data_2VAA
# 
_entry.id   2VAA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VAA         
WWPDB D_1000178727 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1996-06-20 
_pdbx_database_PDB_obs_spr.pdb_id           2VAA 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1VAA 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VAA 
_pdbx_database_status.recvd_initial_deposition_date   1994-11-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fremont, D.H.' 1 
'Wilson, I.A.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb.' Science                257 919  927 
1992 SCIEAS US 0036-8075 0038 ? 1323877 ? 
1       
;Crystal Structure of an H-2Kb-Ovalbumin Peptide Complex Reveals the Interplay of Primary and Secondary Anchor Positions in the Major Histocompatibility Complex Binding Groove
;
Proc.Natl.Acad.Sci.USA 92  2479 ?   1995 PNASA6 US 0027-8424 0040 ? ?       ? 
2       'Emerging Principles for the Recognition of Peptide Antigens by Mhc Class I Molecules' Science                257 927  ?   
1992 SCIEAS US 0036-8075 0038 ? ?       ? 
3       'Crystallization of Murine Major Histocompatibility Complex Class I H-2Kb with Single Peptides' J.Mol.Biol.            228 
975  ?   1992 JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fremont, D.H.'  1  
primary 'Matsumura, M.'  2  
primary 'Stura, E.A.'    3  
primary 'Peterson, P.A.' 4  
primary 'Wilson, I.A.'   5  
1       'Fremont, D.H.'  6  
1       'Stura, E.A.'    7  
1       'Matsumura, M.'  8  
1       'Peterson, P.A.' 9  
1       'Wilson, I.A.'   10 
2       'Matsumura, M.'  11 
2       'Fremont, D.H.'  12 
2       'Peterson, P.A.' 13 
2       'Wilson, I.A.'   14 
3       'Stura, E.A.'    15 
3       'Matsumura, M.'  16 
3       'Fremont, D.H.'  17 
3       'Saito, Y.'      18 
3       'Peterson, P.A.' 19 
3       'Wilson, I.A.'   20 
# 
_cell.entry_id           2VAA 
_cell.length_a           138.100 
_cell.length_b           88.900 
_cell.length_c           45.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VAA 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'MHC CLASS I H-2KB HEAVY CHAIN'            31648.322 1   ? ? 'EXTRACELLULAR DOMAINS' ? 
2 polymer man 'BETA-2 MICROGLOBULIN'                     11704.359 1   ? ? ?                       ? 
3 polymer man 'VESICULAR STOMATITIS VIRUS NUCLEOPROTEIN' 956.078   1   ? ? 'RESIDUES 52 - 59'      ? 
4 water   nat water                                      18.015    136 ? ? ?                       ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        VSV-8 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
;
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
;
A ? 
2 'polypeptide(L)' no no 
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
B ? 
3 'polypeptide(L)' no no RGYVYQGL RGYVYQGL P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   SER n 
1 5   LEU n 
1 6   ARG n 
1 7   TYR n 
1 8   PHE n 
1 9   VAL n 
1 10  THR n 
1 11  ALA n 
1 12  VAL n 
1 13  SER n 
1 14  ARG n 
1 15  PRO n 
1 16  GLY n 
1 17  LEU n 
1 18  GLY n 
1 19  GLU n 
1 20  PRO n 
1 21  ARG n 
1 22  TYR n 
1 23  MET n 
1 24  GLU n 
1 25  VAL n 
1 26  GLY n 
1 27  TYR n 
1 28  VAL n 
1 29  ASP n 
1 30  ASP n 
1 31  THR n 
1 32  GLU n 
1 33  PHE n 
1 34  VAL n 
1 35  ARG n 
1 36  PHE n 
1 37  ASP n 
1 38  SER n 
1 39  ASP n 
1 40  ALA n 
1 41  GLU n 
1 42  ASN n 
1 43  PRO n 
1 44  ARG n 
1 45  TYR n 
1 46  GLU n 
1 47  PRO n 
1 48  ARG n 
1 49  ALA n 
1 50  ARG n 
1 51  TRP n 
1 52  MET n 
1 53  GLU n 
1 54  GLN n 
1 55  GLU n 
1 56  GLY n 
1 57  PRO n 
1 58  GLU n 
1 59  TYR n 
1 60  TRP n 
1 61  GLU n 
1 62  ARG n 
1 63  GLU n 
1 64  THR n 
1 65  GLN n 
1 66  LYS n 
1 67  ALA n 
1 68  LYS n 
1 69  GLY n 
1 70  ASN n 
1 71  GLU n 
1 72  GLN n 
1 73  SER n 
1 74  PHE n 
1 75  ARG n 
1 76  VAL n 
1 77  ASP n 
1 78  LEU n 
1 79  ARG n 
1 80  THR n 
1 81  LEU n 
1 82  LEU n 
1 83  GLY n 
1 84  TYR n 
1 85  TYR n 
1 86  ASN n 
1 87  GLN n 
1 88  SER n 
1 89  LYS n 
1 90  GLY n 
1 91  GLY n 
1 92  SER n 
1 93  HIS n 
1 94  THR n 
1 95  ILE n 
1 96  GLN n 
1 97  VAL n 
1 98  ILE n 
1 99  SER n 
1 100 GLY n 
1 101 CYS n 
1 102 GLU n 
1 103 VAL n 
1 104 GLY n 
1 105 SER n 
1 106 ASP n 
1 107 GLY n 
1 108 ARG n 
1 109 LEU n 
1 110 LEU n 
1 111 ARG n 
1 112 GLY n 
1 113 TYR n 
1 114 GLN n 
1 115 GLN n 
1 116 TYR n 
1 117 ALA n 
1 118 TYR n 
1 119 ASP n 
1 120 GLY n 
1 121 CYS n 
1 122 ASP n 
1 123 TYR n 
1 124 ILE n 
1 125 ALA n 
1 126 LEU n 
1 127 ASN n 
1 128 GLU n 
1 129 ASP n 
1 130 LEU n 
1 131 LYS n 
1 132 THR n 
1 133 TRP n 
1 134 THR n 
1 135 ALA n 
1 136 ALA n 
1 137 ASP n 
1 138 MET n 
1 139 ALA n 
1 140 ALA n 
1 141 LEU n 
1 142 ILE n 
1 143 THR n 
1 144 LYS n 
1 145 HIS n 
1 146 LYS n 
1 147 TRP n 
1 148 GLU n 
1 149 GLN n 
1 150 ALA n 
1 151 GLY n 
1 152 GLU n 
1 153 ALA n 
1 154 GLU n 
1 155 ARG n 
1 156 LEU n 
1 157 ARG n 
1 158 ALA n 
1 159 TYR n 
1 160 LEU n 
1 161 GLU n 
1 162 GLY n 
1 163 THR n 
1 164 CYS n 
1 165 VAL n 
1 166 GLU n 
1 167 TRP n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 TYR n 
1 172 LEU n 
1 173 LYS n 
1 174 ASN n 
1 175 GLY n 
1 176 ASN n 
1 177 ALA n 
1 178 THR n 
1 179 LEU n 
1 180 LEU n 
1 181 ARG n 
1 182 THR n 
1 183 ASP n 
1 184 SER n 
1 185 PRO n 
1 186 LYS n 
1 187 ALA n 
1 188 HIS n 
1 189 VAL n 
1 190 THR n 
1 191 HIS n 
1 192 HIS n 
1 193 SER n 
1 194 ARG n 
1 195 PRO n 
1 196 GLU n 
1 197 ASP n 
1 198 LYS n 
1 199 VAL n 
1 200 THR n 
1 201 LEU n 
1 202 ARG n 
1 203 CYS n 
1 204 TRP n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 PHE n 
1 209 TYR n 
1 210 PRO n 
1 211 ALA n 
1 212 ASP n 
1 213 ILE n 
1 214 THR n 
1 215 LEU n 
1 216 THR n 
1 217 TRP n 
1 218 GLN n 
1 219 LEU n 
1 220 ASN n 
1 221 GLY n 
1 222 GLU n 
1 223 GLU n 
1 224 LEU n 
1 225 ILE n 
1 226 GLN n 
1 227 ASP n 
1 228 MET n 
1 229 GLU n 
1 230 LEU n 
1 231 VAL n 
1 232 GLU n 
1 233 THR n 
1 234 ARG n 
1 235 PRO n 
1 236 ALA n 
1 237 GLY n 
1 238 ASP n 
1 239 GLY n 
1 240 THR n 
1 241 PHE n 
1 242 GLN n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 SER n 
1 247 VAL n 
1 248 VAL n 
1 249 VAL n 
1 250 PRO n 
1 251 LEU n 
1 252 GLY n 
1 253 LYS n 
1 254 GLU n 
1 255 GLN n 
1 256 TYR n 
1 257 TYR n 
1 258 THR n 
1 259 CYS n 
1 260 HIS n 
1 261 VAL n 
1 262 TYR n 
1 263 HIS n 
1 264 GLN n 
1 265 GLY n 
1 266 LEU n 
1 267 PRO n 
1 268 GLU n 
1 269 PRO n 
1 270 LEU n 
1 271 THR n 
1 272 LEU n 
1 273 ARG n 
1 274 TRP n 
2 1   ILE n 
2 2   GLN n 
2 3   LYS n 
2 4   THR n 
2 5   PRO n 
2 6   GLN n 
2 7   ILE n 
2 8   GLN n 
2 9   VAL n 
2 10  TYR n 
2 11  SER n 
2 12  ARG n 
2 13  HIS n 
2 14  PRO n 
2 15  PRO n 
2 16  GLU n 
2 17  ASN n 
2 18  GLY n 
2 19  LYS n 
2 20  PRO n 
2 21  ASN n 
2 22  ILE n 
2 23  LEU n 
2 24  ASN n 
2 25  CYS n 
2 26  TYR n 
2 27  VAL n 
2 28  THR n 
2 29  GLN n 
2 30  PHE n 
2 31  HIS n 
2 32  PRO n 
2 33  PRO n 
2 34  HIS n 
2 35  ILE n 
2 36  GLU n 
2 37  ILE n 
2 38  GLN n 
2 39  MET n 
2 40  LEU n 
2 41  LYS n 
2 42  ASN n 
2 43  GLY n 
2 44  LYS n 
2 45  LYS n 
2 46  ILE n 
2 47  PRO n 
2 48  LYS n 
2 49  VAL n 
2 50  GLU n 
2 51  MET n 
2 52  SER n 
2 53  ASP n 
2 54  MET n 
2 55  SER n 
2 56  PHE n 
2 57  SER n 
2 58  LYS n 
2 59  ASP n 
2 60  TRP n 
2 61  SER n 
2 62  PHE n 
2 63  TYR n 
2 64  ILE n 
2 65  LEU n 
2 66  ALA n 
2 67  HIS n 
2 68  THR n 
2 69  GLU n 
2 70  PHE n 
2 71  THR n 
2 72  PRO n 
2 73  THR n 
2 74  GLU n 
2 75  THR n 
2 76  ASP n 
2 77  THR n 
2 78  TYR n 
2 79  ALA n 
2 80  CYS n 
2 81  ARG n 
2 82  VAL n 
2 83  LYS n 
2 84  HIS n 
2 85  ASP n 
2 86  SER n 
2 87  MET n 
2 88  ALA n 
2 89  GLU n 
2 90  PRO n 
2 91  LYS n 
2 92  THR n 
2 93  VAL n 
2 94  TYR n 
2 95  TRP n 
2 96  ASP n 
2 97  ARG n 
2 98  ASP n 
2 99  MET n 
3 1   ARG n 
3 2   GLY n 
3 3   TYR n 
3 4   VAL n 
3 5   TYR n 
3 6   GLN n 
3 7   GLY n 
3 8   LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus           BETA-2-MICROGLOBULIN ? BALB/B ? ? ? ? 'Mus musculus'               10090 ? ? ? ? ? ? 
? 'fruit fly' 'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus           BETA-2-MICROGLOBULIN ? BALB/B ? ? ? ? 'Mus musculus'               10090 ? ? ? ? ? ? 
? 'fruit fly' 'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? ?             Vesiculovirus ?                    ? ?      ? ? ? ? 'Vesicular stomatitis virus' 11276 ? ? ? ? ? ? 
? ?           ?                         ?    ?          ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP HA1B_MOUSE P01901 1 22 ? ? 
2 UNP B2MG_MOUSE P01887 2 21 ? ? 
3 UNP NCAP_VSVIG P11212 3 52 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VAA A 1 ? 274 ? P01901 22 ? 295 ? 1 274 
2 2 2VAA B 1 ? 99  ? P01887 21 ? 119 ? 1 99  
3 3 2VAA P 1 ? 8   ? P11212 52 ? 59  ? 1 8   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VAA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61.13 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   XENTRONICS 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2VAA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   23289 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90. 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2VAA 
_refine.ls_number_reflns_obs                     19166 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.171 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.171 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3121 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               3257 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2VAA 
_struct.title                     
'MHC CLASS I H-2KB HEAVY CHAIN COMPLEXED WITH BETA-2 MICROGLOBULIN AND VESICULAR STOMATITIS VIRUS NUCLEOPROTEIN' 
_struct.pdbx_descriptor           'MHC CLASS I H-2KB HEAVY CHAIN, BETA-2 MICROGLOBULIN, VESICULAR STOMATITIS VIRUS NUCLEOPROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VAA 
_struct_keywords.pdbx_keywords   'COMPLEX (MHC I/PEPTIDE)' 
_struct_keywords.text            
'HISTOCOMPATIBILITY ANTIGEN, CLASS I MAJOR HISTOCOMPATIBILITY COMPLEX, MHC I, MHC-PEPTIDE COMPLEX, COMPLEX (MHC I-PEPTIDE) COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 50  ? GLN A 54  ? ARG A 50  GLN A 54  5 ? 5  
HELX_P HELX_P2 2 PRO A 57  ? TYR A 85  ? PRO A 57  TYR A 85  1 ? 29 
HELX_P HELX_P3 3 MET A 138 ? ALA A 150 ? MET A 138 ALA A 150 1 ? 13 
HELX_P HELX_P4 4 GLU A 152 ? GLU A 161 ? GLU A 152 GLU A 161 1 ? 10 
HELX_P HELX_P5 5 THR A 163 ? ASN A 174 ? THR A 163 ASN A 174 1 ? 12 
HELX_P HELX_P6 6 ASN A 176 ? LEU A 179 ? ASN A 176 LEU A 179 1 ? 4  
HELX_P HELX_P7 7 GLU A 254 ? TYR A 256 ? GLU A 254 TYR A 256 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 164 SG ? ? A CYS 101 A CYS 164 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 203 SG ? ? ? 1_555 A CYS 259 SG ? ? A CYS 203 A CYS 259 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf3 disulf ? ? B CYS 25  SG ? ? ? 1_555 B CYS 80  SG ? ? B CYS 25  B CYS 80  1_555 ? ? ? ? ? ? ? 2.023 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 209 A . ? TYR 209 A PRO 210 A ? PRO 210 A 1 0.18  
2 HIS 31  B . ? HIS 31  B PRO 32  B ? PRO 32  B 1 -0.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 31  ? ASP A 37  ? THR A 31  ASP A 37  
A 2 ARG A 21  ? VAL A 28  ? ARG A 21  VAL A 28  
A 3 HIS A 3   ? VAL A 12  ? HIS A 3   VAL A 12  
A 4 THR A 94  ? VAL A 103 ? THR A 94  VAL A 103 
A 5 LEU A 109 ? TYR A 118 ? LEU A 109 TYR A 118 
A 6 CYS A 121 ? LEU A 126 ? CYS A 121 LEU A 126 
A 7 TRP A 133 ? ALA A 135 ? TRP A 133 ALA A 135 
B 1 LYS A 186 ? ARG A 194 ? LYS A 186 ARG A 194 
B 2 LYS A 198 ? LEU A 206 ? LYS A 198 LEU A 206 
B 3 LYS A 243 ? PRO A 250 ? LYS A 243 PRO A 250 
C 1 THR A 214 ? LEU A 219 ? THR A 214 LEU A 219 
C 2 TYR A 257 ? TYR A 262 ? TYR A 257 TYR A 262 
C 3 LEU A 270 ? LEU A 272 ? LEU A 270 LEU A 272 
D 1 GLN B 6   ? SER B 11  ? GLN B 6   SER B 11  
D 2 PRO B 20  ? PHE B 30  ? PRO B 20  PHE B 30  
D 3 PHE B 62  ? THR B 71  ? PHE B 62  THR B 71  
D 4 GLU B 50  ? SER B 52  ? GLU B 50  SER B 52  
E 1 GLU B 36  ? LYS B 41  ? GLU B 36  LYS B 41  
E 2 TYR B 78  ? LYS B 83  ? TYR B 78  LYS B 83  
E 3 LYS B 91  ? TYR B 94  ? LYS B 91  TYR B 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 31  ? O THR A 31  N VAL A 28  ? N VAL A 28  
A 2 3 O ARG A 21  ? O ARG A 21  N VAL A 12  ? N VAL A 12  
A 3 4 O HIS A 3   ? O HIS A 3   N VAL A 103 ? N VAL A 103 
A 4 5 O GLN A 96  ? O GLN A 96  N ALA A 117 ? N ALA A 117 
A 5 6 O TYR A 116 ? O TYR A 116 N ILE A 124 ? N ILE A 124 
A 6 7 O ALA A 125 ? O ALA A 125 N THR A 134 ? N THR A 134 
B 1 2 O LYS A 186 ? O LYS A 186 N LEU A 206 ? N LEU A 206 
B 2 3 O VAL A 199 ? O VAL A 199 N VAL A 249 ? N VAL A 249 
C 1 2 O THR A 214 ? O THR A 214 N TYR A 262 ? N TYR A 262 
C 2 3 O CYS A 259 ? O CYS A 259 N LEU A 272 ? N LEU A 272 
D 1 2 O GLN B 6   ? O GLN B 6   N THR B 28  ? N THR B 28  
D 2 3 O ASN B 21  ? O ASN B 21  N PHE B 70  ? N PHE B 70  
D 3 4 O LEU B 65  ? O LEU B 65  N SER B 52  ? N SER B 52  
E 1 2 O GLU B 36  ? O GLU B 36  N LYS B 83  ? N LYS B 83  
E 2 3 O CYS B 80  ? O CYS B 80  N VAL B 93  ? N VAL B 93  
# 
_database_PDB_matrix.entry_id          2VAA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VAA 
_atom_sites.fract_transf_matrix[1][1]   0.007241 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011249 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021882 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 67.351 46.843 4.992   1.00 39.63 ? 1   GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 66.914 46.325 3.675   1.00 34.12 ? 1   GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 65.875 47.280 3.136   1.00 32.15 ? 1   GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 65.617 48.300 3.779   1.00 32.61 ? 1   GLY A O   1 
ATOM   5    N N   . PRO A 1 2   ? 65.276 46.996 1.967   1.00 28.44 ? 2   PRO A N   1 
ATOM   6    C CA  . PRO A 1 2   ? 64.253 47.848 1.356   1.00 25.54 ? 2   PRO A CA  1 
ATOM   7    C C   . PRO A 1 2   ? 62.942 47.742 2.131   1.00 20.87 ? 2   PRO A C   1 
ATOM   8    O O   . PRO A 1 2   ? 62.669 46.725 2.762   1.00 19.94 ? 2   PRO A O   1 
ATOM   9    C CB  . PRO A 1 2   ? 64.112 47.250 -0.039  1.00 26.43 ? 2   PRO A CB  1 
ATOM   10   C CG  . PRO A 1 2   ? 64.330 45.798 0.215   1.00 27.55 ? 2   PRO A CG  1 
ATOM   11   C CD  . PRO A 1 2   ? 65.537 45.817 1.123   1.00 27.00 ? 2   PRO A CD  1 
ATOM   12   N N   . HIS A 1 3   ? 62.152 48.804 2.104   1.00 17.02 ? 3   HIS A N   1 
ATOM   13   C CA  . HIS A 1 3   ? 60.873 48.823 2.799   1.00 14.33 ? 3   HIS A CA  1 
ATOM   14   C C   . HIS A 1 3   ? 59.848 49.467 1.904   1.00 13.08 ? 3   HIS A C   1 
ATOM   15   O O   . HIS A 1 3   ? 60.197 50.293 1.064   1.00 10.79 ? 3   HIS A O   1 
ATOM   16   C CB  . HIS A 1 3   ? 60.990 49.599 4.101   1.00 12.71 ? 3   HIS A CB  1 
ATOM   17   C CG  . HIS A 1 3   ? 61.898 48.952 5.091   1.00 16.37 ? 3   HIS A CG  1 
ATOM   18   N ND1 . HIS A 1 3   ? 61.593 47.756 5.701   1.00 12.94 ? 3   HIS A ND1 1 
ATOM   19   C CD2 . HIS A 1 3   ? 63.121 49.307 5.549   1.00 14.52 ? 3   HIS A CD2 1 
ATOM   20   C CE1 . HIS A 1 3   ? 62.587 47.399 6.493   1.00 13.13 ? 3   HIS A CE1 1 
ATOM   21   N NE2 . HIS A 1 3   ? 63.527 48.324 6.419   1.00 19.00 ? 3   HIS A NE2 1 
ATOM   22   N N   . SER A 1 4   ? 58.581 49.128 2.096   1.00 15.01 ? 4   SER A N   1 
ATOM   23   C CA  . SER A 1 4   ? 57.552 49.699 1.247   1.00 13.98 ? 4   SER A CA  1 
ATOM   24   C C   . SER A 1 4   ? 56.289 50.092 1.977   1.00 13.28 ? 4   SER A C   1 
ATOM   25   O O   . SER A 1 4   ? 55.958 49.528 3.025   1.00 15.70 ? 4   SER A O   1 
ATOM   26   C CB  . SER A 1 4   ? 57.201 48.709 0.143   1.00 11.86 ? 4   SER A CB  1 
ATOM   27   O OG  . SER A 1 4   ? 56.656 47.532 0.705   1.00 12.70 ? 4   SER A OG  1 
ATOM   28   N N   . LEU A 1 5   ? 55.607 51.083 1.415   1.00 8.68  ? 5   LEU A N   1 
ATOM   29   C CA  . LEU A 1 5   ? 54.335 51.578 1.922   1.00 9.19  ? 5   LEU A CA  1 
ATOM   30   C C   . LEU A 1 5   ? 53.387 51.327 0.752   1.00 10.49 ? 5   LEU A C   1 
ATOM   31   O O   . LEU A 1 5   ? 53.579 51.884 -0.326  1.00 8.98  ? 5   LEU A O   1 
ATOM   32   C CB  . LEU A 1 5   ? 54.414 53.080 2.228   1.00 6.84  ? 5   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 5   ? 53.088 53.794 2.530   1.00 6.74  ? 5   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 5   ? 52.346 53.093 3.654   1.00 7.60  ? 5   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 5   ? 53.338 55.247 2.882   1.00 3.41  ? 5   LEU A CD2 1 
ATOM   36   N N   . ARG A 1 6   ? 52.413 50.443 0.941   1.00 9.40  ? 6   ARG A N   1 
ATOM   37   C CA  . ARG A 1 6   ? 51.471 50.111 -0.119  1.00 10.44 ? 6   ARG A CA  1 
ATOM   38   C C   . ARG A 1 6   ? 50.019 50.242 0.309   1.00 11.67 ? 6   ARG A C   1 
ATOM   39   O O   . ARG A 1 6   ? 49.663 49.905 1.439   1.00 12.03 ? 6   ARG A O   1 
ATOM   40   C CB  . ARG A 1 6   ? 51.681 48.667 -0.577  1.00 15.80 ? 6   ARG A CB  1 
ATOM   41   C CG  . ARG A 1 6   ? 52.929 48.402 -1.389  1.00 25.06 ? 6   ARG A CG  1 
ATOM   42   C CD  . ARG A 1 6   ? 53.107 46.904 -1.589  1.00 27.24 ? 6   ARG A CD  1 
ATOM   43   N NE  . ARG A 1 6   ? 53.212 46.230 -0.300  1.00 33.10 ? 6   ARG A NE  1 
ATOM   44   C CZ  . ARG A 1 6   ? 52.792 44.994 -0.043  1.00 36.30 ? 6   ARG A CZ  1 
ATOM   45   N NH1 . ARG A 1 6   ? 52.226 44.261 -0.998  1.00 37.29 ? 6   ARG A NH1 1 
ATOM   46   N NH2 . ARG A 1 6   ? 52.918 44.498 1.182   1.00 32.94 ? 6   ARG A NH2 1 
ATOM   47   N N   . TYR A 1 7   ? 49.173 50.680 -0.617  1.00 10.80 ? 7   TYR A N   1 
ATOM   48   C CA  . TYR A 1 7   ? 47.749 50.803 -0.359  1.00 8.78  ? 7   TYR A CA  1 
ATOM   49   C C   . TYR A 1 7   ? 46.994 50.002 -1.406  1.00 9.83  ? 7   TYR A C   1 
ATOM   50   O O   . TYR A 1 7   ? 47.248 50.160 -2.600  1.00 12.27 ? 7   TYR A O   1 
ATOM   51   C CB  . TYR A 1 7   ? 47.302 52.266 -0.418  1.00 10.58 ? 7   TYR A CB  1 
ATOM   52   C CG  . TYR A 1 7   ? 47.717 53.076 0.786   1.00 12.54 ? 7   TYR A CG  1 
ATOM   53   C CD1 . TYR A 1 7   ? 46.918 53.121 1.929   1.00 13.14 ? 7   TYR A CD1 1 
ATOM   54   C CD2 . TYR A 1 7   ? 48.932 53.755 0.804   1.00 10.03 ? 7   TYR A CD2 1 
ATOM   55   C CE1 . TYR A 1 7   ? 47.327 53.818 3.063   1.00 11.15 ? 7   TYR A CE1 1 
ATOM   56   C CE2 . TYR A 1 7   ? 49.349 54.453 1.926   1.00 11.14 ? 7   TYR A CE2 1 
ATOM   57   C CZ  . TYR A 1 7   ? 48.545 54.479 3.054   1.00 13.26 ? 7   TYR A CZ  1 
ATOM   58   O OH  . TYR A 1 7   ? 48.970 55.165 4.173   1.00 13.13 ? 7   TYR A OH  1 
ATOM   59   N N   . PHE A 1 8   ? 46.130 49.097 -0.954  1.00 10.61 ? 8   PHE A N   1 
ATOM   60   C CA  . PHE A 1 8   ? 45.289 48.286 -1.833  1.00 7.90  ? 8   PHE A CA  1 
ATOM   61   C C   . PHE A 1 8   ? 43.889 48.897 -1.715  1.00 10.01 ? 8   PHE A C   1 
ATOM   62   O O   . PHE A 1 8   ? 43.286 48.855 -0.645  1.00 11.45 ? 8   PHE A O   1 
ATOM   63   C CB  . PHE A 1 8   ? 45.246 46.827 -1.358  1.00 6.50  ? 8   PHE A CB  1 
ATOM   64   C CG  . PHE A 1 8   ? 46.582 46.126 -1.399  1.00 13.50 ? 8   PHE A CG  1 
ATOM   65   C CD1 . PHE A 1 8   ? 47.519 46.318 -0.391  1.00 15.23 ? 8   PHE A CD1 1 
ATOM   66   C CD2 . PHE A 1 8   ? 46.902 45.272 -2.443  1.00 10.79 ? 8   PHE A CD2 1 
ATOM   67   C CE1 . PHE A 1 8   ? 48.752 45.672 -0.425  1.00 12.19 ? 8   PHE A CE1 1 
ATOM   68   C CE2 . PHE A 1 8   ? 48.132 44.624 -2.483  1.00 13.60 ? 8   PHE A CE2 1 
ATOM   69   C CZ  . PHE A 1 8   ? 49.056 44.826 -1.470  1.00 12.53 ? 8   PHE A CZ  1 
ATOM   70   N N   . VAL A 1 9   ? 43.393 49.491 -2.794  1.00 8.04  ? 9   VAL A N   1 
ATOM   71   C CA  . VAL A 1 9   ? 42.074 50.130 -2.814  1.00 5.15  ? 9   VAL A CA  1 
ATOM   72   C C   . VAL A 1 9   ? 41.093 49.324 -3.670  1.00 10.28 ? 9   VAL A C   1 
ATOM   73   O O   . VAL A 1 9   ? 41.468 48.812 -4.720  1.00 13.16 ? 9   VAL A O   1 
ATOM   74   C CB  . VAL A 1 9   ? 42.181 51.565 -3.396  1.00 9.02  ? 9   VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 9   ? 40.812 52.185 -3.575  1.00 11.20 ? 9   VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 9   ? 43.049 52.443 -2.494  1.00 9.31  ? 9   VAL A CG2 1 
ATOM   77   N N   . THR A 1 10  ? 39.843 49.218 -3.222  1.00 9.31  ? 10  THR A N   1 
ATOM   78   C CA  . THR A 1 10  ? 38.820 48.487 -3.957  1.00 6.97  ? 10  THR A CA  1 
ATOM   79   C C   . THR A 1 10  ? 37.479 49.209 -3.911  1.00 10.09 ? 10  THR A C   1 
ATOM   80   O O   . THR A 1 10  ? 37.083 49.745 -2.874  1.00 13.35 ? 10  THR A O   1 
ATOM   81   C CB  . THR A 1 10  ? 38.594 47.101 -3.367  1.00 10.85 ? 10  THR A CB  1 
ATOM   82   O OG1 . THR A 1 10  ? 39.851 46.538 -2.987  1.00 17.05 ? 10  THR A OG1 1 
ATOM   83   C CG2 . THR A 1 10  ? 37.945 46.193 -4.399  1.00 11.95 ? 10  THR A CG2 1 
ATOM   84   N N   . ALA A 1 11  ? 36.792 49.234 -5.045  1.00 10.65 ? 11  ALA A N   1 
ATOM   85   C CA  . ALA A 1 11  ? 35.477 49.846 -5.152  1.00 10.42 ? 11  ALA A CA  1 
ATOM   86   C C   . ALA A 1 11  ? 34.653 48.804 -5.896  1.00 14.26 ? 11  ALA A C   1 
ATOM   87   O O   . ALA A 1 11  ? 35.010 48.405 -7.005  1.00 14.95 ? 11  ALA A O   1 
ATOM   88   C CB  . ALA A 1 11  ? 35.551 51.129 -5.948  1.00 11.21 ? 11  ALA A CB  1 
ATOM   89   N N   . VAL A 1 12  ? 33.605 48.303 -5.252  1.00 16.31 ? 12  VAL A N   1 
ATOM   90   C CA  . VAL A 1 12  ? 32.740 47.290 -5.849  1.00 15.40 ? 12  VAL A CA  1 
ATOM   91   C C   . VAL A 1 12  ? 31.294 47.790 -5.848  1.00 21.47 ? 12  VAL A C   1 
ATOM   92   O O   . VAL A 1 12  ? 30.771 48.163 -4.794  1.00 21.75 ? 12  VAL A O   1 
ATOM   93   C CB  . VAL A 1 12  ? 32.783 45.978 -5.034  1.00 15.63 ? 12  VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 12  ? 32.268 44.822 -5.872  1.00 18.23 ? 12  VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 12  ? 34.182 45.704 -4.538  1.00 13.38 ? 12  VAL A CG2 1 
ATOM   96   N N   . SER A 1 13  ? 30.649 47.812 -7.013  1.00 19.25 ? 13  SER A N   1 
ATOM   97   C CA  . SER A 1 13  ? 29.260 48.262 -7.089  1.00 17.10 ? 13  SER A CA  1 
ATOM   98   C C   . SER A 1 13  ? 28.324 47.122 -6.710  1.00 21.85 ? 13  SER A C   1 
ATOM   99   O O   . SER A 1 13  ? 28.600 45.950 -7.003  1.00 16.82 ? 13  SER A O   1 
ATOM   100  C CB  . SER A 1 13  ? 28.924 48.804 -8.486  1.00 19.51 ? 13  SER A CB  1 
ATOM   101  O OG  . SER A 1 13  ? 29.005 47.811 -9.499  1.00 18.27 ? 13  SER A OG  1 
ATOM   102  N N   . ARG A 1 14  ? 27.230 47.463 -6.039  1.00 24.82 ? 14  ARG A N   1 
ATOM   103  C CA  . ARG A 1 14  ? 26.246 46.477 -5.593  1.00 28.41 ? 14  ARG A CA  1 
ATOM   104  C C   . ARG A 1 14  ? 24.858 46.924 -6.047  1.00 31.40 ? 14  ARG A C   1 
ATOM   105  O O   . ARG A 1 14  ? 24.025 47.324 -5.227  1.00 32.55 ? 14  ARG A O   1 
ATOM   106  C CB  . ARG A 1 14  ? 26.278 46.378 -4.064  1.00 29.07 ? 14  ARG A CB  1 
ATOM   107  C CG  . ARG A 1 14  ? 27.667 46.132 -3.500  1.00 34.24 ? 14  ARG A CG  1 
ATOM   108  C CD  . ARG A 1 14  ? 27.674 46.051 -1.990  1.00 31.08 ? 14  ARG A CD  1 
ATOM   109  N NE  . ARG A 1 14  ? 27.587 47.357 -1.348  1.00 25.62 ? 14  ARG A NE  1 
ATOM   110  C CZ  . ARG A 1 14  ? 27.959 47.578 -0.091  1.00 28.10 ? 14  ARG A CZ  1 
ATOM   111  N NH1 . ARG A 1 14  ? 28.431 46.582 0.645   1.00 22.93 ? 14  ARG A NH1 1 
ATOM   112  N NH2 . ARG A 1 14  ? 27.886 48.794 0.430   1.00 34.53 ? 14  ARG A NH2 1 
ATOM   113  N N   . PRO A 1 15  ? 24.587 46.856 -7.362  1.00 33.55 ? 15  PRO A N   1 
ATOM   114  C CA  . PRO A 1 15  ? 23.288 47.267 -7.906  1.00 37.06 ? 15  PRO A CA  1 
ATOM   115  C C   . PRO A 1 15  ? 22.108 46.659 -7.148  1.00 39.00 ? 15  PRO A C   1 
ATOM   116  O O   . PRO A 1 15  ? 22.070 45.451 -6.894  1.00 40.68 ? 15  PRO A O   1 
ATOM   117  C CB  . PRO A 1 15  ? 23.359 46.778 -9.350  1.00 36.82 ? 15  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 15  ? 24.810 46.920 -9.664  1.00 33.53 ? 15  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 15  ? 25.446 46.327 -8.433  1.00 31.36 ? 15  PRO A CD  1 
ATOM   120  N N   . GLY A 1 16  ? 21.177 47.518 -6.744  1.00 38.97 ? 16  GLY A N   1 
ATOM   121  C CA  . GLY A 1 16  ? 20.016 47.065 -6.003  1.00 39.26 ? 16  GLY A CA  1 
ATOM   122  C C   . GLY A 1 16  ? 20.287 47.000 -4.512  1.00 42.82 ? 16  GLY A C   1 
ATOM   123  O O   . GLY A 1 16  ? 19.402 47.280 -3.707  1.00 41.79 ? 16  GLY A O   1 
ATOM   124  N N   . LEU A 1 17  ? 21.524 46.680 -4.142  1.00 46.07 ? 17  LEU A N   1 
ATOM   125  C CA  . LEU A 1 17  ? 21.902 46.570 -2.740  1.00 45.34 ? 17  LEU A CA  1 
ATOM   126  C C   . LEU A 1 17  ? 22.525 47.851 -2.199  1.00 44.92 ? 17  LEU A C   1 
ATOM   127  O O   . LEU A 1 17  ? 23.355 47.809 -1.288  1.00 47.85 ? 17  LEU A O   1 
ATOM   128  C CB  . LEU A 1 17  ? 22.856 45.392 -2.538  1.00 46.05 ? 17  LEU A CB  1 
ATOM   129  C CG  . LEU A 1 17  ? 22.462 44.081 -3.229  1.00 50.23 ? 17  LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 17  ? 23.441 42.983 -2.836  1.00 53.02 ? 17  LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 17  ? 21.042 43.680 -2.862  1.00 52.42 ? 17  LEU A CD2 1 
ATOM   132  N N   . GLY A 1 18  ? 22.119 48.987 -2.759  1.00 42.88 ? 18  GLY A N   1 
ATOM   133  C CA  . GLY A 1 18  ? 22.630 50.267 -2.304  1.00 39.44 ? 18  GLY A CA  1 
ATOM   134  C C   . GLY A 1 18  ? 23.895 50.777 -2.971  1.00 39.37 ? 18  GLY A C   1 
ATOM   135  O O   . GLY A 1 18  ? 24.160 50.498 -4.144  1.00 38.89 ? 18  GLY A O   1 
ATOM   136  N N   . GLU A 1 19  ? 24.645 51.578 -2.220  1.00 36.16 ? 19  GLU A N   1 
ATOM   137  C CA  . GLU A 1 19  ? 25.888 52.175 -2.688  1.00 35.48 ? 19  GLU A CA  1 
ATOM   138  C C   . GLU A 1 19  ? 26.985 51.126 -2.786  1.00 29.29 ? 19  GLU A C   1 
ATOM   139  O O   . GLU A 1 19  ? 26.911 50.063 -2.153  1.00 27.03 ? 19  GLU A O   1 
ATOM   140  C CB  . GLU A 1 19  ? 26.346 53.274 -1.720  1.00 41.78 ? 19  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 19  ? 25.381 54.439 -1.562  1.00 50.88 ? 19  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 19  ? 25.504 55.487 -2.657  1.00 55.43 ? 19  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 19  ? 25.978 55.169 -3.770  1.00 57.61 ? 19  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 19  ? 25.141 56.654 -2.390  1.00 59.73 ? 19  GLU A OE2 1 
ATOM   145  N N   . PRO A 1 20  ? 28.025 51.409 -3.581  1.00 22.83 ? 20  PRO A N   1 
ATOM   146  C CA  . PRO A 1 20  ? 29.108 50.432 -3.703  1.00 19.89 ? 20  PRO A CA  1 
ATOM   147  C C   . PRO A 1 20  ? 29.963 50.377 -2.435  1.00 17.60 ? 20  PRO A C   1 
ATOM   148  O O   . PRO A 1 20  ? 29.938 51.296 -1.609  1.00 14.66 ? 20  PRO A O   1 
ATOM   149  C CB  . PRO A 1 20  ? 29.895 50.949 -4.913  1.00 20.71 ? 20  PRO A CB  1 
ATOM   150  C CG  . PRO A 1 20  ? 29.668 52.422 -4.874  1.00 22.13 ? 20  PRO A CG  1 
ATOM   151  C CD  . PRO A 1 20  ? 28.211 52.535 -4.514  1.00 20.62 ? 20  PRO A CD  1 
ATOM   152  N N   . ARG A 1 21  ? 30.672 49.275 -2.245  1.00 16.02 ? 21  ARG A N   1 
ATOM   153  C CA  . ARG A 1 21  ? 31.538 49.162 -1.088  1.00 18.17 ? 21  ARG A CA  1 
ATOM   154  C C   . ARG A 1 21  ? 32.907 49.733 -1.449  1.00 18.52 ? 21  ARG A C   1 
ATOM   155  O O   . ARG A 1 21  ? 33.398 49.523 -2.561  1.00 17.66 ? 21  ARG A O   1 
ATOM   156  C CB  . ARG A 1 21  ? 31.680 47.710 -0.654  1.00 18.00 ? 21  ARG A CB  1 
ATOM   157  C CG  . ARG A 1 21  ? 32.473 47.573 0.622   1.00 21.72 ? 21  ARG A CG  1 
ATOM   158  C CD  . ARG A 1 21  ? 32.210 46.257 1.264   1.00 21.98 ? 21  ARG A CD  1 
ATOM   159  N NE  . ARG A 1 21  ? 33.000 46.051 2.469   1.00 23.84 ? 21  ARG A NE  1 
ATOM   160  C CZ  . ARG A 1 21  ? 32.978 44.918 3.160   1.00 27.93 ? 21  ARG A CZ  1 
ATOM   161  N NH1 . ARG A 1 21  ? 32.200 43.923 2.762   1.00 30.12 ? 21  ARG A NH1 1 
ATOM   162  N NH2 . ARG A 1 21  ? 33.765 44.753 4.207   1.00 28.17 ? 21  ARG A NH2 1 
ATOM   163  N N   . TYR A 1 22  ? 33.517 50.453 -0.515  1.00 17.64 ? 22  TYR A N   1 
ATOM   164  C CA  . TYR A 1 22  ? 34.824 51.049 -0.737  1.00 12.06 ? 22  TYR A CA  1 
ATOM   165  C C   . TYR A 1 22  ? 35.761 50.686 0.408   1.00 15.52 ? 22  TYR A C   1 
ATOM   166  O O   . TYR A 1 22  ? 35.403 50.826 1.578   1.00 15.56 ? 22  TYR A O   1 
ATOM   167  C CB  . TYR A 1 22  ? 34.707 52.563 -0.849  1.00 10.19 ? 22  TYR A CB  1 
ATOM   168  C CG  . TYR A 1 22  ? 36.028 53.220 -1.122  1.00 9.44  ? 22  TYR A CG  1 
ATOM   169  C CD1 . TYR A 1 22  ? 36.624 53.133 -2.377  1.00 9.46  ? 22  TYR A CD1 1 
ATOM   170  C CD2 . TYR A 1 22  ? 36.712 53.891 -0.113  1.00 13.62 ? 22  TYR A CD2 1 
ATOM   171  C CE1 . TYR A 1 22  ? 37.873 53.692 -2.620  1.00 8.22  ? 22  TYR A CE1 1 
ATOM   172  C CE2 . TYR A 1 22  ? 37.957 54.455 -0.346  1.00 12.69 ? 22  TYR A CE2 1 
ATOM   173  C CZ  . TYR A 1 22  ? 38.529 54.351 -1.598  1.00 7.72  ? 22  TYR A CZ  1 
ATOM   174  O OH  . TYR A 1 22  ? 39.751 54.918 -1.828  1.00 12.33 ? 22  TYR A OH  1 
ATOM   175  N N   . MET A 1 23  ? 36.965 50.239 0.066   1.00 14.36 ? 23  MET A N   1 
ATOM   176  C CA  . MET A 1 23  ? 37.942 49.837 1.066   1.00 13.83 ? 23  MET A CA  1 
ATOM   177  C C   . MET A 1 23  ? 39.363 50.268 0.747   1.00 12.99 ? 23  MET A C   1 
ATOM   178  O O   . MET A 1 23  ? 39.792 50.213 -0.407  1.00 13.31 ? 23  MET A O   1 
ATOM   179  C CB  . MET A 1 23  ? 37.971 48.314 1.195   1.00 15.73 ? 23  MET A CB  1 
ATOM   180  C CG  . MET A 1 23  ? 36.707 47.669 1.693   1.00 25.71 ? 23  MET A CG  1 
ATOM   181  S SD  . MET A 1 23  ? 37.024 45.943 2.036   1.00 32.24 ? 23  MET A SD  1 
ATOM   182  C CE  . MET A 1 23  ? 38.119 46.096 3.458   1.00 25.18 ? 23  MET A CE  1 
ATOM   183  N N   . GLU A 1 24  ? 40.096 50.652 1.784   1.00 8.87  ? 24  GLU A N   1 
ATOM   184  C CA  . GLU A 1 24  ? 41.503 51.011 1.669   1.00 8.90  ? 24  GLU A CA  1 
ATOM   185  C C   . GLU A 1 24  ? 42.188 50.214 2.772   1.00 10.35 ? 24  GLU A C   1 
ATOM   186  O O   . GLU A 1 24  ? 41.682 50.129 3.885   1.00 10.40 ? 24  GLU A O   1 
ATOM   187  C CB  . GLU A 1 24  ? 41.748 52.504 1.897   1.00 3.85  ? 24  GLU A CB  1 
ATOM   188  C CG  . GLU A 1 24  ? 41.102 53.403 0.869   1.00 9.25  ? 24  GLU A CG  1 
ATOM   189  C CD  . GLU A 1 24  ? 41.554 54.846 0.971   1.00 11.00 ? 24  GLU A CD  1 
ATOM   190  O OE1 . GLU A 1 24  ? 42.550 55.128 1.658   1.00 11.69 ? 24  GLU A OE1 1 
ATOM   191  O OE2 . GLU A 1 24  ? 40.921 55.715 0.349   1.00 12.23 ? 24  GLU A OE2 1 
ATOM   192  N N   . VAL A 1 25  ? 43.292 49.564 2.435   1.00 12.02 ? 25  VAL A N   1 
ATOM   193  C CA  . VAL A 1 25  ? 44.059 48.782 3.397   1.00 11.35 ? 25  VAL A CA  1 
ATOM   194  C C   . VAL A 1 25  ? 45.518 49.181 3.142   1.00 12.74 ? 25  VAL A C   1 
ATOM   195  O O   . VAL A 1 25  ? 45.978 49.167 1.996   1.00 13.00 ? 25  VAL A O   1 
ATOM   196  C CB  . VAL A 1 25  ? 43.853 47.262 3.170   1.00 8.62  ? 25  VAL A CB  1 
ATOM   197  C CG1 . VAL A 1 25  ? 44.612 46.451 4.211   1.00 9.34  ? 25  VAL A CG1 1 
ATOM   198  C CG2 . VAL A 1 25  ? 42.384 46.924 3.229   1.00 7.10  ? 25  VAL A CG2 1 
ATOM   199  N N   . GLY A 1 26  ? 46.217 49.603 4.192   1.00 9.47  ? 26  GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? 47.600 50.025 4.043   1.00 4.06  ? 26  GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? 48.568 49.032 4.642   1.00 5.95  ? 26  GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? 48.266 48.380 5.649   1.00 6.96  ? 26  GLY A O   1 
ATOM   203  N N   . TYR A 1 27  ? 49.743 48.928 4.039   1.00 9.41  ? 27  TYR A N   1 
ATOM   204  C CA  . TYR A 1 27  ? 50.776 48.010 4.510   1.00 10.08 ? 27  TYR A CA  1 
ATOM   205  C C   . TYR A 1 27  ? 52.145 48.664 4.533   1.00 8.59  ? 27  TYR A C   1 
ATOM   206  O O   . TYR A 1 27  ? 52.462 49.492 3.681   1.00 9.28  ? 27  TYR A O   1 
ATOM   207  C CB  . TYR A 1 27  ? 50.905 46.803 3.575   1.00 8.20  ? 27  TYR A CB  1 
ATOM   208  C CG  . TYR A 1 27  ? 49.808 45.785 3.649   1.00 8.19  ? 27  TYR A CG  1 
ATOM   209  C CD1 . TYR A 1 27  ? 48.608 45.979 2.979   1.00 10.96 ? 27  TYR A CD1 1 
ATOM   210  C CD2 . TYR A 1 27  ? 49.975 44.611 4.381   1.00 10.39 ? 27  TYR A CD2 1 
ATOM   211  C CE1 . TYR A 1 27  ? 47.595 45.028 3.037   1.00 12.30 ? 27  TYR A CE1 1 
ATOM   212  C CE2 . TYR A 1 27  ? 48.969 43.659 4.448   1.00 9.10  ? 27  TYR A CE2 1 
ATOM   213  C CZ  . TYR A 1 27  ? 47.781 43.877 3.775   1.00 9.01  ? 27  TYR A CZ  1 
ATOM   214  O OH  . TYR A 1 27  ? 46.769 42.956 3.865   1.00 10.89 ? 27  TYR A OH  1 
ATOM   215  N N   . VAL A 1 28  ? 52.929 48.326 5.546   1.00 8.72  ? 28  VAL A N   1 
ATOM   216  C CA  . VAL A 1 28  ? 54.314 48.769 5.631   1.00 9.91  ? 28  VAL A CA  1 
ATOM   217  C C   . VAL A 1 28  ? 54.924 47.371 5.604   1.00 11.73 ? 28  VAL A C   1 
ATOM   218  O O   . VAL A 1 28  ? 54.633 46.551 6.482   1.00 11.59 ? 28  VAL A O   1 
ATOM   219  C CB  . VAL A 1 28  ? 54.663 49.509 6.942   1.00 8.73  ? 28  VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 28  ? 56.159 49.771 6.995   1.00 7.98  ? 28  VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 28  ? 53.951 50.843 7.001   1.00 4.61  ? 28  VAL A CG2 1 
ATOM   222  N N   . ASP A 1 29  ? 55.646 47.063 4.529   1.00 11.07 ? 29  ASP A N   1 
ATOM   223  C CA  . ASP A 1 29  ? 56.227 45.733 4.331   1.00 8.13  ? 29  ASP A CA  1 
ATOM   224  C C   . ASP A 1 29  ? 55.068 44.729 4.380   1.00 10.17 ? 29  ASP A C   1 
ATOM   225  O O   . ASP A 1 29  ? 54.020 44.987 3.782   1.00 8.14  ? 29  ASP A O   1 
ATOM   226  C CB  . ASP A 1 29  ? 57.305 45.418 5.374   1.00 10.60 ? 29  ASP A CB  1 
ATOM   227  C CG  . ASP A 1 29  ? 58.484 46.373 5.308   1.00 14.59 ? 29  ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 29  ? 58.625 47.100 4.306   1.00 18.27 ? 29  ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 29  ? 59.278 46.414 6.269   1.00 15.44 ? 29  ASP A OD2 1 
ATOM   230  N N   . ASP A 1 30  ? 55.216 43.628 5.115   1.00 14.83 ? 30  ASP A N   1 
ATOM   231  C CA  . ASP A 1 30  ? 54.163 42.611 5.207   1.00 15.46 ? 30  ASP A CA  1 
ATOM   232  C C   . ASP A 1 30  ? 53.155 42.857 6.324   1.00 17.41 ? 30  ASP A C   1 
ATOM   233  O O   . ASP A 1 30  ? 52.343 41.985 6.621   1.00 21.95 ? 30  ASP A O   1 
ATOM   234  C CB  . ASP A 1 30  ? 54.777 41.228 5.438   1.00 20.64 ? 30  ASP A CB  1 
ATOM   235  C CG  . ASP A 1 30  ? 55.769 40.838 4.368   1.00 25.98 ? 30  ASP A CG  1 
ATOM   236  O OD1 . ASP A 1 30  ? 55.479 41.056 3.172   1.00 25.39 ? 30  ASP A OD1 1 
ATOM   237  O OD2 . ASP A 1 30  ? 56.841 40.302 4.729   1.00 26.32 ? 30  ASP A OD2 1 
ATOM   238  N N   . THR A 1 31  ? 53.174 44.043 6.919   1.00 15.60 ? 31  THR A N   1 
ATOM   239  C CA  . THR A 1 31  ? 52.283 44.338 8.033   1.00 9.08  ? 31  THR A CA  1 
ATOM   240  C C   . THR A 1 31  ? 51.139 45.299 7.727   1.00 8.02  ? 31  THR A C   1 
ATOM   241  O O   . THR A 1 31  ? 51.371 46.434 7.319   1.00 7.56  ? 31  THR A O   1 
ATOM   242  C CB  . THR A 1 31  ? 53.101 44.892 9.248   1.00 14.85 ? 31  THR A CB  1 
ATOM   243  O OG1 . THR A 1 31  ? 54.001 43.878 9.739   1.00 13.71 ? 31  THR A OG1 1 
ATOM   244  C CG2 . THR A 1 31  ? 52.172 45.350 10.382  1.00 7.79  ? 31  THR A CG2 1 
ATOM   245  N N   . GLU A 1 32  ? 49.906 44.831 7.915   1.00 7.50  ? 32  GLU A N   1 
ATOM   246  C CA  . GLU A 1 32  ? 48.715 45.663 7.727   1.00 5.90  ? 32  GLU A CA  1 
ATOM   247  C C   . GLU A 1 32  ? 48.790 46.695 8.860   1.00 5.37  ? 32  GLU A C   1 
ATOM   248  O O   . GLU A 1 32  ? 49.101 46.340 9.999   1.00 10.21 ? 32  GLU A O   1 
ATOM   249  C CB  . GLU A 1 32  ? 47.444 44.806 7.880   1.00 3.13  ? 32  GLU A CB  1 
ATOM   250  C CG  . GLU A 1 32  ? 46.126 45.537 7.552   1.00 4.71  ? 32  GLU A CG  1 
ATOM   251  C CD  . GLU A 1 32  ? 44.871 44.698 7.804   1.00 3.14  ? 32  GLU A CD  1 
ATOM   252  O OE1 . GLU A 1 32  ? 44.966 43.502 8.139   1.00 8.03  ? 32  GLU A OE1 1 
ATOM   253  O OE2 . GLU A 1 32  ? 43.756 45.232 7.668   1.00 11.03 ? 32  GLU A OE2 1 
ATOM   254  N N   . PHE A 1 33  ? 48.537 47.965 8.568   1.00 9.20  ? 33  PHE A N   1 
ATOM   255  C CA  . PHE A 1 33  ? 48.622 48.966 9.618   1.00 5.37  ? 33  PHE A CA  1 
ATOM   256  C C   . PHE A 1 33  ? 47.477 49.975 9.697   1.00 10.27 ? 33  PHE A C   1 
ATOM   257  O O   . PHE A 1 33  ? 47.307 50.645 10.718  1.00 10.93 ? 33  PHE A O   1 
ATOM   258  C CB  . PHE A 1 33  ? 49.991 49.658 9.596   1.00 6.86  ? 33  PHE A CB  1 
ATOM   259  C CG  . PHE A 1 33  ? 50.098 50.793 8.622   1.00 7.14  ? 33  PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 33  ? 50.116 50.560 7.252   1.00 7.80  ? 33  PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 33  ? 50.180 52.104 9.080   1.00 5.62  ? 33  PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 33  ? 50.211 51.624 6.345   1.00 5.30  ? 33  PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 33  ? 50.274 53.169 8.190   1.00 7.87  ? 33  PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 33  ? 50.289 52.923 6.815   1.00 8.38  ? 33  PHE A CZ  1 
ATOM   265  N N   . VAL A 1 34  ? 46.709 50.103 8.621   1.00 9.15  ? 34  VAL A N   1 
ATOM   266  C CA  . VAL A 1 34  ? 45.557 51.000 8.598   1.00 4.69  ? 34  VAL A CA  1 
ATOM   267  C C   . VAL A 1 34  ? 44.522 50.417 7.664   1.00 7.64  ? 34  VAL A C   1 
ATOM   268  O O   . VAL A 1 34  ? 44.854 49.678 6.747   1.00 8.37  ? 34  VAL A O   1 
ATOM   269  C CB  . VAL A 1 34  ? 45.878 52.426 8.130   1.00 4.49  ? 34  VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 34  ? 46.633 53.186 9.206   1.00 2.17  ? 34  VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 34  ? 46.629 52.405 6.811   1.00 8.79  ? 34  VAL A CG2 1 
ATOM   272  N N   . ARG A 1 35  ? 43.264 50.753 7.892   1.00 9.98  ? 35  ARG A N   1 
ATOM   273  C CA  . ARG A 1 35  ? 42.205 50.235 7.057   1.00 11.07 ? 35  ARG A CA  1 
ATOM   274  C C   . ARG A 1 35  ? 41.002 51.156 7.144   1.00 11.70 ? 35  ARG A C   1 
ATOM   275  O O   . ARG A 1 35  ? 40.856 51.905 8.111   1.00 11.98 ? 35  ARG A O   1 
ATOM   276  C CB  . ARG A 1 35  ? 41.830 48.831 7.529   1.00 13.19 ? 35  ARG A CB  1 
ATOM   277  C CG  . ARG A 1 35  ? 40.771 48.155 6.699   1.00 18.81 ? 35  ARG A CG  1 
ATOM   278  C CD  . ARG A 1 35  ? 40.558 46.718 7.141   1.00 27.38 ? 35  ARG A CD  1 
ATOM   279  N NE  . ARG A 1 35  ? 39.865 46.629 8.419   1.00 30.12 ? 35  ARG A NE  1 
ATOM   280  C CZ  . ARG A 1 35  ? 39.743 45.512 9.129   1.00 33.61 ? 35  ARG A CZ  1 
ATOM   281  N NH1 . ARG A 1 35  ? 40.271 44.373 8.686   1.00 31.87 ? 35  ARG A NH1 1 
ATOM   282  N NH2 . ARG A 1 35  ? 39.089 45.540 10.285  1.00 34.36 ? 35  ARG A NH2 1 
ATOM   283  N N   . PHE A 1 36  ? 40.212 51.164 6.074   1.00 9.69  ? 36  PHE A N   1 
ATOM   284  C CA  . PHE A 1 36  ? 38.983 51.938 5.977   1.00 9.72  ? 36  PHE A CA  1 
ATOM   285  C C   . PHE A 1 36  ? 38.017 51.040 5.216   1.00 8.84  ? 36  PHE A C   1 
ATOM   286  O O   . PHE A 1 36  ? 38.388 50.442 4.206   1.00 11.67 ? 36  PHE A O   1 
ATOM   287  C CB  . PHE A 1 36  ? 39.185 53.236 5.200   1.00 7.66  ? 36  PHE A CB  1 
ATOM   288  C CG  . PHE A 1 36  ? 37.917 54.045 5.040   1.00 10.96 ? 36  PHE A CG  1 
ATOM   289  C CD1 . PHE A 1 36  ? 37.532 54.961 6.016   1.00 7.42  ? 36  PHE A CD1 1 
ATOM   290  C CD2 . PHE A 1 36  ? 37.095 53.869 3.929   1.00 9.00  ? 36  PHE A CD2 1 
ATOM   291  C CE1 . PHE A 1 36  ? 36.354 55.687 5.893   1.00 3.76  ? 36  PHE A CE1 1 
ATOM   292  C CE2 . PHE A 1 36  ? 35.907 54.594 3.794   1.00 5.17  ? 36  PHE A CE2 1 
ATOM   293  C CZ  . PHE A 1 36  ? 35.538 55.505 4.780   1.00 5.56  ? 36  PHE A CZ  1 
ATOM   294  N N   . ASP A 1 37  ? 36.803 50.911 5.731   1.00 11.63 ? 37  ASP A N   1 
ATOM   295  C CA  . ASP A 1 37  ? 35.780 50.085 5.113   1.00 10.61 ? 37  ASP A CA  1 
ATOM   296  C C   . ASP A 1 37  ? 34.485 50.856 5.194   1.00 15.69 ? 37  ASP A C   1 
ATOM   297  O O   . ASP A 1 37  ? 34.002 51.141 6.292   1.00 19.70 ? 37  ASP A O   1 
ATOM   298  C CB  . ASP A 1 37  ? 35.633 48.784 5.883   1.00 11.02 ? 37  ASP A CB  1 
ATOM   299  C CG  . ASP A 1 37  ? 34.670 47.813 5.228   1.00 14.96 ? 37  ASP A CG  1 
ATOM   300  O OD1 . ASP A 1 37  ? 33.942 48.163 4.272   1.00 18.74 ? 37  ASP A OD1 1 
ATOM   301  O OD2 . ASP A 1 37  ? 34.646 46.661 5.678   1.00 18.05 ? 37  ASP A OD2 1 
ATOM   302  N N   . SER A 1 38  ? 33.911 51.167 4.036   1.00 18.24 ? 38  SER A N   1 
ATOM   303  C CA  . SER A 1 38  ? 32.670 51.933 3.964   1.00 16.20 ? 38  SER A CA  1 
ATOM   304  C C   . SER A 1 38  ? 31.474 51.205 4.561   1.00 14.44 ? 38  SER A C   1 
ATOM   305  O O   . SER A 1 38  ? 30.479 51.829 4.902   1.00 18.20 ? 38  SER A O   1 
ATOM   306  C CB  . SER A 1 38  ? 32.373 52.346 2.514   1.00 16.62 ? 38  SER A CB  1 
ATOM   307  O OG  . SER A 1 38  ? 32.030 51.233 1.705   1.00 20.67 ? 38  SER A OG  1 
ATOM   308  N N   . ASP A 1 39  ? 31.564 49.887 4.670   1.00 17.51 ? 39  ASP A N   1 
ATOM   309  C CA  . ASP A 1 39  ? 30.474 49.097 5.230   1.00 28.74 ? 39  ASP A CA  1 
ATOM   310  C C   . ASP A 1 39  ? 30.493 49.085 6.754   1.00 33.34 ? 39  ASP A C   1 
ATOM   311  O O   . ASP A 1 39  ? 29.554 48.612 7.390   1.00 36.96 ? 39  ASP A O   1 
ATOM   312  C CB  . ASP A 1 39  ? 30.536 47.657 4.713   1.00 28.06 ? 39  ASP A CB  1 
ATOM   313  C CG  . ASP A 1 39  ? 29.635 47.422 3.521   1.00 31.75 ? 39  ASP A CG  1 
ATOM   314  O OD1 . ASP A 1 39  ? 29.148 48.398 2.901   1.00 30.93 ? 39  ASP A OD1 1 
ATOM   315  O OD2 . ASP A 1 39  ? 29.417 46.240 3.186   1.00 35.95 ? 39  ASP A OD2 1 
ATOM   316  N N   . ALA A 1 40  ? 31.584 49.574 7.333   1.00 38.36 ? 40  ALA A N   1 
ATOM   317  C CA  . ALA A 1 40  ? 31.736 49.612 8.777   1.00 39.38 ? 40  ALA A CA  1 
ATOM   318  C C   . ALA A 1 40  ? 30.587 50.349 9.433   1.00 43.67 ? 40  ALA A C   1 
ATOM   319  O O   . ALA A 1 40  ? 29.987 51.250 8.837   1.00 42.01 ? 40  ALA A O   1 
ATOM   320  C CB  . ALA A 1 40  ? 33.052 50.268 9.151   1.00 37.13 ? 40  ALA A CB  1 
ATOM   321  N N   . GLU A 1 41  ? 30.303 49.951 10.670  1.00 49.78 ? 41  GLU A N   1 
ATOM   322  C CA  . GLU A 1 41  ? 29.247 50.535 11.492  1.00 53.61 ? 41  GLU A CA  1 
ATOM   323  C C   . GLU A 1 41  ? 29.473 52.042 11.475  1.00 54.64 ? 41  GLU A C   1 
ATOM   324  O O   . GLU A 1 41  ? 28.549 52.823 11.251  1.00 53.61 ? 41  GLU A O   1 
ATOM   325  C CB  . GLU A 1 41  ? 29.349 50.012 12.932  1.00 57.44 ? 41  GLU A CB  1 
ATOM   326  C CG  . GLU A 1 41  ? 29.396 48.479 13.082  1.00 63.59 ? 41  GLU A CG  1 
ATOM   327  C CD  . GLU A 1 41  ? 30.699 47.845 12.584  1.00 67.40 ? 41  GLU A CD  1 
ATOM   328  O OE1 . GLU A 1 41  ? 31.759 48.510 12.635  1.00 68.52 ? 41  GLU A OE1 1 
ATOM   329  O OE2 . GLU A 1 41  ? 30.661 46.687 12.118  1.00 67.92 ? 41  GLU A OE2 1 
ATOM   330  N N   . ASN A 1 42  ? 30.726 52.429 11.698  1.00 55.15 ? 42  ASN A N   1 
ATOM   331  C CA  . ASN A 1 42  ? 31.138 53.828 11.679  1.00 54.89 ? 42  ASN A CA  1 
ATOM   332  C C   . ASN A 1 42  ? 32.376 53.901 10.794  1.00 47.26 ? 42  ASN A C   1 
ATOM   333  O O   . ASN A 1 42  ? 33.462 53.508 11.217  1.00 50.27 ? 42  ASN A O   1 
ATOM   334  C CB  . ASN A 1 42  ? 31.485 54.311 13.091  1.00 60.58 ? 42  ASN A CB  1 
ATOM   335  C CG  . ASN A 1 42  ? 31.997 55.746 13.110  1.00 63.62 ? 42  ASN A CG  1 
ATOM   336  O OD1 . ASN A 1 42  ? 31.848 56.488 12.138  1.00 65.66 ? 42  ASN A OD1 1 
ATOM   337  N ND2 . ASN A 1 42  ? 32.605 56.140 14.222  1.00 64.83 ? 42  ASN A ND2 1 
ATOM   338  N N   . PRO A 1 43  ? 32.212 54.327 9.529   1.00 40.57 ? 43  PRO A N   1 
ATOM   339  C CA  . PRO A 1 43  ? 33.326 54.437 8.583   1.00 34.44 ? 43  PRO A CA  1 
ATOM   340  C C   . PRO A 1 43  ? 34.334 55.502 9.002   1.00 28.32 ? 43  PRO A C   1 
ATOM   341  O O   . PRO A 1 43  ? 34.074 56.704 8.890   1.00 26.99 ? 43  PRO A O   1 
ATOM   342  C CB  . PRO A 1 43  ? 32.628 54.808 7.274   1.00 34.29 ? 43  PRO A CB  1 
ATOM   343  C CG  . PRO A 1 43  ? 31.285 54.206 7.421   1.00 37.51 ? 43  PRO A CG  1 
ATOM   344  C CD  . PRO A 1 43  ? 30.938 54.579 8.839   1.00 39.73 ? 43  PRO A CD  1 
ATOM   345  N N   . ARG A 1 44  ? 35.490 55.038 9.461   1.00 22.88 ? 44  ARG A N   1 
ATOM   346  C CA  . ARG A 1 44  ? 36.575 55.889 9.917   1.00 21.88 ? 44  ARG A CA  1 
ATOM   347  C C   . ARG A 1 44  ? 37.850 55.127 9.595   1.00 18.78 ? 44  ARG A C   1 
ATOM   348  O O   . ARG A 1 44  ? 37.832 53.899 9.476   1.00 12.64 ? 44  ARG A O   1 
ATOM   349  C CB  . ARG A 1 44  ? 36.521 56.063 11.443  1.00 25.11 ? 44  ARG A CB  1 
ATOM   350  C CG  . ARG A 1 44  ? 35.310 56.794 12.012  1.00 37.59 ? 44  ARG A CG  1 
ATOM   351  C CD  . ARG A 1 44  ? 35.383 58.302 11.811  1.00 44.65 ? 44  ARG A CD  1 
ATOM   352  N NE  . ARG A 1 44  ? 36.551 58.894 12.465  1.00 52.57 ? 44  ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 44  ? 36.867 60.187 12.410  1.00 56.27 ? 44  ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 44  ? 36.096 61.034 11.735  1.00 57.67 ? 44  ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 44  ? 37.972 60.631 13.005  1.00 56.26 ? 44  ARG A NH2 1 
ATOM   356  N N   . TYR A 1 45  ? 38.943 55.854 9.408   1.00 15.88 ? 45  TYR A N   1 
ATOM   357  C CA  . TYR A 1 45  ? 40.230 55.217 9.164   1.00 18.30 ? 45  TYR A CA  1 
ATOM   358  C C   . TYR A 1 45  ? 40.652 54.696 10.540  1.00 19.38 ? 45  TYR A C   1 
ATOM   359  O O   . TYR A 1 45  ? 40.629 55.444 11.523  1.00 21.98 ? 45  TYR A O   1 
ATOM   360  C CB  . TYR A 1 45  ? 41.248 56.242 8.665   1.00 14.56 ? 45  TYR A CB  1 
ATOM   361  C CG  . TYR A 1 45  ? 41.961 55.807 7.414   1.00 17.93 ? 45  TYR A CG  1 
ATOM   362  C CD1 . TYR A 1 45  ? 43.044 54.943 7.481   1.00 22.39 ? 45  TYR A CD1 1 
ATOM   363  C CD2 . TYR A 1 45  ? 41.526 56.221 6.157   1.00 16.45 ? 45  TYR A CD2 1 
ATOM   364  C CE1 . TYR A 1 45  ? 43.672 54.495 6.328   1.00 22.30 ? 45  TYR A CE1 1 
ATOM   365  C CE2 . TYR A 1 45  ? 42.150 55.779 4.998   1.00 14.19 ? 45  TYR A CE2 1 
ATOM   366  C CZ  . TYR A 1 45  ? 43.219 54.911 5.092   1.00 15.79 ? 45  TYR A CZ  1 
ATOM   367  O OH  . TYR A 1 45  ? 43.815 54.404 3.965   1.00 12.79 ? 45  TYR A OH  1 
ATOM   368  N N   . GLU A 1 46  ? 40.998 53.421 10.630  1.00 16.32 ? 46  GLU A N   1 
ATOM   369  C CA  . GLU A 1 46  ? 41.393 52.868 11.911  1.00 19.23 ? 46  GLU A CA  1 
ATOM   370  C C   . GLU A 1 46  ? 42.736 52.157 11.894  1.00 17.16 ? 46  GLU A C   1 
ATOM   371  O O   . GLU A 1 46  ? 43.159 51.630 10.866  1.00 15.84 ? 46  GLU A O   1 
ATOM   372  C CB  . GLU A 1 46  ? 40.311 51.928 12.430  1.00 24.43 ? 46  GLU A CB  1 
ATOM   373  C CG  . GLU A 1 46  ? 39.986 50.784 11.504  1.00 36.62 ? 46  GLU A CG  1 
ATOM   374  C CD  . GLU A 1 46  ? 39.056 49.771 12.137  1.00 44.13 ? 46  GLU A CD  1 
ATOM   375  O OE1 . GLU A 1 46  ? 38.195 50.171 12.957  1.00 44.32 ? 46  GLU A OE1 1 
ATOM   376  O OE2 . GLU A 1 46  ? 39.187 48.568 11.809  1.00 46.49 ? 46  GLU A OE2 1 
ATOM   377  N N   . PRO A 1 47  ? 43.456 52.186 13.026  1.00 12.86 ? 47  PRO A N   1 
ATOM   378  C CA  . PRO A 1 47  ? 44.759 51.527 13.115  1.00 12.18 ? 47  PRO A CA  1 
ATOM   379  C C   . PRO A 1 47  ? 44.607 50.008 13.183  1.00 8.80  ? 47  PRO A C   1 
ATOM   380  O O   . PRO A 1 47  ? 43.648 49.490 13.749  1.00 12.21 ? 47  PRO A O   1 
ATOM   381  C CB  . PRO A 1 47  ? 45.341 52.097 14.411  1.00 12.12 ? 47  PRO A CB  1 
ATOM   382  C CG  . PRO A 1 47  ? 44.126 52.334 15.243  1.00 12.85 ? 47  PRO A CG  1 
ATOM   383  C CD  . PRO A 1 47  ? 43.161 52.940 14.257  1.00 8.84  ? 47  PRO A CD  1 
ATOM   384  N N   . ARG A 1 48  ? 45.568 49.299 12.610  1.00 10.03 ? 48  ARG A N   1 
ATOM   385  C CA  . ARG A 1 48  ? 45.540 47.846 12.598  1.00 9.66  ? 48  ARG A CA  1 
ATOM   386  C C   . ARG A 1 48  ? 46.825 47.332 13.214  1.00 9.86  ? 48  ARG A C   1 
ATOM   387  O O   . ARG A 1 48  ? 47.036 46.128 13.314  1.00 15.02 ? 48  ARG A O   1 
ATOM   388  C CB  . ARG A 1 48  ? 45.409 47.346 11.159  1.00 13.91 ? 48  ARG A CB  1 
ATOM   389  C CG  . ARG A 1 48  ? 44.249 47.978 10.414  1.00 19.10 ? 48  ARG A CG  1 
ATOM   390  C CD  . ARG A 1 48  ? 42.943 47.399 10.875  1.00 18.57 ? 48  ARG A CD  1 
ATOM   391  N NE  . ARG A 1 48  ? 42.816 46.034 10.383  1.00 30.18 ? 48  ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 48  ? 42.272 45.035 11.066  1.00 33.69 ? 48  ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 48  ? 41.794 45.244 12.289  1.00 33.88 ? 48  ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 48  ? 42.211 43.828 10.519  1.00 33.31 ? 48  ARG A NH2 1 
ATOM   395  N N   . ALA A 1 49  ? 47.710 48.259 13.564  1.00 12.73 ? 49  ALA A N   1 
ATOM   396  C CA  . ALA A 1 49  ? 48.985 47.931 14.186  1.00 13.21 ? 49  ALA A CA  1 
ATOM   397  C C   . ALA A 1 49  ? 49.098 48.765 15.458  1.00 16.06 ? 49  ALA A C   1 
ATOM   398  O O   . ALA A 1 49  ? 48.836 49.972 15.447  1.00 15.98 ? 49  ALA A O   1 
ATOM   399  C CB  . ALA A 1 49  ? 50.129 48.245 13.245  1.00 10.07 ? 49  ALA A CB  1 
ATOM   400  N N   . ARG A 1 50  ? 49.508 48.121 16.545  1.00 21.88 ? 50  ARG A N   1 
ATOM   401  C CA  . ARG A 1 50  ? 49.643 48.778 17.847  1.00 22.66 ? 50  ARG A CA  1 
ATOM   402  C C   . ARG A 1 50  ? 50.474 50.059 17.813  1.00 20.75 ? 50  ARG A C   1 
ATOM   403  O O   . ARG A 1 50  ? 50.081 51.071 18.385  1.00 19.70 ? 50  ARG A O   1 
ATOM   404  C CB  . ARG A 1 50  ? 50.226 47.790 18.864  1.00 30.14 ? 50  ARG A CB  1 
ATOM   405  C CG  . ARG A 1 50  ? 50.536 48.368 20.248  1.00 41.24 ? 50  ARG A CG  1 
ATOM   406  C CD  . ARG A 1 50  ? 49.283 48.755 21.017  1.00 41.43 ? 50  ARG A CD  1 
ATOM   407  N NE  . ARG A 1 50  ? 49.609 49.145 22.385  1.00 45.65 ? 50  ARG A NE  1 
ATOM   408  C CZ  . ARG A 1 50  ? 49.469 48.351 23.445  1.00 48.15 ? 50  ARG A CZ  1 
ATOM   409  N NH1 . ARG A 1 50  ? 49.003 47.116 23.292  1.00 50.58 ? 50  ARG A NH1 1 
ATOM   410  N NH2 . ARG A 1 50  ? 49.790 48.792 24.657  1.00 46.81 ? 50  ARG A NH2 1 
ATOM   411  N N   . TRP A 1 51  ? 51.599 50.030 17.107  1.00 16.30 ? 51  TRP A N   1 
ATOM   412  C CA  . TRP A 1 51  ? 52.460 51.203 17.033  1.00 12.59 ? 51  TRP A CA  1 
ATOM   413  C C   . TRP A 1 51  ? 51.812 52.437 16.416  1.00 8.66  ? 51  TRP A C   1 
ATOM   414  O O   . TRP A 1 51  ? 52.330 53.551 16.567  1.00 14.41 ? 51  TRP A O   1 
ATOM   415  C CB  . TRP A 1 51  ? 53.783 50.867 16.333  1.00 15.22 ? 51  TRP A CB  1 
ATOM   416  C CG  . TRP A 1 51  ? 53.633 50.100 15.047  1.00 18.26 ? 51  TRP A CG  1 
ATOM   417  C CD1 . TRP A 1 51  ? 53.612 48.739 14.898  1.00 19.23 ? 51  TRP A CD1 1 
ATOM   418  C CD2 . TRP A 1 51  ? 53.483 50.650 13.731  1.00 13.34 ? 51  TRP A CD2 1 
ATOM   419  N NE1 . TRP A 1 51  ? 53.457 48.410 13.571  1.00 17.73 ? 51  TRP A NE1 1 
ATOM   420  C CE2 . TRP A 1 51  ? 53.373 49.564 12.834  1.00 14.54 ? 51  TRP A CE2 1 
ATOM   421  C CE3 . TRP A 1 51  ? 53.429 51.955 13.226  1.00 10.95 ? 51  TRP A CE3 1 
ATOM   422  C CZ2 . TRP A 1 51  ? 53.209 49.743 11.459  1.00 13.06 ? 51  TRP A CZ2 1 
ATOM   423  C CZ3 . TRP A 1 51  ? 53.265 52.132 11.860  1.00 13.11 ? 51  TRP A CZ3 1 
ATOM   424  C CH2 . TRP A 1 51  ? 53.156 51.031 10.994  1.00 12.27 ? 51  TRP A CH2 1 
ATOM   425  N N   . MET A 1 52  ? 50.677 52.256 15.741  1.00 7.86  ? 52  MET A N   1 
ATOM   426  C CA  . MET A 1 52  ? 49.974 53.388 15.128  1.00 14.87 ? 52  MET A CA  1 
ATOM   427  C C   . MET A 1 52  ? 49.300 54.314 16.155  1.00 13.65 ? 52  MET A C   1 
ATOM   428  O O   . MET A 1 52  ? 48.779 55.377 15.804  1.00 17.71 ? 52  MET A O   1 
ATOM   429  C CB  . MET A 1 52  ? 48.955 52.913 14.077  1.00 13.17 ? 52  MET A CB  1 
ATOM   430  C CG  . MET A 1 52  ? 49.558 52.605 12.695  1.00 9.67  ? 52  MET A CG  1 
ATOM   431  S SD  . MET A 1 52  ? 50.605 53.947 12.011  1.00 12.47 ? 52  MET A SD  1 
ATOM   432  C CE  . MET A 1 52  ? 49.388 55.183 11.605  1.00 6.13  ? 52  MET A CE  1 
ATOM   433  N N   . GLU A 1 53  ? 49.372 53.936 17.430  1.00 15.18 ? 53  GLU A N   1 
ATOM   434  C CA  . GLU A 1 53  ? 48.785 54.715 18.525  1.00 16.47 ? 53  GLU A CA  1 
ATOM   435  C C   . GLU A 1 53  ? 49.571 55.996 18.777  1.00 16.85 ? 53  GLU A C   1 
ATOM   436  O O   . GLU A 1 53  ? 49.157 56.844 19.579  1.00 16.07 ? 53  GLU A O   1 
ATOM   437  C CB  . GLU A 1 53  ? 48.818 53.902 19.803  1.00 18.05 ? 53  GLU A CB  1 
ATOM   438  C CG  . GLU A 1 53  ? 50.237 53.633 20.254  1.00 23.24 ? 53  GLU A CG  1 
ATOM   439  C CD  . GLU A 1 53  ? 50.311 53.219 21.682  1.00 24.38 ? 53  GLU A CD  1 
ATOM   440  O OE1 . GLU A 1 53  ? 49.560 53.793 22.496  1.00 31.07 ? 53  GLU A OE1 1 
ATOM   441  O OE2 . GLU A 1 53  ? 51.118 52.322 21.996  1.00 28.70 ? 53  GLU A OE2 1 
ATOM   442  N N   . GLN A 1 54  ? 50.731 56.099 18.130  1.00 18.27 ? 54  GLN A N   1 
ATOM   443  C CA  . GLN A 1 54  ? 51.610 57.253 18.256  1.00 15.51 ? 54  GLN A CA  1 
ATOM   444  C C   . GLN A 1 54  ? 51.161 58.423 17.393  1.00 17.91 ? 54  GLN A C   1 
ATOM   445  O O   . GLN A 1 54  ? 51.730 59.512 17.473  1.00 21.13 ? 54  GLN A O   1 
ATOM   446  C CB  . GLN A 1 54  ? 53.045 56.850 17.920  1.00 19.38 ? 54  GLN A CB  1 
ATOM   447  C CG  . GLN A 1 54  ? 53.573 55.748 18.845  1.00 26.14 ? 54  GLN A CG  1 
ATOM   448  C CD  . GLN A 1 54  ? 55.013 55.382 18.577  1.00 27.36 ? 54  GLN A CD  1 
ATOM   449  O OE1 . GLN A 1 54  ? 55.899 56.233 18.609  1.00 30.22 ? 54  GLN A OE1 1 
ATOM   450  N NE2 . GLN A 1 54  ? 55.257 54.106 18.327  1.00 29.73 ? 54  GLN A NE2 1 
ATOM   451  N N   . GLU A 1 55  ? 50.154 58.192 16.554  1.00 14.19 ? 55  GLU A N   1 
ATOM   452  C CA  . GLU A 1 55  ? 49.620 59.247 15.703  1.00 11.50 ? 55  GLU A CA  1 
ATOM   453  C C   . GLU A 1 55  ? 48.453 59.895 16.437  1.00 15.12 ? 55  GLU A C   1 
ATOM   454  O O   . GLU A 1 55  ? 47.578 59.204 16.972  1.00 16.75 ? 55  GLU A O   1 
ATOM   455  C CB  . GLU A 1 55  ? 49.147 58.681 14.365  1.00 9.53  ? 55  GLU A CB  1 
ATOM   456  C CG  . GLU A 1 55  ? 50.248 58.079 13.519  1.00 8.40  ? 55  GLU A CG  1 
ATOM   457  C CD  . GLU A 1 55  ? 51.346 59.066 13.193  1.00 14.39 ? 55  GLU A CD  1 
ATOM   458  O OE1 . GLU A 1 55  ? 51.100 60.290 13.194  1.00 13.12 ? 55  GLU A OE1 1 
ATOM   459  O OE2 . GLU A 1 55  ? 52.482 58.619 12.940  1.00 20.32 ? 55  GLU A OE2 1 
ATOM   460  N N   . GLY A 1 56  ? 48.450 61.221 16.467  1.00 21.50 ? 56  GLY A N   1 
ATOM   461  C CA  . GLY A 1 56  ? 47.405 61.950 17.152  1.00 17.25 ? 56  GLY A CA  1 
ATOM   462  C C   . GLY A 1 56  ? 46.061 61.903 16.466  1.00 22.50 ? 56  GLY A C   1 
ATOM   463  O O   . GLY A 1 56  ? 45.920 61.331 15.384  1.00 24.46 ? 56  GLY A O   1 
ATOM   464  N N   . PRO A 1 57  ? 45.046 62.529 17.077  1.00 24.12 ? 57  PRO A N   1 
ATOM   465  C CA  . PRO A 1 57  ? 43.669 62.598 16.584  1.00 20.48 ? 57  PRO A CA  1 
ATOM   466  C C   . PRO A 1 57  ? 43.595 63.244 15.217  1.00 17.08 ? 57  PRO A C   1 
ATOM   467  O O   . PRO A 1 57  ? 42.803 62.836 14.377  1.00 19.65 ? 57  PRO A O   1 
ATOM   468  C CB  . PRO A 1 57  ? 42.982 63.478 17.625  1.00 20.34 ? 57  PRO A CB  1 
ATOM   469  C CG  . PRO A 1 57  ? 43.806 63.285 18.835  1.00 18.08 ? 57  PRO A CG  1 
ATOM   470  C CD  . PRO A 1 57  ? 45.192 63.329 18.299  1.00 19.62 ? 57  PRO A CD  1 
ATOM   471  N N   . GLU A 1 58  ? 44.414 64.263 15.003  1.00 20.90 ? 58  GLU A N   1 
ATOM   472  C CA  . GLU A 1 58  ? 44.429 64.970 13.731  1.00 23.89 ? 58  GLU A CA  1 
ATOM   473  C C   . GLU A 1 58  ? 44.787 64.059 12.562  1.00 22.58 ? 58  GLU A C   1 
ATOM   474  O O   . GLU A 1 58  ? 44.308 64.263 11.447  1.00 23.36 ? 58  GLU A O   1 
ATOM   475  C CB  . GLU A 1 58  ? 45.349 66.196 13.786  1.00 28.12 ? 58  GLU A CB  1 
ATOM   476  C CG  . GLU A 1 58  ? 46.819 65.924 14.121  1.00 42.07 ? 58  GLU A CG  1 
ATOM   477  C CD  . GLU A 1 58  ? 47.046 65.401 15.533  1.00 47.43 ? 58  GLU A CD  1 
ATOM   478  O OE1 . GLU A 1 58  ? 46.427 65.919 16.491  1.00 46.03 ? 58  GLU A OE1 1 
ATOM   479  O OE2 . GLU A 1 58  ? 47.839 64.447 15.678  1.00 52.20 ? 58  GLU A OE2 1 
ATOM   480  N N   . TYR A 1 59  ? 45.593 63.033 12.822  1.00 20.85 ? 59  TYR A N   1 
ATOM   481  C CA  . TYR A 1 59  ? 45.979 62.097 11.778  1.00 17.12 ? 59  TYR A CA  1 
ATOM   482  C C   . TYR A 1 59  ? 44.747 61.338 11.303  1.00 18.34 ? 59  TYR A C   1 
ATOM   483  O O   . TYR A 1 59  ? 44.424 61.316 10.110  1.00 18.34 ? 59  TYR A O   1 
ATOM   484  C CB  . TYR A 1 59  ? 47.013 61.102 12.301  1.00 14.63 ? 59  TYR A CB  1 
ATOM   485  C CG  . TYR A 1 59  ? 47.425 60.033 11.300  1.00 13.82 ? 59  TYR A CG  1 
ATOM   486  C CD1 . TYR A 1 59  ? 46.734 58.820 11.216  1.00 14.04 ? 59  TYR A CD1 1 
ATOM   487  C CD2 . TYR A 1 59  ? 48.516 60.230 10.445  1.00 13.04 ? 59  TYR A CD2 1 
ATOM   488  C CE1 . TYR A 1 59  ? 47.120 57.828 10.307  1.00 12.09 ? 59  TYR A CE1 1 
ATOM   489  C CE2 . TYR A 1 59  ? 48.909 59.246 9.535   1.00 10.43 ? 59  TYR A CE2 1 
ATOM   490  C CZ  . TYR A 1 59  ? 48.205 58.050 9.472   1.00 12.51 ? 59  TYR A CZ  1 
ATOM   491  O OH  . TYR A 1 59  ? 48.584 57.088 8.562   1.00 14.68 ? 59  TYR A OH  1 
ATOM   492  N N   . TRP A 1 60  ? 44.044 60.736 12.247  1.00 16.53 ? 60  TRP A N   1 
ATOM   493  C CA  . TRP A 1 60  ? 42.863 59.957 11.920  1.00 18.85 ? 60  TRP A CA  1 
ATOM   494  C C   . TRP A 1 60  ? 41.751 60.765 11.254  1.00 18.60 ? 60  TRP A C   1 
ATOM   495  O O   . TRP A 1 60  ? 41.079 60.265 10.357  1.00 16.99 ? 60  TRP A O   1 
ATOM   496  C CB  . TRP A 1 60  ? 42.372 59.219 13.166  1.00 17.16 ? 60  TRP A CB  1 
ATOM   497  C CG  . TRP A 1 60  ? 43.471 58.391 13.766  1.00 16.37 ? 60  TRP A CG  1 
ATOM   498  C CD1 . TRP A 1 60  ? 44.194 58.672 14.891  1.00 16.23 ? 60  TRP A CD1 1 
ATOM   499  C CD2 . TRP A 1 60  ? 44.044 57.204 13.208  1.00 13.34 ? 60  TRP A CD2 1 
ATOM   500  N NE1 . TRP A 1 60  ? 45.191 57.739 15.061  1.00 14.30 ? 60  TRP A NE1 1 
ATOM   501  C CE2 . TRP A 1 60  ? 45.122 56.827 14.042  1.00 13.18 ? 60  TRP A CE2 1 
ATOM   502  C CE3 . TRP A 1 60  ? 43.760 56.428 12.078  1.00 12.63 ? 60  TRP A CE3 1 
ATOM   503  C CZ2 . TRP A 1 60  ? 45.917 55.708 13.778  1.00 15.51 ? 60  TRP A CZ2 1 
ATOM   504  C CZ3 . TRP A 1 60  ? 44.554 55.311 11.813  1.00 12.38 ? 60  TRP A CZ3 1 
ATOM   505  C CH2 . TRP A 1 60  ? 45.619 54.964 12.660  1.00 14.89 ? 60  TRP A CH2 1 
ATOM   506  N N   . GLU A 1 61  ? 41.580 62.018 11.658  1.00 21.05 ? 61  GLU A N   1 
ATOM   507  C CA  . GLU A 1 61  ? 40.542 62.851 11.066  1.00 25.22 ? 61  GLU A CA  1 
ATOM   508  C C   . GLU A 1 61  ? 40.879 63.184 9.614   1.00 25.23 ? 61  GLU A C   1 
ATOM   509  O O   . GLU A 1 61  ? 40.011 63.096 8.735   1.00 22.71 ? 61  GLU A O   1 
ATOM   510  C CB  . GLU A 1 61  ? 40.331 64.128 11.883  1.00 31.61 ? 61  GLU A CB  1 
ATOM   511  C CG  . GLU A 1 61  ? 39.209 65.034 11.361  1.00 44.52 ? 61  GLU A CG  1 
ATOM   512  C CD  . GLU A 1 61  ? 37.856 64.329 11.206  1.00 52.20 ? 61  GLU A CD  1 
ATOM   513  O OE1 . GLU A 1 61  ? 37.636 63.252 11.813  1.00 56.24 ? 61  GLU A OE1 1 
ATOM   514  O OE2 . GLU A 1 61  ? 36.999 64.857 10.468  1.00 52.63 ? 61  GLU A OE2 1 
ATOM   515  N N   . ARG A 1 62  ? 42.141 63.532 9.360   1.00 21.69 ? 62  ARG A N   1 
ATOM   516  C CA  . ARG A 1 62  ? 42.590 63.854 8.007   1.00 21.48 ? 62  ARG A CA  1 
ATOM   517  C C   . ARG A 1 62  ? 42.452 62.651 7.073   1.00 19.69 ? 62  ARG A C   1 
ATOM   518  O O   . ARG A 1 62  ? 41.826 62.755 6.020   1.00 22.15 ? 62  ARG A O   1 
ATOM   519  C CB  . ARG A 1 62  ? 44.035 64.355 8.009   1.00 26.89 ? 62  ARG A CB  1 
ATOM   520  C CG  . ARG A 1 62  ? 44.199 65.856 8.270   1.00 38.64 ? 62  ARG A CG  1 
ATOM   521  C CD  . ARG A 1 62  ? 45.656 66.282 8.030   1.00 49.30 ? 62  ARG A CD  1 
ATOM   522  N NE  . ARG A 1 62  ? 45.860 67.733 8.055   1.00 53.60 ? 62  ARG A NE  1 
ATOM   523  C CZ  . ARG A 1 62  ? 46.165 68.472 6.987   1.00 55.79 ? 62  ARG A CZ  1 
ATOM   524  N NH1 . ARG A 1 62  ? 46.301 67.911 5.792   1.00 54.47 ? 62  ARG A NH1 1 
ATOM   525  N NH2 . ARG A 1 62  ? 46.322 69.784 7.112   1.00 58.93 ? 62  ARG A NH2 1 
ATOM   526  N N   . GLU A 1 63  ? 42.990 61.501 7.479   1.00 15.79 ? 63  GLU A N   1 
ATOM   527  C CA  . GLU A 1 63  ? 42.904 60.288 6.665   1.00 14.32 ? 63  GLU A CA  1 
ATOM   528  C C   . GLU A 1 63  ? 41.458 59.866 6.415   1.00 13.10 ? 63  GLU A C   1 
ATOM   529  O O   . GLU A 1 63  ? 41.132 59.368 5.343   1.00 17.79 ? 63  GLU A O   1 
ATOM   530  C CB  . GLU A 1 63  ? 43.676 59.132 7.309   1.00 13.41 ? 63  GLU A CB  1 
ATOM   531  C CG  . GLU A 1 63  ? 45.190 59.333 7.355   1.00 18.79 ? 63  GLU A CG  1 
ATOM   532  C CD  . GLU A 1 63  ? 45.822 59.510 5.977   1.00 22.44 ? 63  GLU A CD  1 
ATOM   533  O OE1 . GLU A 1 63  ? 45.968 58.508 5.235   1.00 21.04 ? 63  GLU A OE1 1 
ATOM   534  O OE2 . GLU A 1 63  ? 46.201 60.655 5.642   1.00 20.94 ? 63  GLU A OE2 1 
ATOM   535  N N   . THR A 1 64  ? 40.596 60.049 7.409   1.00 15.05 ? 64  THR A N   1 
ATOM   536  C CA  . THR A 1 64  ? 39.187 59.697 7.278   1.00 10.61 ? 64  THR A CA  1 
ATOM   537  C C   . THR A 1 64  ? 38.526 60.623 6.254   1.00 11.16 ? 64  THR A C   1 
ATOM   538  O O   . THR A 1 64  ? 37.733 60.180 5.424   1.00 13.81 ? 64  THR A O   1 
ATOM   539  C CB  . THR A 1 64  ? 38.461 59.776 8.646   1.00 9.23  ? 64  THR A CB  1 
ATOM   540  O OG1 . THR A 1 64  ? 38.992 58.767 9.516   1.00 10.00 ? 64  THR A OG1 1 
ATOM   541  C CG2 . THR A 1 64  ? 36.969 59.541 8.496   1.00 10.81 ? 64  THR A CG2 1 
ATOM   542  N N   . GLN A 1 65  ? 38.900 61.894 6.265   1.00 13.17 ? 65  GLN A N   1 
ATOM   543  C CA  . GLN A 1 65  ? 38.316 62.819 5.319   1.00 19.66 ? 65  GLN A CA  1 
ATOM   544  C C   . GLN A 1 65  ? 38.757 62.481 3.907   1.00 18.60 ? 65  GLN A C   1 
ATOM   545  O O   . GLN A 1 65  ? 37.949 62.504 2.976   1.00 16.94 ? 65  GLN A O   1 
ATOM   546  C CB  . GLN A 1 65  ? 38.635 64.266 5.688   1.00 22.89 ? 65  GLN A CB  1 
ATOM   547  C CG  . GLN A 1 65  ? 37.961 64.711 6.984   1.00 38.69 ? 65  GLN A CG  1 
ATOM   548  C CD  . GLN A 1 65  ? 36.585 64.074 7.188   1.00 46.46 ? 65  GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 65  ? 35.688 64.199 6.344   1.00 50.55 ? 65  GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 65  ? 36.419 63.380 8.309   1.00 49.55 ? 65  GLN A NE2 1 
ATOM   551  N N   . LYS A 1 66  ? 40.025 62.123 3.750   1.00 13.80 ? 66  LYS A N   1 
ATOM   552  C CA  . LYS A 1 66  ? 40.520 61.748 2.438   1.00 13.31 ? 66  LYS A CA  1 
ATOM   553  C C   . LYS A 1 66  ? 39.835 60.480 1.929   1.00 11.62 ? 66  LYS A C   1 
ATOM   554  O O   . LYS A 1 66  ? 39.382 60.435 0.786   1.00 14.43 ? 66  LYS A O   1 
ATOM   555  C CB  . LYS A 1 66  ? 42.034 61.565 2.461   1.00 15.48 ? 66  LYS A CB  1 
ATOM   556  C CG  . LYS A 1 66  ? 42.769 62.849 2.785   1.00 20.69 ? 66  LYS A CG  1 
ATOM   557  C CD  . LYS A 1 66  ? 44.230 62.793 2.369   1.00 27.11 ? 66  LYS A CD  1 
ATOM   558  C CE  . LYS A 1 66  ? 44.967 61.671 3.060   1.00 28.25 ? 66  LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 66  ? 46.437 61.749 2.845   1.00 22.73 ? 66  LYS A NZ  1 
ATOM   560  N N   . ALA A 1 67  ? 39.714 59.469 2.788   1.00 10.82 ? 67  ALA A N   1 
ATOM   561  C CA  . ALA A 1 67  ? 39.079 58.212 2.394   1.00 10.66 ? 67  ALA A CA  1 
ATOM   562  C C   . ALA A 1 67  ? 37.642 58.438 1.926   1.00 11.10 ? 67  ALA A C   1 
ATOM   563  O O   . ALA A 1 67  ? 37.219 57.884 0.914   1.00 12.23 ? 67  ALA A O   1 
ATOM   564  C CB  . ALA A 1 67  ? 39.124 57.201 3.531   1.00 6.77  ? 67  ALA A CB  1 
ATOM   565  N N   . LYS A 1 68  ? 36.904 59.287 2.634   1.00 12.59 ? 68  LYS A N   1 
ATOM   566  C CA  . LYS A 1 68  ? 35.525 59.574 2.249   1.00 13.67 ? 68  LYS A CA  1 
ATOM   567  C C   . LYS A 1 68  ? 35.498 60.318 0.918   1.00 8.86  ? 68  LYS A C   1 
ATOM   568  O O   . LYS A 1 68  ? 34.596 60.121 0.098   1.00 9.10  ? 68  LYS A O   1 
ATOM   569  C CB  . LYS A 1 68  ? 34.796 60.353 3.346   1.00 16.83 ? 68  LYS A CB  1 
ATOM   570  C CG  . LYS A 1 68  ? 34.499 59.505 4.561   1.00 21.60 ? 68  LYS A CG  1 
ATOM   571  C CD  . LYS A 1 68  ? 33.395 60.107 5.409   1.00 30.17 ? 68  LYS A CD  1 
ATOM   572  C CE  . LYS A 1 68  ? 32.975 59.143 6.512   1.00 34.73 ? 68  LYS A CE  1 
ATOM   573  N NZ  . LYS A 1 68  ? 32.592 57.795 5.982   1.00 35.69 ? 68  LYS A NZ  1 
ATOM   574  N N   . GLY A 1 69  ? 36.508 61.149 0.692   1.00 9.03  ? 69  GLY A N   1 
ATOM   575  C CA  . GLY A 1 69  ? 36.606 61.866 -0.567  1.00 4.20  ? 69  GLY A CA  1 
ATOM   576  C C   . GLY A 1 69  ? 36.874 60.845 -1.660  1.00 11.27 ? 69  GLY A C   1 
ATOM   577  O O   . GLY A 1 69  ? 36.267 60.888 -2.740  1.00 15.29 ? 69  GLY A O   1 
ATOM   578  N N   . ASN A 1 70  ? 37.731 59.874 -1.353  1.00 5.41  ? 70  ASN A N   1 
ATOM   579  C CA  . ASN A 1 70  ? 38.069 58.830 -2.310  1.00 8.31  ? 70  ASN A CA  1 
ATOM   580  C C   . ASN A 1 70  ? 36.853 57.973 -2.620  1.00 11.28 ? 70  ASN A C   1 
ATOM   581  O O   . ASN A 1 70  ? 36.649 57.572 -3.768  1.00 10.87 ? 70  ASN A O   1 
ATOM   582  C CB  . ASN A 1 70  ? 39.206 57.953 -1.784  1.00 6.01  ? 70  ASN A CB  1 
ATOM   583  C CG  . ASN A 1 70  ? 40.559 58.627 -1.903  1.00 14.20 ? 70  ASN A CG  1 
ATOM   584  O OD1 . ASN A 1 70  ? 40.736 59.567 -2.691  1.00 12.04 ? 70  ASN A OD1 1 
ATOM   585  N ND2 . ASN A 1 70  ? 41.530 58.144 -1.142  1.00 16.91 ? 70  ASN A ND2 1 
ATOM   586  N N   . GLU A 1 71  ? 36.033 57.714 -1.605  1.00 9.22  ? 71  GLU A N   1 
ATOM   587  C CA  . GLU A 1 71  ? 34.824 56.908 -1.776  1.00 10.89 ? 71  GLU A CA  1 
ATOM   588  C C   . GLU A 1 71  ? 33.905 57.554 -2.811  1.00 11.64 ? 71  GLU A C   1 
ATOM   589  O O   . GLU A 1 71  ? 33.442 56.898 -3.739  1.00 14.06 ? 71  GLU A O   1 
ATOM   590  C CB  . GLU A 1 71  ? 34.088 56.772 -0.448  1.00 8.52  ? 71  GLU A CB  1 
ATOM   591  C CG  . GLU A 1 71  ? 32.959 55.756 -0.468  1.00 18.00 ? 71  GLU A CG  1 
ATOM   592  C CD  . GLU A 1 71  ? 32.161 55.717 0.821   1.00 20.72 ? 71  GLU A CD  1 
ATOM   593  O OE1 . GLU A 1 71  ? 32.581 56.331 1.826   1.00 20.33 ? 71  GLU A OE1 1 
ATOM   594  O OE2 . GLU A 1 71  ? 31.100 55.063 0.832   1.00 27.18 ? 71  GLU A OE2 1 
ATOM   595  N N   . GLN A 1 72  ? 33.669 58.852 -2.662  1.00 15.90 ? 72  GLN A N   1 
ATOM   596  C CA  . GLN A 1 72  ? 32.827 59.580 -3.596  1.00 16.45 ? 72  GLN A CA  1 
ATOM   597  C C   . GLN A 1 72  ? 33.408 59.546 -5.015  1.00 20.31 ? 72  GLN A C   1 
ATOM   598  O O   . GLN A 1 72  ? 32.684 59.326 -5.993  1.00 20.18 ? 72  GLN A O   1 
ATOM   599  C CB  . GLN A 1 72  ? 32.646 61.020 -3.119  1.00 17.15 ? 72  GLN A CB  1 
ATOM   600  C CG  . GLN A 1 72  ? 31.921 61.118 -1.787  1.00 25.29 ? 72  GLN A CG  1 
ATOM   601  C CD  . GLN A 1 72  ? 30.708 60.198 -1.724  1.00 32.29 ? 72  GLN A CD  1 
ATOM   602  O OE1 . GLN A 1 72  ? 30.715 59.190 -1.017  1.00 35.89 ? 72  GLN A OE1 1 
ATOM   603  N NE2 . GLN A 1 72  ? 29.671 60.526 -2.487  1.00 33.33 ? 72  GLN A NE2 1 
ATOM   604  N N   . SER A 1 73  ? 34.722 59.729 -5.110  1.00 15.84 ? 73  SER A N   1 
ATOM   605  C CA  . SER A 1 73  ? 35.434 59.716 -6.382  1.00 12.10 ? 73  SER A CA  1 
ATOM   606  C C   . SER A 1 73  ? 35.275 58.376 -7.098  1.00 7.72  ? 73  SER A C   1 
ATOM   607  O O   . SER A 1 73  ? 34.994 58.343 -8.293  1.00 13.61 ? 73  SER A O   1 
ATOM   608  C CB  . SER A 1 73  ? 36.913 60.020 -6.152  1.00 12.94 ? 73  SER A CB  1 
ATOM   609  O OG  . SER A 1 73  ? 37.500 60.566 -7.310  1.00 22.78 ? 73  SER A OG  1 
ATOM   610  N N   . PHE A 1 74  ? 35.401 57.273 -6.369  1.00 8.83  ? 74  PHE A N   1 
ATOM   611  C CA  . PHE A 1 74  ? 35.254 55.960 -6.981  1.00 9.24  ? 74  PHE A CA  1 
ATOM   612  C C   . PHE A 1 74  ? 33.808 55.602 -7.315  1.00 15.74 ? 74  PHE A C   1 
ATOM   613  O O   . PHE A 1 74  ? 33.555 54.795 -8.220  1.00 18.13 ? 74  PHE A O   1 
ATOM   614  C CB  . PHE A 1 74  ? 35.927 54.880 -6.145  1.00 10.05 ? 74  PHE A CB  1 
ATOM   615  C CG  . PHE A 1 74  ? 37.421 54.881 -6.261  1.00 12.58 ? 74  PHE A CG  1 
ATOM   616  C CD1 . PHE A 1 74  ? 38.188 55.764 -5.518  1.00 16.66 ? 74  PHE A CD1 1 
ATOM   617  C CD2 . PHE A 1 74  ? 38.063 54.002 -7.119  1.00 17.59 ? 74  PHE A CD2 1 
ATOM   618  C CE1 . PHE A 1 74  ? 39.574 55.773 -5.624  1.00 16.70 ? 74  PHE A CE1 1 
ATOM   619  C CE2 . PHE A 1 74  ? 39.452 54.004 -7.234  1.00 18.68 ? 74  PHE A CE2 1 
ATOM   620  C CZ  . PHE A 1 74  ? 40.207 54.891 -6.484  1.00 15.92 ? 74  PHE A CZ  1 
ATOM   621  N N   . ARG A 1 75  ? 32.851 56.193 -6.601  1.00 16.38 ? 75  ARG A N   1 
ATOM   622  C CA  . ARG A 1 75  ? 31.452 55.937 -6.919  1.00 18.10 ? 75  ARG A CA  1 
ATOM   623  C C   . ARG A 1 75  ? 31.226 56.428 -8.351  1.00 13.63 ? 75  ARG A C   1 
ATOM   624  O O   . ARG A 1 75  ? 30.609 55.746 -9.173  1.00 10.08 ? 75  ARG A O   1 
ATOM   625  C CB  . ARG A 1 75  ? 30.522 56.693 -5.978  1.00 23.69 ? 75  ARG A CB  1 
ATOM   626  C CG  . ARG A 1 75  ? 30.466 56.127 -4.594  1.00 36.49 ? 75  ARG A CG  1 
ATOM   627  C CD  . ARG A 1 75  ? 29.329 56.733 -3.803  1.00 41.34 ? 75  ARG A CD  1 
ATOM   628  N NE  . ARG A 1 75  ? 29.409 56.341 -2.402  1.00 44.54 ? 75  ARG A NE  1 
ATOM   629  C CZ  . ARG A 1 75  ? 28.536 56.699 -1.470  1.00 47.53 ? 75  ARG A CZ  1 
ATOM   630  N NH1 . ARG A 1 75  ? 27.499 57.462 -1.787  1.00 49.33 ? 75  ARG A NH1 1 
ATOM   631  N NH2 . ARG A 1 75  ? 28.707 56.290 -0.219  1.00 53.27 ? 75  ARG A NH2 1 
ATOM   632  N N   . VAL A 1 76  ? 31.754 57.614 -8.631  1.00 10.34 ? 76  VAL A N   1 
ATOM   633  C CA  . VAL A 1 76  ? 31.647 58.231 -9.941  1.00 13.94 ? 76  VAL A CA  1 
ATOM   634  C C   . VAL A 1 76  ? 32.394 57.416 -10.982 1.00 15.06 ? 76  VAL A C   1 
ATOM   635  O O   . VAL A 1 76  ? 31.886 57.206 -12.080 1.00 16.09 ? 76  VAL A O   1 
ATOM   636  C CB  . VAL A 1 76  ? 32.201 59.666 -9.922  1.00 14.63 ? 76  VAL A CB  1 
ATOM   637  C CG1 . VAL A 1 76  ? 32.196 60.254 -11.322 1.00 9.54  ? 76  VAL A CG1 1 
ATOM   638  C CG2 . VAL A 1 76  ? 31.372 60.524 -8.983  1.00 8.83  ? 76  VAL A CG2 1 
ATOM   639  N N   . ASP A 1 77  ? 33.585 56.940 -10.622 1.00 15.96 ? 77  ASP A N   1 
ATOM   640  C CA  . ASP A 1 77  ? 34.412 56.138 -11.526 1.00 13.96 ? 77  ASP A CA  1 
ATOM   641  C C   . ASP A 1 77  ? 33.669 54.908 -12.019 1.00 16.43 ? 77  ASP A C   1 
ATOM   642  O O   . ASP A 1 77  ? 33.761 54.549 -13.196 1.00 22.98 ? 77  ASP A O   1 
ATOM   643  C CB  . ASP A 1 77  ? 35.710 55.682 -10.841 1.00 14.82 ? 77  ASP A CB  1 
ATOM   644  C CG  . ASP A 1 77  ? 36.737 56.796 -10.697 1.00 13.58 ? 77  ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 77  ? 36.523 57.915 -11.207 1.00 11.95 ? 77  ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 77  ? 37.785 56.542 -10.073 1.00 17.32 ? 77  ASP A OD2 1 
ATOM   647  N N   . LEU A 1 78  ? 32.948 54.245 -11.121 1.00 12.38 ? 78  LEU A N   1 
ATOM   648  C CA  . LEU A 1 78  ? 32.207 53.054 -11.509 1.00 13.18 ? 78  LEU A CA  1 
ATOM   649  C C   . LEU A 1 78  ? 31.167 53.379 -12.582 1.00 18.67 ? 78  LEU A C   1 
ATOM   650  O O   . LEU A 1 78  ? 30.969 52.595 -13.508 1.00 21.54 ? 78  LEU A O   1 
ATOM   651  C CB  . LEU A 1 78  ? 31.548 52.417 -10.292 1.00 9.47  ? 78  LEU A CB  1 
ATOM   652  C CG  . LEU A 1 78  ? 32.518 51.720 -9.344  1.00 7.51  ? 78  LEU A CG  1 
ATOM   653  C CD1 . LEU A 1 78  ? 31.840 51.466 -8.014  1.00 6.80  ? 78  LEU A CD1 1 
ATOM   654  C CD2 . LEU A 1 78  ? 33.017 50.430 -9.971  1.00 3.46  ? 78  LEU A CD2 1 
ATOM   655  N N   . ARG A 1 79  ? 30.529 54.544 -12.465 1.00 18.88 ? 79  ARG A N   1 
ATOM   656  C CA  . ARG A 1 79  ? 29.526 54.981 -13.430 1.00 20.22 ? 79  ARG A CA  1 
ATOM   657  C C   . ARG A 1 79  ? 30.228 55.291 -14.737 1.00 19.90 ? 79  ARG A C   1 
ATOM   658  O O   . ARG A 1 79  ? 29.829 54.817 -15.800 1.00 22.22 ? 79  ARG A O   1 
ATOM   659  C CB  . ARG A 1 79  ? 28.812 56.248 -12.956 1.00 23.15 ? 79  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 79  ? 27.661 56.642 -13.871 1.00 34.13 ? 79  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 79  ? 27.139 58.050 -13.601 1.00 45.46 ? 79  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 79  ? 25.797 58.244 -14.155 1.00 48.46 ? 79  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 79  ? 25.518 58.424 -15.445 1.00 49.41 ? 79  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 79  ? 26.496 58.457 -16.346 1.00 54.20 ? 79  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 79  ? 24.252 58.545 -15.834 1.00 47.79 ? 79  ARG A NH2 1 
ATOM   666  N N   . THR A 1 80  ? 31.282 56.091 -14.646 1.00 18.88 ? 80  THR A N   1 
ATOM   667  C CA  . THR A 1 80  ? 32.063 56.479 -15.807 1.00 16.92 ? 80  THR A CA  1 
ATOM   668  C C   . THR A 1 80  ? 32.512 55.257 -16.617 1.00 19.06 ? 80  THR A C   1 
ATOM   669  O O   . THR A 1 80  ? 32.308 55.203 -17.830 1.00 25.54 ? 80  THR A O   1 
ATOM   670  C CB  . THR A 1 80  ? 33.272 57.329 -15.375 1.00 15.52 ? 80  THR A CB  1 
ATOM   671  O OG1 . THR A 1 80  ? 32.805 58.458 -14.625 1.00 21.33 ? 80  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 80  ? 34.035 57.837 -16.576 1.00 18.14 ? 80  THR A CG2 1 
ATOM   673  N N   . LEU A 1 81  ? 33.028 54.235 -15.947 1.00 15.90 ? 81  LEU A N   1 
ATOM   674  C CA  . LEU A 1 81  ? 33.488 53.056 -16.662 1.00 17.21 ? 81  LEU A CA  1 
ATOM   675  C C   . LEU A 1 81  ? 32.381 52.297 -17.377 1.00 18.24 ? 81  LEU A C   1 
ATOM   676  O O   . LEU A 1 81  ? 32.642 51.594 -18.351 1.00 21.49 ? 81  LEU A O   1 
ATOM   677  C CB  . LEU A 1 81  ? 34.293 52.133 -15.746 1.00 16.14 ? 81  LEU A CB  1 
ATOM   678  C CG  . LEU A 1 81  ? 35.608 52.736 -15.254 1.00 15.95 ? 81  LEU A CG  1 
ATOM   679  C CD1 . LEU A 1 81  ? 36.340 51.720 -14.409 1.00 21.77 ? 81  LEU A CD1 1 
ATOM   680  C CD2 . LEU A 1 81  ? 36.478 53.165 -16.412 1.00 15.10 ? 81  LEU A CD2 1 
ATOM   681  N N   . LEU A 1 82  ? 31.147 52.425 -16.899 1.00 19.59 ? 82  LEU A N   1 
ATOM   682  C CA  . LEU A 1 82  ? 30.023 51.766 -17.566 1.00 20.56 ? 82  LEU A CA  1 
ATOM   683  C C   . LEU A 1 82  ? 29.862 52.425 -18.933 1.00 21.66 ? 82  LEU A C   1 
ATOM   684  O O   . LEU A 1 82  ? 29.540 51.767 -19.922 1.00 23.62 ? 82  LEU A O   1 
ATOM   685  C CB  . LEU A 1 82  ? 28.725 51.929 -16.772 1.00 15.32 ? 82  LEU A CB  1 
ATOM   686  C CG  . LEU A 1 82  ? 28.563 51.096 -15.507 1.00 14.35 ? 82  LEU A CG  1 
ATOM   687  C CD1 . LEU A 1 82  ? 27.185 51.350 -14.953 1.00 14.70 ? 82  LEU A CD1 1 
ATOM   688  C CD2 . LEU A 1 82  ? 28.744 49.622 -15.809 1.00 10.66 ? 82  LEU A CD2 1 
ATOM   689  N N   . GLY A 1 83  ? 30.085 53.735 -18.970 1.00 22.65 ? 83  GLY A N   1 
ATOM   690  C CA  . GLY A 1 83  ? 29.991 54.474 -20.213 1.00 26.37 ? 83  GLY A CA  1 
ATOM   691  C C   . GLY A 1 83  ? 31.102 54.042 -21.150 1.00 27.63 ? 83  GLY A C   1 
ATOM   692  O O   . GLY A 1 83  ? 30.834 53.575 -22.253 1.00 30.31 ? 83  GLY A O   1 
ATOM   693  N N   . TYR A 1 84  ? 32.346 54.128 -20.687 1.00 23.87 ? 84  TYR A N   1 
ATOM   694  C CA  . TYR A 1 84  ? 33.492 53.742 -21.506 1.00 22.81 ? 84  TYR A CA  1 
ATOM   695  C C   . TYR A 1 84  ? 33.321 52.356 -22.118 1.00 24.18 ? 84  TYR A C   1 
ATOM   696  O O   . TYR A 1 84  ? 33.676 52.136 -23.271 1.00 30.87 ? 84  TYR A O   1 
ATOM   697  C CB  . TYR A 1 84  ? 34.790 53.726 -20.688 1.00 19.03 ? 84  TYR A CB  1 
ATOM   698  C CG  . TYR A 1 84  ? 35.301 55.059 -20.207 1.00 13.65 ? 84  TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 84  ? 34.630 56.251 -20.493 1.00 16.79 ? 84  TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 84  ? 36.452 55.123 -19.435 1.00 10.26 ? 84  TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 84  ? 35.101 57.474 -20.012 1.00 12.41 ? 84  TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 84  ? 36.928 56.325 -18.953 1.00 14.92 ? 84  TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 84  ? 36.253 57.495 -19.240 1.00 15.65 ? 84  TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 84  ? 36.733 58.673 -18.733 1.00 16.57 ? 84  TYR A OH  1 
ATOM   705  N N   . TYR A 1 85  ? 32.824 51.412 -21.329 1.00 21.35 ? 85  TYR A N   1 
ATOM   706  C CA  . TYR A 1 85  ? 32.658 50.052 -21.814 1.00 23.55 ? 85  TYR A CA  1 
ATOM   707  C C   . TYR A 1 85  ? 31.286 49.718 -22.371 1.00 25.99 ? 85  TYR A C   1 
ATOM   708  O O   . TYR A 1 85  ? 31.057 48.593 -22.818 1.00 27.83 ? 85  TYR A O   1 
ATOM   709  C CB  . TYR A 1 85  ? 33.032 49.057 -20.720 1.00 18.28 ? 85  TYR A CB  1 
ATOM   710  C CG  . TYR A 1 85  ? 34.500 49.048 -20.422 1.00 20.29 ? 85  TYR A CG  1 
ATOM   711  C CD1 . TYR A 1 85  ? 35.385 48.350 -21.238 1.00 21.89 ? 85  TYR A CD1 1 
ATOM   712  C CD2 . TYR A 1 85  ? 35.016 49.757 -19.339 1.00 17.82 ? 85  TYR A CD2 1 
ATOM   713  C CE1 . TYR A 1 85  ? 36.755 48.355 -20.986 1.00 24.58 ? 85  TYR A CE1 1 
ATOM   714  C CE2 . TYR A 1 85  ? 36.381 49.771 -19.075 1.00 22.06 ? 85  TYR A CE2 1 
ATOM   715  C CZ  . TYR A 1 85  ? 37.246 49.067 -19.904 1.00 26.00 ? 85  TYR A CZ  1 
ATOM   716  O OH  . TYR A 1 85  ? 38.599 49.073 -19.658 1.00 23.16 ? 85  TYR A OH  1 
ATOM   717  N N   . ASN A 1 86  ? 30.375 50.682 -22.340 1.00 25.60 ? 86  ASN A N   1 
ATOM   718  C CA  . ASN A 1 86  ? 29.032 50.459 -22.845 1.00 28.93 ? 86  ASN A CA  1 
ATOM   719  C C   . ASN A 1 86  ? 28.377 49.272 -22.124 1.00 29.24 ? 86  ASN A C   1 
ATOM   720  O O   . ASN A 1 86  ? 27.810 48.384 -22.757 1.00 29.56 ? 86  ASN A O   1 
ATOM   721  C CB  . ASN A 1 86  ? 29.088 50.201 -24.349 1.00 36.05 ? 86  ASN A CB  1 
ATOM   722  C CG  . ASN A 1 86  ? 27.810 50.593 -25.056 1.00 43.71 ? 86  ASN A CG  1 
ATOM   723  O OD1 . ASN A 1 86  ? 27.635 51.751 -25.450 1.00 48.41 ? 86  ASN A OD1 1 
ATOM   724  N ND2 . ASN A 1 86  ? 26.912 49.632 -25.237 1.00 43.68 ? 86  ASN A ND2 1 
ATOM   725  N N   . GLN A 1 87  ? 28.472 49.256 -20.798 1.00 28.33 ? 87  GLN A N   1 
ATOM   726  C CA  . GLN A 1 87  ? 27.889 48.188 -19.984 1.00 30.31 ? 87  GLN A CA  1 
ATOM   727  C C   . GLN A 1 87  ? 26.566 48.632 -19.349 1.00 32.64 ? 87  GLN A C   1 
ATOM   728  O O   . GLN A 1 87  ? 26.336 49.823 -19.130 1.00 33.87 ? 87  GLN A O   1 
ATOM   729  C CB  . GLN A 1 87  ? 28.870 47.755 -18.884 1.00 24.36 ? 87  GLN A CB  1 
ATOM   730  C CG  . GLN A 1 87  ? 30.106 47.020 -19.385 1.00 22.31 ? 87  GLN A CG  1 
ATOM   731  C CD  . GLN A 1 87  ? 31.237 46.989 -18.364 1.00 18.34 ? 87  GLN A CD  1 
ATOM   732  O OE1 . GLN A 1 87  ? 31.480 47.964 -17.665 1.00 19.91 ? 87  GLN A OE1 1 
ATOM   733  N NE2 . GLN A 1 87  ? 31.928 45.870 -18.280 1.00 19.38 ? 87  GLN A NE2 1 
ATOM   734  N N   . SER A 1 88  ? 25.708 47.668 -19.031 1.00 38.78 ? 88  SER A N   1 
ATOM   735  C CA  . SER A 1 88  ? 24.416 47.961 -18.423 1.00 42.90 ? 88  SER A CA  1 
ATOM   736  C C   . SER A 1 88  ? 24.543 48.295 -16.937 1.00 46.23 ? 88  SER A C   1 
ATOM   737  O O   . SER A 1 88  ? 25.406 47.764 -16.240 1.00 47.14 ? 88  SER A O   1 
ATOM   738  C CB  . SER A 1 88  ? 23.466 46.782 -18.616 1.00 44.41 ? 88  SER A CB  1 
ATOM   739  O OG  . SER A 1 88  ? 24.003 45.605 -18.043 1.00 50.52 ? 88  SER A OG  1 
ATOM   740  N N   . LYS A 1 89  ? 23.634 49.127 -16.446 1.00 50.03 ? 89  LYS A N   1 
ATOM   741  C CA  . LYS A 1 89  ? 23.645 49.548 -15.052 1.00 52.03 ? 89  LYS A CA  1 
ATOM   742  C C   . LYS A 1 89  ? 23.397 48.468 -14.003 1.00 48.06 ? 89  LYS A C   1 
ATOM   743  O O   . LYS A 1 89  ? 23.712 48.664 -12.831 1.00 54.74 ? 89  LYS A O   1 
ATOM   744  C CB  . LYS A 1 89  ? 22.638 50.680 -14.837 1.00 57.53 ? 89  LYS A CB  1 
ATOM   745  C CG  . LYS A 1 89  ? 23.108 52.046 -15.309 1.00 66.13 ? 89  LYS A CG  1 
ATOM   746  C CD  . LYS A 1 89  ? 22.302 53.151 -14.630 1.00 71.60 ? 89  LYS A CD  1 
ATOM   747  C CE  . LYS A 1 89  ? 22.902 54.531 -14.868 1.00 72.19 ? 89  LYS A CE  1 
ATOM   748  N NZ  . LYS A 1 89  ? 22.216 55.561 -14.043 1.00 73.05 ? 89  LYS A NZ  1 
ATOM   749  N N   . GLY A 1 90  ? 22.878 47.320 -14.416 1.00 43.61 ? 90  GLY A N   1 
ATOM   750  C CA  . GLY A 1 90  ? 22.564 46.280 -13.451 1.00 40.52 ? 90  GLY A CA  1 
ATOM   751  C C   . GLY A 1 90  ? 23.636 45.341 -12.939 1.00 38.50 ? 90  GLY A C   1 
ATOM   752  O O   . GLY A 1 90  ? 23.367 44.562 -12.024 1.00 39.32 ? 90  GLY A O   1 
ATOM   753  N N   . GLY A 1 91  ? 24.843 45.406 -13.493 1.00 39.29 ? 91  GLY A N   1 
ATOM   754  C CA  . GLY A 1 91  ? 25.893 44.498 -13.054 1.00 34.52 ? 91  GLY A CA  1 
ATOM   755  C C   . GLY A 1 91  ? 26.850 45.039 -12.011 1.00 30.98 ? 91  GLY A C   1 
ATOM   756  O O   . GLY A 1 91  ? 27.013 46.252 -11.869 1.00 30.44 ? 91  GLY A O   1 
ATOM   757  N N   . SER A 1 92  ? 27.479 44.137 -11.267 1.00 23.78 ? 92  SER A N   1 
ATOM   758  C CA  . SER A 1 92  ? 28.442 44.529 -10.248 1.00 23.12 ? 92  SER A CA  1 
ATOM   759  C C   . SER A 1 92  ? 29.806 44.624 -10.926 1.00 24.92 ? 92  SER A C   1 
ATOM   760  O O   . SER A 1 92  ? 30.136 43.792 -11.778 1.00 27.53 ? 92  SER A O   1 
ATOM   761  C CB  . SER A 1 92  ? 28.479 43.489 -9.123  1.00 23.52 ? 92  SER A CB  1 
ATOM   762  O OG  . SER A 1 92  ? 29.530 43.748 -8.200  1.00 28.90 ? 92  SER A OG  1 
ATOM   763  N N   . HIS A 1 93  ? 30.579 45.653 -10.589 1.00 22.49 ? 93  HIS A N   1 
ATOM   764  C CA  . HIS A 1 93  ? 31.902 45.838 -11.182 1.00 17.04 ? 93  HIS A CA  1 
ATOM   765  C C   . HIS A 1 93  ? 32.906 46.198 -10.118 1.00 16.03 ? 93  HIS A C   1 
ATOM   766  O O   . HIS A 1 93  ? 32.530 46.712 -9.066  1.00 14.81 ? 93  HIS A O   1 
ATOM   767  C CB  . HIS A 1 93  ? 31.860 46.895 -12.276 1.00 18.23 ? 93  HIS A CB  1 
ATOM   768  C CG  . HIS A 1 93  ? 31.028 46.485 -13.445 1.00 21.95 ? 93  HIS A CG  1 
ATOM   769  N ND1 . HIS A 1 93  ? 31.451 45.545 -14.357 1.00 19.17 ? 93  HIS A ND1 1 
ATOM   770  C CD2 . HIS A 1 93  ? 29.762 46.808 -13.796 1.00 18.94 ? 93  HIS A CD2 1 
ATOM   771  C CE1 . HIS A 1 93  ? 30.480 45.297 -15.214 1.00 16.52 ? 93  HIS A CE1 1 
ATOM   772  N NE2 . HIS A 1 93  ? 29.444 46.050 -14.894 1.00 15.30 ? 93  HIS A NE2 1 
ATOM   773  N N   . THR A 1 94  ? 34.180 45.952 -10.406 1.00 17.30 ? 94  THR A N   1 
ATOM   774  C CA  . THR A 1 94  ? 35.250 46.200 -9.446  1.00 15.37 ? 94  THR A CA  1 
ATOM   775  C C   . THR A 1 94  ? 36.405 47.028 -9.968  1.00 12.94 ? 94  THR A C   1 
ATOM   776  O O   . THR A 1 94  ? 36.928 46.760 -11.049 1.00 18.54 ? 94  THR A O   1 
ATOM   777  C CB  . THR A 1 94  ? 35.865 44.867 -8.995  1.00 11.47 ? 94  THR A CB  1 
ATOM   778  O OG1 . THR A 1 94  ? 34.819 43.940 -8.688  1.00 17.60 ? 94  THR A OG1 1 
ATOM   779  C CG2 . THR A 1 94  ? 36.725 45.058 -7.776  1.00 12.94 ? 94  THR A CG2 1 
ATOM   780  N N   . ILE A 1 95  ? 36.811 48.027 -9.195  1.00 12.34 ? 95  ILE A N   1 
ATOM   781  C CA  . ILE A 1 95  ? 37.970 48.844 -9.544  1.00 13.05 ? 95  ILE A CA  1 
ATOM   782  C C   . ILE A 1 95  ? 38.985 48.557 -8.435  1.00 14.40 ? 95  ILE A C   1 
ATOM   783  O O   . ILE A 1 95  ? 38.645 48.618 -7.250  1.00 15.69 ? 95  ILE A O   1 
ATOM   784  C CB  . ILE A 1 95  ? 37.659 50.362 -9.571  1.00 11.19 ? 95  ILE A CB  1 
ATOM   785  C CG1 . ILE A 1 95  ? 36.687 50.692 -10.699 1.00 4.64  ? 95  ILE A CG1 1 
ATOM   786  C CG2 . ILE A 1 95  ? 38.959 51.171 -9.764  1.00 7.35  ? 95  ILE A CG2 1 
ATOM   787  C CD1 . ILE A 1 95  ? 36.316 52.172 -10.745 1.00 3.25  ? 95  ILE A CD1 1 
ATOM   788  N N   . GLN A 1 96  ? 40.199 48.179 -8.816  1.00 11.29 ? 96  GLN A N   1 
ATOM   789  C CA  . GLN A 1 96  ? 41.250 47.880 -7.851  1.00 9.33  ? 96  GLN A CA  1 
ATOM   790  C C   . GLN A 1 96  ? 42.422 48.777 -8.137  1.00 10.50 ? 96  GLN A C   1 
ATOM   791  O O   . GLN A 1 96  ? 42.684 49.093 -9.297  1.00 11.17 ? 96  GLN A O   1 
ATOM   792  C CB  . GLN A 1 96  ? 41.707 46.425 -7.966  1.00 12.15 ? 96  GLN A CB  1 
ATOM   793  C CG  . GLN A 1 96  ? 40.738 45.419 -7.382  1.00 7.77  ? 96  GLN A CG  1 
ATOM   794  C CD  . GLN A 1 96  ? 41.021 44.023 -7.859  1.00 11.30 ? 96  GLN A CD  1 
ATOM   795  O OE1 . GLN A 1 96  ? 40.468 43.576 -8.867  1.00 16.19 ? 96  GLN A OE1 1 
ATOM   796  N NE2 . GLN A 1 96  ? 41.877 43.315 -7.144  1.00 12.41 ? 96  GLN A NE2 1 
ATOM   797  N N   . VAL A 1 97  ? 43.098 49.217 -7.080  1.00 7.91  ? 97  VAL A N   1 
ATOM   798  C CA  . VAL A 1 97  ? 44.268 50.076 -7.211  1.00 10.53 ? 97  VAL A CA  1 
ATOM   799  C C   . VAL A 1 97  ? 45.338 49.656 -6.205  1.00 11.52 ? 97  VAL A C   1 
ATOM   800  O O   . VAL A 1 97  ? 45.018 49.217 -5.097  1.00 13.53 ? 97  VAL A O   1 
ATOM   801  C CB  . VAL A 1 97  ? 43.942 51.579 -6.939  1.00 11.29 ? 97  VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 97  ? 45.118 52.456 -7.363  1.00 7.44  ? 97  VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 97  ? 42.674 52.005 -7.654  1.00 12.21 ? 97  VAL A CG2 1 
ATOM   804  N N   . ILE A 1 98  ? 46.595 49.682 -6.638  1.00 11.43 ? 98  ILE A N   1 
ATOM   805  C CA  . ILE A 1 98  ? 47.724 49.383 -5.770  1.00 10.56 ? 98  ILE A CA  1 
ATOM   806  C C   . ILE A 1 98  ? 48.591 50.614 -5.961  1.00 11.69 ? 98  ILE A C   1 
ATOM   807  O O   . ILE A 1 98  ? 48.892 50.995 -7.088  1.00 11.52 ? 98  ILE A O   1 
ATOM   808  C CB  . ILE A 1 98  ? 48.506 48.109 -6.172  1.00 13.76 ? 98  ILE A CB  1 
ATOM   809  C CG1 . ILE A 1 98  ? 47.569 46.907 -6.228  1.00 18.84 ? 98  ILE A CG1 1 
ATOM   810  C CG2 . ILE A 1 98  ? 49.566 47.804 -5.118  1.00 12.60 ? 98  ILE A CG2 1 
ATOM   811  C CD1 . ILE A 1 98  ? 48.279 45.574 -6.319  1.00 23.42 ? 98  ILE A CD1 1 
ATOM   812  N N   . SER A 1 99  ? 48.912 51.282 -4.864  1.00 13.07 ? 99  SER A N   1 
ATOM   813  C CA  . SER A 1 99  ? 49.704 52.501 -4.903  1.00 12.28 ? 99  SER A CA  1 
ATOM   814  C C   . SER A 1 99  ? 50.791 52.371 -3.832  1.00 12.43 ? 99  SER A C   1 
ATOM   815  O O   . SER A 1 99  ? 50.556 51.750 -2.794  1.00 13.85 ? 99  SER A O   1 
ATOM   816  C CB  . SER A 1 99  ? 48.774 53.677 -4.581  1.00 11.65 ? 99  SER A CB  1 
ATOM   817  O OG  . SER A 1 99  ? 49.070 54.814 -5.358  1.00 22.52 ? 99  SER A OG  1 
ATOM   818  N N   . GLY A 1 100 ? 51.985 52.894 -4.087  1.00 10.30 ? 100 GLY A N   1 
ATOM   819  C CA  . GLY A 1 100 ? 53.027 52.788 -3.085  1.00 10.44 ? 100 GLY A CA  1 
ATOM   820  C C   . GLY A 1 100 ? 54.418 53.222 -3.493  1.00 12.62 ? 100 GLY A C   1 
ATOM   821  O O   . GLY A 1 100 ? 54.651 53.617 -4.632  1.00 14.13 ? 100 GLY A O   1 
ATOM   822  N N   . CYS A 1 101 ? 55.339 53.169 -2.538  1.00 7.95  ? 101 CYS A N   1 
ATOM   823  C CA  . CYS A 1 101 ? 56.733 53.543 -2.761  1.00 14.10 ? 101 CYS A CA  1 
ATOM   824  C C   . CYS A 1 101 ? 57.621 52.604 -1.959  1.00 11.59 ? 101 CYS A C   1 
ATOM   825  O O   . CYS A 1 101 ? 57.161 51.951 -1.021  1.00 10.69 ? 101 CYS A O   1 
ATOM   826  C CB  . CYS A 1 101 ? 56.991 54.984 -2.318  1.00 9.72  ? 101 CYS A CB  1 
ATOM   827  S SG  . CYS A 1 101 ? 56.496 55.305 -0.594  1.00 13.84 ? 101 CYS A SG  1 
ATOM   828  N N   . GLU A 1 102 ? 58.889 52.531 -2.338  1.00 12.46 ? 102 GLU A N   1 
ATOM   829  C CA  . GLU A 1 102 ? 59.843 51.670 -1.660  1.00 12.57 ? 102 GLU A CA  1 
ATOM   830  C C   . GLU A 1 102 ? 61.130 52.431 -1.472  1.00 14.15 ? 102 GLU A C   1 
ATOM   831  O O   . GLU A 1 102 ? 61.573 53.125 -2.385  1.00 13.97 ? 102 GLU A O   1 
ATOM   832  C CB  . GLU A 1 102 ? 60.139 50.430 -2.495  1.00 12.43 ? 102 GLU A CB  1 
ATOM   833  C CG  . GLU A 1 102 ? 58.919 49.647 -2.875  1.00 26.14 ? 102 GLU A CG  1 
ATOM   834  C CD  . GLU A 1 102 ? 59.241 48.371 -3.609  1.00 31.81 ? 102 GLU A CD  1 
ATOM   835  O OE1 . GLU A 1 102 ? 60.423 48.146 -3.950  1.00 36.10 ? 102 GLU A OE1 1 
ATOM   836  O OE2 . GLU A 1 102 ? 58.299 47.589 -3.855  1.00 35.50 ? 102 GLU A OE2 1 
ATOM   837  N N   . VAL A 1 103 ? 61.721 52.307 -0.289  1.00 11.23 ? 103 VAL A N   1 
ATOM   838  C CA  . VAL A 1 103 ? 62.983 52.963 0.024   1.00 12.48 ? 103 VAL A CA  1 
ATOM   839  C C   . VAL A 1 103 ? 64.058 51.929 0.367   1.00 15.32 ? 103 VAL A C   1 
ATOM   840  O O   . VAL A 1 103 ? 63.755 50.832 0.852   1.00 14.85 ? 103 VAL A O   1 
ATOM   841  C CB  . VAL A 1 103 ? 62.841 53.915 1.225   1.00 13.23 ? 103 VAL A CB  1 
ATOM   842  C CG1 . VAL A 1 103 ? 61.858 55.035 0.897   1.00 16.15 ? 103 VAL A CG1 1 
ATOM   843  C CG2 . VAL A 1 103 ? 62.404 53.140 2.468   1.00 7.95  ? 103 VAL A CG2 1 
ATOM   844  N N   . GLY A 1 104 ? 65.312 52.262 0.088   1.00 13.89 ? 104 GLY A N   1 
ATOM   845  C CA  . GLY A 1 104 ? 66.387 51.352 0.427   1.00 13.18 ? 104 GLY A CA  1 
ATOM   846  C C   . GLY A 1 104 ? 66.635 51.450 1.923   1.00 18.42 ? 104 GLY A C   1 
ATOM   847  O O   . GLY A 1 104 ? 65.924 52.179 2.624   1.00 18.29 ? 104 GLY A O   1 
ATOM   848  N N   . SER A 1 105 ? 67.667 50.767 2.409   1.00 20.67 ? 105 SER A N   1 
ATOM   849  C CA  . SER A 1 105 ? 68.012 50.779 3.833   1.00 21.91 ? 105 SER A CA  1 
ATOM   850  C C   . SER A 1 105 ? 68.384 52.164 4.373   1.00 23.30 ? 105 SER A C   1 
ATOM   851  O O   . SER A 1 105 ? 68.276 52.421 5.573   1.00 25.18 ? 105 SER A O   1 
ATOM   852  C CB  . SER A 1 105 ? 69.159 49.811 4.094   1.00 24.83 ? 105 SER A CB  1 
ATOM   853  O OG  . SER A 1 105 ? 68.870 48.537 3.541   1.00 32.32 ? 105 SER A OG  1 
ATOM   854  N N   . ASP A 1 106 ? 68.842 53.044 3.490   1.00 21.07 ? 106 ASP A N   1 
ATOM   855  C CA  . ASP A 1 106 ? 69.229 54.393 3.872   1.00 16.15 ? 106 ASP A CA  1 
ATOM   856  C C   . ASP A 1 106 ? 68.066 55.377 3.764   1.00 17.86 ? 106 ASP A C   1 
ATOM   857  O O   . ASP A 1 106 ? 68.257 56.587 3.918   1.00 17.06 ? 106 ASP A O   1 
ATOM   858  C CB  . ASP A 1 106 ? 70.385 54.867 3.000   1.00 22.31 ? 106 ASP A CB  1 
ATOM   859  C CG  . ASP A 1 106 ? 70.048 54.849 1.519   1.00 25.84 ? 106 ASP A CG  1 
ATOM   860  O OD1 . ASP A 1 106 ? 68.951 54.372 1.141   1.00 29.50 ? 106 ASP A OD1 1 
ATOM   861  O OD2 . ASP A 1 106 ? 70.890 55.309 0.724   1.00 29.97 ? 106 ASP A OD2 1 
ATOM   862  N N   . GLY A 1 107 ? 66.883 54.867 3.427   1.00 16.35 ? 107 GLY A N   1 
ATOM   863  C CA  . GLY A 1 107 ? 65.699 55.709 3.332   1.00 15.66 ? 107 GLY A CA  1 
ATOM   864  C C   . GLY A 1 107 ? 65.457 56.479 2.044   1.00 19.79 ? 107 GLY A C   1 
ATOM   865  O O   . GLY A 1 107 ? 64.581 57.352 2.003   1.00 21.81 ? 107 GLY A O   1 
ATOM   866  N N   . ARG A 1 108 ? 66.234 56.204 1.003   1.00 18.34 ? 108 ARG A N   1 
ATOM   867  C CA  . ARG A 1 108 ? 66.046 56.898 -0.269  1.00 21.14 ? 108 ARG A CA  1 
ATOM   868  C C   . ARG A 1 108 ? 65.105 56.092 -1.176  1.00 20.97 ? 108 ARG A C   1 
ATOM   869  O O   . ARG A 1 108 ? 65.058 54.861 -1.107  1.00 21.64 ? 108 ARG A O   1 
ATOM   870  C CB  . ARG A 1 108 ? 67.396 57.166 -0.943  1.00 24.29 ? 108 ARG A CB  1 
ATOM   871  C CG  . ARG A 1 108 ? 68.269 58.172 -0.187  1.00 30.38 ? 108 ARG A CG  1 
ATOM   872  C CD  . ARG A 1 108 ? 69.702 58.256 -0.730  1.00 35.27 ? 108 ARG A CD  1 
ATOM   873  N NE  . ARG A 1 108 ? 69.811 58.966 -2.009  1.00 45.71 ? 108 ARG A NE  1 
ATOM   874  C CZ  . ARG A 1 108 ? 69.724 60.291 -2.159  1.00 48.53 ? 108 ARG A CZ  1 
ATOM   875  N NH1 . ARG A 1 108 ? 69.518 61.077 -1.110  1.00 50.05 ? 108 ARG A NH1 1 
ATOM   876  N NH2 . ARG A 1 108 ? 69.869 60.838 -3.362  1.00 50.41 ? 108 ARG A NH2 1 
ATOM   877  N N   . LEU A 1 109 ? 64.315 56.794 -1.982  1.00 19.53 ? 109 LEU A N   1 
ATOM   878  C CA  . LEU A 1 109 ? 63.360 56.149 -2.879  1.00 16.57 ? 109 LEU A CA  1 
ATOM   879  C C   . LEU A 1 109 ? 64.030 55.213 -3.878  1.00 13.88 ? 109 LEU A C   1 
ATOM   880  O O   . LEU A 1 109 ? 65.039 55.551 -4.479  1.00 16.25 ? 109 LEU A O   1 
ATOM   881  C CB  . LEU A 1 109 ? 62.547 57.213 -3.638  1.00 14.38 ? 109 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 109 ? 61.519 56.774 -4.694  1.00 14.15 ? 109 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 109 ? 60.248 56.254 -4.046  1.00 9.34  ? 109 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 109 ? 61.184 57.946 -5.582  1.00 10.94 ? 109 LEU A CD2 1 
ATOM   885  N N   . LEU A 1 110 ? 63.492 54.012 -3.999  1.00 11.77 ? 110 LEU A N   1 
ATOM   886  C CA  . LEU A 1 110 ? 63.987 53.045 -4.958  1.00 16.21 ? 110 LEU A CA  1 
ATOM   887  C C   . LEU A 1 110 ? 63.014 53.111 -6.129  1.00 19.91 ? 110 LEU A C   1 
ATOM   888  O O   . LEU A 1 110 ? 63.424 53.243 -7.280  1.00 27.29 ? 110 LEU A O   1 
ATOM   889  C CB  . LEU A 1 110 ? 63.982 51.640 -4.373  1.00 18.75 ? 110 LEU A CB  1 
ATOM   890  C CG  . LEU A 1 110 ? 65.009 51.292 -3.306  1.00 21.47 ? 110 LEU A CG  1 
ATOM   891  C CD1 . LEU A 1 110 ? 64.765 49.870 -2.843  1.00 22.89 ? 110 LEU A CD1 1 
ATOM   892  C CD2 . LEU A 1 110 ? 66.409 51.430 -3.872  1.00 23.05 ? 110 LEU A CD2 1 
ATOM   893  N N   . ARG A 1 111 ? 61.718 53.053 -5.827  1.00 20.80 ? 111 ARG A N   1 
ATOM   894  C CA  . ARG A 1 111 ? 60.692 53.115 -6.862  1.00 23.61 ? 111 ARG A CA  1 
ATOM   895  C C   . ARG A 1 111 ? 59.314 53.450 -6.306  1.00 20.55 ? 111 ARG A C   1 
ATOM   896  O O   . ARG A 1 111 ? 59.031 53.231 -5.129  1.00 21.43 ? 111 ARG A O   1 
ATOM   897  C CB  . ARG A 1 111 ? 60.618 51.792 -7.621  1.00 26.93 ? 111 ARG A CB  1 
ATOM   898  C CG  . ARG A 1 111 ? 60.106 50.653 -6.791  1.00 31.23 ? 111 ARG A CG  1 
ATOM   899  C CD  . ARG A 1 111 ? 59.992 49.395 -7.599  1.00 37.37 ? 111 ARG A CD  1 
ATOM   900  N NE  . ARG A 1 111 ? 59.325 48.361 -6.816  1.00 51.01 ? 111 ARG A NE  1 
ATOM   901  C CZ  . ARG A 1 111 ? 58.172 47.787 -7.149  1.00 54.95 ? 111 ARG A CZ  1 
ATOM   902  N NH1 . ARG A 1 111 ? 57.543 48.143 -8.268  1.00 55.61 ? 111 ARG A NH1 1 
ATOM   903  N NH2 . ARG A 1 111 ? 57.631 46.882 -6.341  1.00 57.06 ? 111 ARG A NH2 1 
ATOM   904  N N   . GLY A 1 112 ? 58.469 53.997 -7.167  1.00 17.98 ? 112 GLY A N   1 
ATOM   905  C CA  . GLY A 1 112 ? 57.115 54.354 -6.787  1.00 16.93 ? 112 GLY A CA  1 
ATOM   906  C C   . GLY A 1 112 ? 56.225 53.708 -7.831  1.00 19.83 ? 112 GLY A C   1 
ATOM   907  O O   . GLY A 1 112 ? 56.689 53.428 -8.938  1.00 21.72 ? 112 GLY A O   1 
ATOM   908  N N   . TYR A 1 113 ? 54.972 53.435 -7.493  1.00 16.23 ? 113 TYR A N   1 
ATOM   909  C CA  . TYR A 1 113 ? 54.065 52.816 -8.444  1.00 13.96 ? 113 TYR A CA  1 
ATOM   910  C C   . TYR A 1 113 ? 52.592 53.065 -8.177  1.00 17.87 ? 113 TYR A C   1 
ATOM   911  O O   . TYR A 1 113 ? 52.202 53.463 -7.077  1.00 18.27 ? 113 TYR A O   1 
ATOM   912  C CB  . TYR A 1 113 ? 54.327 51.312 -8.531  1.00 18.37 ? 113 TYR A CB  1 
ATOM   913  C CG  . TYR A 1 113 ? 54.605 50.634 -7.209  1.00 21.80 ? 113 TYR A CG  1 
ATOM   914  C CD1 . TYR A 1 113 ? 53.570 50.112 -6.433  1.00 19.57 ? 113 TYR A CD1 1 
ATOM   915  C CD2 . TYR A 1 113 ? 55.914 50.484 -6.751  1.00 20.99 ? 113 TYR A CD2 1 
ATOM   916  C CE1 . TYR A 1 113 ? 53.838 49.455 -5.237  1.00 23.85 ? 113 TYR A CE1 1 
ATOM   917  C CE2 . TYR A 1 113 ? 56.189 49.833 -5.569  1.00 20.35 ? 113 TYR A CE2 1 
ATOM   918  C CZ  . TYR A 1 113 ? 55.155 49.315 -4.815  1.00 24.80 ? 113 TYR A CZ  1 
ATOM   919  O OH  . TYR A 1 113 ? 55.447 48.616 -3.664  1.00 29.58 ? 113 TYR A OH  1 
ATOM   920  N N   . GLN A 1 114 ? 51.788 52.866 -9.215  1.00 12.42 ? 114 GLN A N   1 
ATOM   921  C CA  . GLN A 1 114 ? 50.345 53.017 -9.140  1.00 15.52 ? 114 GLN A CA  1 
ATOM   922  C C   . GLN A 1 114 ? 49.743 52.287 -10.322 1.00 11.68 ? 114 GLN A C   1 
ATOM   923  O O   . GLN A 1 114 ? 50.058 52.589 -11.472 1.00 15.25 ? 114 GLN A O   1 
ATOM   924  C CB  . GLN A 1 114 ? 49.892 54.480 -9.145  1.00 13.09 ? 114 GLN A CB  1 
ATOM   925  C CG  . GLN A 1 114 ? 48.385 54.561 -8.933  1.00 18.51 ? 114 GLN A CG  1 
ATOM   926  C CD  . GLN A 1 114 ? 47.877 55.939 -8.593  1.00 22.21 ? 114 GLN A CD  1 
ATOM   927  O OE1 . GLN A 1 114 ? 47.587 56.233 -7.431  1.00 20.56 ? 114 GLN A OE1 1 
ATOM   928  N NE2 . GLN A 1 114 ? 47.704 56.775 -9.610  1.00 20.53 ? 114 GLN A NE2 1 
ATOM   929  N N   . GLN A 1 115 ? 48.857 51.346 -10.030 1.00 15.01 ? 115 GLN A N   1 
ATOM   930  C CA  . GLN A 1 115 ? 48.226 50.530 -11.054 1.00 16.68 ? 115 GLN A CA  1 
ATOM   931  C C   . GLN A 1 115 ? 46.746 50.309 -10.787 1.00 15.20 ? 115 GLN A C   1 
ATOM   932  O O   . GLN A 1 115 ? 46.349 50.006 -9.665  1.00 18.23 ? 115 GLN A O   1 
ATOM   933  C CB  . GLN A 1 115 ? 48.945 49.183 -11.116 1.00 22.63 ? 115 GLN A CB  1 
ATOM   934  C CG  . GLN A 1 115 ? 50.378 49.307 -11.582 1.00 33.46 ? 115 GLN A CG  1 
ATOM   935  C CD  . GLN A 1 115 ? 51.259 48.158 -11.153 1.00 40.02 ? 115 GLN A CD  1 
ATOM   936  O OE1 . GLN A 1 115 ? 52.483 48.300 -11.096 1.00 43.35 ? 115 GLN A OE1 1 
ATOM   937  N NE2 . GLN A 1 115 ? 50.653 47.012 -10.853 1.00 42.20 ? 115 GLN A NE2 1 
ATOM   938  N N   . TYR A 1 116 ? 45.941 50.466 -11.831 1.00 17.45 ? 116 TYR A N   1 
ATOM   939  C CA  . TYR A 1 116 ? 44.497 50.286 -11.758 1.00 13.16 ? 116 TYR A CA  1 
ATOM   940  C C   . TYR A 1 116 ? 44.071 49.043 -12.541 1.00 13.75 ? 116 TYR A C   1 
ATOM   941  O O   . TYR A 1 116 ? 44.733 48.639 -13.502 1.00 16.36 ? 116 TYR A O   1 
ATOM   942  C CB  . TYR A 1 116 ? 43.782 51.491 -12.380 1.00 12.48 ? 116 TYR A CB  1 
ATOM   943  C CG  . TYR A 1 116 ? 43.711 52.746 -11.542 1.00 10.48 ? 116 TYR A CG  1 
ATOM   944  C CD1 . TYR A 1 116 ? 44.808 53.597 -11.413 1.00 15.38 ? 116 TYR A CD1 1 
ATOM   945  C CD2 . TYR A 1 116 ? 42.511 53.135 -10.956 1.00 12.66 ? 116 TYR A CD2 1 
ATOM   946  C CE1 . TYR A 1 116 ? 44.700 54.820 -10.723 1.00 16.19 ? 116 TYR A CE1 1 
ATOM   947  C CE2 . TYR A 1 116 ? 42.391 54.347 -10.266 1.00 13.54 ? 116 TYR A CE2 1 
ATOM   948  C CZ  . TYR A 1 116 ? 43.485 55.187 -10.158 1.00 17.23 ? 116 TYR A CZ  1 
ATOM   949  O OH  . TYR A 1 116 ? 43.339 56.404 -9.524  1.00 20.25 ? 116 TYR A OH  1 
ATOM   950  N N   . ALA A 1 117 ? 42.940 48.467 -12.148 1.00 12.62 ? 117 ALA A N   1 
ATOM   951  C CA  . ALA A 1 117 ? 42.372 47.306 -12.823 1.00 10.45 ? 117 ALA A CA  1 
ATOM   952  C C   . ALA A 1 117 ? 40.863 47.463 -12.790 1.00 13.59 ? 117 ALA A C   1 
ATOM   953  O O   . ALA A 1 117 ? 40.310 48.085 -11.875 1.00 16.00 ? 117 ALA A O   1 
ATOM   954  C CB  . ALA A 1 117 ? 42.766 46.021 -12.134 1.00 2.42  ? 117 ALA A CB  1 
ATOM   955  N N   . TYR A 1 118 ? 40.200 46.934 -13.807 1.00 15.87 ? 118 TYR A N   1 
ATOM   956  C CA  . TYR A 1 118 ? 38.755 46.995 -13.884 1.00 11.83 ? 118 TYR A CA  1 
ATOM   957  C C   . TYR A 1 118 ? 38.306 45.568 -14.141 1.00 11.66 ? 118 TYR A C   1 
ATOM   958  O O   . TYR A 1 118 ? 38.794 44.913 -15.052 1.00 14.37 ? 118 TYR A O   1 
ATOM   959  C CB  . TYR A 1 118 ? 38.318 47.918 -15.012 1.00 15.11 ? 118 TYR A CB  1 
ATOM   960  C CG  . TYR A 1 118 ? 36.822 48.090 -15.081 1.00 19.93 ? 118 TYR A CG  1 
ATOM   961  C CD1 . TYR A 1 118 ? 36.092 48.434 -13.943 1.00 19.12 ? 118 TYR A CD1 1 
ATOM   962  C CD2 . TYR A 1 118 ? 36.127 47.883 -16.274 1.00 17.67 ? 118 TYR A CD2 1 
ATOM   963  C CE1 . TYR A 1 118 ? 34.712 48.566 -13.990 1.00 19.32 ? 118 TYR A CE1 1 
ATOM   964  C CE2 . TYR A 1 118 ? 34.744 48.012 -16.327 1.00 17.53 ? 118 TYR A CE2 1 
ATOM   965  C CZ  . TYR A 1 118 ? 34.047 48.349 -15.182 1.00 17.68 ? 118 TYR A CZ  1 
ATOM   966  O OH  . TYR A 1 118 ? 32.683 48.437 -15.212 1.00 22.02 ? 118 TYR A OH  1 
ATOM   967  N N   . ASP A 1 119 ? 37.457 45.056 -13.265 1.00 14.05 ? 119 ASP A N   1 
ATOM   968  C CA  . ASP A 1 119 ? 36.962 43.693 -13.372 1.00 15.90 ? 119 ASP A CA  1 
ATOM   969  C C   . ASP A 1 119 ? 38.058 42.629 -13.477 1.00 17.93 ? 119 ASP A C   1 
ATOM   970  O O   . ASP A 1 119 ? 37.892 41.609 -14.151 1.00 18.35 ? 119 ASP A O   1 
ATOM   971  C CB  . ASP A 1 119 ? 35.951 43.574 -14.515 1.00 16.21 ? 119 ASP A CB  1 
ATOM   972  C CG  . ASP A 1 119 ? 34.647 44.298 -14.218 1.00 20.00 ? 119 ASP A CG  1 
ATOM   973  O OD1 . ASP A 1 119 ? 34.318 44.499 -13.029 1.00 22.63 ? 119 ASP A OD1 1 
ATOM   974  O OD2 . ASP A 1 119 ? 33.933 44.666 -15.171 1.00 23.37 ? 119 ASP A OD2 1 
ATOM   975  N N   . GLY A 1 120 ? 39.159 42.847 -12.762 1.00 18.05 ? 120 GLY A N   1 
ATOM   976  C CA  . GLY A 1 120 ? 40.247 41.885 -12.756 1.00 16.16 ? 120 GLY A CA  1 
ATOM   977  C C   . GLY A 1 120 ? 41.266 42.003 -13.866 1.00 15.53 ? 120 GLY A C   1 
ATOM   978  O O   . GLY A 1 120 ? 42.184 41.193 -13.943 1.00 21.14 ? 120 GLY A O   1 
ATOM   979  N N   . CYS A 1 121 ? 41.132 43.008 -14.718 1.00 19.35 ? 121 CYS A N   1 
ATOM   980  C CA  . CYS A 1 121 ? 42.076 43.189 -15.817 1.00 20.96 ? 121 CYS A CA  1 
ATOM   981  C C   . CYS A 1 121 ? 42.762 44.548 -15.735 1.00 17.70 ? 121 CYS A C   1 
ATOM   982  O O   . CYS A 1 121 ? 42.175 45.520 -15.257 1.00 17.49 ? 121 CYS A O   1 
ATOM   983  C CB  . CYS A 1 121 ? 41.366 43.016 -17.170 1.00 24.96 ? 121 CYS A CB  1 
ATOM   984  S SG  . CYS A 1 121 ? 40.793 41.317 -17.503 1.00 28.10 ? 121 CYS A SG  1 
ATOM   985  N N   . ASP A 1 122 ? 44.024 44.591 -16.144 1.00 14.25 ? 122 ASP A N   1 
ATOM   986  C CA  . ASP A 1 122 ? 44.809 45.815 -16.127 1.00 13.85 ? 122 ASP A CA  1 
ATOM   987  C C   . ASP A 1 122 ? 44.032 46.896 -16.841 1.00 11.76 ? 122 ASP A C   1 
ATOM   988  O O   . ASP A 1 122 ? 43.307 46.613 -17.792 1.00 11.32 ? 122 ASP A O   1 
ATOM   989  C CB  . ASP A 1 122 ? 46.146 45.609 -16.839 1.00 16.59 ? 122 ASP A CB  1 
ATOM   990  C CG  . ASP A 1 122 ? 47.060 44.636 -16.113 1.00 22.25 ? 122 ASP A CG  1 
ATOM   991  O OD1 . ASP A 1 122 ? 46.608 43.946 -15.189 1.00 26.89 ? 122 ASP A OD1 1 
ATOM   992  O OD2 . ASP A 1 122 ? 48.249 44.547 -16.473 1.00 28.25 ? 122 ASP A OD2 1 
ATOM   993  N N   . TYR A 1 123 ? 44.187 48.129 -16.377 1.00 10.60 ? 123 TYR A N   1 
ATOM   994  C CA  . TYR A 1 123 ? 43.491 49.262 -16.957 1.00 8.06  ? 123 TYR A CA  1 
ATOM   995  C C   . TYR A 1 123 ? 44.509 50.325 -17.343 1.00 11.80 ? 123 TYR A C   1 
ATOM   996  O O   . TYR A 1 123 ? 44.715 50.593 -18.528 1.00 19.58 ? 123 TYR A O   1 
ATOM   997  C CB  . TYR A 1 123 ? 42.455 49.817 -15.964 1.00 5.90  ? 123 TYR A CB  1 
ATOM   998  C CG  . TYR A 1 123 ? 41.604 50.935 -16.519 1.00 4.70  ? 123 TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 123 ? 40.569 50.669 -17.417 1.00 4.77  ? 123 TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 123 ? 41.860 52.266 -16.183 1.00 2.91  ? 123 TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 123 ? 39.811 51.704 -17.974 1.00 3.81  ? 123 TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 123 ? 41.113 53.307 -16.731 1.00 8.76  ? 123 TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 123 ? 40.087 53.017 -17.630 1.00 9.81  ? 123 TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 123 ? 39.340 54.040 -18.182 1.00 11.89 ? 123 TYR A OH  1 
ATOM   1005 N N   . ILE A 1 124 ? 45.167 50.911 -16.353 1.00 8.80  ? 124 ILE A N   1 
ATOM   1006 C CA  . ILE A 1 124 ? 46.167 51.934 -16.609 1.00 7.27  ? 124 ILE A CA  1 
ATOM   1007 C C   . ILE A 1 124 ? 47.232 51.835 -15.517 1.00 10.09 ? 124 ILE A C   1 
ATOM   1008 O O   . ILE A 1 124 ? 46.938 51.452 -14.390 1.00 12.61 ? 124 ILE A O   1 
ATOM   1009 C CB  . ILE A 1 124 ? 45.525 53.344 -16.656 1.00 8.93  ? 124 ILE A CB  1 
ATOM   1010 C CG1 . ILE A 1 124 ? 46.460 54.343 -17.345 1.00 7.22  ? 124 ILE A CG1 1 
ATOM   1011 C CG2 . ILE A 1 124 ? 45.165 53.812 -15.260 1.00 14.11 ? 124 ILE A CG2 1 
ATOM   1012 C CD1 . ILE A 1 124 ? 45.782 55.663 -17.685 1.00 7.77  ? 124 ILE A CD1 1 
ATOM   1013 N N   . ALA A 1 125 ? 48.476 52.132 -15.863 1.00 11.18 ? 125 ALA A N   1 
ATOM   1014 C CA  . ALA A 1 125 ? 49.549 52.042 -14.897 1.00 8.90  ? 125 ALA A CA  1 
ATOM   1015 C C   . ALA A 1 125 ? 50.570 53.133 -15.135 1.00 10.50 ? 125 ALA A C   1 
ATOM   1016 O O   . ALA A 1 125 ? 50.757 53.578 -16.268 1.00 11.92 ? 125 ALA A O   1 
ATOM   1017 C CB  . ALA A 1 125 ? 50.207 50.689 -15.000 1.00 7.17  ? 125 ALA A CB  1 
ATOM   1018 N N   . LEU A 1 126 ? 51.185 53.606 -14.057 1.00 13.78 ? 126 LEU A N   1 
ATOM   1019 C CA  . LEU A 1 126 ? 52.213 54.630 -14.159 1.00 11.73 ? 126 LEU A CA  1 
ATOM   1020 C C   . LEU A 1 126 ? 53.465 53.877 -14.580 1.00 16.71 ? 126 LEU A C   1 
ATOM   1021 O O   . LEU A 1 126 ? 53.713 52.770 -14.096 1.00 16.25 ? 126 LEU A O   1 
ATOM   1022 C CB  . LEU A 1 126 ? 52.442 55.291 -12.802 1.00 7.27  ? 126 LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 126 ? 53.501 56.391 -12.721 1.00 7.56  ? 126 LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 126 ? 53.059 57.644 -13.467 1.00 4.86  ? 126 LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 126 ? 53.760 56.715 -11.268 1.00 10.44 ? 126 LEU A CD2 1 
ATOM   1026 N N   . ASN A 1 127 ? 54.226 54.440 -15.509 1.00 21.04 ? 127 ASN A N   1 
ATOM   1027 C CA  . ASN A 1 127 ? 55.445 53.790 -15.963 1.00 24.07 ? 127 ASN A CA  1 
ATOM   1028 C C   . ASN A 1 127 ? 56.584 54.051 -14.987 1.00 26.98 ? 127 ASN A C   1 
ATOM   1029 O O   . ASN A 1 127 ? 56.529 54.991 -14.186 1.00 27.33 ? 127 ASN A O   1 
ATOM   1030 C CB  . ASN A 1 127 ? 55.825 54.264 -17.364 1.00 27.28 ? 127 ASN A CB  1 
ATOM   1031 C CG  . ASN A 1 127 ? 54.895 53.730 -18.435 1.00 24.34 ? 127 ASN A CG  1 
ATOM   1032 O OD1 . ASN A 1 127 ? 54.484 52.573 -18.401 1.00 25.19 ? 127 ASN A OD1 1 
ATOM   1033 N ND2 . ASN A 1 127 ? 54.565 54.573 -19.400 1.00 26.43 ? 127 ASN A ND2 1 
ATOM   1034 N N   . GLU A 1 128 ? 57.616 53.220 -15.063 1.00 27.19 ? 128 GLU A N   1 
ATOM   1035 C CA  . GLU A 1 128 ? 58.777 53.327 -14.189 1.00 30.80 ? 128 GLU A CA  1 
ATOM   1036 C C   . GLU A 1 128 ? 59.392 54.721 -14.164 1.00 29.18 ? 128 GLU A C   1 
ATOM   1037 O O   . GLU A 1 128 ? 60.017 55.098 -13.181 1.00 33.14 ? 128 GLU A O   1 
ATOM   1038 C CB  . GLU A 1 128 ? 59.854 52.309 -14.588 1.00 39.47 ? 128 GLU A CB  1 
ATOM   1039 C CG  . GLU A 1 128 ? 59.431 50.836 -14.532 1.00 52.24 ? 128 GLU A CG  1 
ATOM   1040 C CD  . GLU A 1 128 ? 58.560 50.391 -15.711 1.00 59.77 ? 128 GLU A CD  1 
ATOM   1041 O OE1 . GLU A 1 128 ? 58.491 51.112 -16.734 1.00 62.68 ? 128 GLU A OE1 1 
ATOM   1042 O OE2 . GLU A 1 128 ? 57.942 49.308 -15.613 1.00 63.48 ? 128 GLU A OE2 1 
ATOM   1043 N N   . ASP A 1 129 ? 59.198 55.496 -15.226 1.00 27.30 ? 129 ASP A N   1 
ATOM   1044 C CA  . ASP A 1 129 ? 59.762 56.842 -15.303 1.00 24.36 ? 129 ASP A CA  1 
ATOM   1045 C C   . ASP A 1 129 ? 59.018 57.861 -14.445 1.00 24.32 ? 129 ASP A C   1 
ATOM   1046 O O   . ASP A 1 129 ? 59.442 59.018 -14.339 1.00 24.60 ? 129 ASP A O   1 
ATOM   1047 C CB  . ASP A 1 129 ? 59.804 57.314 -16.762 1.00 29.52 ? 129 ASP A CB  1 
ATOM   1048 C CG  . ASP A 1 129 ? 58.441 57.737 -17.298 1.00 34.79 ? 129 ASP A CG  1 
ATOM   1049 O OD1 . ASP A 1 129 ? 57.399 57.194 -16.872 1.00 31.26 ? 129 ASP A OD1 1 
ATOM   1050 O OD2 . ASP A 1 129 ? 58.412 58.643 -18.151 1.00 42.93 ? 129 ASP A OD2 1 
ATOM   1051 N N   . LEU A 1 130 ? 57.889 57.430 -13.883 1.00 24.58 ? 130 LEU A N   1 
ATOM   1052 C CA  . LEU A 1 130 ? 57.027 58.248 -13.028 1.00 22.92 ? 130 LEU A CA  1 
ATOM   1053 C C   . LEU A 1 130 ? 56.529 59.511 -13.724 1.00 24.40 ? 130 LEU A C   1 
ATOM   1054 O O   . LEU A 1 130 ? 56.139 60.487 -13.066 1.00 25.75 ? 130 LEU A O   1 
ATOM   1055 C CB  . LEU A 1 130 ? 57.731 58.617 -11.712 1.00 24.47 ? 130 LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 130 ? 58.313 57.522 -10.810 1.00 22.25 ? 130 LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 130 ? 58.801 58.180 -9.544  1.00 25.45 ? 130 LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 130 ? 57.290 56.451 -10.473 1.00 22.57 ? 130 LEU A CD2 1 
ATOM   1059 N N   . LYS A 1 131 ? 56.533 59.494 -15.053 1.00 23.20 ? 131 LYS A N   1 
ATOM   1060 C CA  . LYS A 1 131 ? 56.083 60.651 -15.815 1.00 27.10 ? 131 LYS A CA  1 
ATOM   1061 C C   . LYS A 1 131 ? 55.026 60.311 -16.852 1.00 26.80 ? 131 LYS A C   1 
ATOM   1062 O O   . LYS A 1 131 ? 54.298 61.202 -17.291 1.00 26.75 ? 131 LYS A O   1 
ATOM   1063 C CB  . LYS A 1 131 ? 57.257 61.324 -16.529 1.00 33.34 ? 131 LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 131 ? 58.337 61.883 -15.620 1.00 43.21 ? 131 LYS A CG  1 
ATOM   1065 C CD  . LYS A 1 131 ? 59.464 62.517 -16.434 1.00 50.64 ? 131 LYS A CD  1 
ATOM   1066 C CE  . LYS A 1 131 ? 60.052 61.523 -17.433 1.00 58.01 ? 131 LYS A CE  1 
ATOM   1067 N NZ  . LYS A 1 131 ? 60.634 60.325 -16.757 1.00 66.21 ? 131 LYS A NZ  1 
ATOM   1068 N N   . THR A 1 132 ? 54.955 59.044 -17.262 1.00 19.84 ? 132 THR A N   1 
ATOM   1069 C CA  . THR A 1 132 ? 53.994 58.634 -18.282 1.00 19.36 ? 132 THR A CA  1 
ATOM   1070 C C   . THR A 1 132 ? 53.113 57.461 -17.875 1.00 20.59 ? 132 THR A C   1 
ATOM   1071 O O   . THR A 1 132 ? 53.457 56.693 -16.973 1.00 22.63 ? 132 THR A O   1 
ATOM   1072 C CB  . THR A 1 132 ? 54.707 58.290 -19.621 1.00 20.25 ? 132 THR A CB  1 
ATOM   1073 O OG1 . THR A 1 132 ? 55.636 57.215 -19.426 1.00 15.86 ? 132 THR A OG1 1 
ATOM   1074 C CG2 . THR A 1 132 ? 55.458 59.498 -20.141 1.00 20.07 ? 132 THR A CG2 1 
ATOM   1075 N N   . TRP A 1 133 ? 51.980 57.323 -18.556 1.00 19.53 ? 133 TRP A N   1 
ATOM   1076 C CA  . TRP A 1 133 ? 51.024 56.255 -18.284 1.00 15.35 ? 133 TRP A CA  1 
ATOM   1077 C C   . TRP A 1 133 ? 51.008 55.257 -19.432 1.00 18.01 ? 133 TRP A C   1 
ATOM   1078 O O   . TRP A 1 133 ? 51.423 55.577 -20.543 1.00 18.12 ? 133 TRP A O   1 
ATOM   1079 C CB  . TRP A 1 133 ? 49.622 56.843 -18.140 1.00 13.21 ? 133 TRP A CB  1 
ATOM   1080 C CG  . TRP A 1 133 ? 49.550 58.001 -17.193 1.00 16.36 ? 133 TRP A CG  1 
ATOM   1081 C CD1 . TRP A 1 133 ? 49.653 59.321 -17.508 1.00 13.32 ? 133 TRP A CD1 1 
ATOM   1082 C CD2 . TRP A 1 133 ? 49.413 57.936 -15.766 1.00 15.92 ? 133 TRP A CD2 1 
ATOM   1083 N NE1 . TRP A 1 133 ? 49.603 60.085 -16.368 1.00 17.23 ? 133 TRP A NE1 1 
ATOM   1084 C CE2 . TRP A 1 133 ? 49.457 59.260 -15.283 1.00 16.42 ? 133 TRP A CE2 1 
ATOM   1085 C CE3 . TRP A 1 133 ? 49.260 56.884 -14.848 1.00 15.53 ? 133 TRP A CE3 1 
ATOM   1086 C CZ2 . TRP A 1 133 ? 49.356 59.566 -13.922 1.00 16.45 ? 133 TRP A CZ2 1 
ATOM   1087 C CZ3 . TRP A 1 133 ? 49.158 57.189 -13.494 1.00 16.06 ? 133 TRP A CZ3 1 
ATOM   1088 C CH2 . TRP A 1 133 ? 49.207 58.522 -13.046 1.00 15.29 ? 133 TRP A CH2 1 
ATOM   1089 N N   . THR A 1 134 ? 50.520 54.053 -19.154 1.00 19.44 ? 134 THR A N   1 
ATOM   1090 C CA  . THR A 1 134 ? 50.392 53.008 -20.153 1.00 21.63 ? 134 THR A CA  1 
ATOM   1091 C C   . THR A 1 134 ? 48.997 52.396 -19.982 1.00 21.94 ? 134 THR A C   1 
ATOM   1092 O O   . THR A 1 134 ? 48.662 51.872 -18.915 1.00 21.85 ? 134 THR A O   1 
ATOM   1093 C CB  . THR A 1 134 ? 51.504 51.931 -20.024 1.00 26.76 ? 134 THR A CB  1 
ATOM   1094 O OG1 . THR A 1 134 ? 51.366 50.970 -21.079 1.00 29.28 ? 134 THR A OG1 1 
ATOM   1095 C CG2 . THR A 1 134 ? 51.426 51.210 -18.687 1.00 32.71 ? 134 THR A CG2 1 
ATOM   1096 N N   . ALA A 1 135 ? 48.173 52.533 -21.017 1.00 20.83 ? 135 ALA A N   1 
ATOM   1097 C CA  . ALA A 1 135 ? 46.799 52.038 -21.023 1.00 16.57 ? 135 ALA A CA  1 
ATOM   1098 C C   . ALA A 1 135 ? 46.682 50.637 -21.602 1.00 17.78 ? 135 ALA A C   1 
ATOM   1099 O O   . ALA A 1 135 ? 47.306 50.332 -22.613 1.00 23.90 ? 135 ALA A O   1 
ATOM   1100 C CB  . ALA A 1 135 ? 45.929 52.988 -21.806 1.00 15.36 ? 135 ALA A CB  1 
ATOM   1101 N N   . ALA A 1 136 ? 45.862 49.794 -20.979 1.00 18.27 ? 136 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 136 ? 45.673 48.423 -21.443 1.00 16.71 ? 136 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 136 ? 44.631 48.314 -22.559 1.00 20.34 ? 136 ALA A C   1 
ATOM   1104 O O   . ALA A 1 136 ? 44.575 47.302 -23.266 1.00 23.08 ? 136 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 136 ? 45.304 47.505 -20.280 1.00 14.49 ? 136 ALA A CB  1 
ATOM   1106 N N   . ASP A 1 137 ? 43.798 49.336 -22.714 1.00 15.70 ? 137 ASP A N   1 
ATOM   1107 C CA  . ASP A 1 137 ? 42.792 49.314 -23.761 1.00 14.13 ? 137 ASP A CA  1 
ATOM   1108 C C   . ASP A 1 137 ? 42.350 50.698 -24.176 1.00 16.30 ? 137 ASP A C   1 
ATOM   1109 O O   . ASP A 1 137 ? 42.854 51.702 -23.667 1.00 17.54 ? 137 ASP A O   1 
ATOM   1110 C CB  . ASP A 1 137 ? 41.583 48.454 -23.370 1.00 17.71 ? 137 ASP A CB  1 
ATOM   1111 C CG  . ASP A 1 137 ? 40.894 48.921 -22.092 1.00 17.24 ? 137 ASP A CG  1 
ATOM   1112 O OD1 . ASP A 1 137 ? 40.898 50.129 -21.774 1.00 16.20 ? 137 ASP A OD1 1 
ATOM   1113 O OD2 . ASP A 1 137 ? 40.309 48.062 -21.416 1.00 18.27 ? 137 ASP A OD2 1 
ATOM   1114 N N   . MET A 1 138 ? 41.403 50.750 -25.103 1.00 20.18 ? 138 MET A N   1 
ATOM   1115 C CA  . MET A 1 138 ? 40.906 52.024 -25.602 1.00 24.44 ? 138 MET A CA  1 
ATOM   1116 C C   . MET A 1 138 ? 40.159 52.849 -24.565 1.00 23.02 ? 138 MET A C   1 
ATOM   1117 O O   . MET A 1 138 ? 40.205 54.074 -24.606 1.00 24.46 ? 138 MET A O   1 
ATOM   1118 C CB  . MET A 1 138 ? 40.056 51.811 -26.847 1.00 27.47 ? 138 MET A CB  1 
ATOM   1119 C CG  . MET A 1 138 ? 40.881 51.406 -28.046 1.00 31.28 ? 138 MET A CG  1 
ATOM   1120 S SD  . MET A 1 138 ? 39.861 51.156 -29.486 1.00 42.14 ? 138 MET A SD  1 
ATOM   1121 C CE  . MET A 1 138 ? 39.404 52.855 -29.856 1.00 39.89 ? 138 MET A CE  1 
ATOM   1122 N N   . ALA A 1 139 ? 39.481 52.184 -23.633 1.00 22.77 ? 139 ALA A N   1 
ATOM   1123 C CA  . ALA A 1 139 ? 38.756 52.885 -22.579 1.00 18.33 ? 139 ALA A CA  1 
ATOM   1124 C C   . ALA A 1 139 ? 39.792 53.628 -21.733 1.00 17.17 ? 139 ALA A C   1 
ATOM   1125 O O   . ALA A 1 139 ? 39.698 54.847 -21.536 1.00 15.66 ? 139 ALA A O   1 
ATOM   1126 C CB  . ALA A 1 139 ? 37.984 51.897 -21.724 1.00 17.47 ? 139 ALA A CB  1 
ATOM   1127 N N   . ALA A 1 140 ? 40.832 52.903 -21.330 1.00 9.24  ? 140 ALA A N   1 
ATOM   1128 C CA  . ALA A 1 140 ? 41.910 53.451 -20.515 1.00 13.63 ? 140 ALA A CA  1 
ATOM   1129 C C   . ALA A 1 140 ? 42.612 54.585 -21.242 1.00 16.58 ? 140 ALA A C   1 
ATOM   1130 O O   . ALA A 1 140 ? 43.217 55.463 -20.622 1.00 19.52 ? 140 ALA A O   1 
ATOM   1131 C CB  . ALA A 1 140 ? 42.900 52.362 -20.162 1.00 12.47 ? 140 ALA A CB  1 
ATOM   1132 N N   . LEU A 1 141 ? 42.515 54.572 -22.565 1.00 14.98 ? 141 LEU A N   1 
ATOM   1133 C CA  . LEU A 1 141 ? 43.131 55.603 -23.385 1.00 16.72 ? 141 LEU A CA  1 
ATOM   1134 C C   . LEU A 1 141 ? 42.420 56.934 -23.128 1.00 10.74 ? 141 LEU A C   1 
ATOM   1135 O O   . LEU A 1 141 ? 43.025 58.005 -23.221 1.00 12.03 ? 141 LEU A O   1 
ATOM   1136 C CB  . LEU A 1 141 ? 43.039 55.193 -24.856 1.00 21.17 ? 141 LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 141 ? 44.098 55.640 -25.861 1.00 23.94 ? 141 LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 141 ? 45.494 55.559 -25.264 1.00 19.83 ? 141 LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 141 ? 43.980 54.759 -27.111 1.00 22.19 ? 141 LEU A CD2 1 
ATOM   1140 N N   . ILE A 1 142 ? 41.147 56.855 -22.755 1.00 8.47  ? 142 ILE A N   1 
ATOM   1141 C CA  . ILE A 1 142 ? 40.351 58.042 -22.458 1.00 10.20 ? 142 ILE A CA  1 
ATOM   1142 C C   . ILE A 1 142 ? 40.848 58.679 -21.162 1.00 12.72 ? 142 ILE A C   1 
ATOM   1143 O O   . ILE A 1 142 ? 41.057 59.899 -21.088 1.00 19.52 ? 142 ILE A O   1 
ATOM   1144 C CB  . ILE A 1 142 ? 38.856 57.683 -22.323 1.00 9.34  ? 142 ILE A CB  1 
ATOM   1145 C CG1 . ILE A 1 142 ? 38.379 56.982 -23.599 1.00 12.54 ? 142 ILE A CG1 1 
ATOM   1146 C CG2 . ILE A 1 142 ? 38.032 58.945 -22.099 1.00 10.53 ? 142 ILE A CG2 1 
ATOM   1147 C CD1 . ILE A 1 142 ? 36.939 56.515 -23.558 1.00 10.97 ? 142 ILE A CD1 1 
ATOM   1148 N N   . THR A 1 143 ? 41.064 57.840 -20.152 1.00 13.06 ? 143 THR A N   1 
ATOM   1149 C CA  . THR A 1 143 ? 41.554 58.282 -18.849 1.00 11.39 ? 143 THR A CA  1 
ATOM   1150 C C   . THR A 1 143 ? 42.963 58.863 -19.001 1.00 11.37 ? 143 THR A C   1 
ATOM   1151 O O   . THR A 1 143 ? 43.266 59.923 -18.451 1.00 16.95 ? 143 THR A O   1 
ATOM   1152 C CB  . THR A 1 143 ? 41.574 57.100 -17.858 1.00 10.80 ? 143 THR A CB  1 
ATOM   1153 O OG1 . THR A 1 143 ? 40.258 56.533 -17.772 1.00 11.91 ? 143 THR A OG1 1 
ATOM   1154 C CG2 . THR A 1 143 ? 42.046 57.536 -16.483 1.00 6.87  ? 143 THR A CG2 1 
ATOM   1155 N N   . LYS A 1 144 ? 43.797 58.188 -19.785 1.00 14.33 ? 144 LYS A N   1 
ATOM   1156 C CA  . LYS A 1 144 ? 45.177 58.607 -20.042 1.00 15.40 ? 144 LYS A CA  1 
ATOM   1157 C C   . LYS A 1 144 ? 45.218 60.061 -20.505 1.00 16.75 ? 144 LYS A C   1 
ATOM   1158 O O   . LYS A 1 144 ? 45.922 60.898 -19.931 1.00 19.34 ? 144 LYS A O   1 
ATOM   1159 C CB  . LYS A 1 144 ? 45.780 57.696 -21.113 1.00 16.94 ? 144 LYS A CB  1 
ATOM   1160 C CG  . LYS A 1 144 ? 47.262 57.892 -21.413 1.00 17.87 ? 144 LYS A CG  1 
ATOM   1161 C CD  . LYS A 1 144 ? 47.702 56.870 -22.471 1.00 19.29 ? 144 LYS A CD  1 
ATOM   1162 C CE  . LYS A 1 144 ? 49.203 56.894 -22.728 1.00 17.73 ? 144 LYS A CE  1 
ATOM   1163 N NZ  . LYS A 1 144 ? 49.658 58.179 -23.299 1.00 17.57 ? 144 LYS A NZ  1 
ATOM   1164 N N   . HIS A 1 145 ? 44.405 60.368 -21.505 1.00 16.47 ? 145 HIS A N   1 
ATOM   1165 C CA  . HIS A 1 145 ? 44.340 61.716 -22.038 1.00 18.32 ? 145 HIS A CA  1 
ATOM   1166 C C   . HIS A 1 145 ? 43.872 62.724 -20.973 1.00 16.80 ? 145 HIS A C   1 
ATOM   1167 O O   . HIS A 1 145 ? 44.477 63.790 -20.814 1.00 17.25 ? 145 HIS A O   1 
ATOM   1168 C CB  . HIS A 1 145 ? 43.448 61.737 -23.287 1.00 30.04 ? 145 HIS A CB  1 
ATOM   1169 C CG  . HIS A 1 145 ? 43.925 60.832 -24.393 1.00 37.92 ? 145 HIS A CG  1 
ATOM   1170 N ND1 . HIS A 1 145 ? 45.259 60.541 -24.602 1.00 40.69 ? 145 HIS A ND1 1 
ATOM   1171 C CD2 . HIS A 1 145 ? 43.243 60.174 -25.364 1.00 38.35 ? 145 HIS A CD2 1 
ATOM   1172 C CE1 . HIS A 1 145 ? 45.378 59.746 -25.652 1.00 39.71 ? 145 HIS A CE1 1 
ATOM   1173 N NE2 . HIS A 1 145 ? 44.170 59.509 -26.133 1.00 39.18 ? 145 HIS A NE2 1 
ATOM   1174 N N   . LYS A 1 146 ? 42.818 62.384 -20.230 1.00 14.61 ? 146 LYS A N   1 
ATOM   1175 C CA  . LYS A 1 146 ? 42.310 63.258 -19.160 1.00 13.83 ? 146 LYS A CA  1 
ATOM   1176 C C   . LYS A 1 146 ? 43.418 63.583 -18.168 1.00 14.19 ? 146 LYS A C   1 
ATOM   1177 O O   . LYS A 1 146 ? 43.590 64.740 -17.774 1.00 13.74 ? 146 LYS A O   1 
ATOM   1178 C CB  . LYS A 1 146 ? 41.189 62.578 -18.364 1.00 8.39  ? 146 LYS A CB  1 
ATOM   1179 C CG  . LYS A 1 146 ? 39.839 62.541 -19.027 1.00 7.67  ? 146 LYS A CG  1 
ATOM   1180 C CD  . LYS A 1 146 ? 38.836 61.966 -18.063 1.00 10.48 ? 146 LYS A CD  1 
ATOM   1181 C CE  . LYS A 1 146 ? 37.465 61.831 -18.690 1.00 14.39 ? 146 LYS A CE  1 
ATOM   1182 N NZ  . LYS A 1 146 ? 36.468 61.414 -17.665 1.00 18.36 ? 146 LYS A NZ  1 
ATOM   1183 N N   . TRP A 1 147 ? 44.137 62.544 -17.739 1.00 13.65 ? 147 TRP A N   1 
ATOM   1184 C CA  . TRP A 1 147 ? 45.225 62.682 -16.774 1.00 9.69  ? 147 TRP A CA  1 
ATOM   1185 C C   . TRP A 1 147 ? 46.395 63.488 -17.303 1.00 15.82 ? 147 TRP A C   1 
ATOM   1186 O O   . TRP A 1 147 ? 47.009 64.257 -16.559 1.00 15.33 ? 147 TRP A O   1 
ATOM   1187 C CB  . TRP A 1 147 ? 45.693 61.313 -16.296 1.00 7.96  ? 147 TRP A CB  1 
ATOM   1188 C CG  . TRP A 1 147 ? 44.716 60.661 -15.374 1.00 8.87  ? 147 TRP A CG  1 
ATOM   1189 C CD1 . TRP A 1 147 ? 43.511 61.164 -14.966 1.00 8.61  ? 147 TRP A CD1 1 
ATOM   1190 C CD2 . TRP A 1 147 ? 44.861 59.394 -14.727 1.00 11.74 ? 147 TRP A CD2 1 
ATOM   1191 N NE1 . TRP A 1 147 ? 42.898 60.285 -14.105 1.00 12.39 ? 147 TRP A NE1 1 
ATOM   1192 C CE2 . TRP A 1 147 ? 43.705 59.193 -13.937 1.00 12.83 ? 147 TRP A CE2 1 
ATOM   1193 C CE3 . TRP A 1 147 ? 45.851 58.407 -14.739 1.00 9.49  ? 147 TRP A CE3 1 
ATOM   1194 C CZ2 . TRP A 1 147 ? 43.519 58.047 -13.164 1.00 12.71 ? 147 TRP A CZ2 1 
ATOM   1195 C CZ3 . TRP A 1 147 ? 45.663 57.269 -13.973 1.00 12.01 ? 147 TRP A CZ3 1 
ATOM   1196 C CH2 . TRP A 1 147 ? 44.506 57.099 -13.195 1.00 13.51 ? 147 TRP A CH2 1 
ATOM   1197 N N   . GLU A 1 148 ? 46.712 63.318 -18.584 1.00 18.78 ? 148 GLU A N   1 
ATOM   1198 C CA  . GLU A 1 148 ? 47.803 64.074 -19.185 1.00 22.23 ? 148 GLU A CA  1 
ATOM   1199 C C   . GLU A 1 148 ? 47.436 65.555 -19.218 1.00 22.78 ? 148 GLU A C   1 
ATOM   1200 O O   . GLU A 1 148 ? 48.250 66.403 -18.850 1.00 25.87 ? 148 GLU A O   1 
ATOM   1201 C CB  . GLU A 1 148 ? 48.131 63.540 -20.582 1.00 24.88 ? 148 GLU A CB  1 
ATOM   1202 C CG  . GLU A 1 148 ? 48.805 62.176 -20.536 1.00 30.36 ? 148 GLU A CG  1 
ATOM   1203 C CD  . GLU A 1 148 ? 48.977 61.519 -21.892 1.00 34.23 ? 148 GLU A CD  1 
ATOM   1204 O OE1 . GLU A 1 148 ? 48.243 61.861 -22.847 1.00 42.07 ? 148 GLU A OE1 1 
ATOM   1205 O OE2 . GLU A 1 148 ? 49.826 60.606 -21.994 1.00 34.77 ? 148 GLU A OE2 1 
ATOM   1206 N N   . GLN A 1 149 ? 46.190 65.861 -19.571 1.00 22.04 ? 149 GLN A N   1 
ATOM   1207 C CA  . GLN A 1 149 ? 45.742 67.250 -19.615 1.00 25.85 ? 149 GLN A CA  1 
ATOM   1208 C C   . GLN A 1 149 ? 45.627 67.903 -18.239 1.00 25.89 ? 149 GLN A C   1 
ATOM   1209 O O   . GLN A 1 149 ? 45.766 69.124 -18.114 1.00 26.65 ? 149 GLN A O   1 
ATOM   1210 C CB  . GLN A 1 149 ? 44.427 67.393 -20.386 1.00 27.76 ? 149 GLN A CB  1 
ATOM   1211 C CG  . GLN A 1 149 ? 44.632 67.526 -21.885 1.00 40.48 ? 149 GLN A CG  1 
ATOM   1212 C CD  . GLN A 1 149 ? 43.492 68.253 -22.587 1.00 50.38 ? 149 GLN A CD  1 
ATOM   1213 O OE1 . GLN A 1 149 ? 42.581 67.630 -23.137 1.00 54.87 ? 149 GLN A OE1 1 
ATOM   1214 N NE2 . GLN A 1 149 ? 43.553 69.581 -22.591 1.00 53.58 ? 149 GLN A NE2 1 
ATOM   1215 N N   . ALA A 1 150 ? 45.348 67.110 -17.210 1.00 20.86 ? 150 ALA A N   1 
ATOM   1216 C CA  . ALA A 1 150 ? 45.234 67.646 -15.859 1.00 19.79 ? 150 ALA A CA  1 
ATOM   1217 C C   . ALA A 1 150 ? 46.596 67.719 -15.168 1.00 20.19 ? 150 ALA A C   1 
ATOM   1218 O O   . ALA A 1 150 ? 46.727 68.349 -14.129 1.00 23.77 ? 150 ALA A O   1 
ATOM   1219 C CB  . ALA A 1 150 ? 44.263 66.812 -15.029 1.00 14.53 ? 150 ALA A CB  1 
ATOM   1220 N N   . GLY A 1 151 ? 47.613 67.094 -15.754 1.00 19.58 ? 151 GLY A N   1 
ATOM   1221 C CA  . GLY A 1 151 ? 48.935 67.122 -15.153 1.00 21.75 ? 151 GLY A CA  1 
ATOM   1222 C C   . GLY A 1 151 ? 48.978 66.228 -13.932 1.00 25.82 ? 151 GLY A C   1 
ATOM   1223 O O   . GLY A 1 151 ? 49.706 66.479 -12.974 1.00 30.64 ? 151 GLY A O   1 
ATOM   1224 N N   . GLU A 1 152 ? 48.226 65.139 -14.002 1.00 21.96 ? 152 GLU A N   1 
ATOM   1225 C CA  . GLU A 1 152 ? 48.124 64.190 -12.913 1.00 21.99 ? 152 GLU A CA  1 
ATOM   1226 C C   . GLU A 1 152 ? 49.431 63.483 -12.546 1.00 25.10 ? 152 GLU A C   1 
ATOM   1227 O O   . GLU A 1 152 ? 49.747 63.339 -11.361 1.00 22.93 ? 152 GLU A O   1 
ATOM   1228 C CB  . GLU A 1 152 ? 47.014 63.183 -13.232 1.00 19.97 ? 152 GLU A CB  1 
ATOM   1229 C CG  . GLU A 1 152 ? 46.844 62.066 -12.224 1.00 19.70 ? 152 GLU A CG  1 
ATOM   1230 C CD  . GLU A 1 152 ? 46.475 62.550 -10.836 1.00 24.02 ? 152 GLU A CD  1 
ATOM   1231 O OE1 . GLU A 1 152 ? 45.921 63.664 -10.682 1.00 23.29 ? 152 GLU A OE1 1 
ATOM   1232 O OE2 . GLU A 1 152 ? 46.718 61.789 -9.884  1.00 24.81 ? 152 GLU A OE2 1 
ATOM   1233 N N   . ALA A 1 153 ? 50.204 63.072 -13.550 1.00 26.87 ? 153 ALA A N   1 
ATOM   1234 C CA  . ALA A 1 153 ? 51.473 62.374 -13.309 1.00 24.96 ? 153 ALA A CA  1 
ATOM   1235 C C   . ALA A 1 153 ? 52.421 63.184 -12.425 1.00 24.48 ? 153 ALA A C   1 
ATOM   1236 O O   . ALA A 1 153 ? 53.167 62.626 -11.616 1.00 24.40 ? 153 ALA A O   1 
ATOM   1237 C CB  . ALA A 1 153 ? 52.147 62.032 -14.629 1.00 22.48 ? 153 ALA A CB  1 
ATOM   1238 N N   . GLU A 1 154 ? 52.380 64.504 -12.571 1.00 24.57 ? 154 GLU A N   1 
ATOM   1239 C CA  . GLU A 1 154 ? 53.228 65.376 -11.777 1.00 25.79 ? 154 GLU A CA  1 
ATOM   1240 C C   . GLU A 1 154 ? 52.756 65.404 -10.329 1.00 21.30 ? 154 GLU A C   1 
ATOM   1241 O O   . GLU A 1 154 ? 53.568 65.407 -9.398  1.00 24.33 ? 154 GLU A O   1 
ATOM   1242 C CB  . GLU A 1 154 ? 53.236 66.781 -12.364 1.00 32.19 ? 154 GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 154 ? 54.016 67.771 -11.534 1.00 47.65 ? 154 GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 154 ? 54.473 68.971 -12.330 1.00 57.05 ? 154 GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 154 ? 53.627 69.588 -13.016 1.00 61.26 ? 154 GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 154 ? 55.687 69.282 -12.277 1.00 60.95 ? 154 GLU A OE2 1 
ATOM   1247 N N   . ARG A 1 155 ? 51.441 65.391 -10.143 1.00 18.70 ? 155 ARG A N   1 
ATOM   1248 C CA  . ARG A 1 155 ? 50.857 65.407 -8.807  1.00 15.83 ? 155 ARG A CA  1 
ATOM   1249 C C   . ARG A 1 155 ? 51.171 64.097 -8.094  1.00 15.83 ? 155 ARG A C   1 
ATOM   1250 O O   . ARG A 1 155 ? 51.546 64.095 -6.917  1.00 12.88 ? 155 ARG A O   1 
ATOM   1251 C CB  . ARG A 1 155 ? 49.341 65.612 -8.870  1.00 16.03 ? 155 ARG A CB  1 
ATOM   1252 C CG  . ARG A 1 155 ? 48.719 65.786 -7.503  1.00 15.03 ? 155 ARG A CG  1 
ATOM   1253 C CD  . ARG A 1 155 ? 47.237 65.972 -7.584  1.00 13.86 ? 155 ARG A CD  1 
ATOM   1254 N NE  . ARG A 1 155 ? 46.551 64.767 -8.036  1.00 15.88 ? 155 ARG A NE  1 
ATOM   1255 C CZ  . ARG A 1 155 ? 45.849 63.962 -7.245  1.00 13.83 ? 155 ARG A CZ  1 
ATOM   1256 N NH1 . ARG A 1 155 ? 45.747 64.211 -5.943  1.00 12.15 ? 155 ARG A NH1 1 
ATOM   1257 N NH2 . ARG A 1 155 ? 45.240 62.906 -7.762  1.00 12.65 ? 155 ARG A NH2 1 
ATOM   1258 N N   . LEU A 1 156 ? 51.023 62.986 -8.810  1.00 10.93 ? 156 LEU A N   1 
ATOM   1259 C CA  . LEU A 1 156 ? 51.312 61.683 -8.241  1.00 14.27 ? 156 LEU A CA  1 
ATOM   1260 C C   . LEU A 1 156 ? 52.802 61.559 -7.927  1.00 15.30 ? 156 LEU A C   1 
ATOM   1261 O O   . LEU A 1 156 ? 53.168 61.033 -6.879  1.00 19.10 ? 156 LEU A O   1 
ATOM   1262 C CB  . LEU A 1 156 ? 50.869 60.562 -9.187  1.00 15.47 ? 156 LEU A CB  1 
ATOM   1263 C CG  . LEU A 1 156 ? 51.132 59.109 -8.763  1.00 15.36 ? 156 LEU A CG  1 
ATOM   1264 C CD1 . LEU A 1 156 ? 50.408 58.764 -7.464  1.00 14.04 ? 156 LEU A CD1 1 
ATOM   1265 C CD2 . LEU A 1 156 ? 50.690 58.183 -9.874  1.00 14.03 ? 156 LEU A CD2 1 
ATOM   1266 N N   . ARG A 1 157 ? 53.659 62.065 -8.810  1.00 15.73 ? 157 ARG A N   1 
ATOM   1267 C CA  . ARG A 1 157 ? 55.101 61.983 -8.580  1.00 17.61 ? 157 ARG A CA  1 
ATOM   1268 C C   . ARG A 1 157 ? 55.470 62.724 -7.300  1.00 13.86 ? 157 ARG A C   1 
ATOM   1269 O O   . ARG A 1 157 ? 56.324 62.278 -6.534  1.00 14.16 ? 157 ARG A O   1 
ATOM   1270 C CB  . ARG A 1 157 ? 55.885 62.542 -9.769  1.00 20.68 ? 157 ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 157 ? 57.376 62.200 -9.737  1.00 29.39 ? 157 ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 157 ? 58.082 62.564 -11.043 1.00 36.71 ? 157 ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 157 ? 57.919 63.980 -11.380 1.00 49.03 ? 157 ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 157 ? 57.133 64.449 -12.354 1.00 51.33 ? 157 ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 157 ? 56.422 63.611 -13.113 1.00 47.55 ? 157 ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 157 ? 57.024 65.766 -12.533 1.00 50.51 ? 157 ARG A NH2 1 
ATOM   1277 N N   . ALA A 1 158 ? 54.799 63.841 -7.060  1.00 9.25  ? 158 ALA A N   1 
ATOM   1278 C CA  . ALA A 1 158 ? 55.035 64.636 -5.859  1.00 14.12 ? 158 ALA A CA  1 
ATOM   1279 C C   . ALA A 1 158 ? 54.743 63.779 -4.629  1.00 16.42 ? 158 ALA A C   1 
ATOM   1280 O O   . ALA A 1 158 ? 55.486 63.790 -3.645  1.00 16.28 ? 158 ALA A O   1 
ATOM   1281 C CB  . ALA A 1 158 ? 54.133 65.868 -5.866  1.00 15.00 ? 158 ALA A CB  1 
ATOM   1282 N N   . TYR A 1 159 ? 53.648 63.033 -4.694  1.00 15.80 ? 159 TYR A N   1 
ATOM   1283 C CA  . TYR A 1 159 ? 53.261 62.164 -3.597  1.00 11.86 ? 159 TYR A CA  1 
ATOM   1284 C C   . TYR A 1 159 ? 54.253 61.010 -3.412  1.00 16.27 ? 159 TYR A C   1 
ATOM   1285 O O   . TYR A 1 159 ? 54.743 60.783 -2.306  1.00 22.87 ? 159 TYR A O   1 
ATOM   1286 C CB  . TYR A 1 159 ? 51.850 61.616 -3.831  1.00 6.62  ? 159 TYR A CB  1 
ATOM   1287 C CG  . TYR A 1 159 ? 51.492 60.455 -2.936  1.00 6.42  ? 159 TYR A CG  1 
ATOM   1288 C CD1 . TYR A 1 159 ? 51.110 60.659 -1.606  1.00 7.03  ? 159 TYR A CD1 1 
ATOM   1289 C CD2 . TYR A 1 159 ? 51.556 59.148 -3.408  1.00 4.39  ? 159 TYR A CD2 1 
ATOM   1290 C CE1 . TYR A 1 159 ? 50.802 59.583 -0.769  1.00 3.25  ? 159 TYR A CE1 1 
ATOM   1291 C CE2 . TYR A 1 159 ? 51.257 58.073 -2.587  1.00 5.93  ? 159 TYR A CE2 1 
ATOM   1292 C CZ  . TYR A 1 159 ? 50.879 58.296 -1.270  1.00 10.81 ? 159 TYR A CZ  1 
ATOM   1293 O OH  . TYR A 1 159 ? 50.579 57.224 -0.463  1.00 13.57 ? 159 TYR A OH  1 
ATOM   1294 N N   . LEU A 1 160 ? 54.550 60.284 -4.487  1.00 14.98 ? 160 LEU A N   1 
ATOM   1295 C CA  . LEU A 1 160 ? 55.469 59.141 -4.416  1.00 17.10 ? 160 LEU A CA  1 
ATOM   1296 C C   . LEU A 1 160 ? 56.875 59.486 -3.915  1.00 16.96 ? 160 LEU A C   1 
ATOM   1297 O O   . LEU A 1 160 ? 57.455 58.741 -3.133  1.00 18.81 ? 160 LEU A O   1 
ATOM   1298 C CB  . LEU A 1 160 ? 55.556 58.435 -5.774  1.00 10.53 ? 160 LEU A CB  1 
ATOM   1299 C CG  . LEU A 1 160 ? 54.240 57.880 -6.327  1.00 15.39 ? 160 LEU A CG  1 
ATOM   1300 C CD1 . LEU A 1 160 ? 54.450 57.390 -7.754  1.00 15.33 ? 160 LEU A CD1 1 
ATOM   1301 C CD2 . LEU A 1 160 ? 53.699 56.772 -5.430  1.00 3.93  ? 160 LEU A CD2 1 
ATOM   1302 N N   . GLU A 1 161 ? 57.407 60.619 -4.353  1.00 17.36 ? 161 GLU A N   1 
ATOM   1303 C CA  . GLU A 1 161 ? 58.734 61.041 -3.952  1.00 21.27 ? 161 GLU A CA  1 
ATOM   1304 C C   . GLU A 1 161 ? 58.740 61.806 -2.646  1.00 20.57 ? 161 GLU A C   1 
ATOM   1305 O O   . GLU A 1 161 ? 59.786 61.952 -2.015  1.00 28.70 ? 161 GLU A O   1 
ATOM   1306 C CB  . GLU A 1 161 ? 59.351 61.939 -5.018  1.00 23.01 ? 161 GLU A CB  1 
ATOM   1307 C CG  . GLU A 1 161 ? 59.528 61.296 -6.364  1.00 31.15 ? 161 GLU A CG  1 
ATOM   1308 C CD  . GLU A 1 161 ? 60.389 62.138 -7.287  1.00 35.75 ? 161 GLU A CD  1 
ATOM   1309 O OE1 . GLU A 1 161 ? 60.401 63.382 -7.145  1.00 32.41 ? 161 GLU A OE1 1 
ATOM   1310 O OE2 . GLU A 1 161 ? 61.069 61.544 -8.151  1.00 44.91 ? 161 GLU A OE2 1 
ATOM   1311 N N   . GLY A 1 162 ? 57.600 62.364 -2.271  1.00 21.19 ? 162 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 162 ? 57.558 63.131 -1.046  1.00 17.46 ? 162 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 162 ? 56.819 62.450 0.074   1.00 17.74 ? 162 GLY A C   1 
ATOM   1314 O O   . GLY A 1 162 ? 57.379 61.622 0.794   1.00 23.89 ? 162 GLY A O   1 
ATOM   1315 N N   . THR A 1 163 ? 55.542 62.784 0.189   1.00 18.30 ? 163 THR A N   1 
ATOM   1316 C CA  . THR A 1 163 ? 54.665 62.247 1.211   1.00 15.32 ? 163 THR A CA  1 
ATOM   1317 C C   . THR A 1 163 ? 54.861 60.764 1.472   1.00 15.63 ? 163 THR A C   1 
ATOM   1318 O O   . THR A 1 163 ? 55.048 60.345 2.615   1.00 17.08 ? 163 THR A O   1 
ATOM   1319 C CB  . THR A 1 163 ? 53.213 62.479 0.813   1.00 17.94 ? 163 THR A CB  1 
ATOM   1320 O OG1 . THR A 1 163 ? 53.026 63.876 0.555   1.00 21.60 ? 163 THR A OG1 1 
ATOM   1321 C CG2 . THR A 1 163 ? 52.261 62.008 1.922   1.00 14.78 ? 163 THR A CG2 1 
ATOM   1322 N N   . CYS A 1 164 ? 54.820 59.974 0.408   1.00 11.62 ? 164 CYS A N   1 
ATOM   1323 C CA  . CYS A 1 164 ? 54.975 58.539 0.531   1.00 12.88 ? 164 CYS A CA  1 
ATOM   1324 C C   . CYS A 1 164 ? 56.278 58.153 1.225   1.00 12.65 ? 164 CYS A C   1 
ATOM   1325 O O   . CYS A 1 164 ? 56.268 57.361 2.164   1.00 19.32 ? 164 CYS A O   1 
ATOM   1326 C CB  . CYS A 1 164 ? 54.902 57.880 -0.842  1.00 6.30  ? 164 CYS A CB  1 
ATOM   1327 S SG  . CYS A 1 164 ? 54.634 56.083 -0.766  1.00 9.51  ? 164 CYS A SG  1 
ATOM   1328 N N   . VAL A 1 165 ? 57.383 58.743 0.780   1.00 12.77 ? 165 VAL A N   1 
ATOM   1329 C CA  . VAL A 1 165 ? 58.707 58.459 1.328   1.00 16.39 ? 165 VAL A CA  1 
ATOM   1330 C C   . VAL A 1 165 ? 58.852 58.900 2.787   1.00 16.67 ? 165 VAL A C   1 
ATOM   1331 O O   . VAL A 1 165 ? 59.240 58.116 3.660   1.00 15.90 ? 165 VAL A O   1 
ATOM   1332 C CB  . VAL A 1 165 ? 59.805 59.139 0.463   1.00 15.56 ? 165 VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 165 ? 61.144 59.073 1.148   1.00 15.23 ? 165 VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 165 ? 59.897 58.448 -0.880  1.00 15.30 ? 165 VAL A CG2 1 
ATOM   1335 N N   . GLU A 1 166 ? 58.519 60.156 3.044   1.00 12.70 ? 166 GLU A N   1 
ATOM   1336 C CA  . GLU A 1 166 ? 58.624 60.719 4.373   1.00 16.38 ? 166 GLU A CA  1 
ATOM   1337 C C   . GLU A 1 166 ? 57.765 60.006 5.406   1.00 16.24 ? 166 GLU A C   1 
ATOM   1338 O O   . GLU A 1 166 ? 58.225 59.710 6.515   1.00 13.51 ? 166 GLU A O   1 
ATOM   1339 C CB  . GLU A 1 166 ? 58.345 62.215 4.306   1.00 23.07 ? 166 GLU A CB  1 
ATOM   1340 C CG  . GLU A 1 166 ? 59.399 62.910 3.432   1.00 32.14 ? 166 GLU A CG  1 
ATOM   1341 C CD  . GLU A 1 166 ? 59.161 64.385 3.223   1.00 38.43 ? 166 GLU A CD  1 
ATOM   1342 O OE1 . GLU A 1 166 ? 58.168 64.924 3.762   1.00 40.78 ? 166 GLU A OE1 1 
ATOM   1343 O OE2 . GLU A 1 166 ? 59.977 65.004 2.504   1.00 40.93 ? 166 GLU A OE2 1 
ATOM   1344 N N   . TRP A 1 167 ? 56.540 59.664 5.035   1.00 14.32 ? 167 TRP A N   1 
ATOM   1345 C CA  . TRP A 1 167 ? 55.681 58.967 5.968   1.00 9.40  ? 167 TRP A CA  1 
ATOM   1346 C C   . TRP A 1 167 ? 56.126 57.532 6.147   1.00 9.49  ? 167 TRP A C   1 
ATOM   1347 O O   . TRP A 1 167 ? 56.018 56.990 7.241   1.00 8.54  ? 167 TRP A O   1 
ATOM   1348 C CB  . TRP A 1 167 ? 54.211 59.093 5.573   1.00 10.02 ? 167 TRP A CB  1 
ATOM   1349 C CG  . TRP A 1 167 ? 53.667 60.413 6.011   1.00 11.36 ? 167 TRP A CG  1 
ATOM   1350 C CD1 . TRP A 1 167 ? 53.711 61.587 5.315   1.00 13.21 ? 167 TRP A CD1 1 
ATOM   1351 C CD2 . TRP A 1 167 ? 53.075 60.722 7.283   1.00 12.47 ? 167 TRP A CD2 1 
ATOM   1352 N NE1 . TRP A 1 167 ? 53.192 62.606 6.078   1.00 14.67 ? 167 TRP A NE1 1 
ATOM   1353 C CE2 . TRP A 1 167 ? 52.792 62.103 7.288   1.00 14.15 ? 167 TRP A CE2 1 
ATOM   1354 C CE3 . TRP A 1 167 ? 52.759 59.963 8.419   1.00 14.31 ? 167 TRP A CE3 1 
ATOM   1355 C CZ2 . TRP A 1 167 ? 52.205 62.746 8.386   1.00 12.32 ? 167 TRP A CZ2 1 
ATOM   1356 C CZ3 . TRP A 1 167 ? 52.174 60.604 9.513   1.00 14.50 ? 167 TRP A CZ3 1 
ATOM   1357 C CH2 . TRP A 1 167 ? 51.904 61.982 9.484   1.00 14.54 ? 167 TRP A CH2 1 
ATOM   1358 N N   . LEU A 1 168 ? 56.670 56.927 5.096   1.00 6.76  ? 168 LEU A N   1 
ATOM   1359 C CA  . LEU A 1 168 ? 57.166 55.553 5.201   1.00 9.49  ? 168 LEU A CA  1 
ATOM   1360 C C   . LEU A 1 168 ? 58.283 55.529 6.253   1.00 7.31  ? 168 LEU A C   1 
ATOM   1361 O O   . LEU A 1 168 ? 58.316 54.648 7.119   1.00 9.52  ? 168 LEU A O   1 
ATOM   1362 C CB  . LEU A 1 168 ? 57.693 55.066 3.842   1.00 6.95  ? 168 LEU A CB  1 
ATOM   1363 C CG  . LEU A 1 168 ? 58.515 53.772 3.749   1.00 5.53  ? 168 LEU A CG  1 
ATOM   1364 C CD1 . LEU A 1 168 ? 57.831 52.611 4.465   1.00 6.05  ? 168 LEU A CD1 1 
ATOM   1365 C CD2 . LEU A 1 168 ? 58.748 53.442 2.291   1.00 2.00  ? 168 LEU A CD2 1 
ATOM   1366 N N   . ARG A 1 169 ? 59.188 56.505 6.169   1.00 6.89  ? 169 ARG A N   1 
ATOM   1367 C CA  . ARG A 1 169 ? 60.304 56.633 7.113   1.00 9.20  ? 169 ARG A CA  1 
ATOM   1368 C C   . ARG A 1 169 ? 59.778 56.807 8.532   1.00 9.37  ? 169 ARG A C   1 
ATOM   1369 O O   . ARG A 1 169 ? 60.292 56.217 9.479   1.00 17.26 ? 169 ARG A O   1 
ATOM   1370 C CB  . ARG A 1 169 ? 61.155 57.856 6.783   1.00 10.41 ? 169 ARG A CB  1 
ATOM   1371 C CG  . ARG A 1 169 ? 62.013 57.736 5.559   1.00 11.27 ? 169 ARG A CG  1 
ATOM   1372 C CD  . ARG A 1 169 ? 62.715 59.052 5.324   1.00 12.56 ? 169 ARG A CD  1 
ATOM   1373 N NE  . ARG A 1 169 ? 63.417 59.058 4.047   1.00 16.19 ? 169 ARG A NE  1 
ATOM   1374 C CZ  . ARG A 1 169 ? 63.644 60.152 3.327   1.00 15.25 ? 169 ARG A CZ  1 
ATOM   1375 N NH1 . ARG A 1 169 ? 63.219 61.331 3.764   1.00 13.21 ? 169 ARG A NH1 1 
ATOM   1376 N NH2 . ARG A 1 169 ? 64.294 60.060 2.172   1.00 14.31 ? 169 ARG A NH2 1 
ATOM   1377 N N   . ARG A 1 170 ? 58.767 57.652 8.670   1.00 11.05 ? 170 ARG A N   1 
ATOM   1378 C CA  . ARG A 1 170 ? 58.155 57.912 9.957   1.00 9.94  ? 170 ARG A CA  1 
ATOM   1379 C C   . ARG A 1 170 ? 57.545 56.646 10.564  1.00 9.76  ? 170 ARG A C   1 
ATOM   1380 O O   . ARG A 1 170 ? 57.730 56.387 11.748  1.00 17.10 ? 170 ARG A O   1 
ATOM   1381 C CB  . ARG A 1 170 ? 57.097 58.994 9.810   1.00 10.91 ? 170 ARG A CB  1 
ATOM   1382 C CG  . ARG A 1 170 ? 56.284 59.225 11.058  1.00 16.51 ? 170 ARG A CG  1 
ATOM   1383 C CD  . ARG A 1 170 ? 55.240 60.269 10.796  1.00 21.75 ? 170 ARG A CD  1 
ATOM   1384 N NE  . ARG A 1 170 ? 54.298 60.367 11.898  1.00 28.51 ? 170 ARG A NE  1 
ATOM   1385 C CZ  . ARG A 1 170 ? 54.514 61.056 13.009  1.00 33.60 ? 170 ARG A CZ  1 
ATOM   1386 N NH1 . ARG A 1 170 ? 55.653 61.723 13.165  1.00 35.24 ? 170 ARG A NH1 1 
ATOM   1387 N NH2 . ARG A 1 170 ? 53.597 61.057 13.971  1.00 33.01 ? 170 ARG A NH2 1 
ATOM   1388 N N   . TYR A 1 171 ? 56.821 55.866 9.764   1.00 10.48 ? 171 TYR A N   1 
ATOM   1389 C CA  . TYR A 1 171 ? 56.199 54.630 10.238  1.00 11.54 ? 171 TYR A CA  1 
ATOM   1390 C C   . TYR A 1 171 ? 57.255 53.604 10.653  1.00 13.78 ? 171 TYR A C   1 
ATOM   1391 O O   . TYR A 1 171 ? 57.090 52.893 11.647  1.00 16.41 ? 171 TYR A O   1 
ATOM   1392 C CB  . TYR A 1 171 ? 55.318 54.010 9.152   1.00 9.16  ? 171 TYR A CB  1 
ATOM   1393 C CG  . TYR A 1 171 ? 54.156 54.863 8.710   1.00 10.72 ? 171 TYR A CG  1 
ATOM   1394 C CD1 . TYR A 1 171 ? 53.457 55.664 9.622   1.00 9.59  ? 171 TYR A CD1 1 
ATOM   1395 C CD2 . TYR A 1 171 ? 53.754 54.876 7.375   1.00 8.10  ? 171 TYR A CD2 1 
ATOM   1396 C CE1 . TYR A 1 171 ? 52.378 56.461 9.205   1.00 7.90  ? 171 TYR A CE1 1 
ATOM   1397 C CE2 . TYR A 1 171 ? 52.686 55.668 6.950   1.00 8.26  ? 171 TYR A CE2 1 
ATOM   1398 C CZ  . TYR A 1 171 ? 52.003 56.457 7.868   1.00 9.00  ? 171 TYR A CZ  1 
ATOM   1399 O OH  . TYR A 1 171 ? 50.960 57.251 7.432   1.00 9.45  ? 171 TYR A OH  1 
ATOM   1400 N N   . LEU A 1 172 ? 58.320 53.503 9.864   1.00 13.03 ? 172 LEU A N   1 
ATOM   1401 C CA  . LEU A 1 172 ? 59.401 52.571 10.156  1.00 12.12 ? 172 LEU A CA  1 
ATOM   1402 C C   . LEU A 1 172 ? 60.038 52.923 11.487  1.00 11.90 ? 172 LEU A C   1 
ATOM   1403 O O   . LEU A 1 172 ? 60.445 52.047 12.239  1.00 12.58 ? 172 LEU A O   1 
ATOM   1404 C CB  . LEU A 1 172 ? 60.466 52.624 9.064   1.00 9.61  ? 172 LEU A CB  1 
ATOM   1405 C CG  . LEU A 1 172 ? 60.179 51.896 7.756   1.00 9.81  ? 172 LEU A CG  1 
ATOM   1406 C CD1 . LEU A 1 172 ? 61.260 52.250 6.751   1.00 11.49 ? 172 LEU A CD1 1 
ATOM   1407 C CD2 . LEU A 1 172 ? 60.132 50.394 7.985   1.00 7.03  ? 172 LEU A CD2 1 
ATOM   1408 N N   . LYS A 1 173 ? 60.128 54.217 11.767  1.00 16.60 ? 173 LYS A N   1 
ATOM   1409 C CA  . LYS A 1 173 ? 60.717 54.693 13.009  1.00 19.18 ? 173 LYS A CA  1 
ATOM   1410 C C   . LYS A 1 173 ? 59.817 54.399 14.212  1.00 17.98 ? 173 LYS A C   1 
ATOM   1411 O O   . LYS A 1 173 ? 60.219 53.689 15.123  1.00 22.99 ? 173 LYS A O   1 
ATOM   1412 C CB  . LYS A 1 173 ? 61.006 56.194 12.918  1.00 20.13 ? 173 LYS A CB  1 
ATOM   1413 C CG  . LYS A 1 173 ? 61.724 56.736 14.128  1.00 26.62 ? 173 LYS A CG  1 
ATOM   1414 C CD  . LYS A 1 173 ? 62.010 58.200 13.981  1.00 32.33 ? 173 LYS A CD  1 
ATOM   1415 C CE  . LYS A 1 173 ? 60.767 59.023 14.218  1.00 40.62 ? 173 LYS A CE  1 
ATOM   1416 N NZ  . LYS A 1 173 ? 61.043 60.453 13.931  1.00 44.36 ? 173 LYS A NZ  1 
ATOM   1417 N N   . ASN A 1 174 ? 58.590 54.909 14.189  1.00 15.45 ? 174 ASN A N   1 
ATOM   1418 C CA  . ASN A 1 174 ? 57.645 54.705 15.285  1.00 12.19 ? 174 ASN A CA  1 
ATOM   1419 C C   . ASN A 1 174 ? 57.346 53.237 15.533  1.00 13.91 ? 174 ASN A C   1 
ATOM   1420 O O   . ASN A 1 174 ? 57.096 52.834 16.667  1.00 23.97 ? 174 ASN A O   1 
ATOM   1421 C CB  . ASN A 1 174 ? 56.332 55.433 15.009  1.00 10.13 ? 174 ASN A CB  1 
ATOM   1422 C CG  . ASN A 1 174 ? 56.482 56.935 14.983  1.00 14.40 ? 174 ASN A CG  1 
ATOM   1423 O OD1 . ASN A 1 174 ? 57.523 57.488 15.349  1.00 18.53 ? 174 ASN A OD1 1 
ATOM   1424 N ND2 . ASN A 1 174 ? 55.434 57.614 14.541  1.00 20.20 ? 174 ASN A ND2 1 
ATOM   1425 N N   . GLY A 1 175 ? 57.331 52.433 14.478  1.00 17.21 ? 175 GLY A N   1 
ATOM   1426 C CA  . GLY A 1 175 ? 57.042 51.019 14.656  1.00 13.05 ? 175 GLY A CA  1 
ATOM   1427 C C   . GLY A 1 175 ? 58.249 50.125 14.497  1.00 15.92 ? 175 GLY A C   1 
ATOM   1428 O O   . GLY A 1 175 ? 58.106 48.908 14.330  1.00 16.37 ? 175 GLY A O   1 
ATOM   1429 N N   . ASN A 1 176 ? 59.437 50.710 14.615  1.00 19.02 ? 176 ASN A N   1 
ATOM   1430 C CA  . ASN A 1 176 ? 60.689 49.978 14.441  1.00 20.83 ? 176 ASN A CA  1 
ATOM   1431 C C   . ASN A 1 176 ? 60.775 48.658 15.193  1.00 16.56 ? 176 ASN A C   1 
ATOM   1432 O O   . ASN A 1 176 ? 61.335 47.694 14.686  1.00 20.74 ? 176 ASN A O   1 
ATOM   1433 C CB  . ASN A 1 176 ? 61.878 50.853 14.825  1.00 23.47 ? 176 ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 176 ? 62.051 50.962 16.314  1.00 32.87 ? 176 ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 176 ? 61.077 51.109 17.059  1.00 38.81 ? 176 ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 176 ? 63.288 50.845 16.771  1.00 40.97 ? 176 ASN A ND2 1 
ATOM   1437 N N   . ALA A 1 177 ? 60.214 48.606 16.392  1.00 16.30 ? 177 ALA A N   1 
ATOM   1438 C CA  . ALA A 1 177 ? 60.267 47.382 17.187  1.00 18.46 ? 177 ALA A CA  1 
ATOM   1439 C C   . ALA A 1 177 ? 59.476 46.246 16.553  1.00 17.17 ? 177 ALA A C   1 
ATOM   1440 O O   . ALA A 1 177 ? 59.775 45.073 16.752  1.00 26.74 ? 177 ALA A O   1 
ATOM   1441 C CB  . ALA A 1 177 ? 59.764 47.655 18.590  1.00 14.93 ? 177 ALA A CB  1 
ATOM   1442 N N   . THR A 1 178 ? 58.453 46.603 15.796  1.00 20.73 ? 178 THR A N   1 
ATOM   1443 C CA  . THR A 1 178 ? 57.606 45.625 15.142  1.00 22.17 ? 178 THR A CA  1 
ATOM   1444 C C   . THR A 1 178 ? 58.084 45.355 13.724  1.00 19.21 ? 178 THR A C   1 
ATOM   1445 O O   . THR A 1 178 ? 58.284 44.206 13.329  1.00 19.71 ? 178 THR A O   1 
ATOM   1446 C CB  . THR A 1 178 ? 56.163 46.150 15.078  1.00 25.95 ? 178 THR A CB  1 
ATOM   1447 O OG1 . THR A 1 178 ? 55.655 46.289 16.409  1.00 27.39 ? 178 THR A OG1 1 
ATOM   1448 C CG2 . THR A 1 178 ? 55.265 45.215 14.262  1.00 27.04 ? 178 THR A CG2 1 
ATOM   1449 N N   . LEU A 1 179 ? 58.275 46.433 12.973  1.00 18.93 ? 179 LEU A N   1 
ATOM   1450 C CA  . LEU A 1 179 ? 58.684 46.360 11.578  1.00 18.75 ? 179 LEU A CA  1 
ATOM   1451 C C   . LEU A 1 179 ? 60.113 45.904 11.309  1.00 20.62 ? 179 LEU A C   1 
ATOM   1452 O O   . LEU A 1 179 ? 60.370 45.237 10.306  1.00 19.93 ? 179 LEU A O   1 
ATOM   1453 C CB  . LEU A 1 179 ? 58.417 47.705 10.894  1.00 17.09 ? 179 LEU A CB  1 
ATOM   1454 C CG  . LEU A 1 179 ? 56.950 48.149 10.950  1.00 13.11 ? 179 LEU A CG  1 
ATOM   1455 C CD1 . LEU A 1 179 ? 56.801 49.567 10.454  1.00 6.15  ? 179 LEU A CD1 1 
ATOM   1456 C CD2 . LEU A 1 179 ? 56.108 47.200 10.124  1.00 14.60 ? 179 LEU A CD2 1 
ATOM   1457 N N   . LEU A 1 180 ? 61.043 46.242 12.194  1.00 18.07 ? 180 LEU A N   1 
ATOM   1458 C CA  . LEU A 1 180 ? 62.430 45.854 11.980  1.00 19.14 ? 180 LEU A CA  1 
ATOM   1459 C C   . LEU A 1 180 ? 62.857 44.603 12.746  1.00 19.05 ? 180 LEU A C   1 
ATOM   1460 O O   . LEU A 1 180 ? 64.046 44.324 12.875  1.00 24.69 ? 180 LEU A O   1 
ATOM   1461 C CB  . LEU A 1 180 ? 63.359 47.031 12.288  1.00 17.64 ? 180 LEU A CB  1 
ATOM   1462 C CG  . LEU A 1 180 ? 62.989 48.340 11.579  1.00 19.23 ? 180 LEU A CG  1 
ATOM   1463 C CD1 . LEU A 1 180 ? 64.070 49.368 11.821  1.00 23.00 ? 180 LEU A CD1 1 
ATOM   1464 C CD2 . LEU A 1 180 ? 62.808 48.116 10.088  1.00 20.09 ? 180 LEU A CD2 1 
ATOM   1465 N N   . ARG A 1 181 ? 61.894 43.841 13.244  1.00 15.16 ? 181 ARG A N   1 
ATOM   1466 C CA  . ARG A 1 181 ? 62.216 42.627 13.984  1.00 18.61 ? 181 ARG A CA  1 
ATOM   1467 C C   . ARG A 1 181 ? 62.438 41.493 13.000  1.00 22.30 ? 181 ARG A C   1 
ATOM   1468 O O   . ARG A 1 181 ? 62.208 41.632 11.790  1.00 22.61 ? 181 ARG A O   1 
ATOM   1469 C CB  . ARG A 1 181 ? 61.078 42.245 14.943  1.00 14.19 ? 181 ARG A CB  1 
ATOM   1470 C CG  . ARG A 1 181 ? 59.913 41.509 14.277  1.00 16.42 ? 181 ARG A CG  1 
ATOM   1471 C CD  . ARG A 1 181 ? 58.734 41.315 15.228  1.00 16.72 ? 181 ARG A CD  1 
ATOM   1472 N NE  . ARG A 1 181 ? 57.775 40.323 14.734  1.00 17.35 ? 181 ARG A NE  1 
ATOM   1473 C CZ  . ARG A 1 181 ? 56.817 40.561 13.835  1.00 22.08 ? 181 ARG A CZ  1 
ATOM   1474 N NH1 . ARG A 1 181 ? 56.664 41.773 13.305  1.00 19.59 ? 181 ARG A NH1 1 
ATOM   1475 N NH2 . ARG A 1 181 ? 56.031 39.568 13.432  1.00 19.08 ? 181 ARG A NH2 1 
ATOM   1476 N N   . THR A 1 182 ? 62.897 40.369 13.527  1.00 24.84 ? 182 THR A N   1 
ATOM   1477 C CA  . THR A 1 182 ? 63.120 39.186 12.721  1.00 27.37 ? 182 THR A CA  1 
ATOM   1478 C C   . THR A 1 182 ? 62.746 37.997 13.593  1.00 25.32 ? 182 THR A C   1 
ATOM   1479 O O   . THR A 1 182 ? 63.299 37.826 14.675  1.00 29.08 ? 182 THR A O   1 
ATOM   1480 C CB  . THR A 1 182 ? 64.589 39.064 12.259  1.00 26.30 ? 182 THR A CB  1 
ATOM   1481 O OG1 . THR A 1 182 ? 64.869 40.054 11.262  1.00 29.68 ? 182 THR A OG1 1 
ATOM   1482 C CG2 . THR A 1 182 ? 64.831 37.705 11.649  1.00 30.40 ? 182 THR A CG2 1 
ATOM   1483 N N   . ASP A 1 183 ? 61.726 37.260 13.176  1.00 22.83 ? 183 ASP A N   1 
ATOM   1484 C CA  . ASP A 1 183 ? 61.291 36.082 13.903  1.00 21.78 ? 183 ASP A CA  1 
ATOM   1485 C C   . ASP A 1 183 ? 61.825 34.893 13.130  1.00 21.59 ? 183 ASP A C   1 
ATOM   1486 O O   . ASP A 1 183 ? 61.582 34.761 11.922  1.00 22.85 ? 183 ASP A O   1 
ATOM   1487 C CB  . ASP A 1 183 ? 59.763 36.022 13.991  1.00 25.49 ? 183 ASP A CB  1 
ATOM   1488 C CG  . ASP A 1 183 ? 59.174 37.132 14.853  1.00 27.25 ? 183 ASP A CG  1 
ATOM   1489 O OD1 . ASP A 1 183 ? 59.847 37.592 15.797  1.00 26.64 ? 183 ASP A OD1 1 
ATOM   1490 O OD2 . ASP A 1 183 ? 58.025 37.553 14.588  1.00 34.49 ? 183 ASP A OD2 1 
ATOM   1491 N N   . SER A 1 184 ? 62.633 34.083 13.802  1.00 17.98 ? 184 SER A N   1 
ATOM   1492 C CA  . SER A 1 184 ? 63.221 32.905 13.191  1.00 21.73 ? 184 SER A CA  1 
ATOM   1493 C C   . SER A 1 184 ? 62.178 31.812 13.086  1.00 20.53 ? 184 SER A C   1 
ATOM   1494 O O   . SER A 1 184 ? 61.447 31.543 14.037  1.00 22.56 ? 184 SER A O   1 
ATOM   1495 C CB  . SER A 1 184 ? 64.388 32.395 14.034  1.00 20.36 ? 184 SER A CB  1 
ATOM   1496 O OG  . SER A 1 184 ? 65.274 33.452 14.347  1.00 34.38 ? 184 SER A OG  1 
ATOM   1497 N N   . PRO A 1 185 ? 62.085 31.171 11.919  1.00 20.21 ? 185 PRO A N   1 
ATOM   1498 C CA  . PRO A 1 185 ? 61.093 30.108 11.782  1.00 19.70 ? 185 PRO A CA  1 
ATOM   1499 C C   . PRO A 1 185 ? 61.443 28.861 12.581  1.00 20.89 ? 185 PRO A C   1 
ATOM   1500 O O   . PRO A 1 185 ? 62.609 28.613 12.893  1.00 23.03 ? 185 PRO A O   1 
ATOM   1501 C CB  . PRO A 1 185 ? 61.102 29.829 10.276  1.00 17.10 ? 185 PRO A CB  1 
ATOM   1502 C CG  . PRO A 1 185 ? 62.499 30.169 9.870   1.00 17.67 ? 185 PRO A CG  1 
ATOM   1503 C CD  . PRO A 1 185 ? 62.755 31.444 10.636  1.00 18.19 ? 185 PRO A CD  1 
ATOM   1504 N N   . LYS A 1 186 ? 60.409 28.135 12.987  1.00 22.39 ? 186 LYS A N   1 
ATOM   1505 C CA  . LYS A 1 186 ? 60.564 26.874 13.693  1.00 22.38 ? 186 LYS A CA  1 
ATOM   1506 C C   . LYS A 1 186 ? 60.029 25.908 12.657  1.00 21.74 ? 186 LYS A C   1 
ATOM   1507 O O   . LYS A 1 186 ? 58.933 26.105 12.132  1.00 24.18 ? 186 LYS A O   1 
ATOM   1508 C CB  . LYS A 1 186 ? 59.704 26.817 14.954  1.00 26.84 ? 186 LYS A CB  1 
ATOM   1509 C CG  . LYS A 1 186 ? 60.212 27.676 16.092  1.00 37.34 ? 186 LYS A CG  1 
ATOM   1510 C CD  . LYS A 1 186 ? 59.487 27.347 17.387  1.00 43.98 ? 186 LYS A CD  1 
ATOM   1511 C CE  . LYS A 1 186 ? 59.975 28.225 18.531  1.00 51.71 ? 186 LYS A CE  1 
ATOM   1512 N NZ  . LYS A 1 186 ? 59.243 27.942 19.804  1.00 57.90 ? 186 LYS A NZ  1 
ATOM   1513 N N   . ALA A 1 187 ? 60.813 24.898 12.321  1.00 20.13 ? 187 ALA A N   1 
ATOM   1514 C CA  . ALA A 1 187 ? 60.404 23.945 11.304  1.00 21.63 ? 187 ALA A CA  1 
ATOM   1515 C C   . ALA A 1 187 ? 60.227 22.541 11.844  1.00 21.61 ? 187 ALA A C   1 
ATOM   1516 O O   . ALA A 1 187 ? 60.754 22.207 12.903  1.00 24.47 ? 187 ALA A O   1 
ATOM   1517 C CB  . ALA A 1 187 ? 61.424 23.942 10.163  1.00 21.97 ? 187 ALA A CB  1 
ATOM   1518 N N   . HIS A 1 188 ? 59.454 21.735 11.124  1.00 21.11 ? 188 HIS A N   1 
ATOM   1519 C CA  . HIS A 1 188 ? 59.226 20.343 11.489  1.00 21.16 ? 188 HIS A CA  1 
ATOM   1520 C C   . HIS A 1 188 ? 58.684 19.596 10.279  1.00 23.45 ? 188 HIS A C   1 
ATOM   1521 O O   . HIS A 1 188 ? 58.173 20.216 9.344   1.00 20.95 ? 188 HIS A O   1 
ATOM   1522 C CB  . HIS A 1 188 ? 58.307 20.208 12.718  1.00 24.67 ? 188 HIS A CB  1 
ATOM   1523 C CG  . HIS A 1 188 ? 56.871 20.552 12.470  1.00 24.83 ? 188 HIS A CG  1 
ATOM   1524 N ND1 . HIS A 1 188 ? 56.371 21.825 12.635  1.00 24.91 ? 188 HIS A ND1 1 
ATOM   1525 C CD2 . HIS A 1 188 ? 55.813 19.776 12.132  1.00 28.23 ? 188 HIS A CD2 1 
ATOM   1526 C CE1 . HIS A 1 188 ? 55.069 21.819 12.414  1.00 28.24 ? 188 HIS A CE1 1 
ATOM   1527 N NE2 . HIS A 1 188 ? 54.705 20.587 12.106  1.00 29.51 ? 188 HIS A NE2 1 
ATOM   1528 N N   . VAL A 1 189 ? 58.842 18.276 10.276  1.00 27.02 ? 189 VAL A N   1 
ATOM   1529 C CA  . VAL A 1 189 ? 58.388 17.445 9.165   1.00 25.63 ? 189 VAL A CA  1 
ATOM   1530 C C   . VAL A 1 189 ? 57.318 16.454 9.604   1.00 26.47 ? 189 VAL A C   1 
ATOM   1531 O O   . VAL A 1 189 ? 57.382 15.920 10.712  1.00 25.79 ? 189 VAL A O   1 
ATOM   1532 C CB  . VAL A 1 189 ? 59.574 16.664 8.534   1.00 24.94 ? 189 VAL A CB  1 
ATOM   1533 C CG1 . VAL A 1 189 ? 59.096 15.793 7.380   1.00 24.17 ? 189 VAL A CG1 1 
ATOM   1534 C CG2 . VAL A 1 189 ? 60.643 17.632 8.049   1.00 27.26 ? 189 VAL A CG2 1 
ATOM   1535 N N   . THR A 1 190 ? 56.308 16.264 8.756   1.00 30.02 ? 190 THR A N   1 
ATOM   1536 C CA  . THR A 1 190 ? 55.227 15.323 9.028   1.00 28.15 ? 190 THR A CA  1 
ATOM   1537 C C   . THR A 1 190 ? 55.282 14.222 7.967   1.00 31.32 ? 190 THR A C   1 
ATOM   1538 O O   . THR A 1 190 ? 55.793 14.434 6.864   1.00 32.28 ? 190 THR A O   1 
ATOM   1539 C CB  . THR A 1 190 ? 53.815 16.015 9.088   1.00 24.83 ? 190 THR A CB  1 
ATOM   1540 O OG1 . THR A 1 190 ? 53.513 16.661 7.847   1.00 21.89 ? 190 THR A OG1 1 
ATOM   1541 C CG2 . THR A 1 190 ? 53.770 17.044 10.214  1.00 15.91 ? 190 THR A CG2 1 
ATOM   1542 N N   . HIS A 1 191 ? 54.775 13.045 8.318   1.00 35.54 ? 191 HIS A N   1 
ATOM   1543 C CA  . HIS A 1 191 ? 54.795 11.876 7.441   1.00 36.60 ? 191 HIS A CA  1 
ATOM   1544 C C   . HIS A 1 191 ? 53.363 11.417 7.193   1.00 34.06 ? 191 HIS A C   1 
ATOM   1545 O O   . HIS A 1 191 ? 52.553 11.381 8.116   1.00 33.10 ? 191 HIS A O   1 
ATOM   1546 C CB  . HIS A 1 191 ? 55.569 10.770 8.156   1.00 42.42 ? 191 HIS A CB  1 
ATOM   1547 C CG  . HIS A 1 191 ? 56.043 9.665  7.266   1.00 50.71 ? 191 HIS A CG  1 
ATOM   1548 N ND1 . HIS A 1 191 ? 55.439 8.425  7.234   1.00 55.26 ? 191 HIS A ND1 1 
ATOM   1549 C CD2 . HIS A 1 191 ? 57.120 9.576  6.451   1.00 53.81 ? 191 HIS A CD2 1 
ATOM   1550 C CE1 . HIS A 1 191 ? 56.128 7.620  6.444   1.00 56.59 ? 191 HIS A CE1 1 
ATOM   1551 N NE2 . HIS A 1 191 ? 57.153 8.295  5.957   1.00 57.53 ? 191 HIS A NE2 1 
ATOM   1552 N N   . HIS A 1 192 ? 53.043 11.094 5.948   1.00 33.91 ? 192 HIS A N   1 
ATOM   1553 C CA  . HIS A 1 192 ? 51.705 10.633 5.598   1.00 36.04 ? 192 HIS A CA  1 
ATOM   1554 C C   . HIS A 1 192 ? 51.812 9.468  4.631   1.00 39.09 ? 192 HIS A C   1 
ATOM   1555 O O   . HIS A 1 192 ? 52.560 9.530  3.656   1.00 39.44 ? 192 HIS A O   1 
ATOM   1556 C CB  . HIS A 1 192 ? 50.892 11.766 4.968   1.00 35.08 ? 192 HIS A CB  1 
ATOM   1557 C CG  . HIS A 1 192 ? 50.771 12.972 5.843   1.00 40.78 ? 192 HIS A CG  1 
ATOM   1558 N ND1 . HIS A 1 192 ? 49.855 13.060 6.871   1.00 41.76 ? 192 HIS A ND1 1 
ATOM   1559 C CD2 . HIS A 1 192 ? 51.494 14.117 5.887   1.00 43.36 ? 192 HIS A CD2 1 
ATOM   1560 C CE1 . HIS A 1 192 ? 50.022 14.202 7.511   1.00 41.09 ? 192 HIS A CE1 1 
ATOM   1561 N NE2 . HIS A 1 192 ? 51.011 14.861 6.935   1.00 45.67 ? 192 HIS A NE2 1 
ATOM   1562 N N   . SER A 1 193 ? 51.114 8.383  4.937   1.00 40.78 ? 193 SER A N   1 
ATOM   1563 C CA  . SER A 1 193 ? 51.133 7.207  4.081   1.00 47.54 ? 193 SER A CA  1 
ATOM   1564 C C   . SER A 1 193 ? 50.280 7.430  2.830   1.00 49.05 ? 193 SER A C   1 
ATOM   1565 O O   . SER A 1 193 ? 49.385 8.282  2.817   1.00 49.72 ? 193 SER A O   1 
ATOM   1566 C CB  . SER A 1 193 ? 50.628 5.991  4.859   1.00 48.00 ? 193 SER A CB  1 
ATOM   1567 O OG  . SER A 1 193 ? 51.422 5.767  6.015   1.00 53.29 ? 193 SER A OG  1 
ATOM   1568 N N   . ARG A 1 194 ? 50.586 6.683  1.776   1.00 50.19 ? 194 ARG A N   1 
ATOM   1569 C CA  . ARG A 1 194 ? 49.863 6.763  0.511   1.00 53.25 ? 194 ARG A CA  1 
ATOM   1570 C C   . ARG A 1 194 ? 49.866 5.369  -0.100  1.00 52.67 ? 194 ARG A C   1 
ATOM   1571 O O   . ARG A 1 194 ? 50.579 4.476  0.368   1.00 54.12 ? 194 ARG A O   1 
ATOM   1572 C CB  . ARG A 1 194 ? 50.574 7.705  -0.469  1.00 56.77 ? 194 ARG A CB  1 
ATOM   1573 C CG  . ARG A 1 194 ? 50.665 9.154  -0.052  1.00 61.09 ? 194 ARG A CG  1 
ATOM   1574 C CD  . ARG A 1 194 ? 51.552 9.925  -1.018  1.00 63.71 ? 194 ARG A CD  1 
ATOM   1575 N NE  . ARG A 1 194 ? 50.960 10.070 -2.348  1.00 67.10 ? 194 ARG A NE  1 
ATOM   1576 C CZ  . ARG A 1 194 ? 50.357 11.175 -2.784  1.00 68.77 ? 194 ARG A CZ  1 
ATOM   1577 N NH1 . ARG A 1 194 ? 50.261 12.240 -1.992  1.00 70.23 ? 194 ARG A NH1 1 
ATOM   1578 N NH2 . ARG A 1 194 ? 49.858 11.218 -4.014  1.00 69.09 ? 194 ARG A NH2 1 
ATOM   1579 N N   . PRO A 1 195 ? 49.014 5.140  -1.107  1.00 54.27 ? 195 PRO A N   1 
ATOM   1580 C CA  . PRO A 1 195 ? 48.990 3.819  -1.738  1.00 57.78 ? 195 PRO A CA  1 
ATOM   1581 C C   . PRO A 1 195 ? 50.233 3.655  -2.627  1.00 62.43 ? 195 PRO A C   1 
ATOM   1582 O O   . PRO A 1 195 ? 50.910 4.634  -2.957  1.00 61.50 ? 195 PRO A O   1 
ATOM   1583 C CB  . PRO A 1 195 ? 47.713 3.869  -2.578  1.00 56.30 ? 195 PRO A CB  1 
ATOM   1584 C CG  . PRO A 1 195 ? 46.849 4.842  -1.835  1.00 55.34 ? 195 PRO A CG  1 
ATOM   1585 C CD  . PRO A 1 195 ? 47.832 5.924  -1.501  1.00 53.74 ? 195 PRO A CD  1 
ATOM   1586 N N   . GLU A 1 196 ? 50.525 2.414  -3.001  1.00 65.99 ? 196 GLU A N   1 
ATOM   1587 C CA  . GLU A 1 196 ? 51.665 2.086  -3.853  1.00 68.60 ? 196 GLU A CA  1 
ATOM   1588 C C   . GLU A 1 196 ? 53.015 2.345  -3.183  1.00 66.57 ? 196 GLU A C   1 
ATOM   1589 O O   . GLU A 1 196 ? 53.944 2.863  -3.807  1.00 66.90 ? 196 GLU A O   1 
ATOM   1590 C CB  . GLU A 1 196 ? 51.578 2.829  -5.191  1.00 73.50 ? 196 GLU A CB  1 
ATOM   1591 C CG  . GLU A 1 196 ? 52.367 2.165  -6.318  1.00 80.59 ? 196 GLU A CG  1 
ATOM   1592 C CD  . GLU A 1 196 ? 52.603 3.090  -7.496  1.00 84.12 ? 196 GLU A CD  1 
ATOM   1593 O OE1 . GLU A 1 196 ? 51.765 3.984  -7.749  1.00 86.13 ? 196 GLU A OE1 1 
ATOM   1594 O OE2 . GLU A 1 196 ? 53.665 2.973  -8.144  1.00 85.18 ? 196 GLU A OE2 1 
ATOM   1595 N N   . ASP A 1 197 ? 53.104 1.984  -1.906  1.00 64.85 ? 197 ASP A N   1 
ATOM   1596 C CA  . ASP A 1 197 ? 54.324 2.125  -1.109  1.00 64.50 ? 197 ASP A CA  1 
ATOM   1597 C C   . ASP A 1 197 ? 55.066 3.457  -1.251  1.00 62.52 ? 197 ASP A C   1 
ATOM   1598 O O   . ASP A 1 197 ? 56.273 3.489  -1.508  1.00 62.99 ? 197 ASP A O   1 
ATOM   1599 C CB  . ASP A 1 197 ? 55.275 0.949  -1.385  1.00 67.07 ? 197 ASP A CB  1 
ATOM   1600 C CG  . ASP A 1 197 ? 54.674 -0.396 -0.996  1.00 70.63 ? 197 ASP A CG  1 
ATOM   1601 O OD1 . ASP A 1 197 ? 53.700 -0.836 -1.649  1.00 71.94 ? 197 ASP A OD1 1 
ATOM   1602 O OD2 . ASP A 1 197 ? 55.170 -1.014 -0.030  1.00 73.04 ? 197 ASP A OD2 1 
ATOM   1603 N N   . LYS A 1 198 ? 54.344 4.554  -1.055  1.00 58.99 ? 198 LYS A N   1 
ATOM   1604 C CA  . LYS A 1 198 ? 54.918 5.892  -1.140  1.00 55.41 ? 198 LYS A CA  1 
ATOM   1605 C C   . LYS A 1 198 ? 54.406 6.706  0.035   1.00 54.55 ? 198 LYS A C   1 
ATOM   1606 O O   . LYS A 1 198 ? 53.343 6.407  0.589   1.00 54.89 ? 198 LYS A O   1 
ATOM   1607 C CB  . LYS A 1 198 ? 54.515 6.568  -2.448  1.00 57.60 ? 198 LYS A CB  1 
ATOM   1608 C CG  . LYS A 1 198 ? 55.146 5.950  -3.676  1.00 63.39 ? 198 LYS A CG  1 
ATOM   1609 C CD  . LYS A 1 198 ? 54.367 6.305  -4.928  1.00 68.65 ? 198 LYS A CD  1 
ATOM   1610 C CE  . LYS A 1 198 ? 54.821 5.463  -6.109  1.00 72.50 ? 198 LYS A CE  1 
ATOM   1611 N NZ  . LYS A 1 198 ? 53.873 5.566  -7.253  1.00 75.49 ? 198 LYS A NZ  1 
ATOM   1612 N N   . VAL A 1 199 ? 55.171 7.714  0.440   1.00 51.20 ? 199 VAL A N   1 
ATOM   1613 C CA  . VAL A 1 199 ? 54.772 8.562  1.556   1.00 48.77 ? 199 VAL A CA  1 
ATOM   1614 C C   . VAL A 1 199 ? 54.940 10.034 1.221   1.00 45.81 ? 199 VAL A C   1 
ATOM   1615 O O   . VAL A 1 199 ? 55.729 10.398 0.347   1.00 43.63 ? 199 VAL A O   1 
ATOM   1616 C CB  . VAL A 1 199 ? 55.587 8.263  2.838   1.00 48.41 ? 199 VAL A CB  1 
ATOM   1617 C CG1 . VAL A 1 199 ? 55.475 6.798  3.210   1.00 51.63 ? 199 VAL A CG1 1 
ATOM   1618 C CG2 . VAL A 1 199 ? 57.037 8.665  2.657   1.00 47.70 ? 199 VAL A CG2 1 
ATOM   1619 N N   . THR A 1 200 ? 54.160 10.872 1.891   1.00 43.77 ? 200 THR A N   1 
ATOM   1620 C CA  . THR A 1 200 ? 54.242 12.307 1.703   1.00 40.79 ? 200 THR A CA  1 
ATOM   1621 C C   . THR A 1 200 ? 54.954 12.912 2.904   1.00 38.74 ? 200 THR A C   1 
ATOM   1622 O O   . THR A 1 200 ? 54.511 12.754 4.043   1.00 39.02 ? 200 THR A O   1 
ATOM   1623 C CB  . THR A 1 200 ? 52.847 12.946 1.563   1.00 39.73 ? 200 THR A CB  1 
ATOM   1624 O OG1 . THR A 1 200 ? 52.227 12.474 0.362   1.00 41.56 ? 200 THR A OG1 1 
ATOM   1625 C CG2 . THR A 1 200 ? 52.958 14.460 1.498   1.00 41.34 ? 200 THR A CG2 1 
ATOM   1626 N N   . LEU A 1 201 ? 56.107 13.519 2.646   1.00 37.85 ? 201 LEU A N   1 
ATOM   1627 C CA  . LEU A 1 201 ? 56.892 14.175 3.681   1.00 35.48 ? 201 LEU A CA  1 
ATOM   1628 C C   . LEU A 1 201 ? 56.581 15.652 3.512   1.00 32.99 ? 201 LEU A C   1 
ATOM   1629 O O   . LEU A 1 201 ? 56.691 16.188 2.407   1.00 33.34 ? 201 LEU A O   1 
ATOM   1630 C CB  . LEU A 1 201 ? 58.390 13.936 3.463   1.00 35.67 ? 201 LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 201 ? 58.949 12.519 3.595   1.00 34.51 ? 201 LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 201 ? 60.386 12.499 3.120   1.00 36.31 ? 201 LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 201 ? 58.864 12.048 5.031   1.00 36.68 ? 201 LEU A CD2 1 
ATOM   1634 N N   . ARG A 1 202 ? 56.147 16.299 4.586   1.00 32.34 ? 202 ARG A N   1 
ATOM   1635 C CA  . ARG A 1 202 ? 55.811 17.712 4.521   1.00 25.41 ? 202 ARG A CA  1 
ATOM   1636 C C   . ARG A 1 202 ? 56.715 18.485 5.455   1.00 21.42 ? 202 ARG A C   1 
ATOM   1637 O O   . ARG A 1 202 ? 56.893 18.102 6.607   1.00 24.61 ? 202 ARG A O   1 
ATOM   1638 C CB  . ARG A 1 202 ? 54.352 17.929 4.924   1.00 27.86 ? 202 ARG A CB  1 
ATOM   1639 C CG  . ARG A 1 202 ? 53.800 19.306 4.556   1.00 27.73 ? 202 ARG A CG  1 
ATOM   1640 C CD  . ARG A 1 202 ? 52.371 19.488 5.046   1.00 29.13 ? 202 ARG A CD  1 
ATOM   1641 N NE  . ARG A 1 202 ? 51.492 18.388 4.648   1.00 31.71 ? 202 ARG A NE  1 
ATOM   1642 C CZ  . ARG A 1 202 ? 51.044 18.196 3.412   1.00 31.84 ? 202 ARG A CZ  1 
ATOM   1643 N NH1 . ARG A 1 202 ? 51.384 19.034 2.448   1.00 35.86 ? 202 ARG A NH1 1 
ATOM   1644 N NH2 . ARG A 1 202 ? 50.267 17.160 3.134   1.00 31.80 ? 202 ARG A NH2 1 
ATOM   1645 N N   . CYS A 1 203 ? 57.311 19.554 4.947   1.00 19.40 ? 203 CYS A N   1 
ATOM   1646 C CA  . CYS A 1 203 ? 58.188 20.388 5.751   1.00 18.68 ? 203 CYS A CA  1 
ATOM   1647 C C   . CYS A 1 203 ? 57.490 21.700 6.078   1.00 18.50 ? 203 CYS A C   1 
ATOM   1648 O O   . CYS A 1 203 ? 57.180 22.497 5.187   1.00 16.04 ? 203 CYS A O   1 
ATOM   1649 C CB  . CYS A 1 203 ? 59.476 20.673 5.008   1.00 17.43 ? 203 CYS A CB  1 
ATOM   1650 S SG  . CYS A 1 203 ? 60.740 21.432 6.066   1.00 23.62 ? 203 CYS A SG  1 
ATOM   1651 N N   . TRP A 1 204 ? 57.262 21.916 7.365   1.00 18.19 ? 204 TRP A N   1 
ATOM   1652 C CA  . TRP A 1 204 ? 56.583 23.101 7.859   1.00 17.83 ? 204 TRP A CA  1 
ATOM   1653 C C   . TRP A 1 204 ? 57.538 24.128 8.442   1.00 17.16 ? 204 TRP A C   1 
ATOM   1654 O O   . TRP A 1 204 ? 58.493 23.766 9.125   1.00 20.90 ? 204 TRP A O   1 
ATOM   1655 C CB  . TRP A 1 204 ? 55.617 22.698 8.971   1.00 18.14 ? 204 TRP A CB  1 
ATOM   1656 C CG  . TRP A 1 204 ? 54.402 21.955 8.537   1.00 16.22 ? 204 TRP A CG  1 
ATOM   1657 C CD1 . TRP A 1 204 ? 54.255 20.601 8.431   1.00 15.26 ? 204 TRP A CD1 1 
ATOM   1658 C CD2 . TRP A 1 204 ? 53.120 22.525 8.247   1.00 16.71 ? 204 TRP A CD2 1 
ATOM   1659 N NE1 . TRP A 1 204 ? 52.953 20.292 8.106   1.00 15.26 ? 204 TRP A NE1 1 
ATOM   1660 C CE2 . TRP A 1 204 ? 52.236 21.455 7.986   1.00 17.56 ? 204 TRP A CE2 1 
ATOM   1661 C CE3 . TRP A 1 204 ? 52.630 23.840 8.194   1.00 15.13 ? 204 TRP A CE3 1 
ATOM   1662 C CZ2 . TRP A 1 204 ? 50.888 21.657 7.675   1.00 16.02 ? 204 TRP A CZ2 1 
ATOM   1663 C CZ3 . TRP A 1 204 ? 51.291 24.039 7.887   1.00 15.10 ? 204 TRP A CZ3 1 
ATOM   1664 C CH2 . TRP A 1 204 ? 50.437 22.950 7.631   1.00 18.16 ? 204 TRP A CH2 1 
ATOM   1665 N N   . ALA A 1 205 ? 57.237 25.403 8.225   1.00 10.66 ? 205 ALA A N   1 
ATOM   1666 C CA  . ALA A 1 205 ? 58.023 26.502 8.773   1.00 10.14 ? 205 ALA A CA  1 
ATOM   1667 C C   . ALA A 1 205 ? 56.974 27.430 9.393   1.00 17.38 ? 205 ALA A C   1 
ATOM   1668 O O   . ALA A 1 205 ? 56.080 27.923 8.687   1.00 15.75 ? 205 ALA A O   1 
ATOM   1669 C CB  . ALA A 1 205 ? 58.791 27.211 7.678   1.00 13.30 ? 205 ALA A CB  1 
ATOM   1670 N N   . LEU A 1 206 ? 57.070 27.641 10.707  1.00 17.52 ? 206 LEU A N   1 
ATOM   1671 C CA  . LEU A 1 206 ? 56.100 28.450 11.445  1.00 16.54 ? 206 LEU A CA  1 
ATOM   1672 C C   . LEU A 1 206 ? 56.696 29.632 12.193  1.00 15.22 ? 206 LEU A C   1 
ATOM   1673 O O   . LEU A 1 206 ? 57.877 29.634 12.530  1.00 11.76 ? 206 LEU A O   1 
ATOM   1674 C CB  . LEU A 1 206 ? 55.385 27.581 12.487  1.00 15.49 ? 206 LEU A CB  1 
ATOM   1675 C CG  . LEU A 1 206 ? 54.964 26.146 12.165  1.00 19.35 ? 206 LEU A CG  1 
ATOM   1676 C CD1 . LEU A 1 206 ? 54.391 25.494 13.404  1.00 21.03 ? 206 LEU A CD1 1 
ATOM   1677 C CD2 . LEU A 1 206 ? 53.937 26.141 11.059  1.00 24.66 ? 206 LEU A CD2 1 
ATOM   1678 N N   . GLY A 1 207 ? 55.842 30.613 12.473  1.00 12.91 ? 207 GLY A N   1 
ATOM   1679 C CA  . GLY A 1 207 ? 56.219 31.788 13.247  1.00 9.59  ? 207 GLY A CA  1 
ATOM   1680 C C   . GLY A 1 207 ? 57.344 32.702 12.829  1.00 10.20 ? 207 GLY A C   1 
ATOM   1681 O O   . GLY A 1 207 ? 57.962 33.327 13.681  1.00 13.49 ? 207 GLY A O   1 
ATOM   1682 N N   . PHE A 1 208 ? 57.546 32.882 11.533  1.00 16.01 ? 208 PHE A N   1 
ATOM   1683 C CA  . PHE A 1 208 ? 58.624 33.744 11.069  1.00 12.00 ? 208 PHE A CA  1 
ATOM   1684 C C   . PHE A 1 208 ? 58.169 35.105 10.544  1.00 11.81 ? 208 PHE A C   1 
ATOM   1685 O O   . PHE A 1 208 ? 56.999 35.297 10.205  1.00 13.55 ? 208 PHE A O   1 
ATOM   1686 C CB  . PHE A 1 208 ? 59.465 33.016 10.013  1.00 9.27  ? 208 PHE A CB  1 
ATOM   1687 C CG  . PHE A 1 208 ? 58.688 32.589 8.788   1.00 7.75  ? 208 PHE A CG  1 
ATOM   1688 C CD1 . PHE A 1 208 ? 58.487 33.475 7.727   1.00 4.08  ? 208 PHE A CD1 1 
ATOM   1689 C CD2 . PHE A 1 208 ? 58.179 31.300 8.686   1.00 6.91  ? 208 PHE A CD2 1 
ATOM   1690 C CE1 . PHE A 1 208 ? 57.791 33.083 6.581   1.00 5.13  ? 208 PHE A CE1 1 
ATOM   1691 C CE2 . PHE A 1 208 ? 57.479 30.894 7.539   1.00 11.23 ? 208 PHE A CE2 1 
ATOM   1692 C CZ  . PHE A 1 208 ? 57.286 31.789 6.486   1.00 7.57  ? 208 PHE A CZ  1 
ATOM   1693 N N   . TYR A 1 209 ? 59.105 36.050 10.535  1.00 13.35 ? 209 TYR A N   1 
ATOM   1694 C CA  . TYR A 1 209 ? 58.899 37.411 10.043  1.00 16.12 ? 209 TYR A CA  1 
ATOM   1695 C C   . TYR A 1 209 ? 60.305 37.965 9.748   1.00 19.36 ? 209 TYR A C   1 
ATOM   1696 O O   . TYR A 1 209 ? 61.225 37.771 10.541  1.00 23.00 ? 209 TYR A O   1 
ATOM   1697 C CB  . TYR A 1 209 ? 58.196 38.290 11.092  1.00 13.59 ? 209 TYR A CB  1 
ATOM   1698 C CG  . TYR A 1 209 ? 57.811 39.657 10.555  1.00 15.95 ? 209 TYR A CG  1 
ATOM   1699 C CD1 . TYR A 1 209 ? 56.596 39.845 9.893   1.00 18.37 ? 209 TYR A CD1 1 
ATOM   1700 C CD2 . TYR A 1 209 ? 58.690 40.743 10.636  1.00 18.59 ? 209 TYR A CD2 1 
ATOM   1701 C CE1 . TYR A 1 209 ? 56.267 41.062 9.314   1.00 17.47 ? 209 TYR A CE1 1 
ATOM   1702 C CE2 . TYR A 1 209 ? 58.368 41.979 10.057  1.00 16.77 ? 209 TYR A CE2 1 
ATOM   1703 C CZ  . TYR A 1 209 ? 57.154 42.124 9.396   1.00 20.97 ? 209 TYR A CZ  1 
ATOM   1704 O OH  . TYR A 1 209 ? 56.822 43.310 8.792   1.00 21.17 ? 209 TYR A OH  1 
ATOM   1705 N N   . PRO A 1 210 ? 60.511 38.611 8.587   1.00 19.68 ? 210 PRO A N   1 
ATOM   1706 C CA  . PRO A 1 210 ? 59.598 38.912 7.479   1.00 16.17 ? 210 PRO A CA  1 
ATOM   1707 C C   . PRO A 1 210 ? 59.058 37.658 6.804   1.00 13.82 ? 210 PRO A C   1 
ATOM   1708 O O   . PRO A 1 210 ? 59.511 36.548 7.082   1.00 15.09 ? 210 PRO A O   1 
ATOM   1709 C CB  . PRO A 1 210 ? 60.488 39.701 6.519   1.00 14.97 ? 210 PRO A CB  1 
ATOM   1710 C CG  . PRO A 1 210 ? 61.491 40.330 7.427   1.00 16.31 ? 210 PRO A CG  1 
ATOM   1711 C CD  . PRO A 1 210 ? 61.839 39.185 8.314   1.00 16.76 ? 210 PRO A CD  1 
ATOM   1712 N N   . ALA A 1 211 ? 58.116 37.852 5.890   1.00 13.52 ? 211 ALA A N   1 
ATOM   1713 C CA  . ALA A 1 211 ? 57.501 36.749 5.167   1.00 12.17 ? 211 ALA A CA  1 
ATOM   1714 C C   . ALA A 1 211 ? 58.433 36.021 4.196   1.00 13.96 ? 211 ALA A C   1 
ATOM   1715 O O   . ALA A 1 211 ? 58.207 34.852 3.884   1.00 16.32 ? 211 ALA A O   1 
ATOM   1716 C CB  . ALA A 1 211 ? 56.276 37.247 4.432   1.00 10.10 ? 211 ALA A CB  1 
ATOM   1717 N N   . ASP A 1 212 ? 59.467 36.705 3.714   1.00 17.19 ? 212 ASP A N   1 
ATOM   1718 C CA  . ASP A 1 212 ? 60.404 36.111 2.765   1.00 18.43 ? 212 ASP A CA  1 
ATOM   1719 C C   . ASP A 1 212 ? 61.158 34.921 3.334   1.00 17.55 ? 212 ASP A C   1 
ATOM   1720 O O   . ASP A 1 212 ? 61.882 35.039 4.322   1.00 16.04 ? 212 ASP A O   1 
ATOM   1721 C CB  . ASP A 1 212 ? 61.403 37.148 2.256   1.00 31.32 ? 212 ASP A CB  1 
ATOM   1722 C CG  . ASP A 1 212 ? 62.312 36.585 1.176   1.00 41.65 ? 212 ASP A CG  1 
ATOM   1723 O OD1 . ASP A 1 212 ? 61.774 36.092 0.162   1.00 48.37 ? 212 ASP A OD1 1 
ATOM   1724 O OD2 . ASP A 1 212 ? 63.552 36.598 1.346   1.00 47.23 ? 212 ASP A OD2 1 
ATOM   1725 N N   . ILE A 1 213 ? 61.035 33.783 2.668   1.00 17.42 ? 213 ILE A N   1 
ATOM   1726 C CA  . ILE A 1 213 ? 61.687 32.570 3.126   1.00 18.89 ? 213 ILE A CA  1 
ATOM   1727 C C   . ILE A 1 213 ? 61.815 31.618 1.951   1.00 19.78 ? 213 ILE A C   1 
ATOM   1728 O O   . ILE A 1 213 ? 61.067 31.722 0.979   1.00 22.71 ? 213 ILE A O   1 
ATOM   1729 C CB  . ILE A 1 213 ? 60.842 31.892 4.250   1.00 17.79 ? 213 ILE A CB  1 
ATOM   1730 C CG1 . ILE A 1 213 ? 61.620 30.767 4.923   1.00 10.07 ? 213 ILE A CG1 1 
ATOM   1731 C CG2 . ILE A 1 213 ? 59.536 31.339 3.682   1.00 15.90 ? 213 ILE A CG2 1 
ATOM   1732 C CD1 . ILE A 1 213 ? 60.922 30.247 6.129   1.00 9.64  ? 213 ILE A CD1 1 
ATOM   1733 N N   . THR A 1 214 ? 62.750 30.685 2.060   1.00 20.65 ? 214 THR A N   1 
ATOM   1734 C CA  . THR A 1 214 ? 62.976 29.687 1.034   1.00 21.04 ? 214 THR A CA  1 
ATOM   1735 C C   . THR A 1 214 ? 62.988 28.310 1.689   1.00 24.80 ? 214 THR A C   1 
ATOM   1736 O O   . THR A 1 214 ? 63.784 28.054 2.599   1.00 25.62 ? 214 THR A O   1 
ATOM   1737 C CB  . THR A 1 214 ? 64.324 29.911 0.346   1.00 24.49 ? 214 THR A CB  1 
ATOM   1738 O OG1 . THR A 1 214 ? 64.326 31.190 -0.300  1.00 26.36 ? 214 THR A OG1 1 
ATOM   1739 C CG2 . THR A 1 214 ? 64.604 28.802 -0.664  1.00 18.20 ? 214 THR A CG2 1 
ATOM   1740 N N   . LEU A 1 215 ? 62.074 27.451 1.253   1.00 25.38 ? 215 LEU A N   1 
ATOM   1741 C CA  . LEU A 1 215 ? 61.963 26.089 1.759   1.00 25.92 ? 215 LEU A CA  1 
ATOM   1742 C C   . LEU A 1 215 ? 62.258 25.170 0.588   1.00 29.40 ? 215 LEU A C   1 
ATOM   1743 O O   . LEU A 1 215 ? 61.618 25.303 -0.459  1.00 31.97 ? 215 LEU A O   1 
ATOM   1744 C CB  . LEU A 1 215 ? 60.533 25.811 2.215   1.00 25.86 ? 215 LEU A CB  1 
ATOM   1745 C CG  . LEU A 1 215 ? 60.098 25.904 3.670   1.00 23.20 ? 215 LEU A CG  1 
ATOM   1746 C CD1 . LEU A 1 215 ? 58.660 25.419 3.740   1.00 22.03 ? 215 LEU A CD1 1 
ATOM   1747 C CD2 . LEU A 1 215 ? 60.970 25.030 4.544   1.00 24.35 ? 215 LEU A CD2 1 
ATOM   1748 N N   . THR A 1 216 ? 63.212 24.256 0.746   1.00 30.14 ? 216 THR A N   1 
ATOM   1749 C CA  . THR A 1 216 ? 63.553 23.317 -0.328  1.00 31.91 ? 216 THR A CA  1 
ATOM   1750 C C   . THR A 1 216 ? 63.787 21.908 0.211   1.00 30.75 ? 216 THR A C   1 
ATOM   1751 O O   . THR A 1 216 ? 64.112 21.730 1.384   1.00 29.54 ? 216 THR A O   1 
ATOM   1752 C CB  . THR A 1 216 ? 64.833 23.748 -1.116  1.00 31.72 ? 216 THR A CB  1 
ATOM   1753 O OG1 . THR A 1 216 ? 65.992 23.632 -0.278  1.00 33.16 ? 216 THR A OG1 1 
ATOM   1754 C CG2 . THR A 1 216 ? 64.721 25.182 -1.603  1.00 31.65 ? 216 THR A CG2 1 
ATOM   1755 N N   . TRP A 1 217 ? 63.579 20.910 -0.641  1.00 33.11 ? 217 TRP A N   1 
ATOM   1756 C CA  . TRP A 1 217 ? 63.809 19.516 -0.277  1.00 37.45 ? 217 TRP A CA  1 
ATOM   1757 C C   . TRP A 1 217 ? 64.958 19.072 -1.161  1.00 43.07 ? 217 TRP A C   1 
ATOM   1758 O O   . TRP A 1 217 ? 64.980 19.393 -2.352  1.00 44.54 ? 217 TRP A O   1 
ATOM   1759 C CB  . TRP A 1 217 ? 62.585 18.648 -0.577  1.00 36.13 ? 217 TRP A CB  1 
ATOM   1760 C CG  . TRP A 1 217 ? 61.550 18.623 0.505   1.00 33.70 ? 217 TRP A CG  1 
ATOM   1761 C CD1 . TRP A 1 217 ? 60.404 19.362 0.558   1.00 32.04 ? 217 TRP A CD1 1 
ATOM   1762 C CD2 . TRP A 1 217 ? 61.551 17.796 1.677   1.00 32.32 ? 217 TRP A CD2 1 
ATOM   1763 N NE1 . TRP A 1 217 ? 59.692 19.045 1.687   1.00 34.22 ? 217 TRP A NE1 1 
ATOM   1764 C CE2 . TRP A 1 217 ? 60.370 18.088 2.393   1.00 32.36 ? 217 TRP A CE2 1 
ATOM   1765 C CE3 . TRP A 1 217 ? 62.435 16.837 2.192   1.00 32.63 ? 217 TRP A CE3 1 
ATOM   1766 C CZ2 . TRP A 1 217 ? 60.047 17.456 3.601   1.00 31.01 ? 217 TRP A CZ2 1 
ATOM   1767 C CZ3 . TRP A 1 217 ? 62.115 16.209 3.395   1.00 32.08 ? 217 TRP A CZ3 1 
ATOM   1768 C CH2 . TRP A 1 217 ? 60.930 16.523 4.085   1.00 31.56 ? 217 TRP A CH2 1 
ATOM   1769 N N   . GLN A 1 218 ? 65.908 18.339 -0.592  1.00 48.89 ? 218 GLN A N   1 
ATOM   1770 C CA  . GLN A 1 218 ? 67.061 17.880 -1.354  1.00 51.62 ? 218 GLN A CA  1 
ATOM   1771 C C   . GLN A 1 218 ? 67.287 16.384 -1.252  1.00 54.26 ? 218 GLN A C   1 
ATOM   1772 O O   . GLN A 1 218 ? 66.987 15.764 -0.231  1.00 53.49 ? 218 GLN A O   1 
ATOM   1773 C CB  . GLN A 1 218 ? 68.332 18.601 -0.895  1.00 51.91 ? 218 GLN A CB  1 
ATOM   1774 C CG  . GLN A 1 218 ? 68.395 20.087 -1.231  1.00 52.56 ? 218 GLN A CG  1 
ATOM   1775 C CD  . GLN A 1 218 ? 69.719 20.718 -0.824  1.00 52.87 ? 218 GLN A CD  1 
ATOM   1776 O OE1 . GLN A 1 218 ? 70.516 20.104 -0.109  1.00 53.60 ? 218 GLN A OE1 1 
ATOM   1777 N NE2 . GLN A 1 218 ? 69.948 21.952 -1.252  1.00 52.82 ? 218 GLN A NE2 1 
ATOM   1778 N N   . LEU A 1 219 ? 67.840 15.827 -2.323  1.00 59.95 ? 219 LEU A N   1 
ATOM   1779 C CA  . LEU A 1 219 ? 68.181 14.412 -2.432  1.00 62.53 ? 219 LEU A CA  1 
ATOM   1780 C C   . LEU A 1 219 ? 69.511 14.427 -3.171  1.00 67.50 ? 219 LEU A C   1 
ATOM   1781 O O   . LEU A 1 219 ? 69.661 15.165 -4.135  1.00 68.89 ? 219 LEU A O   1 
ATOM   1782 C CB  . LEU A 1 219 ? 67.150 13.668 -3.281  1.00 58.32 ? 219 LEU A CB  1 
ATOM   1783 C CG  . LEU A 1 219 ? 67.511 12.224 -3.627  1.00 53.58 ? 219 LEU A CG  1 
ATOM   1784 C CD1 . LEU A 1 219 ? 67.422 11.369 -2.381  1.00 52.50 ? 219 LEU A CD1 1 
ATOM   1785 C CD2 . LEU A 1 219 ? 66.582 11.700 -4.701  1.00 54.62 ? 219 LEU A CD2 1 
ATOM   1786 N N   . ASN A 1 220 ? 70.492 13.668 -2.694  1.00 72.65 ? 220 ASN A N   1 
ATOM   1787 C CA  . ASN A 1 220 ? 71.812 13.629 -3.336  1.00 75.81 ? 220 ASN A CA  1 
ATOM   1788 C C   . ASN A 1 220 ? 72.393 15.037 -3.458  1.00 74.79 ? 220 ASN A C   1 
ATOM   1789 O O   . ASN A 1 220 ? 73.234 15.301 -4.320  1.00 76.12 ? 220 ASN A O   1 
ATOM   1790 C CB  . ASN A 1 220 ? 71.730 13.011 -4.739  1.00 79.57 ? 220 ASN A CB  1 
ATOM   1791 C CG  . ASN A 1 220 ? 71.115 11.629 -4.740  1.00 82.15 ? 220 ASN A CG  1 
ATOM   1792 O OD1 . ASN A 1 220 ? 71.463 10.777 -3.919  1.00 82.90 ? 220 ASN A OD1 1 
ATOM   1793 N ND2 . ASN A 1 220 ? 70.194 11.395 -5.667  1.00 83.24 ? 220 ASN A ND2 1 
ATOM   1794 N N   . GLY A 1 221 ? 71.926 15.943 -2.604  1.00 71.77 ? 221 GLY A N   1 
ATOM   1795 C CA  . GLY A 1 221 ? 72.407 17.310 -2.638  1.00 71.06 ? 221 GLY A CA  1 
ATOM   1796 C C   . GLY A 1 221 ? 71.734 18.178 -3.687  1.00 70.51 ? 221 GLY A C   1 
ATOM   1797 O O   . GLY A 1 221 ? 71.982 19.381 -3.746  1.00 72.88 ? 221 GLY A O   1 
ATOM   1798 N N   . GLU A 1 222 ? 70.903 17.578 -4.530  1.00 70.25 ? 222 GLU A N   1 
ATOM   1799 C CA  . GLU A 1 222 ? 70.197 18.332 -5.558  1.00 72.64 ? 222 GLU A CA  1 
ATOM   1800 C C   . GLU A 1 222 ? 68.804 18.734 -5.065  1.00 70.78 ? 222 GLU A C   1 
ATOM   1801 O O   . GLU A 1 222 ? 68.094 17.939 -4.437  1.00 68.07 ? 222 GLU A O   1 
ATOM   1802 C CB  . GLU A 1 222 ? 70.112 17.516 -6.854  1.00 78.03 ? 222 GLU A CB  1 
ATOM   1803 C CG  . GLU A 1 222 ? 69.302 16.233 -6.753  1.00 86.04 ? 222 GLU A CG  1 
ATOM   1804 C CD  . GLU A 1 222 ? 69.714 15.187 -7.769  1.00 90.54 ? 222 GLU A CD  1 
ATOM   1805 O OE1 . GLU A 1 222 ? 69.483 15.403 -8.978  1.00 94.56 ? 222 GLU A OE1 1 
ATOM   1806 O OE2 . GLU A 1 222 ? 70.268 14.143 -7.355  1.00 91.61 ? 222 GLU A OE2 1 
ATOM   1807 N N   . GLU A 1 223 ? 68.442 19.992 -5.289  1.00 68.81 ? 223 GLU A N   1 
ATOM   1808 C CA  . GLU A 1 223 ? 67.141 20.491 -4.869  1.00 70.62 ? 223 GLU A CA  1 
ATOM   1809 C C   . GLU A 1 223 ? 66.066 19.962 -5.823  1.00 69.99 ? 223 GLU A C   1 
ATOM   1810 O O   . GLU A 1 223 ? 66.200 20.070 -7.044  1.00 70.62 ? 223 GLU A O   1 
ATOM   1811 C CB  . GLU A 1 223 ? 67.147 22.028 -4.816  1.00 72.68 ? 223 GLU A CB  1 
ATOM   1812 C CG  . GLU A 1 223 ? 68.264 22.601 -3.930  1.00 77.42 ? 223 GLU A CG  1 
ATOM   1813 C CD  . GLU A 1 223 ? 68.058 24.058 -3.515  1.00 79.31 ? 223 GLU A CD  1 
ATOM   1814 O OE1 . GLU A 1 223 ? 67.724 24.900 -4.378  1.00 81.02 ? 223 GLU A OE1 1 
ATOM   1815 O OE2 . GLU A 1 223 ? 68.250 24.366 -2.313  1.00 77.50 ? 223 GLU A OE2 1 
ATOM   1816 N N   . LEU A 1 224 ? 65.015 19.372 -5.256  1.00 67.30 ? 224 LEU A N   1 
ATOM   1817 C CA  . LEU A 1 224 ? 63.912 18.794 -6.028  1.00 64.05 ? 224 LEU A CA  1 
ATOM   1818 C C   . LEU A 1 224 ? 62.800 19.801 -6.319  1.00 64.53 ? 224 LEU A C   1 
ATOM   1819 O O   . LEU A 1 224 ? 61.625 19.503 -6.123  1.00 66.23 ? 224 LEU A O   1 
ATOM   1820 C CB  . LEU A 1 224 ? 63.315 17.609 -5.265  1.00 62.84 ? 224 LEU A CB  1 
ATOM   1821 C CG  . LEU A 1 224 ? 64.272 16.639 -4.572  1.00 63.54 ? 224 LEU A CG  1 
ATOM   1822 C CD1 . LEU A 1 224 ? 63.480 15.683 -3.708  1.00 63.97 ? 224 LEU A CD1 1 
ATOM   1823 C CD2 . LEU A 1 224 ? 65.096 15.886 -5.596  1.00 66.14 ? 224 LEU A CD2 1 
ATOM   1824 N N   . ILE A 1 225 ? 63.166 20.975 -6.823  1.00 67.59 ? 225 ILE A N   1 
ATOM   1825 C CA  . ILE A 1 225 ? 62.193 22.026 -7.127  1.00 70.43 ? 225 ILE A CA  1 
ATOM   1826 C C   . ILE A 1 225 ? 61.067 21.608 -8.077  1.00 72.63 ? 225 ILE A C   1 
ATOM   1827 O O   . ILE A 1 225 ? 59.908 21.960 -7.857  1.00 74.04 ? 225 ILE A O   1 
ATOM   1828 C CB  . ILE A 1 225 ? 62.901 23.321 -7.642  1.00 70.60 ? 225 ILE A CB  1 
ATOM   1829 C CG1 . ILE A 1 225 ? 63.227 24.249 -6.463  1.00 71.41 ? 225 ILE A CG1 1 
ATOM   1830 C CG2 . ILE A 1 225 ? 62.038 24.064 -8.663  1.00 69.20 ? 225 ILE A CG2 1 
ATOM   1831 C CD1 . ILE A 1 225 ? 64.134 23.645 -5.403  1.00 69.63 ? 225 ILE A CD1 1 
ATOM   1832 N N   . GLN A 1 226 ? 61.404 20.855 -9.119  1.00 74.99 ? 226 GLN A N   1 
ATOM   1833 C CA  . GLN A 1 226 ? 60.407 20.415 -10.090 1.00 77.31 ? 226 GLN A CA  1 
ATOM   1834 C C   . GLN A 1 226 ? 59.349 19.502 -9.475  1.00 76.00 ? 226 GLN A C   1 
ATOM   1835 O O   . GLN A 1 226 ? 58.150 19.703 -9.681  1.00 75.97 ? 226 GLN A O   1 
ATOM   1836 C CB  . GLN A 1 226 ? 61.081 19.697 -11.263 1.00 82.89 ? 226 GLN A CB  1 
ATOM   1837 C CG  . GLN A 1 226 ? 60.099 19.164 -12.306 1.00 88.92 ? 226 GLN A CG  1 
ATOM   1838 C CD  . GLN A 1 226 ? 60.779 18.405 -13.430 1.00 91.61 ? 226 GLN A CD  1 
ATOM   1839 O OE1 . GLN A 1 226 ? 61.200 18.997 -14.424 1.00 92.69 ? 226 GLN A OE1 1 
ATOM   1840 N NE2 . GLN A 1 226 ? 60.887 17.090 -13.282 1.00 92.99 ? 226 GLN A NE2 1 
ATOM   1841 N N   . ASP A 1 227 ? 59.806 18.502 -8.729  1.00 73.32 ? 227 ASP A N   1 
ATOM   1842 C CA  . ASP A 1 227 ? 58.925 17.524 -8.093  1.00 71.68 ? 227 ASP A CA  1 
ATOM   1843 C C   . ASP A 1 227 ? 58.643 17.925 -6.643  1.00 66.71 ? 227 ASP A C   1 
ATOM   1844 O O   . ASP A 1 227 ? 58.991 17.199 -5.710  1.00 68.71 ? 227 ASP A O   1 
ATOM   1845 C CB  . ASP A 1 227 ? 59.594 16.142 -8.131  1.00 74.61 ? 227 ASP A CB  1 
ATOM   1846 C CG  . ASP A 1 227 ? 60.411 15.920 -9.395  1.00 76.49 ? 227 ASP A CG  1 
ATOM   1847 O OD1 . ASP A 1 227 ? 61.572 16.387 -9.442  1.00 77.35 ? 227 ASP A OD1 1 
ATOM   1848 O OD2 . ASP A 1 227 ? 59.891 15.301 -10.349 1.00 78.19 ? 227 ASP A OD2 1 
ATOM   1849 N N   . MET A 1 228 ? 57.953 19.044 -6.452  1.00 58.73 ? 228 MET A N   1 
ATOM   1850 C CA  . MET A 1 228 ? 57.683 19.519 -5.104  1.00 51.85 ? 228 MET A CA  1 
ATOM   1851 C C   . MET A 1 228 ? 56.359 20.269 -4.981  1.00 49.92 ? 228 MET A C   1 
ATOM   1852 O O   . MET A 1 228 ? 55.990 21.045 -5.861  1.00 50.36 ? 228 MET A O   1 
ATOM   1853 C CB  . MET A 1 228 ? 58.843 20.414 -4.668  1.00 49.64 ? 228 MET A CB  1 
ATOM   1854 C CG  . MET A 1 228 ? 58.957 20.657 -3.187  1.00 52.44 ? 228 MET A CG  1 
ATOM   1855 S SD  . MET A 1 228 ? 60.556 21.394 -2.788  1.00 54.74 ? 228 MET A SD  1 
ATOM   1856 C CE  . MET A 1 228 ? 60.284 23.084 -3.281  1.00 54.66 ? 228 MET A CE  1 
ATOM   1857 N N   . GLU A 1 229 ? 55.640 19.989 -3.896  1.00 47.69 ? 229 GLU A N   1 
ATOM   1858 C CA  . GLU A 1 229 ? 54.352 20.613 -3.579  1.00 45.27 ? 229 GLU A CA  1 
ATOM   1859 C C   . GLU A 1 229 ? 54.661 21.804 -2.665  1.00 42.88 ? 229 GLU A C   1 
ATOM   1860 O O   . GLU A 1 229 ? 55.537 21.702 -1.797  1.00 39.41 ? 229 GLU A O   1 
ATOM   1861 C CB  . GLU A 1 229 ? 53.471 19.603 -2.853  1.00 51.02 ? 229 GLU A CB  1 
ATOM   1862 C CG  . GLU A 1 229 ? 52.250 20.187 -2.198  1.00 56.31 ? 229 GLU A CG  1 
ATOM   1863 C CD  . GLU A 1 229 ? 51.049 20.178 -3.092  1.00 60.04 ? 229 GLU A CD  1 
ATOM   1864 O OE1 . GLU A 1 229 ? 50.939 21.074 -3.951  1.00 62.91 ? 229 GLU A OE1 1 
ATOM   1865 O OE2 . GLU A 1 229 ? 50.210 19.270 -2.923  1.00 64.15 ? 229 GLU A OE2 1 
ATOM   1866 N N   . LEU A 1 230 ? 53.888 22.884 -2.776  1.00 39.64 ? 230 LEU A N   1 
ATOM   1867 C CA  . LEU A 1 230 ? 54.186 24.089 -2.001  1.00 35.06 ? 230 LEU A CA  1 
ATOM   1868 C C   . LEU A 1 230 ? 53.025 25.097 -1.919  1.00 36.59 ? 230 LEU A C   1 
ATOM   1869 O O   . LEU A 1 230 ? 52.284 25.273 -2.892  1.00 39.10 ? 230 LEU A O   1 
ATOM   1870 C CB  . LEU A 1 230 ? 55.365 24.765 -2.702  1.00 35.36 ? 230 LEU A CB  1 
ATOM   1871 C CG  . LEU A 1 230 ? 56.212 25.876 -2.110  1.00 41.65 ? 230 LEU A CG  1 
ATOM   1872 C CD1 . LEU A 1 230 ? 57.446 25.287 -1.449  1.00 41.31 ? 230 LEU A CD1 1 
ATOM   1873 C CD2 . LEU A 1 230 ? 56.641 26.780 -3.239  1.00 44.99 ? 230 LEU A CD2 1 
ATOM   1874 N N   . VAL A 1 231 ? 52.853 25.749 -0.768  1.00 26.90 ? 231 VAL A N   1 
ATOM   1875 C CA  . VAL A 1 231 ? 51.813 26.770 -0.644  1.00 21.24 ? 231 VAL A CA  1 
ATOM   1876 C C   . VAL A 1 231 ? 52.482 28.130 -0.547  1.00 21.06 ? 231 VAL A C   1 
ATOM   1877 O O   . VAL A 1 231 ? 53.632 28.239 -0.109  1.00 16.94 ? 231 VAL A O   1 
ATOM   1878 C CB  . VAL A 1 231 ? 50.891 26.609 0.601   1.00 23.08 ? 231 VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 231 ? 50.020 25.389 0.470   1.00 25.54 ? 231 VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 231 ? 51.701 26.568 1.873   1.00 26.49 ? 231 VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 232 ? 51.781 29.165 -0.993  1.00 22.30 ? 232 GLU A N   1 
ATOM   1882 C CA  . GLU A 1 232 ? 52.309 30.518 -0.924  1.00 19.09 ? 232 GLU A CA  1 
ATOM   1883 C C   . GLU A 1 232 ? 52.401 30.866 0.559   1.00 16.66 ? 232 GLU A C   1 
ATOM   1884 O O   . GLU A 1 232 ? 51.581 30.416 1.353   1.00 18.37 ? 232 GLU A O   1 
ATOM   1885 C CB  . GLU A 1 232 ? 51.368 31.496 -1.631  1.00 22.53 ? 232 GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 232 ? 51.182 31.247 -3.124  1.00 31.05 ? 232 GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 232 ? 50.113 32.145 -3.740  1.00 36.77 ? 232 GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 232 ? 48.921 31.960 -3.422  1.00 36.17 ? 232 GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 232 ? 50.456 33.031 -4.549  1.00 42.04 ? 232 GLU A OE2 1 
ATOM   1890 N N   . THR A 1 233 ? 53.420 31.627 0.935   1.00 13.17 ? 233 THR A N   1 
ATOM   1891 C CA  . THR A 1 233 ? 53.593 32.034 2.319   1.00 14.83 ? 233 THR A CA  1 
ATOM   1892 C C   . THR A 1 233 ? 52.297 32.722 2.761   1.00 15.56 ? 233 THR A C   1 
ATOM   1893 O O   . THR A 1 233 ? 51.761 33.583 2.052   1.00 14.67 ? 233 THR A O   1 
ATOM   1894 C CB  . THR A 1 233 ? 54.806 32.961 2.452   1.00 13.03 ? 233 THR A CB  1 
ATOM   1895 O OG1 . THR A 1 233 ? 55.939 32.321 1.843   1.00 15.32 ? 233 THR A OG1 1 
ATOM   1896 C CG2 . THR A 1 233 ? 55.116 33.233 3.919   1.00 11.88 ? 233 THR A CG2 1 
ATOM   1897 N N   . ARG A 1 234 ? 51.808 32.352 3.937   1.00 11.58 ? 234 ARG A N   1 
ATOM   1898 C CA  . ARG A 1 234 ? 50.543 32.872 4.425   1.00 11.65 ? 234 ARG A CA  1 
ATOM   1899 C C   . ARG A 1 234 ? 50.605 33.405 5.846   1.00 14.60 ? 234 ARG A C   1 
ATOM   1900 O O   . ARG A 1 234 ? 51.353 32.885 6.676   1.00 19.24 ? 234 ARG A O   1 
ATOM   1901 C CB  . ARG A 1 234 ? 49.512 31.739 4.342   1.00 11.46 ? 234 ARG A CB  1 
ATOM   1902 C CG  . ARG A 1 234 ? 49.986 30.447 5.011   1.00 7.76  ? 234 ARG A CG  1 
ATOM   1903 C CD  . ARG A 1 234 ? 49.215 29.244 4.520   1.00 10.26 ? 234 ARG A CD  1 
ATOM   1904 N NE  . ARG A 1 234 ? 49.391 28.085 5.393   1.00 11.95 ? 234 ARG A NE  1 
ATOM   1905 C CZ  . ARG A 1 234 ? 48.921 26.870 5.122   1.00 14.76 ? 234 ARG A CZ  1 
ATOM   1906 N NH1 . ARG A 1 234 ? 48.256 26.648 3.994   1.00 16.39 ? 234 ARG A NH1 1 
ATOM   1907 N NH2 . ARG A 1 234 ? 49.064 25.886 6.001   1.00 15.59 ? 234 ARG A NH2 1 
ATOM   1908 N N   . PRO A 1 235 ? 49.831 34.469 6.141   1.00 17.64 ? 235 PRO A N   1 
ATOM   1909 C CA  . PRO A 1 235 ? 49.811 35.058 7.483   1.00 15.05 ? 235 PRO A CA  1 
ATOM   1910 C C   . PRO A 1 235 ? 49.125 34.089 8.433   1.00 13.88 ? 235 PRO A C   1 
ATOM   1911 O O   . PRO A 1 235 ? 48.182 33.402 8.042   1.00 16.22 ? 235 PRO A O   1 
ATOM   1912 C CB  . PRO A 1 235 ? 48.996 36.338 7.281   1.00 14.72 ? 235 PRO A CB  1 
ATOM   1913 C CG  . PRO A 1 235 ? 48.049 35.973 6.198   1.00 13.28 ? 235 PRO A CG  1 
ATOM   1914 C CD  . PRO A 1 235 ? 48.937 35.212 5.232   1.00 17.36 ? 235 PRO A CD  1 
ATOM   1915 N N   . ALA A 1 236 ? 49.610 34.016 9.667   1.00 12.45 ? 236 ALA A N   1 
ATOM   1916 C CA  . ALA A 1 236 ? 49.042 33.100 10.644  1.00 12.17 ? 236 ALA A CA  1 
ATOM   1917 C C   . ALA A 1 236 ? 48.180 33.749 11.732  1.00 13.34 ? 236 ALA A C   1 
ATOM   1918 O O   . ALA A 1 236 ? 47.924 33.146 12.771  1.00 17.95 ? 236 ALA A O   1 
ATOM   1919 C CB  . ALA A 1 236 ? 50.138 32.226 11.249  1.00 12.21 ? 236 ALA A CB  1 
ATOM   1920 N N   . GLY A 1 237 ? 47.745 34.980 11.501  1.00 15.57 ? 237 GLY A N   1 
ATOM   1921 C CA  . GLY A 1 237 ? 46.869 35.636 12.452  1.00 14.28 ? 237 GLY A CA  1 
ATOM   1922 C C   . GLY A 1 237 ? 47.436 36.517 13.538  1.00 16.48 ? 237 GLY A C   1 
ATOM   1923 O O   . GLY A 1 237 ? 46.670 37.234 14.175  1.00 24.35 ? 237 GLY A O   1 
ATOM   1924 N N   . ASP A 1 238 ? 48.750 36.508 13.739  1.00 18.97 ? 238 ASP A N   1 
ATOM   1925 C CA  . ASP A 1 238 ? 49.370 37.318 14.791  1.00 13.45 ? 238 ASP A CA  1 
ATOM   1926 C C   . ASP A 1 238 ? 50.533 38.175 14.294  1.00 12.59 ? 238 ASP A C   1 
ATOM   1927 O O   . ASP A 1 238 ? 51.352 38.640 15.084  1.00 16.62 ? 238 ASP A O   1 
ATOM   1928 C CB  . ASP A 1 238 ? 49.875 36.405 15.914  1.00 11.48 ? 238 ASP A CB  1 
ATOM   1929 C CG  . ASP A 1 238 ? 50.950 35.434 15.437  1.00 16.59 ? 238 ASP A CG  1 
ATOM   1930 O OD1 . ASP A 1 238 ? 51.280 35.445 14.232  1.00 15.68 ? 238 ASP A OD1 1 
ATOM   1931 O OD2 . ASP A 1 238 ? 51.469 34.651 16.260  1.00 14.63 ? 238 ASP A OD2 1 
ATOM   1932 N N   . GLY A 1 239 ? 50.625 38.374 12.989  1.00 16.37 ? 239 GLY A N   1 
ATOM   1933 C CA  . GLY A 1 239 ? 51.719 39.176 12.469  1.00 16.20 ? 239 GLY A CA  1 
ATOM   1934 C C   . GLY A 1 239 ? 52.880 38.337 11.958  1.00 14.60 ? 239 GLY A C   1 
ATOM   1935 O O   . GLY A 1 239 ? 53.913 38.876 11.569  1.00 13.81 ? 239 GLY A O   1 
ATOM   1936 N N   . THR A 1 240 ? 52.756 37.019 12.031  1.00 14.42 ? 240 THR A N   1 
ATOM   1937 C CA  . THR A 1 240 ? 53.803 36.160 11.516  1.00 12.43 ? 240 THR A CA  1 
ATOM   1938 C C   . THR A 1 240 ? 53.238 35.349 10.355  1.00 14.64 ? 240 THR A C   1 
ATOM   1939 O O   . THR A 1 240 ? 52.034 35.412 10.066  1.00 13.01 ? 240 THR A O   1 
ATOM   1940 C CB  . THR A 1 240 ? 54.417 35.247 12.600  1.00 10.79 ? 240 THR A CB  1 
ATOM   1941 O OG1 . THR A 1 240 ? 53.430 34.354 13.123  1.00 7.90  ? 240 THR A OG1 1 
ATOM   1942 C CG2 . THR A 1 240 ? 54.988 36.079 13.721  1.00 8.59  ? 240 THR A CG2 1 
ATOM   1943 N N   . PHE A 1 241 ? 54.106 34.601 9.684   1.00 15.56 ? 241 PHE A N   1 
ATOM   1944 C CA  . PHE A 1 241 ? 53.695 33.802 8.539   1.00 16.68 ? 241 PHE A CA  1 
ATOM   1945 C C   . PHE A 1 241 ? 54.130 32.349 8.687   1.00 14.32 ? 241 PHE A C   1 
ATOM   1946 O O   . PHE A 1 241 ? 54.860 32.001 9.622   1.00 17.68 ? 241 PHE A O   1 
ATOM   1947 C CB  . PHE A 1 241 ? 54.312 34.400 7.266   1.00 13.58 ? 241 PHE A CB  1 
ATOM   1948 C CG  . PHE A 1 241 ? 53.997 35.856 7.074   1.00 13.66 ? 241 PHE A CG  1 
ATOM   1949 C CD1 . PHE A 1 241 ? 54.699 36.831 7.777   1.00 14.75 ? 241 PHE A CD1 1 
ATOM   1950 C CD2 . PHE A 1 241 ? 52.961 36.252 6.234   1.00 12.53 ? 241 PHE A CD2 1 
ATOM   1951 C CE1 . PHE A 1 241 ? 54.370 38.177 7.657   1.00 11.23 ? 241 PHE A CE1 1 
ATOM   1952 C CE2 . PHE A 1 241 ? 52.622 37.595 6.104   1.00 9.77  ? 241 PHE A CE2 1 
ATOM   1953 C CZ  . PHE A 1 241 ? 53.329 38.560 6.822   1.00 12.68 ? 241 PHE A CZ  1 
ATOM   1954 N N   . GLN A 1 242 ? 53.602 31.490 7.821   1.00 13.95 ? 242 GLN A N   1 
ATOM   1955 C CA  . GLN A 1 242 ? 53.982 30.082 7.811   1.00 15.68 ? 242 GLN A CA  1 
ATOM   1956 C C   . GLN A 1 242 ? 53.993 29.621 6.359   1.00 16.94 ? 242 GLN A C   1 
ATOM   1957 O O   . GLN A 1 242 ? 53.524 30.341 5.465   1.00 15.64 ? 242 GLN A O   1 
ATOM   1958 C CB  . GLN A 1 242 ? 53.058 29.199 8.672   1.00 17.19 ? 242 GLN A CB  1 
ATOM   1959 C CG  . GLN A 1 242 ? 51.606 29.085 8.234   1.00 17.07 ? 242 GLN A CG  1 
ATOM   1960 C CD  . GLN A 1 242 ? 50.884 27.858 8.819   1.00 16.83 ? 242 GLN A CD  1 
ATOM   1961 O OE1 . GLN A 1 242 ? 50.208 27.123 8.092   1.00 16.35 ? 242 GLN A OE1 1 
ATOM   1962 N NE2 . GLN A 1 242 ? 51.005 27.650 10.126  1.00 11.54 ? 242 GLN A NE2 1 
ATOM   1963 N N   . LYS A 1 243 ? 54.565 28.447 6.125   1.00 16.06 ? 243 LYS A N   1 
ATOM   1964 C CA  . LYS A 1 243 ? 54.652 27.883 4.791   1.00 11.81 ? 243 LYS A CA  1 
ATOM   1965 C C   . LYS A 1 243 ? 55.058 26.437 4.939   1.00 13.85 ? 243 LYS A C   1 
ATOM   1966 O O   . LYS A 1 243 ? 55.658 26.061 5.947   1.00 15.69 ? 243 LYS A O   1 
ATOM   1967 C CB  . LYS A 1 243 ? 55.734 28.604 3.981   1.00 10.41 ? 243 LYS A CB  1 
ATOM   1968 C CG  . LYS A 1 243 ? 55.744 28.281 2.482   1.00 13.22 ? 243 LYS A CG  1 
ATOM   1969 C CD  . LYS A 1 243 ? 56.975 28.887 1.814   1.00 17.22 ? 243 LYS A CD  1 
ATOM   1970 C CE  . LYS A 1 243 ? 56.942 28.751 0.302   1.00 14.90 ? 243 LYS A CE  1 
ATOM   1971 N NZ  . LYS A 1 243 ? 55.903 29.638 -0.280  1.00 21.54 ? 243 LYS A NZ  1 
ATOM   1972 N N   . TRP A 1 244 ? 54.695 25.627 3.951   1.00 14.80 ? 244 TRP A N   1 
ATOM   1973 C CA  . TRP A 1 244 ? 55.065 24.225 3.929   1.00 16.88 ? 244 TRP A CA  1 
ATOM   1974 C C   . TRP A 1 244 ? 55.375 23.810 2.497   1.00 21.51 ? 244 TRP A C   1 
ATOM   1975 O O   . TRP A 1 244 ? 54.912 24.448 1.540   1.00 18.91 ? 244 TRP A O   1 
ATOM   1976 C CB  . TRP A 1 244 ? 54.000 23.314 4.572   1.00 11.33 ? 244 TRP A CB  1 
ATOM   1977 C CG  . TRP A 1 244 ? 52.644 23.272 3.936   1.00 12.33 ? 244 TRP A CG  1 
ATOM   1978 C CD1 . TRP A 1 244 ? 51.509 23.862 4.405   1.00 15.45 ? 244 TRP A CD1 1 
ATOM   1979 C CD2 . TRP A 1 244 ? 52.257 22.540 2.762   1.00 15.31 ? 244 TRP A CD2 1 
ATOM   1980 N NE1 . TRP A 1 244 ? 50.439 23.542 3.604   1.00 16.63 ? 244 TRP A NE1 1 
ATOM   1981 C CE2 . TRP A 1 244 ? 50.869 22.732 2.588   1.00 16.51 ? 244 TRP A CE2 1 
ATOM   1982 C CE3 . TRP A 1 244 ? 52.948 21.740 1.840   1.00 16.47 ? 244 TRP A CE3 1 
ATOM   1983 C CZ2 . TRP A 1 244 ? 50.154 22.153 1.529   1.00 15.40 ? 244 TRP A CZ2 1 
ATOM   1984 C CZ3 . TRP A 1 244 ? 52.243 21.167 0.790   1.00 14.75 ? 244 TRP A CZ3 1 
ATOM   1985 C CH2 . TRP A 1 244 ? 50.856 21.376 0.642   1.00 13.17 ? 244 TRP A CH2 1 
ATOM   1986 N N   . ALA A 1 245 ? 56.221 22.791 2.371   1.00 23.26 ? 245 ALA A N   1 
ATOM   1987 C CA  . ALA A 1 245 ? 56.637 22.241 1.085   1.00 21.88 ? 245 ALA A CA  1 
ATOM   1988 C C   . ALA A 1 245 ? 56.659 20.738 1.279   1.00 22.44 ? 245 ALA A C   1 
ATOM   1989 O O   . ALA A 1 245 ? 57.198 20.261 2.278   1.00 25.47 ? 245 ALA A O   1 
ATOM   1990 C CB  . ALA A 1 245 ? 58.030 22.736 0.732   1.00 22.79 ? 245 ALA A CB  1 
ATOM   1991 N N   . SER A 1 246 ? 56.059 19.987 0.366   1.00 24.10 ? 246 SER A N   1 
ATOM   1992 C CA  . SER A 1 246 ? 56.044 18.536 0.517   1.00 30.53 ? 246 SER A CA  1 
ATOM   1993 C C   . SER A 1 246 ? 56.606 17.783 -0.675  1.00 33.74 ? 246 SER A C   1 
ATOM   1994 O O   . SER A 1 246 ? 56.761 18.340 -1.766  1.00 33.85 ? 246 SER A O   1 
ATOM   1995 C CB  . SER A 1 246 ? 54.636 18.024 0.845   1.00 28.52 ? 246 SER A CB  1 
ATOM   1996 O OG  . SER A 1 246 ? 53.702 18.365 -0.162  1.00 29.36 ? 246 SER A OG  1 
ATOM   1997 N N   . VAL A 1 247 ? 56.885 16.504 -0.457  1.00 35.22 ? 247 VAL A N   1 
ATOM   1998 C CA  . VAL A 1 247 ? 57.427 15.645 -1.493  1.00 37.06 ? 247 VAL A CA  1 
ATOM   1999 C C   . VAL A 1 247 ? 56.996 14.201 -1.217  1.00 37.47 ? 247 VAL A C   1 
ATOM   2000 O O   . VAL A 1 247 ? 56.958 13.764 -0.067  1.00 35.23 ? 247 VAL A O   1 
ATOM   2001 C CB  . VAL A 1 247 ? 58.985 15.779 -1.557  1.00 37.44 ? 247 VAL A CB  1 
ATOM   2002 C CG1 . VAL A 1 247 ? 59.647 15.211 -0.298  1.00 31.33 ? 247 VAL A CG1 1 
ATOM   2003 C CG2 . VAL A 1 247 ? 59.524 15.127 -2.813  1.00 40.26 ? 247 VAL A CG2 1 
ATOM   2004 N N   . VAL A 1 248 ? 56.555 13.507 -2.261  1.00 39.41 ? 248 VAL A N   1 
ATOM   2005 C CA  . VAL A 1 248 ? 56.136 12.116 -2.138  1.00 41.78 ? 248 VAL A CA  1 
ATOM   2006 C C   . VAL A 1 248 ? 57.337 11.240 -2.486  1.00 45.69 ? 248 VAL A C   1 
ATOM   2007 O O   . VAL A 1 248 ? 57.838 11.280 -3.613  1.00 47.55 ? 248 VAL A O   1 
ATOM   2008 C CB  . VAL A 1 248 ? 54.981 11.790 -3.091  1.00 40.70 ? 248 VAL A CB  1 
ATOM   2009 C CG1 . VAL A 1 248 ? 54.607 10.323 -2.972  1.00 39.78 ? 248 VAL A CG1 1 
ATOM   2010 C CG2 . VAL A 1 248 ? 53.791 12.672 -2.779  1.00 40.80 ? 248 VAL A CG2 1 
ATOM   2011 N N   . VAL A 1 249 ? 57.802 10.458 -1.521  1.00 44.90 ? 249 VAL A N   1 
ATOM   2012 C CA  . VAL A 1 249 ? 58.964 9.608  -1.735  1.00 45.74 ? 249 VAL A CA  1 
ATOM   2013 C C   . VAL A 1 249 ? 58.649 8.117  -1.605  1.00 49.26 ? 249 VAL A C   1 
ATOM   2014 O O   . VAL A 1 249 ? 57.567 7.739  -1.149  1.00 49.84 ? 249 VAL A O   1 
ATOM   2015 C CB  . VAL A 1 249 ? 60.108 9.989  -0.751  1.00 42.45 ? 249 VAL A CB  1 
ATOM   2016 C CG1 . VAL A 1 249 ? 60.303 11.494 -0.740  1.00 41.19 ? 249 VAL A CG1 1 
ATOM   2017 C CG2 . VAL A 1 249 ? 59.818 9.478  0.652   1.00 39.00 ? 249 VAL A CG2 1 
ATOM   2018 N N   . PRO A 1 250 ? 59.557 7.253  -2.093  1.00 52.00 ? 250 PRO A N   1 
ATOM   2019 C CA  . PRO A 1 250 ? 59.370 5.801  -2.015  1.00 51.78 ? 250 PRO A CA  1 
ATOM   2020 C C   . PRO A 1 250 ? 59.468 5.385  -0.551  1.00 52.33 ? 250 PRO A C   1 
ATOM   2021 O O   . PRO A 1 250 ? 60.363 5.838  0.165   1.00 50.01 ? 250 PRO A O   1 
ATOM   2022 C CB  . PRO A 1 250 ? 60.562 5.264  -2.804  1.00 53.14 ? 250 PRO A CB  1 
ATOM   2023 C CG  . PRO A 1 250 ? 60.842 6.353  -3.786  1.00 55.87 ? 250 PRO A CG  1 
ATOM   2024 C CD  . PRO A 1 250 ? 60.727 7.577  -2.926  1.00 53.57 ? 250 PRO A CD  1 
ATOM   2025 N N   . LEU A 1 251 ? 58.554 4.528  -0.111  1.00 55.00 ? 251 LEU A N   1 
ATOM   2026 C CA  . LEU A 1 251 ? 58.544 4.071  1.273   1.00 55.98 ? 251 LEU A CA  1 
ATOM   2027 C C   . LEU A 1 251 ? 59.878 3.433  1.624   1.00 57.95 ? 251 LEU A C   1 
ATOM   2028 O O   . LEU A 1 251 ? 60.387 2.595  0.878   1.00 60.12 ? 251 LEU A O   1 
ATOM   2029 C CB  . LEU A 1 251 ? 57.395 3.084  1.499   1.00 54.51 ? 251 LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 251 ? 57.198 2.506  2.903   1.00 55.01 ? 251 LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 251 ? 57.234 3.597  3.964   1.00 54.87 ? 251 LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 251 ? 55.876 1.764  2.941   1.00 55.59 ? 251 LEU A CD2 1 
ATOM   2033 N N   . GLY A 1 252 ? 60.449 3.861  2.746   1.00 61.48 ? 252 GLY A N   1 
ATOM   2034 C CA  . GLY A 1 252 ? 61.730 3.344  3.194   1.00 64.82 ? 252 GLY A CA  1 
ATOM   2035 C C   . GLY A 1 252 ? 62.912 4.153  2.682   1.00 68.67 ? 252 GLY A C   1 
ATOM   2036 O O   . GLY A 1 252 ? 64.062 3.856  3.012   1.00 68.77 ? 252 GLY A O   1 
ATOM   2037 N N   . LYS A 1 253 ? 62.632 5.200  1.910   1.00 70.47 ? 253 LYS A N   1 
ATOM   2038 C CA  . LYS A 1 253 ? 63.676 6.050  1.343   1.00 71.19 ? 253 LYS A CA  1 
ATOM   2039 C C   . LYS A 1 253 ? 63.614 7.473  1.919   1.00 68.93 ? 253 LYS A C   1 
ATOM   2040 O O   . LYS A 1 253 ? 64.354 8.365  1.493   1.00 65.53 ? 253 LYS A O   1 
ATOM   2041 C CB  . LYS A 1 253 ? 63.529 6.084  -0.183  1.00 76.06 ? 253 LYS A CB  1 
ATOM   2042 C CG  . LYS A 1 253 ? 64.669 6.758  -0.930  1.00 83.32 ? 253 LYS A CG  1 
ATOM   2043 C CD  . LYS A 1 253 ? 64.273 7.055  -2.369  1.00 86.78 ? 253 LYS A CD  1 
ATOM   2044 C CE  . LYS A 1 253 ? 65.366 7.805  -3.116  1.00 87.24 ? 253 LYS A CE  1 
ATOM   2045 N NZ  . LYS A 1 253 ? 64.854 8.340  -4.407  1.00 87.12 ? 253 LYS A NZ  1 
ATOM   2046 N N   . GLU A 1 254 ? 62.765 7.662  2.924   1.00 67.50 ? 254 GLU A N   1 
ATOM   2047 C CA  . GLU A 1 254 ? 62.585 8.958  3.574   1.00 67.60 ? 254 GLU A CA  1 
ATOM   2048 C C   . GLU A 1 254 ? 63.872 9.624  4.053   1.00 66.99 ? 254 GLU A C   1 
ATOM   2049 O O   . GLU A 1 254 ? 64.035 10.835 3.915   1.00 67.60 ? 254 GLU A O   1 
ATOM   2050 C CB  . GLU A 1 254 ? 61.625 8.836  4.762   1.00 67.28 ? 254 GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 254 ? 60.182 8.556  4.392   1.00 70.10 ? 254 GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 254 ? 59.894 7.083  4.185   1.00 72.15 ? 254 GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 254 ? 60.277 6.538  3.131   1.00 73.10 ? 254 GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 254 ? 59.264 6.473  5.072   1.00 72.80 ? 254 GLU A OE2 1 
ATOM   2055 N N   . GLN A 1 255 ? 64.787 8.834  4.608   1.00 66.75 ? 255 GLN A N   1 
ATOM   2056 C CA  . GLN A 1 255 ? 66.046 9.364  5.127   1.00 66.89 ? 255 GLN A CA  1 
ATOM   2057 C C   . GLN A 1 255 ? 67.046 9.926  4.120   1.00 65.00 ? 255 GLN A C   1 
ATOM   2058 O O   . GLN A 1 255 ? 68.077 10.475 4.509   1.00 65.64 ? 255 GLN A O   1 
ATOM   2059 C CB  . GLN A 1 255 ? 66.731 8.332  6.020   1.00 70.47 ? 255 GLN A CB  1 
ATOM   2060 C CG  . GLN A 1 255 ? 66.055 8.162  7.366   1.00 77.47 ? 255 GLN A CG  1 
ATOM   2061 C CD  . GLN A 1 255 ? 65.934 9.472  8.127   1.00 81.10 ? 255 GLN A CD  1 
ATOM   2062 O OE1 . GLN A 1 255 ? 66.744 10.388 7.949   1.00 83.42 ? 255 GLN A OE1 1 
ATOM   2063 N NE2 . GLN A 1 255 ? 64.918 9.572  8.971   1.00 82.33 ? 255 GLN A NE2 1 
ATOM   2064 N N   . TYR A 1 256 ? 66.768 9.781  2.832   1.00 61.38 ? 256 TYR A N   1 
ATOM   2065 C CA  . TYR A 1 256 ? 67.674 10.303 1.819   1.00 57.70 ? 256 TYR A CA  1 
ATOM   2066 C C   . TYR A 1 256 ? 67.259 11.717 1.413   1.00 54.67 ? 256 TYR A C   1 
ATOM   2067 O O   . TYR A 1 256 ? 67.899 12.343 0.566   1.00 55.79 ? 256 TYR A O   1 
ATOM   2068 C CB  . TYR A 1 256 ? 67.702 9.376  0.599   1.00 63.08 ? 256 TYR A CB  1 
ATOM   2069 C CG  . TYR A 1 256 ? 68.231 7.979  0.882   1.00 69.29 ? 256 TYR A CG  1 
ATOM   2070 C CD1 . TYR A 1 256 ? 68.594 7.592  2.177   1.00 70.92 ? 256 TYR A CD1 1 
ATOM   2071 C CD2 . TYR A 1 256 ? 68.356 7.040  -0.143  1.00 71.31 ? 256 TYR A CD2 1 
ATOM   2072 C CE1 . TYR A 1 256 ? 69.064 6.308  2.445   1.00 72.32 ? 256 TYR A CE1 1 
ATOM   2073 C CE2 . TYR A 1 256 ? 68.828 5.748  0.115   1.00 73.41 ? 256 TYR A CE2 1 
ATOM   2074 C CZ  . TYR A 1 256 ? 69.179 5.391  1.413   1.00 74.21 ? 256 TYR A CZ  1 
ATOM   2075 O OH  . TYR A 1 256 ? 69.642 4.122  1.680   1.00 75.32 ? 256 TYR A OH  1 
ATOM   2076 N N   . TYR A 1 257 ? 66.198 12.222 2.040   1.00 49.60 ? 257 TYR A N   1 
ATOM   2077 C CA  . TYR A 1 257 ? 65.672 13.551 1.745   1.00 44.17 ? 257 TYR A CA  1 
ATOM   2078 C C   . TYR A 1 257 ? 65.780 14.465 2.956   1.00 43.14 ? 257 TYR A C   1 
ATOM   2079 O O   . TYR A 1 257 ? 65.507 14.044 4.087   1.00 42.66 ? 257 TYR A O   1 
ATOM   2080 C CB  . TYR A 1 257 ? 64.209 13.458 1.308   1.00 39.28 ? 257 TYR A CB  1 
ATOM   2081 C CG  . TYR A 1 257 ? 63.990 12.628 0.068   1.00 39.84 ? 257 TYR A CG  1 
ATOM   2082 C CD1 . TYR A 1 257 ? 64.176 11.244 0.086   1.00 42.85 ? 257 TYR A CD1 1 
ATOM   2083 C CD2 . TYR A 1 257 ? 63.597 13.222 -1.125  1.00 42.64 ? 257 TYR A CD2 1 
ATOM   2084 C CE1 . TYR A 1 257 ? 63.979 10.470 -1.060  1.00 42.27 ? 257 TYR A CE1 1 
ATOM   2085 C CE2 . TYR A 1 257 ? 63.392 12.459 -2.276  1.00 45.01 ? 257 TYR A CE2 1 
ATOM   2086 C CZ  . TYR A 1 257 ? 63.585 11.085 -2.237  1.00 43.56 ? 257 TYR A CZ  1 
ATOM   2087 O OH  . TYR A 1 257 ? 63.369 10.337 -3.379  1.00 47.18 ? 257 TYR A OH  1 
ATOM   2088 N N   . THR A 1 258 ? 66.207 15.703 2.717   1.00 38.48 ? 258 THR A N   1 
ATOM   2089 C CA  . THR A 1 258 ? 66.348 16.695 3.778   1.00 37.99 ? 258 THR A CA  1 
ATOM   2090 C C   . THR A 1 258 ? 65.633 17.985 3.387   1.00 35.76 ? 258 THR A C   1 
ATOM   2091 O O   . THR A 1 258 ? 65.516 18.314 2.201   1.00 35.45 ? 258 THR A O   1 
ATOM   2092 C CB  . THR A 1 258 ? 67.839 17.033 4.086   1.00 39.17 ? 258 THR A CB  1 
ATOM   2093 O OG1 . THR A 1 258 ? 68.499 17.471 2.892   1.00 40.87 ? 258 THR A OG1 1 
ATOM   2094 C CG2 . THR A 1 258 ? 68.567 15.828 4.649   1.00 39.26 ? 258 THR A CG2 1 
ATOM   2095 N N   . CYS A 1 259 ? 65.144 18.705 4.387   1.00 31.70 ? 259 CYS A N   1 
ATOM   2096 C CA  . CYS A 1 259 ? 64.458 19.961 4.151   1.00 25.70 ? 259 CYS A CA  1 
ATOM   2097 C C   . CYS A 1 259 ? 65.376 21.092 4.582   1.00 26.77 ? 259 CYS A C   1 
ATOM   2098 O O   . CYS A 1 259 ? 65.987 21.025 5.654   1.00 25.01 ? 259 CYS A O   1 
ATOM   2099 C CB  . CYS A 1 259 ? 63.166 20.019 4.959   1.00 27.51 ? 259 CYS A CB  1 
ATOM   2100 S SG  . CYS A 1 259 ? 62.284 21.597 4.771   1.00 24.82 ? 259 CYS A SG  1 
ATOM   2101 N N   . HIS A 1 260 ? 65.486 22.123 3.752   1.00 22.64 ? 260 HIS A N   1 
ATOM   2102 C CA  . HIS A 1 260 ? 66.342 23.251 4.073   1.00 24.71 ? 260 HIS A CA  1 
ATOM   2103 C C   . HIS A 1 260 ? 65.527 24.524 4.135   1.00 24.57 ? 260 HIS A C   1 
ATOM   2104 O O   . HIS A 1 260 ? 64.692 24.791 3.263   1.00 24.11 ? 260 HIS A O   1 
ATOM   2105 C CB  . HIS A 1 260 ? 67.477 23.367 3.059   1.00 30.32 ? 260 HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 260 ? 68.328 22.140 2.986   1.00 35.75 ? 260 HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 260 ? 69.509 22.008 3.686   1.00 36.00 ? 260 HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 260 ? 68.131 20.958 2.354   1.00 35.36 ? 260 HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 260 ? 69.999 20.797 3.493   1.00 37.57 ? 260 HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 260 ? 69.182 20.139 2.690   1.00 39.71 ? 260 HIS A NE2 1 
ATOM   2111 N N   . VAL A 1 261 ? 65.761 25.292 5.190   1.00 21.14 ? 261 VAL A N   1 
ATOM   2112 C CA  . VAL A 1 261 ? 65.044 26.533 5.416   1.00 20.61 ? 261 VAL A CA  1 
ATOM   2113 C C   . VAL A 1 261 ? 66.006 27.712 5.467   1.00 19.05 ? 261 VAL A C   1 
ATOM   2114 O O   . VAL A 1 261 ? 66.891 27.755 6.320   1.00 17.92 ? 261 VAL A O   1 
ATOM   2115 C CB  . VAL A 1 261 ? 64.269 26.481 6.761   1.00 18.95 ? 261 VAL A CB  1 
ATOM   2116 C CG1 . VAL A 1 261 ? 63.371 27.702 6.902   1.00 14.32 ? 261 VAL A CG1 1 
ATOM   2117 C CG2 . VAL A 1 261 ? 63.470 25.186 6.869   1.00 12.80 ? 261 VAL A CG2 1 
ATOM   2118 N N   . TYR A 1 262 ? 65.822 28.664 4.559   1.00 17.67 ? 262 TYR A N   1 
ATOM   2119 C CA  . TYR A 1 262 ? 66.654 29.866 4.514   1.00 19.82 ? 262 TYR A CA  1 
ATOM   2120 C C   . TYR A 1 262 ? 65.779 31.066 4.881   1.00 20.86 ? 262 TYR A C   1 
ATOM   2121 O O   . TYR A 1 262 ? 64.703 31.272 4.303   1.00 21.59 ? 262 TYR A O   1 
ATOM   2122 C CB  . TYR A 1 262 ? 67.248 30.068 3.115   1.00 17.93 ? 262 TYR A CB  1 
ATOM   2123 C CG  . TYR A 1 262 ? 67.987 28.864 2.597   1.00 17.18 ? 262 TYR A CG  1 
ATOM   2124 C CD1 . TYR A 1 262 ? 67.298 27.783 2.055   1.00 16.74 ? 262 TYR A CD1 1 
ATOM   2125 C CD2 . TYR A 1 262 ? 69.372 28.792 2.675   1.00 18.71 ? 262 TYR A CD2 1 
ATOM   2126 C CE1 . TYR A 1 262 ? 67.970 26.660 1.611   1.00 20.33 ? 262 TYR A CE1 1 
ATOM   2127 C CE2 . TYR A 1 262 ? 70.054 27.679 2.233   1.00 17.99 ? 262 TYR A CE2 1 
ATOM   2128 C CZ  . TYR A 1 262 ? 69.352 26.614 1.704   1.00 20.79 ? 262 TYR A CZ  1 
ATOM   2129 O OH  . TYR A 1 262 ? 70.031 25.497 1.274   1.00 28.09 ? 262 TYR A OH  1 
ATOM   2130 N N   . HIS A 1 263 ? 66.229 31.846 5.850   1.00 14.82 ? 263 HIS A N   1 
ATOM   2131 C CA  . HIS A 1 263 ? 65.482 33.008 6.291   1.00 16.17 ? 263 HIS A CA  1 
ATOM   2132 C C   . HIS A 1 263 ? 66.503 33.943 6.921   1.00 19.02 ? 263 HIS A C   1 
ATOM   2133 O O   . HIS A 1 263 ? 67.520 33.477 7.446   1.00 20.84 ? 263 HIS A O   1 
ATOM   2134 C CB  . HIS A 1 263 ? 64.430 32.565 7.317   1.00 16.03 ? 263 HIS A CB  1 
ATOM   2135 C CG  . HIS A 1 263 ? 63.519 33.664 7.781   1.00 17.28 ? 263 HIS A CG  1 
ATOM   2136 N ND1 . HIS A 1 263 ? 62.434 34.095 7.046   1.00 17.87 ? 263 HIS A ND1 1 
ATOM   2137 C CD2 . HIS A 1 263 ? 63.520 34.404 8.915   1.00 12.36 ? 263 HIS A CD2 1 
ATOM   2138 C CE1 . HIS A 1 263 ? 61.806 35.048 7.709   1.00 17.91 ? 263 HIS A CE1 1 
ATOM   2139 N NE2 . HIS A 1 263 ? 62.445 35.255 8.847   1.00 17.01 ? 263 HIS A NE2 1 
ATOM   2140 N N   . GLN A 1 264 ? 66.259 35.251 6.880   1.00 19.77 ? 264 GLN A N   1 
ATOM   2141 C CA  . GLN A 1 264 ? 67.219 36.181 7.469   1.00 28.01 ? 264 GLN A CA  1 
ATOM   2142 C C   . GLN A 1 264 ? 67.399 36.005 8.976   1.00 29.59 ? 264 GLN A C   1 
ATOM   2143 O O   . GLN A 1 264 ? 68.399 36.428 9.538   1.00 36.72 ? 264 GLN A O   1 
ATOM   2144 C CB  . GLN A 1 264 ? 66.907 37.633 7.108   1.00 25.96 ? 264 GLN A CB  1 
ATOM   2145 C CG  . GLN A 1 264 ? 65.572 38.145 7.547   1.00 32.88 ? 264 GLN A CG  1 
ATOM   2146 C CD  . GLN A 1 264 ? 65.353 39.578 7.102   1.00 37.79 ? 264 GLN A CD  1 
ATOM   2147 O OE1 . GLN A 1 264 ? 65.273 39.862 5.907   1.00 39.24 ? 264 GLN A OE1 1 
ATOM   2148 N NE2 . GLN A 1 264 ? 65.271 40.491 8.059   1.00 42.31 ? 264 GLN A NE2 1 
ATOM   2149 N N   . GLY A 1 265 ? 66.446 35.339 9.619   1.00 31.97 ? 265 GLY A N   1 
ATOM   2150 C CA  . GLY A 1 265 ? 66.553 35.089 11.047  1.00 31.92 ? 265 GLY A CA  1 
ATOM   2151 C C   . GLY A 1 265 ? 67.339 33.820 11.336  1.00 33.31 ? 265 GLY A C   1 
ATOM   2152 O O   . GLY A 1 265 ? 67.333 33.309 12.454  1.00 36.22 ? 265 GLY A O   1 
ATOM   2153 N N   . LEU A 1 266 ? 67.976 33.271 10.312  1.00 32.62 ? 266 LEU A N   1 
ATOM   2154 C CA  . LEU A 1 266 ? 68.763 32.065 10.477  1.00 33.27 ? 266 LEU A CA  1 
ATOM   2155 C C   . LEU A 1 266 ? 70.181 32.335 9.996   1.00 37.69 ? 266 LEU A C   1 
ATOM   2156 O O   . LEU A 1 266 ? 70.412 32.508 8.798   1.00 36.42 ? 266 LEU A O   1 
ATOM   2157 C CB  . LEU A 1 266 ? 68.163 30.907 9.676   1.00 29.46 ? 266 LEU A CB  1 
ATOM   2158 C CG  . LEU A 1 266 ? 66.801 30.354 10.088  1.00 29.60 ? 266 LEU A CG  1 
ATOM   2159 C CD1 . LEU A 1 266 ? 66.407 29.247 9.133   1.00 26.52 ? 266 LEU A CD1 1 
ATOM   2160 C CD2 . LEU A 1 266 ? 66.852 29.826 11.511  1.00 30.28 ? 266 LEU A CD2 1 
ATOM   2161 N N   . PRO A 1 267 ? 71.144 32.431 10.931  1.00 40.94 ? 267 PRO A N   1 
ATOM   2162 C CA  . PRO A 1 267 ? 72.535 32.682 10.537  1.00 39.51 ? 267 PRO A CA  1 
ATOM   2163 C C   . PRO A 1 267 ? 72.970 31.558 9.599   1.00 35.36 ? 267 PRO A C   1 
ATOM   2164 O O   . PRO A 1 267 ? 73.637 31.786 8.586   1.00 37.44 ? 267 PRO A O   1 
ATOM   2165 C CB  . PRO A 1 267 ? 73.283 32.647 11.876  1.00 39.22 ? 267 PRO A CB  1 
ATOM   2166 C CG  . PRO A 1 267 ? 72.419 31.754 12.738  1.00 43.12 ? 267 PRO A CG  1 
ATOM   2167 C CD  . PRO A 1 267 ? 71.035 32.230 12.387  1.00 40.65 ? 267 PRO A CD  1 
ATOM   2168 N N   . GLU A 1 268 ? 72.527 30.353 9.927   1.00 32.31 ? 268 GLU A N   1 
ATOM   2169 C CA  . GLU A 1 268 ? 72.809 29.176 9.135   1.00 34.09 ? 268 GLU A CA  1 
ATOM   2170 C C   . GLU A 1 268 ? 71.470 28.491 8.899   1.00 32.27 ? 268 GLU A C   1 
ATOM   2171 O O   . GLU A 1 268 ? 70.646 28.389 9.814   1.00 29.36 ? 268 GLU A O   1 
ATOM   2172 C CB  . GLU A 1 268 ? 73.779 28.258 9.871   1.00 37.74 ? 268 GLU A CB  1 
ATOM   2173 C CG  . GLU A 1 268 ? 75.182 28.834 9.961   1.00 43.06 ? 268 GLU A CG  1 
ATOM   2174 C CD  . GLU A 1 268 ? 75.982 28.251 11.098  1.00 47.59 ? 268 GLU A CD  1 
ATOM   2175 O OE1 . GLU A 1 268 ? 75.382 27.790 12.095  1.00 51.42 ? 268 GLU A OE1 1 
ATOM   2176 O OE2 . GLU A 1 268 ? 77.228 28.286 11.030  1.00 51.09 ? 268 GLU A OE2 1 
ATOM   2177 N N   . PRO A 1 269 ? 71.206 28.092 7.646   1.00 31.15 ? 269 PRO A N   1 
ATOM   2178 C CA  . PRO A 1 269 ? 69.979 27.422 7.215   1.00 32.41 ? 269 PRO A CA  1 
ATOM   2179 C C   . PRO A 1 269 ? 69.676 26.168 8.024   1.00 34.48 ? 269 PRO A C   1 
ATOM   2180 O O   . PRO A 1 269 ? 70.586 25.474 8.477   1.00 37.82 ? 269 PRO A O   1 
ATOM   2181 C CB  . PRO A 1 269 ? 70.283 27.074 5.761   1.00 30.11 ? 269 PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 269 ? 71.191 28.179 5.347   1.00 31.72 ? 269 PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 269 ? 72.119 28.277 6.506   1.00 29.18 ? 269 PRO A CD  1 
ATOM   2184 N N   . LEU A 1 270 ? 68.393 25.881 8.201   1.00 34.73 ? 270 LEU A N   1 
ATOM   2185 C CA  . LEU A 1 270 ? 67.977 24.700 8.942   1.00 33.97 ? 270 LEU A CA  1 
ATOM   2186 C C   . LEU A 1 270 ? 67.946 23.502 8.008   1.00 35.56 ? 270 LEU A C   1 
ATOM   2187 O O   . LEU A 1 270 ? 67.560 23.622 6.841   1.00 38.41 ? 270 LEU A O   1 
ATOM   2188 C CB  . LEU A 1 270 ? 66.582 24.898 9.534   1.00 32.28 ? 270 LEU A CB  1 
ATOM   2189 C CG  . LEU A 1 270 ? 66.389 25.987 10.583  1.00 33.55 ? 270 LEU A CG  1 
ATOM   2190 C CD1 . LEU A 1 270 ? 64.923 26.050 10.954  1.00 34.37 ? 270 LEU A CD1 1 
ATOM   2191 C CD2 . LEU A 1 270 ? 67.240 25.704 11.813  1.00 32.86 ? 270 LEU A CD2 1 
ATOM   2192 N N   . THR A 1 271 ? 68.383 22.358 8.510   1.00 36.59 ? 271 THR A N   1 
ATOM   2193 C CA  . THR A 1 271 ? 68.366 21.134 7.733   1.00 40.78 ? 271 THR A CA  1 
ATOM   2194 C C   . THR A 1 271 ? 67.585 20.149 8.583   1.00 41.69 ? 271 THR A C   1 
ATOM   2195 O O   . THR A 1 271 ? 67.926 19.917 9.747   1.00 44.66 ? 271 THR A O   1 
ATOM   2196 C CB  . THR A 1 271 ? 69.784 20.609 7.451   1.00 43.38 ? 271 THR A CB  1 
ATOM   2197 O OG1 . THR A 1 271 ? 70.550 21.626 6.786   1.00 42.64 ? 271 THR A OG1 1 
ATOM   2198 C CG2 . THR A 1 271 ? 69.719 19.371 6.557   1.00 44.78 ? 271 THR A CG2 1 
ATOM   2199 N N   . LEU A 1 272 ? 66.494 19.632 8.030   1.00 42.77 ? 272 LEU A N   1 
ATOM   2200 C CA  . LEU A 1 272 ? 65.644 18.699 8.757   1.00 43.78 ? 272 LEU A CA  1 
ATOM   2201 C C   . LEU A 1 272 ? 65.512 17.368 8.055   1.00 44.72 ? 272 LEU A C   1 
ATOM   2202 O O   . LEU A 1 272 ? 65.774 17.251 6.858   1.00 43.61 ? 272 LEU A O   1 
ATOM   2203 C CB  . LEU A 1 272 ? 64.234 19.275 8.956   1.00 41.55 ? 272 LEU A CB  1 
ATOM   2204 C CG  . LEU A 1 272 ? 63.981 20.483 9.858   1.00 41.14 ? 272 LEU A CG  1 
ATOM   2205 C CD1 . LEU A 1 272 ? 64.411 21.769 9.174   1.00 38.22 ? 272 LEU A CD1 1 
ATOM   2206 C CD2 . LEU A 1 272 ? 62.504 20.536 10.180  1.00 39.66 ? 272 LEU A CD2 1 
ATOM   2207 N N   . ARG A 1 273 ? 65.045 16.389 8.819   1.00 50.17 ? 273 ARG A N   1 
ATOM   2208 C CA  . ARG A 1 273 ? 64.809 15.025 8.362   1.00 57.13 ? 273 ARG A CA  1 
ATOM   2209 C C   . ARG A 1 273 ? 63.612 14.536 9.170   1.00 59.40 ? 273 ARG A C   1 
ATOM   2210 O O   . ARG A 1 273 ? 63.189 15.201 10.123  1.00 59.40 ? 273 ARG A O   1 
ATOM   2211 C CB  . ARG A 1 273 ? 66.017 14.142 8.672   1.00 60.09 ? 273 ARG A CB  1 
ATOM   2212 C CG  . ARG A 1 273 ? 67.221 14.404 7.802   1.00 64.25 ? 273 ARG A CG  1 
ATOM   2213 C CD  . ARG A 1 273 ? 68.475 13.790 8.394   1.00 67.88 ? 273 ARG A CD  1 
ATOM   2214 N NE  . ARG A 1 273 ? 69.493 13.599 7.367   1.00 72.03 ? 273 ARG A NE  1 
ATOM   2215 C CZ  . ARG A 1 273 ? 69.517 12.558 6.540   1.00 73.60 ? 273 ARG A CZ  1 
ATOM   2216 N NH1 . ARG A 1 273 ? 68.585 11.619 6.637   1.00 73.47 ? 273 ARG A NH1 1 
ATOM   2217 N NH2 . ARG A 1 273 ? 70.451 12.468 5.601   1.00 74.31 ? 273 ARG A NH2 1 
ATOM   2218 N N   . TRP A 1 274 ? 63.040 13.408 8.769   1.00 62.08 ? 274 TRP A N   1 
ATOM   2219 C CA  . TRP A 1 274 ? 61.907 12.860 9.494   1.00 63.97 ? 274 TRP A CA  1 
ATOM   2220 C C   . TRP A 1 274 ? 62.449 12.012 10.637  1.00 64.65 ? 274 TRP A C   1 
ATOM   2221 O O   . TRP A 1 274 ? 63.053 10.957 10.351  1.00 65.98 ? 274 TRP A O   1 
ATOM   2222 C CB  . TRP A 1 274 ? 61.016 12.021 8.571   1.00 64.09 ? 274 TRP A CB  1 
ATOM   2223 C CG  . TRP A 1 274 ? 59.806 11.484 9.268   1.00 62.80 ? 274 TRP A CG  1 
ATOM   2224 C CD1 . TRP A 1 274 ? 58.943 12.180 10.061  1.00 61.14 ? 274 TRP A CD1 1 
ATOM   2225 C CD2 . TRP A 1 274 ? 59.353 10.125 9.274   1.00 64.53 ? 274 TRP A CD2 1 
ATOM   2226 N NE1 . TRP A 1 274 ? 57.984 11.339 10.569  1.00 64.36 ? 274 TRP A NE1 1 
ATOM   2227 C CE2 . TRP A 1 274 ? 58.210 10.071 10.102  1.00 64.85 ? 274 TRP A CE2 1 
ATOM   2228 C CE3 . TRP A 1 274 ? 59.801 8.947  8.663   1.00 66.90 ? 274 TRP A CE3 1 
ATOM   2229 C CZ2 . TRP A 1 274 ? 57.508 8.883  10.336  1.00 66.16 ? 274 TRP A CZ2 1 
ATOM   2230 C CZ3 . TRP A 1 274 ? 59.101 7.762  8.895   1.00 67.73 ? 274 TRP A CZ3 1 
ATOM   2231 C CH2 . TRP A 1 274 ? 57.967 7.742  9.726   1.00 67.47 ? 274 TRP A CH2 1 
ATOM   2232 O OXT . TRP A 1 274 ? 62.306 12.441 11.799  1.00 64.52 ? 274 TRP A OXT 1 
ATOM   2233 N N   . ILE B 2 1   ? 35.956 39.233 -14.146 1.00 68.18 ? 1   ILE B N   1 
ATOM   2234 C CA  . ILE B 2 1   ? 36.711 37.944 -14.085 1.00 67.43 ? 1   ILE B CA  1 
ATOM   2235 C C   . ILE B 2 1   ? 36.224 37.089 -12.914 1.00 66.00 ? 1   ILE B C   1 
ATOM   2236 O O   . ILE B 2 1   ? 36.061 37.592 -11.797 1.00 66.76 ? 1   ILE B O   1 
ATOM   2237 C CB  . ILE B 2 1   ? 38.240 38.192 -13.961 1.00 66.57 ? 1   ILE B CB  1 
ATOM   2238 C CG1 . ILE B 2 1   ? 38.774 38.822 -15.251 1.00 64.63 ? 1   ILE B CG1 1 
ATOM   2239 C CG2 . ILE B 2 1   ? 38.978 36.894 -13.643 1.00 66.99 ? 1   ILE B CG2 1 
ATOM   2240 C CD1 . ILE B 2 1   ? 38.456 38.032 -16.511 1.00 62.05 ? 1   ILE B CD1 1 
ATOM   2241 N N   . GLN B 2 2   ? 35.997 35.804 -13.178 1.00 60.24 ? 2   GLN B N   1 
ATOM   2242 C CA  . GLN B 2 2   ? 35.520 34.877 -12.160 1.00 56.84 ? 2   GLN B CA  1 
ATOM   2243 C C   . GLN B 2 2   ? 36.579 33.816 -11.852 1.00 53.40 ? 2   GLN B C   1 
ATOM   2244 O O   . GLN B 2 2   ? 37.007 33.080 -12.740 1.00 53.75 ? 2   GLN B O   1 
ATOM   2245 C CB  . GLN B 2 2   ? 34.227 34.212 -12.629 1.00 57.29 ? 2   GLN B CB  1 
ATOM   2246 C CG  . GLN B 2 2   ? 33.543 33.372 -11.574 1.00 62.36 ? 2   GLN B CG  1 
ATOM   2247 C CD  . GLN B 2 2   ? 32.393 32.562 -12.138 1.00 65.39 ? 2   GLN B CD  1 
ATOM   2248 O OE1 . GLN B 2 2   ? 32.562 31.798 -13.087 1.00 66.75 ? 2   GLN B OE1 1 
ATOM   2249 N NE2 . GLN B 2 2   ? 31.216 32.719 -11.551 1.00 68.37 ? 2   GLN B NE2 1 
ATOM   2250 N N   . LYS B 2 3   ? 37.012 33.759 -10.595 1.00 46.34 ? 3   LYS B N   1 
ATOM   2251 C CA  . LYS B 2 3   ? 38.020 32.803 -10.155 1.00 38.75 ? 3   LYS B CA  1 
ATOM   2252 C C   . LYS B 2 3   ? 37.558 32.129 -8.876  1.00 36.68 ? 3   LYS B C   1 
ATOM   2253 O O   . LYS B 2 3   ? 37.062 32.788 -7.960  1.00 37.43 ? 3   LYS B O   1 
ATOM   2254 C CB  . LYS B 2 3   ? 39.362 33.502 -9.922  1.00 38.81 ? 3   LYS B CB  1 
ATOM   2255 C CG  . LYS B 2 3   ? 40.022 33.986 -11.196 1.00 45.31 ? 3   LYS B CG  1 
ATOM   2256 C CD  . LYS B 2 3   ? 41.343 34.691 -10.936 1.00 52.89 ? 3   LYS B CD  1 
ATOM   2257 C CE  . LYS B 2 3   ? 41.977 35.138 -12.252 1.00 56.59 ? 3   LYS B CE  1 
ATOM   2258 N NZ  . LYS B 2 3   ? 43.222 35.927 -12.064 1.00 60.05 ? 3   LYS B NZ  1 
ATOM   2259 N N   . THR B 2 4   ? 37.692 30.811 -8.835  1.00 35.89 ? 4   THR B N   1 
ATOM   2260 C CA  . THR B 2 4   ? 37.290 30.032 -7.675  1.00 33.51 ? 4   THR B CA  1 
ATOM   2261 C C   . THR B 2 4   ? 38.352 30.145 -6.583  1.00 28.84 ? 4   THR B C   1 
ATOM   2262 O O   . THR B 2 4   ? 39.551 30.000 -6.846  1.00 24.37 ? 4   THR B O   1 
ATOM   2263 C CB  . THR B 2 4   ? 37.047 28.563 -8.066  1.00 38.11 ? 4   THR B CB  1 
ATOM   2264 O OG1 . THR B 2 4   ? 35.993 28.514 -9.037  1.00 43.07 ? 4   THR B OG1 1 
ATOM   2265 C CG2 . THR B 2 4   ? 36.640 27.728 -6.855  1.00 39.80 ? 4   THR B CG2 1 
ATOM   2266 N N   . PRO B 2 5   ? 37.915 30.415 -5.342  1.00 21.88 ? 5   PRO B N   1 
ATOM   2267 C CA  . PRO B 2 5   ? 38.785 30.569 -4.175  1.00 22.14 ? 5   PRO B CA  1 
ATOM   2268 C C   . PRO B 2 5   ? 39.464 29.306 -3.681  1.00 23.23 ? 5   PRO B C   1 
ATOM   2269 O O   . PRO B 2 5   ? 38.893 28.218 -3.738  1.00 23.96 ? 5   PRO B O   1 
ATOM   2270 C CB  . PRO B 2 5   ? 37.826 31.112 -3.120  1.00 21.33 ? 5   PRO B CB  1 
ATOM   2271 C CG  . PRO B 2 5   ? 36.543 30.441 -3.465  1.00 21.36 ? 5   PRO B CG  1 
ATOM   2272 C CD  . PRO B 2 5   ? 36.504 30.605 -4.963  1.00 19.93 ? 5   PRO B CD  1 
ATOM   2273 N N   . GLN B 2 6   ? 40.700 29.464 -3.218  1.00 23.59 ? 6   GLN B N   1 
ATOM   2274 C CA  . GLN B 2 6   ? 41.473 28.365 -2.648  1.00 25.09 ? 6   GLN B CA  1 
ATOM   2275 C C   . GLN B 2 6   ? 41.307 28.595 -1.152  1.00 21.54 ? 6   GLN B C   1 
ATOM   2276 O O   . GLN B 2 6   ? 41.595 29.683 -0.660  1.00 21.66 ? 6   GLN B O   1 
ATOM   2277 C CB  . GLN B 2 6   ? 42.952 28.487 -3.021  1.00 30.88 ? 6   GLN B CB  1 
ATOM   2278 C CG  . GLN B 2 6   ? 43.225 28.498 -4.511  1.00 40.53 ? 6   GLN B CG  1 
ATOM   2279 C CD  . GLN B 2 6   ? 42.856 27.190 -5.170  1.00 48.70 ? 6   GLN B CD  1 
ATOM   2280 O OE1 . GLN B 2 6   ? 43.574 26.200 -5.047  1.00 53.67 ? 6   GLN B OE1 1 
ATOM   2281 N NE2 . GLN B 2 6   ? 41.721 27.168 -5.859  1.00 52.54 ? 6   GLN B NE2 1 
ATOM   2282 N N   . ILE B 2 7   ? 40.795 27.602 -0.438  1.00 21.23 ? 7   ILE B N   1 
ATOM   2283 C CA  . ILE B 2 7   ? 40.576 27.740 0.997   1.00 18.93 ? 7   ILE B CA  1 
ATOM   2284 C C   . ILE B 2 7   ? 41.569 26.916 1.797   1.00 19.06 ? 7   ILE B C   1 
ATOM   2285 O O   . ILE B 2 7   ? 41.659 25.698 1.625   1.00 21.33 ? 7   ILE B O   1 
ATOM   2286 C CB  . ILE B 2 7   ? 39.140 27.323 1.379   1.00 17.52 ? 7   ILE B CB  1 
ATOM   2287 C CG1 . ILE B 2 7   ? 38.133 28.166 0.591   1.00 12.83 ? 7   ILE B CG1 1 
ATOM   2288 C CG2 . ILE B 2 7   ? 38.916 27.498 2.881   1.00 14.13 ? 7   ILE B CG2 1 
ATOM   2289 C CD1 . ILE B 2 7   ? 36.987 27.379 0.057   1.00 18.11 ? 7   ILE B CD1 1 
ATOM   2290 N N   . GLN B 2 8   ? 42.319 27.581 2.667   1.00 14.72 ? 8   GLN B N   1 
ATOM   2291 C CA  . GLN B 2 8   ? 43.304 26.895 3.492   1.00 16.31 ? 8   GLN B CA  1 
ATOM   2292 C C   . GLN B 2 8   ? 42.970 27.114 4.962   1.00 14.65 ? 8   GLN B C   1 
ATOM   2293 O O   . GLN B 2 8   ? 42.730 28.244 5.389   1.00 16.58 ? 8   GLN B O   1 
ATOM   2294 C CB  . GLN B 2 8   ? 44.699 27.428 3.182   1.00 17.86 ? 8   GLN B CB  1 
ATOM   2295 C CG  . GLN B 2 8   ? 45.068 27.335 1.718   1.00 25.89 ? 8   GLN B CG  1 
ATOM   2296 C CD  . GLN B 2 8   ? 46.286 28.157 1.391   1.00 29.46 ? 8   GLN B CD  1 
ATOM   2297 O OE1 . GLN B 2 8   ? 47.373 27.882 1.879   1.00 37.29 ? 8   GLN B OE1 1 
ATOM   2298 N NE2 . GLN B 2 8   ? 46.109 29.187 0.582   1.00 36.45 ? 8   GLN B NE2 1 
ATOM   2299 N N   . VAL B 2 9   ? 42.929 26.031 5.726   1.00 13.48 ? 9   VAL B N   1 
ATOM   2300 C CA  . VAL B 2 9   ? 42.623 26.106 7.151   1.00 16.08 ? 9   VAL B CA  1 
ATOM   2301 C C   . VAL B 2 9   ? 43.846 25.602 7.912   1.00 15.10 ? 9   VAL B C   1 
ATOM   2302 O O   . VAL B 2 9   ? 44.420 24.570 7.562   1.00 18.60 ? 9   VAL B O   1 
ATOM   2303 C CB  . VAL B 2 9   ? 41.380 25.256 7.487   1.00 18.49 ? 9   VAL B CB  1 
ATOM   2304 C CG1 . VAL B 2 9   ? 40.982 25.448 8.945   1.00 16.69 ? 9   VAL B CG1 1 
ATOM   2305 C CG2 . VAL B 2 9   ? 40.225 25.645 6.562   1.00 12.90 ? 9   VAL B CG2 1 
ATOM   2306 N N   . TYR B 2 10  ? 44.264 26.338 8.931   1.00 9.51  ? 10  TYR B N   1 
ATOM   2307 C CA  . TYR B 2 10  ? 45.447 25.960 9.692   1.00 10.11 ? 10  TYR B CA  1 
ATOM   2308 C C   . TYR B 2 10  ? 45.534 26.742 10.994  1.00 9.43  ? 10  TYR B C   1 
ATOM   2309 O O   . TYR B 2 10  ? 44.924 27.801 11.134  1.00 12.50 ? 10  TYR B O   1 
ATOM   2310 C CB  . TYR B 2 10  ? 46.711 26.224 8.851   1.00 8.78  ? 10  TYR B CB  1 
ATOM   2311 C CG  . TYR B 2 10  ? 46.785 27.630 8.287   1.00 9.89  ? 10  TYR B CG  1 
ATOM   2312 C CD1 . TYR B 2 10  ? 46.153 27.954 7.087   1.00 8.16  ? 10  TYR B CD1 1 
ATOM   2313 C CD2 . TYR B 2 10  ? 47.465 28.641 8.962   1.00 10.69 ? 10  TYR B CD2 1 
ATOM   2314 C CE1 . TYR B 2 10  ? 46.194 29.246 6.579   1.00 6.46  ? 10  TYR B CE1 1 
ATOM   2315 C CE2 . TYR B 2 10  ? 47.513 29.937 8.456   1.00 10.42 ? 10  TYR B CE2 1 
ATOM   2316 C CZ  . TYR B 2 10  ? 46.874 30.228 7.266   1.00 9.86  ? 10  TYR B CZ  1 
ATOM   2317 O OH  . TYR B 2 10  ? 46.915 31.506 6.763   1.00 14.20 ? 10  TYR B OH  1 
ATOM   2318 N N   . SER B 2 11  ? 46.302 26.225 11.942  1.00 10.27 ? 11  SER B N   1 
ATOM   2319 C CA  . SER B 2 11  ? 46.475 26.891 13.222  1.00 12.41 ? 11  SER B CA  1 
ATOM   2320 C C   . SER B 2 11  ? 47.825 27.613 13.278  1.00 13.83 ? 11  SER B C   1 
ATOM   2321 O O   . SER B 2 11  ? 48.716 27.364 12.465  1.00 13.45 ? 11  SER B O   1 
ATOM   2322 C CB  . SER B 2 11  ? 46.364 25.870 14.351  1.00 11.13 ? 11  SER B CB  1 
ATOM   2323 O OG  . SER B 2 11  ? 47.192 24.749 14.089  1.00 15.39 ? 11  SER B OG  1 
ATOM   2324 N N   . ARG B 2 12  ? 47.957 28.538 14.218  1.00 17.97 ? 12  ARG B N   1 
ATOM   2325 C CA  . ARG B 2 12  ? 49.191 29.289 14.389  1.00 15.26 ? 12  ARG B CA  1 
ATOM   2326 C C   . ARG B 2 12  ? 50.327 28.409 14.901  1.00 19.58 ? 12  ARG B C   1 
ATOM   2327 O O   . ARG B 2 12  ? 51.473 28.557 14.469  1.00 19.18 ? 12  ARG B O   1 
ATOM   2328 C CB  . ARG B 2 12  ? 48.962 30.457 15.343  1.00 12.94 ? 12  ARG B CB  1 
ATOM   2329 C CG  . ARG B 2 12  ? 50.218 31.103 15.876  1.00 18.56 ? 12  ARG B CG  1 
ATOM   2330 C CD  . ARG B 2 12  ? 51.082 31.692 14.782  1.00 19.22 ? 12  ARG B CD  1 
ATOM   2331 N NE  . ARG B 2 12  ? 52.286 32.275 15.360  1.00 18.14 ? 12  ARG B NE  1 
ATOM   2332 C CZ  . ARG B 2 12  ? 53.383 31.592 15.663  1.00 15.49 ? 12  ARG B CZ  1 
ATOM   2333 N NH1 . ARG B 2 12  ? 53.450 30.293 15.412  1.00 10.25 ? 12  ARG B NH1 1 
ATOM   2334 N NH2 . ARG B 2 12  ? 54.371 32.190 16.317  1.00 13.01 ? 12  ARG B NH2 1 
ATOM   2335 N N   . HIS B 2 13  ? 50.019 27.530 15.849  1.00 15.82 ? 13  HIS B N   1 
ATOM   2336 C CA  . HIS B 2 13  ? 51.020 26.636 16.426  1.00 18.05 ? 13  HIS B CA  1 
ATOM   2337 C C   . HIS B 2 13  ? 50.564 25.202 16.243  1.00 18.71 ? 13  HIS B C   1 
ATOM   2338 O O   . HIS B 2 13  ? 49.401 24.962 15.917  1.00 22.67 ? 13  HIS B O   1 
ATOM   2339 C CB  . HIS B 2 13  ? 51.137 26.858 17.943  1.00 17.65 ? 13  HIS B CB  1 
ATOM   2340 C CG  . HIS B 2 13  ? 51.224 28.291 18.356  1.00 19.73 ? 13  HIS B CG  1 
ATOM   2341 N ND1 . HIS B 2 13  ? 52.425 28.944 18.534  1.00 16.13 ? 13  HIS B ND1 1 
ATOM   2342 C CD2 . HIS B 2 13  ? 50.257 29.194 18.646  1.00 20.40 ? 13  HIS B CD2 1 
ATOM   2343 C CE1 . HIS B 2 13  ? 52.195 30.188 18.913  1.00 18.49 ? 13  HIS B CE1 1 
ATOM   2344 N NE2 . HIS B 2 13  ? 50.888 30.365 18.988  1.00 22.92 ? 13  HIS B NE2 1 
ATOM   2345 N N   . PRO B 2 14  ? 51.477 24.227 16.421  1.00 21.41 ? 14  PRO B N   1 
ATOM   2346 C CA  . PRO B 2 14  ? 51.068 22.826 16.280  1.00 20.66 ? 14  PRO B CA  1 
ATOM   2347 C C   . PRO B 2 14  ? 50.040 22.678 17.404  1.00 22.23 ? 14  PRO B C   1 
ATOM   2348 O O   . PRO B 2 14  ? 50.280 23.129 18.524  1.00 21.52 ? 14  PRO B O   1 
ATOM   2349 C CB  . PRO B 2 14  ? 52.349 22.065 16.616  1.00 23.57 ? 14  PRO B CB  1 
ATOM   2350 C CG  . PRO B 2 14  ? 53.429 23.003 16.173  1.00 22.94 ? 14  PRO B CG  1 
ATOM   2351 C CD  . PRO B 2 14  ? 52.923 24.327 16.685  1.00 20.80 ? 14  PRO B CD  1 
ATOM   2352 N N   . PRO B 2 15  ? 48.865 22.111 17.113  1.00 23.19 ? 15  PRO B N   1 
ATOM   2353 C CA  . PRO B 2 15  ? 47.868 21.979 18.178  1.00 25.74 ? 15  PRO B CA  1 
ATOM   2354 C C   . PRO B 2 15  ? 48.250 21.139 19.400  1.00 28.06 ? 15  PRO B C   1 
ATOM   2355 O O   . PRO B 2 15  ? 48.833 20.064 19.281  1.00 30.72 ? 15  PRO B O   1 
ATOM   2356 C CB  . PRO B 2 15  ? 46.663 21.396 17.436  1.00 23.65 ? 15  PRO B CB  1 
ATOM   2357 C CG  . PRO B 2 15  ? 47.298 20.573 16.362  1.00 19.47 ? 15  PRO B CG  1 
ATOM   2358 C CD  . PRO B 2 15  ? 48.391 21.489 15.865  1.00 19.36 ? 15  PRO B CD  1 
ATOM   2359 N N   . GLU B 2 16  ? 47.930 21.656 20.577  1.00 30.31 ? 16  GLU B N   1 
ATOM   2360 C CA  . GLU B 2 16  ? 48.174 20.952 21.829  1.00 36.24 ? 16  GLU B CA  1 
ATOM   2361 C C   . GLU B 2 16  ? 46.881 21.151 22.606  1.00 33.87 ? 16  GLU B C   1 
ATOM   2362 O O   . GLU B 2 16  ? 46.523 22.278 22.958  1.00 31.01 ? 16  GLU B O   1 
ATOM   2363 C CB  . GLU B 2 16  ? 49.331 21.569 22.612  1.00 43.17 ? 16  GLU B CB  1 
ATOM   2364 C CG  . GLU B 2 16  ? 50.645 21.656 21.871  1.00 56.25 ? 16  GLU B CG  1 
ATOM   2365 C CD  . GLU B 2 16  ? 51.697 22.365 22.691  1.00 62.14 ? 16  GLU B CD  1 
ATOM   2366 O OE1 . GLU B 2 16  ? 51.618 23.604 22.846  1.00 63.69 ? 16  GLU B OE1 1 
ATOM   2367 O OE2 . GLU B 2 16  ? 52.561 21.675 23.268  1.00 67.67 ? 16  GLU B OE2 1 
ATOM   2368 N N   . ASN B 2 17  ? 46.160 20.067 22.847  1.00 32.39 ? 17  ASN B N   1 
ATOM   2369 C CA  . ASN B 2 17  ? 44.896 20.168 23.562  1.00 32.82 ? 17  ASN B CA  1 
ATOM   2370 C C   . ASN B 2 17  ? 45.037 20.953 24.855  1.00 31.00 ? 17  ASN B C   1 
ATOM   2371 O O   . ASN B 2 17  ? 45.970 20.731 25.627  1.00 36.33 ? 17  ASN B O   1 
ATOM   2372 C CB  . ASN B 2 17  ? 44.310 18.778 23.813  1.00 29.99 ? 17  ASN B CB  1 
ATOM   2373 C CG  . ASN B 2 17  ? 43.879 18.093 22.523  1.00 31.37 ? 17  ASN B CG  1 
ATOM   2374 O OD1 . ASN B 2 17  ? 43.541 18.752 21.532  1.00 29.23 ? 17  ASN B OD1 1 
ATOM   2375 N ND2 . ASN B 2 17  ? 43.903 16.770 22.522  1.00 31.96 ? 17  ASN B ND2 1 
ATOM   2376 N N   . GLY B 2 18  ? 44.161 21.930 25.042  1.00 24.73 ? 18  GLY B N   1 
ATOM   2377 C CA  . GLY B 2 18  ? 44.207 22.732 26.243  1.00 29.91 ? 18  GLY B CA  1 
ATOM   2378 C C   . GLY B 2 18  ? 45.015 24.006 26.100  1.00 34.59 ? 18  GLY B C   1 
ATOM   2379 O O   . GLY B 2 18  ? 44.839 24.939 26.882  1.00 38.64 ? 18  GLY B O   1 
ATOM   2380 N N   . LYS B 2 19  ? 45.888 24.069 25.102  1.00 37.29 ? 19  LYS B N   1 
ATOM   2381 C CA  . LYS B 2 19  ? 46.707 25.261 24.901  1.00 37.45 ? 19  LYS B CA  1 
ATOM   2382 C C   . LYS B 2 19  ? 46.026 26.198 23.915  1.00 35.98 ? 19  LYS B C   1 
ATOM   2383 O O   . LYS B 2 19  ? 45.586 25.767 22.849  1.00 40.20 ? 19  LYS B O   1 
ATOM   2384 C CB  . LYS B 2 19  ? 48.079 24.882 24.345  1.00 42.34 ? 19  LYS B CB  1 
ATOM   2385 C CG  . LYS B 2 19  ? 48.779 23.756 25.075  1.00 48.01 ? 19  LYS B CG  1 
ATOM   2386 C CD  . LYS B 2 19  ? 49.790 24.259 26.085  1.00 51.81 ? 19  LYS B CD  1 
ATOM   2387 C CE  . LYS B 2 19  ? 50.664 23.111 26.575  1.00 54.87 ? 19  LYS B CE  1 
ATOM   2388 N NZ  . LYS B 2 19  ? 51.340 22.420 25.439  1.00 54.48 ? 19  LYS B NZ  1 
ATOM   2389 N N   . PRO B 2 20  ? 45.892 27.483 24.273  1.00 31.39 ? 20  PRO B N   1 
ATOM   2390 C CA  . PRO B 2 20  ? 45.261 28.461 23.387  1.00 30.44 ? 20  PRO B CA  1 
ATOM   2391 C C   . PRO B 2 20  ? 46.028 28.528 22.066  1.00 31.91 ? 20  PRO B C   1 
ATOM   2392 O O   . PRO B 2 20  ? 47.232 28.259 22.022  1.00 33.57 ? 20  PRO B O   1 
ATOM   2393 C CB  . PRO B 2 20  ? 45.379 29.752 24.182  1.00 31.05 ? 20  PRO B CB  1 
ATOM   2394 C CG  . PRO B 2 20  ? 45.219 29.271 25.585  1.00 34.38 ? 20  PRO B CG  1 
ATOM   2395 C CD  . PRO B 2 20  ? 46.136 28.069 25.600  1.00 33.87 ? 20  PRO B CD  1 
ATOM   2396 N N   . ASN B 2 21  ? 45.342 28.923 21.000  1.00 27.43 ? 21  ASN B N   1 
ATOM   2397 C CA  . ASN B 2 21  ? 45.948 28.975 19.681  1.00 19.27 ? 21  ASN B CA  1 
ATOM   2398 C C   . ASN B 2 21  ? 45.104 29.899 18.805  1.00 18.64 ? 21  ASN B C   1 
ATOM   2399 O O   . ASN B 2 21  ? 44.202 30.575 19.297  1.00 23.31 ? 21  ASN B O   1 
ATOM   2400 C CB  . ASN B 2 21  ? 45.944 27.553 19.105  1.00 18.49 ? 21  ASN B CB  1 
ATOM   2401 C CG  . ASN B 2 21  ? 47.025 27.329 18.069  1.00 18.68 ? 21  ASN B CG  1 
ATOM   2402 O OD1 . ASN B 2 21  ? 47.471 28.263 17.402  1.00 19.06 ? 21  ASN B OD1 1 
ATOM   2403 N ND2 . ASN B 2 21  ? 47.455 26.082 17.928  1.00 16.49 ? 21  ASN B ND2 1 
ATOM   2404 N N   . ILE B 2 22  ? 45.411 29.952 17.516  1.00 19.39 ? 22  ILE B N   1 
ATOM   2405 C CA  . ILE B 2 22  ? 44.657 30.771 16.579  1.00 18.18 ? 22  ILE B CA  1 
ATOM   2406 C C   . ILE B 2 22  ? 44.342 29.885 15.392  1.00 17.57 ? 22  ILE B C   1 
ATOM   2407 O O   . ILE B 2 22  ? 45.207 29.133 14.930  1.00 21.34 ? 22  ILE B O   1 
ATOM   2408 C CB  . ILE B 2 22  ? 45.475 31.976 16.061  1.00 17.55 ? 22  ILE B CB  1 
ATOM   2409 C CG1 . ILE B 2 22  ? 45.821 32.921 17.209  1.00 18.31 ? 22  ILE B CG1 1 
ATOM   2410 C CG2 . ILE B 2 22  ? 44.696 32.723 14.979  1.00 16.18 ? 22  ILE B CG2 1 
ATOM   2411 C CD1 . ILE B 2 22  ? 46.722 34.072 16.801  1.00 18.62 ? 22  ILE B CD1 1 
ATOM   2412 N N   . LEU B 2 23  ? 43.089 29.904 14.962  1.00 12.85 ? 23  LEU B N   1 
ATOM   2413 C CA  . LEU B 2 23  ? 42.673 29.133 13.806  1.00 14.16 ? 23  LEU B CA  1 
ATOM   2414 C C   . LEU B 2 23  ? 42.560 30.126 12.655  1.00 14.00 ? 23  LEU B C   1 
ATOM   2415 O O   . LEU B 2 23  ? 41.968 31.195 12.805  1.00 10.42 ? 23  LEU B O   1 
ATOM   2416 C CB  . LEU B 2 23  ? 41.322 28.467 14.051  1.00 16.58 ? 23  LEU B CB  1 
ATOM   2417 C CG  . LEU B 2 23  ? 40.856 27.529 12.938  1.00 15.88 ? 23  LEU B CG  1 
ATOM   2418 C CD1 . LEU B 2 23  ? 41.899 26.437 12.680  1.00 16.22 ? 23  LEU B CD1 1 
ATOM   2419 C CD2 . LEU B 2 23  ? 39.525 26.928 13.330  1.00 16.21 ? 23  LEU B CD2 1 
ATOM   2420 N N   . ASN B 2 24  ? 43.115 29.762 11.509  1.00 12.98 ? 24  ASN B N   1 
ATOM   2421 C CA  . ASN B 2 24  ? 43.099 30.627 10.337  1.00 11.97 ? 24  ASN B CA  1 
ATOM   2422 C C   . ASN B 2 24  ? 42.420 29.984 9.145   1.00 12.32 ? 24  ASN B C   1 
ATOM   2423 O O   . ASN B 2 24  ? 42.524 28.774 8.921   1.00 10.85 ? 24  ASN B O   1 
ATOM   2424 C CB  . ASN B 2 24  ? 44.526 30.979 9.913   1.00 8.98  ? 24  ASN B CB  1 
ATOM   2425 C CG  . ASN B 2 24  ? 45.257 31.774 10.944  1.00 5.06  ? 24  ASN B CG  1 
ATOM   2426 O OD1 . ASN B 2 24  ? 45.034 32.972 11.075  1.00 16.44 ? 24  ASN B OD1 1 
ATOM   2427 N ND2 . ASN B 2 24  ? 46.137 31.122 11.693  1.00 5.25  ? 24  ASN B ND2 1 
ATOM   2428 N N   . CYS B 2 25  ? 41.753 30.817 8.362   1.00 13.43 ? 25  CYS B N   1 
ATOM   2429 C CA  . CYS B 2 25  ? 41.100 30.380 7.146   1.00 9.63  ? 25  CYS B CA  1 
ATOM   2430 C C   . CYS B 2 25  ? 41.502 31.427 6.127   1.00 11.03 ? 25  CYS B C   1 
ATOM   2431 O O   . CYS B 2 25  ? 41.009 32.559 6.148   1.00 14.03 ? 25  CYS B O   1 
ATOM   2432 C CB  . CYS B 2 25  ? 39.585 30.340 7.295   1.00 10.67 ? 25  CYS B CB  1 
ATOM   2433 S SG  . CYS B 2 25  ? 38.778 29.798 5.758   1.00 14.88 ? 25  CYS B SG  1 
ATOM   2434 N N   . TYR B 2 26  ? 42.504 31.087 5.329   1.00 10.03 ? 26  TYR B N   1 
ATOM   2435 C CA  . TYR B 2 26  ? 43.010 31.976 4.296   1.00 6.54  ? 26  TYR B CA  1 
ATOM   2436 C C   . TYR B 2 26  ? 42.282 31.624 3.008   1.00 9.89  ? 26  TYR B C   1 
ATOM   2437 O O   . TYR B 2 26  ? 42.360 30.490 2.529   1.00 8.76  ? 26  TYR B O   1 
ATOM   2438 C CB  . TYR B 2 26  ? 44.511 31.750 4.131   1.00 7.91  ? 26  TYR B CB  1 
ATOM   2439 C CG  . TYR B 2 26  ? 45.261 32.888 3.497   1.00 3.31  ? 26  TYR B CG  1 
ATOM   2440 C CD1 . TYR B 2 26  ? 44.863 34.217 3.686   1.00 2.00  ? 26  TYR B CD1 1 
ATOM   2441 C CD2 . TYR B 2 26  ? 46.401 32.641 2.741   1.00 3.60  ? 26  TYR B CD2 1 
ATOM   2442 C CE1 . TYR B 2 26  ? 45.592 35.267 3.140   1.00 2.52  ? 26  TYR B CE1 1 
ATOM   2443 C CE2 . TYR B 2 26  ? 47.138 33.677 2.193   1.00 4.41  ? 26  TYR B CE2 1 
ATOM   2444 C CZ  . TYR B 2 26  ? 46.734 34.985 2.397   1.00 7.93  ? 26  TYR B CZ  1 
ATOM   2445 O OH  . TYR B 2 26  ? 47.517 35.993 1.899   1.00 9.06  ? 26  TYR B OH  1 
ATOM   2446 N N   . VAL B 2 27  ? 41.495 32.566 2.509   1.00 12.20 ? 27  VAL B N   1 
ATOM   2447 C CA  . VAL B 2 27  ? 40.745 32.366 1.279   1.00 12.34 ? 27  VAL B CA  1 
ATOM   2448 C C   . VAL B 2 27  ? 41.469 33.210 0.220   1.00 13.97 ? 27  VAL B C   1 
ATOM   2449 O O   . VAL B 2 27  ? 41.482 34.447 0.275   1.00 14.47 ? 27  VAL B O   1 
ATOM   2450 C CB  . VAL B 2 27  ? 39.276 32.781 1.473   1.00 9.99  ? 27  VAL B CB  1 
ATOM   2451 C CG1 . VAL B 2 27  ? 38.463 32.464 0.239   1.00 16.98 ? 27  VAL B CG1 1 
ATOM   2452 C CG2 . VAL B 2 27  ? 38.698 32.042 2.648   1.00 13.10 ? 27  VAL B CG2 1 
ATOM   2453 N N   . THR B 2 28  ? 42.088 32.530 -0.735  1.00 13.31 ? 28  THR B N   1 
ATOM   2454 C CA  . THR B 2 28  ? 42.884 33.202 -1.744  1.00 16.79 ? 28  THR B CA  1 
ATOM   2455 C C   . THR B 2 28  ? 42.504 32.990 -3.205  1.00 16.16 ? 28  THR B C   1 
ATOM   2456 O O   . THR B 2 28  ? 41.773 32.062 -3.544  1.00 15.56 ? 28  THR B O   1 
ATOM   2457 C CB  . THR B 2 28  ? 44.344 32.762 -1.585  1.00 18.20 ? 28  THR B CB  1 
ATOM   2458 O OG1 . THR B 2 28  ? 44.445 31.362 -1.864  1.00 21.21 ? 28  THR B OG1 1 
ATOM   2459 C CG2 . THR B 2 28  ? 44.797 32.967 -0.163  1.00 20.01 ? 28  THR B CG2 1 
ATOM   2460 N N   . GLN B 2 29  ? 43.038 33.867 -4.055  1.00 19.15 ? 29  GLN B N   1 
ATOM   2461 C CA  . GLN B 2 29  ? 42.863 33.816 -5.504  1.00 22.54 ? 29  GLN B CA  1 
ATOM   2462 C C   . GLN B 2 29  ? 41.434 33.767 -6.038  1.00 24.86 ? 29  GLN B C   1 
ATOM   2463 O O   . GLN B 2 29  ? 41.123 32.953 -6.904  1.00 29.90 ? 29  GLN B O   1 
ATOM   2464 C CB  . GLN B 2 29  ? 43.680 32.646 -6.064  1.00 23.86 ? 29  GLN B CB  1 
ATOM   2465 C CG  . GLN B 2 29  ? 45.181 32.802 -5.846  1.00 30.99 ? 29  GLN B CG  1 
ATOM   2466 C CD  . GLN B 2 29  ? 45.923 31.482 -5.805  1.00 35.82 ? 29  GLN B CD  1 
ATOM   2467 O OE1 . GLN B 2 29  ? 45.371 30.433 -6.129  1.00 38.05 ? 29  GLN B OE1 1 
ATOM   2468 N NE2 . GLN B 2 29  ? 47.175 31.526 -5.379  1.00 39.62 ? 29  GLN B NE2 1 
ATOM   2469 N N   . PHE B 2 30  ? 40.575 34.663 -5.565  1.00 18.93 ? 30  PHE B N   1 
ATOM   2470 C CA  . PHE B 2 30  ? 39.199 34.679 -6.034  1.00 16.76 ? 30  PHE B CA  1 
ATOM   2471 C C   . PHE B 2 30  ? 38.796 36.016 -6.651  1.00 15.25 ? 30  PHE B C   1 
ATOM   2472 O O   . PHE B 2 30  ? 39.421 37.048 -6.399  1.00 17.18 ? 30  PHE B O   1 
ATOM   2473 C CB  . PHE B 2 30  ? 38.229 34.275 -4.910  1.00 15.92 ? 30  PHE B CB  1 
ATOM   2474 C CG  . PHE B 2 30  ? 38.228 35.207 -3.733  1.00 11.35 ? 30  PHE B CG  1 
ATOM   2475 C CD1 . PHE B 2 30  ? 39.123 35.021 -2.681  1.00 12.33 ? 30  PHE B CD1 1 
ATOM   2476 C CD2 . PHE B 2 30  ? 37.336 36.275 -3.675  1.00 10.09 ? 30  PHE B CD2 1 
ATOM   2477 C CE1 . PHE B 2 30  ? 39.133 35.886 -1.587  1.00 10.74 ? 30  PHE B CE1 1 
ATOM   2478 C CE2 . PHE B 2 30  ? 37.336 37.152 -2.583  1.00 12.89 ? 30  PHE B CE2 1 
ATOM   2479 C CZ  . PHE B 2 30  ? 38.235 36.957 -1.537  1.00 12.72 ? 30  PHE B CZ  1 
ATOM   2480 N N   . HIS B 2 31  ? 37.766 35.977 -7.486  1.00 14.32 ? 31  HIS B N   1 
ATOM   2481 C CA  . HIS B 2 31  ? 37.240 37.158 -8.158  1.00 17.51 ? 31  HIS B CA  1 
ATOM   2482 C C   . HIS B 2 31  ? 35.869 36.761 -8.702  1.00 21.64 ? 31  HIS B C   1 
ATOM   2483 O O   . HIS B 2 31  ? 35.692 35.632 -9.161  1.00 20.91 ? 31  HIS B O   1 
ATOM   2484 C CB  . HIS B 2 31  ? 38.155 37.575 -9.318  1.00 17.73 ? 31  HIS B CB  1 
ATOM   2485 C CG  . HIS B 2 31  ? 38.268 39.059 -9.493  1.00 17.94 ? 31  HIS B CG  1 
ATOM   2486 N ND1 . HIS B 2 31  ? 37.224 39.840 -9.940  1.00 20.12 ? 31  HIS B ND1 1 
ATOM   2487 C CD2 . HIS B 2 31  ? 39.290 39.910 -9.238  1.00 19.22 ? 31  HIS B CD2 1 
ATOM   2488 C CE1 . HIS B 2 31  ? 37.596 41.108 -9.948  1.00 20.30 ? 31  HIS B CE1 1 
ATOM   2489 N NE2 . HIS B 2 31  ? 38.846 41.177 -9.526  1.00 19.43 ? 31  HIS B NE2 1 
ATOM   2490 N N   . PRO B 2 32  ? 34.848 37.629 -8.552  1.00 22.84 ? 32  PRO B N   1 
ATOM   2491 C CA  . PRO B 2 32  ? 34.822 38.955 -7.920  1.00 22.31 ? 32  PRO B CA  1 
ATOM   2492 C C   . PRO B 2 32  ? 34.994 38.865 -6.392  1.00 22.05 ? 32  PRO B C   1 
ATOM   2493 O O   . PRO B 2 32  ? 34.989 37.766 -5.832  1.00 16.79 ? 32  PRO B O   1 
ATOM   2494 C CB  . PRO B 2 32  ? 33.444 39.486 -8.327  1.00 26.58 ? 32  PRO B CB  1 
ATOM   2495 C CG  . PRO B 2 32  ? 32.622 38.251 -8.411  1.00 25.10 ? 32  PRO B CG  1 
ATOM   2496 C CD  . PRO B 2 32  ? 33.536 37.316 -9.144  1.00 22.76 ? 32  PRO B CD  1 
ATOM   2497 N N   . PRO B 2 33  ? 35.132 40.016 -5.707  1.00 16.42 ? 33  PRO B N   1 
ATOM   2498 C CA  . PRO B 2 33  ? 35.320 40.104 -4.255  1.00 20.09 ? 33  PRO B CA  1 
ATOM   2499 C C   . PRO B 2 33  ? 34.190 39.668 -3.327  1.00 24.11 ? 33  PRO B C   1 
ATOM   2500 O O   . PRO B 2 33  ? 34.415 39.474 -2.131  1.00 29.14 ? 33  PRO B O   1 
ATOM   2501 C CB  . PRO B 2 33  ? 35.674 41.578 -4.051  1.00 17.23 ? 33  PRO B CB  1 
ATOM   2502 C CG  . PRO B 2 33  ? 34.912 42.251 -5.118  1.00 18.55 ? 33  PRO B CG  1 
ATOM   2503 C CD  . PRO B 2 33  ? 35.175 41.361 -6.305  1.00 18.77 ? 33  PRO B CD  1 
ATOM   2504 N N   . HIS B 2 34  ? 32.979 39.548 -3.857  1.00 28.93 ? 34  HIS B N   1 
ATOM   2505 C CA  . HIS B 2 34  ? 31.830 39.144 -3.051  1.00 33.12 ? 34  HIS B CA  1 
ATOM   2506 C C   . HIS B 2 34  ? 32.082 37.726 -2.540  1.00 29.97 ? 34  HIS B C   1 
ATOM   2507 O O   . HIS B 2 34  ? 32.274 36.805 -3.334  1.00 29.87 ? 34  HIS B O   1 
ATOM   2508 C CB  . HIS B 2 34  ? 30.549 39.164 -3.896  1.00 44.75 ? 34  HIS B CB  1 
ATOM   2509 C CG  . HIS B 2 34  ? 30.407 40.379 -4.763  1.00 54.92 ? 34  HIS B CG  1 
ATOM   2510 N ND1 . HIS B 2 34  ? 29.902 41.575 -4.298  1.00 58.64 ? 34  HIS B ND1 1 
ATOM   2511 C CD2 . HIS B 2 34  ? 30.693 40.577 -6.073  1.00 56.25 ? 34  HIS B CD2 1 
ATOM   2512 C CE1 . HIS B 2 34  ? 29.878 42.456 -5.283  1.00 56.97 ? 34  HIS B CE1 1 
ATOM   2513 N NE2 . HIS B 2 34  ? 30.355 41.876 -6.370  1.00 59.25 ? 34  HIS B NE2 1 
ATOM   2514 N N   . ILE B 2 35  ? 32.064 37.549 -1.224  1.00 25.64 ? 35  ILE B N   1 
ATOM   2515 C CA  . ILE B 2 35  ? 32.305 36.238 -0.633  1.00 21.23 ? 35  ILE B CA  1 
ATOM   2516 C C   . ILE B 2 35  ? 31.788 36.202 0.810   1.00 21.00 ? 35  ILE B C   1 
ATOM   2517 O O   . ILE B 2 35  ? 31.764 37.228 1.493   1.00 20.58 ? 35  ILE B O   1 
ATOM   2518 C CB  . ILE B 2 35  ? 33.830 35.926 -0.660  1.00 16.89 ? 35  ILE B CB  1 
ATOM   2519 C CG1 . ILE B 2 35  ? 34.081 34.430 -0.577  1.00 18.45 ? 35  ILE B CG1 1 
ATOM   2520 C CG2 . ILE B 2 35  ? 34.551 36.633 0.488   1.00 13.31 ? 35  ILE B CG2 1 
ATOM   2521 C CD1 . ILE B 2 35  ? 35.495 34.059 -0.907  1.00 17.97 ? 35  ILE B CD1 1 
ATOM   2522 N N   . GLU B 2 36  ? 31.337 35.036 1.255   1.00 25.43 ? 36  GLU B N   1 
ATOM   2523 C CA  . GLU B 2 36  ? 30.857 34.878 2.624   1.00 28.21 ? 36  GLU B CA  1 
ATOM   2524 C C   . GLU B 2 36  ? 31.723 33.794 3.239   1.00 23.24 ? 36  GLU B C   1 
ATOM   2525 O O   . GLU B 2 36  ? 31.778 32.679 2.725   1.00 25.10 ? 36  GLU B O   1 
ATOM   2526 C CB  . GLU B 2 36  ? 29.394 34.444 2.656   1.00 35.53 ? 36  GLU B CB  1 
ATOM   2527 C CG  . GLU B 2 36  ? 28.758 34.565 4.039   1.00 46.42 ? 36  GLU B CG  1 
ATOM   2528 C CD  . GLU B 2 36  ? 27.471 33.766 4.180   1.00 53.98 ? 36  GLU B CD  1 
ATOM   2529 O OE1 . GLU B 2 36  ? 26.669 33.705 3.221   1.00 56.89 ? 36  GLU B OE1 1 
ATOM   2530 O OE2 . GLU B 2 36  ? 27.271 33.149 5.249   1.00 57.30 ? 36  GLU B OE2 1 
ATOM   2531 N N   . ILE B 2 37  ? 32.424 34.136 4.312   1.00 21.58 ? 37  ILE B N   1 
ATOM   2532 C CA  . ILE B 2 37  ? 33.315 33.206 4.995   1.00 18.95 ? 37  ILE B CA  1 
ATOM   2533 C C   . ILE B 2 37  ? 32.798 32.972 6.408   1.00 19.35 ? 37  ILE B C   1 
ATOM   2534 O O   . ILE B 2 37  ? 32.487 33.921 7.126   1.00 20.36 ? 37  ILE B O   1 
ATOM   2535 C CB  . ILE B 2 37  ? 34.758 33.785 5.083   1.00 21.64 ? 37  ILE B CB  1 
ATOM   2536 C CG1 . ILE B 2 37  ? 35.282 34.123 3.682   1.00 22.07 ? 37  ILE B CG1 1 
ATOM   2537 C CG2 . ILE B 2 37  ? 35.696 32.792 5.771   1.00 21.46 ? 37  ILE B CG2 1 
ATOM   2538 C CD1 . ILE B 2 37  ? 36.595 34.888 3.675   1.00 21.59 ? 37  ILE B CD1 1 
ATOM   2539 N N   . GLN B 2 38  ? 32.704 31.710 6.802   1.00 19.21 ? 38  GLN B N   1 
ATOM   2540 C CA  . GLN B 2 38  ? 32.237 31.356 8.136   1.00 19.84 ? 38  GLN B CA  1 
ATOM   2541 C C   . GLN B 2 38  ? 33.177 30.314 8.722   1.00 19.45 ? 38  GLN B C   1 
ATOM   2542 O O   . GLN B 2 38  ? 33.613 29.401 8.024   1.00 15.22 ? 38  GLN B O   1 
ATOM   2543 C CB  . GLN B 2 38  ? 30.834 30.735 8.081   1.00 25.98 ? 38  GLN B CB  1 
ATOM   2544 C CG  . GLN B 2 38  ? 29.765 31.554 7.376   1.00 33.49 ? 38  GLN B CG  1 
ATOM   2545 C CD  . GLN B 2 38  ? 28.416 30.854 7.372   1.00 37.13 ? 38  GLN B CD  1 
ATOM   2546 O OE1 . GLN B 2 38  ? 28.092 30.085 6.456   1.00 38.67 ? 38  GLN B OE1 1 
ATOM   2547 N NE2 . GLN B 2 38  ? 27.634 31.087 8.417   1.00 40.51 ? 38  GLN B NE2 1 
ATOM   2548 N N   . MET B 2 39  ? 33.512 30.462 9.996   1.00 19.22 ? 39  MET B N   1 
ATOM   2549 C CA  . MET B 2 39  ? 34.359 29.486 10.665  1.00 18.66 ? 39  MET B CA  1 
ATOM   2550 C C   . MET B 2 39  ? 33.402 28.768 11.601  1.00 16.29 ? 39  MET B C   1 
ATOM   2551 O O   . MET B 2 39  ? 32.563 29.403 12.235  1.00 17.70 ? 39  MET B O   1 
ATOM   2552 C CB  . MET B 2 39  ? 35.509 30.168 11.398  1.00 21.95 ? 39  MET B CB  1 
ATOM   2553 C CG  . MET B 2 39  ? 36.455 30.888 10.436  1.00 25.93 ? 39  MET B CG  1 
ATOM   2554 S SD  . MET B 2 39  ? 38.057 31.317 11.135  1.00 28.12 ? 39  MET B SD  1 
ATOM   2555 C CE  . MET B 2 39  ? 38.877 29.766 11.038  1.00 20.71 ? 39  MET B CE  1 
ATOM   2556 N N   . LEU B 2 40  ? 33.489 27.446 11.650  1.00 17.02 ? 40  LEU B N   1 
ATOM   2557 C CA  . LEU B 2 40  ? 32.567 26.660 12.451  1.00 14.52 ? 40  LEU B CA  1 
ATOM   2558 C C   . LEU B 2 40  ? 33.228 25.759 13.476  1.00 14.39 ? 40  LEU B C   1 
ATOM   2559 O O   . LEU B 2 40  ? 34.225 25.098 13.191  1.00 15.78 ? 40  LEU B O   1 
ATOM   2560 C CB  . LEU B 2 40  ? 31.712 25.787 11.522  1.00 14.69 ? 40  LEU B CB  1 
ATOM   2561 C CG  . LEU B 2 40  ? 31.148 26.433 10.249  1.00 16.57 ? 40  LEU B CG  1 
ATOM   2562 C CD1 . LEU B 2 40  ? 30.952 25.401 9.169   1.00 14.74 ? 40  LEU B CD1 1 
ATOM   2563 C CD2 . LEU B 2 40  ? 29.862 27.151 10.535  1.00 15.69 ? 40  LEU B CD2 1 
ATOM   2564 N N   . LYS B 2 41  ? 32.664 25.734 14.674  1.00 12.35 ? 41  LYS B N   1 
ATOM   2565 C CA  . LYS B 2 41  ? 33.156 24.866 15.722  1.00 13.04 ? 41  LYS B CA  1 
ATOM   2566 C C   . LYS B 2 41  ? 32.035 23.858 15.913  1.00 16.44 ? 41  LYS B C   1 
ATOM   2567 O O   . LYS B 2 41  ? 30.924 24.237 16.277  1.00 15.91 ? 41  LYS B O   1 
ATOM   2568 C CB  . LYS B 2 41  ? 33.358 25.645 17.014  1.00 14.62 ? 41  LYS B CB  1 
ATOM   2569 C CG  . LYS B 2 41  ? 33.716 24.763 18.207  1.00 14.13 ? 41  LYS B CG  1 
ATOM   2570 C CD  . LYS B 2 41  ? 33.818 25.592 19.465  1.00 16.03 ? 41  LYS B CD  1 
ATOM   2571 C CE  . LYS B 2 41  ? 34.178 24.733 20.649  1.00 21.31 ? 41  LYS B CE  1 
ATOM   2572 N NZ  . LYS B 2 41  ? 34.538 25.576 21.814  1.00 30.64 ? 41  LYS B NZ  1 
ATOM   2573 N N   . ASN B 2 42  ? 32.298 22.589 15.627  1.00 14.31 ? 42  ASN B N   1 
ATOM   2574 C CA  . ASN B 2 42  ? 31.277 21.566 15.785  1.00 16.97 ? 42  ASN B CA  1 
ATOM   2575 C C   . ASN B 2 42  ? 30.000 21.868 14.991  1.00 19.47 ? 42  ASN B C   1 
ATOM   2576 O O   . ASN B 2 42  ? 28.885 21.714 15.494  1.00 20.48 ? 42  ASN B O   1 
ATOM   2577 C CB  . ASN B 2 42  ? 30.939 21.381 17.265  1.00 19.96 ? 42  ASN B CB  1 
ATOM   2578 C CG  . ASN B 2 42  ? 32.079 20.780 18.046  1.00 22.23 ? 42  ASN B CG  1 
ATOM   2579 O OD1 . ASN B 2 42  ? 32.762 19.858 17.574  1.00 22.08 ? 42  ASN B OD1 1 
ATOM   2580 N ND2 . ASN B 2 42  ? 32.287 21.279 19.258  1.00 20.92 ? 42  ASN B ND2 1 
ATOM   2581 N N   . GLY B 2 43  ? 30.176 22.349 13.765  1.00 21.73 ? 43  GLY B N   1 
ATOM   2582 C CA  . GLY B 2 43  ? 29.048 22.639 12.898  1.00 18.98 ? 43  GLY B CA  1 
ATOM   2583 C C   . GLY B 2 43  ? 28.297 23.908 13.217  1.00 20.22 ? 43  GLY B C   1 
ATOM   2584 O O   . GLY B 2 43  ? 27.352 24.272 12.517  1.00 24.85 ? 43  GLY B O   1 
ATOM   2585 N N   . LYS B 2 44  ? 28.727 24.601 14.258  1.00 20.81 ? 44  LYS B N   1 
ATOM   2586 C CA  . LYS B 2 44  ? 28.079 25.832 14.651  1.00 23.63 ? 44  LYS B CA  1 
ATOM   2587 C C   . LYS B 2 44  ? 28.992 27.013 14.342  1.00 22.82 ? 44  LYS B C   1 
ATOM   2588 O O   . LYS B 2 44  ? 30.203 26.939 14.530  1.00 24.05 ? 44  LYS B O   1 
ATOM   2589 C CB  . LYS B 2 44  ? 27.732 25.777 16.138  1.00 27.22 ? 44  LYS B CB  1 
ATOM   2590 C CG  . LYS B 2 44  ? 26.726 26.806 16.538  1.00 32.51 ? 44  LYS B CG  1 
ATOM   2591 C CD  . LYS B 2 44  ? 26.198 26.550 17.922  1.00 40.09 ? 44  LYS B CD  1 
ATOM   2592 C CE  . LYS B 2 44  ? 24.946 27.388 18.146  1.00 50.04 ? 44  LYS B CE  1 
ATOM   2593 N NZ  . LYS B 2 44  ? 23.868 27.065 17.144  1.00 53.16 ? 44  LYS B NZ  1 
ATOM   2594 N N   . LYS B 2 45  ? 28.404 28.086 13.829  1.00 25.60 ? 45  LYS B N   1 
ATOM   2595 C CA  . LYS B 2 45  ? 29.143 29.287 13.473  1.00 29.12 ? 45  LYS B CA  1 
ATOM   2596 C C   . LYS B 2 45  ? 29.822 29.959 14.665  1.00 29.31 ? 45  LYS B C   1 
ATOM   2597 O O   . LYS B 2 45  ? 29.223 30.113 15.728  1.00 31.24 ? 45  LYS B O   1 
ATOM   2598 C CB  . LYS B 2 45  ? 28.209 30.295 12.805  1.00 32.51 ? 45  LYS B CB  1 
ATOM   2599 C CG  . LYS B 2 45  ? 28.931 31.500 12.254  1.00 43.35 ? 45  LYS B CG  1 
ATOM   2600 C CD  . LYS B 2 45  ? 28.013 32.697 12.100  1.00 52.81 ? 45  LYS B CD  1 
ATOM   2601 C CE  . LYS B 2 45  ? 28.751 33.876 11.466  1.00 58.42 ? 45  LYS B CE  1 
ATOM   2602 N NZ  . LYS B 2 45  ? 30.100 34.119 12.072  1.00 65.88 ? 45  LYS B NZ  1 
ATOM   2603 N N   . ILE B 2 46  ? 31.069 30.375 14.465  1.00 30.12 ? 46  ILE B N   1 
ATOM   2604 C CA  . ILE B 2 46  ? 31.843 31.068 15.489  1.00 24.94 ? 46  ILE B CA  1 
ATOM   2605 C C   . ILE B 2 46  ? 31.607 32.561 15.284  1.00 28.23 ? 46  ILE B C   1 
ATOM   2606 O O   . ILE B 2 46  ? 31.736 33.067 14.168  1.00 26.49 ? 46  ILE B O   1 
ATOM   2607 C CB  . ILE B 2 46  ? 33.343 30.769 15.350  1.00 20.65 ? 46  ILE B CB  1 
ATOM   2608 C CG1 . ILE B 2 46  ? 33.606 29.277 15.569  1.00 17.48 ? 46  ILE B CG1 1 
ATOM   2609 C CG2 . ILE B 2 46  ? 34.140 31.601 16.340  1.00 20.26 ? 46  ILE B CG2 1 
ATOM   2610 C CD1 . ILE B 2 46  ? 35.020 28.839 15.209  1.00 14.32 ? 46  ILE B CD1 1 
ATOM   2611 N N   . PRO B 2 47  ? 31.206 33.277 16.348  1.00 36.69 ? 47  PRO B N   1 
ATOM   2612 C CA  . PRO B 2 47  ? 30.936 34.719 16.298  1.00 37.63 ? 47  PRO B CA  1 
ATOM   2613 C C   . PRO B 2 47  ? 32.164 35.619 16.263  1.00 40.09 ? 47  PRO B C   1 
ATOM   2614 O O   . PRO B 2 47  ? 32.266 36.500 15.413  1.00 43.62 ? 47  PRO B O   1 
ATOM   2615 C CB  . PRO B 2 47  ? 30.109 34.948 17.563  1.00 36.57 ? 47  PRO B CB  1 
ATOM   2616 C CG  . PRO B 2 47  ? 30.684 33.961 18.519  1.00 33.59 ? 47  PRO B CG  1 
ATOM   2617 C CD  . PRO B 2 47  ? 30.816 32.720 17.658  1.00 36.58 ? 47  PRO B CD  1 
ATOM   2618 N N   . LYS B 2 48  ? 33.088 35.397 17.189  1.00 45.52 ? 48  LYS B N   1 
ATOM   2619 C CA  . LYS B 2 48  ? 34.302 36.199 17.284  1.00 51.37 ? 48  LYS B CA  1 
ATOM   2620 C C   . LYS B 2 48  ? 35.310 35.818 16.198  1.00 48.16 ? 48  LYS B C   1 
ATOM   2621 O O   . LYS B 2 48  ? 36.232 35.044 16.452  1.00 50.99 ? 48  LYS B O   1 
ATOM   2622 C CB  . LYS B 2 48  ? 34.918 36.018 18.681  1.00 60.99 ? 48  LYS B CB  1 
ATOM   2623 C CG  . LYS B 2 48  ? 36.248 36.735 18.920  1.00 71.94 ? 48  LYS B CG  1 
ATOM   2624 C CD  . LYS B 2 48  ? 36.826 36.358 20.283  1.00 78.73 ? 48  LYS B CD  1 
ATOM   2625 C CE  . LYS B 2 48  ? 38.173 37.025 20.556  1.00 83.56 ? 48  LYS B CE  1 
ATOM   2626 N NZ  . LYS B 2 48  ? 39.264 36.562 19.652  1.00 86.84 ? 48  LYS B NZ  1 
ATOM   2627 N N   . VAL B 2 49  ? 35.123 36.334 14.986  1.00 38.84 ? 49  VAL B N   1 
ATOM   2628 C CA  . VAL B 2 49  ? 36.035 36.031 13.886  1.00 31.03 ? 49  VAL B CA  1 
ATOM   2629 C C   . VAL B 2 49  ? 36.500 37.309 13.205  1.00 29.67 ? 49  VAL B C   1 
ATOM   2630 O O   . VAL B 2 49  ? 35.693 38.079 12.689  1.00 32.71 ? 49  VAL B O   1 
ATOM   2631 C CB  . VAL B 2 49  ? 35.387 35.066 12.858  1.00 30.45 ? 49  VAL B CB  1 
ATOM   2632 C CG1 . VAL B 2 49  ? 36.242 34.949 11.599  1.00 26.71 ? 49  VAL B CG1 1 
ATOM   2633 C CG2 . VAL B 2 49  ? 35.221 33.689 13.479  1.00 30.29 ? 49  VAL B CG2 1 
ATOM   2634 N N   . GLU B 2 50  ? 37.808 37.539 13.234  1.00 28.26 ? 50  GLU B N   1 
ATOM   2635 C CA  . GLU B 2 50  ? 38.412 38.721 12.633  1.00 28.00 ? 50  GLU B CA  1 
ATOM   2636 C C   . GLU B 2 50  ? 38.849 38.481 11.186  1.00 23.76 ? 50  GLU B C   1 
ATOM   2637 O O   . GLU B 2 50  ? 39.413 37.438 10.863  1.00 27.34 ? 50  GLU B O   1 
ATOM   2638 C CB  . GLU B 2 50  ? 39.630 39.155 13.457  1.00 35.76 ? 50  GLU B CB  1 
ATOM   2639 C CG  . GLU B 2 50  ? 39.318 39.557 14.905  1.00 49.44 ? 50  GLU B CG  1 
ATOM   2640 C CD  . GLU B 2 50  ? 40.558 39.586 15.802  1.00 54.99 ? 50  GLU B CD  1 
ATOM   2641 O OE1 . GLU B 2 50  ? 41.548 40.261 15.444  1.00 59.07 ? 50  GLU B OE1 1 
ATOM   2642 O OE2 . GLU B 2 50  ? 40.546 38.916 16.861  1.00 59.93 ? 50  GLU B OE2 1 
ATOM   2643 N N   . MET B 2 51  ? 38.585 39.456 10.325  1.00 18.82 ? 51  MET B N   1 
ATOM   2644 C CA  . MET B 2 51  ? 38.982 39.402 8.920   1.00 20.20 ? 51  MET B CA  1 
ATOM   2645 C C   . MET B 2 51  ? 40.148 40.376 8.774   1.00 20.32 ? 51  MET B C   1 
ATOM   2646 O O   . MET B 2 51  ? 40.072 41.514 9.252   1.00 23.80 ? 51  MET B O   1 
ATOM   2647 C CB  . MET B 2 51  ? 37.842 39.872 8.020   1.00 25.12 ? 51  MET B CB  1 
ATOM   2648 C CG  . MET B 2 51  ? 36.550 39.100 8.191   1.00 31.43 ? 51  MET B CG  1 
ATOM   2649 S SD  . MET B 2 51  ? 36.609 37.522 7.386   1.00 33.60 ? 51  MET B SD  1 
ATOM   2650 C CE  . MET B 2 51  ? 35.884 37.953 5.813   1.00 37.12 ? 51  MET B CE  1 
ATOM   2651 N N   . SER B 2 52  ? 41.227 39.945 8.134   1.00 16.15 ? 52  SER B N   1 
ATOM   2652 C CA  . SER B 2 52  ? 42.374 40.816 7.957   1.00 12.83 ? 52  SER B CA  1 
ATOM   2653 C C   . SER B 2 52  ? 43.255 40.353 6.810   1.00 13.86 ? 52  SER B C   1 
ATOM   2654 O O   . SER B 2 52  ? 42.929 39.387 6.112   1.00 16.28 ? 52  SER B O   1 
ATOM   2655 C CB  . SER B 2 52  ? 43.198 40.861 9.247   1.00 14.74 ? 52  SER B CB  1 
ATOM   2656 O OG  . SER B 2 52  ? 43.811 39.611 9.518   1.00 16.99 ? 52  SER B OG  1 
ATOM   2657 N N   . ASP B 2 53  ? 44.378 41.047 6.637   1.00 9.36  ? 53  ASP B N   1 
ATOM   2658 C CA  . ASP B 2 53  ? 45.355 40.740 5.608   1.00 10.11 ? 53  ASP B CA  1 
ATOM   2659 C C   . ASP B 2 53  ? 44.769 40.640 4.210   1.00 14.19 ? 53  ASP B C   1 
ATOM   2660 O O   . ASP B 2 53  ? 45.034 39.677 3.486   1.00 13.33 ? 53  ASP B O   1 
ATOM   2661 C CB  . ASP B 2 53  ? 46.113 39.465 5.970   1.00 8.35  ? 53  ASP B CB  1 
ATOM   2662 C CG  . ASP B 2 53  ? 46.949 39.634 7.211   1.00 14.24 ? 53  ASP B CG  1 
ATOM   2663 O OD1 . ASP B 2 53  ? 48.074 40.157 7.088   1.00 19.38 ? 53  ASP B OD1 1 
ATOM   2664 O OD2 . ASP B 2 53  ? 46.479 39.277 8.316   1.00 18.93 ? 53  ASP B OD2 1 
ATOM   2665 N N   . MET B 2 54  ? 43.956 41.623 3.834   1.00 9.94  ? 54  MET B N   1 
ATOM   2666 C CA  . MET B 2 54  ? 43.370 41.613 2.504   1.00 13.69 ? 54  MET B CA  1 
ATOM   2667 C C   . MET B 2 54  ? 44.385 42.183 1.534   1.00 15.15 ? 54  MET B C   1 
ATOM   2668 O O   . MET B 2 54  ? 45.035 43.193 1.832   1.00 13.08 ? 54  MET B O   1 
ATOM   2669 C CB  . MET B 2 54  ? 42.104 42.452 2.435   1.00 13.84 ? 54  MET B CB  1 
ATOM   2670 C CG  . MET B 2 54  ? 41.361 42.236 1.134   1.00 24.57 ? 54  MET B CG  1 
ATOM   2671 S SD  . MET B 2 54  ? 40.356 43.618 0.643   1.00 29.73 ? 54  MET B SD  1 
ATOM   2672 C CE  . MET B 2 54  ? 41.503 44.440 -0.401  1.00 30.38 ? 54  MET B CE  1 
ATOM   2673 N N   . SER B 2 55  ? 44.510 41.554 0.373   1.00 9.83  ? 55  SER B N   1 
ATOM   2674 C CA  . SER B 2 55  ? 45.451 42.009 -0.642  1.00 8.93  ? 55  SER B CA  1 
ATOM   2675 C C   . SER B 2 55  ? 45.062 41.404 -1.983  1.00 8.25  ? 55  SER B C   1 
ATOM   2676 O O   . SER B 2 55  ? 44.116 40.617 -2.058  1.00 9.24  ? 55  SER B O   1 
ATOM   2677 C CB  . SER B 2 55  ? 46.865 41.562 -0.262  1.00 8.48  ? 55  SER B CB  1 
ATOM   2678 O OG  . SER B 2 55  ? 46.911 40.152 -0.093  1.00 10.34 ? 55  SER B OG  1 
ATOM   2679 N N   . PHE B 2 56  ? 45.741 41.827 -3.045  1.00 9.14  ? 56  PHE B N   1 
ATOM   2680 C CA  . PHE B 2 56  ? 45.496 41.292 -4.383  1.00 15.09 ? 56  PHE B CA  1 
ATOM   2681 C C   . PHE B 2 56  ? 46.842 40.783 -4.821  1.00 14.64 ? 56  PHE B C   1 
ATOM   2682 O O   . PHE B 2 56  ? 47.862 41.324 -4.401  1.00 17.07 ? 56  PHE B O   1 
ATOM   2683 C CB  . PHE B 2 56  ? 45.149 42.369 -5.421  1.00 12.26 ? 56  PHE B CB  1 
ATOM   2684 C CG  . PHE B 2 56  ? 44.344 43.508 -4.905  1.00 13.59 ? 56  PHE B CG  1 
ATOM   2685 C CD1 . PHE B 2 56  ? 43.272 43.301 -4.040  1.00 11.27 ? 56  PHE B CD1 1 
ATOM   2686 C CD2 . PHE B 2 56  ? 44.653 44.808 -5.311  1.00 8.14  ? 56  PHE B CD2 1 
ATOM   2687 C CE1 . PHE B 2 56  ? 42.522 44.375 -3.591  1.00 10.65 ? 56  PHE B CE1 1 
ATOM   2688 C CE2 . PHE B 2 56  ? 43.912 45.884 -4.869  1.00 6.61  ? 56  PHE B CE2 1 
ATOM   2689 C CZ  . PHE B 2 56  ? 42.843 45.671 -4.006  1.00 14.36 ? 56  PHE B CZ  1 
ATOM   2690 N N   . SER B 2 57  ? 46.860 39.772 -5.676  1.00 19.11 ? 57  SER B N   1 
ATOM   2691 C CA  . SER B 2 57  ? 48.123 39.280 -6.206  1.00 20.99 ? 57  SER B CA  1 
ATOM   2692 C C   . SER B 2 57  ? 48.340 40.055 -7.506  1.00 24.13 ? 57  SER B C   1 
ATOM   2693 O O   . SER B 2 57  ? 47.585 40.986 -7.803  1.00 24.74 ? 57  SER B O   1 
ATOM   2694 C CB  . SER B 2 57  ? 48.052 37.785 -6.467  1.00 16.26 ? 57  SER B CB  1 
ATOM   2695 O OG  . SER B 2 57  ? 46.842 37.469 -7.102  1.00 20.93 ? 57  SER B OG  1 
ATOM   2696 N N   . LYS B 2 58  ? 49.350 39.675 -8.285  1.00 31.87 ? 58  LYS B N   1 
ATOM   2697 C CA  . LYS B 2 58  ? 49.648 40.363 -9.544  1.00 30.96 ? 58  LYS B CA  1 
ATOM   2698 C C   . LYS B 2 58  ? 48.556 40.190 -10.594 1.00 28.15 ? 58  LYS B C   1 
ATOM   2699 O O   . LYS B 2 58  ? 48.374 41.051 -11.447 1.00 29.86 ? 58  LYS B O   1 
ATOM   2700 C CB  . LYS B 2 58  ? 50.985 39.898 -10.118 1.00 35.36 ? 58  LYS B CB  1 
ATOM   2701 C CG  . LYS B 2 58  ? 52.180 40.219 -9.246  1.00 43.84 ? 58  LYS B CG  1 
ATOM   2702 C CD  . LYS B 2 58  ? 53.475 39.861 -9.954  1.00 49.95 ? 58  LYS B CD  1 
ATOM   2703 C CE  . LYS B 2 58  ? 54.674 39.993 -9.030  1.00 53.97 ? 58  LYS B CE  1 
ATOM   2704 N NZ  . LYS B 2 58  ? 54.646 38.972 -7.945  1.00 57.42 ? 58  LYS B NZ  1 
ATOM   2705 N N   . ASP B 2 59  ? 47.824 39.085 -10.528 1.00 24.58 ? 59  ASP B N   1 
ATOM   2706 C CA  . ASP B 2 59  ? 46.763 38.843 -11.488 1.00 21.54 ? 59  ASP B CA  1 
ATOM   2707 C C   . ASP B 2 59  ? 45.456 39.488 -11.022 1.00 21.11 ? 59  ASP B C   1 
ATOM   2708 O O   . ASP B 2 59  ? 44.396 39.245 -11.601 1.00 21.50 ? 59  ASP B O   1 
ATOM   2709 C CB  . ASP B 2 59  ? 46.583 37.340 -11.710 1.00 27.41 ? 59  ASP B CB  1 
ATOM   2710 C CG  . ASP B 2 59  ? 45.953 36.644 -10.530 1.00 32.55 ? 59  ASP B CG  1 
ATOM   2711 O OD1 . ASP B 2 59  ? 45.982 37.200 -9.420  1.00 38.45 ? 59  ASP B OD1 1 
ATOM   2712 O OD2 . ASP B 2 59  ? 45.404 35.540 -10.711 1.00 39.07 ? 59  ASP B OD2 1 
ATOM   2713 N N   . TRP B 2 60  ? 45.536 40.241 -9.925  1.00 14.98 ? 60  TRP B N   1 
ATOM   2714 C CA  . TRP B 2 60  ? 44.408 40.966 -9.341  1.00 15.99 ? 60  TRP B CA  1 
ATOM   2715 C C   . TRP B 2 60  ? 43.405 40.163 -8.526  1.00 18.54 ? 60  TRP B C   1 
ATOM   2716 O O   . TRP B 2 60  ? 42.403 40.720 -8.078  1.00 20.16 ? 60  TRP B O   1 
ATOM   2717 C CB  . TRP B 2 60  ? 43.651 41.772 -10.405 1.00 10.58 ? 60  TRP B CB  1 
ATOM   2718 C CG  . TRP B 2 60  ? 44.489 42.772 -11.100 1.00 12.92 ? 60  TRP B CG  1 
ATOM   2719 C CD1 . TRP B 2 60  ? 44.973 42.688 -12.372 1.00 11.57 ? 60  TRP B CD1 1 
ATOM   2720 C CD2 . TRP B 2 60  ? 44.962 44.016 -10.569 1.00 10.93 ? 60  TRP B CD2 1 
ATOM   2721 N NE1 . TRP B 2 60  ? 45.715 43.799 -12.665 1.00 10.58 ? 60  TRP B NE1 1 
ATOM   2722 C CE2 . TRP B 2 60  ? 45.727 44.633 -11.581 1.00 11.38 ? 60  TRP B CE2 1 
ATOM   2723 C CE3 . TRP B 2 60  ? 44.814 44.668 -9.342  1.00 11.41 ? 60  TRP B CE3 1 
ATOM   2724 C CZ2 . TRP B 2 60  ? 46.343 45.874 -11.406 1.00 7.70  ? 60  TRP B CZ2 1 
ATOM   2725 C CZ3 . TRP B 2 60  ? 45.427 45.904 -9.166  1.00 8.84  ? 60  TRP B CZ3 1 
ATOM   2726 C CH2 . TRP B 2 60  ? 46.182 46.492 -10.196 1.00 10.33 ? 60  TRP B CH2 1 
ATOM   2727 N N   . SER B 2 61  ? 43.644 38.870 -8.344  1.00 17.92 ? 61  SER B N   1 
ATOM   2728 C CA  . SER B 2 61  ? 42.718 38.061 -7.560  1.00 17.77 ? 61  SER B CA  1 
ATOM   2729 C C   . SER B 2 61  ? 42.876 38.425 -6.073  1.00 16.35 ? 61  SER B C   1 
ATOM   2730 O O   . SER B 2 61  ? 43.957 38.832 -5.637  1.00 16.36 ? 61  SER B O   1 
ATOM   2731 C CB  . SER B 2 61  ? 42.977 36.576 -7.796  1.00 14.63 ? 61  SER B CB  1 
ATOM   2732 O OG  . SER B 2 61  ? 44.250 36.211 -7.307  1.00 19.70 ? 61  SER B OG  1 
ATOM   2733 N N   . PHE B 2 62  ? 41.793 38.285 -5.313  1.00 15.36 ? 62  PHE B N   1 
ATOM   2734 C CA  . PHE B 2 62  ? 41.768 38.624 -3.891  1.00 13.82 ? 62  PHE B CA  1 
ATOM   2735 C C   . PHE B 2 62  ? 42.274 37.565 -2.925  1.00 12.83 ? 62  PHE B C   1 
ATOM   2736 O O   . PHE B 2 62  ? 42.166 36.368 -3.187  1.00 12.53 ? 62  PHE B O   1 
ATOM   2737 C CB  . PHE B 2 62  ? 40.347 39.016 -3.469  1.00 13.53 ? 62  PHE B CB  1 
ATOM   2738 C CG  . PHE B 2 62  ? 39.874 40.313 -4.051  1.00 12.11 ? 62  PHE B CG  1 
ATOM   2739 C CD1 . PHE B 2 62  ? 39.326 40.357 -5.329  1.00 15.41 ? 62  PHE B CD1 1 
ATOM   2740 C CD2 . PHE B 2 62  ? 39.994 41.494 -3.332  1.00 9.47  ? 62  PHE B CD2 1 
ATOM   2741 C CE1 . PHE B 2 62  ? 38.906 41.561 -5.882  1.00 9.17  ? 62  PHE B CE1 1 
ATOM   2742 C CE2 . PHE B 2 62  ? 39.578 42.691 -3.878  1.00 10.69 ? 62  PHE B CE2 1 
ATOM   2743 C CZ  . PHE B 2 62  ? 39.035 42.723 -5.156  1.00 9.90  ? 62  PHE B CZ  1 
ATOM   2744 N N   . TYR B 2 63  ? 42.803 38.036 -1.795  1.00 15.75 ? 63  TYR B N   1 
ATOM   2745 C CA  . TYR B 2 63  ? 43.314 37.208 -0.698  1.00 14.46 ? 63  TYR B CA  1 
ATOM   2746 C C   . TYR B 2 63  ? 42.764 37.845 0.577   1.00 13.18 ? 63  TYR B C   1 
ATOM   2747 O O   . TYR B 2 63  ? 42.869 39.060 0.752   1.00 13.86 ? 63  TYR B O   1 
ATOM   2748 C CB  . TYR B 2 63  ? 44.845 37.259 -0.632  1.00 19.74 ? 63  TYR B CB  1 
ATOM   2749 C CG  . TYR B 2 63  ? 45.577 36.471 -1.696  1.00 21.85 ? 63  TYR B CG  1 
ATOM   2750 C CD1 . TYR B 2 63  ? 45.278 36.635 -3.048  1.00 21.87 ? 63  TYR B CD1 1 
ATOM   2751 C CD2 . TYR B 2 63  ? 46.588 35.572 -1.348  1.00 21.39 ? 63  TYR B CD2 1 
ATOM   2752 C CE1 . TYR B 2 63  ? 45.963 35.926 -4.030  1.00 23.96 ? 63  TYR B CE1 1 
ATOM   2753 C CE2 . TYR B 2 63  ? 47.284 34.858 -2.321  1.00 23.03 ? 63  TYR B CE2 1 
ATOM   2754 C CZ  . TYR B 2 63  ? 46.964 35.041 -3.660  1.00 25.89 ? 63  TYR B CZ  1 
ATOM   2755 O OH  . TYR B 2 63  ? 47.629 34.335 -4.631  1.00 26.37 ? 63  TYR B OH  1 
ATOM   2756 N N   . ILE B 2 64  ? 42.166 37.047 1.451   1.00 10.21 ? 64  ILE B N   1 
ATOM   2757 C CA  . ILE B 2 64  ? 41.612 37.561 2.702   1.00 12.99 ? 64  ILE B CA  1 
ATOM   2758 C C   . ILE B 2 64  ? 41.822 36.517 3.797   1.00 12.51 ? 64  ILE B C   1 
ATOM   2759 O O   . ILE B 2 64  ? 41.789 35.315 3.528   1.00 14.21 ? 64  ILE B O   1 
ATOM   2760 C CB  . ILE B 2 64  ? 40.088 37.914 2.562   1.00 17.37 ? 64  ILE B CB  1 
ATOM   2761 C CG1 . ILE B 2 64  ? 39.537 38.537 3.852   1.00 19.88 ? 64  ILE B CG1 1 
ATOM   2762 C CG2 . ILE B 2 64  ? 39.270 36.672 2.236   1.00 17.48 ? 64  ILE B CG2 1 
ATOM   2763 C CD1 . ILE B 2 64  ? 40.171 39.856 4.233   1.00 16.41 ? 64  ILE B CD1 1 
ATOM   2764 N N   . LEU B 2 65  ? 42.067 36.975 5.022   1.00 14.51 ? 65  LEU B N   1 
ATOM   2765 C CA  . LEU B 2 65  ? 42.290 36.073 6.145   1.00 7.31  ? 65  LEU B CA  1 
ATOM   2766 C C   . LEU B 2 65  ? 41.217 36.193 7.207   1.00 7.25  ? 65  LEU B C   1 
ATOM   2767 O O   . LEU B 2 65  ? 40.866 37.296 7.631   1.00 7.66  ? 65  LEU B O   1 
ATOM   2768 C CB  . LEU B 2 65  ? 43.649 36.347 6.790   1.00 7.72  ? 65  LEU B CB  1 
ATOM   2769 C CG  . LEU B 2 65  ? 44.035 35.471 7.985   1.00 6.06  ? 65  LEU B CG  1 
ATOM   2770 C CD1 . LEU B 2 65  ? 44.232 34.034 7.545   1.00 5.48  ? 65  LEU B CD1 1 
ATOM   2771 C CD2 . LEU B 2 65  ? 45.295 36.000 8.634   1.00 4.08  ? 65  LEU B CD2 1 
ATOM   2772 N N   . ALA B 2 66  ? 40.649 35.053 7.579   1.00 9.06  ? 66  ALA B N   1 
ATOM   2773 C CA  . ALA B 2 66  ? 39.644 34.991 8.630   1.00 6.87  ? 66  ALA B CA  1 
ATOM   2774 C C   . ALA B 2 66  ? 40.329 34.209 9.749   1.00 11.43 ? 66  ALA B C   1 
ATOM   2775 O O   . ALA B 2 66  ? 40.906 33.137 9.511   1.00 10.56 ? 66  ALA B O   1 
ATOM   2776 C CB  . ALA B 2 66  ? 38.395 34.261 8.143   1.00 6.02  ? 66  ALA B CB  1 
ATOM   2777 N N   . HIS B 2 67  ? 40.356 34.781 10.945  1.00 10.08 ? 67  HIS B N   1 
ATOM   2778 C CA  . HIS B 2 67  ? 40.982 34.105 12.066  1.00 8.50  ? 67  HIS B CA  1 
ATOM   2779 C C   . HIS B 2 67  ? 40.275 34.358 13.392  1.00 10.69 ? 67  HIS B C   1 
ATOM   2780 O O   . HIS B 2 67  ? 39.584 35.361 13.569  1.00 12.90 ? 67  HIS B O   1 
ATOM   2781 C CB  . HIS B 2 67  ? 42.469 34.478 12.167  1.00 10.91 ? 67  HIS B CB  1 
ATOM   2782 C CG  . HIS B 2 67  ? 42.731 35.949 12.297  1.00 7.91  ? 67  HIS B CG  1 
ATOM   2783 N ND1 . HIS B 2 67  ? 43.122 36.533 13.483  1.00 8.83  ? 67  HIS B ND1 1 
ATOM   2784 C CD2 . HIS B 2 67  ? 42.724 36.941 11.376  1.00 5.41  ? 67  HIS B CD2 1 
ATOM   2785 C CE1 . HIS B 2 67  ? 43.350 37.819 13.286  1.00 9.69  ? 67  HIS B CE1 1 
ATOM   2786 N NE2 . HIS B 2 67  ? 43.117 38.092 12.015  1.00 10.93 ? 67  HIS B NE2 1 
ATOM   2787 N N   . THR B 2 68  ? 40.450 33.426 14.315  1.00 10.32 ? 68  THR B N   1 
ATOM   2788 C CA  . THR B 2 68  ? 39.857 33.514 15.630  1.00 15.14 ? 68  THR B CA  1 
ATOM   2789 C C   . THR B 2 68  ? 40.735 32.726 16.607  1.00 15.74 ? 68  THR B C   1 
ATOM   2790 O O   . THR B 2 68  ? 41.490 31.834 16.204  1.00 13.53 ? 68  THR B O   1 
ATOM   2791 C CB  . THR B 2 68  ? 38.420 32.940 15.620  1.00 19.06 ? 68  THR B CB  1 
ATOM   2792 O OG1 . THR B 2 68  ? 37.810 33.162 16.896  1.00 25.99 ? 68  THR B OG1 1 
ATOM   2793 C CG2 . THR B 2 68  ? 38.431 31.437 15.320  1.00 19.88 ? 68  THR B CG2 1 
ATOM   2794 N N   . GLU B 2 69  ? 40.676 33.077 17.883  1.00 20.60 ? 69  GLU B N   1 
ATOM   2795 C CA  . GLU B 2 69  ? 41.468 32.361 18.877  1.00 26.17 ? 69  GLU B CA  1 
ATOM   2796 C C   . GLU B 2 69  ? 40.675 31.127 19.273  1.00 23.89 ? 69  GLU B C   1 
ATOM   2797 O O   . GLU B 2 69  ? 39.451 31.102 19.165  1.00 26.89 ? 69  GLU B O   1 
ATOM   2798 C CB  . GLU B 2 69  ? 41.722 33.241 20.100  1.00 30.82 ? 69  GLU B CB  1 
ATOM   2799 C CG  . GLU B 2 69  ? 42.478 34.512 19.783  1.00 46.64 ? 69  GLU B CG  1 
ATOM   2800 C CD  . GLU B 2 69  ? 42.393 35.533 20.890  1.00 54.86 ? 69  GLU B CD  1 
ATOM   2801 O OE1 . GLU B 2 69  ? 43.228 35.504 21.808  1.00 58.56 ? 69  GLU B OE1 1 
ATOM   2802 O OE2 . GLU B 2 69  ? 41.482 36.378 20.845  1.00 63.57 ? 69  GLU B OE2 1 
ATOM   2803 N N   . PHE B 2 70  ? 41.363 30.082 19.689  1.00 21.53 ? 70  PHE B N   1 
ATOM   2804 C CA  . PHE B 2 70  ? 40.660 28.892 20.097  1.00 19.27 ? 70  PHE B CA  1 
ATOM   2805 C C   . PHE B 2 70  ? 41.623 27.993 20.850  1.00 21.29 ? 70  PHE B C   1 
ATOM   2806 O O   . PHE B 2 70  ? 42.835 28.129 20.720  1.00 24.75 ? 70  PHE B O   1 
ATOM   2807 C CB  . PHE B 2 70  ? 40.054 28.178 18.880  1.00 15.17 ? 70  PHE B CB  1 
ATOM   2808 C CG  . PHE B 2 70  ? 41.021 27.292 18.152  1.00 16.44 ? 70  PHE B CG  1 
ATOM   2809 C CD1 . PHE B 2 70  ? 42.166 27.820 17.564  1.00 15.23 ? 70  PHE B CD1 1 
ATOM   2810 C CD2 . PHE B 2 70  ? 40.808 25.920 18.091  1.00 11.60 ? 70  PHE B CD2 1 
ATOM   2811 C CE1 . PHE B 2 70  ? 43.091 26.989 16.927  1.00 13.89 ? 70  PHE B CE1 1 
ATOM   2812 C CE2 . PHE B 2 70  ? 41.722 25.088 17.459  1.00 13.97 ? 70  PHE B CE2 1 
ATOM   2813 C CZ  . PHE B 2 70  ? 42.871 25.628 16.875  1.00 13.73 ? 70  PHE B CZ  1 
ATOM   2814 N N   . THR B 2 71  ? 41.074 27.121 21.680  1.00 26.51 ? 71  THR B N   1 
ATOM   2815 C CA  . THR B 2 71  ? 41.857 26.179 22.458  1.00 24.52 ? 71  THR B CA  1 
ATOM   2816 C C   . THR B 2 71  ? 41.384 24.808 22.024  1.00 25.65 ? 71  THR B C   1 
ATOM   2817 O O   . THR B 2 71  ? 40.263 24.409 22.341  1.00 29.99 ? 71  THR B O   1 
ATOM   2818 C CB  . THR B 2 71  ? 41.594 26.358 23.963  1.00 24.04 ? 71  THR B CB  1 
ATOM   2819 O OG1 . THR B 2 71  ? 42.162 27.600 24.401  1.00 24.90 ? 71  THR B OG1 1 
ATOM   2820 C CG2 . THR B 2 71  ? 42.195 25.210 24.757  1.00 22.88 ? 71  THR B CG2 1 
ATOM   2821 N N   . PRO B 2 72  ? 42.207 24.093 21.247  1.00 26.76 ? 72  PRO B N   1 
ATOM   2822 C CA  . PRO B 2 72  ? 41.852 22.758 20.767  1.00 29.33 ? 72  PRO B CA  1 
ATOM   2823 C C   . PRO B 2 72  ? 41.574 21.754 21.877  1.00 32.92 ? 72  PRO B C   1 
ATOM   2824 O O   . PRO B 2 72  ? 42.145 21.828 22.964  1.00 37.00 ? 72  PRO B O   1 
ATOM   2825 C CB  . PRO B 2 72  ? 43.070 22.356 19.932  1.00 28.31 ? 72  PRO B CB  1 
ATOM   2826 C CG  . PRO B 2 72  ? 44.184 23.099 20.571  1.00 28.62 ? 72  PRO B CG  1 
ATOM   2827 C CD  . PRO B 2 72  ? 43.561 24.459 20.801  1.00 28.25 ? 72  PRO B CD  1 
ATOM   2828 N N   . THR B 2 73  ? 40.668 20.833 21.573  1.00 35.62 ? 73  THR B N   1 
ATOM   2829 C CA  . THR B 2 73  ? 40.241 19.758 22.456  1.00 32.31 ? 73  THR B CA  1 
ATOM   2830 C C   . THR B 2 73  ? 40.273 18.555 21.527  1.00 35.07 ? 73  THR B C   1 
ATOM   2831 O O   . THR B 2 73  ? 40.305 18.723 20.305  1.00 35.60 ? 73  THR B O   1 
ATOM   2832 C CB  . THR B 2 73  ? 38.796 19.996 22.926  1.00 35.71 ? 73  THR B CB  1 
ATOM   2833 O OG1 . THR B 2 73  ? 38.745 21.190 23.715  1.00 42.84 ? 73  THR B OG1 1 
ATOM   2834 C CG2 . THR B 2 73  ? 38.291 18.836 23.755  1.00 44.15 ? 73  THR B CG2 1 
ATOM   2835 N N   . GLU B 2 74  ? 40.272 17.345 22.068  1.00 38.81 ? 74  GLU B N   1 
ATOM   2836 C CA  . GLU B 2 74  ? 40.310 16.188 21.188  1.00 44.92 ? 74  GLU B CA  1 
ATOM   2837 C C   . GLU B 2 74  ? 38.949 15.847 20.559  1.00 46.60 ? 74  GLU B C   1 
ATOM   2838 O O   . GLU B 2 74  ? 38.892 15.131 19.559  1.00 53.48 ? 74  GLU B O   1 
ATOM   2839 C CB  . GLU B 2 74  ? 40.924 14.978 21.901  1.00 48.38 ? 74  GLU B CB  1 
ATOM   2840 C CG  . GLU B 2 74  ? 41.639 13.985 20.967  1.00 53.85 ? 74  GLU B CG  1 
ATOM   2841 C CD  . GLU B 2 74  ? 42.805 14.604 20.190  1.00 56.55 ? 74  GLU B CD  1 
ATOM   2842 O OE1 . GLU B 2 74  ? 43.941 14.620 20.713  1.00 55.86 ? 74  GLU B OE1 1 
ATOM   2843 O OE2 . GLU B 2 74  ? 42.597 15.063 19.043  1.00 58.74 ? 74  GLU B OE2 1 
ATOM   2844 N N   . THR B 2 75  ? 37.858 16.391 21.101  1.00 41.00 ? 75  THR B N   1 
ATOM   2845 C CA  . THR B 2 75  ? 36.536 16.100 20.544  1.00 40.15 ? 75  THR B CA  1 
ATOM   2846 C C   . THR B 2 75  ? 35.931 17.227 19.706  1.00 35.72 ? 75  THR B C   1 
ATOM   2847 O O   . THR B 2 75  ? 34.855 17.062 19.127  1.00 34.17 ? 75  THR B O   1 
ATOM   2848 C CB  . THR B 2 75  ? 35.514 15.679 21.640  1.00 43.22 ? 75  THR B CB  1 
ATOM   2849 O OG1 . THR B 2 75  ? 35.192 16.800 22.471  1.00 46.42 ? 75  THR B OG1 1 
ATOM   2850 C CG2 . THR B 2 75  ? 36.081 14.561 22.504  1.00 44.04 ? 75  THR B CG2 1 
ATOM   2851 N N   . ASP B 2 76  ? 36.612 18.368 19.652  1.00 32.26 ? 76  ASP B N   1 
ATOM   2852 C CA  . ASP B 2 76  ? 36.135 19.520 18.887  1.00 26.58 ? 76  ASP B CA  1 
ATOM   2853 C C   . ASP B 2 76  ? 36.694 19.549 17.484  1.00 23.42 ? 76  ASP B C   1 
ATOM   2854 O O   . ASP B 2 76  ? 37.895 19.369 17.289  1.00 21.86 ? 76  ASP B O   1 
ATOM   2855 C CB  . ASP B 2 76  ? 36.519 20.827 19.572  1.00 27.68 ? 76  ASP B CB  1 
ATOM   2856 C CG  . ASP B 2 76  ? 35.654 21.140 20.759  1.00 31.27 ? 76  ASP B CG  1 
ATOM   2857 O OD1 . ASP B 2 76  ? 34.580 20.523 20.910  1.00 35.10 ? 76  ASP B OD1 1 
ATOM   2858 O OD2 . ASP B 2 76  ? 36.045 22.027 21.542  1.00 36.14 ? 76  ASP B OD2 1 
ATOM   2859 N N   . THR B 2 77  ? 35.825 19.803 16.512  1.00 22.34 ? 77  THR B N   1 
ATOM   2860 C CA  . THR B 2 77  ? 36.238 19.878 15.120  1.00 17.53 ? 77  THR B CA  1 
ATOM   2861 C C   . THR B 2 77  ? 35.961 21.291 14.632  1.00 16.28 ? 77  THR B C   1 
ATOM   2862 O O   . THR B 2 77  ? 35.039 21.955 15.112  1.00 10.72 ? 77  THR B O   1 
ATOM   2863 C CB  . THR B 2 77  ? 35.476 18.886 14.258  1.00 14.89 ? 77  THR B CB  1 
ATOM   2864 O OG1 . THR B 2 77  ? 34.092 19.241 14.243  1.00 23.30 ? 77  THR B OG1 1 
ATOM   2865 C CG2 . THR B 2 77  ? 35.637 17.476 14.805  1.00 19.69 ? 77  THR B CG2 1 
ATOM   2866 N N   . TYR B 2 78  ? 36.794 21.762 13.712  1.00 16.71 ? 78  TYR B N   1 
ATOM   2867 C CA  . TYR B 2 78  ? 36.661 23.103 13.164  1.00 12.67 ? 78  TYR B CA  1 
ATOM   2868 C C   . TYR B 2 78  ? 36.640 23.046 11.649  1.00 12.77 ? 78  TYR B C   1 
ATOM   2869 O O   . TYR B 2 78  ? 37.163 22.112 11.039  1.00 16.00 ? 78  TYR B O   1 
ATOM   2870 C CB  . TYR B 2 78  ? 37.814 23.984 13.645  1.00 11.49 ? 78  TYR B CB  1 
ATOM   2871 C CG  . TYR B 2 78  ? 37.762 24.264 15.125  1.00 13.45 ? 78  TYR B CG  1 
ATOM   2872 C CD1 . TYR B 2 78  ? 38.301 23.363 16.052  1.00 8.86  ? 78  TYR B CD1 1 
ATOM   2873 C CD2 . TYR B 2 78  ? 37.137 25.418 15.606  1.00 11.39 ? 78  TYR B CD2 1 
ATOM   2874 C CE1 . TYR B 2 78  ? 38.211 23.606 17.421  1.00 13.14 ? 78  TYR B CE1 1 
ATOM   2875 C CE2 . TYR B 2 78  ? 37.045 25.670 16.966  1.00 12.46 ? 78  TYR B CE2 1 
ATOM   2876 C CZ  . TYR B 2 78  ? 37.580 24.763 17.866  1.00 14.63 ? 78  TYR B CZ  1 
ATOM   2877 O OH  . TYR B 2 78  ? 37.463 25.024 19.208  1.00 22.14 ? 78  TYR B OH  1 
ATOM   2878 N N   . ALA B 2 79  ? 36.033 24.051 11.041  1.00 13.59 ? 79  ALA B N   1 
ATOM   2879 C CA  . ALA B 2 79  ? 35.941 24.102 9.596   1.00 14.09 ? 79  ALA B CA  1 
ATOM   2880 C C   . ALA B 2 79  ? 35.703 25.526 9.143   1.00 14.15 ? 79  ALA B C   1 
ATOM   2881 O O   . ALA B 2 79  ? 35.395 26.407 9.946   1.00 14.80 ? 79  ALA B O   1 
ATOM   2882 C CB  . ALA B 2 79  ? 34.803 23.207 9.119   1.00 8.11  ? 79  ALA B CB  1 
ATOM   2883 N N   . CYS B 2 80  ? 35.886 25.755 7.853   1.00 15.28 ? 80  CYS B N   1 
ATOM   2884 C CA  . CYS B 2 80  ? 35.655 27.063 7.275   1.00 14.58 ? 80  CYS B CA  1 
ATOM   2885 C C   . CYS B 2 80  ? 34.748 26.813 6.085   1.00 15.80 ? 80  CYS B C   1 
ATOM   2886 O O   . CYS B 2 80  ? 35.022 25.936 5.263   1.00 15.35 ? 80  CYS B O   1 
ATOM   2887 C CB  . CYS B 2 80  ? 36.969 27.686 6.826   1.00 13.87 ? 80  CYS B CB  1 
ATOM   2888 S SG  . CYS B 2 80  ? 36.868 29.431 6.313   1.00 13.92 ? 80  CYS B SG  1 
ATOM   2889 N N   . ARG B 2 81  ? 33.604 27.480 6.067   1.00 17.25 ? 81  ARG B N   1 
ATOM   2890 C CA  . ARG B 2 81  ? 32.667 27.331 4.971   1.00 21.48 ? 81  ARG B CA  1 
ATOM   2891 C C   . ARG B 2 81  ? 32.701 28.624 4.172   1.00 20.89 ? 81  ARG B C   1 
ATOM   2892 O O   . ARG B 2 81  ? 32.602 29.719 4.737   1.00 17.72 ? 81  ARG B O   1 
ATOM   2893 C CB  . ARG B 2 81  ? 31.258 27.052 5.499   1.00 27.67 ? 81  ARG B CB  1 
ATOM   2894 C CG  . ARG B 2 81  ? 30.232 26.802 4.407   1.00 36.34 ? 81  ARG B CG  1 
ATOM   2895 C CD  . ARG B 2 81  ? 28.924 26.289 4.971   1.00 44.94 ? 81  ARG B CD  1 
ATOM   2896 N NE  . ARG B 2 81  ? 28.314 27.238 5.899   1.00 58.68 ? 81  ARG B NE  1 
ATOM   2897 C CZ  . ARG B 2 81  ? 27.572 26.885 6.947   1.00 65.14 ? 81  ARG B CZ  1 
ATOM   2898 N NH1 . ARG B 2 81  ? 27.349 25.599 7.202   1.00 68.19 ? 81  ARG B NH1 1 
ATOM   2899 N NH2 . ARG B 2 81  ? 27.056 27.817 7.740   1.00 66.36 ? 81  ARG B NH2 1 
ATOM   2900 N N   . VAL B 2 82  ? 32.858 28.492 2.859   1.00 19.74 ? 82  VAL B N   1 
ATOM   2901 C CA  . VAL B 2 82  ? 32.924 29.639 1.965   1.00 20.24 ? 82  VAL B CA  1 
ATOM   2902 C C   . VAL B 2 82  ? 31.848 29.590 0.873   1.00 20.97 ? 82  VAL B C   1 
ATOM   2903 O O   . VAL B 2 82  ? 31.620 28.547 0.260   1.00 17.20 ? 82  VAL B O   1 
ATOM   2904 C CB  . VAL B 2 82  ? 34.321 29.714 1.298   1.00 23.61 ? 82  VAL B CB  1 
ATOM   2905 C CG1 . VAL B 2 82  ? 34.401 30.885 0.321   1.00 18.61 ? 82  VAL B CG1 1 
ATOM   2906 C CG2 . VAL B 2 82  ? 35.405 29.825 2.370   1.00 19.14 ? 82  VAL B CG2 1 
ATOM   2907 N N   . LYS B 2 83  ? 31.152 30.707 0.684   1.00 23.44 ? 83  LYS B N   1 
ATOM   2908 C CA  . LYS B 2 83  ? 30.131 30.821 -0.349  1.00 27.42 ? 83  LYS B CA  1 
ATOM   2909 C C   . LYS B 2 83  ? 30.650 31.858 -1.339  1.00 29.77 ? 83  LYS B C   1 
ATOM   2910 O O   . LYS B 2 83  ? 31.024 32.967 -0.946  1.00 31.47 ? 83  LYS B O   1 
ATOM   2911 C CB  . LYS B 2 83  ? 28.798 31.297 0.229   1.00 32.57 ? 83  LYS B CB  1 
ATOM   2912 C CG  . LYS B 2 83  ? 28.227 30.423 1.323   1.00 40.83 ? 83  LYS B CG  1 
ATOM   2913 C CD  . LYS B 2 83  ? 26.794 30.828 1.636   1.00 47.99 ? 83  LYS B CD  1 
ATOM   2914 C CE  . LYS B 2 83  ? 26.319 30.224 2.950   1.00 52.98 ? 83  LYS B CE  1 
ATOM   2915 N NZ  . LYS B 2 83  ? 27.058 30.811 4.094   1.00 55.40 ? 83  LYS B NZ  1 
ATOM   2916 N N   . HIS B 2 84  ? 30.697 31.488 -2.613  1.00 27.39 ? 84  HIS B N   1 
ATOM   2917 C CA  . HIS B 2 84  ? 31.180 32.374 -3.665  1.00 28.55 ? 84  HIS B CA  1 
ATOM   2918 C C   . HIS B 2 84  ? 30.549 31.949 -4.988  1.00 33.83 ? 84  HIS B C   1 
ATOM   2919 O O   . HIS B 2 84  ? 30.566 30.769 -5.340  1.00 37.58 ? 84  HIS B O   1 
ATOM   2920 C CB  . HIS B 2 84  ? 32.699 32.278 -3.766  1.00 23.61 ? 84  HIS B CB  1 
ATOM   2921 C CG  . HIS B 2 84  ? 33.308 33.269 -4.705  1.00 20.31 ? 84  HIS B CG  1 
ATOM   2922 N ND1 . HIS B 2 84  ? 33.807 32.918 -5.941  1.00 18.47 ? 84  HIS B ND1 1 
ATOM   2923 C CD2 . HIS B 2 84  ? 33.532 34.596 -4.573  1.00 17.94 ? 84  HIS B CD2 1 
ATOM   2924 C CE1 . HIS B 2 84  ? 34.316 33.985 -6.528  1.00 16.73 ? 84  HIS B CE1 1 
ATOM   2925 N NE2 . HIS B 2 84  ? 34.161 35.016 -5.718  1.00 19.49 ? 84  HIS B NE2 1 
ATOM   2926 N N   . ASP B 2 85  ? 30.070 32.931 -5.743  1.00 37.90 ? 85  ASP B N   1 
ATOM   2927 C CA  . ASP B 2 85  ? 29.399 32.715 -7.023  1.00 39.17 ? 85  ASP B CA  1 
ATOM   2928 C C   . ASP B 2 85  ? 30.046 31.746 -7.998  1.00 38.51 ? 85  ASP B C   1 
ATOM   2929 O O   . ASP B 2 85  ? 29.359 31.147 -8.816  1.00 42.12 ? 85  ASP B O   1 
ATOM   2930 C CB  . ASP B 2 85  ? 29.148 34.056 -7.694  1.00 44.36 ? 85  ASP B CB  1 
ATOM   2931 C CG  . ASP B 2 85  ? 28.542 35.061 -6.738  1.00 54.56 ? 85  ASP B CG  1 
ATOM   2932 O OD1 . ASP B 2 85  ? 29.325 35.731 -6.029  1.00 61.27 ? 85  ASP B OD1 1 
ATOM   2933 O OD2 . ASP B 2 85  ? 27.297 35.144 -6.654  1.00 56.22 ? 85  ASP B OD2 1 
ATOM   2934 N N   . SER B 2 86  ? 31.356 31.567 -7.909  1.00 37.60 ? 86  SER B N   1 
ATOM   2935 C CA  . SER B 2 86  ? 32.041 30.641 -8.803  1.00 36.50 ? 86  SER B CA  1 
ATOM   2936 C C   . SER B 2 86  ? 31.723 29.199 -8.431  1.00 34.86 ? 86  SER B C   1 
ATOM   2937 O O   . SER B 2 86  ? 32.211 28.265 -9.070  1.00 34.59 ? 86  SER B O   1 
ATOM   2938 C CB  . SER B 2 86  ? 33.553 30.853 -8.727  1.00 39.81 ? 86  SER B CB  1 
ATOM   2939 O OG  . SER B 2 86  ? 34.058 30.518 -7.442  1.00 41.42 ? 86  SER B OG  1 
ATOM   2940 N N   . MET B 2 87  ? 30.938 29.028 -7.371  1.00 36.87 ? 87  MET B N   1 
ATOM   2941 C CA  . MET B 2 87  ? 30.568 27.712 -6.870  1.00 40.70 ? 87  MET B CA  1 
ATOM   2942 C C   . MET B 2 87  ? 29.063 27.640 -6.653  1.00 41.22 ? 87  MET B C   1 
ATOM   2943 O O   . MET B 2 87  ? 28.453 28.603 -6.198  1.00 42.23 ? 87  MET B O   1 
ATOM   2944 C CB  . MET B 2 87  ? 31.294 27.442 -5.548  1.00 40.11 ? 87  MET B CB  1 
ATOM   2945 C CG  . MET B 2 87  ? 32.781 27.771 -5.583  1.00 37.69 ? 87  MET B CG  1 
ATOM   2946 S SD  . MET B 2 87  ? 33.664 27.311 -4.086  1.00 39.30 ? 87  MET B SD  1 
ATOM   2947 C CE  . MET B 2 87  ? 33.078 28.560 -2.951  1.00 33.74 ? 87  MET B CE  1 
ATOM   2948 N N   . ALA B 2 88  ? 28.471 26.498 -6.995  1.00 45.53 ? 88  ALA B N   1 
ATOM   2949 C CA  . ALA B 2 88  ? 27.031 26.289 -6.842  1.00 48.03 ? 88  ALA B CA  1 
ATOM   2950 C C   . ALA B 2 88  ? 26.690 25.914 -5.408  1.00 47.76 ? 88  ALA B C   1 
ATOM   2951 O O   . ALA B 2 88  ? 25.691 26.374 -4.854  1.00 48.93 ? 88  ALA B O   1 
ATOM   2952 C CB  . ALA B 2 88  ? 26.558 25.201 -7.786  1.00 49.23 ? 88  ALA B CB  1 
ATOM   2953 N N   . GLU B 2 89  ? 27.506 25.032 -4.841  1.00 47.51 ? 89  GLU B N   1 
ATOM   2954 C CA  . GLU B 2 89  ? 27.342 24.568 -3.467  1.00 44.39 ? 89  GLU B CA  1 
ATOM   2955 C C   . GLU B 2 89  ? 28.465 25.212 -2.650  1.00 38.86 ? 89  GLU B C   1 
ATOM   2956 O O   . GLU B 2 89  ? 29.596 25.337 -3.133  1.00 38.04 ? 89  GLU B O   1 
ATOM   2957 C CB  . GLU B 2 89  ? 27.516 23.044 -3.404  1.00 47.70 ? 89  GLU B CB  1 
ATOM   2958 C CG  . GLU B 2 89  ? 26.703 22.243 -4.417  1.00 53.03 ? 89  GLU B CG  1 
ATOM   2959 C CD  . GLU B 2 89  ? 25.277 21.985 -3.971  1.00 56.27 ? 89  GLU B CD  1 
ATOM   2960 O OE1 . GLU B 2 89  ? 25.007 22.017 -2.749  1.00 57.61 ? 89  GLU B OE1 1 
ATOM   2961 O OE2 . GLU B 2 89  ? 24.424 21.730 -4.850  1.00 56.39 ? 89  GLU B OE2 1 
ATOM   2962 N N   . PRO B 2 90  ? 28.168 25.666 -1.424  1.00 30.96 ? 90  PRO B N   1 
ATOM   2963 C CA  . PRO B 2 90  ? 29.197 26.286 -0.582  1.00 30.15 ? 90  PRO B CA  1 
ATOM   2964 C C   . PRO B 2 90  ? 30.271 25.246 -0.268  1.00 29.66 ? 90  PRO B C   1 
ATOM   2965 O O   . PRO B 2 90  ? 29.978 24.051 -0.196  1.00 32.02 ? 90  PRO B O   1 
ATOM   2966 C CB  . PRO B 2 90  ? 28.421 26.660 0.677   1.00 28.69 ? 90  PRO B CB  1 
ATOM   2967 C CG  . PRO B 2 90  ? 27.043 26.914 0.152   1.00 32.30 ? 90  PRO B CG  1 
ATOM   2968 C CD  . PRO B 2 90  ? 26.848 25.757 -0.787  1.00 30.70 ? 90  PRO B CD  1 
ATOM   2969 N N   . LYS B 2 91  ? 31.508 25.682 -0.082  1.00 25.74 ? 91  LYS B N   1 
ATOM   2970 C CA  . LYS B 2 91  ? 32.565 24.732 0.210   1.00 25.56 ? 91  LYS B CA  1 
ATOM   2971 C C   . LYS B 2 91  ? 33.040 24.804 1.655   1.00 22.51 ? 91  LYS B C   1 
ATOM   2972 O O   . LYS B 2 91  ? 33.321 25.878 2.175   1.00 26.37 ? 91  LYS B O   1 
ATOM   2973 C CB  . LYS B 2 91  ? 33.731 24.918 -0.762  1.00 24.62 ? 91  LYS B CB  1 
ATOM   2974 C CG  . LYS B 2 91  ? 34.841 23.897 -0.597  1.00 26.59 ? 91  LYS B CG  1 
ATOM   2975 C CD  . LYS B 2 91  ? 35.742 23.867 -1.815  1.00 31.82 ? 91  LYS B CD  1 
ATOM   2976 C CE  . LYS B 2 91  ? 36.980 23.021 -1.566  1.00 38.01 ? 91  LYS B CE  1 
ATOM   2977 N NZ  . LYS B 2 91  ? 36.670 21.607 -1.198  1.00 45.01 ? 91  LYS B NZ  1 
ATOM   2978 N N   . THR B 2 92  ? 33.072 23.652 2.311   1.00 22.86 ? 92  THR B N   1 
ATOM   2979 C CA  . THR B 2 92  ? 33.520 23.557 3.692   1.00 20.48 ? 92  THR B CA  1 
ATOM   2980 C C   . THR B 2 92  ? 34.853 22.831 3.735   1.00 19.37 ? 92  THR B C   1 
ATOM   2981 O O   . THR B 2 92  ? 34.987 21.728 3.202   1.00 26.11 ? 92  THR B O   1 
ATOM   2982 C CB  . THR B 2 92  ? 32.513 22.783 4.561   1.00 18.05 ? 92  THR B CB  1 
ATOM   2983 O OG1 . THR B 2 92  ? 31.251 23.454 4.534   1.00 21.66 ? 92  THR B OG1 1 
ATOM   2984 C CG2 . THR B 2 92  ? 32.998 22.700 6.004   1.00 21.17 ? 92  THR B CG2 1 
ATOM   2985 N N   . VAL B 2 93  ? 35.858 23.479 4.306   1.00 16.06 ? 93  VAL B N   1 
ATOM   2986 C CA  . VAL B 2 93  ? 37.168 22.869 4.428   1.00 15.51 ? 93  VAL B CA  1 
ATOM   2987 C C   . VAL B 2 93  ? 37.434 22.676 5.913   1.00 15.46 ? 93  VAL B C   1 
ATOM   2988 O O   . VAL B 2 93  ? 37.307 23.606 6.707   1.00 13.40 ? 93  VAL B O   1 
ATOM   2989 C CB  . VAL B 2 93  ? 38.263 23.715 3.743   1.00 13.98 ? 93  VAL B CB  1 
ATOM   2990 C CG1 . VAL B 2 93  ? 39.629 23.133 4.018   1.00 12.19 ? 93  VAL B CG1 1 
ATOM   2991 C CG2 . VAL B 2 93  ? 38.025 23.726 2.242   1.00 15.27 ? 93  VAL B CG2 1 
ATOM   2992 N N   . TYR B 2 94  ? 37.713 21.433 6.282   1.00 19.17 ? 94  TYR B N   1 
ATOM   2993 C CA  . TYR B 2 94  ? 37.973 21.064 7.661   1.00 21.41 ? 94  TYR B CA  1 
ATOM   2994 C C   . TYR B 2 94  ? 39.411 21.223 8.091   1.00 21.62 ? 94  TYR B C   1 
ATOM   2995 O O   . TYR B 2 94  ? 40.340 21.022 7.307   1.00 23.67 ? 94  TYR B O   1 
ATOM   2996 C CB  . TYR B 2 94  ? 37.546 19.620 7.910   1.00 21.17 ? 94  TYR B CB  1 
ATOM   2997 C CG  . TYR B 2 94  ? 36.067 19.468 8.102   1.00 27.94 ? 94  TYR B CG  1 
ATOM   2998 C CD1 . TYR B 2 94  ? 35.216 19.276 7.008   1.00 29.51 ? 94  TYR B CD1 1 
ATOM   2999 C CD2 . TYR B 2 94  ? 35.507 19.526 9.379   1.00 27.45 ? 94  TYR B CD2 1 
ATOM   3000 C CE1 . TYR B 2 94  ? 33.840 19.145 7.181   1.00 30.98 ? 94  TYR B CE1 1 
ATOM   3001 C CE2 . TYR B 2 94  ? 34.138 19.397 9.566   1.00 32.25 ? 94  TYR B CE2 1 
ATOM   3002 C CZ  . TYR B 2 94  ? 33.307 19.205 8.463   1.00 34.94 ? 94  TYR B CZ  1 
ATOM   3003 O OH  . TYR B 2 94  ? 31.950 19.059 8.654   1.00 40.86 ? 94  TYR B OH  1 
ATOM   3004 N N   . TRP B 2 95  ? 39.584 21.577 9.356   1.00 21.36 ? 95  TRP B N   1 
ATOM   3005 C CA  . TRP B 2 95  ? 40.911 21.720 9.916   1.00 20.32 ? 95  TRP B CA  1 
ATOM   3006 C C   . TRP B 2 95  ? 41.448 20.305 10.130  1.00 22.83 ? 95  TRP B C   1 
ATOM   3007 O O   . TRP B 2 95  ? 40.849 19.496 10.855  1.00 18.93 ? 95  TRP B O   1 
ATOM   3008 C CB  . TRP B 2 95  ? 40.858 22.485 11.240  1.00 14.73 ? 95  TRP B CB  1 
ATOM   3009 C CG  . TRP B 2 95  ? 42.175 22.577 11.918  1.00 15.85 ? 95  TRP B CG  1 
ATOM   3010 C CD1 . TRP B 2 95  ? 43.385 22.843 11.338  1.00 14.14 ? 95  TRP B CD1 1 
ATOM   3011 C CD2 . TRP B 2 95  ? 42.435 22.361 13.308  1.00 18.39 ? 95  TRP B CD2 1 
ATOM   3012 N NE1 . TRP B 2 95  ? 44.382 22.798 12.281  1.00 13.74 ? 95  TRP B NE1 1 
ATOM   3013 C CE2 . TRP B 2 95  ? 43.829 22.505 13.500  1.00 17.12 ? 95  TRP B CE2 1 
ATOM   3014 C CE3 . TRP B 2 95  ? 41.626 22.056 14.413  1.00 18.87 ? 95  TRP B CE3 1 
ATOM   3015 C CZ2 . TRP B 2 95  ? 44.431 22.355 14.751  1.00 19.55 ? 95  TRP B CZ2 1 
ATOM   3016 C CZ3 . TRP B 2 95  ? 42.227 21.908 15.656  1.00 20.30 ? 95  TRP B CZ3 1 
ATOM   3017 C CH2 . TRP B 2 95  ? 43.616 22.057 15.814  1.00 20.92 ? 95  TRP B CH2 1 
ATOM   3018 N N   . ASP B 2 96  ? 42.506 19.981 9.398   1.00 26.72 ? 96  ASP B N   1 
ATOM   3019 C CA  . ASP B 2 96  ? 43.159 18.683 9.496   1.00 26.51 ? 96  ASP B CA  1 
ATOM   3020 C C   . ASP B 2 96  ? 44.337 18.865 10.443  1.00 27.24 ? 96  ASP B C   1 
ATOM   3021 O O   . ASP B 2 96  ? 45.407 19.320 10.030  1.00 31.55 ? 96  ASP B O   1 
ATOM   3022 C CB  . ASP B 2 96  ? 43.662 18.247 8.119   1.00 27.88 ? 96  ASP B CB  1 
ATOM   3023 C CG  . ASP B 2 96  ? 44.424 16.928 8.157   1.00 29.54 ? 96  ASP B CG  1 
ATOM   3024 O OD1 . ASP B 2 96  ? 44.536 16.309 9.236   1.00 30.27 ? 96  ASP B OD1 1 
ATOM   3025 O OD2 . ASP B 2 96  ? 44.918 16.502 7.094   1.00 35.65 ? 96  ASP B OD2 1 
ATOM   3026 N N   . ARG B 2 97  ? 44.148 18.519 11.710  1.00 28.36 ? 97  ARG B N   1 
ATOM   3027 C CA  . ARG B 2 97  ? 45.220 18.686 12.679  1.00 31.87 ? 97  ARG B CA  1 
ATOM   3028 C C   . ARG B 2 97  ? 46.390 17.705 12.532  1.00 35.33 ? 97  ARG B C   1 
ATOM   3029 O O   . ARG B 2 97  ? 47.398 17.830 13.225  1.00 35.41 ? 97  ARG B O   1 
ATOM   3030 C CB  . ARG B 2 97  ? 44.674 18.699 14.111  1.00 34.23 ? 97  ARG B CB  1 
ATOM   3031 C CG  . ARG B 2 97  ? 43.995 17.433 14.566  1.00 34.66 ? 97  ARG B CG  1 
ATOM   3032 C CD  . ARG B 2 97  ? 44.061 17.311 16.084  1.00 40.36 ? 97  ARG B CD  1 
ATOM   3033 N NE  . ARG B 2 97  ? 43.125 18.185 16.790  1.00 44.54 ? 97  ARG B NE  1 
ATOM   3034 C CZ  . ARG B 2 97  ? 43.177 18.444 18.099  1.00 45.19 ? 97  ARG B CZ  1 
ATOM   3035 N NH1 . ARG B 2 97  ? 44.130 17.910 18.858  1.00 42.04 ? 97  ARG B NH1 1 
ATOM   3036 N NH2 . ARG B 2 97  ? 42.241 19.198 18.663  1.00 45.62 ? 97  ARG B NH2 1 
ATOM   3037 N N   . ASP B 2 98  ? 46.273 16.755 11.610  1.00 40.04 ? 98  ASP B N   1 
ATOM   3038 C CA  . ASP B 2 98  ? 47.337 15.779 11.375  1.00 44.92 ? 98  ASP B CA  1 
ATOM   3039 C C   . ASP B 2 98  ? 47.919 16.018 9.979   1.00 46.09 ? 98  ASP B C   1 
ATOM   3040 O O   . ASP B 2 98  ? 48.128 15.067 9.219   1.00 51.84 ? 98  ASP B O   1 
ATOM   3041 C CB  . ASP B 2 98  ? 46.791 14.339 11.440  1.00 47.82 ? 98  ASP B CB  1 
ATOM   3042 C CG  . ASP B 2 98  ? 46.328 13.927 12.831  1.00 50.26 ? 98  ASP B CG  1 
ATOM   3043 O OD1 . ASP B 2 98  ? 46.785 14.484 13.851  1.00 50.17 ? 98  ASP B OD1 1 
ATOM   3044 O OD2 . ASP B 2 98  ? 45.511 12.986 12.915  1.00 52.44 ? 98  ASP B OD2 1 
ATOM   3045 N N   . MET B 2 99  ? 48.170 17.276 9.635   1.00 40.97 ? 99  MET B N   1 
ATOM   3046 C CA  . MET B 2 99  ? 48.703 17.609 8.316   1.00 37.08 ? 99  MET B CA  1 
ATOM   3047 C C   . MET B 2 99  ? 50.202 17.940 8.355   1.00 33.51 ? 99  MET B C   1 
ATOM   3048 O O   . MET B 2 99  ? 50.914 17.623 7.381   1.00 31.59 ? 99  MET B O   1 
ATOM   3049 C CB  . MET B 2 99  ? 47.910 18.772 7.714   1.00 36.08 ? 99  MET B CB  1 
ATOM   3050 C CG  . MET B 2 99  ? 48.180 19.020 6.238   1.00 39.20 ? 99  MET B CG  1 
ATOM   3051 S SD  . MET B 2 99  ? 47.460 20.563 5.623   1.00 39.22 ? 99  MET B SD  1 
ATOM   3052 C CE  . MET B 2 99  ? 45.771 20.062 5.366   1.00 41.84 ? 99  MET B CE  1 
ATOM   3053 O OXT . MET B 2 99  ? 50.665 18.499 9.365   1.00 31.70 ? 99  MET B OXT 1 
ATOM   3054 N N   . ARG C 3 1   ? 50.491 57.289 4.801   1.00 15.50 ? 1   ARG P N   1 
ATOM   3055 C CA  . ARG C 3 1   ? 49.506 58.338 4.416   1.00 22.67 ? 1   ARG P CA  1 
ATOM   3056 C C   . ARG C 3 1   ? 49.032 58.067 2.992   1.00 19.37 ? 1   ARG P C   1 
ATOM   3057 O O   . ARG C 3 1   ? 49.838 58.039 2.058   1.00 14.98 ? 1   ARG P O   1 
ATOM   3058 C CB  . ARG C 3 1   ? 50.158 59.712 4.479   1.00 29.06 ? 1   ARG P CB  1 
ATOM   3059 C CG  . ARG C 3 1   ? 49.376 60.724 5.266   1.00 36.70 ? 1   ARG P CG  1 
ATOM   3060 C CD  . ARG C 3 1   ? 50.011 62.077 5.131   1.00 44.48 ? 1   ARG P CD  1 
ATOM   3061 N NE  . ARG C 3 1   ? 49.342 63.070 5.959   1.00 54.12 ? 1   ARG P NE  1 
ATOM   3062 C CZ  . ARG C 3 1   ? 49.621 64.370 5.946   1.00 59.27 ? 1   ARG P CZ  1 
ATOM   3063 N NH1 . ARG C 3 1   ? 50.568 64.848 5.138   1.00 58.60 ? 1   ARG P NH1 1 
ATOM   3064 N NH2 . ARG C 3 1   ? 48.969 65.186 6.765   1.00 64.09 ? 1   ARG P NH2 1 
ATOM   3065 N N   . GLY C 3 2   ? 47.729 57.877 2.834   1.00 16.21 ? 2   GLY P N   1 
ATOM   3066 C CA  . GLY C 3 2   ? 47.172 57.586 1.529   1.00 11.02 ? 2   GLY P CA  1 
ATOM   3067 C C   . GLY C 3 2   ? 47.166 58.739 0.555   1.00 12.36 ? 2   GLY P C   1 
ATOM   3068 O O   . GLY C 3 2   ? 47.391 59.896 0.924   1.00 14.87 ? 2   GLY P O   1 
ATOM   3069 N N   . TYR C 3 3   ? 46.831 58.423 -0.686  1.00 12.65 ? 3   TYR P N   1 
ATOM   3070 C CA  . TYR C 3 3   ? 46.773 59.401 -1.758  1.00 11.41 ? 3   TYR P CA  1 
ATOM   3071 C C   . TYR C 3 3   ? 45.324 59.818 -2.011  1.00 12.85 ? 3   TYR P C   1 
ATOM   3072 O O   . TYR C 3 3   ? 44.392 59.090 -1.667  1.00 10.66 ? 3   TYR P O   1 
ATOM   3073 C CB  . TYR C 3 3   ? 47.365 58.772 -3.028  1.00 13.20 ? 3   TYR P CB  1 
ATOM   3074 C CG  . TYR C 3 3   ? 47.479 59.692 -4.220  1.00 14.92 ? 3   TYR P CG  1 
ATOM   3075 C CD1 . TYR C 3 3   ? 48.344 60.787 -4.195  1.00 13.99 ? 3   TYR P CD1 1 
ATOM   3076 C CD2 . TYR C 3 3   ? 46.748 59.453 -5.382  1.00 14.36 ? 3   TYR P CD2 1 
ATOM   3077 C CE1 . TYR C 3 3   ? 48.483 61.620 -5.292  1.00 13.31 ? 3   TYR P CE1 1 
ATOM   3078 C CE2 . TYR C 3 3   ? 46.883 60.282 -6.490  1.00 16.86 ? 3   TYR P CE2 1 
ATOM   3079 C CZ  . TYR C 3 3   ? 47.755 61.362 -6.437  1.00 16.40 ? 3   TYR P CZ  1 
ATOM   3080 O OH  . TYR C 3 3   ? 47.914 62.182 -7.527  1.00 16.79 ? 3   TYR P OH  1 
ATOM   3081 N N   . VAL C 3 4   ? 45.147 61.015 -2.566  1.00 14.97 ? 4   VAL P N   1 
ATOM   3082 C CA  . VAL C 3 4   ? 43.828 61.537 -2.925  1.00 12.70 ? 4   VAL P CA  1 
ATOM   3083 C C   . VAL C 3 4   ? 43.733 61.267 -4.426  1.00 10.79 ? 4   VAL P C   1 
ATOM   3084 O O   . VAL C 3 4   ? 44.339 61.963 -5.241  1.00 8.76  ? 4   VAL P O   1 
ATOM   3085 C CB  . VAL C 3 4   ? 43.725 63.057 -2.662  1.00 18.33 ? 4   VAL P CB  1 
ATOM   3086 C CG1 . VAL C 3 4   ? 42.428 63.604 -3.235  1.00 18.29 ? 4   VAL P CG1 1 
ATOM   3087 C CG2 . VAL C 3 4   ? 43.791 63.336 -1.166  1.00 17.89 ? 4   VAL P CG2 1 
ATOM   3088 N N   . TYR C 3 5   ? 42.988 60.233 -4.782  1.00 11.71 ? 5   TYR P N   1 
ATOM   3089 C CA  . TYR C 3 5   ? 42.861 59.819 -6.168  1.00 12.55 ? 5   TYR P CA  1 
ATOM   3090 C C   . TYR C 3 5   ? 42.153 60.756 -7.136  1.00 16.79 ? 5   TYR P C   1 
ATOM   3091 O O   . TYR C 3 5   ? 41.236 61.496 -6.765  1.00 10.94 ? 5   TYR P O   1 
ATOM   3092 C CB  . TYR C 3 5   ? 42.248 58.415 -6.231  1.00 10.15 ? 5   TYR P CB  1 
ATOM   3093 C CG  . TYR C 3 5   ? 43.052 57.413 -5.445  1.00 10.83 ? 5   TYR P CG  1 
ATOM   3094 C CD1 . TYR C 3 5   ? 42.837 57.237 -4.081  1.00 12.25 ? 5   TYR P CD1 1 
ATOM   3095 C CD2 . TYR C 3 5   ? 44.079 56.692 -6.049  1.00 7.42  ? 5   TYR P CD2 1 
ATOM   3096 C CE1 . TYR C 3 5   ? 43.634 56.374 -3.334  1.00 19.14 ? 5   TYR P CE1 1 
ATOM   3097 C CE2 . TYR C 3 5   ? 44.878 55.831 -5.320  1.00 11.55 ? 5   TYR P CE2 1 
ATOM   3098 C CZ  . TYR C 3 5   ? 44.659 55.675 -3.962  1.00 16.52 ? 5   TYR P CZ  1 
ATOM   3099 O OH  . TYR C 3 5   ? 45.481 54.843 -3.233  1.00 19.71 ? 5   TYR P OH  1 
ATOM   3100 N N   . GLN C 3 6   ? 42.614 60.704 -8.383  1.00 17.51 ? 6   GLN P N   1 
ATOM   3101 C CA  . GLN C 3 6   ? 42.074 61.483 -9.490  1.00 19.73 ? 6   GLN P CA  1 
ATOM   3102 C C   . GLN C 3 6   ? 40.995 60.621 -10.169 1.00 18.15 ? 6   GLN P C   1 
ATOM   3103 O O   . GLN C 3 6   ? 41.127 59.397 -10.237 1.00 19.39 ? 6   GLN P O   1 
ATOM   3104 C CB  . GLN C 3 6   ? 43.205 61.774 -10.477 1.00 25.34 ? 6   GLN P CB  1 
ATOM   3105 C CG  . GLN C 3 6   ? 42.826 62.652 -11.647 1.00 34.71 ? 6   GLN P CG  1 
ATOM   3106 C CD  . GLN C 3 6   ? 42.326 64.003 -11.208 1.00 39.70 ? 6   GLN P CD  1 
ATOM   3107 O OE1 . GLN C 3 6   ? 41.122 64.205 -11.045 1.00 44.90 ? 6   GLN P OE1 1 
ATOM   3108 N NE2 . GLN C 3 6   ? 43.245 64.934 -10.996 1.00 41.29 ? 6   GLN P NE2 1 
ATOM   3109 N N   . GLY C 3 7   ? 39.926 61.243 -10.655 1.00 15.97 ? 7   GLY P N   1 
ATOM   3110 C CA  . GLY C 3 7   ? 38.877 60.478 -11.316 1.00 13.28 ? 7   GLY P CA  1 
ATOM   3111 C C   . GLY C 3 7   ? 39.266 59.960 -12.700 1.00 15.17 ? 7   GLY P C   1 
ATOM   3112 O O   . GLY C 3 7   ? 40.040 60.605 -13.419 1.00 11.26 ? 7   GLY P O   1 
ATOM   3113 N N   . LEU C 3 8   ? 38.722 58.801 -13.070 1.00 9.75  ? 8   LEU P N   1 
ATOM   3114 C CA  . LEU C 3 8   ? 38.991 58.166 -14.355 1.00 11.76 ? 8   LEU P CA  1 
ATOM   3115 C C   . LEU C 3 8   ? 38.236 58.800 -15.541 1.00 15.70 ? 8   LEU P C   1 
ATOM   3116 O O   . LEU C 3 8   ? 37.251 59.531 -15.325 1.00 12.80 ? 8   LEU P O   1 
ATOM   3117 C CB  . LEU C 3 8   ? 38.639 56.682 -14.277 1.00 12.76 ? 8   LEU P CB  1 
ATOM   3118 C CG  . LEU C 3 8   ? 39.299 55.837 -13.192 1.00 13.23 ? 8   LEU P CG  1 
ATOM   3119 C CD1 . LEU C 3 8   ? 38.892 54.396 -13.383 1.00 12.70 ? 8   LEU P CD1 1 
ATOM   3120 C CD2 . LEU C 3 8   ? 40.805 55.963 -13.268 1.00 15.60 ? 8   LEU P CD2 1 
ATOM   3121 O OXT . LEU C 3 8   ? 38.620 58.540 -16.696 1.00 12.31 ? 8   LEU P OXT 1 
HETATM 3122 O O   . HOH D 4 .   ? 53.366 31.694 11.929  1.00 9.75  ? 275 HOH A O   1 
HETATM 3123 O O   . HOH D 4 .   ? 41.708 66.790 -17.865 1.00 13.29 ? 276 HOH A O   1 
HETATM 3124 O O   . HOH D 4 .   ? 54.326 41.843 11.897  1.00 14.17 ? 277 HOH A O   1 
HETATM 3125 O O   . HOH D 4 .   ? 52.730 29.208 11.753  1.00 16.71 ? 278 HOH A O   1 
HETATM 3126 O O   . HOH D 4 .   ? 47.123 56.154 6.000   1.00 18.14 ? 279 HOH A O   1 
HETATM 3127 O O   . HOH D 4 .   ? 54.180 46.838 2.082   1.00 18.14 ? 280 HOH A O   1 
HETATM 3128 O O   . HOH D 4 .   ? 39.034 44.917 -10.622 1.00 18.17 ? 281 HOH A O   1 
HETATM 3129 O O   . HOH D 4 .   ? 69.154 31.067 6.260   1.00 18.43 ? 282 HOH A O   1 
HETATM 3130 O O   . HOH D 4 .   ? 31.211 49.929 -13.249 1.00 18.56 ? 283 HOH A O   1 
HETATM 3131 O O   . HOH D 4 .   ? 48.831 30.272 0.792   1.00 19.51 ? 284 HOH A O   1 
HETATM 3132 O O   . HOH D 4 .   ? 57.734 34.259 1.235   1.00 19.77 ? 285 HOH A O   1 
HETATM 3133 O O   . HOH D 4 .   ? 36.703 51.414 8.779   1.00 21.14 ? 286 HOH A O   1 
HETATM 3134 O O   . HOH D 4 .   ? 42.628 43.478 5.900   1.00 21.54 ? 287 HOH A O   1 
HETATM 3135 O O   . HOH D 4 .   ? 53.231 56.203 13.342  1.00 22.02 ? 288 HOH A O   1 
HETATM 3136 O O   . HOH D 4 .   ? 47.037 23.764 5.885   1.00 23.69 ? 289 HOH A O   1 
HETATM 3137 O O   . HOH D 4 .   ? 26.397 50.054 -6.172  1.00 24.53 ? 290 HOH A O   1 
HETATM 3138 O O   . HOH D 4 .   ? 28.997 49.212 -11.829 1.00 24.68 ? 291 HOH A O   1 
HETATM 3139 O O   . HOH D 4 .   ? 46.883 59.093 -10.679 1.00 24.72 ? 292 HOH A O   1 
HETATM 3140 O O   . HOH D 4 .   ? 50.838 65.458 -4.620  1.00 24.78 ? 293 HOH A O   1 
HETATM 3141 O O   . HOH D 4 .   ? 53.253 51.548 -11.490 1.00 24.96 ? 294 HOH A O   1 
HETATM 3142 O O   . HOH D 4 .   ? 30.154 54.016 -1.480  1.00 25.94 ? 295 HOH A O   1 
HETATM 3143 O O   . HOH D 4 .   ? 48.853 44.357 11.881  1.00 26.34 ? 296 HOH A O   1 
HETATM 3144 O O   . HOH D 4 .   ? 38.652 58.439 -8.242  1.00 26.62 ? 297 HOH A O   1 
HETATM 3145 O O   . HOH D 4 .   ? 60.461 27.853 -1.082  1.00 27.48 ? 298 HOH A O   1 
HETATM 3146 O O   . HOH D 4 .   ? 55.013 32.627 -1.324  1.00 27.97 ? 299 HOH A O   1 
HETATM 3147 O O   . HOH D 4 .   ? 58.835 44.829 8.305   1.00 28.28 ? 300 HOH A O   1 
HETATM 3148 O O   . HOH D 4 .   ? 57.413 23.453 14.447  1.00 28.29 ? 301 HOH A O   1 
HETATM 3149 O O   . HOH D 4 .   ? 64.232 35.947 5.029   1.00 29.04 ? 302 HOH A O   1 
HETATM 3150 O O   . HOH D 4 .   ? 28.457 53.754 -8.710  1.00 29.39 ? 303 HOH A O   1 
HETATM 3151 O O   . HOH D 4 .   ? 49.687 41.941 9.403   1.00 29.56 ? 304 HOH A O   1 
HETATM 3152 O O   . HOH D 4 .   ? 36.909 62.125 -15.266 1.00 29.59 ? 305 HOH A O   1 
HETATM 3153 O O   . HOH D 4 .   ? 43.610 44.202 -19.691 1.00 30.18 ? 306 HOH A O   1 
HETATM 3154 O O   . HOH D 4 .   ? 45.220 42.050 -16.742 1.00 30.33 ? 307 HOH A O   1 
HETATM 3155 O O   . HOH D 4 .   ? 47.552 31.007 -1.490  1.00 30.64 ? 308 HOH A O   1 
HETATM 3156 O O   . HOH D 4 .   ? 60.172 61.390 7.670   1.00 30.86 ? 309 HOH A O   1 
HETATM 3157 O O   . HOH D 4 .   ? 59.606 53.840 -10.206 1.00 31.21 ? 310 HOH A O   1 
HETATM 3158 O O   . HOH D 4 .   ? 47.384 24.144 3.320   1.00 31.90 ? 311 HOH A O   1 
HETATM 3159 O O   . HOH D 4 .   ? 53.199 55.448 23.050  1.00 32.19 ? 312 HOH A O   1 
HETATM 3160 O O   . HOH D 4 .   ? 50.738 38.262 9.400   1.00 32.77 ? 313 HOH A O   1 
HETATM 3161 O O   . HOH D 4 .   ? 64.954 51.898 5.177   1.00 32.95 ? 314 HOH A O   1 
HETATM 3162 O O   . HOH D 4 .   ? 62.244 62.197 6.083   1.00 33.17 ? 315 HOH A O   1 
HETATM 3163 O O   . HOH D 4 .   ? 45.782 43.074 10.735  1.00 33.66 ? 316 HOH A O   1 
HETATM 3164 O O   . HOH D 4 .   ? 68.561 48.819 -0.108  1.00 34.30 ? 317 HOH A O   1 
HETATM 3165 O O   . HOH D 4 .   ? 58.354 50.501 17.826  1.00 34.82 ? 318 HOH A O   1 
HETATM 3166 O O   . HOH D 4 .   ? 53.349 51.912 20.508  1.00 35.17 ? 319 HOH A O   1 
HETATM 3167 O O   . HOH D 4 .   ? 31.519 56.182 4.396   1.00 35.53 ? 320 HOH A O   1 
HETATM 3168 O O   . HOH D 4 .   ? 49.658 63.203 -16.446 1.00 36.24 ? 321 HOH A O   1 
HETATM 3169 O O   . HOH D 4 .   ? 40.663 56.754 -9.571  1.00 36.48 ? 322 HOH A O   1 
HETATM 3170 O O   . HOH D 4 .   ? 62.207 43.759 8.982   1.00 37.26 ? 323 HOH A O   1 
HETATM 3171 O O   . HOH D 4 .   ? 44.064 39.298 -14.318 1.00 37.90 ? 324 HOH A O   1 
HETATM 3172 O O   . HOH D 4 .   ? 29.036 52.193 1.079   1.00 37.95 ? 325 HOH A O   1 
HETATM 3173 O O   . HOH D 4 .   ? 64.349 54.497 6.441   1.00 38.60 ? 326 HOH A O   1 
HETATM 3174 O O   . HOH D 4 .   ? 26.710 51.515 -8.397  1.00 38.67 ? 327 HOH A O   1 
HETATM 3175 O O   . HOH D 4 .   ? 52.216 42.266 13.611  1.00 38.72 ? 328 HOH A O   1 
HETATM 3176 O O   . HOH D 4 .   ? 64.271 33.671 1.213   1.00 38.78 ? 329 HOH A O   1 
HETATM 3177 O O   . HOH D 4 .   ? 50.496 33.947 18.927  1.00 38.86 ? 330 HOH A O   1 
HETATM 3178 O O   . HOH D 4 .   ? 27.078 45.862 -16.308 1.00 38.99 ? 331 HOH A O   1 
HETATM 3179 O O   . HOH D 4 .   ? 44.875 48.373 17.736  1.00 39.08 ? 332 HOH A O   1 
HETATM 3180 O O   . HOH D 4 .   ? 34.516 44.753 -18.021 1.00 39.30 ? 333 HOH A O   1 
HETATM 3181 O O   . HOH D 4 .   ? 45.820 50.209 -26.308 1.00 39.51 ? 334 HOH A O   1 
HETATM 3182 O O   . HOH D 4 .   ? 70.889 34.370 7.058   1.00 39.88 ? 335 HOH A O   1 
HETATM 3183 O O   . HOH D 4 .   ? 47.423 48.176 -15.232 1.00 40.05 ? 336 HOH A O   1 
HETATM 3184 O O   . HOH D 4 .   ? 35.832 60.733 -10.674 1.00 40.08 ? 337 HOH A O   1 
HETATM 3185 O O   . HOH D 4 .   ? 50.883 17.992 0.066   1.00 40.90 ? 338 HOH A O   1 
HETATM 3186 O O   . HOH D 4 .   ? 30.090 59.702 -14.226 1.00 41.96 ? 339 HOH A O   1 
HETATM 3187 O O   . HOH D 4 .   ? 61.551 63.319 0.749   1.00 42.66 ? 340 HOH A O   1 
HETATM 3188 O O   . HOH D 4 .   ? 37.710 48.269 9.397   1.00 43.08 ? 341 HOH A O   1 
HETATM 3189 O O   . HOH D 4 .   ? 52.106 65.961 -15.577 1.00 43.14 ? 342 HOH A O   1 
HETATM 3190 O O   . HOH D 4 .   ? 41.257 47.373 -0.544  1.00 44.51 ? 343 HOH A O   1 
HETATM 3191 O O   . HOH D 4 .   ? 39.958 43.513 6.015   1.00 45.23 ? 344 HOH A O   1 
HETATM 3192 O O   . HOH D 4 .   ? 56.251 66.421 -9.624  1.00 45.25 ? 345 HOH A O   1 
HETATM 3193 O O   . HOH D 4 .   ? 51.647 59.552 -20.294 1.00 45.38 ? 346 HOH A O   1 
HETATM 3194 O O   . HOH D 4 .   ? 49.090 28.542 -1.669  1.00 45.64 ? 347 HOH A O   1 
HETATM 3195 O O   . HOH D 4 .   ? 32.690 42.070 -15.504 1.00 46.08 ? 348 HOH A O   1 
HETATM 3196 O O   . HOH D 4 .   ? 32.108 59.014 1.417   1.00 46.17 ? 349 HOH A O   1 
HETATM 3197 O O   . HOH D 4 .   ? 47.787 65.007 -4.310  1.00 47.46 ? 350 HOH A O   1 
HETATM 3198 O O   . HOH D 4 .   ? 40.254 66.742 -20.505 1.00 48.01 ? 351 HOH A O   1 
HETATM 3199 O O   . HOH D 4 .   ? 66.681 58.243 -5.218  1.00 48.20 ? 352 HOH A O   1 
HETATM 3200 O O   . HOH D 4 .   ? 62.516 60.990 -2.783  1.00 48.31 ? 353 HOH A O   1 
HETATM 3201 O O   . HOH D 4 .   ? 48.387 49.106 -17.950 1.00 48.89 ? 354 HOH A O   1 
HETATM 3202 O O   . HOH D 4 .   ? 55.852 29.671 -3.021  1.00 49.98 ? 355 HOH A O   1 
HETATM 3203 O O   . HOH D 4 .   ? 50.909 42.671 1.018   1.00 50.10 ? 356 HOH A O   1 
HETATM 3204 O O   . HOH D 4 .   ? 35.852 45.504 -0.576  1.00 50.58 ? 357 HOH A O   1 
HETATM 3205 O O   . HOH D 4 .   ? 48.385 37.576 10.547  1.00 50.61 ? 358 HOH A O   1 
HETATM 3206 O O   . HOH D 4 .   ? 53.579 28.354 -4.287  1.00 51.30 ? 359 HOH A O   1 
HETATM 3207 O O   . HOH D 4 .   ? 41.468 47.663 13.503  1.00 52.20 ? 360 HOH A O   1 
HETATM 3208 O O   . HOH D 4 .   ? 39.850 46.779 -18.335 1.00 52.73 ? 361 HOH A O   1 
HETATM 3209 O O   . HOH D 4 .   ? 26.525 48.630 -12.833 1.00 52.91 ? 362 HOH A O   1 
HETATM 3210 O O   . HOH D 4 .   ? 32.555 41.569 4.133   1.00 53.07 ? 363 HOH A O   1 
HETATM 3211 O O   . HOH D 4 .   ? 47.743 41.382 -14.701 1.00 55.96 ? 364 HOH A O   1 
HETATM 3212 O O   . HOH D 4 .   ? 69.900 22.590 10.813  1.00 59.37 ? 365 HOH A O   1 
HETATM 3213 O O   . HOH E 4 .   ? 46.923 38.583 2.214   1.00 6.97  ? 100 HOH B O   1 
HETATM 3214 O O   . HOH E 4 .   ? 38.563 19.674 13.005  1.00 13.21 ? 101 HOH B O   1 
HETATM 3215 O O   . HOH E 4 .   ? 32.486 22.212 12.336  1.00 22.65 ? 102 HOH B O   1 
HETATM 3216 O O   . HOH E 4 .   ? 47.368 24.380 21.005  1.00 22.83 ? 103 HOH B O   1 
HETATM 3217 O O   . HOH E 4 .   ? 43.910 21.801 7.646   1.00 26.53 ? 104 HOH B O   1 
HETATM 3218 O O   . HOH E 4 .   ? 47.283 23.080 11.511  1.00 27.36 ? 105 HOH B O   1 
HETATM 3219 O O   . HOH E 4 .   ? 35.957 41.280 0.499   1.00 28.72 ? 106 HOH B O   1 
HETATM 3220 O O   . HOH E 4 .   ? 29.639 31.162 4.271   1.00 29.60 ? 107 HOH B O   1 
HETATM 3221 O O   . HOH E 4 .   ? 41.207 17.181 12.259  1.00 30.58 ? 108 HOH B O   1 
HETATM 3222 O O   . HOH E 4 .   ? 38.407 23.086 20.593  1.00 31.31 ? 109 HOH B O   1 
HETATM 3223 O O   . HOH E 4 .   ? 32.326 32.824 11.476  1.00 32.05 ? 110 HOH B O   1 
HETATM 3224 O O   . HOH E 4 .   ? 43.578 23.361 4.590   1.00 34.18 ? 111 HOH B O   1 
HETATM 3225 O O   . HOH E 4 .   ? 42.040 38.101 -11.434 1.00 36.67 ? 112 HOH B O   1 
HETATM 3226 O O   . HOH E 4 .   ? 34.830 39.913 -11.855 1.00 37.00 ? 113 HOH B O   1 
HETATM 3227 O O   . HOH E 4 .   ? 39.981 20.822 18.561  1.00 37.95 ? 114 HOH B O   1 
HETATM 3228 O O   . HOH E 4 .   ? 41.195 20.313 26.674  1.00 40.03 ? 115 HOH B O   1 
HETATM 3229 O O   . HOH E 4 .   ? 37.973 19.335 3.958   1.00 40.35 ? 116 HOH B O   1 
HETATM 3230 O O   . HOH E 4 .   ? 44.568 40.593 12.451  1.00 40.61 ? 117 HOH B O   1 
HETATM 3231 O O   . HOH E 4 .   ? 29.609 22.744 2.273   1.00 41.03 ? 118 HOH B O   1 
HETATM 3232 O O   . HOH E 4 .   ? 30.843 19.106 4.072   1.00 41.21 ? 119 HOH B O   1 
HETATM 3233 O O   . HOH E 4 .   ? 56.646 30.091 16.937  1.00 41.47 ? 120 HOH B O   1 
HETATM 3234 O O   . HOH E 4 .   ? 38.676 20.756 0.229   1.00 41.78 ? 121 HOH B O   1 
HETATM 3235 O O   . HOH E 4 .   ? 50.728 23.790 12.467  1.00 43.46 ? 122 HOH B O   1 
HETATM 3236 O O   . HOH E 4 .   ? 36.658 27.265 20.801  1.00 44.92 ? 123 HOH B O   1 
HETATM 3237 O O   . HOH E 4 .   ? 42.697 36.103 16.111  1.00 46.09 ? 124 HOH B O   1 
HETATM 3238 O O   . HOH E 4 .   ? 35.342 23.786 23.732  1.00 47.50 ? 125 HOH B O   1 
HETATM 3239 O O   . HOH E 4 .   ? 47.130 14.810 6.405   1.00 47.76 ? 126 HOH B O   1 
HETATM 3240 O O   . HOH E 4 .   ? 34.637 43.160 -1.039  1.00 48.53 ? 127 HOH B O   1 
HETATM 3241 O O   . HOH E 4 .   ? 49.502 34.571 0.400   1.00 51.31 ? 128 HOH B O   1 
HETATM 3242 O O   . HOH E 4 .   ? 48.569 44.132 -9.390  1.00 52.65 ? 129 HOH B O   1 
HETATM 3243 O O   . HOH E 4 .   ? 48.824 34.663 -6.754  1.00 53.09 ? 130 HOH B O   1 
HETATM 3244 O O   . HOH E 4 .   ? 35.708 20.087 0.677   1.00 53.17 ? 131 HOH B O   1 
HETATM 3245 O O   . HOH E 4 .   ? 33.035 37.191 4.354   1.00 53.90 ? 132 HOH B O   1 
HETATM 3246 O O   . HOH E 4 .   ? 38.540 42.629 11.720  1.00 58.58 ? 133 HOH B O   1 
HETATM 3247 O O   . HOH F 4 .   ? 35.224 59.366 -13.473 1.00 7.13  ? 9   HOH P O   1 
HETATM 3248 O O   . HOH F 4 .   ? 39.621 61.365 -4.804  1.00 20.54 ? 10  HOH P O   1 
HETATM 3249 O O   . HOH F 4 .   ? 39.481 63.204 -14.557 1.00 24.96 ? 11  HOH P O   1 
HETATM 3250 O O   . HOH F 4 .   ? 44.556 59.007 -9.439  1.00 26.47 ? 12  HOH P O   1 
HETATM 3251 O O   . HOH F 4 .   ? 44.894 55.783 -0.344  1.00 33.33 ? 13  HOH P O   1 
HETATM 3252 O O   . HOH F 4 .   ? 48.234 64.429 9.696   1.00 36.85 ? 14  HOH P O   1 
HETATM 3253 O O   . HOH F 4 .   ? 39.282 63.155 -7.058  1.00 39.69 ? 15  HOH P O   1 
HETATM 3254 O O   . HOH F 4 .   ? 47.296 62.599 7.765   1.00 41.71 ? 16  HOH P O   1 
HETATM 3255 O O   . HOH F 4 .   ? 47.775 55.816 -1.828  1.00 46.11 ? 17  HOH P O   1 
HETATM 3256 O O   . HOH F 4 .   ? 42.121 64.702 -6.957  1.00 46.74 ? 18  HOH P O   1 
HETATM 3257 O O   . HOH F 4 .   ? 53.396 65.082 4.389   1.00 55.54 ? 19  HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  TRP 60  60  60  TRP TRP A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  HIS 93  93  93  HIS HIS A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 CYS 121 121 121 CYS CYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 TRP 147 147 147 TRP TRP A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 CYS 164 164 164 CYS CYS A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TRP 167 167 167 TRP TRP A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 HIS 188 188 188 HIS HIS A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 HIS 192 192 192 HIS HIS A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 CYS 203 203 203 CYS CYS A . n 
A 1 204 TRP 204 204 204 TRP TRP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 MET 228 228 228 MET MET A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLU 232 232 232 GLU GLU A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 PHE 241 241 241 PHE PHE A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 SER 246 246 246 SER SER A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 HIS 260 260 260 HIS HIS A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 HIS 263 263 263 HIS HIS A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 TRP 274 274 274 TRP TRP A . n 
B 2 1   ILE 1   1   1   ILE ILE B . n 
B 2 2   GLN 2   2   2   GLN GLN B . n 
B 2 3   LYS 3   3   3   LYS LYS B . n 
B 2 4   THR 4   4   4   THR THR B . n 
B 2 5   PRO 5   5   5   PRO PRO B . n 
B 2 6   GLN 6   6   6   GLN GLN B . n 
B 2 7   ILE 7   7   7   ILE ILE B . n 
B 2 8   GLN 8   8   8   GLN GLN B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  SER 11  11  11  SER SER B . n 
B 2 12  ARG 12  12  12  ARG ARG B . n 
B 2 13  HIS 13  13  13  HIS HIS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  PRO 15  15  15  PRO PRO B . n 
B 2 16  GLU 16  16  16  GLU GLU B . n 
B 2 17  ASN 17  17  17  ASN ASN B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  PRO 20  20  20  PRO PRO B . n 
B 2 21  ASN 21  21  21  ASN ASN B . n 
B 2 22  ILE 22  22  22  ILE ILE B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  CYS 25  25  25  CYS CYS B . n 
B 2 26  TYR 26  26  26  TYR TYR B . n 
B 2 27  VAL 27  27  27  VAL VAL B . n 
B 2 28  THR 28  28  28  THR THR B . n 
B 2 29  GLN 29  29  29  GLN GLN B . n 
B 2 30  PHE 30  30  30  PHE PHE B . n 
B 2 31  HIS 31  31  31  HIS HIS B . n 
B 2 32  PRO 32  32  32  PRO PRO B . n 
B 2 33  PRO 33  33  33  PRO PRO B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  ILE 35  35  35  ILE ILE B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  GLN 38  38  38  GLN GLN B . n 
B 2 39  MET 39  39  39  MET MET B . n 
B 2 40  LEU 40  40  40  LEU LEU B . n 
B 2 41  LYS 41  41  41  LYS LYS B . n 
B 2 42  ASN 42  42  42  ASN ASN B . n 
B 2 43  GLY 43  43  43  GLY GLY B . n 
B 2 44  LYS 44  44  44  LYS LYS B . n 
B 2 45  LYS 45  45  45  LYS LYS B . n 
B 2 46  ILE 46  46  46  ILE ILE B . n 
B 2 47  PRO 47  47  47  PRO PRO B . n 
B 2 48  LYS 48  48  48  LYS LYS B . n 
B 2 49  VAL 49  49  49  VAL VAL B . n 
B 2 50  GLU 50  50  50  GLU GLU B . n 
B 2 51  MET 51  51  51  MET MET B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  ASP 53  53  53  ASP ASP B . n 
B 2 54  MET 54  54  54  MET MET B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  SER 57  57  57  SER SER B . n 
B 2 58  LYS 58  58  58  LYS LYS B . n 
B 2 59  ASP 59  59  59  ASP ASP B . n 
B 2 60  TRP 60  60  60  TRP TRP B . n 
B 2 61  SER 61  61  61  SER SER B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  TYR 63  63  63  TYR TYR B . n 
B 2 64  ILE 64  64  64  ILE ILE B . n 
B 2 65  LEU 65  65  65  LEU LEU B . n 
B 2 66  ALA 66  66  66  ALA ALA B . n 
B 2 67  HIS 67  67  67  HIS HIS B . n 
B 2 68  THR 68  68  68  THR THR B . n 
B 2 69  GLU 69  69  69  GLU GLU B . n 
B 2 70  PHE 70  70  70  PHE PHE B . n 
B 2 71  THR 71  71  71  THR THR B . n 
B 2 72  PRO 72  72  72  PRO PRO B . n 
B 2 73  THR 73  73  73  THR THR B . n 
B 2 74  GLU 74  74  74  GLU GLU B . n 
B 2 75  THR 75  75  75  THR THR B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  THR 77  77  77  THR THR B . n 
B 2 78  TYR 78  78  78  TYR TYR B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  CYS 80  80  80  CYS CYS B . n 
B 2 81  ARG 81  81  81  ARG ARG B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  LYS 83  83  83  LYS LYS B . n 
B 2 84  HIS 84  84  84  HIS HIS B . n 
B 2 85  ASP 85  85  85  ASP ASP B . n 
B 2 86  SER 86  86  86  SER SER B . n 
B 2 87  MET 87  87  87  MET MET B . n 
B 2 88  ALA 88  88  88  ALA ALA B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  PRO 90  90  90  PRO PRO B . n 
B 2 91  LYS 91  91  91  LYS LYS B . n 
B 2 92  THR 92  92  92  THR THR B . n 
B 2 93  VAL 93  93  93  VAL VAL B . n 
B 2 94  TYR 94  94  94  TYR TYR B . n 
B 2 95  TRP 95  95  95  TRP TRP B . n 
B 2 96  ASP 96  96  96  ASP ASP B . n 
B 2 97  ARG 97  97  97  ARG ARG B . n 
B 2 98  ASP 98  98  98  ASP ASP B . n 
B 2 99  MET 99  99  99  MET MET B . n 
C 3 1   ARG 1   1   1   ARG ARG P . n 
C 3 2   GLY 2   2   2   GLY GLY P . n 
C 3 3   TYR 3   3   3   TYR TYR P . n 
C 3 4   VAL 4   4   4   VAL VAL P . n 
C 3 5   TYR 5   5   5   TYR TYR P . n 
C 3 6   GLN 6   6   6   GLN GLN P . n 
C 3 7   GLY 7   7   7   GLY GLY P . n 
C 3 8   LEU 8   8   8   LEU LEU P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1  275 3   HOH HOH A . 
D 4 HOH 2  276 5   HOH HOH A . 
D 4 HOH 3  277 6   HOH HOH A . 
D 4 HOH 4  278 7   HOH HOH A . 
D 4 HOH 5  279 8   HOH HOH A . 
D 4 HOH 6  280 9   HOH HOH A . 
D 4 HOH 7  281 10  HOH HOH A . 
D 4 HOH 8  282 11  HOH HOH A . 
D 4 HOH 9  283 12  HOH HOH A . 
D 4 HOH 10 284 13  HOH HOH A . 
D 4 HOH 11 285 14  HOH HOH A . 
D 4 HOH 12 286 16  HOH HOH A . 
D 4 HOH 13 287 17  HOH HOH A . 
D 4 HOH 14 288 18  HOH HOH A . 
D 4 HOH 15 289 21  HOH HOH A . 
D 4 HOH 16 290 22  HOH HOH A . 
D 4 HOH 17 291 23  HOH HOH A . 
D 4 HOH 18 292 24  HOH HOH A . 
D 4 HOH 19 293 25  HOH HOH A . 
D 4 HOH 20 294 27  HOH HOH A . 
D 4 HOH 21 295 28  HOH HOH A . 
D 4 HOH 22 296 29  HOH HOH A . 
D 4 HOH 23 297 32  HOH HOH A . 
D 4 HOH 24 298 34  HOH HOH A . 
D 4 HOH 25 299 35  HOH HOH A . 
D 4 HOH 26 300 36  HOH HOH A . 
D 4 HOH 27 301 37  HOH HOH A . 
D 4 HOH 28 302 39  HOH HOH A . 
D 4 HOH 29 303 40  HOH HOH A . 
D 4 HOH 30 304 41  HOH HOH A . 
D 4 HOH 31 305 42  HOH HOH A . 
D 4 HOH 32 306 44  HOH HOH A . 
D 4 HOH 33 307 45  HOH HOH A . 
D 4 HOH 34 308 47  HOH HOH A . 
D 4 HOH 35 309 48  HOH HOH A . 
D 4 HOH 36 310 49  HOH HOH A . 
D 4 HOH 37 311 51  HOH HOH A . 
D 4 HOH 38 312 53  HOH HOH A . 
D 4 HOH 39 313 54  HOH HOH A . 
D 4 HOH 40 314 55  HOH HOH A . 
D 4 HOH 41 315 56  HOH HOH A . 
D 4 HOH 42 316 58  HOH HOH A . 
D 4 HOH 43 317 60  HOH HOH A . 
D 4 HOH 44 318 61  HOH HOH A . 
D 4 HOH 45 319 62  HOH HOH A . 
D 4 HOH 46 320 63  HOH HOH A . 
D 4 HOH 47 321 64  HOH HOH A . 
D 4 HOH 48 322 65  HOH HOH A . 
D 4 HOH 49 323 69  HOH HOH A . 
D 4 HOH 50 324 70  HOH HOH A . 
D 4 HOH 51 325 72  HOH HOH A . 
D 4 HOH 52 326 73  HOH HOH A . 
D 4 HOH 53 327 74  HOH HOH A . 
D 4 HOH 54 328 75  HOH HOH A . 
D 4 HOH 55 329 76  HOH HOH A . 
D 4 HOH 56 330 77  HOH HOH A . 
D 4 HOH 57 331 78  HOH HOH A . 
D 4 HOH 58 332 79  HOH HOH A . 
D 4 HOH 59 333 80  HOH HOH A . 
D 4 HOH 60 334 81  HOH HOH A . 
D 4 HOH 61 335 83  HOH HOH A . 
D 4 HOH 62 336 85  HOH HOH A . 
D 4 HOH 63 337 86  HOH HOH A . 
D 4 HOH 64 338 89  HOH HOH A . 
D 4 HOH 65 339 95  HOH HOH A . 
D 4 HOH 66 340 96  HOH HOH A . 
D 4 HOH 67 341 97  HOH HOH A . 
D 4 HOH 68 342 98  HOH HOH A . 
D 4 HOH 69 343 100 HOH HOH A . 
D 4 HOH 70 344 102 HOH HOH A . 
D 4 HOH 71 345 103 HOH HOH A . 
D 4 HOH 72 346 104 HOH HOH A . 
D 4 HOH 73 347 105 HOH HOH A . 
D 4 HOH 74 348 106 HOH HOH A . 
D 4 HOH 75 349 109 HOH HOH A . 
D 4 HOH 76 350 111 HOH HOH A . 
D 4 HOH 77 351 114 HOH HOH A . 
D 4 HOH 78 352 115 HOH HOH A . 
D 4 HOH 79 353 116 HOH HOH A . 
D 4 HOH 80 354 118 HOH HOH A . 
D 4 HOH 81 355 119 HOH HOH A . 
D 4 HOH 82 356 120 HOH HOH A . 
D 4 HOH 83 357 121 HOH HOH A . 
D 4 HOH 84 358 122 HOH HOH A . 
D 4 HOH 85 359 123 HOH HOH A . 
D 4 HOH 86 360 125 HOH HOH A . 
D 4 HOH 87 361 127 HOH HOH A . 
D 4 HOH 88 362 128 HOH HOH A . 
D 4 HOH 89 363 129 HOH HOH A . 
D 4 HOH 90 364 134 HOH HOH A . 
D 4 HOH 91 365 136 HOH HOH A . 
E 4 HOH 1  100 1   HOH HOH B . 
E 4 HOH 2  101 4   HOH HOH B . 
E 4 HOH 3  102 19  HOH HOH B . 
E 4 HOH 4  103 20  HOH HOH B . 
E 4 HOH 5  104 31  HOH HOH B . 
E 4 HOH 6  105 33  HOH HOH B . 
E 4 HOH 7  106 38  HOH HOH B . 
E 4 HOH 8  107 43  HOH HOH B . 
E 4 HOH 9  108 46  HOH HOH B . 
E 4 HOH 10 109 50  HOH HOH B . 
E 4 HOH 11 110 52  HOH HOH B . 
E 4 HOH 12 111 59  HOH HOH B . 
E 4 HOH 13 112 66  HOH HOH B . 
E 4 HOH 14 113 68  HOH HOH B . 
E 4 HOH 15 114 71  HOH HOH B . 
E 4 HOH 16 115 84  HOH HOH B . 
E 4 HOH 17 116 87  HOH HOH B . 
E 4 HOH 18 117 88  HOH HOH B . 
E 4 HOH 19 118 90  HOH HOH B . 
E 4 HOH 20 119 91  HOH HOH B . 
E 4 HOH 21 120 92  HOH HOH B . 
E 4 HOH 22 121 94  HOH HOH B . 
E 4 HOH 23 122 99  HOH HOH B . 
E 4 HOH 24 123 101 HOH HOH B . 
E 4 HOH 25 124 107 HOH HOH B . 
E 4 HOH 26 125 112 HOH HOH B . 
E 4 HOH 27 126 113 HOH HOH B . 
E 4 HOH 28 127 117 HOH HOH B . 
E 4 HOH 29 128 124 HOH HOH B . 
E 4 HOH 30 129 126 HOH HOH B . 
E 4 HOH 31 130 130 HOH HOH B . 
E 4 HOH 32 131 131 HOH HOH B . 
E 4 HOH 33 132 132 HOH HOH B . 
E 4 HOH 34 133 135 HOH HOH B . 
F 4 HOH 1  9   2   HOH HOH P . 
F 4 HOH 2  10  15  HOH HOH P . 
F 4 HOH 3  11  26  HOH HOH P . 
F 4 HOH 4  12  30  HOH HOH P . 
F 4 HOH 5  13  57  HOH HOH P . 
F 4 HOH 6  14  67  HOH HOH P . 
F 4 HOH 7  15  82  HOH HOH P . 
F 4 HOH 8  16  93  HOH HOH P . 
F 4 HOH 9  17  108 HOH HOH P . 
F 4 HOH 10 18  110 HOH HOH P . 
F 4 HOH 11 19  133 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4470  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  18410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-06-20 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' .   ? 1 
X-PLOR 'model building'  3.1 ? 2 
X-PLOR refinement        3.1 ? 3 
XENGEN 'data reduction'  .   ? 4 
X-PLOR phasing           3.1 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 29  ? ? 57.11   -133.73 
2 1 TYR A 123 ? ? -125.54 -66.32  
3 1 LEU A 224 ? ? -89.25  49.60   
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#