    . PRO A 1 269 ? 15.821  60.376  25.879  1.00 57.65  ? 263  PRO A CA    1 
ATOM   2089 C  C     . PRO A 1 269 ? 15.070  59.707  24.708  1.00 58.71  ? 263  PRO A C     1 
ATOM   2090 O  O     . PRO A 1 269 ? 13.878  59.948  24.508  1.00 58.18  ? 263  PRO A O     1 
ATOM   2091 C  CB    . PRO A 1 269 ? 16.754  61.505  25.446  1.00 57.31  ? 263  PRO A CB    1 
ATOM   2092 C  CG    . PRO A 1 269 ? 18.081  60.780  25.228  1.00 57.55  ? 263  PRO A CG    1 
ATOM   2093 C  CD    . PRO A 1 269 ? 18.141  59.855  26.396  1.00 55.69  ? 263  PRO A CD    1 
ATOM   2094 N  N     . TYR A 1 270 ? 15.785  58.861  23.959  1.00 59.22  ? 264  TYR A N     1 
ATOM   2095 C  CA    . TYR A 1 270 ? 15.237  58.125  22.828  1.00 58.87  ? 264  TYR A CA    1 
ATOM   2096 C  C     . TYR A 1 270 ? 14.096  57.236  23.293  1.00 58.79  ? 264  TYR A C     1 
ATOM   2097 O  O     . TYR A 1 270 ? 12.955  57.409  22.877  1.00 59.44  ? 264  TYR A O     1 
ATOM   2098 C  CB    . TYR A 1 270 ? 16.327  57.263  22.188  1.00 59.94  ? 264  TYR A CB    1 
ATOM   2099 C  CG    . TYR A 1 270 ? 17.235  58.016  21.239  1.00 61.97  ? 264  TYR A CG    1 
ATOM   2100 C  CD1   . TYR A 1 270 ? 16.731  58.595  20.076  1.00 63.52  ? 264  TYR A CD1   1 
ATOM   2101 C  CD2   . TYR A 1 270 ? 18.591  58.161  21.505  1.00 61.69  ? 264  TYR A CD2   1 
ATOM   2102 C  CE1   . TYR A 1 270 ? 17.553  59.298  19.208  1.00 62.65  ? 264  TYR A CE1   1 
ATOM   2103 C  CE2   . TYR A 1 270 ? 19.419  58.863  20.645  1.00 61.35  ? 264  TYR A CE2   1 
ATOM   2104 C  CZ    . TYR A 1 270 ? 18.894  59.427  19.502  1.00 62.27  ? 264  TYR A CZ    1 
ATOM   2105 O  OH    . TYR A 1 270 ? 19.720  60.110  18.649  1.00 62.50  ? 264  TYR A OH    1 
ATOM   2106 N  N     . LEU A 1 271 ? 14.405  56.278  24.153  1.00 58.06  ? 265  LEU A N     1 
ATOM   2107 C  CA    . LEU A 1 271 ? 13.382  55.391  24.678  1.00 58.61  ? 265  LEU A CA    1 
ATOM   2108 C  C     . LEU A 1 271 ? 12.213  56.257  25.132  1.00 59.03  ? 265  LEU A C     1 
ATOM   2109 O  O     . LEU A 1 271 ? 11.104  56.127  24.639  1.00 59.73  ? 265  LEU A O     1 
ATOM   2110 C  CB    . LEU A 1 271 ? 13.926  54.624  25.874  1.00 59.19  ? 265  LEU A CB    1 
ATOM   2111 C  CG    . LEU A 1 271 ? 13.439  53.202  26.107  1.00 58.71  ? 265  LEU A CG    1 
ATOM   2112 C  CD1   . LEU A 1 271 ? 13.915  52.331  24.962  1.00 59.76  ? 265  LEU A CD1   1 
ATOM   2113 C  CD2   . LEU A 1 271 ? 14.002  52.677  27.418  1.00 59.70  ? 265  LEU A CD2   1 
ATOM   2114 N  N     . PHE A 1 272 ? 12.474  57.152  26.073  1.00 59.42  ? 266  PHE A N     1 
ATOM   2115 C  CA    . PHE A 1 272 ? 11.439  58.039  26.577  1.00 59.65  ? 266  PHE A CA    1 
ATOM   2116 C  C     . PHE A 1 272 ? 10.595  58.536  25.416  1.00 57.93  ? 266  PHE A C     1 
ATOM   2117 O  O     . PHE A 1 272 ? 9.379   58.471  25.469  1.00 56.52  ? 266  PHE A O     1 
ATOM   2118 C  CB    . PHE A 1 272 ? 12.082  59.226  27.304  1.00 63.81  ? 266  PHE A CB    1 
ATOM   2119 C  CG    . PHE A 1 272 ? 12.157  59.067  28.798  1.00 67.57  ? 266  PHE A CG    1 
ATOM   2120 C  CD1   . PHE A 1 272 ? 12.430  57.840  29.359  1.00 69.75  ? 266  PHE A CD1   1 
ATOM   2121 C  CD2   . PHE A 1 272 ? 11.950  60.157  29.648  1.00 68.72  ? 266  PHE A CD2   1 
ATOM   2122 C  CE1   . PHE A 1 272 ? 12.492  57.703  30.727  1.00 70.88  ? 266  PHE A CE1   1 
ATOM   2123 C  CE2   . PHE A 1 272 ? 12.018  60.016  31.048  1.00 70.29  ? 266  PHE A CE2   1 
ATOM   2124 C  CZ    . PHE A 1 272 ? 12.289  58.786  31.580  1.00 70.40  ? 266  PHE A CZ    1 
ATOM   2125 N  N     . ARG A 1 273 ? 11.258  59.022  24.369  1.00 57.55  ? 267  ARG A N     1 
ATOM   2126 C  CA    . ARG A 1 273 ? 10.595  59.546  23.170  1.00 57.05  ? 267  ARG A CA    1 
ATOM   2127 C  C     . ARG A 1 273 ? 9.592   58.555  22.588  1.00 55.84  ? 267  ARG A C     1 
ATOM   2128 O  O     . ARG A 1 273 ? 8.391   58.847  22.458  1.00 55.42  ? 267  ARG A O     1 
ATOM   2129 C  CB    . ARG A 1 273 ? 11.636  59.879  22.096  1.00 58.96  ? 267  ARG A CB    1 
ATOM   2130 C  CG    . ARG A 1 273 ? 12.502  61.112  22.369  1.00 61.62  ? 267  ARG A CG    1 
ATOM   2131 C  CD    . ARG A 1 273 ? 13.751  61.121  21.473  1.00 62.35  ? 267  ARG A CD    1 
ATOM   2132 N  NE    . ARG A 1 273 ? 14.476  62.389  21.519  1.00 62.41  ? 267  ARG A NE    1 
ATOM   2133 C  CZ    . ARG A 1 273 ? 15.738  62.543  21.122  1.00 62.62  ? 267  ARG A CZ    1 
ATOM   2134 N  NH1   . ARG A 1 273 ? 16.421  61.503  20.655  1.00 61.33  ? 267  ARG A NH1   1 
ATOM   2135 N  NH2   . ARG A 1 273 ? 16.310  63.741  21.178  1.00 60.42  ? 267  ARG A NH2   1 
ATOM   2136 N  N     . ALA A 1 274 ? 10.104  57.387  22.216  1.00 53.37  ? 268  ALA A N     1 
ATOM   2137 C  CA    . ALA A 1 274 ? 9.265   56.344  21.663  1.00 51.86  ? 268  ALA A CA    1 
ATOM   2138 C  C     . ALA A 1 274 ? 8.204   55.979  22.701  1.00 51.19  ? 268  ALA A C     1 
ATOM   2139 O  O     . ALA A 1 274 ? 7.013   56.046  22.424  1.00 52.41  ? 268  ALA A O     1 
ATOM   2140 C  CB    . ALA A 1 274 ? 10.103  55.145  21.306  1.00 51.33  ? 268  ALA A CB    1 
ATOM   2141 N  N     . ILE A 1 275 ? 8.627   55.624  23.902  1.00 49.53  ? 269  ILE A N     1 
ATOM   2142 C  CA    . ILE A 1 275 ? 7.679   55.288  24.952  1.00 49.78  ? 269  ILE A CA    1 
ATOM   2143 C  C     . ILE A 1 275 ? 6.567   56.338  25.093  1.00 50.38  ? 269  ILE A C     1 
ATOM   2144 O  O     . ILE A 1 275 ? 5.641   56.159  25.886  1.00 51.17  ? 269  ILE A O     1 
ATOM   2145 C  CB    . ILE A 1 275 ? 8.391   55.173  26.310  1.00 50.61  ? 269  ILE A CB    1 
ATOM   2146 C  CG1   . ILE A 1 275 ? 9.636   54.302  26.153  1.00 51.64  ? 269  ILE A CG1   1 
ATOM   2147 C  CG2   . ILE A 1 275 ? 7.438   54.602  27.375  1.00 48.47  ? 269  ILE A CG2   1 
ATOM   2148 C  CD1   . ILE A 1 275 ? 10.436  54.129  27.423  1.00 53.46  ? 269  ILE A CD1   1 
ATOM   2149 N  N     . GLU A 1 276 ? 6.658   57.437  24.350  1.00 50.29  ? 270  GLU A N     1 
ATOM   2150 C  CA    . GLU A 1 276 ? 5.639   58.475  24.428  1.00 50.17  ? 270  GLU A CA    1 
ATOM   2151 C  C     . GLU A 1 276 ? 4.636   58.287  23.312  1.00 50.19  ? 270  GLU A C     1 
ATOM   2152 O  O     . GLU A 1 276 ? 3.419   58.291  23.531  1.00 50.22  ? 270  GLU A O     1 
ATOM   2153 C  CB    . GLU A 1 276 ? 6.267   59.851  24.277  1.00 50.78  ? 270  GLU A CB    1 
ATOM   2154 C  CG    . GLU A 1 276 ? 7.221   60.238  25.370  1.00 52.90  ? 270  GLU A CG    1 
ATOM   2155 C  CD    . GLU A 1 276 ? 6.534   60.421  26.702  1.00 55.51  ? 270  GLU A CD    1 
ATOM   2156 O  OE1   . GLU A 1 276 ? 5.282   60.480  26.718  1.00 56.16  ? 270  GLU A OE1   1 
ATOM   2157 O  OE2   . GLU A 1 276 ? 7.251   60.518  27.726  1.00 56.58  ? 270  GLU A OE2   1 
ATOM   2158 N  N     . GLU A 1 277 ? 5.167   58.125  22.106  1.00 49.67  ? 271  GLU A N     1 
ATOM   2159 C  CA    . GLU A 1 277 ? 4.339   57.950  20.924  1.00 49.83  ? 271  GLU A CA    1 
ATOM   2160 C  C     . GLU A 1 277 ? 3.467   56.699  21.016  1.00 50.52  ? 271  GLU A C     1 
ATOM   2161 O  O     . GLU A 1 277 ? 2.299   56.711  20.644  1.00 50.38  ? 271  GLU A O     1 
ATOM   2162 C  CB    . GLU A 1 277 ? 5.235   57.889  19.691  1.00 48.62  ? 271  GLU A CB    1 
ATOM   2163 C  CG    A GLU A 1 277 ? 6.420   58.835  19.779  0.50 47.78  ? 271  GLU A CG    1 
ATOM   2164 C  CD    A GLU A 1 277 ? 7.148   58.992  18.457  0.50 47.25  ? 271  GLU A CD    1 
ATOM   2165 O  OE1   A GLU A 1 277 ? 7.323   57.973  17.754  0.50 45.90  ? 271  GLU A OE1   1 
ATOM   2166 O  OE2   A GLU A 1 277 ? 7.552   60.131  18.128  0.50 46.19  ? 271  GLU A OE2   1 
ATOM   2167 N  N     . SER A 1 278 ? 4.040   55.622  21.530  1.00 51.77  ? 272  SER A N     1 
ATOM   2168 C  CA    . SER A 1 278 ? 3.319   54.371  21.678  1.00 52.51  ? 272  SER A CA    1 
ATOM   2169 C  C     . SER A 1 278 ? 2.082   54.526  22.539  1.00 53.47  ? 272  SER A C     1 
ATOM   2170 O  O     . SER A 1 278 ? 1.017   54.027  22.195  1.00 54.11  ? 272  SER A O     1 
ATOM   2171 C  CB    . SER A 1 278 ? 4.233   53.340  22.299  1.00 52.50  ? 272  SER A CB    1 
ATOM   2172 O  OG    . SER A 1 278 ? 5.419   53.267  21.542  1.00 55.79  ? 272  SER A OG    1 
ATOM   2173 N  N     . TYR A 1 279 ? 2.223   55.215  23.664  1.00 54.80  ? 273  TYR A N     1 
ATOM   2174 C  CA    . TYR A 1 279 ? 1.097   55.414  24.566  1.00 56.22  ? 273  TYR A CA    1 
ATOM   2175 C  C     . TYR A 1 279 ? 0.005   56.291  23.985  1.00 57.43  ? 273  TYR A C     1 
ATOM   2176 O  O     . TYR A 1 279 ? -1.067  56.423  24.572  1.00 59.02  ? 273  TYR A O     1 
ATOM   2177 C  CB    . TYR A 1 279 ? 1.577   55.998  25.886  1.00 55.76  ? 273  TYR A CB    1 
ATOM   2178 C  CG    . TYR A 1 279 ? 1.486   55.021  27.029  1.00 56.00  ? 273  TYR A CG    1 
ATOM   2179 C  CD1   . TYR A 1 279 ? 0.351   54.967  27.842  1.00 54.66  ? 273  TYR A CD1   1 
ATOM   2180 C  CD2   . TYR A 1 279 ? 2.542   54.139  27.293  1.00 56.82  ? 273  TYR A CD2   1 
ATOM   2181 C  CE1   . TYR A 1 279 ? 0.276   54.061  28.890  1.00 56.54  ? 273  TYR A CE1   1 
ATOM   2182 C  CE2   . TYR A 1 279 ? 2.483   53.229  28.332  1.00 57.08  ? 273  TYR A CE2   1 
ATOM   2183 C  CZ    . TYR A 1 279 ? 1.351   53.191  29.130  1.00 57.72  ? 273  TYR A CZ    1 
ATOM   2184 O  OH    . TYR A 1 279 ? 1.302   52.277  30.162  1.00 57.59  ? 273  TYR A OH    1 
ATOM   2185 N  N     . TYR A 1 280 ? 0.271   56.898  22.837  1.00 57.72  ? 274  TYR A N     1 
ATOM   2186 C  CA    . TYR A 1 280 ? -0.734  57.729  22.193  1.00 58.05  ? 274  TYR A CA    1 
ATOM   2187 C  C     . TYR A 1 280 ? -1.663  56.844  21.354  1.00 56.86  ? 274  TYR A C     1 
ATOM   2188 O  O     . TYR A 1 280 ? -2.853  57.134  21.193  1.00 55.82  ? 274  TYR A O     1 
ATOM   2189 C  CB    . TYR A 1 280 ? -0.067  58.751  21.283  1.00 60.12  ? 274  TYR A CB    1 
ATOM   2190 C  CG    . TYR A 1 280 ? -1.051  59.732  20.708  1.00 62.51  ? 274  TYR A CG    1 
ATOM   2191 C  CD1   . TYR A 1 280 ? -1.768  60.585  21.547  1.00 64.31  ? 274  TYR A CD1   1 
ATOM   2192 C  CD2   . TYR A 1 280 ? -1.258  59.825  19.339  1.00 63.01  ? 274  TYR A CD2   1 
ATOM   2193 C  CE1   . TYR A 1 280 ? -2.657  61.502  21.050  1.00 65.24  ? 274  TYR A CE1   1 
ATOM   2194 C  CE2   . TYR A 1 280 ? -2.153  60.749  18.823  1.00 65.14  ? 274  TYR A CE2   1 
ATOM   2195 C  CZ    . TYR A 1 280 ? -2.850  61.588  19.691  1.00 66.17  ? 274  TYR A CZ    1 
ATOM   2196 O  OH    . TYR A 1 280 ? -3.739  62.529  19.219  1.00 68.01  ? 274  TYR A OH    1 
ATOM   2197 N  N     . LYS A 1 281 ? -1.080  55.764  20.831  1.00 55.54  ? 275  LYS A N     1 
ATOM   2198 C  CA    . LYS A 1 281 ? -1.750  54.778  19.984  1.00 52.63  ? 275  LYS A CA    1 
ATOM   2199 C  C     . LYS A 1 281 ? -2.437  53.729  20.833  1.00 50.97  ? 275  LYS A C     1 
ATOM   2200 O  O     . LYS A 1 281 ? -3.331  53.036  20.364  1.00 49.20  ? 275  LYS A O     1 
ATOM   2201 C  CB    . LYS A 1 281 ? -0.719  54.109  19.062  1.00 51.59  ? 275  LYS A CB    1 
ATOM   2202 C  CG    . LYS A 1 281 ? 0.318   55.102  18.528  1.00 51.03  ? 275  LYS A CG    1 
ATOM   2203 C  CD    . LYS A 1 281 ? 1.089   54.625  17.295  1.00 51.35  ? 275  LYS A CD    1 
ATOM   2204 C  CE    . LYS A 1 281 ? 2.081   53.506  17.582  1.00 51.43  ? 275  LYS A CE    1 
ATOM   2205 N  NZ    . LYS A 1 281 ? 3.029   53.264  16.426  1.00 50.04  ? 275  LYS A NZ    1 
ATOM   2206 N  N     . LEU A 1 282 ? -2.012  53.622  22.088  1.00 51.00  ? 276  LEU A N     1 
ATOM   2207 C  CA    . LEU A 1 282 ? -2.592  52.653  23.009  1.00 52.08  ? 276  LEU A CA    1 
ATOM   2208 C  C     . LEU A 1 282 ? -4.069  52.918  23.228  1.00 53.02  ? 276  LEU A C     1 
ATOM   2209 O  O     . LEU A 1 282 ? -4.778  52.131  23.858  1.00 51.06  ? 276  LEU A O     1 
ATOM   2210 C  CB    . LEU A 1 282 ? -1.855  52.667  24.350  1.00 50.45  ? 276  LEU A CB    1 
ATOM   2211 C  CG    . LEU A 1 282 ? -0.555  51.861  24.370  1.00 50.58  ? 276  LEU A CG    1 
ATOM   2212 C  CD1   . LEU A 1 282 ? 0.037   51.832  25.774  1.00 51.09  ? 276  LEU A CD1   1 
ATOM   2213 C  CD2   . LEU A 1 282 ? -0.843  50.450  23.914  1.00 50.97  ? 276  LEU A CD2   1 
ATOM   2214 N  N     . ASP A 1 283 ? -4.529  54.039  22.693  1.00 55.99  ? 277  ASP A N     1 
ATOM   2215 C  CA    . ASP A 1 283 ? -5.925  54.394  22.826  1.00 58.18  ? 277  ASP A CA    1 
ATOM   2216 C  C     . ASP A 1 283 ? -6.287  54.377  24.303  1.00 57.81  ? 277  ASP A C     1 
ATOM   2217 O  O     . ASP A 1 283 ? -5.665  55.049  25.128  1.00 56.06  ? 277  ASP A O     1 
ATOM   2218 C  CB    . ASP A 1 283 ? -6.778  53.368  22.066  1.00 61.58  ? 277  ASP A CB    1 
ATOM   2219 C  CG    . ASP A 1 283 ? -8.274  53.667  22.136  1.00 64.48  ? 277  ASP A CG    1 
ATOM   2220 O  OD1   . ASP A 1 283 ? -8.726  54.660  21.508  1.00 66.55  ? 277  ASP A OD1   1 
ATOM   2221 O  OD2   . ASP A 1 283 ? -8.990  52.901  22.824  1.00 64.44  ? 277  ASP A OD2   1 
ATOM   2222 N  N     . LYS A 1 284 ? -7.296  53.579  24.615  1.00 57.79  ? 278  LYS A N     1 
ATOM   2223 C  CA    . LYS A 1 284 ? -7.780  53.431  25.963  1.00 58.34  ? 278  LYS A CA    1 
ATOM   2224 C  C     . LYS A 1 284 ? -7.427  52.008  26.375  1.00 59.22  ? 278  LYS A C     1 
ATOM   2225 O  O     . LYS A 1 284 ? -8.126  51.374  27.161  1.00 60.68  ? 278  LYS A O     1 
ATOM   2226 C  CB    . LYS A 1 284 ? -9.289  53.655  25.975  1.00 58.32  ? 278  LYS A CB    1 
ATOM   2227 C  CG    . LYS A 1 284 ? -9.872  53.978  27.342  1.00 60.56  ? 278  LYS A CG    1 
ATOM   2228 C  CD    . LYS A 1 284 ? -11.173 54.787  27.217  1.00 61.16  ? 278  LYS A CD    1 
ATOM   2229 C  CE    . LYS A 1 284 ? -10.923 56.156  26.587  1.00 59.54  ? 278  LYS A CE    1 
ATOM   2230 N  NZ    . LYS A 1 284 ? -12.178 56.921  26.470  1.00 60.16  ? 278  LYS A NZ    1 
ATOM   2231 N  N     . ARG A 1 285 ? -6.331  51.505  25.824  1.00 58.87  ? 279  ARG A N     1 
ATOM   2232 C  CA    . ARG A 1 285 ? -5.892  50.163  26.148  1.00 59.00  ? 279  ARG A CA    1 
ATOM   2233 C  C     . ARG A 1 285 ? -4.976  50.187  27.362  1.00 58.52  ? 279  ARG A C     1 
ATOM   2234 O  O     . ARG A 1 285 ? -4.364  51.210  27.670  1.00 58.73  ? 279  ARG A O     1 
ATOM   2235 C  CB    . ARG A 1 285 ? -5.160  49.555  24.961  1.00 59.22  ? 279  ARG A CB    1 
ATOM   2236 C  CG    . ARG A 1 285 ? -6.012  49.408  23.741  1.00 60.02  ? 279  ARG A CG    1 
ATOM   2237 C  CD    . ARG A 1 285 ? -5.173  48.824  22.627  1.00 62.89  ? 279  ARG A CD    1 
ATOM   2238 N  NE    . ARG A 1 285 ? -5.972  48.244  21.550  1.00 65.72  ? 279  ARG A NE    1 
ATOM   2239 C  CZ    . ARG A 1 285 ? -6.949  47.355  21.727  1.00 66.46  ? 279  ARG A CZ    1 
ATOM   2240 N  NH1   . ARG A 1 285 ? -7.277  46.930  22.952  1.00 65.38  ? 279  ARG A NH1   1 
ATOM   2241 N  NH2   . ARG A 1 285 ? -7.584  46.870  20.667  1.00 65.89  ? 279  ARG A NH2   1 
ATOM   2242 N  N     . ILE A 1 286 ? -4.900  49.059  28.061  1.00 57.55  ? 280  ILE A N     1 
ATOM   2243 C  CA    . ILE A 1 286 ? -4.047  48.948  29.237  1.00 55.68  ? 280  ILE A CA    1 
ATOM   2244 C  C     . ILE A 1 286 ? -3.193  47.709  29.035  1.00 54.64  ? 280  ILE A C     1 
ATOM   2245 O  O     . ILE A 1 286 ? -3.680  46.596  29.159  1.00 55.23  ? 280  ILE A O     1 
ATOM   2246 C  CB    . ILE A 1 286 ? -4.868  48.765  30.530  1.00 54.81  ? 280  ILE A CB    1 
ATOM   2247 C  CG1   . ILE A 1 286 ? -6.090  49.682  30.538  1.00 54.54  ? 280  ILE A CG1   1 
ATOM   2248 C  CG2   . ILE A 1 286 ? -4.008  49.099  31.712  1.00 53.80  ? 280  ILE A CG2   1 
ATOM   2249 C  CD1   . ILE A 1 286 ? -5.765  51.140  30.726  1.00 54.61  ? 280  ILE A CD1   1 
ATOM   2250 N  N     . PRO A 1 287 ? -1.912  47.886  28.702  1.00 53.61  ? 281  PRO A N     1 
ATOM   2251 C  CA    . PRO A 1 287 ? -1.006  46.758  28.484  1.00 53.88  ? 281  PRO A CA    1 
ATOM   2252 C  C     . PRO A 1 287 ? -0.378  46.220  29.758  1.00 54.56  ? 281  PRO A C     1 
ATOM   2253 O  O     . PRO A 1 287 ? 0.106   46.983  30.592  1.00 56.06  ? 281  PRO A O     1 
ATOM   2254 C  CB    . PRO A 1 287 ? 0.043   47.346  27.564  1.00 53.28  ? 281  PRO A CB    1 
ATOM   2255 C  CG    . PRO A 1 287 ? 0.169   48.719  28.104  1.00 53.37  ? 281  PRO A CG    1 
ATOM   2256 C  CD    . PRO A 1 287 ? -1.277  49.141  28.275  1.00 53.35  ? 281  PRO A CD    1 
ATOM   2257 N  N     . LYS A 1 288 ? -0.376  44.899  29.889  1.00 53.63  ? 282  LYS A N     1 
ATOM   2258 C  CA    . LYS A 1 288 ? 0.203   44.251  31.044  1.00 53.20  ? 282  LYS A CA    1 
ATOM   2259 C  C     . LYS A 1 288 ? 1.605   43.800  30.677  1.00 52.65  ? 282  LYS A C     1 
ATOM   2260 O  O     . LYS A 1 288 ? 2.393   43.430  31.533  1.00 53.97  ? 282  LYS A O     1 
ATOM   2261 C  CB    . LYS A 1 288 ? -0.629  43.039  31.446  1.00 55.02  ? 282  LYS A CB    1 
ATOM   2262 C  CG    . LYS A 1 288 ? -2.124  43.289  31.508  1.00 58.17  ? 282  LYS A CG    1 
ATOM   2263 C  CD    . LYS A 1 288 ? -2.840  42.037  31.992  1.00 61.03  ? 282  LYS A CD    1 
ATOM   2264 C  CE    . LYS A 1 288 ? -4.339  42.160  31.792  1.00 63.79  ? 282  LYS A CE    1 
ATOM   2265 N  NZ    . LYS A 1 288 ? -4.647  42.427  30.360  1.00 63.97  ? 282  LYS A NZ    1 
ATOM   2266 N  N     . ALA A 1 289 ? 1.926   43.833  29.396  1.00 51.68  ? 283  ALA A N     1 
ATOM   2267 C  CA    . ALA A 1 289 ? 3.249   43.412  28.973  1.00 51.33  ? 283  ALA A CA    1 
ATOM   2268 C  C     . ALA A 1 289 ? 3.943   44.511  28.181  1.00 51.43  ? 283  ALA A C     1 
ATOM   2269 O  O     . ALA A 1 289 ? 3.298   45.274  27.464  1.00 51.38  ? 283  ALA A O     1 
ATOM   2270 C  CB    . ALA A 1 289 ? 3.141   42.155  28.145  1.00 51.52  ? 283  ALA A CB    1 
ATOM   2271 N  N     . ILE A 1 290 ? 5.262   44.588  28.331  1.00 51.04  ? 284  ILE A N     1 
ATOM   2272 C  CA    . ILE A 1 290 ? 6.074   45.584  27.641  1.00 50.58  ? 284  ILE A CA    1 
ATOM   2273 C  C     . ILE A 1 290 ? 7.462   45.027  27.337  1.00 49.23  ? 284  ILE A C     1 
ATOM   2274 O  O     . ILE A 1 290 ? 8.071   44.389  28.187  1.00 49.68  ? 284  ILE A O     1 
ATOM   2275 C  CB    . ILE A 1 290 ? 6.260   46.843  28.495  1.00 51.37  ? 284  ILE A CB    1 
ATOM   2276 C  CG1   . ILE A 1 290 ? 7.258   47.786  27.808  1.00 51.89  ? 284  ILE A CG1   1 
ATOM   2277 C  CG2   . ILE A 1 290 ? 6.726   46.445  29.899  1.00 52.23  ? 284  ILE A CG2   1 
ATOM   2278 C  CD1   . ILE A 1 290 ? 7.726   48.933  28.657  1.00 52.91  ? 284  ILE A CD1   1 
ATOM   2279 N  N     . HIS A 1 291 ? 7.963   45.285  26.134  1.00 47.76  ? 285  HIS A N     1 
ATOM   2280 C  CA    . HIS A 1 291 ? 9.278   44.803  25.731  1.00 47.63  ? 285  HIS A CA    1 
ATOM   2281 C  C     . HIS A 1 291 ? 10.114  45.930  25.121  1.00 47.44  ? 285  HIS A C     1 
ATOM   2282 O  O     . HIS A 1 291 ? 9.589   46.802  24.443  1.00 47.93  ? 285  HIS A O     1 
ATOM   2283 C  CB    . HIS A 1 291 ? 9.117   43.661  24.724  1.00 48.39  ? 285  HIS A CB    1 
ATOM   2284 C  CG    . HIS A 1 291 ? 8.217   42.563  25.198  1.00 49.56  ? 285  HIS A CG    1 
ATOM   2285 N  ND1   . HIS A 1 291 ? 6.888   42.768  25.508  1.00 51.18  ? 285  HIS A ND1   1 
ATOM   2286 C  CD2   . HIS A 1 291 ? 8.465   41.259  25.462  1.00 48.39  ? 285  HIS A CD2   1 
ATOM   2287 C  CE1   . HIS A 1 291 ? 6.360   41.639  25.946  1.00 50.36  ? 285  HIS A CE1   1 
ATOM   2288 N  NE2   . HIS A 1 291 ? 7.296   40.708  25.929  1.00 48.99  ? 285  HIS A NE2   1 
ATOM   2289 N  N     . VAL A 1 292 ? 11.415  45.921  25.370  1.00 46.39  ? 286  VAL A N     1 
ATOM   2290 C  CA    . VAL A 1 292 ? 12.276  46.955  24.826  1.00 46.31  ? 286  VAL A CA    1 
ATOM   2291 C  C     . VAL A 1 292 ? 13.072  46.347  23.694  1.00 47.61  ? 286  VAL A C     1 
ATOM   2292 O  O     . VAL A 1 292 ? 13.997  45.575  23.929  1.00 49.33  ? 286  VAL A O     1 
ATOM   2293 C  CB    . VAL A 1 292 ? 13.247  47.522  25.905  1.00 44.86  ? 286  VAL A CB    1 
ATOM   2294 C  CG1   . VAL A 1 292 ? 14.246  48.485  25.274  1.00 42.05  ? 286  VAL A CG1   1 
ATOM   2295 C  CG2   . VAL A 1 292 ? 12.455  48.244  26.982  1.00 43.70  ? 286  VAL A CG2   1 
ATOM   2296 N  N     . VAL A 1 293 ? 12.699  46.683  22.463  1.00 48.50  ? 287  VAL A N     1 
ATOM   2297 C  CA    . VAL A 1 293 ? 13.390  46.163  21.289  1.00 48.59  ? 287  VAL A CA    1 
ATOM   2298 C  C     . VAL A 1 293 ? 14.604  47.038  21.025  1.00 49.05  ? 287  VAL A C     1 
ATOM   2299 O  O     . VAL A 1 293 ? 14.516  48.263  21.066  1.00 48.76  ? 287  VAL A O     1 
ATOM   2300 C  CB    . VAL A 1 293 ? 12.478  46.178  20.043  1.00 48.20  ? 287  VAL A CB    1 
ATOM   2301 C  CG1   . VAL A 1 293 ? 13.244  45.660  18.858  1.00 47.60  ? 287  VAL A CG1   1 
ATOM   2302 C  CG2   . VAL A 1 293 ? 11.225  45.332  20.283  1.00 47.97  ? 287  VAL A CG2   1 
ATOM   2303 N  N     . ALA A 1 294 ? 15.743  46.412  20.769  1.00 50.03  ? 288  ALA A N     1 
ATOM   2304 C  CA    . ALA A 1 294 ? 16.955  47.172  20.509  1.00 51.43  ? 288  ALA A CA    1 
ATOM   2305 C  C     . ALA A 1 294 ? 17.690  46.671  19.282  1.00 52.88  ? 288  ALA A C     1 
ATOM   2306 O  O     . ALA A 1 294 ? 18.081  45.503  19.189  1.00 53.04  ? 288  ALA A O     1 
ATOM   2307 C  CB    . ALA A 1 294 ? 17.874  47.128  21.713  1.00 50.68  ? 288  ALA A CB    1 
ATOM   2308 N  N     . VAL A 1 295 ? 17.877  47.572  18.332  1.00 54.64  ? 289  VAL A N     1 
ATOM   2309 C  CA    . VAL A 1 295 ? 18.577  47.227  17.111  1.00 57.29  ? 289  VAL A CA    1 
ATOM   2310 C  C     . VAL A 1 295 ? 20.024  47.631  17.333  1.00 57.62  ? 289  VAL A C     1 
ATOM   2311 O  O     . VAL A 1 295 ? 20.305  48.759  17.759  1.00 54.82  ? 289  VAL A O     1 
ATOM   2312 C  CB    . VAL A 1 295 ? 17.990  47.999  15.879  1.00 58.74  ? 289  VAL A CB    1 
ATOM   2313 C  CG1   . VAL A 1 295 ? 18.572  47.443  14.568  1.00 57.39  ? 289  VAL A CG1   1 
ATOM   2314 C  CG2   . VAL A 1 295 ? 16.458  47.913  15.881  1.00 58.21  ? 289  VAL A CG2   1 
ATOM   2315 N  N     . THR A 1 296 ? 20.936  46.710  17.041  1.00 59.93  ? 290  THR A N     1 
ATOM   2316 C  CA    . THR A 1 296 ? 22.350  46.975  17.222  1.00 64.03  ? 290  THR A CA    1 
ATOM   2317 C  C     . THR A 1 296 ? 23.011  47.744  16.090  1.00 66.34  ? 290  THR A C     1 
ATOM   2318 O  O     . THR A 1 296 ? 22.706  48.926  15.869  1.00 66.65  ? 290  THR A O     1 
ATOM   2319 C  CB    . THR A 1 296 ? 23.109  45.690  17.425  1.00 64.72  ? 290  THR A CB    1 
ATOM   2320 O  OG1   . THR A 1 296 ? 22.617  44.712  16.503  1.00 66.05  ? 290  THR A OG1   1 
ATOM   2321 C  CG2   . THR A 1 296 ? 22.939  45.209  18.853  1.00 65.62  ? 290  THR A CG2   1 
ATOM   2322 N  N     . GLU A 1 297 ? 23.936  47.076  15.398  1.00 68.41  ? 291  GLU A N     1 
ATOM   2323 C  CA    . GLU A 1 297 ? 24.674  47.679  14.284  1.00 71.12  ? 291  GLU A CA    1 
ATOM   2324 C  C     . GLU A 1 297 ? 24.795  46.621  13.198  1.00 72.42  ? 291  GLU A C     1 
ATOM   2325 O  O     . GLU A 1 297 ? 24.379  46.824  12.049  1.00 72.56  ? 291  GLU A O     1 
ATOM   2326 C  CB    . GLU A 1 297 ? 26.070  48.115  14.750  1.00 71.63  ? 291  GLU A CB    1 
ATOM   2327 C  CG    . GLU A 1 297 ? 26.061  48.961  16.025  1.00 72.53  ? 291  GLU A CG    1 
ATOM   2328 C  CD    . GLU A 1 297 ? 27.454  49.245  16.560  1.00 72.66  ? 291  GLU A CD    1 
ATOM   2329 O  OE1   . GLU A 1 297 ? 28.174  48.288  16.915  1.00 72.83  ? 291  GLU A OE1   1 
ATOM   2330 O  OE2   . GLU A 1 297 ? 27.829  50.434  16.627  1.00 73.33  ? 291  GLU A OE2   1 
ATOM   2331 N  N     . ASP A 1 298 ? 25.377  45.490  13.584  1.00 74.10  ? 292  ASP A N     1 
ATOM   2332 C  CA    . ASP A 1 298 ? 25.529  44.356  12.688  1.00 75.66  ? 292  ASP A CA    1 
ATOM   2333 C  C     . ASP A 1 298 ? 24.193  43.614  12.732  1.00 75.96  ? 292  ASP A C     1 
ATOM   2334 O  O     . ASP A 1 298 ? 24.119  42.457  13.159  1.00 75.95  ? 292  ASP A O     1 
ATOM   2335 C  CB    . ASP A 1 298 ? 26.677  43.434  13.153  1.00 77.59  ? 292  ASP A CB    1 
ATOM   2336 C  CG    . ASP A 1 298 ? 26.610  43.092  14.655  1.00 78.85  ? 292  ASP A CG    1 
ATOM   2337 O  OD1   . ASP A 1 298 ? 26.864  43.991  15.492  1.00 79.11  ? 292  ASP A OD1   1 
ATOM   2338 O  OD2   . ASP A 1 298 ? 26.307  41.924  15.001  1.00 79.10  ? 292  ASP A OD2   1 
ATOM   2339 N  N     . LEU A 1 299 ? 23.137  44.306  12.306  1.00 76.36  ? 293  LEU A N     1 
ATOM   2340 C  CA    . LEU A 1 299 ? 21.782  43.751  12.276  1.00 76.54  ? 293  LEU A CA    1 
ATOM   2341 C  C     . LEU A 1 299 ? 21.324  43.184  13.626  1.00 76.70  ? 293  LEU A C     1 
ATOM   2342 O  O     . LEU A 1 299 ? 21.278  43.915  14.627  1.00 77.33  ? 293  LEU A O     1 
ATOM   2343 C  CB    . LEU A 1 299 ? 21.650  42.666  11.174  1.00 75.97  ? 293  LEU A CB    1 
ATOM   2344 C  CG    . LEU A 1 299 ? 22.699  41.550  10.990  1.00 75.05  ? 293  LEU A CG    1 
ATOM   2345 C  CD1   . LEU A 1 299 ? 22.011  40.232  10.696  1.00 74.41  ? 293  LEU A CD1   1 
ATOM   2346 C  CD2   . LEU A 1 299 ? 23.682  41.922  9.879   1.00 73.17  ? 293  LEU A CD2   1 
ATOM   2347 N  N     . ASP A 1 300 ? 20.998  41.884  13.621  1.00 75.93  ? 294  ASP A N     1 
ATOM   2348 C  CA    . ASP A 1 300 ? 20.508  41.112  14.777  1.00 73.58  ? 294  ASP A CA    1 
ATOM   2349 C  C     . ASP A 1 300 ? 19.942  41.968  15.907  1.00 71.18  ? 294  ASP A C     1 
ATOM   2350 O  O     . ASP A 1 300 ? 20.664  42.693  16.594  1.00 69.89  ? 294  ASP A O     1 
ATOM   2351 C  CB    . ASP A 1 300 ? 21.607  40.168  15.302  1.00 74.26  ? 294  ASP A CB    1 
ATOM   2352 C  CG    . ASP A 1 300 ? 21.049  39.008  16.142  1.00 74.43  ? 294  ASP A CG    1 
ATOM   2353 O  OD1   . ASP A 1 300 ? 19.892  38.594  15.915  1.00 73.73  ? 294  ASP A OD1   1 
ATOM   2354 O  OD2   . ASP A 1 300 ? 21.778  38.490  17.021  1.00 75.00  ? 294  ASP A OD2   1 
ATOM   2355 N  N     . ILE A 1 301 ? 18.625  41.874  16.062  1.00 69.00  ? 295  ILE A N     1 
ATOM   2356 C  CA    . ILE A 1 301 ? 17.881  42.610  17.072  1.00 66.96  ? 295  ILE A CA    1 
ATOM   2357 C  C     . ILE A 1 301 ? 17.933  41.850  18.392  1.00 65.71  ? 295  ILE A C     1 
ATOM   2358 O  O     . ILE A 1 301 ? 18.100  40.628  18.408  1.00 66.31  ? 295  ILE A O     1 
ATOM   2359 C  CB    . ILE A 1 301 ? 16.396  42.750  16.673  1.00 66.10  ? 295  ILE A CB    1 
ATOM   2360 C  CG1   . ILE A 1 301 ? 16.262  43.515  15.366  1.00 65.30  ? 295  ILE A CG1   1 
ATOM   2361 C  CG2   . ILE A 1 301 ? 15.639  43.485  17.736  1.00 66.82  ? 295  ILE A CG2   1 
ATOM   2362 C  CD1   . ILE A 1 301 ? 16.597  42.699  14.163  1.00 64.71  ? 295  ILE A CD1   1 
ATOM   2363 N  N     . VAL A 1 302 ? 17.790  42.580  19.494  1.00 63.33  ? 296  VAL A N     1 
ATOM   2364 C  CA    . VAL A 1 302 ? 17.794  41.977  20.818  1.00 61.54  ? 296  VAL A CA    1 
ATOM   2365 C  C     . VAL A 1 302 ? 16.630  42.562  21.614  1.00 60.57  ? 296  VAL A C     1 
ATOM   2366 O  O     . VAL A 1 302 ? 16.266  43.729  21.427  1.00 59.72  ? 296  VAL A O     1 
ATOM   2367 C  CB    . VAL A 1 302 ? 19.119  42.249  21.552  1.00 60.76  ? 296  VAL A CB    1 
ATOM   2368 C  CG1   . VAL A 1 302 ? 20.280  41.777  20.698  1.00 59.46  ? 296  VAL A CG1   1 
ATOM   2369 C  CG2   . VAL A 1 302 ? 19.249  43.726  21.872  1.00 61.42  ? 296  VAL A CG2   1 
ATOM   2370 N  N     . SER A 1 303 ? 16.043  41.759  22.496  1.00 59.31  ? 297  SER A N     1 
ATOM   2371 C  CA    . SER A 1 303 ? 14.913  42.233  23.280  1.00 58.16  ? 297  SER A CA    1 
ATOM   2372 C  C     . SER A 1 303 ? 14.803  41.633  24.675  1.00 56.73  ? 297  SER A C     1 
ATOM   2373 O  O     . SER A 1 303 ? 15.194  40.487  24.902  1.00 56.84  ? 297  SER A O     1 
ATOM   2374 C  CB    . SER A 1 303 ? 13.623  41.969  22.508  1.00 58.73  ? 297  SER A CB    1 
ATOM   2375 O  OG    . SER A 1 303 ? 13.517  40.599  22.158  1.00 60.12  ? 297  SER A OG    1 
ATOM   2376 N  N     . ARG A 1 304 ? 14.267  42.422  25.602  1.00 54.25  ? 298  ARG A N     1 
ATOM   2377 C  CA    . ARG A 1 304 ? 14.068  41.986  26.983  1.00 53.66  ? 298  ARG A CA    1 
ATOM   2378 C  C     . ARG A 1 304 ? 12.777  42.630  27.493  1.00 52.74  ? 298  ARG A C     1 
ATOM   2379 O  O     . ARG A 1 304 ? 12.642  43.850  27.447  1.00 53.75  ? 298  ARG A O     1 
ATOM   2380 C  CB    . ARG A 1 304 ? 15.247  42.424  27.862  1.00 53.21  ? 298  ARG A CB    1 
ATOM   2381 C  CG    . ARG A 1 304 ? 16.603  41.852  27.466  1.00 52.60  ? 298  ARG A CG    1 
ATOM   2382 C  CD    . ARG A 1 304 ? 16.703  40.356  27.726  1.00 51.81  ? 298  ARG A CD    1 
ATOM   2383 N  NE    . ARG A 1 304 ? 18.042  39.844  27.436  1.00 52.52  ? 298  ARG A NE    1 
ATOM   2384 C  CZ    . ARG A 1 304 ? 18.509  39.598  26.215  1.00 53.19  ? 298  ARG A CZ    1 
ATOM   2385 N  NH1   . ARG A 1 304 ? 17.739  39.809  25.151  1.00 54.18  ? 298  ARG A NH1   1 
ATOM   2386 N  NH2   . ARG A 1 304 ? 19.754  39.159  26.054  1.00 52.54  ? 298  ARG A NH2   1 
ATOM   2387 N  N     . GLY A 1 305 ? 11.831  41.826  27.978  1.00 50.34  ? 299  GLY A N     1 
ATOM   2388 C  CA    . GLY A 1 305 ? 10.581  42.395  28.453  1.00 47.60  ? 299  GLY A CA    1 
ATOM   2389 C  C     . GLY A 1 305 ? 10.028  41.739  29.695  1.00 46.76  ? 299  GLY A C     1 
ATOM   2390 O  O     . GLY A 1 305 ? 10.641  40.837  30.250  1.00 46.53  ? 299  GLY A O     1 
ATOM   2391 N  N     . ARG A 1 306 ? 8.859   42.188  30.129  1.00 46.19  ? 300  ARG A N     1 
ATOM   2392 C  CA    . ARG A 1 306 ? 8.252   41.635  31.320  1.00 46.36  ? 300  ARG A CA    1 
ATOM   2393 C  C     . ARG A 1 306 ? 6.741   41.810  31.331  1.00 46.36  ? 300  ARG A C     1 
ATOM   2394 O  O     . ARG A 1 306 ? 6.210   42.782  30.791  1.00 45.45  ? 300  ARG A O     1 
ATOM   2395 C  CB    . ARG A 1 306 ? 8.864   42.303  32.558  1.00 47.21  ? 300  ARG A CB    1 
ATOM   2396 C  CG    . ARG A 1 306 ? 8.147   42.009  33.874  1.00 48.04  ? 300  ARG A CG    1 
ATOM   2397 C  CD    . ARG A 1 306 ? 8.801   42.739  35.028  1.00 48.13  ? 300  ARG A CD    1 
ATOM   2398 N  NE    . ARG A 1 306 ? 7.949   42.773  36.210  1.00 48.85  ? 300  ARG A NE    1 
ATOM   2399 C  CZ    . ARG A 1 306 ? 8.297   43.370  37.343  1.00 49.14  ? 300  ARG A CZ    1 
ATOM   2400 N  NH1   . ARG A 1 306 ? 9.481   43.965  37.426  1.00 49.16  ? 300  ARG A NH1   1 
ATOM   2401 N  NH2   . ARG A 1 306 ? 7.459   43.393  38.377  1.00 49.09  ? 300  ARG A NH2   1 
ATOM   2402 N  N     . THR A 1 307 ? 6.057   40.859  31.962  1.00 46.35  ? 301  THR A N     1 
ATOM   2403 C  CA    . THR A 1 307 ? 4.604   40.898  32.087  1.00 46.48  ? 301  THR A CA    1 
ATOM   2404 C  C     . THR A 1 307 ? 4.173   41.207  33.540  1.00 47.28  ? 301  THR A C     1 
ATOM   2405 O  O     . THR A 1 307 ? 4.769   40.712  34.491  1.00 47.98  ? 301  THR A O     1 
ATOM   2406 C  CB    . THR A 1 307 ? 3.993   39.562  31.639  1.00 44.02  ? 301  THR A CB    1 
ATOM   2407 O  OG1   . THR A 1 307 ? 4.525   39.212  30.358  1.00 43.00  ? 301  THR A OG1   1 
ATOM   2408 C  CG2   . THR A 1 307 ? 2.487   39.672  31.535  1.00 41.31  ? 301  THR A CG2   1 
ATOM   2409 N  N     . PHE A 1 308 ? 3.151   42.043  33.697  1.00 47.38  ? 302  PHE A N     1 
ATOM   2410 C  CA    . PHE A 1 308 ? 2.640   42.418  35.007  1.00 48.70  ? 302  PHE A CA    1 
ATOM   2411 C  C     . PHE A 1 308 ? 1.205   41.923  35.157  1.00 50.56  ? 302  PHE A C     1 
ATOM   2412 O  O     . PHE A 1 308 ? 0.489   41.781  34.178  1.00 51.97  ? 302  PHE A O     1 
ATOM   2413 C  CB    . PHE A 1 308 ? 2.665   43.933  35.166  1.00 49.30  ? 302  PHE A CB    1 
ATOM   2414 C  CG    . PHE A 1 308 ? 4.037   44.534  35.071  1.00 49.65  ? 302  PHE A CG    1 
ATOM   2415 C  CD1   . PHE A 1 308 ? 4.748   44.489  33.877  1.00 49.62  ? 302  PHE A CD1   1 
ATOM   2416 C  CD2   . PHE A 1 308 ? 4.619   45.144  36.178  1.00 48.67  ? 302  PHE A CD2   1 
ATOM   2417 C  CE1   . PHE A 1 308 ? 6.016   45.041  33.785  1.00 49.24  ? 302  PHE A CE1   1 
ATOM   2418 C  CE2   . PHE A 1 308 ? 5.886   45.699  36.098  1.00 48.33  ? 302  PHE A CE2   1 
ATOM   2419 C  CZ    . PHE A 1 308 ? 6.588   45.648  34.900  1.00 48.69  ? 302  PHE A CZ    1 
ATOM   2420 N  N     . PRO A 1 309 ? 0.764   41.659  36.392  1.00 51.81  ? 303  PRO A N     1 
ATOM   2421 C  CA    . PRO A 1 309 ? -0.594  41.178  36.649  1.00 52.71  ? 303  PRO A CA    1 
ATOM   2422 C  C     . PRO A 1 309 ? -1.627  42.284  36.591  1.00 54.73  ? 303  PRO A C     1 
ATOM   2423 O  O     . PRO A 1 309 ? -2.816  42.040  36.804  1.00 57.01  ? 303  PRO A O     1 
ATOM   2424 C  CB    . PRO A 1 309 ? -0.484  40.585  38.044  1.00 52.45  ? 303  PRO A CB    1 
ATOM   2425 C  CG    . PRO A 1 309 ? 0.475   41.497  38.697  1.00 52.74  ? 303  PRO A CG    1 
ATOM   2426 C  CD    . PRO A 1 309 ? 1.554   41.651  37.634  1.00 52.74  ? 303  PRO A CD    1 
ATOM   2427 N  N     . HIS A 1 310 ? -1.168  43.502  36.317  1.00 56.71  ? 304  HIS A N     1 
ATOM   2428 C  CA    . HIS A 1 310 ? -2.048  44.675  36.234  1.00 56.83  ? 304  HIS A CA    1 
ATOM   2429 C  C     . HIS A 1 310 ? -1.661  45.563  35.041  1.00 55.42  ? 304  HIS A C     1 
ATOM   2430 O  O     . HIS A 1 310 ? -0.600  45.396  34.429  1.00 53.41  ? 304  HIS A O     1 
ATOM   2431 C  CB    . HIS A 1 310 ? -1.953  45.502  37.528  1.00 59.16  ? 304  HIS A CB    1 
ATOM   2432 C  CG    . HIS A 1 310 ? -0.612  46.150  37.736  1.00 63.35  ? 304  HIS A CG    1 
ATOM   2433 N  ND1   . HIS A 1 310 ? 0.479   45.482  38.256  1.00 63.32  ? 304  HIS A ND1   1 
ATOM   2434 C  CD2   . HIS A 1 310 ? -0.182  47.405  37.459  1.00 63.90  ? 304  HIS A CD2   1 
ATOM   2435 C  CE1   . HIS A 1 310 ? 1.519   46.298  38.293  1.00 64.42  ? 304  HIS A CE1   1 
ATOM   2436 N  NE2   . HIS A 1 310 ? 1.144   47.471  37.815  1.00 65.28  ? 304  HIS A NE2   1 
ATOM   2437 N  N     . GLY A 1 311 ? -2.518  46.529  34.737  1.00 54.93  ? 305  GLY A N     1 
ATOM   2438 C  CA    . GLY A 1 311 ? -2.249  47.425  33.629  1.00 54.07  ? 305  GLY A CA    1 
ATOM   2439 C  C     . GLY A 1 311 ? -0.983  48.212  33.853  1.00 53.23  ? 305  GLY A C     1 
ATOM   2440 O  O     . GLY A 1 311 ? -0.263  47.961  34.814  1.00 54.40  ? 305  GLY A O     1 
ATOM   2441 N  N     . ILE A 1 312 ? -0.703  49.158  32.966  1.00 51.60  ? 306  ILE A N     1 
ATOM   2442 C  CA    . ILE A 1 312 ? 0.491   49.978  33.099  1.00 50.55  ? 306  ILE A CA    1 
ATOM   2443 C  C     . ILE A 1 312 ? 0.224   51.468  32.893  1.00 51.18  ? 306  ILE A C     1 
ATOM   2444 O  O     . ILE A 1 312 ? -0.598  51.864  32.069  1.00 51.67  ? 306  ILE A O     1 
ATOM   2445 C  CB    . ILE A 1 312 ? 1.587   49.514  32.113  1.00 49.08  ? 306  ILE A CB    1 
ATOM   2446 C  CG1   . ILE A 1 312 ? 2.260   48.250  32.652  1.00 50.05  ? 306  ILE A CG1   1 
ATOM   2447 C  CG2   . ILE A 1 312 ? 2.621   50.605  31.917  1.00 49.81  ? 306  ILE A CG2   1 
ATOM   2448 C  CD1   . ILE A 1 312 ? 3.421   47.751  31.823  1.00 47.79  ? 306  ILE A CD1   1 
ATOM   2449 N  N     . SER A 1 313 ? 0.913   52.298  33.663  1.00 51.22  ? 307  SER A N     1 
ATOM   2450 C  CA    . SER A 1 313 ? 0.755   53.734  33.524  1.00 50.28  ? 307  SER A CA    1 
ATOM   2451 C  C     . SER A 1 313 ? 2.065   54.199  32.933  1.00 48.94  ? 307  SER A C     1 
ATOM   2452 O  O     . SER A 1 313 ? 3.128   53.678  33.288  1.00 46.52  ? 307  SER A O     1 
ATOM   2453 C  CB    . SER A 1 313 ? 0.569   54.382  34.876  1.00 51.70  ? 307  SER A CB    1 
ATOM   2454 O  OG    . SER A 1 313 ? 1.797   54.313  35.566  1.00 53.00  ? 307  SER A OG    1 
ATOM   2455 N  N     . LYS A 1 314 ? 1.976   55.173  32.034  1.00 48.09  ? 308  LYS A N     1 
ATOM   2456 C  CA    . LYS A 1 314 ? 3.140   55.715  31.358  1.00 47.36  ? 308  LYS A CA    1 
ATOM   2457 C  C     . LYS A 1 314 ? 4.390   55.550  32.230  1.00 48.74  ? 308  LYS A C     1 
ATOM   2458 O  O     . LYS A 1 314 ? 5.303   54.774  31.913  1.00 47.68  ? 308  LYS A O     1 
ATOM   2459 C  CB    . LYS A 1 314 ? 2.901   57.192  31.061  1.00 45.90  ? 308  LYS A CB    1 
ATOM   2460 C  CG    . LYS A 1 314 ? 3.306   57.609  29.682  1.00 44.53  ? 308  LYS A CG    1 
ATOM   2461 C  CD    . LYS A 1 314 ? 3.540   59.104  29.551  1.00 46.32  ? 308  LYS A CD    1 
ATOM   2462 C  CE    . LYS A 1 314 ? 2.265   59.915  29.682  1.00 47.26  ? 308  LYS A CE    1 
ATOM   2463 N  NZ    . LYS A 1 314 ? 2.578   61.380  29.563  1.00 47.93  ? 308  LYS A NZ    1 
ATOM   2464 N  N     . GLU A 1 315 ? 4.404   56.291  33.337  1.00 49.46  ? 309  GLU A N     1 
ATOM   2465 C  CA    . GLU A 1 315 ? 5.497   56.290  34.307  1.00 49.47  ? 309  GLU A CA    1 
ATOM   2466 C  C     . GLU A 1 315 ? 5.958   54.886  34.659  1.00 49.58  ? 309  GLU A C     1 
ATOM   2467 O  O     . GLU A 1 315 ? 7.157   54.593  34.652  1.00 49.08  ? 309  GLU A O     1 
ATOM   2468 C  CB    . GLU A 1 315 ? 5.046   57.014  35.566  1.00 49.12  ? 309  GLU A CB    1 
ATOM   2469 C  CG    . GLU A 1 315 ? 3.598   56.745  35.892  1.00 51.67  ? 309  GLU A CG    1 
ATOM   2470 C  CD    . GLU A 1 315 ? 2.621   57.484  34.980  1.00 52.49  ? 309  GLU A CD    1 
ATOM   2471 O  OE1   . GLU A 1 315 ? 2.505   58.723  35.099  1.00 52.86  ? 309  GLU A OE1   1 
ATOM   2472 O  OE2   . GLU A 1 315 ? 1.966   56.822  34.143  1.00 52.39  ? 309  GLU A OE2   1 
ATOM   2473 N  N     . THR A 1 316 ? 4.996   54.020  34.963  1.00 49.83  ? 310  THR A N     1 
ATOM   2474 C  CA    . THR A 1 316 ? 5.305   52.641  35.313  1.00 49.35  ? 310  THR A CA    1 
ATOM   2475 C  C     . THR A 1 316 ? 6.173   52.082  34.211  1.00 49.51  ? 310  THR A C     1 
ATOM   2476 O  O     . THR A 1 316 ? 7.107   51.319  34.452  1.00 48.25  ? 310  THR A O     1 
ATOM   2477 C  CB    . THR A 1 316 ? 4.053   51.766  35.377  1.00 49.11  ? 310  THR A CB    1 
ATOM   2478 O  OG1   . THR A 1 316 ? 3.028   52.433  36.116  1.00 48.75  ? 310  THR A OG1   1 
ATOM   2479 C  CG2   . THR A 1 316 ? 4.376   50.447  36.053  1.00 47.33  ? 310  THR A CG2   1 
ATOM   2480 N  N     . ALA A 1 317 ? 5.843   52.464  32.985  1.00 50.40  ? 311  ALA A N     1 
ATOM   2481 C  CA    . ALA A 1 317 ? 6.600   51.993  31.847  1.00 52.10  ? 311  ALA A CA    1 
ATOM   2482 C  C     . ALA A 1 317 ? 8.023   52.555  31.876  1.00 53.41  ? 311  ALA A C     1 
ATOM   2483 O  O     . ALA A 1 317 ? 8.991   51.775  31.876  1.00 52.65  ? 311  ALA A O     1 
ATOM   2484 C  CB    . ALA A 1 317 ? 5.892   52.371  30.566  1.00 52.41  ? 311  ALA A CB    1 
ATOM   2485 N  N     . TYR A 1 318 ? 8.144   53.891  31.924  1.00 53.82  ? 312  TYR A N     1 
ATOM   2486 C  CA    . TYR A 1 318 ? 9.452   54.558  31.953  1.00 54.13  ? 312  TYR A CA    1 
ATOM   2487 C  C     . TYR A 1 318 ? 10.473  53.805  32.800  1.00 54.72  ? 312  TYR A C     1 
ATOM   2488 O  O     . TYR A 1 318 ? 11.587  53.528  32.346  1.00 55.20  ? 312  TYR A O     1 
ATOM   2489 C  CB    . TYR A 1 318 ? 9.351   55.969  32.524  1.00 54.91  ? 312  TYR A CB    1 
ATOM   2490 C  CG    . TYR A 1 318 ? 8.574   56.967  31.707  1.00 55.79  ? 312  TYR A CG    1 
ATOM   2491 C  CD1   . TYR A 1 318 ? 7.204   57.106  31.876  1.00 55.34  ? 312  TYR A CD1   1 
ATOM   2492 C  CD2   . TYR A 1 318 ? 9.225   57.839  30.826  1.00 55.10  ? 312  TYR A CD2   1 
ATOM   2493 C  CE1   . TYR A 1 318 ? 6.494   58.096  31.208  1.00 55.73  ? 312  TYR A CE1   1 
ATOM   2494 C  CE2   . TYR A 1 318 ? 8.526   58.831  30.147  1.00 54.52  ? 312  TYR A CE2   1 
ATOM   2495 C  CZ    . TYR A 1 318 ? 7.158   58.956  30.350  1.00 55.66  ? 312  TYR A CZ    1 
ATOM   2496 O  OH    . TYR A 1 318 ? 6.437   59.953  29.734  1.00 55.20  ? 312  TYR A OH    1 
ATOM   2497 N  N     . SER A 1 319 ? 10.082  53.488  34.033  1.00 54.08  ? 313  SER A N     1 
ATOM   2498 C  CA    . SER A 1 319 ? 10.940  52.786  34.975  1.00 53.21  ? 313  SER A CA    1 
ATOM   2499 C  C     . SER A 1 319 ? 11.443  51.429  34.469  1.00 52.66  ? 313  SER A C     1 
ATOM   2500 O  O     . SER A 1 319 ? 12.650  51.214  34.322  1.00 52.62  ? 313  SER A O     1 
ATOM   2501 C  CB    . SER A 1 319 ? 10.195  52.611  36.300  1.00 54.77  ? 313  SER A CB    1 
ATOM   2502 O  OG    . SER A 1 319 ? 9.745   53.864  36.802  1.00 57.15  ? 313  SER A OG    1 
ATOM   2503 N  N     . GLU A 1 320 ? 10.520  50.516  34.187  1.00 51.59  ? 314  GLU A N     1 
ATOM   2504 C  CA    . GLU A 1 320 ? 10.897  49.184  33.729  1.00 50.14  ? 314  GLU A CA    1 
ATOM   2505 C  C     . GLU A 1 320 ? 11.739  49.251  32.463  1.00 49.31  ? 314  GLU A C     1 
ATOM   2506 O  O     . GLU A 1 320 ? 12.617  48.419  32.220  1.00 48.15  ? 314  GLU A O     1 
ATOM   2507 C  CB    . GLU A 1 320 ? 9.642   48.357  33.486  1.00 49.97  ? 314  GLU A CB    1 
ATOM   2508 C  CG    . GLU A 1 320 ? 9.913   46.907  33.141  1.00 52.27  ? 314  GLU A CG    1 
ATOM   2509 C  CD    . GLU A 1 320 ? 10.605  46.124  34.258  1.00 53.55  ? 314  GLU A CD    1 
ATOM   2510 O  OE1   . GLU A 1 320 ? 10.065  46.090  35.389  1.00 53.39  ? 314  GLU A OE1   1 
ATOM   2511 O  OE2   . GLU A 1 320 ? 11.681  45.530  33.994  1.00 52.42  ? 314  GLU A OE2   1 
ATOM   2512 N  N     . SER A 1 321 ? 11.466  50.260  31.657  1.00 48.30  ? 315  SER A N     1 
ATOM   2513 C  CA    . SER A 1 321 ? 12.202  50.445  30.428  1.00 48.42  ? 315  SER A CA    1 
ATOM   2514 C  C     . SER A 1 321 ? 13.698  50.344  30.672  1.00 49.56  ? 315  SER A C     1 
ATOM   2515 O  O     . SER A 1 321 ? 14.403  49.594  29.984  1.00 49.62  ? 315  SER A O     1 
ATOM   2516 C  CB    . SER A 1 321 ? 11.869  51.805  29.846  1.00 47.02  ? 315  SER A CB    1 
ATOM   2517 O  OG    . SER A 1 321 ? 10.477  51.898  29.623  1.00 47.16  ? 315  SER A OG    1 
ATOM   2518 N  N     . VAL A 1 322 ? 14.169  51.093  31.670  1.00 49.55  ? 316  VAL A N     1 
ATOM   2519 C  CA    . VAL A 1 322 ? 15.586  51.132  32.023  1.00 47.74  ? 316  VAL A CA    1 
ATOM   2520 C  C     . VAL A 1 322 ? 16.153  49.792  32.494  1.00 47.21  ? 316  VAL A C     1 
ATOM   2521 O  O     . VAL A 1 322 ? 17.218  49.347  32.042  1.00 45.30  ? 316  VAL A O     1 
ATOM   2522 C  CB    . VAL A 1 322 ? 15.832  52.207  33.096  1.00 45.97  ? 316  VAL A CB    1 
ATOM   2523 C  CG1   . VAL A 1 322 ? 17.183  52.009  33.739  1.00 47.81  ? 316  VAL A CG1   1 
ATOM   2524 C  CG2   . VAL A 1 322 ? 15.776  53.562  32.463  1.00 44.52  ? 316  VAL A CG2   1 
ATOM   2525 N  N     . LYS A 1 323 ? 15.435  49.141  33.397  1.00 47.19  ? 317  LYS A N     1 
ATOM   2526 C  CA    . LYS A 1 323 ? 15.913  47.876  33.921  1.00 48.56  ? 317  LYS A CA    1 
ATOM   2527 C  C     . LYS A 1 323 ? 15.985  46.866  32.813  1.00 49.91  ? 317  LYS A C     1 
ATOM   2528 O  O     . LYS A 1 323 ? 16.839  45.974  32.831  1.00 50.03  ? 317  LYS A O     1 
ATOM   2529 C  CB    . LYS A 1 323 ? 14.999  47.366  35.046  1.00 48.08  ? 317  LYS A CB    1 
ATOM   2530 C  CG    . LYS A 1 323 ? 15.300  47.972  36.432  1.00 45.24  ? 317  LYS A CG    1 
ATOM   2531 C  CD    . LYS A 1 323 ? 14.400  47.417  37.537  1.00 42.11  ? 317  LYS A CD    1 
ATOM   2532 C  CE    . LYS A 1 323 ? 13.045  48.080  37.531  1.00 40.40  ? 317  LYS A CE    1 
ATOM   2533 N  NZ    . LYS A 1 323 ? 12.507  48.135  36.149  1.00 37.47  ? 317  LYS A NZ    1 
ATOM   2534 N  N     . LEU A 1 324 ? 15.076  47.010  31.849  1.00 51.21  ? 318  LEU A N     1 
ATOM   2535 C  CA    . LEU A 1 324 ? 15.018  46.103  30.707  1.00 51.31  ? 318  LEU A CA    1 
ATOM   2536 C  C     . LEU A 1 324 ? 16.109  46.444  29.701  1.00 51.26  ? 318  LEU A C     1 
ATOM   2537 O  O     . LEU A 1 324 ? 16.571  45.577  28.966  1.00 50.46  ? 318  LEU A O     1 
ATOM   2538 C  CB    . LEU A 1 324 ? 13.643  46.172  30.054  1.00 51.38  ? 318  LEU A CB    1 
ATOM   2539 C  CG    . LEU A 1 324 ? 12.485  45.601  30.877  1.00 51.22  ? 318  LEU A CG    1 
ATOM   2540 C  CD1   . LEU A 1 324 ? 11.168  45.954  30.218  1.00 52.15  ? 318  LEU A CD1   1 
ATOM   2541 C  CD2   . LEU A 1 324 ? 12.627  44.107  30.993  1.00 49.98  ? 318  LEU A CD2   1 
ATOM   2542 N  N     . LEU A 1 325 ? 16.524  47.711  29.685  1.00 51.94  ? 319  LEU A N     1 
ATOM   2543 C  CA    . LEU A 1 325 ? 17.600  48.161  28.794  1.00 51.98  ? 319  LEU A CA    1 
ATOM   2544 C  C     . LEU A 1 325 ? 18.972  47.759  29.360  1.00 52.72  ? 319  LEU A C     1 
ATOM   2545 O  O     . LEU A 1 325 ? 19.863  47.332  28.615  1.00 53.00  ? 319  LEU A O     1 
ATOM   2546 C  CB    . LEU A 1 325 ? 17.539  49.686  28.585  1.00 49.44  ? 319  LEU A CB    1 
ATOM   2547 C  CG    . LEU A 1 325 ? 18.709  50.326  27.821  1.00 47.56  ? 319  LEU A CG    1 
ATOM   2548 C  CD1   . LEU A 1 325 ? 19.082  49.501  26.609  1.00 47.58  ? 319  LEU A CD1   1 
ATOM   2549 C  CD2   . LEU A 1 325 ? 18.339  51.718  27.410  1.00 46.57  ? 319  LEU A CD2   1 
ATOM   2550 N  N     . GLN A 1 326 ? 19.140  47.899  30.671  1.00 52.22  ? 320  GLN A N     1 
ATOM   2551 C  CA    . GLN A 1 326 ? 20.390  47.515  31.286  1.00 52.83  ? 320  GLN A CA    1 
ATOM   2552 C  C     . GLN A 1 326 ? 20.546  46.005  31.146  1.00 54.06  ? 320  GLN A C     1 
ATOM   2553 O  O     . GLN A 1 326 ? 21.651  45.496  30.949  1.00 54.68  ? 320  GLN A O     1 
ATOM   2554 C  CB    . GLN A 1 326 ? 20.383  47.890  32.755  1.00 54.07  ? 320  GLN A CB    1 
ATOM   2555 C  CG    . GLN A 1 326 ? 20.425  49.372  33.013  1.00 57.06  ? 320  GLN A CG    1 
ATOM   2556 C  CD    . GLN A 1 326 ? 20.413  49.683  34.484  1.00 58.16  ? 320  GLN A CD    1 
ATOM   2557 O  OE1   . GLN A 1 326 ? 21.249  49.187  35.245  1.00 59.47  ? 320  GLN A OE1   1 
ATOM   2558 N  NE2   . GLN A 1 326 ? 19.459  50.500  34.901  1.00 56.97  ? 320  GLN A NE2   1 
ATOM   2559 N  N     . LYS A 1 327 ? 19.424  45.298  31.258  1.00 54.25  ? 321  LYS A N     1 
ATOM   2560 C  CA    . LYS A 1 327 ? 19.383  43.843  31.153  1.00 54.87  ? 321  LYS A CA    1 
ATOM   2561 C  C     . LYS A 1 327 ? 19.913  43.444  29.776  1.00 57.72  ? 321  LYS A C     1 
ATOM   2562 O  O     . LYS A 1 327 ? 20.472  42.361  29.591  1.00 57.87  ? 321  LYS A O     1 
ATOM   2563 C  CB    . LYS A 1 327 ? 17.936  43.376  31.325  1.00 52.42  ? 321  LYS A CB    1 
ATOM   2564 C  CG    . LYS A 1 327 ? 17.753  42.103  32.123  1.00 51.30  ? 321  LYS A CG    1 
ATOM   2565 C  CD    . LYS A 1 327 ? 16.298  41.963  32.600  1.00 50.16  ? 321  LYS A CD    1 
ATOM   2566 C  CE    . LYS A 1 327 ? 16.091  40.789  33.571  1.00 49.25  ? 321  LYS A CE    1 
ATOM   2567 N  NZ    . LYS A 1 327 ? 16.377  39.451  32.983  1.00 47.66  ? 321  LYS A NZ    1 
ATOM   2568 N  N     . ILE A 1 328 ? 19.741  44.349  28.816  1.00 60.35  ? 322  ILE A N     1 
ATOM   2569 C  CA    . ILE A 1 328 ? 20.183  44.141  27.437  1.00 62.88  ? 322  ILE A CA    1 
ATOM   2570 C  C     . ILE A 1 328 ? 21.687  44.384  27.293  1.00 64.30  ? 322  ILE A C     1 
ATOM   2571 O  O     . ILE A 1 328 ? 22.460  43.476  26.948  1.00 63.21  ? 322  ILE A O     1 
ATOM   2572 C  CB    . ILE A 1 328 ? 19.433  45.107  26.456  1.00 62.68  ? 322  ILE A CB    1 
ATOM   2573 C  CG1   . ILE A 1 328 ? 17.923  44.854  26.513  1.00 62.23  ? 322  ILE A CG1   1 
ATOM   2574 C  CG2   . ILE A 1 328 ? 19.933  44.904  25.026  1.00 62.14  ? 322  ILE A CG2   1 
ATOM   2575 C  CD1   . ILE A 1 328 ? 17.114  45.754  25.610  1.00 61.06  ? 322  ILE A CD1   1 
ATOM   2576 N  N     . LEU A 1 329 ? 22.081  45.626  27.559  1.00 66.30  ? 323  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 329 ? 23.472  46.043  27.460  1.00 68.92  ? 323  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 329 ? 24.448  45.054  28.091  1.00 70.84  ? 323  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 329 ? 25.274  44.463  27.392  1.00 70.89  ? 323  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 329 ? 23.643  47.437  28.083  1.00 68.12  ? 323  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 329 ? 22.939  48.584  27.339  1.00 67.59  ? 323  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 329 ? 23.146  49.933  28.037  1.00 65.00  ? 323  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 329 ? 23.493  48.630  25.923  1.00 67.40  ? 323  LEU A CD2   1 
ATOM   2584 N  N     . GLU A 1 330 ? 24.337  44.864  29.402  1.00 73.27  ? 324  GLU A N     1 
ATOM   2585 C  CA    . GLU A 1 330 ? 25.219  43.960  30.128  1.00 75.99  ? 324  GLU A CA    1 
ATOM   2586 C  C     . GLU A 1 330 ? 25.252  42.534  29.580  1.00 77.21  ? 324  GLU A C     1 
ATOM   2587 O  O     . GLU A 1 330 ? 25.947  41.680  30.136  1.00 78.57  ? 324  GLU A O     1 
ATOM   2588 C  CB    . GLU A 1 330 ? 24.827  43.915  31.602  1.00 77.02  ? 324  GLU A CB    1 
ATOM   2589 C  CG    . GLU A 1 330 ? 25.945  43.423  32.498  1.00 81.03  ? 324  GLU A CG    1 
ATOM   2590 C  CD    . GLU A 1 330 ? 25.548  43.373  33.967  1.00 83.71  ? 324  GLU A CD    1 
ATOM   2591 O  OE1   . GLU A 1 330 ? 25.024  44.394  34.482  1.00 84.02  ? 324  GLU A OE1   1 
ATOM   2592 O  OE2   . GLU A 1 330 ? 25.772  42.313  34.605  1.00 84.68  ? 324  GLU A OE2   1 
ATOM   2593 N  N     . GLU A 1 331 ? 24.511  42.272  28.500  1.00 77.30  ? 325  GLU A N     1 
ATOM   2594 C  CA    . GLU A 1 331 ? 24.480  40.940  27.901  1.00 76.57  ? 325  GLU A CA    1 
ATOM   2595 C  C     . GLU A 1 331 ? 24.975  40.935  26.473  1.00 76.33  ? 325  GLU A C     1 
ATOM   2596 O  O     . GLU A 1 331 ? 24.907  39.909  25.795  1.00 77.02  ? 325  GLU A O     1 
ATOM   2597 C  CB    . GLU A 1 331 ? 23.068  40.358  27.940  1.00 76.86  ? 325  GLU A CB    1 
ATOM   2598 C  CG    . GLU A 1 331 ? 22.692  39.805  29.296  1.00 78.61  ? 325  GLU A CG    1 
ATOM   2599 C  CD    . GLU A 1 331 ? 21.291  39.222  29.343  1.00 79.62  ? 325  GLU A CD    1 
ATOM   2600 O  OE1   . GLU A 1 331 ? 21.023  38.231  28.625  1.00 79.07  ? 325  GLU A OE1   1 
ATOM   2601 O  OE2   . GLU A 1 331 ? 20.459  39.758  30.108  1.00 80.25  ? 325  GLU A OE2   1 
ATOM   2602 N  N     . ASP A 1 332 ? 25.470  42.081  26.014  1.00 75.45  ? 326  ASP A N     1 
ATOM   2603 C  CA    . ASP A 1 332 ? 25.986  42.180  24.653  1.00 74.43  ? 326  ASP A CA    1 
ATOM   2604 C  C     . ASP A 1 332 ? 27.111  43.211  24.546  1.00 73.03  ? 326  ASP A C     1 
ATOM   2605 O  O     . ASP A 1 332 ? 27.006  44.323  25.061  1.00 70.86  ? 326  ASP A O     1 
ATOM   2606 C  CB    . ASP A 1 332 ? 24.848  42.521  23.688  1.00 75.51  ? 326  ASP A CB    1 
ATOM   2607 C  CG    . ASP A 1 332 ? 25.196  42.215  22.248  1.00 76.05  ? 326  ASP A CG    1 
ATOM   2608 O  OD1   . ASP A 1 332 ? 24.328  42.412  21.379  1.00 76.95  ? 326  ASP A OD1   1 
ATOM   2609 O  OD2   . ASP A 1 332 ? 26.335  41.777  21.981  1.00 76.23  ? 326  ASP A OD2   1 
ATOM   2610 N  N     . GLU A 1 333 ? 28.185  42.826  23.863  1.00 72.77  ? 327  GLU A N     1 
ATOM   2611 C  CA    . GLU A 1 333 ? 29.354  43.684  23.695  1.00 74.00  ? 327  GLU A CA    1 
ATOM   2612 C  C     . GLU A 1 333 ? 29.329  44.586  22.449  1.00 74.34  ? 327  GLU A C     1 
ATOM   2613 O  O     . GLU A 1 333 ? 30.365  45.094  22.024  1.00 73.10  ? 327  GLU A O     1 
ATOM   2614 C  CB    . GLU A 1 333 ? 30.617  42.817  23.663  1.00 74.74  ? 327  GLU A CB    1 
ATOM   2615 C  CG    . GLU A 1 333 ? 30.450  41.432  24.273  1.00 74.60  ? 327  GLU A CG    1 
ATOM   2616 C  CD    . GLU A 1 333 ? 30.488  40.328  23.230  1.00 75.58  ? 327  GLU A CD    1 
ATOM   2617 O  OE1   . GLU A 1 333 ? 29.637  39.412  23.299  1.00 75.91  ? 327  GLU A OE1   1 
ATOM   2618 O  OE2   . GLU A 1 333 ? 31.376  40.372  22.346  1.00 76.06  ? 327  GLU A OE2   1 
ATOM   2619 N  N     . ARG A 1 334 ? 28.154  44.787  21.863  1.00 75.63  ? 328  ARG A N     1 
ATOM   2620 C  CA    . ARG A 1 334 ? 28.042  45.633  20.678  1.00 76.25  ? 328  ARG A CA    1 
ATOM   2621 C  C     . ARG A 1 334 ? 27.186  46.877  20.915  1.00 76.53  ? 328  ARG A C     1 
ATOM   2622 O  O     . ARG A 1 334 ? 26.199  46.838  21.651  1.00 76.30  ? 328  ARG A O     1 
ATOM   2623 C  CB    . ARG A 1 334 ? 27.488  44.823  19.493  1.00 75.59  ? 328  ARG A CB    1 
ATOM   2624 C  CG    . ARG A 1 334 ? 26.391  43.827  19.854  1.00 75.16  ? 328  ARG A CG    1 
ATOM   2625 C  CD    . ARG A 1 334 ? 25.836  43.107  18.611  1.00 75.90  ? 328  ARG A CD    1 
ATOM   2626 N  NE    . ARG A 1 334 ? 25.078  41.894  18.945  1.00 75.15  ? 328  ARG A NE    1 
ATOM   2627 C  CZ    . ARG A 1 334 ? 24.428  41.135  18.063  1.00 73.63  ? 328  ARG A CZ    1 
ATOM   2628 N  NH1   . ARG A 1 334 ? 24.429  41.455  16.779  1.00 73.63  ? 328  ARG A NH1   1 
ATOM   2629 N  NH2   . ARG A 1 334 ? 23.786  40.048  18.465  1.00 71.82  ? 328  ARG A NH2   1 
ATOM   2630 N  N     . LYS A 1 335 ? 27.582  47.981  20.285  1.00 77.11  ? 329  LYS A N     1 
ATOM   2631 C  CA    . LYS A 1 335 ? 26.874  49.256  20.402  1.00 78.27  ? 329  LYS A CA    1 
ATOM   2632 C  C     . LYS A 1 335 ? 25.458  49.143  19.812  1.00 78.68  ? 329  LYS A C     1 
ATOM   2633 O  O     . LYS A 1 335 ? 25.164  48.206  19.055  1.00 79.10  ? 329  LYS A O     1 
ATOM   2634 C  CB    . LYS A 1 335 ? 27.659  50.347  19.663  1.00 78.61  ? 329  LYS A CB    1 
ATOM   2635 C  CG    . LYS A 1 335 ? 29.147  50.352  19.982  1.00 79.14  ? 329  LYS A CG    1 
ATOM   2636 C  CD    . LYS A 1 335 ? 29.982  51.137  18.957  1.00 80.90  ? 329  LYS A CD    1 
ATOM   2637 C  CE    . LYS A 1 335 ? 29.756  52.655  19.020  1.00 81.57  ? 329  LYS A CE    1 
ATOM   2638 N  NZ    . LYS A 1 335 ? 30.561  53.411  18.020  1.00 80.50  ? 329  LYS A NZ    1 
ATOM   2639 N  N     . ILE A 1 336 ? 24.586  50.095  20.153  1.00 77.45  ? 330  ILE A N     1 
ATOM   2640 C  CA    . ILE A 1 336 ? 23.206  50.087  19.652  1.00 76.52  ? 330  ILE A CA    1 
ATOM   2641 C  C     . ILE A 1 336 ? 22.906  51.232  18.680  1.00 75.20  ? 330  ILE A C     1 
ATOM   2642 O  O     . ILE A 1 336 ? 23.448  52.322  18.828  1.00 75.81  ? 330  ILE A O     1 
ATOM   2643 C  CB    . ILE A 1 336 ? 22.192  50.124  20.835  1.00 76.77  ? 330  ILE A CB    1 
ATOM   2644 C  CG1   . ILE A 1 336 ? 22.066  48.719  21.439  1.00 76.50  ? 330  ILE A CG1   1 
ATOM   2645 C  CG2   . ILE A 1 336 ? 20.831  50.651  20.370  1.00 76.13  ? 330  ILE A CG2   1 
ATOM   2646 C  CD1   . ILE A 1 336 ? 21.088  48.625  22.595  1.00 76.56  ? 330  ILE A CD1   1 
ATOM   2647 N  N     . ARG A 1 337 ? 22.054  50.976  17.685  1.00 72.40  ? 331  ARG A N     1 
ATOM   2648 C  CA    . ARG A 1 337 ? 21.687  51.997  16.703  1.00 69.80  ? 331  ARG A CA    1 
ATOM   2649 C  C     . ARG A 1 337 ? 20.261  52.531  16.887  1.00 66.26  ? 331  ARG A C     1 
ATOM   2650 O  O     . ARG A 1 337 ? 20.025  53.741  16.896  1.00 64.66  ? 331  ARG A O     1 
ATOM   2651 C  CB    . ARG A 1 337 ? 21.844  51.445  15.287  1.00 72.19  ? 331  ARG A CB    1 
ATOM   2652 C  CG    . ARG A 1 337 ? 21.140  52.284  14.238  1.00 76.10  ? 331  ARG A CG    1 
ATOM   2653 C  CD    . ARG A 1 337 ? 21.443  51.823  12.817  1.00 79.28  ? 331  ARG A CD    1 
ATOM   2654 N  NE    . ARG A 1 337 ? 20.728  52.637  11.833  1.00 82.00  ? 331  ARG A NE    1 
ATOM   2655 C  CZ    . ARG A 1 337 ? 21.098  52.776  10.564  1.00 83.30  ? 331  ARG A CZ    1 
ATOM   2656 N  NH1   . ARG A 1 337 ? 22.185  52.150  10.126  1.00 83.64  ? 331  ARG A NH1   1 
ATOM   2657 N  NH2   . ARG A 1 337 ? 20.387  53.542  9.736   1.00 83.22  ? 331  ARG A NH2   1 
ATOM   2658 N  N     . ARG A 1 338 ? 19.313  51.617  17.033  1.00 62.64  ? 332  ARG A N     1 
ATOM   2659 C  CA    . ARG A 1 338 ? 17.919  51.983  17.213  1.00 59.21  ? 332  ARG A CA    1 
ATOM   2660 C  C     . ARG A 1 338 ? 17.402  51.302  18.462  1.00 56.90  ? 332  ARG A C     1 
ATOM   2661 O  O     . ARG A 1 338 ? 17.775  50.161  18.748  1.00 56.89  ? 332  ARG A O     1 
ATOM   2662 C  CB    . ARG A 1 338 ? 17.098  51.514  16.016  1.00 61.33  ? 332  ARG A CB    1 
ATOM   2663 C  CG    . ARG A 1 338 ? 17.510  52.136  14.686  1.00 63.21  ? 332  ARG A CG    1 
ATOM   2664 C  CD    . ARG A 1 338 ? 16.884  51.402  13.513  1.00 62.95  ? 332  ARG A CD    1 
ATOM   2665 N  NE    . ARG A 1 338 ? 15.426  51.409  13.578  1.00 64.07  ? 332  ARG A NE    1 
ATOM   2666 C  CZ    . ARG A 1 338 ? 14.665  50.405  13.159  1.00 65.02  ? 332  ARG A CZ    1 
ATOM   2667 N  NH1   . ARG A 1 338 ? 15.238  49.317  12.646  1.00 64.61  ? 332  ARG A NH1   1 
ATOM   2668 N  NH2   . ARG A 1 338 ? 13.339  50.486  13.256  1.00 64.40  ? 332  ARG A NH2   1 
ATOM   2669 N  N     . ILE A 1 339 ? 16.538  51.994  19.197  1.00 53.57  ? 333  ILE A N     1 
ATOM   2670 C  CA    . ILE A 1 339 ? 15.979  51.437  20.423  1.00 52.10  ? 333  ILE A CA    1 
ATOM   2671 C  C     . ILE A 1 339 ? 14.483  51.707  20.453  1.00 50.09  ? 333  ILE A C     1 
ATOM   2672 O  O     . ILE A 1 339 ? 14.043  52.791  20.065  1.00 49.98  ? 333  ILE A O     1 
ATOM   2673 C  CB    . ILE A 1 339 ? 16.674  52.056  21.692  1.00 52.59  ? 333  ILE A CB    1 
ATOM   2674 C  CG1   . ILE A 1 339 ? 16.203  51.350  22.961  1.00 51.57  ? 333  ILE A CG1   1 
ATOM   2675 C  CG2   . ILE A 1 339 ? 16.369  53.533  21.801  1.00 53.38  ? 333  ILE A CG2   1 
ATOM   2676 C  CD1   . ILE A 1 339 ? 16.643  49.906  23.044  1.00 52.68  ? 333  ILE A CD1   1 
ATOM   2677 N  N     . GLY A 1 340 ? 13.705  50.723  20.904  1.00 47.69  ? 334  GLY A N     1 
ATOM   2678 C  CA    . GLY A 1 340 ? 12.265  50.899  20.953  1.00 45.72  ? 334  GLY A CA    1 
ATOM   2679 C  C     . GLY A 1 340 ? 11.529  50.112  22.016  1.00 43.86  ? 334  GLY A C     1 
ATOM   2680 O  O     . GLY A 1 340 ? 12.134  49.402  22.808  1.00 43.63  ? 334  GLY A O     1 
ATOM   2681 N  N     . VAL A 1 341 ? 10.205  50.243  22.019  1.00 41.74  ? 335  VAL A N     1 
ATOM   2682 C  CA    . VAL A 1 341 ? 9.351   49.561  22.979  1.00 39.85  ? 335  VAL A CA    1 
ATOM   2683 C  C     . VAL A 1 341 ? 7.988   49.114  22.421  1.00 39.38  ? 335  VAL A C     1 
ATOM   2684 O  O     . VAL A 1 341 ? 7.363   49.786  21.591  1.00 38.48  ? 335  VAL A O     1 
ATOM   2685 C  CB    . VAL A 1 341 ? 9.121   50.437  24.189  1.00 38.52  ? 335  VAL A CB    1 
ATOM   2686 C  CG1   . VAL A 1 341 ? 10.362  50.458  25.023  1.00 37.43  ? 335  VAL A CG1   1 
ATOM   2687 C  CG2   . VAL A 1 341 ? 8.728   51.843  23.735  1.00 39.47  ? 335  VAL A CG2   1 
ATOM   2688 N  N     . ARG A 1 342 ? 7.524   47.975  22.918  1.00 38.48  ? 336  ARG A N     1 
ATOM   2689 C  CA    . ARG A 1 342 ? 6.284   47.390  22.464  1.00 38.02  ? 336  ARG A CA    1 
ATOM   2690 C  C     . ARG A 1 342 ? 5.438   46.887  23.619  1.00 38.08  ? 336  ARG A C     1 
ATOM   2691 O  O     . ARG A 1 342 ? 5.914   46.183  24.491  1.00 38.66  ? 336  ARG A O     1 
ATOM   2692 C  CB    . ARG A 1 342 ? 6.613   46.241  21.503  1.00 37.89  ? 336  ARG A CB    1 
ATOM   2693 C  CG    . ARG A 1 342 ? 5.416   45.629  20.823  1.00 37.29  ? 336  ARG A CG    1 
ATOM   2694 C  CD    . ARG A 1 342 ? 5.714   45.258  19.372  1.00 36.45  ? 336  ARG A CD    1 
ATOM   2695 N  NE    . ARG A 1 342 ? 4.743   45.899  18.481  1.00 34.30  ? 336  ARG A NE    1 
ATOM   2696 C  CZ    . ARG A 1 342 ? 5.035   46.907  17.676  1.00 31.23  ? 336  ARG A CZ    1 
ATOM   2697 N  NH1   . ARG A 1 342 ? 6.275   47.363  17.647  1.00 33.63  ? 336  ARG A NH1   1 
ATOM   2698 N  NH2   . ARG A 1 342 ? 4.088   47.488  16.954  1.00 25.46  ? 336  ARG A NH2   1 
ATOM   2699 N  N     . PHE A 1 343 ? 4.167   47.239  23.602  1.00 38.95  ? 337  PHE A N     1 
ATOM   2700 C  CA    . PHE A 1 343 ? 3.237   46.827  24.641  1.00 40.00  ? 337  PHE A CA    1 
ATOM   2701 C  C     . PHE A 1 343 ? 2.251   45.783  24.117  1.00 40.47  ? 337  PHE A C     1 
ATOM   2702 O  O     . PHE A 1 343 ? 1.960   45.749  22.922  1.00 42.26  ? 337  PHE A O     1 
ATOM   2703 C  CB    . PHE A 1 343 ? 2.455   48.039  25.120  1.00 40.89  ? 337  PHE A CB    1 
ATOM   2704 C  CG    . PHE A 1 343 ? 3.311   49.132  25.619  1.00 42.45  ? 337  PHE A CG    1 
ATOM   2705 C  CD1   . PHE A 1 343 ? 4.158   48.915  26.703  1.00 43.65  ? 337  PHE A CD1   1 
ATOM   2706 C  CD2   . PHE A 1 343 ? 3.274   50.380  25.023  1.00 43.05  ? 337  PHE A CD2   1 
ATOM   2707 C  CE1   . PHE A 1 343 ? 4.963   49.928  27.198  1.00 44.63  ? 337  PHE A CE1   1 
ATOM   2708 C  CE2   . PHE A 1 343 ? 4.074   51.410  25.503  1.00 46.66  ? 337  PHE A CE2   1 
ATOM   2709 C  CZ    . PHE A 1 343 ? 4.927   51.183  26.601  1.00 46.62  ? 337  PHE A CZ    1 
ATOM   2710 N  N     . SER A 1 344 ? 1.726   44.949  25.009  1.00 38.91  ? 338  SER A N     1 
ATOM   2711 C  CA    . SER A 1 344 ? 0.763   43.943  24.601  1.00 38.66  ? 338  SER A CA    1 
ATOM   2712 C  C     . SER A 1 344 ? -0.183  43.540  25.724  1.00 39.81  ? 338  SER A C     1 
ATOM   2713 O  O     . SER A 1 344 ? -0.440  44.316  26.640  1.00 39.56  ? 338  SER A O     1 
ATOM   2714 C  CB    . SER A 1 344 ? 1.487   42.712  24.062  1.00 38.63  ? 338  SER A CB    1 
ATOM   2715 O  OG    . SER A 1 344 ? 2.140   41.977  25.081  1.00 36.41  ? 338  SER A OG    1 
ATOM   2716 N  N     . LYS A 1 345 ? -0.722  42.333  25.620  1.00 40.00  ? 339  LYS A N     1 
ATOM   2717 C  CA    . LYS A 1 345 ? -1.623  41.805  26.614  1.00 41.45  ? 339  LYS A CA    1 
ATOM   2718 C  C     . LYS A 1 345 ? -2.573  42.841  27.199  1.00 43.65  ? 339  LYS A C     1 
ATOM   2719 O  O     . LYS A 1 345 ? -2.676  42.974  28.419  1.00 43.92  ? 339  LYS A O     1 
ATOM   2720 C  CB    . LYS A 1 345 ? -0.801  41.177  27.721  1.00 41.80  ? 339  LYS A CB    1 
ATOM   2721 C  CG    . LYS A 1 345 ? 0.384   40.400  27.214  1.00 43.60  ? 339  LYS A CG    1 
ATOM   2722 C  CD    . LYS A 1 345 ? 0.776   39.296  28.198  1.00 46.20  ? 339  LYS A CD    1 
ATOM   2723 C  CE    . LYS A 1 345 ? 2.049   38.569  27.731  1.00 47.73  ? 339  LYS A CE    1 
ATOM   2724 N  NZ    . LYS A 1 345 ? 2.412   37.371  28.558  1.00 46.68  ? 339  LYS A NZ    1 
ATOM   2725 N  N     . PHE A 1 346 ? -3.274  43.567  26.333  1.00 46.63  ? 340  PHE A N     1 
ATOM   2726 C  CA    . PHE A 1 346 ? -4.221  44.590  26.779  1.00 49.30  ? 340  PHE A CA    1 
ATOM   2727 C  C     . PHE A 1 346 ? -5.333  43.988  27.628  1.00 50.91  ? 340  PHE A C     1 
ATOM   2728 O  O     . PHE A 1 346 ? -5.505  42.778  27.669  1.00 50.05  ? 340  PHE A O     1 
ATOM   2729 C  CB    . PHE A 1 346 ? -4.832  45.317  25.579  1.00 50.48  ? 340  PHE A CB    1 
ATOM   2730 C  CG    . PHE A 1 346 ? -3.815  45.943  24.667  1.00 52.08  ? 340  PHE A CG    1 
ATOM   2731 C  CD1   . PHE A 1 346 ? -2.744  46.647  25.191  1.00 53.51  ? 340  PHE A CD1   1 
ATOM   2732 C  CD2   . PHE A 1 346 ? -3.941  45.851  23.281  1.00 52.70  ? 340  PHE A CD2   1 
ATOM   2733 C  CE1   . PHE A 1 346 ? -1.817  47.251  24.349  1.00 54.26  ? 340  PHE A CE1   1 
ATOM   2734 C  CE2   . PHE A 1 346 ? -3.019  46.453  22.436  1.00 52.49  ? 340  PHE A CE2   1 
ATOM   2735 C  CZ    . PHE A 1 346 ? -1.960  47.151  22.967  1.00 53.21  ? 340  PHE A CZ    1 
ATOM   2736 N  N     . ILE A 1 347 ? -6.096  44.838  28.296  1.00 54.28  ? 341  ILE A N     1 
ATOM   2737 C  CA    . ILE A 1 347 ? -7.165  44.363  29.154  1.00 58.96  ? 341  ILE A CA    1 
ATOM   2738 C  C     . ILE A 1 347 ? -8.527  44.154  28.477  1.00 62.41  ? 341  ILE A C     1 
ATOM   2739 O  O     . ILE A 1 347 ? -9.067  45.063  27.851  1.00 63.01  ? 341  ILE A O     1 
ATOM   2740 C  CB    . ILE A 1 347 ? -7.302  45.299  30.333  1.00 59.22  ? 341  ILE A CB    1 
ATOM   2741 C  CG1   . ILE A 1 347 ? -6.020  45.205  31.174  1.00 58.88  ? 341  ILE A CG1   1 
ATOM   2742 C  CG2   . ILE A 1 347 ? -8.562  44.957  31.118  1.00 61.18  ? 341  ILE A CG2   1 
ATOM   2743 C  CD1   . ILE A 1 347 ? -5.959  46.134  32.342  1.00 58.31  ? 341  ILE A CD1   1 
ATOM   2744 N  N     . GLU A 1 348 ? -9.081  42.951  28.658  1.00 66.02  ? 342  GLU A N     1 
ATOM   2745 C  CA    . GLU A 1 348 ? -10.356 42.495  28.066  1.00 69.36  ? 342  GLU A CA    1 
ATOM   2746 C  C     . GLU A 1 348 ? -11.655 43.221  28.419  1.00 71.70  ? 342  GLU A C     1 
ATOM   2747 O  O     . GLU A 1 348 ? -11.678 44.431  28.674  1.00 72.52  ? 342  GLU A O     1 
ATOM   2748 C  CB    . GLU A 1 348 ? -10.575 41.015  28.396  1.00 70.10  ? 342  GLU A CB    1 
ATOM   2749 C  CG    . GLU A 1 348 ? -9.474  40.064  27.978  1.00 71.82  ? 342  GLU A CG    1 
ATOM   2750 C  CD    . GLU A 1 348 ? -9.539  38.752  28.753  1.00 73.43  ? 342  GLU A CD    1 
ATOM   2751 O  OE1   . GLU A 1 348 ? -9.173  38.736  29.953  1.00 73.30  ? 342  GLU A OE1   1 
ATOM   2752 O  OE2   . GLU A 1 348 ? -9.970  37.736  28.170  1.00 74.94  ? 342  GLU A OE2   1 
ATOM   2753 N  N     . ALA A 1 349 ? -12.739 42.437  28.420  1.00 73.76  ? 343  ALA A N     1 
ATOM   2754 C  CA    . ALA A 1 349 ? -14.091 42.913  28.736  1.00 75.62  ? 343  ALA A CA    1 
ATOM   2755 C  C     . ALA A 1 349 ? -14.665 42.149  29.937  1.00 76.35  ? 343  ALA A C     1 
ATOM   2756 O  O     . ALA A 1 349 ? -13.992 41.205  30.411  1.00 76.44  ? 343  ALA A O     1 
ATOM   2757 C  CB    . ALA A 1 349 ? -15.013 42.736  27.518  1.00 74.22  ? 343  ALA A CB    1 
ATOM   2758 N  N     . ILE A 1 350 ? -15.783 42.496  30.383  1.00 77.46  ? 344  ILE A N     1 
ATOM   2759 N  N     . MET B 1 7   ? 26.417  97.649  30.967  1.00 68.18  ? 1    MET B N     1 
ATOM   2760 C  CA    . MET B 1 7   ? 26.216  96.493  30.040  1.00 69.16  ? 1    MET B CA    1 
ATOM   2761 C  C     . MET B 1 7   ? 27.528  95.837  29.617  1.00 68.57  ? 1    MET B C     1 
ATOM   2762 O  O     . MET B 1 7   ? 28.458  96.505  29.154  1.00 69.40  ? 1    MET B O     1 
ATOM   2763 C  CB    . MET B 1 7   ? 25.454  96.933  28.787  1.00 70.31  ? 1    MET B CB    1 
ATOM   2764 C  CG    . MET B 1 7   ? 25.483  95.912  27.673  1.00 72.81  ? 1    MET B CG    1 
ATOM   2765 S  SD    . MET B 1 7   ? 24.591  96.425  26.182  1.00 79.23  ? 1    MET B SD    1 
ATOM   2766 C  CE    . MET B 1 7   ? 23.181  95.283  26.226  1.00 77.07  ? 1    MET B CE    1 
ATOM   2767 N  N     . ILE B 1 8   ? 27.588  94.521  29.786  1.00 66.83  ? 2    ILE B N     1 
ATOM   2768 C  CA    . ILE B 1 8   ? 28.764  93.737  29.425  1.00 65.55  ? 2    ILE B CA    1 
ATOM   2769 C  C     . ILE B 1 8   ? 28.335  92.470  28.675  1.00 63.71  ? 2    ILE B C     1 
ATOM   2770 O  O     . ILE B 1 8   ? 27.502  91.689  29.169  1.00 63.75  ? 2    ILE B O     1 
ATOM   2771 C  CB    . ILE B 1 8   ? 29.561  93.361  30.677  1.00 67.25  ? 2    ILE B CB    1 
ATOM   2772 C  CG1   . ILE B 1 8   ? 30.500  92.194  30.368  1.00 68.84  ? 2    ILE B CG1   1 
ATOM   2773 C  CG2   . ILE B 1 8   ? 28.610  93.040  31.807  1.00 67.79  ? 2    ILE B CG2   1 
ATOM   2774 C  CD1   . ILE B 1 8   ? 31.312  91.749  31.562  1.00 71.93  ? 2    ILE B CD1   1 
ATOM   2775 N  N     . VAL B 1 9   ? 28.906  92.273  27.484  1.00 60.16  ? 3    VAL B N     1 
ATOM   2776 C  CA    . VAL B 1 9   ? 28.559  91.130  26.643  1.00 56.54  ? 3    VAL B CA    1 
ATOM   2777 C  C     . VAL B 1 9   ? 29.639  90.058  26.562  1.00 54.45  ? 3    VAL B C     1 
ATOM   2778 O  O     . VAL B 1 9   ? 30.834  90.368  26.567  1.00 54.74  ? 3    VAL B O     1 
ATOM   2779 C  CB    . VAL B 1 9   ? 28.249  91.581  25.211  1.00 56.36  ? 3    VAL B CB    1 
ATOM   2780 C  CG1   . VAL B 1 9   ? 27.793  90.400  24.395  1.00 55.72  ? 3    VAL B CG1   1 
ATOM   2781 C  CG2   . VAL B 1 9   ? 27.188  92.664  25.224  1.00 55.60  ? 3    VAL B CG2   1 
ATOM   2782 N  N     . LEU B 1 10  ? 29.205  88.798  26.477  1.00 50.75  ? 4    LEU B N     1 
ATOM   2783 C  CA    . LEU B 1 10  ? 30.113  87.652  26.376  1.00 46.81  ? 4    LEU B CA    1 
ATOM   2784 C  C     . LEU B 1 10  ? 29.945  86.935  25.032  1.00 44.02  ? 4    LEU B C     1 
ATOM   2785 O  O     . LEU B 1 10  ? 28.927  86.304  24.778  1.00 44.23  ? 4    LEU B O     1 
ATOM   2786 C  CB    . LEU B 1 10  ? 29.836  86.669  27.508  1.00 47.19  ? 4    LEU B CB    1 
ATOM   2787 C  CG    . LEU B 1 10  ? 30.865  85.549  27.701  1.00 47.63  ? 4    LEU B CG    1 
ATOM   2788 C  CD1   . LEU B 1 10  ? 32.181  86.163  28.098  1.00 45.88  ? 4    LEU B CD1   1 
ATOM   2789 C  CD2   . LEU B 1 10  ? 30.388  84.569  28.787  1.00 47.14  ? 4    LEU B CD2   1 
ATOM   2790 N  N     . PHE B 1 11  ? 30.948  87.030  24.174  1.00 39.79  ? 5    PHE B N     1 
ATOM   2791 C  CA    . PHE B 1 11  ? 30.867  86.397  22.872  1.00 36.41  ? 5    PHE B CA    1 
ATOM   2792 C  C     . PHE B 1 11  ? 31.638  85.085  22.821  1.00 36.40  ? 5    PHE B C     1 
ATOM   2793 O  O     . PHE B 1 11  ? 32.801  85.018  23.194  1.00 36.26  ? 5    PHE B O     1 
ATOM   2794 C  CB    . PHE B 1 11  ? 31.410  87.342  21.801  1.00 32.77  ? 5    PHE B CB    1 
ATOM   2795 C  CG    . PHE B 1 11  ? 31.281  86.811  20.388  1.00 28.90  ? 5    PHE B CG    1 
ATOM   2796 C  CD1   . PHE B 1 11  ? 30.028  86.595  19.818  1.00 26.69  ? 5    PHE B CD1   1 
ATOM   2797 C  CD2   . PHE B 1 11  ? 32.408  86.574  19.614  1.00 25.25  ? 5    PHE B CD2   1 
ATOM   2798 C  CE1   . PHE B 1 11  ? 29.905  86.165  18.513  1.00 24.29  ? 5    PHE B CE1   1 
ATOM   2799 C  CE2   . PHE B 1 11  ? 32.285  86.145  18.307  1.00 24.11  ? 5    PHE B CE2   1 
ATOM   2800 C  CZ    . PHE B 1 11  ? 31.033  85.942  17.756  1.00 24.00  ? 5    PHE B CZ    1 
ATOM   2801 N  N     . VAL B 1 12  ? 31.000  84.035  22.333  1.00 36.15  ? 6    VAL B N     1 
ATOM   2802 C  CA    . VAL B 1 12  ? 31.681  82.757  22.249  1.00 37.09  ? 6    VAL B CA    1 
ATOM   2803 C  C     . VAL B 1 12  ? 31.843  82.337  20.805  1.00 37.90  ? 6    VAL B C     1 
ATOM   2804 O  O     . VAL B 1 12  ? 30.933  82.516  20.017  1.00 38.89  ? 6    VAL B O     1 
ATOM   2805 C  CB    . VAL B 1 12  ? 30.889  81.687  22.953  1.00 36.97  ? 6    VAL B CB    1 
ATOM   2806 C  CG1   . VAL B 1 12  ? 31.737  80.449  23.097  1.00 37.73  ? 6    VAL B CG1   1 
ATOM   2807 C  CG2   . VAL B 1 12  ? 30.411  82.204  24.280  1.00 36.43  ? 6    VAL B CG2   1 
ATOM   2808 N  N     . ASP B 1 13  ? 32.991  81.776  20.452  1.00 38.87  ? 7    ASP B N     1 
ATOM   2809 C  CA    . ASP B 1 13  ? 33.219  81.334  19.076  1.00 40.39  ? 7    ASP B CA    1 
ATOM   2810 C  C     . ASP B 1 13  ? 34.075  80.068  19.014  1.00 40.56  ? 7    ASP B C     1 
ATOM   2811 O  O     . ASP B 1 13  ? 35.246  80.092  19.426  1.00 41.81  ? 7    ASP B O     1 
ATOM   2812 C  CB    . ASP B 1 13  ? 33.893  82.444  18.276  1.00 40.98  ? 7    ASP B CB    1 
ATOM   2813 C  CG    . ASP B 1 13  ? 34.486  81.944  16.974  1.00 43.88  ? 7    ASP B CG    1 
ATOM   2814 O  OD1   . ASP B 1 13  ? 35.504  81.216  17.021  1.00 43.94  ? 7    ASP B OD1   1 
ATOM   2815 O  OD2   . ASP B 1 13  ? 33.934  82.276  15.898  1.00 44.54  ? 7    ASP B OD2   1 
ATOM   2816 N  N     . PHE B 1 14  ? 33.496  78.974  18.500  1.00 38.52  ? 8    PHE B N     1 
ATOM   2817 C  CA    . PHE B 1 14  ? 34.205  77.695  18.407  1.00 37.21  ? 8    PHE B CA    1 
ATOM   2818 C  C     . PHE B 1 14  ? 35.424  77.851  17.506  1.00 36.71  ? 8    PHE B C     1 
ATOM   2819 O  O     . PHE B 1 14  ? 35.429  78.687  16.630  1.00 36.51  ? 8    PHE B O     1 
ATOM   2820 C  CB    . PHE B 1 14  ? 33.293  76.600  17.851  1.00 37.03  ? 8    PHE B CB    1 
ATOM   2821 C  CG    . PHE B 1 14  ? 31.924  76.553  18.475  1.00 34.60  ? 8    PHE B CG    1 
ATOM   2822 C  CD1   . PHE B 1 14  ? 31.712  76.925  19.794  1.00 34.07  ? 8    PHE B CD1   1 
ATOM   2823 C  CD2   . PHE B 1 14  ? 30.842  76.110  17.732  1.00 33.87  ? 8    PHE B CD2   1 
ATOM   2824 C  CE1   . PHE B 1 14  ? 30.437  76.860  20.368  1.00 33.42  ? 8    PHE B CE1   1 
ATOM   2825 C  CE2   . PHE B 1 14  ? 29.566  76.040  18.294  1.00 34.60  ? 8    PHE B CE2   1 
ATOM   2826 C  CZ    . PHE B 1 14  ? 29.362  76.417  19.618  1.00 33.41  ? 8    PHE B CZ    1 
ATOM   2827 N  N     . ASP B 1 15  ? 36.467  77.060  17.715  1.00 36.80  ? 9    ASP B N     1 
ATOM   2828 C  CA    . ASP B 1 15  ? 37.662  77.216  16.896  1.00 37.37  ? 9    ASP B CA    1 
ATOM   2829 C  C     . ASP B 1 15  ? 37.573  76.330  15.668  1.00 38.16  ? 9    ASP B C     1 
ATOM   2830 O  O     . ASP B 1 15  ? 37.507  75.107  15.778  1.00 37.93  ? 9    ASP B O     1 
ATOM   2831 C  CB    . ASP B 1 15  ? 38.931  76.883  17.709  1.00 38.73  ? 9    ASP B CB    1 
ATOM   2832 C  CG    . ASP B 1 15  ? 39.113  77.783  18.957  1.00 37.89  ? 9    ASP B CG    1 
ATOM   2833 O  OD1   . ASP B 1 15  ? 39.153  79.025  18.823  1.00 35.12  ? 9    ASP B OD1   1 
ATOM   2834 O  OD2   . ASP B 1 15  ? 39.231  77.235  20.077  1.00 37.69  ? 9    ASP B OD2   1 
ATOM   2835 N  N     . TYR B 1 16  ? 37.581  76.972  14.500  1.00 40.26  ? 10   TYR B N     1 
ATOM   2836 C  CA    . TYR B 1 16  ? 37.480  76.313  13.192  1.00 41.17  ? 10   TYR B CA    1 
ATOM   2837 C  C     . TYR B 1 16  ? 36.606  75.074  13.299  1.00 40.85  ? 10   TYR B C     1 
ATOM   2838 O  O     . TYR B 1 16  ? 36.953  73.993  12.835  1.00 39.93  ? 10   TYR B O     1 
ATOM   2839 C  CB    . TYR B 1 16  ? 38.877  75.979  12.660  1.00 43.69  ? 10   TYR B CB    1 
ATOM   2840 C  CG    . TYR B 1 16  ? 39.757  75.159  13.588  1.00 46.98  ? 10   TYR B CG    1 
ATOM   2841 C  CD1   . TYR B 1 16  ? 40.096  73.843  13.264  1.00 48.59  ? 10   TYR B CD1   1 
ATOM   2842 C  CD2   . TYR B 1 16  ? 40.299  75.710  14.759  1.00 47.01  ? 10   TYR B CD2   1 
ATOM   2843 C  CE1   . TYR B 1 16  ? 40.957  73.092  14.073  1.00 48.80  ? 10   TYR B CE1   1 
ATOM   2844 C  CE2   . TYR B 1 16  ? 41.160  74.973  15.579  1.00 47.10  ? 10   TYR B CE2   1 
ATOM   2845 C  CZ    . TYR B 1 16  ? 41.486  73.657  15.225  1.00 48.42  ? 10   TYR B CZ    1 
ATOM   2846 O  OH    . TYR B 1 16  ? 42.334  72.888  16.000  1.00 47.03  ? 10   TYR B OH    1 
ATOM   2847 N  N     . PHE B 1 17  ? 35.452  75.289  13.925  1.00 41.43  ? 11   PHE B N     1 
ATOM   2848 C  CA    . PHE B 1 17  ? 34.439  74.283  14.215  1.00 41.14  ? 11   PHE B CA    1 
ATOM   2849 C  C     . PHE B 1 17  ? 34.477  72.998  13.390  1.00 41.59  ? 11   PHE B C     1 
ATOM   2850 O  O     . PHE B 1 17  ? 35.061  72.001  13.823  1.00 41.93  ? 11   PHE B O     1 
ATOM   2851 C  CB    . PHE B 1 17  ? 33.063  74.937  14.119  1.00 41.07  ? 11   PHE B CB    1 
ATOM   2852 C  CG    . PHE B 1 17  ? 31.964  74.134  14.732  1.00 41.06  ? 11   PHE B CG    1 
ATOM   2853 C  CD1   . PHE B 1 17  ? 32.221  73.294  15.805  1.00 41.24  ? 11   PHE B CD1   1 
ATOM   2854 C  CD2   . PHE B 1 17  ? 30.648  74.274  14.278  1.00 41.18  ? 11   PHE B CD2   1 
ATOM   2855 C  CE1   . PHE B 1 17  ? 31.173  72.595  16.438  1.00 43.23  ? 11   PHE B CE1   1 
ATOM   2856 C  CE2   . PHE B 1 17  ? 29.593  73.592  14.890  1.00 41.81  ? 11   PHE B CE2   1 
ATOM   2857 C  CZ    . PHE B 1 17  ? 29.853  72.747  15.979  1.00 43.47  ? 11   PHE B CZ    1 
ATOM   2858 N  N     . TYR B 1 18  ? 33.867  73.036  12.205  1.00 40.47  ? 12   TYR B N     1 
ATOM   2859 C  CA    . TYR B 1 18  ? 33.781  71.877  11.315  1.00 39.47  ? 12   TYR B CA    1 
ATOM   2860 C  C     . TYR B 1 18  ? 35.009  70.969  11.347  1.00 38.95  ? 12   TYR B C     1 
ATOM   2861 O  O     . TYR B 1 18  ? 34.885  69.746  11.403  1.00 37.96  ? 12   TYR B O     1 
ATOM   2862 C  CB    . TYR B 1 18  ? 33.526  72.312  9.860   1.00 40.90  ? 12   TYR B CB    1 
ATOM   2863 C  CG    . TYR B 1 18  ? 32.210  73.032  9.593   1.00 44.25  ? 12   TYR B CG    1 
ATOM   2864 C  CD1   . TYR B 1 18  ? 31.310  73.305  10.618  1.00 46.22  ? 12   TYR B CD1   1 
ATOM   2865 C  CD2   . TYR B 1 18  ? 31.902  73.511  8.315   1.00 47.11  ? 12   TYR B CD2   1 
ATOM   2866 C  CE1   . TYR B 1 18  ? 30.139  74.046  10.381  1.00 47.70  ? 12   TYR B CE1   1 
ATOM   2867 C  CE2   . TYR B 1 18  ? 30.735  74.256  8.064   1.00 47.95  ? 12   TYR B CE2   1 
ATOM   2868 C  CZ    . TYR B 1 18  ? 29.864  74.521  9.104   1.00 48.64  ? 12   TYR B CZ    1 
ATOM   2869 O  OH    . TYR B 1 18  ? 28.737  75.288  8.883   1.00 50.59  ? 12   TYR B OH    1 
ATOM   2870 N  N     . ALA B 1 19  ? 36.192  71.569  11.324  1.00 38.43  ? 13   ALA B N     1 
ATOM   2871 C  CA    . ALA B 1 19  ? 37.428  70.802  11.320  1.00 38.68  ? 13   ALA B CA    1 
ATOM   2872 C  C     . ALA B 1 19  ? 37.886  70.370  12.720  1.00 40.18  ? 13   ALA B C     1 
ATOM   2873 O  O     . ALA B 1 19  ? 38.669  69.424  12.864  1.00 38.47  ? 13   ALA B O     1 
ATOM   2874 C  CB    . ALA B 1 19  ? 38.527  71.597  10.611  1.00 36.41  ? 13   ALA B CB    1 
ATOM   2875 N  N     . GLN B 1 20  ? 37.398  71.047  13.755  1.00 41.89  ? 14   GLN B N     1 
ATOM   2876 C  CA    . GLN B 1 20  ? 37.794  70.663  15.103  1.00 44.18  ? 14   GLN B CA    1 
ATOM   2877 C  C     . GLN B 1 20  ? 37.010  69.476  15.564  1.00 43.56  ? 14   GLN B C     1 
ATOM   2878 O  O     . GLN B 1 20  ? 37.500  68.694  16.372  1.00 45.32  ? 14   GLN B O     1 
ATOM   2879 C  CB    . GLN B 1 20  ? 37.612  71.779  16.126  1.00 46.06  ? 14   GLN B CB    1 
ATOM   2880 C  CG    . GLN B 1 20  ? 37.907  71.289  17.539  1.00 47.57  ? 14   GLN B CG    1 
ATOM   2881 C  CD    . GLN B 1 20  ? 38.446  72.376  18.432  1.00 50.42  ? 14   GLN B CD    1 
ATOM   2882 O  OE1   . GLN B 1 20  ? 38.657  73.508  17.977  1.00 51.06  ? 14   GLN B OE1   1 
ATOM   2883 N  NE2   . GLN B 1 20  ? 38.682  72.046  19.717  1.00 50.05  ? 14   GLN B NE2   1 
ATOM   2884 N  N     . VAL B 1 21  ? 35.784  69.348  15.079  1.00 42.36  ? 15   VAL B N     1 
ATOM   2885 C  CA    . VAL B 1 21  ? 34.994  68.195  15.454  1.00 42.62  ? 15   VAL B CA    1 
ATOM   2886 C  C     . VAL B 1 21  ? 35.633  66.997  14.742  1.00 43.73  ? 15   VAL B C     1 
ATOM   2887 O  O     . VAL B 1 21  ? 35.776  65.921  15.305  1.00 44.48  ? 15   VAL B O     1 
ATOM   2888 C  CB    . VAL B 1 21  ? 33.556  68.320  14.986  1.00 41.92  ? 15   VAL B CB    1 
ATOM   2889 C  CG1   . VAL B 1 21  ? 32.742  67.204  15.583  1.00 43.02  ? 15   VAL B CG1   1 
ATOM   2890 C  CG2   . VAL B 1 21  ? 32.990  69.658  15.373  1.00 42.23  ? 15   VAL B CG2   1 
ATOM   2891 N  N     . GLU B 1 22  ? 36.045  67.198  13.499  1.00 44.40  ? 16   GLU B N     1 
ATOM   2892 C  CA    . GLU B 1 22  ? 36.656  66.128  12.728  1.00 45.66  ? 16   GLU B CA    1 
ATOM   2893 C  C     . GLU B 1 22  ? 37.970  65.648  13.353  1.00 47.32  ? 16   GLU B C     1 
ATOM   2894 O  O     . GLU B 1 22  ? 38.352  64.478  13.189  1.00 46.72  ? 16   GLU B O     1 
ATOM   2895 C  CB    . GLU B 1 22  ? 36.869  66.601  11.285  1.00 44.65  ? 16   GLU B CB    1 
ATOM   2896 C  CG    . GLU B 1 22  ? 36.149  65.751  10.229  1.00 46.63  ? 16   GLU B CG    1 
ATOM   2897 C  CD    . GLU B 1 22  ? 34.641  65.590  10.464  1.00 46.93  ? 16   GLU B CD    1 
ATOM   2898 O  OE1   . GLU B 1 22  ? 33.971  64.978  9.616   1.00 46.32  ? 16   GLU B OE1   1 
ATOM   2899 O  OE2   . GLU B 1 22  ? 34.113  66.064  11.485  1.00 48.73  ? 16   GLU B OE2   1 
ATOM   2900 N  N     . GLU B 1 23  ? 38.658  66.555  14.057  1.00 48.86  ? 17   GLU B N     1 
ATOM   2901 C  CA    . GLU B 1 23  ? 39.923  66.235  14.735  1.00 48.42  ? 17   GLU B CA    1 
ATOM   2902 C  C     . GLU B 1 23  ? 39.580  65.491  16.002  1.00 47.02  ? 17   GLU B C     1 
ATOM   2903 O  O     . GLU B 1 23  ? 40.338  64.655  16.470  1.00 46.59  ? 17   GLU B O     1 
ATOM   2904 C  CB    . GLU B 1 23  ? 40.709  67.503  15.099  1.00 49.35  ? 17   GLU B CB    1 
ATOM   2905 C  CG    . GLU B 1 23  ? 41.583  68.061  13.963  1.00 54.02  ? 17   GLU B CG    1 
ATOM   2906 C  CD    . GLU B 1 23  ? 42.380  69.326  14.350  1.00 55.73  ? 17   GLU B CD    1 
ATOM   2907 O  OE1   . GLU B 1 23  ? 41.784  70.268  14.912  1.00 58.89  ? 17   GLU B OE1   1 
ATOM   2908 O  OE2   . GLU B 1 23  ? 43.599  69.390  14.076  1.00 55.63  ? 17   GLU B OE2   1 
ATOM   2909 N  N     . VAL B 1 24  ? 38.421  65.808  16.551  1.00 45.51  ? 18   VAL B N     1 
ATOM   2910 C  CA    . VAL B 1 24  ? 37.976  65.158  17.754  1.00 45.77  ? 18   VAL B CA    1 
ATOM   2911 C  C     . VAL B 1 24  ? 37.512  63.752  17.423  1.00 47.22  ? 18   VAL B C     1 
ATOM   2912 O  O     . VAL B 1 24  ? 37.953  62.806  18.062  1.00 49.56  ? 18   VAL B O     1 
ATOM   2913 C  CB    . VAL B 1 24  ? 36.834  65.929  18.407  1.00 45.62  ? 18   VAL B CB    1 
ATOM   2914 C  CG1   . VAL B 1 24  ? 36.233  65.102  19.535  1.00 46.56  ? 18   VAL B CG1   1 
ATOM   2915 C  CG2   . VAL B 1 24  ? 37.341  67.262  18.932  1.00 44.04  ? 18   VAL B CG2   1 
ATOM   2916 N  N     . LEU B 1 25  ? 36.629  63.608  16.435  1.00 46.97  ? 19   LEU B N     1 
ATOM   2917 C  CA    . LEU B 1 25  ? 36.142  62.288  16.049  1.00 46.47  ? 19   LEU B CA    1 
ATOM   2918 C  C     . LEU B 1 25  ? 37.304  61.363  15.709  1.00 47.02  ? 19   LEU B C     1 
ATOM   2919 O  O     . LEU B 1 25  ? 37.241  60.152  15.949  1.00 47.75  ? 19   LEU B O     1 
ATOM   2920 C  CB    . LEU B 1 25  ? 35.215  62.377  14.840  1.00 47.65  ? 19   LEU B CB    1 
ATOM   2921 C  CG    . LEU B 1 25  ? 33.718  62.209  15.092  1.00 48.24  ? 19   LEU B CG    1 
ATOM   2922 C  CD1   . LEU B 1 25  ? 33.193  63.465  15.769  1.00 48.95  ? 19   LEU B CD1   1 
ATOM   2923 C  CD2   . LEU B 1 25  ? 32.983  61.955  13.785  1.00 47.85  ? 19   LEU B CD2   1 
ATOM   2924 N  N     . ASN B 1 26  ? 38.354  61.936  15.130  1.00 46.46  ? 20   ASN B N     1 
ATOM   2925 C  CA    . ASN B 1 26  ? 39.532  61.167  14.778  1.00 45.65  ? 20   ASN B CA    1 
ATOM   2926 C  C     . ASN B 1 26  ? 40.743  61.865  15.352  1.00 45.20  ? 20   ASN B C     1 
ATOM   2927 O  O     . ASN B 1 26  ? 41.413  62.636  14.664  1.00 45.46  ? 20   ASN B O     1 
ATOM   2928 C  CB    . ASN B 1 26  ? 39.681  61.048  13.268  1.00 46.25  ? 20   ASN B CB    1 
ATOM   2929 C  CG    . ASN B 1 26  ? 40.843  60.161  12.878  1.00 47.81  ? 20   ASN B CG    1 
ATOM   2930 O  OD1   . ASN B 1 26  ? 40.939  59.012  13.316  1.00 48.88  ? 20   ASN B OD1   1 
ATOM   2931 N  ND2   . ASN B 1 26  ? 41.737  60.687  12.055  1.00 49.04  ? 20   ASN B ND2   1 
ATOM   2932 N  N     . PRO B 1 27  ? 41.043  61.598  16.628  1.00 44.17  ? 21   PRO B N     1 
ATOM   2933 C  CA    . PRO B 1 27  ? 42.191  62.211  17.301  1.00 43.78  ? 21   PRO B CA    1 
ATOM   2934 C  C     . PRO B 1 27  ? 43.454  62.132  16.461  1.00 41.20  ? 21   PRO B C     1 
ATOM   2935 O  O     . PRO B 1 27  ? 44.267  63.037  16.475  1.00 40.43  ? 21   PRO B O     1 
ATOM   2936 C  CB    . PRO B 1 27  ? 42.291  61.412  18.594  1.00 45.19  ? 21   PRO B CB    1 
ATOM   2937 C  CG    . PRO B 1 27  ? 41.770  60.057  18.176  1.00 45.38  ? 21   PRO B CG    1 
ATOM   2938 C  CD    . PRO B 1 27  ? 40.547  60.450  17.403  1.00 43.96  ? 21   PRO B CD    1 
ATOM   2939 N  N     . SER B 1 28  ? 43.607  61.037  15.732  1.00 38.99  ? 22   SER B N     1 
ATOM   2940 C  CA    . SER B 1 28  ? 44.755  60.859  14.870  1.00 37.96  ? 22   SER B CA    1 
ATOM   2941 C  C     . SER B 1 28  ? 44.954  62.066  13.982  1.00 38.79  ? 22   SER B C     1 
ATOM   2942 O  O     . SER B 1 28  ? 45.974  62.178  13.299  1.00 37.92  ? 22   SER B O     1 
ATOM   2943 C  CB    . SER B 1 28  ? 44.552  59.662  13.966  1.00 37.25  ? 22   SER B CB    1 
ATOM   2944 O  OG    . SER B 1 28  ? 45.190  59.901  12.725  1.00 37.91  ? 22   SER B OG    1 
ATOM   2945 N  N     . LEU B 1 29  ? 43.964  62.953  13.970  1.00 39.49  ? 23   LEU B N     1 
ATOM   2946 C  CA    . LEU B 1 29  ? 44.033  64.142  13.137  1.00 39.64  ? 23   LEU B CA    1 
ATOM   2947 C  C     . LEU B 1 29  ? 44.753  65.314  13.778  1.00 39.70  ? 23   LEU B C     1 
ATOM   2948 O  O     . LEU B 1 29  ? 45.594  65.934  13.148  1.00 40.34  ? 23   LEU B O     1 
ATOM   2949 C  CB    . LEU B 1 29  ? 42.630  64.573  12.711  1.00 38.91  ? 23   LEU B CB    1 
ATOM   2950 C  CG    . LEU B 1 29  ? 41.950  63.702  11.658  1.00 37.21  ? 23   LEU B CG    1 
ATOM   2951 C  CD1   . LEU B 1 29  ? 40.681  64.433  11.210  1.00 37.82  ? 23   LEU B CD1   1 
ATOM   2952 C  CD2   . LEU B 1 29  ? 42.884  63.445  10.464  1.00 32.57  ? 23   LEU B CD2   1 
ATOM   2953 N  N     . LYS B 1 30  ? 44.434  65.614  15.027  1.00 39.98  ? 24   LYS B N     1 
ATOM   2954 C  CA    . LYS B 1 30  ? 45.070  66.734  15.702  1.00 40.83  ? 24   LYS B CA    1 
ATOM   2955 C  C     . LYS B 1 30  ? 46.576  66.776  15.485  1.00 41.47  ? 24   LYS B C     1 
ATOM   2956 O  O     . LYS B 1 30  ? 47.279  65.811  15.764  1.00 41.37  ? 24   LYS B O     1 
ATOM   2957 C  CB    . LYS B 1 30  ? 44.749  66.698  17.202  1.00 41.57  ? 24   LYS B CB    1 
ATOM   2958 C  CG    A LYS B 1 30  ? 44.900  65.320  17.840  0.50 43.64  ? 24   LYS B CG    1 
ATOM   2959 C  CD    A LYS B 1 30  ? 46.356  64.961  18.152  0.50 43.45  ? 24   LYS B CD    1 
ATOM   2960 C  CE    A LYS B 1 30  ? 46.593  63.453  18.138  0.50 42.80  ? 24   LYS B CE    1 
ATOM   2961 N  NZ    A LYS B 1 30  ? 46.712  62.909  16.745  0.50 41.77  ? 24   LYS B NZ    1 
ATOM   2962 N  N     . GLY B 1 31  ? 47.063  67.902  14.978  1.00 42.08  ? 25   GLY B N     1 
ATOM   2963 C  CA    . GLY B 1 31  ? 48.481  68.036  14.752  1.00 44.44  ? 25   GLY B CA    1 
ATOM   2964 C  C     . GLY B 1 31  ? 48.833  68.310  13.309  1.00 47.79  ? 25   GLY B C     1 
ATOM   2965 O  O     . GLY B 1 31  ? 49.868  68.926  13.025  1.00 49.21  ? 25   GLY B O     1 
ATOM   2966 N  N     . LYS B 1 32  ? 47.982  67.864  12.387  1.00 49.36  ? 26   LYS B N     1 
ATOM   2967 C  CA    . LYS B 1 32  ? 48.244  68.075  10.960  1.00 49.40  ? 26   LYS B CA    1 
ATOM   2968 C  C     . LYS B 1 32  ? 47.093  68.751  10.177  1.00 46.97  ? 26   LYS B C     1 
ATOM   2969 O  O     . LYS B 1 32  ? 45.932  68.722  10.602  1.00 44.74  ? 26   LYS B O     1 
ATOM   2970 C  CB    . LYS B 1 32  ? 48.663  66.736  10.328  1.00 50.80  ? 26   LYS B CB    1 
ATOM   2971 C  CG    . LYS B 1 32  ? 50.039  66.252  10.802  1.00 52.15  ? 26   LYS B CG    1 
ATOM   2972 C  CD    . LYS B 1 32  ? 51.170  67.229  10.393  1.00 54.47  ? 26   LYS B CD    1 
ATOM   2973 C  CE    . LYS B 1 32  ? 52.548  66.749  10.906  1.00 56.48  ? 26   LYS B CE    1 
ATOM   2974 N  NZ    . LYS B 1 32  ? 53.699  67.659  10.604  1.00 56.33  ? 26   LYS B NZ    1 
ATOM   2975 N  N     . PRO B 1 33  ? 47.416  69.387  9.032   1.00 45.70  ? 27   PRO B N     1 
ATOM   2976 C  CA    . PRO B 1 33  ? 46.457  70.086  8.169   1.00 46.02  ? 27   PRO B CA    1 
ATOM   2977 C  C     . PRO B 1 33  ? 45.219  69.291  7.761   1.00 47.26  ? 27   PRO B C     1 
ATOM   2978 O  O     . PRO B 1 33  ? 45.307  68.194  7.191   1.00 48.46  ? 27   PRO B O     1 
ATOM   2979 C  CB    . PRO B 1 33  ? 47.308  70.509  6.967   1.00 44.86  ? 27   PRO B CB    1 
ATOM   2980 C  CG    . PRO B 1 33  ? 48.396  69.507  6.930   1.00 43.94  ? 27   PRO B CG    1 
ATOM   2981 C  CD    . PRO B 1 33  ? 48.743  69.372  8.396   1.00 45.78  ? 27   PRO B CD    1 
ATOM   2982 N  N     . VAL B 1 34  ? 44.064  69.868  8.070   1.00 46.71  ? 28   VAL B N     1 
ATOM   2983 C  CA    . VAL B 1 34  ? 42.780  69.271  7.761   1.00 46.32  ? 28   VAL B CA    1 
ATOM   2984 C  C     . VAL B 1 34  ? 41.971  70.279  6.975   1.00 47.70  ? 28   VAL B C     1 
ATOM   2985 O  O     . VAL B 1 34  ? 42.027  71.479  7.250   1.00 48.15  ? 28   VAL B O     1 
ATOM   2986 C  CB    . VAL B 1 34  ? 42.018  68.902  9.036   1.00 44.95  ? 28   VAL B CB    1 
ATOM   2987 C  CG1   . VAL B 1 34  ? 40.546  68.726  8.730   1.00 44.50  ? 28   VAL B CG1   1 
ATOM   2988 C  CG2   . VAL B 1 34  ? 42.591  67.626  9.621   1.00 43.14  ? 28   VAL B CG2   1 
ATOM   2989 N  N     . VAL B 1 35  ? 41.213  69.793  5.998   1.00 48.07  ? 29   VAL B N     1 
ATOM   2990 C  CA    . VAL B 1 35  ? 40.401  70.678  5.176   1.00 46.92  ? 29   VAL B CA    1 
ATOM   2991 C  C     . VAL B 1 35  ? 39.018  70.088  4.943   1.00 47.18  ? 29   VAL B C     1 
ATOM   2992 O  O     . VAL B 1 35  ? 38.874  69.123  4.189   1.00 47.54  ? 29   VAL B O     1 
ATOM   2993 C  CB    . VAL B 1 35  ? 41.079  70.928  3.816   1.00 45.15  ? 29   VAL B CB    1 
ATOM   2994 C  CG1   . VAL B 1 35  ? 40.261  71.876  3.002   1.00 44.91  ? 29   VAL B CG1   1 
ATOM   2995 C  CG2   . VAL B 1 35  ? 42.469  71.474  4.022   1.00 42.36  ? 29   VAL B CG2   1 
ATOM   2996 N  N     . VAL B 1 36  ? 38.016  70.664  5.608   1.00 46.72  ? 30   VAL B N     1 
ATOM   2997 C  CA    . VAL B 1 36  ? 36.633  70.217  5.464   1.00 47.04  ? 30   VAL B CA    1 
ATOM   2998 C  C     . VAL B 1 36  ? 36.058  70.842  4.199   1.00 47.58  ? 30   VAL B C     1 
ATOM   2999 O  O     . VAL B 1 36  ? 35.798  72.041  4.158   1.00 46.40  ? 30   VAL B O     1 
ATOM   3000 C  CB    . VAL B 1 36  ? 35.771  70.634  6.671   1.00 45.95  ? 30   VAL B CB    1 
ATOM   3001 C  CG1   . VAL B 1 36  ? 34.346  70.211  6.468   1.00 46.54  ? 30   VAL B CG1   1 
ATOM   3002 C  CG2   . VAL B 1 36  ? 36.292  69.978  7.914   1.00 46.06  ? 30   VAL B CG2   1 
ATOM   3003 N  N     . CYS B 1 37  ? 35.866  70.010  3.175   1.00 49.10  ? 31   CYS B N     1 
ATOM   3004 C  CA    . CYS B 1 37  ? 35.343  70.442  1.877   1.00 50.77  ? 31   CYS B CA    1 
ATOM   3005 C  C     . CYS B 1 37  ? 33.855  70.149  1.653   1.00 51.62  ? 31   CYS B C     1 
ATOM   3006 O  O     . CYS B 1 37  ? 33.212  69.465  2.451   1.00 53.46  ? 31   CYS B O     1 
ATOM   3007 C  CB    . CYS B 1 37  ? 36.165  69.804  0.755   1.00 50.47  ? 31   CYS B CB    1 
ATOM   3008 S  SG    . CYS B 1 37  ? 37.968  70.156  0.845   1.00 53.03  ? 31   CYS B SG    1 
ATOM   3009 N  N     . VAL B 1 38  ? 33.311  70.682  0.565   1.00 51.72  ? 32   VAL B N     1 
ATOM   3010 C  CA    . VAL B 1 38  ? 31.908  70.490  0.249   1.00 51.86  ? 32   VAL B CA    1 
ATOM   3011 C  C     . VAL B 1 38  ? 31.882  70.113  -1.196  1.00 53.13  ? 32   VAL B C     1 
ATOM   3012 O  O     . VAL B 1 38  ? 31.573  70.938  -2.037  1.00 53.47  ? 32   VAL B O     1 
ATOM   3013 C  CB    . VAL B 1 38  ? 31.102  71.782  0.394   1.00 51.24  ? 32   VAL B CB    1 
ATOM   3014 C  CG1   . VAL B 1 38  ? 29.635  71.463  0.346   1.00 50.72  ? 32   VAL B CG1   1 
ATOM   3015 C  CG2   . VAL B 1 38  ? 31.476  72.503  1.678   1.00 51.71  ? 32   VAL B CG2   1 
ATOM   3016 N  N     . PHE B 1 39  ? 32.226  68.866  -1.487  1.00 55.76  ? 33   PHE B N     1 
ATOM   3017 C  CA    . PHE B 1 39  ? 32.258  68.375  -2.868  1.00 56.74  ? 33   PHE B CA    1 
ATOM   3018 C  C     . PHE B 1 39  ? 30.932  68.584  -3.595  1.00 57.22  ? 33   PHE B C     1 
ATOM   3019 O  O     . PHE B 1 39  ? 29.900  68.082  -3.157  1.00 57.41  ? 33   PHE B O     1 
ATOM   3020 C  CB    . PHE B 1 39  ? 32.629  66.884  -2.892  1.00 54.62  ? 33   PHE B CB    1 
ATOM   3021 C  CG    . PHE B 1 39  ? 33.957  66.583  -2.266  1.00 52.53  ? 33   PHE B CG    1 
ATOM   3022 C  CD1   . PHE B 1 39  ? 34.117  66.633  -0.889  1.00 52.76  ? 33   PHE B CD1   1 
ATOM   3023 C  CD2   . PHE B 1 39  ? 35.059  66.295  -3.057  1.00 51.89  ? 33   PHE B CD2   1 
ATOM   3024 C  CE1   . PHE B 1 39  ? 35.363  66.403  -0.310  1.00 53.84  ? 33   PHE B CE1   1 
ATOM   3025 C  CE2   . PHE B 1 39  ? 36.297  66.067  -2.496  1.00 51.41  ? 33   PHE B CE2   1 
ATOM   3026 C  CZ    . PHE B 1 39  ? 36.455  66.121  -1.119  1.00 52.94  ? 33   PHE B CZ    1 
ATOM   3027 N  N     . SER B 1 40  ? 30.966  69.325  -4.703  1.00 58.27  ? 34   SER B N     1 
ATOM   3028 C  CA    . SER B 1 40  ? 29.762  69.596  -5.498  1.00 59.58  ? 34   SER B CA    1 
ATOM   3029 C  C     . SER B 1 40  ? 29.230  68.293  -6.091  1.00 61.04  ? 34   SER B C     1 
ATOM   3030 O  O     . SER B 1 40  ? 28.181  68.267  -6.730  1.00 61.28  ? 34   SER B O     1 
ATOM   3031 C  CB    . SER B 1 40  ? 30.074  70.574  -6.634  1.00 57.95  ? 34   SER B CB    1 
ATOM   3032 O  OG    . SER B 1 40  ? 30.977  70.001  -7.563  1.00 54.07  ? 34   SER B OG    1 
ATOM   3033 N  N     . GLY B 1 41  ? 29.978  67.215  -5.878  1.00 61.97  ? 35   GLY B N     1 
ATOM   3034 C  CA    . GLY B 1 41  ? 29.576  65.919  -6.377  1.00 61.97  ? 35   GLY B CA    1 
ATOM   3035 C  C     . GLY B 1 41  ? 29.849  65.781  -7.849  1.00 62.51  ? 35   GLY B C     1 
ATOM   3036 O  O     . GLY B 1 41  ? 29.707  64.693  -8.398  1.00 62.88  ? 35   GLY B O     1 
ATOM   3037 N  N     . ARG B 1 42  ? 30.249  66.875  -8.488  1.00 63.40  ? 36   ARG B N     1 
ATOM   3038 C  CA    . ARG B 1 42  ? 30.524  66.856  -9.917  1.00 64.86  ? 36   ARG B CA    1 
ATOM   3039 C  C     . ARG B 1 42  ? 31.739  65.986  -10.273 1.00 66.12  ? 36   ARG B C     1 
ATOM   3040 O  O     . ARG B 1 42  ? 31.783  64.805  -9.927  1.00 66.87  ? 36   ARG B O     1 
ATOM   3041 C  CB    . ARG B 1 42  ? 30.704  68.288  -10.420 1.00 64.46  ? 36   ARG B CB    1 
ATOM   3042 C  CG    . ARG B 1 42  ? 30.930  68.385  -11.904 1.00 65.37  ? 36   ARG B CG    1 
ATOM   3043 C  CD    . ARG B 1 42  ? 30.899  69.822  -12.399 1.00 66.85  ? 36   ARG B CD    1 
ATOM   3044 N  NE    . ARG B 1 42  ? 29.563  70.405  -12.309 1.00 67.88  ? 36   ARG B NE    1 
ATOM   3045 C  CZ    . ARG B 1 42  ? 29.158  71.463  -13.005 1.00 68.50  ? 36   ARG B CZ    1 
ATOM   3046 N  NH1   . ARG B 1 42  ? 29.987  72.063  -13.853 1.00 68.92  ? 36   ARG B NH1   1 
ATOM   3047 N  NH2   . ARG B 1 42  ? 27.921  71.920  -12.854 1.00 67.80  ? 36   ARG B NH2   1 
ATOM   3048 N  N     . PHE B 1 43  ? 32.722  66.551  -10.962 1.00 67.31  ? 37   PHE B N     1 
ATOM   3049 C  CA    . PHE B 1 43  ? 33.903  65.783  -11.346 1.00 69.24  ? 37   PHE B CA    1 
ATOM   3050 C  C     . PHE B 1 43  ? 34.807  65.414  -10.177 1.00 70.14  ? 37   PHE B C     1 
ATOM   3051 O  O     . PHE B 1 43  ? 35.430  66.280  -9.575  1.00 71.30  ? 37   PHE B O     1 
ATOM   3052 C  CB    . PHE B 1 43  ? 34.705  66.548  -12.404 1.00 70.42  ? 37   PHE B CB    1 
ATOM   3053 C  CG    . PHE B 1 43  ? 35.123  67.938  -11.987 1.00 71.69  ? 37   PHE B CG    1 
ATOM   3054 C  CD1   . PHE B 1 43  ? 36.363  68.170  -11.400 1.00 71.66  ? 37   PHE B CD1   1 
ATOM   3055 C  CD2   . PHE B 1 43  ? 34.297  69.027  -12.237 1.00 72.06  ? 37   PHE B CD2   1 
ATOM   3056 C  CE1   . PHE B 1 43  ? 36.770  69.467  -11.076 1.00 71.87  ? 37   PHE B CE1   1 
ATOM   3057 C  CE2   . PHE B 1 43  ? 34.702  70.326  -11.914 1.00 72.25  ? 37   PHE B CE2   1 
ATOM   3058 C  CZ    . PHE B 1 43  ? 35.939  70.542  -11.335 1.00 71.19  ? 37   PHE B CZ    1 
ATOM   3059 N  N     . GLU B 1 44  ? 34.874  64.121  -9.865  1.00 71.11  ? 38   GLU B N     1 
ATOM   3060 C  CA    . GLU B 1 44  ? 35.701  63.607  -8.763  1.00 71.43  ? 38   GLU B CA    1 
ATOM   3061 C  C     . GLU B 1 44  ? 35.899  64.553  -7.563  1.00 70.05  ? 38   GLU B C     1 
ATOM   3062 O  O     . GLU B 1 44  ? 35.127  64.486  -6.605  1.00 69.66  ? 38   GLU B O     1 
ATOM   3063 C  CB    . GLU B 1 44  ? 37.066  63.149  -9.299  1.00 73.42  ? 38   GLU B CB    1 
ATOM   3064 C  CG    . GLU B 1 44  ? 38.025  62.643  -8.229  1.00 75.64  ? 38   GLU B CG    1 
ATOM   3065 C  CD    . GLU B 1 44  ? 37.402  61.580  -7.340  1.00 77.48  ? 38   GLU B CD    1 
ATOM   3066 O  OE1   . GLU B 1 44  ? 38.073  61.131  -6.381  1.00 77.72  ? 38   GLU B OE1   1 
ATOM   3067 O  OE2   . GLU B 1 44  ? 36.239  61.195  -7.602  1.00 77.95  ? 38   GLU B OE2   1 
ATOM   3068 N  N     . ASP B 1 45  ? 36.924  65.414  -7.610  1.00 68.34  ? 39   ASP B N     1 
ATOM   3069 C  CA    . ASP B 1 45  ? 37.216  66.358  -6.513  1.00 66.64  ? 39   ASP B CA    1 
ATOM   3070 C  C     . ASP B 1 45  ? 36.846  67.812  -6.832  1.00 64.64  ? 39   ASP B C     1 
ATOM   3071 O  O     . ASP B 1 45  ? 37.680  68.709  -6.733  1.00 64.71  ? 39   ASP B O     1 
ATOM   3072 C  CB    . ASP B 1 45  ? 38.708  66.302  -6.126  1.00 67.40  ? 39   ASP B CB    1 
ATOM   3073 C  CG    . ASP B 1 45  ? 39.140  64.931  -5.605  1.00 68.57  ? 39   ASP B CG    1 
ATOM   3074 O  OD1   . ASP B 1 45  ? 38.531  64.418  -4.641  1.00 69.65  ? 39   ASP B OD1   1 
ATOM   3075 O  OD2   . ASP B 1 45  ? 40.102  64.361  -6.158  1.00 68.52  ? 39   ASP B OD2   1 
ATOM   3076 N  N     . SER B 1 46  ? 35.592  68.047  -7.203  1.00 62.89  ? 40   SER B N     1 
ATOM   3077 C  CA    . SER B 1 46  ? 35.141  69.396  -7.544  1.00 60.60  ? 40   SER B CA    1 
ATOM   3078 C  C     . SER B 1 46  ? 34.372  69.990  -6.368  1.00 59.12  ? 40   SER B C     1 
ATOM   3079 O  O     . SER B 1 46  ? 33.627  69.289  -5.680  1.00 59.31  ? 40   SER B O     1 
ATOM   3080 C  CB    . SER B 1 46  ? 34.226  69.366  -8.776  1.00 59.43  ? 40   SER B CB    1 
ATOM   3081 O  OG    . SER B 1 46  ? 32.903  69.008  -8.413  1.00 59.97  ? 40   SER B OG    1 
ATOM   3082 N  N     . GLY B 1 47  ? 34.546  71.285  -6.142  1.00 56.67  ? 41   GLY B N     1 
ATOM   3083 C  CA    . GLY B 1 47  ? 33.850  71.931  -5.047  1.00 53.27  ? 41   GLY B CA    1 
ATOM   3084 C  C     . GLY B 1 47  ? 34.583  73.137  -4.490  1.00 51.53  ? 41   GLY B C     1 
ATOM   3085 O  O     . GLY B 1 47  ? 35.478  73.705  -5.126  1.00 49.89  ? 41   GLY B O     1 
ATOM   3086 N  N     . ALA B 1 48  ? 34.183  73.533  -3.289  1.00 50.86  ? 42   ALA B N     1 
ATOM   3087 C  CA    . ALA B 1 48  ? 34.785  74.664  -2.598  1.00 50.55  ? 42   ALA B CA    1 
ATOM   3088 C  C     . ALA B 1 48  ? 35.164  74.179  -1.209  1.00 50.26  ? 42   ALA B C     1 
ATOM   3089 O  O     . ALA B 1 48  ? 34.917  73.027  -0.863  1.00 50.53  ? 42   ALA B O     1 
ATOM   3090 C  CB    . ALA B 1 48  ? 33.784  75.807  -2.498  1.00 49.74  ? 42   ALA B CB    1 
ATOM   3091 N  N     . VAL B 1 49  ? 35.754  75.055  -0.412  1.00 49.84  ? 43   VAL B N     1 
ATOM   3092 C  CA    . VAL B 1 49  ? 36.149  74.683  0.942   1.00 49.64  ? 43   VAL B CA    1 
ATOM   3093 C  C     . VAL B 1 49  ? 35.250  75.347  1.975   1.00 49.70  ? 43   VAL B C     1 
ATOM   3094 O  O     . VAL B 1 49  ? 34.929  76.535  1.861   1.00 50.03  ? 43   VAL B O     1 
ATOM   3095 C  CB    . VAL B 1 49  ? 37.602  75.101  1.254   1.00 49.17  ? 43   VAL B CB    1 
ATOM   3096 C  CG1   . VAL B 1 49  ? 37.981  74.629  2.643   1.00 47.37  ? 43   VAL B CG1   1 
ATOM   3097 C  CG2   . VAL B 1 49  ? 38.548  74.558  0.196   1.00 48.80  ? 43   VAL B CG2   1 
ATOM   3098 N  N     . ALA B 1 50  ? 34.873  74.574  2.989   1.00 48.74  ? 44   ALA B N     1 
ATOM   3099 C  CA    . ALA B 1 50  ? 34.020  75.049  4.067   1.00 48.00  ? 44   ALA B CA    1 
ATOM   3100 C  C     . ALA B 1 50  ? 34.818  75.566  5.267   1.00 47.58  ? 44   ALA B C     1 
ATOM   3101 O  O     . ALA B 1 50  ? 34.546  76.642  5.775   1.00 46.79  ? 44   ALA B O     1 
ATOM   3102 C  CB    . ALA B 1 50  ? 33.078  73.923  4.513   1.00 47.77  ? 44   ALA B CB    1 
ATOM   3103 N  N     . THR B 1 51  ? 35.797  74.789  5.725   1.00 49.13  ? 45   THR B N     1 
ATOM   3104 C  CA    . THR B 1 51  ? 36.618  75.156  6.887   1.00 48.32  ? 45   THR B CA    1 
ATOM   3105 C  C     . THR B 1 51  ? 38.010  74.557  6.794   1.00 47.87  ? 45   THR B C     1 
ATOM   3106 O  O     . THR B 1 51  ? 38.197  73.486  6.214   1.00 48.09  ? 45   THR B O     1 
ATOM   3107 C  CB    . THR B 1 51  ? 35.983  74.654  8.205   1.00 47.82  ? 45   THR B CB    1 
ATOM   3108 O  OG1   . THR B 1 51  ? 34.888  75.504  8.577   1.00 49.07  ? 45   THR B OG1   1 
ATOM   3109 C  CG2   . THR B 1 51  ? 37.007  74.631  9.309   1.00 48.13  ? 45   THR B CG2   1 
ATOM   3110 N  N     . ALA B 1 52  ? 38.987  75.245  7.373   1.00 47.70  ? 46   ALA B N     1 
ATOM   3111 C  CA    . ALA B 1 52  ? 40.361  74.750  7.351   1.00 48.18  ? 46   ALA B CA    1 
ATOM   3112 C  C     . ALA B 1 52  ? 40.994  74.905  8.721   1.00 48.07  ? 46   ALA B C     1 
ATOM   3113 O  O     . ALA B 1 52  ? 40.943  75.977  9.302   1.00 49.25  ? 46   ALA B O     1 
ATOM   3114 C  CB    . ALA B 1 52  ? 41.180  75.507  6.314   1.00 46.93  ? 46   ALA B CB    1 
ATOM   3115 N  N     . ASN B 1 53  ? 41.581  73.840  9.250   1.00 47.51  ? 47   ASN B N     1 
ATOM   3116 C  CA    . ASN B 1 53  ? 42.222  73.931  10.553  1.00 46.78  ? 47   ASN B CA    1 
ATOM   3117 C  C     . ASN B 1 53  ? 43.314  75.015  10.456  1.00 45.59  ? 47   ASN B C     1 
ATOM   3118 O  O     . ASN B 1 53  ? 43.503  75.603  9.372   1.00 44.36  ? 47   ASN B O     1 
ATOM   3119 C  CB    . ASN B 1 53  ? 42.818  72.570  10.931  1.00 48.03  ? 47   ASN B CB    1 
ATOM   3120 C  CG    . ASN B 1 53  ? 44.081  72.255  10.168  1.00 49.98  ? 47   ASN B CG    1 
ATOM   3121 O  OD1   . ASN B 1 53  ? 44.220  72.597  8.989   1.00 52.19  ? 47   ASN B OD1   1 
ATOM   3122 N  ND2   . ASN B 1 53  ? 45.011  71.585  10.832  1.00 50.87  ? 47   ASN B ND2   1 
ATOM   3123 N  N     . TYR B 1 54  ? 44.024  75.288  11.558  1.00 43.09  ? 48   TYR B N     1 
ATOM   3124 C  CA    . TYR B 1 54  ? 45.059  76.322  11.510  1.00 41.90  ? 48   TYR B CA    1 
ATOM   3125 C  C     . TYR B 1 54  ? 46.348  75.899  10.830  1.00 41.43  ? 48   TYR B C     1 
ATOM   3126 O  O     . TYR B 1 54  ? 47.076  76.725  10.281  1.00 40.02  ? 48   TYR B O     1 
ATOM   3127 C  CB    . TYR B 1 54  ? 45.363  76.873  12.904  1.00 40.76  ? 48   TYR B CB    1 
ATOM   3128 C  CG    . TYR B 1 54  ? 44.279  77.807  13.429  1.00 40.64  ? 48   TYR B CG    1 
ATOM   3129 C  CD1   . TYR B 1 54  ? 43.080  77.292  13.936  1.00 39.95  ? 48   TYR B CD1   1 
ATOM   3130 C  CD2   . TYR B 1 54  ? 44.425  79.207  13.361  1.00 38.17  ? 48   TYR B CD2   1 
ATOM   3131 C  CE1   . TYR B 1 54  ? 42.060  78.134  14.353  1.00 39.15  ? 48   TYR B CE1   1 
ATOM   3132 C  CE2   . TYR B 1 54  ? 43.393  80.062  13.779  1.00 37.25  ? 48   TYR B CE2   1 
ATOM   3133 C  CZ    . TYR B 1 54  ? 42.211  79.504  14.271  1.00 38.15  ? 48   TYR B CZ    1 
ATOM   3134 O  OH    . TYR B 1 54  ? 41.138  80.273  14.647  1.00 37.20  ? 48   TYR B OH    1 
ATOM   3135 N  N     . GLU B 1 55  ? 46.619  74.606  10.834  1.00 41.62  ? 49   GLU B N     1 
ATOM   3136 C  CA    . GLU B 1 55  ? 47.818  74.097  10.198  1.00 42.97  ? 49   GLU B CA    1 
ATOM   3137 C  C     . GLU B 1 55  ? 47.751  74.328  8.685   1.00 43.15  ? 49   GLU B C     1 
ATOM   3138 O  O     . GLU B 1 55  ? 48.740  74.733  8.075   1.00 43.27  ? 49   GLU B O     1 
ATOM   3139 C  CB    . GLU B 1 55  ? 47.974  72.612  10.505  1.00 45.28  ? 49   GLU B CB    1 
ATOM   3140 C  CG    . GLU B 1 55  ? 48.134  72.279  11.989  1.00 50.41  ? 49   GLU B CG    1 
ATOM   3141 C  CD    . GLU B 1 55  ? 46.856  72.486  12.823  1.00 55.03  ? 49   GLU B CD    1 
ATOM   3142 O  OE1   . GLU B 1 55  ? 46.789  71.896  13.939  1.00 56.90  ? 49   GLU B OE1   1 
ATOM   3143 O  OE2   . GLU B 1 55  ? 45.930  73.232  12.384  1.00 56.23  ? 49   GLU B OE2   1 
ATOM   3144 N  N     . ALA B 1 56  ? 46.575  74.081  8.097   1.00 43.00  ? 50   ALA B N     1 
ATOM   3145 C  CA    . ALA B 1 56  ? 46.326  74.251  6.663   1.00 40.86  ? 50   ALA B CA    1 
ATOM   3146 C  C     . ALA B 1 56  ? 46.265  75.715  6.267   1.00 40.24  ? 50   ALA B C     1 
ATOM   3147 O  O     . ALA B 1 56  ? 46.722  76.106  5.191   1.00 40.03  ? 50   ALA B O     1 
ATOM   3148 C  CB    . ALA B 1 56  ? 45.027  73.584  6.290   1.00 42.62  ? 50   ALA B CB    1 
ATOM   3149 N  N     . ARG B 1 57  ? 45.674  76.521  7.139   1.00 39.28  ? 51   ARG B N     1 
ATOM   3150 C  CA    . ARG B 1 57  ? 45.563  77.942  6.888   1.00 38.42  ? 51   ARG B CA    1 
ATOM   3151 C  C     . ARG B 1 57  ? 46.944  78.560  6.675   1.00 39.52  ? 51   ARG B C     1 
ATOM   3152 O  O     . ARG B 1 57  ? 47.113  79.446  5.845   1.00 39.35  ? 51   ARG B O     1 
ATOM   3153 C  CB    . ARG B 1 57  ? 44.838  78.605  8.044   1.00 36.48  ? 51   ARG B CB    1 
ATOM   3154 C  CG    . ARG B 1 57  ? 43.477  79.117  7.648   1.00 35.25  ? 51   ARG B CG    1 
ATOM   3155 C  CD    . ARG B 1 57  ? 42.363  78.467  8.434   1.00 34.04  ? 51   ARG B CD    1 
ATOM   3156 N  NE    . ARG B 1 57  ? 41.919  79.248  9.582   1.00 33.50  ? 51   ARG B NE    1 
ATOM   3157 C  CZ    . ARG B 1 57  ? 40.738  79.070  10.162  1.00 37.28  ? 51   ARG B CZ    1 
ATOM   3158 N  NH1   . ARG B 1 57  ? 39.918  78.152  9.680   1.00 41.01  ? 51   ARG B NH1   1 
ATOM   3159 N  NH2   . ARG B 1 57  ? 40.368  79.781  11.221  1.00 39.67  ? 51   ARG B NH2   1 
ATOM   3160 N  N     . LYS B 1 58  ? 47.939  78.073  7.411   1.00 40.90  ? 52   LYS B N     1 
ATOM   3161 C  CA    . LYS B 1 58  ? 49.306  78.564  7.259   1.00 40.29  ? 52   LYS B CA    1 
ATOM   3162 C  C     . LYS B 1 58  ? 49.778  78.417  5.799   1.00 40.57  ? 52   LYS B C     1 
ATOM   3163 O  O     . LYS B 1 58  ? 50.866  78.854  5.434   1.00 41.56  ? 52   LYS B O     1 
ATOM   3164 C  CB    . LYS B 1 58  ? 50.247  77.806  8.217   1.00 38.01  ? 52   LYS B CB    1 
ATOM   3165 C  CG    A LYS B 1 58  ? 50.290  78.413  9.631   0.50 37.22  ? 52   LYS B CG    1 
ATOM   3166 C  CD    A LYS B 1 58  ? 51.095  77.573  10.611  0.50 36.10  ? 52   LYS B CD    1 
ATOM   3167 C  CE    A LYS B 1 58  ? 52.506  77.327  10.110  0.50 36.10  ? 52   LYS B CE    1 
ATOM   3168 N  NZ    A LYS B 1 58  ? 53.261  76.380  10.976  0.50 34.66  ? 52   LYS B NZ    1 
ATOM   3169 N  N     . PHE B 1 59  ? 48.951  77.824  4.950   1.00 39.37  ? 53   PHE B N     1 
ATOM   3170 C  CA    . PHE B 1 59  ? 49.355  77.655  3.573   1.00 39.41  ? 53   PHE B CA    1 
ATOM   3171 C  C     . PHE B 1 59  ? 48.414  78.360  2.606   1.00 39.92  ? 53   PHE B C     1 
ATOM   3172 O  O     . PHE B 1 59  ? 48.497  78.167  1.386   1.00 39.30  ? 53   PHE B O     1 
ATOM   3173 C  CB    . PHE B 1 59  ? 49.469  76.165  3.242   1.00 38.99  ? 53   PHE B CB    1 
ATOM   3174 C  CG    . PHE B 1 59  ? 50.543  75.458  4.018   1.00 38.22  ? 53   PHE B CG    1 
ATOM   3175 C  CD1   . PHE B 1 59  ? 50.219  74.626  5.087   1.00 37.56  ? 53   PHE B CD1   1 
ATOM   3176 C  CD2   . PHE B 1 59  ? 51.885  75.637  3.690   1.00 37.26  ? 53   PHE B CD2   1 
ATOM   3177 C  CE1   . PHE B 1 59  ? 51.213  73.978  5.825   1.00 35.53  ? 53   PHE B CE1   1 
ATOM   3178 C  CE2   . PHE B 1 59  ? 52.882  74.999  4.417   1.00 36.98  ? 53   PHE B CE2   1 
ATOM   3179 C  CZ    . PHE B 1 59  ? 52.540  74.163  5.492   1.00 36.24  ? 53   PHE B CZ    1 
ATOM   3180 N  N     . GLY B 1 60  ? 47.536  79.196  3.157   1.00 39.52  ? 54   GLY B N     1 
ATOM   3181 C  CA    . GLY B 1 60  ? 46.590  79.938  2.336   1.00 38.65  ? 54   GLY B CA    1 
ATOM   3182 C  C     . GLY B 1 60  ? 45.224  79.283  2.234   1.00 38.31  ? 54   GLY B C     1 
ATOM   3183 O  O     . GLY B 1 60  ? 44.220  79.946  2.043   1.00 38.06  ? 54   GLY B O     1 
ATOM   3184 N  N     . VAL B 1 61  ? 45.182  77.966  2.359   1.00 37.71  ? 55   VAL B N     1 
ATOM   3185 C  CA    . VAL B 1 61  ? 43.926  77.259  2.282   1.00 36.41  ? 55   VAL B CA    1 
ATOM   3186 C  C     . VAL B 1 61  ? 42.879  77.834  3.212   1.00 37.95  ? 55   VAL B C     1 
ATOM   3187 O  O     . VAL B 1 61  ? 42.828  77.468  4.382   1.00 38.04  ? 55   VAL B O     1 
ATOM   3188 C  CB    . VAL B 1 61  ? 44.098  75.779  2.641   1.00 35.23  ? 55   VAL B CB    1 
ATOM   3189 C  CG1   . VAL B 1 61  ? 42.732  75.104  2.744   1.00 32.41  ? 55   VAL B CG1   1 
ATOM   3190 C  CG2   . VAL B 1 61  ? 44.970  75.096  1.594   1.00 34.17  ? 55   VAL B CG2   1 
ATOM   3191 N  N     . LYS B 1 62  ? 42.036  78.722  2.687   1.00 39.26  ? 56   LYS B N     1 
ATOM   3192 C  CA    . LYS B 1 62  ? 40.951  79.307  3.473   1.00 40.14  ? 56   LYS B CA    1 
ATOM   3193 C  C     . LYS B 1 62  ? 39.607  78.848  2.912   1.00 39.21  ? 56   LYS B C     1 
ATOM   3194 O  O     . LYS B 1 62  ? 39.551  78.283  1.832   1.00 38.68  ? 56   LYS B O     1 
ATOM   3195 C  CB    . LYS B 1 62  ? 41.014  80.830  3.426   1.00 42.81  ? 56   LYS B CB    1 
ATOM   3196 C  CG    . LYS B 1 62  ? 40.588  81.437  2.092   1.00 47.00  ? 56   LYS B CG    1 
ATOM   3197 C  CD    . LYS B 1 62  ? 40.473  82.959  2.178   1.00 50.79  ? 56   LYS B CD    1 
ATOM   3198 C  CE    . LYS B 1 62  ? 41.812  83.588  2.565   1.00 52.88  ? 56   LYS B CE    1 
ATOM   3199 N  NZ    . LYS B 1 62  ? 42.917  83.182  1.632   1.00 55.63  ? 56   LYS B NZ    1 
ATOM   3200 N  N     . ALA B 1 63  ? 38.524  79.107  3.636   1.00 39.61  ? 57   ALA B N     1 
ATOM   3201 C  CA    . ALA B 1 63  ? 37.183  78.725  3.186   1.00 40.05  ? 57   ALA B CA    1 
ATOM   3202 C  C     . ALA B 1 63  ? 36.708  79.486  1.943   1.00 41.30  ? 57   ALA B C     1 
ATOM   3203 O  O     . ALA B 1 63  ? 37.112  80.635  1.700   1.00 41.33  ? 57   ALA B O     1 
ATOM   3204 C  CB    . ALA B 1 63  ? 36.199  78.945  4.294   1.00 40.23  ? 57   ALA B CB    1 
ATOM   3205 N  N     . GLY B 1 64  ? 35.838  78.839  1.167   1.00 41.50  ? 58   GLY B N     1 
ATOM   3206 C  CA    . GLY B 1 64  ? 35.295  79.462  -0.029  1.00 41.74  ? 58   GLY B CA    1 
ATOM   3207 C  C     . GLY B 1 64  ? 36.090  79.235  -1.301  1.00 41.60  ? 58   GLY B C     1 
ATOM   3208 O  O     . GLY B 1 64  ? 35.535  79.266  -2.399  1.00 42.64  ? 58   GLY B O     1 
ATOM   3209 N  N     . ILE B 1 65  ? 37.390  79.010  -1.168  1.00 40.34  ? 59   ILE B N     1 
ATOM   3210 C  CA    . ILE B 1 65  ? 38.206  78.788  -2.343  1.00 39.37  ? 59   ILE B CA    1 
ATOM   3211 C  C     . ILE B 1 65  ? 37.909  77.418  -2.911  1.00 39.87  ? 59   ILE B C     1 
ATOM   3212 O  O     . ILE B 1 65  ? 37.471  76.506  -2.203  1.00 40.91  ? 59   ILE B O     1 
ATOM   3213 C  CB    . ILE B 1 65  ? 39.711  78.855  -2.023  1.00 38.28  ? 59   ILE B CB    1 
ATOM   3214 C  CG1   . ILE B 1 65  ? 40.229  77.501  -1.572  1.00 37.88  ? 59   ILE B CG1   1 
ATOM   3215 C  CG2   . ILE B 1 65  ? 39.955  79.787  -0.877  1.00 40.21  ? 59   ILE B CG2   1 
ATOM   3216 C  CD1   . ILE B 1 65  ? 41.712  77.496  -1.397  1.00 37.88  ? 59   ILE B CD1   1 
ATOM   3217 N  N     . PRO B 1 66  ? 38.151  77.250  -4.208  1.00 40.16  ? 60   PRO B N     1 
ATOM   3218 C  CA    . PRO B 1 66  ? 37.915  75.973  -4.887  1.00 40.90  ? 60   PRO B CA    1 
ATOM   3219 C  C     . PRO B 1 66  ? 38.865  74.883  -4.383  1.00 41.02  ? 60   PRO B C     1 
ATOM   3220 O  O     . PRO B 1 66  ? 40.074  75.093  -4.289  1.00 41.05  ? 60   PRO B O     1 
ATOM   3221 C  CB    . PRO B 1 66  ? 38.181  76.301  -6.349  1.00 40.83  ? 60   PRO B CB    1 
ATOM   3222 C  CG    . PRO B 1 66  ? 37.919  77.764  -6.431  1.00 41.56  ? 60   PRO B CG    1 
ATOM   3223 C  CD    . PRO B 1 66  ? 38.503  78.304  -5.167  1.00 39.50  ? 60   PRO B CD    1 
ATOM   3224 N  N     . ILE B 1 67  ? 38.306  73.722  -4.064  1.00 40.29  ? 61   ILE B N     1 
ATOM   3225 C  CA    . ILE B 1 67  ? 39.091  72.588  -3.592  1.00 38.94  ? 61   ILE B CA    1 
ATOM   3226 C  C     . ILE B 1 67  ? 40.344  72.377  -4.432  1.00 42.36  ? 61   ILE B C     1 
ATOM   3227 O  O     . ILE B 1 67  ? 41.448  72.323  -3.909  1.00 43.62  ? 61   ILE B O     1 
ATOM   3228 C  CB    . ILE B 1 67  ? 38.269  71.295  -3.627  1.00 34.02  ? 61   ILE B CB    1 
ATOM   3229 C  CG1   . ILE B 1 67  ? 37.182  71.353  -2.556  1.00 32.76  ? 61   ILE B CG1   1 
ATOM   3230 C  CG2   . ILE B 1 67  ? 39.178  70.105  -3.455  1.00 33.00  ? 61   ILE B CG2   1 
ATOM   3231 C  CD1   . ILE B 1 67  ? 36.156  70.248  -2.638  1.00 33.20  ? 61   ILE B CD1   1 
ATOM   3232 N  N     . VAL B 1 68  ? 40.177  72.247  -5.739  1.00 46.70  ? 62   VAL B N     1 
ATOM   3233 C  CA    . VAL B 1 68  ? 41.322  72.046  -6.617  1.00 49.33  ? 62   VAL B CA    1 
ATOM   3234 C  C     . VAL B 1 68  ? 42.409  73.080  -6.338  1.00 51.33  ? 62   VAL B C     1 
ATOM   3235 O  O     . VAL B 1 68  ? 43.590  72.794  -6.523  1.00 52.45  ? 62   VAL B O     1 
ATOM   3236 C  CB    . VAL B 1 68  ? 40.897  72.120  -8.106  1.00 48.95  ? 62   VAL B CB    1 
ATOM   3237 C  CG1   . VAL B 1 68  ? 42.115  72.212  -8.997  1.00 48.16  ? 62   VAL B CG1   1 
ATOM   3238 C  CG2   . VAL B 1 68  ? 40.085  70.876  -8.471  1.00 47.87  ? 62   VAL B CG2   1 
ATOM   3239 N  N     . GLU B 1 69  ? 42.007  74.273  -5.895  1.00 52.69  ? 63   GLU B N     1 
ATOM   3240 C  CA    . GLU B 1 69  ? 42.959  75.338  -5.585  1.00 54.41  ? 63   GLU B CA    1 
ATOM   3241 C  C     . GLU B 1 69  ? 43.803  74.909  -4.382  1.00 53.95  ? 63   GLU B C     1 
ATOM   3242 O  O     . GLU B 1 69  ? 45.035  74.907  -4.424  1.00 55.22  ? 63   GLU B O     1 
ATOM   3243 C  CB    . GLU B 1 69  ? 42.215  76.627  -5.251  1.00 56.57  ? 63   GLU B CB    1 
ATOM   3244 C  CG    . GLU B 1 69  ? 41.138  76.966  -6.238  1.00 63.01  ? 63   GLU B CG    1 
ATOM   3245 C  CD    . GLU B 1 69  ? 41.668  77.287  -7.634  1.00 67.96  ? 63   GLU B CD    1 
ATOM   3246 O  OE1   . GLU B 1 69  ? 42.371  78.314  -7.775  1.00 70.37  ? 63   GLU B OE1   1 
ATOM   3247 O  OE2   . GLU B 1 69  ? 41.378  76.520  -8.589  1.00 70.83  ? 63   GLU B OE2   1 
ATOM   3248 N  N     . ALA B 1 70  ? 43.117  74.544  -3.309  1.00 51.23  ? 64   ALA B N     1 
ATOM   3249 C  CA    . ALA B 1 70  ? 43.769  74.095  -2.100  1.00 48.84  ? 64   ALA B CA    1 
ATOM   3250 C  C     . ALA B 1 70  ? 44.788  72.993  -2.406  1.00 47.80  ? 64   ALA B C     1 
ATOM   3251 O  O     . ALA B 1 70  ? 45.958  73.092  -2.044  1.00 47.81  ? 64   ALA B O     1 
ATOM   3252 C  CB    . ALA B 1 70  ? 42.721  73.585  -1.136  1.00 48.44  ? 64   ALA B CB    1 
ATOM   3253 N  N     . LYS B 1 71  ? 44.343  71.938  -3.070  1.00 46.11  ? 65   LYS B N     1 
ATOM   3254 C  CA    . LYS B 1 71  ? 45.234  70.838  -3.396  1.00 44.40  ? 65   LYS B CA    1 
ATOM   3255 C  C     . LYS B 1 71  ? 46.397  71.253  -4.288  1.00 44.62  ? 65   LYS B C     1 
ATOM   3256 O  O     . LYS B 1 71  ? 47.196  70.416  -4.714  1.00 43.16  ? 65   LYS B O     1 
ATOM   3257 C  CB    . LYS B 1 71  ? 44.433  69.726  -4.051  1.00 43.81  ? 65   LYS B CB    1 
ATOM   3258 C  CG    . LYS B 1 71  ? 43.415  69.123  -3.102  1.00 45.46  ? 65   LYS B CG    1 
ATOM   3259 C  CD    . LYS B 1 71  ? 42.820  67.863  -3.671  1.00 46.01  ? 65   LYS B CD    1 
ATOM   3260 C  CE    . LYS B 1 71  ? 42.059  67.088  -2.634  1.00 45.55  ? 65   LYS B CE    1 
ATOM   3261 N  NZ    . LYS B 1 71  ? 41.690  65.732  -3.168  1.00 47.17  ? 65   LYS B NZ    1 
ATOM   3262 N  N     . LYS B 1 72  ? 46.496  72.551  -4.565  1.00 44.91  ? 66   LYS B N     1 
ATOM   3263 C  CA    . LYS B 1 72  ? 47.577  73.070  -5.404  1.00 45.69  ? 66   LYS B CA    1 
ATOM   3264 C  C     . LYS B 1 72  ? 48.611  73.744  -4.501  1.00 45.04  ? 66   LYS B C     1 
ATOM   3265 O  O     . LYS B 1 72  ? 49.822  73.672  -4.737  1.00 44.98  ? 66   LYS B O     1 
ATOM   3266 C  CB    . LYS B 1 72  ? 47.039  74.084  -6.422  1.00 46.30  ? 66   LYS B CB    1 
ATOM   3267 C  CG    . LYS B 1 72  ? 48.029  74.436  -7.533  1.00 48.73  ? 66   LYS B CG    1 
ATOM   3268 C  CD    . LYS B 1 72  ? 47.530  75.620  -8.370  1.00 51.49  ? 66   LYS B CD    1 
ATOM   3269 C  CE    . LYS B 1 72  ? 48.285  75.789  -9.710  1.00 52.94  ? 66   LYS B CE    1 
ATOM   3270 N  NZ    . LYS B 1 72  ? 49.751  76.119  -9.621  1.00 51.37  ? 66   LYS B NZ    1 
ATOM   3271 N  N     . ILE B 1 73  ? 48.116  74.395  -3.457  1.00 43.54  ? 67   ILE B N     1 
ATOM   3272 C  CA    . ILE B 1 73  ? 48.976  75.078  -2.499  1.00 41.60  ? 67   ILE B CA    1 
ATOM   3273 C  C     . ILE B 1 73  ? 49.303  74.174  -1.297  1.00 40.70  ? 67   ILE B C     1 
ATOM   3274 O  O     . ILE B 1 73  ? 50.319  74.388  -0.615  1.00 39.55  ? 67   ILE B O     1 
ATOM   3275 C  CB    . ILE B 1 73  ? 48.302  76.387  -1.954  1.00 40.53  ? 67   ILE B CB    1 
ATOM   3276 C  CG1   . ILE B 1 73  ? 46.782  76.221  -1.878  1.00 38.61  ? 67   ILE B CG1   1 
ATOM   3277 C  CG2   . ILE B 1 73  ? 48.657  77.560  -2.806  1.00 39.28  ? 67   ILE B CG2   1 
ATOM   3278 C  CD1   . ILE B 1 73  ? 46.106  77.306  -1.095  1.00 37.38  ? 67   ILE B CD1   1 
ATOM   3279 N  N     . LEU B 1 74  ? 48.428  73.189  -1.048  1.00 39.03  ? 68   LEU B N     1 
ATOM   3280 C  CA    . LEU B 1 74  ? 48.562  72.257  0.071   1.00 38.48  ? 68   LEU B CA    1 
ATOM   3281 C  C     . LEU B 1 74  ? 47.954  70.914  -0.277  1.00 38.54  ? 68   LEU B C     1 
ATOM   3282 O  O     . LEU B 1 74  ? 46.947  70.529  0.288   1.00 37.76  ? 68   LEU B O     1 
ATOM   3283 C  CB    . LEU B 1 74  ? 47.848  72.812  1.307   1.00 37.73  ? 68   LEU B CB    1 
ATOM   3284 C  CG    . LEU B 1 74  ? 48.514  72.594  2.668   1.00 35.37  ? 68   LEU B CG    1 
ATOM   3285 C  CD1   . LEU B 1 74  ? 47.580  72.999  3.778   1.00 34.49  ? 68   LEU B CD1   1 
ATOM   3286 C  CD2   . LEU B 1 74  ? 48.880  71.153  2.806   1.00 34.84  ? 68   LEU B CD2   1 
ATOM   3287 N  N     . PRO B 1 75  ? 48.574  70.178  -1.205  1.00 39.80  ? 69   PRO B N     1 
ATOM   3288 C  CA    . PRO B 1 75  ? 48.108  68.865  -1.654  1.00 40.20  ? 69   PRO B CA    1 
ATOM   3289 C  C     . PRO B 1 75  ? 48.298  67.798  -0.611  1.00 40.71  ? 69   PRO B C     1 
ATOM   3290 O  O     . PRO B 1 75  ? 47.729  66.712  -0.712  1.00 39.62  ? 69   PRO B O     1 
ATOM   3291 C  CB    . PRO B 1 75  ? 48.956  68.606  -2.890  1.00 41.66  ? 69   PRO B CB    1 
ATOM   3292 C  CG    . PRO B 1 75  ? 50.261  69.225  -2.507  1.00 42.99  ? 69   PRO B CG    1 
ATOM   3293 C  CD    . PRO B 1 75  ? 49.817  70.552  -1.896  1.00 41.83  ? 69   PRO B CD    1 
ATOM   3294 N  N     . ASN B 1 76  ? 49.111  68.111  0.388   1.00 42.51  ? 70   ASN B N     1 
ATOM   3295 C  CA    . ASN B 1 76  ? 49.376  67.167  1.456   1.00 44.42  ? 70   ASN B CA    1 
ATOM   3296 C  C     . ASN B 1 76  ? 48.591  67.529  2.711   1.00 44.74  ? 70   ASN B C     1 
ATOM   3297 O  O     . ASN B 1 76  ? 49.151  68.013  3.688   1.00 45.40  ? 70   ASN B O     1 
ATOM   3298 C  CB    . ASN B 1 76  ? 50.863  67.136  1.755   1.00 45.15  ? 70   ASN B CB    1 
ATOM   3299 C  CG    . ASN B 1 76  ? 51.209  66.095  2.769   1.00 47.67  ? 70   ASN B CG    1 
ATOM   3300 O  OD1   . ASN B 1 76  ? 52.377  65.744  2.926   1.00 51.79  ? 70   ASN B OD1   1 
ATOM   3301 N  ND2   . ASN B 1 76  ? 50.195  65.585  3.477   1.00 45.86  ? 70   ASN B ND2   1 
ATOM   3302 N  N     . ALA B 1 77  ? 47.288  67.287  2.673   1.00 45.13  ? 71   ALA B N     1 
ATOM   3303 C  CA    . ALA B 1 77  ? 46.419  67.601  3.797   1.00 46.42  ? 71   ALA B CA    1 
ATOM   3304 C  C     . ALA B 1 77  ? 45.297  66.579  3.830   1.00 47.14  ? 71   ALA B C     1 
ATOM   3305 O  O     . ALA B 1 77  ? 45.092  65.853  2.857   1.00 48.54  ? 71   ALA B O     1 
ATOM   3306 C  CB    . ALA B 1 77  ? 45.852  69.007  3.638   1.00 44.12  ? 71   ALA B CB    1 
ATOM   3307 N  N     . VAL B 1 78  ? 44.588  66.502  4.951   1.00 46.64  ? 72   VAL B N     1 
ATOM   3308 C  CA    . VAL B 1 78  ? 43.482  65.565  5.070   1.00 45.86  ? 72   VAL B CA    1 
ATOM   3309 C  C     . VAL B 1 78  ? 42.170  66.221  4.616   1.00 46.48  ? 72   VAL B C     1 
ATOM   3310 O  O     . VAL B 1 78  ? 41.458  66.851  5.400   1.00 46.38  ? 72   VAL B O     1 
ATOM   3311 C  CB    . VAL B 1 78  ? 43.342  65.064  6.514   1.00 44.67  ? 72   VAL B CB    1 
ATOM   3312 C  CG1   . VAL B 1 78  ? 42.124  64.180  6.643   1.00 44.11  ? 72   VAL B CG1   1 
ATOM   3313 C  CG2   . VAL B 1 78  ? 44.580  64.303  6.914   1.00 45.55  ? 72   VAL B CG2   1 
ATOM   3314 N  N     . TYR B 1 79  ? 41.855  66.081  3.335   1.00 47.32  ? 73   TYR B N     1 
ATOM   3315 C  CA    . TYR B 1 79  ? 40.625  66.657  2.804   1.00 48.03  ? 73   TYR B CA    1 
ATOM   3316 C  C     . TYR B 1 79  ? 39.422  65.759  3.084   1.00 47.65  ? 73   TYR B C     1 
ATOM   3317 O  O     . TYR B 1 79  ? 39.278  64.712  2.458   1.00 49.16  ? 73   TYR B O     1 
ATOM   3318 C  CB    . TYR B 1 79  ? 40.761  66.888  1.297   1.00 47.85  ? 73   TYR B CB    1 
ATOM   3319 C  CG    . TYR B 1 79  ? 41.775  67.947  0.943   1.00 47.70  ? 73   TYR B CG    1 
ATOM   3320 C  CD1   . TYR B 1 79  ? 43.113  67.623  0.764   1.00 47.38  ? 73   TYR B CD1   1 
ATOM   3321 C  CD2   . TYR B 1 79  ? 41.404  69.285  0.842   1.00 49.04  ? 73   TYR B CD2   1 
ATOM   3322 C  CE1   . TYR B 1 79  ? 44.058  68.599  0.496   1.00 48.75  ? 73   TYR B CE1   1 
ATOM   3323 C  CE2   . TYR B 1 79  ? 42.344  70.275  0.577   1.00 49.89  ? 73   TYR B CE2   1 
ATOM   3324 C  CZ    . TYR B 1 79  ? 43.668  69.924  0.405   1.00 49.78  ? 73   TYR B CZ    1 
ATOM   3325 O  OH    . TYR B 1 79  ? 44.594  70.908  0.151   1.00 50.40  ? 73   TYR B OH    1 
ATOM   3326 N  N     . LEU B 1 80  ? 38.569  66.170  4.024   1.00 46.05  ? 74   LEU B N     1 
ATOM   3327 C  CA    . LEU B 1 80  ? 37.381  65.398  4.377   1.00 44.91  ? 74   LEU B CA    1 
ATOM   3328 C  C     . LEU B 1 80  ? 36.083  66.069  3.957   1.00 45.49  ? 74   LEU B C     1 
ATOM   3329 O  O     . LEU B 1 80  ? 35.984  67.290  3.900   1.00 45.00  ? 74   LEU B O     1 
ATOM   3330 C  CB    . LEU B 1 80  ? 37.322  65.150  5.877   1.00 43.71  ? 74   LEU B CB    1 
ATOM   3331 C  CG    . LEU B 1 80  ? 38.549  64.478  6.474   1.00 44.07  ? 74   LEU B CG    1 
ATOM   3332 C  CD1   . LEU B 1 80  ? 38.153  63.878  7.804   1.00 42.77  ? 74   LEU B CD1   1 
ATOM   3333 C  CD2   . LEU B 1 80  ? 39.091  63.396  5.523   1.00 45.15  ? 74   LEU B CD2   1 
ATOM   3334 N  N     . PRO B 1 81  ? 35.054  65.264  3.674   1.00 45.83  ? 75   PRO B N     1 
ATOM   3335 C  CA    . PRO B 1 81  ? 33.739  65.747  3.255   1.00 45.30  ? 75   PRO B CA    1 
ATOM   3336 C  C     . PRO B 1 81  ? 32.957  66.277  4.443   1.00 45.28  ? 75   PRO B C     1 
ATOM   3337 O  O     . PRO B 1 81  ? 32.903  65.639  5.496   1.00 45.09  ? 75   PRO B O     1 
ATOM   3338 C  CB    . PRO B 1 81  ? 33.099  64.499  2.677   1.00 46.03  ? 75   PRO B CB    1 
ATOM   3339 C  CG    . PRO B 1 81  ? 33.605  63.431  3.622   1.00 45.80  ? 75   PRO B CG    1 
ATOM   3340 C  CD    . PRO B 1 81  ? 35.080  63.790  3.726   1.00 46.00  ? 75   PRO B CD    1 
ATOM   3341 N  N     . MET B 1 82  ? 32.334  67.432  4.260   1.00 45.55  ? 76   MET B N     1 
ATOM   3342 C  CA    . MET B 1 82  ? 31.553  68.043  5.318   1.00 46.87  ? 76   MET B CA    1 
ATOM   3343 C  C     . MET B 1 82  ? 30.378  67.215  5.818   1.00 47.27  ? 76   MET B C     1 
ATOM   3344 O  O     . MET B 1 82  ? 29.454  66.921  5.070   1.00 48.34  ? 76   MET B O     1 
ATOM   3345 C  CB    . MET B 1 82  ? 31.033  69.402  4.871   1.00 48.10  ? 76   MET B CB    1 
ATOM   3346 C  CG    . MET B 1 82  ? 30.010  69.983  5.824   1.00 50.10  ? 76   MET B CG    1 
ATOM   3347 S  SD    . MET B 1 82  ? 29.993  71.762  5.725   1.00 52.77  ? 76   MET B SD    1 
ATOM   3348 C  CE    . MET B 1 82  ? 29.062  72.081  4.129   1.00 52.23  ? 76   MET B CE    1 
ATOM   3349 N  N     . ARG B 1 83  ? 30.429  66.855  7.096   1.00 47.68  ? 77   ARG B N     1 
ATOM   3350 C  CA    . ARG B 1 83  ? 29.375  66.087  7.752   1.00 47.84  ? 77   ARG B CA    1 
ATOM   3351 C  C     . ARG B 1 83  ? 28.488  67.077  8.510   1.00 48.49  ? 77   ARG B C     1 
ATOM   3352 O  O     . ARG B 1 83  ? 28.298  66.958  9.723   1.00 47.58  ? 77   ARG B O     1 
ATOM   3353 C  CB    . ARG B 1 83  ? 29.972  65.098  8.751   1.00 48.77  ? 77   ARG B CB    1 
ATOM   3354 C  CG    . ARG B 1 83  ? 30.913  64.090  8.156   1.00 50.26  ? 77   ARG B CG    1 
ATOM   3355 C  CD    . ARG B 1 83  ? 31.456  63.168  9.235   1.00 51.45  ? 77   ARG B CD    1 
ATOM   3356 N  NE    . ARG B 1 83  ? 32.365  62.201  8.636   1.00 54.50  ? 77   ARG B NE    1 
ATOM   3357 C  CZ    . ARG B 1 83  ? 33.265  61.491  9.305   1.00 54.59  ? 77   ARG B CZ    1 
ATOM   3358 N  NH1   . ARG B 1 83  ? 33.382  61.630  10.617  1.00 55.88  ? 77   ARG B NH1   1 
ATOM   3359 N  NH2   . ARG B 1 83  ? 34.067  60.656  8.652   1.00 55.07  ? 77   ARG B NH2   1 
ATOM   3360 N  N     . LYS B 1 84  ? 27.959  68.056  7.783   1.00 48.97  ? 78   LYS B N     1 
ATOM   3361 C  CA    . LYS B 1 84  ? 27.102  69.087  8.350   1.00 49.58  ? 78   LYS B CA    1 
ATOM   3362 C  C     . LYS B 1 84  ? 26.117  68.595  9.401   1.00 49.99  ? 78   LYS B C     1 
ATOM   3363 O  O     . LYS B 1 84  ? 25.497  69.397  10.089  1.00 49.61  ? 78   LYS B O     1 
ATOM   3364 C  CB    . LYS B 1 84  ? 26.320  69.783  7.237   1.00 50.80  ? 78   LYS B CB    1 
ATOM   3365 C  CG    . LYS B 1 84  ? 25.649  71.086  7.667   1.00 52.04  ? 78   LYS B CG    1 
ATOM   3366 C  CD    . LYS B 1 84  ? 26.712  72.092  8.137   1.00 53.20  ? 78   LYS B CD    1 
ATOM   3367 C  CE    . LYS B 1 84  ? 26.106  73.397  8.640   1.00 52.66  ? 78   LYS B CE    1 
ATOM   3368 N  NZ    . LYS B 1 84  ? 25.504  74.221  7.542   1.00 52.92  ? 78   LYS B NZ    1 
ATOM   3369 N  N     . GLU B 1 85  ? 25.951  67.287  9.525   1.00 51.40  ? 79   GLU B N     1 
ATOM   3370 C  CA    . GLU B 1 85  ? 25.019  66.780  10.515  1.00 53.72  ? 79   GLU B CA    1 
ATOM   3371 C  C     . GLU B 1 85  ? 25.652  66.717  11.901  1.00 54.09  ? 79   GLU B C     1 
ATOM   3372 O  O     . GLU B 1 85  ? 25.069  67.205  12.871  1.00 54.80  ? 79   GLU B O     1 
ATOM   3373 C  CB    . GLU B 1 85  ? 24.487  65.399  10.116  1.00 55.76  ? 79   GLU B CB    1 
ATOM   3374 C  CG    . GLU B 1 85  ? 22.956  65.345  10.006  1.00 60.08  ? 79   GLU B CG    1 
ATOM   3375 C  CD    . GLU B 1 85  ? 22.237  66.111  11.133  1.00 62.42  ? 79   GLU B CD    1 
ATOM   3376 O  OE1   . GLU B 1 85  ? 21.059  66.501  10.945  1.00 63.64  ? 79   GLU B OE1   1 
ATOM   3377 O  OE2   . GLU B 1 85  ? 22.842  66.321  12.208  1.00 63.12  ? 79   GLU B OE2   1 
ATOM   3378 N  N     . VAL B 1 86  ? 26.838  66.116  12.002  1.00 53.51  ? 80   VAL B N     1 
ATOM   3379 C  CA    . VAL B 1 86  ? 27.526  66.018  13.288  1.00 50.65  ? 80   VAL B CA    1 
ATOM   3380 C  C     . VAL B 1 86  ? 27.791  67.426  13.811  1.00 49.94  ? 80   VAL B C     1 
ATOM   3381 O  O     . VAL B 1 86  ? 27.664  67.687  15.004  1.00 50.77  ? 80   VAL B O     1 
ATOM   3382 C  CB    . VAL B 1 86  ? 28.867  65.275  13.156  1.00 49.83  ? 80   VAL B CB    1 
ATOM   3383 C  CG1   . VAL B 1 86  ? 29.611  65.296  14.484  1.00 48.14  ? 80   VAL B CG1   1 
ATOM   3384 C  CG2   . VAL B 1 86  ? 28.621  63.859  12.693  1.00 47.93  ? 80   VAL B CG2   1 
ATOM   3385 N  N     . TYR B 1 87  ? 28.142  68.336  12.908  1.00 47.17  ? 81   TYR B N     1 
ATOM   3386 C  CA    . TYR B 1 87  ? 28.411  69.702  13.302  1.00 44.80  ? 81   TYR B CA    1 
ATOM   3387 C  C     . TYR B 1 87  ? 27.166  70.262  13.975  1.00 45.91  ? 81   TYR B C     1 
ATOM   3388 O  O     . TYR B 1 87  ? 27.249  70.861  15.037  1.00 46.24  ? 81   TYR B O     1 
ATOM   3389 C  CB    . TYR B 1 87  ? 28.767  70.541  12.082  1.00 41.99  ? 81   TYR B CB    1 
ATOM   3390 C  CG    . TYR B 1 87  ? 29.796  69.918  11.159  1.00 39.56  ? 81   TYR B CG    1 
ATOM   3391 C  CD1   . TYR B 1 87  ? 30.530  68.785  11.538  1.00 39.35  ? 81   TYR B CD1   1 
ATOM   3392 C  CD2   . TYR B 1 87  ? 30.043  70.467  9.903   1.00 37.59  ? 81   TYR B CD2   1 
ATOM   3393 C  CE1   . TYR B 1 87  ? 31.480  68.223  10.684  1.00 36.70  ? 81   TYR B CE1   1 
ATOM   3394 C  CE2   . TYR B 1 87  ? 30.983  69.921  9.051   1.00 36.24  ? 81   TYR B CE2   1 
ATOM   3395 C  CZ    . TYR B 1 87  ? 31.698  68.803  9.440   1.00 36.85  ? 81   TYR B CZ    1 
ATOM   3396 O  OH    . TYR B 1 87  ? 32.627  68.281  8.572   1.00 35.17  ? 81   TYR B OH    1 
ATOM   3397 N  N     . GLN B 1 88  ? 26.010  70.054  13.357  1.00 47.50  ? 82   GLN B N     1 
ATOM   3398 C  CA    . GLN B 1 88  ? 24.750  70.541  13.910  1.00 49.98  ? 82   GLN B CA    1 
ATOM   3399 C  C     . GLN B 1 88  ? 24.492  70.064  15.334  1.00 50.89  ? 82   GLN B C     1 
ATOM   3400 O  O     . GLN B 1 88  ? 24.336  70.873  16.255  1.00 51.94  ? 82   GLN B O     1 
ATOM   3401 C  CB    . GLN B 1 88  ? 23.584  70.103  13.025  1.00 50.75  ? 82   GLN B CB    1 
ATOM   3402 C  CG    . GLN B 1 88  ? 23.471  70.902  11.753  1.00 55.87  ? 82   GLN B CG    1 
ATOM   3403 C  CD    . GLN B 1 88  ? 22.482  70.307  10.775  1.00 58.48  ? 82   GLN B CD    1 
ATOM   3404 O  OE1   . GLN B 1 88  ? 22.017  70.988  9.848   1.00 59.40  ? 82   GLN B OE1   1 
ATOM   3405 N  NE2   . GLN B 1 88  ? 22.159  69.025  10.963  1.00 58.37  ? 82   GLN B NE2   1 
ATOM   3406 N  N     . GLN B 1 89  ? 24.446  68.746  15.505  1.00 51.13  ? 83   GLN B N     1 
ATOM   3407 C  CA    . GLN B 1 89  ? 24.179  68.134  16.801  1.00 50.35  ? 83   GLN B CA    1 
ATOM   3408 C  C     . GLN B 1 89  ? 25.112  68.651  17.879  1.00 48.30  ? 83   GLN B C     1 
ATOM   3409 O  O     . GLN B 1 89  ? 24.676  68.894  18.998  1.00 47.31  ? 83   GLN B O     1 
ATOM   3410 C  CB    . GLN B 1 89  ? 24.293  66.610  16.692  1.00 53.37  ? 83   GLN B CB    1 
ATOM   3411 C  CG    . GLN B 1 89  ? 23.445  66.007  15.573  1.00 56.60  ? 83   GLN B CG    1 
ATOM   3412 C  CD    . GLN B 1 89  ? 23.728  64.529  15.340  1.00 59.91  ? 83   GLN B CD    1 
ATOM   3413 O  OE1   . GLN B 1 89  ? 23.389  63.979  14.283  1.00 61.17  ? 83   GLN B OE1   1 
ATOM   3414 N  NE2   . GLN B 1 89  ? 24.346  63.875  16.329  1.00 60.76  ? 83   GLN B NE2   1 
ATOM   3415 N  N     . VAL B 1 90  ? 26.390  68.812  17.535  1.00 46.60  ? 84   VAL B N     1 
ATOM   3416 C  CA    . VAL B 1 90  ? 27.398  69.316  18.470  1.00 44.72  ? 84   VAL B CA    1 
ATOM   3417 C  C     . VAL B 1 90  ? 27.028  70.733  18.892  1.00 44.61  ? 84   VAL B C     1 
ATOM   3418 O  O     . VAL B 1 90  ? 27.105  71.088  20.074  1.00 44.57  ? 84   VAL B O     1 
ATOM   3419 C  CB    . VAL B 1 90  ? 28.801  69.337  17.831  1.00 43.69  ? 84   VAL B CB    1 
ATOM   3420 C  CG1   . VAL B 1 90  ? 29.754  70.089  18.705  1.00 42.79  ? 84   VAL B CG1   1 
ATOM   3421 C  CG2   . VAL B 1 90  ? 29.304  67.933  17.641  1.00 43.17  ? 84   VAL B CG2   1 
ATOM   3422 N  N     . SER B 1 91  ? 26.619  71.536  17.914  1.00 43.41  ? 85   SER B N     1 
ATOM   3423 C  CA    . SER B 1 91  ? 26.217  72.906  18.172  1.00 41.60  ? 85   SER B CA    1 
ATOM   3424 C  C     . SER B 1 91  ? 25.114  72.882  19.197  1.00 40.86  ? 85   SER B C     1 
ATOM   3425 O  O     . SER B 1 91  ? 25.254  73.455  20.266  1.00 39.25  ? 85   SER B O     1 
ATOM   3426 C  CB    . SER B 1 91  ? 25.701  73.559  16.901  1.00 42.49  ? 85   SER B CB    1 
ATOM   3427 O  OG    . SER B 1 91  ? 25.268  74.882  17.161  1.00 43.48  ? 85   SER B OG    1 
ATOM   3428 N  N     . SER B 1 92  ? 24.019  72.208  18.858  1.00 41.40  ? 86   SER B N     1 
ATOM   3429 C  CA    . SER B 1 92  ? 22.871  72.083  19.748  1.00 43.25  ? 86   SER B CA    1 
ATOM   3430 C  C     . SER B 1 92  ? 23.313  71.755  21.166  1.00 44.08  ? 86   SER B C     1 
ATOM   3431 O  O     . SER B 1 92  ? 22.710  72.215  22.133  1.00 44.59  ? 86   SER B O     1 
ATOM   3432 C  CB    . SER B 1 92  ? 21.947  70.972  19.261  1.00 44.24  ? 86   SER B CB    1 
ATOM   3433 O  OG    . SER B 1 92  ? 21.807  71.019  17.856  1.00 46.85  ? 86   SER B OG    1 
ATOM   3434 N  N     . ARG B 1 93  ? 24.357  70.938  21.284  1.00 45.28  ? 87   ARG B N     1 
ATOM   3435 C  CA    . ARG B 1 93  ? 24.874  70.549  22.589  1.00 45.77  ? 87   ARG B CA    1 
ATOM   3436 C  C     . ARG B 1 93  ? 25.611  71.701  23.235  1.00 45.71  ? 87   ARG B C     1 
ATOM   3437 O  O     . ARG B 1 93  ? 25.214  72.184  24.289  1.00 44.57  ? 87   ARG B O     1 
ATOM   3438 C  CB    . ARG B 1 93  ? 25.804  69.336  22.473  1.00 46.67  ? 87   ARG B CB    1 
ATOM   3439 C  CG    . ARG B 1 93  ? 25.085  67.974  22.526  1.00 48.87  ? 87   ARG B CG    1 
ATOM   3440 C  CD    . ARG B 1 93  ? 26.078  66.811  22.621  1.00 51.13  ? 87   ARG B CD    1 
ATOM   3441 N  NE    . ARG B 1 93  ? 26.729  66.469  21.350  1.00 53.16  ? 87   ARG B NE    1 
ATOM   3442 C  CZ    . ARG B 1 93  ? 26.135  65.814  20.354  1.00 55.37  ? 87   ARG B CZ    1 
ATOM   3443 N  NH1   . ARG B 1 93  ? 24.873  65.428  20.473  1.00 57.60  ? 87   ARG B NH1   1 
ATOM   3444 N  NH2   . ARG B 1 93  ? 26.802  65.526  19.243  1.00 55.69  ? 87   ARG B NH2   1 
ATOM   3445 N  N     . ILE B 1 94  ? 26.681  72.157  22.606  1.00 46.68  ? 88   ILE B N     1 
ATOM   3446 C  CA    . ILE B 1 94  ? 27.422  73.273  23.180  1.00 48.57  ? 88   ILE B CA    1 
ATOM   3447 C  C     . ILE B 1 94  ? 26.523  74.479  23.442  1.00 50.58  ? 88   ILE B C     1 
ATOM   3448 O  O     . ILE B 1 94  ? 26.574  75.082  24.511  1.00 51.20  ? 88   ILE B O     1 
ATOM   3449 C  CB    . ILE B 1 94  ? 28.581  73.728  22.266  1.00 47.20  ? 88   ILE B CB    1 
ATOM   3450 C  CG1   . ILE B 1 94  ? 29.684  72.669  22.268  1.00 45.68  ? 88   ILE B CG1   1 
ATOM   3451 C  CG2   . ILE B 1 94  ? 29.108  75.089  22.731  1.00 46.43  ? 88   ILE B CG2   1 
ATOM   3452 C  CD1   . ILE B 1 94  ? 31.013  73.147  21.725  1.00 45.19  ? 88   ILE B CD1   1 
ATOM   3453 N  N     . MET B 1 95  ? 25.697  74.827  22.464  1.00 53.26  ? 89   MET B N     1 
ATOM   3454 C  CA    . MET B 1 95  ? 24.813  75.976  22.593  1.00 55.16  ? 89   MET B CA    1 
ATOM   3455 C  C     . MET B 1 95  ? 23.942  75.919  23.852  1.00 57.74  ? 89   MET B C     1 
ATOM   3456 O  O     . MET B 1 95  ? 23.730  76.928  24.530  1.00 57.42  ? 89   MET B O     1 
ATOM   3457 C  CB    . MET B 1 95  ? 23.961  76.086  21.334  1.00 53.10  ? 89   MET B CB    1 
ATOM   3458 C  CG    . MET B 1 95  ? 23.978  77.473  20.717  1.00 53.83  ? 89   MET B CG    1 
ATOM   3459 S  SD    . MET B 1 95  ? 25.621  78.238  20.505  1.00 52.68  ? 89   MET B SD    1 
ATOM   3460 C  CE    . MET B 1 95  ? 25.935  77.954  18.782  1.00 52.95  ? 89   MET B CE    1 
ATOM   3461 N  N     . ASN B 1 96  ? 23.458  74.727  24.177  1.00 61.40  ? 90   ASN B N     1 
ATOM   3462 C  CA    . ASN B 1 96  ? 22.625  74.532  25.361  1.00 64.59  ? 90   ASN B CA    1 
ATOM   3463 C  C     . ASN B 1 96  ? 23.388  74.793  26.658  1.00 64.79  ? 90   ASN B C     1 
ATOM   3464 O  O     . ASN B 1 96  ? 22.873  75.459  27.556  1.00 65.31  ? 90   ASN B O     1 
ATOM   3465 C  CB    . ASN B 1 96  ? 22.058  73.111  25.364  1.00 67.44  ? 90   ASN B CB    1 
ATOM   3466 C  CG    . ASN B 1 96  ? 20.641  73.056  24.833  1.00 69.98  ? 90   ASN B CG    1 
ATOM   3467 O  OD1   . ASN B 1 96  ? 19.680  73.265  25.584  1.00 71.79  ? 90   ASN B OD1   1 
ATOM   3468 N  ND2   . ASN B 1 96  ? 20.498  72.797  23.529  1.00 70.67  ? 90   ASN B ND2   1 
ATOM   3469 N  N     . LEU B 1 97  ? 24.606  74.263  26.750  1.00 64.64  ? 91   LEU B N     1 
ATOM   3470 C  CA    . LEU B 1 97  ? 25.446  74.449  27.927  1.00 64.07  ? 91   LEU B CA    1 
ATOM   3471 C  C     . LEU B 1 97  ? 25.427  75.924  28.326  1.00 65.47  ? 91   LEU B C     1 
ATOM   3472 O  O     . LEU B 1 97  ? 25.107  76.266  29.472  1.00 66.27  ? 91   LEU B O     1 
ATOM   3473 C  CB    . LEU B 1 97  ? 26.886  74.020  27.626  1.00 63.20  ? 91   LEU B CB    1 
ATOM   3474 C  CG    . LEU B 1 97  ? 27.167  72.547  27.293  1.00 62.82  ? 91   LEU B CG    1 
ATOM   3475 C  CD1   . LEU B 1 97  ? 28.495  72.393  26.573  1.00 61.48  ? 91   LEU B CD1   1 
ATOM   3476 C  CD2   . LEU B 1 97  ? 27.170  71.740  28.571  1.00 63.22  ? 91   LEU B CD2   1 
ATOM   3477 N  N     . LEU B 1 98  ? 25.743  76.795  27.367  1.00 65.82  ? 92   LEU B N     1 
ATOM   3478 C  CA    . LEU B 1 98  ? 25.781  78.238  27.612  1.00 65.72  ? 92   LEU B CA    1 
ATOM   3479 C  C     . LEU B 1 98  ? 24.431  78.751  28.070  1.00 66.50  ? 92   LEU B C     1 
ATOM   3480 O  O     . LEU B 1 98  ? 24.349  79.561  28.982  1.00 65.17  ? 92   LEU B O     1 
ATOM   3481 C  CB    . LEU B 1 98  ? 26.194  78.986  26.345  1.00 64.19  ? 92   LEU B CB    1 
ATOM   3482 C  CG    . LEU B 1 98  ? 27.218  78.309  25.433  1.00 63.07  ? 92   LEU B CG    1 
ATOM   3483 C  CD1   . LEU B 1 98  ? 27.881  79.344  24.537  1.00 61.82  ? 92   LEU B CD1   1 
ATOM   3484 C  CD2   . LEU B 1 98  ? 28.271  77.628  26.273  1.00 63.64  ? 92   LEU B CD2   1 
ATOM   3485 N  N     . ARG B 1 99  ? 23.378  78.264  27.422  1.00 69.21  ? 93   ARG B N     1 
ATOM   3486 C  CA    . ARG B 1 99  ? 22.004  78.644  27.733  1.00 71.33  ? 93   ARG B CA    1 
ATOM   3487 C  C     . ARG B 1 99  ? 21.751  78.501  29.223  1.00 72.02  ? 93   ARG B C     1 
ATOM   3488 O  O     . ARG B 1 99  ? 20.683  78.859  29.715  1.00 73.11  ? 93   ARG B O     1 
ATOM   3489 C  CB    . ARG B 1 99  ? 21.020  77.753  26.956  1.00 72.87  ? 93   ARG B CB    1 
ATOM   3490 C  CG    . ARG B 1 99  ? 19.566  78.247  26.939  1.00 74.31  ? 93   ARG B CG    1 
ATOM   3491 C  CD    . ARG B 1 99  ? 18.615  77.221  26.310  1.00 74.15  ? 93   ARG B CD    1 
ATOM   3492 N  NE    . ARG B 1 99  ? 17.304  77.791  25.992  1.00 74.11  ? 93   ARG B NE    1 
ATOM   3493 C  CZ    . ARG B 1 99  ? 17.106  78.740  25.081  1.00 74.21  ? 93   ARG B CZ    1 
ATOM   3494 N  NH1   . ARG B 1 99  ? 18.130  79.231  24.398  1.00 74.24  ? 93   ARG B NH1   1 
ATOM   3495 N  NH2   . ARG B 1 99  ? 15.886  79.196  24.843  1.00 73.90  ? 93   ARG B NH2   1 
ATOM   3496 N  N     . GLU B 1 100 ? 22.729  77.964  29.941  1.00 72.30  ? 94   GLU B N     1 
ATOM   3497 C  CA    . GLU B 1 100 ? 22.588  77.808  31.376  1.00 73.28  ? 94   GLU B CA    1 
ATOM   3498 C  C     . GLU B 1 100 ? 23.384  78.833  32.180  1.00 72.33  ? 94   GLU B C     1 
ATOM   3499 O  O     . GLU B 1 100 ? 23.592  78.676  33.376  1.00 72.39  ? 94   GLU B O     1 
ATOM   3500 C  CB    . GLU B 1 100 ? 22.973  76.391  31.789  1.00 75.19  ? 94   GLU B CB    1 
ATOM   3501 C  CG    . GLU B 1 100 ? 21.770  75.456  31.852  1.00 78.01  ? 94   GLU B CG    1 
ATOM   3502 C  CD    . GLU B 1 100 ? 20.703  75.928  32.852  1.00 79.69  ? 94   GLU B CD    1 
ATOM   3503 O  OE1   . GLU B 1 100 ? 20.584  75.321  33.945  1.00 79.27  ? 94   GLU B OE1   1 
ATOM   3504 O  OE2   . GLU B 1 100 ? 19.988  76.913  32.544  1.00 80.57  ? 94   GLU B OE2   1 
ATOM   3505 N  N     . TYR B 1 101 ? 23.829  79.886  31.512  1.00 71.76  ? 95   TYR B N     1 
ATOM   3506 C  CA    . TYR B 1 101 ? 24.576  80.941  32.170  1.00 70.24  ? 95   TYR B CA    1 
ATOM   3507 C  C     . TYR B 1 101 ? 23.827  82.259  31.994  1.00 70.02  ? 95   TYR B C     1 
ATOM   3508 O  O     . TYR B 1 101 ? 24.206  83.288  32.556  1.00 70.50  ? 95   TYR B O     1 
ATOM   3509 C  CB    . TYR B 1 101 ? 25.975  81.045  31.573  1.00 69.35  ? 95   TYR B CB    1 
ATOM   3510 C  CG    . TYR B 1 101 ? 26.876  79.874  31.898  1.00 68.86  ? 95   TYR B CG    1 
ATOM   3511 C  CD1   . TYR B 1 101 ? 26.552  78.579  31.495  1.00 67.93  ? 95   TYR B CD1   1 
ATOM   3512 C  CD2   . TYR B 1 101 ? 28.067  80.066  32.597  1.00 69.28  ? 95   TYR B CD2   1 
ATOM   3513 C  CE1   . TYR B 1 101 ? 27.393  77.510  31.780  1.00 67.47  ? 95   TYR B CE1   1 
ATOM   3514 C  CE2   . TYR B 1 101 ? 28.912  79.006  32.886  1.00 68.30  ? 95   TYR B CE2   1 
ATOM   3515 C  CZ    . TYR B 1 101 ? 28.572  77.733  32.479  1.00 67.99  ? 95   TYR B CZ    1 
ATOM   3516 O  OH    . TYR B 1 101 ? 29.406  76.691  32.802  1.00 67.10  ? 95   TYR B OH    1 
ATOM   3517 N  N     . SER B 1 102 ? 22.750  82.215  31.215  1.00 69.02  ? 96   SER B N     1 
ATOM   3518 C  CA    . SER B 1 102 ? 21.930  83.393  30.964  1.00 67.44  ? 96   SER B CA    1 
ATOM   3519 C  C     . SER B 1 102 ? 20.763  83.007  30.061  1.00 66.65  ? 96   SER B C     1 
ATOM   3520 O  O     . SER B 1 102 ? 20.949  82.369  29.028  1.00 66.06  ? 96   SER B O     1 
ATOM   3521 C  CB    . SER B 1 102 ? 22.772  84.488  30.304  1.00 66.90  ? 96   SER B CB    1 
ATOM   3522 O  OG    . SER B 1 102 ? 22.058  85.706  30.243  1.00 64.86  ? 96   SER B OG    1 
ATOM   3523 N  N     . GLU B 1 103 ? 19.560  83.383  30.470  1.00 65.95  ? 97   GLU B N     1 
ATOM   3524 C  CA    . GLU B 1 103 ? 18.353  83.086  29.714  1.00 65.75  ? 97   GLU B CA    1 
ATOM   3525 C  C     . GLU B 1 103 ? 18.239  84.047  28.538  1.00 63.96  ? 97   GLU B C     1 
ATOM   3526 O  O     . GLU B 1 103 ? 17.449  83.827  27.615  1.00 63.31  ? 97   GLU B O     1 
ATOM   3527 C  CB    . GLU B 1 103 ? 17.128  83.229  30.619  1.00 68.33  ? 97   GLU B CB    1 
ATOM   3528 C  CG    . GLU B 1 103 ? 16.977  84.614  31.236  1.00 71.41  ? 97   GLU B CG    1 
ATOM   3529 C  CD    . GLU B 1 103 ? 18.120  84.987  32.180  1.00 73.85  ? 97   GLU B CD    1 
ATOM   3530 O  OE1   . GLU B 1 103 ? 18.236  86.194  32.513  1.00 73.19  ? 97   GLU B OE1   1 
ATOM   3531 O  OE2   . GLU B 1 103 ? 18.888  84.080  32.593  1.00 75.50  ? 97   GLU B OE2   1 
ATOM   3532 N  N     . LYS B 1 104 ? 19.040  85.110  28.589  1.00 62.04  ? 98   LYS B N     1 
ATOM   3533 C  CA    . LYS B 1 104 ? 19.077  86.147  27.553  1.00 59.98  ? 98   LYS B CA    1 
ATOM   3534 C  C     . LYS B 1 104 ? 20.257  85.935  26.599  1.00 57.93  ? 98   LYS B C     1 
ATOM   3535 O  O     . LYS B 1 104 ? 21.173  86.750  26.504  1.00 56.42  ? 98   LYS B O     1 
ATOM   3536 C  CB    . LYS B 1 104 ? 19.155  87.540  28.206  1.00 60.37  ? 98   LYS B CB    1 
ATOM   3537 C  CG    . LYS B 1 104 ? 17.802  88.130  28.647  1.00 59.92  ? 98   LYS B CG    1 
ATOM   3538 C  CD    . LYS B 1 104 ? 16.908  87.093  29.319  1.00 59.45  ? 98   LYS B CD    1 
ATOM   3539 C  CE    . LYS B 1 104 ? 15.632  87.694  29.873  1.00 59.22  ? 98   LYS B CE    1 
ATOM   3540 N  NZ    . LYS B 1 104 ? 15.891  88.512  31.101  1.00 59.82  ? 98   LYS B NZ    1 
ATOM   3541 N  N     . ILE B 1 105 ? 20.211  84.820  25.885  1.00 56.67  ? 99   ILE B N     1 
ATOM   3542 C  CA    . ILE B 1 105 ? 21.254  84.456  24.939  1.00 54.08  ? 99   ILE B CA    1 
ATOM   3543 C  C     . ILE B 1 105 ? 20.809  84.746  23.517  1.00 52.56  ? 99   ILE B C     1 
ATOM   3544 O  O     . ILE B 1 105 ? 19.630  84.949  23.250  1.00 52.02  ? 99   ILE B O     1 
ATOM   3545 C  CB    . ILE B 1 105 ? 21.592  82.943  25.062  1.00 53.68  ? 99   ILE B CB    1 
ATOM   3546 C  CG1   . ILE B 1 105 ? 22.657  82.555  24.038  1.00 53.58  ? 99   ILE B CG1   1 
ATOM   3547 C  CG2   . ILE B 1 105 ? 20.318  82.104  24.902  1.00 51.55  ? 99   ILE B CG2   1 
ATOM   3548 C  CD1   . ILE B 1 105 ? 23.025  81.089  24.056  1.00 54.33  ? 99   ILE B CD1   1 
ATOM   3549 N  N     . GLU B 1 106 ? 21.764  84.765  22.604  1.00 51.39  ? 100  GLU B N     1 
ATOM   3550 C  CA    . GLU B 1 106 ? 21.452  85.006  21.210  1.00 50.42  ? 100  GLU B CA    1 
ATOM   3551 C  C     . GLU B 1 106 ? 22.384  84.240  20.282  1.00 48.77  ? 100  GLU B C     1 
ATOM   3552 O  O     . GLU B 1 106 ? 23.550  84.618  20.098  1.00 47.53  ? 100  GLU B O     1 
ATOM   3553 C  CB    . GLU B 1 106 ? 21.535  86.493  20.904  1.00 52.10  ? 100  GLU B CB    1 
ATOM   3554 C  CG    . GLU B 1 106 ? 21.547  86.796  19.428  1.00 54.16  ? 100  GLU B CG    1 
ATOM   3555 C  CD    . GLU B 1 106 ? 21.276  88.240  19.146  1.00 55.87  ? 100  GLU B CD    1 
ATOM   3556 O  OE1   . GLU B 1 106 ? 21.451  88.654  17.984  1.00 58.46  ? 100  GLU B OE1   1 
ATOM   3557 O  OE2   . GLU B 1 106 ? 20.875  88.961  20.085  1.00 56.53  ? 100  GLU B OE2   1 
ATOM   3558 N  N     . ILE B 1 107 ? 21.855  83.167  19.695  1.00 46.91  ? 101  ILE B N     1 
ATOM   3559 C  CA    . ILE B 1 107 ? 22.614  82.324  18.773  1.00 45.91  ? 101  ILE B CA    1 
ATOM   3560 C  C     . ILE B 1 107 ? 22.772  83.023  17.410  1.00 45.93  ? 101  ILE B C     1 
ATOM   3561 O  O     . ILE B 1 107 ? 21.798  83.262  16.692  1.00 47.78  ? 101  ILE B O     1 
ATOM   3562 C  CB    . ILE B 1 107 ? 21.921  80.924  18.594  1.00 44.63  ? 101  ILE B CB    1 
ATOM   3563 C  CG1   . ILE B 1 107 ? 22.063  80.090  19.865  1.00 45.03  ? 101  ILE B CG1   1 
ATOM   3564 C  CG2   . ILE B 1 107 ? 22.603  80.118  17.505  1.00 43.99  ? 101  ILE B CG2   1 
ATOM   3565 C  CD1   . ILE B 1 107 ? 21.537  80.728  21.113  1.00 45.89  ? 101  ILE B CD1   1 
ATOM   3566 N  N     . ALA B 1 108 ? 24.003  83.370  17.060  1.00 44.32  ? 102  ALA B N     1 
ATOM   3567 C  CA    . ALA B 1 108 ? 24.246  84.030  15.789  1.00 43.61  ? 102  ALA B CA    1 
ATOM   3568 C  C     . ALA B 1 108 ? 24.248  83.012  14.655  1.00 44.15  ? 102  ALA B C     1 
ATOM   3569 O  O     . ALA B 1 108 ? 23.580  83.198  13.629  1.00 44.79  ? 102  ALA B O     1 
ATOM   3570 C  CB    . ALA B 1 108 ? 25.560  84.758  15.833  1.00 42.92  ? 102  ALA B CB    1 
ATOM   3571 N  N     . SER B 1 109 ? 25.001  81.932  14.841  1.00 42.99  ? 103  SER B N     1 
ATOM   3572 C  CA    . SER B 1 109 ? 25.065  80.902  13.821  1.00 42.27  ? 103  SER B CA    1 
ATOM   3573 C  C     . SER B 1 109 ? 25.282  79.525  14.402  1.00 40.11  ? 103  SER B C     1 
ATOM   3574 O  O     . SER B 1 109 ? 24.932  79.257  15.537  1.00 37.15  ? 103  SER B O     1 
ATOM   3575 C  CB    . SER B 1 109 ? 26.173  81.211  12.789  1.00 44.36  ? 103  SER B CB    1 
ATOM   3576 O  OG    . SER B 1 109 ? 27.478  80.891  13.260  1.00 43.67  ? 103  SER B OG    1 
ATOM   3577 N  N     . ILE B 1 110 ? 25.861  78.661  13.581  1.00 40.06  ? 104  ILE B N     1 
ATOM   3578 C  CA    . ILE B 1 110 ? 26.154  77.298  13.943  1.00 39.05  ? 104  ILE B CA    1 
ATOM   3579 C  C     . ILE B 1 110 ? 27.306  77.269  14.918  1.00 39.43  ? 104  ILE B C     1 
ATOM   3580 O  O     . ILE B 1 110 ? 27.529  76.263  15.563  1.00 41.28  ? 104  ILE B O     1 
ATOM   3581 C  CB    . ILE B 1 110 ? 26.536  76.465  12.692  1.00 38.07  ? 104  ILE B CB    1 
ATOM   3582 C  CG1   . ILE B 1 110 ? 26.742  74.997  13.060  1.00 38.23  ? 104  ILE B CG1   1 
ATOM   3583 C  CG2   . ILE B 1 110 ? 27.836  76.962  12.100  1.00 39.25  ? 104  ILE B CG2   1 
ATOM   3584 C  CD1   . ILE B 1 110 ? 25.473  74.263  13.426  1.00 37.80  ? 104  ILE B CD1   1 
ATOM   3585 N  N     . ASP B 1 111 ? 28.037  78.366  15.046  1.00 40.19  ? 105  ASP B N     1 
ATOM   3586 C  CA    . ASP B 1 111 ? 29.191  78.379  15.957  1.00 41.38  ? 105  ASP B CA    1 
ATOM   3587 C  C     . ASP B 1 111 ? 29.346  79.645  16.805  1.00 40.43  ? 105  ASP B C     1 
ATOM   3588 O  O     . ASP B 1 111 ? 30.453  79.970  17.230  1.00 37.87  ? 105  ASP B O     1 
ATOM   3589 C  CB    . ASP B 1 111 ? 30.466  78.211  15.152  1.00 43.44  ? 105  ASP B CB    1 
ATOM   3590 C  CG    . ASP B 1 111 ? 30.720  79.397  14.271  1.00 45.55  ? 105  ASP B CG    1 
ATOM   3591 O  OD1   . ASP B 1 111 ? 29.866  79.683  13.403  1.00 49.00  ? 105  ASP B OD1   1 
ATOM   3592 O  OD2   . ASP B 1 111 ? 31.749  80.062  14.455  1.00 45.12  ? 105  ASP B OD2   1 
ATOM   3593 N  N     . GLU B 1 112 ? 28.244  80.354  17.039  1.00 41.55  ? 106  GLU B N     1 
ATOM   3594 C  CA    . GLU B 1 112 ? 28.265  81.584  17.825  1.00 41.72  ? 106  GLU B CA    1 
ATOM   3595 C  C     . GLU B 1 112 ? 27.029  81.983  18.594  1.00 41.75  ? 106  GLU B C     1 
ATOM   3596 O  O     . GLU B 1 112 ? 25.907  81.659  18.238  1.00 43.97  ? 106  GLU B O     1 
ATOM   3597 C  CB    . GLU B 1 112 ? 28.627  82.751  16.956  1.00 41.69  ? 106  GLU B CB    1 
ATOM   3598 C  CG    . GLU B 1 112 ? 30.056  83.035  17.054  1.00 45.94  ? 106  GLU B CG    1 
ATOM   3599 C  CD    . GLU B 1 112 ? 30.707  82.901  15.736  1.00 47.74  ? 106  GLU B CD    1 
ATOM   3600 O  OE1   . GLU B 1 112 ? 30.290  83.672  14.852  1.00 48.67  ? 106  GLU B OE1   1 
ATOM   3601 O  OE2   . GLU B 1 112 ? 31.607  82.043  15.581  1.00 46.51  ? 106  GLU B OE2   1 
ATOM   3602 N  N     . ALA B 1 113 ? 27.238  82.736  19.650  1.00 40.66  ? 107  ALA B N     1 
ATOM   3603 C  CA    . ALA B 1 113 ? 26.114  83.149  20.438  1.00 41.63  ? 107  ALA B CA    1 
ATOM   3604 C  C     . ALA B 1 113 ? 26.570  84.311  21.276  1.00 42.38  ? 107  ALA B C     1 
ATOM   3605 O  O     . ALA B 1 113 ? 27.732  84.384  21.664  1.00 42.71  ? 107  ALA B O     1 
ATOM   3606 C  CB    . ALA B 1 113 ? 25.650  81.994  21.322  1.00 41.74  ? 107  ALA B CB    1 
ATOM   3607 N  N     . TYR B 1 114 ? 25.659  85.231  21.538  1.00 42.15  ? 108  TYR B N     1 
ATOM   3608 C  CA    . TYR B 1 114 ? 25.995  86.372  22.345  1.00 43.66  ? 108  TYR B CA    1 
ATOM   3609 C  C     . TYR B 1 114 ? 25.340  86.182  23.696  1.00 44.66  ? 108  TYR B C     1 
ATOM   3610 O  O     . TYR B 1 114 ? 24.191  85.733  23.784  1.00 44.35  ? 108  TYR B O     1 
ATOM   3611 C  CB    . TYR B 1 114 ? 25.497  87.662  21.697  1.00 44.92  ? 108  TYR B CB    1 
ATOM   3612 C  CG    . TYR B 1 114 ? 26.287  88.103  20.500  1.00 45.66  ? 108  TYR B CG    1 
ATOM   3613 C  CD1   . TYR B 1 114 ? 25.891  87.755  19.209  1.00 47.28  ? 108  TYR B CD1   1 
ATOM   3614 C  CD2   . TYR B 1 114 ? 27.417  88.892  20.655  1.00 46.24  ? 108  TYR B CD2   1 
ATOM   3615 C  CE1   . TYR B 1 114 ? 26.602  88.193  18.085  1.00 48.80  ? 108  TYR B CE1   1 
ATOM   3616 C  CE2   . TYR B 1 114 ? 28.136  89.337  19.550  1.00 49.84  ? 108  TYR B CE2   1 
ATOM   3617 C  CZ    . TYR B 1 114 ? 27.724  88.989  18.259  1.00 50.17  ? 108  TYR B CZ    1 
ATOM   3618 O  OH    . TYR B 1 114 ? 28.420  89.466  17.162  1.00 50.84  ? 108  TYR B OH    1 
ATOM   3619 N  N     . LEU B 1 115 ? 26.084  86.534  24.742  1.00 46.26  ? 109  LEU B N     1 
ATOM   3620 C  CA    . LEU B 1 115 ? 25.627  86.425  26.125  1.00 47.04  ? 109  LEU B CA    1 
ATOM   3621 C  C     . LEU B 1 115 ? 25.665  87.748  26.879  1.00 48.67  ? 109  LEU B C     1 
ATOM   3622 O  O     . LEU B 1 115 ? 26.656  88.478  26.836  1.00 49.15  ? 109  LEU B O     1 
ATOM   3623 C  CB    . LEU B 1 115 ? 26.479  85.402  26.869  1.00 46.30  ? 109  LEU B CB    1 
ATOM   3624 C  CG    . LEU B 1 115 ? 26.085  83.941  26.655  1.00 46.67  ? 109  LEU B CG    1 
ATOM   3625 C  CD1   . LEU B 1 115 ? 27.178  83.031  27.160  1.00 46.19  ? 109  LEU B CD1   1 
ATOM   3626 C  CD2   . LEU B 1 115 ? 24.761  83.668  27.361  1.00 45.95  ? 109  LEU B CD2   1 
ATOM   3627 N  N     . ASP B 1 116 ? 24.570  88.044  27.571  1.00 50.43  ? 110  ASP B N     1 
ATOM   3628 C  CA    . ASP B 1 116 ? 24.445  89.269  28.353  1.00 52.08  ? 110  ASP B CA    1 
ATOM   3629 C  C     . ASP B 1 116 ? 24.541  88.826  29.794  1.00 53.50  ? 110  ASP B C     1 
ATOM   3630 O  O     . ASP B 1 116 ? 23.539  88.452  30.397  1.00 55.25  ? 110  ASP B O     1 
ATOM   3631 C  CB    A ASP B 1 116 ? 23.083  89.930  28.102  0.50 51.56  ? 110  ASP B CB    1 
ATOM   3632 C  CG    A ASP B 1 116 ? 22.932  91.270  28.812  0.50 51.32  ? 110  ASP B CG    1 
ATOM   3633 O  OD1   A ASP B 1 116 ? 22.994  91.295  30.060  0.50 51.52  ? 110  ASP B OD1   1 
ATOM   3634 O  OD2   A ASP B 1 116 ? 22.747  92.299  28.121  0.50 50.47  ? 110  ASP B OD2   1 
ATOM   3635 N  N     . ILE B 1 117 ? 25.749  88.859  30.340  1.00 54.26  ? 111  ILE B N     1 
ATOM   3636 C  CA    . ILE B 1 117 ? 25.969  88.432  31.715  1.00 54.28  ? 111  ILE B CA    1 
ATOM   3637 C  C     . ILE B 1 117 ? 25.833  89.597  32.688  1.00 55.30  ? 111  ILE B C     1 
ATOM   3638 O  O     . ILE B 1 117 ? 25.889  89.411  33.899  1.00 55.57  ? 111  ILE B O     1 
ATOM   3639 C  CB    . ILE B 1 117 ? 27.368  87.819  31.874  1.00 52.70  ? 111  ILE B CB    1 
ATOM   3640 C  CG1   . ILE B 1 117 ? 28.418  88.868  31.513  1.00 52.21  ? 111  ILE B CG1   1 
ATOM   3641 C  CG2   . ILE B 1 117 ? 27.506  86.588  30.987  1.00 50.51  ? 111  ILE B CG2   1 
ATOM   3642 C  CD1   . ILE B 1 117 ? 29.829  88.414  31.723  1.00 52.36  ? 111  ILE B CD1   1 
ATOM   3643 N  N     . SER B 1 118 ? 25.644  90.793  32.149  1.00 55.91  ? 112  SER B N     1 
ATOM   3644 C  CA    . SER B 1 118 ? 25.510  91.987  32.968  1.00 57.01  ? 112  SER B CA    1 
ATOM   3645 C  C     . SER B 1 118 ? 24.961  91.773  34.394  1.00 58.43  ? 112  SER B C     1 
ATOM   3646 O  O     . SER B 1 118 ? 25.656  92.051  35.383  1.00 58.53  ? 112  SER B O     1 
ATOM   3647 C  CB    . SER B 1 118 ? 24.660  93.006  32.209  1.00 55.48  ? 112  SER B CB    1 
ATOM   3648 O  OG    . SER B 1 118 ? 25.285  93.320  30.981  1.00 52.44  ? 112  SER B OG    1 
ATOM   3649 N  N     . ASP B 1 119 ? 23.727  91.283  34.499  1.00 60.13  ? 113  ASP B N     1 
ATOM   3650 C  CA    . ASP B 1 119 ? 23.096  91.056  35.802  1.00 61.85  ? 113  ASP B CA    1 
ATOM   3651 C  C     . ASP B 1 119 ? 23.478  89.722  36.462  1.00 62.78  ? 113  ASP B C     1 
ATOM   3652 O  O     . ASP B 1 119 ? 22.652  89.061  37.106  1.00 63.30  ? 113  ASP B O     1 
ATOM   3653 C  CB    . ASP B 1 119 ? 21.566  91.147  35.682  1.00 63.15  ? 113  ASP B CB    1 
ATOM   3654 C  CG    . ASP B 1 119 ? 21.033  92.551  35.935  1.00 65.24  ? 113  ASP B CG    1 
ATOM   3655 O  OD1   . ASP B 1 119 ? 19.856  92.661  36.342  1.00 66.82  ? 113  ASP B OD1   1 
ATOM   3656 O  OD2   . ASP B 1 119 ? 21.772  93.541  35.726  1.00 65.40  ? 113  ASP B OD2   1 
ATOM   3657 N  N     . LYS B 1 120 ? 24.738  89.335  36.304  1.00 62.90  ? 114  LYS B N     1 
ATOM   3658 C  CA    . LYS B 1 120 ? 25.242  88.095  36.883  1.00 61.78  ? 114  LYS B CA    1 
ATOM   3659 C  C     . LYS B 1 120 ? 26.721  88.281  37.220  1.00 60.70  ? 114  LYS B C     1 
ATOM   3660 O  O     . LYS B 1 120 ? 27.399  87.352  37.637  1.00 59.76  ? 114  LYS B O     1 
ATOM   3661 C  CB    . LYS B 1 120 ? 25.069  86.948  35.887  1.00 62.05  ? 114  LYS B CB    1 
ATOM   3662 C  CG    . LYS B 1 120 ? 25.335  85.583  36.472  1.00 63.92  ? 114  LYS B CG    1 
ATOM   3663 C  CD    . LYS B 1 120 ? 24.346  85.269  37.583  1.00 65.74  ? 114  LYS B CD    1 
ATOM   3664 C  CE    . LYS B 1 120 ? 24.577  83.873  38.139  1.00 67.24  ? 114  LYS B CE    1 
ATOM   3665 N  NZ    . LYS B 1 120 ? 23.510  83.490  39.101  1.00 69.89  ? 114  LYS B NZ    1 
ATOM   3666 N  N     . VAL B 1 121 ? 27.202  89.505  37.038  1.00 59.86  ? 115  VAL B N     1 
ATOM   3667 C  CA    . VAL B 1 121 ? 28.587  89.851  37.305  1.00 59.86  ? 115  VAL B CA    1 
ATOM   3668 C  C     . VAL B 1 121 ? 28.655  91.286  37.834  1.00 60.94  ? 115  VAL B C     1 
ATOM   3669 O  O     . VAL B 1 121 ? 27.714  92.069  37.661  1.00 62.13  ? 115  VAL B O     1 
ATOM   3670 C  CB    . VAL B 1 121 ? 29.434  89.725  36.013  1.00 58.51  ? 115  VAL B CB    1 
ATOM   3671 C  CG1   . VAL B 1 121 ? 30.810  90.309  36.213  1.00 60.29  ? 115  VAL B CG1   1 
ATOM   3672 C  CG2   . VAL B 1 121 ? 29.575  88.288  35.645  1.00 57.82  ? 115  VAL B CG2   1 
ATOM   3673 N  N     . ARG B 1 122 ? 29.758  91.616  38.496  1.00 60.17  ? 116  ARG B N     1 
ATOM   3674 C  CA    . ARG B 1 122 ? 29.953  92.948  39.033  1.00 60.20  ? 116  ARG B CA    1 
ATOM   3675 C  C     . ARG B 1 122 ? 30.883  93.729  38.115  1.00 60.53  ? 116  ARG B C     1 
ATOM   3676 O  O     . ARG B 1 122 ? 30.521  94.790  37.612  1.00 60.76  ? 116  ARG B O     1 
ATOM   3677 C  CB    A ARG B 1 122 ? 30.552  92.861  40.441  0.50 60.62  ? 116  ARG B CB    1 
ATOM   3678 C  CG    A ARG B 1 122 ? 31.101  94.181  41.010  0.50 60.76  ? 116  ARG B CG    1 
ATOM   3679 C  CD    A ARG B 1 122 ? 30.018  95.239  41.249  0.50 59.91  ? 116  ARG B CD    1 
ATOM   3680 N  NE    A ARG B 1 122 ? 29.490  95.811  40.013  0.50 58.55  ? 116  ARG B NE    1 
ATOM   3681 C  CZ    A ARG B 1 122 ? 28.453  96.642  39.956  0.50 57.57  ? 116  ARG B CZ    1 
ATOM   3682 N  NH1   A ARG B 1 122 ? 27.822  97.007  41.065  0.50 57.14  ? 116  ARG B NH1   1 
ATOM   3683 N  NH2   A ARG B 1 122 ? 28.041  97.106  38.788  0.50 56.56  ? 116  ARG B NH2   1 
ATOM   3684 N  N     . ASP B 1 123 ? 32.081  93.196  37.895  1.00 61.40  ? 117  ASP B N     1 
ATOM   3685 C  CA    . ASP B 1 123 ? 33.070  93.853  37.045  1.00 62.52  ? 117  ASP B CA    1 
ATOM   3686 C  C     . ASP B 1 123 ? 33.780  92.854  36.136  1.00 62.18  ? 117  ASP B C     1 
ATOM   3687 O  O     . ASP B 1 123 ? 33.859  91.659  36.433  1.00 60.02  ? 117  ASP B O     1 
ATOM   3688 C  CB    . ASP B 1 123 ? 34.105  94.604  37.904  1.00 65.47  ? 117  ASP B CB    1 
ATOM   3689 C  CG    . ASP B 1 123 ? 35.067  93.660  38.660  1.00 69.20  ? 117  ASP B CG    1 
ATOM   3690 O  OD1   . ASP B 1 123 ? 34.594  92.790  39.438  1.00 70.43  ? 117  ASP B OD1   1 
ATOM   3691 O  OD2   . ASP B 1 123 ? 36.305  93.800  38.477  1.00 69.88  ? 117  ASP B OD2   1 
ATOM   3692 N  N     . TYR B 1 124 ? 34.313  93.364  35.033  1.00 62.63  ? 118  TYR B N     1 
ATOM   3693 C  CA    . TYR B 1 124 ? 35.002  92.528  34.061  1.00 63.74  ? 118  TYR B CA    1 
ATOM   3694 C  C     . TYR B 1 124 ? 35.836  91.380  34.617  1.00 65.03  ? 118  TYR B C     1 
ATOM   3695 O  O     . TYR B 1 124 ? 35.726  90.256  34.140  1.00 65.24  ? 118  TYR B O     1 
ATOM   3696 C  CB    . TYR B 1 124 ? 35.864  93.397  33.143  1.00 61.83  ? 118  TYR B CB    1 
ATOM   3697 C  CG    A TYR B 1 124 ? 35.055  94.288  32.232  0.50 60.13  ? 118  TYR B CG    1 
ATOM   3698 C  CD1   A TYR B 1 124 ? 33.823  93.864  31.729  0.50 59.72  ? 118  TYR B CD1   1 
ATOM   3699 C  CD2   A TYR B 1 124 ? 35.526  95.540  31.852  0.50 58.82  ? 118  TYR B CD2   1 
ATOM   3700 C  CE1   A TYR B 1 124 ? 33.080  94.663  30.872  0.50 58.48  ? 118  TYR B CE1   1 
ATOM   3701 C  CE2   A TYR B 1 124 ? 34.792  96.346  30.994  0.50 58.42  ? 118  TYR B CE2   1 
ATOM   3702 C  CZ    A TYR B 1 124 ? 33.570  95.900  30.508  0.50 58.16  ? 118  TYR B CZ    1 
ATOM   3703 O  OH    A TYR B 1 124 ? 32.835  96.688  29.659  0.50 57.64  ? 118  TYR B OH    1 
ATOM   3704 N  N     A ARG B 1 125 ? 36.665  91.659  35.615  0.50 65.72  ? 119  ARG B N     1 
ATOM   3705 N  N     B ARG B 1 125 ? 36.674  91.653  35.609  0.50 66.65  ? 119  ARG B N     1 
ATOM   3706 C  CA    A ARG B 1 125 ? 37.492  90.614  36.208  0.50 66.49  ? 119  ARG B CA    1 
ATOM   3707 C  CA    B ARG B 1 125 ? 37.501  90.595  36.179  0.50 68.17  ? 119  ARG B CA    1 
ATOM   3708 C  C     A ARG B 1 125 ? 36.623  89.403  36.554  0.50 67.61  ? 119  ARG B C     1 
ATOM   3709 C  C     B ARG B 1 125 ? 36.626  89.391  36.558  0.50 68.63  ? 119  ARG B C     1 
ATOM   3710 O  O     A ARG B 1 125 ? 37.044  88.266  36.352  0.50 67.74  ? 119  ARG B O     1 
ATOM   3711 O  O     B ARG B 1 125 ? 37.032  88.255  36.376  0.50 68.66  ? 119  ARG B O     1 
ATOM   3712 C  CB    A ARG B 1 125 ? 38.210  91.134  37.470  0.50 65.10  ? 119  ARG B CB    1 
ATOM   3713 C  CB    B ARG B 1 125 ? 38.274  91.092  37.407  0.50 68.72  ? 119  ARG B CB    1 
ATOM   3714 C  CG    A ARG B 1 125 ? 38.067  90.221  38.688  0.50 62.34  ? 119  ARG B CG    1 
ATOM   3715 C  CG    B ARG B 1 125 ? 39.378  90.135  37.854  0.50 69.27  ? 119  ARG B CG    1 
ATOM   3716 C  CD    A ARG B 1 125 ? 39.179  90.429  39.707  0.50 60.23  ? 119  ARG B CD    1 
ATOM   3717 C  CD    B ARG B 1 125 ? 40.016  90.554  39.172  0.50 69.52  ? 119  ARG B CD    1 
ATOM   3718 N  NE    A ARG B 1 125 ? 40.473  89.950  39.237  0.50 57.25  ? 119  ARG B NE    1 
ATOM   3719 N  NE    B ARG B 1 125 ? 39.079  90.444  40.287  0.50 69.99  ? 119  ARG B NE    1 
ATOM   3720 C  CZ    A ARG B 1 125 ? 41.478  90.732  38.872  0.50 55.48  ? 119  ARG B CZ    1 
ATOM   3721 C  CZ    B ARG B 1 125 ? 38.194  91.377  40.620  0.50 69.86  ? 119  ARG B CZ    1 
ATOM   3722 N  NH1   A ARG B 1 125 ? 41.335  92.048  38.927  0.50 53.66  ? 119  ARG B NH1   1 
ATOM   3723 N  NH1   B ARG B 1 125 ? 38.123  92.504  39.924  0.50 69.82  ? 119  ARG B NH1   1 
ATOM   3724 N  NH2   A ARG B 1 125 ? 42.612  90.182  38.455  0.50 54.16  ? 119  ARG B NH2   1 
ATOM   3725 N  NH2   B ARG B 1 125 ? 37.377  91.180  41.646  0.50 69.90  ? 119  ARG B NH2   1 
ATOM   3726 N  N     . GLU B 1 126 ? 35.427  89.639  37.061  1.00 68.43  ? 120  GLU B N     1 
ATOM   3727 C  CA    . GLU B 1 126 ? 34.532  88.543  37.416  1.00 69.61  ? 120  GLU B CA    1 
ATOM   3728 C  C     . GLU B 1 126 ? 34.077  87.925  36.103  1.00 69.14  ? 120  GLU B C     1 
ATOM   3729 O  O     . GLU B 1 126 ? 33.964  86.702  35.979  1.00 69.81  ? 120  GLU B O     1 
ATOM   3730 C  CB    . GLU B 1 126 ? 33.305  89.039  38.177  1.00 71.58  ? 120  GLU B CB    1 
ATOM   3731 C  CG    . GLU B 1 126 ? 33.557  89.608  39.555  1.00 75.65  ? 120  GLU B CG    1 
ATOM   3732 C  CD    . GLU B 1 126 ? 32.336  89.579  40.450  1.00 78.04  ? 120  GLU B CD    1 
ATOM   3733 O  OE1   . GLU B 1 126 ? 32.450  90.048  41.602  1.00 78.04  ? 120  GLU B OE1   1 
ATOM   3734 O  OE2   . GLU B 1 126 ? 31.266  89.091  40.023  1.00 79.78  ? 120  GLU B OE2   1 
ATOM   3735 N  N     . ALA B 1 127 ? 33.806  88.782  35.123  1.00 67.68  ? 121  ALA B N     1 
ATOM   3736 C  CA    . ALA B 1 127 ? 33.358  88.309  33.830  1.00 65.22  ? 121  ALA B CA    1 
ATOM   3737 C  C     . ALA B 1 127 ? 34.447  87.470  33.153  1.00 63.67  ? 121  ALA B C     1 
ATOM   3738 O  O     . ALA B 1 127 ? 34.165  86.635  32.296  1.00 62.80  ? 121  ALA B O     1 
ATOM   3739 C  CB    . ALA B 1 127 ? 32.986  89.493  32.963  1.00 64.85  ? 121  ALA B CB    1 
ATOM   3740 N  N     . TYR B 1 128 ? 35.696  87.704  33.541  1.00 62.26  ? 122  TYR B N     1 
ATOM   3741 C  CA    . TYR B 1 128 ? 36.819  86.976  32.974  1.00 61.17  ? 122  TYR B CA    1 
ATOM   3742 C  C     . TYR B 1 128 ? 36.816  85.568  33.561  1.00 60.92  ? 122  TYR B C     1 
ATOM   3743 O  O     . TYR B 1 128 ? 37.145  84.588  32.883  1.00 60.47  ? 122  TYR B O     1 
ATOM   3744 C  CB    . TYR B 1 128 ? 38.122  87.712  33.318  1.00 58.95  ? 122  TYR B CB    1 
ATOM   3745 C  CG    . TYR B 1 128 ? 39.359  87.194  32.615  1.00 56.31  ? 122  TYR B CG    1 
ATOM   3746 C  CD1   . TYR B 1 128 ? 39.997  87.947  31.624  1.00 54.83  ? 122  TYR B CD1   1 
ATOM   3747 C  CD2   . TYR B 1 128 ? 39.918  85.967  32.967  1.00 55.03  ? 122  TYR B CD2   1 
ATOM   3748 C  CE1   . TYR B 1 128 ? 41.170  87.486  31.012  1.00 53.39  ? 122  TYR B CE1   1 
ATOM   3749 C  CE2   . TYR B 1 128 ? 41.083  85.501  32.359  1.00 53.33  ? 122  TYR B CE2   1 
ATOM   3750 C  CZ    . TYR B 1 128 ? 41.704  86.262  31.389  1.00 52.59  ? 122  TYR B CZ    1 
ATOM   3751 O  OH    . TYR B 1 128 ? 42.864  85.802  30.816  1.00 50.11  ? 122  TYR B OH    1 
ATOM   3752 N  N     . ASN B 1 129 ? 36.417  85.479  34.823  1.00 60.47  ? 123  ASN B N     1 
ATOM   3753 C  CA    . ASN B 1 129 ? 36.365  84.204  35.513  1.00 60.60  ? 123  ASN B CA    1 
ATOM   3754 C  C     . ASN B 1 129 ? 35.288  83.312  34.898  1.00 59.41  ? 123  ASN B C     1 
ATOM   3755 O  O     . ASN B 1 129 ? 35.396  82.075  34.895  1.00 58.74  ? 123  ASN B O     1 
ATOM   3756 C  CB    . ASN B 1 129 ? 36.100  84.446  36.998  1.00 63.10  ? 123  ASN B CB    1 
ATOM   3757 C  CG    . ASN B 1 129 ? 36.101  83.167  37.804  1.00 66.96  ? 123  ASN B CG    1 
ATOM   3758 O  OD1   . ASN B 1 129 ? 35.076  82.480  37.900  1.00 68.70  ? 123  ASN B OD1   1 
ATOM   3759 N  ND2   . ASN B 1 129 ? 37.259  82.826  38.381  1.00 67.61  ? 123  ASN B ND2   1 
ATOM   3760 N  N     . LEU B 1 130 ? 34.262  83.960  34.352  1.00 57.19  ? 124  LEU B N     1 
ATOM   3761 C  CA    . LEU B 1 130 ? 33.150  83.271  33.701  1.00 53.95  ? 124  LEU B CA    1 
ATOM   3762 C  C     . LEU B 1 130 ? 33.549  82.816  32.310  1.00 52.64  ? 124  LEU B C     1 
ATOM   3763 O  O     . LEU B 1 130 ? 32.939  81.932  31.732  1.00 49.59  ? 124  LEU B O     1 
ATOM   3764 C  CB    . LEU B 1 130 ? 31.966  84.209  33.589  1.00 52.35  ? 124  LEU B CB    1 
ATOM   3765 C  CG    . LEU B 1 130 ? 30.679  83.625  34.133  1.00 51.97  ? 124  LEU B CG    1 
ATOM   3766 C  CD1   . LEU B 1 130 ? 30.871  83.218  35.589  1.00 52.58  ? 124  LEU B CD1   1 
ATOM   3767 C  CD2   . LEU B 1 130 ? 29.594  84.667  34.007  1.00 51.68  ? 124  LEU B CD2   1 
ATOM   3768 N  N     . GLY B 1 131 ? 34.579  83.450  31.775  1.00 53.74  ? 125  GLY B N     1 
ATOM   3769 C  CA    . GLY B 1 131 ? 35.052  83.096  30.458  1.00 55.91  ? 125  GLY B CA    1 
ATOM   3770 C  C     . GLY B 1 131 ? 35.828  81.799  30.523  1.00 57.95  ? 125  GLY B C     1 
ATOM   3771 O  O     . GLY B 1 131 ? 35.572  80.880  29.735  1.00 59.01  ? 125  GLY B O     1 
ATOM   3772 N  N     . LEU B 1 132 ? 36.775  81.719  31.462  1.00 57.71  ? 126  LEU B N     1 
ATOM   3773 C  CA    . LEU B 1 132 ? 37.591  80.521  31.627  1.00 56.02  ? 126  LEU B CA    1 
ATOM   3774 C  C     . LEU B 1 132 ? 36.706  79.388  32.105  1.00 55.08  ? 126  LEU B C     1 
ATOM   3775 O  O     . LEU B 1 132 ? 36.845  78.245  31.681  1.00 53.63  ? 126  LEU B O     1 
ATOM   3776 C  CB    . LEU B 1 132 ? 38.688  80.765  32.659  1.00 58.47  ? 126  LEU B CB    1 
ATOM   3777 C  CG    . LEU B 1 132 ? 39.913  81.573  32.226  1.00 60.93  ? 126  LEU B CG    1 
ATOM   3778 C  CD1   . LEU B 1 132 ? 40.241  82.636  33.270  1.00 61.99  ? 126  LEU B CD1   1 
ATOM   3779 C  CD2   . LEU B 1 132 ? 41.087  80.622  32.044  1.00 60.62  ? 126  LEU B CD2   1 
ATOM   3780 N  N     . GLU B 1 133 ? 35.781  79.719  32.996  1.00 53.59  ? 127  GLU B N     1 
ATOM   3781 C  CA    . GLU B 1 133 ? 34.881  78.720  33.540  1.00 51.96  ? 127  GLU B CA    1 
ATOM   3782 C  C     . GLU B 1 133 ? 34.074  78.068  32.431  1.00 49.35  ? 127  GLU B C     1 
ATOM   3783 O  O     . GLU B 1 133 ? 33.744  76.890  32.483  1.00 49.80  ? 127  GLU B O     1 
ATOM   3784 C  CB    . GLU B 1 133 ? 33.939  79.371  34.539  1.00 53.28  ? 127  GLU B CB    1 
ATOM   3785 C  CG    . GLU B 1 133 ? 33.059  78.387  35.248  1.00 56.98  ? 127  GLU B CG    1 
ATOM   3786 C  CD    . GLU B 1 133 ? 31.991  79.066  36.067  1.00 60.56  ? 127  GLU B CD    1 
ATOM   3787 O  OE1   . GLU B 1 133 ? 32.325  79.956  36.882  1.00 63.74  ? 127  GLU B OE1   1 
ATOM   3788 O  OE2   . GLU B 1 133 ? 30.809  78.708  35.899  1.00 63.27  ? 127  GLU B OE2   1 
ATOM   3789 N  N     . ILE B 1 134 ? 33.758  78.857  31.420  1.00 46.64  ? 128  ILE B N     1 
ATOM   3790 C  CA    . ILE B 1 134 ? 32.981  78.380  30.293  1.00 43.23  ? 128  ILE B CA    1 
ATOM   3791 C  C     . ILE B 1 134 ? 33.834  77.529  29.364  1.00 41.71  ? 128  ILE B C     1 
ATOM   3792 O  O     . ILE B 1 134 ? 33.513  76.369  29.132  1.00 40.97  ? 128  ILE B O     1 
ATOM   3793 C  CB    . ILE B 1 134 ? 32.343  79.583  29.531  1.00 41.98  ? 128  ILE B CB    1 
ATOM   3794 C  CG1   . ILE B 1 134 ? 31.094  80.052  30.271  1.00 40.45  ? 128  ILE B CG1   1 
ATOM   3795 C  CG2   . ILE B 1 134 ? 31.984  79.212  28.144  1.00 41.45  ? 128  ILE B CG2   1 
ATOM   3796 C  CD1   . ILE B 1 134 ? 30.110  80.725  29.412  1.00 39.63  ? 128  ILE B CD1   1 
ATOM   3797 N  N     . LYS B 1 135 ? 34.916  78.098  28.842  1.00 39.54  ? 129  LYS B N     1 
ATOM   3798 C  CA    . LYS B 1 135 ? 35.783  77.356  27.949  1.00 39.54  ? 129  LYS B CA    1 
ATOM   3799 C  C     . LYS B 1 135 ? 35.992  75.946  28.470  1.00 42.01  ? 129  LYS B C     1 
ATOM   3800 O  O     . LYS B 1 135 ? 35.971  74.981  27.708  1.00 43.39  ? 129  LYS B O     1 
ATOM   3801 C  CB    . LYS B 1 135 ? 37.131  78.047  27.829  1.00 37.27  ? 129  LYS B CB    1 
ATOM   3802 C  CG    . LYS B 1 135 ? 37.009  79.504  27.507  1.00 37.13  ? 129  LYS B CG    1 
ATOM   3803 C  CD    . LYS B 1 135 ? 38.356  80.189  27.303  1.00 38.97  ? 129  LYS B CD    1 
ATOM   3804 C  CE    . LYS B 1 135 ? 39.215  79.510  26.211  1.00 39.46  ? 129  LYS B CE    1 
ATOM   3805 N  NZ    . LYS B 1 135 ? 40.559  80.186  26.003  1.00 42.38  ? 129  LYS B NZ    1 
ATOM   3806 N  N     . ASN B 1 136 ? 36.186  75.840  29.779  1.00 44.21  ? 130  ASN B N     1 
ATOM   3807 C  CA    . ASN B 1 136 ? 36.417  74.567  30.438  1.00 46.32  ? 130  ASN B CA    1 
ATOM   3808 C  C     . ASN B 1 136 ? 35.185  73.691  30.353  1.00 46.98  ? 130  ASN B C     1 
ATOM   3809 O  O     . ASN B 1 136 ? 35.235  72.586  29.822  1.00 47.62  ? 130  ASN B O     1 
ATOM   3810 C  CB    . ASN B 1 136 ? 36.786  74.811  31.898  1.00 49.18  ? 130  ASN B CB    1 
ATOM   3811 C  CG    . ASN B 1 136 ? 38.007  75.718  32.055  1.00 51.51  ? 130  ASN B CG    1 
ATOM   3812 O  OD1   . ASN B 1 136 ? 38.657  76.107  31.070  1.00 51.66  ? 130  ASN B OD1   1 
ATOM   3813 N  ND2   . ASN B 1 136 ? 38.327  76.055  33.301  1.00 52.77  ? 130  ASN B ND2   1 
ATOM   3814 N  N     . LYS B 1 137 ? 34.082  74.189  30.896  1.00 48.18  ? 131  LYS B N     1 
ATOM   3815 C  CA    . LYS B 1 137 ? 32.811  73.473  30.866  1.00 50.35  ? 131  LYS B CA    1 
ATOM   3816 C  C     . LYS B 1 137 ? 32.551  72.870  29.485  1.00 50.95  ? 131  LYS B C     1 
ATOM   3817 O  O     . LYS B 1 137 ? 31.842  71.884  29.349  1.00 50.92  ? 131  LYS B O     1 
ATOM   3818 C  CB    . LYS B 1 137 ? 31.670  74.434  31.203  1.00 51.83  ? 131  LYS B CB    1 
ATOM   3819 C  CG    . LYS B 1 137 ? 30.274  73.843  31.042  1.00 53.81  ? 131  LYS B CG    1 
ATOM   3820 C  CD    . LYS B 1 137 ? 30.035  72.697  32.028  1.00 56.45  ? 131  LYS B CD    1 
ATOM   3821 C  CE    . LYS B 1 137 ? 28.533  72.419  32.251  1.00 57.12  ? 131  LYS B CE    1 
ATOM   3822 N  NZ    . LYS B 1 137 ? 27.791  73.568  32.887  1.00 56.27  ? 131  LYS B NZ    1 
ATOM   3823 N  N     . ILE B 1 138 ? 33.122  73.480  28.457  1.00 51.56  ? 132  ILE B N     1 
ATOM   3824 C  CA    . ILE B 1 138 ? 32.933  73.004  27.097  1.00 52.49  ? 132  ILE B CA    1 
ATOM   3825 C  C     . ILE B 1 138 ? 34.044  72.054  26.706  1.00 53.13  ? 132  ILE B C     1 
ATOM   3826 O  O     . ILE B 1 138 ? 33.793  70.978  26.157  1.00 53.36  ? 132  ILE B O     1 
ATOM   3827 C  CB    . ILE B 1 138 ? 32.937  74.174  26.102  1.00 53.35  ? 132  ILE B CB    1 
ATOM   3828 C  CG1   . ILE B 1 138 ? 31.807  75.153  26.451  1.00 52.59  ? 132  ILE B CG1   1 
ATOM   3829 C  CG2   . ILE B 1 138 ? 32.805  73.636  24.671  1.00 53.25  ? 132  ILE B CG2   1 
ATOM   3830 C  CD1   . ILE B 1 138 ? 31.730  76.345  25.544  1.00 51.26  ? 132  ILE B CD1   1 
ATOM   3831 N  N     . LEU B 1 139 ? 35.273  72.490  26.976  1.00 52.79  ? 133  LEU B N     1 
ATOM   3832 C  CA    . LEU B 1 139 ? 36.481  71.728  26.689  1.00 50.86  ? 133  LEU B CA    1 
ATOM   3833 C  C     . LEU B 1 139 ? 36.475  70.364  27.337  1.00 51.31  ? 133  LEU B C     1 
ATOM   3834 O  O     . LEU B 1 139 ? 37.239  69.493  26.945  1.00 52.21  ? 133  LEU B O     1 
ATOM   3835 C  CB    . LEU B 1 139 ? 37.698  72.496  27.175  1.00 48.67  ? 133  LEU B CB    1 
ATOM   3836 C  CG    . LEU B 1 139 ? 39.041  71.789  27.084  1.00 47.42  ? 133  LEU B CG    1 
ATOM   3837 C  CD1   . LEU B 1 139 ? 39.210  71.173  25.710  1.00 46.37  ? 133  LEU B CD1   1 
ATOM   3838 C  CD2   . LEU B 1 139 ? 40.158  72.804  27.392  1.00 47.58  ? 133  LEU B CD2   1 
ATOM   3839 N  N     . GLU B 1 140 ? 35.616  70.170  28.327  1.00 50.91  ? 134  GLU B N     1 
ATOM   3840 C  CA    . GLU B 1 140 ? 35.580  68.888  28.978  1.00 52.02  ? 134  GLU B CA    1 
ATOM   3841 C  C     . GLU B 1 140 ? 34.336  68.125  28.626  1.00 51.75  ? 134  GLU B C     1 
ATOM   3842 O  O     . GLU B 1 140 ? 34.282  66.914  28.820  1.00 52.66  ? 134  GLU B O     1 
ATOM   3843 C  CB    . GLU B 1 140 ? 35.673  69.062  30.477  1.00 55.45  ? 134  GLU B CB    1 
ATOM   3844 C  CG    . GLU B 1 140 ? 34.555  69.880  31.070  1.00 60.35  ? 134  GLU B CG    1 
ATOM   3845 C  CD    . GLU B 1 140 ? 34.634  69.947  32.600  1.00 63.81  ? 134  GLU B CD    1 
ATOM   3846 O  OE1   . GLU B 1 140 ? 35.669  70.433  33.136  1.00 64.91  ? 134  GLU B OE1   1 
ATOM   3847 O  OE2   . GLU B 1 140 ? 33.658  69.511  33.261  1.00 65.34  ? 134  GLU B OE2   1 
ATOM   3848 N  N     . LYS B 1 141 ? 33.338  68.830  28.101  1.00 50.88  ? 135  LYS B N     1 
ATOM   3849 C  CA    . LYS B 1 141 ? 32.089  68.191  27.704  1.00 48.58  ? 135  LYS B CA    1 
ATOM   3850 C  C     . LYS B 1 141 ? 32.051  67.870  26.216  1.00 48.56  ? 135  LYS B C     1 
ATOM   3851 O  O     . LYS B 1 141 ? 31.216  67.079  25.787  1.00 50.20  ? 135  LYS B O     1 
ATOM   3852 C  CB    . LYS B 1 141 ? 30.907  69.080  28.037  1.00 46.54  ? 135  LYS B CB    1 
ATOM   3853 C  CG    . LYS B 1 141 ? 30.584  69.157  29.487  1.00 47.02  ? 135  LYS B CG    1 
ATOM   3854 C  CD    . LYS B 1 141 ? 29.820  67.949  29.959  1.00 48.60  ? 135  LYS B CD    1 
ATOM   3855 C  CE    . LYS B 1 141 ? 29.384  68.127  31.431  1.00 51.17  ? 135  LYS B CE    1 
ATOM   3856 N  NZ    . LYS B 1 141 ? 28.568  66.991  32.012  1.00 52.29  ? 135  LYS B NZ    1 
ATOM   3857 N  N     . GLU B 1 142 ? 32.939  68.478  25.430  1.00 47.15  ? 136  GLU B N     1 
ATOM   3858 C  CA    . GLU B 1 142 ? 32.965  68.222  23.996  1.00 45.86  ? 136  GLU B CA    1 
ATOM   3859 C  C     . GLU B 1 142 ? 34.362  68.333  23.406  1.00 44.90  ? 136  GLU B C     1 
ATOM   3860 O  O     . GLU B 1 142 ? 34.502  68.446  22.187  1.00 45.14  ? 136  GLU B O     1 
ATOM   3861 C  CB    . GLU B 1 142 ? 32.067  69.206  23.254  1.00 48.85  ? 136  GLU B CB    1 
ATOM   3862 C  CG    . GLU B 1 142 ? 30.784  69.625  23.969  1.00 53.55  ? 136  GLU B CG    1 
ATOM   3863 C  CD    . GLU B 1 142 ? 29.645  68.626  23.791  1.00 57.96  ? 136  GLU B CD    1 
ATOM   3864 O  OE1   . GLU B 1 142 ? 29.427  68.165  22.648  1.00 59.99  ? 136  GLU B OE1   1 
ATOM   3865 O  OE2   . GLU B 1 142 ? 28.956  68.307  24.789  1.00 60.79  ? 136  GLU B OE2   1 
ATOM   3866 N  N     . LYS B 1 143 ? 35.388  68.311  24.258  1.00 42.83  ? 137  LYS B N     1 
ATOM   3867 C  CA    . LYS B 1 143 ? 36.791  68.389  23.818  1.00 39.88  ? 137  LYS B CA    1 
ATOM   3868 C  C     . LYS B 1 143 ? 36.877  69.416  22.721  1.00 39.13  ? 137  LYS B C     1 
ATOM   3869 O  O     . LYS B 1 143 ? 37.738  69.342  21.835  1.00 40.12  ? 137  LYS B O     1 
ATOM   3870 C  CB    . LYS B 1 143 ? 37.295  67.025  23.292  1.00 37.69  ? 137  LYS B CB    1 
ATOM   3871 C  CG    . LYS B 1 143 ? 37.272  65.928  24.334  1.00 36.70  ? 137  LYS B CG    1 
ATOM   3872 C  CD    . LYS B 1 143 ? 36.611  64.646  23.843  1.00 35.73  ? 137  LYS B CD    1 
ATOM   3873 C  CE    . LYS B 1 143 ? 37.659  63.681  23.259  1.00 37.92  ? 137  LYS B CE    1 
ATOM   3874 N  NZ    . LYS B 1 143 ? 37.233  62.226  23.209  1.00 33.70  ? 137  LYS B NZ    1 
ATOM   3875 N  N     . ILE B 1 144 ? 35.972  70.386  22.797  1.00 36.99  ? 138  ILE B N     1 
ATOM   3876 C  CA    . ILE B 1 144 ? 35.892  71.437  21.799  1.00 35.35  ? 138  ILE B CA    1 
ATOM   3877 C  C     . ILE B 1 144 ? 36.357  72.739  22.384  1.00 33.71  ? 138  ILE B C     1 
ATOM   3878 O  O     . ILE B 1 144 ? 35.712  73.267  23.275  1.00 34.73  ? 138  ILE B O     1 
ATOM   3879 C  CB    . ILE B 1 144 ? 34.407  71.583  21.254  1.00 34.84  ? 138  ILE B CB    1 
ATOM   3880 C  CG1   . ILE B 1 144 ? 34.152  70.567  20.146  1.00 31.36  ? 138  ILE B CG1   1 
ATOM   3881 C  CG2   . ILE B 1 144 ? 34.167  72.944  20.642  1.00 35.11  ? 138  ILE B CG2   1 
ATOM   3882 C  CD1   . ILE B 1 144 ? 35.105  70.724  18.997  1.00 29.07  ? 138  ILE B CD1   1 
ATOM   3883 N  N     . THR B 1 145 ? 37.472  73.261  21.895  1.00 33.12  ? 139  THR B N     1 
ATOM   3884 C  CA    . THR B 1 145 ? 37.950  74.542  22.409  1.00 37.01  ? 139  THR B CA    1 
ATOM   3885 C  C     . THR B 1 145 ? 37.223  75.717  21.753  1.00 38.70  ? 139  THR B C     1 
ATOM   3886 O  O     . THR B 1 145 ? 36.685  75.581  20.658  1.00 39.97  ? 139  THR B O     1 
ATOM   3887 C  CB    . THR B 1 145 ? 39.480  74.741  22.184  1.00 37.74  ? 139  THR B CB    1 
ATOM   3888 O  OG1   . THR B 1 145 ? 39.794  74.665  20.782  1.00 34.48  ? 139  THR B OG1   1 
ATOM   3889 C  CG2   . THR B 1 145 ? 40.268  73.691  22.952  1.00 39.40  ? 139  THR B CG2   1 
ATOM   3890 N  N     . VAL B 1 146 ? 37.195  76.868  22.420  1.00 39.96  ? 140  VAL B N     1 
ATOM   3891 C  CA    . VAL B 1 146 ? 36.555  78.045  21.838  1.00 41.96  ? 140  VAL B CA    1 
ATOM   3892 C  C     . VAL B 1 146 ? 37.411  79.268  22.067  1.00 42.61  ? 140  VAL B C     1 
ATOM   3893 O  O     . VAL B 1 146 ? 38.589  79.153  22.416  1.00 43.34  ? 140  VAL B O     1 
ATOM   3894 C  CB    . VAL B 1 146 ? 35.173  78.326  22.443  1.00 41.86  ? 140  VAL B CB    1 
ATOM   3895 C  CG1   . VAL B 1 146 ? 34.243  77.221  22.110  1.00 43.06  ? 140  VAL B CG1   1 
ATOM   3896 C  CG2   . VAL B 1 146 ? 35.277  78.486  23.937  1.00 42.73  ? 140  VAL B CG2   1 
ATOM   3897 N  N     . THR B 1 147 ? 36.811  80.435  21.848  1.00 42.86  ? 141  THR B N     1 
ATOM   3898 C  CA    . THR B 1 147 ? 37.475  81.717  22.063  1.00 42.99  ? 141  THR B CA    1 
ATOM   3899 C  C     . THR B 1 147 ? 36.394  82.722  22.433  1.00 43.73  ? 141  THR B C     1 
ATOM   3900 O  O     . THR B 1 147 ? 35.562  83.076  21.606  1.00 44.85  ? 141  THR B O     1 
ATOM   3901 C  CB    . THR B 1 147 ? 38.212  82.203  20.805  1.00 42.79  ? 141  THR B CB    1 
ATOM   3902 O  OG1   . THR B 1 147 ? 39.154  81.211  20.390  1.00 43.33  ? 141  THR B OG1   1 
ATOM   3903 C  CG2   . THR B 1 147 ? 38.960  83.472  21.086  1.00 40.94  ? 141  THR B CG2   1 
ATOM   3904 N  N     . VAL B 1 148 ? 36.407  83.166  23.687  1.00 44.34  ? 142  VAL B N     1 
ATOM   3905 C  CA    . VAL B 1 148 ? 35.422  84.121  24.193  1.00 43.76  ? 142  VAL B CA    1 
ATOM   3906 C  C     . VAL B 1 148 ? 35.855  85.590  24.149  1.00 43.91  ? 142  VAL B C     1 
ATOM   3907 O  O     . VAL B 1 148 ? 36.999  85.938  24.418  1.00 43.06  ? 142  VAL B O     1 
ATOM   3908 C  CB    . VAL B 1 148 ? 35.040  83.798  25.644  1.00 42.94  ? 142  VAL B CB    1 
ATOM   3909 C  CG1   . VAL B 1 148 ? 33.827  84.618  26.057  1.00 42.11  ? 142  VAL B CG1   1 
ATOM   3910 C  CG2   . VAL B 1 148 ? 34.785  82.319  25.783  1.00 43.11  ? 142  VAL B CG2   1 
ATOM   3911 N  N     . GLY B 1 149 ? 34.906  86.448  23.808  1.00 44.70  ? 143  GLY B N     1 
ATOM   3912 C  CA    . GLY B 1 149 ? 35.168  87.866  23.740  1.00 44.59  ? 143  GLY B CA    1 
ATOM   3913 C  C     . GLY B 1 149 ? 34.268  88.579  24.733  1.00 45.27  ? 143  GLY B C     1 
ATOM   3914 O  O     . GLY B 1 149 ? 33.121  88.181  24.971  1.00 45.07  ? 143  GLY B O     1 
ATOM   3915 N  N     . ILE B 1 150 ? 34.798  89.644  25.324  1.00 45.40  ? 144  ILE B N     1 
ATOM   3916 C  CA    . ILE B 1 150 ? 34.055  90.431  26.295  1.00 43.16  ? 144  ILE B CA    1 
ATOM   3917 C  C     . ILE B 1 150 ? 34.308  91.922  26.105  1.00 42.07  ? 144  ILE B C     1 
ATOM   3918 O  O     . ILE B 1 150 ? 35.415  92.337  25.774  1.00 41.44  ? 144  ILE B O     1 
ATOM   3919 C  CB    . ILE B 1 150 ? 34.449  90.020  27.728  1.00 42.80  ? 144  ILE B CB    1 
ATOM   3920 C  CG1   . ILE B 1 150 ? 34.258  88.503  27.879  1.00 42.63  ? 144  ILE B CG1   1 
ATOM   3921 C  CG2   . ILE B 1 150 ? 33.635  90.813  28.743  1.00 42.61  ? 144  ILE B CG2   1 
ATOM   3922 C  CD1   . ILE B 1 150 ? 34.614  87.912  29.244  1.00 41.02  ? 144  ILE B CD1   1 
ATOM   3923 N  N     . SER B 1 151 ? 33.250  92.708  26.282  1.00 41.99  ? 145  SER B N     1 
ATOM   3924 C  CA    . SER B 1 151 ? 33.289  94.167  26.193  1.00 42.03  ? 145  SER B CA    1 
ATOM   3925 C  C     . SER B 1 151 ? 31.928  94.753  26.519  1.00 42.33  ? 145  SER B C     1 
ATOM   3926 O  O     . SER B 1 151 ? 31.081  94.073  27.102  1.00 41.82  ? 145  SER B O     1 
ATOM   3927 C  CB    . SER B 1 151 ? 33.727  94.667  24.817  1.00 42.10  ? 145  SER B CB    1 
ATOM   3928 O  OG    . SER B 1 151 ? 33.791  96.088  24.814  1.00 38.98  ? 145  SER B OG    1 
ATOM   3929 N  N     . LYS B 1 152 ? 31.720  96.007  26.128  1.00 42.84  ? 146  LYS B N     1 
ATOM   3930 C  CA    . LYS B 1 152 ? 30.477  96.699  26.423  1.00 44.30  ? 146  LYS B CA    1 
ATOM   3931 C  C     . LYS B 1 152 ? 29.329  96.348  25.494  1.00 45.19  ? 146  LYS B C     1 
ATOM   3932 O  O     . LYS B 1 152 ? 28.184  96.253  25.926  1.00 46.04  ? 146  LYS B O     1 
ATOM   3933 C  CB    . LYS B 1 152 ? 30.720  98.201  26.399  1.00 44.72  ? 146  LYS B CB    1 
ATOM   3934 C  CG    . LYS B 1 152 ? 31.223  98.708  25.071  1.00 46.22  ? 146  LYS B CG    1 
ATOM   3935 C  CD    . LYS B 1 152 ? 32.241  99.821  25.251  1.00 48.41  ? 146  LYS B CD    1 
ATOM   3936 C  CE    . LYS B 1 152 ? 31.775  100.858 26.263  1.00 49.48  ? 146  LYS B CE    1 
ATOM   3937 N  NZ    . LYS B 1 152 ? 30.489  101.482 25.885  1.00 52.01  ? 146  LYS B NZ    1 
ATOM   3938 N  N     . ASN B 1 153 ? 29.626  96.142  24.220  1.00 44.93  ? 147  ASN B N     1 
ATOM   3939 C  CA    . ASN B 1 153 ? 28.577  95.818  23.268  1.00 45.21  ? 147  ASN B CA    1 
ATOM   3940 C  C     . ASN B 1 153 ? 28.954  94.612  22.411  1.00 46.68  ? 147  ASN B C     1 
ATOM   3941 O  O     . ASN B 1 153 ? 30.138  94.248  22.313  1.00 47.63  ? 147  ASN B O     1 
ATOM   3942 C  CB    . ASN B 1 153 ? 28.308  97.031  22.388  1.00 43.54  ? 147  ASN B CB    1 
ATOM   3943 C  CG    . ASN B 1 153 ? 29.574  97.719  21.981  1.00 41.26  ? 147  ASN B CG    1 
ATOM   3944 O  OD1   . ASN B 1 153 ? 30.525  97.065  21.562  1.00 41.48  ? 147  ASN B OD1   1 
ATOM   3945 N  ND2   . ASN B 1 153 ? 29.605  99.040  22.102  1.00 40.66  ? 147  ASN B ND2   1 
ATOM   3946 N  N     . LYS B 1 154 ? 27.941  94.011  21.782  1.00 45.76  ? 148  LYS B N     1 
ATOM   3947 C  CA    . LYS B 1 154 ? 28.138  92.824  20.962  1.00 43.57  ? 148  LYS B CA    1 
ATOM   3948 C  C     . LYS B 1 154 ? 29.187  92.998  19.907  1.00 42.21  ? 148  LYS B C     1 
ATOM   3949 O  O     . LYS B 1 154 ? 29.847  92.040  19.521  1.00 41.49  ? 148  LYS B O     1 
ATOM   3950 C  CB    . LYS B 1 154 ? 26.854  92.412  20.263  1.00 44.44  ? 148  LYS B CB    1 
ATOM   3951 C  CG    . LYS B 1 154 ? 25.667  92.183  21.169  1.00 47.04  ? 148  LYS B CG    1 
ATOM   3952 C  CD    . LYS B 1 154 ? 24.517  91.477  20.444  1.00 50.06  ? 148  LYS B CD    1 
ATOM   3953 C  CE    . LYS B 1 154 ? 24.277  91.988  19.022  1.00 51.63  ? 148  LYS B CE    1 
ATOM   3954 N  NZ    . LYS B 1 154 ? 24.932  93.278  18.742  1.00 54.94  ? 148  LYS B NZ    1 
ATOM   3955 N  N     . VAL B 1 155 ? 29.354  94.220  19.441  1.00 41.41  ? 149  VAL B N     1 
ATOM   3956 C  CA    . VAL B 1 155 ? 30.319  94.465  18.390  1.00 42.77  ? 149  VAL B CA    1 
ATOM   3957 C  C     . VAL B 1 155 ? 31.755  94.272  18.810  1.00 43.43  ? 149  VAL B C     1 
ATOM   3958 O  O     . VAL B 1 155 ? 32.514  93.559  18.134  1.00 41.53  ? 149  VAL B O     1 
ATOM   3959 C  CB    . VAL B 1 155 ? 30.174  95.858  17.866  1.00 42.84  ? 149  VAL B CB    1 
ATOM   3960 C  CG1   . VAL B 1 155 ? 30.090  95.818  16.351  1.00 41.39  ? 149  VAL B CG1   1 
ATOM   3961 C  CG2   . VAL B 1 155 ? 28.944  96.504  18.509  1.00 44.30  ? 149  VAL B CG2   1 
ATOM   3962 N  N     . PHE B 1 156 ? 32.123  94.918  19.920  1.00 44.31  ? 150  PHE B N     1 
ATOM   3963 C  CA    . PHE B 1 156 ? 33.483  94.830  20.433  1.00 44.69  ? 150  PHE B CA    1 
ATOM   3964 C  C     . PHE B 1 156 ? 33.749  93.463  21.029  1.00 44.81  ? 150  PHE B C     1 
ATOM   3965 O  O     . PHE B 1 156 ? 34.841  92.913  20.861  1.00 46.68  ? 150  PHE B O     1 
ATOM   3966 C  CB    . PHE B 1 156 ? 33.747  95.943  21.443  1.00 45.12  ? 150  PHE B CB    1 
ATOM   3967 C  CG    . PHE B 1 156 ? 34.186  97.240  20.803  1.00 48.65  ? 150  PHE B CG    1 
ATOM   3968 C  CD1   . PHE B 1 156 ? 33.721  98.464  21.280  1.00 50.57  ? 150  PHE B CD1   1 
ATOM   3969 C  CD2   . PHE B 1 156 ? 35.067  97.235  19.715  1.00 49.82  ? 150  PHE B CD2   1 
ATOM   3970 C  CE1   . PHE B 1 156 ? 34.122  99.663  20.683  1.00 51.34  ? 150  PHE B CE1   1 
ATOM   3971 C  CE2   . PHE B 1 156 ? 35.478  98.432  19.108  1.00 49.71  ? 150  PHE B CE2   1 
ATOM   3972 C  CZ    . PHE B 1 156 ? 35.003  99.644  19.595  1.00 50.89  ? 150  PHE B CZ    1 
ATOM   3973 N  N     . ALA B 1 157 ? 32.745  92.907  21.701  1.00 42.70  ? 151  ALA B N     1 
ATOM   3974 C  CA    . ALA B 1 157 ? 32.860  91.577  22.277  1.00 41.31  ? 151  ALA B CA    1 
ATOM   3975 C  C     . ALA B 1 157 ? 33.316  90.617  21.179  1.00 41.80  ? 151  ALA B C     1 
ATOM   3976 O  O     . ALA B 1 157 ? 34.230  89.814  21.365  1.00 41.30  ? 151  ALA B O     1 
ATOM   3977 C  CB    . ALA B 1 157 ? 31.529  91.148  22.808  1.00 39.94  ? 151  ALA B CB    1 
ATOM   3978 N  N     . LYS B 1 158 ? 32.673  90.721  20.024  1.00 42.72  ? 152  LYS B N     1 
ATOM   3979 C  CA    . LYS B 1 158 ? 32.998  89.875  18.892  1.00 44.68  ? 152  LYS B CA    1 
ATOM   3980 C  C     . LYS B 1 158 ? 34.389  90.201  18.362  1.00 45.39  ? 152  LYS B C     1 
ATOM   3981 O  O     . LYS B 1 158 ? 35.157  89.306  18.040  1.00 44.95  ? 152  LYS B O     1 
ATOM   3982 C  CB    . LYS B 1 158 ? 31.949  90.054  17.794  1.00 46.08  ? 152  LYS B CB    1 
ATOM   3983 C  CG    . LYS B 1 158 ? 32.159  89.138  16.603  1.00 47.72  ? 152  LYS B CG    1 
ATOM   3984 C  CD    . LYS B 1 158 ? 31.249  89.458  15.438  1.00 48.85  ? 152  LYS B CD    1 
ATOM   3985 C  CE    . LYS B 1 158 ? 31.598  88.553  14.277  1.00 51.95  ? 152  LYS B CE    1 
ATOM   3986 N  NZ    . LYS B 1 158 ? 33.066  88.554  13.950  1.00 53.60  ? 152  LYS B NZ    1 
ATOM   3987 N  N     . ILE B 1 159 ? 34.712  91.486  18.278  1.00 46.56  ? 153  ILE B N     1 
ATOM   3988 C  CA    . ILE B 1 159 ? 36.022  91.912  17.800  1.00 47.72  ? 153  ILE B CA    1 
ATOM   3989 C  C     . ILE B 1 159 ? 37.131  91.358  18.688  1.00 48.63  ? 153  ILE B C     1 
ATOM   3990 O  O     . ILE B 1 159 ? 38.195  90.990  18.191  1.00 48.55  ? 153  ILE B O     1 
ATOM   3991 C  CB    . ILE B 1 159 ? 36.138  93.450  17.767  1.00 48.37  ? 153  ILE B CB    1 
ATOM   3992 C  CG1   . ILE B 1 159 ? 35.136  94.017  16.759  1.00 49.00  ? 153  ILE B CG1   1 
ATOM   3993 C  CG2   . ILE B 1 159 ? 37.552  93.865  17.374  1.00 47.28  ? 153  ILE B CG2   1 
ATOM   3994 C  CD1   . ILE B 1 159 ? 35.059  95.530  16.735  1.00 49.21  ? 153  ILE B CD1   1 
ATOM   3995 N  N     . ALA B 1 160 ? 36.874  91.300  19.996  1.00 49.68  ? 154  ALA B N     1 
ATOM   3996 C  CA    . ALA B 1 160 ? 37.846  90.787  20.972  1.00 50.91  ? 154  ALA B CA    1 
ATOM   3997 C  C     . ALA B 1 160 ? 38.274  89.393  20.581  1.00 52.07  ? 154  ALA B C     1 
ATOM   3998 O  O     . ALA B 1 160 ? 39.464  89.103  20.423  1.00 52.10  ? 154  ALA B O     1 
ATOM   3999 C  CB    . ALA B 1 160 ? 37.230  90.742  22.354  1.00 51.10  ? 154  ALA B CB    1 
ATOM   4000 N  N     . ALA B 1 161 ? 37.277  88.527  20.437  1.00 52.92  ? 155  ALA B N     1 
ATOM   4001 C  CA    . ALA B 1 161 ? 37.514  87.152  20.047  1.00 52.46  ? 155  ALA B CA    1 
ATOM   4002 C  C     . ALA B 1 161 ? 38.335  87.107  18.760  1.00 51.98  ? 155  ALA B C     1 
ATOM   4003 O  O     . ALA B 1 161 ? 39.269  86.329  18.648  1.00 52.98  ? 155  ALA B O     1 
ATOM   4004 C  CB    . ALA B 1 161 ? 36.185  86.431  19.862  1.00 52.39  ? 155  ALA B CB    1 
ATOM   4005 N  N     . ASP B 1 162 ? 38.009  87.955  17.794  1.00 51.74  ? 156  ASP B N     1 
ATOM   4006 C  CA    . ASP B 1 162 ? 38.747  87.952  16.540  1.00 52.40  ? 156  ASP B CA    1 
ATOM   4007 C  C     . ASP B 1 162 ? 40.250  88.003  16.771  1.00 52.59  ? 156  ASP B C     1 
ATOM   4008 O  O     . ASP B 1 162 ? 41.018  87.337  16.076  1.00 52.02  ? 156  ASP B O     1 
ATOM   4009 C  CB    A ASP B 1 162 ? 38.305  89.128  15.678  0.50 52.73  ? 156  ASP B CB    1 
ATOM   4010 C  CG    A ASP B 1 162 ? 36.853  89.022  15.269  0.50 53.40  ? 156  ASP B CG    1 
ATOM   4011 O  OD1   A ASP B 1 162 ? 36.539  88.203  14.381  0.50 52.89  ? 156  ASP B OD1   1 
ATOM   4012 O  OD2   A ASP B 1 162 ? 36.020  89.747  15.849  0.50 54.05  ? 156  ASP B OD2   1 
ATOM   4013 N  N     . MET B 1 163 ? 40.669  88.785  17.760  1.00 52.96  ? 157  MET B N     1 
ATOM   4014 C  CA    . MET B 1 163 ? 42.090  88.910  18.054  1.00 52.78  ? 157  MET B CA    1 
ATOM   4015 C  C     . MET B 1 163 ? 42.543  87.864  19.056  1.00 51.50  ? 157  MET B C     1 
ATOM   4016 O  O     . MET B 1 163 ? 43.696  87.444  19.049  1.00 50.80  ? 157  MET B O     1 
ATOM   4017 C  CB    . MET B 1 163 ? 42.403  90.332  18.549  1.00 54.00  ? 157  MET B CB    1 
ATOM   4018 C  CG    . MET B 1 163 ? 41.189  91.110  19.074  1.00 57.19  ? 157  MET B CG    1 
ATOM   4019 S  SD    . MET B 1 163 ? 41.524  92.882  19.487  1.00 58.54  ? 157  MET B SD    1 
ATOM   4020 C  CE    . MET B 1 163 ? 41.636  93.551  17.859  1.00 57.22  ? 157  MET B CE    1 
ATOM   4021 N  N     . ALA B 1 164 ? 41.604  87.409  19.872  1.00 50.15  ? 158  ALA B N     1 
ATOM   4022 C  CA    . ALA B 1 164 ? 41.873  86.409  20.891  1.00 50.52  ? 158  ALA B CA    1 
ATOM   4023 C  C     . ALA B 1 164 ? 42.054  84.959  20.389  1.00 51.03  ? 158  ALA B C     1 
ATOM   4024 O  O     . ALA B 1 164 ? 42.739  84.154  21.037  1.00 51.03  ? 158  ALA B O     1 
ATOM   4025 C  CB    . ALA B 1 164 ? 40.764  86.467  21.937  1.00 49.85  ? 158  ALA B CB    1 
ATOM   4026 N  N     . LYS B 1 165 ? 41.446  84.629  19.248  1.00 51.07  ? 159  LYS B N     1 
ATOM   4027 C  CA    . LYS B 1 165 ? 41.528  83.274  18.690  1.00 51.35  ? 159  LYS B CA    1 
ATOM   4028 C  C     . LYS B 1 165 ? 42.955  82.937  18.273  1.00 52.01  ? 159  LYS B C     1 
ATOM   4029 O  O     . LYS B 1 165 ? 43.712  83.822  17.896  1.00 53.82  ? 159  LYS B O     1 
ATOM   4030 C  CB    A LYS B 1 165 ? 40.597  83.129  17.472  0.50 49.52  ? 159  LYS B CB    1 
ATOM   4031 C  CG    A LYS B 1 165 ? 41.235  83.485  16.128  0.50 47.15  ? 159  LYS B CG    1 
ATOM   4032 C  CD    A LYS B 1 165 ? 40.241  83.409  14.967  0.50 45.10  ? 159  LYS B CD    1 
ATOM   4033 C  CE    A LYS B 1 165 ? 40.930  83.622  13.617  0.50 43.47  ? 159  LYS B CE    1 
ATOM   4034 N  NZ    A LYS B 1 165 ? 39.968  83.898  12.517  0.50 42.48  ? 159  LYS B NZ    1 
ATOM   4035 N  N     . PRO B 1 166 ? 43.333  81.645  18.305  1.00 51.43  ? 160  PRO B N     1 
ATOM   4036 C  CA    . PRO B 1 166 ? 42.519  80.493  18.701  1.00 50.33  ? 160  PRO B CA    1 
ATOM   4037 C  C     . PRO B 1 166 ? 42.592  80.207  20.192  1.00 49.92  ? 160  PRO B C     1 
ATOM   4038 O  O     . PRO B 1 166 ? 43.479  80.702  20.877  1.00 48.91  ? 160  PRO B O     1 
ATOM   4039 C  CB    . PRO B 1 166 ? 43.106  79.376  17.868  1.00 50.30  ? 160  PRO B CB    1 
ATOM   4040 C  CG    . PRO B 1 166 ? 44.562  79.709  17.917  1.00 51.29  ? 160  PRO B CG    1 
ATOM   4041 C  CD    . PRO B 1 166 ? 44.598  81.201  17.695  1.00 50.59  ? 160  PRO B CD    1 
ATOM   4042 N  N     . ASN B 1 167 ? 41.645  79.408  20.676  1.00 50.57  ? 161  ASN B N     1 
ATOM   4043 C  CA    . ASN B 1 167 ? 41.544  79.033  22.085  1.00 50.05  ? 161  ASN B CA    1 
ATOM   4044 C  C     . ASN B 1 167 ? 41.954  80.167  22.996  1.00 49.15  ? 161  ASN B C     1 
ATOM   4045 O  O     . ASN B 1 167 ? 42.881  80.027  23.784  1.00 48.95  ? 161  ASN B O     1 
ATOM   4046 C  CB    . ASN B 1 167 ? 42.426  77.836  22.386  1.00 52.44  ? 161  ASN B CB    1 
ATOM   4047 C  CG    . ASN B 1 167 ? 42.153  77.249  23.759  1.00 56.21  ? 161  ASN B CG    1 
ATOM   4048 O  OD1   . ASN B 1 167 ? 41.553  77.908  24.632  1.00 58.78  ? 161  ASN B OD1   1 
ATOM   4049 N  ND2   . ASN B 1 167 ? 42.598  76.006  23.969  1.00 56.40  ? 161  ASN B ND2   1 
ATOM   4050 N  N     . GLY B 1 168 ? 41.256  81.289  22.894  1.00 48.89  ? 162  GLY B N     1 
ATOM   4051 C  CA    . GLY B 1 168 ? 41.597  82.433  23.714  1.00 48.42  ? 162  GLY B CA    1 
ATOM   4052 C  C     . GLY B 1 168 ? 40.490  82.994  24.585  1.00 48.34  ? 162  GLY B C     1 
ATOM   4053 O  O     . GLY B 1 168 ? 39.442  82.384  24.770  1.00 46.94  ? 162  GLY B O     1 
ATOM   4054 N  N     . ILE B 1 169 ? 40.745  84.177  25.130  1.00 48.57  ? 163  ILE B N     1 
ATOM   4055 C  CA    . ILE B 1 169 ? 39.800  84.864  25.989  1.00 48.71  ? 163  ILE B CA    1 
ATOM   4056 C  C     . ILE B 1 169 ? 40.367  86.250  26.188  1.00 50.33  ? 163  ILE B C     1 
ATOM   4057 O  O     . ILE B 1 169 ? 41.389  86.409  26.827  1.00 51.22  ? 163  ILE B O     1 
ATOM   4058 C  CB    . ILE B 1 169 ? 39.678  84.165  27.345  1.00 47.69  ? 163  ILE B CB    1 
ATOM   4059 C  CG1   . ILE B 1 169 ? 38.692  84.921  28.240  1.00 46.04  ? 163  ILE B CG1   1 
ATOM   4060 C  CG2   . ILE B 1 169 ? 41.047  84.060  27.989  1.00 47.78  ? 163  ILE B CG2   1 
ATOM   4061 C  CD1   . ILE B 1 169 ? 38.487  84.296  29.617  1.00 42.96  ? 163  ILE B CD1   1 
ATOM   4062 N  N     . LYS B 1 170 ? 39.708  87.246  25.611  1.00 52.56  ? 164  LYS B N     1 
ATOM   4063 C  CA    . LYS B 1 170 ? 40.157  88.625  25.709  1.00 53.65  ? 164  LYS B CA    1 
ATOM   4064 C  C     . LYS B 1 170 ? 39.095  89.545  26.273  1.00 53.99  ? 164  LYS B C     1 
ATOM   4065 O  O     . LYS B 1 170 ? 37.904  89.245  26.258  1.00 53.62  ? 164  LYS B O     1 
ATOM   4066 C  CB    . LYS B 1 170 ? 40.585  89.152  24.336  1.00 54.65  ? 164  LYS B CB    1 
ATOM   4067 C  CG    . LYS B 1 170 ? 41.111  90.591  24.370  1.00 57.02  ? 164  LYS B CG    1 
ATOM   4068 C  CD    . LYS B 1 170 ? 41.880  90.952  23.111  1.00 58.12  ? 164  LYS B CD    1 
ATOM   4069 C  CE    . LYS B 1 170 ? 42.593  92.282  23.270  1.00 59.84  ? 164  LYS B CE    1 
ATOM   4070 N  NZ    . LYS B 1 170 ? 43.541  92.531  22.142  1.00 61.40  ? 164  LYS B NZ    1 
ATOM   4071 N  N     . VAL B 1 171 ? 39.555  90.683  26.769  1.00 54.94  ? 165  VAL B N     1 
ATOM   4072 C  CA    . VAL B 1 171 ? 38.683  91.688  27.343  1.00 54.15  ? 165  VAL B CA    1 
ATOM   4073 C  C     . VAL B 1 171 ? 39.069  93.052  26.789  1.00 54.73  ? 165  VAL B C     1 
ATOM   4074 O  O     . VAL B 1 171 ? 40.250  93.398  26.695  1.00 53.46  ? 165  VAL B O     1 
ATOM   4075 C  CB    . VAL B 1 171 ? 38.785  91.693  28.905  1.00 52.77  ? 165  VAL B CB    1 
ATOM   4076 C  CG1   . VAL B 1 171 ? 38.084  92.924  29.501  1.00 50.00  ? 165  VAL B CG1   1 
ATOM   4077 C  CG2   . VAL B 1 171 ? 38.177  90.413  29.454  1.00 50.10  ? 165  VAL B CG2   1 
ATOM   4078 N  N     . ILE B 1 172 ? 38.054  93.803  26.383  1.00 56.35  ? 166  ILE B N     1 
ATOM   4079 C  CA    . ILE B 1 172 ? 38.262  95.143  25.873  1.00 58.79  ? 166  ILE B CA    1 
ATOM   4080 C  C     . ILE B 1 172 ? 37.455  96.094  26.751  1.00 60.90  ? 166  ILE B C     1 
ATOM   4081 O  O     . ILE B 1 172 ? 36.350  96.520  26.395  1.00 60.68  ? 166  ILE B O     1 
ATOM   4082 C  CB    . ILE B 1 172 ? 37.824  95.283  24.394  1.00 57.37  ? 166  ILE B CB    1 
ATOM   4083 C  CG1   . ILE B 1 172 ? 38.511  94.202  23.553  1.00 55.90  ? 166  ILE B CG1   1 
ATOM   4084 C  CG2   . ILE B 1 172 ? 38.194  96.687  23.875  1.00 57.34  ? 166  ILE B CG2   1 
ATOM   4085 C  CD1   . ILE B 1 172 ? 38.387  94.382  22.067  1.00 54.97  ? 166  ILE B CD1   1 
ATOM   4086 N  N     A ASP B 1 173 ? 38.015  96.392  27.922  0.50 63.08  ? 167  ASP B N     1 
ATOM   4087 C  CA    A ASP B 1 173 ? 37.382  97.292  28.878  0.50 65.16  ? 167  ASP B CA    1 
ATOM   4088 C  C     . ASP B 1 173 ? 37.423  98.709  28.329  1.00 67.26  ? 167  ASP B C     1 
ATOM   4089 O  O     . ASP B 1 173 ? 38.434  99.139  27.774  1.00 67.40  ? 167  ASP B O     1 
ATOM   4090 C  CB    A ASP B 1 173 ? 38.100  97.232  30.231  0.50 63.66  ? 167  ASP B CB    1 
ATOM   4091 C  CG    A ASP B 1 173 ? 39.596  97.403  30.102  0.50 62.69  ? 167  ASP B CG    1 
ATOM   4092 O  OD1   A ASP B 1 173 ? 40.031  98.436  29.564  0.50 62.73  ? 167  ASP B OD1   1 
ATOM   4093 O  OD2   A ASP B 1 173 ? 40.344  96.507  30.536  0.50 61.68  ? 167  ASP B OD2   1 
ATOM   4094 N  N     . ASP B 1 174 ? 36.305  99.413  28.472  1.00 69.37  ? 168  ASP B N     1 
ATOM   4095 C  CA    . ASP B 1 174 ? 36.156  100.787 28.007  1.00 71.54  ? 168  ASP B CA    1 
ATOM   4096 C  C     . ASP B 1 174 ? 37.487  101.516 28.006  1.00 72.70  ? 168  ASP B C     1 
ATOM   4097 O  O     . ASP B 1 174 ? 37.847  102.192 27.042  1.00 71.54  ? 168  ASP B O     1 
ATOM   4098 C  CB    . ASP B 1 174 ? 35.173  101.527 28.912  1.00 72.26  ? 168  ASP B CB    1 
ATOM   4099 C  CG    . ASP B 1 174 ? 34.540  100.617 29.949  1.00 72.63  ? 168  ASP B CG    1 
ATOM   4100 O  OD1   . ASP B 1 174 ? 35.290  99.880  30.617  1.00 72.65  ? 168  ASP B OD1   1 
ATOM   4101 O  OD2   . ASP B 1 174 ? 33.301  100.640 30.104  1.00 73.32  ? 168  ASP B OD2   1 
ATOM   4102 N  N     . GLU B 1 175 ? 38.217  101.362 29.103  1.00 75.46  ? 169  GLU B N     1 
ATOM   4103 C  CA    . GLU B 1 175 ? 39.518  101.997 29.262  1.00 78.68  ? 169  GLU B CA    1 
ATOM   4104 C  C     . GLU B 1 175 ? 40.443  101.638 28.093  1.00 79.55  ? 169  GLU B C     1 
ATOM   4105 O  O     . GLU B 1 175 ? 41.579  102.113 28.021  1.00 80.84  ? 169  GLU B O     1 
ATOM   4106 C  CB    . GLU B 1 175 ? 40.180  101.562 30.588  1.00 79.73  ? 169  GLU B CB    1 
ATOM   4107 C  CG    . GLU B 1 175 ? 39.535  102.075 31.893  1.00 82.11  ? 169  GLU B CG    1 
ATOM   4108 C  CD    . GLU B 1 175 ? 38.710  101.010 32.628  1.00 84.23  ? 169  GLU B CD    1 
ATOM   4109 O  OE1   . GLU B 1 175 ? 39.029  99.799  32.512  1.00 84.93  ? 169  GLU B OE1   1 
ATOM   4110 O  OE2   . GLU B 1 175 ? 37.749  101.394 33.336  1.00 84.35  ? 169  GLU B OE2   1 
ATOM   4111 N  N     . GLU B 1 176 ? 39.949  100.816 27.174  1.00 79.12  ? 170  GLU B N     1 
ATOM   4112 C  CA    . GLU B 1 176 ? 40.746  100.380 26.039  1.00 78.65  ? 170  GLU B CA    1 
ATOM   4113 C  C     . GLU B 1 176 ? 39.959  100.425 24.746  1.00 77.76  ? 170  GLU B C     1 
ATOM   4114 O  O     . GLU B 1 176 ? 40.523  100.274 23.659  1.00 76.65  ? 170  GLU B O     1 
ATOM   4115 C  CB    . GLU B 1 176 ? 41.231  98.956  26.283  1.00 80.30  ? 170  GLU B CB    1 
ATOM   4116 C  CG    . GLU B 1 176 ? 41.998  98.357  25.124  1.00 82.20  ? 170  GLU B CG    1 
ATOM   4117 C  CD    . GLU B 1 176 ? 42.508  96.963  25.428  1.00 82.71  ? 170  GLU B CD    1 
ATOM   4118 O  OE1   . GLU B 1 176 ? 41.676  96.055  25.661  1.00 82.78  ? 170  GLU B OE1   1 
ATOM   4119 O  OE2   . GLU B 1 176 ? 43.744  96.783  25.436  1.00 82.61  ? 170  GLU B OE2   1 
ATOM   4120 N  N     . VAL B 1 177 ? 38.651  100.625 24.874  1.00 77.43  ? 171  VAL B N     1 
ATOM   4121 C  CA    . VAL B 1 177 ? 37.762  100.684 23.717  1.00 76.70  ? 171  VAL B CA    1 
ATOM   4122 C  C     . VAL B 1 177 ? 38.206  101.698 22.674  1.00 76.08  ? 171  VAL B C     1 
ATOM   4123 O  O     . VAL B 1 177 ? 38.144  101.421 21.475  1.00 76.28  ? 171  VAL B O     1 
ATOM   4124 C  CB    . VAL B 1 177 ? 36.319  101.021 24.132  1.00 76.45  ? 171  VAL B CB    1 
ATOM   4125 C  CG1   . VAL B 1 177 ? 35.543  101.528 22.942  1.00 75.52  ? 171  VAL B CG1   1 
ATOM   4126 C  CG2   . VAL B 1 177 ? 35.650  99.789  24.699  1.00 75.67  ? 171  VAL B CG2   1 
ATOM   4127 N  N     . LYS B 1 178 ? 38.647  102.867 23.132  1.00 75.41  ? 172  LYS B N     1 
ATOM   4128 C  CA    . LYS B 1 178 ? 39.102  103.931 22.233  1.00 74.03  ? 172  LYS B CA    1 
ATOM   4129 C  C     . LYS B 1 178 ? 40.347  103.561 21.425  1.00 72.87  ? 172  LYS B C     1 
ATOM   4130 O  O     . LYS B 1 178 ? 40.334  103.626 20.199  1.00 73.06  ? 172  LYS B O     1 
ATOM   4131 C  CB    . LYS B 1 178 ? 39.369  105.221 23.022  1.00 74.05  ? 172  LYS B CB    1 
ATOM   4132 C  CG    . LYS B 1 178 ? 38.129  106.064 23.284  1.00 72.79  ? 172  LYS B CG    1 
ATOM   4133 C  CD    . LYS B 1 178 ? 37.077  105.268 24.025  1.00 72.88  ? 172  LYS B CD    1 
ATOM   4134 C  CE    . LYS B 1 178 ? 35.755  105.981 24.013  1.00 71.87  ? 172  LYS B CE    1 
ATOM   4135 N  NZ    . LYS B 1 178 ? 35.871  107.271 24.707  1.00 72.18  ? 172  LYS B NZ    1 
ATOM   4136 N  N     . ARG B 1 179 ? 41.417  103.176 22.114  1.00 71.45  ? 173  ARG B N     1 
ATOM   4137 C  CA    . ARG B 1 179 ? 42.658  102.803 21.455  1.00 69.88  ? 173  ARG B CA    1 
ATOM   4138 C  C     . ARG B 1 179 ? 42.359  101.974 20.211  1.00 69.05  ? 173  ARG B C     1 
ATOM   4139 O  O     . ARG B 1 179 ? 43.062  102.086 19.206  1.00 69.58  ? 173  ARG B O     1 
ATOM   4140 C  CB    . ARG B 1 179 ? 43.554  102.015 22.411  1.00 70.67  ? 173  ARG B CB    1 
ATOM   4141 C  CG    . ARG B 1 179 ? 44.983  101.885 21.919  1.00 72.20  ? 173  ARG B CG    1 
ATOM   4142 C  CD    . ARG B 1 179 ? 45.790  100.868 22.704  1.00 74.37  ? 173  ARG B CD    1 
ATOM   4143 N  NE    . ARG B 1 179 ? 45.201  99.526  22.694  1.00 76.62  ? 173  ARG B NE    1 
ATOM   4144 C  CZ    . ARG B 1 179 ? 44.999  98.783  21.606  1.00 77.61  ? 173  ARG B CZ    1 
ATOM   4145 N  NH1   . ARG B 1 179 ? 45.337  99.244  20.405  1.00 77.36  ? 173  ARG B NH1   1 
ATOM   4146 N  NH2   . ARG B 1 179 ? 44.454  97.569  21.723  1.00 77.04  ? 173  ARG B NH2   1 
ATOM   4147 N  N     . LEU B 1 180 ? 41.323  101.137 20.273  1.00 67.14  ? 174  LEU B N     1 
ATOM   4148 C  CA    . LEU B 1 180 ? 40.959  100.342 19.106  1.00 65.22  ? 174  LEU B CA    1 
ATOM   4149 C  C     . LEU B 1 180 ? 40.181  101.169 18.100  1.00 64.20  ? 174  LEU B C     1 
ATOM   4150 O  O     . LEU B 1 180 ? 40.442  101.093 16.900  1.00 63.83  ? 174  LEU B O     1 
ATOM   4151 C  CB    . LEU B 1 180 ? 40.137  99.120  19.492  1.00 64.76  ? 174  LEU B CB    1 
ATOM   4152 C  CG    . LEU B 1 180 ? 40.958  97.884  19.870  1.00 65.22  ? 174  LEU B CG    1 
ATOM   4153 C  CD1   . LEU B 1 180 ? 40.073  96.652  19.754  1.00 64.27  ? 174  LEU B CD1   1 
ATOM   4154 C  CD2   . LEU B 1 180 ? 42.158  97.730  18.955  1.00 63.35  ? 174  LEU B CD2   1 
ATOM   4155 N  N     . ILE B 1 181 ? 39.232  101.965 18.582  1.00 62.87  ? 175  ILE B N     1 
ATOM   4156 C  CA    . ILE B 1 181 ? 38.453  102.799 17.685  1.00 63.02  ? 175  ILE B CA    1 
ATOM   4157 C  C     . ILE B 1 181 ? 39.410  103.564 16.779  1.00 65.23  ? 175  ILE B C     1 
ATOM   4158 O  O     . ILE B 1 181 ? 39.051  103.983 15.686  1.00 66.28  ? 175  ILE B O     1 
ATOM   4159 C  CB    . ILE B 1 181 ? 37.588  103.799 18.453  1.00 61.17  ? 175  ILE B CB    1 
ATOM   4160 C  CG1   . ILE B 1 181 ? 36.540  103.052 19.263  1.00 61.50  ? 175  ILE B CG1   1 
ATOM   4161 C  CG2   . ILE B 1 181 ? 36.897  104.736 17.488  1.00 60.87  ? 175  ILE B CG2   1 
ATOM   4162 C  CD1   . ILE B 1 181 ? 35.717  103.940 20.172  1.00 61.82  ? 175  ILE B CD1   1 
ATOM   4163 N  N     . ARG B 1 182 ? 40.645  103.728 17.230  1.00 67.14  ? 176  ARG B N     1 
ATOM   4164 C  CA    . ARG B 1 182 ? 41.634  104.443 16.443  1.00 69.16  ? 176  ARG B CA    1 
ATOM   4165 C  C     . ARG B 1 182 ? 42.515  103.511 15.622  1.00 70.68  ? 176  ARG B C     1 
ATOM   4166 O  O     . ARG B 1 182 ? 42.394  103.455 14.397  1.00 70.07  ? 176  ARG B O     1 
ATOM   4167 C  CB    . ARG B 1 182 ? 42.521  105.287 17.356  1.00 69.72  ? 176  ARG B CB    1 
ATOM   4168 C  CG    . ARG B 1 182 ? 41.788  106.360 18.136  1.00 71.47  ? 176  ARG B CG    1 
ATOM   4169 C  CD    . ARG B 1 182 ? 42.771  107.373 18.712  1.00 72.57  ? 176  ARG B CD    1 
ATOM   4170 N  NE    . ARG B 1 182 ? 43.586  106.820 19.788  1.00 72.49  ? 176  ARG B NE    1 
ATOM   4171 C  CZ    . ARG B 1 182 ? 43.161  106.680 21.037  1.00 72.15  ? 176  ARG B CZ    1 
ATOM   4172 N  NH1   . ARG B 1 182 ? 41.929  107.058 21.365  1.00 72.06  ? 176  ARG B NH1   1 
ATOM   4173 N  NH2   . ARG B 1 182 ? 43.970  106.167 21.953  1.00 71.98  ? 176  ARG B NH2   1 
ATOM   4174 N  N     . GLU B 1 183 ? 43.394  102.787 16.318  1.00 72.63  ? 177  GLU B N     1 
ATOM   4175 C  CA    . GLU B 1 183 ? 44.353  101.862 15.709  1.00 74.48  ? 177  GLU B CA    1 
ATOM   4176 C  C     . GLU B 1 183 ? 43.772  100.594 15.097  1.00 75.04  ? 177  GLU B C     1 
ATOM   4177 O  O     . GLU B 1 183 ? 44.476  99.881  14.385  1.00 74.93  ? 177  GLU B O     1 
ATOM   4178 C  CB    . GLU B 1 183 ? 45.428  101.457 16.726  1.00 75.12  ? 177  GLU B CB    1 
ATOM   4179 C  CG    . GLU B 1 183 ? 46.410  102.555 17.125  1.00 77.93  ? 177  GLU B CG    1 
ATOM   4180 C  CD    . GLU B 1 183 ? 45.943  103.374 18.321  1.00 80.17  ? 177  GLU B CD    1 
ATOM   4181 O  OE1   . GLU B 1 183 ? 45.595  102.758 19.346  1.00 81.31  ? 177  GLU B OE1   1 
ATOM   4182 O  OE2   . GLU B 1 183 ? 45.936  104.627 18.248  1.00 81.48  ? 177  GLU B OE2   1 
ATOM   4183 N  N     . LEU B 1 184 ? 42.507  100.299 15.377  1.00 75.69  ? 178  LEU B N     1 
ATOM   4184 C  CA    . LEU B 1 184 ? 41.886  99.105  14.814  1.00 76.78  ? 178  LEU B CA    1 
ATOM   4185 C  C     . LEU B 1 184 ? 41.610  99.269  13.325  1.00 78.41  ? 178  LEU B C     1 
ATOM   4186 O  O     . LEU B 1 184 ? 40.941  100.223 12.916  1.00 79.24  ? 178  LEU B O     1 
ATOM   4187 C  CB    . LEU B 1 184 ? 40.572  98.781  15.529  1.00 75.34  ? 178  LEU B CB    1 
ATOM   4188 C  CG    . LEU B 1 184 ? 39.727  97.648  14.931  1.00 73.60  ? 178  LEU B CG    1 
ATOM   4189 C  CD1   . LEU B 1 184 ? 40.594  96.427  14.628  1.00 72.68  ? 178  LEU B CD1   1 
ATOM   4190 C  CD2   . LEU B 1 184 ? 38.620  97.296  15.898  1.00 72.60  ? 178  LEU B CD2   1 
ATOM   4191 N  N     . ASP B 1 185 ? 42.120  98.330  12.525  1.00 79.49  ? 179  ASP B N     1 
ATOM   4192 C  CA    . ASP B 1 185 ? 41.932  98.346  11.073  1.00 79.61  ? 179  ASP B CA    1 
ATOM   4193 C  C     . ASP B 1 185 ? 40.436  98.447  10.753  1.00 78.61  ? 179  ASP B C     1 
ATOM   4194 O  O     . ASP B 1 185 ? 39.591  98.092  11.571  1.00 78.86  ? 179  ASP B O     1 
ATOM   4195 C  CB    . ASP B 1 185 ? 42.523  97.076  10.446  1.00 81.07  ? 179  ASP B CB    1 
ATOM   4196 C  CG    . ASP B 1 185 ? 43.893  96.712  11.024  1.00 82.83  ? 179  ASP B CG    1 
ATOM   4197 O  OD1   . ASP B 1 185 ? 43.958  96.345  12.223  1.00 82.32  ? 179  ASP B OD1   1 
ATOM   4198 O  OD2   . ASP B 1 185 ? 44.901  96.791  10.281  1.00 83.43  ? 179  ASP B OD2   1 
ATOM   4199 N  N     . ILE B 1 186 ? 40.103  98.925  9.565   1.00 77.32  ? 180  ILE B N     1 
ATOM   4200 C  CA    . ILE B 1 186 ? 38.704  99.089  9.212   1.00 75.85  ? 180  ILE B CA    1 
ATOM   4201 C  C     . ILE B 1 186 ? 38.107  97.816  8.643   1.00 75.49  ? 180  ILE B C     1 
ATOM   4202 O  O     . ILE B 1 186 ? 36.980  97.447  8.975   1.00 76.26  ? 180  ILE B O     1 
ATOM   4203 C  CB    . ILE B 1 186 ? 38.538  100.233 8.200   1.00 75.62  ? 180  ILE B CB    1 
ATOM   4204 C  CG1   . ILE B 1 186 ? 37.067  100.627 8.091   1.00 75.04  ? 180  ILE B CG1   1 
ATOM   4205 C  CG2   . ILE B 1 186 ? 39.114  99.821  6.850   1.00 75.45  ? 180  ILE B CG2   1 
ATOM   4206 C  CD1   . ILE B 1 186 ? 36.849  101.956 7.392   1.00 74.24  ? 180  ILE B CD1   1 
ATOM   4207 N  N     . ALA B 1 187 ? 38.870  97.138  7.792   1.00 74.06  ? 181  ALA B N     1 
ATOM   4208 C  CA    . ALA B 1 187 ? 38.402  95.903  7.180   1.00 72.10  ? 181  ALA B CA    1 
ATOM   4209 C  C     . ALA B 1 187 ? 38.100  94.858  8.242   1.00 70.67  ? 181  ALA B C     1 
ATOM   4210 O  O     . ALA B 1 187 ? 37.369  93.900  7.994   1.00 70.63  ? 181  ALA B O     1 
ATOM   4211 C  CB    . ALA B 1 187 ? 39.440  95.379  6.208   1.00 72.04  ? 181  ALA B CB    1 
ATOM   4212 N  N     . ASP B 1 188 ? 38.659  95.058  9.428   1.00 69.39  ? 182  ASP B N     1 
ATOM   4213 C  CA    . ASP B 1 188 ? 38.447  94.132  10.529  1.00 69.05  ? 182  ASP B CA    1 
ATOM   4214 C  C     . ASP B 1 188 ? 37.174  94.374  11.330  1.00 67.19  ? 182  ASP B C     1 
ATOM   4215 O  O     . ASP B 1 188 ? 37.008  93.824  12.416  1.00 66.89  ? 182  ASP B O     1 
ATOM   4216 C  CB    . ASP B 1 188 ? 39.655  94.140  11.473  1.00 71.44  ? 182  ASP B CB    1 
ATOM   4217 C  CG    . ASP B 1 188 ? 40.779  93.219  10.996  1.00 74.28  ? 182  ASP B CG    1 
ATOM   4218 O  OD1   . ASP B 1 188 ? 41.575  93.628  10.115  1.00 74.79  ? 182  ASP B OD1   1 
ATOM   4219 O  OD2   . ASP B 1 188 ? 40.853  92.070  11.499  1.00 75.53  ? 182  ASP B OD2   1 
ATOM   4220 N  N     . VAL B 1 189 ? 36.267  95.178  10.794  1.00 65.54  ? 183  VAL B N     1 
ATOM   4221 C  CA    . VAL B 1 189 ? 35.023  95.456  11.494  1.00 64.53  ? 183  VAL B CA    1 
ATOM   4222 C  C     . VAL B 1 189 ? 33.891  94.568  10.960  1.00 64.13  ? 183  VAL B C     1 
ATOM   4223 O  O     . VAL B 1 189 ? 33.517  94.647  9.777   1.00 64.69  ? 183  VAL B O     1 
ATOM   4224 C  CB    . VAL B 1 189 ? 34.628  96.942  11.352  1.00 64.73  ? 183  VAL B CB    1 
ATOM   4225 C  CG1   . VAL B 1 189 ? 33.456  97.249  12.259  1.00 64.96  ? 183  VAL B CG1   1 
ATOM   4226 C  CG2   . VAL B 1 189 ? 35.807  97.833  11.698  1.00 63.55  ? 183  VAL B CG2   1 
ATOM   4227 N  N     . PRO B 1 190 ? 33.331  93.709  11.834  1.00 62.51  ? 184  PRO B N     1 
ATOM   4228 C  CA    . PRO B 1 190 ? 32.244  92.773  11.529  1.00 61.28  ? 184  PRO B CA    1 
ATOM   4229 C  C     . PRO B 1 190 ? 31.092  93.395  10.766  1.00 60.66  ? 184  PRO B C     1 
ATOM   4230 O  O     . PRO B 1 190 ? 30.275  94.107  11.355  1.00 60.38  ? 184  PRO B O     1 
ATOM   4231 C  CB    . PRO B 1 190 ? 31.796  92.302  12.907  1.00 60.56  ? 184  PRO B CB    1 
ATOM   4232 C  CG    . PRO B 1 190 ? 33.027  92.320  13.673  1.00 60.95  ? 184  PRO B CG    1 
ATOM   4233 C  CD    . PRO B 1 190 ? 33.679  93.629  13.261  1.00 61.51  ? 184  PRO B CD    1 
ATOM   4234 N  N     . GLY B 1 191 ? 31.028  93.121  9.464   1.00 59.35  ? 185  GLY B N     1 
ATOM   4235 C  CA    . GLY B 1 191 ? 29.947  93.651  8.653   1.00 58.45  ? 185  GLY B CA    1 
ATOM   4236 C  C     . GLY B 1 191 ? 30.458  94.426  7.463   1.00 58.11  ? 185  GLY B C     1 
ATOM   4237 O  O     . GLY B 1 191 ? 29.838  94.457  6.403   1.00 57.67  ? 185  GLY B O     1 
ATOM   4238 N  N     . ILE B 1 192 ? 31.601  95.068  7.638   1.00 58.12  ? 186  ILE B N     1 
ATOM   4239 C  CA    . ILE B 1 192 ? 32.182  95.833  6.548   1.00 57.95  ? 186  ILE B CA    1 
ATOM   4240 C  C     . ILE B 1 192 ? 32.934  94.878  5.654   1.00 58.45  ? 186  ILE B C     1 
ATOM   4241 O  O     . ILE B 1 192 ? 34.156  94.797  5.721   1.00 60.13  ? 186  ILE B O     1 
ATOM   4242 C  CB    . ILE B 1 192 ? 33.160  96.876  7.068   1.00 56.66  ? 186  ILE B CB    1 
ATOM   4243 C  CG1   . ILE B 1 192 ? 32.424  97.827  8.009   1.00 57.16  ? 186  ILE B CG1   1 
ATOM   4244 C  CG2   . ILE B 1 192 ? 33.802  97.605  5.910   1.00 54.88  ? 186  ILE B CG2   1 
ATOM   4245 C  CD1   . ILE B 1 192 ? 31.168  98.423  7.418   1.00 55.91  ? 186  ILE B CD1   1 
ATOM   4246 N  N     . GLY B 1 193 ? 32.208  94.147  4.824   1.00 57.09  ? 187  GLY B N     1 
ATOM   4247 C  CA    . GLY B 1 193 ? 32.863  93.194  3.951   1.00 56.63  ? 187  GLY B CA    1 
ATOM   4248 C  C     . GLY B 1 193 ? 34.049  93.719  3.157   1.00 56.27  ? 187  GLY B C     1 
ATOM   4249 O  O     . GLY B 1 193 ? 34.508  94.843  3.344   1.00 54.27  ? 187  GLY B O     1 
ATOM   4250 N  N     . ASN B 1 194 ? 34.534  92.888  2.242   1.00 57.15  ? 188  ASN B N     1 
ATOM   4251 C  CA    . ASN B 1 194 ? 35.673  93.234  1.409   1.00 58.07  ? 188  ASN B CA    1 
ATOM   4252 C  C     . ASN B 1 194 ? 35.451  94.417  0.460   1.00 58.40  ? 188  ASN B C     1 
ATOM   4253 O  O     . ASN B 1 194 ? 36.282  95.327  0.405   1.00 59.44  ? 188  ASN B O     1 
ATOM   4254 C  CB    . ASN B 1 194 ? 36.129  91.994  0.641   1.00 58.47  ? 188  ASN B CB    1 
ATOM   4255 C  CG    . ASN B 1 194 ? 36.665  90.908  1.568   1.00 58.22  ? 188  ASN B CG    1 
ATOM   4256 O  OD1   . ASN B 1 194 ? 35.921  90.335  2.371   1.00 56.13  ? 188  ASN B OD1   1 
ATOM   4257 N  ND2   . ASN B 1 194 ? 37.966  90.632  1.469   1.00 58.45  ? 188  ASN B ND2   1 
ATOM   4258 N  N     . ILE B 1 195 ? 34.347  94.418  -0.286  1.00 57.86  ? 189  ILE B N     1 
ATOM   4259 C  CA    . ILE B 1 195 ? 34.054  95.532  -1.199  1.00 55.67  ? 189  ILE B CA    1 
ATOM   4260 C  C     . ILE B 1 195 ? 34.033  96.876  -0.462  1.00 53.16  ? 189  ILE B C     1 
ATOM   4261 O  O     . ILE B 1 195 ? 34.666  97.828  -0.886  1.00 51.58  ? 189  ILE B O     1 
ATOM   4262 C  CB    . ILE B 1 195 ? 32.691  95.336  -1.909  1.00 56.44  ? 189  ILE B CB    1 
ATOM   4263 C  CG1   . ILE B 1 195 ? 32.785  94.161  -2.877  1.00 57.24  ? 189  ILE B CG1   1 
ATOM   4264 C  CG2   . ILE B 1 195 ? 32.281  96.605  -2.636  1.00 55.97  ? 189  ILE B CG2   1 
ATOM   4265 C  CD1   . ILE B 1 195 ? 33.889  94.304  -3.907  1.00 58.72  ? 189  ILE B CD1   1 
ATOM   4266 N  N     . THR B 1 196 ? 33.303  96.952  0.640   1.00 51.85  ? 190  THR B N     1 
ATOM   4267 C  CA    . THR B 1 196 ? 33.249  98.193  1.379   1.00 52.60  ? 190  THR B CA    1 
ATOM   4268 C  C     . THR B 1 196 ? 34.658  98.565  1.819   1.00 53.41  ? 190  THR B C     1 
ATOM   4269 O  O     . THR B 1 196 ? 35.092  99.703  1.634   1.00 53.14  ? 190  THR B O     1 
ATOM   4270 C  CB    . THR B 1 196 ? 32.369  98.081  2.632   1.00 52.79  ? 190  THR B CB    1 
ATOM   4271 O  OG1   . THR B 1 196 ? 31.012  97.805  2.266   1.00 53.29  ? 190  THR B OG1   1 
ATOM   4272 C  CG2   . THR B 1 196 ? 32.394  99.390  3.388   1.00 54.37  ? 190  THR B CG2   1 
ATOM   4273 N  N     . ALA B 1 197 ? 35.360  97.589  2.397   1.00 54.06  ? 191  ALA B N     1 
ATOM   4274 C  CA    . ALA B 1 197 ? 36.723  97.762  2.900   1.00 53.60  ? 191  ALA B CA    1 
ATOM   4275 C  C     . ALA B 1 197 ? 37.647  98.400  1.892   1.00 54.65  ? 191  ALA B C     1 
ATOM   4276 O  O     . ALA B 1 197 ? 38.267  99.433  2.140   1.00 55.01  ? 191  ALA B O     1 
ATOM   4277 C  CB    . ALA B 1 197 ? 37.296  96.427  3.308   1.00 52.17  ? 191  ALA B CB    1 
ATOM   4278 N  N     . GLU B 1 198 ? 37.752  97.770  0.739   1.00 56.41  ? 192  GLU B N     1 
ATOM   4279 C  CA    . GLU B 1 198 ? 38.639  98.297  -0.267  1.00 58.14  ? 192  GLU B CA    1 
ATOM   4280 C  C     . GLU B 1 198 ? 38.288  99.722  -0.641  1.00 59.06  ? 192  GLU B C     1 
ATOM   4281 O  O     . GLU B 1 198 ? 39.170  100.575 -0.675  1.00 60.29  ? 192  GLU B O     1 
ATOM   4282 C  CB    . GLU B 1 198 ? 38.645  97.403  -1.505  1.00 58.29  ? 192  GLU B CB    1 
ATOM   4283 C  CG    . GLU B 1 198 ? 39.842  97.667  -2.392  1.00 59.14  ? 192  GLU B CG    1 
ATOM   4284 C  CD    . GLU B 1 198 ? 41.165  97.660  -1.620  1.00 58.91  ? 192  GLU B CD    1 
ATOM   4285 O  OE1   . GLU B 1 198 ? 42.234  97.661  -2.263  1.00 58.90  ? 192  GLU B OE1   1 
ATOM   4286 O  OE2   . GLU B 1 198 ? 41.148  97.661  -0.373  1.00 58.18  ? 192  GLU B OE2   1 
ATOM   4287 N  N     . LYS B 1 199 ? 37.010  99.984  -0.913  1.00 59.60  ? 193  LYS B N     1 
ATOM   4288 C  CA    . LYS B 1 199 ? 36.582  101.330 -1.276  1.00 59.81  ? 193  LYS B CA    1 
ATOM   4289 C  C     . LYS B 1 199 ? 37.278  102.338 -0.360  1.00 60.65  ? 193  LYS B C     1 
ATOM   4290 O  O     . LYS B 1 199 ? 38.169  103.094 -0.777  1.00 60.09  ? 193  LYS B O     1 
ATOM   4291 C  CB    . LYS B 1 199 ? 35.066  101.474 -1.125  1.00 59.54  ? 193  LYS B CB    1 
ATOM   4292 C  CG    . LYS B 1 199 ? 34.247  101.049 -2.327  1.00 59.36  ? 193  LYS B CG    1 
ATOM   4293 C  CD    . LYS B 1 199 ? 32.810  101.566 -2.176  1.00 60.07  ? 193  LYS B CD    1 
ATOM   4294 C  CE    . LYS B 1 199 ? 31.964  101.361 -3.436  1.00 61.53  ? 193  LYS B CE    1 
ATOM   4295 N  NZ    . LYS B 1 199 ? 31.820  99.927  -3.831  1.00 60.75  ? 193  LYS B NZ    1 
ATOM   4296 N  N     . LEU B 1 200 ? 36.864  102.332 0.899   1.00 60.63  ? 194  LEU B N     1 
ATOM   4297 C  CA    . LEU B 1 200 ? 37.438  103.217 1.885   1.00 61.12  ? 194  LEU B CA    1 
ATOM   4298 C  C     . LEU B 1 200 ? 38.961  103.221 1.790   1.00 62.71  ? 194  LEU B C     1 
ATOM   4299 O  O     . LEU B 1 200 ? 39.571  104.280 1.704   1.00 63.42  ? 194  LEU B O     1 
ATOM   4300 C  CB    . LEU B 1 200 ? 36.996  102.770 3.270   1.00 59.14  ? 194  LEU B CB    1 
ATOM   4301 C  CG    . LEU B 1 200 ? 35.486  102.833 3.461   1.00 59.08  ? 194  LEU B CG    1 
ATOM   4302 C  CD1   . LEU B 1 200 ? 35.089  101.914 4.573   1.00 59.69  ? 194  LEU B CD1   1 
ATOM   4303 C  CD2   . LEU B 1 200 ? 35.053  104.256 3.768   1.00 59.26  ? 194  LEU B CD2   1 
ATOM   4304 N  N     . LYS B 1 201 ? 39.573  102.041 1.795   1.00 64.52  ? 195  LYS B N     1 
ATOM   4305 C  CA    . LYS B 1 201 ? 41.029  101.942 1.721   1.00 66.24  ? 195  LYS B CA    1 
ATOM   4306 C  C     . LYS B 1 201 ? 41.590  102.875 0.648   1.00 66.69  ? 195  LYS B C     1 
ATOM   4307 O  O     . LYS B 1 201 ? 42.380  103.777 0.936   1.00 68.68  ? 195  LYS B O     1 
ATOM   4308 C  CB    . LYS B 1 201 ? 41.451  100.510 1.395   1.00 67.95  ? 195  LYS B CB    1 
ATOM   4309 C  CG    . LYS B 1 201 ? 42.855  100.155 1.853   1.00 68.98  ? 195  LYS B CG    1 
ATOM   4310 C  CD    . LYS B 1 201 ? 42.859  99.854  3.344   1.00 71.62  ? 195  LYS B CD    1 
ATOM   4311 C  CE    . LYS B 1 201 ? 42.019  98.608  3.663   1.00 72.75  ? 195  LYS B CE    1 
ATOM   4312 N  NZ    . LYS B 1 201 ? 41.759  98.445  5.131   1.00 72.27  ? 195  LYS B NZ    1 
ATOM   4313 N  N     . LYS B 1 202 ? 41.173  102.657 -0.592  1.00 65.04  ? 196  LYS B N     1 
ATOM   4314 C  CA    . LYS B 1 202 ? 41.639  103.468 -1.702  1.00 64.16  ? 196  LYS B CA    1 
ATOM   4315 C  C     . LYS B 1 202 ? 41.297  104.944 -1.546  1.00 63.04  ? 196  LYS B C     1 
ATOM   4316 O  O     . LYS B 1 202 ? 41.619  105.768 -2.397  1.00 63.15  ? 196  LYS B O     1 
ATOM   4317 C  CB    . LYS B 1 202 ? 41.056  102.920 -2.998  1.00 65.13  ? 196  LYS B CB    1 
ATOM   4318 C  CG    . LYS B 1 202 ? 41.970  101.930 -3.709  1.00 66.26  ? 196  LYS B CG    1 
ATOM   4319 C  CD    . LYS B 1 202 ? 42.584  100.893 -2.762  1.00 65.54  ? 196  LYS B CD    1 
ATOM   4320 C  CE    . LYS B 1 202 ? 43.587  99.997  -3.503  1.00 64.26  ? 196  LYS B CE    1 
ATOM   4321 N  NZ    . LYS B 1 202 ? 42.984  99.254  -4.655  1.00 60.98  ? 196  LYS B NZ    1 
ATOM   4322 N  N     . LEU B 1 203 ? 40.647  105.276 -0.445  1.00 61.83  ? 197  LEU B N     1 
ATOM   4323 C  CA    . LEU B 1 203 ? 40.271  106.650 -0.177  1.00 61.83  ? 197  LEU B CA    1 
ATOM   4324 C  C     . LEU B 1 203 ? 40.925  107.144 1.117   1.00 61.94  ? 197  LEU B C     1 
ATOM   4325 O  O     . LEU B 1 203 ? 40.512  108.168 1.678   1.00 62.26  ? 197  LEU B O     1 
ATOM   4326 C  CB    . LEU B 1 203 ? 38.752  106.751 -0.066  1.00 61.48  ? 197  LEU B CB    1 
ATOM   4327 C  CG    . LEU B 1 203 ? 38.020  107.474 -1.188  1.00 60.57  ? 197  LEU B CG    1 
ATOM   4328 C  CD1   . LEU B 1 203 ? 36.531  107.158 -1.110  1.00 61.15  ? 197  LEU B CD1   1 
ATOM   4329 C  CD2   . LEU B 1 203 ? 38.272  108.961 -1.073  1.00 58.76  ? 197  LEU B CD2   1 
ATOM   4330 N  N     . GLY B 1 204 ? 41.929  106.404 1.592   1.00 60.58  ? 198  GLY B N     1 
ATOM   4331 C  CA    . GLY B 1 204 ? 42.640  106.774 2.808   1.00 60.26  ? 198  GLY B CA    1 
ATOM   4332 C  C     . GLY B 1 204 ? 41.934  106.570 4.145   1.00 60.23  ? 198  GLY B C     1 
ATOM   4333 O  O     . GLY B 1 204 ? 42.442  107.001 5.189   1.00 58.91  ? 198  GLY B O     1 
ATOM   4334 N  N     . ILE B 1 205 ? 40.772  105.915 4.116   1.00 60.37  ? 199  ILE B N     1 
ATOM   4335 C  CA    . ILE B 1 205 ? 39.983  105.648 5.322   1.00 60.12  ? 199  ILE B CA    1 
ATOM   4336 C  C     . ILE B 1 205 ? 40.169  104.189 5.744   1.00 59.23  ? 199  ILE B C     1 
ATOM   4337 O  O     . ILE B 1 205 ? 39.445  103.307 5.286   1.00 59.99  ? 199  ILE B O     1 
ATOM   4338 C  CB    . ILE B 1 205 ? 38.471  105.894 5.073   1.00 60.19  ? 199  ILE B CB    1 
ATOM   4339 C  CG1   . ILE B 1 205 ? 38.264  107.200 4.309   1.00 60.50  ? 199  ILE B CG1   1 
ATOM   4340 C  CG2   . ILE B 1 205 ? 37.731  105.988 6.395   1.00 60.47  ? 199  ILE B CG2   1 
ATOM   4341 C  CD1   . ILE B 1 205 ? 36.822  107.454 3.937   1.00 60.65  ? 199  ILE B CD1   1 
ATOM   4342 N  N     . ASN B 1 206 ? 41.140  103.941 6.617   1.00 58.05  ? 200  ASN B N     1 
ATOM   4343 C  CA    . ASN B 1 206 ? 41.412  102.588 7.077   1.00 56.59  ? 200  ASN B CA    1 
ATOM   4344 C  C     . ASN B 1 206 ? 41.347  102.431 8.593   1.00 54.33  ? 200  ASN B C     1 
ATOM   4345 O  O     . ASN B 1 206 ? 41.704  101.385 9.125   1.00 52.90  ? 200  ASN B O     1 
ATOM   4346 C  CB    . ASN B 1 206 ? 42.773  102.131 6.556   1.00 57.35  ? 200  ASN B CB    1 
ATOM   4347 C  CG    . ASN B 1 206 ? 43.746  103.267 6.447   1.00 59.35  ? 200  ASN B CG    1 
ATOM   4348 O  OD1   . ASN B 1 206 ? 43.843  104.100 7.359   1.00 61.43  ? 200  ASN B OD1   1 
ATOM   4349 N  ND2   . ASN B 1 206 ? 44.482  103.320 5.335   1.00 59.87  ? 200  ASN B ND2   1 
ATOM   4350 N  N     . LYS B 1 207 ? 40.885  103.459 9.293   1.00 51.86  ? 201  LYS B N     1 
ATOM   4351 C  CA    . LYS B 1 207 ? 40.762  103.359 10.738  1.00 51.20  ? 201  LYS B CA    1 
ATOM   4352 C  C     . LYS B 1 207 ? 39.372  103.799 11.161  1.00 49.86  ? 201  LYS B C     1 
ATOM   4353 O  O     . LYS B 1 207 ? 38.883  104.842 10.739  1.00 49.44  ? 201  LYS B O     1 
ATOM   4354 C  CB    . LYS B 1 207 ? 41.820  104.217 11.435  1.00 53.94  ? 201  LYS B CB    1 
ATOM   4355 C  CG    . LYS B 1 207 ? 43.258  103.785 11.153  1.00 56.03  ? 201  LYS B CG    1 
ATOM   4356 C  CD    . LYS B 1 207 ? 43.515  102.386 11.701  1.00 56.78  ? 201  LYS B CD    1 
ATOM   4357 C  CE    . LYS B 1 207 ? 44.766  101.755 11.105  1.00 56.20  ? 201  LYS B CE    1 
ATOM   4358 N  NZ    . LYS B 1 207 ? 44.863  100.327 11.501  1.00 54.82  ? 201  LYS B NZ    1 
ATOM   4359 N  N     . LEU B 1 208 ? 38.739  102.998 12.007  1.00 48.29  ? 202  LEU B N     1 
ATOM   4360 C  CA    . LEU B 1 208 ? 37.395  103.294 12.468  1.00 45.96  ? 202  LEU B CA    1 
ATOM   4361 C  C     . LEU B 1 208 ? 37.175  104.783 12.703  1.00 45.50  ? 202  LEU B C     1 
ATOM   4362 O  O     . LEU B 1 208 ? 36.231  105.359 12.187  1.00 45.15  ? 202  LEU B O     1 
ATOM   4363 C  CB    . LEU B 1 208 ? 37.101  102.522 13.753  1.00 44.02  ? 202  LEU B CB    1 
ATOM   4364 C  CG    . LEU B 1 208 ? 35.743  101.824 13.844  1.00 43.21  ? 202  LEU B CG    1 
ATOM   4365 C  CD1   . LEU B 1 208 ? 35.327  101.722 15.292  1.00 42.44  ? 202  LEU B CD1   1 
ATOM   4366 C  CD2   . LEU B 1 208 ? 34.693  102.581 13.076  1.00 43.67  ? 202  LEU B CD2   1 
ATOM   4367 N  N     . VAL B 1 209 ? 38.068  105.404 13.467  1.00 47.00  ? 203  VAL B N     1 
ATOM   4368 C  CA    . VAL B 1 209 ? 37.966  106.831 13.803  1.00 46.93  ? 203  VAL B CA    1 
ATOM   4369 C  C     . VAL B 1 209 ? 37.914  107.742 12.579  1.00 46.83  ? 203  VAL B C     1 
ATOM   4370 O  O     . VAL B 1 209 ? 37.177  108.728 12.568  1.00 45.63  ? 203  VAL B O     1 
ATOM   4371 C  CB    . VAL B 1 209 ? 39.140  107.275 14.724  1.00 45.65  ? 203  VAL B CB    1 
ATOM   4372 C  CG1   . VAL B 1 209 ? 40.348  107.699 13.897  1.00 44.85  ? 203  VAL B CG1   1 
ATOM   4373 C  CG2   . VAL B 1 209 ? 38.682  108.379 15.633  1.00 45.22  ? 203  VAL B CG2   1 
ATOM   4374 N  N     . ASP B 1 210 ? 38.688  107.408 11.552  1.00 46.76  ? 204  ASP B N     1 
ATOM   4375 C  CA    . ASP B 1 210 ? 38.703  108.200 10.337  1.00 49.35  ? 204  ASP B CA    1 
ATOM   4376 C  C     . ASP B 1 210 ? 37.294  108.517 9.836   1.00 52.19  ? 204  ASP B C     1 
ATOM   4377 O  O     . ASP B 1 210 ? 36.991  109.672 9.521   1.00 54.02  ? 204  ASP B O     1 
ATOM   4378 C  CB    . ASP B 1 210 ? 39.479  107.469 9.264   1.00 49.69  ? 204  ASP B CB    1 
ATOM   4379 C  CG    . ASP B 1 210 ? 40.929  107.330 9.608   1.00 52.08  ? 204  ASP B CG    1 
ATOM   4380 O  OD1   . ASP B 1 210 ? 41.298  107.429 10.797  1.00 53.25  ? 204  ASP B OD1   1 
ATOM   4381 O  OD2   . ASP B 1 210 ? 41.717  107.107 8.686   1.00 52.70  ? 204  ASP B OD2   1 
ATOM   4382 N  N     . THR B 1 211 ? 36.430  107.502 9.771   1.00 53.85  ? 205  THR B N     1 
ATOM   4383 C  CA    . THR B 1 211 ? 35.044  107.680 9.310   1.00 53.53  ? 205  THR B CA    1 
ATOM   4384 C  C     . THR B 1 211 ? 34.363  108.882 9.966   1.00 53.46  ? 205  THR B C     1 
ATOM   4385 O  O     . THR B 1 211 ? 33.324  109.332 9.516   1.00 53.37  ? 205  THR B O     1 
ATOM   4386 C  CB    . THR B 1 211 ? 34.167  106.447 9.625   1.00 53.95  ? 205  THR B CB    1 
ATOM   4387 O  OG1   . THR B 1 211 ? 33.601  106.591 10.937  1.00 54.41  ? 205  THR B OG1   1 
ATOM   4388 C  CG2   . THR B 1 211 ? 34.990  105.167 9.563   1.00 51.82  ? 205  THR B CG2   1 
ATOM   4389 N  N     . LEU B 1 212 ? 34.938  109.386 11.046  1.00 54.47  ? 206  LEU B N     1 
ATOM   4390 C  CA    . LEU B 1 212 ? 34.365  110.536 11.720  1.00 56.35  ? 206  LEU B CA    1 
ATOM   4391 C  C     . LEU B 1 212 ? 34.760  111.810 10.989  1.00 58.76  ? 206  LEU B C     1 
ATOM   4392 O  O     . LEU B 1 212 ? 34.074  112.814 11.083  1.00 60.11  ? 206  LEU B O     1 
ATOM   4393 C  CB    . LEU B 1 212 ? 34.848  110.607 13.176  1.00 54.65  ? 206  LEU B CB    1 
ATOM   4394 C  CG    . LEU B 1 212 ? 34.307  109.566 14.169  1.00 54.48  ? 206  LEU B CG    1 
ATOM   4395 C  CD1   . LEU B 1 212 ? 34.995  109.710 15.510  1.00 52.00  ? 206  LEU B CD1   1 
ATOM   4396 C  CD2   . LEU B 1 212 ? 32.794  109.730 14.320  1.00 53.29  ? 206  LEU B CD2   1 
ATOM   4397 N  N     . SER B 1 213 ? 35.856  111.764 10.245  1.00 60.99  ? 207  SER B N     1 
ATOM   4398 C  CA    . SER B 1 213 ? 36.325  112.940 9.535   1.00 63.64  ? 207  SER B CA    1 
ATOM   4399 C  C     . SER B 1 213 ? 35.910  112.912 8.085   1.00 65.60  ? 207  SER B C     1 
ATOM   4400 O  O     . SER B 1 213 ? 36.713  113.206 7.207   1.00 66.05  ? 207  SER B O     1 
ATOM   4401 C  CB    . SER B 1 213 ? 37.840  113.012 9.596   1.00 65.15  ? 207  SER B CB    1 
ATOM   4402 O  OG    . SER B 1 213 ? 38.394  111.947 8.839   1.00 65.38  ? 207  SER B OG    1 
ATOM   4403 N  N     . ILE B 1 214 ? 34.660  112.554 7.832   1.00 68.33  ? 208  ILE B N     1 
ATOM   4404 C  CA    . ILE B 1 214 ? 34.149  112.497 6.465   1.00 71.80  ? 208  ILE B CA    1 
ATOM   4405 C  C     . ILE B 1 214 ? 32.742  113.074 6.460   1.00 73.88  ? 208  ILE B C     1 
ATOM   4406 O  O     . ILE B 1 214 ? 31.894  112.648 7.246   1.00 74.78  ? 208  ILE B O     1 
ATOM   4407 C  CB    . ILE B 1 214 ? 34.066  111.038 5.933   1.00 72.34  ? 208  ILE B CB    1 
ATOM   4408 C  CG1   . ILE B 1 214 ? 35.425  110.341 6.054   1.00 73.49  ? 208  ILE B CG1   1 
ATOM   4409 C  CG2   . ILE B 1 214 ? 33.610  111.038 4.484   1.00 72.06  ? 208  ILE B CG2   1 
ATOM   4410 C  CD1   . ILE B 1 214 ? 36.533  110.968 5.236   1.00 73.72  ? 208  ILE B CD1   1 
ATOM   4411 N  N     . GLU B 1 215 ? 32.495  114.047 5.589   1.00 75.73  ? 209  GLU B N     1 
ATOM   4412 C  CA    . GLU B 1 215 ? 31.169  114.652 5.507   1.00 76.74  ? 209  GLU B CA    1 
ATOM   4413 C  C     . GLU B 1 215 ? 30.202  113.520 5.175   1.00 76.41  ? 209  GLU B C     1 
ATOM   4414 O  O     . GLU B 1 215 ? 29.998  113.184 4.006   1.00 76.54  ? 209  GLU B O     1 
ATOM   4415 C  CB    . GLU B 1 215 ? 31.141  115.736 4.416   1.00 77.92  ? 209  GLU B CB    1 
ATOM   4416 C  CG    . GLU B 1 215 ? 29.871  116.589 4.384   1.00 78.50  ? 209  GLU B CG    1 
ATOM   4417 C  CD    . GLU B 1 215 ? 30.018  117.832 3.523   1.00 79.45  ? 209  GLU B CD    1 
ATOM   4418 O  OE1   . GLU B 1 215 ? 30.206  117.700 2.293   1.00 78.80  ? 209  GLU B OE1   1 
ATOM   4419 O  OE2   . GLU B 1 215 ? 29.947  118.948 4.083   1.00 81.54  ? 209  GLU B OE2   1 
ATOM   4420 N  N     . PHE B 1 216 ? 29.628  112.936 6.223   1.00 75.98  ? 210  PHE B N     1 
ATOM   4421 C  CA    . PHE B 1 216 ? 28.697  111.814 6.109   1.00 75.96  ? 210  PHE B CA    1 
ATOM   4422 C  C     . PHE B 1 216 ? 28.234  111.481 4.694   1.00 75.05  ? 210  PHE B C     1 
ATOM   4423 O  O     . PHE B 1 216 ? 28.670  110.497 4.100   1.00 75.13  ? 210  PHE B O     1 
ATOM   4424 C  CB    . PHE B 1 216 ? 27.464  112.059 6.978   1.00 76.99  ? 210  PHE B CB    1 
ATOM   4425 C  CG    . PHE B 1 216 ? 26.533  110.879 7.050   1.00 77.40  ? 210  PHE B CG    1 
ATOM   4426 C  CD1   . PHE B 1 216 ? 26.703  109.900 8.026   1.00 77.12  ? 210  PHE B CD1   1 
ATOM   4427 C  CD2   . PHE B 1 216 ? 25.492  110.743 6.133   1.00 77.59  ? 210  PHE B CD2   1 
ATOM   4428 C  CE1   . PHE B 1 216 ? 25.852  108.806 8.091   1.00 77.45  ? 210  PHE B CE1   1 
ATOM   4429 C  CE2   . PHE B 1 216 ? 24.635  109.653 6.186   1.00 77.37  ? 210  PHE B CE2   1 
ATOM   4430 C  CZ    . PHE B 1 216 ? 24.814  108.681 7.170   1.00 78.20  ? 210  PHE B CZ    1 
ATOM   4431 N  N     . ASP B 1 217 ? 27.337  112.305 4.172   1.00 74.02  ? 211  ASP B N     1 
ATOM   4432 C  CA    . ASP B 1 217 ? 26.789  112.114 2.840   1.00 73.16  ? 211  ASP B CA    1 
ATOM   4433 C  C     . ASP B 1 217 ? 27.772  111.539 1.815   1.00 72.03  ? 211  ASP B C     1 
ATOM   4434 O  O     . ASP B 1 217 ? 27.442  110.601 1.086   1.00 72.20  ? 211  ASP B O     1 
ATOM   4435 C  CB    . ASP B 1 217 ? 26.204  113.437 2.363   1.00 73.43  ? 211  ASP B CB    1 
ATOM   4436 C  CG    . ASP B 1 217 ? 25.159  113.963 3.317   1.00 74.42  ? 211  ASP B CG    1 
ATOM   4437 O  OD1   . ASP B 1 217 ? 24.149  113.263 3.530   1.00 73.71  ? 211  ASP B OD1   1 
ATOM   4438 O  OD2   . ASP B 1 217 ? 25.345  115.065 3.868   1.00 76.57  ? 211  ASP B OD2   1 
ATOM   4439 N  N     . LYS B 1 218 ? 28.979  112.082 1.755   1.00 70.57  ? 212  LYS B N     1 
ATOM   4440 C  CA    . LYS B 1 218 ? 29.954  111.568 0.803   1.00 69.88  ? 212  LYS B CA    1 
ATOM   4441 C  C     . LYS B 1 218 ? 30.124  110.071 1.042   1.00 68.49  ? 212  LYS B C     1 
ATOM   4442 O  O     . LYS B 1 218 ? 30.213  109.273 0.100   1.00 67.48  ? 212  LYS B O     1 
ATOM   4443 C  CB    . LYS B 1 218 ? 31.300  112.286 0.968   1.00 70.73  ? 212  LYS B CB    1 
ATOM   4444 C  CG    . LYS B 1 218 ? 31.695  113.167 -0.235  1.00 71.54  ? 212  LYS B CG    1 
ATOM   4445 C  CD    . LYS B 1 218 ? 31.744  112.369 -1.556  1.00 69.95  ? 212  LYS B CD    1 
ATOM   4446 C  CE    . LYS B 1 218 ? 32.044  113.270 -2.744  1.00 69.04  ? 212  LYS B CE    1 
ATOM   4447 N  NZ    . LYS B 1 218 ? 31.910  112.568 -4.045  1.00 69.54  ? 212  LYS B NZ    1 
ATOM   4448 N  N     . LEU B 1 219 ? 30.166  109.715 2.322   1.00 66.71  ? 213  LEU B N     1 
ATOM   4449 C  CA    . LEU B 1 219 ? 30.317  108.335 2.758   1.00 65.02  ? 213  LEU B CA    1 
ATOM   4450 C  C     . LEU B 1 219 ? 29.047  107.575 2.387   1.00 65.32  ? 213  LEU B C     1 
ATOM   4451 O  O     . LEU B 1 219 ? 29.094  106.582 1.656   1.00 64.65  ? 213  LEU B O     1 
ATOM   4452 C  CB    . LEU B 1 219 ? 30.531  108.301 4.272   1.00 62.43  ? 213  LEU B CB    1 
ATOM   4453 C  CG    . LEU B 1 219 ? 31.018  107.003 4.906   1.00 61.09  ? 213  LEU B CG    1 
ATOM   4454 C  CD1   . LEU B 1 219 ? 32.440  106.735 4.451   1.00 60.30  ? 213  LEU B CD1   1 
ATOM   4455 C  CD2   . LEU B 1 219 ? 30.964  107.110 6.421   1.00 59.45  ? 213  LEU B CD2   1 
ATOM   4456 N  N     . LYS B 1 220 ? 27.911  108.066 2.879   1.00 65.64  ? 214  LYS B N     1 
ATOM   4457 C  CA    . LYS B 1 220 ? 26.625  107.443 2.605   1.00 66.12  ? 214  LYS B CA    1 
ATOM   4458 C  C     . LYS B 1 220 ? 26.482  107.040 1.142   1.00 66.46  ? 214  LYS B C     1 
ATOM   4459 O  O     . LYS B 1 220 ? 26.231  105.876 0.829   1.00 66.93  ? 214  LYS B O     1 
ATOM   4460 C  CB    . LYS B 1 220 ? 25.484  108.381 2.999   1.00 66.30  ? 214  LYS B CB    1 
ATOM   4461 C  CG    . LYS B 1 220 ? 24.107  107.863 2.598   1.00 68.38  ? 214  LYS B CG    1 
ATOM   4462 C  CD    . LYS B 1 220 ? 22.966  108.627 3.279   1.00 70.41  ? 214  LYS B CD    1 
ATOM   4463 C  CE    . LYS B 1 220 ? 22.951  110.110 2.916   1.00 71.39  ? 214  LYS B CE    1 
ATOM   4464 N  NZ    . LYS B 1 220 ? 22.816  110.329 1.446   1.00 72.46  ? 214  LYS B NZ    1 
ATOM   4465 N  N     . GLY B 1 221 ? 26.644  108.001 0.245   1.00 66.66  ? 215  GLY B N     1 
ATOM   4466 C  CA    . GLY B 1 221 ? 26.531  107.690 -1.163  1.00 67.40  ? 215  GLY B CA    1 
ATOM   4467 C  C     . GLY B 1 221 ? 27.804  107.055 -1.681  1.00 67.95  ? 215  GLY B C     1 
ATOM   4468 O  O     . GLY B 1 221 ? 28.423  107.567 -2.613  1.00 68.14  ? 215  GLY B O     1 
ATOM   4469 N  N     . MET B 1 222 ? 28.206  105.945 -1.070  1.00 68.65  ? 216  MET B N     1 
ATOM   4470 C  CA    . MET B 1 222 ? 29.411  105.238 -1.492  1.00 69.06  ? 216  MET B CA    1 
ATOM   4471 C  C     . MET B 1 222 ? 29.415  103.813 -0.942  1.00 67.88  ? 216  MET B C     1 
ATOM   4472 O  O     . MET B 1 222 ? 30.033  102.913 -1.511  1.00 67.20  ? 216  MET B O     1 
ATOM   4473 C  CB    . MET B 1 222 ? 30.654  105.999 -1.021  1.00 71.22  ? 216  MET B CB    1 
ATOM   4474 C  CG    . MET B 1 222 ? 31.765  106.062 -2.063  1.00 74.62  ? 216  MET B CG    1 
ATOM   4475 S  SD    . MET B 1 222 ? 31.158  106.586 -3.725  1.00 77.65  ? 216  MET B SD    1 
ATOM   4476 C  CE    . MET B 1 222 ? 31.607  105.119 -4.705  1.00 77.75  ? 216  MET B CE    1 
ATOM   4477 N  N     . ILE B 1 223 ? 28.719  103.619 0.172   1.00 66.98  ? 217  ILE B N     1 
ATOM   4478 C  CA    . ILE B 1 223 ? 28.625  102.312 0.798   1.00 65.76  ? 217  ILE B CA    1 
ATOM   4479 C  C     . ILE B 1 223 ? 27.188  102.132 1.232   1.00 65.24  ? 217  ILE B C     1 
ATOM   4480 O  O     . ILE B 1 223 ? 26.820  101.100 1.783   1.00 66.93  ? 217  ILE B O     1 
ATOM   4481 C  CB    . ILE B 1 223 ? 29.515  102.197 2.056   1.00 65.72  ? 217  ILE B CB    1 
ATOM   4482 C  CG1   . ILE B 1 223 ? 28.948  103.074 3.169   1.00 66.02  ? 217  ILE B CG1   1 
ATOM   4483 C  CG2   . ILE B 1 223 ? 30.951  102.602 1.744   1.00 64.22  ? 217  ILE B CG2   1 
ATOM   4484 C  CD1   . ILE B 1 223 ? 29.687  102.923 4.488   1.00 68.72  ? 217  ILE B CD1   1 
ATOM   4485 N  N     . GLY B 1 224 ? 26.375  103.149 0.984   1.00 64.16  ? 218  GLY B N     1 
ATOM   4486 C  CA    . GLY B 1 224 ? 24.980  103.075 1.366   1.00 64.00  ? 218  GLY B CA    1 
ATOM   4487 C  C     . GLY B 1 224 ? 24.762  103.713 2.719   1.00 63.49  ? 218  GLY B C     1 
ATOM   4488 O  O     . GLY B 1 224 ? 25.720  103.923 3.455   1.00 62.85  ? 218  GLY B O     1 
ATOM   4489 N  N     . GLU B 1 225 ? 23.510  104.012 3.049   1.00 63.91  ? 219  GLU B N     1 
ATOM   4490 C  CA    . GLU B 1 225 ? 23.183  104.638 4.322   1.00 65.09  ? 219  GLU B CA    1 
ATOM   4491 C  C     . GLU B 1 225 ? 23.422  103.694 5.499   1.00 64.98  ? 219  GLU B C     1 
ATOM   4492 O  O     . GLU B 1 225 ? 24.040  104.065 6.502   1.00 65.63  ? 219  GLU B O     1 
ATOM   4493 C  CB    . GLU B 1 225 ? 21.723  105.088 4.329   1.00 67.86  ? 219  GLU B CB    1 
ATOM   4494 C  CG    . GLU B 1 225 ? 21.348  105.922 5.552   1.00 73.03  ? 219  GLU B CG    1 
ATOM   4495 C  CD    . GLU B 1 225 ? 19.933  106.506 5.472   1.00 76.87  ? 219  GLU B CD    1 
ATOM   4496 O  OE1   . GLU B 1 225 ? 19.599  107.126 4.428   1.00 77.69  ? 219  GLU B OE1   1 
ATOM   4497 O  OE2   . GLU B 1 225 ? 19.162  106.354 6.458   1.00 77.68  ? 219  GLU B OE2   1 
ATOM   4498 N  N     . ALA B 1 226 ? 22.930  102.466 5.368   1.00 63.23  ? 220  ALA B N     1 
ATOM   4499 C  CA    . ALA B 1 226 ? 23.067  101.468 6.419   1.00 58.81  ? 220  ALA B CA    1 
ATOM   4500 C  C     . ALA B 1 226 ? 24.473  101.439 6.955   1.00 55.92  ? 220  ALA B C     1 
ATOM   4501 O  O     . ALA B 1 226 ? 24.745  101.946 8.032   1.00 53.69  ? 220  ALA B O     1 
ATOM   4502 C  CB    . ALA B 1 226 ? 22.695  100.101 5.887   1.00 59.41  ? 220  ALA B CB    1 
ATOM   4503 N  N     . LYS B 1 227 ? 25.369  100.847 6.181   1.00 55.05  ? 221  LYS B N     1 
ATOM   4504 C  CA    . LYS B 1 227 ? 26.752  100.722 6.593   1.00 54.31  ? 221  LYS B CA    1 
ATOM   4505 C  C     . LYS B 1 227 ? 27.279  102.008 7.214   1.00 53.94  ? 221  LYS B C     1 
ATOM   4506 O  O     . LYS B 1 227 ? 27.581  102.042 8.398   1.00 53.72  ? 221  LYS B O     1 
ATOM   4507 C  CB    . LYS B 1 227 ? 27.621  100.299 5.405   1.00 53.22  ? 221  LYS B CB    1 
ATOM   4508 C  CG    . LYS B 1 227 ? 28.262  98.923  5.567   1.00 51.85  ? 221  LYS B CG    1 
ATOM   4509 C  CD    . LYS B 1 227 ? 27.292  97.783  5.300   1.00 51.17  ? 221  LYS B CD    1 
ATOM   4510 C  CE    . LYS B 1 227 ? 27.344  97.350  3.835   1.00 50.70  ? 221  LYS B CE    1 
ATOM   4511 N  NZ    . LYS B 1 227 ? 28.717  96.924  3.463   1.00 47.68  ? 221  LYS B NZ    1 
ATOM   4512 N  N     . ALA B 1 228 ? 27.374  103.062 6.413   1.00 53.58  ? 222  ALA B N     1 
ATOM   4513 C  CA    . ALA B 1 228 ? 27.865  104.351 6.874   1.00 53.45  ? 222  ALA B CA    1 
ATOM   4514 C  C     . ALA B 1 228 ? 27.527  104.610 8.336   1.00 54.02  ? 222  ALA B C     1 
ATOM   4515 O  O     . ALA B 1 228 ? 28.408  104.642 9.196   1.00 53.50  ? 222  ALA B O     1 
ATOM   4516 C  CB    . ALA B 1 228 ? 27.288  105.445 6.013   1.00 52.89  ? 222  ALA B CB    1 
ATOM   4517 N  N     . LYS B 1 229 ? 26.248  104.803 8.624   1.00 55.12  ? 223  LYS B N     1 
ATOM   4518 C  CA    . LYS B 1 229 ? 25.831  105.052 10.000  1.00 57.27  ? 223  LYS B CA    1 
ATOM   4519 C  C     . LYS B 1 229 ? 26.371  104.001 10.992  1.00 57.32  ? 223  LYS B C     1 
ATOM   4520 O  O     . LYS B 1 229 ? 26.651  104.329 12.151  1.00 58.17  ? 223  LYS B O     1 
ATOM   4521 C  CB    . LYS B 1 229 ? 24.300  105.115 10.089  1.00 58.28  ? 223  LYS B CB    1 
ATOM   4522 C  CG    . LYS B 1 229 ? 23.674  106.095 9.110   1.00 60.31  ? 223  LYS B CG    1 
ATOM   4523 C  CD    . LYS B 1 229 ? 22.202  106.349 9.422   1.00 61.97  ? 223  LYS B CD    1 
ATOM   4524 C  CE    . LYS B 1 229 ? 22.036  107.365 10.550  1.00 63.73  ? 223  LYS B CE    1 
ATOM   4525 N  NZ    . LYS B 1 229 ? 20.613  107.703 10.855  1.00 64.01  ? 223  LYS B NZ    1 
ATOM   4526 N  N     . TYR B 1 230 ? 26.510  102.751 10.536  1.00 56.17  ? 224  TYR B N     1 
ATOM   4527 C  CA    . TYR B 1 230 ? 27.019  101.649 11.364  1.00 53.74  ? 224  TYR B CA    1 
ATOM   4528 C  C     . TYR B 1 230 ? 28.385  101.996 11.968  1.00 53.64  ? 224  TYR B C     1 
ATOM   4529 O  O     . TYR B 1 230 ? 28.557  102.003 13.201  1.00 52.85  ? 224  TYR B O     1 
ATOM   4530 C  CB    . TYR B 1 230 ? 27.137  100.379 10.514  1.00 51.35  ? 224  TYR B CB    1 
ATOM   4531 C  CG    . TYR B 1 230 ? 27.723  99.180  11.234  1.00 48.77  ? 224  TYR B CG    1 
ATOM   4532 C  CD1   . TYR B 1 230 ? 27.185  98.738  12.433  1.00 47.55  ? 224  TYR B CD1   1 
ATOM   4533 C  CD2   . TYR B 1 230 ? 28.794  98.470  10.696  1.00 47.13  ? 224  TYR B CD2   1 
ATOM   4534 C  CE1   . TYR B 1 230 ? 27.692  97.631  13.069  1.00 46.44  ? 224  TYR B CE1   1 
ATOM   4535 C  CE2   . TYR B 1 230 ? 29.305  97.358  11.329  1.00 45.64  ? 224  TYR B CE2   1 
ATOM   4536 C  CZ    . TYR B 1 230 ? 28.748  96.947  12.514  1.00 46.38  ? 224  TYR B CZ    1 
ATOM   4537 O  OH    . TYR B 1 230 ? 29.247  95.846  13.159  1.00 47.02  ? 224  TYR B OH    1 
ATOM   4538 N  N     . LEU B 1 231 ? 29.348  102.281 11.091  1.00 52.45  ? 225  LEU B N     1 
ATOM   4539 C  CA    . LEU B 1 231 ? 30.698  102.644 11.504  1.00 51.39  ? 225  LEU B CA    1 
ATOM   4540 C  C     . LEU B 1 231 ? 30.676  103.878 12.403  1.00 51.32  ? 225  LEU B C     1 
ATOM   4541 O  O     . LEU B 1 231 ? 31.166  103.851 13.531  1.00 50.92  ? 225  LEU B O     1 
ATOM   4542 C  CB    . LEU B 1 231 ? 31.562  102.936 10.283  1.00 49.89  ? 225  LEU B CB    1 
ATOM   4543 C  CG    . LEU B 1 231 ? 31.712  101.784 9.295   1.00 50.24  ? 225  LEU B CG    1 
ATOM   4544 C  CD1   . LEU B 1 231 ? 32.189  102.333 7.956   1.00 52.03  ? 225  LEU B CD1   1 
ATOM   4545 C  CD2   . LEU B 1 231 ? 32.681  100.752 9.836   1.00 49.34  ? 225  LEU B CD2   1 
ATOM   4546 N  N     . ILE B 1 232 ? 30.094  104.963 11.910  1.00 51.02  ? 226  ILE B N     1 
ATOM   4547 C  CA    . ILE B 1 232 ? 30.040  106.186 12.696  1.00 50.32  ? 226  ILE B CA    1 
ATOM   4548 C  C     . ILE B 1 232 ? 29.440  105.939 14.071  1.00 49.09  ? 226  ILE B C     1 
ATOM   4549 O  O     . ILE B 1 232 ? 29.993  106.367 15.064  1.00 48.49  ? 226  ILE B O     1 
ATOM   4550 C  CB    . ILE B 1 232 ? 29.241  107.271 11.973  1.00 50.58  ? 226  ILE B CB    1 
ATOM   4551 C  CG1   . ILE B 1 232 ? 29.837  107.509 10.585  1.00 50.97  ? 226  ILE B CG1   1 
ATOM   4552 C  CG2   . ILE B 1 232 ? 29.314  108.556 12.748  1.00 49.41  ? 226  ILE B CG2   1 
ATOM   4553 C  CD1   . ILE B 1 232 ? 29.065  108.496 9.756   1.00 51.79  ? 226  ILE B CD1   1 
ATOM   4554 N  N     . SER B 1 233 ? 28.314  105.246 14.135  1.00 49.32  ? 227  SER B N     1 
ATOM   4555 C  CA    . SER B 1 233 ? 27.705  104.957 15.422  1.00 50.10  ? 227  SER B CA    1 
ATOM   4556 C  C     . SER B 1 233 ? 28.715  104.203 16.287  1.00 50.63  ? 227  SER B C     1 
ATOM   4557 O  O     . SER B 1 233 ? 28.570  104.132 17.505  1.00 50.63  ? 227  SER B O     1 
ATOM   4558 C  CB    . SER B 1 233 ? 26.442  104.102 15.250  1.00 51.10  ? 227  SER B CB    1 
ATOM   4559 O  OG    . SER B 1 233 ? 26.755  102.784 14.820  1.00 51.44  ? 227  SER B OG    1 
ATOM   4560 N  N     . LEU B 1 234 ? 29.732  103.619 15.661  1.00 50.68  ? 228  LEU B N     1 
ATOM   4561 C  CA    . LEU B 1 234 ? 30.744  102.896 16.423  1.00 50.96  ? 228  LEU B CA    1 
ATOM   4562 C  C     . LEU B 1 234 ? 31.866  103.832 16.818  1.00 51.10  ? 228  LEU B C     1 
ATOM   4563 O  O     . LEU B 1 234 ? 32.050  104.115 17.993  1.00 51.56  ? 228  LEU B O     1 
ATOM   4564 C  CB    . LEU B 1 234 ? 31.334  101.755 15.612  1.00 51.94  ? 228  LEU B CB    1 
ATOM   4565 C  CG    . LEU B 1 234 ? 30.439  100.559 15.314  1.00 52.50  ? 228  LEU B CG    1 
ATOM   4566 C  CD1   . LEU B 1 234 ? 31.177  99.631  14.349  1.00 50.84  ? 228  LEU B CD1   1 
ATOM   4567 C  CD2   . LEU B 1 234 ? 30.073  99.844  16.608  1.00 50.33  ? 228  LEU B CD2   1 
ATOM   4568 N  N     . ALA B 1 235 ? 32.614  104.313 15.827  1.00 51.12  ? 229  ALA B N     1 
ATOM   4569 C  CA    . ALA B 1 235 ? 33.719  105.227 16.081  1.00 50.18  ? 229  ALA B CA    1 
ATOM   4570 C  C     . ALA B 1 235 ? 33.327  106.263 17.136  1.00 49.79  ? 229  ALA B C     1 
ATOM   4571 O  O     . ALA B 1 235 ? 34.166  106.710 17.899  1.00 49.07  ? 229  ALA B O     1 
ATOM   4572 C  CB    . ALA B 1 235 ? 34.146  105.908 14.788  1.00 48.78  ? 229  ALA B CB    1 
ATOM   4573 N  N     . ARG B 1 236 ? 32.052  106.631 17.192  1.00 50.80  ? 230  ARG B N     1 
ATOM   4574 C  CA    . ARG B 1 236 ? 31.600  107.596 18.187  1.00 54.20  ? 230  ARG B CA    1 
ATOM   4575 C  C     . ARG B 1 236 ? 31.408  106.923 19.544  1.00 57.19  ? 230  ARG B C     1 
ATOM   4576 O  O     . ARG B 1 236 ? 31.635  107.538 20.587  1.00 58.56  ? 230  ARG B O     1 
ATOM   4577 C  CB    . ARG B 1 236 ? 30.267  108.252 17.787  1.00 52.50  ? 230  ARG B CB    1 
ATOM   4578 C  CG    A ARG B 1 236 ? 30.321  109.281 16.662  0.50 51.91  ? 230  ARG B CG    1 
ATOM   4579 C  CD    A ARG B 1 236 ? 28.959  109.969 16.533  0.50 50.35  ? 230  ARG B CD    1 
ATOM   4580 N  NE    A ARG B 1 236 ? 28.702  110.499 15.195  0.50 49.96  ? 230  ARG B NE    1 
ATOM   4581 C  CZ    A ARG B 1 236 ? 29.151  111.664 14.733  0.50 49.88  ? 230  ARG B CZ    1 
ATOM   4582 N  NH1   A ARG B 1 236 ? 29.891  112.444 15.502  0.50 49.99  ? 230  ARG B NH1   1 
ATOM   4583 N  NH2   A ARG B 1 236 ? 28.856  112.054 13.496  0.50 49.05  ? 230  ARG B NH2   1 
ATOM   4584 N  N     . ASP B 1 237 ? 30.971  105.667 19.512  1.00 59.94  ? 231  ASP B N     1 
ATOM   4585 C  CA    . ASP B 1 237 ? 30.705  104.867 20.706  1.00 63.38  ? 231  ASP B CA    1 
ATOM   4586 C  C     . ASP B 1 237 ? 29.220  104.974 21.075  1.00 64.84  ? 231  ASP B C     1 
ATOM   4587 O  O     . ASP B 1 237 ? 28.861  105.083 22.251  1.00 65.37  ? 231  ASP B O     1 
ATOM   4588 C  CB    . ASP B 1 237 ? 31.568  105.332 21.892  1.00 65.91  ? 231  ASP B CB    1 
ATOM   4589 C  CG    . ASP B 1 237 ? 31.606  104.314 23.033  1.00 68.27  ? 231  ASP B CG    1 
ATOM   4590 O  OD1   . ASP B 1 237 ? 32.375  103.330 22.924  1.00 69.83  ? 231  ASP B OD1   1 
ATOM   4591 O  OD2   . ASP B 1 237 ? 30.863  104.493 24.029  1.00 68.90  ? 231  ASP B OD2   1 
ATOM   4592 N  N     . GLU B 1 238 ? 28.357  104.940 20.066  1.00 65.58  ? 232  GLU B N     1 
ATOM   4593 C  CA    . GLU B 1 238 ? 26.921  105.034 20.297  1.00 66.51  ? 232  GLU B CA    1 
ATOM   4594 C  C     . GLU B 1 238 ? 26.290  103.661 20.159  1.00 66.66  ? 232  GLU B C     1 
ATOM   4595 O  O     . GLU B 1 238 ? 25.392  103.297 20.913  1.00 67.54  ? 232  GLU B O     1 
ATOM   4596 C  CB    . GLU B 1 238 ? 26.264  105.980 19.283  1.00 67.56  ? 232  GLU B CB    1 
ATOM   4597 C  CG    . GLU B 1 238 ? 26.712  107.424 19.363  1.00 70.08  ? 232  GLU B CG    1 
ATOM   4598 C  CD    . GLU B 1 238 ? 26.459  108.029 20.733  1.00 72.11  ? 232  GLU B CD    1 
ATOM   4599 O  OE1   . GLU B 1 238 ? 25.380  107.758 21.306  1.00 72.93  ? 232  GLU B OE1   1 
ATOM   4600 O  OE2   . GLU B 1 238 ? 27.329  108.780 21.232  1.00 72.64  ? 232  GLU B OE2   1 
ATOM   4601 N  N     . TYR B 1 239 ? 26.761  102.904 19.179  1.00 66.70  ? 233  TYR B N     1 
ATOM   4602 C  CA    . TYR B 1 239 ? 26.232  101.577 18.919  1.00 66.32  ? 233  TYR B CA    1 
ATOM   4603 C  C     . TYR B 1 239 ? 25.947  100.838 20.223  1.00 65.65  ? 233  TYR B C     1 
ATOM   4604 O  O     . TYR B 1 239 ? 26.826  100.680 21.064  1.00 65.44  ? 233  TYR B O     1 
ATOM   4605 C  CB    A TYR B 1 239 ? 27.229  100.790 18.068  0.50 66.60  ? 233  TYR B CB    1 
ATOM   4606 C  CG    A TYR B 1 239 ? 26.573  99.910  17.037  0.50 67.46  ? 233  TYR B CG    1 
ATOM   4607 C  CD1   A TYR B 1 239 ? 25.719  100.449 16.072  0.50 67.95  ? 233  TYR B CD1   1 
ATOM   4608 C  CD2   A TYR B 1 239 ? 26.801  98.539  17.022  0.50 67.61  ? 233  TYR B CD2   1 
ATOM   4609 C  CE1   A TYR B 1 239 ? 25.108  99.639  15.120  0.50 67.84  ? 233  TYR B CE1   1 
ATOM   4610 C  CE2   A TYR B 1 239 ? 26.199  97.725  16.079  0.50 67.84  ? 233  TYR B CE2   1 
ATOM   4611 C  CZ    A TYR B 1 239 ? 25.355  98.279  15.135  0.50 68.02  ? 233  TYR B CZ    1 
ATOM   4612 O  OH    A TYR B 1 239 ? 24.759  97.457  14.213  0.50 69.28  ? 233  TYR B OH    1 
ATOM   4613 N  N     . ASN B 1 240 ? 24.708  100.400 20.398  1.00 65.12  ? 234  ASN B N     1 
ATOM   4614 C  CA    . ASN B 1 240 ? 24.342  99.681  21.601  1.00 64.76  ? 234  ASN B CA    1 
ATOM   4615 C  C     . ASN B 1 240 ? 23.019  98.937  21.416  1.00 63.91  ? 234  ASN B C     1 
ATOM   4616 O  O     . ASN B 1 240 ? 21.987  99.332  21.956  1.00 64.21  ? 234  ASN B O     1 
ATOM   4617 C  CB    . ASN B 1 240 ? 24.228  100.655 22.766  1.00 68.02  ? 234  ASN B CB    1 
ATOM   4618 C  CG    . ASN B 1 240 ? 24.206  99.954  24.115  1.00 71.33  ? 234  ASN B CG    1 
ATOM   4619 O  OD1   . ASN B 1 240 ? 23.861  100.562 25.137  1.00 72.77  ? 234  ASN B OD1   1 
ATOM   4620 N  ND2   . ASN B 1 240 ? 24.589  98.671  24.129  1.00 72.29  ? 234  ASN B ND2   1 
ATOM   4621 N  N     . GLU B 1 241 ? 23.060  97.855  20.648  1.00 62.79  ? 235  GLU B N     1 
ATOM   4622 C  CA    . GLU B 1 241 ? 21.879  97.046  20.385  1.00 60.79  ? 235  GLU B CA    1 
ATOM   4623 C  C     . GLU B 1 241 ? 21.822  95.883  21.368  1.00 58.93  ? 235  GLU B C     1 
ATOM   4624 O  O     . GLU B 1 241 ? 22.837  95.242  21.661  1.00 57.40  ? 235  GLU B O     1 
ATOM   4625 C  CB    . GLU B 1 241 ? 21.910  96.526  18.946  1.00 63.07  ? 235  GLU B CB    1 
ATOM   4626 C  CG    . GLU B 1 241 ? 23.141  96.973  18.131  1.00 65.59  ? 235  GLU B CG    1 
ATOM   4627 C  CD    . GLU B 1 241 ? 24.438  96.276  18.542  1.00 66.04  ? 235  GLU B CD    1 
ATOM   4628 O  OE1   . GLU B 1 241 ? 24.802  96.296  19.741  1.00 66.28  ? 235  GLU B OE1   1 
ATOM   4629 O  OE2   . GLU B 1 241 ? 25.098  95.709  17.648  1.00 66.59  ? 235  GLU B OE2   1 
ATOM   4630 N  N     . PRO B 1 242 ? 20.622  95.590  21.883  1.00 57.33  ? 236  PRO B N     1 
ATOM   4631 C  CA    . PRO B 1 242 ? 20.417  94.510  22.843  1.00 55.93  ? 236  PRO B CA    1 
ATOM   4632 C  C     . PRO B 1 242 ? 20.638  93.122  22.277  1.00 55.00  ? 236  PRO B C     1 
ATOM   4633 O  O     . PRO B 1 242 ? 20.945  92.951  21.098  1.00 53.58  ? 236  PRO B O     1 
ATOM   4634 C  CB    . PRO B 1 242 ? 18.982  94.728  23.299  1.00 55.93  ? 236  PRO B CB    1 
ATOM   4635 C  CG    . PRO B 1 242 ? 18.326  95.230  22.073  1.00 56.87  ? 236  PRO B CG    1 
ATOM   4636 C  CD    . PRO B 1 242 ? 19.337  96.206  21.505  1.00 57.36  ? 236  PRO B CD    1 
ATOM   4637 N  N     . ILE B 1 243 ? 20.494  92.133  23.152  1.00 55.00  ? 237  ILE B N     1 
ATOM   4638 C  CA    . ILE B 1 243 ? 20.655  90.731  22.786  1.00 54.12  ? 237  ILE B CA    1 
ATOM   4639 C  C     . ILE B 1 243 ? 19.250  90.155  22.616  1.00 55.94  ? 237  ILE B C     1 
ATOM   4640 O  O     . ILE B 1 243 ? 18.565  89.840  23.589  1.00 57.31  ? 237  ILE B O     1 
ATOM   4641 C  CB    . ILE B 1 243 ? 21.463  89.937  23.886  1.00 49.72  ? 237  ILE B CB    1 
ATOM   4642 C  CG1   . ILE B 1 243 ? 22.897  89.693  23.411  1.00 45.88  ? 237  ILE B CG1   1 
ATOM   4643 C  CG2   . ILE B 1 243 ? 20.809  88.593  24.196  1.00 49.08  ? 237  ILE B CG2   1 
ATOM   4644 C  CD1   . ILE B 1 243 ? 23.856  90.768  23.759  1.00 42.34  ? 237  ILE B CD1   1 
ATOM   4645 N  N     . ARG B 1 244 ? 18.800  90.056  21.374  1.00 56.83  ? 238  ARG B N     1 
ATOM   4646 C  CA    . ARG B 1 244 ? 17.484  89.503  21.136  1.00 59.23  ? 238  ARG B CA    1 
ATOM   4647 C  C     . ARG B 1 244 ? 17.586  88.011  20.806  1.00 59.79  ? 238  ARG B C     1 
ATOM   4648 O  O     . ARG B 1 244 ? 18.587  87.550  20.258  1.00 60.70  ? 238  ARG B O     1 
ATOM   4649 C  CB    . ARG B 1 244 ? 16.791  90.285  20.019  1.00 60.79  ? 238  ARG B CB    1 
ATOM   4650 C  CG    . ARG B 1 244 ? 16.269  91.644  20.488  1.00 63.84  ? 238  ARG B CG    1 
ATOM   4651 C  CD    . ARG B 1 244 ? 15.298  91.457  21.652  1.00 65.97  ? 238  ARG B CD    1 
ATOM   4652 N  NE    . ARG B 1 244 ? 15.393  92.526  22.644  1.00 67.35  ? 238  ARG B NE    1 
ATOM   4653 C  CZ    . ARG B 1 244 ? 14.905  92.443  23.881  1.00 68.29  ? 238  ARG B CZ    1 
ATOM   4654 N  NH1   . ARG B 1 244 ? 14.282  91.338  24.282  1.00 67.86  ? 238  ARG B NH1   1 
ATOM   4655 N  NH2   . ARG B 1 244 ? 15.046  93.460  24.724  1.00 68.47  ? 238  ARG B NH2   1 
ATOM   4656 N  N     . THR B 1 245 ? 16.564  87.248  21.166  1.00 59.08  ? 239  THR B N     1 
ATOM   4657 C  CA    . THR B 1 245 ? 16.576  85.822  20.899  1.00 58.94  ? 239  THR B CA    1 
ATOM   4658 C  C     . THR B 1 245 ? 16.321  85.579  19.422  1.00 58.84  ? 239  THR B C     1 
ATOM   4659 O  O     . THR B 1 245 ? 15.200  85.275  19.034  1.00 59.37  ? 239  THR B O     1 
ATOM   4660 C  CB    . THR B 1 245 ? 15.480  85.106  21.702  1.00 60.06  ? 239  THR B CB    1 
ATOM   4661 O  OG1   . THR B 1 245 ? 15.126  85.907  22.836  1.00 60.22  ? 239  THR B OG1   1 
ATOM   4662 C  CG2   . THR B 1 245 ? 15.970  83.745  22.196  1.00 59.61  ? 239  THR B CG2   1 
ATOM   4663 N  N     . ARG B 1 246 ? 17.356  85.718  18.600  1.00 59.03  ? 240  ARG B N     1 
ATOM   4664 C  CA    . ARG B 1 246 ? 17.236  85.502  17.157  1.00 58.58  ? 240  ARG B CA    1 
ATOM   4665 C  C     . ARG B 1 246 ? 16.277  84.365  16.790  1.00 57.69  ? 240  ARG B C     1 
ATOM   4666 O  O     . ARG B 1 246 ? 16.182  83.363  17.491  1.00 57.61  ? 240  ARG B O     1 
ATOM   4667 C  CB    . ARG B 1 246 ? 18.606  85.187  16.543  1.00 60.11  ? 240  ARG B CB    1 
ATOM   4668 C  CG    . ARG B 1 246 ? 19.388  86.380  15.971  1.00 62.49  ? 240  ARG B CG    1 
ATOM   4669 C  CD    . ARG B 1 246 ? 20.492  85.863  15.045  1.00 63.23  ? 240  ARG B CD    1 
ATOM   4670 N  NE    . ARG B 1 246 ? 21.304  86.921  14.449  1.00 63.86  ? 240  ARG B NE    1 
ATOM   4671 C  CZ    . ARG B 1 246 ? 22.260  86.708  13.545  1.00 64.57  ? 240  ARG B CZ    1 
ATOM   4672 N  NH1   . ARG B 1 246 ? 22.525  85.481  13.125  1.00 64.61  ? 240  ARG B NH1   1 
ATOM   4673 N  NH2   . ARG B 1 246 ? 22.965  87.719  13.063  1.00 65.57  ? 240  ARG B NH2   1 
ATOM   4674 N  N     . VAL B 1 247 ? 15.574  84.533  15.678  1.00 56.96  ? 241  VAL B N     1 
ATOM   4675 C  CA    . VAL B 1 247 ? 14.634  83.535  15.186  1.00 56.59  ? 241  VAL B CA    1 
ATOM   4676 C  C     . VAL B 1 247 ? 14.830  83.454  13.678  1.00 56.11  ? 241  VAL B C     1 
ATOM   4677 O  O     . VAL B 1 247 ? 14.995  84.488  13.020  1.00 56.22  ? 241  VAL B O     1 
ATOM   4678 C  CB    . VAL B 1 247 ? 13.186  83.954  15.445  1.00 57.94  ? 241  VAL B CB    1 
ATOM   4679 C  CG1   . VAL B 1 247 ? 12.298  82.709  15.540  1.00 59.29  ? 241  VAL B CG1   1 
ATOM   4680 C  CG2   . VAL B 1 247 ? 13.107  84.810  16.701  1.00 58.16  ? 241  VAL B CG2   1 
ATOM   4681 N  N     . ARG B 1 248 ? 14.802  82.238  13.135  1.00 55.46  ? 242  ARG B N     1 
ATOM   4682 C  CA    . ARG B 1 248 ? 15.003  82.029  11.700  1.00 55.05  ? 242  ARG B CA    1 
ATOM   4683 C  C     . ARG B 1 248 ? 13.868  82.625  10.873  1.00 53.30  ? 242  ARG B C     1 
ATOM   4684 O  O     . ARG B 1 248 ? 12.691  82.381  11.131  1.00 52.75  ? 242  ARG B O     1 
ATOM   4685 C  CB    . ARG B 1 248 ? 15.150  80.537  11.402  1.00 57.65  ? 242  ARG B CB    1 
ATOM   4686 C  CG    . ARG B 1 248 ? 15.944  80.224  10.144  1.00 61.92  ? 242  ARG B CG    1 
ATOM   4687 C  CD    . ARG B 1 248 ? 17.107  79.257  10.435  1.00 66.80  ? 242  ARG B CD    1 
ATOM   4688 N  NE    . ARG B 1 248 ? 18.086  79.824  11.370  1.00 69.37  ? 242  ARG B NE    1 
ATOM   4689 C  CZ    . ARG B 1 248 ? 19.264  79.276  11.666  1.00 69.37  ? 242  ARG B CZ    1 
ATOM   4690 N  NH1   . ARG B 1 248 ? 19.634  78.128  11.108  1.00 69.68  ? 242  ARG B NH1   1 
ATOM   4691 N  NH2   . ARG B 1 248 ? 20.079  79.888  12.514  1.00 69.48  ? 242  ARG B NH2   1 
ATOM   4692 N  N     . LYS B 1 249 ? 14.241  83.415  9.876   1.00 50.97  ? 243  LYS B N     1 
ATOM   4693 C  CA    . LYS B 1 249 ? 13.272  84.072  9.021   1.00 49.77  ? 243  LYS B CA    1 
ATOM   4694 C  C     . LYS B 1 249 ? 13.120  83.414  7.652   1.00 49.57  ? 243  LYS B C     1 
ATOM   4695 O  O     . LYS B 1 249 ? 12.075  83.532  7.023   1.00 50.61  ? 243  LYS B O     1 
ATOM   4696 C  CB    . LYS B 1 249 ? 13.651  85.548  8.872   1.00 50.12  ? 243  LYS B CB    1 
ATOM   4697 C  CG    . LYS B 1 249 ? 13.192  86.396  10.061  1.00 50.55  ? 243  LYS B CG    1 
ATOM   4698 C  CD    . LYS B 1 249 ? 14.046  87.635  10.312  1.00 49.46  ? 243  LYS B CD    1 
ATOM   4699 C  CE    . LYS B 1 249 ? 14.077  88.570  9.124   1.00 49.41  ? 243  LYS B CE    1 
ATOM   4700 N  NZ    . LYS B 1 249 ? 14.741  89.859  9.476   1.00 49.62  ? 243  LYS B NZ    1 
ATOM   4701 N  N     . SER B 1 250 ? 14.157  82.719  7.195   1.00 47.94  ? 244  SER B N     1 
ATOM   4702 C  CA    . SER B 1 250 ? 14.113  82.039  5.908   1.00 45.18  ? 244  SER B CA    1 
ATOM   4703 C  C     . SER B 1 250 ? 14.943  80.755  5.901   1.00 43.48  ? 244  SER B C     1 
ATOM   4704 O  O     . SER B 1 250 ? 16.124  80.755  6.225   1.00 42.95  ? 244  SER B O     1 
ATOM   4705 C  CB    . SER B 1 250 ? 14.616  82.959  4.798   1.00 45.83  ? 244  SER B CB    1 
ATOM   4706 O  OG    . SER B 1 250 ? 16.033  83.001  4.770   1.00 47.97  ? 244  SER B OG    1 
ATOM   4707 N  N     . ILE B 1 251 ? 14.310  79.662  5.507   1.00 41.96  ? 245  ILE B N     1 
ATOM   4708 C  CA    . ILE B 1 251 ? 14.964  78.367  5.426   1.00 39.68  ? 245  ILE B CA    1 
ATOM   4709 C  C     . ILE B 1 251 ? 14.901  77.885  3.976   1.00 39.40  ? 245  ILE B C     1 
ATOM   4710 O  O     . ILE B 1 251 ? 13.825  77.850  3.377   1.00 39.64  ? 245  ILE B O     1 
ATOM   4711 C  CB    . ILE B 1 251 ? 14.234  77.365  6.291   1.00 39.22  ? 245  ILE B CB    1 
ATOM   4712 C  CG1   . ILE B 1 251 ? 13.992  77.969  7.678   1.00 40.36  ? 245  ILE B CG1   1 
ATOM   4713 C  CG2   . ILE B 1 251 ? 15.009  76.080  6.336   1.00 40.23  ? 245  ILE B CG2   1 
ATOM   4714 C  CD1   . ILE B 1 251 ? 13.166  77.101  8.616   1.00 38.50  ? 245  ILE B CD1   1 
ATOM   4715 N  N     . GLY B 1 252 ? 16.044  77.511  3.411   1.00 38.40  ? 246  GLY B N     1 
ATOM   4716 C  CA    . GLY B 1 252 ? 16.060  77.049  2.030   1.00 37.70  ? 246  GLY B CA    1 
ATOM   4717 C  C     . GLY B 1 252 ? 17.024  75.901  1.773   1.00 37.76  ? 246  GLY B C     1 
ATOM   4718 O  O     . GLY B 1 252 ? 17.397  75.184  2.702   1.00 38.15  ? 246  GLY B O     1 
ATOM   4719 N  N     . ARG B 1 253 ? 17.421  75.724  0.513   1.00 35.79  ? 247  ARG B N     1 
ATOM   4720 C  CA    . ARG B 1 253 ? 18.345  74.662  0.143   1.00 35.25  ? 247  ARG B CA    1 
ATOM   4721 C  C     . ARG B 1 253 ? 18.705  74.711  -1.351  1.00 34.75  ? 247  ARG B C     1 
ATOM   4722 O  O     . ARG B 1 253 ? 17.858  74.557  -2.208  1.00 35.64  ? 247  ARG B O     1 
ATOM   4723 C  CB    . ARG B 1 253 ? 17.741  73.296  0.514   1.00 35.54  ? 247  ARG B CB    1 
ATOM   4724 C  CG    . ARG B 1 253 ? 18.636  72.083  0.229   1.00 37.53  ? 247  ARG B CG    1 
ATOM   4725 C  CD    . ARG B 1 253 ? 19.930  72.158  0.986   1.00 38.98  ? 247  ARG B CD    1 
ATOM   4726 N  NE    . ARG B 1 253 ? 21.095  72.105  0.106   1.00 41.01  ? 247  ARG B NE    1 
ATOM   4727 C  CZ    . ARG B 1 253 ? 21.786  71.002  -0.142  1.00 43.37  ? 247  ARG B CZ    1 
ATOM   4728 N  NH1   . ARG B 1 253 ? 21.420  69.859  0.422   1.00 41.81  ? 247  ARG B NH1   1 
ATOM   4729 N  NH2   . ARG B 1 253 ? 22.861  71.045  -0.923  1.00 45.59  ? 247  ARG B NH2   1 
ATOM   4730 N  N     . ILE B 1 254 ? 19.972  74.942  -1.656  1.00 34.55  ? 248  ILE B N     1 
ATOM   4731 C  CA    . ILE B 1 254 ? 20.417  74.998  -3.035  1.00 33.80  ? 248  ILE B CA    1 
ATOM   4732 C  C     . ILE B 1 254 ? 21.356  73.816  -3.268  1.00 36.57  ? 248  ILE B C     1 
ATOM   4733 O  O     . ILE B 1 254 ? 22.067  73.380  -2.357  1.00 36.76  ? 248  ILE B O     1 
ATOM   4734 C  CB    . ILE B 1 254 ? 21.142  76.324  -3.326  1.00 30.98  ? 248  ILE B CB    1 
ATOM   4735 C  CG1   . ILE B 1 254 ? 21.643  76.319  -4.770  1.00 30.01  ? 248  ILE B CG1   1 
ATOM   4736 C  CG2   . ILE B 1 254 ? 22.249  76.537  -2.306  1.00 29.52  ? 248  ILE B CG2   1 
ATOM   4737 C  CD1   . ILE B 1 254 ? 22.204  77.616  -5.246  1.00 27.49  ? 248  ILE B CD1   1 
ATOM   4738 N  N     . VAL B 1 255 ? 21.357  73.303  -4.492  1.00 38.55  ? 249  VAL B N     1 
ATOM   4739 C  CA    . VAL B 1 255 ? 22.163  72.143  -4.819  1.00 41.03  ? 249  VAL B CA    1 
ATOM   4740 C  C     . VAL B 1 255 ? 22.800  72.320  -6.183  1.00 43.76  ? 249  VAL B C     1 
ATOM   4741 O  O     . VAL B 1 255 ? 22.321  73.110  -6.999  1.00 43.65  ? 249  VAL B O     1 
ATOM   4742 C  CB    . VAL B 1 255 ? 21.288  70.862  -4.850  1.00 40.39  ? 249  VAL B CB    1 
ATOM   4743 C  CG1   . VAL B 1 255 ? 20.449  70.734  -3.569  1.00 40.27  ? 249  VAL B CG1   1 
ATOM   4744 C  CG2   . VAL B 1 255 ? 20.382  70.910  -6.035  1.00 39.65  ? 249  VAL B CG2   1 
ATOM   4745 N  N     . THR B 1 256 ? 23.868  71.563  -6.427  1.00 46.82  ? 250  THR B N     1 
ATOM   4746 C  CA    . THR B 1 256 ? 24.586  71.623  -7.695  1.00 50.97  ? 250  THR B CA    1 
ATOM   4747 C  C     . THR B 1 256 ? 24.206  70.469  -8.620  1.00 53.62  ? 250  THR B C     1 
ATOM   4748 O  O     . THR B 1 256 ? 23.909  69.362  -8.163  1.00 54.07  ? 250  THR B O     1 
ATOM   4749 C  CB    . THR B 1 256 ? 26.084  71.562  -7.465  1.00 51.17  ? 250  THR B CB    1 
ATOM   4750 O  OG1   . THR B 1 256 ? 26.428  72.484  -6.428  1.00 53.79  ? 250  THR B OG1   1 
ATOM   4751 C  CG2   . THR B 1 256 ? 26.834  71.924  -8.742  1.00 50.14  ? 250  THR B CG2   1 
ATOM   4752 N  N     . MET B 1 257 ? 24.239  70.727  -9.924  1.00 55.73  ? 251  MET B N     1 
ATOM   4753 C  CA    . MET B 1 257 ? 23.886  69.714  -10.907 1.00 57.89  ? 251  MET B CA    1 
ATOM   4754 C  C     . MET B 1 257 ? 25.124  69.092  -11.543 1.00 58.38  ? 251  MET B C     1 
ATOM   4755 O  O     . MET B 1 257 ? 26.060  69.806  -11.894 1.00 58.93  ? 251  MET B O     1 
ATOM   4756 C  CB    . MET B 1 257 ? 23.041  70.345  -12.005 1.00 59.59  ? 251  MET B CB    1 
ATOM   4757 C  CG    . MET B 1 257 ? 22.049  71.357  -11.501 1.00 62.84  ? 251  MET B CG    1 
ATOM   4758 S  SD    . MET B 1 257 ? 20.870  71.869  -12.777 1.00 67.26  ? 251  MET B SD    1 
ATOM   4759 C  CE    . MET B 1 257 ? 21.989  72.320  -14.136 1.00 64.83  ? 251  MET B CE    1 
ATOM   4760 N  N     . LYS B 1 258 ? 25.127  67.772  -11.707 1.00 58.86  ? 252  LYS B N     1 
ATOM   4761 C  CA    . LYS B 1 258 ? 26.256  67.096  -12.339 1.00 59.73  ? 252  LYS B CA    1 
ATOM   4762 C  C     . LYS B 1 258 ? 26.704  67.865  -13.586 1.00 61.60  ? 252  LYS B C     1 
ATOM   4763 O  O     . LYS B 1 258 ? 27.905  67.979  -13.864 1.00 62.21  ? 252  LYS B O     1 
ATOM   4764 C  CB    . LYS B 1 258 ? 25.869  65.675  -12.748 1.00 59.21  ? 252  LYS B CB    1 
ATOM   4765 C  CG    . LYS B 1 258 ? 26.002  64.627  -11.663 1.00 59.12  ? 252  LYS B CG    1 
ATOM   4766 C  CD    . LYS B 1 258 ? 25.244  64.998  -10.404 1.00 59.01  ? 252  LYS B CD    1 
ATOM   4767 C  CE    . LYS B 1 258 ? 25.247  63.842  -9.409  1.00 59.78  ? 252  LYS B CE    1 
ATOM   4768 N  NZ    . LYS B 1 258 ? 26.615  63.287  -9.134  1.00 59.86  ? 252  LYS B NZ    1 
ATOM   4769 N  N     . ARG B 1 259 ? 25.732  68.390  -14.335 1.00 62.75  ? 253  ARG B N     1 
ATOM   4770 C  CA    . ARG B 1 259 ? 26.009  69.145  -15.557 1.00 62.54  ? 253  ARG B CA    1 
ATOM   4771 C  C     . ARG B 1 259 ? 25.124  70.378  -15.593 1.00 62.53  ? 253  ARG B C     1 
ATOM   4772 O  O     . ARG B 1 259 ? 24.112  70.456  -14.902 1.00 61.74  ? 253  ARG B O     1 
ATOM   4773 C  CB    . ARG B 1 259 ? 25.714  68.289  -16.795 1.00 63.17  ? 253  ARG B CB    1 
ATOM   4774 C  CG    . ARG B 1 259 ? 25.955  66.791  -16.592 1.00 65.10  ? 253  ARG B CG    1 
ATOM   4775 C  CD    . ARG B 1 259 ? 25.700  65.961  -17.858 1.00 65.95  ? 253  ARG B CD    1 
ATOM   4776 N  NE    . ARG B 1 259 ? 25.838  64.515  -17.628 1.00 65.52  ? 253  ARG B NE    1 
ATOM   4777 C  CZ    . ARG B 1 259 ? 24.990  63.772  -16.911 1.00 65.00  ? 253  ARG B CZ    1 
ATOM   4778 N  NH1   . ARG B 1 259 ? 23.924  64.325  -16.337 1.00 63.47  ? 253  ARG B NH1   1 
ATOM   4779 N  NH2   . ARG B 1 259 ? 25.203  62.468  -16.775 1.00 64.01  ? 253  ARG B NH2   1 
ATOM   4780 N  N     . ASN B 1 260 ? 25.511  71.352  -16.399 1.00 63.52  ? 254  ASN B N     1 
ATOM   4781 C  CA    . ASN B 1 260 ? 24.710  72.559  -16.513 1.00 65.31  ? 254  ASN B CA    1 
ATOM   4782 C  C     . ASN B 1 260 ? 23.636  72.262  -17.556 1.00 65.88  ? 254  ASN B C     1 
ATOM   4783 O  O     . ASN B 1 260 ? 23.819  71.398  -18.417 1.00 65.18  ? 254  ASN B O     1 
ATOM   4784 C  CB    . ASN B 1 260 ? 25.562  73.769  -16.955 1.00 66.26  ? 254  ASN B CB    1 
ATOM   4785 C  CG    . ASN B 1 260 ? 26.680  74.125  -15.954 1.00 67.43  ? 254  ASN B CG    1 
ATOM   4786 O  OD1   . ASN B 1 260 ? 26.475  74.120  -14.729 1.00 67.52  ? 254  ASN B OD1   1 
ATOM   4787 N  ND2   . ASN B 1 260 ? 27.863  74.454  -16.482 1.00 67.20  ? 254  ASN B ND2   1 
ATOM   4788 N  N     . SER B 1 261 ? 22.516  72.974  -17.472 1.00 67.00  ? 255  SER B N     1 
ATOM   4789 C  CA    . SER B 1 261 ? 21.421  72.767  -18.412 1.00 66.81  ? 255  SER B CA    1 
ATOM   4790 C  C     . SER B 1 261 ? 20.331  73.848  -18.390 1.00 66.56  ? 255  SER B C     1 
ATOM   4791 O  O     . SER B 1 261 ? 20.458  74.889  -17.726 1.00 66.47  ? 255  SER B O     1 
ATOM   4792 C  CB    . SER B 1 261 ? 20.778  71.408  -18.145 1.00 67.17  ? 255  SER B CB    1 
ATOM   4793 O  OG    . SER B 1 261 ? 19.785  71.126  -19.115 1.00 69.82  ? 255  SER B OG    1 
ATOM   4794 N  N     . ARG B 1 262 ? 19.264  73.578  -19.140 1.00 65.55  ? 256  ARG B N     1 
ATOM   4795 C  CA    . ARG B 1 262 ? 18.108  74.461  -19.248 1.00 64.31  ? 256  ARG B CA    1 
ATOM   4796 C  C     . ARG B 1 262 ? 16.869  73.605  -19.455 1.00 63.30  ? 256  ARG B C     1 
ATOM   4797 O  O     . ARG B 1 262 ? 15.743  74.096  -19.375 1.00 62.94  ? 256  ARG B O     1 
ATOM   4798 C  CB    . ARG B 1 262 ? 18.263  75.408  -20.431 1.00 63.83  ? 256  ARG B CB    1 
ATOM   4799 C  CG    . ARG B 1 262 ? 19.499  76.248  -20.375 1.00 65.71  ? 256  ARG B CG    1 
ATOM   4800 C  CD    . ARG B 1 262 ? 20.101  76.318  -21.747 1.00 67.93  ? 256  ARG B CD    1 
ATOM   4801 N  NE    . ARG B 1 262 ? 20.680  75.037  -22.152 1.00 69.81  ? 256  ARG B NE    1 
ATOM   4802 C  CZ    . ARG B 1 262 ? 20.760  74.616  -23.414 1.00 71.04  ? 256  ARG B CZ    1 
ATOM   4803 N  NH1   . ARG B 1 262 ? 20.288  75.367  -24.403 1.00 72.23  ? 256  ARG B NH1   1 
ATOM   4804 N  NH2   . ARG B 1 262 ? 21.328  73.449  -23.694 1.00 70.41  ? 256  ARG B NH2   1 
ATOM   4805 N  N     . ASN B 1 263 ? 17.085  72.322  -19.728 1.00 62.63  ? 257  ASN B N     1 
ATOM   4806 C  CA    . ASN B 1 263 ? 15.978  71.408  -19.943 1.00 63.37  ? 257  ASN B CA    1 
ATOM   4807 C  C     . ASN B 1 263 ? 15.147  71.321  -18.681 1.00 63.57  ? 257  ASN B C     1 
ATOM   4808 O  O     . ASN B 1 263 ? 15.453  70.559  -17.772 1.00 62.51  ? 257  ASN B O     1 
ATOM   4809 C  CB    . ASN B 1 263 ? 16.484  70.021  -20.325 1.00 63.25  ? 257  ASN B CB    1 
ATOM   4810 C  CG    . ASN B 1 263 ? 15.351  69.059  -20.637 1.00 62.56  ? 257  ASN B CG    1 
ATOM   4811 O  OD1   . ASN B 1 263 ? 14.709  68.508  -19.733 1.00 61.29  ? 257  ASN B OD1   1 
ATOM   4812 N  ND2   . ASN B 1 263 ? 15.084  68.868  -21.928 1.00 62.27  ? 257  ASN B ND2   1 
ATOM   4813 N  N     . LEU B 1 264 ? 14.090  72.118  -18.647 1.00 64.84  ? 258  LEU B N     1 
ATOM   4814 C  CA    . LEU B 1 264 ? 13.194  72.182  -17.510 1.00 66.07  ? 258  LEU B CA    1 
ATOM   4815 C  C     . LEU B 1 264 ? 12.882  70.817  -16.914 1.00 67.49  ? 258  LEU B C     1 
ATOM   4816 O  O     . LEU B 1 264 ? 12.696  70.698  -15.703 1.00 68.83  ? 258  LEU B O     1 
ATOM   4817 C  CB    . LEU B 1 264 ? 11.912  72.888  -17.934 1.00 65.59  ? 258  LEU B CB    1 
ATOM   4818 C  CG    . LEU B 1 264 ? 10.855  73.224  -16.894 1.00 65.48  ? 258  LEU B CG    1 
ATOM   4819 C  CD1   . LEU B 1 264 ? 10.075  74.425  -17.420 1.00 66.74  ? 258  LEU B CD1   1 
ATOM   4820 C  CD2   . LEU B 1 264 ? 9.941   72.023  -16.624 1.00 63.86  ? 258  LEU B CD2   1 
ATOM   4821 N  N     . GLU B 1 265 ? 12.839  69.783  -17.749 1.00 68.14  ? 259  GLU B N     1 
ATOM   4822 C  CA    . GLU B 1 265 ? 12.532  68.446  -17.249 1.00 69.00  ? 259  GLU B CA    1 
ATOM   4823 C  C     . GLU B 1 265 ? 13.735  67.794  -16.600 1.00 69.02  ? 259  GLU B C     1 
ATOM   4824 O  O     . GLU B 1 265 ? 13.596  66.903  -15.757 1.00 67.56  ? 259  GLU B O     1 
ATOM   4825 C  CB    . GLU B 1 265 ? 12.022  67.559  -18.377 1.00 70.75  ? 259  GLU B CB    1 
ATOM   4826 C  CG    . GLU B 1 265 ? 10.696  68.005  -18.983 1.00 72.82  ? 259  GLU B CG    1 
ATOM   4827 C  CD    . GLU B 1 265 ? 9.632   68.300  -17.936 1.00 74.12  ? 259  GLU B CD    1 
ATOM   4828 O  OE1   . GLU B 1 265 ? 9.544   67.559  -16.925 1.00 73.00  ? 259  GLU B OE1   1 
ATOM   4829 O  OE2   . GLU B 1 265 ? 8.876   69.279  -18.137 1.00 75.51  ? 259  GLU B OE2   1 
ATOM   4830 N  N     . GLU B 1 266 ? 14.916  68.237  -17.021 1.00 70.22  ? 260  GLU B N     1 
ATOM   4831 C  CA    . GLU B 1 266 ? 16.178  67.738  -16.481 1.00 70.26  ? 260  GLU B CA    1 
ATOM   4832 C  C     . GLU B 1 266 ? 16.498  68.534  -15.236 1.00 67.90  ? 260  GLU B C     1 
ATOM   4833 O  O     . GLU B 1 266 ? 17.387  68.172  -14.471 1.00 67.55  ? 260  GLU B O     1 
ATOM   4834 C  CB    . GLU B 1 266 ? 17.322  67.905  -17.490 1.00 73.15  ? 260  GLU B CB    1 
ATOM   4835 C  CG    . GLU B 1 266 ? 18.710  67.656  -16.890 1.00 76.67  ? 260  GLU B CG    1 
ATOM   4836 C  CD    . GLU B 1 266 ? 19.819  67.574  -17.936 1.00 78.81  ? 260  GLU B CD    1 
ATOM   4837 O  OE1   . GLU B 1 266 ? 19.781  68.365  -18.913 1.00 78.32  ? 260  GLU B OE1   1 
ATOM   4838 O  OE2   . GLU B 1 266 ? 20.734  66.725  -17.766 1.00 79.90  ? 260  GLU B OE2   1 
ATOM   4839 N  N     . ILE B 1 267 ? 15.765  69.624  -15.042 1.00 65.54  ? 261  ILE B N     1 
ATOM   4840 C  CA    . ILE B 1 267 ? 15.970  70.461  -13.876 1.00 63.26  ? 261  ILE B CA    1 
ATOM   4841 C  C     . ILE B 1 267 ? 14.922  70.216  -12.787 1.00 61.52  ? 261  ILE B C     1 
ATOM   4842 O  O     . ILE B 1 267 ? 15.211  70.362  -11.602 1.00 61.05  ? 261  ILE B O     1 
ATOM   4843 C  CB    . ILE B 1 267 ? 15.983  71.951  -14.254 1.00 62.83  ? 261  ILE B CB    1 
ATOM   4844 C  CG1   . ILE B 1 267 ? 17.121  72.227  -15.239 1.00 62.84  ? 261  ILE B CG1   1 
ATOM   4845 C  CG2   . ILE B 1 267 ? 16.199  72.793  -13.011 1.00 63.95  ? 261  ILE B CG2   1 
ATOM   4846 C  CD1   . ILE B 1 267 ? 17.436  73.708  -15.436 1.00 60.82  ? 261  ILE B CD1   1 
ATOM   4847 N  N     . LYS B 1 268 ? 13.714  69.827  -13.175 1.00 59.49  ? 262  LYS B N     1 
ATOM   4848 C  CA    . LYS B 1 268 ? 12.677  69.569  -12.183 1.00 58.50  ? 262  LYS B CA    1 
ATOM   4849 C  C     . LYS B 1 268 ? 13.094  68.575  -11.082 1.00 58.14  ? 262  LYS B C     1 
ATOM   4850 O  O     . LYS B 1 268 ? 12.752  68.756  -9.913  1.00 58.66  ? 262  LYS B O     1 
ATOM   4851 C  CB    . LYS B 1 268 ? 11.397  69.066  -12.858 1.00 57.60  ? 262  LYS B CB    1 
ATOM   4852 C  CG    . LYS B 1 268 ? 10.697  70.065  -13.756 1.00 56.26  ? 262  LYS B CG    1 
ATOM   4853 C  CD    . LYS B 1 268 ? 9.186   69.938  -13.613 1.00 57.95  ? 262  LYS B CD    1 
ATOM   4854 C  CE    . LYS B 1 268 ? 8.678   68.513  -13.912 1.00 58.79  ? 262  LYS B CE    1 
ATOM   4855 N  NZ    . LYS B 1 268 ? 7.308   68.221  -13.344 1.00 58.48  ? 262  LYS B NZ    1 
ATOM   4856 N  N     . PRO B 1 269 ? 13.833  67.511  -11.435 1.00 57.85  ? 263  PRO B N     1 
ATOM   4857 C  CA    . PRO B 1 269 ? 14.251  66.537  -10.414 1.00 57.71  ? 263  PRO B CA    1 
ATOM   4858 C  C     . PRO B 1 269 ? 15.138  67.122  -9.292  1.00 56.92  ? 263  PRO B C     1 
ATOM   4859 O  O     . PRO B 1 269 ? 14.981  66.761  -8.124  1.00 56.17  ? 263  PRO B O     1 
ATOM   4860 C  CB    . PRO B 1 269 ? 14.953  65.453  -11.240 1.00 57.97  ? 263  PRO B CB    1 
ATOM   4861 C  CG    . PRO B 1 269 ? 15.486  66.221  -12.438 1.00 57.36  ? 263  PRO B CG    1 
ATOM   4862 C  CD    . PRO B 1 269 ? 14.321  67.120  -12.770 1.00 57.82  ? 263  PRO B CD    1 
ATOM   4863 N  N     . TYR B 1 270 ? 16.061  68.017  -9.651  1.00 55.60  ? 264  TYR B N     1 
ATOM   4864 C  CA    . TYR B 1 270 ? 16.941  68.659  -8.677  1.00 53.62  ? 264  TYR B CA    1 
ATOM   4865 C  C     . TYR B 1 270 ? 16.082  69.570  -7.832  1.00 52.11  ? 264  TYR B C     1 
ATOM   4866 O  O     . TYR B 1 270 ? 15.878  69.321  -6.657  1.00 52.82  ? 264  TYR B O     1 
ATOM   4867 C  CB    . TYR B 1 270 ? 18.010  69.496  -9.372  1.00 54.95  ? 264  TYR B CB    1 
ATOM   4868 C  CG    . TYR B 1 270 ? 19.156  68.713  -10.001 1.00 57.74  ? 264  TYR B CG    1 
ATOM   4869 C  CD1   . TYR B 1 270 ? 19.853  67.741  -9.278  1.00 57.67  ? 264  TYR B CD1   1 
ATOM   4870 C  CD2   . TYR B 1 270 ? 19.592  69.002  -11.301 1.00 58.09  ? 264  TYR B CD2   1 
ATOM   4871 C  CE1   . TYR B 1 270 ? 20.954  67.089  -9.833  1.00 58.55  ? 264  TYR B CE1   1 
ATOM   4872 C  CE2   . TYR B 1 270 ? 20.687  68.353  -11.861 1.00 57.83  ? 264  TYR B CE2   1 
ATOM   4873 C  CZ    . TYR B 1 270 ? 21.364  67.404  -11.129 1.00 58.76  ? 264  TYR B CZ    1 
ATOM   4874 O  OH    . TYR B 1 270 ? 22.453  66.783  -11.702 1.00 58.80  ? 264  TYR B OH    1 
ATOM   4875 N  N     . LEU B 1 271 ? 15.593  70.633  -8.451  1.00 50.73  ? 265  LEU B N     1 
ATOM   4876 C  CA    . LEU B 1 271 ? 14.715  71.589  -7.806  1.00 51.23  ? 265  LEU B CA    1 
ATOM   4877 C  C     . LEU B 1 271 ? 13.806  70.900  -6.808  1.00 53.47  ? 265  LEU B C     1 
ATOM   4878 O  O     . LEU B 1 271 ? 13.665  71.343  -5.678  1.00 55.09  ? 265  LEU B O     1 
ATOM   4879 C  CB    . LEU B 1 271 ? 13.851  72.258  -8.860  1.00 50.82  ? 265  LEU B CB    1 
ATOM   4880 C  CG    . LEU B 1 271 ? 12.569  72.901  -8.355  1.00 49.26  ? 265  LEU B CG    1 
ATOM   4881 C  CD1   . LEU B 1 271 ? 12.936  74.126  -7.570  1.00 47.76  ? 265  LEU B CD1   1 
ATOM   4882 C  CD2   . LEU B 1 271 ? 11.671  73.236  -9.519  1.00 48.25  ? 265  LEU B CD2   1 
ATOM   4883 N  N     . PHE B 1 272 ? 13.177  69.814  -7.239  1.00 55.44  ? 266  PHE B N     1 
ATOM   4884 C  CA    . PHE B 1 272 ? 12.270  69.058  -6.381  1.00 57.04  ? 266  PHE B CA    1 
ATOM   4885 C  C     . PHE B 1 272 ? 12.887  68.621  -5.062  1.00 57.46  ? 266  PHE B C     1 
ATOM   4886 O  O     . PHE B 1 272 ? 12.186  68.455  -4.067  1.00 57.15  ? 266  PHE B O     1 
ATOM   4887 C  CB    . PHE B 1 272 ? 11.770  67.829  -7.126  1.00 58.41  ? 266  PHE B CB    1 
ATOM   4888 C  CG    . PHE B 1 272 ? 10.496  68.055  -7.865  1.00 61.21  ? 266  PHE B CG    1 
ATOM   4889 C  CD1   . PHE B 1 272 ? 10.170  69.325  -8.348  1.00 62.12  ? 266  PHE B CD1   1 
ATOM   4890 C  CD2   . PHE B 1 272 ? 9.621   67.000  -8.089  1.00 61.81  ? 266  PHE B CD2   1 
ATOM   4891 C  CE1   . PHE B 1 272 ? 8.988   69.539  -9.046  1.00 62.12  ? 266  PHE B CE1   1 
ATOM   4892 C  CE2   . PHE B 1 272 ? 8.439   67.199  -8.784  1.00 62.21  ? 266  PHE B CE2   1 
ATOM   4893 C  CZ    . PHE B 1 272 ? 8.120   68.475  -9.265  1.00 62.74  ? 266  PHE B CZ    1 
ATOM   4894 N  N     . ARG B 1 273 ? 14.198  68.422  -5.059  1.00 57.82  ? 267  ARG B N     1 
ATOM   4895 C  CA    . ARG B 1 273 ? 14.877  68.000  -3.852  1.00 58.94  ? 267  ARG B CA    1 
ATOM   4896 C  C     . ARG B 1 273 ? 14.988  69.158  -2.880  1.00 59.11  ? 267  ARG B C     1 
ATOM   4897 O  O     . ARG B 1 273 ? 14.609  69.035  -1.711  1.00 60.34  ? 267  ARG B O     1 
ATOM   4898 C  CB    . ARG B 1 273 ? 16.259  67.457  -4.192  1.00 60.82  ? 267  ARG B CB    1 
ATOM   4899 C  CG    . ARG B 1 273 ? 16.895  66.628  -3.084  1.00 63.28  ? 267  ARG B CG    1 
ATOM   4900 C  CD    . ARG B 1 273 ? 17.860  65.613  -3.687  1.00 66.59  ? 267  ARG B CD    1 
ATOM   4901 N  NE    . ARG B 1 273 ? 19.085  65.471  -2.901  1.00 70.81  ? 267  ARG B NE    1 
ATOM   4902 C  CZ    . ARG B 1 273 ? 19.939  66.464  -2.652  1.00 71.35  ? 267  ARG B CZ    1 
ATOM   4903 N  NH1   . ARG B 1 273 ? 19.706  67.681  -3.126  1.00 72.56  ? 267  ARG B NH1   1 
ATOM   4904 N  NH2   . ARG B 1 273 ? 21.030  66.239  -1.932  1.00 71.91  ? 267  ARG B NH2   1 
ATOM   4905 N  N     . ALA B 1 274 ? 15.499  70.287  -3.360  1.00 57.83  ? 268  ALA B N     1 
ATOM   4906 C  CA    . ALA B 1 274 ? 15.643  71.466  -2.516  1.00 57.03  ? 268  ALA B CA    1 
ATOM   4907 C  C     . ALA B 1 274 ? 14.313  71.764  -1.849  1.00 56.71  ? 268  ALA B C     1 
ATOM   4908 O  O     . ALA B 1 274 ? 14.266  72.349  -0.774  1.00 57.32  ? 268  ALA B O     1 
ATOM   4909 C  CB    . ALA B 1 274 ? 16.082  72.646  -3.348  1.00 56.81  ? 268  ALA B CB    1 
ATOM   4910 N  N     . ILE B 1 275 ? 13.237  71.331  -2.495  1.00 57.25  ? 269  ILE B N     1 
ATOM   4911 C  CA    . ILE B 1 275 ? 11.877  71.538  -1.999  1.00 58.06  ? 269  ILE B CA    1 
ATOM   4912 C  C     . ILE B 1 275 ? 11.472  70.556  -0.893  1.00 57.89  ? 269  ILE B C     1 
ATOM   4913 O  O     . ILE B 1 275 ? 10.491  70.790  -0.175  1.00 56.28  ? 269  ILE B O     1 
ATOM   4914 C  CB    . ILE B 1 275 ? 10.854  71.403  -3.149  1.00 58.14  ? 269  ILE B CB    1 
ATOM   4915 C  CG1   . ILE B 1 275 ? 11.338  72.182  -4.373  1.00 57.84  ? 269  ILE B CG1   1 
ATOM   4916 C  CG2   . ILE B 1 275 ? 9.496   71.909  -2.693  1.00 58.62  ? 269  ILE B CG2   1 
ATOM   4917 C  CD1   . ILE B 1 275 ? 10.374  72.172  -5.548  1.00 57.70  ? 269  ILE B CD1   1 
ATOM   4918 N  N     . GLU B 1 276 ? 12.224  69.462  -0.772  1.00 58.20  ? 270  GLU B N     1 
ATOM   4919 C  CA    . GLU B 1 276 ? 11.941  68.442  0.232   1.00 59.00  ? 270  GLU B CA    1 
ATOM   4920 C  C     . GLU B 1 276 ? 12.704  68.627  1.520   1.00 58.23  ? 270  GLU B C     1 
ATOM   4921 O  O     . GLU B 1 276 ? 12.153  68.476  2.612   1.00 56.52  ? 270  GLU B O     1 
ATOM   4922 C  CB    . GLU B 1 276 ? 12.236  67.053  -0.318  1.00 60.81  ? 270  GLU B CB    1 
ATOM   4923 C  CG    . GLU B 1 276 ? 10.999  66.364  -0.846  1.00 64.04  ? 270  GLU B CG    1 
ATOM   4924 C  CD    . GLU B 1 276 ? 9.870   66.350  0.183   1.00 65.47  ? 270  GLU B CD    1 
ATOM   4925 O  OE1   . GLU B 1 276 ? 8.725   66.019  -0.210  1.00 64.72  ? 270  GLU B OE1   1 
ATOM   4926 O  OE2   . GLU B 1 276 ? 10.131  66.665  1.377   1.00 65.50  ? 270  GLU B OE2   1 
ATOM   4927 N  N     . GLU B 1 277 ? 13.986  68.931  1.383   1.00 58.25  ? 271  GLU B N     1 
ATOM   4928 C  CA    . GLU B 1 277 ? 14.826  69.151  2.540   1.00 58.43  ? 271  GLU B CA    1 
ATOM   4929 C  C     . GLU B 1 277 ? 14.256  70.315  3.311   1.00 57.69  ? 271  GLU B C     1 
ATOM   4930 O  O     . GLU B 1 277 ? 13.958  70.206  4.501   1.00 58.29  ? 271  GLU B O     1 
ATOM   4931 C  CB    . GLU B 1 277 ? 16.242  69.472  2.096   1.00 59.45  ? 271  GLU B CB    1 
ATOM   4932 C  CG    . GLU B 1 277 ? 16.942  68.282  1.527   1.00 62.74  ? 271  GLU B CG    1 
ATOM   4933 C  CD    . GLU B 1 277 ? 18.310  68.613  1.005   1.00 65.67  ? 271  GLU B CD    1 
ATOM   4934 O  OE1   . GLU B 1 277 ? 19.099  69.246  1.752   1.00 65.95  ? 271  GLU B OE1   1 
ATOM   4935 O  OE2   . GLU B 1 277 ? 18.589  68.229  -0.155  1.00 67.48  ? 271  GLU B OE2   1 
ATOM   4936 N  N     . SER B 1 278 ? 14.095  71.430  2.608   1.00 56.03  ? 272  SER B N     1 
ATOM   4937 C  CA    . SER B 1 278 ? 13.557  72.643  3.196   1.00 53.76  ? 272  SER B CA    1 
ATOM   4938 C  C     . SER B 1 278 ? 12.305  72.407  4.034   1.00 54.18  ? 272  SER B C     1 
ATOM   4939 O  O     . SER B 1 278 ? 12.317  72.617  5.254   1.00 53.96  ? 272  SER B O     1 
ATOM   4940 C  CB    . SER B 1 278 ? 13.253  73.641  2.101   1.00 51.33  ? 272  SER B CB    1 
ATOM   4941 O  OG    . SER B 1 278 ? 14.445  74.032  1.472   1.00 49.57  ? 272  SER B OG    1 
ATOM   4942 N  N     . TYR B 1 279 ? 11.224  71.980  3.381   1.00 54.16  ? 273  TYR B N     1 
ATOM   4943 C  CA    . TYR B 1 279 ? 9.963   71.732  4.075   1.00 53.92  ? 273  TYR B CA    1 
ATOM   4944 C  C     . TYR B 1 279 ? 10.108  70.806  5.244   1.00 55.10  ? 273  TYR B C     1 
ATOM   4945 O  O     . TYR B 1 279 ? 9.264   70.763  6.161   1.00 54.48  ? 273  TYR B O     1 
ATOM   4946 C  CB    . TYR B 1 279 ? 8.960   71.134  3.115   1.00 51.73  ? 273  TYR B CB    1 
ATOM   4947 C  CG    . TYR B 1 279 ? 8.083   72.182  2.518   1.00 51.34  ? 273  TYR B CG    1 
ATOM   4948 C  CD1   . TYR B 1 279 ? 6.965   72.629  3.201   1.00 49.82  ? 273  TYR B CD1   1 
ATOM   4949 C  CD2   . TYR B 1 279 ? 8.409   72.772  1.298   1.00 50.74  ? 273  TYR B CD2   1 
ATOM   4950 C  CE1   . TYR B 1 279 ? 6.196   73.633  2.691   1.00 50.49  ? 273  TYR B CE1   1 
ATOM   4951 C  CE2   . TYR B 1 279 ? 7.646   73.777  0.784   1.00 50.20  ? 273  TYR B CE2   1 
ATOM   4952 C  CZ    . TYR B 1 279 ? 6.532   74.213  1.480   1.00 51.86  ? 273  TYR B CZ    1 
ATOM   4953 O  OH    . TYR B 1 279 ? 5.762   75.246  0.991   1.00 54.44  ? 273  TYR B OH    1 
ATOM   4954 N  N     . TYR B 1 280 ? 11.200  70.052  5.180   1.00 56.22  ? 274  TYR B N     1 
ATOM   4955 C  CA    . TYR B 1 280 ? 11.527  69.099  6.205   1.00 55.64  ? 274  TYR B CA    1 
ATOM   4956 C  C     . TYR B 1 280 ? 12.055  69.839  7.449   1.00 55.05  ? 274  TYR B C     1 
ATOM   4957 O  O     . TYR B 1 280 ? 11.720  69.500  8.557   1.00 54.78  ? 274  TYR B O     1 
ATOM   4958 C  CB    . TYR B 1 280 ? 12.565  68.147  5.630   1.00 58.00  ? 274  TYR B CB    1 
ATOM   4959 C  CG    . TYR B 1 280 ? 13.316  67.404  6.686   1.00 61.68  ? 274  TYR B CG    1 
ATOM   4960 C  CD1   . TYR B 1 280 ? 12.647  66.821  7.758   1.00 61.92  ? 274  TYR B CD1   1 
ATOM   4961 C  CD2   . TYR B 1 280 ? 14.703  67.314  6.634   1.00 63.64  ? 274  TYR B CD2   1 
ATOM   4962 C  CE1   . TYR B 1 280 ? 13.336  66.183  8.750   1.00 62.40  ? 274  TYR B CE1   1 
ATOM   4963 C  CE2   . TYR B 1 280 ? 15.403  66.665  7.629   1.00 63.80  ? 274  TYR B CE2   1 
ATOM   4964 C  CZ    . TYR B 1 280 ? 14.712  66.103  8.688   1.00 64.09  ? 274  TYR B CZ    1 
ATOM   4965 O  OH    . TYR B 1 280 ? 15.394  65.476  9.701   1.00 67.03  ? 274  TYR B OH    1 
ATOM   4966 N  N     . LYS B 1 281 ? 12.860  70.868  7.179   1.00 53.84  ? 275  LYS B N     1 
ATOM   4967 C  CA    . LYS B 1 281 ? 13.515  71.791  8.133   1.00 52.45  ? 275  LYS B CA    1 
ATOM   4968 C  C     . LYS B 1 281 ? 12.520  72.810  8.688   1.00 53.13  ? 275  LYS B C     1 
ATOM   4969 O  O     . LYS B 1 281 ? 12.504  73.083  9.879   1.00 54.99  ? 275  LYS B O     1 
ATOM   4970 C  CB    . LYS B 1 281 ? 14.626  72.603  7.431   1.00 49.71  ? 275  LYS B CB    1 
ATOM   4971 C  CG    . LYS B 1 281 ? 15.887  71.888  6.947   1.00 47.79  ? 275  LYS B CG    1 
ATOM   4972 C  CD    . LYS B 1 281 ? 17.061  72.880  6.761   1.00 46.28  ? 275  LYS B CD    1 
ATOM   4973 C  CE    . LYS B 1 281 ? 17.894  72.551  5.518   1.00 45.87  ? 275  LYS B CE    1 
ATOM   4974 N  NZ    . LYS B 1 281 ? 18.933  73.602  5.248   1.00 44.12  ? 275  LYS B NZ    1 
ATOM   4975 N  N     . LEU B 1 282 ? 11.716  73.399  7.815   1.00 52.74  ? 276  LEU B N     1 
ATOM   4976 C  CA    . LEU B 1 282 ? 10.731  74.368  8.265   1.00 52.78  ? 276  LEU B CA    1 
ATOM   4977 C  C     . LEU B 1 282 ? 10.017  73.811  9.500   1.00 53.23  ? 276  LEU B C     1 
ATOM   4978 O  O     . LEU B 1 282 ? 9.569   74.561  10.355  1.00 53.52  ? 276  LEU B O     1 
ATOM   4979 C  CB    . LEU B 1 282 ? 9.702   74.619  7.167   1.00 52.95  ? 276  LEU B CB    1 
ATOM   4980 C  CG    . LEU B 1 282 ? 10.215  74.845  5.747   1.00 52.45  ? 276  LEU B CG    1 
ATOM   4981 C  CD1   . LEU B 1 282 ? 9.063   75.244  4.859   1.00 51.62  ? 276  LEU B CD1   1 
ATOM   4982 C  CD2   . LEU B 1 282 ? 11.283  75.913  5.749   1.00 52.24  ? 276  LEU B CD2   1 
ATOM   4983 N  N     . ASP B 1 283 ? 9.897   72.490  9.578   1.00 54.31  ? 277  ASP B N     1 
ATOM   4984 C  CA    . ASP B 1 283 ? 9.244   71.841  10.711  1.00 55.25  ? 277  ASP B CA    1 
ATOM   4985 C  C     . ASP B 1 283 ? 7.752   72.165  10.712  1.00 54.86  ? 277  ASP B C     1 
ATOM   4986 O  O     . ASP B 1 283 ? 7.046   71.867  9.741   1.00 55.49  ? 277  ASP B O     1 
ATOM   4987 C  CB    . ASP B 1 283 ? 9.875   72.318  12.030  1.00 58.97  ? 277  ASP B CB    1 
ATOM   4988 C  CG    . ASP B 1 283 ? 10.080  71.189  13.051  1.00 60.94  ? 277  ASP B CG    1 
ATOM   4989 O  OD1   . ASP B 1 283 ? 9.153   70.370  13.262  1.00 61.84  ? 277  ASP B OD1   1 
ATOM   4990 O  OD2   . ASP B 1 283 ? 11.177  71.141  13.656  1.00 60.36  ? 277  ASP B OD2   1 
ATOM   4991 N  N     . LYS B 1 284 ? 7.283   72.776  11.804  1.00 53.73  ? 278  LYS B N     1 
ATOM   4992 C  CA    . LYS B 1 284 ? 5.873   73.138  11.962  1.00 51.86  ? 278  LYS B CA    1 
ATOM   4993 C  C     . LYS B 1 284 ? 5.597   74.489  11.310  1.00 50.55  ? 278  LYS B C     1 
ATOM   4994 O  O     . LYS B 1 284 ? 4.475   74.980  11.353  1.00 50.17  ? 278  LYS B O     1 
ATOM   4995 C  CB    . LYS B 1 284 ? 5.492   73.216  13.442  1.00 51.07  ? 278  LYS B CB    1 
ATOM   4996 C  CG    . LYS B 1 284 ? 6.388   72.438  14.390  1.00 51.92  ? 278  LYS B CG    1 
ATOM   4997 C  CD    . LYS B 1 284 ? 6.124   70.926  14.374  1.00 54.57  ? 278  LYS B CD    1 
ATOM   4998 C  CE    . LYS B 1 284 ? 7.080   70.163  15.336  1.00 54.35  ? 278  LYS B CE    1 
ATOM   4999 N  NZ    . LYS B 1 284 ? 6.752   68.718  15.566  1.00 51.63  ? 278  LYS B NZ    1 
ATOM   5000 N  N     . ARG B 1 285 ? 6.633   75.070  10.708  1.00 49.22  ? 279  ARG B N     1 
ATOM   5001 C  CA    . ARG B 1 285 ? 6.544   76.360  10.033  1.00 49.58  ? 279  ARG B CA    1 
ATOM   5002 C  C     . ARG B 1 285 ? 5.824   76.327  8.680   1.00 49.24  ? 279  ARG B C     1 
ATOM   5003 O  O     . ARG B 1 285 ? 5.810   75.314  7.998   1.00 50.03  ? 279  ARG B O     1 
ATOM   5004 C  CB    . ARG B 1 285 ? 7.951   76.953  9.867   1.00 50.11  ? 279  ARG B CB    1 
ATOM   5005 C  CG    . ARG B 1 285 ? 8.589   77.359  11.199  1.00 51.99  ? 279  ARG B CG    1 
ATOM   5006 C  CD    . ARG B 1 285 ? 9.898   78.107  11.018  1.00 53.80  ? 279  ARG B CD    1 
ATOM   5007 N  NE    . ARG B 1 285 ? 11.015  77.178  10.910  1.00 58.43  ? 279  ARG B NE    1 
ATOM   5008 C  CZ    . ARG B 1 285 ? 11.506  76.466  11.928  1.00 58.49  ? 279  ARG B CZ    1 
ATOM   5009 N  NH1   . ARG B 1 285 ? 10.974  76.591  13.140  1.00 58.73  ? 279  ARG B NH1   1 
ATOM   5010 N  NH2   . ARG B 1 285 ? 12.516  75.616  11.730  1.00 55.90  ? 279  ARG B NH2   1 
ATOM   5011 N  N     . ILE B 1 286 ? 5.223   77.453  8.304   1.00 49.68  ? 280  ILE B N     1 
ATOM   5012 C  CA    . ILE B 1 286 ? 4.481   77.571  7.053   1.00 48.57  ? 280  ILE B CA    1 
ATOM   5013 C  C     . ILE B 1 286 ? 4.933   78.817  6.314   1.00 47.88  ? 280  ILE B C     1 
ATOM   5014 O  O     . ILE B 1 286 ? 4.618   79.935  6.713   1.00 48.44  ? 280  ILE B O     1 
ATOM   5015 C  CB    . ILE B 1 286 ? 2.978   77.747  7.299   1.00 49.61  ? 280  ILE B CB    1 
ATOM   5016 C  CG1   . ILE B 1 286 ? 2.532   76.938  8.520   1.00 50.72  ? 280  ILE B CG1   1 
ATOM   5017 C  CG2   . ILE B 1 286 ? 2.214   77.316  6.060   1.00 49.73  ? 280  ILE B CG2   1 
ATOM   5018 C  CD1   . ILE B 1 286 ? 2.466   75.437  8.291   1.00 52.19  ? 280  ILE B CD1   1 
ATOM   5019 N  N     . PRO B 1 287 ? 5.664   78.648  5.217   1.00 46.49  ? 281  PRO B N     1 
ATOM   5020 C  CA    . PRO B 1 287 ? 6.133   79.804  4.456   1.00 46.45  ? 281  PRO B CA    1 
ATOM   5021 C  C     . PRO B 1 287 ? 5.026   80.460  3.612   1.00 45.69  ? 281  PRO B C     1 
ATOM   5022 O  O     . PRO B 1 287 ? 4.293   79.766  2.912   1.00 47.09  ? 281  PRO B O     1 
ATOM   5023 C  CB    . PRO B 1 287 ? 7.246   79.204  3.601   1.00 45.89  ? 281  PRO B CB    1 
ATOM   5024 C  CG    . PRO B 1 287 ? 6.709   77.849  3.293   1.00 45.87  ? 281  PRO B CG    1 
ATOM   5025 C  CD    . PRO B 1 287 ? 6.175   77.395  4.643   1.00 46.42  ? 281  PRO B CD    1 
ATOM   5026 N  N     . LYS B 1 288 ? 4.902   81.788  3.689   1.00 43.48  ? 282  LYS B N     1 
ATOM   5027 C  CA    . LYS B 1 288 ? 3.899   82.516  2.904   1.00 40.58  ? 282  LYS B CA    1 
ATOM   5028 C  C     . LYS B 1 288 ? 4.495   82.984  1.588   1.00 38.15  ? 282  LYS B C     1 
ATOM   5029 O  O     . LYS B 1 288 ? 3.773   83.248  0.632   1.00 38.23  ? 282  LYS B O     1 
ATOM   5030 C  CB    . LYS B 1 288 ? 3.359   83.734  3.662   1.00 41.31  ? 282  LYS B CB    1 
ATOM   5031 C  CG    . LYS B 1 288 ? 2.324   83.406  4.723   1.00 44.07  ? 282  LYS B CG    1 
ATOM   5032 C  CD    . LYS B 1 288 ? 1.401   84.591  4.999   1.00 44.91  ? 282  LYS B CD    1 
ATOM   5033 C  CE    . LYS B 1 288 ? 2.084   85.677  5.825   1.00 47.85  ? 282  LYS B CE    1 
ATOM   5034 N  NZ    . LYS B 1 288 ? 2.405   85.309  7.247   1.00 47.29  ? 282  LYS B NZ    1 
ATOM   5035 N  N     . ALA B 1 289 ? 5.814   83.090  1.545   1.00 35.21  ? 283  ALA B N     1 
ATOM   5036 C  CA    . ALA B 1 289 ? 6.497   83.518  0.338   1.00 34.09  ? 283  ALA B CA    1 
ATOM   5037 C  C     . ALA B 1 289 ? 7.424   82.402  -0.117  1.00 34.97  ? 283  ALA B C     1 
ATOM   5038 O  O     . ALA B 1 289 ? 7.629   81.424  0.594   1.00 36.34  ? 283  ALA B O     1 
ATOM   5039 C  CB    . ALA B 1 289 ? 7.286   84.772  0.607   1.00 33.70  ? 283  ALA B CB    1 
ATOM   5040 N  N     . ILE B 1 290 ? 7.986   82.542  -1.306  1.00 34.12  ? 284  ILE B N     1 
ATOM   5041 C  CA    . ILE B 1 290 ? 8.878   81.521  -1.828  1.00 33.80  ? 284  ILE B CA    1 
ATOM   5042 C  C     . ILE B 1 290 ? 9.669   82.043  -3.016  1.00 34.53  ? 284  ILE B C     1 
ATOM   5043 O  O     . ILE B 1 290 ? 9.125   82.670  -3.926  1.00 35.66  ? 284  ILE B O     1 
ATOM   5044 C  CB    . ILE B 1 290 ? 8.099   80.233  -2.256  1.00 33.83  ? 284  ILE B CB    1 
ATOM   5045 C  CG1   . ILE B 1 290 ? 9.009   79.327  -3.078  1.00 33.21  ? 284  ILE B CG1   1 
ATOM   5046 C  CG2   . ILE B 1 290 ? 6.883   80.572  -3.104  1.00 32.46  ? 284  ILE B CG2   1 
ATOM   5047 C  CD1   . ILE B 1 290 ? 8.359   78.050  -3.467  1.00 34.46  ? 284  ILE B CD1   1 
ATOM   5048 N  N     . HIS B 1 291 ? 10.961  81.769  -3.009  1.00 33.26  ? 285  HIS B N     1 
ATOM   5049 C  CA    . HIS B 1 291 ? 11.817  82.234  -4.071  1.00 33.93  ? 285  HIS B CA    1 
ATOM   5050 C  C     . HIS B 1 291 ? 12.572  81.060  -4.633  1.00 34.92  ? 285  HIS B C     1 
ATOM   5051 O  O     . HIS B 1 291 ? 12.827  80.097  -3.916  1.00 34.43  ? 285  HIS B O     1 
ATOM   5052 C  CB    . HIS B 1 291 ? 12.812  83.284  -3.531  1.00 33.95  ? 285  HIS B CB    1 
ATOM   5053 C  CG    . HIS B 1 291 ? 12.169  84.571  -3.097  1.00 35.01  ? 285  HIS B CG    1 
ATOM   5054 N  ND1   . HIS B 1 291 ? 11.310  84.652  -2.019  1.00 35.09  ? 285  HIS B ND1   1 
ATOM   5055 C  CD2   . HIS B 1 291 ? 12.223  85.817  -3.627  1.00 33.11  ? 285  HIS B CD2   1 
ATOM   5056 C  CE1   . HIS B 1 291 ? 10.859  85.889  -1.910  1.00 33.89  ? 285  HIS B CE1   1 
ATOM   5057 N  NE2   . HIS B 1 291 ? 11.397  86.614  -2.874  1.00 33.46  ? 285  HIS B NE2   1 
ATOM   5058 N  N     . VAL B 1 292 ? 12.917  81.134  -5.916  1.00 36.34  ? 286  VAL B N     1 
ATOM   5059 C  CA    . VAL B 1 292 ? 13.691  80.080  -6.559  1.00 37.67  ? 286  VAL B CA    1 
ATOM   5060 C  C     . VAL B 1 292 ? 14.971  80.741  -7.051  1.00 38.20  ? 286  VAL B C     1 
ATOM   5061 O  O     . VAL B 1 292 ? 14.921  81.656  -7.870  1.00 39.42  ? 286  VAL B O     1 
ATOM   5062 C  CB    . VAL B 1 292 ? 12.932  79.427  -7.768  1.00 37.09  ? 286  VAL B CB    1 
ATOM   5063 C  CG1   . VAL B 1 292 ? 13.882  78.540  -8.556  1.00 37.37  ? 286  VAL B CG1   1 
ATOM   5064 C  CG2   . VAL B 1 292 ? 11.773  78.568  -7.274  1.00 33.98  ? 286  VAL B CG2   1 
ATOM   5065 N  N     . VAL B 1 293 ? 16.104  80.283  -6.529  1.00 38.35  ? 287  VAL B N     1 
ATOM   5066 C  CA    . VAL B 1 293 ? 17.407  80.823  -6.897  1.00 40.09  ? 287  VAL B CA    1 
ATOM   5067 C  C     . VAL B 1 293 ? 18.112  79.847  -7.824  1.00 41.38  ? 287  VAL B C     1 
ATOM   5068 O  O     . VAL B 1 293 ? 17.943  78.639  -7.706  1.00 40.75  ? 287  VAL B O     1 
ATOM   5069 C  CB    . VAL B 1 293 ? 18.310  81.069  -5.644  1.00 40.89  ? 287  VAL B CB    1 
ATOM   5070 C  CG1   . VAL B 1 293 ? 19.522  81.933  -6.017  1.00 39.87  ? 287  VAL B CG1   1 
ATOM   5071 C  CG2   . VAL B 1 293 ? 17.499  81.730  -4.530  1.00 40.30  ? 287  VAL B CG2   1 
ATOM   5072 N  N     . ALA B 1 294 ? 18.909  80.395  -8.737  1.00 44.28  ? 288  ALA B N     1 
ATOM   5073 C  CA    . ALA B 1 294 ? 19.646  79.624  -9.729  1.00 46.08  ? 288  ALA B CA    1 
ATOM   5074 C  C     . ALA B 1 294 ? 21.016  80.243  -9.960  1.00 47.97  ? 288  ALA B C     1 
ATOM   5075 O  O     . ALA B 1 294 ? 21.172  81.469  -9.934  1.00 47.73  ? 288  ALA B O     1 
ATOM   5076 C  CB    . ALA B 1 294 ? 18.870  79.605  -11.039 1.00 45.54  ? 288  ALA B CB    1 
ATOM   5077 N  N     . VAL B 1 295 ? 22.009  79.394  -10.189 1.00 50.34  ? 289  VAL B N     1 
ATOM   5078 C  CA    . VAL B 1 295 ? 23.363  79.874  -10.437 1.00 53.57  ? 289  VAL B CA    1 
ATOM   5079 C  C     . VAL B 1 295 ? 23.740  79.348  -11.815 1.00 56.12  ? 289  VAL B C     1 
ATOM   5080 O  O     . VAL B 1 295 ? 23.923  78.139  -11.984 1.00 57.26  ? 289  VAL B O     1 
ATOM   5081 C  CB    . VAL B 1 295 ? 24.378  79.331  -9.377  1.00 52.60  ? 289  VAL B CB    1 
ATOM   5082 C  CG1   . VAL B 1 295 ? 25.648  80.136  -9.418  1.00 51.55  ? 289  VAL B CG1   1 
ATOM   5083 C  CG2   . VAL B 1 295 ? 23.788  79.397  -7.984  1.00 53.19  ? 289  VAL B CG2   1 
ATOM   5084 N  N     . THR B 1 296 ? 23.843  80.246  -12.796 1.00 57.79  ? 290  THR B N     1 
ATOM   5085 C  CA    . THR B 1 296 ? 24.183  79.851  -14.163 1.00 59.99  ? 290  THR B CA    1 
ATOM   5086 C  C     . THR B 1 296 ? 25.659  79.519  -14.375 1.00 62.53  ? 290  THR B C     1 
ATOM   5087 O  O     . THR B 1 296 ? 26.488  79.778  -13.510 1.00 62.49  ? 290  THR B O     1 
ATOM   5088 C  CB    . THR B 1 296 ? 23.819  80.942  -15.141 1.00 58.31  ? 290  THR B CB    1 
ATOM   5089 O  OG1   . THR B 1 296 ? 24.558  82.120  -14.817 1.00 57.86  ? 290  THR B OG1   1 
ATOM   5090 C  CG2   . THR B 1 296 ? 22.354  81.243  -15.060 1.00 58.56  ? 290  THR B CG2   1 
ATOM   5091 N  N     . GLU B 1 297 ? 25.966  78.953  -15.543 1.00 65.65  ? 291  GLU B N     1 
ATOM   5092 C  CA    . GLU B 1 297 ? 27.322  78.560  -15.938 1.00 68.49  ? 291  GLU B CA    1 
ATOM   5093 C  C     . GLU B 1 297 ? 28.426  79.502  -15.483 1.00 69.84  ? 291  GLU B C     1 
ATOM   5094 O  O     . GLU B 1 297 ? 29.471  79.047  -15.014 1.00 70.36  ? 291  GLU B O     1 
ATOM   5095 C  CB    . GLU B 1 297 ? 27.410  78.441  -17.457 1.00 70.22  ? 291  GLU B CB    1 
ATOM   5096 C  CG    . GLU B 1 297 ? 28.806  78.103  -17.962 1.00 72.79  ? 291  GLU B CG    1 
ATOM   5097 C  CD    . GLU B 1 297 ? 28.905  78.178  -19.469 1.00 73.63  ? 291  GLU B CD    1 
ATOM   5098 O  OE1   . GLU B 1 297 ? 27.877  77.892  -20.125 1.00 74.01  ? 291  GLU B OE1   1 
ATOM   5099 O  OE2   . GLU B 1 297 ? 30.000  78.506  -19.990 1.00 73.14  ? 291  GLU B OE2   1 
ATOM   5100 N  N     . ASP B 1 298 ? 28.196  80.807  -15.652 1.00 71.02  ? 292  ASP B N     1 
ATOM   5101 C  CA    . ASP B 1 298 ? 29.168  81.841  -15.275 1.00 71.43  ? 292  ASP B CA    1 
ATOM   5102 C  C     . ASP B 1 298 ? 29.099  82.191  -13.790 1.00 70.93  ? 292  ASP B C     1 
ATOM   5103 O  O     . ASP B 1 298 ? 29.586  83.241  -13.370 1.00 71.31  ? 292  ASP B O     1 
ATOM   5104 C  CB    . ASP B 1 298 ? 28.962  83.119  -16.109 1.00 72.60  ? 292  ASP B CB    1 
ATOM   5105 C  CG    . ASP B 1 298 ? 27.795  83.968  -15.620 1.00 73.52  ? 292  ASP B CG    1 
ATOM   5106 O  OD1   . ASP B 1 298 ? 26.659  83.451  -15.568 1.00 74.76  ? 292  ASP B OD1   1 
ATOM   5107 O  OD2   . ASP B 1 298 ? 28.016  85.155  -15.296 1.00 73.01  ? 292  ASP B OD2   1 
ATOM   5108 N  N     . LEU B 1 299 ? 28.481  81.306  -13.012 1.00 69.92  ? 293  LEU B N     1 
ATOM   5109 C  CA    . LEU B 1 299 ? 28.344  81.463  -11.565 1.00 69.31  ? 293  LEU B CA    1 
ATOM   5110 C  C     . LEU B 1 299 ? 27.500  82.657  -11.138 1.00 69.22  ? 293  LEU B C     1 
ATOM   5111 O  O     . LEU B 1 299 ? 27.437  82.981  -9.951  1.00 69.42  ? 293  LEU B O     1 
ATOM   5112 C  CB    . LEU B 1 299 ? 29.733  81.541  -10.914 1.00 68.26  ? 293  LEU B CB    1 
ATOM   5113 C  CG    . LEU B 1 299 ? 30.666  80.355  -11.203 1.00 67.40  ? 293  LEU B CG    1 
ATOM   5114 C  CD1   . LEU B 1 299 ? 32.046  80.656  -10.650 1.00 67.76  ? 293  LEU B CD1   1 
ATOM   5115 C  CD2   . LEU B 1 299 ? 30.100  79.072  -10.600 1.00 65.59  ? 293  LEU B CD2   1 
ATOM   5116 N  N     . ASP B 1 300 ? 26.849  83.305  -12.102 1.00 69.41  ? 294  ASP B N     1 
ATOM   5117 C  CA    . ASP B 1 300 ? 26.006  84.461  -11.809 1.00 68.33  ? 294  ASP B CA    1 
ATOM   5118 C  C     . ASP B 1 300 ? 24.735  83.949  -11.146 1.00 66.49  ? 294  ASP B C     1 
ATOM   5119 O  O     . ASP B 1 300 ? 24.266  82.843  -11.430 1.00 66.57  ? 294  ASP B O     1 
ATOM   5120 C  CB    . ASP B 1 300 ? 25.666  85.227  -13.097 1.00 70.20  ? 294  ASP B CB    1 
ATOM   5121 C  CG    . ASP B 1 300 ? 25.477  86.736  -12.863 1.00 73.63  ? 294  ASP B CG    1 
ATOM   5122 O  OD1   . ASP B 1 300 ? 24.599  87.123  -12.052 1.00 74.87  ? 294  ASP B OD1   1 
ATOM   5123 O  OD2   . ASP B 1 300 ? 26.209  87.541  -13.495 1.00 74.32  ? 294  ASP B OD2   1 
ATOM   5124 N  N     . ILE B 1 301 ? 24.179  84.754  -10.255 1.00 64.33  ? 295  ILE B N     1 
ATOM   5125 C  CA    . ILE B 1 301 ? 22.976  84.360  -9.543  1.00 62.42  ? 295  ILE B CA    1 
ATOM   5126 C  C     . ILE B 1 301 ? 21.742  85.163  -9.960  1.00 61.65  ? 295  ILE B C     1 
ATOM   5127 O  O     . ILE B 1 301 ? 21.790  86.394  -10.092 1.00 61.72  ? 295  ILE B O     1 
ATOM   5128 C  CB    . ILE B 1 301 ? 23.201  84.485  -8.011  1.00 61.48  ? 295  ILE B CB    1 
ATOM   5129 C  CG1   . ILE B 1 301 ? 24.244  83.458  -7.569  1.00 60.30  ? 295  ILE B CG1   1 
ATOM   5130 C  CG2   . ILE B 1 301 ? 21.906  84.283  -7.257  1.00 60.64  ? 295  ILE B CG2   1 
ATOM   5131 C  CD1   . ILE B 1 301 ? 24.502  83.444  -6.097  1.00 60.42  ? 295  ILE B CD1   1 
ATOM   5132 N  N     . VAL B 1 302 ? 20.646  84.442  -10.181 1.00 60.22  ? 296  VAL B N     1 
ATOM   5133 C  CA    . VAL B 1 302 ? 19.367  85.035  -10.563 1.00 59.05  ? 296  VAL B CA    1 
ATOM   5134 C  C     . VAL B 1 302 ? 18.291  84.382  -9.705  1.00 57.64  ? 296  VAL B C     1 
ATOM   5135 O  O     . VAL B 1 302 ? 18.425  83.213  -9.335  1.00 56.73  ? 296  VAL B O     1 
ATOM   5136 C  CB    . VAL B 1 302 ? 19.028  84.764  -12.047 1.00 59.61  ? 296  VAL B CB    1 
ATOM   5137 C  CG1   . VAL B 1 302 ? 20.008  85.488  -12.956 1.00 60.11  ? 296  VAL B CG1   1 
ATOM   5138 C  CG2   . VAL B 1 302 ? 19.060  83.273  -12.318 1.00 59.93  ? 296  VAL B CG2   1 
ATOM   5139 N  N     . SER B 1 303 ? 17.232  85.124  -9.379  1.00 55.32  ? 297  SER B N     1 
ATOM   5140 C  CA    . SER B 1 303 ? 16.154  84.568  -8.558  1.00 53.31  ? 297  SER B CA    1 
ATOM   5141 C  C     . SER B 1 303 ? 14.782  85.142  -8.876  1.00 51.49  ? 297  SER B C     1 
ATOM   5142 O  O     . SER B 1 303 ? 14.659  86.302  -9.264  1.00 51.64  ? 297  SER B O     1 
ATOM   5143 C  CB    . SER B 1 303 ? 16.436  84.796  -7.070  1.00 52.93  ? 297  SER B CB    1 
ATOM   5144 O  OG    . SER B 1 303 ? 16.379  86.174  -6.742  1.00 54.96  ? 297  SER B OG    1 
ATOM   5145 N  N     . ARG B 1 304 ? 13.753  84.321  -8.717  1.00 49.30  ? 298  ARG B N     1 
ATOM   5146 C  CA    . ARG B 1 304 ? 12.393  84.770  -8.938  1.00 47.86  ? 298  ARG B CA    1 
ATOM   5147 C  C     . ARG B 1 304 ? 11.553  84.331  -7.760  1.00 47.11  ? 298  ARG B C     1 
ATOM   5148 O  O     . ARG B 1 304 ? 11.424  83.133  -7.484  1.00 45.52  ? 298  ARG B O     1 
ATOM   5149 C  CB    . ARG B 1 304 ? 11.823  84.188  -10.219 1.00 48.91  ? 298  ARG B CB    1 
ATOM   5150 C  CG    . ARG B 1 304 ? 12.409  84.791  -11.445 1.00 51.00  ? 298  ARG B CG    1 
ATOM   5151 C  CD    . ARG B 1 304 ? 12.189  86.298  -11.437 1.00 54.24  ? 298  ARG B CD    1 
ATOM   5152 N  NE    . ARG B 1 304 ? 12.862  86.974  -12.548 1.00 56.11  ? 298  ARG B NE    1 
ATOM   5153 C  CZ    . ARG B 1 304 ? 14.178  87.136  -12.647 1.00 55.88  ? 298  ARG B CZ    1 
ATOM   5154 N  NH1   . ARG B 1 304 ? 14.990  86.680  -11.706 1.00 57.84  ? 298  ARG B NH1   1 
ATOM   5155 N  NH2   . ARG B 1 304 ? 14.688  87.751  -13.695 1.00 56.54  ? 298  ARG B NH2   1 
ATOM   5156 N  N     . GLY B 1 305 ? 11.001  85.312  -7.056  1.00 45.82  ? 299  GLY B N     1 
ATOM   5157 C  CA    . GLY B 1 305 ? 10.178  85.021  -5.905  1.00 44.95  ? 299  GLY B CA    1 
ATOM   5158 C  C     . GLY B 1 305 ? 8.751   85.469  -6.107  1.00 45.20  ? 299  GLY B C     1 
ATOM   5159 O  O     . GLY B 1 305 ? 8.456   86.209  -7.052  1.00 46.23  ? 299  GLY B O     1 
ATOM   5160 N  N     . ARG B 1 306 ? 7.880   85.025  -5.202  1.00 43.63  ? 300  ARG B N     1 
ATOM   5161 C  CA    . ARG B 1 306 ? 6.453   85.333  -5.221  1.00 41.87  ? 300  ARG B CA    1 
ATOM   5162 C  C     . ARG B 1 306 ? 5.925   85.249  -3.798  1.00 41.56  ? 300  ARG B C     1 
ATOM   5163 O  O     . ARG B 1 306 ? 6.258   84.320  -3.069  1.00 42.99  ? 300  ARG B O     1 
ATOM   5164 C  CB    . ARG B 1 306 ? 5.730   84.297  -6.070  1.00 41.07  ? 300  ARG B CB    1 
ATOM   5165 C  CG    A ARG B 1 306 ? 4.222   84.443  -6.188  0.50 40.31  ? 300  ARG B CG    1 
ATOM   5166 C  CD    A ARG B 1 306 ? 3.664   83.152  -6.771  0.50 40.52  ? 300  ARG B CD    1 
ATOM   5167 N  NE    A ARG B 1 306 ? 2.466   83.313  -7.589  0.50 40.93  ? 300  ARG B NE    1 
ATOM   5168 C  CZ    A ARG B 1 306 ? 1.261   83.612  -7.115  0.50 41.86  ? 300  ARG B CZ    1 
ATOM   5169 N  NH1   A ARG B 1 306 ? 1.079   83.793  -5.812  0.50 42.31  ? 300  ARG B NH1   1 
ATOM   5170 N  NH2   A ARG B 1 306 ? 0.232   83.712  -7.945  0.50 41.31  ? 300  ARG B NH2   1 
ATOM   5171 N  N     . THR B 1 307 ? 5.109   86.209  -3.390  1.00 39.56  ? 301  THR B N     1 
ATOM   5172 C  CA    . THR B 1 307 ? 4.558   86.166  -2.048  1.00 38.25  ? 301  THR B CA    1 
ATOM   5173 C  C     . THR B 1 307 ? 3.086   85.855  -2.155  1.00 38.12  ? 301  THR B C     1 
ATOM   5174 O  O     . THR B 1 307 ? 2.432   86.226  -3.127  1.00 37.62  ? 301  THR B O     1 
ATOM   5175 C  CB    . THR B 1 307 ? 4.770   87.501  -1.293  1.00 37.38  ? 301  THR B CB    1 
ATOM   5176 O  OG1   . THR B 1 307 ? 6.177   87.738  -1.159  1.00 37.46  ? 301  THR B OG1   1 
ATOM   5177 C  CG2   . THR B 1 307 ? 4.128   87.454  0.103   1.00 32.03  ? 301  THR B CG2   1 
ATOM   5178 N  N     . PHE B 1 308 ? 2.579   85.142  -1.162  1.00 38.64  ? 302  PHE B N     1 
ATOM   5179 C  CA    . PHE B 1 308 ? 1.183   84.771  -1.141  1.00 39.95  ? 302  PHE B CA    1 
ATOM   5180 C  C     . PHE B 1 308 ? 0.549   85.365  0.073   1.00 39.61  ? 302  PHE B C     1 
ATOM   5181 O  O     . PHE B 1 308 ? 1.230   85.798  0.992   1.00 39.36  ? 302  PHE B O     1 
ATOM   5182 C  CB    . PHE B 1 308 ? 1.002   83.260  -1.057  1.00 42.01  ? 302  PHE B CB    1 
ATOM   5183 C  CG    . PHE B 1 308 ? 1.546   82.518  -2.227  1.00 45.41  ? 302  PHE B CG    1 
ATOM   5184 C  CD1   . PHE B 1 308 ? 2.908   82.312  -2.365  1.00 46.17  ? 302  PHE B CD1   1 
ATOM   5185 C  CD2   . PHE B 1 308 ? 0.692   82.015  -3.197  1.00 47.45  ? 302  PHE B CD2   1 
ATOM   5186 C  CE1   . PHE B 1 308 ? 3.408   81.609  -3.458  1.00 47.66  ? 302  PHE B CE1   1 
ATOM   5187 C  CE2   . PHE B 1 308 ? 1.186   81.311  -4.293  1.00 48.07  ? 302  PHE B CE2   1 
ATOM   5188 C  CZ    . PHE B 1 308 ? 2.540   81.109  -4.422  1.00 47.54  ? 302  PHE B CZ    1 
ATOM   5189 N  N     . PRO B 1 309 ? -0.781  85.402  0.084   1.00 39.47  ? 303  PRO B N     1 
ATOM   5190 C  CA    . PRO B 1 309 ? -1.520  85.948  1.216   1.00 38.71  ? 303  PRO B CA    1 
ATOM   5191 C  C     . PRO B 1 309 ? -1.852  84.870  2.247   1.00 38.22  ? 303  PRO B C     1 
ATOM   5192 O  O     . PRO B 1 309 ? -2.464  85.160  3.278   1.00 39.03  ? 303  PRO B O     1 
ATOM   5193 C  CB    . PRO B 1 309 ? -2.759  86.526  0.549   1.00 39.17  ? 303  PRO B CB    1 
ATOM   5194 C  CG    . PRO B 1 309 ? -2.996  85.581  -0.569  1.00 38.20  ? 303  PRO B CG    1 
ATOM   5195 C  CD    . PRO B 1 309 ? -1.626  85.380  -1.128  1.00 38.38  ? 303  PRO B CD    1 
ATOM   5196 N  N     . HIS B 1 310 ? -1.452  83.632  1.957   1.00 38.22  ? 304  HIS B N     1 
ATOM   5197 C  CA    . HIS B 1 310 ? -1.707  82.488  2.843   1.00 38.06  ? 304  HIS B CA    1 
ATOM   5198 C  C     . HIS B 1 310 ? -0.554  81.479  2.834   1.00 37.92  ? 304  HIS B C     1 
ATOM   5199 O  O     . HIS B 1 310 ? 0.433   81.649  2.116   1.00 37.62  ? 304  HIS B O     1 
ATOM   5200 C  CB    . HIS B 1 310 ? -2.987  81.785  2.412   1.00 38.35  ? 304  HIS B CB    1 
ATOM   5201 C  CG    . HIS B 1 310 ? -2.943  81.289  1.003   1.00 40.11  ? 304  HIS B CG    1 
ATOM   5202 N  ND1   . HIS B 1 310 ? -2.106  80.274  0.596   1.00 41.26  ? 304  HIS B ND1   1 
ATOM   5203 C  CD2   . HIS B 1 310 ? -3.603  81.698  -0.105  1.00 41.37  ? 304  HIS B CD2   1 
ATOM   5204 C  CE1   . HIS B 1 310 ? -2.250  80.080  -0.702  1.00 40.72  ? 304  HIS B CE1   1 
ATOM   5205 N  NE2   . HIS B 1 310 ? -3.152  80.931  -1.151  1.00 41.53  ? 304  HIS B NE2   1 
ATOM   5206 N  N     . GLY B 1 311 ? -0.686  80.419  3.621   1.00 38.11  ? 305  GLY B N     1 
ATOM   5207 C  CA    . GLY B 1 311 ? 0.369   79.420  3.684   1.00 39.43  ? 305  GLY B CA    1 
ATOM   5208 C  C     . GLY B 1 311 ? 0.587   78.642  2.407   1.00 39.98  ? 305  GLY B C     1 
ATOM   5209 O  O     . GLY B 1 311 ? -0.329  78.491  1.619   1.00 40.91  ? 305  GLY B O     1 
ATOM   5210 N  N     . ILE B 1 312 ? 1.804   78.142  2.211   1.00 41.26  ? 306  ILE B N     1 
ATOM   5211 C  CA    . ILE B 1 312 ? 2.164   77.363  1.017   1.00 42.42  ? 306  ILE B CA    1 
ATOM   5212 C  C     . ILE B 1 312 ? 2.445   75.885  1.327   1.00 43.58  ? 306  ILE B C     1 
ATOM   5213 O  O     . ILE B 1 312 ? 3.494   75.560  1.889   1.00 43.71  ? 306  ILE B O     1 
ATOM   5214 C  CB    . ILE B 1 312 ? 3.427   77.928  0.358   1.00 41.98  ? 306  ILE B CB    1 
ATOM   5215 C  CG1   . ILE B 1 312 ? 3.143   79.329  -0.186  1.00 43.17  ? 306  ILE B CG1   1 
ATOM   5216 C  CG2   . ILE B 1 312 ? 3.918   76.976  -0.725  1.00 41.64  ? 306  ILE B CG2   1 
ATOM   5217 C  CD1   . ILE B 1 312 ? 4.397   80.114  -0.537  1.00 43.62  ? 306  ILE B CD1   1 
ATOM   5218 N  N     . SER B 1 313 ? 1.524   75.000  0.950   1.00 43.55  ? 307  SER B N     1 
ATOM   5219 C  CA    . SER B 1 313 ? 1.698   73.575  1.200   1.00 43.35  ? 307  SER B CA    1 
ATOM   5220 C  C     . SER B 1 313 ? 2.830   73.050  0.334   1.00 43.49  ? 307  SER B C     1 
ATOM   5221 O  O     . SER B 1 313 ? 3.122   73.634  -0.714  1.00 42.55  ? 307  SER B O     1 
ATOM   5222 C  CB    . SER B 1 313 ? 0.426   72.815  0.855   1.00 44.00  ? 307  SER B CB    1 
ATOM   5223 O  OG    . SER B 1 313 ? 0.483   72.332  -0.473  1.00 44.94  ? 307  SER B OG    1 
ATOM   5224 N  N     . LYS B 1 314 ? 3.442   71.942  0.764   1.00 43.74  ? 308  LYS B N     1 
ATOM   5225 C  CA    . LYS B 1 314 ? 4.552   71.327  0.039   1.00 43.87  ? 308  LYS B CA    1 
ATOM   5226 C  C     . LYS B 1 314 ? 4.144   71.009  -1.390  1.00 44.27  ? 308  LYS B C     1 
ATOM   5227 O  O     . LYS B 1 314 ? 4.945   71.154  -2.309  1.00 42.95  ? 308  LYS B O     1 
ATOM   5228 C  CB    . LYS B 1 314 ? 5.009   70.050  0.734   1.00 44.02  ? 308  LYS B CB    1 
ATOM   5229 C  CG    . LYS B 1 314 ? 6.472   69.758  0.492   1.00 44.69  ? 308  LYS B CG    1 
ATOM   5230 C  CD    . LYS B 1 314 ? 6.718   68.367  -0.055  1.00 46.62  ? 308  LYS B CD    1 
ATOM   5231 C  CE    . LYS B 1 314 ? 6.407   67.280  0.952   1.00 47.34  ? 308  LYS B CE    1 
ATOM   5232 N  NZ    . LYS B 1 314 ? 4.951   67.129  1.220   1.00 49.52  ? 308  LYS B NZ    1 
ATOM   5233 N  N     . GLU B 1 315 ? 2.892   70.574  -1.561  1.00 45.80  ? 309  GLU B N     1 
ATOM   5234 C  CA    . GLU B 1 315 ? 2.323   70.264  -2.877  1.00 46.03  ? 309  GLU B CA    1 
ATOM   5235 C  C     . GLU B 1 315 ? 2.381   71.490  -3.748  1.00 45.20  ? 309  GLU B C     1 
ATOM   5236 O  O     . GLU B 1 315 ? 3.034   71.472  -4.784  1.00 46.18  ? 309  GLU B O     1 
ATOM   5237 C  CB    . GLU B 1 315 ? 0.864   69.836  -2.757  1.00 48.17  ? 309  GLU B CB    1 
ATOM   5238 C  CG    . GLU B 1 315 ? 0.702   68.390  -2.391  1.00 53.42  ? 309  GLU B CG    1 
ATOM   5239 C  CD    . GLU B 1 315 ? 1.576   68.012  -1.213  1.00 57.30  ? 309  GLU B CD    1 
ATOM   5240 O  OE1   . GLU B 1 315 ? 1.301   68.508  -0.088  1.00 57.55  ? 309  GLU B OE1   1 
ATOM   5241 O  OE2   . GLU B 1 315 ? 2.541   67.234  -1.430  1.00 58.81  ? 309  GLU B OE2   1 
ATOM   5242 N  N     . THR B 1 316 ? 1.703   72.558  -3.327  1.00 43.74  ? 310  THR B N     1 
ATOM   5243 C  CA    . THR B 1 316 ? 1.705   73.794  -4.102  1.00 44.29  ? 310  THR B CA    1 
ATOM   5244 C  C     . THR B 1 316 ? 3.117   74.325  -4.261  1.00 45.11  ? 310  THR B C     1 
ATOM   5245 O  O     . THR B 1 316 ? 3.407   75.102  -5.173  1.00 45.37  ? 310  THR B O     1 
ATOM   5246 C  CB    . THR B 1 316 ? 0.890   74.897  -3.447  1.00 43.50  ? 310  THR B CB    1 
ATOM   5247 O  OG1   . THR B 1 316 ? -0.313  74.351  -2.909  1.00 46.46  ? 310  THR B OG1   1 
ATOM   5248 C  CG2   . THR B 1 316 ? 0.514   75.929  -4.473  1.00 41.70  ? 310  THR B CG2   1 
ATOM   5249 N  N     . ALA B 1 317 ? 3.995   73.902  -3.362  1.00 46.71  ? 311  ALA B N     1 
ATOM   5250 C  CA    . ALA B 1 317 ? 5.389   74.325  -3.399  1.00 48.44  ? 311  ALA B CA    1 
ATOM   5251 C  C     . ALA B 1 317 ? 6.058   73.910  -4.712  1.00 49.25  ? 311  ALA B C     1 
ATOM   5252 O  O     . ALA B 1 317 ? 6.854   74.661  -5.290  1.00 50.05  ? 311  ALA B O     1 
ATOM   5253 C  CB    . ALA B 1 317 ? 6.137   73.732  -2.218  1.00 48.53  ? 311  ALA B CB    1 
ATOM   5254 N  N     . TYR B 1 318 ? 5.735   72.711  -5.174  1.00 48.00  ? 312  TYR B N     1 
ATOM   5255 C  CA    . TYR B 1 318 ? 6.298   72.218  -6.413  1.00 48.12  ? 312  TYR B CA    1 
ATOM   5256 C  C     . TYR B 1 318 ? 5.817   73.043  -7.611  1.00 48.43  ? 312  TYR B C     1 
ATOM   5257 O  O     . TYR B 1 318 ? 6.609   73.471  -8.454  1.00 47.27  ? 312  TYR B O     1 
ATOM   5258 C  CB    . TYR B 1 318 ? 5.898   70.758  -6.625  1.00 49.44  ? 312  TYR B CB    1 
ATOM   5259 C  CG    . TYR B 1 318 ? 6.554   69.766  -5.693  1.00 49.97  ? 312  TYR B CG    1 
ATOM   5260 C  CD1   . TYR B 1 318 ? 6.769   68.452  -6.100  1.00 50.03  ? 312  TYR B CD1   1 
ATOM   5261 C  CD2   . TYR B 1 318 ? 6.960   70.131  -4.414  1.00 49.62  ? 312  TYR B CD2   1 
ATOM   5262 C  CE1   . TYR B 1 318 ? 7.373   67.525  -5.263  1.00 50.17  ? 312  TYR B CE1   1 
ATOM   5263 C  CE2   . TYR B 1 318 ? 7.569   69.202  -3.564  1.00 49.21  ? 312  TYR B CE2   1 
ATOM   5264 C  CZ    . TYR B 1 318 ? 7.771   67.902  -4.003  1.00 49.74  ? 312  TYR B CZ    1 
ATOM   5265 O  OH    . TYR B 1 318 ? 8.392   66.978  -3.194  1.00 51.89  ? 312  TYR B OH    1 
ATOM   5266 N  N     . SER B 1 319 ? 4.505   73.251  -7.681  1.00 48.90  ? 313  SER B N     1 
ATOM   5267 C  CA    . SER B 1 319 ? 3.891   73.995  -8.773  1.00 48.42  ? 313  SER B CA    1 
ATOM   5268 C  C     . SER B 1 319 ? 4.433   75.408  -8.853  1.00 48.52  ? 313  SER B C     1 
ATOM   5269 O  O     . SER B 1 319 ? 4.884   75.859  -9.907  1.00 48.16  ? 313  SER B O     1 
ATOM   5270 C  CB    . SER B 1 319 ? 2.375   74.059  -8.583  1.00 48.18  ? 313  SER B CB    1 
ATOM   5271 O  OG    . SER B 1 319 ? 1.840   72.789  -8.261  1.00 48.15  ? 313  SER B OG    1 
ATOM   5272 N  N     . GLU B 1 320 ? 4.394   76.107  -7.726  1.00 48.20  ? 314  GLU B N     1 
ATOM   5273 C  CA    . GLU B 1 320 ? 4.860   77.472  -7.712  1.00 48.26  ? 314  GLU B CA    1 
ATOM   5274 C  C     . GLU B 1 320 ? 6.347   77.556  -7.976  1.00 49.14  ? 314  GLU B C     1 
ATOM   5275 O  O     . GLU B 1 320 ? 6.838   78.547  -8.531  1.00 49.09  ? 314  GLU B O     1 
ATOM   5276 C  CB    . GLU B 1 320 ? 4.530   78.126  -6.387  1.00 46.71  ? 314  GLU B CB    1 
ATOM   5277 C  CG    A GLU B 1 320 ? 4.539   79.628  -6.507  0.50 46.88  ? 314  GLU B CG    1 
ATOM   5278 C  CD    A GLU B 1 320 ? 3.609   80.124  -7.608  0.50 46.25  ? 314  GLU B CD    1 
ATOM   5279 O  OE1   A GLU B 1 320 ? 2.387   79.876  -7.508  0.50 45.78  ? 314  GLU B OE1   1 
ATOM   5280 O  OE2   A GLU B 1 320 ? 4.101   80.760  -8.570  0.50 45.14  ? 314  GLU B OE2   1 
ATOM   5281 N  N     . SER B 1 321 ? 7.056   76.508  -7.573  1.00 48.94  ? 315  SER B N     1 
ATOM   5282 C  CA    . SER B 1 321 ? 8.490   76.440  -7.761  1.00 48.43  ? 315  SER B CA    1 
ATOM   5283 C  C     . SER B 1 321 ? 8.805   76.306  -9.240  1.00 47.54  ? 315  SER B C     1 
ATOM   5284 O  O     . SER B 1 321 ? 9.551   77.112  -9.803  1.00 47.72  ? 315  SER B O     1 
ATOM   5285 C  CB    . SER B 1 321 ? 9.049   75.253  -6.996  1.00 50.24  ? 315  SER B CB    1 
ATOM   5286 O  OG    . SER B 1 321 ? 10.398  75.027  -7.347  1.00 54.50  ? 315  SER B OG    1 
ATOM   5287 N  N     . VAL B 1 322 ? 8.233   75.288  -9.872  1.00 47.27  ? 316  VAL B N     1 
ATOM   5288 C  CA    . VAL B 1 322 ? 8.457   75.071  -11.300 1.00 48.27  ? 316  VAL B CA    1 
ATOM   5289 C  C     . VAL B 1 322 ? 8.142   76.365  -12.043 1.00 47.79  ? 316  VAL B C     1 
ATOM   5290 O  O     . VAL B 1 322 ? 8.947   76.852  -12.842 1.00 46.73  ? 316  VAL B O     1 
ATOM   5291 C  CB    . VAL B 1 322 ? 7.563   73.930  -11.849 1.00 49.15  ? 316  VAL B CB    1 
ATOM   5292 C  CG1   . VAL B 1 322 ? 7.752   73.801  -13.354 1.00 47.90  ? 316  VAL B CG1   1 
ATOM   5293 C  CG2   . VAL B 1 322 ? 7.911   72.607  -11.152 1.00 49.40  ? 316  VAL B CG2   1 
ATOM   5294 N  N     . LYS B 1 323 ? 6.970   76.922  -11.753 1.00 47.15  ? 317  LYS B N     1 
ATOM   5295 C  CA    . LYS B 1 323 ? 6.535   78.171  -12.359 1.00 46.94  ? 317  LYS B CA    1 
ATOM   5296 C  C     . LYS B 1 323 ? 7.628   79.229  -12.294 1.00 45.63  ? 317  LYS B C     1 
ATOM   5297 O  O     . LYS B 1 323 ? 7.940   79.861  -13.303 1.00 42.76  ? 317  LYS B O     1 
ATOM   5298 C  CB    . LYS B 1 323 ? 5.279   78.667  -11.646 1.00 48.27  ? 317  LYS B CB    1 
ATOM   5299 C  CG    . LYS B 1 323 ? 4.084   77.739  -11.830 1.00 51.33  ? 317  LYS B CG    1 
ATOM   5300 C  CD    . LYS B 1 323 ? 3.394   77.938  -13.183 1.00 51.47  ? 317  LYS B CD    1 
ATOM   5301 C  CE    . LYS B 1 323 ? 2.020   78.549  -12.962 1.00 53.03  ? 317  LYS B CE    1 
ATOM   5302 N  NZ    . LYS B 1 323 ? 2.092   79.770  -12.089 1.00 51.94  ? 317  LYS B NZ    1 
ATOM   5303 N  N     . LEU B 1 324 ? 8.204   79.406  -11.103 1.00 46.38  ? 318  LEU B N     1 
ATOM   5304 C  CA    . LEU B 1 324 ? 9.271   80.377  -10.871 1.00 47.49  ? 318  LEU B CA    1 
ATOM   5305 C  C     . LEU B 1 324 ? 10.526  80.064  -11.691 1.00 48.24  ? 318  LEU B C     1 
ATOM   5306 O  O     . LEU B 1 324 ? 11.146  80.962  -12.285 1.00 47.03  ? 318  LEU B O     1 
ATOM   5307 C  CB    . LEU B 1 324 ? 9.624   80.430  -9.383  1.00 47.92  ? 318  LEU B CB    1 
ATOM   5308 C  CG    . LEU B 1 324 ? 8.590   81.035  -8.425  1.00 50.25  ? 318  LEU B CG    1 
ATOM   5309 C  CD1   . LEU B 1 324 ? 9.126   81.012  -6.989  1.00 52.24  ? 318  LEU B CD1   1 
ATOM   5310 C  CD2   . LEU B 1 324 ? 8.292   82.461  -8.827  1.00 50.10  ? 318  LEU B CD2   1 
ATOM   5311 N  N     . LEU B 1 325 ? 10.904  78.791  -11.737 1.00 48.41  ? 319  LEU B N     1 
ATOM   5312 C  CA    . LEU B 1 325 ? 12.078  78.422  -12.511 1.00 49.93  ? 319  LEU B CA    1 
ATOM   5313 C  C     . LEU B 1 325 ? 11.886  78.822  -13.971 1.00 51.47  ? 319  LEU B C     1 
ATOM   5314 O  O     . LEU B 1 325 ? 12.785  79.393  -14.586 1.00 51.85  ? 319  LEU B O     1 
ATOM   5315 C  CB    . LEU B 1 325 ? 12.357  76.918  -12.413 1.00 49.51  ? 319  LEU B CB    1 
ATOM   5316 C  CG    . LEU B 1 325 ? 13.570  76.384  -13.204 1.00 48.55  ? 319  LEU B CG    1 
ATOM   5317 C  CD1   . LEU B 1 325 ? 14.833  77.172  -12.893 1.00 47.56  ? 319  LEU B CD1   1 
ATOM   5318 C  CD2   . LEU B 1 325 ? 13.763  74.939  -12.864 1.00 47.83  ? 319  LEU B CD2   1 
ATOM   5319 N  N     . GLN B 1 326 ? 10.711  78.527  -14.523 1.00 52.75  ? 320  GLN B N     1 
ATOM   5320 C  CA    . GLN B 1 326 ? 10.422  78.878  -15.910 1.00 52.71  ? 320  GLN B CA    1 
ATOM   5321 C  C     . GLN B 1 326 ? 10.756  80.336  -16.159 1.00 53.41  ? 320  GLN B C     1 
ATOM   5322 O  O     . GLN B 1 326 ? 11.625  80.644  -16.978 1.00 53.17  ? 320  GLN B O     1 
ATOM   5323 C  CB    . GLN B 1 326 ? 8.948   78.657  -16.235 1.00 52.34  ? 320  GLN B CB    1 
ATOM   5324 C  CG    . GLN B 1 326 ? 8.536   77.217  -16.240 1.00 54.17  ? 320  GLN B CG    1 
ATOM   5325 C  CD    . GLN B 1 326 ? 7.074   77.036  -16.596 1.00 55.58  ? 320  GLN B CD    1 
ATOM   5326 O  OE1   . GLN B 1 326 ? 6.617   77.558  -17.603 1.00 57.06  ? 320  GLN B OE1   1 
ATOM   5327 N  NE2   . GLN B 1 326 ? 6.337   76.286  -15.778 1.00 56.77  ? 320  GLN B NE2   1 
ATOM   5328 N  N     . LYS B 1 327 ? 10.072  81.229  -15.441 1.00 54.25  ? 321  LYS B N     1 
ATOM   5329 C  CA    . LYS B 1 327 ? 10.277  82.668  -15.595 1.00 54.86  ? 321  LYS B CA    1 
ATOM   5330 C  C     . LYS B 1 327 ? 11.726  82.999  -15.891 1.00 55.53  ? 321  LYS B C     1 
ATOM   5331 O  O     . LYS B 1 327 ? 12.018  83.788  -16.783 1.00 54.74  ? 321  LYS B O     1 
ATOM   5332 C  CB    . LYS B 1 327 ? 9.837   83.413  -14.337 1.00 55.41  ? 321  LYS B CB    1 
ATOM   5333 C  CG    . LYS B 1 327 ? 8.365   83.245  -13.982 1.00 56.85  ? 321  LYS B CG    1 
ATOM   5334 C  CD    . LYS B 1 327 ? 7.935   84.254  -12.913 1.00 58.38  ? 321  LYS B CD    1 
ATOM   5335 C  CE    . LYS B 1 327 ? 8.180   85.715  -13.377 1.00 59.71  ? 321  LYS B CE    1 
ATOM   5336 N  NZ    . LYS B 1 327 ? 7.836   86.752  -12.347 1.00 60.66  ? 321  LYS B NZ    1 
ATOM   5337 N  N     . ILE B 1 328 ? 12.633  82.376  -15.142 1.00 57.95  ? 322  ILE B N     1 
ATOM   5338 C  CA    . ILE B 1 328 ? 14.070  82.604  -15.311 1.00 58.73  ? 322  ILE B CA    1 
ATOM   5339 C  C     . ILE B 1 328 ? 14.555  82.184  -16.692 1.00 59.38  ? 322  ILE B C     1 
ATOM   5340 O  O     . ILE B 1 328 ? 15.130  82.992  -17.435 1.00 59.32  ? 322  ILE B O     1 
ATOM   5341 C  CB    . ILE B 1 328 ? 14.885  81.858  -14.217 1.00 57.19  ? 322  ILE B CB    1 
ATOM   5342 C  CG1   . ILE B 1 328 ? 14.483  82.419  -12.842 1.00 56.96  ? 322  ILE B CG1   1 
ATOM   5343 C  CG2   . ILE B 1 328 ? 16.388  81.984  -14.494 1.00 53.72  ? 322  ILE B CG2   1 
ATOM   5344 C  CD1   . ILE B 1 328 ? 15.165  81.784  -11.644 1.00 58.55  ? 322  ILE B CD1   1 
ATOM   5345 N  N     . LEU B 1 329 ? 14.308  80.923  -17.031 1.00 59.82  ? 323  LEU B N     1 
ATOM   5346 C  CA    . LEU B 1 329 ? 14.712  80.395  -18.324 1.00 61.29  ? 323  LEU B CA    1 
ATOM   5347 C  C     . LEU B 1 329 ? 14.175  81.284  -19.448 1.00 63.37  ? 323  LEU B C     1 
ATOM   5348 O  O     . LEU B 1 329 ? 14.783  81.394  -20.515 1.00 64.38  ? 323  LEU B O     1 
ATOM   5349 C  CB    . LEU B 1 329 ? 14.209  78.955  -18.487 1.00 59.11  ? 323  LEU B CB    1 
ATOM   5350 C  CG    . LEU B 1 329 ? 14.955  77.880  -17.686 1.00 56.77  ? 323  LEU B CG    1 
ATOM   5351 C  CD1   . LEU B 1 329 ? 14.267  76.517  -17.763 1.00 54.92  ? 323  LEU B CD1   1 
ATOM   5352 C  CD2   . LEU B 1 329 ? 16.358  77.802  -18.224 1.00 55.89  ? 323  LEU B CD2   1 
ATOM   5353 N  N     . GLU B 1 330 ? 13.037  81.923  -19.205 1.00 64.26  ? 324  GLU B N     1 
ATOM   5354 C  CA    . GLU B 1 330 ? 12.462  82.796  -20.208 1.00 65.73  ? 324  GLU B CA    1 
ATOM   5355 C  C     . GLU B 1 330 ? 13.155  84.154  -20.199 1.00 65.56  ? 324  GLU B C     1 
ATOM   5356 O  O     . GLU B 1 330 ? 13.807  84.540  -21.166 1.00 65.25  ? 324  GLU B O     1 
ATOM   5357 C  CB    . GLU B 1 330 ? 10.957  82.962  -19.966 1.00 67.07  ? 324  GLU B CB    1 
ATOM   5358 C  CG    . GLU B 1 330 ? 10.101  81.886  -20.647 1.00 70.87  ? 324  GLU B CG    1 
ATOM   5359 C  CD    . GLU B 1 330 ? 10.085  82.009  -22.182 1.00 73.44  ? 324  GLU B CD    1 
ATOM   5360 O  OE1   . GLU B 1 330 ? 9.534   83.013  -22.692 1.00 74.20  ? 324  GLU B OE1   1 
ATOM   5361 O  OE2   . GLU B 1 330 ? 10.624  81.111  -22.875 1.00 73.66  ? 324  GLU B OE2   1 
ATOM   5362 N  N     . GLU B 1 331 ? 13.022  84.863  -19.088 1.00 66.04  ? 325  GLU B N     1 
ATOM   5363 C  CA    . GLU B 1 331 ? 13.601  86.189  -18.931 1.00 66.40  ? 325  GLU B CA    1 
ATOM   5364 C  C     . GLU B 1 331 ? 15.109  86.213  -19.100 1.00 67.23  ? 325  GLU B C     1 
ATOM   5365 O  O     . GLU B 1 331 ? 15.683  87.242  -19.477 1.00 66.33  ? 325  GLU B O     1 
ATOM   5366 C  CB    . GLU B 1 331 ? 13.230  86.741  -17.553 1.00 65.64  ? 325  GLU B CB    1 
ATOM   5367 C  CG    . GLU B 1 331 ? 11.735  86.690  -17.277 1.00 66.43  ? 325  GLU B CG    1 
ATOM   5368 C  CD    . GLU B 1 331 ? 11.355  87.160  -15.891 1.00 66.54  ? 325  GLU B CD    1 
ATOM   5369 O  OE1   . GLU B 1 331 ? 11.604  88.338  -15.570 1.00 66.46  ? 325  GLU B OE1   1 
ATOM   5370 O  OE2   . GLU B 1 331 ? 10.795  86.350  -15.122 1.00 67.54  ? 325  GLU B OE2   1 
ATOM   5371 N  N     . ASP B 1 332 ? 15.743  85.075  -18.830 1.00 68.44  ? 326  ASP B N     1 
ATOM   5372 C  CA    . ASP B 1 332 ? 17.197  84.959  -18.919 1.00 70.12  ? 326  ASP B CA    1 
ATOM   5373 C  C     . ASP B 1 332 ? 17.580  83.562  -19.395 1.00 70.40  ? 326  ASP B C     1 
ATOM   5374 O  O     . ASP B 1 332 ? 16.909  82.590  -19.052 1.00 70.33  ? 326  ASP B O     1 
ATOM   5375 C  CB    . ASP B 1 332 ? 17.804  85.243  -17.535 1.00 71.01  ? 326  ASP B CB    1 
ATOM   5376 C  CG    . ASP B 1 332 ? 19.327  85.166  -17.518 1.00 72.39  ? 326  ASP B CG    1 
ATOM   5377 O  OD1   . ASP B 1 332 ? 19.927  85.823  -16.636 1.00 71.82  ? 326  ASP B OD1   1 
ATOM   5378 O  OD2   . ASP B 1 332 ? 19.921  84.449  -18.359 1.00 73.78  ? 326  ASP B OD2   1 
ATOM   5379 N  N     . GLU B 1 333 ? 18.646  83.453  -20.191 1.00 70.56  ? 327  GLU B N     1 
ATOM   5380 C  CA    . GLU B 1 333 ? 19.058  82.134  -20.664 1.00 71.51  ? 327  GLU B CA    1 
ATOM   5381 C  C     . GLU B 1 333 ? 20.540  81.803  -20.919 1.00 71.20  ? 327  GLU B C     1 
ATOM   5382 O  O     . GLU B 1 333 ? 21.089  82.046  -22.004 1.00 70.58  ? 327  GLU B O     1 
ATOM   5383 C  CB    . GLU B 1 333 ? 18.243  81.741  -21.899 1.00 72.43  ? 327  GLU B CB    1 
ATOM   5384 C  CG    . GLU B 1 333 ? 17.316  80.561  -21.640 1.00 73.86  ? 327  GLU B CG    1 
ATOM   5385 C  CD    . GLU B 1 333 ? 18.066  79.296  -21.250 1.00 75.24  ? 327  GLU B CD    1 
ATOM   5386 O  OE1   . GLU B 1 333 ? 17.410  78.330  -20.803 1.00 76.24  ? 327  GLU B OE1   1 
ATOM   5387 O  OE2   . GLU B 1 333 ? 19.308  79.260  -21.399 1.00 75.14  ? 327  GLU B OE2   1 
ATOM   5388 N  N     . ARG B 1 334 ? 21.157  81.228  -19.887 1.00 70.03  ? 328  ARG B N     1 
ATOM   5389 C  CA    . ARG B 1 334 ? 22.535  80.752  -19.889 1.00 68.28  ? 328  ARG B CA    1 
ATOM   5390 C  C     . ARG B 1 334 ? 22.277  79.388  -19.261 1.00 68.31  ? 328  ARG B C     1 
ATOM   5391 O  O     . ARG B 1 334 ? 21.148  79.121  -18.846 1.00 68.15  ? 328  ARG B O     1 
ATOM   5392 C  CB    . ARG B 1 334 ? 23.405  81.592  -18.957 1.00 67.28  ? 328  ARG B CB    1 
ATOM   5393 C  CG    . ARG B 1 334 ? 23.253  83.092  -19.131 1.00 66.42  ? 328  ARG B CG    1 
ATOM   5394 C  CD    . ARG B 1 334 ? 22.719  83.727  -17.862 1.00 65.98  ? 328  ARG B CD    1 
ATOM   5395 N  NE    . ARG B 1 334 ? 23.650  84.695  -17.278 1.00 66.26  ? 328  ARG B NE    1 
ATOM   5396 C  CZ    . ARG B 1 334 ? 23.520  85.220  -16.058 1.00 66.11  ? 328  ARG B CZ    1 
ATOM   5397 N  NH1   . ARG B 1 334 ? 22.503  84.876  -15.281 1.00 66.17  ? 328  ARG B NH1   1 
ATOM   5398 N  NH2   . ARG B 1 334 ? 24.407  86.092  -15.604 1.00 65.54  ? 328  ARG B NH2   1 
ATOM   5399 N  N     . LYS B 1 335 ? 23.266  78.507  -19.189 1.00 68.69  ? 329  LYS B N     1 
ATOM   5400 C  CA    . LYS B 1 335 ? 22.979  77.219  -18.557 1.00 69.30  ? 329  LYS B CA    1 
ATOM   5401 C  C     . LYS B 1 335 ? 22.934  77.385  -17.042 1.00 68.96  ? 329  LYS B C     1 
ATOM   5402 O  O     . LYS B 1 335 ? 23.592  78.266  -16.477 1.00 69.66  ? 329  LYS B O     1 
ATOM   5403 C  CB    . LYS B 1 335 ? 24.023  76.159  -18.912 1.00 70.22  ? 329  LYS B CB    1 
ATOM   5404 C  CG    . LYS B 1 335 ? 23.821  75.492  -20.264 1.00 71.58  ? 329  LYS B CG    1 
ATOM   5405 C  CD    . LYS B 1 335 ? 24.419  74.080  -20.263 1.00 72.18  ? 329  LYS B CD    1 
ATOM   5406 C  CE    . LYS B 1 335 ? 25.192  73.779  -21.543 1.00 72.32  ? 329  LYS B CE    1 
ATOM   5407 N  NZ    . LYS B 1 335 ? 24.364  73.980  -22.763 1.00 73.12  ? 329  LYS B NZ    1 
ATOM   5408 N  N     . ILE B 1 336 ? 22.146  76.548  -16.384 1.00 66.54  ? 330  ILE B N     1 
ATOM   5409 C  CA    . ILE B 1 336 ? 22.050  76.631  -14.942 1.00 64.70  ? 330  ILE B CA    1 
ATOM   5410 C  C     . ILE B 1 336 ? 23.028  75.643  -14.318 1.00 63.51  ? 330  ILE B C     1 
ATOM   5411 O  O     . ILE B 1 336 ? 23.122  74.508  -14.762 1.00 62.91  ? 330  ILE B O     1 
ATOM   5412 C  CB    . ILE B 1 336 ? 20.632  76.318  -14.481 1.00 64.73  ? 330  ILE B CB    1 
ATOM   5413 C  CG1   . ILE B 1 336 ? 19.656  77.267  -15.168 1.00 64.67  ? 330  ILE B CG1   1 
ATOM   5414 C  CG2   . ILE B 1 336 ? 20.534  76.475  -12.986 1.00 64.79  ? 330  ILE B CG2   1 
ATOM   5415 C  CD1   . ILE B 1 336 ? 18.238  77.127  -14.681 1.00 64.53  ? 330  ILE B CD1   1 
ATOM   5416 N  N     . ARG B 1 337 ? 23.765  76.090  -13.305 1.00 62.15  ? 331  ARG B N     1 
ATOM   5417 C  CA    . ARG B 1 337 ? 24.741  75.255  -12.619 1.00 61.02  ? 331  ARG B CA    1 
ATOM   5418 C  C     . ARG B 1 337 ? 24.164  74.728  -11.308 1.00 60.84  ? 331  ARG B C     1 
ATOM   5419 O  O     . ARG B 1 337 ? 24.315  73.545  -10.978 1.00 60.77  ? 331  ARG B O     1 
ATOM   5420 C  CB    . ARG B 1 337 ? 26.001  76.064  -12.326 1.00 61.63  ? 331  ARG B CB    1 
ATOM   5421 C  CG    . ARG B 1 337 ? 27.115  75.259  -11.680 1.00 63.49  ? 331  ARG B CG    1 
ATOM   5422 C  CD    . ARG B 1 337 ? 28.330  76.119  -11.337 1.00 65.18  ? 331  ARG B CD    1 
ATOM   5423 N  NE    . ARG B 1 337 ? 29.490  75.294  -10.994 1.00 67.69  ? 331  ARG B NE    1 
ATOM   5424 C  CZ    . ARG B 1 337 ? 30.213  74.606  -11.877 1.00 69.81  ? 331  ARG B CZ    1 
ATOM   5425 N  NH1   . ARG B 1 337 ? 29.911  74.636  -13.180 1.00 71.57  ? 331  ARG B NH1   1 
ATOM   5426 N  NH2   . ARG B 1 337 ? 31.240  73.877  -11.457 1.00 70.02  ? 331  ARG B NH2   1 
ATOM   5427 N  N     . ARG B 1 338 ? 23.506  75.614  -10.561 1.00 59.36  ? 332  ARG B N     1 
ATOM   5428 C  CA    . ARG B 1 338 ? 22.906  75.247  -9.281  1.00 57.08  ? 332  ARG B CA    1 
ATOM   5429 C  C     . ARG B 1 338 ? 21.497  75.817  -9.158  1.00 53.94  ? 332  ARG B C     1 
ATOM   5430 O  O     . ARG B 1 338 ? 21.253  76.985  -9.486  1.00 52.79  ? 332  ARG B O     1 
ATOM   5431 C  CB    . ARG B 1 338 ? 23.761  75.766  -8.117  1.00 60.44  ? 332  ARG B CB    1 
ATOM   5432 C  CG    . ARG B 1 338 ? 25.231  75.327  -8.128  1.00 64.19  ? 332  ARG B CG    1 
ATOM   5433 C  CD    . ARG B 1 338 ? 25.833  75.400  -6.719  1.00 67.24  ? 332  ARG B CD    1 
ATOM   5434 N  NE    . ARG B 1 338 ? 25.856  76.762  -6.183  1.00 70.78  ? 332  ARG B NE    1 
ATOM   5435 C  CZ    . ARG B 1 338 ? 25.719  77.075  -4.894  1.00 71.72  ? 332  ARG B CZ    1 
ATOM   5436 N  NH1   . ARG B 1 338 ? 25.540  76.111  -3.983  1.00 70.99  ? 332  ARG B NH1   1 
ATOM   5437 N  NH2   . ARG B 1 338 ? 25.764  78.357  -4.523  1.00 70.85  ? 332  ARG B NH2   1 
ATOM   5438 N  N     . ILE B 1 339 ? 20.574  74.985  -8.683  1.00 50.34  ? 333  ILE B N     1 
ATOM   5439 C  CA    . ILE B 1 339 ? 19.189  75.407  -8.511  1.00 46.23  ? 333  ILE B CA    1 
ATOM   5440 C  C     . ILE B 1 339 ? 18.797  75.280  -7.046  1.00 43.32  ? 333  ILE B C     1 
ATOM   5441 O  O     . ILE B 1 339 ? 18.969  74.223  -6.423  1.00 41.66  ? 333  ILE B O     1 
ATOM   5442 C  CB    . ILE B 1 339 ? 18.210  74.553  -9.377  1.00 46.78  ? 333  ILE B CB    1 
ATOM   5443 C  CG1   . ILE B 1 339 ? 16.858  75.259  -9.492  1.00 44.80  ? 333  ILE B CG1   1 
ATOM   5444 C  CG2   . ILE B 1 339 ? 18.018  73.157  -8.754  1.00 46.82  ? 333  ILE B CG2   1 
ATOM   5445 C  CD1   . ILE B 1 339 ? 16.948  76.628  -10.124 1.00 45.21  ? 333  ILE B CD1   1 
ATOM   5446 N  N     . GLY B 1 340 ? 18.262  76.369  -6.508  1.00 40.01  ? 334  GLY B N     1 
ATOM   5447 C  CA    . GLY B 1 340 ? 17.860  76.374  -5.122  1.00 38.20  ? 334  GLY B CA    1 
ATOM   5448 C  C     . GLY B 1 340 ? 16.476  76.930  -4.881  1.00 36.10  ? 334  GLY B C     1 
ATOM   5449 O  O     . GLY B 1 340 ? 15.831  77.461  -5.788  1.00 35.02  ? 334  GLY B O     1 
ATOM   5450 N  N     . VAL B 1 341 ? 16.031  76.790  -3.637  1.00 34.14  ? 335  VAL B N     1 
ATOM   5451 C  CA    . VAL B 1 341 ? 14.728  77.260  -3.207  1.00 34.19  ? 335  VAL B CA    1 
ATOM   5452 C  C     . VAL B 1 341 ? 14.874  77.874  -1.813  1.00 34.09  ? 335  VAL B C     1 
ATOM   5453 O  O     . VAL B 1 341 ? 15.745  77.479  -1.027  1.00 33.92  ? 335  VAL B O     1 
ATOM   5454 C  CB    . VAL B 1 341 ? 13.682  76.112  -3.137  1.00 33.30  ? 335  VAL B CB    1 
ATOM   5455 C  CG1   . VAL B 1 341 ? 13.872  75.176  -4.276  1.00 32.70  ? 335  VAL B CG1   1 
ATOM   5456 C  CG2   . VAL B 1 341 ? 13.785  75.373  -1.814  1.00 33.67  ? 335  VAL B CG2   1 
ATOM   5457 N  N     . ARG B 1 342 ? 13.997  78.824  -1.512  1.00 32.37  ? 336  ARG B N     1 
ATOM   5458 C  CA    . ARG B 1 342 ? 14.035  79.504  -0.247  1.00 32.53  ? 336  ARG B CA    1 
ATOM   5459 C  C     . ARG B 1 342 ? 12.623  79.815  0.196   1.00 33.08  ? 336  ARG B C     1 
ATOM   5460 O  O     . ARG B 1 342 ? 11.779  80.152  -0.613  1.00 33.96  ? 336  ARG B O     1 
ATOM   5461 C  CB    . ARG B 1 342 ? 14.848  80.784  -0.410  1.00 34.08  ? 336  ARG B CB    1 
ATOM   5462 C  CG    . ARG B 1 342 ? 15.322  81.412  0.898   1.00 36.47  ? 336  ARG B CG    1 
ATOM   5463 C  CD    . ARG B 1 342 ? 16.798  81.764  0.815   1.00 36.37  ? 336  ARG B CD    1 
ATOM   5464 N  NE    . ARG B 1 342 ? 17.704  80.684  1.223   1.00 35.79  ? 336  ARG B NE    1 
ATOM   5465 C  CZ    . ARG B 1 342 ? 17.946  80.334  2.485   1.00 34.56  ? 336  ARG B CZ    1 
ATOM   5466 N  NH1   . ARG B 1 342 ? 17.362  80.950  3.504   1.00 31.25  ? 336  ARG B NH1   1 
ATOM   5467 N  NH2   . ARG B 1 342 ? 18.809  79.375  2.728   1.00 36.96  ? 336  ARG B NH2   1 
ATOM   5468 N  N     . PHE B 1 343 ? 12.364  79.705  1.489   1.00 33.74  ? 337  PHE B N     1 
ATOM   5469 C  CA    . PHE B 1 343 ? 11.030  79.964  2.001   1.00 35.19  ? 337  PHE B CA    1 
ATOM   5470 C  C     . PHE B 1 343 ? 11.032  80.993  3.117   1.00 33.67  ? 337  PHE B C     1 
ATOM   5471 O  O     . PHE B 1 343 ? 11.534  80.743  4.205   1.00 34.91  ? 337  PHE B O     1 
ATOM   5472 C  CB    . PHE B 1 343 ? 10.427  78.643  2.469   1.00 38.42  ? 337  PHE B CB    1 
ATOM   5473 C  CG    . PHE B 1 343 ? 10.189  77.667  1.349   1.00 39.30  ? 337  PHE B CG    1 
ATOM   5474 C  CD1   . PHE B 1 343 ? 8.989   77.674  0.646   1.00 39.80  ? 337  PHE B CD1   1 
ATOM   5475 C  CD2   . PHE B 1 343 ? 11.183  76.779  0.965   1.00 40.00  ? 337  PHE B CD2   1 
ATOM   5476 C  CE1   . PHE B 1 343 ? 8.788   76.819  -0.416  1.00 40.84  ? 337  PHE B CE1   1 
ATOM   5477 C  CE2   . PHE B 1 343 ? 10.990  75.917  -0.103  1.00 41.66  ? 337  PHE B CE2   1 
ATOM   5478 C  CZ    . PHE B 1 343 ? 9.791   75.938  -0.795  1.00 41.95  ? 337  PHE B CZ    1 
ATOM   5479 N  N     . SER B 1 344 ? 10.440  82.143  2.836   1.00 30.42  ? 338  SER B N     1 
ATOM   5480 C  CA    . SER B 1 344 ? 10.406  83.235  3.778   1.00 29.50  ? 338  SER B CA    1 
ATOM   5481 C  C     . SER B 1 344 ? 9.038   83.504  4.356   1.00 29.94  ? 338  SER B C     1 
ATOM   5482 O  O     . SER B 1 344 ? 8.132   82.701  4.238   1.00 30.34  ? 338  SER B O     1 
ATOM   5483 C  CB    . SER B 1 344 ? 10.902  84.487  3.086   1.00 28.74  ? 338  SER B CB    1 
ATOM   5484 O  OG    . SER B 1 344 ? 11.809  84.136  2.056   1.00 30.73  ? 338  SER B OG    1 
ATOM   5485 N  N     . LYS B 1 345 ? 8.919   84.648  5.009   1.00 29.33  ? 339  LYS B N     1 
ATOM   5486 C  CA    . LYS B 1 345 ? 7.689   85.087  5.622   1.00 30.30  ? 339  LYS B CA    1 
ATOM   5487 C  C     . LYS B 1 345 ? 6.872   84.011  6.347   1.00 32.01  ? 339  LYS B C     1 
ATOM   5488 O  O     . LYS B 1 345 ? 5.703   83.823  6.060   1.00 33.57  ? 339  LYS B O     1 
ATOM   5489 C  CB    . LYS B 1 345 ? 6.847   85.778  4.554   1.00 29.09  ? 339  LYS B CB    1 
ATOM   5490 C  CG    . LYS B 1 345 ? 7.696   86.586  3.585   1.00 28.20  ? 339  LYS B CG    1 
ATOM   5491 C  CD    A LYS B 1 345 ? 6.937   87.770  2.985   0.50 25.13  ? 339  LYS B CD    1 
ATOM   5492 C  CE    A LYS B 1 345 ? 7.840   88.547  2.032   0.50 23.13  ? 339  LYS B CE    1 
ATOM   5493 N  NZ    A LYS B 1 345 ? 7.318   89.894  1.684   0.50 20.93  ? 339  LYS B NZ    1 
ATOM   5494 N  N     . PHE B 1 346 ? 7.463   83.329  7.316   1.00 33.73  ? 340  PHE B N     1 
ATOM   5495 C  CA    . PHE B 1 346 ? 6.726   82.296  8.029   1.00 36.60  ? 340  PHE B CA    1 
ATOM   5496 C  C     . PHE B 1 346 ? 5.503   82.857  8.752   1.00 37.48  ? 340  PHE B C     1 
ATOM   5497 O  O     . PHE B 1 346 ? 5.438   84.025  9.062   1.00 35.91  ? 340  PHE B O     1 
ATOM   5498 C  CB    . PHE B 1 346 ? 7.636   81.594  9.036   1.00 38.84  ? 340  PHE B CB    1 
ATOM   5499 C  CG    . PHE B 1 346 ? 8.851   80.965  8.422   1.00 42.16  ? 340  PHE B CG    1 
ATOM   5500 C  CD1   . PHE B 1 346 ? 8.721   79.985  7.453   1.00 44.55  ? 340  PHE B CD1   1 
ATOM   5501 C  CD2   . PHE B 1 346 ? 10.133  81.363  8.805   1.00 43.59  ? 340  PHE B CD2   1 
ATOM   5502 C  CE1   . PHE B 1 346 ? 9.857   79.410  6.867   1.00 46.90  ? 340  PHE B CE1   1 
ATOM   5503 C  CE2   . PHE B 1 346 ? 11.269  80.797  8.228   1.00 44.43  ? 340  PHE B CE2   1 
ATOM   5504 C  CZ    . PHE B 1 346 ? 11.137  79.825  7.263   1.00 44.88  ? 340  PHE B CZ    1 
ATOM   5505 N  N     . ILE B 1 347 ? 4.533   81.999  9.029   1.00 41.79  ? 341  ILE B N     1 
ATOM   5506 C  CA    . ILE B 1 347 ? 3.299   82.396  9.700   1.00 45.11  ? 341  ILE B CA    1 
ATOM   5507 C  C     . ILE B 1 347 ? 3.451   82.401  11.207  1.00 47.70  ? 341  ILE B C     1 
ATOM   5508 O  O     . ILE B 1 347 ? 3.693   81.365  11.813  1.00 49.13  ? 341  ILE B O     1 
ATOM   5509 C  CB    . ILE B 1 347 ? 2.112   81.441  9.294   1.00 45.82  ? 341  ILE B CB    1 
ATOM   5510 C  CG1   . ILE B 1 347 ? 1.592   81.833  7.902   1.00 45.60  ? 341  ILE B CG1   1 
ATOM   5511 C  CG2   . ILE B 1 347 ? 0.994   81.457  10.345  1.00 43.61  ? 341  ILE B CG2   1 
ATOM   5512 C  CD1   . ILE B 1 347 ? 0.328   81.138  7.499   1.00 46.81  ? 341  ILE B CD1   1 
ATOM   5513 N  N     . GLU B 1 348 ? 3.292   83.576  11.807  1.00 51.66  ? 342  GLU B N     1 
ATOM   5514 C  CA    . GLU B 1 348 ? 3.396   83.738  13.259  1.00 55.32  ? 342  GLU B CA    1 
ATOM   5515 C  C     . GLU B 1 348 ? 2.004   83.629  13.893  1.00 56.24  ? 342  GLU B C     1 
ATOM   5516 O  O     . GLU B 1 348 ? 1.690   82.580  14.512  1.00 57.92  ? 342  GLU B O     1 
ATOM   5517 C  CB    . GLU B 1 348 ? 3.986   85.113  13.584  1.00 57.10  ? 342  GLU B CB    1 
ATOM   5518 C  CG    . GLU B 1 348 ? 4.225   85.383  15.062  1.00 60.69  ? 342  GLU B CG    1 
ATOM   5519 C  CD    . GLU B 1 348 ? 3.096   84.885  15.959  1.00 62.97  ? 342  GLU B CD    1 
ATOM   5520 O  OE1   . GLU B 1 348 ? 3.085   83.668  16.267  1.00 64.80  ? 342  GLU B OE1   1 
ATOM   5521 O  OE2   . GLU B 1 348 ? 2.220   85.701  16.341  1.00 63.35  ? 342  GLU B OE2   1 
ATOM   5522 N  N     . ALA B 1 349 ? 1.249   84.619  13.768  1.00 55.90  ? 343  ALA B N     1 
ATOM   5523 O  "O5'" . DG  C 2 1   ? -3.734  18.124  31.330  1.00 68.54  ? 1    DG  C "O5'" 1 
ATOM   5524 C  "C5'" . DG  C 2 1   ? -2.832  17.276  30.604  1.00 73.11  ? 1    DG  C "C5'" 1 
ATOM   5525 C  "C4'" . DG  C 2 1   ? -2.000  18.039  29.598  1.00 74.95  ? 1    DG  C "C4'" 1 
ATOM   5526 O  "O4'" . DG  C 2 1   ? -1.122  18.947  30.301  1.00 75.79  ? 1    DG  C "O4'" 1 
ATOM   5527 C  "C3'" . DG  C 2 1   ? -1.095  17.184  28.707  1.00 76.52  ? 1    DG  C "C3'" 1 
ATOM   5528 O  "O3'" . DG  C 2 1   ? -1.011  17.771  27.399  1.00 78.43  ? 1    DG  C "O3'" 1 
ATOM   5529 C  "C2'" . DG  C 2 1   ? 0.261   17.288  29.387  1.00 75.34  ? 1    DG  C "C2'" 1 
ATOM   5530 C  "C1'" . DG  C 2 1   ? 0.234   18.697  29.952  1.00 74.35  ? 1    DG  C "C1'" 1 
ATOM   5531 N  N9    . DG  C 2 1   ? 1.055   18.911  31.144  1.00 73.37  ? 1    DG  C N9    1 
ATOM   5532 C  C8    . DG  C 2 1   ? 2.347   18.486  31.341  1.00 72.01  ? 1    DG  C C8    1 
ATOM   5533 N  N7    . DG  C 2 1   ? 2.829   18.841  32.499  1.00 72.46  ? 1    DG  C N7    1 
ATOM   5534 C  C5    . DG  C 2 1   ? 1.793   19.539  33.110  1.00 72.17  ? 1    DG  C C5    1 
ATOM   5535 C  C6    . DG  C 2 1   ? 1.732   20.155  34.377  1.00 72.18  ? 1    DG  C C6    1 
ATOM   5536 O  O6    . DG  C 2 1   ? 2.605   20.208  35.233  1.00 71.84  ? 1    DG  C O6    1 
ATOM   5537 N  N1    . DG  C 2 1   ? 0.494   20.750  34.604  1.00 71.88  ? 1    DG  C N1    1 
ATOM   5538 C  C2    . DG  C 2 1   ? -0.554  20.754  33.718  1.00 71.18  ? 1    DG  C C2    1 
ATOM   5539 N  N2    . DG  C 2 1   ? -1.674  21.379  34.115  1.00 71.48  ? 1    DG  C N2    1 
ATOM   5540 N  N3    . DG  C 2 1   ? -0.507  20.185  32.528  1.00 71.08  ? 1    DG  C N3    1 
ATOM   5541 C  C4    . DG  C 2 1   ? 0.690   19.595  32.292  1.00 72.33  ? 1    DG  C C4    1 
ATOM   5542 P  P     . DG  C 2 2   ? -2.243  17.633  26.367  1.00 79.21  ? 2    DG  C P     1 
ATOM   5543 O  OP1   . DG  C 2 2   ? -2.817  16.265  26.459  1.00 79.67  ? 2    DG  C OP1   1 
ATOM   5544 O  OP2   . DG  C 2 2   ? -1.737  18.119  25.065  1.00 78.61  ? 2    DG  C OP2   1 
ATOM   5545 O  "O5'" . DG  C 2 2   ? -3.295  18.676  26.941  1.00 76.55  ? 2    DG  C "O5'" 1 
ATOM   5546 C  "C5'" . DG  C 2 2   ? -3.565  19.867  26.203  1.00 74.26  ? 2    DG  C "C5'" 1 
ATOM   5547 C  "C4'" . DG  C 2 2   ? -3.340  21.091  27.053  1.00 72.05  ? 2    DG  C "C4'" 1 
ATOM   5548 O  "O4'" . DG  C 2 2   ? -2.216  20.955  27.968  1.00 70.50  ? 2    DG  C "O4'" 1 
ATOM   5549 C  "C3'" . DG  C 2 2   ? -3.025  22.290  26.162  1.00 72.22  ? 2    DG  C "C3'" 1 
ATOM   5550 O  "O3'" . DG  C 2 2   ? -3.830  23.401  26.527  1.00 72.24  ? 2    DG  C "O3'" 1 
ATOM   5551 C  "C2'" . DG  C 2 2   ? -1.555  22.568  26.424  1.00 71.18  ? 2    DG  C "C2'" 1 
ATOM   5552 C  "C1'" . DG  C 2 2   ? -1.395  22.115  27.865  1.00 68.96  ? 2    DG  C "C1'" 1 
ATOM   5553 N  N9    . DG  C 2 2   ? -0.016  21.772  28.223  1.00 66.11  ? 2    DG  C N9    1 
ATOM   5554 C  C8    . DG  C 2 2   ? 0.908   21.102  27.444  1.00 64.98  ? 2    DG  C C8    1 
ATOM   5555 N  N7    . DG  C 2 2   ? 2.079   20.990  28.012  1.00 63.20  ? 2    DG  C N7    1 
ATOM   5556 C  C5    . DG  C 2 2   ? 1.924   21.611  29.246  1.00 62.90  ? 2    DG  C C5    1 
ATOM   5557 C  C6    . DG  C 2 2   ? 2.862   21.805  30.313  1.00 62.17  ? 2    DG  C C6    1 
ATOM   5558 O  O6    . DG  C 2 2   ? 4.058   21.448  30.380  1.00 62.04  ? 2    DG  C O6    1 
ATOM   5559 N  N1    . DG  C 2 2   ? 2.282   22.489  31.376  1.00 59.32  ? 2    DG  C N1    1 
ATOM   5560 C  C2    . DG  C 2 2   ? 0.983   22.924  31.418  1.00 59.10  ? 2    DG  C C2    1 
ATOM   5561 N  N2    . DG  C 2 2   ? 0.634   23.581  32.525  1.00 59.57  ? 2    DG  C N2    1 
ATOM   5562 N  N3    . DG  C 2 2   ? 0.098   22.738  30.449  1.00 59.69  ? 2    DG  C N3    1 
ATOM   5563 C  C4    . DG  C 2 2   ? 0.632   22.088  29.398  1.00 62.64  ? 2    DG  C C4    1 
ATOM   5564 P  P     . DG  C 2 3   ? -3.705  24.761  25.696  1.00 72.11  ? 3    DG  C P     1 
ATOM   5565 O  OP1   . DG  C 2 3   ? -5.107  25.136  25.404  1.00 72.20  ? 3    DG  C OP1   1 
ATOM   5566 O  OP2   . DG  C 2 3   ? -2.735  24.576  24.593  1.00 70.31  ? 3    DG  C OP2   1 
ATOM   5567 O  "O5'" . DG  C 2 3   ? -3.094  25.762  26.762  1.00 70.29  ? 3    DG  C "O5'" 1 
ATOM   5568 C  "C5'" . DG  C 2 3   ? -3.635  25.834  28.083  1.00 69.88  ? 3    DG  C "C5'" 1 
ATOM   5569 C  "C4'" . DG  C 2 3   ? -2.760  26.712  28.944  1.00 70.97  ? 3    DG  C "C4'" 1 
ATOM   5570 O  "O4'" . DG  C 2 3   ? -1.530  26.014  29.267  1.00 71.02  ? 3    DG  C "O4'" 1 
ATOM   5571 C  "C3'" . DG  C 2 3   ? -2.342  28.022  28.268  1.00 72.74  ? 3    DG  C "C3'" 1 
ATOM   5572 O  "O3'" . DG  C 2 3   ? -2.478  29.120  29.186  1.00 73.46  ? 3    DG  C "O3'" 1 
ATOM   5573 C  "C2'" . DG  C 2 3   ? -0.887  27.782  27.891  1.00 71.68  ? 3    DG  C "C2'" 1 
ATOM   5574 C  "C1'" . DG  C 2 3   ? -0.423  26.863  29.008  1.00 70.09  ? 3    DG  C "C1'" 1 
ATOM   5575 N  N9    . DG  C 2 3   ? 0.740   26.032  28.690  1.00 67.85  ? 3    DG  C N9    1 
ATOM   5576 C  C8    . DG  C 2 3   ? 0.923   25.250  27.571  1.00 67.28  ? 3    DG  C C8    1 
ATOM   5577 N  N7    . DG  C 2 3   ? 2.076   24.638  27.554  1.00 65.39  ? 3    DG  C N7    1 
ATOM   5578 C  C5    . DG  C 2 3   ? 2.695   25.033  28.732  1.00 64.27  ? 3    DG  C C5    1 
ATOM   5579 C  C6    . DG  C 2 3   ? 3.968   24.692  29.254  1.00 63.24  ? 3    DG  C C6    1 
ATOM   5580 O  O6    . DG  C 2 3   ? 4.833   23.947  28.759  1.00 62.86  ? 3    DG  C O6    1 
ATOM   5581 N  N1    . DG  C 2 3   ? 4.197   25.311  30.481  1.00 61.87  ? 3    DG  C N1    1 
ATOM   5582 C  C2    . DG  C 2 3   ? 3.314   26.144  31.121  1.00 62.51  ? 3    DG  C C2    1 
ATOM   5583 N  N2    . DG  C 2 3   ? 3.711   26.619  32.299  1.00 61.89  ? 3    DG  C N2    1 
ATOM   5584 N  N3    . DG  C 2 3   ? 2.128   26.477  30.643  1.00 63.63  ? 3    DG  C N3    1 
ATOM   5585 C  C4    . DG  C 2 3   ? 1.883   25.889  29.452  1.00 65.52  ? 3    DG  C C4    1 
ATOM   5586 P  P     . DG  C 2 4   ? -2.338  30.636  28.654  1.00 73.00  ? 4    DG  C P     1 
ATOM   5587 O  OP1   . DG  C 2 4   ? -3.557  31.340  29.127  1.00 72.50  ? 4    DG  C OP1   1 
ATOM   5588 O  OP2   . DG  C 2 4   ? -1.994  30.647  27.214  1.00 70.96  ? 4    DG  C OP2   1 
ATOM   5589 O  "O5'" . DG  C 2 4   ? -1.090  31.166  29.474  1.00 72.69  ? 4    DG  C "O5'" 1 
ATOM   5590 C  "C5'" . DG  C 2 4   ? -1.117  31.209  30.903  1.00 71.83  ? 4    DG  C "C5'" 1 
ATOM   5591 C  "C4'" . DG  C 2 4   ? 0.123   31.903  31.410  1.00 70.90  ? 4    DG  C "C4'" 1 
ATOM   5592 O  "O4'" . DG  C 2 4   ? 1.268   31.026  31.278  1.00 71.08  ? 4    DG  C "O4'" 1 
ATOM   5593 C  "C3'" . DG  C 2 4   ? 0.462   33.161  30.616  1.00 70.02  ? 4    DG  C "C3'" 1 
ATOM   5594 O  "O3'" . DG  C 2 4   ? 0.927   34.176  31.502  1.00 67.97  ? 4    DG  C "O3'" 1 
ATOM   5595 C  "C2'" . DG  C 2 4   ? 1.534   32.701  29.641  1.00 70.09  ? 4    DG  C "C2'" 1 
ATOM   5596 C  "C1'" . DG  C 2 4   ? 2.228   31.567  30.380  1.00 70.63  ? 4    DG  C "C1'" 1 
ATOM   5597 N  N9    . DG  C 2 4   ? 2.682   30.481  29.514  1.00 71.09  ? 4    DG  C N9    1 
ATOM   5598 C  C8    . DG  C 2 4   ? 2.013   29.951  28.437  1.00 71.27  ? 4    DG  C C8    1 
ATOM   5599 N  N7    . DG  C 2 4   ? 2.671   28.993  27.846  1.00 71.55  ? 4    DG  C N7    1 
ATOM   5600 C  C5    . DG  C 2 4   ? 3.846   28.878  28.576  1.00 71.31  ? 4    DG  C C5    1 
ATOM   5601 C  C6    . DG  C 2 4   ? 4.957   28.011  28.398  1.00 71.55  ? 4    DG  C C6    1 
ATOM   5602 O  O6    . DG  C 2 4   ? 5.139   27.159  27.520  1.00 70.65  ? 4    DG  C O6    1 
ATOM   5603 N  N1    . DG  C 2 4   ? 5.929   28.220  29.371  1.00 72.14  ? 4    DG  C N1    1 
ATOM   5604 C  C2    . DG  C 2 4   ? 5.853   29.153  30.372  1.00 72.32  ? 4    DG  C C2    1 
ATOM   5605 N  N2    . DG  C 2 4   ? 6.894   29.200  31.210  1.00 72.38  ? 4    DG  C N2    1 
ATOM   5606 N  N3    . DG  C 2 4   ? 4.832   29.979  30.539  1.00 72.77  ? 4    DG  C N3    1 
ATOM   5607 C  C4    . DG  C 2 4   ? 3.868   29.784  29.613  1.00 71.87  ? 4    DG  C C4    1 
ATOM   5608 P  P     . DG  C 2 5   ? 1.435   35.574  30.907  1.00 66.33  ? 5    DG  C P     1 
ATOM   5609 O  OP1   . DG  C 2 5   ? 1.049   36.595  31.915  1.00 66.10  ? 5    DG  C OP1   1 
ATOM   5610 O  OP2   . DG  C 2 5   ? 0.951   35.704  29.514  1.00 66.64  ? 5    DG  C OP2   1 
ATOM   5611 O  "O5'" . DG  C 2 5   ? 3.013   35.371  30.894  1.00 63.73  ? 5    DG  C "O5'" 1 
ATOM   5612 C  "C5'" . DG  C 2 5   ? 3.687   34.925  32.072  1.00 60.09  ? 5    DG  C "C5'" 1 
ATOM   5613 C  "C4'" . DG  C 2 5   ? 5.167   34.796  31.813  1.00 59.09  ? 5    DG  C "C4'" 1 
ATOM   5614 O  "O4'" . DG  C 2 5   ? 5.444   33.553  31.124  1.00 58.48  ? 5    DG  C "O4'" 1 
ATOM   5615 C  "C3'" . DG  C 2 5   ? 5.773   35.916  30.961  1.00 58.95  ? 5    DG  C "C3'" 1 
ATOM   5616 O  "O3'" . DG  C 2 5   ? 6.971   36.386  31.580  1.00 58.62  ? 5    DG  C "O3'" 1 
ATOM   5617 C  "C2'" . DG  C 2 5   ? 6.082   35.231  29.641  1.00 57.90  ? 5    DG  C "C2'" 1 
ATOM   5618 C  "C1'" . DG  C 2 5   ? 6.361   33.805  30.083  1.00 57.68  ? 5    DG  C "C1'" 1 
ATOM   5619 N  N9    . DG  C 2 5   ? 6.162   32.804  29.044  1.00 55.04  ? 5    DG  C N9    1 
ATOM   5620 C  C8    . DG  C 2 5   ? 5.051   32.628  28.259  1.00 53.37  ? 5    DG  C C8    1 
ATOM   5621 N  N7    . DG  C 2 5   ? 5.201   31.693  27.366  1.00 52.23  ? 5    DG  C N7    1 
ATOM   5622 C  C5    . DG  C 2 5   ? 6.480   31.212  27.586  1.00 53.01  ? 5    DG  C C5    1 
ATOM   5623 C  C6    . DG  C 2 5   ? 7.204   30.208  26.914  1.00 53.52  ? 5    DG  C C6    1 
ATOM   5624 O  O6    . DG  C 2 5   ? 6.856   29.522  25.957  1.00 55.35  ? 5    DG  C O6    1 
ATOM   5625 N  N1    . DG  C 2 5   ? 8.468   30.040  27.453  1.00 54.74  ? 5    DG  C N1    1 
ATOM   5626 C  C2    . DG  C 2 5   ? 8.976   30.745  28.505  1.00 54.59  ? 5    DG  C C2    1 
ATOM   5627 N  N2    . DG  C 2 5   ? 10.212  30.417  28.870  1.00 53.10  ? 5    DG  C N2    1 
ATOM   5628 N  N3    . DG  C 2 5   ? 8.313   31.694  29.145  1.00 55.35  ? 5    DG  C N3    1 
ATOM   5629 C  C4    . DG  C 2 5   ? 7.078   31.874  28.631  1.00 54.25  ? 5    DG  C C4    1 
ATOM   5630 P  P     . DA  C 2 6   ? 7.669   37.740  31.066  1.00 59.84  ? 6    DA  C P     1 
ATOM   5631 O  OP1   . DA  C 2 6   ? 8.135   38.387  32.316  1.00 59.06  ? 6    DA  C OP1   1 
ATOM   5632 O  OP2   . DA  C 2 6   ? 6.794   38.494  30.140  1.00 56.61  ? 6    DA  C OP2   1 
ATOM   5633 O  "O5'" . DA  C 2 6   ? 8.927   37.181  30.269  1.00 58.97  ? 6    DA  C "O5'" 1 
ATOM   5634 C  "C5'" . DA  C 2 6   ? 9.976   36.519  30.979  1.00 60.98  ? 6    DA  C "C5'" 1 
ATOM   5635 C  "C4'" . DA  C 2 6   ? 11.052  36.056  30.030  1.00 61.45  ? 6    DA  C "C4'" 1 
ATOM   5636 O  "O4'" . DA  C 2 6   ? 10.570  34.932  29.260  1.00 62.31  ? 6    DA  C "O4'" 1 
ATOM   5637 C  "C3'" . DA  C 2 6   ? 11.494  37.107  29.015  1.00 62.17  ? 6    DA  C "C3'" 1 
ATOM   5638 O  "O3'" . DA  C 2 6   ? 12.904  37.017  28.826  1.00 62.88  ? 6    DA  C "O3'" 1 
ATOM   5639 C  "C2'" . DA  C 2 6   ? 10.787  36.680  27.745  1.00 62.06  ? 6    DA  C "C2'" 1 
ATOM   5640 C  "C1'" . DA  C 2 6   ? 10.831  35.175  27.890  1.00 62.99  ? 6    DA  C "C1'" 1 
ATOM   5641 N  N9    . DA  C 2 6   ? 9.852   34.435  27.092  1.00 63.41  ? 6    DA  C N9    1 
ATOM   5642 C  C8    . DA  C 2 6   ? 8.503   34.652  26.988  1.00 63.15  ? 6    DA  C C8    1 
ATOM   5643 N  N7    . DA  C 2 6   ? 7.896   33.818  26.181  1.00 64.03  ? 6    DA  C N7    1 
ATOM   5644 C  C5    . DA  C 2 6   ? 8.912   32.992  25.726  1.00 63.12  ? 6    DA  C C5    1 
ATOM   5645 C  C6    . DA  C 2 6   ? 8.916   31.896  24.844  1.00 64.13  ? 6    DA  C C6    1 
ATOM   5646 N  N6    . DA  C 2 6   ? 7.826   31.426  24.233  1.00 63.38  ? 6    DA  C N6    1 
ATOM   5647 N  N1    . DA  C 2 6   ? 10.096  31.289  24.609  1.00 64.30  ? 6    DA  C N1    1 
ATOM   5648 C  C2    . DA  C 2 6   ? 11.188  31.759  25.218  1.00 64.06  ? 6    DA  C C2    1 
ATOM   5649 N  N3    . DA  C 2 6   ? 11.310  32.778  26.061  1.00 63.09  ? 6    DA  C N3    1 
ATOM   5650 C  C4    . DA  C 2 6   ? 10.121  33.360  26.277  1.00 62.64  ? 6    DA  C C4    1 
ATOM   5651 P  P     . DA  C 2 7   ? 13.682  38.209  28.083  1.00 63.98  ? 7    DA  C P     1 
ATOM   5652 O  OP1   . DA  C 2 7   ? 14.761  38.623  29.012  1.00 64.19  ? 7    DA  C OP1   1 
ATOM   5653 O  OP2   . DA  C 2 7   ? 12.690  39.206  27.622  1.00 61.69  ? 7    DA  C OP2   1 
ATOM   5654 O  "O5'" . DA  C 2 7   ? 14.331  37.490  26.819  1.00 62.85  ? 7    DA  C "O5'" 1 
ATOM   5655 C  "C5'" . DA  C 2 7   ? 15.389  36.542  26.980  1.00 62.43  ? 7    DA  C "C5'" 1 
ATOM   5656 C  "C4'" . DA  C 2 7   ? 15.859  36.053  25.632  1.00 62.27  ? 7    DA  C "C4'" 1 
ATOM   5657 O  "O4'" . DA  C 2 7   ? 14.813  35.248  25.032  1.00 63.27  ? 7    DA  C "O4'" 1 
ATOM   5658 C  "C3'" . DA  C 2 7   ? 16.170  37.167  24.630  1.00 63.69  ? 7    DA  C "C3'" 1 
ATOM   5659 O  "O3'" . DA  C 2 7   ? 17.348  36.815  23.888  1.00 65.75  ? 7    DA  C "O3'" 1 
ATOM   5660 C  "C2'" . DA  C 2 7   ? 14.926  37.215  23.758  1.00 63.08  ? 7    DA  C "C2'" 1 
ATOM   5661 C  "C1'" . DA  C 2 7   ? 14.487  35.759  23.746  1.00 62.87  ? 7    DA  C "C1'" 1 
ATOM   5662 N  N9    . DA  C 2 7   ? 13.057  35.532  23.501  1.00 61.00  ? 7    DA  C N9    1 
ATOM   5663 C  C8    . DA  C 2 7   ? 12.019  36.398  23.741  1.00 60.28  ? 7    DA  C C8    1 
ATOM   5664 N  N7    . DA  C 2 7   ? 10.847  35.933  23.400  1.00 58.95  ? 7    DA  C N7    1 
ATOM   5665 C  C5    . DA  C 2 7   ? 11.124  34.670  22.906  1.00 58.45  ? 7    DA  C C5    1 
ATOM   5666 C  C6    . DA  C 2 7   ? 10.303  33.677  22.371  1.00 58.14  ? 7    DA  C C6    1 
ATOM   5667 N  N6    . DA  C 2 7   ? 8.977   33.810  22.238  1.00 58.84  ? 7    DA  C N6    1 
ATOM   5668 N  N1    . DA  C 2 7   ? 10.890  32.530  21.965  1.00 56.34  ? 7    DA  C N1    1 
ATOM   5669 C  C2    . DA  C 2 7   ? 12.217  32.411  22.085  1.00 55.69  ? 7    DA  C C2    1 
ATOM   5670 N  N3    . DA  C 2 7   ? 13.097  33.280  22.564  1.00 57.20  ? 7    DA  C N3    1 
ATOM   5671 C  C4    . DA  C 2 7   ? 12.480  34.404  22.964  1.00 58.94  ? 7    DA  C C4    1 
ATOM   5672 P  P     . DG  C 2 8   ? 17.626  37.476  22.442  1.00 67.40  ? 8    DG  C P     1 
ATOM   5673 O  OP1   . DG  C 2 8   ? 19.095  37.397  22.239  1.00 69.00  ? 8    DG  C OP1   1 
ATOM   5674 O  OP2   . DG  C 2 8   ? 16.955  38.793  22.360  1.00 65.46  ? 8    DG  C OP2   1 
ATOM   5675 O  "O5'" . DG  C 2 8   ? 16.917  36.445  21.452  1.00 68.21  ? 8    DG  C "O5'" 1 
ATOM   5676 C  "C5'" . DG  C 2 8   ? 17.248  35.053  21.493  1.00 67.92  ? 8    DG  C "C5'" 1 
ATOM   5677 C  "C4'" . DG  C 2 8   ? 16.869  34.372  20.195  1.00 67.71  ? 8    DG  C "C4'" 1 
ATOM   5678 O  "O4'" . DG  C 2 8   ? 15.446  34.088  20.149  1.00 65.76  ? 8    DG  C "O4'" 1 
ATOM   5679 C  "C3'" . DG  C 2 8   ? 17.195  35.173  18.932  1.00 67.89  ? 8    DG  C "C3'" 1 
ATOM   5680 O  "O3'" . DG  C 2 8   ? 17.809  34.327  17.955  1.00 69.18  ? 8    DG  C "O3'" 1 
ATOM   5681 C  "C2'" . DG  C 2 8   ? 15.842  35.684  18.467  1.00 66.46  ? 8    DG  C "C2'" 1 
ATOM   5682 C  "C1'" . DG  C 2 8   ? 14.886  34.601  18.947  1.00 64.25  ? 8    DG  C "C1'" 1 
ATOM   5683 N  N9    . DG  C 2 8   ? 13.535  35.079  19.242  1.00 62.02  ? 8    DG  C N9    1 
ATOM   5684 C  C8    . DG  C 2 8   ? 13.178  36.166  20.011  1.00 60.81  ? 8    DG  C C8    1 
ATOM   5685 N  N7    . DG  C 2 8   ? 11.885  36.339  20.084  1.00 60.46  ? 8    DG  C N7    1 
ATOM   5686 C  C5    . DG  C 2 8   ? 11.353  35.303  19.320  1.00 59.87  ? 8    DG  C C5    1 
ATOM   5687 C  C6    . DG  C 2 8   ? 10.000  34.962  19.032  1.00 58.49  ? 8    DG  C C6    1 
ATOM   5688 O  O6    . DG  C 2 8   ? 8.967   35.516  19.408  1.00 58.71  ? 8    DG  C O6    1 
ATOM   5689 N  N1    . DG  C 2 8   ? 9.917   33.843  18.216  1.00 57.68  ? 8    DG  C N1    1 
ATOM   5690 C  C2    . DG  C 2 8   ? 10.985  33.136  17.735  1.00 58.61  ? 8    DG  C C2    1 
ATOM   5691 N  N2    . DG  C 2 8   ? 10.698  32.088  16.948  1.00 59.12  ? 8    DG  C N2    1 
ATOM   5692 N  N3    . DG  C 2 8   ? 12.245  33.432  17.999  1.00 59.63  ? 8    DG  C N3    1 
ATOM   5693 C  C4    . DG  C 2 8   ? 12.356  34.520  18.792  1.00 60.48  ? 8    DG  C C4    1 
ATOM   5694 P  P     . DG  C 2 9   ? 18.187  34.922  16.511  1.00 70.94  ? 9    DG  C P     1 
ATOM   5695 O  OP1   . DG  C 2 9   ? 19.329  34.106  16.010  1.00 69.49  ? 9    DG  C OP1   1 
ATOM   5696 O  OP2   . DG  C 2 9   ? 18.322  36.393  16.606  1.00 69.61  ? 9    DG  C OP2   1 
ATOM   5697 O  "O5'" . DG  C 2 9   ? 16.878  34.580  15.674  1.00 72.42  ? 9    DG  C "O5'" 1 
ATOM   5698 C  "C5'" . DG  C 2 9   ? 16.428  33.227  15.559  1.00 75.14  ? 9    DG  C "C5'" 1 
ATOM   5699 C  "C4'" . DG  C 2 9   ? 15.491  33.071  14.382  1.00 76.13  ? 9    DG  C "C4'" 1 
ATOM   5700 O  "O4'" . DG  C 2 9   ? 14.123  33.344  14.763  1.00 76.49  ? 9    DG  C "O4'" 1 
ATOM   5701 C  "C3'" . DG  C 2 9   ? 15.793  33.952  13.173  1.00 76.57  ? 9    DG  C "C3'" 1 
ATOM   5702 O  "O3'" . DG  C 2 9   ? 15.684  33.150  11.990  1.00 78.20  ? 9    DG  C "O3'" 1 
ATOM   5703 C  "C2'" . DG  C 2 9   ? 14.743  35.049  13.270  1.00 76.08  ? 9    DG  C "C2'" 1 
ATOM   5704 C  "C1'" . DG  C 2 9   ? 13.565  34.336  13.920  1.00 76.19  ? 9    DG  C "C1'" 1 
ATOM   5705 N  N9    . DG  C 2 9   ? 12.675  35.166  14.735  1.00 76.69  ? 9    DG  C N9    1 
ATOM   5706 C  C8    . DG  C 2 9   ? 13.032  36.144  15.638  1.00 76.94  ? 9    DG  C C8    1 
ATOM   5707 N  N7    . DG  C 2 9   ? 12.005  36.701  16.228  1.00 77.32  ? 9    DG  C N7    1 
ATOM   5708 C  C5    . DG  C 2 9   ? 10.900  36.052  15.685  1.00 77.09  ? 9    DG  C C5    1 
ATOM   5709 C  C6    . DG  C 2 9   ? 9.505   36.222  15.944  1.00 76.51  ? 9    DG  C C6    1 
ATOM   5710 O  O6    . DG  C 2 9   ? 8.952   37.003  16.736  1.00 75.70  ? 9    DG  C O6    1 
ATOM   5711 N  N1    . DG  C 2 9   ? 8.735   35.360  15.166  1.00 75.37  ? 9    DG  C N1    1 
ATOM   5712 C  C2    . DG  C 2 9   ? 9.234   34.455  14.258  1.00 75.21  ? 9    DG  C C2    1 
ATOM   5713 N  N2    . DG  C 2 9   ? 8.335   33.721  13.591  1.00 75.09  ? 9    DG  C N2    1 
ATOM   5714 N  N3    . DG  C 2 9   ? 10.520  34.283  14.016  1.00 75.97  ? 9    DG  C N3    1 
ATOM   5715 C  C4    . DG  C 2 9   ? 11.293  35.107  14.758  1.00 76.63  ? 9    DG  C C4    1 
ATOM   5716 P  P     . DA  C 2 10  ? 15.775  33.829  10.536  1.00 79.48  ? 10   DA  C P     1 
ATOM   5717 O  OP1   . DA  C 2 10  ? 16.531  32.894  9.669   1.00 78.89  ? 10   DA  C OP1   1 
ATOM   5718 O  OP2   . DA  C 2 10  ? 16.248  35.223  10.689  1.00 78.29  ? 10   DA  C OP2   1 
ATOM   5719 O  "O5'" . DA  C 2 10  ? 14.246  33.812  10.089  1.00 81.95  ? 10   DA  C "O5'" 1 
ATOM   5720 C  "C5'" . DA  C 2 10  ? 13.386  32.734  10.475  1.00 84.58  ? 10   DA  C "C5'" 1 
ATOM   5721 C  "C4'" . DA  C 2 10  ? 11.970  32.982  10.004  1.00 86.29  ? 10   DA  C "C4'" 1 
ATOM   5722 O  "O4'" . DA  C 2 10  ? 11.253  33.898  10.874  1.00 85.80  ? 10   DA  C "O4'" 1 
ATOM   5723 C  "C3'" . DA  C 2 10  ? 11.879  33.567  8.596   1.00 88.47  ? 10   DA  C "C3'" 1 
ATOM   5724 O  "O3'" . DA  C 2 10  ? 10.845  32.899  7.872   1.00 91.29  ? 10   DA  C "O3'" 1 
ATOM   5725 C  "C2'" . DA  C 2 10  ? 11.559  35.036  8.835   1.00 87.01  ? 10   DA  C "C2'" 1 
ATOM   5726 C  "C1'" . DA  C 2 10  ? 10.733  34.987  10.114  1.00 85.23  ? 10   DA  C "C1'" 1 
ATOM   5727 N  N9    . DA  C 2 10  ? 10.771  36.202  10.943  1.00 82.53  ? 10   DA  C N9    1 
ATOM   5728 C  C8    . DA  C 2 10  ? 11.807  37.093  11.129  1.00 80.60  ? 10   DA  C C8    1 
ATOM   5729 N  N7    . DA  C 2 10  ? 11.505  38.099  11.911  1.00 80.13  ? 10   DA  C N7    1 
ATOM   5730 C  C5    . DA  C 2 10  ? 10.185  37.858  12.274  1.00 81.28  ? 10   DA  C C5    1 
ATOM   5731 C  C6    . DA  C 2 10  ? 9.270   38.570  13.094  1.00 81.46  ? 10   DA  C C6    1 
ATOM   5732 N  N6    . DA  C 2 10  ? 9.562   39.715  13.722  1.00 79.73  ? 10   DA  C N6    1 
ATOM   5733 N  N1    . DA  C 2 10  ? 8.029   38.054  13.242  1.00 81.37  ? 10   DA  C N1    1 
ATOM   5734 C  C2    . DA  C 2 10  ? 7.732   36.908  12.610  1.00 81.37  ? 10   DA  C C2    1 
ATOM   5735 N  N3    . DA  C 2 10  ? 8.497   36.153  11.818  1.00 80.52  ? 10   DA  C N3    1 
ATOM   5736 C  C4    . DA  C 2 10  ? 9.724   36.689  11.690  1.00 81.25  ? 10   DA  C C4    1 
ATOM   5737 P  P     . DC  C 2 11  ? 10.763  33.048  6.275   1.00 93.29  ? 11   DC  C P     1 
ATOM   5738 O  OP1   . DC  C 2 11  ? 10.517  31.688  5.749   1.00 93.89  ? 11   DC  C OP1   1 
ATOM   5739 O  OP2   . DC  C 2 11  ? 11.933  33.815  5.794   1.00 93.02  ? 11   DC  C OP2   1 
ATOM   5740 O  "O5'" . DC  C 2 11  ? 9.447   33.921  6.086   1.00 96.24  ? 11   DC  C "O5'" 1 
ATOM   5741 C  "C5'" . DC  C 2 11  ? 8.185   33.435  6.550   1.00 98.51  ? 11   DC  C "C5'" 1 
ATOM   5742 C  "C4'" . DC  C 2 11  ? 7.161   34.545  6.555   1.00 99.77  ? 11   DC  C "C4'" 1 
ATOM   5743 O  "O4'" . DC  C 2 11  ? 7.423   35.453  7.659   1.00 99.62  ? 11   DC  C "O4'" 1 
ATOM   5744 C  "C3'" . DC  C 2 11  ? 7.120   35.402  5.280   1.00 100.97 ? 11   DC  C "C3'" 1 
ATOM   5745 O  "O3'" . DC  C 2 11  ? 5.750   35.572  4.867   1.00 102.19 ? 11   DC  C "O3'" 1 
ATOM   5746 C  "C2'" . DC  C 2 11  ? 7.747   36.712  5.729   1.00 101.11 ? 11   DC  C "C2'" 1 
ATOM   5747 C  "C1'" . DC  C 2 11  ? 7.308   36.779  7.181   1.00 100.95 ? 11   DC  C "C1'" 1 
ATOM   5748 N  N1    . DC  C 2 11  ? 8.072   37.692  8.065   1.00 101.37 ? 11   DC  C N1    1 
ATOM   5749 C  C2    . DC  C 2 11  ? 7.412   38.290  9.170   1.00 101.24 ? 11   DC  C C2    1 
ATOM   5750 O  O2    . DC  C 2 11  ? 6.251   37.948  9.454   1.00 100.39 ? 11   DC  C O2    1 
ATOM   5751 N  N3    . DC  C 2 11  ? 8.068   39.214  9.907   1.00 101.04 ? 11   DC  C N3    1 
ATOM   5752 C  C4    . DC  C 2 11  ? 9.331   39.529  9.615   1.00 100.89 ? 11   DC  C C4    1 
ATOM   5753 N  N4    . DC  C 2 11  ? 9.921   40.476  10.347  1.00 99.46  ? 11   DC  C N4    1 
ATOM   5754 C  C5    . DC  C 2 11  ? 10.044  38.893  8.551   1.00 101.39 ? 11   DC  C C5    1 
ATOM   5755 C  C6    . DC  C 2 11  ? 9.383   37.993  7.808   1.00 101.32 ? 11   DC  C C6    1 
ATOM   5756 P  P     . DT  C 2 12  ? 5.378   36.465  3.570   1.00 102.23 ? 12   DT  C P     1 
ATOM   5757 O  OP1   . DT  C 2 12  ? 4.489   35.659  2.707   1.00 102.31 ? 12   DT  C OP1   1 
ATOM   5758 O  OP2   . DT  C 2 12  ? 6.637   36.986  2.993   1.00 101.75 ? 12   DT  C OP2   1 
ATOM   5759 O  "O5'" . DT  C 2 12  ? 4.524   37.633  4.262   1.00 103.09 ? 12   DT  C "O5'" 1 
ATOM   5760 C  "C5'" . DT  C 2 12  ? 4.953   38.152  5.525   1.00 104.07 ? 12   DT  C "C5'" 1 
ATOM   5761 C  "C4'" . DT  C 2 12  ? 3.875   38.917  6.271   1.00 104.04 ? 12   DT  C "C4'" 1 
ATOM   5762 O  "O4'" . DT  C 2 12  ? 4.602   39.537  7.369   1.00 105.63 ? 12   DT  C "O4'" 1 
ATOM   5763 C  "C3'" . DT  C 2 12  ? 3.083   40.056  5.616   1.00 103.47 ? 12   DT  C "C3'" 1 
ATOM   5764 O  "O3'" . DT  C 2 12  ? 1.742   40.036  6.125   1.00 102.19 ? 12   DT  C "O3'" 1 
ATOM   5765 C  "C2'" . DT  C 2 12  ? 3.811   41.319  6.057   1.00 104.25 ? 12   DT  C "C2'" 1 
ATOM   5766 C  "C1'" . DT  C 2 12  ? 4.514   40.960  7.343   1.00 105.23 ? 12   DT  C "C1'" 1 
ATOM   5767 N  N1    . DT  C 2 12  ? 5.895   41.535  7.417   1.00 105.12 ? 12   DT  C N1    1 
ATOM   5768 C  C2    . DT  C 2 12  ? 6.062   42.758  8.038   1.00 104.33 ? 12   DT  C C2    1 
ATOM   5769 O  O2    . DT  C 2 12  ? 5.149   43.373  8.564   1.00 104.00 ? 12   DT  C O2    1 
ATOM   5770 N  N3    . DT  C 2 12  ? 7.349   43.240  8.019   1.00 103.64 ? 12   DT  C N3    1 
ATOM   5771 C  C4    . DT  C 2 12  ? 8.460   42.644  7.459   1.00 103.51 ? 12   DT  C C4    1 
ATOM   5772 O  O4    . DT  C 2 12  ? 9.548   43.207  7.511   1.00 101.83 ? 12   DT  C O4    1 
ATOM   5773 C  C5    . DT  C 2 12  ? 8.222   41.365  6.838   1.00 104.70 ? 12   DT  C C5    1 
ATOM   5774 C  C7    . DT  C 2 12  ? 9.368   40.649  6.195   1.00 104.61 ? 12   DT  C C7    1 
ATOM   5775 C  C6    . DT  C 2 12  ? 6.973   40.876  6.856   1.00 105.40 ? 12   DT  C C6    1 
ATOM   5776 P  P     . DG  C 2 13  ? 0.728   41.259  5.827   1.00 102.03 ? 13   DG  C P     1 
ATOM   5777 O  OP1   . DG  C 2 13  ? 0.631   42.016  7.106   1.00 101.39 ? 13   DG  C OP1   1 
ATOM   5778 O  OP2   . DG  C 2 13  ? -0.492  40.666  5.236   1.00 101.56 ? 13   DG  C OP2   1 
ATOM   5779 O  "O5'" . DG  C 2 13  ? 1.464   42.170  4.737   1.00 100.95 ? 13   DG  C "O5'" 1 
ATOM   5780 C  "C5'" . DG  C 2 13  ? 2.027   43.435  5.100   1.00 98.88  ? 13   DG  C "C5'" 1 
ATOM   5781 C  "C4'" . DG  C 2 13  ? 3.169   43.811  4.178   1.00 97.07  ? 13   DG  C "C4'" 1 
ATOM   5782 O  "O4'" . DG  C 2 13  ? 4.432   43.122  4.439   1.00 96.61  ? 13   DG  C "O4'" 1 
ATOM   5783 C  "C3'" . DG  C 2 13  ? 2.896   43.619  2.690   1.00 96.50  ? 13   DG  C "C3'" 1 
ATOM   5784 O  "O3'" . DG  C 2 13  ? 3.682   44.650  2.136   1.00 96.21  ? 13   DG  C "O3'" 1 
ATOM   5785 C  "C2'" . DG  C 2 13  ? 3.673   42.358  2.370   1.00 96.41  ? 13   DG  C "C2'" 1 
ATOM   5786 C  "C1'" . DG  C 2 13  ? 4.926   42.609  3.198   1.00 96.39  ? 13   DG  C "C1'" 1 
ATOM   5787 N  N9    . DG  C 2 13  ? 5.743   41.420  3.436   1.00 96.17  ? 13   DG  C N9    1 
ATOM   5788 C  C8    . DG  C 2 13  ? 5.279   40.225  3.863   1.00 96.21  ? 13   DG  C C8    1 
ATOM   5789 N  N7    . DG  C 2 13  ? 6.195   39.312  3.960   1.00 96.54  ? 13   DG  C N7    1 
ATOM   5790 C  C5    . DG  C 2 13  ? 7.346   39.936  3.572   1.00 96.11  ? 13   DG  C C5    1 
ATOM   5791 C  C6    . DG  C 2 13  ? 8.645   39.414  3.447   1.00 96.09  ? 13   DG  C C6    1 
ATOM   5792 O  O6    . DG  C 2 13  ? 9.060   38.261  3.713   1.00 97.90  ? 13   DG  C O6    1 
ATOM   5793 N  N1    . DG  C 2 13  ? 9.507   40.371  2.964   1.00 94.77  ? 13   DG  C N1    1 
ATOM   5794 C  C2    . DG  C 2 13  ? 9.148   41.663  2.663   1.00 94.19  ? 13   DG  C C2    1 
ATOM   5795 N  N2    . DG  C 2 13  ? 10.115  42.438  2.207   1.00 93.47  ? 13   DG  C N2    1 
ATOM   5796 N  N3    . DG  C 2 13  ? 7.940   42.160  2.794   1.00 94.61  ? 13   DG  C N3    1 
ATOM   5797 C  C4    . DG  C 2 13  ? 7.093   41.249  3.244   1.00 95.77  ? 13   DG  C C4    1 
ATOM   5798 O  "O5'" . DT  D 3 1   ? 34.385  58.534  13.411  1.00 120.53 ? 1    DT  D "O5'" 1 
ATOM   5799 C  "C5'" . DT  D 3 1   ? 35.450  57.585  13.282  1.00 121.97 ? 1    DT  D "C5'" 1 
ATOM   5800 C  "C4'" . DT  D 3 1   ? 35.652  57.172  11.842  1.00 122.81 ? 1    DT  D "C4'" 1 
ATOM   5801 O  "O4'" . DT  D 3 1   ? 36.538  56.027  11.795  1.00 123.26 ? 1    DT  D "O4'" 1 
ATOM   5802 C  "C3'" . DT  D 3 1   ? 34.366  56.739  11.134  1.00 123.20 ? 1    DT  D "C3'" 1 
ATOM   5803 O  "O3'" . DT  D 3 1   ? 34.408  57.145  9.763   1.00 123.35 ? 1    DT  D "O3'" 1 
ATOM   5804 C  "C2'" . DT  D 3 1   ? 34.394  55.227  11.241  1.00 123.68 ? 1    DT  D "C2'" 1 
ATOM   5805 C  "C1'" . DT  D 3 1   ? 35.878  54.918  11.189  1.00 124.05 ? 1    DT  D "C1'" 1 
ATOM   5806 N  N1    . DT  D 3 1   ? 36.263  53.679  11.919  1.00 124.59 ? 1    DT  D N1    1 
ATOM   5807 C  C2    . DT  D 3 1   ? 35.882  52.456  11.387  1.00 124.35 ? 1    DT  D C2    1 
ATOM   5808 O  O2    . DT  D 3 1   ? 35.231  52.341  10.360  1.00 124.77 ? 1    DT  D O2    1 
ATOM   5809 N  N3    . DT  D 3 1   ? 36.293  51.367  12.109  1.00 124.34 ? 1    DT  D N3    1 
ATOM   5810 C  C4    . DT  D 3 1   ? 37.024  51.365  13.280  1.00 124.82 ? 1    DT  D C4    1 
ATOM   5811 O  O4    . DT  D 3 1   ? 37.322  50.296  13.808  1.00 125.61 ? 1    DT  D O4    1 
ATOM   5812 C  C5    . DT  D 3 1   ? 37.382  52.677  13.789  1.00 124.71 ? 1    DT  D C5    1 
ATOM   5813 C  C7    . DT  D 3 1   ? 38.171  52.781  15.059  1.00 123.89 ? 1    DT  D C7    1 
ATOM   5814 C  C6    . DT  D 3 1   ? 36.987  53.750  13.093  1.00 124.53 ? 1    DT  D C6    1 
ATOM   5815 P  P     . DT  D 3 2   ? 33.101  57.796  9.085   1.00 123.34 ? 2    DT  D P     1 
ATOM   5816 O  OP1   . DT  D 3 2   ? 33.461  58.086  7.668   1.00 122.67 ? 2    DT  D OP1   1 
ATOM   5817 O  OP2   . DT  D 3 2   ? 32.636  58.885  9.974   1.00 123.31 ? 2    DT  D OP2   1 
ATOM   5818 O  "O5'" . DT  D 3 2   ? 32.024  56.625  9.111   1.00 122.48 ? 2    DT  D "O5'" 1 
ATOM   5819 C  "C5'" . DT  D 3 2   ? 30.806  56.755  9.850   1.00 119.77 ? 2    DT  D "C5'" 1 
ATOM   5820 C  "C4'" . DT  D 3 2   ? 30.000  55.483  9.727   1.00 117.01 ? 2    DT  D "C4'" 1 
ATOM   5821 O  "O4'" . DT  D 3 2   ? 30.834  54.351  10.075  1.00 117.30 ? 2    DT  D "O4'" 1 
ATOM   5822 C  "C3'" . DT  D 3 2   ? 28.760  55.386  10.616  1.00 114.69 ? 2    DT  D "C3'" 1 
ATOM   5823 O  "O3'" . DT  D 3 2   ? 27.762  54.665  9.887   1.00 110.68 ? 2    DT  D "O3'" 1 
ATOM   5824 C  "C2'" . DT  D 3 2   ? 29.252  54.560  11.791  1.00 115.78 ? 2    DT  D "C2'" 1 
ATOM   5825 C  "C1'" A DT  D 3 2   ? 30.218  53.602  11.108  0.70 116.51 ? 2    DT  D "C1'" 1 
ATOM   5826 N  N1    A DT  D 3 2   ? 31.287  53.027  11.952  0.70 116.52 ? 2    DT  D N1    1 
ATOM   5827 C  C2    A DT  D 3 2   ? 31.565  51.684  11.805  0.70 116.82 ? 2    DT  D C2    1 
ATOM   5828 O  O2    A DT  D 3 2   ? 30.980  50.960  11.013  0.70 116.84 ? 2    DT  D O2    1 
ATOM   5829 N  N3    A DT  D 3 2   ? 32.563  51.214  12.622  0.70 116.93 ? 2    DT  D N3    1 
ATOM   5830 C  C4    A DT  D 3 2   ? 33.297  51.933  13.543  0.70 116.67 ? 2    DT  D C4    1 
ATOM   5831 O  O4    A DT  D 3 2   ? 34.157  51.366  14.210  0.70 116.33 ? 2    DT  D O4    1 
ATOM   5832 C  C5    A DT  D 3 2   ? 32.963  53.340  13.636  0.70 116.66 ? 2    DT  D C5    1 
ATOM   5833 C  C7    A DT  D 3 2   ? 33.724  54.209  14.587  0.70 116.62 ? 2    DT  D C7    1 
ATOM   5834 C  C6    A DT  D 3 2   ? 31.983  53.807  12.852  0.70 116.29 ? 2    DT  D C6    1 
ATOM   5835 P  P     . DC  D 3 3   ? 26.264  54.550  10.460  1.00 107.85 ? 3    DC  D P     1 
ATOM   5836 O  OP1   . DC  D 3 3   ? 25.710  55.923  10.473  1.00 107.93 ? 3    DC  D OP1   1 
ATOM   5837 O  OP2   . DC  D 3 3   ? 26.308  53.757  11.722  1.00 106.97 ? 3    DC  D OP2   1 
ATOM   5838 O  "O5'" . DC  D 3 3   ? 25.533  53.694  9.328   1.00 102.87 ? 3    DC  D "O5'" 1 
ATOM   5839 C  "C5'" . DC  D 3 3   ? 26.161  52.550  8.742   1.00 94.20  ? 3    DC  D "C5'" 1 
ATOM   5840 C  "C4'" . DC  D 3 3   ? 25.680  52.361  7.322   1.00 88.10  ? 3    DC  D "C4'" 1 
ATOM   5841 O  "O4'" . DC  D 3 3   ? 26.408  51.272  6.703   1.00 86.41  ? 3    DC  D "O4'" 1 
ATOM   5842 C  "C3'" . DC  D 3 3   ? 24.195  52.014  7.202   1.00 84.63  ? 3    DC  D "C3'" 1 
ATOM   5843 O  "O3'" . DC  D 3 3   ? 23.608  52.738  6.112   1.00 78.23  ? 3    DC  D "O3'" 1 
ATOM   5844 C  "C2'" . DC  D 3 3   ? 24.182  50.513  6.973   1.00 85.06  ? 3    DC  D "C2'" 1 
ATOM   5845 C  "C1'" . DC  D 3 3   ? 25.513  50.254  6.276   1.00 86.00  ? 3    DC  D "C1'" 1 
ATOM   5846 N  N1    A DC  D 3 3   ? 26.130  48.941  6.574   0.80 85.30  ? 3    DC  D N1    1 
ATOM   5847 C  C2    A DC  D 3 3   ? 26.218  48.489  7.914   0.80 84.33  ? 3    DC  D C2    1 
ATOM   5848 O  O2    A DC  D 3 3   ? 25.818  49.220  8.831   0.80 82.92  ? 3    DC  D O2    1 
ATOM   5849 N  N3    A DC  D 3 3   ? 26.744  47.269  8.162   0.80 84.05  ? 3    DC  D N3    1 
ATOM   5850 C  C4    A DC  D 3 3   ? 27.180  46.512  7.151   0.80 84.48  ? 3    DC  D C4    1 
ATOM   5851 N  N4    A DC  D 3 3   ? 27.677  45.307  7.439   0.80 84.69  ? 3    DC  D N4    1 
ATOM   5852 C  C5    A DC  D 3 3   ? 27.124  46.954  5.798   0.80 84.03  ? 3    DC  D C5    1 
ATOM   5853 C  C6    A DC  D 3 3   ? 26.599  48.159  5.556   0.80 84.68  ? 3    DC  D C6    1 
ATOM   5854 P  P     . DA  D 3 4   ? 22.317  53.658  6.379   1.00 71.64  ? 4    DA  D P     1 
ATOM   5855 O  OP1   . DA  D 3 4   ? 21.976  54.255  5.079   1.00 73.74  ? 4    DA  D OP1   1 
ATOM   5856 O  OP2   . DA  D 3 4   ? 22.589  54.537  7.537   1.00 72.42  ? 4    DA  D OP2   1 
ATOM   5857 O  "O5'" . DA  D 3 4   ? 21.191  52.612  6.767   1.00 69.13  ? 4    DA  D "O5'" 1 
ATOM   5858 C  "C5'" . DA  D 3 4   ? 20.956  51.470  5.942   1.00 66.15  ? 4    DA  D "C5'" 1 
ATOM   5859 C  "C4'" . DA  D 3 4   ? 19.580  50.916  6.214   1.00 65.22  ? 4    DA  D "C4'" 1 
ATOM   5860 O  "O4'" . DA  D 3 4   ? 19.337  49.848  5.279   1.00 64.71  ? 4    DA  D "O4'" 1 
ATOM   5861 C  "C3'" . DA  D 3 4   ? 19.397  50.316  7.607   1.00 65.11  ? 4    DA  D "C3'" 1 
ATOM   5862 O  "O3'" . DA  D 3 4   ? 18.070  50.585  8.071   1.00 63.42  ? 4    DA  D "O3'" 1 
ATOM   5863 C  "C2'" . DA  D 3 4   ? 19.601  48.832  7.378   1.00 66.07  ? 4    DA  D "C2'" 1 
ATOM   5864 C  "C1'" . DA  D 3 4   ? 19.073  48.641  5.965   1.00 66.94  ? 4    DA  D "C1'" 1 
ATOM   5865 N  N9    . DA  D 3 4   ? 19.712  47.563  5.210   1.00 69.83  ? 4    DA  D N9    1 
ATOM   5866 C  C8    . DA  D 3 4   ? 19.102  46.534  4.528   1.00 70.83  ? 4    DA  D C8    1 
ATOM   5867 N  N7    . DA  D 3 4   ? 19.942  45.712  3.946   1.00 71.11  ? 4    DA  D N7    1 
ATOM   5868 C  C5    . DA  D 3 4   ? 21.189  46.232  4.264   1.00 71.72  ? 4    DA  D C5    1 
ATOM   5869 C  C6    . DA  D 3 4   ? 22.488  45.817  3.949   1.00 72.22  ? 4    DA  D C6    1 
ATOM   5870 N  N6    . DA  D 3 4   ? 22.756  44.724  3.231   1.00 73.03  ? 4    DA  D N6    1 
ATOM   5871 N  N1    . DA  D 3 4   ? 23.517  46.567  4.406   1.00 73.05  ? 4    DA  D N1    1 
ATOM   5872 C  C2    . DA  D 3 4   ? 23.242  47.655  5.145   1.00 73.32  ? 4    DA  D C2    1 
ATOM   5873 N  N3    . DA  D 3 4   ? 22.061  48.140  5.520   1.00 72.60  ? 4    DA  D N3    1 
ATOM   5874 C  C4    . DA  D 3 4   ? 21.063  47.375  5.039   1.00 71.51  ? 4    DA  D C4    1 
ATOM   5875 P  P     . DG  D 3 5   ? 17.764  50.627  9.653   1.00 63.78  ? 5    DG  D P     1 
ATOM   5876 O  OP1   . DG  D 3 5   ? 18.879  51.343  10.308  1.00 63.27  ? 5    DG  D OP1   1 
ATOM   5877 O  OP2   . DG  D 3 5   ? 17.417  49.257  10.092  1.00 63.95  ? 5    DG  D OP2   1 
ATOM   5878 O  "O5'" . DG  D 3 5   ? 16.463  51.531  9.749   1.00 61.12  ? 5    DG  D "O5'" 1 
ATOM   5879 C  "C5'" . DG  D 3 5   ? 16.468  52.869  9.244   1.00 58.09  ? 5    DG  D "C5'" 1 
ATOM   5880 C  "C4'" . DG  D 3 5   ? 15.053  53.379  9.110   1.00 55.54  ? 5    DG  D "C4'" 1 
ATOM   5881 O  "O4'" . DG  D 3 5   ? 14.400  52.725  7.995   1.00 54.22  ? 5    DG  D "O4'" 1 
ATOM   5882 C  "C3'" . DG  D 3 5   ? 14.182  53.123  10.337  1.00 54.31  ? 5    DG  D "C3'" 1 
ATOM   5883 O  "O3'" . DG  D 3 5   ? 13.442  54.304  10.666  1.00 53.28  ? 5    DG  D "O3'" 1 
ATOM   5884 C  "C2'" . DG  D 3 5   ? 13.293  51.959  9.923   1.00 54.57  ? 5    DG  D "C2'" 1 
ATOM   5885 C  "C1'" . DG  D 3 5   ? 13.187  52.114  8.413   1.00 54.83  ? 5    DG  D "C1'" 1 
ATOM   5886 N  N9    . DG  D 3 5   ? 13.031  50.860  7.669   1.00 55.74  ? 5    DG  D N9    1 
ATOM   5887 C  C8    . DG  D 3 5   ? 13.959  49.854  7.521   1.00 55.17  ? 5    DG  D C8    1 
ATOM   5888 N  N7    . DG  D 3 5   ? 13.523  48.855  6.804   1.00 53.83  ? 5    DG  D N7    1 
ATOM   5889 C  C5    . DG  D 3 5   ? 12.233  49.219  6.452   1.00 54.46  ? 5    DG  D C5    1 
ATOM   5890 C  C6    . DG  D 3 5   ? 11.269  48.533  5.692   1.00 55.59  ? 5    DG  D C6    1 
ATOM   5891 O  O6    . DG  D 3 5   ? 11.359  47.422  5.153   1.00 57.85  ? 5    DG  D O6    1 
ATOM   5892 N  N1    . DG  D 3 5   ? 10.088  49.259  5.590   1.00 55.82  ? 5    DG  D N1    1 
ATOM   5893 C  C2    . DG  D 3 5   ? 9.864   50.491  6.150   1.00 54.67  ? 5    DG  D C2    1 
ATOM   5894 N  N2    . DG  D 3 5   ? 8.659   51.034  5.949   1.00 54.75  ? 5    DG  D N2    1 
ATOM   5895 N  N3    . DG  D 3 5   ? 10.757  51.145  6.859   1.00 55.72  ? 5    DG  D N3    1 
ATOM   5896 C  C4    . DG  D 3 5   ? 11.913  50.454  6.974   1.00 55.62  ? 5    DG  D C4    1 
HETATM 5897 P  P     . DFT D 3 6   ? 13.094  54.611  12.201  1.00 51.81  ? 6    DFT D P     1 
HETATM 5898 O  OP1   . DFT D 3 6   ? 13.134  56.074  12.430  1.00 53.06  ? 6    DFT D OP1   1 
HETATM 5899 O  OP2   . DFT D 3 6   ? 13.955  53.731  13.023  1.00 50.91  ? 6    DFT D OP2   1 
HETATM 5900 O  "O5'" . DFT D 3 6   ? 11.600  54.094  12.395  1.00 52.27  ? 6    DFT D "O5'" 1 
HETATM 5901 C  "C5'" . DFT D 3 6   ? 10.504  54.624  11.643  1.00 48.97  ? 6    DFT D "C5'" 1 
HETATM 5902 C  "C4'" . DFT D 3 6   ? 9.431   53.568  11.489  1.00 49.18  ? 6    DFT D "C4'" 1 
HETATM 5903 O  "O4'" . DFT D 3 6   ? 9.874   52.506  10.631  1.00 49.57  ? 6    DFT D "O4'" 1 
HETATM 5904 C  "C3'" . DFT D 3 6   ? 8.913   52.859  12.754  1.00 49.36  ? 6    DFT D "C3'" 1 
HETATM 5905 O  "O3'" . DFT D 3 6   ? 7.608   53.350  13.116  1.00 48.51  ? 6    DFT D "O3'" 1 
HETATM 5906 C  "C2'" . DFT D 3 6   ? 8.813   51.393  12.326  1.00 49.53  ? 6    DFT D "C2'" 1 
HETATM 5907 C  "C1'" . DFT D 3 6   ? 8.837   51.530  10.805  1.00 50.62  ? 6    DFT D "C1'" 1 
HETATM 5908 C  C2    . DFT D 3 6   ? 8.292   49.561  9.303   1.00 52.44  ? 6    DFT D C2    1 
HETATM 5909 C  C4    . DFT D 3 6   ? 9.956   47.922  8.733   1.00 49.51  ? 6    DFT D C4    1 
HETATM 5910 C  C5    . DFT D 3 6   ? 10.873  48.573  9.553   1.00 50.42  ? 6    DFT D C5    1 
HETATM 5911 C  C5M   . DFT D 3 6   ? 12.307  48.056  9.685   1.00 50.58  ? 6    DFT D C5M   1 
HETATM 5912 C  C6    . DFT D 3 6   ? 10.499  49.716  10.251  1.00 50.79  ? 6    DFT D C6    1 
HETATM 5913 F  F4    . DFT D 3 6   ? 10.313  46.810  8.062   1.00 46.78  ? 6    DFT D F4    1 
HETATM 5914 C  C3    . DFT D 3 6   ? 8.663   48.415  8.608   1.00 50.01  ? 6    DFT D C3    1 
HETATM 5915 F  F2    . DFT D 3 6   ? 7.041   50.048  9.169   1.00 56.25  ? 6    DFT D F2    1 
HETATM 5916 C  C1    . DFT D 3 6   ? 9.208   50.211  10.121  1.00 51.77  ? 6    DFT D C1    1 
ATOM   5917 P  P     . DA  D 3 7   ? 6.796   52.647  14.321  1.00 49.99  ? 7    DA  D P     1 
ATOM   5918 O  OP1   . DA  D 3 7   ? 5.709   53.550  14.780  1.00 48.25  ? 7    DA  D OP1   1 
ATOM   5919 O  OP2   . DA  D 3 7   ? 7.807   52.186  15.297  1.00 52.29  ? 7    DA  D OP2   1 
ATOM   5920 O  "O5'" . DA  D 3 7   ? 6.145   51.369  13.624  1.00 49.59  ? 7    DA  D "O5'" 1 
ATOM   5921 C  "C5'" . DA  D 3 7   ? 5.085   51.523  12.677  1.00 48.19  ? 7    DA  D "C5'" 1 
ATOM   5922 C  "C4'" . DA  D 3 7   ? 4.183   50.312  12.672  1.00 47.02  ? 7    DA  D "C4'" 1 
ATOM   5923 O  "O4'" . DA  D 3 7   ? 4.849   49.222  12.005  1.00 48.26  ? 7    DA  D "O4'" 1 
ATOM   5924 C  "C3'" . DA  D 3 7   ? 3.745   49.800  14.037  1.00 47.04  ? 7    DA  D "C3'" 1 
ATOM   5925 O  "O3'" . DA  D 3 7   ? 2.335   49.610  14.062  1.00 44.79  ? 7    DA  D "O3'" 1 
ATOM   5926 C  "C2'" . DA  D 3 7   ? 4.498   48.491  14.218  1.00 48.34  ? 7    DA  D "C2'" 1 
ATOM   5927 C  "C1'" . DA  D 3 7   ? 4.951   48.079  12.826  1.00 48.90  ? 7    DA  D "C1'" 1 
ATOM   5928 N  N9    . DA  D 3 7   ? 6.351   47.663  12.773  1.00 51.02  ? 7    DA  D N9    1 
ATOM   5929 C  C8    . DA  D 3 7   ? 7.417   48.115  13.526  1.00 52.54  ? 7    DA  D C8    1 
ATOM   5930 N  N7    . DA  D 3 7   ? 8.558   47.550  13.218  1.00 53.60  ? 7    DA  D N7    1 
ATOM   5931 C  C5    . DA  D 3 7   ? 8.223   46.664  12.203  1.00 53.36  ? 7    DA  D C5    1 
ATOM   5932 C  C6    . DA  D 3 7   ? 8.983   45.749  11.463  1.00 52.98  ? 7    DA  D C6    1 
ATOM   5933 N  N6    . DA  D 3 7   ? 10.290  45.563  11.648  1.00 53.60  ? 7    DA  D N6    1 
ATOM   5934 N  N1    . DA  D 3 7   ? 8.348   45.018  10.523  1.00 52.31  ? 7    DA  D N1    1 
ATOM   5935 C  C2    . DA  D 3 7   ? 7.034   45.199  10.354  1.00 53.17  ? 7    DA  D C2    1 
ATOM   5936 N  N3    . DA  D 3 7   ? 6.205   46.019  10.995  1.00 53.37  ? 7    DA  D N3    1 
ATOM   5937 C  C4    . DA  D 3 7   ? 6.869   46.729  11.918  1.00 52.47  ? 7    DA  D C4    1 
ATOM   5938 P  P     . DG  D 3 8   ? 1.603   49.240  15.441  1.00 45.49  ? 8    DG  D P     1 
ATOM   5939 O  OP1   . DG  D 3 8   ? 0.300   49.951  15.491  1.00 42.49  ? 8    DG  D OP1   1 
ATOM   5940 O  OP2   . DG  D 3 8   ? 2.569   49.444  16.541  1.00 46.49  ? 8    DG  D OP2   1 
ATOM   5941 O  "O5'" . DG  D 3 8   ? 1.381   47.673  15.245  1.00 45.80  ? 8    DG  D "O5'" 1 
ATOM   5942 C  "C5'" . DG  D 3 8   ? 0.898   47.173  13.996  1.00 44.59  ? 8    DG  D "C5'" 1 
ATOM   5943 C  "C4'" . DG  D 3 8   ? 1.140   45.689  13.854  1.00 43.21  ? 8    DG  D "C4'" 1 
ATOM   5944 O  "O4'" . DG  D 3 8   ? 2.477   45.388  13.385  1.00 43.58  ? 8    DG  D "O4'" 1 
ATOM   5945 C  "C3'" . DG  D 3 8   ? 0.896   44.813  15.083  1.00 43.02  ? 8    DG  D "C3'" 1 
ATOM   5946 O  "O3'" . DG  D 3 8   ? 0.073   43.724  14.698  1.00 43.98  ? 8    DG  D "O3'" 1 
ATOM   5947 C  "C2'" . DG  D 3 8   ? 2.276   44.255  15.385  1.00 43.22  ? 8    DG  D "C2'" 1 
ATOM   5948 C  "C1'" . DG  D 3 8   ? 2.849   44.172  13.987  1.00 43.92  ? 8    DG  D "C1'" 1 
ATOM   5949 N  N9    . DG  D 3 8   ? 4.292   43.993  13.858  1.00 44.04  ? 8    DG  D N9    1 
ATOM   5950 C  C8    . DG  D 3 8   ? 5.284   44.627  14.556  1.00 45.05  ? 8    DG  D C8    1 
ATOM   5951 N  N7    . DG  D 3 8   ? 6.480   44.234  14.218  1.00 46.17  ? 8    DG  D N7    1 
ATOM   5952 C  C5    . DG  D 3 8   ? 6.264   43.286  13.231  1.00 45.16  ? 8    DG  D C5    1 
ATOM   5953 C  C6    . DG  D 3 8   ? 7.184   42.511  12.489  1.00 46.04  ? 8    DG  D C6    1 
ATOM   5954 O  O6    . DG  D 3 8   ? 8.409   42.510  12.547  1.00 47.96  ? 8    DG  D O6    1 
ATOM   5955 N  N1    . DG  D 3 8   ? 6.541   41.668  11.598  1.00 48.78  ? 8    DG  D N1    1 
ATOM   5956 C  C2    . DG  D 3 8   ? 5.183   41.585  11.427  1.00 49.07  ? 8    DG  D C2    1 
ATOM   5957 N  N2    . DG  D 3 8   ? 4.758   40.728  10.478  1.00 49.37  ? 8    DG  D N2    1 
ATOM   5958 N  N3    . DG  D 3 8   ? 4.310   42.295  12.123  1.00 47.06  ? 8    DG  D N3    1 
ATOM   5959 C  C4    . DG  D 3 8   ? 4.919   43.122  12.999  1.00 45.10  ? 8    DG  D C4    1 
ATOM   5960 P  P     . DT  D 3 9   ? -0.837  42.975  15.787  1.00 45.83  ? 9    DT  D P     1 
ATOM   5961 O  OP1   . DT  D 3 9   ? -2.213  43.479  15.537  1.00 45.94  ? 9    DT  D OP1   1 
ATOM   5962 O  OP2   . DT  D 3 9   ? -0.262  43.041  17.149  1.00 45.30  ? 9    DT  D OP2   1 
ATOM   5963 O  "O5'" . DT  D 3 9   ? -0.736  41.474  15.314  1.00 45.18  ? 9    DT  D "O5'" 1 
ATOM   5964 C  "C5'" . DT  D 3 9   ? -0.954  41.140  13.945  1.00 45.46  ? 9    DT  D "C5'" 1 
ATOM   5965 C  "C4'" . DT  D 3 9   ? -0.159  39.913  13.603  1.00 46.99  ? 9    DT  D "C4'" 1 
ATOM   5966 O  "O4'" . DT  D 3 9   ? 1.242   40.268  13.568  1.00 46.94  ? 9    DT  D "O4'" 1 
ATOM   5967 C  "C3'" . DT  D 3 9   ? -0.294  38.785  14.627  1.00 48.30  ? 9    DT  D "C3'" 1 
ATOM   5968 O  "O3'" . DT  D 3 9   ? -0.626  37.581  13.953  1.00 52.61  ? 9    DT  D "O3'" 1 
ATOM   5969 C  "C2'" . DT  D 3 9   ? 1.098   38.674  15.235  1.00 47.58  ? 9    DT  D "C2'" 1 
ATOM   5970 C  "C1'" . DT  D 3 9   ? 1.972   39.206  14.124  1.00 45.48  ? 9    DT  D "C1'" 1 
ATOM   5971 N  N1    . DT  D 3 9   ? 3.307   39.703  14.510  1.00 44.09  ? 9    DT  D N1    1 
ATOM   5972 C  C2    . DT  D 3 9   ? 4.361   39.356  13.696  1.00 44.31  ? 9    DT  D C2    1 
ATOM   5973 O  O2    . DT  D 3 9   ? 4.225   38.741  12.644  1.00 45.39  ? 9    DT  D O2    1 
ATOM   5974 N  N3    . DT  D 3 9   ? 5.591   39.762  14.156  1.00 43.29  ? 9    DT  D N3    1 
ATOM   5975 C  C4    . DT  D 3 9   ? 5.857   40.476  15.308  1.00 41.43  ? 9    DT  D C4    1 
ATOM   5976 O  O4    . DT  D 3 9   ? 7.013   40.713  15.627  1.00 40.31  ? 9    DT  D O4    1 
ATOM   5977 C  C5    . DT  D 3 9   ? 4.706   40.870  16.066  1.00 41.38  ? 9    DT  D C5    1 
ATOM   5978 C  C7    . DT  D 3 9   ? 4.899   41.729  17.275  1.00 42.49  ? 9    DT  D C7    1 
ATOM   5979 C  C6    . DT  D 3 9   ? 3.502   40.460  15.645  1.00 42.82  ? 9    DT  D C6    1 
ATOM   5980 P  P     . DC  D 3 10  ? -1.546  36.485  14.682  1.00 56.76  ? 10   DC  D P     1 
ATOM   5981 O  OP1   . DC  D 3 10  ? -2.895  36.570  14.076  1.00 55.56  ? 10   DC  D OP1   1 
ATOM   5982 O  OP2   . DC  D 3 10  ? -1.398  36.631  16.147  1.00 57.16  ? 10   DC  D OP2   1 
ATOM   5983 O  "O5'" . DC  D 3 10  ? -0.857  35.126  14.237  1.00 58.88  ? 10   DC  D "O5'" 1 
ATOM   5984 C  "C5'" . DC  D 3 10  ? -0.124  35.046  13.012  1.00 63.08  ? 10   DC  D "C5'" 1 
ATOM   5985 C  "C4'" . DC  D 3 10  ? 1.168   34.295  13.226  1.00 67.08  ? 10   DC  D "C4'" 1 
ATOM   5986 O  "O4'" . DC  D 3 10  ? 2.232   35.199  13.634  1.00 69.46  ? 10   DC  D "O4'" 1 
ATOM   5987 C  "C3'" . DC  D 3 10  ? 1.081   33.201  14.299  1.00 68.62  ? 10   DC  D "C3'" 1 
ATOM   5988 O  "O3'" . DC  D 3 10  ? 1.708   32.004  13.837  1.00 69.94  ? 10   DC  D "O3'" 1 
ATOM   5989 C  "C2'" . DC  D 3 10  ? 1.882   33.778  15.452  1.00 69.69  ? 10   DC  D "C2'" 1 
ATOM   5990 C  "C1'" . DC  D 3 10  ? 2.928   34.603  14.714  1.00 70.67  ? 10   DC  D "C1'" 1 
ATOM   5991 N  N1    . DC  D 3 10  ? 3.615   35.658  15.501  1.00 70.66  ? 10   DC  D N1    1 
ATOM   5992 C  C2    . DC  D 3 10  ? 4.953   35.962  15.194  1.00 70.69  ? 10   DC  D C2    1 
ATOM   5993 O  O2    . DC  D 3 10  ? 5.491   35.411  14.214  1.00 70.09  ? 10   DC  D O2    1 
ATOM   5994 N  N3    . DC  D 3 10  ? 5.623   36.852  15.970  1.00 70.55  ? 10   DC  D N3    1 
ATOM   5995 C  C4    . DC  D 3 10  ? 5.005   37.440  16.999  1.00 69.85  ? 10   DC  D C4    1 
ATOM   5996 N  N4    . DC  D 3 10  ? 5.712   38.278  17.757  1.00 69.62  ? 10   DC  D N4    1 
ATOM   5997 C  C5    . DC  D 3 10  ? 3.637   37.186  17.302  1.00 69.84  ? 10   DC  D C5    1 
ATOM   5998 C  C6    . DC  D 3 10  ? 2.985   36.302  16.533  1.00 70.38  ? 10   DC  D C6    1 
ATOM   5999 P  P     . DC  D 3 11  ? 1.362   30.597  14.536  1.00 69.31  ? 11   DC  D P     1 
ATOM   6000 O  OP1   . DC  D 3 11  ? -0.013  30.224  14.131  1.00 70.87  ? 11   DC  D OP1   1 
ATOM   6001 O  OP2   . DC  D 3 11  ? 1.696   30.712  15.973  1.00 70.14  ? 11   DC  D OP2   1 
ATOM   6002 O  "O5'" . DC  D 3 11  ? 2.380   29.592  13.858  1.00 70.03  ? 11   DC  D "O5'" 1 
ATOM   6003 C  "C5'" . DC  D 3 11  ? 3.282   30.032  12.840  1.00 72.34  ? 11   DC  D "C5'" 1 
ATOM   6004 C  "C4'" . DC  D 3 11  ? 4.699   29.677  13.222  1.00 73.55  ? 11   DC  D "C4'" 1 
ATOM   6005 O  "O4'" . DC  D 3 11  ? 5.368   30.823  13.808  1.00 73.44  ? 11   DC  D "O4'" 1 
ATOM   6006 C  "C3'" . DC  D 3 11  ? 4.778   28.547  14.255  1.00 75.30  ? 11   DC  D "C3'" 1 
ATOM   6007 O  "O3'" . DC  D 3 11  ? 5.742   27.567  13.857  1.00 76.08  ? 11   DC  D "O3'" 1 
ATOM   6008 C  "C2'" . DC  D 3 11  ? 5.176   29.259  15.538  1.00 75.15  ? 11   DC  D "C2'" 1 
ATOM   6009 C  "C1'" . DC  D 3 11  ? 5.996   30.427  15.012  1.00 73.98  ? 11   DC  D "C1'" 1 
ATOM   6010 N  N1    . DC  D 3 11  ? 6.102   31.604  15.900  1.00 73.29  ? 11   DC  D N1    1 
ATOM   6011 C  C2    . DC  D 3 11  ? 7.367   32.160  16.115  1.00 73.77  ? 11   DC  D C2    1 
ATOM   6012 O  O2    . DC  D 3 11  ? 8.351   31.667  15.537  1.00 73.84  ? 11   DC  D O2    1 
ATOM   6013 N  N3    . DC  D 3 11  ? 7.491   33.217  16.947  1.00 73.97  ? 11   DC  D N3    1 
ATOM   6014 C  C4    . DC  D 3 11  ? 6.418   33.717  17.558  1.00 73.00  ? 11   DC  D C4    1 
ATOM   6015 N  N4    . DC  D 3 11  ? 6.599   34.749  18.384  1.00 73.51  ? 11   DC  D N4    1 
ATOM   6016 C  C5    . DC  D 3 11  ? 5.115   33.179  17.350  1.00 72.15  ? 11   DC  D C5    1 
ATOM   6017 C  C6    . DC  D 3 11  ? 5.003   32.138  16.516  1.00 72.55  ? 11   DC  D C6    1 
ATOM   6018 P  P     . DT  D 3 12  ? 5.974   26.263  14.769  1.00 76.15  ? 12   DT  D P     1 
ATOM   6019 O  OP1   . DT  D 3 12  ? 6.245   25.162  13.809  1.00 76.32  ? 12   DT  D OP1   1 
ATOM   6020 O  OP2   . DT  D 3 12  ? 4.865   26.130  15.741  1.00 74.17  ? 12   DT  D OP2   1 
ATOM   6021 O  "O5'" . DT  D 3 12  ? 7.309   26.629  15.553  1.00 75.97  ? 12   DT  D "O5'" 1 
ATOM   6022 C  "C5'" . DT  D 3 12  ? 8.473   27.073  14.849  1.00 76.74  ? 12   DT  D "C5'" 1 
ATOM   6023 C  "C4'" . DT  D 3 12  ? 9.613   27.292  15.814  1.00 78.29  ? 12   DT  D "C4'" 1 
ATOM   6024 O  "O4'" . DT  D 3 12  ? 9.511   28.575  16.482  1.00 77.86  ? 12   DT  D "O4'" 1 
ATOM   6025 C  "C3'" . DT  D 3 12  ? 9.662   26.241  16.917  1.00 79.98  ? 12   DT  D "C3'" 1 
ATOM   6026 O  "O3'" . DT  D 3 12  ? 10.991  25.807  17.127  1.00 83.40  ? 12   DT  D "O3'" 1 
ATOM   6027 C  "C2'" . DT  D 3 12  ? 9.171   26.975  18.147  1.00 78.75  ? 12   DT  D "C2'" 1 
ATOM   6028 C  "C1'" . DT  D 3 12  ? 9.639   28.388  17.880  1.00 76.97  ? 12   DT  D "C1'" 1 
ATOM   6029 N  N1    . DT  D 3 12  ? 8.834   29.414  18.561  1.00 75.15  ? 12   DT  D N1    1 
ATOM   6030 C  C2    . DT  D 3 12  ? 9.505   30.369  19.286  1.00 74.58  ? 12   DT  D C2    1 
ATOM   6031 O  O2    . DT  D 3 12  ? 10.722  30.415  19.367  1.00 74.08  ? 12   DT  D O2    1 
ATOM   6032 N  N3    . DT  D 3 12  ? 8.699   31.272  19.921  1.00 74.36  ? 12   DT  D N3    1 
ATOM   6033 C  C4    . DT  D 3 12  ? 7.318   31.314  19.908  1.00 74.97  ? 12   DT  D C4    1 
ATOM   6034 O  O4    . DT  D 3 12  ? 6.727   32.191  20.539  1.00 75.88  ? 12   DT  D O4    1 
ATOM   6035 C  C5    . DT  D 3 12  ? 6.677   30.281  19.122  1.00 74.36  ? 12   DT  D C5    1 
ATOM   6036 C  C7    . DT  D 3 12  ? 5.184   30.232  19.062  1.00 74.36  ? 12   DT  D C7    1 
ATOM   6037 C  C6    . DT  D 3 12  ? 7.458   29.403  18.488  1.00 73.64  ? 12   DT  D C6    1 
ATOM   6038 P  P     . DT  D 3 13  ? 11.250  24.294  17.572  1.00 86.62  ? 13   DT  D P     1 
ATOM   6039 O  OP1   . DT  D 3 13  ? 11.571  23.526  16.344  1.00 85.87  ? 13   DT  D OP1   1 
ATOM   6040 O  OP2   . DT  D 3 13  ? 10.108  23.887  18.421  1.00 85.90  ? 13   DT  D OP2   1 
ATOM   6041 O  "O5'" . DT  D 3 13  ? 12.550  24.405  18.473  1.00 88.30  ? 13   DT  D "O5'" 1 
ATOM   6042 C  "C5'" . DT  D 3 13  ? 13.622  25.289  18.136  1.00 90.25  ? 13   DT  D "C5'" 1 
ATOM   6043 C  "C4'" . DT  D 3 13  ? 14.307  25.733  19.403  1.00 91.43  ? 13   DT  D "C4'" 1 
ATOM   6044 O  "O4'" . DT  D 3 13  ? 13.599  26.862  19.973  1.00 91.89  ? 13   DT  D "O4'" 1 
ATOM   6045 C  "C3'" . DT  D 3 13  ? 14.286  24.634  20.469  1.00 92.08  ? 13   DT  D "C3'" 1 
ATOM   6046 O  "O3'" . DT  D 3 13  ? 15.525  24.614  21.181  1.00 93.48  ? 13   DT  D "O3'" 1 
ATOM   6047 C  "C2'" . DT  D 3 13  ? 13.125  25.032  21.363  1.00 91.89  ? 13   DT  D "C2'" 1 
ATOM   6048 C  "C1'" . DT  D 3 13  ? 13.199  26.548  21.299  1.00 91.54  ? 13   DT  D "C1'" 1 
ATOM   6049 N  N1    . DT  D 3 13  ? 11.947  27.280  21.601  1.00 90.66  ? 13   DT  D N1    1 
ATOM   6050 C  C2    . DT  D 3 13  ? 12.057  28.488  22.254  1.00 90.61  ? 13   DT  D C2    1 
ATOM   6051 O  O2    . DT  D 3 13  ? 13.127  28.998  22.563  1.00 89.96  ? 13   DT  D O2    1 
ATOM   6052 N  N3    . DT  D 3 13  ? 10.858  29.090  22.533  1.00 91.20  ? 13   DT  D N3    1 
ATOM   6053 C  C4    . DT  D 3 13  ? 9.593   28.625  22.230  1.00 90.90  ? 13   DT  D C4    1 
ATOM   6054 O  O4    . DT  D 3 13  ? 8.608   29.282  22.558  1.00 92.00  ? 13   DT  D O4    1 
ATOM   6055 C  C5    . DT  D 3 13  ? 9.551   27.360  21.534  1.00 90.16  ? 13   DT  D C5    1 
ATOM   6056 C  C7    . DT  D 3 13  ? 8.225   26.771  21.168  1.00 88.86  ? 13   DT  D C7    1 
ATOM   6057 C  C6    . DT  D 3 13  ? 10.714  26.763  21.254  1.00 90.36  ? 13   DT  D C6    1 
ATOM   6058 P  P     . DC  D 3 14  ? 15.737  23.563  22.378  1.00 93.62  ? 14   DC  D P     1 
ATOM   6059 O  OP1   . DC  D 3 14  ? 17.212  23.485  22.585  1.00 93.06  ? 14   DC  D OP1   1 
ATOM   6060 O  OP2   . DC  D 3 14  ? 14.976  22.335  22.057  1.00 93.65  ? 14   DC  D OP2   1 
ATOM   6061 O  "O5'" . DC  D 3 14  ? 15.043  24.280  23.624  1.00 92.06  ? 14   DC  D "O5'" 1 
ATOM   6062 C  "C5'" . DC  D 3 14  ? 15.498  25.558  24.079  1.00 90.26  ? 14   DC  D "C5'" 1 
ATOM   6063 C  "C4'" . DC  D 3 14  ? 14.870  25.908  25.409  1.00 89.34  ? 14   DC  D "C4'" 1 
ATOM   6064 O  "O4'" . DC  D 3 14  ? 13.626  26.634  25.245  1.00 88.90  ? 14   DC  D "O4'" 1 
ATOM   6065 C  "C3'" . DC  D 3 14  ? 14.566  24.727  26.336  1.00 89.06  ? 14   DC  D "C3'" 1 
ATOM   6066 O  "O3'" . DC  D 3 14  ? 15.013  25.027  27.661  1.00 88.37  ? 14   DC  D "O3'" 1 
ATOM   6067 C  "C2'" . DC  D 3 14  ? 13.049  24.665  26.329  1.00 88.89  ? 14   DC  D "C2'" 1 
ATOM   6068 C  "C1'" . DC  D 3 14  ? 12.692  26.131  26.177  1.00 88.53  ? 14   DC  D "C1'" 1 
ATOM   6069 N  N1    . DC  D 3 14  ? 11.334  26.435  25.688  1.00 88.87  ? 14   DC  D N1    1 
ATOM   6070 C  C2    . DC  D 3 14  ? 10.672  27.561  26.203  1.00 89.28  ? 14   DC  D C2    1 
ATOM   6071 O  O2    . DC  D 3 14  ? 11.257  28.280  27.039  1.00 89.82  ? 14   DC  D O2    1 
ATOM   6072 N  N3    . DC  D 3 14  ? 9.418   27.838  25.779  1.00 88.94  ? 14   DC  D N3    1 
ATOM   6073 C  C4    . DC  D 3 14  ? 8.827   27.049  24.881  1.00 89.38  ? 14   DC  D C4    1 
ATOM   6074 N  N4    . DC  D 3 14  ? 7.591   27.362  24.496  1.00 90.40  ? 14   DC  D N4    1 
ATOM   6075 C  C5    . DC  D 3 14  ? 9.479   25.906  24.336  1.00 89.30  ? 14   DC  D C5    1 
ATOM   6076 C  C6    . DC  D 3 14  ? 10.719  25.640  24.760  1.00 89.17  ? 14   DC  D C6    1 
ATOM   6077 P  P     . DC  D 3 15  ? 15.560  23.851  28.616  1.00 86.53  ? 15   DC  D P     1 
ATOM   6078 O  OP1   . DC  D 3 15  ? 17.020  23.734  28.332  1.00 85.43  ? 15   DC  D OP1   1 
ATOM   6079 O  OP2   . DC  D 3 15  ? 14.679  22.673  28.448  1.00 84.93  ? 15   DC  D OP2   1 
ATOM   6080 O  "O5'" . DC  D 3 15  ? 15.349  24.454  30.074  1.00 86.58  ? 15   DC  D "O5'" 1 
ATOM   6081 C  "C5'" . DC  D 3 15  ? 15.582  25.841  30.334  1.00 87.37  ? 15   DC  D "C5'" 1 
ATOM   6082 C  "C4'" . DC  D 3 15  ? 14.469  26.419  31.180  1.00 87.68  ? 15   DC  D "C4'" 1 
ATOM   6083 O  "O4'" . DC  D 3 15  ? 13.293  26.749  30.386  1.00 87.23  ? 15   DC  D "O4'" 1 
ATOM   6084 C  "C3'" . DC  D 3 15  ? 13.989  25.493  32.302  1.00 88.11  ? 15   DC  D "C3'" 1 
ATOM   6085 O  "O3'" . DC  D 3 15  ? 13.875  26.230  33.518  1.00 89.74  ? 15   DC  D "O3'" 1 
ATOM   6086 C  "C2'" . DC  D 3 15  ? 12.613  25.053  31.832  1.00 88.21  ? 15   DC  D "C2'" 1 
ATOM   6087 C  "C1'" . DC  D 3 15  ? 12.137  26.277  31.067  1.00 86.81  ? 15   DC  D "C1'" 1 
ATOM   6088 N  N1    . DC  D 3 15  ? 11.046  26.038  30.085  1.00 85.25  ? 15   DC  D N1    1 
ATOM   6089 C  C2    . DC  D 3 15  ? 9.913   26.889  30.096  1.00 84.32  ? 15   DC  D C2    1 
ATOM   6090 O  O2    . DC  D 3 15  ? 9.875   27.848  30.888  1.00 84.56  ? 15   DC  D O2    1 
ATOM   6091 N  N3    . DC  D 3 15  ? 8.896   26.642  29.237  1.00 82.68  ? 15   DC  D N3    1 
ATOM   6092 C  C4    . DC  D 3 15  ? 8.976   25.620  28.381  1.00 82.55  ? 15   DC  D C4    1 
ATOM   6093 N  N4    . DC  D 3 15  ? 7.952   25.417  27.549  1.00 81.85  ? 15   DC  D N4    1 
ATOM   6094 C  C5    . DC  D 3 15  ? 10.111  24.759  28.336  1.00 82.67  ? 15   DC  D C5    1 
ATOM   6095 C  C6    . DC  D 3 15  ? 11.113  25.001  29.194  1.00 84.01  ? 15   DC  D C6    1 
ATOM   6096 P  P     . DC  D 3 16  ? 13.614  25.451  34.903  1.00 90.86  ? 16   DC  D P     1 
ATOM   6097 O  OP1   . DC  D 3 16  ? 14.431  26.164  35.923  1.00 90.96  ? 16   DC  D OP1   1 
ATOM   6098 O  OP2   . DC  D 3 16  ? 13.828  24.005  34.671  1.00 90.25  ? 16   DC  D OP2   1 
ATOM   6099 O  "O5'" . DC  D 3 16  ? 12.065  25.702  35.187  1.00 90.02  ? 16   DC  D "O5'" 1 
ATOM   6100 C  "C5'" . DC  D 3 16  ? 11.570  27.025  35.411  1.00 90.20  ? 16   DC  D "C5'" 1 
ATOM   6101 C  "C4'" . DC  D 3 16  ? 10.072  27.006  35.612  1.00 90.53  ? 16   DC  D "C4'" 1 
ATOM   6102 O  "O4'" . DC  D 3 16  ? 9.395   26.753  34.353  1.00 89.45  ? 16   DC  D "O4'" 1 
ATOM   6103 C  "C3'" . DC  D 3 16  ? 9.566   25.951  36.598  1.00 91.23  ? 16   DC  D "C3'" 1 
ATOM   6104 O  "O3'" . DC  D 3 16  ? 8.539   26.513  37.416  1.00 94.31  ? 16   DC  D "O3'" 1 
ATOM   6105 C  "C2'" . DC  D 3 16  ? 8.970   24.885  35.697  1.00 90.16  ? 16   DC  D "C2'" 1 
ATOM   6106 C  "C1'" . DC  D 3 16  ? 8.455   25.705  34.519  1.00 87.99  ? 16   DC  D "C1'" 1 
ATOM   6107 N  N1    . DC  D 3 16  ? 8.332   24.972  33.237  1.00 84.83  ? 16   DC  D N1    1 
ATOM   6108 C  C2    . DC  D 3 16  ? 7.115   25.019  32.544  1.00 83.10  ? 16   DC  D C2    1 
ATOM   6109 O  O2    . DC  D 3 16  ? 6.193   25.708  32.989  1.00 82.64  ? 16   DC  D O2    1 
ATOM   6110 N  N3    . DC  D 3 16  ? 6.977   24.313  31.406  1.00 82.06  ? 16   DC  D N3    1 
ATOM   6111 C  C4    . DC  D 3 16  ? 7.995   23.587  30.944  1.00 82.65  ? 16   DC  D C4    1 
ATOM   6112 N  N4    . DC  D 3 16  ? 7.808   22.893  29.822  1.00 82.66  ? 16   DC  D N4    1 
ATOM   6113 C  C5    . DC  D 3 16  ? 9.249   23.539  31.611  1.00 83.05  ? 16   DC  D C5    1 
ATOM   6114 C  C6    . DC  D 3 16  ? 9.376   24.241  32.740  1.00 83.57  ? 16   DC  D C6    1 
ATOM   6115 P  P     . DC  D 3 17  ? 8.305   25.952  38.904  1.00 96.59  ? 17   DC  D P     1 
ATOM   6116 O  OP1   . DC  D 3 17  ? 8.872   26.968  39.822  1.00 96.99  ? 17   DC  D OP1   1 
ATOM   6117 O  OP2   . DC  D 3 17  ? 8.792   24.556  38.969  1.00 97.02  ? 17   DC  D OP2   1 
ATOM   6118 O  "O5'" . DC  D 3 17  ? 6.719   25.957  39.042  1.00 98.55  ? 17   DC  D "O5'" 1 
ATOM   6119 C  "C5'" . DC  D 3 17  ? 5.957   27.142  38.790  1.00 100.37 ? 17   DC  D "C5'" 1 
ATOM   6120 C  "C4'" . DC  D 3 17  ? 4.504   26.791  38.568  1.00 101.49 ? 17   DC  D "C4'" 1 
ATOM   6121 O  "O4'" . DC  D 3 17  ? 4.319   26.217  37.252  1.00 100.09 ? 17   DC  D "O4'" 1 
ATOM   6122 C  "C3'" . DC  D 3 17  ? 3.956   25.764  39.559  1.00 102.38 ? 17   DC  D "C3'" 1 
ATOM   6123 O  "O3'" . DC  D 3 17  ? 2.582   26.061  39.829  1.00 104.99 ? 17   DC  D "O3'" 1 
ATOM   6124 C  "C2'" . DC  D 3 17  ? 4.086   24.461  38.794  1.00 100.47 ? 17   DC  D "C2'" 1 
ATOM   6125 C  "C1'" . DC  D 3 17  ? 3.769   24.914  37.376  1.00 99.32  ? 17   DC  D "C1'" 1 
ATOM   6126 N  N1    . DC  D 3 17  ? 4.311   24.091  36.281  1.00 97.84  ? 17   DC  D N1    1 
ATOM   6127 C  C2    . DC  D 3 17  ? 3.452   23.717  35.234  1.00 97.10  ? 17   DC  D C2    1 
ATOM   6128 O  O2    . DC  D 3 17  ? 2.257   24.054  35.285  1.00 97.10  ? 17   DC  D O2    1 
ATOM   6129 N  N3    . DC  D 3 17  ? 3.942   22.996  34.201  1.00 96.03  ? 17   DC  D N3    1 
ATOM   6130 C  C4    . DC  D 3 17  ? 5.225   22.638  34.189  1.00 95.66  ? 17   DC  D C4    1 
ATOM   6131 N  N4    . DC  D 3 17  ? 5.661   21.946  33.137  1.00 95.38  ? 17   DC  D N4    1 
ATOM   6132 C  C5    . DC  D 3 17  ? 6.117   22.981  35.252  1.00 95.84  ? 17   DC  D C5    1 
ATOM   6133 C  C6    . DC  D 3 17  ? 5.624   23.703  36.267  1.00 96.87  ? 17   DC  D C6    1 
ATOM   6134 P  P     . DC  D 3 18  ? 2.215   27.132  40.968  1.00 107.45 ? 18   DC  D P     1 
ATOM   6135 O  OP1   . DC  D 3 18  ? 2.712   28.461  40.496  1.00 106.22 ? 18   DC  D OP1   1 
ATOM   6136 O  OP2   . DC  D 3 18  ? 2.710   26.562  42.241  1.00 107.48 ? 18   DC  D OP2   1 
ATOM   6137 O  "O5'" . DC  D 3 18  ? 0.622   27.148  40.974  1.00 107.36 ? 18   DC  D "O5'" 1 
ATOM   6138 C  "C5'" . DC  D 3 18  ? -0.124  26.038  41.480  1.00 107.90 ? 18   DC  D "C5'" 1 
ATOM   6139 C  "C4'" . DC  D 3 18  ? -1.268  25.715  40.547  1.00 108.11 ? 18   DC  D "C4'" 1 
ATOM   6140 O  "O4'" . DC  D 3 18  ? -0.723  25.226  39.302  1.00 107.83 ? 18   DC  D "O4'" 1 
ATOM   6141 C  "C3'" . DC  D 3 18  ? -2.215  24.625  41.048  1.00 108.10 ? 18   DC  D "C3'" 1 
ATOM   6142 O  "O3'" . DC  D 3 18  ? -3.520  24.774  40.464  1.00 108.15 ? 18   DC  D "O3'" 1 
ATOM   6143 C  "C2'" . DC  D 3 18  ? -1.614  23.366  40.460  1.00 108.35 ? 18   DC  D "C2'" 1 
ATOM   6144 C  "C1'" . DC  D 3 18  ? -1.077  23.864  39.121  1.00 108.50 ? 18   DC  D "C1'" 1 
ATOM   6145 N  N1    . DC  D 3 18  ? 0.110   23.153  38.624  1.00 108.77 ? 18   DC  D N1    1 
ATOM   6146 C  C2    . DC  D 3 18  ? 0.128   22.713  37.292  1.00 108.98 ? 18   DC  D C2    1 
ATOM   6147 O  O2    . DC  D 3 18  ? -0.848  22.958  36.554  1.00 109.73 ? 18   DC  D O2    1 
ATOM   6148 N  N3    . DC  D 3 18  ? 1.207   22.030  36.845  1.00 108.66 ? 18   DC  D N3    1 
ATOM   6149 C  C4    . DC  D 3 18  ? 2.231   21.784  37.669  1.00 109.04 ? 18   DC  D C4    1 
ATOM   6150 N  N4    . DC  D 3 18  ? 3.276   21.107  37.202  1.00 109.29 ? 18   DC  D N4    1 
ATOM   6151 C  C5    . DC  D 3 18  ? 2.234   22.224  39.017  1.00 109.18 ? 18   DC  D C5    1 
ATOM   6152 C  C6    . DC  D 3 18  ? 1.174   22.906  39.447  1.00 108.92 ? 18   DC  D C6    1 
ATOM   6153 O  "O5'" . DG  E 2 1   ? 6.590   113.053 5.026   1.00 84.58  ? 1    DG  E "O5'" 1 
ATOM   6154 C  "C5'" . DG  E 2 1   ? 5.571   112.185 4.527   1.00 85.51  ? 1    DG  E "C5'" 1 
ATOM   6155 C  "C4'" . DG  E 2 1   ? 5.434   110.929 5.358   1.00 86.11  ? 1    DG  E "C4'" 1 
ATOM   6156 O  "O4'" . DG  E 2 1   ? 4.448   110.063 4.742   1.00 85.34  ? 1    DG  E "O4'" 1 
ATOM   6157 C  "C3'" . DG  E 2 1   ? 6.717   110.102 5.471   1.00 87.13  ? 1    DG  E "C3'" 1 
ATOM   6158 O  "O3'" . DG  E 2 1   ? 6.834   109.563 6.802   1.00 88.84  ? 1    DG  E "O3'" 1 
ATOM   6159 C  "C2'" . DG  E 2 1   ? 6.545   109.027 4.409   1.00 86.16  ? 1    DG  E "C2'" 1 
ATOM   6160 C  "C1'" . DG  E 2 1   ? 5.035   108.833 4.331   1.00 84.50  ? 1    DG  E "C1'" 1 
ATOM   6161 N  N9    . DG  E 2 1   ? 4.536   108.533 2.989   1.00 82.69  ? 1    DG  E N9    1 
ATOM   6162 C  C8    . DG  E 2 1   ? 4.999   109.047 1.802   1.00 81.80  ? 1    DG  E C8    1 
ATOM   6163 N  N7    . DG  E 2 1   ? 4.339   108.615 0.764   1.00 80.92  ? 1    DG  E N7    1 
ATOM   6164 C  C5    . DG  E 2 1   ? 3.383   107.760 1.292   1.00 80.42  ? 1    DG  E C5    1 
ATOM   6165 C  C6    . DG  E 2 1   ? 2.378   107.004 0.646   1.00 79.82  ? 1    DG  E C6    1 
ATOM   6166 O  O6    . DG  E 2 1   ? 2.120   106.948 -0.553  1.00 80.11  ? 1    DG  E O6    1 
ATOM   6167 N  N1    . DG  E 2 1   ? 1.631   106.263 1.550   1.00 79.76  ? 1    DG  E N1    1 
ATOM   6168 C  C2    . DG  E 2 1   ? 1.820   106.253 2.908   1.00 81.21  ? 1    DG  E C2    1 
ATOM   6169 N  N2    . DG  E 2 1   ? 0.992   105.473 3.614   1.00 82.00  ? 1    DG  E N2    1 
ATOM   6170 N  N3    . DG  E 2 1   ? 2.754   106.958 3.528   1.00 81.78  ? 1    DG  E N3    1 
ATOM   6171 C  C4    . DG  E 2 1   ? 3.495   107.687 2.663   1.00 81.72  ? 1    DG  E C4    1 
ATOM   6172 P  P     . DG  E 2 2   ? 8.099   108.642 7.197   1.00 89.17  ? 2    DG  E P     1 
ATOM   6173 O  OP1   . DG  E 2 2   ? 8.223   108.691 8.679   1.00 88.64  ? 2    DG  E OP1   1 
ATOM   6174 O  OP2   . DG  E 2 2   ? 9.252   109.027 6.351   1.00 88.96  ? 2    DG  E OP2   1 
ATOM   6175 O  "O5'" . DG  E 2 2   ? 7.614   107.190 6.773   1.00 87.64  ? 2    DG  E "O5'" 1 
ATOM   6176 C  "C5'" . DG  E 2 2   ? 6.395   106.653 7.291   1.00 85.13  ? 2    DG  E "C5'" 1 
ATOM   6177 C  "C4'" . DG  E 2 2   ? 6.219   105.229 6.823   1.00 83.61  ? 2    DG  E "C4'" 1 
ATOM   6178 O  "O4'" . DG  E 2 2   ? 5.652   105.171 5.488   1.00 82.70  ? 2    DG  E "O4'" 1 
ATOM   6179 C  "C3'" . DG  E 2 2   ? 7.508   104.405 6.787   1.00 83.27  ? 2    DG  E "C3'" 1 
ATOM   6180 O  "O3'" . DG  E 2 2   ? 7.228   103.140 7.376   1.00 85.74  ? 2    DG  E "O3'" 1 
ATOM   6181 C  "C2'" . DG  E 2 2   ? 7.799   104.273 5.302   1.00 81.87  ? 2    DG  E "C2'" 1 
ATOM   6182 C  "C1'" . DG  E 2 2   ? 6.405   104.270 4.695   1.00 80.32  ? 2    DG  E "C1'" 1 
ATOM   6183 N  N9    . DG  E 2 2   ? 6.334   104.709 3.299   1.00 76.81  ? 2    DG  E N9    1 
ATOM   6184 C  C8    . DG  E 2 2   ? 7.275   105.439 2.608   1.00 75.51  ? 2    DG  E C8    1 
ATOM   6185 N  N7    . DG  E 2 2   ? 6.956   105.641 1.359   1.00 74.04  ? 2    DG  E N7    1 
ATOM   6186 C  C5    . DG  E 2 2   ? 5.725   105.017 1.213   1.00 72.61  ? 2    DG  E C5    1 
ATOM   6187 C  C6    . DG  E 2 2   ? 4.895   104.898 0.080   1.00 70.85  ? 2    DG  E C6    1 
ATOM   6188 O  O6    . DG  E 2 2   ? 5.089   105.330 -1.058  1.00 68.47  ? 2    DG  E O6    1 
ATOM   6189 N  N1    . DG  E 2 2   ? 3.734   104.187 0.370   1.00 70.84  ? 2    DG  E N1    1 
ATOM   6190 C  C2    . DG  E 2 2   ? 3.415   103.655 1.599   1.00 71.05  ? 2    DG  E C2    1 
ATOM   6191 N  N2    . DG  E 2 2   ? 2.248   102.997 1.687   1.00 69.57  ? 2    DG  E N2    1 
ATOM   6192 N  N3    . DG  E 2 2   ? 4.185   103.759 2.665   1.00 72.19  ? 2    DG  E N3    1 
ATOM   6193 C  C4    . DG  E 2 2   ? 5.318   104.446 2.404   1.00 73.96  ? 2    DG  E C4    1 
ATOM   6194 P  P     . DG  E 2 3   ? 8.341   101.974 7.401   1.00 87.01  ? 3    DG  E P     1 
ATOM   6195 O  OP1   . DG  E 2 3   ? 8.888   101.949 8.782   1.00 88.12  ? 3    DG  E OP1   1 
ATOM   6196 O  OP2   . DG  E 2 3   ? 9.269   102.107 6.255   1.00 86.09  ? 3    DG  E OP2   1 
ATOM   6197 O  "O5'" . DG  E 2 3   ? 7.419   100.693 7.190   1.00 85.88  ? 3    DG  E "O5'" 1 
ATOM   6198 C  "C5'" . DG  E 2 3   ? 6.006   100.776 7.407   1.00 82.56  ? 3    DG  E "C5'" 1 
ATOM   6199 C  "C4'" . DG  E 2 3   ? 5.258   100.040 6.320   1.00 80.41  ? 3    DG  E "C4'" 1 
ATOM   6200 O  "O4'" . DG  E 2 3   ? 5.219   100.806 5.086   1.00 77.77  ? 3    DG  E "O4'" 1 
ATOM   6201 C  "C3'" . DG  E 2 3   ? 5.887   98.689  5.974   1.00 80.54  ? 3    DG  E "C3'" 1 
ATOM   6202 O  "O3'" . DG  E 2 3   ? 4.884   97.677  5.932   1.00 82.72  ? 3    DG  E "O3'" 1 
ATOM   6203 C  "C2'" . DG  E 2 3   ? 6.497   98.913  4.603   1.00 78.16  ? 3    DG  E "C2'" 1 
ATOM   6204 C  "C1'" . DG  E 2 3   ? 5.574   99.961  4.005   1.00 75.89  ? 3    DG  E "C1'" 1 
ATOM   6205 N  N9    . DG  E 2 3   ? 6.191   100.765 2.953   1.00 72.05  ? 3    DG  E N9    1 
ATOM   6206 C  C8    . DG  E 2 3   ? 7.325   101.534 3.050   1.00 70.23  ? 3    DG  E C8    1 
ATOM   6207 N  N7    . DG  E 2 3   ? 7.676   102.076 1.915   1.00 70.77  ? 3    DG  E N7    1 
ATOM   6208 C  C5    . DG  E 2 3   ? 6.704   101.656 1.013   1.00 71.10  ? 3    DG  E C5    1 
ATOM   6209 C  C6    . DG  E 2 3   ? 6.561   101.915 -0.389  1.00 70.89  ? 3    DG  E C6    1 
ATOM   6210 O  O6    . DG  E 2 3   ? 7.284   102.595 -1.131  1.00 70.37  ? 3    DG  E O6    1 
ATOM   6211 N  N1    . DG  E 2 3   ? 5.439   101.283 -0.911  1.00 70.97  ? 3    DG  E N1    1 
ATOM   6212 C  C2    . DG  E 2 3   ? 4.563   100.503 -0.193  1.00 70.90  ? 3    DG  E C2    1 
ATOM   6213 N  N2    . DG  E 2 3   ? 3.546   99.967  -0.893  1.00 71.01  ? 3    DG  E N2    1 
ATOM   6214 N  N3    . DG  E 2 3   ? 4.678   100.262 1.108   1.00 69.90  ? 3    DG  E N3    1 
ATOM   6215 C  C4    . DG  E 2 3   ? 5.768   100.861 1.641   1.00 71.04  ? 3    DG  E C4    1 
ATOM   6216 P  P     . DG  E 2 4   ? 5.116   96.294  6.722   1.00 84.16  ? 4    DG  E P     1 
ATOM   6217 O  OP1   . DG  E 2 4   ? 4.330   96.379  7.984   1.00 84.04  ? 4    DG  E OP1   1 
ATOM   6218 O  OP2   . DG  E 2 4   ? 6.572   96.030  6.780   1.00 83.42  ? 4    DG  E OP2   1 
ATOM   6219 O  "O5'" . DG  E 2 4   ? 4.436   95.234  5.756   1.00 82.62  ? 4    DG  E "O5'" 1 
ATOM   6220 C  "C5'" . DG  E 2 4   ? 5.207   94.592  4.739   1.00 80.55  ? 4    DG  E "C5'" 1 
ATOM   6221 C  "C4'" . DG  E 2 4   ? 4.500   94.676  3.408   1.00 77.22  ? 4    DG  E "C4'" 1 
ATOM   6222 O  "O4'" . DG  E 2 4   ? 4.804   95.933  2.745   1.00 76.00  ? 4    DG  E "O4'" 1 
ATOM   6223 C  "C3'" . DG  E 2 4   ? 4.956   93.575  2.458   1.00 75.89  ? 4    DG  E "C3'" 1 
ATOM   6224 O  "O3'" . DG  E 2 4   ? 3.819   92.987  1.826   1.00 73.61  ? 4    DG  E "O3'" 1 
ATOM   6225 C  "C2'" . DG  E 2 4   ? 5.867   94.277  1.469   1.00 75.59  ? 4    DG  E "C2'" 1 
ATOM   6226 C  "C1'" . DG  E 2 4   ? 5.325   95.691  1.442   1.00 74.93  ? 4    DG  E "C1'" 1 
ATOM   6227 N  N9    . DG  E 2 4   ? 6.370   96.674  1.171   1.00 73.62  ? 4    DG  E N9    1 
ATOM   6228 C  C8    . DG  E 2 4   ? 7.315   97.154  2.048   1.00 73.22  ? 4    DG  E C8    1 
ATOM   6229 N  N7    . DG  E 2 4   ? 8.136   98.006  1.501   1.00 72.80  ? 4    DG  E N7    1 
ATOM   6230 C  C5    . DG  E 2 4   ? 7.702   98.105  0.186   1.00 72.48  ? 4    DG  E C5    1 
ATOM   6231 C  C6    . DG  E 2 4   ? 8.201   98.884  -0.895  1.00 72.24  ? 4    DG  E C6    1 
ATOM   6232 O  O6    . DG  E 2 4   ? 9.143   99.686  -0.901  1.00 71.30  ? 4    DG  E O6    1 
ATOM   6233 N  N1    . DG  E 2 4   ? 7.480   98.658  -2.060  1.00 73.43  ? 4    DG  E N1    1 
ATOM   6234 C  C2    . DG  E 2 4   ? 6.412   97.801  -2.176  1.00 74.45  ? 4    DG  E C2    1 
ATOM   6235 N  N2    . DG  E 2 4   ? 5.862   97.704  -3.400  1.00 74.07  ? 4    DG  E N2    1 
ATOM   6236 N  N3    . DG  E 2 4   ? 5.924   97.088  -1.172  1.00 73.92  ? 4    DG  E N3    1 
ATOM   6237 C  C4    . DG  E 2 4   ? 6.614   97.286  -0.031  1.00 72.91  ? 4    DG  E C4    1 
ATOM   6238 P  P     . DG  E 2 5   ? 3.905   91.472  1.310   1.00 69.90  ? 5    DG  E P     1 
ATOM   6239 O  OP1   . DG  E 2 5   ? 2.504   91.033  1.085   1.00 68.45  ? 5    DG  E OP1   1 
ATOM   6240 O  OP2   . DG  E 2 5   ? 4.760   90.743  2.273   1.00 69.81  ? 5    DG  E OP2   1 
ATOM   6241 O  "O5'" . DG  E 2 5   ? 4.660   91.625  -0.088  1.00 66.25  ? 5    DG  E "O5'" 1 
ATOM   6242 C  "C5'" . DG  E 2 5   ? 3.999   92.265  -1.183  1.00 62.13  ? 5    DG  E "C5'" 1 
ATOM   6243 C  "C4'" . DG  E 2 5   ? 4.941   92.481  -2.341  1.00 59.75  ? 5    DG  E "C4'" 1 
ATOM   6244 O  "O4'" . DG  E 2 5   ? 5.776   93.649  -2.143  1.00 58.21  ? 5    DG  E "O4'" 1 
ATOM   6245 C  "C3'" . DG  E 2 5   ? 5.880   91.318  -2.674  1.00 59.63  ? 5    DG  E "C3'" 1 
ATOM   6246 O  "O3'" . DG  E 2 5   ? 5.831   91.094  -4.087  1.00 61.25  ? 5    DG  E "O3'" 1 
ATOM   6247 C  "C2'" . DG  E 2 5   ? 7.246   91.861  -2.286  1.00 58.89  ? 5    DG  E "C2'" 1 
ATOM   6248 C  "C1'" . DG  E 2 5   ? 7.079   93.339  -2.582  1.00 57.11  ? 5    DG  E "C1'" 1 
ATOM   6249 N  N9    . DG  E 2 5   ? 8.021   94.250  -1.938  1.00 54.85  ? 5    DG  E N9    1 
ATOM   6250 C  C8    . DG  E 2 5   ? 8.337   94.336  -0.604  1.00 53.68  ? 5    DG  E C8    1 
ATOM   6251 N  N7    . DG  E 2 5   ? 9.244   95.241  -0.349  1.00 53.33  ? 5    DG  E N7    1 
ATOM   6252 C  C5    . DG  E 2 5   ? 9.539   95.792  -1.590  1.00 53.85  ? 5    DG  E C5    1 
ATOM   6253 C  C6    . DG  E 2 5   ? 10.454  96.822  -1.954  1.00 53.67  ? 5    DG  E C6    1 
ATOM   6254 O  O6    . DG  E 2 5   ? 11.209  97.477  -1.225  1.00 54.52  ? 5    DG  E O6    1 
ATOM   6255 N  N1    . DG  E 2 5   ? 10.442  97.058  -3.327  1.00 51.90  ? 5    DG  E N1    1 
ATOM   6256 C  C2    . DG  E 2 5   ? 9.660   96.390  -4.233  1.00 50.80  ? 5    DG  E C2    1 
ATOM   6257 N  N2    . DG  E 2 5   ? 9.823   96.722  -5.513  1.00 48.80  ? 5    DG  E N2    1 
ATOM   6258 N  N3    . DG  E 2 5   ? 8.792   95.450  -3.907  1.00 53.04  ? 5    DG  E N3    1 
ATOM   6259 C  C4    . DG  E 2 5   ? 8.788   95.197  -2.579  1.00 54.25  ? 5    DG  E C4    1 
ATOM   6260 P  P     . DA  E 2 6   ? 6.133   89.637  -4.692  1.00 61.29  ? 6    DA  E P     1 
ATOM   6261 O  OP1   . DA  E 2 6   ? 4.972   89.365  -5.577  1.00 61.11  ? 6    DA  E OP1   1 
ATOM   6262 O  OP2   . DA  E 2 6   ? 6.477   88.691  -3.608  1.00 59.82  ? 6    DA  E OP2   1 
ATOM   6263 O  "O5'" . DA  E 2 6   ? 7.413   89.899  -5.598  1.00 60.85  ? 6    DA  E "O5'" 1 
ATOM   6264 C  "C5'" . DA  E 2 6   ? 7.326   90.805  -6.701  1.00 61.40  ? 6    DA  E "C5'" 1 
ATOM   6265 C  "C4'" . DA  E 2 6   ? 8.701   91.185  -7.191  1.00 61.18  ? 6    DA  E "C4'" 1 
ATOM   6266 O  "O4'" . DA  E 2 6   ? 9.278   92.257  -6.404  1.00 60.06  ? 6    DA  E "O4'" 1 
ATOM   6267 C  "C3'" . DA  E 2 6   ? 9.705   90.039  -7.169  1.00 61.84  ? 6    DA  E "C3'" 1 
ATOM   6268 O  "O3'" . DA  E 2 6   ? 10.423  90.019  -8.393  1.00 63.04  ? 6    DA  E "O3'" 1 
ATOM   6269 C  "C2'" . DA  E 2 6   ? 10.635  90.409  -6.028  1.00 62.35  ? 6    DA  E "C2'" 1 
ATOM   6270 C  "C1'" . DA  E 2 6   ? 10.623  91.924  -6.101  1.00 61.45  ? 6    DA  E "C1'" 1 
ATOM   6271 N  N9    . DA  E 2 6   ? 11.014  92.616  -4.867  1.00 61.31  ? 6    DA  E N9    1 
ATOM   6272 C  C8    . DA  E 2 6   ? 10.618  92.357  -3.576  1.00 61.41  ? 6    DA  E C8    1 
ATOM   6273 N  N7    . DA  E 2 6   ? 11.170  93.143  -2.685  1.00 60.49  ? 6    DA  E N7    1 
ATOM   6274 C  C5    . DA  E 2 6   ? 11.982  93.980  -3.437  1.00 61.52  ? 6    DA  E C5    1 
ATOM   6275 C  C6    . DA  E 2 6   ? 12.843  95.035  -3.081  1.00 61.91  ? 6    DA  E C6    1 
ATOM   6276 N  N6    . DA  E 2 6   ? 13.039  95.439  -1.823  1.00 63.56  ? 6    DA  E N6    1 
ATOM   6277 N  N1    . DA  E 2 6   ? 13.507  95.668  -4.071  1.00 61.40  ? 6    DA  E N1    1 
ATOM   6278 C  C2    . DA  E 2 6   ? 13.313  95.262  -5.327  1.00 61.73  ? 6    DA  E C2    1 
ATOM   6279 N  N3    . DA  E 2 6   ? 12.533  94.284  -5.789  1.00 62.36  ? 6    DA  E N3    1 
ATOM   6280 C  C4    . DA  E 2 6   ? 11.890  93.673  -4.781  1.00 61.40  ? 6    DA  E C4    1 
ATOM   6281 P  P     . DA  E 2 7   ? 11.059  88.646  -8.912  1.00 64.68  ? 7    DA  E P     1 
ATOM   6282 O  OP1   . DA  E 2 7   ? 10.339  88.313  -10.159 1.00 67.08  ? 7    DA  E OP1   1 
ATOM   6283 O  OP2   . DA  E 2 7   ? 11.068  87.675  -7.795  1.00 63.55  ? 7    DA  E OP2   1 
ATOM   6284 O  "O5'" . DA  E 2 7   ? 12.550  89.071  -9.253  1.00 64.56  ? 7    DA  E "O5'" 1 
ATOM   6285 C  "C5'" . DA  E 2 7   ? 12.814  90.230  -10.047 1.00 64.91  ? 7    DA  E "C5'" 1 
ATOM   6286 C  "C4'" . DA  E 2 7   ? 14.187  90.774  -9.735  1.00 66.49  ? 7    DA  E "C4'" 1 
ATOM   6287 O  "O4'" . DA  E 2 7   ? 14.148  91.603  -8.547  1.00 66.00  ? 7    DA  E "O4'" 1 
ATOM   6288 C  "C3'" . DA  E 2 7   ? 15.264  89.709  -9.492  1.00 67.71  ? 7    DA  E "C3'" 1 
ATOM   6289 O  "O3'" . DA  E 2 7   ? 16.457  90.070  -10.190 1.00 69.64  ? 7    DA  E "O3'" 1 
ATOM   6290 C  "C2'" . DA  E 2 7   ? 15.498  89.790  -7.995  1.00 67.79  ? 7    DA  E "C2'" 1 
ATOM   6291 C  "C1'" . DA  E 2 7   ? 15.246  91.263  -7.729  1.00 68.10  ? 7    DA  E "C1'" 1 
ATOM   6292 N  N9    . DA  E 2 7   ? 14.908  91.575  -6.342  1.00 69.45  ? 7    DA  E N9    1 
ATOM   6293 C  C8    . DA  E 2 7   ? 13.962  90.986  -5.539  1.00 69.60  ? 7    DA  E C8    1 
ATOM   6294 N  N7    . DA  E 2 7   ? 13.949  91.447  -4.311  1.00 70.31  ? 7    DA  E N7    1 
ATOM   6295 C  C5    . DA  E 2 7   ? 14.944  92.416  -4.307  1.00 70.59  ? 7    DA  E C5    1 
ATOM   6296 C  C6    . DA  E 2 7   ? 15.436  93.265  -3.295  1.00 70.63  ? 7    DA  E C6    1 
ATOM   6297 N  N6    . DA  E 2 7   ? 14.996  93.246  -2.028  1.00 69.25  ? 7    DA  E N6    1 
ATOM   6298 N  N1    . DA  E 2 7   ? 16.418  94.134  -3.631  1.00 70.65  ? 7    DA  E N1    1 
ATOM   6299 C  C2    . DA  E 2 7   ? 16.883  94.124  -4.893  1.00 70.07  ? 7    DA  E C2    1 
ATOM   6300 N  N3    . DA  E 2 7   ? 16.517  93.361  -5.923  1.00 69.63  ? 7    DA  E N3    1 
ATOM   6301 C  C4    . DA  E 2 7   ? 15.530  92.520  -5.560  1.00 70.20  ? 7    DA  E C4    1 
ATOM   6302 P  P     . DG  E 2 8   ? 17.721  89.067  -10.217 1.00 72.13  ? 8    DG  E P     1 
ATOM   6303 O  OP1   . DG  E 2 8   ? 17.925  88.737  -11.650 1.00 71.89  ? 8    DG  E OP1   1 
ATOM   6304 O  OP2   . DG  E 2 8   ? 17.551  87.977  -9.230  1.00 70.68  ? 8    DG  E OP2   1 
ATOM   6305 O  "O5'" . DG  E 2 8   ? 18.917  90.001  -9.747  1.00 72.22  ? 8    DG  E "O5'" 1 
ATOM   6306 C  "C5'" . DG  E 2 8   ? 19.067  91.318  -10.282 1.00 72.03  ? 8    DG  E "C5'" 1 
ATOM   6307 C  "C4'" . DG  E 2 8   ? 20.033  92.112  -9.437  1.00 72.60  ? 8    DG  E "C4'" 1 
ATOM   6308 O  "O4'" . DG  E 2 8   ? 19.425  92.398  -8.153  1.00 72.89  ? 8    DG  E "O4'" 1 
ATOM   6309 C  "C3'" . DG  E 2 8   ? 21.341  91.380  -9.136  1.00 73.77  ? 8    DG  E "C3'" 1 
ATOM   6310 O  "O3'" . DG  E 2 8   ? 22.437  92.294  -9.258  1.00 76.17  ? 8    DG  E "O3'" 1 
ATOM   6311 C  "C2'" . DG  E 2 8   ? 21.158  90.887  -7.709  1.00 72.20  ? 8    DG  E "C2'" 1 
ATOM   6312 C  "C1'" . DG  E 2 8   ? 20.268  91.959  -7.102  1.00 70.69  ? 8    DG  E "C1'" 1 
ATOM   6313 N  N9    . DG  E 2 8   ? 19.417  91.503  -6.008  1.00 68.84  ? 8    DG  E N9    1 
ATOM   6314 C  C8    . DG  E 2 8   ? 18.405  90.575  -6.071  1.00 68.60  ? 8    DG  E C8    1 
ATOM   6315 N  N7    . DG  E 2 8   ? 17.821  90.375  -4.923  1.00 67.55  ? 8    DG  E N7    1 
ATOM   6316 C  C5    . DG  E 2 8   ? 18.481  91.228  -4.052  1.00 68.23  ? 8    DG  E C5    1 
ATOM   6317 C  C6    . DG  E 2 8   ? 18.276  91.465  -2.670  1.00 69.09  ? 8    DG  E C6    1 
ATOM   6318 O  O6    . DG  E 2 8   ? 17.429  90.966  -1.920  1.00 71.93  ? 8    DG  E O6    1 
ATOM   6319 N  N1    . DG  E 2 8   ? 19.178  92.397  -2.171  1.00 68.25  ? 8    DG  E N1    1 
ATOM   6320 C  C2    . DG  E 2 8   ? 20.146  93.028  -2.907  1.00 68.13  ? 8    DG  E C2    1 
ATOM   6321 N  N2    . DG  E 2 8   ? 20.939  93.881  -2.235  1.00 66.67  ? 8    DG  E N2    1 
ATOM   6322 N  N3    . DG  E 2 8   ? 20.331  92.832  -4.204  1.00 68.09  ? 8    DG  E N3    1 
ATOM   6323 C  C4    . DG  E 2 8   ? 19.472  91.925  -4.706  1.00 68.06  ? 8    DG  E C4    1 
ATOM   6324 P  P     . DG  E 2 9   ? 23.947  91.757  -9.117  1.00 79.50  ? 9    DG  E P     1 
ATOM   6325 O  OP1   . DG  E 2 9   ? 24.768  92.616  -10.003 1.00 78.68  ? 9    DG  E OP1   1 
ATOM   6326 O  OP2   . DG  E 2 9   ? 23.957  90.289  -9.311  1.00 79.74  ? 9    DG  E OP2   1 
ATOM   6327 O  "O5'" . DG  E 2 9   ? 24.288  92.076  -7.596  1.00 81.01  ? 9    DG  E "O5'" 1 
ATOM   6328 C  "C5'" . DG  E 2 9   ? 24.050  93.378  -7.055  1.00 84.26  ? 9    DG  E "C5'" 1 
ATOM   6329 C  "C4'" . DG  E 2 9   ? 24.507  93.445  -5.616  1.00 87.08  ? 9    DG  E "C4'" 1 
ATOM   6330 O  "O4'" . DG  E 2 9   ? 23.476  92.989  -4.704  1.00 87.55  ? 9    DG  E "O4'" 1 
ATOM   6331 C  "C3'" . DG  E 2 9   ? 25.758  92.623  -5.310  1.00 88.59  ? 9    DG  E "C3'" 1 
ATOM   6332 O  "O3'" . DG  E 2 9   ? 26.644  93.398  -4.512  1.00 90.72  ? 9    DG  E "O3'" 1 
ATOM   6333 C  "C2'" . DG  E 2 9   ? 25.222  91.443  -4.516  1.00 88.82  ? 9    DG  E "C2'" 1 
ATOM   6334 C  "C1'" . DG  E 2 9   ? 24.021  92.042  -3.798  1.00 88.16  ? 9    DG  E "C1'" 1 
ATOM   6335 N  N9    . DG  E 2 9   ? 22.969  91.087  -3.433  1.00 89.21  ? 9    DG  E N9    1 
ATOM   6336 C  C8    . DG  E 2 9   ? 22.370  90.144  -4.245  1.00 89.86  ? 9    DG  E C8    1 
ATOM   6337 N  N7    . DG  E 2 9   ? 21.477  89.421  -3.622  1.00 89.76  ? 9    DG  E N7    1 
ATOM   6338 C  C5    . DG  E 2 9   ? 21.479  89.912  -2.322  1.00 89.26  ? 9    DG  E C5    1 
ATOM   6339 C  C6    . DG  E 2 9   ? 20.715  89.520  -1.189  1.00 88.84  ? 9    DG  E C6    1 
ATOM   6340 O  O6    . DG  E 2 9   ? 19.859  88.626  -1.105  1.00 88.43  ? 9    DG  E O6    1 
ATOM   6341 N  N1    . DG  E 2 9   ? 21.028  90.290  -0.073  1.00 88.58  ? 9    DG  E N1    1 
ATOM   6342 C  C2    . DG  E 2 9   ? 21.950  91.309  -0.049  1.00 89.00  ? 9    DG  E C2    1 
ATOM   6343 N  N2    . DG  E 2 9   ? 22.093  91.943  1.115   1.00 89.90  ? 9    DG  E N2    1 
ATOM   6344 N  N3    . DG  E 2 9   ? 22.674  91.680  -1.091  1.00 88.87  ? 9    DG  E N3    1 
ATOM   6345 C  C4    . DG  E 2 9   ? 22.390  90.945  -2.188  1.00 89.23  ? 9    DG  E C4    1 
ATOM   6346 P  P     . DA  E 2 10  ? 28.226  93.352  -4.793  1.00 92.28  ? 10   DA  E P     1 
ATOM   6347 O  OP1   . DA  E 2 10  ? 28.502  94.210  -5.967  1.00 91.52  ? 10   DA  E OP1   1 
ATOM   6348 O  OP2   . DA  E 2 10  ? 28.638  91.931  -4.821  1.00 91.73  ? 10   DA  E OP2   1 
ATOM   6349 O  "O5'" . DA  E 2 10  ? 28.812  94.050  -3.485  1.00 95.02  ? 10   DA  E "O5'" 1 
ATOM   6350 C  "C5'" . DA  E 2 10  ? 28.049  95.015  -2.752  1.00 97.59  ? 10   DA  E "C5'" 1 
ATOM   6351 C  "C4'" . DA  E 2 10  ? 27.983  94.651  -1.282  1.00 99.11  ? 10   DA  E "C4'" 1 
ATOM   6352 O  "O4'" . DA  E 2 10  ? 26.917  93.701  -0.992  1.00 99.73  ? 10   DA  E "O4'" 1 
ATOM   6353 C  "C3'" . DA  E 2 10  ? 29.265  94.040  -0.703  1.00 100.02 ? 10   DA  E "C3'" 1 
ATOM   6354 O  "O3'" . DA  E 2 10  ? 29.551  94.626  0.575   1.00 99.07  ? 10   DA  E "O3'" 1 
ATOM   6355 C  "C2'" . DA  E 2 10  ? 28.911  92.568  -0.551  1.00 100.68 ? 10   DA  E "C2'" 1 
ATOM   6356 C  "C1'" . DA  E 2 10  ? 27.444  92.659  -0.173  1.00 100.82 ? 10   DA  E "C1'" 1 
ATOM   6357 N  N9    . DA  E 2 10  ? 26.658  91.432  -0.370  1.00 101.40 ? 10   DA  E N9    1 
ATOM   6358 C  C8    . DA  E 2 10  ? 26.664  90.559  -1.435  1.00 101.44 ? 10   DA  E C8    1 
ATOM   6359 N  N7    . DA  E 2 10  ? 25.853  89.536  -1.286  1.00 101.15 ? 10   DA  E N7    1 
ATOM   6360 C  C5    . DA  E 2 10  ? 25.267  89.750  -0.045  1.00 101.31 ? 10   DA  E C5    1 
ATOM   6361 C  C6    . DA  E 2 10  ? 24.309  89.021  0.694   1.00 101.09 ? 10   DA  E C6    1 
ATOM   6362 N  N6    . DA  E 2 10  ? 23.739  87.894  0.266   1.00 100.51 ? 10   DA  E N6    1 
ATOM   6363 N  N1    . DA  E 2 10  ? 23.953  89.501  1.904   1.00 101.31 ? 10   DA  E N1    1 
ATOM   6364 C  C2    . DA  E 2 10  ? 24.516  90.635  2.334   1.00 101.81 ? 10   DA  E C2    1 
ATOM   6365 N  N3    . DA  E 2 10  ? 25.416  91.414  1.732   1.00 102.01 ? 10   DA  E N3    1 
ATOM   6366 C  C4    . DA  E 2 10  ? 25.755  90.912  0.531   1.00 101.57 ? 10   DA  E C4    1 
ATOM   6367 P  P     . DC  E 2 11  ? 30.712  93.999  1.499   1.00 98.23  ? 11   DC  E P     1 
ATOM   6368 O  OP1   . DC  E 2 11  ? 31.090  95.059  2.468   1.00 98.99  ? 11   DC  E OP1   1 
ATOM   6369 O  OP2   . DC  E 2 11  ? 31.744  93.404  0.619   1.00 96.95  ? 11   DC  E OP2   1 
ATOM   6370 O  "O5'" . DC  E 2 11  ? 29.959  92.828  2.277   1.00 98.68  ? 11   DC  E "O5'" 1 
ATOM   6371 C  "C5'" . DC  E 2 11  ? 28.977  93.123  3.274   1.00 97.54  ? 11   DC  E "C5'" 1 
ATOM   6372 C  "C4'" . DC  E 2 11  ? 28.815  91.957  4.222   1.00 97.07  ? 11   DC  E "C4'" 1 
ATOM   6373 O  "O4'" . DC  E 2 11  ? 27.918  90.960  3.662   1.00 97.85  ? 11   DC  E "O4'" 1 
ATOM   6374 C  "C3'" . DC  E 2 11  ? 30.111  91.224  4.598   1.00 97.25  ? 11   DC  E "C3'" 1 
ATOM   6375 O  "O3'" . DC  E 2 11  ? 30.151  91.044  6.026   1.00 94.56  ? 11   DC  E "O3'" 1 
ATOM   6376 C  "C2'" . DC  E 2 11  ? 30.002  89.916  3.829   1.00 98.50  ? 11   DC  E "C2'" 1 
ATOM   6377 C  "C1'" . DC  E 2 11  ? 28.502  89.676  3.815   1.00 98.86  ? 11   DC  E "C1'" 1 
ATOM   6378 N  N1    . DC  E 2 11  ? 27.992  88.774  2.750   1.00 98.96  ? 11   DC  E N1    1 
ATOM   6379 C  C2    . DC  E 2 11  ? 26.841  88.016  3.011   1.00 98.96  ? 11   DC  E C2    1 
ATOM   6380 O  O2    . DC  E 2 11  ? 26.225  88.205  4.075   1.00 98.51  ? 11   DC  E O2    1 
ATOM   6381 N  N3    . DC  E 2 11  ? 26.423  87.107  2.092   1.00 99.14  ? 11   DC  E N3    1 
ATOM   6382 C  C4    . DC  E 2 11  ? 27.089  86.963  0.942   1.00 98.80  ? 11   DC  E C4    1 
ATOM   6383 N  N4    . DC  E 2 11  ? 26.661  86.034  0.087   1.00 97.73  ? 11   DC  E N4    1 
ATOM   6384 C  C5    . DC  E 2 11  ? 28.228  87.762  0.625   1.00 98.47  ? 11   DC  E C5    1 
ATOM   6385 C  C6    . DC  E 2 11  ? 28.641  88.647  1.547   1.00 99.10  ? 11   DC  E C6    1 
ATOM   6386 P  P     . DT  E 2 12  ? 31.185  90.008  6.711   1.00 91.63  ? 12   DT  E P     1 
ATOM   6387 O  OP1   . DT  E 2 12  ? 32.061  90.815  7.591   1.00 91.65  ? 12   DT  E OP1   1 
ATOM   6388 O  OP2   . DT  E 2 12  ? 31.811  89.113  5.713   1.00 92.52  ? 12   DT  E OP2   1 
ATOM   6389 O  "O5'" . DT  E 2 12  ? 30.185  89.145  7.596   1.00 91.25  ? 12   DT  E "O5'" 1 
ATOM   6390 C  "C5'" . DT  E 2 12  ? 28.851  89.609  7.820   1.00 90.56  ? 12   DT  E "C5'" 1 
ATOM   6391 C  "C4'" . DT  E 2 12  ? 27.900  88.444  7.935   1.00 90.25  ? 12   DT  E "C4'" 1 
ATOM   6392 O  "O4'" . DT  E 2 12  ? 27.652  87.817  6.651   1.00 92.64  ? 12   DT  E "O4'" 1 
ATOM   6393 C  "C3'" . DT  E 2 12  ? 28.401  87.336  8.850   1.00 89.42  ? 12   DT  E "C3'" 1 
ATOM   6394 O  "O3'" . DT  E 2 12  ? 27.303  86.870  9.626   1.00 88.50  ? 12   DT  E "O3'" 1 
ATOM   6395 C  "C2'" . DT  E 2 12  ? 28.866  86.260  7.882   1.00 90.47  ? 12   DT  E "C2'" 1 
ATOM   6396 C  "C1'" . DT  E 2 12  ? 27.850  86.412  6.775   1.00 92.94  ? 12   DT  E "C1'" 1 
ATOM   6397 N  N1    . DT  E 2 12  ? 28.203  85.837  5.436   1.00 94.79  ? 12   DT  E N1    1 
ATOM   6398 C  C2    . DT  E 2 12  ? 27.502  84.715  5.021   1.00 94.40  ? 12   DT  E C2    1 
ATOM   6399 O  O2    . DT  E 2 12  ? 26.658  84.167  5.709   1.00 93.44  ? 12   DT  E O2    1 
ATOM   6400 N  N3    . DT  E 2 12  ? 27.834  84.253  3.768   1.00 95.11  ? 12   DT  E N3    1 
ATOM   6401 C  C4    . DT  E 2 12  ? 28.781  84.765  2.909   1.00 95.80  ? 12   DT  E C4    1 
ATOM   6402 O  O4    . DT  E 2 12  ? 28.962  84.240  1.805   1.00 96.39  ? 12   DT  E O4    1 
ATOM   6403 C  C5    . DT  E 2 12  ? 29.501  85.913  3.407   1.00 95.25  ? 12   DT  E C5    1 
ATOM   6404 C  C7    . DT  E 2 12  ? 30.577  86.492  2.551   1.00 95.49  ? 12   DT  E C7    1 
ATOM   6405 C  C6    . DT  E 2 12  ? 29.179  86.396  4.625   1.00 95.11  ? 12   DT  E C6    1 
ATOM   6406 P  P     . DG  E 2 13  ? 27.571  85.965  10.924  1.00 88.84  ? 13   DG  E P     1 
ATOM   6407 O  OP1   . DG  E 2 13  ? 26.786  84.727  10.683  1.00 88.31  ? 13   DG  E OP1   1 
ATOM   6408 O  OP2   . DG  E 2 13  ? 27.303  86.776  12.133  1.00 90.09  ? 13   DG  E OP2   1 
ATOM   6409 O  "O5'" . DG  E 2 13  ? 29.130  85.643  10.857  1.00 86.30  ? 13   DG  E "O5'" 1 
ATOM   6410 C  "C5'" . DG  E 2 13  ? 29.654  84.483  11.504  1.00 84.65  ? 13   DG  E "C5'" 1 
ATOM   6411 C  "C4'" . DG  E 2 13  ? 28.964  83.257  10.955  1.00 84.66  ? 13   DG  E "C4'" 1 
ATOM   6412 O  "O4'" . DG  E 2 13  ? 28.876  83.407  9.522   1.00 85.90  ? 13   DG  E "O4'" 1 
ATOM   6413 C  "C3'" . DG  E 2 13  ? 29.717  81.962  11.169  1.00 84.15  ? 13   DG  E "C3'" 1 
ATOM   6414 O  "O3'" . DG  E 2 13  ? 28.791  80.875  11.007  1.00 81.32  ? 13   DG  E "O3'" 1 
ATOM   6415 C  "C2'" . DG  E 2 13  ? 30.708  82.023  10.022  1.00 85.07  ? 13   DG  E "C2'" 1 
ATOM   6416 C  "C1'" . DG  E 2 13  ? 29.920  82.681  8.896   1.00 85.49  ? 13   DG  E "C1'" 1 
ATOM   6417 N  N9    . DG  E 2 13  ? 30.701  83.638  8.123   1.00 85.04  ? 13   DG  E N9    1 
ATOM   6418 C  C8    . DG  E 2 13  ? 31.375  84.733  8.611   1.00 85.54  ? 13   DG  E C8    1 
ATOM   6419 N  N7    . DG  E 2 13  ? 31.959  85.434  7.681   1.00 85.46  ? 13   DG  E N7    1 
ATOM   6420 C  C5    . DG  E 2 13  ? 31.668  84.753  6.509   1.00 85.74  ? 13   DG  E C5    1 
ATOM   6421 C  C6    . DG  E 2 13  ? 32.044  85.036  5.174   1.00 86.29  ? 13   DG  E C6    1 
ATOM   6422 O  O6    . DG  E 2 13  ? 32.734  85.963  4.753   1.00 84.95  ? 13   DG  E O6    1 
ATOM   6423 N  N1    . DG  E 2 13  ? 31.531  84.094  4.287   1.00 86.77  ? 13   DG  E N1    1 
ATOM   6424 C  C2    . DG  E 2 13  ? 30.754  83.012  4.644   1.00 86.84  ? 13   DG  E C2    1 
ATOM   6425 N  N2    . DG  E 2 13  ? 30.332  82.220  3.635   1.00 87.19  ? 13   DG  E N2    1 
ATOM   6426 N  N3    . DG  E 2 13  ? 30.410  82.729  5.895   1.00 85.50  ? 13   DG  E N3    1 
ATOM   6427 C  C4    . DG  E 2 13  ? 30.896  83.638  6.767   1.00 85.26  ? 13   DG  E C4    1 
ATOM   6428 O  OP3   . DC  F 3 3   ? 33.146  72.616  -16.312 1.00 106.79 ? 3    DC  F OP3   1 
ATOM   6429 P  P     . DC  F 3 3   ? 33.000  73.872  -15.456 1.00 108.49 ? 3    DC  F P     1 
ATOM   6430 O  OP1   . DC  F 3 3   ? 32.538  73.550  -14.040 1.00 108.31 ? 3    DC  F OP1   1 
ATOM   6431 O  OP2   . DC  F 3 3   ? 32.172  74.963  -16.131 1.00 106.77 ? 3    DC  F OP2   1 
ATOM   6432 O  "O5'" . DC  F 3 3   ? 34.509  74.488  -15.304 1.00 106.32 ? 3    DC  F "O5'" 1 
ATOM   6433 C  "C5'" . DC  F 3 3   ? 34.857  75.364  -14.209 1.00 102.20 ? 3    DC  F "C5'" 1 
ATOM   6434 C  "C4'" . DC  F 3 3   ? 35.550  74.582  -13.117 1.00 99.64  ? 3    DC  F "C4'" 1 
ATOM   6435 O  "O4'" . DC  F 3 3   ? 36.949  74.977  -13.070 1.00 100.52 ? 3    DC  F "O4'" 1 
ATOM   6436 C  "C3'" . DC  F 3 3   ? 34.988  74.841  -11.718 1.00 97.31  ? 3    DC  F "C3'" 1 
ATOM   6437 O  "O3'" . DC  F 3 3   ? 34.993  73.633  -10.942 1.00 92.03  ? 3    DC  F "O3'" 1 
ATOM   6438 C  "C2'" . DC  F 3 3   ? 35.980  75.822  -11.134 1.00 98.26  ? 3    DC  F "C2'" 1 
ATOM   6439 C  "C1'" A DC  F 3 3   ? 37.289  75.367  -11.747 0.50 98.63  ? 3    DC  F "C1'" 1 
ATOM   6440 N  N1    A DC  F 3 3   ? 38.327  76.423  -11.807 0.50 97.76  ? 3    DC  F N1    1 
ATOM   6441 C  C2    A DC  F 3 3   ? 38.479  77.291  -10.706 0.50 97.39  ? 3    DC  F C2    1 
ATOM   6442 O  O2    A DC  F 3 3   ? 37.758  77.145  -9.710  0.50 97.01  ? 3    DC  F O2    1 
ATOM   6443 N  N3    A DC  F 3 3   ? 39.407  78.265  -10.756 0.50 97.54  ? 3    DC  F N3    1 
ATOM   6444 C  C4    A DC  F 3 3   ? 40.177  78.398  -11.835 0.50 97.52  ? 3    DC  F C4    1 
ATOM   6445 N  N4    A DC  F 3 3   ? 41.074  79.385  -11.839 0.50 97.21  ? 3    DC  F N4    1 
ATOM   6446 C  C5    A DC  F 3 3   ? 40.061  77.529  -12.959 0.50 97.17  ? 3    DC  F C5    1 
ATOM   6447 C  C6    A DC  F 3 3   ? 39.130  76.568  -12.905 0.50 97.43  ? 3    DC  F C6    1 
ATOM   6448 P  P     . DA  F 3 4   ? 34.104  73.544  -9.602  1.00 88.21  ? 4    DA  F P     1 
ATOM   6449 O  OP1   . DA  F 3 4   ? 33.906  72.105  -9.311  1.00 89.50  ? 4    DA  F OP1   1 
ATOM   6450 O  OP2   . DA  F 3 4   ? 32.927  74.424  -9.781  1.00 89.62  ? 4    DA  F OP2   1 
ATOM   6451 O  "O5'" . DA  F 3 4   ? 35.033  74.167  -8.478  1.00 84.33  ? 4    DA  F "O5'" 1 
ATOM   6452 C  "C5'" . DA  F 3 4   ? 35.111  75.581  -8.285  1.00 78.67  ? 4    DA  F "C5'" 1 
ATOM   6453 C  "C4'" . DA  F 3 4   ? 34.251  75.995  -7.116  1.00 74.62  ? 4    DA  F "C4'" 1 
ATOM   6454 O  "O4'" . DA  F 3 4   ? 34.911  77.055  -6.404  1.00 74.06  ? 4    DA  F "O4'" 1 
ATOM   6455 C  "C3'" . DA  F 3 4   ? 32.850  76.512  -7.443  1.00 72.99  ? 4    DA  F "C3'" 1 
ATOM   6456 O  "O3'" . DA  F 3 4   ? 31.972  76.105  -6.388  1.00 70.38  ? 4    DA  F "O3'" 1 
ATOM   6457 C  "C2'" . DA  F 3 4   ? 33.035  78.018  -7.411  1.00 73.21  ? 4    DA  F "C2'" 1 
ATOM   6458 C  "C1'" . DA  F 3 4   ? 34.055  78.170  -6.296  1.00 74.12  ? 4    DA  F "C1'" 1 
ATOM   6459 N  N9    . DA  F 3 4   ? 34.896  79.364  -6.337  1.00 76.03  ? 4    DA  F N9    1 
ATOM   6460 C  C8    . DA  F 3 4   ? 35.283  80.136  -5.262  1.00 77.18  ? 4    DA  F C8    1 
ATOM   6461 N  N7    . DA  F 3 4   ? 36.059  81.145  -5.585  1.00 76.44  ? 4    DA  F N7    1 
ATOM   6462 C  C5    . DA  F 3 4   ? 36.191  81.033  -6.963  1.00 75.64  ? 4    DA  F C5    1 
ATOM   6463 C  C6    . DA  F 3 4   ? 36.888  81.801  -7.904  1.00 75.14  ? 4    DA  F C6    1 
ATOM   6464 N  N6    . DA  F 3 4   ? 37.616  82.880  -7.582  1.00 74.68  ? 4    DA  F N6    1 
ATOM   6465 N  N1    . DA  F 3 4   ? 36.814  81.422  -9.201  1.00 74.87  ? 4    DA  F N1    1 
ATOM   6466 C  C2    . DA  F 3 4   ? 36.080  80.341  -9.517  1.00 74.89  ? 4    DA  F C2    1 
ATOM   6467 N  N3    . DA  F 3 4   ? 35.378  79.539  -8.723  1.00 74.61  ? 4    DA  F N3    1 
ATOM   6468 C  C4    . DA  F 3 4   ? 35.476  79.943  -7.442  1.00 75.86  ? 4    DA  F C4    1 
ATOM   6469 P  P     . DG  F 3 5   ? 30.388  76.303  -6.535  1.00 67.59  ? 5    DG  F P     1 
ATOM   6470 O  OP1   . DG  F 3 5   ? 29.970  75.601  -7.770  1.00 68.82  ? 5    DG  F OP1   1 
ATOM   6471 O  OP2   . DG  F 3 5   ? 30.100  77.744  -6.361  1.00 68.78  ? 5    DG  F OP2   1 
ATOM   6472 O  "O5'" . DG  F 3 5   ? 29.811  75.509  -5.295  1.00 67.15  ? 5    DG  F "O5'" 1 
ATOM   6473 C  "C5'" . DG  F 3 5   ? 29.967  74.092  -5.210  1.00 65.13  ? 5    DG  F "C5'" 1 
ATOM   6474 C  "C4'" . DG  F 3 5   ? 29.507  73.634  -3.851  1.00 65.16  ? 5    DG  F "C4'" 1 
ATOM   6475 O  "O4'" . DG  F 3 5   ? 30.337  74.275  -2.836  1.00 64.56  ? 5    DG  F "O4'" 1 
ATOM   6476 C  "C3'" . DG  F 3 5   ? 28.043  74.003  -3.532  1.00 64.48  ? 5    DG  F "C3'" 1 
ATOM   6477 O  "O3'" . DG  F 3 5   ? 27.522  72.961  -2.667  1.00 64.89  ? 5    DG  F "O3'" 1 
ATOM   6478 C  "C2'" . DG  F 3 5   ? 28.197  75.241  -2.652  1.00 63.93  ? 5    DG  F "C2'" 1 
ATOM   6479 C  "C1'" . DG  F 3 5   ? 29.515  74.987  -1.930  1.00 63.81  ? 5    DG  F "C1'" 1 
ATOM   6480 N  N9    . DG  F 3 5   ? 30.229  76.199  -1.564  1.00 62.65  ? 5    DG  F N9    1 
ATOM   6481 C  C8    . DG  F 3 5   ? 30.823  77.104  -2.407  1.00 61.79  ? 5    DG  F C8    1 
ATOM   6482 N  N7    . DG  F 3 5   ? 31.425  78.070  -1.772  1.00 61.47  ? 5    DG  F N7    1 
ATOM   6483 C  C5    . DG  F 3 5   ? 31.203  77.785  -0.432  1.00 60.68  ? 5    DG  F C5    1 
ATOM   6484 C  C6    . DG  F 3 5   ? 31.616  78.470  0.724   1.00 60.40  ? 5    DG  F C6    1 
ATOM   6485 O  O6    . DG  F 3 5   ? 32.279  79.509  0.802   1.00 62.82  ? 5    DG  F O6    1 
ATOM   6486 N  N1    . DG  F 3 5   ? 31.180  77.829  1.880   1.00 58.74  ? 5    DG  F N1    1 
ATOM   6487 C  C2    . DG  F 3 5   ? 30.440  76.673  1.911   1.00 58.66  ? 5    DG  F C2    1 
ATOM   6488 N  N2    . DG  F 3 5   ? 30.123  76.178  3.124   1.00 57.59  ? 5    DG  F N2    1 
ATOM   6489 N  N3    . DG  F 3 5   ? 30.041  76.036  0.834   1.00 59.97  ? 5    DG  F N3    1 
ATOM   6490 C  C4    . DG  F 3 5   ? 30.458  76.641  -0.293  1.00 60.99  ? 5    DG  F C4    1 
HETATM 6491 P  P     . DFT F 3 6   ? 26.135  72.370  -2.895  1.00 65.35  ? 6    DFT F P     1 
HETATM 6492 O  OP1   . DFT F 3 6   ? 26.502  70.942  -3.174  1.00 66.64  ? 6    DFT F OP1   1 
HETATM 6493 O  OP2   . DFT F 3 6   ? 25.362  73.121  -3.906  1.00 65.24  ? 6    DFT F OP2   1 
HETATM 6494 O  "O5'" . DFT F 3 6   ? 25.488  72.726  -1.479  1.00 65.03  ? 6    DFT F "O5'" 1 
HETATM 6495 C  "C5'" . DFT F 3 6   ? 25.830  74.036  -1.028  1.00 65.08  ? 6    DFT F "C5'" 1 
HETATM 6496 C  "C4'" . DFT F 3 6   ? 25.374  74.287  0.406   1.00 63.44  ? 6    DFT F "C4'" 1 
HETATM 6497 O  "O4'" . DFT F 3 6   ? 26.486  75.069  0.859   1.00 63.93  ? 6    DFT F "O4'" 1 
HETATM 6498 C  "C3'" . DFT F 3 6   ? 24.114  75.115  0.539   1.00 62.71  ? 6    DFT F "C3'" 1 
HETATM 6499 O  "O3'" . DFT F 3 6   ? 23.620  75.018  1.871   1.00 59.99  ? 6    DFT F "O3'" 1 
HETATM 6500 C  "C2'" . DFT F 3 6   ? 24.706  76.472  0.176   1.00 63.58  ? 6    DFT F "C2'" 1 
HETATM 6501 C  "C1'" . DFT F 3 6   ? 25.998  76.400  0.989   1.00 62.62  ? 6    DFT F "C1'" 1 
HETATM 6502 C  C2    . DFT F 3 6   ? 27.656  78.321  1.399   1.00 60.34  ? 6    DFT F C2    1 
HETATM 6503 C  C4    . DFT F 3 6   ? 28.523  79.688  -0.408  1.00 63.73  ? 6    DFT F C4    1 
HETATM 6504 C  C5    . DFT F 3 6   ? 27.757  78.932  -1.290  1.00 64.07  ? 6    DFT F C5    1 
HETATM 6505 C  C5M   . DFT F 3 6   ? 27.805  79.284  -2.790  1.00 64.62  ? 6    DFT F C5M   1 
HETATM 6506 C  C6    . DFT F 3 6   ? 26.966  77.889  -0.839  1.00 61.84  ? 6    DFT F C6    1 
HETATM 6507 F  F4    . DFT F 3 6   ? 29.329  80.688  -0.853  1.00 65.79  ? 6    DFT F F4    1 
HETATM 6508 C  C3    . DFT F 3 6   ? 28.459  79.373  0.935   1.00 61.04  ? 6    DFT F C3    1 
HETATM 6509 F  F2    . DFT F 3 6   ? 27.610  78.102  2.723   1.00 59.84  ? 6    DFT F F2    1 
HETATM 6510 C  C1    . DFT F 3 6   ? 26.896  77.550  0.514   1.00 61.29  ? 6    DFT F C1    1 
ATOM   6511 P  P     . DA  F 3 7   ? 22.157  74.373  1.995   1.00 59.50  ? 7    DA  F P     1 
ATOM   6512 O  OP1   . DA  F 3 7   ? 22.478  72.968  2.214   1.00 60.11  ? 7    DA  F OP1   1 
ATOM   6513 O  OP2   . DA  F 3 7   ? 21.277  74.735  0.858   1.00 61.52  ? 7    DA  F OP2   1 
ATOM   6514 O  "O5'" . DA  F 3 7   ? 21.491  74.962  3.329   1.00 56.33  ? 7    DA  F "O5'" 1 
ATOM   6515 C  "C5'" . DA  F 3 7   ? 22.377  75.163  4.430   1.00 51.72  ? 7    DA  F "C5'" 1 
ATOM   6516 C  "C4'" . DA  F 3 7   ? 22.227  76.565  4.965   1.00 48.91  ? 7    DA  F "C4'" 1 
ATOM   6517 O  "O4'" . DA  F 3 7   ? 23.163  77.566  4.611   1.00 46.24  ? 7    DA  F "O4'" 1 
ATOM   6518 C  "C3'" . DA  F 3 7   ? 20.844  77.191  4.740   1.00 47.73  ? 7    DA  F "C3'" 1 
ATOM   6519 O  "O3'" . DA  F 3 7   ? 20.483  77.572  6.036   1.00 48.42  ? 7    DA  F "O3'" 1 
ATOM   6520 C  "C2'" . DA  F 3 7   ? 21.151  78.380  3.828   1.00 45.11  ? 7    DA  F "C2'" 1 
ATOM   6521 C  "C1'" . DA  F 3 7   ? 22.499  78.775  4.308   1.00 42.66  ? 7    DA  F "C1'" 1 
ATOM   6522 N  N9    . DA  F 3 7   ? 23.339  79.427  3.317   1.00 41.36  ? 7    DA  F N9    1 
ATOM   6523 C  C8    . DA  F 3 7   ? 23.395  79.214  1.963   1.00 41.17  ? 7    DA  F C8    1 
ATOM   6524 N  N7    . DA  F 3 7   ? 24.292  79.948  1.346   1.00 40.31  ? 7    DA  F N7    1 
ATOM   6525 C  C5    . DA  F 3 7   ? 24.868  80.685  2.364   1.00 40.41  ? 7    DA  F C5    1 
ATOM   6526 C  C6    . DA  F 3 7   ? 25.892  81.626  2.374   1.00 41.04  ? 7    DA  F C6    1 
ATOM   6527 N  N6    . DA  F 3 7   ? 26.585  81.987  1.294   1.00 41.43  ? 7    DA  F N6    1 
ATOM   6528 N  N1    . DA  F 3 7   ? 26.207  82.189  3.549   1.00 44.20  ? 7    DA  F N1    1 
ATOM   6529 C  C2    . DA  F 3 7   ? 25.546  81.804  4.647   1.00 46.07  ? 7    DA  F C2    1 
ATOM   6530 N  N3    . DA  F 3 7   ? 24.578  80.911  4.775   1.00 44.60  ? 7    DA  F N3    1 
ATOM   6531 C  C4    . DA  F 3 7   ? 24.281  80.381  3.584   1.00 41.14  ? 7    DA  F C4    1 
ATOM   6532 P  P     . DG  F 3 8   ? 18.987  77.791  6.367   1.00 49.94  ? 8    DG  F P     1 
ATOM   6533 O  OP1   . DG  F 3 8   ? 18.568  76.726  7.279   1.00 49.23  ? 8    DG  F OP1   1 
ATOM   6534 O  OP2   . DG  F 3 8   ? 18.284  77.995  5.076   1.00 50.47  ? 8    DG  F OP2   1 
ATOM   6535 O  "O5'" . DG  F 3 8   ? 19.129  79.210  7.122   1.00 50.06  ? 8    DG  F "O5'" 1 
ATOM   6536 C  "C5'" . DG  F 3 8   ? 20.271  79.995  6.766   1.00 47.02  ? 8    DG  F "C5'" 1 
ATOM   6537 C  "C4'" . DG  F 3 8   ? 20.303  81.296  7.490   1.00 45.93  ? 8    DG  F "C4'" 1 
ATOM   6538 O  "O4'" . DG  F 3 8   ? 21.349  82.057  6.870   1.00 45.68  ? 8    DG  F "O4'" 1 
ATOM   6539 C  "C3'" . DG  F 3 8   ? 19.021  82.082  7.344   1.00 45.92  ? 8    DG  F "C3'" 1 
ATOM   6540 O  "O3'" . DG  F 3 8   ? 18.758  82.792  8.568   1.00 49.23  ? 8    DG  F "O3'" 1 
ATOM   6541 C  "C2'" . DG  F 3 8   ? 19.296  82.989  6.159   1.00 43.92  ? 8    DG  F "C2'" 1 
ATOM   6542 C  "C1'" . DG  F 3 8   ? 20.805  83.188  6.212   1.00 41.79  ? 8    DG  F "C1'" 1 
ATOM   6543 N  N9    . DG  F 3 8   ? 21.442  83.283  4.903   1.00 37.76  ? 8    DG  F N9    1 
ATOM   6544 C  C8    . DG  F 3 8   ? 21.084  82.636  3.746   1.00 35.41  ? 8    DG  F C8    1 
ATOM   6545 N  N7    . DG  F 3 8   ? 21.858  82.927  2.738   1.00 34.26  ? 8    DG  F N7    1 
ATOM   6546 C  C5    . DG  F 3 8   ? 22.782  83.814  3.266   1.00 36.04  ? 8    DG  F C5    1 
ATOM   6547 C  C6    . DG  F 3 8   ? 23.879  84.483  2.660   1.00 38.37  ? 8    DG  F C6    1 
ATOM   6548 O  O6    . DG  F 3 8   ? 24.283  84.416  1.509   1.00 42.16  ? 8    DG  F O6    1 
ATOM   6549 N  N1    . DG  F 3 8   ? 24.530  85.312  3.552   1.00 39.21  ? 8    DG  F N1    1 
ATOM   6550 C  C2    . DG  F 3 8   ? 24.175  85.489  4.857   1.00 39.73  ? 8    DG  F C2    1 
ATOM   6551 N  N2    . DG  F 3 8   ? 24.893  86.379  5.550   1.00 40.55  ? 8    DG  F N2    1 
ATOM   6552 N  N3    . DG  F 3 8   ? 23.179  84.859  5.443   1.00 38.39  ? 8    DG  F N3    1 
ATOM   6553 C  C4    . DG  F 3 8   ? 22.528  84.047  4.595   1.00 36.40  ? 8    DG  F C4    1 
ATOM   6554 P  P     . DT  F 3 9   ? 17.811  84.116  8.562   1.00 52.74  ? 9    DT  F P     1 
ATOM   6555 O  OP1   . DT  F 3 9   ? 17.249  84.192  9.924   1.00 50.52  ? 9    DT  F OP1   1 
ATOM   6556 O  OP2   . DT  F 3 9   ? 16.908  84.172  7.391   1.00 52.65  ? 9    DT  F OP2   1 
ATOM   6557 O  "O5'" . DT  F 3 9   ? 18.889  85.267  8.368   1.00 54.84  ? 9    DT  F "O5'" 1 
ATOM   6558 C  "C5'" . DT  F 3 9   ? 19.839  85.573  9.391   1.00 57.81  ? 9    DT  F "C5'" 1 
ATOM   6559 C  "C4'" . DT  F 3 9   ? 20.277  87.010  9.250   1.00 59.11  ? 9    DT  F "C4'" 1 
ATOM   6560 O  "O4'" . DT  F 3 9   ? 21.055  87.137  8.035   1.00 58.52  ? 9    DT  F "O4'" 1 
ATOM   6561 C  "C3'" . DT  F 3 9   ? 19.109  87.989  9.117   1.00 60.80  ? 9    DT  F "C3'" 1 
ATOM   6562 O  "O3'" . DT  F 3 9   ? 19.363  89.193  9.837   1.00 64.92  ? 9    DT  F "O3'" 1 
ATOM   6563 C  "C2'" . DT  F 3 9   ? 19.031  88.257  7.629   1.00 59.18  ? 9    DT  F "C2'" 1 
ATOM   6564 C  "C1'" . DT  F 3 9   ? 20.468  88.093  7.169   1.00 58.07  ? 9    DT  F "C1'" 1 
ATOM   6565 N  N1    . DT  F 3 9   ? 20.622  87.605  5.774   1.00 57.46  ? 9    DT  F N1    1 
ATOM   6566 C  C2    . DT  F 3 9   ? 21.782  87.924  5.083   1.00 56.78  ? 9    DT  F C2    1 
ATOM   6567 O  O2    . DT  F 3 9   ? 22.715  88.551  5.571   1.00 58.06  ? 9    DT  F O2    1 
ATOM   6568 N  N3    . DT  F 3 9   ? 21.811  87.473  3.786   1.00 54.17  ? 9    DT  F N3    1 
ATOM   6569 C  C4    . DT  F 3 9   ? 20.838  86.750  3.130   1.00 52.02  ? 9    DT  F C4    1 
ATOM   6570 O  O4    . DT  F 3 9   ? 21.001  86.441  1.963   1.00 50.05  ? 9    DT  F O4    1 
ATOM   6571 C  C5    . DT  F 3 9   ? 19.673  86.421  3.917   1.00 52.85  ? 9    DT  F C5    1 
ATOM   6572 C  C7    . DT  F 3 9   ? 18.583  85.605  3.302   1.00 52.91  ? 9    DT  F C7    1 
ATOM   6573 C  C6    . DT  F 3 9   ? 19.621  86.860  5.176   1.00 55.18  ? 9    DT  F C6    1 
ATOM   6574 P  P     . DC  F 3 10  ? 18.189  90.284  10.004  1.00 68.09  ? 10   DC  F P     1 
ATOM   6575 O  OP1   . DC  F 3 10  ? 17.870  90.361  11.448  1.00 67.22  ? 10   DC  F OP1   1 
ATOM   6576 O  OP2   . DC  F 3 10  ? 17.111  89.980  9.037   1.00 67.02  ? 10   DC  F OP2   1 
ATOM   6577 O  "O5'" . DC  F 3 10  ? 18.896  91.636  9.552   1.00 70.76  ? 10   DC  F "O5'" 1 
ATOM   6578 C  "C5'" . DC  F 3 10  ? 20.311  91.813  9.669   1.00 74.27  ? 10   DC  F "C5'" 1 
ATOM   6579 C  "C4'" . DC  F 3 10  ? 20.804  92.715  8.563   1.00 76.82  ? 10   DC  F "C4'" 1 
ATOM   6580 O  "O4'" . DC  F 3 10  ? 20.899  91.976  7.317   1.00 78.65  ? 10   DC  F "O4'" 1 
ATOM   6581 C  "C3'" . DC  F 3 10  ? 19.862  93.888  8.297   1.00 78.10  ? 10   DC  F "C3'" 1 
ATOM   6582 O  "O3'" . DC  F 3 10  ? 20.620  95.081  8.088   1.00 79.31  ? 10   DC  F "O3'" 1 
ATOM   6583 C  "C2'" . DC  F 3 10  ? 19.109  93.467  7.045   1.00 79.14  ? 10   DC  F "C2'" 1 
ATOM   6584 C  "C1'" . DC  F 3 10  ? 20.143  92.629  6.306   1.00 79.92  ? 10   DC  F "C1'" 1 
ATOM   6585 N  N1    . DC  F 3 10  ? 19.594  91.600  5.391   1.00 81.07  ? 10   DC  F N1    1 
ATOM   6586 C  C2    . DC  F 3 10  ? 20.070  91.536  4.060   1.00 82.02  ? 10   DC  F C2    1 
ATOM   6587 O  O2    . DC  F 3 10  ? 20.932  92.341  3.687   1.00 83.28  ? 10   DC  F O2    1 
ATOM   6588 N  N3    . DC  F 3 10  ? 19.568  90.602  3.217   1.00 82.38  ? 10   DC  F N3    1 
ATOM   6589 C  C4    . DC  F 3 10  ? 18.625  89.759  3.644   1.00 82.96  ? 10   DC  F C4    1 
ATOM   6590 N  N4    . DC  F 3 10  ? 18.147  88.859  2.774   1.00 82.24  ? 10   DC  F N4    1 
ATOM   6591 C  C5    . DC  F 3 10  ? 18.124  89.800  4.984   1.00 83.59  ? 10   DC  F C5    1 
ATOM   6592 C  C6    . DC  F 3 10  ? 18.635  90.724  5.815   1.00 82.03  ? 10   DC  F C6    1 
ATOM   6593 P  P     . DC  F 3 11  ? 19.865  96.502  7.979   1.00 80.11  ? 11   DC  F P     1 
ATOM   6594 O  OP1   . DC  F 3 11  ? 20.378  97.370  9.072   1.00 79.61  ? 11   DC  F OP1   1 
ATOM   6595 O  OP2   . DC  F 3 11  ? 18.411  96.243  7.878   1.00 80.40  ? 11   DC  F OP2   1 
ATOM   6596 O  "O5'" . DC  F 3 11  ? 20.389  97.068  6.587   1.00 79.08  ? 11   DC  F "O5'" 1 
ATOM   6597 C  "C5'" . DC  F 3 11  ? 20.583  96.190  5.477   1.00 78.29  ? 11   DC  F "C5'" 1 
ATOM   6598 C  "C4'" . DC  F 3 11  ? 21.299  96.902  4.355   1.00 78.57  ? 11   DC  F "C4'" 1 
ATOM   6599 O  "O4'" . DC  F 3 11  ? 21.373  95.971  3.250   1.00 80.81  ? 11   DC  F "O4'" 1 
ATOM   6600 C  "C3'" . DC  F 3 11  ? 20.553  98.124  3.823   1.00 79.05  ? 11   DC  F "C3'" 1 
ATOM   6601 O  "O3'" . DC  F 3 11  ? 21.495  99.116  3.384   1.00 76.80  ? 11   DC  F "O3'" 1 
ATOM   6602 C  "C2'" . DC  F 3 11  ? 19.705  97.568  2.690   1.00 80.72  ? 11   DC  F "C2'" 1 
ATOM   6603 C  "C1'" . DC  F 3 11  ? 20.476  96.341  2.204   1.00 81.42  ? 11   DC  F "C1'" 1 
ATOM   6604 N  N1    . DC  F 3 11  ? 19.632  95.160  1.896   1.00 82.13  ? 11   DC  F N1    1 
ATOM   6605 C  C2    . DC  F 3 11  ? 20.020  94.303  0.854   1.00 83.45  ? 11   DC  F C2    1 
ATOM   6606 O  O2    . DC  F 3 11  ? 21.072  94.540  0.230   1.00 84.20  ? 11   DC  F O2    1 
ATOM   6607 N  N3    . DC  F 3 11  ? 19.243  93.235  0.558   1.00 83.75  ? 11   DC  F N3    1 
ATOM   6608 C  C4    . DC  F 3 11  ? 18.129  93.001  1.259   1.00 83.50  ? 11   DC  F C4    1 
ATOM   6609 N  N4    . DC  F 3 11  ? 17.389  91.941  0.922   1.00 84.50  ? 11   DC  F N4    1 
ATOM   6610 C  C5    . DC  F 3 11  ? 17.722  93.844  2.333   1.00 81.79  ? 11   DC  F C5    1 
ATOM   6611 C  C6    . DC  F 3 11  ? 18.491  94.901  2.612   1.00 81.41  ? 11   DC  F C6    1 
ATOM   6612 P  P     . DT  F 3 12  ? 20.975  100.553 2.880   1.00 74.54  ? 12   DT  F P     1 
ATOM   6613 O  OP1   . DT  F 3 12  ? 22.100  101.489 3.116   1.00 74.74  ? 12   DT  F OP1   1 
ATOM   6614 O  OP2   . DT  F 3 12  ? 19.647  100.837 3.469   1.00 72.99  ? 12   DT  F OP2   1 
ATOM   6615 O  "O5'" . DT  F 3 12  ? 20.809  100.334 1.316   1.00 75.83  ? 12   DT  F "O5'" 1 
ATOM   6616 C  "C5'" . DT  F 3 12  ? 21.926  99.942  0.514   1.00 77.70  ? 12   DT  F "C5'" 1 
ATOM   6617 C  "C4'" . DT  F 3 12  ? 21.509  99.814  -0.931  1.00 79.38  ? 12   DT  F "C4'" 1 
ATOM   6618 O  "O4'" . DT  F 3 12  ? 20.798  98.569  -1.126  1.00 79.85  ? 12   DT  F "O4'" 1 
ATOM   6619 C  "C3'" . DT  F 3 12  ? 20.577  100.928 -1.404  1.00 80.47  ? 12   DT  F "C3'" 1 
ATOM   6620 O  "O3'" . DT  F 3 12  ? 20.991  101.395 -2.682  1.00 82.64  ? 12   DT  F "O3'" 1 
ATOM   6621 C  "C2'" . DT  F 3 12  ? 19.211  100.272 -1.468  1.00 79.61  ? 12   DT  F "C2'" 1 
ATOM   6622 C  "C1'" . DT  F 3 12  ? 19.536  98.805  -1.727  1.00 80.15  ? 12   DT  F "C1'" 1 
ATOM   6623 N  N1    . DT  F 3 12  ? 18.568  97.838  -1.146  1.00 80.34  ? 12   DT  F N1    1 
ATOM   6624 C  C2    . DT  F 3 12  ? 18.317  96.659  -1.821  1.00 79.67  ? 12   DT  F C2    1 
ATOM   6625 O  O2    . DT  F 3 12  ? 18.867  96.351  -2.864  1.00 78.96  ? 12   DT  F O2    1 
ATOM   6626 N  N3    . DT  F 3 12  ? 17.391  95.847  -1.221  1.00 79.44  ? 12   DT  F N3    1 
ATOM   6627 C  C4    . DT  F 3 12  ? 16.707  96.084  -0.043  1.00 80.97  ? 12   DT  F C4    1 
ATOM   6628 O  O4    . DT  F 3 12  ? 15.893  95.262  0.364   1.00 82.13  ? 12   DT  F O4    1 
ATOM   6629 C  C5    . DT  F 3 12  ? 17.026  97.332  0.616   1.00 80.93  ? 12   DT  F C5    1 
ATOM   6630 C  C7    . DT  F 3 12  ? 16.336  97.687  1.897   1.00 80.62  ? 12   DT  F C7    1 
ATOM   6631 C  C6    . DT  F 3 12  ? 17.930  98.127  0.042   1.00 80.79  ? 12   DT  F C6    1 
ATOM   6632 P  P     . DT  F 3 13  ? 20.695  102.917 -3.105  1.00 84.47  ? 13   DT  F P     1 
ATOM   6633 O  OP1   . DT  F 3 13  ? 21.996  103.462 -3.575  1.00 84.27  ? 13   DT  F OP1   1 
ATOM   6634 O  OP2   . DT  F 3 13  ? 19.954  103.607 -2.025  1.00 83.66  ? 13   DT  F OP2   1 
ATOM   6635 O  "O5'" . DT  F 3 13  ? 19.732  102.725 -4.347  1.00 86.21  ? 13   DT  F "O5'" 1 
ATOM   6636 C  "C5'" . DT  F 3 13  ? 20.097  101.825 -5.397  1.00 89.91  ? 13   DT  F "C5'" 1 
ATOM   6637 C  "C4'" . DT  F 3 13  ? 18.864  101.313 -6.101  1.00 91.40  ? 13   DT  F "C4'" 1 
ATOM   6638 O  "O4'" . DT  F 3 13  ? 18.243  100.217 -5.382  1.00 92.36  ? 13   DT  F "O4'" 1 
ATOM   6639 C  "C3'" . DT  F 3 13  ? 17.782  102.374 -6.288  1.00 92.53  ? 13   DT  F "C3'" 1 
ATOM   6640 O  "O3'" . DT  F 3 13  ? 17.323  102.328 -7.629  1.00 92.12  ? 13   DT  F "O3'" 1 
ATOM   6641 C  "C2'" . DT  F 3 13  ? 16.680  101.943 -5.333  1.00 92.64  ? 13   DT  F "C2'" 1 
ATOM   6642 C  "C1'" . DT  F 3 13  ? 16.845  100.433 -5.336  1.00 92.40  ? 13   DT  F "C1'" 1 
ATOM   6643 N  N1    . DT  F 3 13  ? 16.293  99.711  -4.163  1.00 92.34  ? 13   DT  F N1    1 
ATOM   6644 C  C2    . DT  F 3 13  ? 15.812  98.432  -4.357  1.00 92.06  ? 13   DT  F C2    1 
ATOM   6645 O  O2    . DT  F 3 13  ? 15.847  97.860  -5.433  1.00 91.00  ? 13   DT  F O2    1 
ATOM   6646 N  N3    . DT  F 3 13  ? 15.282  97.844  -3.237  1.00 92.37  ? 13   DT  F N3    1 
ATOM   6647 C  C4    . DT  F 3 13  ? 15.181  98.390  -1.976  1.00 92.92  ? 13   DT  F C4    1 
ATOM   6648 O  O4    . DT  F 3 13  ? 14.656  97.744  -1.073  1.00 93.78  ? 13   DT  F O4    1 
ATOM   6649 C  C5    . DT  F 3 13  ? 15.716  99.728  -1.838  1.00 93.17  ? 13   DT  F C5    1 
ATOM   6650 C  C7    . DT  F 3 13  ? 15.649  100.409 -0.509  1.00 93.59  ? 13   DT  F C7    1 
ATOM   6651 C  C6    . DT  F 3 13  ? 16.247  100.307 -2.921  1.00 92.74  ? 13   DT  F C6    1 
ATOM   6652 P  P     . DC  F 3 14  ? 16.802  103.666 -8.332  1.00 91.63  ? 14   DC  F P     1 
ATOM   6653 O  OP1   . DC  F 3 14  ? 17.823  104.014 -9.350  1.00 90.20  ? 14   DC  F OP1   1 
ATOM   6654 O  OP2   . DC  F 3 14  ? 16.443  104.649 -7.284  1.00 91.34  ? 14   DC  F OP2   1 
ATOM   6655 O  "O5'" . DC  F 3 14  ? 15.481  103.148 -9.043  1.00 92.31  ? 14   DC  F "O5'" 1 
ATOM   6656 C  "C5'" . DC  F 3 14  ? 15.472  101.882 -9.707  1.00 93.31  ? 14   DC  F "C5'" 1 
ATOM   6657 C  "C4'" . DC  F 3 14  ? 14.121  101.222 -9.572  1.00 94.04  ? 14   DC  F "C4'" 1 
ATOM   6658 O  "O4'" . DC  F 3 14  ? 13.988  100.527 -8.308  1.00 94.03  ? 14   DC  F "O4'" 1 
ATOM   6659 C  "C3'" . DC  F 3 14  ? 12.927  102.173 -9.668  1.00 95.22  ? 14   DC  F "C3'" 1 
ATOM   6660 O  "O3'" . DC  F 3 14  ? 11.972  101.637 -10.586 1.00 96.66  ? 14   DC  F "O3'" 1 
ATOM   6661 C  "C2'" . DC  F 3 14  ? 12.363  102.185 -8.256  1.00 94.49  ? 14   DC  F "C2'" 1 
ATOM   6662 C  "C1'" . DC  F 3 14  ? 12.698  100.786 -7.785  1.00 93.98  ? 14   DC  F "C1'" 1 
ATOM   6663 N  N1    . DC  F 3 14  ? 12.722  100.571 -6.321  1.00 94.26  ? 14   DC  F N1    1 
ATOM   6664 C  C2    . DC  F 3 14  ? 11.962  99.515  -5.784  1.00 93.91  ? 14   DC  F C2    1 
ATOM   6665 O  O2    . DC  F 3 14  ? 11.304  98.793  -6.550  1.00 93.84  ? 14   DC  F O2    1 
ATOM   6666 N  N3    . DC  F 3 14  ? 11.961  99.313  -4.445  1.00 93.12  ? 14   DC  F N3    1 
ATOM   6667 C  C4    . DC  F 3 14  ? 12.672  100.113 -3.651  1.00 92.81  ? 14   DC  F C4    1 
ATOM   6668 N  N4    . DC  F 3 14  ? 12.622  99.887  -2.341  1.00 92.36  ? 14   DC  F N4    1 
ATOM   6669 C  C5    . DC  F 3 14  ? 13.460  101.186 -4.166  1.00 93.26  ? 14   DC  F C5    1 
ATOM   6670 C  C6    . DC  F 3 14  ? 13.458  101.377 -5.494  1.00 93.98  ? 14   DC  F C6    1 
ATOM   6671 P  P     . DC  F 3 15  ? 10.848  102.593 -11.223 1.00 97.20  ? 15   DC  F P     1 
ATOM   6672 O  OP1   . DC  F 3 15  ? 10.960  102.453 -12.704 1.00 96.29  ? 15   DC  F OP1   1 
ATOM   6673 O  OP2   . DC  F 3 15  ? 10.961  103.933 -10.602 1.00 96.31  ? 15   DC  F OP2   1 
ATOM   6674 O  "O5'" . DC  F 3 15  ? 9.506   101.903 -10.727 1.00 95.65  ? 15   DC  F "O5'" 1 
ATOM   6675 C  "C5'" . DC  F 3 15  ? 9.287   100.504 -10.927 1.00 95.49  ? 15   DC  F "C5'" 1 
ATOM   6676 C  "C4'" . DC  F 3 15  ? 8.077   100.060 -10.144 1.00 96.19  ? 15   DC  F "C4'" 1 
ATOM   6677 O  "O4'" . DC  F 3 15  ? 8.436   99.734  -8.775  1.00 94.72  ? 15   DC  F "O4'" 1 
ATOM   6678 C  "C3'" . DC  F 3 15  ? 7.010   101.151 -10.063 1.00 97.98  ? 15   DC  F "C3'" 1 
ATOM   6679 O  "O3'" . DC  F 3 15  ? 5.723   100.630 -10.377 1.00 101.67 ? 15   DC  F "O3'" 1 
ATOM   6680 C  "C2'" . DC  F 3 15  ? 7.068   101.616 -8.619  1.00 96.07  ? 15   DC  F "C2'" 1 
ATOM   6681 C  "C1'" . DC  F 3 15  ? 7.519   100.360 -7.895  1.00 93.33  ? 15   DC  F "C1'" 1 
ATOM   6682 N  N1    . DC  F 3 15  ? 8.185   100.585 -6.593  1.00 90.02  ? 15   DC  F N1    1 
ATOM   6683 C  C2    . DC  F 3 15  ? 7.821   99.782  -5.509  1.00 88.10  ? 15   DC  F C2    1 
ATOM   6684 O  O2    . DC  F 3 15  ? 6.968   98.892  -5.674  1.00 86.43  ? 15   DC  F O2    1 
ATOM   6685 N  N3    . DC  F 3 15  ? 8.403   99.999  -4.308  1.00 87.02  ? 15   DC  F N3    1 
ATOM   6686 C  C4    . DC  F 3 15  ? 9.309   100.966 -4.166  1.00 85.96  ? 15   DC  F C4    1 
ATOM   6687 N  N4    . DC  F 3 15  ? 9.845   101.143 -2.964  1.00 84.75  ? 15   DC  F N4    1 
ATOM   6688 C  C5    . DC  F 3 15  ? 9.704   101.792 -5.251  1.00 85.80  ? 15   DC  F C5    1 
ATOM   6689 C  C6    . DC  F 3 15  ? 9.128   101.567 -6.436  1.00 88.31  ? 15   DC  F C6    1 
ATOM   6690 P  P     . DC  F 3 16  ? 4.597   101.621 -10.953 1.00 104.72 ? 16   DC  F P     1 
ATOM   6691 O  OP1   . DC  F 3 16  ? 4.214   101.078 -12.284 1.00 104.60 ? 16   DC  F OP1   1 
ATOM   6692 O  OP2   . DC  F 3 16  ? 5.115   103.004 -10.853 1.00 105.06 ? 16   DC  F OP2   1 
ATOM   6693 O  "O5'" . DC  F 3 16  ? 3.389   101.449 -9.924  1.00 104.92 ? 16   DC  F "O5'" 1 
ATOM   6694 C  "C5'" . DC  F 3 16  ? 2.493   100.342 -10.044 1.00 105.03 ? 16   DC  F "C5'" 1 
ATOM   6695 C  "C4'" . DC  F 3 16  ? 1.657   100.181 -8.796  1.00 105.19 ? 16   DC  F "C4'" 1 
ATOM   6696 O  "O4'" . DC  F 3 16  ? 2.549   99.899  -7.687  1.00 104.17 ? 16   DC  F "O4'" 1 
ATOM   6697 C  "C3'" . DC  F 3 16  ? 0.801   101.380 -8.381  1.00 106.28 ? 16   DC  F "C3'" 1 
ATOM   6698 O  "O3'" . DC  F 3 16  ? -0.611  101.044 -8.320  1.00 108.67 ? 16   DC  F "O3'" 1 
ATOM   6699 C  "C2'" . DC  F 3 16  ? 1.426   101.890 -7.091  1.00 104.93 ? 16   DC  F "C2'" 1 
ATOM   6700 C  "C1'" . DC  F 3 16  ? 2.244   100.710 -6.562  1.00 102.69 ? 16   DC  F "C1'" 1 
ATOM   6701 N  N1    . DC  F 3 16  ? 3.522   101.103 -5.913  1.00 99.80  ? 16   DC  F N1    1 
ATOM   6702 C  C2    . DC  F 3 16  ? 3.820   100.626 -4.616  1.00 98.11  ? 16   DC  F C2    1 
ATOM   6703 O  O2    . DC  F 3 16  ? 3.052   99.820  -4.069  1.00 97.68  ? 16   DC  F O2    1 
ATOM   6704 N  N3    . DC  F 3 16  ? 4.943   101.060 -3.998  1.00 96.76  ? 16   DC  F N3    1 
ATOM   6705 C  C4    . DC  F 3 16  ? 5.754   101.922 -4.613  1.00 96.59  ? 16   DC  F C4    1 
ATOM   6706 N  N4    . DC  F 3 16  ? 6.815   102.369 -3.945  1.00 95.23  ? 16   DC  F N4    1 
ATOM   6707 C  C5    . DC  F 3 16  ? 5.505   102.378 -5.939  1.00 97.27  ? 16   DC  F C5    1 
ATOM   6708 C  C6    . DC  F 3 16  ? 4.393   101.946 -6.547  1.00 98.40  ? 16   DC  F C6    1 
ATOM   6709 P  P     . DC  F 3 17  ? -1.152  99.845  -7.380  1.00 110.79 ? 17   DC  F P     1 
ATOM   6710 O  OP1   . DC  F 3 17  ? -0.474  98.595  -7.818  1.00 110.17 ? 17   DC  F OP1   1 
ATOM   6711 O  OP2   . DC  F 3 17  ? -2.630  99.916  -7.430  1.00 110.77 ? 17   DC  F OP2   1 
ATOM   6712 O  "O5'" . DC  F 3 17  ? -0.677  100.212 -5.902  1.00 111.84 ? 17   DC  F "O5'" 1 
ATOM   6713 C  "C5'" . DC  F 3 17  ? -0.800  99.249  -4.851  1.00 113.09 ? 17   DC  F "C5'" 1 
ATOM   6714 C  "C4'" . DC  F 3 17  ? -1.156  99.918  -3.541  1.00 113.14 ? 17   DC  F "C4'" 1 
ATOM   6715 O  "O4'" . DC  F 3 17  ? -0.020  100.649 -3.020  1.00 112.15 ? 17   DC  F "O4'" 1 
ATOM   6716 C  "C3'" . DC  F 3 17  ? -2.318  100.915 -3.594  1.00 114.06 ? 17   DC  F "C3'" 1 
ATOM   6717 O  "O3'" . DC  F 3 17  ? -3.056  100.829 -2.366  1.00 117.05 ? 17   DC  F "O3'" 1 
ATOM   6718 C  "C2'" . DC  F 3 17  ? -1.601  102.252 -3.663  1.00 112.69 ? 17   DC  F "C2'" 1 
ATOM   6719 C  "C1'" . DC  F 3 17  ? -0.397  101.992 -2.768  1.00 110.89 ? 17   DC  F "C1'" 1 
ATOM   6720 N  N1    . DC  F 3 17  ? 0.792   102.840 -2.981  1.00 108.37 ? 17   DC  F N1    1 
ATOM   6721 C  C2    . DC  F 3 17  ? 1.621   103.119 -1.887  1.00 107.16 ? 17   DC  F C2    1 
ATOM   6722 O  O2    . DC  F 3 17  ? 1.313   102.675 -0.770  1.00 107.07 ? 17   DC  F O2    1 
ATOM   6723 N  N3    . DC  F 3 17  ? 2.734   103.864 -2.074  1.00 106.09 ? 17   DC  F N3    1 
ATOM   6724 C  C4    . DC  F 3 17  ? 3.030   104.324 -3.289  1.00 106.08 ? 17   DC  F C4    1 
ATOM   6725 N  N4    . DC  F 3 17  ? 4.151   105.030 -3.435  1.00 105.70 ? 17   DC  F N4    1 
ATOM   6726 C  C5    . DC  F 3 17  ? 2.195   104.073 -4.414  1.00 106.61 ? 17   DC  F C5    1 
ATOM   6727 C  C6    . DC  F 3 17  ? 1.098   103.335 -4.217  1.00 107.51 ? 17   DC  F C6    1 
ATOM   6728 P  P     . DC  F 3 18  ? -4.603  100.377 -2.380  1.00 119.36 ? 18   DC  F P     1 
ATOM   6729 O  OP1   . DC  F 3 18  ? -4.613  98.910  -2.638  1.00 119.35 ? 18   DC  F OP1   1 
ATOM   6730 O  OP2   . DC  F 3 18  ? -5.350  101.278 -3.286  1.00 119.16 ? 18   DC  F OP2   1 
ATOM   6731 O  "O5'" . DC  F 3 18  ? -5.069  100.658 -0.878  1.00 117.81 ? 18   DC  F "O5'" 1 
ATOM   6732 C  "C5'" . DC  F 3 18  ? -4.717  99.772  0.188   1.00 115.67 ? 18   DC  F "C5'" 1 
ATOM   6733 C  "C4'" . DC  F 3 18  ? -4.551  100.538 1.483   1.00 114.34 ? 18   DC  F "C4'" 1 
ATOM   6734 O  "O4'" . DC  F 3 18  ? -3.327  101.310 1.446   1.00 113.48 ? 18   DC  F "O4'" 1 
ATOM   6735 C  "C3'" . DC  F 3 18  ? -5.668  101.526 1.836   1.00 113.80 ? 18   DC  F "C3'" 1 
ATOM   6736 O  "O3'" . DC  F 3 18  ? -5.870  101.602 3.257   1.00 113.43 ? 18   DC  F "O3'" 1 
ATOM   6737 C  "C2'" . DC  F 3 18  ? -5.084  102.867 1.427   1.00 113.14 ? 18   DC  F "C2'" 1 
ATOM   6738 C  "C1'" . DC  F 3 18  ? -3.603  102.674 1.728   1.00 112.23 ? 18   DC  F "C1'" 1 
ATOM   6739 N  N1    . DC  F 3 18  ? -2.662  103.501 0.942   1.00 110.47 ? 18   DC  F N1    1 
ATOM   6740 C  C2    . DC  F 3 18  ? -1.482  103.960 1.557   1.00 109.78 ? 18   DC  F C2    1 
ATOM   6741 O  O2    . DC  F 3 18  ? -1.256  103.660 2.740   1.00 109.77 ? 18   DC  F O2    1 
ATOM   6742 N  N3    . DC  F 3 18  ? -0.618  104.716 0.842   1.00 108.73 ? 18   DC  F N3    1 
ATOM   6743 C  C4    . DC  F 3 18  ? -0.891  105.019 -0.428  1.00 108.16 ? 18   DC  F C4    1 
ATOM   6744 N  N4    . DC  F 3 18  ? -0.017  105.768 -1.092  1.00 107.45 ? 18   DC  F N4    1 
ATOM   6745 C  C5    . DC  F 3 18  ? -2.077  104.567 -1.075  1.00 108.42 ? 18   DC  F C5    1 
ATOM   6746 C  C6    . DC  F 3 18  ? -2.924  103.818 -0.363  1.00 109.43 ? 18   DC  F C6    1 
HETATM 6747 CA CA    . CA  G 4 .   ? -0.726  46.641  -1.998  1.00 50.76  ? 1345 CA  A CA    1 
HETATM 6748 CA CA    . CA  H 4 .   ? -0.107  43.651  0.556   1.00 49.55  ? 1346 CA  A CA    1 
HETATM 6749 N  N1    . DCT I 5 .   ? 5.999   47.867  2.998   1.00 52.01  ? 1347 DCT A N1    1 
HETATM 6750 C  C2    . DCT I 5 .   ? 6.909   48.272  3.988   1.00 50.17  ? 1347 DCT A C2    1 
HETATM 6751 N  N3    . DCT I 5 .   ? 8.155   47.649  4.093   1.00 48.03  ? 1347 DCT A N3    1 
HETATM 6752 C  C4    . DCT I 5 .   ? 8.498   46.613  3.212   1.00 48.08  ? 1347 DCT A C4    1 
HETATM 6753 C  C5    . DCT I 5 .   ? 7.592   46.210  2.238   1.00 49.57  ? 1347 DCT A C5    1 
HETATM 6754 C  C6    . DCT I 5 .   ? 6.351   46.830  2.127   1.00 51.00  ? 1347 DCT A C6    1 
HETATM 6755 O  O2    . DCT I 5 .   ? 6.593   49.162  4.775   1.00 50.67  ? 1347 DCT A O2    1 
HETATM 6756 N  N4    . DCT I 5 .   ? 9.682   46.019  3.313   1.00 48.99  ? 1347 DCT A N4    1 
HETATM 6757 C  "C1'" . DCT I 5 .   ? 4.711   48.585  2.858   1.00 54.97  ? 1347 DCT A "C1'" 1 
HETATM 6758 C  "C2'" . DCT I 5 .   ? 4.439   48.987  1.410   1.00 57.29  ? 1347 DCT A "C2'" 1 
HETATM 6759 C  "C3'" . DCT I 5 .   ? 2.998   49.448  1.616   1.00 57.51  ? 1347 DCT A "C3'" 1 
HETATM 6760 C  "C4'" . DCT I 5 .   ? 2.458   48.269  2.429   1.00 58.39  ? 1347 DCT A "C4'" 1 
HETATM 6761 O  "O4'" . DCT I 5 .   ? 3.570   47.785  3.207   1.00 56.82  ? 1347 DCT A "O4'" 1 
HETATM 6762 C  "C5'" . DCT I 5 .   ? 2.021   47.150  1.477   1.00 62.83  ? 1347 DCT A "C5'" 1 
HETATM 6763 O  "O5'" . DCT I 5 .   ? 3.112   46.581  0.742   1.00 67.73  ? 1347 DCT A "O5'" 1 
HETATM 6764 P  PA    . DCT I 5 .   ? 2.824   45.628  -0.524  1.00 70.18  ? 1347 DCT A PA    1 
HETATM 6765 O  O1A   . DCT I 5 .   ? 1.366   45.401  -0.653  1.00 69.81  ? 1347 DCT A O1A   1 
HETATM 6766 O  O2A   . DCT I 5 .   ? 3.718   44.448  -0.480  1.00 70.73  ? 1347 DCT A O2A   1 
HETATM 6767 O  O3A   . DCT I 5 .   ? 3.279   46.540  -1.774  1.00 68.38  ? 1347 DCT A O3A   1 
HETATM 6768 P  PB    . DCT I 5 .   ? 2.467   47.877  -2.165  1.00 65.78  ? 1347 DCT A PB    1 
HETATM 6769 O  O1B   . DCT I 5 .   ? 3.341   48.753  -2.980  1.00 65.37  ? 1347 DCT A O1B   1 
HETATM 6770 O  O2B   . DCT I 5 .   ? 1.823   48.446  -0.960  1.00 65.96  ? 1347 DCT A O2B   1 
HETATM 6771 O  O3B   . DCT I 5 .   ? 1.310   47.306  -3.129  1.00 61.98  ? 1347 DCT A O3B   1 
HETATM 6772 P  PG    . DCT I 5 .   ? 1.573   46.019  -4.060  1.00 59.47  ? 1347 DCT A PG    1 
HETATM 6773 O  O1G   . DCT I 5 .   ? 1.446   44.718  -3.118  1.00 58.86  ? 1347 DCT A O1G   1 
HETATM 6774 O  O2G   . DCT I 5 .   ? 0.317   45.946  -5.068  1.00 60.46  ? 1347 DCT A O2G   1 
HETATM 6775 O  O3G   . DCT I 5 .   ? 2.868   46.071  -4.777  1.00 58.10  ? 1347 DCT A O3G   1 
HETATM 6776 CA CA    . CA  J 4 .   ? 34.308  79.606  14.588  1.00 55.51  ? 1344 CA  B CA    1 
HETATM 6777 CA CA    . CA  K 4 .   ? 31.968  82.951  13.062  1.00 63.57  ? 1345 CA  B CA    1 
HETATM 6778 N  N1    . DCT L 5 .   ? 31.899  78.834  6.773   1.00 53.89  ? 1346 DCT B N1    1 
HETATM 6779 C  C2    . DCT L 5 .   ? 31.665  78.509  5.432   1.00 51.09  ? 1346 DCT B C2    1 
HETATM 6780 N  N3    . DCT L 5 .   ? 32.150  79.339  4.414   1.00 48.89  ? 1346 DCT B N3    1 
HETATM 6781 C  C4    . DCT L 5 .   ? 32.868  80.495  4.741   1.00 50.10  ? 1346 DCT B C4    1 
HETATM 6782 C  C5    . DCT L 5 .   ? 33.100  80.820  6.073   1.00 51.33  ? 1346 DCT B C5    1 
HETATM 6783 C  C6    . DCT L 5 .   ? 32.620  79.995  7.084   1.00 52.97  ? 1346 DCT B C6    1 
HETATM 6784 O  O2    . DCT L 5 .   ? 31.019  77.498  5.159   1.00 51.21  ? 1346 DCT B O2    1 
HETATM 6785 N  N4    . DCT L 5 .   ? 33.333  81.279  3.774   1.00 50.74  ? 1346 DCT B N4    1 
HETATM 6786 C  "C1'" . DCT L 5 .   ? 31.365  77.952  7.838   1.00 58.02  ? 1346 DCT B "C1'" 1 
HETATM 6787 C  "C2'" . DCT L 5 .   ? 32.480  77.445  8.760   1.00 59.21  ? 1346 DCT B "C2'" 1 
HETATM 6788 C  "C3'" . DCT L 5 .   ? 31.750  77.401  10.102  1.00 60.87  ? 1346 DCT B "C3'" 1 
HETATM 6789 C  "C4'" . DCT L 5 .   ? 31.025  78.738  9.971   1.00 62.13  ? 1346 DCT B "C4'" 1 
HETATM 6790 O  "O4'" . DCT L 5 .   ? 30.413  78.633  8.676   1.00 60.87  ? 1346 DCT B "O4'" 1 
HETATM 6791 C  "C5'" . DCT L 5 .   ? 32.088  79.835  9.891   1.00 66.58  ? 1346 DCT B "C5'" 1 
HETATM 6792 O  "O5'" . DCT L 5 .   ? 32.722  80.107  11.143  1.00 72.28  ? 1346 DCT B "O5'" 1 
HETATM 6793 P  PA    . DCT L 5 .   ? 33.885  81.219  11.196  1.00 75.44  ? 1346 DCT B PA    1 
HETATM 6794 O  O1A   . DCT L 5 .   ? 33.977  81.754  12.573  1.00 77.32  ? 1346 DCT B O1A   1 
HETATM 6795 O  O2A   . DCT L 5 .   ? 33.704  82.171  10.077  1.00 74.19  ? 1346 DCT B O2A   1 
HETATM 6796 O  O3A   . DCT L 5 .   ? 35.221  80.356  10.952  1.00 72.76  ? 1346 DCT B O3A   1 
HETATM 6797 P  PB    . DCT L 5 .   ? 35.365  78.908  11.646  1.00 70.57  ? 1346 DCT B PB    1 
HETATM 6798 O  O1B   . DCT L 5 .   ? 36.218  78.042  10.802  1.00 70.05  ? 1346 DCT B O1B   1 
HETATM 6799 O  O2B   . DCT L 5 .   ? 34.025  78.414  12.036  1.00 71.83  ? 1346 DCT B O2B   1 
HETATM 6800 O  O3B   . DCT L 5 .   ? 36.177  79.207  13.000  1.00 67.35  ? 1346 DCT B O3B   1 
HETATM 6801 P  PG    . DCT L 5 .   ? 36.935  80.603  13.249  1.00 63.32  ? 1346 DCT B PG    1 
HETATM 6802 O  O1G   . DCT L 5 .   ? 35.831  81.675  13.714  1.00 63.64  ? 1346 DCT B O1G   1 
HETATM 6803 O  O2G   . DCT L 5 .   ? 37.823  80.342  14.566  1.00 64.67  ? 1346 DCT B O2G   1 
HETATM 6804 O  O3G   . DCT L 5 .   ? 37.737  81.074  12.097  1.00 59.76  ? 1346 DCT B O3G   1 
HETATM 6805 O  O     . HOH M 6 .   ? -21.177 27.495  -0.209  1.00 24.66  ? 2001 HOH A O     1 
HETATM 6806 O  O     . HOH M 6 .   ? 2.229   70.047  -8.538  1.00 37.83  ? 2002 HOH A O     1 
HETATM 6807 O  O     . HOH M 6 .   ? 13.075  60.413  34.422  1.00 34.12  ? 2003 HOH A O     1 
HETATM 6808 O  O     . HOH M 6 .   ? 16.444  58.319  36.132  1.00 39.81  ? 2004 HOH A O     1 
HETATM 6809 O  O     . HOH M 6 .   ? 1.831   51.716  -13.848 1.00 32.70  ? 2005 HOH A O     1 
HETATM 6810 O  O     . HOH M 6 .   ? -1.021  50.633  -12.245 1.00 39.03  ? 2006 HOH A O     1 
HETATM 6811 O  O     . HOH M 6 .   ? 16.769  45.971  -6.563  1.00 25.85  ? 2007 HOH A O     1 
HETATM 6812 O  O     . HOH M 6 .   ? -1.051  32.612  -15.988 1.00 44.80  ? 2008 HOH A O     1 
HETATM 6813 O  O     . HOH M 6 .   ? -11.652 58.115  8.334   1.00 20.83  ? 2009 HOH A O     1 
HETATM 6814 O  O     . HOH M 6 .   ? -9.595  51.227  9.935   1.00 14.06  ? 2010 HOH A O     1 
HETATM 6815 O  O     . HOH M 6 .   ? -6.220  62.742  3.064   1.00 17.52  ? 2011 HOH A O     1 
HETATM 6816 O  O     . HOH M 6 .   ? -15.087 56.696  2.510   1.00 30.06  ? 2012 HOH A O     1 
HETATM 6817 O  O     . HOH M 6 .   ? -27.418 49.735  3.269   1.00 38.29  ? 2013 HOH A O     1 
HETATM 6818 O  O     . HOH M 6 .   ? 16.009  58.892  33.334  1.00 39.69  ? 2014 HOH A O     1 
HETATM 6819 O  O     . HOH M 6 .   ? -0.296  46.906  8.330   1.00 44.06  ? 2015 HOH A O     1 
HETATM 6820 O  O     . HOH M 6 .   ? -29.110 30.963  2.883   1.00 43.73  ? 2016 HOH A O     1 
HETATM 6821 O  O     . HOH M 6 .   ? -17.793 28.445  -4.690  1.00 71.40  ? 2017 HOH A O     1 
HETATM 6822 O  O     . HOH M 6 .   ? -22.969 38.345  -16.805 1.00 38.94  ? 2018 HOH A O     1 
HETATM 6823 O  O     . HOH M 6 .   ? -8.966  48.495  29.404  1.00 56.71  ? 2019 HOH A O     1 
HETATM 6824 O  O     . HOH M 6 .   ? -8.419  50.425  -10.173 1.00 32.17  ? 2020 HOH A O     1 
HETATM 6825 O  O     . HOH M 6 .   ? -11.219 50.108  -11.844 1.00 38.37  ? 2021 HOH A O     1 
HETATM 6826 O  O     . HOH M 6 .   ? -14.312 59.989  -11.319 1.00 37.54  ? 2022 HOH A O     1 
HETATM 6827 O  O     . HOH M 6 .   ? -10.685 65.878  -6.644  1.00 43.60  ? 2023 HOH A O     1 
HETATM 6828 O  O     . HOH M 6 .   ? -6.666  62.151  -8.551  1.00 60.96  ? 2024 HOH A O     1 
HETATM 6829 O  O     . HOH M 6 .   ? -2.804  51.803  -10.710 1.00 11.44  ? 2025 HOH A O     1 
HETATM 6830 O  O     . HOH M 6 .   ? -18.577 25.700  2.173   1.00 40.90  ? 2026 HOH A O     1 
HETATM 6831 O  O     . HOH M 6 .   ? -3.978  34.628  9.013   1.00 40.77  ? 2027 HOH A O     1 
HETATM 6832 O  O     . HOH M 6 .   ? -7.860  30.302  -17.850 1.00 41.29  ? 2028 HOH A O     1 
HETATM 6833 O  O     . HOH M 6 .   ? -3.298  28.475  -17.520 1.00 48.23  ? 2029 HOH A O     1 
HETATM 6834 O  O     . HOH M 6 .   ? 5.443   35.241  -0.611  1.00 31.42  ? 2030 HOH A O     1 
HETATM 6835 O  O     . HOH M 6 .   ? 6.962   37.281  -7.561  1.00 27.06  ? 2031 HOH A O     1 
HETATM 6836 O  O     . HOH M 6 .   ? 2.201   30.942  7.404   1.00 44.86  ? 2032 HOH A O     1 
HETATM 6837 O  O     . HOH M 6 .   ? 9.309   16.881  -6.733  1.00 28.25  ? 2033 HOH A O     1 
HETATM 6838 O  O     . HOH M 6 .   ? 9.620   20.077  -8.202  1.00 51.36  ? 2034 HOH A O     1 
HETATM 6839 O  O     . HOH M 6 .   ? 7.127   14.933  -6.330  1.00 30.97  ? 2035 HOH A O     1 
HETATM 6840 O  O     . HOH M 6 .   ? -4.602  34.233  15.439  1.00 29.03  ? 2036 HOH A O     1 
HETATM 6841 O  O     . HOH M 6 .   ? 17.671  60.317  32.927  1.00 42.44  ? 2037 HOH A O     1 
HETATM 6842 O  O     . HOH M 6 .   ? 18.170  56.745  32.890  1.00 37.77  ? 2038 HOH A O     1 
HETATM 6843 O  O     . HOH M 6 .   ? 13.238  57.210  35.332  1.00 29.80  ? 2039 HOH A O     1 
HETATM 6844 O  O     . HOH M 6 .   ? 13.195  61.092  17.945  1.00 42.22  ? 2040 HOH A O     1 
HETATM 6845 O  O     . HOH M 6 .   ? 5.406   56.655  28.470  1.00 12.66  ? 2041 HOH A O     1 
HETATM 6846 O  O     . HOH M 6 .   ? -2.955  38.876  30.910  1.00 27.55  ? 2042 HOH A O     1 
HETATM 6847 O  O     . HOH M 6 .   ? 4.752   43.736  24.749  1.00 31.52  ? 2043 HOH A O     1 
HETATM 6848 O  O     . HOH M 6 .   ? 31.197  45.454  16.079  1.00 49.09  ? 2044 HOH A O     1 
HETATM 6849 O  O     . HOH M 6 .   ? 22.521  35.704  18.889  1.00 43.88  ? 2045 HOH A O     1 
HETATM 6850 O  O     . HOH M 6 .   ? 12.320  38.864  24.324  1.00 16.21  ? 2046 HOH A O     1 
HETATM 6851 O  O     . HOH M 6 .   ? 14.796  38.966  20.233  1.00 44.14  ? 2047 HOH A O     1 
HETATM 6852 O  O     . HOH M 6 .   ? 4.202   44.845  39.864  1.00 33.49  ? 2048 HOH A O     1 
HETATM 6853 O  O     . HOH M 6 .   ? -1.951  56.413  32.638  1.00 43.56  ? 2049 HOH A O     1 
HETATM 6854 O  O     . HOH M 6 .   ? 24.218  49.615  35.269  1.00 34.81  ? 2050 HOH A O     1 
HETATM 6855 O  O     . HOH M 6 .   ? 14.649  36.038  32.113  1.00 41.93  ? 2051 HOH A O     1 
HETATM 6856 O  O     . HOH M 6 .   ? 26.964  37.348  24.767  1.00 31.63  ? 2052 HOH A O     1 
HETATM 6857 O  O     . HOH M 6 .   ? 34.405  42.125  20.494  1.00 34.37  ? 2053 HOH A O     1 
HETATM 6858 O  O     . HOH M 6 .   ? 32.482  54.047  16.859  1.00 63.03  ? 2054 HOH A O     1 
HETATM 6859 O  O     . HOH M 6 .   ? 13.143  46.329  14.119  1.00 37.37  ? 2055 HOH A O     1 
HETATM 6860 O  O     . HOH M 6 .   ? 8.543   47.658  18.060  1.00 18.36  ? 2056 HOH A O     1 
HETATM 6861 O  O     . HOH M 6 .   ? -7.860  46.588  26.587  1.00 63.30  ? 2057 HOH A O     1 
HETATM 6862 O  O     . HOH M 6 .   ? -17.996 45.776  31.146  1.00 39.02  ? 2058 HOH A O     1 
HETATM 6863 O  O     . HOH M 6 .   ? 2.061   41.925  -0.844  1.00 29.86  ? 2059 HOH A O     1 
HETATM 6864 O  O     . HOH N 6 .   ? 47.853  63.160  12.284  1.00 31.75  ? 2001 HOH B O     1 
HETATM 6865 O  O     . HOH N 6 .   ? 34.039  61.906  -12.702 1.00 35.38  ? 2002 HOH B O     1 
HETATM 6866 O  O     . HOH N 6 .   ? 40.457  63.925  -9.769  1.00 47.02  ? 2003 HOH B O     1 
HETATM 6867 O  O     . HOH N 6 .   ? 32.852  68.745  -22.071 1.00 54.82  ? 2004 HOH B O     1 
HETATM 6868 O  O     . HOH N 6 .   ? 33.840  75.596  11.138  1.00 38.13  ? 2005 HOH B O     1 
HETATM 6869 O  O     . HOH N 6 .   ? 49.914  70.971  -5.740  1.00 21.22  ? 2006 HOH B O     1 
HETATM 6870 O  O     . HOH N 6 .   ? 28.487  111.090 -3.631  1.00 36.03  ? 2007 HOH B O     1 
HETATM 6871 O  O     . HOH N 6 .   ? 23.047  72.845  13.996  1.00 43.96  ? 2008 HOH B O     1 
HETATM 6872 O  O     . HOH N 6 .   ? 19.708  81.735  34.917  1.00 37.50  ? 2009 HOH B O     1 
HETATM 6873 O  O     . HOH N 6 .   ? 17.728  86.506  24.284  1.00 38.58  ? 2010 HOH B O     1 
HETATM 6874 O  O     . HOH N 6 .   ? 31.782  85.856  13.970  1.00 46.10  ? 2011 HOH B O     1 
HETATM 6875 O  O     . HOH N 6 .   ? 30.501  71.417  -21.354 1.00 49.50  ? 2012 HOH B O     1 
HETATM 6876 O  O     . HOH N 6 .   ? 17.597  91.268  37.157  1.00 50.78  ? 2013 HOH B O     1 
HETATM 6877 O  O     . HOH N 6 .   ? 33.658  94.833  42.169  1.00 47.00  ? 2014 HOH B O     1 
HETATM 6878 O  O     . HOH N 6 .   ? 38.552  86.524  37.195  1.00 69.43  ? 2015 HOH B O     1 
HETATM 6879 O  O     . HOH N 6 .   ? 40.937  90.386  34.829  1.00 36.77  ? 2016 HOH B O     1 
HETATM 6880 O  O     . HOH N 6 .   ? 41.869  77.187  28.238  1.00 42.45  ? 2017 HOH B O     1 
HETATM 6881 O  O     . HOH N 6 .   ? 37.390  74.940  35.788  1.00 12.45  ? 2018 HOH B O     1 
HETATM 6882 O  O     . HOH N 6 .   ? 40.277  72.172  32.205  1.00 34.88  ? 2019 HOH B O     1 
HETATM 6883 O  O     . HOH N 6 .   ? 41.885  69.334  22.928  1.00 20.21  ? 2020 HOH B O     1 
HETATM 6884 O  O     . HOH N 6 .   ? 41.016  74.726  25.664  1.00 68.13  ? 2021 HOH B O     1 
HETATM 6885 O  O     . HOH N 6 .   ? 44.484  110.247 20.217  1.00 47.10  ? 2022 HOH B O     1 
HETATM 6886 O  O     . HOH N 6 .   ? 35.574  91.877  7.814   1.00 54.75  ? 2023 HOH B O     1 
HETATM 6887 O  O     . HOH N 6 .   ? 29.049  99.076  0.824   1.00 31.22  ? 2024 HOH B O     1 
HETATM 6888 O  O     . HOH N 6 .   ? 43.658  106.972 7.496   1.00 27.02  ? 2025 HOH B O     1 
HETATM 6889 O  O     . HOH N 6 .   ? 41.443  111.716 9.172   1.00 34.70  ? 2026 HOH B O     1 
HETATM 6890 O  O     . HOH N 6 .   ? 28.903  116.213 7.928   1.00 64.51  ? 2027 HOH B O     1 
HETATM 6891 O  O     . HOH N 6 .   ? 24.359  115.753 6.473   1.00 56.86  ? 2028 HOH B O     1 
HETATM 6892 O  O     . HOH N 6 .   ? 25.892  117.742 2.910   1.00 56.94  ? 2029 HOH B O     1 
HETATM 6893 O  O     . HOH N 6 .   ? 30.587  109.681 -3.779  1.00 24.17  ? 2030 HOH B O     1 
HETATM 6894 O  O     . HOH N 6 .   ? 29.875  111.449 -5.784  1.00 23.72  ? 2031 HOH B O     1 
HETATM 6895 O  O     . HOH N 6 .   ? 23.458  100.993 11.958  1.00 44.22  ? 2032 HOH B O     1 
HETATM 6896 O  O     . HOH N 6 .   ? 25.699  94.188  12.253  1.00 34.54  ? 2033 HOH B O     1 
HETATM 6897 O  O     . HOH N 6 .   ? 23.274  101.578 17.328  1.00 41.76  ? 2034 HOH B O     1 
HETATM 6898 O  O     . HOH N 6 .   ? 20.376  82.499  11.764  1.00 23.48  ? 2035 HOH B O     1 
HETATM 6899 O  O     . HOH N 6 .   ? 10.909  80.333  13.139  1.00 31.34  ? 2036 HOH B O     1 
HETATM 6900 O  O     . HOH N 6 .   ? 13.895  64.837  3.542   1.00 18.98  ? 2037 HOH B O     1 
HETATM 6901 O  O     . HOH N 6 .   ? 9.383   66.732  7.139   1.00 45.60  ? 2038 HOH B O     1 
HETATM 6902 O  O     . HOH N 6 .   ? 2.406   72.012  8.031   1.00 49.97  ? 2039 HOH B O     1 
HETATM 6903 O  O     . HOH N 6 .   ? 29.909  76.514  -15.123 1.00 47.59  ? 2040 HOH B O     1 
HETATM 6904 O  O     . HOH N 6 .   ? 31.305  75.062  -19.690 1.00 34.57  ? 2041 HOH B O     1 
HETATM 6905 O  O     . HOH N 6 .   ? -1.391  70.426  1.149   1.00 26.63  ? 2042 HOH B O     1 
HETATM 6906 O  O     . HOH N 6 .   ? 3.034   70.970  3.084   1.00 38.19  ? 2043 HOH B O     1 
HETATM 6907 O  O     . HOH N 6 .   ? 5.406   85.021  -11.335 1.00 31.99  ? 2044 HOH B O     1 
HETATM 6908 O  O     . HOH N 6 .   ? 12.903  81.721  -24.852 1.00 38.57  ? 2045 HOH B O     1 
HETATM 6909 O  O     . HOH N 6 .   ? 11.473  79.523  -24.560 1.00 33.17  ? 2046 HOH B O     1 
HETATM 6910 O  O     . HOH N 6 .   ? 24.513  80.432  -3.329  1.00 24.04  ? 2047 HOH B O     1 
HETATM 6911 O  O     . HOH N 6 .   ? 38.096  80.192  16.760  1.00 50.40  ? 2048 HOH B O     1 
HETATM 6912 O  O     . HOH O 6 .   ? -2.931  26.638  21.262  1.00 27.37  ? 2001 HOH C O     1 
HETATM 6913 O  O     . HOH O 6 .   ? 18.891  28.538  21.715  1.00 36.65  ? 2002 HOH C O     1 
HETATM 6914 O  O     . HOH O 6 .   ? 12.188  30.933  29.754  1.00 43.54  ? 2003 HOH C O     1 
HETATM 6915 O  O     . HOH O 6 .   ? 16.438  32.034  26.286  1.00 59.07  ? 2004 HOH C O     1 
HETATM 6916 O  O     . HOH O 6 .   ? 6.802   36.867  22.396  1.00 34.17  ? 2005 HOH C O     1 
HETATM 6917 O  O     . HOH O 6 .   ? 17.293  31.653  19.724  1.00 37.75  ? 2006 HOH C O     1 
HETATM 6918 O  O     . HOH O 6 .   ? 9.716   39.386  18.588  1.00 47.72  ? 2007 HOH C O     1 
HETATM 6919 O  O     . HOH O 6 .   ? 20.951  36.167  16.048  1.00 37.49  ? 2008 HOH C O     1 
HETATM 6920 O  O     . HOH O 6 .   ? 20.515  32.934  11.558  1.00 27.01  ? 2009 HOH C O     1 
HETATM 6921 O  O     . HOH O 6 .   ? 12.783  35.876  5.064   1.00 40.52  ? 2010 HOH C O     1 
HETATM 6922 O  O     . HOH O 6 .   ? 4.679   37.116  8.030   1.00 18.22  ? 2011 HOH C O     1 
HETATM 6923 O  O     . HOH O 6 .   ? 12.627  44.045  8.089   1.00 25.93  ? 2012 HOH C O     1 
HETATM 6924 O  O     . HOH O 6 .   ? 10.667  37.077  5.072   1.00 28.89  ? 2013 HOH C O     1 
HETATM 6925 O  O     . HOH O 6 .   ? -0.167  43.663  9.852   1.00 25.97  ? 2014 HOH C O     1 
HETATM 6926 O  O     . HOH P 6 .   ? 34.480  57.787  15.894  1.00 59.54  ? 2001 HOH D O     1 
HETATM 6927 O  O     . HOH P 6 .   ? 31.724  56.130  15.288  1.00 74.98  ? 2002 HOH D O     1 
HETATM 6928 O  O     . HOH P 6 .   ? 32.291  57.735  16.881  1.00 61.44  ? 2003 HOH D O     1 
HETATM 6929 O  O     . HOH P 6 .   ? 30.069  59.830  12.995  1.00 33.70  ? 2004 HOH D O     1 
HETATM 6930 O  O     . HOH P 6 .   ? 27.668  44.923  4.337   1.00 40.30  ? 2005 HOH D O     1 
HETATM 6931 O  O     . HOH P 6 .   ? 21.508  54.658  2.772   1.00 9.98   ? 2006 HOH D O     1 
HETATM 6932 O  O     . HOH P 6 .   ? 12.348  60.899  12.918  1.00 29.22  ? 2007 HOH D O     1 
HETATM 6933 O  O     . HOH P 6 .   ? 0.386   40.845  18.011  1.00 35.09  ? 2008 HOH D O     1 
HETATM 6934 O  O     . HOH P 6 .   ? 5.026   40.837  21.072  1.00 39.59  ? 2009 HOH D O     1 
HETATM 6935 O  O     . HOH Q 6 .   ? 15.511  101.702 1.823   1.00 44.56  ? 2001 HOH E O     1 
HETATM 6936 O  O     . HOH Q 6 .   ? 13.065  99.613  1.872   1.00 51.63  ? 2002 HOH E O     1 
HETATM 6937 O  O     . HOH Q 6 .   ? 12.210  97.235  3.682   1.00 27.67  ? 2003 HOH E O     1 
HETATM 6938 O  O     . HOH Q 6 .   ? 9.513   95.577  4.203   1.00 38.01  ? 2004 HOH E O     1 
HETATM 6939 O  O     . HOH Q 6 .   ? 10.535  99.090  1.814   1.00 46.09  ? 2005 HOH E O     1 
HETATM 6940 O  O     . HOH Q 6 .   ? 3.673   96.218  -1.987  1.00 40.59  ? 2006 HOH E O     1 
HETATM 6941 O  O     . HOH Q 6 .   ? 11.446  96.620  1.657   1.00 61.46  ? 2007 HOH E O     1 
HETATM 6942 O  O     . HOH Q 6 .   ? 14.758  90.021  -0.164  1.00 32.19  ? 2008 HOH E O     1 
HETATM 6943 O  O     . HOH Q 6 .   ? 17.871  87.331  -3.549  1.00 28.75  ? 2009 HOH E O     1 
HETATM 6944 O  O     . HOH Q 6 .   ? 32.235  90.622  0.890   1.00 18.68  ? 2010 HOH E O     1 
HETATM 6945 O  O     . HOH Q 6 .   ? 32.086  88.001  3.793   1.00 87.32  ? 2011 HOH E O     1 
HETATM 6946 O  O     . HOH Q 6 .   ? 32.917  89.617  9.586   1.00 38.08  ? 2012 HOH E O     1 
HETATM 6947 O  O     . HOH R 6 .   ? 33.830  77.862  -14.871 1.00 36.01  ? 2001 HOH F O     1 
HETATM 6948 O  O     . HOH R 6 .   ? 32.442  69.242  -16.598 1.00 53.62  ? 2002 HOH F O     1 
HETATM 6949 O  O     . HOH R 6 .   ? 33.814  82.629  -0.100  1.00 38.46  ? 2003 HOH F O     1 
HETATM 6950 O  O     . HOH R 6 .   ? 12.492  94.366  2.053   1.00 47.63  ? 2004 HOH F O     1 
HETATM 6951 O  O     . HOH R 6 .   ? 21.377  77.144  0.593   1.00 38.01  ? 2005 HOH F O     1 
HETATM 6952 O  O     . HOH R 6 .   ? 26.395  102.327 -2.720  1.00 26.59  ? 2006 HOH F O     1 
HETATM 6953 O  O     . HOH R 6 .   ? 24.543  96.354  9.291   1.00 51.61  ? 2007 HOH F O     1 
HETATM 6954 O  O     . HOH R 6 .   ? 14.760  95.387  2.720   1.00 37.57  ? 2008 HOH F O     1 
HETATM 6955 O  O     . HOH R 6 .   ? 24.458  103.460 -1.725  1.00 29.28  ? 2009 HOH F O     1 
HETATM 6956 O  O     . HOH R 6 .   ? 17.434  103.535 -2.763  1.00 28.17  ? 2010 HOH F O     1 
HETATM 6957 O  O     . HOH R 6 .   ? 23.384  106.952 -2.566  1.00 56.88  ? 2011 HOH F O     1 
HETATM 6958 O  O     . HOH R 6 .   ? 14.091  104.964 -5.732  1.00 51.85  ? 2012 HOH F O     1 
HETATM 6959 O  O     . HOH R 6 .   ? -1.497  98.252  -1.161  1.00 33.52  ? 2013 HOH F O     1 
HETATM 6960 O  O     . HOH R 6 .   ? 3.020   105.336 -6.730  1.00 41.38  ? 2014 HOH F O     1 
HETATM 6961 O  O     . HOH R 6 .   ? -5.818  103.400 -1.165  1.00 30.57  ? 2015 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 ARG 338 332 332 ARG ARG A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 343 ALA ALA A . n 
A 1 350 ILE 350 344 344 ILE ILE A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 1 1   HIS 1   -5  ?   ?   ?   B . n 
B 1 2   HIS 2   -4  ?   ?   ?   B . n 
B 1 3   HIS 3   -3  ?   ?   ?   B . n 
B 1 4   HIS 4   -2  ?   ?   ?   B . n 
B 1 5   HIS 5   -1  ?   ?   ?   B . n 
B 1 6   HIS 6   0   ?   ?   ?   B . n 
B 1 7   MET 7   1   1   MET MET B . n 
B 1 8   ILE 8   2   2   ILE ILE B . n 
B 1 9   VAL 9   3   3   VAL VAL B . n 
B 1 10  LEU 10  4   4   LEU LEU B . n 
B 1 11  PHE 11  5   5   PHE PHE B . n 
B 1 12  VAL 12  6   6   VAL VAL B . n 
B 1 13  ASP 13  7   7   ASP ASP B . n 
B 1 14  PHE 14  8   8   PHE PHE B . n 
B 1 15  ASP 15  9   9   ASP ASP B . n 
B 1 16  TYR 16  10  10  TYR TYR B . n 
B 1 17  PHE 17  11  11  PHE PHE B . n 
B 1 18  TYR 18  12  12  TYR TYR B . n 
B 1 19  ALA 19  13  13  ALA ALA B . n 
B 1 20  GLN 20  14  14  GLN GLN B . n 
B 1 21  VAL 21  15  15  VAL VAL B . n 
B 1 22  GLU 22  16  16  GLU GLU B . n 
B 1 23  GLU 23  17  17  GLU GLU B . n 
B 1 24  VAL 24  18  18  VAL VAL B . n 
B 1 25  LEU 25  19  19  LEU LEU B . n 
B 1 26  ASN 26  20  20  ASN ASN B . n 
B 1 27  PRO 27  21  21  PRO PRO B . n 
B 1 28  SER 28  22  22  SER SER B . n 
B 1 29  LEU 29  23  23  LEU LEU B . n 
B 1 30  LYS 30  24  24  LYS LYS B . n 
B 1 31  GLY 31  25  25  GLY GLY B . n 
B 1 32  LYS 32  26  26  LYS LYS B . n 
B 1 33  PRO 33  27  27  PRO PRO B . n 
B 1 34  VAL 34  28  28  VAL VAL B . n 
B 1 35  VAL 35  29  29  VAL VAL B . n 
B 1 36  VAL 36  30  30  VAL VAL B . n 
B 1 37  CYS 37  31  31  CYS CYS B . n 
B 1 38  VAL 38  32  32  VAL VAL B . n 
B 1 39  PHE 39  33  33  PHE PHE B . n 
B 1 40  SER 40  34  34  SER SER B . n 
B 1 41  GLY 41  35  35  GLY GLY B . n 
B 1 42  ARG 42  36  36  ARG ARG B . n 
B 1 43  PHE 43  37  37  PHE PHE B . n 
B 1 44  GLU 44  38  38  GLU GLU B . n 
B 1 45  ASP 45  39  39  ASP ASP B . n 
B 1 46  SER 46  40  40  SER SER B . n 
B 1 47  GLY 47  41  41  GLY GLY B . n 
B 1 48  ALA 48  42  42  ALA ALA B . n 
B 1 49  VAL 49  43  43  VAL VAL B . n 
B 1 50  ALA 50  44  44  ALA ALA B . n 
B 1 51  THR 51  45  45  THR THR B . n 
B 1 52  ALA 52  46  46  ALA ALA B . n 
B 1 53  ASN 53  47  47  ASN ASN B . n 
B 1 54  TYR 54  48  48  TYR TYR B . n 
B 1 55  GLU 55  49  49  GLU GLU B . n 
B 1 56  ALA 56  50  50  ALA ALA B . n 
B 1 57  ARG 57  51  51  ARG ARG B . n 
B 1 58  LYS 58  52  52  LYS LYS B . n 
B 1 59  PHE 59  53  53  PHE PHE B . n 
B 1 60  GLY 60  54  54  GLY GLY B . n 
B 1 61  VAL 61  55  55  VAL VAL B . n 
B 1 62  LYS 62  56  56  LYS LYS B . n 
B 1 63  ALA 63  57  57  ALA ALA B . n 
B 1 64  GLY 64  58  58  GLY GLY B . n 
B 1 65  ILE 65  59  59  ILE ILE B . n 
B 1 66  PRO 66  60  60  PRO PRO B . n 
B 1 67  ILE 67  61  61  ILE ILE B . n 
B 1 68  VAL 68  62  62  VAL VAL B . n 
B 1 69  GLU 69  63  63  GLU GLU B . n 
B 1 70  ALA 70  64  64  ALA ALA B . n 
B 1 71  LYS 71  65  65  LYS LYS B . n 
B 1 72  LYS 72  66  66  LYS LYS B . n 
B 1 73  ILE 73  67  67  ILE ILE B . n 
B 1 74  LEU 74  68  68  LEU LEU B . n 
B 1 75  PRO 75  69  69  PRO PRO B . n 
B 1 76  ASN 76  70  70  ASN ASN B . n 
B 1 77  ALA 77  71  71  ALA ALA B . n 
B 1 78  VAL 78  72  72  VAL VAL B . n 
B 1 79  TYR 79  73  73  TYR TYR B . n 
B 1 80  LEU 80  74  74  LEU LEU B . n 
B 1 81  PRO 81  75  75  PRO PRO B . n 
B 1 82  MET 82  76  76  MET MET B . n 
B 1 83  ARG 83  77  77  ARG ARG B . n 
B 1 84  LYS 84  78  78  LYS LYS B . n 
B 1 85  GLU 85  79  79  GLU GLU B . n 
B 1 86  VAL 86  80  80  VAL VAL B . n 
B 1 87  TYR 87  81  81  TYR TYR B . n 
B 1 88  GLN 88  82  82  GLN GLN B . n 
B 1 89  GLN 89  83  83  GLN GLN B . n 
B 1 90  VAL 90  84  84  VAL VAL B . n 
B 1 91  SER 91  85  85  SER SER B . n 
B 1 92  SER 92  86  86  SER SER B . n 
B 1 93  ARG 93  87  87  ARG ARG B . n 
B 1 94  ILE 94  88  88  ILE ILE B . n 
B 1 95  MET 95  89  89  MET MET B . n 
B 1 96  ASN 96  90  90  ASN ASN B . n 
B 1 97  LEU 97  91  91  LEU LEU B . n 
B 1 98  LEU 98  92  92  LEU LEU B . n 
B 1 99  ARG 99  93  93  ARG ARG B . n 
B 1 100 GLU 100 94  94  GLU GLU B . n 
B 1 101 TYR 101 95  95  TYR TYR B . n 
B 1 102 SER 102 96  96  SER SER B . n 
B 1 103 GLU 103 97  97  GLU GLU B . n 
B 1 104 LYS 104 98  98  LYS LYS B . n 
B 1 105 ILE 105 99  99  ILE ILE B . n 
B 1 106 GLU 106 100 100 GLU GLU B . n 
B 1 107 ILE 107 101 101 ILE ILE B . n 
B 1 108 ALA 108 102 102 ALA ALA B . n 
B 1 109 SER 109 103 103 SER SER B . n 
B 1 110 ILE 110 104 104 ILE ILE B . n 
B 1 111 ASP 111 105 105 ASP ASP B . n 
B 1 112 GLU 112 106 106 GLU GLU B . n 
B 1 113 ALA 113 107 107 ALA ALA B . n 
B 1 114 TYR 114 108 108 TYR TYR B . n 
B 1 115 LEU 115 109 109 LEU LEU B . n 
B 1 116 ASP 116 110 110 ASP ASP B . n 
B 1 117 ILE 117 111 111 ILE ILE B . n 
B 1 118 SER 118 112 112 SER SER B . n 
B 1 119 ASP 119 113 113 ASP ASP B . n 
B 1 120 LYS 120 114 114 LYS LYS B . n 
B 1 121 VAL 121 115 115 VAL VAL B . n 
B 1 122 ARG 122 116 116 ARG ARG B . n 
B 1 123 ASP 123 117 117 ASP ASP B . n 
B 1 124 TYR 124 118 118 TYR TYR B . n 
B 1 125 ARG 125 119 119 ARG ARG B . n 
B 1 126 GLU 126 120 120 GLU GLU B . n 
B 1 127 ALA 127 121 121 ALA ALA B . n 
B 1 128 TYR 128 122 122 TYR TYR B . n 
B 1 129 ASN 129 123 123 ASN ASN B . n 
B 1 130 LEU 130 124 124 LEU LEU B . n 
B 1 131 GLY 131 125 125 GLY GLY B . n 
B 1 132 LEU 132 126 126 LEU LEU B . n 
B 1 133 GLU 133 127 127 GLU GLU B . n 
B 1 134 ILE 134 128 128 ILE ILE B . n 
B 1 135 LYS 135 129 129 LYS LYS B . n 
B 1 136 ASN 136 130 130 ASN ASN B . n 
B 1 137 LYS 137 131 131 LYS LYS B . n 
B 1 138 ILE 138 132 132 ILE ILE B . n 
B 1 139 LEU 139 133 133 LEU LEU B . n 
B 1 140 GLU 140 134 134 GLU GLU B . n 
B 1 141 LYS 141 135 135 LYS LYS B . n 
B 1 142 GLU 142 136 136 GLU GLU B . n 
B 1 143 LYS 143 137 137 LYS LYS B . n 
B 1 144 ILE 144 138 138 ILE ILE B . n 
B 1 145 THR 145 139 139 THR THR B . n 
B 1 146 VAL 146 140 140 VAL VAL B . n 
B 1 147 THR 147 141 141 THR THR B . n 
B 1 148 VAL 148 142 142 VAL VAL B . n 
B 1 149 GLY 149 143 143 GLY GLY B . n 
B 1 150 ILE 150 144 144 ILE ILE B . n 
B 1 151 SER 151 145 145 SER SER B . n 
B 1 152 LYS 152 146 146 LYS LYS B . n 
B 1 153 ASN 153 147 147 ASN ASN B . n 
B 1 154 LYS 154 148 148 LYS LYS B . n 
B 1 155 VAL 155 149 149 VAL VAL B . n 
B 1 156 PHE 156 150 150 PHE PHE B . n 
B 1 157 ALA 157 151 151 ALA ALA B . n 
B 1 158 LYS 158 152 152 LYS LYS B . n 
B 1 159 ILE 159 153 153 ILE ILE B . n 
B 1 160 ALA 160 154 154 ALA ALA B . n 
B 1 161 ALA 161 155 155 ALA ALA B . n 
B 1 162 ASP 162 156 156 ASP ASP B . n 
B 1 163 MET 163 157 157 MET MET B . n 
B 1 164 ALA 164 158 158 ALA ALA B . n 
B 1 165 LYS 165 159 159 LYS LYS B . n 
B 1 166 PRO 166 160 160 PRO PRO B . n 
B 1 167 ASN 167 161 161 ASN ASN B . n 
B 1 168 GLY 168 162 162 GLY GLY B . n 
B 1 169 ILE 169 163 163 ILE ILE B . n 
B 1 170 LYS 170 164 164 LYS LYS B . n 
B 1 171 VAL 171 165 165 VAL VAL B . n 
B 1 172 ILE 172 166 166 ILE ILE B . n 
B 1 173 ASP 173 167 167 ASP ASP B . n 
B 1 174 ASP 174 168 168 ASP ASP B . n 
B 1 175 GLU 175 169 169 GLU GLU B . n 
B 1 176 GLU 176 170 170 GLU GLU B . n 
B 1 177 VAL 177 171 171 VAL VAL B . n 
B 1 178 LYS 178 172 172 LYS LYS B . n 
B 1 179 ARG 179 173 173 ARG ARG B . n 
B 1 180 LEU 180 174 174 LEU LEU B . n 
B 1 181 ILE 181 175 175 ILE ILE B . n 
B 1 182 ARG 182 176 176 ARG ARG B . n 
B 1 183 GLU 183 177 177 GLU GLU B . n 
B 1 184 LEU 184 178 178 LEU LEU B . n 
B 1 185 ASP 185 179 179 ASP ASP B . n 
B 1 186 ILE 186 180 180 ILE ILE B . n 
B 1 187 ALA 187 181 181 ALA ALA B . n 
B 1 188 ASP 188 182 182 ASP ASP B . n 
B 1 189 VAL 189 183 183 VAL VAL B . n 
B 1 190 PRO 190 184 184 PRO PRO B . n 
B 1 191 GLY 191 185 185 GLY GLY B . n 
B 1 192 ILE 192 186 186 ILE ILE B . n 
B 1 193 GLY 193 187 187 GLY GLY B . n 
B 1 194 ASN 194 188 188 ASN ASN B . n 
B 1 195 ILE 195 189 189 ILE ILE B . n 
B 1 196 THR 196 190 190 THR THR B . n 
B 1 197 ALA 197 191 191 ALA ALA B . n 
B 1 198 GLU 198 192 192 GLU GLU B . n 
B 1 199 LYS 199 193 193 LYS LYS B . n 
B 1 200 LEU 200 194 194 LEU LEU B . n 
B 1 201 LYS 201 195 195 LYS LYS B . n 
B 1 202 LYS 202 196 196 LYS LYS B . n 
B 1 203 LEU 203 197 197 LEU LEU B . n 
B 1 204 GLY 204 198 198 GLY GLY B . n 
B 1 205 ILE 205 199 199 ILE ILE B . n 
B 1 206 ASN 206 200 200 ASN ASN B . n 
B 1 207 LYS 207 201 201 LYS LYS B . n 
B 1 208 LEU 208 202 202 LEU LEU B . n 
B 1 209 VAL 209 203 203 VAL VAL B . n 
B 1 210 ASP 210 204 204 ASP ASP B . n 
B 1 211 THR 211 205 205 THR THR B . n 
B 1 212 LEU 212 206 206 LEU LEU B . n 
B 1 213 SER 213 207 207 SER SER B . n 
B 1 214 ILE 214 208 208 ILE ILE B . n 
B 1 215 GLU 215 209 209 GLU GLU B . n 
B 1 216 PHE 216 210 210 PHE PHE B . n 
B 1 217 ASP 217 211 211 ASP ASP B . n 
B 1 218 LYS 218 212 212 LYS LYS B . n 
B 1 219 LEU 219 213 213 LEU LEU B . n 
B 1 220 LYS 220 214 214 LYS LYS B . n 
B 1 221 GLY 221 215 215 GLY GLY B . n 
B 1 222 MET 222 216 216 MET MET B . n 
B 1 223 ILE 223 217 217 ILE ILE B . n 
B 1 224 GLY 224 218 218 GLY GLY B . n 
B 1 225 GLU 225 219 219 GLU GLU B . n 
B 1 226 ALA 226 220 220 ALA ALA B . n 
B 1 227 LYS 227 221 221 LYS LYS B . n 
B 1 228 ALA 228 222 222 ALA ALA B . n 
B 1 229 LYS 229 223 223 LYS LYS B . n 
B 1 230 TYR 230 224 224 TYR TYR B . n 
B 1 231 LEU 231 225 225 LEU LEU B . n 
B 1 232 ILE 232 226 226 ILE ILE B . n 
B 1 233 SER 233 227 227 SER SER B . n 
B 1 234 LEU 234 228 228 LEU LEU B . n 
B 1 235 ALA 235 229 229 ALA ALA B . n 
B 1 236 ARG 236 230 230 ARG ARG B . n 
B 1 237 ASP 237 231 231 ASP ASP B . n 
B 1 238 GLU 238 232 232 GLU GLU B . n 
B 1 239 TYR 239 233 233 TYR TYR B . n 
B 1 240 ASN 240 234 234 ASN ASN B . n 
B 1 241 GLU 241 235 235 GLU GLU B . n 
B 1 242 PRO 242 236 236 PRO PRO B . n 
B 1 243 ILE 243 237 237 ILE ILE B . n 
B 1 244 ARG 244 238 238 ARG ARG B . n 
B 1 245 THR 245 239 239 THR THR B . n 
B 1 246 ARG 246 240 240 ARG ARG B . n 
B 1 247 VAL 247 241 241 VAL VAL B . n 
B 1 248 ARG 248 242 242 ARG ARG B . n 
B 1 249 LYS 249 243 243 LYS LYS B . n 
B 1 250 SER 250 244 244 SER SER B . n 
B 1 251 ILE 251 245 245 ILE ILE B . n 
B 1 252 GLY 252 246 246 GLY GLY B . n 
B 1 253 ARG 253 247 247 ARG ARG B . n 
B 1 254 ILE 254 248 248 ILE ILE B . n 
B 1 255 VAL 255 249 249 VAL VAL B . n 
B 1 256 THR 256 250 250 THR THR B . n 
B 1 257 MET 257 251 251 MET MET B . n 
B 1 258 LYS 258 252 252 LYS LYS B . n 
B 1 259 ARG 259 253 253 ARG ARG B . n 
B 1 260 ASN 260 254 254 ASN ASN B . n 
B 1 261 SER 261 255 255 SER SER B . n 
B 1 262 ARG 262 256 256 ARG ARG B . n 
B 1 263 ASN 263 257 257 ASN ASN B . n 
B 1 264 LEU 264 258 258 LEU LEU B . n 
B 1 265 GLU 265 259 259 GLU GLU B . n 
B 1 266 GLU 266 260 260 GLU GLU B . n 
B 1 267 ILE 267 261 261 ILE ILE B . n 
B 1 268 LYS 268 262 262 LYS LYS B . n 
B 1 269 PRO 269 263 263 PRO PRO B . n 
B 1 270 TYR 270 264 264 TYR TYR B . n 
B 1 271 LEU 271 265 265 LEU LEU B . n 
B 1 272 PHE 272 266 266 PHE PHE B . n 
B 1 273 ARG 273 267 267 ARG ARG B . n 
B 1 274 ALA 274 268 268 ALA ALA B . n 
B 1 275 ILE 275 269 269 ILE ILE B . n 
B 1 276 GLU 276 270 270 GLU GLU B . n 
B 1 277 GLU 277 271 271 GLU GLU B . n 
B 1 278 SER 278 272 272 SER SER B . n 
B 1 279 TYR 279 273 273 TYR TYR B . n 
B 1 280 TYR 280 274 274 TYR TYR B . n 
B 1 281 LYS 281 275 275 LYS LYS B . n 
B 1 282 LEU 282 276 276 LEU LEU B . n 
B 1 283 ASP 283 277 277 ASP ASP B . n 
B 1 284 LYS 284 278 278 LYS LYS B . n 
B 1 285 ARG 285 279 279 ARG ARG B . n 
B 1 286 ILE 286 280 280 ILE ILE B . n 
B 1 287 PRO 287 281 281 PRO PRO B . n 
B 1 288 LYS 288 282 282 LYS LYS B . n 
B 1 289 ALA 289 283 283 ALA ALA B . n 
B 1 290 ILE 290 284 284 ILE ILE B . n 
B 1 291 HIS 291 285 285 HIS HIS B . n 
B 1 292 VAL 292 286 286 VAL VAL B . n 
B 1 293 VAL 293 287 287 VAL VAL B . n 
B 1 294 ALA 294 288 288 ALA ALA B . n 
B 1 295 VAL 295 289 289 VAL VAL B . n 
B 1 296 THR 296 290 290 THR THR B . n 
B 1 297 GLU 297 291 291 GLU GLU B . n 
B 1 298 ASP 298 292 292 ASP ASP B . n 
B 1 299 LEU 299 293 293 LEU LEU B . n 
B 1 300 ASP 300 294 294 ASP ASP B . n 
B 1 301 ILE 301 295 295 ILE ILE B . n 
B 1 302 VAL 302 296 296 VAL VAL B . n 
B 1 303 SER 303 297 297 SER SER B . n 
B 1 304 ARG 304 298 298 ARG ARG B . n 
B 1 305 GLY 305 299 299 GLY GLY B . n 
B 1 306 ARG 306 300 300 ARG ARG B . n 
B 1 307 THR 307 301 301 THR THR B . n 
B 1 308 PHE 308 302 302 PHE PHE B . n 
B 1 309 PRO 309 303 303 PRO PRO B . n 
B 1 310 HIS 310 304 304 HIS HIS B . n 
B 1 311 GLY 311 305 305 GLY GLY B . n 
B 1 312 ILE 312 306 306 ILE ILE B . n 
B 1 313 SER 313 307 307 SER SER B . n 
B 1 314 LYS 314 308 308 LYS LYS B . n 
B 1 315 GLU 315 309 309 GLU GLU B . n 
B 1 316 THR 316 310 310 THR THR B . n 
B 1 317 ALA 317 311 311 ALA ALA B . n 
B 1 318 TYR 318 312 312 TYR TYR B . n 
B 1 319 SER 319 313 313 SER SER B . n 
B 1 320 GLU 320 314 314 GLU GLU B . n 
B 1 321 SER 321 315 315 SER SER B . n 
B 1 322 VAL 322 316 316 VAL VAL B . n 
B 1 323 LYS 323 317 317 LYS LYS B . n 
B 1 324 LEU 324 318 318 LEU LEU B . n 
B 1 325 LEU 325 319 319 LEU LEU B . n 
B 1 326 GLN 326 320 320 GLN GLN B . n 
B 1 327 LYS 327 321 321 LYS LYS B . n 
B 1 328 ILE 328 322 322 ILE ILE B . n 
B 1 329 LEU 329 323 323 LEU LEU B . n 
B 1 330 GLU 330 324 324 GLU GLU B . n 
B 1 331 GLU 331 325 325 GLU GLU B . n 
B 1 332 ASP 332 326 326 ASP ASP B . n 
B 1 333 GLU 333 327 327 GLU GLU B . n 
B 1 334 ARG 334 328 328 ARG ARG B . n 
B 1 335 LYS 335 329 329 LYS LYS B . n 
B 1 336 ILE 336 330 330 ILE ILE B . n 
B 1 337 ARG 337 331 331 ARG ARG B . n 
B 1 338 ARG 338 332 332 ARG ARG B . n 
B 1 339 ILE 339 333 333 ILE ILE B . n 
B 1 340 GLY 340 334 334 GLY GLY B . n 
B 1 341 VAL 341 335 335 VAL VAL B . n 
B 1 342 ARG 342 336 336 ARG ARG B . n 
B 1 343 PHE 343 337 337 PHE PHE B . n 
B 1 344 SER 344 338 338 SER SER B . n 
B 1 345 LYS 345 339 339 LYS LYS B . n 
B 1 346 PHE 346 340 340 PHE PHE B . n 
B 1 347 ILE 347 341 341 ILE ILE B . n 
B 1 348 GLU 348 342 342 GLU GLU B . n 
B 1 349 ALA 349 343 343 ALA ALA B . n 
B 1 350 ILE 350 344 ?   ?   ?   B . n 
B 1 351 GLY 351 345 ?   ?   ?   B . n 
B 1 352 LEU 352 346 ?   ?   ?   B . n 
B 1 353 ASP 353 347 ?   ?   ?   B . n 
B 1 354 LYS 354 348 ?   ?   ?   B . n 
B 1 355 PHE 355 349 ?   ?   ?   B . n 
B 1 356 PHE 356 350 ?   ?   ?   B . n 
B 1 357 ASP 357 351 ?   ?   ?   B . n 
B 1 358 THR 358 352 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  C . n 
C 2 2   DG  2   2   2   DG  DG  C . n 
C 2 3   DG  3   3   3   DG  DG  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DG  5   5   5   DG  DG  C . n 
C 2 6   DA  6   6   6   DA  DA  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DG  8   8   8   DG  DG  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DA  10  10  10  DA  DA  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
C 2 12  DT  12  12  12  DT  DT  C . n 
C 2 13  DG  13  13  13  DG  DG  C . n 
D 3 1   DT  1   1   1   DT  DT  D . n 
D 3 2   DT  2   2   2   DT  DT  D . n 
D 3 3   DC  3   3   3   DC  DC  D . n 
D 3 4   DA  4   4   4   DA  DA  D . n 
D 3 5   DG  5   5   5   DG  DG  D . n 
D 3 6   DFT 6   6   6   DFT DFT D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DG  8   8   8   DG  DG  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DT  12  12  12  DT  DT  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DC  14  14  14  DC  DC  D . n 
D 3 15  DC  15  15  15  DC  DC  D . n 
D 3 16  DC  16  16  16  DC  DC  D . n 
D 3 17  DC  17  17  17  DC  DC  D . n 
D 3 18  DC  18  18  18  DC  DC  D . n 
E 2 1   DG  1   1   1   DG  DG  E . n 
E 2 2   DG  2   2   2   DG  DG  E . n 
E 2 3   DG  3   3   3   DG  DG  E . n 
E 2 4   DG  4   4   4   DG  DG  E . n 
E 2 5   DG  5   5   5   DG  DG  E . n 
E 2 6   DA  6   6   6   DA  DA  E . n 
E 2 7   DA  7   7   7   DA  DA  E . n 
E 2 8   DG  8   8   8   DG  DG  E . n 
E 2 9   DG  9   9   9   DG  DG  E . n 
E 2 10  DA  10  10  10  DA  DA  E . n 
E 2 11  DC  11  11  11  DC  DC  E . n 
E 2 12  DT  12  12  12  DT  DT  E . n 
E 2 13  DG  13  13  13  DG  DG  E . n 
F 3 1   DT  1   1   ?   ?   ?   F . n 
F 3 2   DT  2   2   ?   ?   ?   F . n 
F 3 3   DC  3   3   3   DC  DC  F . n 
F 3 4   DA  4   4   4   DA  DA  F . n 
F 3 5   DG  5   5   5   DG  DG  F . n 
F 3 6   DFT 6   6   6   DFT DFT F . n 
F 3 7   DA  7   7   7   DA  DA  F . n 
F 3 8   DG  8   8   8   DG  DG  F . n 
F 3 9   DT  9   9   9   DT  DT  F . n 
F 3 10  DC  10  10  10  DC  DC  F . n 
F 3 11  DC  11  11  11  DC  DC  F . n 
F 3 12  DT  12  12  12  DT  DT  F . n 
F 3 13  DT  13  13  13  DT  DT  F . n 
F 3 14  DC  14  14  14  DC  DC  F . n 
F 3 15  DC  15  15  15  DC  DC  F . n 
F 3 16  DC  16  16  16  DC  DC  F . n 
F 3 17  DC  17  17  17  DC  DC  F . n 
F 3 18  DC  18  18  18  DC  DC  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CA  1  1345 1345 CA  CA  A . 
H 4 CA  1  1346 1346 CA  CA  A . 
I 5 DCT 1  1347 1347 DCT DCT A . 
J 4 CA  1  1344 1344 CA  CA  B . 
K 4 CA  1  1345 1345 CA  CA  B . 
L 5 DCT 1  1346 1346 DCT DCT B . 
M 6 HOH 1  2001 2001 HOH HOH A . 
M 6 HOH 2  2002 2002 HOH HOH A . 
M 6 HOH 3  2003 2003 HOH HOH A . 
M 6 HOH 4  2004 2004 HOH HOH A . 
M 6 HOH 5  2005 2005 HOH HOH A . 
M 6 HOH 6  2006 2006 HOH HOH A . 
M 6 HOH 7  2007 2007 HOH HOH A . 
M 6 HOH 8  2008 2008 HOH HOH A . 
M 6 HOH 9  2009 2009 HOH HOH A . 
M 6 HOH 10 2010 2010 HOH HOH A . 
M 6 HOH 11 2011 2011 HOH HOH A . 
M 6 HOH 12 2012 2012 HOH HOH A . 
M 6 HOH 13 2013 2013 HOH HOH A . 
M 6 HOH 14 2014 2014 HOH HOH A . 
M 6 HOH 15 2015 2015 HOH HOH A . 
M 6 HOH 16 2016 2016 HOH HOH A . 
M 6 HOH 17 2017 2017 HOH HOH A . 
M 6 HOH 18 2018 2018 HOH HOH A . 
M 6 HOH 19 2019 2019 HOH HOH A . 
M 6 HOH 20 2020 2020 HOH HOH A . 
M 6 HOH 21 2021 2021 HOH HOH A . 
M 6 HOH 22 2022 2022 HOH HOH A . 
M 6 HOH 23 2023 2023 HOH HOH A . 
M 6 HOH 24 2024 2024 HOH HOH A . 
M 6 HOH 25 2025 2025 HOH HOH A . 
M 6 HOH 26 2026 2026 HOH HOH A . 
M 6 HOH 27 2027 2027 HOH HOH A . 
M 6 HOH 28 2028 2028 HOH HOH A . 
M 6 HOH 29 2029 2029 HOH HOH A . 
M 6 HOH 30 2030 2030 HOH HOH A . 
M 6 HOH 31 2031 2031 HOH HOH A . 
M 6 HOH 32 2032 2032 HOH HOH A . 
M 6 HOH 33 2033 2033 HOH HOH A . 
M 6 HOH 34 2034 2034 HOH HOH A . 
M 6 HOH 35 2035 2035 HOH HOH A . 
M 6 HOH 36 2036 2036 HOH HOH A . 
M 6 HOH 37 2037 2037 HOH HOH A . 
M 6 HOH 38 2038 2038 HOH HOH A . 
M 6 HOH 39 2039 2039 HOH HOH A . 
M 6 HOH 40 2040 2040 HOH HOH A . 
M 6 HOH 41 2041 2041 HOH HOH A . 
M 6 HOH 42 2042 2042 HOH HOH A . 
M 6 HOH 43 2043 2043 HOH HOH A . 
M 6 HOH 44 2044 2044 HOH HOH A . 
M 6 HOH 45 2045 2045 HOH HOH A . 
M 6 HOH 46 2046 2046 HOH HOH A . 
M 6 HOH 47 2047 2047 HOH HOH A . 
M 6 HOH 48 2048 2048 HOH HOH A . 
M 6 HOH 49 2049 2049 HOH HOH A . 
M 6 HOH 50 2050 2050 HOH HOH A . 
M 6 HOH 51 2051 2051 HOH HOH A . 
M 6 HOH 52 2052 2052 HOH HOH A . 
M 6 HOH 53 2053 2053 HOH HOH A . 
M 6 HOH 54 2054 2054 HOH HOH A . 
M 6 HOH 55 2055 2055 HOH HOH A . 
M 6 HOH 56 2056 2056 HOH HOH A . 
M 6 HOH 57 2057 2057 HOH HOH A . 
M 6 HOH 58 2058 2058 HOH HOH A . 
M 6 HOH 59 2059 2059 HOH HOH A . 
N 6 HOH 1  2001 2001 HOH HOH B . 
N 6 HOH 2  2002 2002 HOH HOH B . 
N 6 HOH 3  2003 2003 HOH HOH B . 
N 6 HOH 4  2004 2004 HOH HOH B . 
N 6 HOH 5  2005 2005 HOH HOH B . 
N 6 HOH 6  2006 2006 HOH HOH B . 
N 6 HOH 7  2007 2007 HOH HOH B . 
N 6 HOH 8  2008 2008 HOH HOH B . 
N 6 HOH 9  2009 2009 HOH HOH B . 
N 6 HOH 10 2010 2010 HOH HOH B . 
N 6 HOH 11 2011 2011 HOH HOH B . 
N 6 HOH 12 2012 2012 HOH HOH B . 
N 6 HOH 13 2013 2013 HOH HOH B . 
N 6 HOH 14 2014 2014 HOH HOH B . 
N 6 HOH 15 2015 2015 HOH HOH B . 
N 6 HOH 16 2016 2016 HOH HOH B . 
N 6 HOH 17 2017 2017 HOH HOH B . 
N 6 HOH 18 2018 2018 HOH HOH B . 
N 6 HOH 19 2019 2019 HOH HOH B . 
N 6 HOH 20 2020 2020 HOH HOH B . 
N 6 HOH 21 2021 2021 HOH HOH B . 
N 6 HOH 22 2022 2022 HOH HOH B . 
N 6 HOH 23 2023 2023 HOH HOH B . 
N 6 HOH 24 2024 2024 HOH HOH B . 
N 6 HOH 25 2025 2025 HOH HOH B . 
N 6 HOH 26 2026 2026 HOH HOH B . 
N 6 HOH 27 2027 2027 HOH HOH B . 
N 6 HOH 28 2028 2028 HOH HOH B . 
N 6 HOH 29 2029 2029 HOH HOH B . 
N 6 HOH 30 2030 2030 HOH HOH B . 
N 6 HOH 31 2031 2031 HOH HOH B . 
N 6 HOH 32 2032 2032 HOH HOH B . 
N 6 HOH 33 2033 2033 HOH HOH B . 
N 6 HOH 34 2034 2034 HOH HOH B . 
N 6 HOH 35 2035 2035 HOH HOH B . 
N 6 HOH 36 2036 2036 HOH HOH B . 
N 6 HOH 37 2037 2037 HOH HOH B . 
N 6 HOH 38 2038 2038 HOH HOH B . 
N 6 HOH 39 2039 2039 HOH HOH B . 
N 6 HOH 40 2040 2040 HOH HOH B . 
N 6 HOH 41 2041 2041 HOH HOH B . 
N 6 HOH 42 2042 2042 HOH HOH B . 
N 6 HOH 43 2043 2043 HOH HOH B . 
N 6 HOH 44 2044 2044 HOH HOH B . 
N 6 HOH 45 2045 2045 HOH HOH B . 
N 6 HOH 46 2046 2046 HOH HOH B . 
N 6 HOH 47 2047 2047 HOH HOH B . 
N 6 HOH 48 2048 2048 HOH HOH B . 
O 6 HOH 1  2001 2001 HOH HOH C . 
O 6 HOH 2  2002 2002 HOH HOH C . 
O 6 HOH 3  2003 2003 HOH HOH C . 
O 6 HOH 4  2004 2004 HOH HOH C . 
O 6 HOH 5  2005 2005 HOH HOH C . 
O 6 HOH 6  2006 2006 HOH HOH C . 
O 6 HOH 7  2007 2007 HOH HOH C . 
O 6 HOH 8  2008 2008 HOH HOH C . 
O 6 HOH 9  2009 2009 HOH HOH C . 
O 6 HOH 10 2010 2010 HOH HOH C . 
O 6 HOH 11 2011 2011 HOH HOH C . 
O 6 HOH 12 2012 2012 HOH HOH C . 
O 6 HOH 13 2013 2013 HOH HOH C . 
O 6 HOH 14 2014 2014 HOH HOH C . 
P 6 HOH 1  2001 2001 HOH HOH D . 
P 6 HOH 2  2002 2002 HOH HOH D . 
P 6 HOH 3  2003 2003 HOH HOH D . 
P 6 HOH 4  2004 2004 HOH HOH D . 
P 6 HOH 5  2005 2005 HOH HOH D . 
P 6 HOH 6  2006 2006 HOH HOH D . 
P 6 HOH 7  2007 2007 HOH HOH D . 
P 6 HOH 8  2008 2008 HOH HOH D . 
P 6 HOH 9  2009 2009 HOH HOH D . 
Q 6 HOH 1  2001 2001 HOH HOH E . 
Q 6 HOH 2  2002 2002 HOH HOH E . 
Q 6 HOH 3  2003 2003 HOH HOH E . 
Q 6 HOH 4  2004 2004 HOH HOH E . 
Q 6 HOH 5  2005 2005 HOH HOH E . 
Q 6 HOH 6  2006 2006 HOH HOH E . 
Q 6 HOH 7  2007 2007 HOH HOH E . 
Q 6 HOH 8  2008 2008 HOH HOH E . 
Q 6 HOH 9  2009 2009 HOH HOH E . 
Q 6 HOH 10 2010 2010 HOH HOH E . 
Q 6 HOH 11 2011 2011 HOH HOH E . 
Q 6 HOH 12 2012 2012 HOH HOH E . 
R 6 HOH 1  2001 2001 HOH HOH F . 
R 6 HOH 2  2002 2002 HOH HOH F . 
R 6 HOH 3  2003 2003 HOH HOH F . 
R 6 HOH 4  2004 2004 HOH HOH F . 
R 6 HOH 5  2005 2005 HOH HOH F . 
R 6 HOH 6  2006 2006 HOH HOH F . 
R 6 HOH 7  2007 2007 HOH HOH F . 
R 6 HOH 8  2008 2008 HOH HOH F . 
R 6 HOH 9  2009 2009 HOH HOH F . 
R 6 HOH 10 2010 2010 HOH HOH F . 
R 6 HOH 11 2011 2011 HOH HOH F . 
R 6 HOH 12 2012 2012 HOH HOH F . 
R 6 HOH 13 2013 2013 HOH HOH F . 
R 6 HOH 14 2014 2014 HOH HOH F . 
R 6 HOH 15 2015 2015 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS trimeric 3 
2 author_and_software_defined_assembly PQS trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,I,M,O,P 
2 1 B,E,F,J,K,L,N,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1644 ? 
2 'ABSA (A^2)' 1760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 45.9  ? 
2  OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O1A ? I DCT .   ? A DCT 1347 ? 1_555 111.5 ? 
3  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O1A ? I DCT .   ? A DCT 1347 ? 1_555 81.8  ? 
4  OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O1G ? I DCT .   ? A DCT 1347 ? 1_555 75.3  ? 
5  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O1G ? I DCT .   ? A DCT 1347 ? 1_555 80.1  ? 
6  O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O1G ? I DCT .   ? A DCT 1347 ? 1_555 51.1  ? 
7  OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 89.5  ? 
8  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 123.8 ? 
9  O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 154.4 ? 
10 O1G ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 126.4 ? 
11 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 143.7 ? 
12 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 100.7 ? 
13 O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 67.8  ? 
14 O1G ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 118.3 ? 
15 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 104.2 ? 
16 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 109.7 ? 
17 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 134.0 ? 
18 O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 73.5  ? 
19 O1G ? I DCT .   ? A DCT 1347 ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 54.2  ? 
20 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 85.9  ? 
21 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O3B ? I DCT .   ? A DCT 1347 ? 1_555 104.7 ? 
22 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 O1A ? I DCT .   ? A DCT 1347 ? 1_555 86.9  ? 
23 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 O   ? M HOH .   ? A HOH 2059 ? 1_555 103.2 ? 
24 O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 O   ? M HOH .   ? A HOH 2059 ? 1_555 76.6  ? 
25 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 109.7 ? 
26 O1A ? I DCT .   ? A DCT 1347 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 147.9 ? 
27 O   ? M HOH .   ? A HOH 2059 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 123.0 ? 
28 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O2B ? L DCT .   ? B DCT 1346 ? 1_555 55.4  ? 
29 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1A ? L DCT .   ? B DCT 1346 ? 1_555 76.5  ? 
30 O2B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1A ? L DCT .   ? B DCT 1346 ? 1_555 71.4  ? 
31 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 137.3 ? 
32 O2B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 86.0  ? 
33 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 74.2  ? 
34 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1G ? L DCT .   ? B DCT 1346 ? 1_555 59.6  ? 
35 O2B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1G ? L DCT .   ? B DCT 1346 ? 1_555 95.0  ? 
36 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1G ? L DCT .   ? B DCT 1346 ? 1_555 44.9  ? 
37 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O1G ? L DCT .   ? B DCT 1346 ? 1_555 113.7 ? 
38 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 121.1 ? 
39 O2B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 139.2 ? 
40 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 68.8  ? 
41 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 75.1  ? 
42 O1G ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 62.1  ? 
43 O3B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 97.2  ? 
44 O2B ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 128.7 ? 
45 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 150.5 ? 
46 OD2 ? B ASP 111 ? B ASP 105  ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 123.1 ? 
47 O1G ? L DCT .   ? B DCT 1346 ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 106.9 ? 
48 OD2 ? B ASP 13  ? B ASP 7    ? 1_555 CA ? J CA . ? B CA 1344 ? 1_555 O   ? B PHE 14  ? B PHE 8    ? 1_555 91.5  ? 
49 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 OE1 ? B GLU 112 ? B GLU 106  ? 1_555 146.8 ? 
50 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 O   ? N HOH .   ? B HOH 2011 ? 1_555 126.1 ? 
51 OE1 ? B GLU 112 ? B GLU 106  ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 O   ? N HOH .   ? B HOH 2011 ? 1_555 58.9  ? 
52 O1A ? L DCT .   ? B DCT 1346 ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 OE2 ? B GLU 112 ? B GLU 106  ? 1_555 97.7  ? 
53 OE1 ? B GLU 112 ? B GLU 106  ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 OE2 ? B GLU 112 ? B GLU 106  ? 1_555 49.8  ? 
54 O   ? N HOH .   ? B HOH 2011 ? 1_555 CA ? K CA . ? B CA 1345 ? 1_555 OE2 ? B GLU 112 ? B GLU 106  ? 1_555 92.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-10-30 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.1 ? 1 
HKL-2000 'data reduction' .   ? 2 
HKL-2000 'data scaling'   .   ? 3 
PHASER   phasing          .   ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P     F DC 3 ? ? OP3 F DC  3 ? ? 1.527 1.607 -0.080 0.012 N 
2 1 "O3'" F DG 5 ? ? P   F DFT 6 ? ? 1.525 1.607 -0.082 0.012 Y 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "C5'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             F 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_1              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             F 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_2              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_3             F 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_3              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                120.20 
_pdbx_validate_rmsd_angle.angle_target_value         109.80 
_pdbx_validate_rmsd_angle.angle_deviation            10.40 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 9   ? ? -26.86  -51.69  
2  1 TYR A 10  ? ? -176.57 44.81   
3  1 PHE A 11  ? ? 3.55    -102.17 
4  1 TYR A 12  ? ? -34.40  -88.25  
5  1 ALA A 13  ? ? -36.56  -31.61  
6  1 LYS A 24  ? ? -39.62  157.21  
7  1 ARG A 36  ? ? -99.71  -95.22  
8  1 PHE A 37  ? ? -35.98  -35.08  
9  1 GLU A 38  ? ? 135.43  -60.97  
10 1 ALA A 46  ? ? -177.03 146.12  
11 1 VAL A 55  ? ? -50.63  87.58   
12 1 ILE A 67  ? ? -101.00 -64.22  
13 1 ALA A 71  ? ? -44.95  -174.48 
14 1 VAL A 84  ? ? -49.91  -70.24  
15 1 ALA A 102 ? ? -84.19  -72.19  
16 1 SER A 103 ? ? -111.40 -162.63 
17 1 ALA A 107 ? ? -173.76 135.74  
18 1 SER A 112 ? ? -29.74  -61.17  
19 1 ASP A 113 ? ? -104.04 41.54   
20 1 LYS A 114 ? ? -150.58 18.55   
21 1 LYS A 129 ? ? -37.00  -18.42  
22 1 LYS A 131 ? ? -37.27  -34.58  
23 1 LYS A 135 ? ? 176.33  -19.98  
24 1 GLU A 136 ? ? -146.20 -3.87   
25 1 SER A 145 ? ? -170.25 -156.76 
26 1 ILE A 175 ? ? -55.35  -9.83   
27 1 ASP A 179 ? ? -117.96 -144.73 
28 1 ILE A 180 ? ? -26.65  -126.24 
29 1 ASP A 182 ? ? -68.73  16.13   
30 1 ASP A 204 ? ? -38.69  -30.34  
31 1 PHE A 210 ? ? -17.63  -38.29  
32 1 MET A 216 ? ? 168.91  -26.12  
33 1 ASP A 231 ? ? 73.93   36.79   
34 1 ASN A 234 ? ? -107.33 -82.75  
35 1 GLU A 235 ? ? 24.80   105.51  
36 1 VAL A 249 ? ? -126.92 -161.95 
37 1 ARG A 253 ? ? -78.02  -115.57 
38 1 ASN A 254 ? ? 133.43  61.56   
39 1 ARG A 256 ? ? -154.29 -11.23  
40 1 ILE A 261 ? ? -156.81 -27.01  
41 1 ILE A 269 ? ? -48.65  -5.28   
42 1 ASP A 277 ? ? 54.18   -123.62 
43 1 THR A 290 ? ? -82.09  -114.30 
44 1 GLU A 291 ? ? -139.70 -56.81  
45 1 LEU A 293 ? ? 53.99   -120.62 
46 1 ASP A 294 ? ? 19.45   110.30  
47 1 LYS A 308 ? ? -27.00  -68.03  
48 1 GLU A 324 ? ? -55.17  1.41    
49 1 SER A 338 ? ? -153.30 -155.31 
50 1 LYS A 339 ? ? 37.64   52.03   
51 1 GLU A 342 ? ? -62.13  -148.62 
52 1 TYR B 10  ? ? 32.92   48.61   
53 1 PHE B 11  ? ? -19.88  -84.15  
54 1 ARG B 36  ? ? -66.40  -124.73 
55 1 GLU B 38  ? ? 30.85   -88.12  
56 1 ASP B 39  ? ? -106.20 55.30   
57 1 ASN B 47  ? ? -58.86  178.81  
58 1 LYS B 52  ? ? -56.29  -3.75   
59 1 VAL B 55  ? ? -51.62  95.09   
60 1 LYS B 65  ? ? -61.23  4.57    
61 1 ASN B 70  ? ? -102.77 73.44   
62 1 ARG B 77  ? ? -98.24  56.22   
63 1 LYS B 78  ? ? -39.62  -12.14  
64 1 ARG B 93  ? ? -50.66  -5.80   
65 1 SER B 96  ? ? -178.84 129.78  
66 1 SER B 103 ? ? -148.83 -154.52 
67 1 SER B 112 ? ? -27.02  -62.34  
68 1 ASP B 113 ? ? -83.16  37.74   
69 1 GLU B 136 ? ? -148.67 16.02   
70 1 LYS B 137 ? ? 41.43   28.99   
71 1 SER B 145 ? ? -177.06 -162.19 
72 1 ASN B 161 ? ? 35.53   59.67   
73 1 ILE B 163 ? ? -170.32 110.53  
74 1 ASP B 168 ? ? -28.48  -46.12  
75 1 GLU B 169 ? ? -54.60  -1.47   
76 1 ARG B 176 ? ? -96.02  -71.26  
77 1 PRO B 184 ? ? -46.96  103.40  
78 1 LYS B 193 ? ? -42.68  -70.42  
79 1 LYS B 196 ? ? -60.32  0.41    
80 1 THR B 205 ? ? -47.07  -15.77  
81 1 SER B 207 ? ? -98.98  44.37   
82 1 GLU B 209 ? ? -58.99  93.02   
83 1 PHE B 210 ? ? -9.55   -75.46  
84 1 MET B 216 ? ? -162.61 -25.96  
85 1 ALA B 220 ? ? -45.91  -75.77  
86 1 ASP B 231 ? ? 94.40   41.01   
87 1 TYR B 233 ? ? -39.90  123.32  
88 1 ASN B 234 ? ? -163.59 73.22   
89 1 ARG B 240 ? ? -36.26  145.17  
90 1 ARG B 247 ? ? -177.02 116.58  
91 1 ARG B 256 ? ? -147.89 -11.31  
92 1 ASN B 257 ? ? -62.36  95.72   
93 1 ASP B 277 ? ? 67.61   -121.19 
94 1 SER B 338 ? ? -109.89 -167.21 
95 1 GLU B 342 ? ? -93.70  -75.79  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? B HOH 2004 ? 6.95 . 
2 1 O ? B HOH 2012 ? 5.82 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ILE 344 ? CA  ? A ILE 350 CA  
2  1 Y 1 A ILE 344 ? C   ? A ILE 350 C   
3  1 Y 1 A ILE 344 ? O   ? A ILE 350 O   
4  1 Y 1 A ILE 344 ? CB  ? A ILE 350 CB  
5  1 Y 1 A ILE 344 ? CG1 ? A ILE 350 CG1 
6  1 Y 1 A ILE 344 ? CG2 ? A ILE 350 CG2 
7  1 Y 1 A ILE 344 ? CD1 ? A ILE 350 CD1 
8  1 Y 1 B ALA 343 ? CA  ? B ALA 349 CA  
9  1 Y 1 B ALA 343 ? C   ? B ALA 349 C   
10 1 Y 1 B ALA 343 ? O   ? B ALA 349 O   
11 1 Y 1 B ALA 343 ? CB  ? B ALA 349 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A GLY 345 ? A GLY 351 
8  1 Y 1 A LEU 346 ? A LEU 352 
9  1 Y 1 A ASP 347 ? A ASP 353 
10 1 Y 1 A LYS 348 ? A LYS 354 
11 1 Y 1 A PHE 349 ? A PHE 355 
12 1 Y 1 A PHE 350 ? A PHE 356 
13 1 Y 1 A ASP 351 ? A ASP 357 
14 1 Y 1 A THR 352 ? A THR 358 
15 1 Y 1 B HIS -5  ? B HIS 1   
16 1 Y 1 B HIS -4  ? B HIS 2   
17 1 Y 1 B HIS -3  ? B HIS 3   
18 1 Y 1 B HIS -2  ? B HIS 4   
19 1 Y 1 B HIS -1  ? B HIS 5   
20 1 Y 1 B HIS 0   ? B HIS 6   
21 1 Y 1 B ILE 344 ? B ILE 350 
22 1 Y 1 B GLY 345 ? B GLY 351 
23 1 Y 1 B LEU 346 ? B LEU 352 
24 1 Y 1 B ASP 347 ? B ASP 353 
25 1 Y 1 B LYS 348 ? B LYS 354 
26 1 Y 1 B PHE 349 ? B PHE 355 
27 1 Y 1 B PHE 350 ? B PHE 356 
28 1 Y 1 B ASP 351 ? B ASP 357 
29 1 Y 1 B THR 352 ? B THR 358 
30 1 Y 1 F DT  1   ? F DT  1   
31 1 Y 1 F DT  2   ? F DT  2   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2V9W 'double helix'        
2V9W 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 18 1_555 -0.602 -0.699 -0.627 -4.945  -6.816  -11.182 1  C_DG1:DC18_D C 1  ? D 18 ? 19 1 
1 C DG 2  1_555 D DC 17 1_555 0.121  0.299  0.464  5.343   -0.257  -1.455  2  C_DG2:DC17_D C 2  ? D 17 ? 19 1 
1 C DG 3  1_555 D DC 16 1_555 -1.015 -0.094 0.324  5.961   0.503   6.000   3  C_DG3:DC16_D C 3  ? D 16 ? 19 1 
1 C DG 4  1_555 D DC 15 1_555 0.102  0.346  -0.340 -1.405  -6.006  -1.010  4  C_DG4:DC15_D C 4  ? D 15 ? 19 1 
1 C DG 5  1_555 D DC 14 1_555 -0.782 -0.368 -0.201 -6.705  -5.442  -5.849  5  C_DG5:DC14_D C 5  ? D 14 ? 19 1 
1 C DA 6  1_555 D DT 13 1_555 0.808  0.053  -0.669 -9.190  -8.445  -8.517  6  C_DA6:DT13_D C 6  ? D 13 ? 20 1 
1 C DA 7  1_555 D DT 12 1_555 -0.923 -0.107 -0.728 10.600  -9.847  1.210   7  C_DA7:DT12_D C 7  ? D 12 ? 20 1 
1 C DG 8  1_555 D DC 11 1_555 0.127  -0.291 -0.775 -6.448  -7.810  -0.720  8  C_DG8:DC11_D C 8  ? D 11 ? 19 1 
1 C DG 9  1_555 D DC 10 1_555 -1.595 -0.058 -1.171 -13.474 -7.635  4.839   9  C_DG9:DC10_D C 9  ? D 10 ? 19 1 
1 C DA 10 1_555 D DT 9  1_555 -0.025 0.056  -0.855 -2.887  -27.323 8.426   10 C_DA10:DT9_D C 10 ? D 9  ? 20 1 
1 C DC 11 1_555 D DG 8  1_555 -0.145 0.292  -0.893 11.987  -16.599 3.309   11 C_DC11:DG8_D C 11 ? D 8  ? 19 1 
1 C DT 12 1_555 D DA 7  1_555 -0.961 0.401  1.556  -17.300 -22.010 35.608  12 C_DT12:DA7_D C 12 ? D 7  ? ?  1 
1 E DG 1  1_555 F DC 18 1_555 0.525  -0.223 -0.230 -12.708 -8.866  -8.694  13 E_DG1:DC18_F E 1  ? F 18 ? 19 1 
1 E DG 2  1_555 F DC 17 1_555 -0.721 -0.598 -0.257 5.117   -0.106  -2.674  14 E_DG2:DC17_F E 2  ? F 17 ? 19 1 
1 E DG 3  1_555 F DC 16 1_555 0.406  0.001  -0.973 -10.050 -0.825  -6.438  15 E_DG3:DC16_F E 3  ? F 16 ? 19 1 
1 E DG 4  1_555 F DC 15 1_555 -0.057 -0.285 -0.199 -2.891  -7.865  -3.412  16 E_DG4:DC15_F E 4  ? F 15 ? 19 1 
1 E DG 5  1_555 F DC 14 1_555 -0.046 -0.049 0.193  -3.687  -4.575  1.499   17 E_DG5:DC14_F E 5  ? F 14 ? 19 1 
1 E DA 6  1_555 F DT 13 1_555 -0.278 -0.102 -0.721 -17.512 -7.096  -1.402  18 E_DA6:DT13_F E 6  ? F 13 ? 20 1 
1 E DA 7  1_555 F DT 12 1_555 -0.649 0.019  -0.891 -18.621 -6.742  2.721   19 E_DA7:DT12_F E 7  ? F 12 ? 20 1 
1 E DG 8  1_555 F DC 11 1_555 -0.005 -0.092 -1.014 -27.010 -6.847  4.919   20 E_DG8:DC11_F E 8  ? F 11 ? 19 1 
1 E DG 9  1_555 F DC 10 1_555 0.048  0.804  0.317  -1.760  0.940   16.339  21 E_DG9:DC10_F E 9  ? F 10 ? ?  1 
1 E DA 10 1_555 F DT 9  1_555 -0.471 0.410  -0.876 -13.426 -22.835 1.938   22 E_DA10:DT9_F E 10 ? F 9  ? 20 1 
1 E DC 11 1_555 F DG 8  1_555 0.718  -0.143 -0.557 0.273   -9.852  7.746   23 E_DC11:DG8_F E 11 ? F 8  ? 19 1 
1 E DT 12 1_555 F DA 7  1_555 0.481  -0.229 0.136  -10.525 -12.891 15.513  24 E_DT12:DA7_F E 12 ? F 7  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 18 1_555 C DG 2  1_555 D DC 17 1_555 1.188  2.220  2.858 -6.389  -6.834 40.853 3.674  -2.193 2.272 -9.638 
9.011   41.866 1  CC_DG1DG2:DC17DC18_DD C 1  ? D 18 ? C 2  ? D 17 ? 
1 C DG 2  1_555 D DC 17 1_555 C DG 3  1_555 D DC 16 1_555 1.100  -0.372 3.281 1.162   7.843  30.379 -2.158 -1.817 3.128 14.655 
-2.171  31.373 2  CC_DG2DG3:DC16DC17_DD C 2  ? D 17 ? C 3  ? D 16 ? 
1 C DG 3  1_555 D DC 16 1_555 C DG 4  1_555 D DC 15 1_555 -0.984 -0.080 3.587 3.522   11.937 40.499 -1.437 1.754  3.342 16.772 
-4.949  42.291 3  CC_DG3DG4:DC15DC16_DD C 3  ? D 16 ? C 4  ? D 15 ? 
1 C DG 4  1_555 D DC 15 1_555 C DG 5  1_555 D DC 14 1_555 0.069  -0.332 3.349 -2.000  4.542  28.335 -1.703 -0.594 3.245 9.189  
4.047   28.758 4  CC_DG4DG5:DC14DC15_DD C 4  ? D 15 ? C 5  ? D 14 ? 
1 C DG 5  1_555 D DC 14 1_555 C DA 6  1_555 D DT 13 1_555 -0.849 -0.778 3.379 0.481   17.875 33.526 -3.447 1.369  2.636 28.601 
-0.770  37.875 5  CC_DG5DA6:DT13DC14_DD C 5  ? D 14 ? C 6  ? D 13 ? 
1 C DA 6  1_555 D DT 13 1_555 C DA 7  1_555 D DT 12 1_555 0.591  0.180  2.860 4.163   1.031  29.906 0.159  -0.384 2.918 1.986  
-8.014  30.205 6  CC_DA6DA7:DT12DT13_DD C 6  ? D 13 ? C 7  ? D 12 ? 
1 C DA 7  1_555 D DT 12 1_555 C DG 8  1_555 D DC 11 1_555 0.035  -0.873 3.797 -1.173  10.611 35.292 -3.004 -0.234 3.399 17.027 
1.882   36.822 7  CC_DA7DG8:DC11DT12_DD C 7  ? D 12 ? C 8  ? D 11 ? 
1 C DG 8  1_555 D DC 11 1_555 C DG 9  1_555 D DC 10 1_555 0.594  -0.662 3.397 3.207   11.027 26.687 -3.782 -0.470 2.947 22.606 
-6.575  29.011 8  CC_DG8DG9:DC10DC11_DD C 8  ? D 11 ? C 9  ? D 10 ? 
1 C DG 9  1_555 D DC 10 1_555 C DA 10 1_555 D DT 9  1_555 -0.018 0.588  3.254 2.015   -1.582 38.863 1.072  0.269  3.224 -2.374 
-3.024  38.944 9  CC_DG9DA10:DT9DC10_DD C 9  ? D 10 ? C 10 ? D 9  ? 
1 C DA 10 1_555 D DT 9  1_555 C DC 11 1_555 D DG 8  1_555 0.061  0.073  2.712 -1.309  4.186  30.858 -0.526 -0.320 2.694 7.817  
2.444   31.161 10 CC_DA10DC11:DG8DT9_DD C 10 ? D 9  ? C 11 ? D 8  ? 
1 C DC 11 1_555 D DG 8  1_555 C DT 12 1_555 D DA 7  1_555 1.816  -1.274 4.025 -12.116 5.057  22.428 -4.313 -7.583 2.404 11.791 
28.252  25.946 11 CC_DC11DT12:DA7DG8_DD C 11 ? D 8  ? C 12 ? D 7  ? 
1 E DG 1  1_555 F DC 18 1_555 E DG 2  1_555 F DC 17 1_555 1.663  0.823  2.900 4.840   -0.958 27.768 1.896  -2.368 3.110 -1.976 
-9.984  28.194 12 EE_DG1DG2:DC17DC18_FF E 1  ? F 18 ? E 2  ? F 17 ? 
1 E DG 2  1_555 F DC 17 1_555 E DG 3  1_555 F DC 16 1_555 -0.120 -0.205 3.940 2.252   4.935  35.656 -1.170 0.577  3.864 8.001  
-3.651  36.053 13 EE_DG2DG3:DC16DC17_FF E 2  ? F 17 ? E 3  ? F 16 ? 
1 E DG 3  1_555 F DC 16 1_555 E DG 4  1_555 F DC 15 1_555 0.560  0.299  3.054 -1.880  10.146 34.055 -0.908 -1.177 2.984 16.850 
3.122   35.540 14 EE_DG3DG4:DC15DC16_FF E 3  ? F 16 ? E 4  ? F 15 ? 
1 E DG 4  1_555 F DC 15 1_555 E DG 5  1_555 F DC 14 1_555 0.522  -0.765 3.121 -1.953  9.072  32.843 -2.632 -1.176 2.783 15.659 
3.371   34.094 15 EE_DG4DG5:DC14DC15_FF E 4  ? F 15 ? E 5  ? F 14 ? 
1 E DG 5  1_555 F DC 14 1_555 E DA 6  1_555 F DT 13 1_555 -0.229 -0.346 3.530 5.101   17.414 32.020 -3.067 1.101  2.903 28.859 
-8.453  36.687 16 EE_DG5DA6:DT13DC14_FF E 5  ? F 14 ? E 6  ? F 13 ? 
1 E DA 6  1_555 F DT 13 1_555 E DA 7  1_555 F DT 12 1_555 -0.030 0.157  3.135 -2.632  15.073 27.861 -2.420 -0.417 2.837 28.726 
5.016   31.713 17 EE_DA6DA7:DT12DT13_FF E 6  ? F 13 ? E 7  ? F 12 ? 
1 E DA 7  1_555 F DT 12 1_555 E DG 8  1_555 F DC 11 1_555 -0.337 0.166  3.549 -2.348  8.054  37.043 -0.871 0.190  3.522 12.481 
3.638   37.949 18 EE_DA7DG8:DC11DT12_FF E 7  ? F 12 ? E 8  ? F 11 ? 
1 E DG 8  1_555 F DC 11 1_555 E DG 9  1_555 F DC 10 1_555 0.637  -0.882 2.712 -10.309 -5.253 31.010 -0.820 -2.554 2.492 -9.424 
18.495  33.049 19 EE_DG8DG9:DC10DC11_FF E 8  ? F 11 ? E 9  ? F 10 ? 
1 E DG 9  1_555 F DC 10 1_555 E DA 10 1_555 F DT 9  1_555 -1.250 0.518  3.732 9.127   2.524  32.967 0.444  3.699  3.309 4.337  
-15.684 34.264 20 EE_DG9DA10:DT9DC10_FF E 9  ? F 10 ? E 10 ? F 9  ? 
1 E DA 10 1_555 F DT 9  1_555 E DC 11 1_555 F DG 8  1_555 0.993  -0.365 2.922 -0.253  3.094  33.994 -1.057 -1.727 2.871 5.279  
0.431   34.132 21 EE_DA10DC11:DG8DT9_FF E 10 ? F 9  ? E 11 ? F 8  ? 
1 E DC 11 1_555 F DG 8  1_555 E DT 12 1_555 F DA 7  1_555 0.606  -0.640 3.531 -6.175  3.604  30.208 -1.926 -2.382 3.250 6.796  
11.644  31.024 22 EE_DC11DT12:DA7DG8_FF E 11 ? F 8  ? E 12 ? F 7  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                           CA  
5 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
DCT 
6 water                                   HOH 
#