data_2VBJ
# 
_entry.id   2VBJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VBJ         
PDBE  EBI-33736    
WWPDB D_1290033736 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1G9Z unspecified 'LAGLIDADG HOMING ENDONUCLEASE I-CREI / DNA PRODUCT COMPLEXWITH MAGNESIUM' 
PDB 1BP7 unspecified 'GROUP I MOBILE INTRON ENDONUCLEASE I-CREI COMPLEXED WITH HOMING SITE DEOXYRIBONUCLEIC ACID' 
PDB 2VBL unspecified 'MOLECULAR BASIS OF HUMAN XPC GENE RECOGNITION AND CLEAVAGE BY ENGINEERED HOMING ENDONUCLEASE HETERODIMERS' 
PDB 1AF5 unspecified 'GROUP I MOBILE INTRON ENDONUCLEASE' 
PDB 2VBO unspecified 'MOLECULAR BASIS OF HUMAN XPC GENE RECOGNITION AND CLEAVAGE BY ENGINEERED HOMING ENDONUCLEASE HETERODIMERS' 
PDB 1MOW unspecified E-DREI 
PDB 1G9Y unspecified 'HOMING ENDONUCLEASE I-CREI / DNA SUBSTRATE COMPLEX WITHCALCIUM' 
PDB 2VBN unspecified 'MOLECULAR BASIS OF HUMAN XPC GENE RECOGNITION AND CLEAVAGE BY ENGINEERED HOMING ENDONUCLEASE HETERODIMERS' 
PDB 1N3F unspecified 
'CRYSTAL STRUCTURE OF I-CREI BOUND TO A PALINDROMIC DNASEQUENCE II (PALINDROME OF RIGHT SIDE OF WILDTYPE DNATARGET SEQUENCE)' 
PDB 1T9I unspecified 'I-CREI(D20N)/DNA COMPLEX' 
PDB 1U0D unspecified 'Y33H MUTATANT OF HOMING ENDONUCLEASE I-CREI' 
PDB 1T9J unspecified 'I-CREI(Q47E)/DNA COMPLEX' 
PDB 1N3E unspecified 
'CRYSTAL STRUCTURE OF I-CREI BOUND TO A PALINDROMIC DNASEQUENCE I (PALINDROME OF LEFT SIDE OF WILDTYPE DNA TARGETSEQUENCE)'   
PDB 1U0C unspecified 'Y33C MUTATANT OF HOMING ENDONUCLEASE I-CREI' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VBJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-09-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Redondo, P.'     1  
'Prieto, J.'      2  
'Munoz, I.G.'     3  
'Alibes, A.'      4  
'Stricher, F.'    5  
'Serrano, L.'     6  
'Arnould, S.'     7  
'Perez, C.'       8  
'Cabaniols, J.P.' 9  
'Duchateau, P.'   10 
'Paques, F.'      11 
'Blanco, F.J.'    12 
'Montoya, G.'     13 
# 
_citation.id                        primary 
_citation.title                     'Molecular Basis of Xeroderma Pigmentosum Group C DNA Recognition by Engineered Meganucleases' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            456 
_citation.page_first                107 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18987743 
_citation.pdbx_database_id_DOI      10.1038/NATURE07343 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Redondo, P.'     1  ? 
primary 'Prieto, J.'      2  ? 
primary 'Munoz, I.G.'     3  ? 
primary 'Alibes, A.'      4  ? 
primary 'Stricher, F.'    5  ? 
primary 'Serrano, L.'     6  ? 
primary 'Cabaniols, J.P.' 7  ? 
primary 'Daboussi, F.'    8  ? 
primary 'Arnould, S.'     9  ? 
primary 'Perez, C.'       10 ? 
primary 'Duchateau, P.'   11 ? 
primary 'Paques, F.'      12 ? 
primary 'Blanco, F.J.'    13 ? 
primary 'Montoya, G.'     14 ? 
# 
_cell.entry_id           2VBJ 
_cell.length_a           44.552 
_cell.length_b           68.700 
_cell.length_c           88.731 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.36 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VBJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA ENDONUCLEASE I-CREI'                                                           17566.201 1   3.1.-.- ? 
'RESIDUES 2-153' ? 
2 polymer     man 'DNA ENDONUCLEASE I-CREI'                                                           17454.051 1   3.1.-.- ? 
'RESIDUES 2-153' ? 
3 polymer     syn 
;5'-D(*TP*CP*TP*GP*CP*CP*TP*TP*TP*TP *TP*TP*GP*AP*AP*GP*GP*AP*TP*CP*CP*TP*AP*A)-3'
;
7325.738  1   ?       ? ?                ? 
4 polymer     syn 
;5'-D(*TP*TP*AP*GP*GP*AP*TP*CP*CP*TP *TP*CP*AP*AP*AP*AP*AP*AP*GP*GP*CP*AP*GP*A)-3'
;
7410.833  1   ?       ? ?                ? 
5 non-polymer syn 'CALCIUM ION'                                                                       40.078    2   ?       ? ? ? 
6 water       nat water                                                                               18.015    330 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'AMEL3-4-CA, 23S RRNA INTRON PROTEIN' 
2 'AMEL3-4-CA, 23S RRNA INTRON PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;NTKYNKEFLLYLAGFVDGDGSIIAQIEPNQSYKFKHRLKLTFKVTQKTQRRWFLDKLVDEIGVGYVRDEGSVSNYILSEI
KPLRNFLTQLQPFLKLKQKQANLVLKITEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
;
;NTKYNKEFLLYLAGFVDGDGSIIAQIEPNQSYKFKHRLKLTFKVTQKTQRRWFLDKLVDEIGVGYVRDEGSVSNYILSEI
KPLRNFLTQLQPFLKLKQKQANLVLKITEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
;
A ? 
2 'polypeptide(L)'        no no 
;NTKYNKEFLLYLAGFVDADGSIIAQIEPNQSSKFKHRLKLTFQVTQKTQRRWFLDKLVDEIGVGYVRDSGSVSNYILSEI
KPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
;
;NTKYNKEFLLYLAGFVDADGSIIAQIEPNQSSKFKHRLKLTFQVTQKTQRRWFLDKLVDEIGVGYVRDSGSVSNYILSEI
KPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
;
B ? 
3 polydeoxyribonucleotide no no 
;(DT)(DC)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DT)(DT)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DC)
(DC)(DT)(DA)(DA)
;
TCTGCCTTTTTTGAAGGATCCTAA C ? 
4 polydeoxyribonucleotide no no 
;(DT)(DT)(DA)(DG)(DG)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DA)(DA)(DA)(DA)(DA)(DA)(DG)(DG)
(DC)(DA)(DG)(DA)
;
TTAGGATCCTTCAAAAAAGGCAGA E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   THR n 
1 3   LYS n 
1 4   TYR n 
1 5   ASN n 
1 6   LYS n 
1 7   GLU n 
1 8   PHE n 
1 9   LEU n 
1 10  LEU n 
1 11  TYR n 
1 12  LEU n 
1 13  ALA n 
1 14  GLY n 
1 15  PHE n 
1 16  VAL n 
1 17  ASP n 
1 18  GLY n 
1 19  ASP n 
1 20  GLY n 
1 21  SER n 
1 22  ILE n 
1 23  ILE n 
1 24  ALA n 
1 25  GLN n 
1 26  ILE n 
1 27  GLU n 
1 28  PRO n 
1 29  ASN n 
1 30  GLN n 
1 31  SER n 
1 32  TYR n 
1 33  LYS n 
1 34  PHE n 
1 35  LYS n 
1 36  HIS n 
1 37  ARG n 
1 38  LEU n 
1 39  LYS n 
1 40  LEU n 
1 41  THR n 
1 42  PHE n 
1 43  LYS n 
1 44  VAL n 
1 45  THR n 
1 46  GLN n 
1 47  LYS n 
1 48  THR n 
1 49  GLN n 
1 50  ARG n 
1 51  ARG n 
1 52  TRP n 
1 53  PHE n 
1 54  LEU n 
1 55  ASP n 
1 56  LYS n 
1 57  LEU n 
1 58  VAL n 
1 59  ASP n 
1 60  GLU n 
1 61  ILE n 
1 62  GLY n 
1 63  VAL n 
1 64  GLY n 
1 65  TYR n 
1 66  VAL n 
1 67  ARG n 
1 68  ASP n 
1 69  GLU n 
1 70  GLY n 
1 71  SER n 
1 72  VAL n 
1 73  SER n 
1 74  ASN n 
1 75  TYR n 
1 76  ILE n 
1 77  LEU n 
1 78  SER n 
1 79  GLU n 
1 80  ILE n 
1 81  LYS n 
1 82  PRO n 
1 83  LEU n 
1 84  ARG n 
1 85  ASN n 
1 86  PHE n 
1 87  LEU n 
1 88  THR n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  PRO n 
1 93  PHE n 
1 94  LEU n 
1 95  LYS n 
1 96  LEU n 
1 97  LYS n 
1 98  GLN n 
1 99  LYS n 
1 100 GLN n 
1 101 ALA n 
1 102 ASN n 
1 103 LEU n 
1 104 VAL n 
1 105 LEU n 
1 106 LYS n 
1 107 ILE n 
1 108 THR n 
1 109 GLU n 
1 110 GLN n 
1 111 LEU n 
1 112 PRO n 
1 113 SER n 
1 114 ALA n 
1 115 LYS n 
1 116 GLU n 
1 117 SER n 
1 118 PRO n 
1 119 ASP n 
1 120 LYS n 
1 121 PHE n 
1 122 LEU n 
1 123 GLU n 
1 124 VAL n 
1 125 CYS n 
1 126 THR n 
1 127 TRP n 
1 128 VAL n 
1 129 ASP n 
1 130 GLN n 
1 131 ILE n 
1 132 ALA n 
1 133 ALA n 
1 134 LEU n 
1 135 ASN n 
1 136 ASP n 
1 137 SER n 
1 138 LYS n 
1 139 THR n 
1 140 ARG n 
1 141 LYS n 
1 142 THR n 
1 143 THR n 
1 144 SER n 
1 145 GLU n 
1 146 THR n 
1 147 VAL n 
1 148 ARG n 
1 149 ALA n 
1 150 VAL n 
1 151 LEU n 
1 152 ASP n 
2 1   ASN n 
2 2   THR n 
2 3   LYS n 
2 4   TYR n 
2 5   ASN n 
2 6   LYS n 
2 7   GLU n 
2 8   PHE n 
2 9   LEU n 
2 10  LEU n 
2 11  TYR n 
2 12  LEU n 
2 13  ALA n 
2 14  GLY n 
2 15  PHE n 
2 16  VAL n 
2 17  ASP n 
2 18  ALA n 
2 19  ASP n 
2 20  GLY n 
2 21  SER n 
2 22  ILE n 
2 23  ILE n 
2 24  ALA n 
2 25  GLN n 
2 26  ILE n 
2 27  GLU n 
2 28  PRO n 
2 29  ASN n 
2 30  GLN n 
2 31  SER n 
2 32  SER n 
2 33  LYS n 
2 34  PHE n 
2 35  LYS n 
2 36  HIS n 
2 37  ARG n 
2 38  LEU n 
2 39  LYS n 
2 40  LEU n 
2 41  THR n 
2 42  PHE n 
2 43  GLN n 
2 44  VAL n 
2 45  THR n 
2 46  GLN n 
2 47  LYS n 
2 48  THR n 
2 49  GLN n 
2 50  ARG n 
2 51  ARG n 
2 52  TRP n 
2 53  PHE n 
2 54  LEU n 
2 55  ASP n 
2 56  LYS n 
2 57  LEU n 
2 58  VAL n 
2 59  ASP n 
2 60  GLU n 
2 61  ILE n 
2 62  GLY n 
2 63  VAL n 
2 64  GLY n 
2 65  TYR n 
2 66  VAL n 
2 67  ARG n 
2 68  ASP n 
2 69  SER n 
2 70  GLY n 
2 71  SER n 
2 72  VAL n 
2 73  SER n 
2 74  ASN n 
2 75  TYR n 
2 76  ILE n 
2 77  LEU n 
2 78  SER n 
2 79  GLU n 
2 80  ILE n 
2 81  LYS n 
2 82  PRO n 
2 83  LEU n 
2 84  HIS n 
2 85  ASN n 
2 86  PHE n 
2 87  LEU n 
2 88  THR n 
2 89  GLN n 
2 90  LEU n 
2 91  GLN n 
2 92  PRO n 
2 93  PHE n 
2 94  LEU n 
2 95  LYS n 
2 96  LEU n 
2 97  LYS n 
2 98  GLN n 
2 99  LYS n 
2 100 GLN n 
2 101 ALA n 
2 102 ASN n 
2 103 LEU n 
2 104 VAL n 
2 105 LEU n 
2 106 LYS n 
2 107 ILE n 
2 108 ILE n 
2 109 GLU n 
2 110 GLN n 
2 111 LEU n 
2 112 PRO n 
2 113 SER n 
2 114 ALA n 
2 115 LYS n 
2 116 GLU n 
2 117 SER n 
2 118 PRO n 
2 119 ASP n 
2 120 LYS n 
2 121 PHE n 
2 122 LEU n 
2 123 GLU n 
2 124 VAL n 
2 125 CYS n 
2 126 THR n 
2 127 TRP n 
2 128 VAL n 
2 129 ASP n 
2 130 GLN n 
2 131 ILE n 
2 132 ALA n 
2 133 ALA n 
2 134 LEU n 
2 135 ASN n 
2 136 ASP n 
2 137 SER n 
2 138 LYS n 
2 139 THR n 
2 140 ARG n 
2 141 LYS n 
2 142 THR n 
2 143 THR n 
2 144 SER n 
2 145 GLU n 
2 146 THR n 
2 147 VAL n 
2 148 ARG n 
2 149 ALA n 
2 150 VAL n 
2 151 LEU n 
2 152 ASP n 
3 1   DT  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DC  n 
3 6   DC  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DT  n 
3 11  DT  n 
3 12  DT  n 
3 13  DG  n 
3 14  DA  n 
3 15  DA  n 
3 16  DG  n 
3 17  DG  n 
3 18  DA  n 
3 19  DT  n 
3 20  DC  n 
3 21  DC  n 
3 22  DT  n 
3 23  DA  n 
3 24  DA  n 
4 1   DT  n 
4 2   DT  n 
4 3   DA  n 
4 4   DG  n 
4 5   DG  n 
4 6   DA  n 
4 7   DT  n 
4 8   DC  n 
4 9   DC  n 
4 10  DT  n 
4 11  DT  n 
4 12  DC  n 
4 13  DA  n 
4 14  DA  n 
4 15  DA  n 
4 16  DA  n 
4 17  DA  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DC  n 
4 22  DA  n 
4 23  DG  n 
4 24  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'CHLAMYDOMONAS REINHARDTII' 3055 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ROSETTA 
D3PLYSS ? ? ? ? ? ? ? ? ? ? CDFDUET-1 ? 'AMEL4 STREP-TAG C-TERM AMEL3 HIS-TAG C-TERM' 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'CHLAMYDOMONAS REINHARDTII' 3055 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ROSETTA 
D3PLYSS ? ? ? ? ? ? ? ? ? ? CDFDUET-1 ? 'AMEL4 STREP-TAG C-TERM AMEL3 HIS-TAG C-TERM' 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DNE1_CHLRE 1 ? ? P05725 ? 
2 UNP DNE1_CHLRE 2 ? ? P05725 ? 
3 PDB 2VBJ       3 ? ? 2VBJ   ? 
4 PDB 2VBJ       4 ? ? 2VBJ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VBJ A 1 ? 152 ? P05725 2 ? 153 ? 2 153 
2 2 2VBJ B 1 ? 152 ? P05725 2 ? 153 ? 2 153 
3 3 2VBJ C 1 ? 24  ? 2VBJ   1 ? 24  ? 1 24  
4 4 2VBJ E 1 ? 24  ? 2VBJ   1 ? 24  ? 1 24  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2VBJ GLU A 27  ? UNP P05725 LYS 28  conflict 28  1  
1 2VBJ ARG A 37  ? UNP P05725 GLN 38  conflict 38  2  
1 2VBJ LYS A 39  ? UNP P05725 SER 40  conflict 40  3  
1 2VBJ THR A 41  ? UNP P05725 ALA 42  conflict 42  4  
1 2VBJ LYS A 43  ? UNP P05725 GLN 44  conflict 44  5  
1 2VBJ GLU A 69  ? UNP P05725 ARG 70  conflict 70  6  
1 2VBJ ASN A 74  ? UNP P05725 ASP 75  conflict 75  7  
1 2VBJ ARG A 84  ? UNP P05725 HIS 85  conflict 85  8  
1 2VBJ THR A 108 ? UNP P05725 ILE 109 conflict 109 9  
1 2VBJ GLU A 109 ? UNP P05725 TRP 110 conflict 110 10 
1 2VBJ GLN A 110 ? UNP P05725 ARG 111 conflict 111 11 
2 2VBJ ALA B 18  ? UNP P05725 GLY 19  conflict 19  12 
2 2VBJ GLU B 27  ? UNP P05725 LYS 28  conflict 28  13 
2 2VBJ SER B 32  ? UNP P05725 TYR 33  conflict 33  14 
2 2VBJ ARG B 37  ? UNP P05725 GLN 38  conflict 38  15 
2 2VBJ LYS B 39  ? UNP P05725 SER 40  conflict 40  16 
2 2VBJ THR B 41  ? UNP P05725 ALA 42  conflict 42  17 
2 2VBJ SER B 69  ? UNP P05725 ARG 70  conflict 70  18 
2 2VBJ ASN B 74  ? UNP P05725 ASP 75  conflict 75  19 
2 2VBJ GLU B 109 ? UNP P05725 TRP 110 conflict 110 20 
2 2VBJ GLN B 110 ? UNP P05725 ARG 111 conflict 111 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2VBJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   59.13 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'HANGING-DROP DNA-PROTEIN COMPLEX SOLUTION WAS 4 MG/ML. 35% 2-ETHOXYETHANOL IN 0.1M NA-CACODYLATE PH6.5' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.983 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.983 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VBJ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.88 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   35740 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.001 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.05 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VBJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     35736 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.88 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_obs                          0.150 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.147 
_refine.ls_R_factor_R_free                       0.216 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  1949 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               42.34 
_refine.aniso_B[1][1]                            -0.42000 
_refine.aniso_B[2][2]                            0.34000 
_refine.aniso_B[3][3]                            0.06000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.10000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1G9Z' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.407 
_refine.pdbx_overall_ESU_R_Free                  0.141 
_refine.overall_SU_ML                            0.093 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.010 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2456 
_refine_hist.pdbx_number_atoms_nucleic_acid   978 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             330 
_refine_hist.number_atoms_total               3766 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        32.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 3596 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.081  2.313  ? 5065 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.686  5.000  ? 302  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       41.746 24.821 ? 112  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.878 15.000 ? 477  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.257 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.143  0.200  ? 580  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 2335 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.232  0.200  ? 1500 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.322  0.200  ? 2331 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.233  0.200  ? 317  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.100  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.238  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.325  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.994  1.500  ? 1565 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.244  2.000  ? 2466 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.198  3.000  ? 2638 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.695  4.500  ? 2599 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        2.00 
_refine_ls_shell.number_reflns_R_work             2087 
_refine_ls_shell.R_factor_R_work                  0.1410 
_refine_ls_shell.percent_reflns_obs               77.59 
_refine_ls_shell.R_factor_R_free                  0.2320 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2VBJ 
_struct.title                     
'Molecular basis of human XPC gene recognition and cleavage by engineered homing endonuclease heterodimers' 
_struct.pdbx_descriptor           'DNA ENDONUCLEASE I-CREI (E.C.3.1.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VBJ 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            
;DOUBLE STRAND BREAK (DSB), CUTTING DNA ENDONUCLEASES, AMEL3-4-CALCIUM, UV-INDUCED DNA DAMAGE, HOMING ENDONUCLEASES (HES), HYDROLASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 5   ? ASP A 19  ? ASN A 6   ASP A 20  1 ? 15 
HELX_P HELX_P2  2  ARG A 50  ? GLY A 62  ? ARG A 51  GLY A 63  1 ? 13 
HELX_P HELX_P3  3  GLU A 79  ? GLN A 91  ? GLU A 80  GLN A 92  1 ? 13 
HELX_P HELX_P4  4  PRO A 92  ? LEU A 94  ? PRO A 93  LEU A 95  5 ? 3  
HELX_P HELX_P5  5  LYS A 97  ? LYS A 115 ? LYS A 98  LYS A 116 1 ? 19 
HELX_P HELX_P6  6  ASP A 119 ? ASN A 135 ? ASP A 120 ASN A 136 1 ? 17 
HELX_P HELX_P7  7  THR A 143 ? ARG A 148 ? THR A 144 ARG A 149 1 ? 6  
HELX_P HELX_P8  8  ASN B 5   ? ASP B 19  ? ASN B 6   ASP B 20  1 ? 15 
HELX_P HELX_P9  9  ARG B 50  ? GLY B 62  ? ARG B 51  GLY B 63  1 ? 13 
HELX_P HELX_P10 10 GLU B 79  ? GLN B 91  ? GLU B 80  GLN B 92  1 ? 13 
HELX_P HELX_P11 11 PRO B 92  ? LEU B 94  ? PRO B 93  LEU B 95  5 ? 3  
HELX_P HELX_P12 12 LYS B 97  ? LYS B 115 ? LYS B 98  LYS B 116 1 ? 19 
HELX_P HELX_P13 13 SER B 117 ? ASN B 135 ? SER B 118 ASN B 136 1 ? 19 
HELX_P HELX_P14 14 THR B 143 ? LEU B 151 ? THR B 144 LEU B 152 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E CA .  CA ? ? ? 1_555 C DA  14 OP1 ? ? A CA 1154 C DA  14   1_555 ? ? ? ? ? ? ?            2.246 ? 
metalc2  metalc ? ? E CA .  CA ? ? ? 1_555 D DA  15 OP2 ? ? A CA 1154 E DA  15   1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc3  metalc ? ? E CA .  CA ? ? ? 1_555 J HOH .  O   ? ? A CA 1154 E HOH 1035 1_555 ? ? ? ? ? ? ?            2.472 ? 
metalc4  metalc ? ? E CA .  CA ? ? ? 1_555 A ASP 19 OD1 ? ? A CA 1154 A ASP 20   1_555 ? ? ? ? ? ? ?            2.747 ? 
metalc5  metalc ? ? E CA .  CA ? ? ? 1_555 A ASP 19 OD2 ? ? A CA 1154 A ASP 20   1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc6  metalc ? ? E CA .  CA ? ? ? 1_555 B ALA 18 O   ? ? A CA 1154 B ALA 19   1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc7  metalc ? ? E CA .  CA ? ? ? 1_555 H HOH .  O   ? ? A CA 1154 B HOH 1016 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc8  metalc ? ? F CA .  CA ? ? ? 1_555 A GLY 18 O   ? ? A CA 1155 A GLY 19   1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc9  metalc ? ? F CA .  CA ? ? ? 1_555 B ASP 19 OD1 ? ? A CA 1155 B ASP 20   1_555 ? ? ? ? ? ? ?            2.716 ? 
metalc10 metalc ? ? F CA .  CA ? ? ? 1_555 I HOH .  O   ? ? A CA 1155 C HOH 1051 1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc11 metalc ? ? F CA .  CA ? ? ? 1_555 B ASP 19 OD2 ? ? A CA 1155 B ASP 20   1_555 ? ? ? ? ? ? ?            2.493 ? 
metalc12 metalc ? ? F CA .  CA ? ? ? 1_555 D DA  14 OP1 ? ? A CA 1155 E DA  14   1_555 ? ? ? ? ? ? ?            2.266 ? 
metalc13 metalc ? ? F CA .  CA ? ? ? 1_555 G HOH .  O   ? ? A CA 1155 A HOH 1013 1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc14 metalc ? ? F CA .  CA ? ? ? 1_555 C DA  15 OP2 ? ? A CA 1155 C DA  15   1_555 ? ? ? ? ? ? ?            2.299 ? 
hydrog1  hydrog ? ? C DT 1  N3 ? ? ? 1_555 D DA  24 N1  ? ? C DT 1    E DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DT 1  O4 ? ? ? 1_555 D DA  24 N6  ? ? C DT 1    E DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG  23 N1  ? ? C DC 2    E DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG  23 O6  ? ? C DC 2    E DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG  23 N2  ? ? C DC 2    E DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA  22 N1  ? ? C DT 3    E DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA  22 N6  ? ? C DT 3    E DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC  21 N3  ? ? C DG 4    E DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC  21 O2  ? ? C DG 4    E DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC  21 N4  ? ? C DG 4    E DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DC 5  N3 ? ? ? 1_555 D DG  20 N1  ? ? C DC 5    E DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DC 5  N4 ? ? ? 1_555 D DG  20 O6  ? ? C DC 5    E DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC 5  O2 ? ? ? 1_555 D DG  20 N2  ? ? C DC 5    E DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG  19 N1  ? ? C DC 6    E DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG  19 O6  ? ? C DC 6    E DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG  19 N2  ? ? C DC 6    E DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DT 7  N3 ? ? ? 1_555 D DA  18 N1  ? ? C DT 7    E DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DT 7  O4 ? ? ? 1_555 D DA  18 N6  ? ? C DT 7    E DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA  17 N1  ? ? C DT 8    E DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA  17 N6  ? ? C DT 8    E DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA  16 N1  ? ? C DT 9    E DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DT 9  O4 ? ? ? 1_555 D DA  16 N6  ? ? C DT 9    E DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT 10 N3 ? ? ? 1_555 D DA  15 N1  ? ? C DT 10   E DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT 10 O4 ? ? ? 1_555 D DA  15 N6  ? ? C DT 10   E DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA  14 N1  ? ? C DT 11   E DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA  14 N6  ? ? C DT 11   E DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA  13 N1  ? ? C DT 12   E DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA  13 N6  ? ? C DT 12   E DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC  12 N3  ? ? C DG 13   E DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC  12 O2  ? ? C DG 13   E DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC  12 N4  ? ? C DG 13   E DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT  11 N3  ? ? C DA 14   E DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT  11 O4  ? ? C DA 14   E DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT  10 N3  ? ? C DA 15   E DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DA 15 N6 ? ? ? 1_555 D DT  10 O4  ? ? C DA 15   E DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG 16 N1 ? ? ? 1_555 D DC  9  N3  ? ? C DG 16   E DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG 16 N2 ? ? ? 1_555 D DC  9  O2  ? ? C DG 16   E DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG 16 O6 ? ? ? 1_555 D DC  9  N4  ? ? C DG 16   E DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG 17 N1 ? ? ? 1_555 D DC  8  N3  ? ? C DG 17   E DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG 17 N2 ? ? ? 1_555 D DC  8  O2  ? ? C DG 17   E DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG 17 O6 ? ? ? 1_555 D DC  8  N4  ? ? C DG 17   E DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DA 18 N1 ? ? ? 1_555 D DT  7  N3  ? ? C DA 18   E DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DA 18 N6 ? ? ? 1_555 D DT  7  O4  ? ? C DA 18   E DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DT 19 N3 ? ? ? 1_555 D DA  6  N1  ? ? C DT 19   E DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DT 19 O4 ? ? ? 1_555 D DA  6  N6  ? ? C DT 19   E DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DC 20 N3 ? ? ? 1_555 D DG  5  N1  ? ? C DC 20   E DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DC 20 N4 ? ? ? 1_555 D DG  5  O6  ? ? C DC 20   E DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DC 20 O2 ? ? ? 1_555 D DG  5  N2  ? ? C DC 20   E DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DC 21 N3 ? ? ? 1_555 D DG  4  N1  ? ? C DC 21   E DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DC 21 N4 ? ? ? 1_555 D DG  4  O6  ? ? C DC 21   E DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DC 21 O2 ? ? ? 1_555 D DG  4  N2  ? ? C DC 21   E DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DT 22 N3 ? ? ? 1_555 D DA  3  N1  ? ? C DT 22   E DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DT 22 O4 ? ? ? 1_555 D DA  3  N6  ? ? C DT 22   E DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DA 23 N1 ? ? ? 1_555 D DT  2  N3  ? ? C DA 23   E DT  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DA 23 N6 ? ? ? 1_555 D DT  2  O4  ? ? C DA 23   E DT  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DA 24 N1 ? ? ? 1_555 D DT  1  N3  ? ? C DA 24   E DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DA 24 N6 ? ? ? 1_555 D DT  1  O4  ? ? C DA 24   E DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
BA ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 20 ? PRO A 28 ? GLY A 21 PRO A 29 
AA 2 HIS A 36 ? LYS A 47 ? HIS A 37 LYS A 48 
AA 3 VAL A 72 ? LEU A 77 ? VAL A 73 LEU A 78 
AA 4 TYR A 65 ? ASP A 68 ? TYR A 66 ASP A 69 
BA 1 GLY B 20 ? PRO B 28 ? GLY B 21 PRO B 29 
BA 2 HIS B 36 ? LYS B 47 ? HIS B 37 LYS B 48 
BA 3 VAL B 72 ? LEU B 77 ? VAL B 73 LEU B 78 
BA 4 TYR B 65 ? SER B 69 ? TYR B 66 SER B 70 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 27 ? N GLU A 28 O ARG A 37 ? O ARG A 38 
AA 2 3 N GLN A 46 ? N GLN A 47 O SER A 73 ? O SER A 74 
AA 3 4 N ILE A 76 ? N ILE A 77 O TYR A 65 ? O TYR A 66 
BA 1 2 N GLU B 27 ? N GLU B 28 O ARG B 37 ? O ARG B 38 
BA 2 3 N GLN B 46 ? N GLN B 47 O SER B 73 ? O SER B 74 
BA 3 4 N ILE B 76 ? N ILE B 77 O TYR B 65 ? O TYR B 66 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1154' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1155' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 19 ? ASP A 20   . ? 1_555 ? 
2  AC1 6 ALA B 18 ? ALA B 19   . ? 1_555 ? 
3  AC1 6 HOH H .  ? HOH B 1016 . ? 1_555 ? 
4  AC1 6 DA  C 14 ? DA  C 14   . ? 1_555 ? 
5  AC1 6 DA  D 15 ? DA  E 15   . ? 1_555 ? 
6  AC1 6 HOH J .  ? HOH E 1035 . ? 1_555 ? 
7  AC2 6 GLY A 18 ? GLY A 19   . ? 1_555 ? 
8  AC2 6 HOH G .  ? HOH A 1013 . ? 1_555 ? 
9  AC2 6 ASP B 19 ? ASP B 20   . ? 1_555 ? 
10 AC2 6 DA  C 15 ? DA  C 15   . ? 1_555 ? 
11 AC2 6 HOH I .  ? HOH C 1051 . ? 1_555 ? 
12 AC2 6 DA  D 14 ? DA  E 14   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VBJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VBJ 
_atom_sites.fract_transf_matrix[1][1]   0.022446 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002106 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 1   ? 41.807 -9.783  6.563   1.00 70.92 ? 2    ASN A N     1 
ATOM   2    C  CA    . ASN A 1 1   ? 40.406 -9.352  6.864   1.00 70.56 ? 2    ASN A CA    1 
ATOM   3    C  C     . ASN A 1 1   ? 40.281 -7.834  7.006   1.00 69.71 ? 2    ASN A C     1 
ATOM   4    O  O     . ASN A 1 1   ? 41.275 -7.134  7.292   1.00 69.13 ? 2    ASN A O     1 
ATOM   5    C  CB    . ASN A 1 1   ? 39.866 -10.072 8.106   1.00 71.02 ? 2    ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 1   ? 39.628 -11.563 7.867   1.00 75.18 ? 2    ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 1   ? 39.087 -11.964 6.829   1.00 79.79 ? 2    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 1   ? 40.027 -12.390 8.831   1.00 74.45 ? 2    ASN A ND2   1 
ATOM   9    N  N     . THR A 1 2   ? 39.067 -7.328  6.783   1.00 67.26 ? 3    THR A N     1 
ATOM   10   C  CA    . THR A 1 2   ? 38.707 -5.997  7.286   1.00 65.00 ? 3    THR A CA    1 
ATOM   11   C  C     . THR A 1 2   ? 38.939 -5.979  8.794   1.00 61.44 ? 3    THR A C     1 
ATOM   12   O  O     . THR A 1 2   ? 38.387 -6.813  9.510   1.00 58.66 ? 3    THR A O     1 
ATOM   13   C  CB    . THR A 1 2   ? 37.226 -5.640  7.027   1.00 64.58 ? 3    THR A CB    1 
ATOM   14   O  OG1   . THR A 1 2   ? 36.932 -5.817  5.637   1.00 66.36 ? 3    THR A OG1   1 
ATOM   15   C  CG2   . THR A 1 2   ? 36.957 -4.187  7.408   1.00 62.31 ? 3    THR A CG2   1 
ATOM   16   N  N     . LYS A 1 3   ? 39.774 -5.048  9.249   1.00 59.07 ? 4    LYS A N     1 
ATOM   17   C  CA    . LYS A 1 3   ? 40.118 -4.947  10.669  1.00 56.03 ? 4    LYS A CA    1 
ATOM   18   C  C     . LYS A 1 3   ? 39.517 -3.681  11.291  1.00 51.57 ? 4    LYS A C     1 
ATOM   19   O  O     . LYS A 1 3   ? 39.967 -2.588  10.992  1.00 50.32 ? 4    LYS A O     1 
ATOM   20   C  CB    . LYS A 1 3   ? 41.635 -4.923  10.844  1.00 57.34 ? 4    LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 3   ? 42.075 -5.170  12.283  1.00 63.46 ? 4    LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 3   ? 41.897 -6.632  12.669  1.00 69.34 ? 4    LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 3   ? 41.986 -6.849  14.185  1.00 77.77 ? 4    LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 3   ? 42.042 -5.550  14.953  1.00 86.38 ? 4    LYS A NZ    1 
ATOM   25   N  N     . TYR A 1 4   ? 38.523 -3.829  12.166  1.00 45.84 ? 5    TYR A N     1 
ATOM   26   C  CA    . TYR A 1 4   ? 37.764 -2.681  12.645  1.00 39.95 ? 5    TYR A CA    1 
ATOM   27   C  C     . TYR A 1 4   ? 38.478 -1.944  13.771  1.00 41.35 ? 5    TYR A C     1 
ATOM   28   O  O     . TYR A 1 4   ? 39.140 -2.574  14.604  1.00 41.23 ? 5    TYR A O     1 
ATOM   29   C  CB    . TYR A 1 4   ? 36.403 -3.179  13.115  1.00 38.15 ? 5    TYR A CB    1 
ATOM   30   C  CG    . TYR A 1 4   ? 35.652 -3.876  12.019  1.00 35.75 ? 5    TYR A CG    1 
ATOM   31   C  CD1   . TYR A 1 4   ? 35.202 -3.152  10.907  1.00 35.40 ? 5    TYR A CD1   1 
ATOM   32   C  CD2   . TYR A 1 4   ? 35.386 -5.247  12.085  1.00 33.61 ? 5    TYR A CD2   1 
ATOM   33   C  CE1   . TYR A 1 4   ? 34.517 -3.774  9.865   1.00 32.73 ? 5    TYR A CE1   1 
ATOM   34   C  CE2   . TYR A 1 4   ? 34.690 -5.878  11.053  1.00 35.42 ? 5    TYR A CE2   1 
ATOM   35   C  CZ    . TYR A 1 4   ? 34.251 -5.124  9.964   1.00 39.46 ? 5    TYR A CZ    1 
ATOM   36   O  OH    . TYR A 1 4   ? 33.575 -5.729  8.941   1.00 39.41 ? 5    TYR A OH    1 
ATOM   37   N  N     . ASN A 1 5   ? 38.356 -0.621  13.838  1.00 40.48 ? 6    ASN A N     1 
ATOM   38   C  CA    . ASN A 1 5   ? 39.031 0.030   14.939  1.00 42.93 ? 6    ASN A CA    1 
ATOM   39   C  C     . ASN A 1 5   ? 38.325 -0.138  16.262  1.00 43.09 ? 6    ASN A C     1 
ATOM   40   O  O     . ASN A 1 5   ? 37.095 -0.347  16.324  1.00 43.16 ? 6    ASN A O     1 
ATOM   41   C  CB    . ASN A 1 5   ? 39.433 1.479   14.664  1.00 45.40 ? 6    ASN A CB    1 
ATOM   42   C  CG    . ASN A 1 5   ? 38.295 2.430   14.793  1.00 53.48 ? 6    ASN A CG    1 
ATOM   43   O  OD1   . ASN A 1 5   ? 37.949 2.890   15.887  1.00 51.52 ? 6    ASN A OD1   1 
ATOM   44   N  ND2   . ASN A 1 5   ? 37.694 2.750   13.658  1.00 60.79 ? 6    ASN A ND2   1 
ATOM   45   N  N     . LYS A 1 6   ? 39.135 -0.103  17.316  1.00 38.71 ? 7    LYS A N     1 
ATOM   46   C  CA    . LYS A 1 6   ? 38.660 -0.401  18.652  1.00 39.01 ? 7    LYS A CA    1 
ATOM   47   C  C     . LYS A 1 6   ? 37.511 0.500   19.112  1.00 33.76 ? 7    LYS A C     1 
ATOM   48   O  O     . LYS A 1 6   ? 36.614 -0.006  19.793  1.00 35.01 ? 7    LYS A O     1 
ATOM   49   C  CB    . LYS A 1 6   ? 39.802 -0.206  19.647  1.00 39.79 ? 7    LYS A CB    1 
ATOM   50   C  CG    . LYS A 1 6   ? 39.434 -0.540  21.077  1.00 41.87 ? 7    LYS A CG    1 
ATOM   51   C  CD    . LYS A 1 6   ? 40.602 -0.317  22.064  1.00 45.47 ? 7    LYS A CD    1 
ATOM   52   C  CE    . LYS A 1 6   ? 40.511 -1.377  23.166  1.00 57.37 ? 7    LYS A CE    1 
ATOM   53   N  NZ    . LYS A 1 6   ? 40.504 -2.779  22.600  1.00 57.92 ? 7    LYS A NZ    1 
ATOM   54   N  N     . GLU A 1 7   ? 37.587 1.807   18.850  1.00 29.36 ? 8    GLU A N     1 
ATOM   55   C  CA    . GLU A 1 7   ? 36.611 2.737   19.405  1.00 34.18 ? 8    GLU A CA    1 
ATOM   56   C  C     . GLU A 1 7   ? 35.291 2.464   18.686  1.00 32.21 ? 8    GLU A C     1 
ATOM   57   O  O     . GLU A 1 7   ? 34.219 2.595   19.293  1.00 30.63 ? 8    GLU A O     1 
ATOM   58   C  CB    . GLU A 1 7   ? 37.033 4.196   19.170  1.00 33.22 ? 8    GLU A CB    1 
ATOM   59   C  CG    . GLU A 1 7   ? 38.200 4.656   20.047  1.00 39.50 ? 8    GLU A CG    1 
ATOM   60   C  CD    . GLU A 1 7   ? 38.311 6.189   20.115  1.00 48.55 ? 8    GLU A CD    1 
ATOM   61   O  OE1   . GLU A 1 7   ? 37.583 6.881   19.356  1.00 68.77 ? 8    GLU A OE1   1 
ATOM   62   O  OE2   . GLU A 1 7   ? 39.104 6.711   20.939  1.00 62.64 ? 8    GLU A OE2   1 
ATOM   63   N  N     . PHE A 1 8   ? 35.375 2.088   17.405  1.00 30.37 ? 9    PHE A N     1 
ATOM   64   C  CA    . PHE A 1 8   ? 34.163 1.710   16.637  1.00 32.33 ? 9    PHE A CA    1 
ATOM   65   C  C     . PHE A 1 8   ? 33.483 0.479   17.265  1.00 32.83 ? 9    PHE A C     1 
ATOM   66   O  O     . PHE A 1 8   ? 32.278 0.479   17.563  1.00 30.28 ? 9    PHE A O     1 
ATOM   67   C  CB    . PHE A 1 8   ? 34.522 1.417   15.178  1.00 32.95 ? 9    PHE A CB    1 
ATOM   68   C  CG    . PHE A 1 8   ? 33.424 0.716   14.385  1.00 33.84 ? 9    PHE A CG    1 
ATOM   69   C  CD1   . PHE A 1 8   ? 32.290 1.409   13.972  1.00 38.20 ? 9    PHE A CD1   1 
ATOM   70   C  CD2   . PHE A 1 8   ? 33.548 -0.619  14.004  1.00 33.21 ? 9    PHE A CD2   1 
ATOM   71   C  CE1   . PHE A 1 8   ? 31.299 0.773   13.209  1.00 38.04 ? 9    PHE A CE1   1 
ATOM   72   C  CE2   . PHE A 1 8   ? 32.555 -1.262  13.247  1.00 33.79 ? 9    PHE A CE2   1 
ATOM   73   C  CZ    . PHE A 1 8   ? 31.437 -0.566  12.846  1.00 32.63 ? 9    PHE A CZ    1 
ATOM   74   N  N     . LEU A 1 9   ? 34.262 -0.574  17.479  1.00 30.67 ? 10   LEU A N     1 
ATOM   75   C  CA    . LEU A 1 9   ? 33.757 -1.795  18.119  1.00 33.09 ? 10   LEU A CA    1 
ATOM   76   C  C     . LEU A 1 9   ? 33.202 -1.616  19.545  1.00 32.32 ? 10   LEU A C     1 
ATOM   77   O  O     . LEU A 1 9   ? 32.188 -2.251  19.901  1.00 32.00 ? 10   LEU A O     1 
ATOM   78   C  CB    . LEU A 1 9   ? 34.814 -2.898  18.069  1.00 31.83 ? 10   LEU A CB    1 
ATOM   79   C  CG    . LEU A 1 9   ? 35.306 -3.294  16.673  1.00 32.98 ? 10   LEU A CG    1 
ATOM   80   C  CD1   . LEU A 1 9   ? 36.572 -4.197  16.868  1.00 31.54 ? 10   LEU A CD1   1 
ATOM   81   C  CD2   . LEU A 1 9   ? 34.173 -4.033  15.894  1.00 33.99 ? 10   LEU A CD2   1 
ATOM   82   N  N     . LEU A 1 10  ? 33.854 -0.790  20.373  1.00 30.34 ? 11   LEU A N     1 
ATOM   83   C  CA    . LEU A 1 10  ? 33.319 -0.500  21.710  1.00 31.94 ? 11   LEU A CA    1 
ATOM   84   C  C     . LEU A 1 10  ? 31.913 0.137   21.626  1.00 32.59 ? 11   LEU A C     1 
ATOM   85   O  O     . LEU A 1 10  ? 30.984 -0.337  22.268  1.00 27.72 ? 11   LEU A O     1 
ATOM   86   C  CB    . LEU A 1 10  ? 34.253 0.431   22.491  1.00 33.30 ? 11   LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 10  ? 35.440 -0.354  23.100  1.00 33.53 ? 11   LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 10  ? 36.584 0.669   23.380  1.00 30.13 ? 11   LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 10  ? 34.988 -1.107  24.361  1.00 29.27 ? 11   LEU A CD2   1 
ATOM   90   N  N     . TYR A 1 11  ? 31.815 1.243   20.887  1.00 32.19 ? 12   TYR A N     1 
ATOM   91   C  CA    . TYR A 1 11  ? 30.545 1.956   20.713  1.00 33.08 ? 12   TYR A CA    1 
ATOM   92   C  C     . TYR A 1 11  ? 29.527 1.006   20.095  1.00 27.00 ? 12   TYR A C     1 
ATOM   93   O  O     . TYR A 1 11  ? 28.404 0.912   20.558  1.00 29.96 ? 12   TYR A O     1 
ATOM   94   C  CB    . TYR A 1 11  ? 30.713 3.215   19.823  1.00 29.39 ? 12   TYR A CB    1 
ATOM   95   C  CG    . TYR A 1 11  ? 29.344 3.883   19.532  1.00 23.19 ? 12   TYR A CG    1 
ATOM   96   C  CD1   . TYR A 1 11  ? 28.872 4.933   20.319  1.00 27.56 ? 12   TYR A CD1   1 
ATOM   97   C  CD2   . TYR A 1 11  ? 28.502 3.356   18.538  1.00 27.22 ? 12   TYR A CD2   1 
ATOM   98   C  CE1   . TYR A 1 11  ? 27.608 5.475   20.084  1.00 28.65 ? 12   TYR A CE1   1 
ATOM   99   C  CE2   . TYR A 1 11  ? 27.228 3.896   18.292  1.00 27.83 ? 12   TYR A CE2   1 
ATOM   100  C  CZ    . TYR A 1 11  ? 26.820 4.969   19.046  1.00 26.70 ? 12   TYR A CZ    1 
ATOM   101  O  OH    . TYR A 1 11  ? 25.577 5.514   18.818  1.00 29.72 ? 12   TYR A OH    1 
ATOM   102  N  N     . LEU A 1 12  ? 29.880 0.285   19.044  1.00 28.55 ? 13   LEU A N     1 
ATOM   103  C  CA    . LEU A 1 12  ? 28.896 -0.587  18.349  1.00 26.30 ? 13   LEU A CA    1 
ATOM   104  C  C     . LEU A 1 12  ? 28.457 -1.729  19.272  1.00 26.90 ? 13   LEU A C     1 
ATOM   105  O  O     . LEU A 1 12  ? 27.302 -2.133  19.235  1.00 23.12 ? 13   LEU A O     1 
ATOM   106  C  CB    . LEU A 1 12  ? 29.507 -1.197  17.074  1.00 26.80 ? 13   LEU A CB    1 
ATOM   107  C  CG    . LEU A 1 12  ? 28.611 -2.104  16.212  1.00 29.29 ? 13   LEU A CG    1 
ATOM   108  C  CD1   . LEU A 1 12  ? 27.365 -1.338  15.841  1.00 28.21 ? 13   LEU A CD1   1 
ATOM   109  C  CD2   . LEU A 1 12  ? 29.351 -2.522  14.927  1.00 33.98 ? 13   LEU A CD2   1 
ATOM   110  N  N     . ALA A 1 13  ? 29.356 -2.271  20.104  1.00 22.19 ? 14   ALA A N     1 
ATOM   111  C  CA    . ALA A 1 13  ? 28.947 -3.372  20.969  1.00 22.60 ? 14   ALA A CA    1 
ATOM   112  C  C     . ALA A 1 13  ? 27.895 -2.865  21.945  1.00 27.25 ? 14   ALA A C     1 
ATOM   113  O  O     . ALA A 1 13  ? 26.976 -3.636  22.289  1.00 28.09 ? 14   ALA A O     1 
ATOM   114  C  CB    . ALA A 1 13  ? 30.118 -3.978  21.742  1.00 26.14 ? 14   ALA A CB    1 
ATOM   115  N  N     . GLY A 1 14  ? 28.045 -1.629  22.441  1.00 22.29 ? 15   GLY A N     1 
ATOM   116  C  CA    . GLY A 1 14  ? 27.048 -1.093  23.399  1.00 21.72 ? 15   GLY A CA    1 
ATOM   117  C  C     . GLY A 1 14  ? 25.729 -0.911  22.654  1.00 25.98 ? 15   GLY A C     1 
ATOM   118  O  O     . GLY A 1 14  ? 24.647 -1.226  23.169  1.00 24.24 ? 15   GLY A O     1 
ATOM   119  N  N     . PHE A 1 15  ? 25.795 -0.403  21.422  1.00 24.07 ? 16   PHE A N     1 
ATOM   120  C  CA    . PHE A 1 15  ? 24.590 -0.188  20.613  1.00 26.23 ? 16   PHE A CA    1 
ATOM   121  C  C     . PHE A 1 15  ? 23.870 -1.493  20.260  1.00 28.14 ? 16   PHE A C     1 
ATOM   122  O  O     . PHE A 1 15  ? 22.626 -1.614  20.288  1.00 27.39 ? 16   PHE A O     1 
ATOM   123  C  CB    . PHE A 1 15  ? 24.896 0.649   19.359  1.00 24.91 ? 16   PHE A CB    1 
ATOM   124  C  CG    . PHE A 1 15  ? 23.656 1.263   18.752  1.00 23.17 ? 16   PHE A CG    1 
ATOM   125  C  CD1   . PHE A 1 15  ? 22.868 0.563   17.843  1.00 27.27 ? 16   PHE A CD1   1 
ATOM   126  C  CD2   . PHE A 1 15  ? 23.240 2.522   19.156  1.00 24.49 ? 16   PHE A CD2   1 
ATOM   127  C  CE1   . PHE A 1 15  ? 21.716 1.165   17.312  1.00 28.90 ? 16   PHE A CE1   1 
ATOM   128  C  CE2   . PHE A 1 15  ? 22.049 3.117   18.622  1.00 28.69 ? 16   PHE A CE2   1 
ATOM   129  C  CZ    . PHE A 1 15  ? 21.308 2.420   17.721  1.00 26.67 ? 16   PHE A CZ    1 
ATOM   130  N  N     . VAL A 1 16  ? 24.670 -2.502  19.963  1.00 24.26 ? 17   VAL A N     1 
ATOM   131  C  CA    . VAL A 1 16  ? 24.146 -3.820  19.647  1.00 23.97 ? 17   VAL A CA    1 
ATOM   132  C  C     . VAL A 1 16  ? 23.522 -4.456  20.875  1.00 24.87 ? 17   VAL A C     1 
ATOM   133  O  O     . VAL A 1 16  ? 22.419 -5.040  20.813  1.00 27.63 ? 17   VAL A O     1 
ATOM   134  C  CB    . VAL A 1 16  ? 25.258 -4.722  19.026  1.00 24.01 ? 17   VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 16  ? 24.853 -6.208  18.991  1.00 25.57 ? 17   VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 16  ? 25.628 -4.184  17.611  1.00 24.72 ? 17   VAL A CG2   1 
ATOM   137  N  N     . ASP A 1 17  ? 24.220 -4.427  22.002  1.00 24.91 ? 18   ASP A N     1 
ATOM   138  C  CA    . ASP A 1 17  ? 23.628 -4.977  23.242  1.00 22.68 ? 18   ASP A CA    1 
ATOM   139  C  C     . ASP A 1 17  ? 22.278 -4.279  23.521  1.00 25.16 ? 18   ASP A C     1 
ATOM   140  O  O     . ASP A 1 17  ? 21.355 -4.885  24.095  1.00 23.96 ? 18   ASP A O     1 
ATOM   141  C  CB    . ASP A 1 17  ? 24.578 -4.756  24.453  1.00 23.61 ? 18   ASP A CB    1 
ATOM   142  C  CG    . ASP A 1 17  ? 25.666 -5.823  24.559  1.00 29.71 ? 18   ASP A CG    1 
ATOM   143  O  OD1   . ASP A 1 17  ? 25.470 -6.910  23.991  1.00 29.40 ? 18   ASP A OD1   1 
ATOM   144  O  OD2   . ASP A 1 17  ? 26.678 -5.612  25.250  1.00 30.03 ? 18   ASP A OD2   1 
ATOM   145  N  N     . GLY A 1 18  ? 22.174 -3.009  23.126  1.00 23.11 ? 19   GLY A N     1 
ATOM   146  C  CA    . GLY A 1 18  ? 20.907 -2.245  23.292  1.00 22.95 ? 19   GLY A CA    1 
ATOM   147  C  C     . GLY A 1 18  ? 19.850 -2.573  22.206  1.00 24.89 ? 19   GLY A C     1 
ATOM   148  O  O     . GLY A 1 18  ? 18.843 -3.217  22.497  1.00 29.83 ? 19   GLY A O     1 
ATOM   149  N  N     . ASP A 1 19  ? 20.073 -2.191  20.940  1.00 22.65 ? 20   ASP A N     1 
ATOM   150  C  CA    . ASP A 1 19  ? 18.997 -2.262  19.921  1.00 23.17 ? 20   ASP A CA    1 
ATOM   151  C  C     . ASP A 1 19  ? 19.233 -3.381  18.901  1.00 23.38 ? 20   ASP A C     1 
ATOM   152  O  O     . ASP A 1 19  ? 18.499 -3.488  17.903  1.00 26.19 ? 20   ASP A O     1 
ATOM   153  C  CB    . ASP A 1 19  ? 18.904 -0.956  19.092  1.00 23.72 ? 20   ASP A CB    1 
ATOM   154  C  CG    . ASP A 1 19  ? 18.194 0.172   19.801  1.00 23.63 ? 20   ASP A CG    1 
ATOM   155  O  OD1   . ASP A 1 19  ? 17.402 -0.112  20.718  1.00 25.24 ? 20   ASP A OD1   1 
ATOM   156  O  OD2   . ASP A 1 19  ? 18.431 1.365   19.438  1.00 23.05 ? 20   ASP A OD2   1 
ATOM   157  N  N     . GLY A 1 20  ? 20.276 -4.195  19.098  1.00 24.34 ? 21   GLY A N     1 
ATOM   158  C  CA    . GLY A 1 20  ? 20.625 -5.220  18.093  1.00 21.66 ? 21   GLY A CA    1 
ATOM   159  C  C     . GLY A 1 20  ? 20.083 -6.598  18.437  1.00 26.24 ? 21   GLY A C     1 
ATOM   160  O  O     . GLY A 1 20  ? 19.448 -6.794  19.480  1.00 25.46 ? 21   GLY A O     1 
ATOM   161  N  N     . SER A 1 21  ? 20.310 -7.584  17.579  1.00 26.70 ? 22   SER A N     1 
ATOM   162  C  CA    . SER A 1 21  ? 19.759 -8.897  17.841  1.00 28.03 ? 22   SER A CA    1 
ATOM   163  C  C     . SER A 1 21  ? 20.656 -9.894  17.112  1.00 30.07 ? 22   SER A C     1 
ATOM   164  O  O     . SER A 1 21  ? 20.990 -9.667  15.946  1.00 30.64 ? 22   SER A O     1 
ATOM   165  C  CB    . SER A 1 21  ? 18.331 -8.998  17.278  1.00 29.90 ? 22   SER A CB    1 
ATOM   166  O  OG    . SER A 1 21  ? 17.689 -10.204 17.689  1.00 30.21 ? 22   SER A OG    1 
ATOM   167  N  N     . ILE A 1 22  ? 21.058 -10.968 17.795  1.00 29.00 ? 23   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 22  ? 21.805 -12.058 17.156  1.00 28.75 ? 23   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 22  ? 20.870 -13.244 17.144  1.00 31.60 ? 23   ILE A C     1 
ATOM   170  O  O     . ILE A 1 22  ? 20.528 -13.789 18.206  1.00 31.18 ? 23   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 22  ? 23.077 -12.351 17.937  1.00 31.66 ? 23   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 22  ? 23.946 -11.083 17.852  1.00 32.80 ? 23   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 22  ? 23.849 -13.584 17.312  1.00 28.05 ? 23   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 22  ? 25.336 -11.155 18.535  1.00 36.19 ? 23   ILE A CD1   1 
ATOM   175  N  N     . ILE A 1 23  ? 20.427 -13.591 15.932  1.00 32.16 ? 24   ILE A N     1 
ATOM   176  C  CA    . ILE A 1 23  ? 19.289 -14.472 15.693  1.00 34.78 ? 24   ILE A CA    1 
ATOM   177  C  C     . ILE A 1 23  ? 19.710 -15.761 14.998  1.00 35.77 ? 24   ILE A C     1 
ATOM   178  O  O     . ILE A 1 23  ? 20.414 -15.723 13.987  1.00 35.20 ? 24   ILE A O     1 
ATOM   179  C  CB    . ILE A 1 23  ? 18.224 -13.816 14.812  1.00 33.92 ? 24   ILE A CB    1 
ATOM   180  C  CG1   . ILE A 1 23  ? 17.802 -12.451 15.384  1.00 36.37 ? 24   ILE A CG1   1 
ATOM   181  C  CG2   . ILE A 1 23  ? 17.011 -14.750 14.660  1.00 31.28 ? 24   ILE A CG2   1 
ATOM   182  C  CD1   . ILE A 1 23  ? 16.773 -11.654 14.460  1.00 33.26 ? 24   ILE A CD1   1 
ATOM   183  N  N     . ALA A 1 24  ? 19.295 -16.899 15.552  1.00 36.77 ? 25   ALA A N     1 
ATOM   184  C  CA    . ALA A 1 24  ? 19.562 -18.190 14.910  1.00 31.26 ? 25   ALA A CA    1 
ATOM   185  C  C     . ALA A 1 24  ? 18.232 -18.875 14.707  1.00 31.12 ? 25   ALA A C     1 
ATOM   186  O  O     . ALA A 1 24  ? 17.472 -18.945 15.676  1.00 29.90 ? 25   ALA A O     1 
ATOM   187  C  CB    . ALA A 1 24  ? 20.480 -19.020 15.824  1.00 31.30 ? 25   ALA A CB    1 
ATOM   188  N  N     . GLN A 1 25  ? 17.936 -19.372 13.495  1.00 32.53 ? 26   GLN A N     1 
ATOM   189  C  CA    . GLN A 1 25  ? 16.634 -20.002 13.190  1.00 33.50 ? 26   GLN A CA    1 
ATOM   190  C  C     . GLN A 1 25  ? 16.812 -21.329 12.510  1.00 34.53 ? 26   GLN A C     1 
ATOM   191  O  O     . GLN A 1 25  ? 17.813 -21.549 11.836  1.00 36.12 ? 26   GLN A O     1 
ATOM   192  C  CB    . GLN A 1 25  ? 15.767 -19.128 12.283  1.00 30.45 ? 26   GLN A CB    1 
ATOM   193  C  CG    . GLN A 1 25  ? 15.381 -17.819 12.975  1.00 32.24 ? 26   GLN A CG    1 
ATOM   194  C  CD    . GLN A 1 25  ? 14.764 -16.862 11.995  1.00 36.94 ? 26   GLN A CD    1 
ATOM   195  O  OE1   . GLN A 1 25  ? 15.472 -16.048 11.386  1.00 37.18 ? 26   GLN A OE1   1 
ATOM   196  N  NE2   . GLN A 1 25  ? 13.449 -16.988 11.786  1.00 31.43 ? 26   GLN A NE2   1 
ATOM   197  N  N     . ILE A 1 26  ? 15.844 -22.220 12.688  1.00 36.76 ? 27   ILE A N     1 
ATOM   198  C  CA    . ILE A 1 26  ? 15.839 -23.487 11.961  1.00 34.43 ? 27   ILE A CA    1 
ATOM   199  C  C     . ILE A 1 26  ? 14.583 -23.395 11.122  1.00 38.33 ? 27   ILE A C     1 
ATOM   200  O  O     . ILE A 1 26  ? 13.495 -23.299 11.672  1.00 41.44 ? 27   ILE A O     1 
ATOM   201  C  CB    . ILE A 1 26  ? 15.633 -24.663 12.942  1.00 35.11 ? 27   ILE A CB    1 
ATOM   202  C  CG1   . ILE A 1 26  ? 16.786 -24.734 13.961  1.00 34.93 ? 27   ILE A CG1   1 
ATOM   203  C  CG2   . ILE A 1 26  ? 15.432 -25.967 12.168  1.00 35.40 ? 27   ILE A CG2   1 
ATOM   204  C  CD1   . ILE A 1 26  ? 16.410 -25.391 15.310  1.00 35.72 ? 27   ILE A CD1   1 
ATOM   205  N  N     . GLU A 1 27  ? 14.705 -23.344 9.803   1.00 38.01 ? 28   GLU A N     1 
ATOM   206  C  CA    . GLU A 1 27  ? 13.545 -23.091 8.955   1.00 43.23 ? 28   GLU A CA    1 
ATOM   207  C  C     . GLU A 1 27  ? 13.129 -24.376 8.278   1.00 43.05 ? 28   GLU A C     1 
ATOM   208  O  O     . GLU A 1 27  ? 13.956 -24.997 7.596   1.00 45.92 ? 28   GLU A O     1 
ATOM   209  C  CB    . GLU A 1 27  ? 13.873 -22.089 7.846   1.00 40.34 ? 28   GLU A CB    1 
ATOM   210  C  CG    . GLU A 1 27  ? 12.705 -21.981 6.840   1.00 47.83 ? 28   GLU A CG    1 
ATOM   211  C  CD    . GLU A 1 27  ? 12.913 -20.998 5.683   1.00 48.67 ? 28   GLU A CD    1 
ATOM   212  O  OE1   . GLU A 1 27  ? 14.020 -20.453 5.516   1.00 55.88 ? 28   GLU A OE1   1 
ATOM   213  O  OE2   . GLU A 1 27  ? 11.951 -20.773 4.915   1.00 52.65 ? 28   GLU A OE2   1 
ATOM   214  N  N     . PRO A 1 28  ? 11.852 -24.768 8.425   1.00 45.73 ? 29   PRO A N     1 
ATOM   215  C  CA    . PRO A 1 28  ? 11.409 -25.980 7.721   1.00 46.06 ? 29   PRO A CA    1 
ATOM   216  C  C     . PRO A 1 28  ? 11.302 -25.711 6.223   1.00 47.95 ? 29   PRO A C     1 
ATOM   217  O  O     . PRO A 1 28  ? 10.806 -24.652 5.794   1.00 46.75 ? 29   PRO A O     1 
ATOM   218  C  CB    . PRO A 1 28  ? 10.022 -26.295 8.319   1.00 48.23 ? 29   PRO A CB    1 
ATOM   219  C  CG    . PRO A 1 28  ? 9.624  -25.104 9.143   1.00 45.99 ? 29   PRO A CG    1 
ATOM   220  C  CD    . PRO A 1 28  ? 10.775 -24.109 9.192   1.00 45.04 ? 29   PRO A CD    1 
ATOM   221  N  N     . ASN A 1 29  ? 11.780 -26.654 5.421   1.00 46.99 ? 30   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 11.672 -26.499 3.973   1.00 49.25 ? 30   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 12.006 -27.833 3.322   1.00 48.23 ? 30   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 13.114 -28.320 3.514   1.00 44.64 ? 30   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 12.641 -25.428 3.455   1.00 48.99 ? 30   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 12.517 -25.225 1.953   1.00 53.46 ? 30   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 12.332 -26.189 1.210   1.00 53.08 ? 30   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 12.607 -23.976 1.501   1.00 50.99 ? 30   ASN A ND2   1 
ATOM   229  N  N     . GLN A 1 30  ? 11.051 -28.413 2.600   1.00 48.91 ? 31   GLN A N     1 
ATOM   230  C  CA    . GLN A 1 30  ? 11.136 -29.822 2.201   1.00 55.50 ? 31   GLN A CA    1 
ATOM   231  C  C     . GLN A 1 30  ? 12.206 -30.037 1.138   1.00 54.35 ? 31   GLN A C     1 
ATOM   232  O  O     . GLN A 1 30  ? 12.508 -31.181 0.791   1.00 54.53 ? 31   GLN A O     1 
ATOM   233  C  CB    . GLN A 1 30  ? 9.805  -30.337 1.623   1.00 57.97 ? 31   GLN A CB    1 
ATOM   234  C  CG    . GLN A 1 30  ? 8.628  -30.350 2.588   1.00 69.18 ? 31   GLN A CG    1 
ATOM   235  C  CD    . GLN A 1 30  ? 8.580  -31.616 3.435   1.00 76.31 ? 31   GLN A CD    1 
ATOM   236  O  OE1   . GLN A 1 30  ? 9.062  -31.634 4.576   1.00 82.54 ? 31   GLN A OE1   1 
ATOM   237  N  NE2   . GLN A 1 30  ? 7.989  -32.679 2.883   1.00 75.70 ? 31   GLN A NE2   1 
ATOM   238  N  N     . SER A 1 31  ? 12.761 -28.956 0.598   1.00 51.96 ? 32   SER A N     1 
ATOM   239  C  CA    . SER A 1 31  ? 13.755 -29.151 -0.426  1.00 52.08 ? 32   SER A CA    1 
ATOM   240  C  C     . SER A 1 31  ? 15.196 -29.167 0.057   1.00 52.32 ? 32   SER A C     1 
ATOM   241  O  O     . SER A 1 31  ? 16.092 -29.398 -0.745  1.00 54.07 ? 32   SER A O     1 
ATOM   242  C  CB    . SER A 1 31  ? 13.521 -28.247 -1.623  1.00 52.84 ? 32   SER A CB    1 
ATOM   243  O  OG    . SER A 1 31  ? 13.772 -26.905 -1.308  1.00 60.49 ? 32   SER A OG    1 
ATOM   244  N  N     . TYR A 1 32  ? 15.430 -28.982 1.357   1.00 49.54 ? 33   TYR A N     1 
ATOM   245  C  CA    . TYR A 1 32  ? 16.754 -29.212 1.939   1.00 49.19 ? 33   TYR A CA    1 
ATOM   246  C  C     . TYR A 1 32  ? 16.899 -30.655 2.426   1.00 52.16 ? 33   TYR A C     1 
ATOM   247  O  O     . TYR A 1 32  ? 15.913 -31.323 2.779   1.00 49.94 ? 33   TYR A O     1 
ATOM   248  C  CB    . TYR A 1 32  ? 17.028 -28.265 3.115   1.00 49.33 ? 33   TYR A CB    1 
ATOM   249  C  CG    . TYR A 1 32  ? 17.073 -26.812 2.718   1.00 49.34 ? 33   TYR A CG    1 
ATOM   250  C  CD1   . TYR A 1 32  ? 15.885 -26.091 2.474   1.00 49.03 ? 33   TYR A CD1   1 
ATOM   251  C  CD2   . TYR A 1 32  ? 18.307 -26.157 2.544   1.00 49.08 ? 33   TYR A CD2   1 
ATOM   252  C  CE1   . TYR A 1 32  ? 15.921 -24.723 2.097   1.00 48.88 ? 33   TYR A CE1   1 
ATOM   253  C  CE2   . TYR A 1 32  ? 18.357 -24.803 2.164   1.00 47.63 ? 33   TYR A CE2   1 
ATOM   254  C  CZ    . TYR A 1 32  ? 17.167 -24.094 1.948   1.00 49.44 ? 33   TYR A CZ    1 
ATOM   255  O  OH    . TYR A 1 32  ? 17.257 -22.766 1.553   1.00 50.35 ? 33   TYR A OH    1 
ATOM   256  N  N     . LYS A 1 33  ? 18.145 -31.115 2.464   1.00 56.26 ? 34   LYS A N     1 
ATOM   257  C  CA    . LYS A 1 33  ? 18.451 -32.520 2.705   1.00 60.97 ? 34   LYS A CA    1 
ATOM   258  C  C     . LYS A 1 33  ? 17.793 -32.960 3.995   1.00 61.07 ? 34   LYS A C     1 
ATOM   259  O  O     . LYS A 1 33  ? 17.186 -34.040 4.087   1.00 65.70 ? 34   LYS A O     1 
ATOM   260  C  CB    . LYS A 1 33  ? 19.960 -32.725 2.827   1.00 62.33 ? 34   LYS A CB    1 
ATOM   261  C  CG    . LYS A 1 33  ? 20.478 -33.909 2.017   1.00 68.26 ? 34   LYS A CG    1 
ATOM   262  C  CD    . LYS A 1 33  ? 21.983 -34.046 2.153   1.00 73.37 ? 34   LYS A CD    1 
ATOM   263  C  CE    . LYS A 1 33  ? 22.349 -34.793 3.433   1.00 77.57 ? 34   LYS A CE    1 
ATOM   264  N  NZ    . LYS A 1 33  ? 23.831 -34.827 3.638   1.00 79.93 ? 34   LYS A NZ    1 
ATOM   265  N  N     . PHE A 1 34  ? 17.911 -32.127 5.012   1.00 58.19 ? 35   PHE A N     1 
ATOM   266  C  CA    . PHE A 1 34  ? 17.333 -32.545 6.277   1.00 55.30 ? 35   PHE A CA    1 
ATOM   267  C  C     . PHE A 1 34  ? 15.934 -31.978 6.524   1.00 51.47 ? 35   PHE A C     1 
ATOM   268  O  O     . PHE A 1 34  ? 15.478 -31.920 7.662   1.00 50.31 ? 35   PHE A O     1 
ATOM   269  C  CB    . PHE A 1 34  ? 18.317 -32.279 7.410   1.00 57.61 ? 35   PHE A CB    1 
ATOM   270  C  CG    . PHE A 1 34  ? 19.489 -33.218 7.403   1.00 64.35 ? 35   PHE A CG    1 
ATOM   271  C  CD1   . PHE A 1 34  ? 19.314 -34.562 7.079   1.00 68.87 ? 35   PHE A CD1   1 
ATOM   272  C  CD2   . PHE A 1 34  ? 20.769 -32.763 7.695   1.00 67.81 ? 35   PHE A CD2   1 
ATOM   273  C  CE1   . PHE A 1 34  ? 20.395 -35.443 7.066   1.00 70.73 ? 35   PHE A CE1   1 
ATOM   274  C  CE2   . PHE A 1 34  ? 21.854 -33.633 7.678   1.00 72.41 ? 35   PHE A CE2   1 
ATOM   275  C  CZ    . PHE A 1 34  ? 21.665 -34.979 7.367   1.00 67.71 ? 35   PHE A CZ    1 
ATOM   276  N  N     . LYS A 1 35  ? 15.262 -31.567 5.452   1.00 45.22 ? 36   LYS A N     1 
ATOM   277  C  CA    . LYS A 1 35  ? 13.975 -30.880 5.542   1.00 44.95 ? 36   LYS A CA    1 
ATOM   278  C  C     . LYS A 1 35  ? 14.002 -29.556 6.344   1.00 44.58 ? 36   LYS A C     1 
ATOM   279  O  O     . LYS A 1 35  ? 12.929 -28.981 6.610   1.00 41.77 ? 36   LYS A O     1 
ATOM   280  C  CB    . LYS A 1 35  ? 12.921 -31.827 6.131   1.00 45.57 ? 36   LYS A CB    1 
ATOM   281  C  CG    . LYS A 1 35  ? 12.882 -33.202 5.479   1.00 47.45 ? 36   LYS A CG    1 
ATOM   282  C  CD    . LYS A 1 35  ? 12.792 -33.040 3.945   1.00 48.98 ? 36   LYS A CD    1 
ATOM   283  C  CE    . LYS A 1 35  ? 12.390 -34.354 3.303   1.00 52.23 ? 36   LYS A CE    1 
ATOM   284  N  NZ    . LYS A 1 35  ? 13.631 -35.106 3.035   1.00 58.82 ? 36   LYS A NZ    1 
ATOM   285  N  N     . HIS A 1 36  ? 15.202 -29.094 6.715   1.00 39.60 ? 37   HIS A N     1 
ATOM   286  C  CA    . HIS A 1 36  ? 15.399 -27.773 7.341   1.00 42.89 ? 37   HIS A CA    1 
ATOM   287  C  C     . HIS A 1 36  ? 16.721 -27.104 6.940   1.00 42.22 ? 37   HIS A C     1 
ATOM   288  O  O     . HIS A 1 36  ? 17.665 -27.797 6.571   1.00 43.02 ? 37   HIS A O     1 
ATOM   289  C  CB    . HIS A 1 36  ? 15.386 -27.898 8.878   1.00 43.61 ? 37   HIS A CB    1 
ATOM   290  C  CG    . HIS A 1 36  ? 14.211 -28.655 9.410   1.00 43.96 ? 37   HIS A CG    1 
ATOM   291  N  ND1   . HIS A 1 36  ? 14.054 -30.014 9.222   1.00 48.91 ? 37   HIS A ND1   1 
ATOM   292  C  CD2   . HIS A 1 36  ? 13.117 -28.239 10.091  1.00 50.00 ? 37   HIS A CD2   1 
ATOM   293  C  CE1   . HIS A 1 36  ? 12.915 -30.401 9.771   1.00 45.50 ? 37   HIS A CE1   1 
ATOM   294  N  NE2   . HIS A 1 36  ? 12.329 -29.345 10.310  1.00 45.70 ? 37   HIS A NE2   1 
ATOM   295  N  N     . ARG A 1 37  ? 16.812 -25.775 7.056   1.00 40.96 ? 38   ARG A N     1 
ATOM   296  C  CA    . ARG A 1 37  ? 18.088 -25.076 6.936   1.00 40.26 ? 38   ARG A CA    1 
ATOM   297  C  C     . ARG A 1 37  ? 18.289 -24.177 8.160   1.00 40.50 ? 38   ARG A C     1 
ATOM   298  O  O     . ARG A 1 37  ? 17.330 -23.750 8.806   1.00 42.65 ? 38   ARG A O     1 
ATOM   299  C  CB    . ARG A 1 37  ? 18.090 -24.185 5.692   1.00 42.15 ? 38   ARG A CB    1 
ATOM   300  C  CG    . ARG A 1 37  ? 16.738 -23.541 5.413   1.00 46.91 ? 38   ARG A CG    1 
ATOM   301  C  CD    . ARG A 1 37  ? 16.632 -22.005 5.548   1.00 55.47 ? 38   ARG A CD    1 
ATOM   302  N  NE    . ARG A 1 37  ? 17.745 -21.302 4.954   1.00 57.25 ? 38   ARG A NE    1 
ATOM   303  C  CZ    . ARG A 1 37  ? 17.663 -20.266 4.128   1.00 49.28 ? 38   ARG A CZ    1 
ATOM   304  N  NH1   . ARG A 1 37  ? 16.494 -19.752 3.738   1.00 53.68 ? 38   ARG A NH1   1 
ATOM   305  N  NH2   . ARG A 1 37  ? 18.792 -19.760 3.679   1.00 49.10 ? 38   ARG A NH2   1 
ATOM   306  N  N     . LEU A 1 38  ? 19.542 -23.864 8.452   1.00 38.67 ? 39   LEU A N     1 
ATOM   307  C  CA    . LEU A 1 38  ? 19.869 -22.951 9.511   1.00 38.16 ? 39   LEU A CA    1 
ATOM   308  C  C     . LEU A 1 38  ? 19.978 -21.565 8.889   1.00 38.78 ? 39   LEU A C     1 
ATOM   309  O  O     . LEU A 1 38  ? 20.536 -21.392 7.794   1.00 36.88 ? 39   LEU A O     1 
ATOM   310  C  CB    . LEU A 1 38  ? 21.185 -23.384 10.157  1.00 39.28 ? 39   LEU A CB    1 
ATOM   311  C  CG    . LEU A 1 38  ? 21.080 -24.797 10.784  1.00 42.51 ? 39   LEU A CG    1 
ATOM   312  C  CD1   . LEU A 1 38  ? 22.366 -25.301 11.405  1.00 47.16 ? 39   LEU A CD1   1 
ATOM   313  C  CD2   . LEU A 1 38  ? 19.930 -24.998 11.769  1.00 45.06 ? 39   LEU A CD2   1 
ATOM   314  N  N     . LYS A 1 39  ? 19.436 -20.574 9.586   1.00 38.57 ? 40   LYS A N     1 
ATOM   315  C  CA    . LYS A 1 39  ? 19.555 -19.195 9.148   1.00 36.92 ? 40   LYS A CA    1 
ATOM   316  C  C     . LYS A 1 39  ? 20.114 -18.371 10.313  1.00 36.12 ? 40   LYS A C     1 
ATOM   317  O  O     . LYS A 1 39  ? 19.589 -18.433 11.422  1.00 36.79 ? 40   LYS A O     1 
ATOM   318  C  CB    . LYS A 1 39  ? 18.148 -18.741 8.788   1.00 39.90 ? 40   LYS A CB    1 
ATOM   319  C  CG    . LYS A 1 39  ? 18.037 -17.756 7.683   1.00 49.93 ? 40   LYS A CG    1 
ATOM   320  C  CD    . LYS A 1 39  ? 16.555 -17.658 7.306   1.00 60.18 ? 40   LYS A CD    1 
ATOM   321  C  CE    . LYS A 1 39  ? 16.382 -16.983 5.956   1.00 65.96 ? 40   LYS A CE    1 
ATOM   322  N  NZ    . LYS A 1 39  ? 15.022 -17.278 5.426   1.00 69.40 ? 40   LYS A NZ    1 
ATOM   323  N  N     . LEU A 1 40  ? 21.198 -17.646 10.087  1.00 34.68 ? 41   LEU A N     1 
ATOM   324  C  CA    . LEU A 1 40  ? 21.858 -16.882 11.156  1.00 34.73 ? 41   LEU A CA    1 
ATOM   325  C  C     . LEU A 1 40  ? 21.870 -15.419 10.737  1.00 36.79 ? 41   LEU A C     1 
ATOM   326  O  O     . LEU A 1 40  ? 22.345 -15.106 9.656   1.00 33.06 ? 41   LEU A O     1 
ATOM   327  C  CB    . LEU A 1 40  ? 23.315 -17.324 11.289  1.00 38.12 ? 41   LEU A CB    1 
ATOM   328  C  CG    . LEU A 1 40  ? 23.715 -18.573 12.088  1.00 46.49 ? 41   LEU A CG    1 
ATOM   329  C  CD1   . LEU A 1 40  ? 22.585 -19.404 12.619  1.00 43.68 ? 41   LEU A CD1   1 
ATOM   330  C  CD2   . LEU A 1 40  ? 24.745 -19.437 11.394  1.00 43.00 ? 41   LEU A CD2   1 
ATOM   331  N  N     . THR A 1 41  ? 21.386 -14.518 11.588  1.00 35.59 ? 42   THR A N     1 
ATOM   332  C  CA    . THR A 1 41  ? 21.264 -13.132 11.212  1.00 33.89 ? 42   THR A CA    1 
ATOM   333  C  C     . THR A 1 41  ? 21.769 -12.276 12.359  1.00 34.92 ? 42   THR A C     1 
ATOM   334  O  O     . THR A 1 41  ? 21.376 -12.485 13.512  1.00 36.17 ? 42   THR A O     1 
ATOM   335  C  CB    . THR A 1 41  ? 19.796 -12.777 11.025  1.00 34.07 ? 42   THR A CB    1 
ATOM   336  O  OG1   . THR A 1 41  ? 19.220 -13.723 10.119  1.00 38.81 ? 42   THR A OG1   1 
ATOM   337  C  CG2   . THR A 1 41  ? 19.619 -11.321 10.492  1.00 33.98 ? 42   THR A CG2   1 
ATOM   338  N  N     . PHE A 1 42  ? 22.621 -11.308 12.038  1.00 32.62 ? 43   PHE A N     1 
ATOM   339  C  CA    . PHE A 1 42  ? 22.906 -10.172 12.918  1.00 31.35 ? 43   PHE A CA    1 
ATOM   340  C  C     . PHE A 1 42  ? 22.043 -8.986  12.459  1.00 31.57 ? 43   PHE A C     1 
ATOM   341  O  O     . PHE A 1 42  ? 22.033 -8.617  11.270  1.00 31.18 ? 43   PHE A O     1 
ATOM   342  C  CB    . PHE A 1 42  ? 24.398 -9.852  12.867  1.00 29.63 ? 43   PHE A CB    1 
ATOM   343  C  CG    . PHE A 1 42  ? 24.775 -8.526  13.505  1.00 35.09 ? 43   PHE A CG    1 
ATOM   344  C  CD1   . PHE A 1 42  ? 24.834 -8.383  14.874  1.00 34.30 ? 43   PHE A CD1   1 
ATOM   345  C  CD2   . PHE A 1 42  ? 25.087 -7.424  12.722  1.00 34.90 ? 43   PHE A CD2   1 
ATOM   346  C  CE1   . PHE A 1 42  ? 25.192 -7.171  15.455  1.00 33.89 ? 43   PHE A CE1   1 
ATOM   347  C  CE2   . PHE A 1 42  ? 25.417 -6.197  13.300  1.00 30.38 ? 43   PHE A CE2   1 
ATOM   348  C  CZ    . PHE A 1 42  ? 25.489 -6.073  14.661  1.00 31.17 ? 43   PHE A CZ    1 
ATOM   349  N  N     . LYS A 1 43  ? 21.260 -8.409  13.372  1.00 30.62 ? 44   LYS A N     1 
ATOM   350  C  CA    . LYS A 1 43  ? 20.290 -7.400  12.977  1.00 31.54 ? 44   LYS A CA    1 
ATOM   351  C  C     . LYS A 1 43  ? 20.426 -6.207  13.919  1.00 29.75 ? 44   LYS A C     1 
ATOM   352  O  O     . LYS A 1 43  ? 20.650 -6.387  15.107  1.00 30.36 ? 44   LYS A O     1 
ATOM   353  C  CB    . LYS A 1 43  ? 18.884 -8.017  13.053  1.00 34.43 ? 44   LYS A CB    1 
ATOM   354  C  CG    . LYS A 1 43  ? 17.726 -7.023  12.995  1.00 35.96 ? 44   LYS A CG    1 
ATOM   355  C  CD    . LYS A 1 43  ? 16.401 -7.693  13.407  1.00 39.83 ? 44   LYS A CD    1 
ATOM   356  C  CE    . LYS A 1 43  ? 15.861 -8.385  12.166  1.00 38.61 ? 44   LYS A CE    1 
ATOM   357  N  NZ    . LYS A 1 43  ? 14.524 -9.055  12.290  1.00 46.21 ? 44   LYS A NZ    1 
ATOM   358  N  N     . VAL A 1 44  ? 20.365 -4.991  13.390  1.00 27.37 ? 45   VAL A N     1 
ATOM   359  C  CA    . VAL A 1 44  ? 20.203 -3.796  14.226  1.00 26.76 ? 45   VAL A CA    1 
ATOM   360  C  C     . VAL A 1 44  ? 18.971 -3.044  13.763  1.00 25.15 ? 45   VAL A C     1 
ATOM   361  O  O     . VAL A 1 44  ? 18.864 -2.705  12.583  1.00 26.73 ? 45   VAL A O     1 
ATOM   362  C  CB    . VAL A 1 44  ? 21.394 -2.849  14.142  1.00 24.85 ? 45   VAL A CB    1 
ATOM   363  C  CG1   . VAL A 1 44  ? 21.123 -1.637  15.015  1.00 25.56 ? 45   VAL A CG1   1 
ATOM   364  C  CG2   . VAL A 1 44  ? 22.714 -3.573  14.597  1.00 25.02 ? 45   VAL A CG2   1 
ATOM   365  N  N     . THR A 1 45  ? 18.020 -2.806  14.665  1.00 25.34 ? 46   THR A N     1 
ATOM   366  C  CA    . THR A 1 45  ? 16.725 -2.198  14.256  1.00 24.74 ? 46   THR A CA    1 
ATOM   367  C  C     . THR A 1 45  ? 16.747 -0.712  14.624  1.00 28.47 ? 46   THR A C     1 
ATOM   368  O  O     . THR A 1 45  ? 17.320 -0.317  15.638  1.00 25.74 ? 46   THR A O     1 
ATOM   369  C  CB    . THR A 1 45  ? 15.532 -2.847  15.005  1.00 27.41 ? 46   THR A CB    1 
ATOM   370  O  OG1   . THR A 1 45  ? 15.584 -4.255  14.794  1.00 29.63 ? 46   THR A OG1   1 
ATOM   371  C  CG2   . THR A 1 45  ? 14.126 -2.319  14.530  1.00 22.75 ? 46   THR A CG2   1 
ATOM   372  N  N     . GLN A 1 46  ? 16.150 0.135   13.801  1.00 25.27 ? 47   GLN A N     1 
ATOM   373  C  CA    . GLN A 1 46  ? 15.999 1.507   14.244  1.00 26.51 ? 47   GLN A CA    1 
ATOM   374  C  C     . GLN A 1 46  ? 14.821 2.103   13.432  1.00 24.57 ? 47   GLN A C     1 
ATOM   375  O  O     . GLN A 1 46  ? 14.529 1.735   12.267  1.00 27.03 ? 47   GLN A O     1 
ATOM   376  C  CB    . GLN A 1 46  ? 17.294 2.312   14.024  1.00 21.34 ? 47   GLN A CB    1 
ATOM   377  C  CG    . GLN A 1 46  ? 17.415 3.655   14.744  1.00 22.90 ? 47   GLN A CG    1 
ATOM   378  C  CD    . GLN A 1 46  ? 17.718 3.497   16.237  1.00 26.05 ? 47   GLN A CD    1 
ATOM   379  O  OE1   . GLN A 1 46  ? 17.758 4.480   16.976  1.00 25.65 ? 47   GLN A OE1   1 
ATOM   380  N  NE2   . GLN A 1 46  ? 17.920 2.278   16.683  1.00 28.93 ? 47   GLN A NE2   1 
ATOM   381  N  N     . LYS A 1 47  ? 14.148 3.043   14.075  1.00 28.36 ? 48   LYS A N     1 
ATOM   382  C  CA    . LYS A 1 47  ? 13.048 3.837   13.452  1.00 26.59 ? 48   LYS A CA    1 
ATOM   383  C  C     . LYS A 1 47  ? 13.508 4.434   12.140  1.00 24.44 ? 48   LYS A C     1 
ATOM   384  O  O     . LYS A 1 47  ? 14.611 4.943   12.052  1.00 26.75 ? 48   LYS A O     1 
ATOM   385  C  CB    . LYS A 1 47  ? 12.675 4.971   14.450  1.00 30.65 ? 48   LYS A CB    1 
ATOM   386  C  CG    . LYS A 1 47  ? 11.427 5.709   14.134  1.00 33.97 ? 48   LYS A CG    1 
ATOM   387  C  CD    . LYS A 1 47  ? 11.053 6.758   15.187  1.00 35.51 ? 48   LYS A CD    1 
ATOM   388  C  CE    . LYS A 1 47  ? 9.763  7.425   14.708  1.00 35.51 ? 48   LYS A CE    1 
ATOM   389  N  NZ    . LYS A 1 47  ? 9.562  8.466   15.721  1.00 53.10 ? 48   LYS A NZ    1 
ATOM   390  N  N     . THR A 1 48  ? 12.694 4.410   11.078  1.00 30.18 ? 49   THR A N     1 
ATOM   391  C  CA    . THR A 1 48  ? 13.176 4.694   9.728   1.00 30.47 ? 49   THR A CA    1 
ATOM   392  C  C     . THR A 1 48  ? 13.674 6.129   9.615   1.00 33.41 ? 49   THR A C     1 
ATOM   393  O  O     . THR A 1 48  ? 14.579 6.463   8.822   1.00 29.57 ? 49   THR A O     1 
ATOM   394  C  CB    . THR A 1 48  ? 12.063 4.356   8.695   1.00 32.34 ? 49   THR A CB    1 
ATOM   395  O  OG1   . THR A 1 48  ? 11.814 2.942   8.810   1.00 29.71 ? 49   THR A OG1   1 
ATOM   396  C  CG2   . THR A 1 48  ? 12.490 4.713   7.246   1.00 32.49 ? 49   THR A CG2   1 
ATOM   397  N  N     . GLN A 1 49  ? 13.132 7.017   10.442  1.00 31.92 ? 50   GLN A N     1 
ATOM   398  C  CA    . GLN A 1 49  ? 13.682 8.367   10.346  1.00 34.14 ? 50   GLN A CA    1 
ATOM   399  C  C     . GLN A 1 49  ? 15.169 8.400   10.688  1.00 33.40 ? 50   GLN A C     1 
ATOM   400  O  O     . GLN A 1 49  ? 15.872 9.331   10.325  1.00 30.41 ? 50   GLN A O     1 
ATOM   401  C  CB    . GLN A 1 49  ? 12.872 9.345   11.198  1.00 39.28 ? 50   GLN A CB    1 
ATOM   402  C  CG    . GLN A 1 49  ? 13.291 9.416   12.632  1.00 46.46 ? 50   GLN A CG    1 
ATOM   403  C  CD    . GLN A 1 49  ? 12.581 10.539  13.368  1.00 53.96 ? 50   GLN A CD    1 
ATOM   404  O  OE1   . GLN A 1 49  ? 11.362 10.621  13.356  1.00 58.65 ? 50   GLN A OE1   1 
ATOM   405  N  NE2   . GLN A 1 49  ? 13.347 11.418  13.987  1.00 56.17 ? 50   GLN A NE2   1 
ATOM   406  N  N     . ARG A 1 50  ? 15.673 7.364   11.350  1.00 28.80 ? 51   ARG A N     1 
ATOM   407  C  CA    . ARG A 1 50  ? 17.117 7.281   11.660  1.00 29.83 ? 51   ARG A CA    1 
ATOM   408  C  C     . ARG A 1 50  ? 17.801 6.191   10.811  1.00 31.69 ? 51   ARG A C     1 
ATOM   409  O  O     . ARG A 1 50  ? 18.884 5.705   11.151  1.00 30.00 ? 51   ARG A O     1 
ATOM   410  C  CB    . ARG A 1 50  ? 17.323 6.993   13.154  1.00 27.59 ? 51   ARG A CB    1 
ATOM   411  C  CG    . ARG A 1 50  ? 17.133 8.228   14.016  1.00 28.75 ? 51   ARG A CG    1 
ATOM   412  C  CD    . ARG A 1 50  ? 17.413 7.934   15.503  1.00 29.11 ? 51   ARG A CD    1 
ATOM   413  N  NE    . ARG A 1 50  ? 16.554 6.900   16.116  1.00 30.97 ? 51   ARG A NE    1 
ATOM   414  C  CZ    . ARG A 1 50  ? 15.360 7.179   16.651  1.00 27.13 ? 51   ARG A CZ    1 
ATOM   415  N  NH1   . ARG A 1 50  ? 14.899 8.413   16.594  1.00 26.39 ? 51   ARG A NH1   1 
ATOM   416  N  NH2   . ARG A 1 50  ? 14.619 6.248   17.231  1.00 25.61 ? 51   ARG A NH2   1 
ATOM   417  N  N     . ARG A 1 51  ? 17.210 5.833   9.682   1.00 31.00 ? 52   ARG A N     1 
ATOM   418  C  CA    . ARG A 1 51  ? 17.862 4.853   8.800   1.00 33.79 ? 52   ARG A CA    1 
ATOM   419  C  C     . ARG A 1 51  ? 19.252 5.297   8.339   1.00 33.31 ? 52   ARG A C     1 
ATOM   420  O  O     . ARG A 1 51  ? 20.098 4.451   8.061   1.00 33.10 ? 52   ARG A O     1 
ATOM   421  C  CB    . ARG A 1 51  ? 16.965 4.404   7.633   1.00 33.44 ? 52   ARG A CB    1 
ATOM   422  C  CG    . ARG A 1 51  ? 17.394 4.905   6.280   1.00 51.81 ? 52   ARG A CG    1 
ATOM   423  C  CD    . ARG A 1 51  ? 16.237 5.614   5.597   1.00 71.00 ? 52   ARG A CD    1 
ATOM   424  N  NE    . ARG A 1 51  ? 16.514 7.021   5.276   1.00 80.58 ? 52   ARG A NE    1 
ATOM   425  C  CZ    . ARG A 1 51  ? 15.698 8.048   5.525   1.00 82.71 ? 52   ARG A CZ    1 
ATOM   426  N  NH1   . ARG A 1 51  ? 14.516 7.863   6.121   1.00 70.84 ? 52   ARG A NH1   1 
ATOM   427  N  NH2   . ARG A 1 51  ? 16.083 9.276   5.180   1.00 85.91 ? 52   ARG A NH2   1 
ATOM   428  N  N     . TRP A 1 52  ? 19.547 6.595   8.315   1.00 33.19 ? 53   TRP A N     1 
ATOM   429  C  CA    . TRP A 1 52  ? 20.894 7.034   7.932   1.00 31.81 ? 53   TRP A CA    1 
ATOM   430  C  C     . TRP A 1 52  ? 21.962 6.412   8.861   1.00 32.68 ? 53   TRP A C     1 
ATOM   431  O  O     . TRP A 1 52  ? 23.109 6.183   8.458   1.00 32.01 ? 53   TRP A O     1 
ATOM   432  C  CB    . TRP A 1 52  ? 21.000 8.551   8.013   1.00 36.71 ? 53   TRP A CB    1 
ATOM   433  C  CG    . TRP A 1 52  ? 20.863 9.084   9.427   1.00 37.46 ? 53   TRP A CG    1 
ATOM   434  C  CD1   . TRP A 1 52  ? 19.714 9.556   10.021  1.00 38.45 ? 53   TRP A CD1   1 
ATOM   435  C  CD2   . TRP A 1 52  ? 21.904 9.218   10.402  1.00 34.91 ? 53   TRP A CD2   1 
ATOM   436  N  NE1   . TRP A 1 52  ? 19.982 9.965   11.314  1.00 33.97 ? 53   TRP A NE1   1 
ATOM   437  C  CE2   . TRP A 1 52  ? 21.315 9.768   11.573  1.00 36.70 ? 53   TRP A CE2   1 
ATOM   438  C  CE3   . TRP A 1 52  ? 23.277 8.929   10.405  1.00 38.89 ? 53   TRP A CE3   1 
ATOM   439  C  CZ2   . TRP A 1 52  ? 22.061 10.033  12.735  1.00 38.41 ? 53   TRP A CZ2   1 
ATOM   440  C  CZ3   . TRP A 1 52  ? 24.021 9.203   11.557  1.00 39.54 ? 53   TRP A CZ3   1 
ATOM   441  C  CH2   . TRP A 1 52  ? 23.410 9.749   12.706  1.00 39.33 ? 53   TRP A CH2   1 
ATOM   442  N  N     . PHE A 1 53  ? 21.579 6.158   10.111  1.00 29.84 ? 54   PHE A N     1 
ATOM   443  C  CA    . PHE A 1 53  ? 22.494 5.570   11.121  1.00 27.51 ? 54   PHE A CA    1 
ATOM   444  C  C     . PHE A 1 53  ? 22.823 4.154   10.656  1.00 29.52 ? 54   PHE A C     1 
ATOM   445  O  O     . PHE A 1 53  ? 23.997 3.708   10.678  1.00 29.78 ? 54   PHE A O     1 
ATOM   446  C  CB    . PHE A 1 53  ? 21.790 5.569   12.492  1.00 30.97 ? 54   PHE A CB    1 
ATOM   447  C  CG    . PHE A 1 53  ? 22.640 5.007   13.631  1.00 31.28 ? 54   PHE A CG    1 
ATOM   448  C  CD1   . PHE A 1 53  ? 23.434 5.830   14.427  1.00 40.21 ? 54   PHE A CD1   1 
ATOM   449  C  CD2   . PHE A 1 53  ? 22.658 3.659   13.877  1.00 40.35 ? 54   PHE A CD2   1 
ATOM   450  C  CE1   . PHE A 1 53  ? 24.203 5.319   15.480  1.00 33.08 ? 54   PHE A CE1   1 
ATOM   451  C  CE2   . PHE A 1 53  ? 23.419 3.126   14.925  1.00 43.79 ? 54   PHE A CE2   1 
ATOM   452  C  CZ    . PHE A 1 53  ? 24.188 3.973   15.726  1.00 36.88 ? 54   PHE A CZ    1 
ATOM   453  N  N     . LEU A 1 54  ? 21.797 3.454   10.174  1.00 27.62 ? 55   LEU A N     1 
ATOM   454  C  CA    . LEU A 1 54  ? 21.978 2.063   9.718   1.00 26.14 ? 55   LEU A CA    1 
ATOM   455  C  C     . LEU A 1 54  ? 22.709 2.022   8.373   1.00 29.31 ? 55   LEU A C     1 
ATOM   456  O  O     . LEU A 1 54  ? 23.540 1.122   8.120   1.00 29.93 ? 55   LEU A O     1 
ATOM   457  C  CB    . LEU A 1 54  ? 20.606 1.395   9.581   1.00 26.69 ? 55   LEU A CB    1 
ATOM   458  C  CG    . LEU A 1 54  ? 19.777 1.383   10.888  1.00 27.08 ? 55   LEU A CG    1 
ATOM   459  C  CD1   . LEU A 1 54  ? 18.382 0.788   10.503  1.00 26.36 ? 55   LEU A CD1   1 
ATOM   460  C  CD2   . LEU A 1 54  ? 20.481 0.513   11.975  1.00 27.95 ? 55   LEU A CD2   1 
ATOM   461  N  N     . ASP A 1 55  ? 22.425 2.991   7.504   1.00 32.36 ? 56   ASP A N     1 
ATOM   462  C  CA    . ASP A 1 55  ? 23.184 3.118   6.239   1.00 31.68 ? 56   ASP A CA    1 
ATOM   463  C  C     . ASP A 1 55  ? 24.655 3.311   6.509   1.00 32.22 ? 56   ASP A C     1 
ATOM   464  O  O     . ASP A 1 55  ? 25.521 2.648   5.918   1.00 33.72 ? 56   ASP A O     1 
ATOM   465  C  CB    . ASP A 1 55  ? 22.666 4.328   5.442   1.00 33.36 ? 56   ASP A CB    1 
ATOM   466  C  CG    . ASP A 1 55  ? 21.284 4.061   4.842   1.00 38.65 ? 56   ASP A CG    1 
ATOM   467  O  OD1   . ASP A 1 55  ? 20.906 2.885   4.660   1.00 34.85 ? 56   ASP A OD1   1 
ATOM   468  O  OD2   . ASP A 1 55  ? 20.566 5.025   4.544   1.00 40.09 ? 56   ASP A OD2   1 
ATOM   469  N  N     . LYS A 1 56  ? 24.962 4.235   7.406   1.00 30.96 ? 57   LYS A N     1 
ATOM   470  C  CA    . LYS A 1 56  ? 26.368 4.413   7.834   1.00 35.43 ? 57   LYS A CA    1 
ATOM   471  C  C     . LYS A 1 56  ? 27.021 3.103   8.311   1.00 35.67 ? 57   LYS A C     1 
ATOM   472  O  O     . LYS A 1 56  ? 28.178 2.803   7.996   1.00 35.08 ? 57   LYS A O     1 
ATOM   473  C  CB    . LYS A 1 56  ? 26.461 5.490   8.903   1.00 33.64 ? 57   LYS A CB    1 
ATOM   474  C  CG    . LYS A 1 56  ? 27.785 6.238   8.868   1.00 45.39 ? 57   LYS A CG    1 
ATOM   475  C  CD    . LYS A 1 56  ? 27.996 7.323   9.940   1.00 45.84 ? 57   LYS A CD    1 
ATOM   476  C  CE    . LYS A 1 56  ? 29.515 7.641   10.014  1.00 56.74 ? 57   LYS A CE    1 
ATOM   477  N  NZ    . LYS A 1 56  ? 29.947 8.753   10.950  1.00 60.32 ? 57   LYS A NZ    1 
ATOM   478  N  N     . LEU A 1 57  ? 26.259 2.296   9.042   1.00 34.00 ? 58   LEU A N     1 
ATOM   479  C  CA    . LEU A 1 57  ? 26.724 1.007   9.521   1.00 34.32 ? 58   LEU A CA    1 
ATOM   480  C  C     . LEU A 1 57  ? 27.162 0.100   8.374   1.00 33.93 ? 58   LEU A C     1 
ATOM   481  O  O     . LEU A 1 57  ? 28.242 -0.536  8.434   1.00 36.98 ? 58   LEU A O     1 
ATOM   482  C  CB    . LEU A 1 57  ? 25.598 0.345   10.316  1.00 36.93 ? 58   LEU A CB    1 
ATOM   483  C  CG    . LEU A 1 57  ? 25.939 -0.574  11.468  1.00 37.30 ? 58   LEU A CG    1 
ATOM   484  C  CD1   . LEU A 1 57  ? 27.095 0.064   12.303  1.00 43.28 ? 58   LEU A CD1   1 
ATOM   485  C  CD2   . LEU A 1 57  ? 24.657 -0.786  12.330  1.00 36.67 ? 58   LEU A CD2   1 
ATOM   486  N  N     . VAL A 1 58  ? 26.365 0.047   7.311   1.00 32.41 ? 59   VAL A N     1 
ATOM   487  C  CA    . VAL A 1 58  ? 26.768 -0.705  6.108   1.00 31.43 ? 59   VAL A CA    1 
ATOM   488  C  C     . VAL A 1 58  ? 28.137 -0.236  5.659   1.00 33.60 ? 59   VAL A C     1 
ATOM   489  O  O     . VAL A 1 58  ? 28.995 -1.059  5.323   1.00 34.04 ? 59   VAL A O     1 
ATOM   490  C  CB    . VAL A 1 58  ? 25.849 -0.501  4.880   1.00 34.25 ? 59   VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 58  ? 26.427 -1.285  3.639   1.00 36.70 ? 59   VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 58  ? 24.393 -0.842  5.181   1.00 33.07 ? 59   VAL A CG2   1 
ATOM   493  N  N     . ASP A 1 59  ? 28.354 1.074   5.603   1.00 33.66 ? 60   ASP A N     1 
ATOM   494  C  CA    . ASP A 1 59  ? 29.645 1.551   5.127   1.00 35.14 ? 60   ASP A CA    1 
ATOM   495  C  C     . ASP A 1 59  ? 30.772 1.159   6.076   1.00 36.53 ? 60   ASP A C     1 
ATOM   496  O  O     . ASP A 1 59  ? 31.847 0.777   5.643   1.00 31.91 ? 60   ASP A O     1 
ATOM   497  C  CB    . ASP A 1 59  ? 29.660 3.056   4.984   1.00 39.12 ? 60   ASP A CB    1 
ATOM   498  C  CG    . ASP A 1 59  ? 30.534 3.487   3.862   1.00 50.11 ? 60   ASP A CG    1 
ATOM   499  O  OD1   . ASP A 1 59  ? 31.686 3.866   4.126   1.00 56.98 ? 60   ASP A OD1   1 
ATOM   500  O  OD2   . ASP A 1 59  ? 30.077 3.365   2.705   1.00 70.34 ? 60   ASP A OD2   1 
ATOM   501  N  N     . GLU A 1 60  ? 30.538 1.266   7.375   1.00 32.90 ? 61   GLU A N     1 
ATOM   502  C  CA    . GLU A 1 60  ? 31.617 1.006   8.315   1.00 36.15 ? 61   GLU A CA    1 
ATOM   503  C  C     . GLU A 1 60  ? 31.907 -0.492  8.446   1.00 33.71 ? 61   GLU A C     1 
ATOM   504  O  O     . GLU A 1 60  ? 33.057 -0.896  8.526   1.00 35.52 ? 61   GLU A O     1 
ATOM   505  C  CB    . GLU A 1 60  ? 31.264 1.594   9.666   1.00 33.45 ? 61   GLU A CB    1 
ATOM   506  C  CG    . GLU A 1 60  ? 31.214 3.120   9.690   1.00 39.06 ? 61   GLU A CG    1 
ATOM   507  C  CD    . GLU A 1 60  ? 30.532 3.653   10.951  1.00 51.17 ? 61   GLU A CD    1 
ATOM   508  O  OE1   . GLU A 1 60  ? 31.038 4.617   11.547  1.00 58.77 ? 61   GLU A OE1   1 
ATOM   509  O  OE2   . GLU A 1 60  ? 29.487 3.114   11.369  1.00 54.82 ? 61   GLU A OE2   1 
ATOM   510  N  N     . ILE A 1 61  ? 30.876 -1.327  8.507   1.00 34.57 ? 62   ILE A N     1 
ATOM   511  C  CA    . ILE A 1 61  ? 31.077 -2.786  8.547   1.00 33.20 ? 62   ILE A CA    1 
ATOM   512  C  C     . ILE A 1 61  ? 31.613 -3.267  7.191   1.00 36.63 ? 62   ILE A C     1 
ATOM   513  O  O     . ILE A 1 61  ? 32.419 -4.209  7.103   1.00 34.55 ? 62   ILE A O     1 
ATOM   514  C  CB    . ILE A 1 61  ? 29.795 -3.563  9.009   1.00 35.33 ? 62   ILE A CB    1 
ATOM   515  C  CG1   . ILE A 1 61  ? 29.374 -3.106  10.431  1.00 30.75 ? 62   ILE A CG1   1 
ATOM   516  C  CG2   . ILE A 1 61  ? 30.051 -5.100  8.963   1.00 32.91 ? 62   ILE A CG2   1 
ATOM   517  C  CD1   . ILE A 1 61  ? 28.081 -3.696  11.064  1.00 31.70 ? 62   ILE A CD1   1 
ATOM   518  N  N     . GLY A 1 62  ? 31.146 -2.606  6.141   1.00 33.40 ? 63   GLY A N     1 
ATOM   519  C  CA    . GLY A 1 62  ? 31.622 -2.827  4.784   1.00 38.28 ? 63   GLY A CA    1 
ATOM   520  C  C     . GLY A 1 62  ? 30.896 -3.966  4.098   1.00 37.13 ? 63   GLY A C     1 
ATOM   521  O  O     . GLY A 1 62  ? 31.276 -4.383  3.025   1.00 36.29 ? 63   GLY A O     1 
ATOM   522  N  N     . VAL A 1 63  ? 29.872 -4.510  4.743   1.00 37.22 ? 64   VAL A N     1 
ATOM   523  C  CA    . VAL A 1 63  ? 29.041 -5.538  4.126   1.00 37.21 ? 64   VAL A CA    1 
ATOM   524  C  C     . VAL A 1 63  ? 27.690 -5.433  4.824   1.00 35.59 ? 64   VAL A C     1 
ATOM   525  O  O     . VAL A 1 63  ? 27.563 -4.715  5.820   1.00 31.34 ? 64   VAL A O     1 
ATOM   526  C  CB    . VAL A 1 63  ? 29.673 -6.947  4.324   1.00 41.38 ? 64   VAL A CB    1 
ATOM   527  C  CG1   . VAL A 1 63  ? 29.939 -7.255  5.814   1.00 39.73 ? 64   VAL A CG1   1 
ATOM   528  C  CG2   . VAL A 1 63  ? 28.847 -7.994  3.662   1.00 44.65 ? 64   VAL A CG2   1 
ATOM   529  N  N     . GLY A 1 64  ? 26.690 -6.141  4.316   1.00 34.48 ? 65   GLY A N     1 
ATOM   530  C  CA    . GLY A 1 64  ? 25.353 -6.110  4.918   1.00 35.05 ? 65   GLY A CA    1 
ATOM   531  C  C     . GLY A 1 64  ? 24.438 -5.179  4.142   1.00 34.97 ? 65   GLY A C     1 
ATOM   532  O  O     . GLY A 1 64  ? 24.876 -4.501  3.195   1.00 33.35 ? 65   GLY A O     1 
ATOM   533  N  N     . TYR A 1 65  ? 23.178 -5.061  4.545   1.00 31.44 ? 66   TYR A N     1 
ATOM   534  C  CA    . TYR A 1 65  ? 22.379 -4.036  3.892   1.00 34.68 ? 66   TYR A CA    1 
ATOM   535  C  C     . TYR A 1 65  ? 21.288 -3.510  4.813   1.00 34.26 ? 66   TYR A C     1 
ATOM   536  O  O     . TYR A 1 65  ? 21.096 -4.019  5.915   1.00 33.40 ? 66   TYR A O     1 
ATOM   537  C  CB    . TYR A 1 65  ? 21.727 -4.603  2.619   1.00 37.21 ? 66   TYR A CB    1 
ATOM   538  C  CG    . TYR A 1 65  ? 20.916 -5.829  2.927   1.00 33.90 ? 66   TYR A CG    1 
ATOM   539  C  CD1   . TYR A 1 65  ? 19.565 -5.725  3.197   1.00 36.67 ? 66   TYR A CD1   1 
ATOM   540  C  CD2   . TYR A 1 65  ? 21.518 -7.086  3.010   1.00 40.04 ? 66   TYR A CD2   1 
ATOM   541  C  CE1   . TYR A 1 65  ? 18.800 -6.846  3.511   1.00 42.16 ? 66   TYR A CE1   1 
ATOM   542  C  CE2   . TYR A 1 65  ? 20.766 -8.210  3.324   1.00 39.57 ? 66   TYR A CE2   1 
ATOM   543  C  CZ    . TYR A 1 65  ? 19.408 -8.083  3.566   1.00 41.31 ? 66   TYR A CZ    1 
ATOM   544  O  OH    . TYR A 1 65  ? 18.657 -9.187  3.887   1.00 40.72 ? 66   TYR A OH    1 
ATOM   545  N  N     . VAL A 1 66  ? 20.531 -2.534  4.327   1.00 31.39 ? 67   VAL A N     1 
ATOM   546  C  CA    . VAL A 1 66  ? 19.457 -1.983  5.139   1.00 32.51 ? 67   VAL A CA    1 
ATOM   547  C  C     . VAL A 1 66  ? 18.133 -2.194  4.409   1.00 33.62 ? 67   VAL A C     1 
ATOM   548  O  O     . VAL A 1 66  ? 18.031 -1.910  3.207   1.00 35.27 ? 67   VAL A O     1 
ATOM   549  C  CB    . VAL A 1 66  ? 19.649 -0.473  5.403   1.00 29.96 ? 67   VAL A CB    1 
ATOM   550  C  CG1   . VAL A 1 66  ? 18.463 0.060   6.263   1.00 32.22 ? 67   VAL A CG1   1 
ATOM   551  C  CG2   . VAL A 1 66  ? 20.960 -0.219  6.180   1.00 30.50 ? 67   VAL A CG2   1 
ATOM   552  N  N     . ARG A 1 67  ? 17.130 -2.650  5.151   1.00 31.38 ? 68   ARG A N     1 
ATOM   553  C  CA    . ARG A 1 67  ? 15.779 -2.957  4.644   1.00 38.71 ? 68   ARG A CA    1 
ATOM   554  C  C     . ARG A 1 67  ? 14.779 -2.060  5.386   1.00 38.78 ? 68   ARG A C     1 
ATOM   555  O  O     . ARG A 1 67  ? 14.801 -1.984  6.624   1.00 35.20 ? 68   ARG A O     1 
ATOM   556  C  CB    . ARG A 1 67  ? 15.485 -4.441  4.957   1.00 41.21 ? 68   ARG A CB    1 
ATOM   557  C  CG    . ARG A 1 67  ? 14.033 -4.864  4.921   1.00 60.32 ? 68   ARG A CG    1 
ATOM   558  C  CD    . ARG A 1 67  ? 13.534 -5.099  3.481   1.00 72.30 ? 68   ARG A CD    1 
ATOM   559  N  NE    . ARG A 1 67  ? 12.140 -5.549  3.429   1.00 77.53 ? 68   ARG A NE    1 
ATOM   560  C  CZ    . ARG A 1 67  ? 11.526 -5.960  2.317   1.00 77.55 ? 68   ARG A CZ    1 
ATOM   561  N  NH1   . ARG A 1 67  ? 12.174 -5.963  1.151   1.00 75.34 ? 68   ARG A NH1   1 
ATOM   562  N  NH2   . ARG A 1 67  ? 10.258 -6.365  2.368   1.00 76.80 ? 68   ARG A NH2   1 
ATOM   563  N  N     . ASP A 1 68  ? 13.938 -1.349  4.636   1.00 40.86 ? 69   ASP A N     1 
ATOM   564  C  CA    . ASP A 1 68  ? 12.858 -0.553  5.221   1.00 45.87 ? 69   ASP A CA    1 
ATOM   565  C  C     . ASP A 1 68  ? 11.694 -1.460  5.504   1.00 48.66 ? 69   ASP A C     1 
ATOM   566  O  O     . ASP A 1 68  ? 11.230 -2.163  4.594   1.00 49.54 ? 69   ASP A O     1 
ATOM   567  C  CB    . ASP A 1 68  ? 12.344 0.459   4.193   1.00 49.13 ? 69   ASP A CB    1 
ATOM   568  C  CG    . ASP A 1 68  ? 11.559 1.599   4.832   1.00 54.11 ? 69   ASP A CG    1 
ATOM   569  O  OD1   . ASP A 1 68  ? 10.851 1.384   5.847   1.00 58.65 ? 69   ASP A OD1   1 
ATOM   570  O  OD2   . ASP A 1 68  ? 11.658 2.731   4.312   1.00 60.28 ? 69   ASP A OD2   1 
ATOM   571  N  N     . GLU A 1 69  ? 11.169 -1.421  6.718   1.00 48.08 ? 70   GLU A N     1 
ATOM   572  C  CA    . GLU A 1 69  ? 9.962  -2.201  7.000   1.00 51.31 ? 70   GLU A CA    1 
ATOM   573  C  C     . GLU A 1 69  ? 8.717  -1.354  7.248   1.00 49.34 ? 70   GLU A C     1 
ATOM   574  O  O     . GLU A 1 69  ? 7.857  -1.765  8.015   1.00 51.03 ? 70   GLU A O     1 
ATOM   575  C  CB    . GLU A 1 69  ? 10.178 -3.209  8.141   1.00 51.03 ? 70   GLU A CB    1 
ATOM   576  C  CG    . GLU A 1 69  ? 10.617 -4.589  7.670   1.00 65.17 ? 70   GLU A CG    1 
ATOM   577  C  CD    . GLU A 1 69  ? 11.854 -5.098  8.403   1.00 76.28 ? 70   GLU A CD    1 
ATOM   578  O  OE1   . GLU A 1 69  ? 11.701 -5.769  9.455   1.00 83.24 ? 70   GLU A OE1   1 
ATOM   579  O  OE2   . GLU A 1 69  ? 12.979 -4.819  7.928   1.00 80.47 ? 70   GLU A OE2   1 
ATOM   580  N  N     . GLY A 1 70  ? 8.612  -0.187  6.612   1.00 48.29 ? 71   GLY A N     1 
ATOM   581  C  CA    . GLY A 1 70  ? 7.625  0.800   7.053   1.00 46.86 ? 71   GLY A CA    1 
ATOM   582  C  C     . GLY A 1 70  ? 8.116  1.664   8.208   1.00 44.84 ? 71   GLY A C     1 
ATOM   583  O  O     . GLY A 1 70  ? 8.949  2.570   8.023   1.00 42.31 ? 71   GLY A O     1 
ATOM   584  N  N     . SER A 1 71  ? 7.639  1.363   9.416   1.00 40.95 ? 72   SER A N     1 
ATOM   585  C  CA    . SER A 1 71  ? 7.883  2.225   10.575  1.00 40.73 ? 72   SER A CA    1 
ATOM   586  C  C     . SER A 1 71  ? 9.341  2.139   11.089  1.00 36.07 ? 72   SER A C     1 
ATOM   587  O  O     . SER A 1 71  ? 9.942  3.097   11.606  1.00 31.22 ? 72   SER A O     1 
ATOM   588  C  CB    . SER A 1 71  ? 6.930  1.778   11.680  1.00 43.34 ? 72   SER A CB    1 
ATOM   589  O  OG    . SER A 1 71  ? 7.096  2.615   12.811  1.00 53.28 ? 72   SER A OG    1 
ATOM   590  N  N     . VAL A 1 72  ? 9.915  0.956   10.955  1.00 31.85 ? 73   VAL A N     1 
ATOM   591  C  CA    . VAL A 1 72  ? 11.300 0.752   11.373  1.00 33.57 ? 73   VAL A CA    1 
ATOM   592  C  C     . VAL A 1 72  ? 12.092 0.190   10.197  1.00 31.90 ? 73   VAL A C     1 
ATOM   593  O  O     . VAL A 1 72  ? 11.513 -0.323  9.230   1.00 31.35 ? 73   VAL A O     1 
ATOM   594  C  CB    . VAL A 1 72  ? 11.426 -0.212  12.557  1.00 31.87 ? 73   VAL A CB    1 
ATOM   595  C  CG1   . VAL A 1 72  ? 10.635 0.305   13.693  1.00 30.98 ? 73   VAL A CG1   1 
ATOM   596  C  CG2   . VAL A 1 72  ? 10.980 -1.579  12.172  1.00 34.17 ? 73   VAL A CG2   1 
ATOM   597  N  N     . SER A 1 73  ? 13.413 0.348   10.279  1.00 29.52 ? 74   SER A N     1 
ATOM   598  C  CA    . SER A 1 73  ? 14.338 -0.233  9.317   1.00 29.98 ? 74   SER A CA    1 
ATOM   599  C  C     . SER A 1 73  ? 15.271 -1.187  10.045  1.00 30.09 ? 74   SER A C     1 
ATOM   600  O  O     . SER A 1 73  ? 15.380 -1.125  11.282  1.00 28.15 ? 74   SER A O     1 
ATOM   601  C  CB    . SER A 1 73  ? 15.161 0.880   8.670   1.00 28.41 ? 74   SER A CB    1 
ATOM   602  O  OG    . SER A 1 73  ? 14.294 1.763   7.934   1.00 32.89 ? 74   SER A OG    1 
ATOM   603  N  N     . ASN A 1 74  ? 15.980 -2.037  9.283   1.00 29.99 ? 75   ASN A N     1 
ATOM   604  C  CA    . ASN A 1 74  ? 16.932 -2.957  9.893   1.00 28.91 ? 75   ASN A CA    1 
ATOM   605  C  C     . ASN A 1 74  ? 18.207 -2.998  9.078   1.00 27.62 ? 75   ASN A C     1 
ATOM   606  O  O     . ASN A 1 74  ? 18.143 -3.097  7.862   1.00 28.28 ? 75   ASN A O     1 
ATOM   607  C  CB    . ASN A 1 74  ? 16.311 -4.360  9.928   1.00 30.46 ? 75   ASN A CB    1 
ATOM   608  C  CG    . ASN A 1 74  ? 15.369 -4.526  11.103  1.00 34.33 ? 75   ASN A CG    1 
ATOM   609  O  OD1   . ASN A 1 74  ? 14.137 -4.504  10.962  1.00 42.91 ? 75   ASN A OD1   1 
ATOM   610  N  ND2   . ASN A 1 74  ? 15.941 -4.642  12.280  1.00 31.56 ? 75   ASN A ND2   1 
ATOM   611  N  N     . TYR A 1 75  ? 19.366 -2.886  9.728   1.00 25.86 ? 76   TYR A N     1 
ATOM   612  C  CA    . TYR A 1 75  ? 20.603 -3.375  9.119   1.00 26.78 ? 76   TYR A CA    1 
ATOM   613  C  C     . TYR A 1 75  ? 20.640 -4.892  9.293   1.00 29.29 ? 76   TYR A C     1 
ATOM   614  O  O     . TYR A 1 75  ? 20.359 -5.405  10.385  1.00 28.44 ? 76   TYR A O     1 
ATOM   615  C  CB    . TYR A 1 75  ? 21.822 -2.764  9.844   1.00 26.14 ? 76   TYR A CB    1 
ATOM   616  C  CG    . TYR A 1 75  ? 23.108 -3.437  9.441   1.00 30.23 ? 76   TYR A CG    1 
ATOM   617  C  CD1   . TYR A 1 75  ? 23.770 -3.069  8.273   1.00 25.11 ? 76   TYR A CD1   1 
ATOM   618  C  CD2   . TYR A 1 75  ? 23.654 -4.455  10.242  1.00 32.94 ? 76   TYR A CD2   1 
ATOM   619  C  CE1   . TYR A 1 75  ? 24.954 -3.717  7.894   1.00 28.51 ? 76   TYR A CE1   1 
ATOM   620  C  CE2   . TYR A 1 75  ? 24.840 -5.093  9.891   1.00 29.95 ? 76   TYR A CE2   1 
ATOM   621  C  CZ    . TYR A 1 75  ? 25.483 -4.718  8.708   1.00 24.55 ? 76   TYR A CZ    1 
ATOM   622  O  OH    . TYR A 1 75  ? 26.665 -5.345  8.327   1.00 27.27 ? 76   TYR A OH    1 
ATOM   623  N  N     . ILE A 1 76  ? 21.026 -5.619  8.238   1.00 30.48 ? 77   ILE A N     1 
ATOM   624  C  CA    . ILE A 1 76  ? 21.010 -7.069  8.289   1.00 30.42 ? 77   ILE A CA    1 
ATOM   625  C  C     . ILE A 1 76  ? 22.366 -7.528  7.786   1.00 29.50 ? 77   ILE A C     1 
ATOM   626  O  O     . ILE A 1 76  ? 22.844 -7.042  6.742   1.00 27.18 ? 77   ILE A O     1 
ATOM   627  C  CB    . ILE A 1 76  ? 19.953 -7.660  7.303   1.00 30.50 ? 77   ILE A CB    1 
ATOM   628  C  CG1   . ILE A 1 76  ? 18.523 -7.187  7.646   1.00 35.89 ? 77   ILE A CG1   1 
ATOM   629  C  CG2   . ILE A 1 76  ? 20.050 -9.224  7.227   1.00 32.16 ? 77   ILE A CG2   1 
ATOM   630  C  CD1   . ILE A 1 76  ? 17.963 -7.779  8.968   1.00 35.42 ? 77   ILE A CD1   1 
ATOM   631  N  N     . LEU A 1 77  ? 22.974 -8.463  8.509   1.00 30.80 ? 78   LEU A N     1 
ATOM   632  C  CA    . LEU A 1 77  ? 24.123 -9.212  7.991   1.00 33.44 ? 78   LEU A CA    1 
ATOM   633  C  C     . LEU A 1 77  ? 23.852 -10.698 8.196   1.00 34.40 ? 78   LEU A C     1 
ATOM   634  O  O     . LEU A 1 77  ? 23.704 -11.151 9.332   1.00 31.67 ? 78   LEU A O     1 
ATOM   635  C  CB    . LEU A 1 77  ? 25.395 -8.836  8.760   1.00 32.35 ? 78   LEU A CB    1 
ATOM   636  C  CG    . LEU A 1 77  ? 26.706 -9.479  8.268   1.00 33.81 ? 78   LEU A CG    1 
ATOM   637  C  CD1   . LEU A 1 77  ? 26.907 -9.344  6.739   1.00 31.17 ? 78   LEU A CD1   1 
ATOM   638  C  CD2   . LEU A 1 77  ? 27.891 -8.864  9.050   1.00 33.73 ? 78   LEU A CD2   1 
ATOM   639  N  N     . SER A 1 78  ? 23.771 -11.471 7.120   1.00 37.77 ? 79   SER A N     1 
ATOM   640  C  CA    . SER A 1 78  ? 23.640 -12.925 7.294   1.00 41.72 ? 79   SER A CA    1 
ATOM   641  C  C     . SER A 1 78  ? 24.558 -13.765 6.413   1.00 42.41 ? 79   SER A C     1 
ATOM   642  O  O     . SER A 1 78  ? 24.667 -14.969 6.606   1.00 41.68 ? 79   SER A O     1 
ATOM   643  C  CB    . SER A 1 78  ? 22.185 -13.399 7.149   1.00 44.26 ? 79   SER A CB    1 
ATOM   644  O  OG    . SER A 1 78  ? 21.602 -12.904 5.962   1.00 53.53 ? 79   SER A OG    1 
ATOM   645  N  N     . GLU A 1 79  ? 25.218 -13.156 5.443   1.00 42.60 ? 80   GLU A N     1 
ATOM   646  C  CA    . GLU A 1 79  ? 26.175 -13.924 4.610   1.00 43.97 ? 80   GLU A CA    1 
ATOM   647  C  C     . GLU A 1 79  ? 27.257 -14.494 5.530   1.00 42.59 ? 80   GLU A C     1 
ATOM   648  O  O     . GLU A 1 79  ? 27.897 -13.736 6.259   1.00 40.30 ? 80   GLU A O     1 
ATOM   649  C  CB    . GLU A 1 79  ? 26.864 -12.951 3.664   1.00 45.39 ? 80   GLU A CB    1 
ATOM   650  C  CG    . GLU A 1 79  ? 26.593 -13.076 2.202   1.00 57.14 ? 80   GLU A CG    1 
ATOM   651  C  CD    . GLU A 1 79  ? 27.730 -12.421 1.410   1.00 65.74 ? 80   GLU A CD    1 
ATOM   652  O  OE1   . GLU A 1 79  ? 27.847 -11.181 1.503   1.00 64.81 ? 80   GLU A OE1   1 
ATOM   653  O  OE2   . GLU A 1 79  ? 28.524 -13.136 0.742   1.00 70.32 ? 80   GLU A OE2   1 
ATOM   654  N  N     . ILE A 1 80  ? 27.482 -15.806 5.484   1.00 42.02 ? 81   ILE A N     1 
ATOM   655  C  CA    . ILE A 1 80  ? 28.150 -16.528 6.561   1.00 41.77 ? 81   ILE A CA    1 
ATOM   656  C  C     . ILE A 1 80  ? 29.582 -16.068 6.818   1.00 41.09 ? 81   ILE A C     1 
ATOM   657  O  O     . ILE A 1 80  ? 29.965 -15.786 7.946   1.00 43.95 ? 81   ILE A O     1 
ATOM   658  C  CB    . ILE A 1 80  ? 28.107 -18.055 6.295   1.00 44.23 ? 81   ILE A CB    1 
ATOM   659  C  CG1   . ILE A 1 80  ? 26.703 -18.550 6.554   1.00 49.92 ? 81   ILE A CG1   1 
ATOM   660  C  CG2   . ILE A 1 80  ? 28.955 -18.801 7.296   1.00 46.95 ? 81   ILE A CG2   1 
ATOM   661  C  CD1   . ILE A 1 80  ? 26.238 -18.201 7.976   1.00 58.10 ? 81   ILE A CD1   1 
ATOM   662  N  N     . LYS A 1 81  ? 30.395 -15.969 5.777   1.00 43.49 ? 82   LYS A N     1 
ATOM   663  C  CA    . LYS A 1 81  ? 31.784 -15.546 5.980   1.00 43.64 ? 82   LYS A CA    1 
ATOM   664  C  C     . LYS A 1 81  ? 31.997 -14.140 6.552   1.00 40.09 ? 82   LYS A C     1 
ATOM   665  O  O     . LYS A 1 81  ? 32.728 -13.969 7.536   1.00 40.03 ? 82   LYS A O     1 
ATOM   666  C  CB    . LYS A 1 81  ? 32.625 -15.805 4.718   1.00 47.33 ? 82   LYS A CB    1 
ATOM   667  C  CG    . LYS A 1 81  ? 34.084 -15.340 4.833   1.00 56.79 ? 82   LYS A CG    1 
ATOM   668  C  CD    . LYS A 1 81  ? 34.971 -16.185 5.776   1.00 67.98 ? 82   LYS A CD    1 
ATOM   669  C  CE    . LYS A 1 81  ? 34.961 -15.670 7.233   1.00 66.89 ? 82   LYS A CE    1 
ATOM   670  N  NZ    . LYS A 1 81  ? 35.852 -14.499 7.522   1.00 71.66 ? 82   LYS A NZ    1 
ATOM   671  N  N     . PRO A 1 82  ? 31.382 -13.104 5.960   1.00 39.56 ? 83   PRO A N     1 
ATOM   672  C  CA    . PRO A 1 82  ? 31.617 -11.829 6.626   1.00 38.91 ? 83   PRO A CA    1 
ATOM   673  C  C     . PRO A 1 82  ? 30.977 -11.795 8.010   1.00 37.80 ? 83   PRO A C     1 
ATOM   674  O  O     . PRO A 1 82  ? 31.511 -11.159 8.912   1.00 37.75 ? 83   PRO A O     1 
ATOM   675  C  CB    . PRO A 1 82  ? 30.943 -10.813 5.700   1.00 37.67 ? 83   PRO A CB    1 
ATOM   676  C  CG    . PRO A 1 82  ? 29.934 -11.612 4.928   1.00 43.00 ? 83   PRO A CG    1 
ATOM   677  C  CD    . PRO A 1 82  ? 30.548 -12.973 4.752   1.00 39.73 ? 83   PRO A CD    1 
ATOM   678  N  N     . LEU A 1 83  ? 29.831 -12.453 8.177   1.00 37.51 ? 84   LEU A N     1 
ATOM   679  C  CA    . LEU A 1 83  ? 29.210 -12.521 9.510   1.00 36.22 ? 84   LEU A CA    1 
ATOM   680  C  C     . LEU A 1 83  ? 30.218 -13.089 10.507  1.00 41.13 ? 84   LEU A C     1 
ATOM   681  O  O     . LEU A 1 83  ? 30.404 -12.556 11.606  1.00 37.16 ? 84   LEU A O     1 
ATOM   682  C  CB    . LEU A 1 83  ? 27.959 -13.406 9.472   1.00 37.26 ? 84   LEU A CB    1 
ATOM   683  C  CG    . LEU A 1 83  ? 27.206 -13.631 10.776  1.00 35.38 ? 84   LEU A CG    1 
ATOM   684  C  CD1   . LEU A 1 83  ? 26.825 -12.245 11.364  1.00 31.21 ? 84   LEU A CD1   1 
ATOM   685  C  CD2   . LEU A 1 83  ? 25.992 -14.521 10.490  1.00 34.15 ? 84   LEU A CD2   1 
ATOM   686  N  N     . ARG A 1 84  ? 30.909 -14.143 10.095  1.00 40.69 ? 85   ARG A N     1 
ATOM   687  C  CA    . ARG A 1 84  ? 31.891 -14.772 10.989  1.00 49.03 ? 85   ARG A CA    1 
ATOM   688  C  C     . ARG A 1 84  ? 33.022 -13.806 11.314  1.00 42.28 ? 85   ARG A C     1 
ATOM   689  O  O     . ARG A 1 84  ? 33.448 -13.699 12.456  1.00 41.86 ? 85   ARG A O     1 
ATOM   690  C  CB    . ARG A 1 84  ? 32.463 -16.069 10.371  1.00 44.25 ? 85   ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 84  ? 33.416 -16.819 11.323  1.00 55.84 ? 85   ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 84  ? 33.965 -18.119 10.725  1.00 56.47 ? 85   ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 84  ? 35.409 -18.020 10.492  1.00 80.93 ? 85   ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 84  ? 36.140 -18.877 9.772   1.00 77.95 ? 85   ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 84  ? 35.566 -19.929 9.189   1.00 72.86 ? 85   ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 84  ? 37.452 -18.673 9.635   1.00 74.00 ? 85   ARG A NH2   1 
ATOM   697  N  N     . ASN A 1 85  ? 33.528 -13.105 10.299  1.00 42.46 ? 86   ASN A N     1 
ATOM   698  C  CA    . ASN A 1 85  ? 34.630 -12.156 10.498  1.00 39.40 ? 86   ASN A CA    1 
ATOM   699  C  C     . ASN A 1 85  ? 34.218 -11.019 11.437  1.00 40.42 ? 86   ASN A C     1 
ATOM   700  O  O     . ASN A 1 85  ? 34.983 -10.583 12.281  1.00 37.15 ? 86   ASN A O     1 
ATOM   701  C  CB    . ASN A 1 85  ? 35.058 -11.557 9.146   1.00 40.51 ? 86   ASN A CB    1 
ATOM   702  C  CG    . ASN A 1 85  ? 36.114 -10.472 9.294   1.00 48.90 ? 86   ASN A CG    1 
ATOM   703  O  OD1   . ASN A 1 85  ? 37.187 -10.703 9.855   1.00 53.40 ? 86   ASN A OD1   1 
ATOM   704  N  ND2   . ASN A 1 85  ? 35.814 -9.276  8.802   1.00 49.64 ? 86   ASN A ND2   1 
ATOM   705  N  N     . PHE A 1 86  ? 33.017 -10.486 11.228  1.00 39.22 ? 87   PHE A N     1 
ATOM   706  C  CA    . PHE A 1 86  ? 32.528 -9.364  12.036  1.00 37.15 ? 87   PHE A CA    1 
ATOM   707  C  C     . PHE A 1 86  ? 32.270 -9.793  13.491  1.00 36.80 ? 87   PHE A C     1 
ATOM   708  O  O     . PHE A 1 86  ? 32.712 -9.140  14.434  1.00 35.47 ? 87   PHE A O     1 
ATOM   709  C  CB    . PHE A 1 86  ? 31.245 -8.793  11.431  1.00 34.76 ? 87   PHE A CB    1 
ATOM   710  C  CG    . PHE A 1 86  ? 30.539 -7.794  12.340  1.00 37.77 ? 87   PHE A CG    1 
ATOM   711  C  CD1   . PHE A 1 86  ? 31.135 -6.579  12.610  1.00 33.52 ? 87   PHE A CD1   1 
ATOM   712  C  CD2   . PHE A 1 86  ? 29.306 -8.094  12.923  1.00 30.85 ? 87   PHE A CD2   1 
ATOM   713  C  CE1   . PHE A 1 86  ? 30.518 -5.620  13.427  1.00 34.88 ? 87   PHE A CE1   1 
ATOM   714  C  CE2   . PHE A 1 86  ? 28.663 -7.131  13.747  1.00 34.45 ? 87   PHE A CE2   1 
ATOM   715  C  CZ    . PHE A 1 86  ? 29.282 -5.903  13.999  1.00 34.50 ? 87   PHE A CZ    1 
ATOM   716  N  N     . LEU A 1 87  ? 31.570 -10.903 13.685  1.00 34.90 ? 88   LEU A N     1 
ATOM   717  C  CA    . LEU A 1 87  ? 31.261 -11.273 15.080  1.00 36.22 ? 88   LEU A CA    1 
ATOM   718  C  C     . LEU A 1 87  ? 32.525 -11.656 15.843  1.00 37.23 ? 88   LEU A C     1 
ATOM   719  O  O     . LEU A 1 87  ? 32.653 -11.384 17.033  1.00 37.06 ? 88   LEU A O     1 
ATOM   720  C  CB    . LEU A 1 87  ? 30.248 -12.407 15.161  1.00 32.12 ? 88   LEU A CB    1 
ATOM   721  C  CG    . LEU A 1 87  ? 28.795 -12.063 14.881  1.00 35.42 ? 88   LEU A CG    1 
ATOM   722  C  CD1   . LEU A 1 87  ? 28.030 -13.368 15.080  1.00 39.20 ? 88   LEU A CD1   1 
ATOM   723  C  CD2   . LEU A 1 87  ? 28.372 -10.939 15.868  1.00 35.25 ? 88   LEU A CD2   1 
ATOM   724  N  N     . THR A 1 88  ? 33.482 -12.281 15.167  1.00 40.75 ? 89   THR A N     1 
ATOM   725  C  CA    . THR A 1 88  ? 34.748 -12.604 15.845  1.00 39.70 ? 89   THR A CA    1 
ATOM   726  C  C     . THR A 1 88  ? 35.341 -11.331 16.440  1.00 38.83 ? 89   THR A C     1 
ATOM   727  O  O     . THR A 1 88  ? 35.820 -11.317 17.581  1.00 42.37 ? 89   THR A O     1 
ATOM   728  C  CB    . THR A 1 88  ? 35.778 -13.269 14.860  1.00 40.03 ? 89   THR A CB    1 
ATOM   729  O  OG1   . THR A 1 88  ? 35.228 -14.484 14.341  1.00 42.43 ? 89   THR A OG1   1 
ATOM   730  C  CG2   . THR A 1 88  ? 37.062 -13.635 15.574  1.00 41.27 ? 89   THR A CG2   1 
ATOM   731  N  N     . GLN A 1 89  ? 35.300 -10.232 15.693  1.00 35.61 ? 90   GLN A N     1 
ATOM   732  C  CA    . GLN A 1 89  ? 35.888 -8.996  16.200  1.00 37.23 ? 90   GLN A CA    1 
ATOM   733  C  C     . GLN A 1 89  ? 35.039 -8.279  17.260  1.00 34.69 ? 90   GLN A C     1 
ATOM   734  O  O     . GLN A 1 89  ? 35.541 -7.606  18.166  1.00 35.16 ? 90   GLN A O     1 
ATOM   735  C  CB    . GLN A 1 89  ? 36.145 -8.064  15.015  1.00 38.00 ? 90   GLN A CB    1 
ATOM   736  C  CG    . GLN A 1 89  ? 37.357 -8.585  14.175  1.00 43.42 ? 90   GLN A CG    1 
ATOM   737  C  CD    . GLN A 1 89  ? 37.773 -7.605  13.112  1.00 39.51 ? 90   GLN A CD    1 
ATOM   738  O  OE1   . GLN A 1 89  ? 38.276 -6.508  13.400  1.00 41.71 ? 90   GLN A OE1   1 
ATOM   739  N  NE2   . GLN A 1 89  ? 37.536 -7.980  11.871  1.00 44.88 ? 90   GLN A NE2   1 
ATOM   740  N  N     . LEU A 1 90  ? 33.732 -8.392  17.141  1.00 34.05 ? 91   LEU A N     1 
ATOM   741  C  CA    . LEU A 1 90  ? 32.828 -7.655  18.036  1.00 31.69 ? 91   LEU A CA    1 
ATOM   742  C  C     . LEU A 1 90  ? 32.661 -8.392  19.361  1.00 34.36 ? 91   LEU A C     1 
ATOM   743  O  O     . LEU A 1 90  ? 32.550 -7.762  20.417  1.00 35.68 ? 91   LEU A O     1 
ATOM   744  C  CB    . LEU A 1 90  ? 31.450 -7.536  17.338  1.00 30.85 ? 91   LEU A CB    1 
ATOM   745  C  CG    . LEU A 1 90  ? 30.458 -6.707  18.186  1.00 31.44 ? 91   LEU A CG    1 
ATOM   746  C  CD1   . LEU A 1 90  ? 30.946 -5.271  18.220  1.00 25.44 ? 91   LEU A CD1   1 
ATOM   747  C  CD2   . LEU A 1 90  ? 29.026 -6.801  17.638  1.00 29.99 ? 91   LEU A CD2   1 
ATOM   748  N  N     . GLN A 1 91  ? 32.662 -9.725  19.305  1.00 34.85 ? 92   GLN A N     1 
ATOM   749  C  CA    . GLN A 1 91  ? 32.398 -10.569 20.463  1.00 37.59 ? 92   GLN A CA    1 
ATOM   750  C  C     . GLN A 1 91  ? 33.076 -10.142 21.777  1.00 38.50 ? 92   GLN A C     1 
ATOM   751  O  O     . GLN A 1 91  ? 32.434 -10.195 22.851  1.00 36.43 ? 92   GLN A O     1 
ATOM   752  C  CB    . GLN A 1 91  ? 32.750 -12.010 20.088  1.00 42.10 ? 92   GLN A CB    1 
ATOM   753  C  CG    . GLN A 1 91  ? 32.676 -13.047 21.171  1.00 47.16 ? 92   GLN A CG    1 
ATOM   754  C  CD    . GLN A 1 91  ? 33.873 -13.056 22.101  1.00 46.99 ? 92   GLN A CD    1 
ATOM   755  O  OE1   . GLN A 1 91  ? 33.722 -13.312 23.289  1.00 60.78 ? 92   GLN A OE1   1 
ATOM   756  N  NE2   . GLN A 1 91  ? 35.073 -12.835 21.564  1.00 50.90 ? 92   GLN A NE2   1 
ATOM   757  N  N     . PRO A 1 92  ? 34.378 -9.771  21.736  1.00 40.85 ? 93   PRO A N     1 
ATOM   758  C  CA    . PRO A 1 92  ? 35.065 -9.444  23.005  1.00 41.68 ? 93   PRO A CA    1 
ATOM   759  C  C     . PRO A 1 92  ? 34.449 -8.286  23.766  1.00 42.04 ? 93   PRO A C     1 
ATOM   760  O  O     . PRO A 1 92  ? 34.659 -8.180  24.971  1.00 39.49 ? 93   PRO A O     1 
ATOM   761  C  CB    . PRO A 1 92  ? 36.484 -9.036  22.581  1.00 42.21 ? 93   PRO A CB    1 
ATOM   762  C  CG    . PRO A 1 92  ? 36.664 -9.686  21.259  1.00 43.59 ? 93   PRO A CG    1 
ATOM   763  C  CD    . PRO A 1 92  ? 35.300 -9.703  20.591  1.00 42.11 ? 93   PRO A CD    1 
ATOM   764  N  N     . PHE A 1 93  ? 33.735 -7.421  23.052  1.00 36.87 ? 94   PHE A N     1 
ATOM   765  C  CA    . PHE A 1 93  ? 33.260 -6.164  23.603  1.00 36.51 ? 94   PHE A CA    1 
ATOM   766  C  C     . PHE A 1 93  ? 31.795 -6.244  24.023  1.00 33.39 ? 94   PHE A C     1 
ATOM   767  O  O     . PHE A 1 93  ? 31.295 -5.376  24.721  1.00 30.68 ? 94   PHE A O     1 
ATOM   768  C  CB    . PHE A 1 93  ? 33.430 -5.058  22.584  1.00 36.85 ? 94   PHE A CB    1 
ATOM   769  C  CG    . PHE A 1 93  ? 34.867 -4.823  22.217  1.00 37.50 ? 94   PHE A CG    1 
ATOM   770  C  CD1   . PHE A 1 93  ? 35.715 -4.156  23.088  1.00 43.24 ? 94   PHE A CD1   1 
ATOM   771  C  CD2   . PHE A 1 93  ? 35.374 -5.304  21.022  1.00 39.88 ? 94   PHE A CD2   1 
ATOM   772  C  CE1   . PHE A 1 93  ? 37.063 -3.949  22.759  1.00 49.50 ? 94   PHE A CE1   1 
ATOM   773  C  CE2   . PHE A 1 93  ? 36.721 -5.082  20.668  1.00 42.37 ? 94   PHE A CE2   1 
ATOM   774  C  CZ    . PHE A 1 93  ? 37.561 -4.405  21.552  1.00 45.18 ? 94   PHE A CZ    1 
ATOM   775  N  N     . LEU A 1 94  ? 31.110 -7.289  23.596  1.00 34.26 ? 95   LEU A N     1 
ATOM   776  C  CA    . LEU A 1 94  ? 29.734 -7.472  23.989  1.00 31.35 ? 95   LEU A CA    1 
ATOM   777  C  C     . LEU A 1 94  ? 29.557 -7.846  25.452  1.00 34.73 ? 95   LEU A C     1 
ATOM   778  O  O     . LEU A 1 94  ? 30.343 -8.599  25.985  1.00 34.02 ? 95   LEU A O     1 
ATOM   779  C  CB    . LEU A 1 94  ? 29.065 -8.526  23.092  1.00 31.03 ? 95   LEU A CB    1 
ATOM   780  C  CG    . LEU A 1 94  ? 28.829 -8.121  21.626  1.00 28.09 ? 95   LEU A CG    1 
ATOM   781  C  CD1   . LEU A 1 94  ? 28.466 -9.386  20.778  1.00 30.30 ? 95   LEU A CD1   1 
ATOM   782  C  CD2   . LEU A 1 94  ? 27.736 -7.049  21.536  1.00 31.01 ? 95   LEU A CD2   1 
ATOM   783  N  N     . LYS A 1 95  ? 28.495 -7.362  26.094  1.00 33.10 ? 96   LYS A N     1 
ATOM   784  C  CA    . LYS A 1 95  ? 28.200 -7.731  27.482  1.00 33.75 ? 96   LYS A CA    1 
ATOM   785  C  C     . LYS A 1 95  ? 26.856 -8.428  27.668  1.00 35.57 ? 96   LYS A C     1 
ATOM   786  O  O     . LYS A 1 95  ? 26.741 -9.262  28.563  1.00 40.41 ? 96   LYS A O     1 
ATOM   787  C  CB    . LYS A 1 95  ? 28.202 -6.511  28.403  1.00 32.61 ? 96   LYS A CB    1 
ATOM   788  C  CG    . LYS A 1 95  ? 29.531 -5.805  28.526  1.00 37.07 ? 96   LYS A CG    1 
ATOM   789  C  CD    . LYS A 1 95  ? 29.308 -4.594  29.407  1.00 38.24 ? 96   LYS A CD    1 
ATOM   790  C  CE    . LYS A 1 95  ? 30.358 -3.536  29.129  1.00 42.07 ? 96   LYS A CE    1 
ATOM   791  N  NZ    . LYS A 1 95  ? 31.709 -4.031  29.542  1.00 40.97 ? 96   LYS A NZ    1 
ATOM   792  N  N     . LEU A 1 96  ? 25.828 -8.088  26.886  1.00 33.02 ? 97   LEU A N     1 
ATOM   793  C  CA    . LEU A 1 96  ? 24.561 -8.839  26.982  1.00 33.25 ? 97   LEU A CA    1 
ATOM   794  C  C     . LEU A 1 96  ? 24.481 -9.936  25.922  1.00 33.70 ? 97   LEU A C     1 
ATOM   795  O  O     . LEU A 1 96  ? 23.796 -10.931 26.125  1.00 34.15 ? 97   LEU A O     1 
ATOM   796  C  CB    . LEU A 1 96  ? 23.330 -7.926  26.822  1.00 29.49 ? 97   LEU A CB    1 
ATOM   797  C  CG    . LEU A 1 96  ? 23.227 -6.854  27.907  1.00 30.44 ? 97   LEU A CG    1 
ATOM   798  C  CD1   . LEU A 1 96  ? 21.989 -5.945  27.727  1.00 26.59 ? 97   LEU A CD1   1 
ATOM   799  C  CD2   . LEU A 1 96  ? 23.268 -7.455  29.334  1.00 32.96 ? 97   LEU A CD2   1 
ATOM   800  N  N     . LYS A 1 97  ? 25.148 -9.763  24.779  1.00 29.77 ? 98   LYS A N     1 
ATOM   801  C  CA    . LYS A 1 97  ? 24.921 -10.701 23.675  1.00 30.10 ? 98   LYS A CA    1 
ATOM   802  C  C     . LYS A 1 97  ? 26.195 -11.473 23.300  1.00 31.83 ? 98   LYS A C     1 
ATOM   803  O  O     . LYS A 1 97  ? 26.286 -12.105 22.243  1.00 27.85 ? 98   LYS A O     1 
ATOM   804  C  CB    . LYS A 1 97  ? 24.279 -9.970  22.479  1.00 32.24 ? 98   LYS A CB    1 
ATOM   805  C  CG    . LYS A 1 97  ? 22.878 -9.368  22.908  1.00 26.38 ? 98   LYS A CG    1 
ATOM   806  C  CD    . LYS A 1 97  ? 22.310 -8.414  21.849  1.00 32.46 ? 98   LYS A CD    1 
ATOM   807  C  CE    . LYS A 1 97  ? 20.990 -7.757  22.361  1.00 32.12 ? 98   LYS A CE    1 
ATOM   808  N  NZ    . LYS A 1 97  ? 19.872 -8.649  22.033  1.00 41.82 ? 98   LYS A NZ    1 
ATOM   809  N  N     . GLN A 1 98  ? 27.150 -11.471 24.215  1.00 29.98 ? 99   GLN A N     1 
ATOM   810  C  CA    . GLN A 1 98  ? 28.410 -12.172 23.980  1.00 33.31 ? 99   GLN A CA    1 
ATOM   811  C  C     . GLN A 1 98  ? 28.238 -13.686 23.793  1.00 34.76 ? 99   GLN A C     1 
ATOM   812  O  O     . GLN A 1 98  ? 28.818 -14.293 22.874  1.00 32.08 ? 99   GLN A O     1 
ATOM   813  C  CB    . GLN A 1 98  ? 29.382 -11.890 25.120  1.00 35.01 ? 99   GLN A CB    1 
ATOM   814  C  CG    . GLN A 1 98  ? 30.842 -12.128 24.704  1.00 39.49 ? 99   GLN A CG    1 
ATOM   815  C  CD    . GLN A 1 98  ? 31.800 -11.806 25.807  1.00 43.97 ? 99   GLN A CD    1 
ATOM   816  O  OE1   . GLN A 1 98  ? 31.725 -12.401 26.886  1.00 52.73 ? 99   GLN A OE1   1 
ATOM   817  N  NE2   . GLN A 1 98  ? 32.702 -10.853 25.563  1.00 41.11 ? 99   GLN A NE2   1 
ATOM   818  N  N     . LYS A 1 99  ? 27.416 -14.310 24.628  1.00 33.42 ? 100  LYS A N     1 
ATOM   819  C  CA    . LYS A 1 99  ? 27.212 -15.746 24.468  1.00 33.73 ? 100  LYS A CA    1 
ATOM   820  C  C     . LYS A 1 99  ? 26.535 -16.091 23.172  1.00 35.43 ? 100  LYS A C     1 
ATOM   821  O  O     . LYS A 1 99  ? 26.905 -17.099 22.569  1.00 36.74 ? 100  LYS A O     1 
ATOM   822  C  CB    . LYS A 1 99  ? 26.392 -16.303 25.623  1.00 34.45 ? 100  LYS A CB    1 
ATOM   823  C  CG    . LYS A 1 99  ? 27.169 -16.301 26.968  1.00 38.24 ? 100  LYS A CG    1 
ATOM   824  C  CD    . LYS A 1 99  ? 26.353 -17.093 27.981  1.00 44.93 ? 100  LYS A CD    1 
ATOM   825  C  CE    . LYS A 1 99  ? 26.680 -16.665 29.381  1.00 48.28 ? 100  LYS A CE    1 
ATOM   826  N  NZ    . LYS A 1 99  ? 25.589 -17.129 30.289  1.00 57.23 ? 100  LYS A NZ    1 
ATOM   827  N  N     . GLN A 1 100 ? 25.550 -15.294 22.756  1.00 31.42 ? 101  GLN A N     1 
ATOM   828  C  CA    . GLN A 1 100 ? 24.845 -15.538 21.504  1.00 33.67 ? 101  GLN A CA    1 
ATOM   829  C  C     . GLN A 1 100 ? 25.856 -15.427 20.359  1.00 34.15 ? 101  GLN A C     1 
ATOM   830  O  O     . GLN A 1 100 ? 25.890 -16.295 19.486  1.00 32.14 ? 101  GLN A O     1 
ATOM   831  C  CB    . GLN A 1 100 ? 23.701 -14.514 21.277  1.00 31.79 ? 101  GLN A CB    1 
ATOM   832  C  CG    . GLN A 1 100 ? 22.488 -14.690 22.204  1.00 32.62 ? 101  GLN A CG    1 
ATOM   833  C  CD    . GLN A 1 100 ? 22.559 -13.753 23.403  1.00 33.14 ? 101  GLN A CD    1 
ATOM   834  O  OE1   . GLN A 1 100 ? 23.608 -13.657 24.059  1.00 32.29 ? 101  GLN A OE1   1 
ATOM   835  N  NE2   . GLN A 1 100 ? 21.442 -13.069 23.710  1.00 31.17 ? 101  GLN A NE2   1 
ATOM   836  N  N     . ALA A 1 101 ? 26.651 -14.352 20.360  1.00 32.41 ? 102  ALA A N     1 
ATOM   837  C  CA    . ALA A 1 101 ? 27.724 -14.190 19.368  1.00 36.80 ? 102  ALA A CA    1 
ATOM   838  C  C     . ALA A 1 101 ? 28.614 -15.434 19.304  1.00 37.14 ? 102  ALA A C     1 
ATOM   839  O  O     . ALA A 1 101 ? 28.871 -15.963 18.232  1.00 35.54 ? 102  ALA A O     1 
ATOM   840  C  CB    . ALA A 1 101 ? 28.573 -12.968 19.670  1.00 32.92 ? 102  ALA A CB    1 
ATOM   841  N  N     . ASN A 1 102 ? 29.089 -15.917 20.449  1.00 41.00 ? 103  ASN A N     1 
ATOM   842  C  CA    . ASN A 1 102 ? 29.947 -17.110 20.441  1.00 40.04 ? 103  ASN A CA    1 
ATOM   843  C  C     . ASN A 1 102 ? 29.257 -18.390 19.999  1.00 40.51 ? 103  ASN A C     1 
ATOM   844  O  O     . ASN A 1 102 ? 29.877 -19.197 19.301  1.00 39.47 ? 103  ASN A O     1 
ATOM   845  C  CB    . ASN A 1 102 ? 30.719 -17.277 21.741  1.00 41.76 ? 103  ASN A CB    1 
ATOM   846  C  CG    . ASN A 1 102 ? 31.738 -16.163 21.938  1.00 50.51 ? 103  ASN A CG    1 
ATOM   847  O  OD1   . ASN A 1 102 ? 32.422 -15.743 20.996  1.00 51.93 ? 103  ASN A OD1   1 
ATOM   848  N  ND2   . ASN A 1 102 ? 31.835 -15.668 23.159  1.00 55.38 ? 103  ASN A ND2   1 
ATOM   849  N  N     . LEU A 1 103 ? 27.975 -18.565 20.325  1.00 37.75 ? 104  LEU A N     1 
ATOM   850  C  CA    . LEU A 1 103 ? 27.204 -19.666 19.730  1.00 37.34 ? 104  LEU A CA    1 
ATOM   851  C  C     . LEU A 1 103 ? 27.086 -19.623 18.197  1.00 38.89 ? 104  LEU A C     1 
ATOM   852  O  O     . LEU A 1 103 ? 27.188 -20.660 17.516  1.00 38.50 ? 104  LEU A O     1 
ATOM   853  C  CB    . LEU A 1 103 ? 25.835 -19.791 20.386  1.00 37.44 ? 104  LEU A CB    1 
ATOM   854  C  CG    . LEU A 1 103 ? 25.937 -20.425 21.781  1.00 40.80 ? 104  LEU A CG    1 
ATOM   855  C  CD1   . LEU A 1 103 ? 24.741 -20.090 22.668  1.00 32.66 ? 104  LEU A CD1   1 
ATOM   856  C  CD2   . LEU A 1 103 ? 26.078 -21.946 21.646  1.00 34.03 ? 104  LEU A CD2   1 
ATOM   857  N  N     . VAL A 1 104 ? 26.906 -18.422 17.643  1.00 36.93 ? 105  VAL A N     1 
ATOM   858  C  CA    . VAL A 1 104 ? 26.777 -18.287 16.197  1.00 36.47 ? 105  VAL A CA    1 
ATOM   859  C  C     . VAL A 1 104 ? 28.133 -18.693 15.601  1.00 37.53 ? 105  VAL A C     1 
ATOM   860  O  O     . VAL A 1 104 ? 28.185 -19.426 14.611  1.00 38.71 ? 105  VAL A O     1 
ATOM   861  C  CB    . VAL A 1 104 ? 26.421 -16.839 15.828  1.00 33.20 ? 105  VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 104 ? 26.611 -16.602 14.312  1.00 35.91 ? 105  VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 104 ? 24.959 -16.579 16.221  1.00 31.46 ? 105  VAL A CG2   1 
ATOM   864  N  N     . LEU A 1 105 ? 29.221 -18.247 16.227  1.00 36.69 ? 106  LEU A N     1 
ATOM   865  C  CA    . LEU A 1 105 ? 30.567 -18.521 15.701  1.00 39.88 ? 106  LEU A CA    1 
ATOM   866  C  C     . LEU A 1 105 ? 30.778 -20.025 15.743  1.00 41.84 ? 106  LEU A C     1 
ATOM   867  O  O     . LEU A 1 105 ? 31.285 -20.626 14.791  1.00 44.45 ? 106  LEU A O     1 
ATOM   868  C  CB    . LEU A 1 105 ? 31.653 -17.820 16.529  1.00 37.05 ? 106  LEU A CB    1 
ATOM   869  C  CG    . LEU A 1 105 ? 31.727 -16.283 16.354  1.00 37.18 ? 106  LEU A CG    1 
ATOM   870  C  CD1   . LEU A 1 105 ? 32.740 -15.639 17.272  1.00 39.73 ? 106  LEU A CD1   1 
ATOM   871  C  CD2   . LEU A 1 105 ? 32.036 -15.860 14.937  1.00 37.11 ? 106  LEU A CD2   1 
ATOM   872  N  N     . LYS A 1 106 ? 30.354 -20.635 16.838  1.00 39.64 ? 107  LYS A N     1 
ATOM   873  C  CA    . LYS A 1 106 ? 30.501 -22.078 17.022  1.00 43.32 ? 107  LYS A CA    1 
ATOM   874  C  C     . LYS A 1 106 ? 29.738 -22.866 15.956  1.00 44.42 ? 107  LYS A C     1 
ATOM   875  O  O     . LYS A 1 106 ? 30.293 -23.808 15.372  1.00 42.70 ? 107  LYS A O     1 
ATOM   876  C  CB    . LYS A 1 106 ? 30.054 -22.461 18.429  1.00 39.75 ? 107  LYS A CB    1 
ATOM   877  C  CG    . LYS A 1 106 ? 30.291 -23.926 18.808  1.00 49.58 ? 107  LYS A CG    1 
ATOM   878  C  CD    . LYS A 1 106 ? 29.695 -24.204 20.185  1.00 59.35 ? 107  LYS A CD    1 
ATOM   879  C  CE    . LYS A 1 106 ? 29.636 -25.690 20.496  1.00 65.77 ? 107  LYS A CE    1 
ATOM   880  N  NZ    . LYS A 1 106 ? 29.030 -25.875 21.845  1.00 73.99 ? 107  LYS A NZ    1 
ATOM   881  N  N     . ILE A 1 107 ? 28.493 -22.464 15.687  1.00 40.74 ? 108  ILE A N     1 
ATOM   882  C  CA    . ILE A 1 107 ? 27.645 -23.072 14.670  1.00 41.37 ? 108  ILE A CA    1 
ATOM   883  C  C     . ILE A 1 107 ? 28.282 -22.944 13.290  1.00 44.51 ? 108  ILE A C     1 
ATOM   884  O  O     . ILE A 1 107 ? 28.381 -23.921 12.549  1.00 44.46 ? 108  ILE A O     1 
ATOM   885  C  CB    . ILE A 1 107 ? 26.246 -22.374 14.623  1.00 42.36 ? 108  ILE A CB    1 
ATOM   886  C  CG1   . ILE A 1 107 ? 25.447 -22.673 15.899  1.00 37.27 ? 108  ILE A CG1   1 
ATOM   887  C  CG2   . ILE A 1 107 ? 25.495 -22.775 13.346  1.00 42.18 ? 108  ILE A CG2   1 
ATOM   888  C  CD1   . ILE A 1 107 ? 24.256 -21.755 16.173  1.00 42.37 ? 108  ILE A CD1   1 
ATOM   889  N  N     . THR A 1 108 ? 28.708 -21.723 12.960  1.00 46.07 ? 109  THR A N     1 
ATOM   890  C  CA    . THR A 1 108 ? 29.323 -21.404 11.686  1.00 49.59 ? 109  THR A CA    1 
ATOM   891  C  C     . THR A 1 108 ? 30.503 -22.368 11.436  1.00 53.95 ? 109  THR A C     1 
ATOM   892  O  O     . THR A 1 108 ? 30.643 -22.948 10.349  1.00 52.41 ? 109  THR A O     1 
ATOM   893  C  CB    . THR A 1 108 ? 29.841 -19.956 11.748  1.00 48.72 ? 109  THR A CB    1 
ATOM   894  O  OG1   . THR A 1 108 ? 28.722 -19.059 11.769  1.00 49.21 ? 109  THR A OG1   1 
ATOM   895  C  CG2   . THR A 1 108 ? 30.723 -19.643 10.558  1.00 54.39 ? 109  THR A CG2   1 
ATOM   896  N  N     . GLU A 1 109 ? 31.330 -22.546 12.462  1.00 57.04 ? 110  GLU A N     1 
ATOM   897  C  CA    . GLU A 1 109 ? 32.504 -23.406 12.379  1.00 63.72 ? 110  GLU A CA    1 
ATOM   898  C  C     . GLU A 1 109 ? 32.133 -24.864 12.097  1.00 61.25 ? 110  GLU A C     1 
ATOM   899  O  O     . GLU A 1 109 ? 32.867 -25.571 11.410  1.00 62.08 ? 110  GLU A O     1 
ATOM   900  C  CB    . GLU A 1 109 ? 33.393 -23.230 13.621  1.00 62.74 ? 110  GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 109 ? 34.290 -24.408 13.976  1.00 71.35 ? 110  GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 109 ? 34.996 -24.244 15.336  1.00 71.66 ? 110  GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 109 ? 36.232 -24.472 15.404  1.00 83.59 ? 110  GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 109 ? 34.321 -23.894 16.341  1.00 80.68 ? 110  GLU A OE2   1 
ATOM   905  N  N     . GLN A 1 110 ? 30.975 -25.306 12.568  1.00 58.95 ? 111  GLN A N     1 
ATOM   906  C  CA    . GLN A 1 110 ? 30.556 -26.689 12.353  1.00 60.11 ? 111  GLN A CA    1 
ATOM   907  C  C     . GLN A 1 110 ? 29.697 -26.895 11.111  1.00 61.27 ? 111  GLN A C     1 
ATOM   908  O  O     . GLN A 1 110 ? 29.347 -28.031 10.775  1.00 63.36 ? 111  GLN A O     1 
ATOM   909  C  CB    . GLN A 1 110 ? 29.820 -27.252 13.576  1.00 58.88 ? 111  GLN A CB    1 
ATOM   910  C  CG    . GLN A 1 110 ? 30.669 -27.371 14.828  1.00 59.11 ? 111  GLN A CG    1 
ATOM   911  C  CD    . GLN A 1 110 ? 31.920 -28.214 14.631  1.00 61.93 ? 111  GLN A CD    1 
ATOM   912  O  OE1   . GLN A 1 110 ? 31.917 -29.210 13.900  1.00 67.79 ? 111  GLN A OE1   1 
ATOM   913  N  NE2   . GLN A 1 110 ? 33.000 -27.811 15.278  1.00 61.78 ? 111  GLN A NE2   1 
ATOM   914  N  N     . LEU A 1 111 ? 29.316 -25.816 10.437  1.00 61.65 ? 112  LEU A N     1 
ATOM   915  C  CA    . LEU A 1 111 ? 28.245 -25.952 9.464   1.00 62.66 ? 112  LEU A CA    1 
ATOM   916  C  C     . LEU A 1 111 ? 28.678 -27.040 8.504   1.00 66.51 ? 112  LEU A C     1 
ATOM   917  O  O     . LEU A 1 111 ? 27.921 -27.979 8.261   1.00 65.60 ? 112  LEU A O     1 
ATOM   918  C  CB    . LEU A 1 111 ? 27.955 -24.651 8.711   1.00 60.54 ? 112  LEU A CB    1 
ATOM   919  C  CG    . LEU A 1 111 ? 27.057 -23.673 9.478   1.00 55.83 ? 112  LEU A CG    1 
ATOM   920  C  CD1   . LEU A 1 111 ? 26.940 -22.348 8.767   1.00 52.58 ? 112  LEU A CD1   1 
ATOM   921  C  CD2   . LEU A 1 111 ? 25.695 -24.276 9.785   1.00 46.70 ? 112  LEU A CD2   1 
ATOM   922  N  N     . PRO A 1 112 ? 29.911 -26.932 7.983   1.00 69.34 ? 113  PRO A N     1 
ATOM   923  C  CA    . PRO A 1 112 ? 30.341 -27.860 6.939   1.00 71.99 ? 113  PRO A CA    1 
ATOM   924  C  C     . PRO A 1 112 ? 30.042 -29.309 7.313   1.00 72.82 ? 113  PRO A C     1 
ATOM   925  O  O     . PRO A 1 112 ? 29.351 -30.000 6.559   1.00 72.82 ? 113  PRO A O     1 
ATOM   926  C  CB    . PRO A 1 112 ? 31.849 -27.605 6.846   1.00 72.93 ? 113  PRO A CB    1 
ATOM   927  C  CG    . PRO A 1 112 ? 31.978 -26.158 7.211   1.00 72.13 ? 113  PRO A CG    1 
ATOM   928  C  CD    . PRO A 1 112 ? 30.968 -25.966 8.325   1.00 69.55 ? 113  PRO A CD    1 
ATOM   929  N  N     . SER A 1 113 ? 30.521 -29.754 8.475   1.00 74.54 ? 114  SER A N     1 
ATOM   930  C  CA    . SER A 1 113 ? 30.238 -31.121 8.922   1.00 76.43 ? 114  SER A CA    1 
ATOM   931  C  C     . SER A 1 113 ? 28.808 -31.387 9.382   1.00 78.18 ? 114  SER A C     1 
ATOM   932  O  O     . SER A 1 113 ? 28.446 -32.537 9.620   1.00 78.64 ? 114  SER A O     1 
ATOM   933  C  CB    . SER A 1 113 ? 31.243 -31.608 9.968   1.00 76.76 ? 114  SER A CB    1 
ATOM   934  O  OG    . SER A 1 113 ? 31.636 -30.558 10.828  1.00 77.06 ? 114  SER A OG    1 
ATOM   935  N  N     . ALA A 1 114 ? 27.999 -30.337 9.490   1.00 78.29 ? 115  ALA A N     1 
ATOM   936  C  CA    . ALA A 1 114 ? 26.598 -30.465 9.871   1.00 79.17 ? 115  ALA A CA    1 
ATOM   937  C  C     . ALA A 1 114 ? 25.794 -31.067 8.722   1.00 81.07 ? 115  ALA A C     1 
ATOM   938  O  O     . ALA A 1 114 ? 24.874 -31.856 8.923   1.00 80.87 ? 115  ALA A O     1 
ATOM   939  C  CB    . ALA A 1 114 ? 26.039 -29.091 10.236  1.00 78.88 ? 115  ALA A CB    1 
ATOM   940  N  N     . LYS A 1 115 ? 26.142 -30.670 7.503   1.00 84.71 ? 116  LYS A N     1 
ATOM   941  C  CA    . LYS A 1 115 ? 25.369 -31.042 6.321   1.00 86.94 ? 116  LYS A CA    1 
ATOM   942  C  C     . LYS A 1 115 ? 25.817 -32.415 5.795   1.00 88.13 ? 116  LYS A C     1 
ATOM   943  O  O     . LYS A 1 115 ? 25.900 -32.633 4.580   1.00 88.76 ? 116  LYS A O     1 
ATOM   944  C  CB    . LYS A 1 115 ? 25.509 -29.956 5.243   1.00 86.61 ? 116  LYS A CB    1 
ATOM   945  N  N     . GLU A 1 116 ? 26.096 -33.335 6.722   1.00 88.51 ? 117  GLU A N     1 
ATOM   946  C  CA    . GLU A 1 116 ? 26.766 -34.597 6.400   1.00 88.07 ? 117  GLU A CA    1 
ATOM   947  C  C     . GLU A 1 116 ? 26.404 -35.719 7.372   1.00 87.42 ? 117  GLU A C     1 
ATOM   948  O  O     . GLU A 1 116 ? 26.830 -36.861 7.199   1.00 87.60 ? 117  GLU A O     1 
ATOM   949  C  CB    . GLU A 1 116 ? 28.292 -34.407 6.346   1.00 88.19 ? 117  GLU A CB    1 
ATOM   950  N  N     . SER A 1 117 ? 25.624 -35.401 8.399   1.00 86.12 ? 118  SER A N     1 
ATOM   951  C  CA    . SER A 1 117 ? 25.042 -36.440 9.248   1.00 85.46 ? 118  SER A CA    1 
ATOM   952  C  C     . SER A 1 117 ? 23.838 -35.950 10.031  1.00 84.46 ? 118  SER A C     1 
ATOM   953  O  O     . SER A 1 117 ? 23.839 -34.832 10.554  1.00 82.90 ? 118  SER A O     1 
ATOM   954  C  CB    . SER A 1 117 ? 26.073 -37.037 10.217  1.00 86.16 ? 118  SER A CB    1 
ATOM   955  O  OG    . SER A 1 117 ? 27.056 -36.083 10.602  1.00 88.29 ? 118  SER A OG    1 
ATOM   956  N  N     . PRO A 1 118 ? 22.814 -36.807 10.143  1.00 84.51 ? 119  PRO A N     1 
ATOM   957  C  CA    . PRO A 1 118 ? 21.872 -36.625 11.236  1.00 84.63 ? 119  PRO A CA    1 
ATOM   958  C  C     . PRO A 1 118 ? 22.660 -36.803 12.530  1.00 84.00 ? 119  PRO A C     1 
ATOM   959  O  O     . PRO A 1 118 ? 23.833 -37.196 12.485  1.00 86.24 ? 119  PRO A O     1 
ATOM   960  C  CB    . PRO A 1 118 ? 20.886 -37.786 11.051  1.00 84.64 ? 119  PRO A CB    1 
ATOM   961  C  CG    . PRO A 1 118 ? 21.058 -38.234 9.643   1.00 83.12 ? 119  PRO A CG    1 
ATOM   962  C  CD    . PRO A 1 118 ? 22.496 -37.988 9.325   1.00 84.04 ? 119  PRO A CD    1 
ATOM   963  N  N     . ASP A 1 119 ? 22.031 -36.512 13.663  1.00 81.32 ? 120  ASP A N     1 
ATOM   964  C  CA    . ASP A 1 119 ? 22.715 -36.556 14.955  1.00 77.23 ? 120  ASP A CA    1 
ATOM   965  C  C     . ASP A 1 119 ? 23.624 -35.351 15.181  1.00 72.61 ? 120  ASP A C     1 
ATOM   966  O  O     . ASP A 1 119 ? 23.650 -34.798 16.278  1.00 67.29 ? 120  ASP A O     1 
ATOM   967  C  CB    . ASP A 1 119 ? 23.507 -37.858 15.132  1.00 79.75 ? 120  ASP A CB    1 
ATOM   968  C  CG    . ASP A 1 119 ? 22.609 -39.069 15.326  1.00 82.96 ? 120  ASP A CG    1 
ATOM   969  O  OD1   . ASP A 1 119 ? 21.791 -39.070 16.275  1.00 85.84 ? 120  ASP A OD1   1 
ATOM   970  O  OD2   . ASP A 1 119 ? 22.727 -40.018 14.522  1.00 85.84 ? 120  ASP A OD2   1 
ATOM   971  N  N     . LYS A 1 120 ? 24.374 -34.964 14.153  1.00 68.26 ? 121  LYS A N     1 
ATOM   972  C  CA    . LYS A 1 120 ? 25.206 -33.775 14.242  1.00 66.88 ? 121  LYS A CA    1 
ATOM   973  C  C     . LYS A 1 120 ? 24.528 -32.516 13.680  1.00 64.94 ? 121  LYS A C     1 
ATOM   974  O  O     . LYS A 1 120 ? 24.808 -31.412 14.146  1.00 63.92 ? 121  LYS A O     1 
ATOM   975  C  CB    . LYS A 1 120 ? 26.567 -33.995 13.583  1.00 66.93 ? 121  LYS A CB    1 
ATOM   976  C  CG    . LYS A 1 120 ? 27.307 -32.709 13.254  1.00 67.98 ? 121  LYS A CG    1 
ATOM   977  C  CD    . LYS A 1 120 ? 28.009 -32.143 14.483  1.00 70.61 ? 121  LYS A CD    1 
ATOM   978  C  CE    . LYS A 1 120 ? 29.290 -31.413 14.099  1.00 70.34 ? 121  LYS A CE    1 
ATOM   979  N  NZ    . LYS A 1 120 ? 30.346 -31.625 15.127  1.00 72.11 ? 121  LYS A NZ    1 
ATOM   980  N  N     . PHE A 1 121 ? 23.642 -32.664 12.696  1.00 62.36 ? 122  PHE A N     1 
ATOM   981  C  CA    . PHE A 1 121 ? 22.741 -31.562 12.370  1.00 59.87 ? 122  PHE A CA    1 
ATOM   982  C  C     . PHE A 1 121 ? 21.854 -31.245 13.575  1.00 59.83 ? 122  PHE A C     1 
ATOM   983  O  O     . PHE A 1 121 ? 21.685 -30.074 13.943  1.00 60.13 ? 122  PHE A O     1 
ATOM   984  C  CB    . PHE A 1 121 ? 21.897 -31.870 11.135  1.00 58.34 ? 122  PHE A CB    1 
ATOM   985  C  CG    . PHE A 1 121 ? 20.964 -30.764 10.749  1.00 54.58 ? 122  PHE A CG    1 
ATOM   986  C  CD1   . PHE A 1 121 ? 21.440 -29.623 10.121  1.00 52.04 ? 122  PHE A CD1   1 
ATOM   987  C  CD2   . PHE A 1 121 ? 19.604 -30.864 10.998  1.00 51.04 ? 122  PHE A CD2   1 
ATOM   988  C  CE1   . PHE A 1 121 ? 20.570 -28.601 9.749   1.00 49.84 ? 122  PHE A CE1   1 
ATOM   989  C  CE2   . PHE A 1 121 ? 18.732 -29.841 10.627  1.00 47.91 ? 122  PHE A CE2   1 
ATOM   990  C  CZ    . PHE A 1 121 ? 19.228 -28.700 10.007  1.00 48.23 ? 122  PHE A CZ    1 
ATOM   991  N  N     . LEU A 1 122 ? 21.319 -32.291 14.203  1.00 56.52 ? 123  LEU A N     1 
ATOM   992  C  CA    . LEU A 1 122 ? 20.483 -32.148 15.392  1.00 57.04 ? 123  LEU A CA    1 
ATOM   993  C  C     . LEU A 1 122 ? 21.294 -31.501 16.512  1.00 54.61 ? 123  LEU A C     1 
ATOM   994  O  O     . LEU A 1 122 ? 20.776 -30.725 17.320  1.00 53.04 ? 123  LEU A O     1 
ATOM   995  C  CB    . LEU A 1 122 ? 19.978 -33.522 15.843  1.00 58.05 ? 123  LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 122 ? 18.490 -33.750 16.095  1.00 64.99 ? 123  LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 122 ? 18.167 -33.625 17.572  1.00 72.71 ? 123  LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 122 ? 17.602 -32.833 15.276  1.00 68.46 ? 123  LEU A CD2   1 
ATOM   999  N  N     . GLU A 1 123 ? 22.579 -31.820 16.566  1.00 51.72 ? 124  GLU A N     1 
ATOM   1000 C  CA    . GLU A 1 123 ? 23.402 -31.259 17.626  1.00 51.32 ? 124  GLU A CA    1 
ATOM   1001 C  C     . GLU A 1 123 ? 23.509 -29.744 17.446  1.00 50.89 ? 124  GLU A C     1 
ATOM   1002 O  O     . GLU A 1 123 ? 23.442 -28.967 18.402  1.00 51.42 ? 124  GLU A O     1 
ATOM   1003 C  CB    . GLU A 1 123 ? 24.816 -31.822 17.580  1.00 51.09 ? 124  GLU A CB    1 
ATOM   1004 C  CG    . GLU A 1 123 ? 25.627 -31.306 18.754  1.00 54.71 ? 124  GLU A CG    1 
ATOM   1005 C  CD    . GLU A 1 123 ? 27.054 -31.814 18.791  1.00 65.41 ? 124  GLU A CD    1 
ATOM   1006 O  OE1   . GLU A 1 123 ? 27.478 -32.462 17.807  1.00 69.15 ? 124  GLU A OE1   1 
ATOM   1007 O  OE2   . GLU A 1 123 ? 27.747 -31.559 19.810  1.00 68.57 ? 124  GLU A OE2   1 
ATOM   1008 N  N     . VAL A 1 124 ? 23.729 -29.334 16.203  1.00 50.32 ? 125  VAL A N     1 
ATOM   1009 C  CA    . VAL A 1 124 ? 23.880 -27.918 15.901  1.00 46.98 ? 125  VAL A CA    1 
ATOM   1010 C  C     . VAL A 1 124 ? 22.571 -27.211 16.235  1.00 43.88 ? 125  VAL A C     1 
ATOM   1011 O  O     . VAL A 1 124 ? 22.590 -26.091 16.761  1.00 43.36 ? 125  VAL A O     1 
ATOM   1012 C  CB    . VAL A 1 124 ? 24.330 -27.740 14.439  1.00 48.74 ? 125  VAL A CB    1 
ATOM   1013 C  CG1   . VAL A 1 124 ? 24.403 -26.276 14.077  1.00 45.82 ? 125  VAL A CG1   1 
ATOM   1014 C  CG2   . VAL A 1 124 ? 25.702 -28.389 14.263  1.00 49.20 ? 125  VAL A CG2   1 
ATOM   1015 N  N     . CYS A 1 125 ? 21.445 -27.880 15.976  1.00 41.80 ? 126  CYS A N     1 
ATOM   1016 C  CA    . CYS A 1 125 ? 20.122 -27.343 16.278  1.00 43.60 ? 126  CYS A CA    1 
ATOM   1017 C  C     . CYS A 1 125 ? 19.892 -27.031 17.750  1.00 44.45 ? 126  CYS A C     1 
ATOM   1018 O  O     . CYS A 1 125 ? 19.184 -26.066 18.095  1.00 42.81 ? 126  CYS A O     1 
ATOM   1019 C  CB    . CYS A 1 125 ? 19.009 -28.234 15.731  1.00 43.13 ? 126  CYS A CB    1 
ATOM   1020 S  SG    . CYS A 1 125 ? 18.908 -28.192 13.933  1.00 43.46 ? 126  CYS A SG    1 
ATOM   1021 N  N     . THR A 1 126 ? 20.503 -27.828 18.625  1.00 44.72 ? 127  THR A N     1 
ATOM   1022 C  CA    . THR A 1 126 ? 20.440 -27.522 20.040  1.00 43.44 ? 127  THR A CA    1 
ATOM   1023 C  C     . THR A 1 126 ? 21.276 -26.299 20.354  1.00 45.04 ? 127  THR A C     1 
ATOM   1024 O  O     . THR A 1 126 ? 21.025 -25.626 21.361  1.00 45.13 ? 127  THR A O     1 
ATOM   1025 C  CB    . THR A 1 126 ? 20.861 -28.691 20.977  1.00 45.26 ? 127  THR A CB    1 
ATOM   1026 O  OG1   . THR A 1 126 ? 22.260 -28.988 20.819  1.00 45.29 ? 127  THR A OG1   1 
ATOM   1027 C  CG2   . THR A 1 126 ? 20.008 -29.934 20.729  1.00 42.80 ? 127  THR A CG2   1 
ATOM   1028 N  N     . TRP A 1 127 ? 22.257 -25.980 19.513  1.00 43.31 ? 128  TRP A N     1 
ATOM   1029 C  CA    . TRP A 1 127 ? 23.010 -24.761 19.790  1.00 42.68 ? 128  TRP A CA    1 
ATOM   1030 C  C     . TRP A 1 127 ? 22.197 -23.548 19.381  1.00 41.32 ? 128  TRP A C     1 
ATOM   1031 O  O     . TRP A 1 127 ? 22.261 -22.529 20.039  1.00 41.00 ? 128  TRP A O     1 
ATOM   1032 C  CB    . TRP A 1 127 ? 24.354 -24.722 19.095  1.00 46.19 ? 128  TRP A CB    1 
ATOM   1033 C  CG    . TRP A 1 127 ? 25.255 -25.868 19.421  1.00 47.74 ? 128  TRP A CG    1 
ATOM   1034 C  CD1   . TRP A 1 127 ? 25.138 -26.757 20.455  1.00 52.25 ? 128  TRP A CD1   1 
ATOM   1035 C  CD2   . TRP A 1 127 ? 26.412 -26.251 18.681  1.00 49.86 ? 128  TRP A CD2   1 
ATOM   1036 N  NE1   . TRP A 1 127 ? 26.163 -27.682 20.398  1.00 52.90 ? 128  TRP A NE1   1 
ATOM   1037 C  CE2   . TRP A 1 127 ? 26.957 -27.395 19.317  1.00 54.61 ? 128  TRP A CE2   1 
ATOM   1038 C  CE3   . TRP A 1 127 ? 27.044 -25.740 17.544  1.00 48.07 ? 128  TRP A CE3   1 
ATOM   1039 C  CZ2   . TRP A 1 127 ? 28.109 -28.033 18.850  1.00 53.56 ? 128  TRP A CZ2   1 
ATOM   1040 C  CZ3   . TRP A 1 127 ? 28.200 -26.378 17.076  1.00 52.74 ? 128  TRP A CZ3   1 
ATOM   1041 C  CH2   . TRP A 1 127 ? 28.716 -27.515 17.729  1.00 54.75 ? 128  TRP A CH2   1 
ATOM   1042 N  N     . VAL A 1 128 ? 21.413 -23.683 18.319  1.00 40.33 ? 129  VAL A N     1 
ATOM   1043 C  CA    . VAL A 1 128 ? 20.368 -22.707 17.984  1.00 37.85 ? 129  VAL A CA    1 
ATOM   1044 C  C     . VAL A 1 128 ? 19.350 -22.518 19.121  1.00 39.19 ? 129  VAL A C     1 
ATOM   1045 O  O     . VAL A 1 128 ? 19.024 -21.379 19.500  1.00 32.72 ? 129  VAL A O     1 
ATOM   1046 C  CB    . VAL A 1 128 ? 19.665 -23.095 16.661  1.00 38.10 ? 129  VAL A CB    1 
ATOM   1047 C  CG1   . VAL A 1 128 ? 18.561 -22.125 16.336  1.00 33.53 ? 129  VAL A CG1   1 
ATOM   1048 C  CG2   . VAL A 1 128 ? 20.680 -23.147 15.491  1.00 39.38 ? 129  VAL A CG2   1 
ATOM   1049 N  N     . ASP A 1 129 ? 18.863 -23.622 19.678  1.00 39.66 ? 130  ASP A N     1 
ATOM   1050 C  CA    . ASP A 1 129 ? 17.962 -23.577 20.854  1.00 40.83 ? 130  ASP A CA    1 
ATOM   1051 C  C     . ASP A 1 129 ? 18.507 -22.675 21.970  1.00 38.44 ? 130  ASP A C     1 
ATOM   1052 O  O     . ASP A 1 129 ? 17.769 -21.879 22.567  1.00 37.14 ? 130  ASP A O     1 
ATOM   1053 C  CB    . ASP A 1 129 ? 17.817 -24.972 21.486  1.00 41.08 ? 130  ASP A CB    1 
ATOM   1054 C  CG    . ASP A 1 129 ? 16.906 -25.924 20.711  1.00 44.64 ? 130  ASP A CG    1 
ATOM   1055 O  OD1   . ASP A 1 129 ? 16.159 -25.524 19.786  1.00 42.69 ? 130  ASP A OD1   1 
ATOM   1056 O  OD2   . ASP A 1 129 ? 16.915 -27.129 21.054  1.00 46.98 ? 130  ASP A OD2   1 
ATOM   1057 N  N     . GLN A 1 130 ? 19.776 -22.884 22.302  1.00 34.19 ? 131  GLN A N     1 
ATOM   1058 C  CA    . GLN A 1 130 ? 20.465 -22.138 23.338  1.00 36.28 ? 131  GLN A CA    1 
ATOM   1059 C  C     . GLN A 1 130 ? 20.562 -20.632 23.022  1.00 35.41 ? 131  GLN A C     1 
ATOM   1060 O  O     . GLN A 1 130 ? 20.501 -19.812 23.923  1.00 33.20 ? 131  GLN A O     1 
ATOM   1061 C  CB    . GLN A 1 130 ? 21.903 -22.628 23.444  1.00 34.38 ? 131  GLN A CB    1 
ATOM   1062 C  CG    . GLN A 1 130 ? 22.086 -23.896 24.272  1.00 45.70 ? 131  GLN A CG    1 
ATOM   1063 C  CD    . GLN A 1 130 ? 23.556 -24.135 24.571  1.00 52.08 ? 131  GLN A CD    1 
ATOM   1064 O  OE1   . GLN A 1 130 ? 24.224 -24.844 23.838  1.00 61.49 ? 131  GLN A OE1   1 
ATOM   1065 N  NE2   . GLN A 1 130 ? 24.069 -23.512 25.625  1.00 60.17 ? 131  GLN A NE2   1 
ATOM   1066 N  N     . ILE A 1 131 ? 20.772 -20.251 21.764  1.00 37.33 ? 132  ILE A N     1 
ATOM   1067 C  CA    . ILE A 1 131 ? 20.788 -18.822 21.433  1.00 33.58 ? 132  ILE A CA    1 
ATOM   1068 C  C     . ILE A 1 131 ? 19.394 -18.235 21.650  1.00 35.52 ? 132  ILE A C     1 
ATOM   1069 O  O     . ILE A 1 131 ? 19.260 -17.175 22.276  1.00 35.86 ? 132  ILE A O     1 
ATOM   1070 C  CB    . ILE A 1 131 ? 21.149 -18.592 19.966  1.00 34.10 ? 132  ILE A CB    1 
ATOM   1071 C  CG1   . ILE A 1 131 ? 22.610 -18.980 19.715  1.00 34.07 ? 132  ILE A CG1   1 
ATOM   1072 C  CG2   . ILE A 1 131 ? 20.793 -17.101 19.578  1.00 31.74 ? 132  ILE A CG2   1 
ATOM   1073 C  CD1   . ILE A 1 131 ? 23.043 -18.976 18.257  1.00 32.43 ? 132  ILE A CD1   1 
ATOM   1074 N  N     . ALA A 1 132 ? 18.355 -18.944 21.190  1.00 36.30 ? 133  ALA A N     1 
ATOM   1075 C  CA    . ALA A 1 132 ? 16.970 -18.505 21.458  1.00 35.82 ? 133  ALA A CA    1 
ATOM   1076 C  C     . ALA A 1 132 ? 16.653 -18.383 22.956  1.00 38.22 ? 133  ALA A C     1 
ATOM   1077 O  O     . ALA A 1 132 ? 15.901 -17.494 23.374  1.00 35.42 ? 133  ALA A O     1 
ATOM   1078 C  CB    . ALA A 1 132 ? 15.982 -19.390 20.788  1.00 38.54 ? 133  ALA A CB    1 
ATOM   1079 N  N     . ALA A 1 133 ? 17.251 -19.239 23.770  1.00 36.99 ? 134  ALA A N     1 
ATOM   1080 C  CA    . ALA A 1 133 ? 17.022 -19.193 25.222  1.00 36.61 ? 134  ALA A CA    1 
ATOM   1081 C  C     . ALA A 1 133 ? 17.627 -17.933 25.806  1.00 38.03 ? 134  ALA A C     1 
ATOM   1082 O  O     . ALA A 1 133 ? 17.101 -17.374 26.772  1.00 39.04 ? 134  ALA A O     1 
ATOM   1083 C  CB    . ALA A 1 133 ? 17.670 -20.392 25.895  1.00 37.17 ? 134  ALA A CB    1 
ATOM   1084 N  N     . LEU A 1 134 ? 18.764 -17.522 25.252  1.00 35.47 ? 135  LEU A N     1 
ATOM   1085 C  CA    . LEU A 1 134 ? 19.476 -16.340 25.725  1.00 32.27 ? 135  LEU A CA    1 
ATOM   1086 C  C     . LEU A 1 134 ? 18.753 -15.053 25.309  1.00 33.07 ? 135  LEU A C     1 
ATOM   1087 O  O     . LEU A 1 134 ? 18.819 -14.047 26.015  1.00 30.08 ? 135  LEU A O     1 
ATOM   1088 C  CB    . LEU A 1 134 ? 20.930 -16.348 25.221  1.00 31.92 ? 135  LEU A CB    1 
ATOM   1089 C  CG    . LEU A 1 134 ? 21.828 -17.408 25.889  1.00 32.03 ? 135  LEU A CG    1 
ATOM   1090 C  CD1   . LEU A 1 134 ? 23.120 -17.599 25.115  1.00 31.18 ? 135  LEU A CD1   1 
ATOM   1091 C  CD2   . LEU A 1 134 ? 22.186 -16.986 27.316  1.00 38.92 ? 135  LEU A CD2   1 
ATOM   1092 N  N     . ASN A 1 135 ? 18.060 -15.102 24.177  1.00 31.98 ? 136  ASN A N     1 
ATOM   1093 C  CA    . ASN A 1 135 ? 17.356 -13.940 23.670  1.00 32.70 ? 136  ASN A CA    1 
ATOM   1094 C  C     . ASN A 1 135 ? 16.062 -13.766 24.433  1.00 32.99 ? 136  ASN A C     1 
ATOM   1095 O  O     . ASN A 1 135 ? 15.706 -14.645 25.213  1.00 31.95 ? 136  ASN A O     1 
ATOM   1096 C  CB    . ASN A 1 135 ? 17.075 -14.134 22.191  1.00 29.28 ? 136  ASN A CB    1 
ATOM   1097 C  CG    . ASN A 1 135 ? 18.326 -13.964 21.339  1.00 31.09 ? 136  ASN A CG    1 
ATOM   1098 O  OD1   . ASN A 1 135 ? 19.373 -13.453 21.792  1.00 28.31 ? 136  ASN A OD1   1 
ATOM   1099 N  ND2   . ASN A 1 135 ? 18.227 -14.412 20.095  1.00 27.64 ? 136  ASN A ND2   1 
ATOM   1100 N  N     . ASP A 1 136 ? 15.351 -12.659 24.230  1.00 31.85 ? 137  ASP A N     1 
ATOM   1101 C  CA    . ASP A 1 136 ? 13.962 -12.570 24.746  1.00 34.05 ? 137  ASP A CA    1 
ATOM   1102 C  C     . ASP A 1 136 ? 12.982 -13.256 23.771  1.00 31.86 ? 137  ASP A C     1 
ATOM   1103 O  O     . ASP A 1 136 ? 12.107 -12.604 23.188  1.00 28.81 ? 137  ASP A O     1 
ATOM   1104 C  CB    . ASP A 1 136 ? 13.544 -11.115 24.980  1.00 30.60 ? 137  ASP A CB    1 
ATOM   1105 C  CG    . ASP A 1 136 ? 14.385 -10.410 26.080  1.00 35.91 ? 137  ASP A CG    1 
ATOM   1106 O  OD1   . ASP A 1 136 ? 14.886 -11.086 27.006  1.00 34.68 ? 137  ASP A OD1   1 
ATOM   1107 O  OD2   . ASP A 1 136 ? 14.556 -9.170  26.032  1.00 33.39 ? 137  ASP A OD2   1 
ATOM   1108 N  N     . SER A 1 137 ? 13.091 -14.573 23.623  1.00 34.54 ? 138  SER A N     1 
ATOM   1109 C  CA    . SER A 1 137 ? 12.304 -15.293 22.614  1.00 34.31 ? 138  SER A CA    1 
ATOM   1110 C  C     . SER A 1 137 ? 10.828 -15.362 22.974  1.00 35.08 ? 138  SER A C     1 
ATOM   1111 O  O     . SER A 1 137 ? 10.472 -15.741 24.094  1.00 36.84 ? 138  SER A O     1 
ATOM   1112 C  CB    . SER A 1 137 ? 12.841 -16.714 22.386  1.00 35.58 ? 138  SER A CB    1 
ATOM   1113 O  OG    . SER A 1 137 ? 12.060 -17.375 21.390  1.00 34.49 ? 138  SER A OG    1 
ATOM   1114 N  N     . LYS A 1 138 ? 9.958  -15.016 22.028  1.00 36.70 ? 139  LYS A N     1 
ATOM   1115 C  CA    . LYS A 1 138 ? 8.516  -15.012 22.289  1.00 35.97 ? 139  LYS A CA    1 
ATOM   1116 C  C     . LYS A 1 138 ? 7.670  -15.626 21.169  1.00 37.53 ? 139  LYS A C     1 
ATOM   1117 O  O     . LYS A 1 138 ? 6.507  -15.903 21.408  1.00 32.85 ? 139  LYS A O     1 
ATOM   1118 C  CB    . LYS A 1 138 ? 8.006  -13.584 22.511  1.00 35.29 ? 139  LYS A CB    1 
ATOM   1119 C  CG    . LYS A 1 138 ? 8.702  -12.853 23.659  1.00 38.07 ? 139  LYS A CG    1 
ATOM   1120 C  CD    . LYS A 1 138 ? 8.027  -11.511 23.950  1.00 37.17 ? 139  LYS A CD    1 
ATOM   1121 C  CE    . LYS A 1 138 ? 8.784  -10.366 23.262  1.00 35.60 ? 139  LYS A CE    1 
ATOM   1122 N  NZ    . LYS A 1 138 ? 10.319 -10.356 23.415  1.00 35.21 ? 139  LYS A NZ    1 
ATOM   1123 N  N     . THR A 1 139 ? 8.188  -15.759 19.948  1.00 37.37 ? 140  THR A N     1 
ATOM   1124 C  CA    . THR A 1 139 ? 7.330  -16.238 18.836  1.00 37.71 ? 140  THR A CA    1 
ATOM   1125 C  C     . THR A 1 139 ? 7.966  -17.437 18.110  1.00 37.12 ? 140  THR A C     1 
ATOM   1126 O  O     . THR A 1 139 ? 7.647  -17.741 16.954  1.00 40.06 ? 140  THR A O     1 
ATOM   1127 C  CB    . THR A 1 139 ? 6.997  -15.143 17.782  1.00 36.13 ? 140  THR A CB    1 
ATOM   1128 O  OG1   . THR A 1 139 ? 8.211  -14.603 17.239  1.00 37.09 ? 140  THR A OG1   1 
ATOM   1129 C  CG2   . THR A 1 139 ? 6.188  -14.001 18.382  1.00 37.60 ? 140  THR A CG2   1 
ATOM   1130 N  N     . ARG A 1 140 ? 8.860  -18.132 18.798  1.00 36.25 ? 141  ARG A N     1 
ATOM   1131 C  CA    . ARG A 1 140 ? 9.658  -19.160 18.163  1.00 39.03 ? 141  ARG A CA    1 
ATOM   1132 C  C     . ARG A 1 140 ? 8.743  -20.378 17.948  1.00 39.55 ? 141  ARG A C     1 
ATOM   1133 O  O     . ARG A 1 140 ? 7.925  -20.698 18.814  1.00 39.05 ? 141  ARG A O     1 
ATOM   1134 C  CB    . ARG A 1 140 ? 10.804 -19.551 19.089  1.00 38.22 ? 141  ARG A CB    1 
ATOM   1135 C  CG    . ARG A 1 140 ? 11.795 -20.516 18.479  1.00 39.44 ? 141  ARG A CG    1 
ATOM   1136 C  CD    . ARG A 1 140 ? 13.110 -20.540 19.303  1.00 42.00 ? 141  ARG A CD    1 
ATOM   1137 N  NE    . ARG A 1 140 ? 13.934 -21.766 19.202  1.00 45.15 ? 141  ARG A NE    1 
ATOM   1138 C  CZ    . ARG A 1 140 ? 14.916 -21.970 18.326  1.00 51.12 ? 141  ARG A CZ    1 
ATOM   1139 N  NH1   . ARG A 1 140 ? 15.226 -21.070 17.358  1.00 58.41 ? 141  ARG A NH1   1 
ATOM   1140 N  NH2   . ARG A 1 140 ? 15.574 -23.121 18.414  1.00 49.94 ? 141  ARG A NH2   1 
ATOM   1141 N  N     . LYS A 1 141 ? 8.899  -21.058 16.815  1.00 37.71 ? 142  LYS A N     1 
ATOM   1142 C  CA    . LYS A 1 141 ? 8.093  -22.219 16.517  1.00 40.92 ? 142  LYS A CA    1 
ATOM   1143 C  C     . LYS A 1 141 ? 8.954  -23.444 16.298  1.00 42.53 ? 142  LYS A C     1 
ATOM   1144 O  O     . LYS A 1 141 ? 8.675  -24.500 16.874  1.00 41.84 ? 142  LYS A O     1 
ATOM   1145 C  CB    . LYS A 1 141 ? 7.193  -21.971 15.303  1.00 39.57 ? 142  LYS A CB    1 
ATOM   1146 C  CG    . LYS A 1 141 ? 6.321  -23.181 14.876  1.00 45.08 ? 142  LYS A CG    1 
ATOM   1147 C  CD    . LYS A 1 141 ? 5.527  -22.845 13.633  1.00 47.45 ? 142  LYS A CD    1 
ATOM   1148 C  CE    . LYS A 1 141 ? 4.628  -21.619 13.835  1.00 54.95 ? 142  LYS A CE    1 
ATOM   1149 N  NZ    . LYS A 1 141 ? 3.355  -21.714 13.029  1.00 58.08 ? 142  LYS A NZ    1 
ATOM   1150 N  N     . THR A 1 142 ? 9.979  -23.342 15.453  1.00 38.27 ? 143  THR A N     1 
ATOM   1151 C  CA    . THR A 1 142 ? 10.672 -24.580 15.063  1.00 41.35 ? 143  THR A CA    1 
ATOM   1152 C  C     . THR A 1 142 ? 11.930 -24.703 15.871  1.00 38.99 ? 143  THR A C     1 
ATOM   1153 O  O     . THR A 1 142 ? 12.755 -23.797 15.855  1.00 41.48 ? 143  THR A O     1 
ATOM   1154 C  CB    . THR A 1 142 ? 11.030 -24.576 13.575  1.00 39.89 ? 143  THR A CB    1 
ATOM   1155 O  OG1   . THR A 1 142 ? 9.816  -24.502 12.821  1.00 43.97 ? 143  THR A OG1   1 
ATOM   1156 C  CG2   . THR A 1 142 ? 11.862 -25.814 13.189  1.00 41.06 ? 143  THR A CG2   1 
ATOM   1157 N  N     . THR A 1 143 ? 12.048 -25.801 16.607  1.00 39.07 ? 144  THR A N     1 
ATOM   1158 C  CA    . THR A 1 143 ? 13.157 -26.007 17.524  1.00 41.22 ? 144  THR A CA    1 
ATOM   1159 C  C     . THR A 1 143 ? 13.820 -27.307 17.120  1.00 42.78 ? 144  THR A C     1 
ATOM   1160 O  O     . THR A 1 143 ? 13.326 -28.005 16.233  1.00 43.38 ? 144  THR A O     1 
ATOM   1161 C  CB    . THR A 1 143 ? 12.637 -26.186 18.955  1.00 43.30 ? 144  THR A CB    1 
ATOM   1162 O  OG1   . THR A 1 143 ? 12.041 -27.494 19.076  1.00 45.26 ? 144  THR A OG1   1 
ATOM   1163 C  CG2   . THR A 1 143 ? 11.570 -25.125 19.249  1.00 41.89 ? 144  THR A CG2   1 
ATOM   1164 N  N     . SER A 1 144 ? 14.908 -27.651 17.794  1.00 42.77 ? 145  SER A N     1 
ATOM   1165 C  CA    . SER A 1 144 ? 15.537 -28.951 17.587  1.00 45.39 ? 145  SER A CA    1 
ATOM   1166 C  C     . SER A 1 144 ? 14.582 -30.155 17.647  1.00 50.64 ? 145  SER A C     1 
ATOM   1167 O  O     . SER A 1 144 ? 14.762 -31.120 16.901  1.00 50.20 ? 145  SER A O     1 
ATOM   1168 C  CB    . SER A 1 144 ? 16.723 -29.172 18.531  1.00 42.75 ? 145  SER A CB    1 
ATOM   1169 O  OG    . SER A 1 144 ? 16.295 -29.264 19.882  1.00 44.63 ? 145  SER A OG    1 
ATOM   1170 N  N     . GLU A 1 145 ? 13.594 -30.109 18.533  1.00 49.92 ? 146  GLU A N     1 
ATOM   1171 C  CA    . GLU A 1 145 ? 12.647 -31.209 18.674  1.00 52.80 ? 146  GLU A CA    1 
ATOM   1172 C  C     . GLU A 1 145 ? 11.676 -31.288 17.511  1.00 53.01 ? 146  GLU A C     1 
ATOM   1173 O  O     . GLU A 1 145 ? 11.214 -32.374 17.153  1.00 53.41 ? 146  GLU A O     1 
ATOM   1174 C  CB    . GLU A 1 145 ? 11.878 -31.117 19.998  1.00 54.83 ? 146  GLU A CB    1 
ATOM   1175 C  CG    . GLU A 1 145 ? 12.697 -31.558 21.217  1.00 63.02 ? 146  GLU A CG    1 
ATOM   1176 C  CD    . GLU A 1 145 ? 13.041 -33.063 21.208  1.00 74.10 ? 146  GLU A CD    1 
ATOM   1177 O  OE1   . GLU A 1 145 ? 12.140 -33.894 21.465  1.00 74.08 ? 146  GLU A OE1   1 
ATOM   1178 O  OE2   . GLU A 1 145 ? 14.216 -33.421 20.957  1.00 76.79 ? 146  GLU A OE2   1 
ATOM   1179 N  N     . THR A 1 146 ? 11.365 -30.151 16.905  1.00 50.27 ? 147  THR A N     1 
ATOM   1180 C  CA    . THR A 1 146 ? 10.640 -30.178 15.666  1.00 52.37 ? 147  THR A CA    1 
ATOM   1181 C  C     . THR A 1 146 ? 11.456 -30.966 14.647  1.00 54.51 ? 147  THR A C     1 
ATOM   1182 O  O     . THR A 1 146 ? 10.919 -31.810 13.910  1.00 52.71 ? 147  THR A O     1 
ATOM   1183 C  CB    . THR A 1 146 ? 10.418 -28.758 15.153  1.00 54.10 ? 147  THR A CB    1 
ATOM   1184 O  OG1   . THR A 1 146 ? 9.776  -27.994 16.180  1.00 50.64 ? 147  THR A OG1   1 
ATOM   1185 C  CG2   . THR A 1 146 ? 9.542  -28.782 13.901  1.00 54.54 ? 147  THR A CG2   1 
ATOM   1186 N  N     . VAL A 1 147 ? 12.759 -30.688 14.621  1.00 54.55 ? 148  VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 147 ? 13.655 -31.360 13.709  1.00 52.49 ? 148  VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 147 ? 13.651 -32.876 13.911  1.00 56.48 ? 148  VAL A C     1 
ATOM   1189 O  O     . VAL A 1 147 ? 13.808 -33.616 12.954  1.00 52.08 ? 148  VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 147 ? 15.074 -30.776 13.721  1.00 51.99 ? 148  VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 147 ? 15.972 -31.558 12.755  1.00 49.34 ? 148  VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 147 ? 15.036 -29.309 13.296  1.00 40.27 ? 148  VAL A CG2   1 
ATOM   1193 N  N     . ARG A 1 148 ? 13.420 -33.374 15.117  1.00 62.18 ? 149  ARG A N     1 
ATOM   1194 C  CA    . ARG A 1 148 ? 12.993 -34.785 15.189  1.00 65.61 ? 149  ARG A CA    1 
ATOM   1195 C  C     . ARG A 1 148 ? 11.640 -35.020 14.469  1.00 68.25 ? 149  ARG A C     1 
ATOM   1196 O  O     . ARG A 1 148 ? 10.627 -35.367 15.071  1.00 67.58 ? 149  ARG A O     1 
ATOM   1197 C  CB    . ARG A 1 148 ? 13.059 -35.309 16.612  1.00 66.73 ? 149  ARG A CB    1 
ATOM   1198 C  CG    . ARG A 1 148 ? 14.433 -35.153 17.257  1.00 69.86 ? 149  ARG A CG    1 
ATOM   1199 C  CD    . ARG A 1 148 ? 14.564 -36.059 18.497  1.00 70.63 ? 149  ARG A CD    1 
ATOM   1200 N  NE    . ARG A 1 148 ? 15.751 -35.714 19.273  1.00 73.97 ? 149  ARG A NE    1 
ATOM   1201 C  CZ    . ARG A 1 148 ? 16.884 -36.413 19.261  1.00 75.56 ? 149  ARG A CZ    1 
ATOM   1202 N  NH1   . ARG A 1 148 ? 16.975 -37.515 18.526  1.00 80.40 ? 149  ARG A NH1   1 
ATOM   1203 N  NH2   . ARG A 1 148 ? 17.926 -36.018 19.981  1.00 70.98 ? 149  ARG A NH2   1 
ATOM   1204 N  N     . ALA A 1 149 ? 11.628 -34.703 13.168  1.00 70.67 ? 150  ALA A N     1 
ATOM   1205 C  CA    . ALA A 1 149 ? 10.887 -35.428 12.136  1.00 71.78 ? 150  ALA A CA    1 
ATOM   1206 C  C     . ALA A 1 149 ? 11.906 -36.098 11.197  1.00 71.90 ? 150  ALA A C     1 
ATOM   1207 O  O     . ALA A 1 149 ? 11.547 -36.746 10.207  1.00 70.30 ? 150  ALA A O     1 
ATOM   1208 C  CB    . ALA A 1 149 ? 9.989  -34.471 11.356  1.00 71.73 ? 150  ALA A CB    1 
ATOM   1209 N  N     . VAL A 1 150 ? 13.179 -35.909 11.532  1.00 71.83 ? 151  VAL A N     1 
ATOM   1210 C  CA    . VAL A 1 150 ? 14.282 -36.736 11.072  1.00 73.71 ? 151  VAL A CA    1 
ATOM   1211 C  C     . VAL A 1 150 ? 14.116 -38.185 11.561  1.00 77.74 ? 151  VAL A C     1 
ATOM   1212 O  O     . VAL A 1 150 ? 14.983 -39.041 11.310  1.00 79.51 ? 151  VAL A O     1 
ATOM   1213 C  CB    . VAL A 1 150 ? 15.639 -36.136 11.546  1.00 73.22 ? 151  VAL A CB    1 
ATOM   1214 C  CG1   . VAL A 1 150 ? 16.580 -37.215 12.092  1.00 74.01 ? 151  VAL A CG1   1 
ATOM   1215 C  CG2   . VAL A 1 150 ? 16.320 -35.316 10.434  1.00 70.89 ? 151  VAL A CG2   1 
ATOM   1216 N  N     . LEU A 1 151 ? 12.997 -38.468 12.230  1.00 77.58 ? 152  LEU A N     1 
ATOM   1217 C  CA    . LEU A 1 151 ? 12.751 -39.806 12.766  1.00 78.97 ? 152  LEU A CA    1 
ATOM   1218 C  C     . LEU A 1 151 ? 11.736 -40.607 11.937  1.00 80.82 ? 152  LEU A C     1 
ATOM   1219 O  O     . LEU A 1 151 ? 10.616 -40.143 11.692  1.00 80.60 ? 152  LEU A O     1 
ATOM   1220 C  CB    . LEU A 1 151 ? 12.315 -39.723 14.229  1.00 78.95 ? 152  LEU A CB    1 
ATOM   1221 C  CG    . LEU A 1 151 ? 13.361 -39.951 15.327  1.00 78.23 ? 152  LEU A CG    1 
ATOM   1222 C  CD1   . LEU A 1 151 ? 14.712 -39.297 15.017  1.00 77.99 ? 152  LEU A CD1   1 
ATOM   1223 C  CD2   . LEU A 1 151 ? 12.814 -39.511 16.691  1.00 77.66 ? 152  LEU A CD2   1 
ATOM   1224 N  N     . ASP A 1 152 ? 12.147 -41.814 11.538  1.00 81.98 ? 153  ASP A N     1 
ATOM   1225 C  CA    . ASP A 1 152 ? 11.628 -42.512 10.350  1.00 83.91 ? 153  ASP A CA    1 
ATOM   1226 C  C     . ASP A 1 152 ? 11.546 -44.054 10.452  1.00 84.62 ? 153  ASP A C     1 
ATOM   1227 O  O     . ASP A 1 152 ? 12.283 -44.723 11.179  1.00 84.48 ? 153  ASP A O     1 
ATOM   1228 C  CB    . ASP A 1 152 ? 12.401 -42.085 9.093   1.00 84.03 ? 153  ASP A CB    1 
ATOM   1229 C  CG    . ASP A 1 152 ? 11.993 -40.703 8.605   1.00 84.30 ? 153  ASP A CG    1 
ATOM   1230 O  OD1   . ASP A 1 152 ? 10.844 -40.286 8.895   1.00 79.65 ? 153  ASP A OD1   1 
ATOM   1231 O  OD2   . ASP A 1 152 ? 12.826 -40.034 7.950   1.00 85.06 ? 153  ASP A OD2   1 
ATOM   1232 O  OXT   . ASP A 1 152 ? 10.714 -44.703 9.807   1.00 84.82 ? 153  ASP A OXT   1 
ATOM   1233 N  N     . ASN B 2 1   ? 33.781 15.500  41.484  1.00 67.07 ? 2    ASN B N     1 
ATOM   1234 C  CA    . ASN B 2 1   ? 33.855 15.114  40.049  1.00 66.63 ? 2    ASN B CA    1 
ATOM   1235 C  C     . ASN B 2 1   ? 34.607 13.795  39.828  1.00 64.01 ? 2    ASN B C     1 
ATOM   1236 O  O     . ASN B 2 1   ? 35.825 13.776  39.651  1.00 64.28 ? 2    ASN B O     1 
ATOM   1237 C  CB    . ASN B 2 1   ? 34.479 16.244  39.220  1.00 68.75 ? 2    ASN B CB    1 
ATOM   1238 C  CG    . ASN B 2 1   ? 33.538 17.433  39.041  1.00 74.89 ? 2    ASN B CG    1 
ATOM   1239 O  OD1   . ASN B 2 1   ? 32.742 17.755  39.927  1.00 76.18 ? 2    ASN B OD1   1 
ATOM   1240 N  ND2   . ASN B 2 1   ? 33.635 18.098  37.886  1.00 81.99 ? 2    ASN B ND2   1 
ATOM   1241 N  N     . THR B 2 2   ? 33.873 12.688  39.829  1.00 58.50 ? 3    THR B N     1 
ATOM   1242 C  CA    . THR B 2 2   ? 34.415 11.423  39.351  1.00 54.89 ? 3    THR B CA    1 
ATOM   1243 C  C     . THR B 2 2   ? 34.861 11.535  37.891  1.00 51.07 ? 3    THR B C     1 
ATOM   1244 O  O     . THR B 2 2   ? 34.195 12.166  37.071  1.00 47.90 ? 3    THR B O     1 
ATOM   1245 C  CB    . THR B 2 2   ? 33.347 10.316  39.514  1.00 56.53 ? 3    THR B CB    1 
ATOM   1246 O  OG1   . THR B 2 2   ? 32.816 10.405  40.843  1.00 60.13 ? 3    THR B OG1   1 
ATOM   1247 C  CG2   . THR B 2 2   ? 33.912 8.905   39.256  1.00 57.57 ? 3    THR B CG2   1 
ATOM   1248 N  N     . LYS B 2 3   ? 36.013 10.949  37.581  1.00 46.68 ? 4    LYS B N     1 
ATOM   1249 C  CA    . LYS B 2 3   ? 36.503 10.889  36.210  1.00 45.27 ? 4    LYS B CA    1 
ATOM   1250 C  C     . LYS B 2 3   ? 36.236 9.498   35.631  1.00 40.91 ? 4    LYS B C     1 
ATOM   1251 O  O     . LYS B 2 3   ? 36.547 8.506   36.265  1.00 43.99 ? 4    LYS B O     1 
ATOM   1252 C  CB    . LYS B 2 3   ? 38.008 11.216  36.202  1.00 46.33 ? 4    LYS B CB    1 
ATOM   1253 C  CG    . LYS B 2 3   ? 38.680 10.913  34.892  1.00 48.42 ? 4    LYS B CG    1 
ATOM   1254 C  CD    . LYS B 2 3   ? 38.469 12.031  33.906  1.00 54.19 ? 4    LYS B CD    1 
ATOM   1255 C  CE    . LYS B 2 3   ? 39.010 11.651  32.541  1.00 62.82 ? 4    LYS B CE    1 
ATOM   1256 N  NZ    . LYS B 2 3   ? 39.047 12.828  31.634  1.00 66.07 ? 4    LYS B NZ    1 
ATOM   1257 N  N     . TYR B 2 4   ? 35.632 9.398   34.453  1.00 36.00 ? 5    TYR B N     1 
ATOM   1258 C  CA    . TYR B 2 4   ? 35.242 8.079   33.926  1.00 31.25 ? 5    TYR B CA    1 
ATOM   1259 C  C     . TYR B 2 4   ? 36.244 7.673   32.842  1.00 32.86 ? 5    TYR B C     1 
ATOM   1260 O  O     . TYR B 2 4   ? 36.619 8.541   32.054  1.00 33.55 ? 5    TYR B O     1 
ATOM   1261 C  CB    . TYR B 2 4   ? 33.782 8.107   33.366  1.00 27.35 ? 5    TYR B CB    1 
ATOM   1262 C  CG    . TYR B 2 4   ? 32.777 8.455   34.437  1.00 29.35 ? 5    TYR B CG    1 
ATOM   1263 C  CD1   . TYR B 2 4   ? 32.475 7.555   35.456  1.00 31.27 ? 5    TYR B CD1   1 
ATOM   1264 C  CD2   . TYR B 2 4   ? 32.126 9.690   34.424  1.00 30.88 ? 5    TYR B CD2   1 
ATOM   1265 C  CE1   . TYR B 2 4   ? 31.547 7.890   36.478  1.00 29.50 ? 5    TYR B CE1   1 
ATOM   1266 C  CE2   . TYR B 2 4   ? 31.238 10.045  35.443  1.00 31.50 ? 5    TYR B CE2   1 
ATOM   1267 C  CZ    . TYR B 2 4   ? 30.939 9.134   36.439  1.00 28.90 ? 5    TYR B CZ    1 
ATOM   1268 O  OH    . TYR B 2 4   ? 30.040 9.495   37.415  1.00 30.43 ? 5    TYR B OH    1 
ATOM   1269 N  N     . ASN B 2 5   ? 36.669 6.393   32.808  1.00 30.49 ? 6    ASN B N     1 
ATOM   1270 C  CA    . ASN B 2 5   ? 37.552 5.893   31.750  1.00 33.21 ? 6    ASN B CA    1 
ATOM   1271 C  C     . ASN B 2 5   ? 36.948 5.807   30.384  1.00 33.08 ? 6    ASN B C     1 
ATOM   1272 O  O     . ASN B 2 5   ? 35.770 5.498   30.241  1.00 34.31 ? 6    ASN B O     1 
ATOM   1273 C  CB    . ASN B 2 5   ? 38.230 4.544   32.093  1.00 35.19 ? 6    ASN B CB    1 
ATOM   1274 C  CG    . ASN B 2 5   ? 37.280 3.298   32.063  1.00 50.61 ? 6    ASN B CG    1 
ATOM   1275 O  OD1   . ASN B 2 5   ? 37.230 2.508   31.076  1.00 49.90 ? 6    ASN B OD1   1 
ATOM   1276 N  ND2   . ASN B 2 5   ? 36.620 3.049   33.213  1.00 60.91 ? 6    ASN B ND2   1 
ATOM   1277 N  N     . LYS B 2 6   ? 37.788 5.983   29.373  1.00 30.38 ? 7    LYS B N     1 
ATOM   1278 C  CA    . LYS B 2 6   ? 37.310 6.148   28.014  1.00 31.96 ? 7    LYS B CA    1 
ATOM   1279 C  C     . LYS B 2 6   ? 36.636 4.903   27.445  1.00 31.14 ? 7    LYS B C     1 
ATOM   1280 O  O     . LYS B 2 6   ? 35.628 5.032   26.733  1.00 29.36 ? 7    LYS B O     1 
ATOM   1281 C  CB    . LYS B 2 6   ? 38.490 6.543   27.097  1.00 35.45 ? 7    LYS B CB    1 
ATOM   1282 C  CG    . LYS B 2 6   ? 38.067 6.987   25.716  1.00 38.65 ? 7    LYS B CG    1 
ATOM   1283 C  CD    . LYS B 2 6   ? 39.143 7.828   25.032  1.00 40.63 ? 7    LYS B CD    1 
ATOM   1284 C  CE    . LYS B 2 6   ? 38.940 7.759   23.525  1.00 52.23 ? 7    LYS B CE    1 
ATOM   1285 N  NZ    . LYS B 2 6   ? 39.755 8.771   22.764  1.00 55.08 ? 7    LYS B NZ    1 
ATOM   1286 N  N     . GLU B 2 7   ? 37.156 3.707   27.712  1.00 30.03 ? 8    GLU B N     1 
ATOM   1287 C  CA    . GLU B 2 7   ? 36.514 2.524   27.120  1.00 31.97 ? 8    GLU B CA    1 
ATOM   1288 C  C     . GLU B 2 7   ? 35.115 2.310   27.697  1.00 29.88 ? 8    GLU B C     1 
ATOM   1289 O  O     . GLU B 2 7   ? 34.197 1.882   26.980  1.00 28.43 ? 8    GLU B O     1 
ATOM   1290 C  CB    . GLU B 2 7   ? 37.333 1.268   27.313  1.00 30.99 ? 8    GLU B CB    1 
ATOM   1291 C  CG    . GLU B 2 7   ? 38.510 1.246   26.323  1.00 43.37 ? 8    GLU B CG    1 
ATOM   1292 C  CD    . GLU B 2 7   ? 39.291 -0.051  26.395  1.00 55.94 ? 8    GLU B CD    1 
ATOM   1293 O  OE1   . GLU B 2 7   ? 38.699 -1.129  26.160  1.00 65.20 ? 8    GLU B OE1   1 
ATOM   1294 O  OE2   . GLU B 2 7   ? 40.496 0.014   26.699  1.00 58.20 ? 8    GLU B OE2   1 
ATOM   1295 N  N     . PHE B 2 8   ? 34.984 2.558   29.000  1.00 29.80 ? 9    PHE B N     1 
ATOM   1296 C  CA    . PHE B 2 8   ? 33.668 2.594   29.661  1.00 30.70 ? 9    PHE B CA    1 
ATOM   1297 C  C     . PHE B 2 8   ? 32.702 3.583   28.989  1.00 28.83 ? 9    PHE B C     1 
ATOM   1298 O  O     . PHE B 2 8   ? 31.545 3.245   28.696  1.00 28.21 ? 9    PHE B O     1 
ATOM   1299 C  CB    . PHE B 2 8   ? 33.834 2.918   31.148  1.00 30.34 ? 9    PHE B CB    1 
ATOM   1300 C  CG    . PHE B 2 8   ? 32.534 3.295   31.853  1.00 32.67 ? 9    PHE B CG    1 
ATOM   1301 C  CD1   . PHE B 2 8   ? 31.614 2.311   32.185  1.00 33.95 ? 9    PHE B CD1   1 
ATOM   1302 C  CD2   . PHE B 2 8   ? 32.267 4.621   32.217  1.00 30.90 ? 9    PHE B CD2   1 
ATOM   1303 C  CE1   . PHE B 2 8   ? 30.413 2.641   32.860  1.00 28.93 ? 9    PHE B CE1   1 
ATOM   1304 C  CE2   . PHE B 2 8   ? 31.078 4.963   32.905  1.00 33.32 ? 9    PHE B CE2   1 
ATOM   1305 C  CZ    . PHE B 2 8   ? 30.176 3.960   33.223  1.00 33.91 ? 9    PHE B CZ    1 
ATOM   1306 N  N     . LEU B 2 9   ? 33.159 4.796   28.722  1.00 27.16 ? 10   LEU B N     1 
ATOM   1307 C  CA    . LEU B 2 9   ? 32.297 5.804   28.123  1.00 27.36 ? 10   LEU B CA    1 
ATOM   1308 C  C     . LEU B 2 9   ? 31.938 5.484   26.682  1.00 28.85 ? 10   LEU B C     1 
ATOM   1309 O  O     . LEU B 2 9   ? 30.842 5.811   26.240  1.00 28.01 ? 10   LEU B O     1 
ATOM   1310 C  CB    . LEU B 2 9   ? 32.928 7.212   28.191  1.00 28.37 ? 10   LEU B CB    1 
ATOM   1311 C  CG    . LEU B 2 9   ? 33.104 7.836   29.586  1.00 27.03 ? 10   LEU B CG    1 
ATOM   1312 C  CD1   . LEU B 2 9   ? 34.116 9.024   29.590  1.00 26.39 ? 10   LEU B CD1   1 
ATOM   1313 C  CD2   . LEU B 2 9   ? 31.757 8.196   30.265  1.00 29.07 ? 10   LEU B CD2   1 
ATOM   1314 N  N     . LEU B 2 10  ? 32.838 4.869   25.933  1.00 27.19 ? 11   LEU B N     1 
ATOM   1315 C  CA    . LEU B 2 10  ? 32.533 4.495   24.549  1.00 29.04 ? 11   LEU B CA    1 
ATOM   1316 C  C     . LEU B 2 10  ? 31.420 3.450   24.490  1.00 27.96 ? 11   LEU B C     1 
ATOM   1317 O  O     . LEU B 2 10  ? 30.458 3.598   23.720  1.00 27.68 ? 11   LEU B O     1 
ATOM   1318 C  CB    . LEU B 2 10  ? 33.764 3.936   23.842  1.00 28.72 ? 11   LEU B CB    1 
ATOM   1319 C  CG    . LEU B 2 10  ? 34.755 4.990   23.293  1.00 31.69 ? 11   LEU B CG    1 
ATOM   1320 C  CD1   . LEU B 2 10  ? 36.147 4.346   23.095  1.00 29.42 ? 11   LEU B CD1   1 
ATOM   1321 C  CD2   . LEU B 2 10  ? 34.206 5.463   21.950  1.00 31.46 ? 11   LEU B CD2   1 
ATOM   1322 N  N     . TYR B 2 11  ? 31.560 2.393   25.270  1.00 24.15 ? 12   TYR B N     1 
ATOM   1323 C  CA    . TYR B 2 11  ? 30.550 1.309   25.266  1.00 24.91 ? 12   TYR B CA    1 
ATOM   1324 C  C     . TYR B 2 11  ? 29.223 1.879   25.774  1.00 28.22 ? 12   TYR B C     1 
ATOM   1325 O  O     . TYR B 2 11  ? 28.130 1.645   25.200  1.00 27.13 ? 12   TYR B O     1 
ATOM   1326 C  CB    . TYR B 2 11  ? 31.017 0.198   26.227  1.00 26.91 ? 12   TYR B CB    1 
ATOM   1327 C  CG    . TYR B 2 11  ? 29.925 -0.848  26.377  1.00 27.29 ? 12   TYR B CG    1 
ATOM   1328 C  CD1   . TYR B 2 11  ? 29.843 -1.952  25.505  1.00 26.45 ? 12   TYR B CD1   1 
ATOM   1329 C  CD2   . TYR B 2 11  ? 28.921 -0.687  27.361  1.00 28.80 ? 12   TYR B CD2   1 
ATOM   1330 C  CE1   . TYR B 2 11  ? 28.803 -2.910  25.652  1.00 27.91 ? 12   TYR B CE1   1 
ATOM   1331 C  CE2   . TYR B 2 11  ? 27.873 -1.626  27.497  1.00 29.54 ? 12   TYR B CE2   1 
ATOM   1332 C  CZ    . TYR B 2 11  ? 27.810 -2.721  26.651  1.00 30.97 ? 12   TYR B CZ    1 
ATOM   1333 O  OH    . TYR B 2 11  ? 26.728 -3.594  26.804  1.00 27.70 ? 12   TYR B OH    1 
ATOM   1334 N  N     . LEU B 2 12  ? 29.306 2.607   26.888  1.00 26.25 ? 13   LEU B N     1 
ATOM   1335 C  CA    . LEU B 2 12  ? 28.108 3.200   27.505  1.00 26.12 ? 13   LEU B CA    1 
ATOM   1336 C  C     . LEU B 2 12  ? 27.390 4.144   26.543  1.00 24.32 ? 13   LEU B C     1 
ATOM   1337 O  O     . LEU B 2 12  ? 26.153 4.146   26.461  1.00 27.12 ? 13   LEU B O     1 
ATOM   1338 C  CB    . LEU B 2 12  ? 28.414 3.913   28.838  1.00 29.04 ? 13   LEU B CB    1 
ATOM   1339 C  CG    . LEU B 2 12  ? 27.202 4.488   29.606  1.00 23.47 ? 13   LEU B CG    1 
ATOM   1340 C  CD1   . LEU B 2 12  ? 26.147 3.362   29.886  1.00 25.78 ? 13   LEU B CD1   1 
ATOM   1341 C  CD2   . LEU B 2 12  ? 27.649 5.171   30.909  1.00 25.31 ? 13   LEU B CD2   1 
ATOM   1342 N  N     . ALA B 2 13  ? 28.133 4.945   25.792  1.00 25.03 ? 14   ALA B N     1 
ATOM   1343 C  CA    . ALA B 2 13  ? 27.535 5.809   24.809  1.00 26.14 ? 14   ALA B CA    1 
ATOM   1344 C  C     . ALA B 2 13  ? 26.724 5.011   23.766  1.00 27.65 ? 14   ALA B C     1 
ATOM   1345 O  O     . ALA B 2 13  ? 25.620 5.430   23.422  1.00 26.75 ? 14   ALA B O     1 
ATOM   1346 C  CB    . ALA B 2 13  ? 28.627 6.638   24.122  1.00 27.50 ? 14   ALA B CB    1 
ATOM   1347 N  N     . GLY B 2 14  ? 27.257 3.900   23.264  1.00 24.72 ? 15   GLY B N     1 
ATOM   1348 C  CA    . GLY B 2 14  ? 26.523 3.036   22.318  1.00 21.21 ? 15   GLY B CA    1 
ATOM   1349 C  C     . GLY B 2 14  ? 25.241 2.572   23.017  1.00 27.10 ? 15   GLY B C     1 
ATOM   1350 O  O     . GLY B 2 14  ? 24.145 2.600   22.428  1.00 24.50 ? 15   GLY B O     1 
ATOM   1351 N  N     . PHE B 2 15  ? 25.357 2.159   24.268  1.00 25.68 ? 16   PHE B N     1 
ATOM   1352 C  CA    . PHE B 2 15  ? 24.218 1.533   24.984  1.00 26.17 ? 16   PHE B CA    1 
ATOM   1353 C  C     . PHE B 2 15  ? 23.130 2.578   25.244  1.00 23.73 ? 16   PHE B C     1 
ATOM   1354 O  O     . PHE B 2 15  ? 21.918 2.306   25.115  1.00 25.48 ? 16   PHE B O     1 
ATOM   1355 C  CB    . PHE B 2 15  ? 24.655 0.869   26.324  1.00 20.93 ? 16   PHE B CB    1 
ATOM   1356 C  CG    . PHE B 2 15  ? 23.603 -0.109  26.849  1.00 28.86 ? 16   PHE B CG    1 
ATOM   1357 C  CD1   . PHE B 2 15  ? 23.545 -1.403  26.367  1.00 28.51 ? 16   PHE B CD1   1 
ATOM   1358 C  CD2   . PHE B 2 15  ? 22.614 0.314   27.724  1.00 29.06 ? 16   PHE B CD2   1 
ATOM   1359 C  CE1   . PHE B 2 15  ? 22.540 -2.289  26.760  1.00 31.50 ? 16   PHE B CE1   1 
ATOM   1360 C  CE2   . PHE B 2 15  ? 21.630 -0.571  28.144  1.00 23.28 ? 16   PHE B CE2   1 
ATOM   1361 C  CZ    . PHE B 2 15  ? 21.571 -1.858  27.648  1.00 24.66 ? 16   PHE B CZ    1 
ATOM   1362 N  N     . VAL B 2 16  ? 23.560 3.781   25.611  1.00 22.10 ? 17   VAL B N     1 
ATOM   1363 C  CA    . VAL B 2 16  ? 22.652 4.916   25.842  1.00 23.26 ? 17   VAL B CA    1 
ATOM   1364 C  C     . VAL B 2 16  ? 21.946 5.331   24.551  1.00 24.48 ? 17   VAL B C     1 
ATOM   1365 O  O     . VAL B 2 16  ? 20.708 5.552   24.519  1.00 25.94 ? 17   VAL B O     1 
ATOM   1366 C  CB    . VAL B 2 16  ? 23.414 6.086   26.452  1.00 22.81 ? 17   VAL B CB    1 
ATOM   1367 C  CG1   . VAL B 2 16  ? 22.524 7.394   26.433  1.00 24.98 ? 17   VAL B CG1   1 
ATOM   1368 C  CG2   . VAL B 2 16  ? 23.835 5.666   27.902  1.00 21.15 ? 17   VAL B CG2   1 
ATOM   1369 N  N     . ASP B 2 17  ? 22.716 5.506   23.483  1.00 21.81 ? 18   ASP B N     1 
ATOM   1370 C  CA    . ASP B 2 17  ? 22.111 5.844   22.194  1.00 23.06 ? 18   ASP B CA    1 
ATOM   1371 C  C     . ASP B 2 17  ? 21.030 4.817   21.819  1.00 27.17 ? 18   ASP B C     1 
ATOM   1372 O  O     . ASP B 2 17  ? 20.036 5.149   21.100  1.00 26.69 ? 18   ASP B O     1 
ATOM   1373 C  CB    . ASP B 2 17  ? 23.174 5.905   21.094  1.00 24.07 ? 18   ASP B CB    1 
ATOM   1374 C  CG    . ASP B 2 17  ? 23.780 7.261   20.965  1.00 29.38 ? 18   ASP B CG    1 
ATOM   1375 O  OD1   . ASP B 2 17  ? 23.218 8.226   21.542  1.00 27.94 ? 18   ASP B OD1   1 
ATOM   1376 O  OD2   . ASP B 2 17  ? 24.836 7.354   20.288  1.00 29.52 ? 18   ASP B OD2   1 
ATOM   1377 N  N     . ALA B 2 18  ? 21.207 3.578   22.282  1.00 24.41 ? 19   ALA B N     1 
ATOM   1378 C  CA    . ALA B 2 18  ? 20.209 2.529   22.003  1.00 25.90 ? 19   ALA B CA    1 
ATOM   1379 C  C     . ALA B 2 18  ? 19.060 2.480   23.046  1.00 27.64 ? 19   ALA B C     1 
ATOM   1380 O  O     . ALA B 2 18  ? 17.910 2.773   22.717  1.00 28.69 ? 19   ALA B O     1 
ATOM   1381 C  CB    . ALA B 2 18  ? 20.864 1.203   21.862  1.00 31.61 ? 19   ALA B CB    1 
ATOM   1382 N  N     . ASP B 2 19  ? 19.372 2.167   24.301  1.00 23.60 ? 20   ASP B N     1 
ATOM   1383 C  CA    . ASP B 2 19  ? 18.316 1.928   25.303  1.00 25.30 ? 20   ASP B CA    1 
ATOM   1384 C  C     . ASP B 2 19  ? 18.069 3.064   26.285  1.00 24.74 ? 20   ASP B C     1 
ATOM   1385 O  O     . ASP B 2 19  ? 17.273 2.895   27.240  1.00 24.65 ? 20   ASP B O     1 
ATOM   1386 C  CB    . ASP B 2 19  ? 18.546 0.644   26.106  1.00 20.33 ? 20   ASP B CB    1 
ATOM   1387 C  CG    . ASP B 2 19  ? 18.179 -0.630  25.338  1.00 27.37 ? 20   ASP B CG    1 
ATOM   1388 O  OD1   . ASP B 2 19  ? 17.403 -0.629  24.355  1.00 25.45 ? 20   ASP B OD1   1 
ATOM   1389 O  OD2   . ASP B 2 19  ? 18.711 -1.712  25.698  1.00 25.67 ? 20   ASP B OD2   1 
ATOM   1390 N  N     . GLY B 2 20  ? 18.780 4.176   26.136  1.00 22.91 ? 21   GLY B N     1 
ATOM   1391 C  CA    . GLY B 2 20  ? 18.791 5.206   27.174  1.00 23.26 ? 21   GLY B CA    1 
ATOM   1392 C  C     . GLY B 2 20  ? 17.901 6.347   26.735  1.00 24.80 ? 21   GLY B C     1 
ATOM   1393 O  O     . GLY B 2 20  ? 17.389 6.346   25.599  1.00 25.99 ? 21   GLY B O     1 
ATOM   1394 N  N     . SER B 2 21  ? 17.742 7.355   27.591  1.00 27.20 ? 22   SER B N     1 
ATOM   1395 C  CA    . SER B 2 21  ? 16.864 8.481   27.272  1.00 26.55 ? 22   SER B CA    1 
ATOM   1396 C  C     . SER B 2 21  ? 17.387 9.700   28.047  1.00 26.87 ? 22   SER B C     1 
ATOM   1397 O  O     . SER B 2 21  ? 17.721 9.613   29.227  1.00 27.84 ? 22   SER B O     1 
ATOM   1398 C  CB    . SER B 2 21  ? 15.424 8.167   27.711  1.00 29.77 ? 22   SER B CB    1 
ATOM   1399 O  OG    . SER B 2 21  ? 14.514 9.154   27.202  1.00 28.84 ? 22   SER B OG    1 
ATOM   1400 N  N     . ILE B 2 22  ? 17.515 10.820  27.356  1.00 25.46 ? 23   ILE B N     1 
ATOM   1401 C  CA    . ILE B 2 22  ? 17.808 12.086  27.983  1.00 27.95 ? 23   ILE B CA    1 
ATOM   1402 C  C     . ILE B 2 22  ? 16.582 12.972  27.936  1.00 27.42 ? 23   ILE B C     1 
ATOM   1403 O  O     . ILE B 2 22  ? 16.161 13.427  26.863  1.00 28.97 ? 23   ILE B O     1 
ATOM   1404 C  CB    . ILE B 2 22  ? 19.032 12.732  27.349  1.00 29.60 ? 23   ILE B CB    1 
ATOM   1405 C  CG1   . ILE B 2 22  ? 20.224 11.772  27.569  1.00 30.26 ? 23   ILE B CG1   1 
ATOM   1406 C  CG2   . ILE B 2 22  ? 19.271 14.079  28.002  1.00 31.08 ? 23   ILE B CG2   1 
ATOM   1407 C  CD1   . ILE B 2 22  ? 21.482 12.178  26.829  1.00 34.96 ? 23   ILE B CD1   1 
ATOM   1408 N  N     . ILE B 2 23  ? 15.981 13.139  29.113  1.00 29.66 ? 24   ILE B N     1 
ATOM   1409 C  CA    . ILE B 2 23  ? 14.595 13.589  29.255  1.00 30.11 ? 24   ILE B CA    1 
ATOM   1410 C  C     . ILE B 2 23  ? 14.596 14.954  29.915  1.00 32.54 ? 24   ILE B C     1 
ATOM   1411 O  O     . ILE B 2 23  ? 15.230 15.151  30.970  1.00 34.05 ? 24   ILE B O     1 
ATOM   1412 C  CB    . ILE B 2 23  ? 13.728 12.616  30.097  1.00 28.57 ? 24   ILE B CB    1 
ATOM   1413 C  CG1   . ILE B 2 23  ? 13.770 11.205  29.491  1.00 31.73 ? 24   ILE B CG1   1 
ATOM   1414 C  CG2   . ILE B 2 23  ? 12.228 13.107  30.117  1.00 27.97 ? 24   ILE B CG2   1 
ATOM   1415 C  CD1   . ILE B 2 23  ? 13.317 10.158  30.445  1.00 30.13 ? 24   ILE B CD1   1 
ATOM   1416 N  N     . ALA B 2 24  ? 13.961 15.923  29.264  1.00 29.78 ? 25   ALA B N     1 
ATOM   1417 C  CA    . ALA B 2 24  ? 13.858 17.244  29.877  1.00 30.82 ? 25   ALA B CA    1 
ATOM   1418 C  C     . ALA B 2 24  ? 12.384 17.590  29.968  1.00 30.49 ? 25   ALA B C     1 
ATOM   1419 O  O     . ALA B 2 24  ? 11.656 17.459  28.953  1.00 30.19 ? 25   ALA B O     1 
ATOM   1420 C  CB    . ALA B 2 24  ? 14.618 18.302  29.041  1.00 30.62 ? 25   ALA B CB    1 
ATOM   1421 N  N     . GLN B 2 25  ? 11.931 18.018  31.155  1.00 30.27 ? 26   GLN B N     1 
ATOM   1422 C  CA    . GLN B 2 25  ? 10.506 18.297  31.326  1.00 28.94 ? 26   GLN B CA    1 
ATOM   1423 C  C     . GLN B 2 25  ? 10.259 19.668  31.955  1.00 32.10 ? 26   GLN B C     1 
ATOM   1424 O  O     . GLN B 2 25  ? 11.108 20.210  32.698  1.00 30.94 ? 26   GLN B O     1 
ATOM   1425 C  CB    . GLN B 2 25  ? 9.813  17.222  32.178  1.00 28.92 ? 26   GLN B CB    1 
ATOM   1426 C  CG    . GLN B 2 25  ? 9.827  15.797  31.583  1.00 27.46 ? 26   GLN B CG    1 
ATOM   1427 C  CD    . GLN B 2 25  ? 9.486  14.789  32.616  1.00 29.85 ? 26   GLN B CD    1 
ATOM   1428 O  OE1   . GLN B 2 25  ? 10.369 14.264  33.316  1.00 32.84 ? 26   GLN B OE1   1 
ATOM   1429 N  NE2   . GLN B 2 25  ? 8.201  14.528  32.773  1.00 31.08 ? 26   GLN B NE2   1 
ATOM   1430 N  N     . ILE B 2 26  ? 9.108  20.251  31.639  1.00 32.56 ? 27   ILE B N     1 
ATOM   1431 C  CA    . ILE B 2 26  ? 8.624  21.449  32.371  1.00 33.18 ? 27   ILE B CA    1 
ATOM   1432 C  C     . ILE B 2 26  ? 7.385  20.951  33.137  1.00 36.66 ? 27   ILE B C     1 
ATOM   1433 O  O     . ILE B 2 26  ? 6.511  20.325  32.530  1.00 35.66 ? 27   ILE B O     1 
ATOM   1434 C  CB    . ILE B 2 26  ? 8.218  22.587  31.396  1.00 32.78 ? 27   ILE B CB    1 
ATOM   1435 C  CG1   . ILE B 2 26  ? 9.347  22.944  30.426  1.00 34.18 ? 27   ILE B CG1   1 
ATOM   1436 C  CG2   . ILE B 2 26  ? 7.826  23.876  32.152  1.00 34.82 ? 27   ILE B CG2   1 
ATOM   1437 C  CD1   . ILE B 2 26  ? 8.855  23.518  28.995  1.00 32.40 ? 27   ILE B CD1   1 
ATOM   1438 N  N     . GLU B 2 27  ? 7.329  21.155  34.451  1.00 33.39 ? 28   GLU B N     1 
ATOM   1439 C  CA    . GLU B 2 27  ? 6.216  20.664  35.270  1.00 33.57 ? 28   GLU B CA    1 
ATOM   1440 C  C     . GLU B 2 27  ? 5.578  21.854  35.946  1.00 39.74 ? 28   GLU B C     1 
ATOM   1441 O  O     . GLU B 2 27  ? 6.279  22.583  36.668  1.00 39.75 ? 28   GLU B O     1 
ATOM   1442 C  CB    . GLU B 2 27  ? 6.679  19.705  36.347  1.00 35.51 ? 28   GLU B CB    1 
ATOM   1443 N  N     . PRO B 2 28  ? 4.270  22.058  35.711  1.00 41.92 ? 29   PRO B N     1 
ATOM   1444 C  CA    . PRO B 2 28  ? 3.459  23.048  36.395  1.00 42.04 ? 29   PRO B CA    1 
ATOM   1445 C  C     . PRO B 2 28  ? 3.620  22.884  37.882  1.00 43.39 ? 29   PRO B C     1 
ATOM   1446 O  O     . PRO B 2 28  ? 3.575  21.764  38.409  1.00 41.81 ? 29   PRO B O     1 
ATOM   1447 C  CB    . PRO B 2 28  ? 2.035  22.661  35.980  1.00 44.70 ? 29   PRO B CB    1 
ATOM   1448 C  CG    . PRO B 2 28  ? 2.242  22.128  34.610  1.00 44.59 ? 29   PRO B CG    1 
ATOM   1449 C  CD    . PRO B 2 28  ? 3.461  21.292  34.740  1.00 42.15 ? 29   PRO B CD    1 
ATOM   1450 N  N     . ASN B 2 29  ? 3.824  24.002  38.569  1.00 42.78 ? 30   ASN B N     1 
ATOM   1451 C  CA    . ASN B 2 29  ? 3.837  23.914  39.999  1.00 46.06 ? 30   ASN B CA    1 
ATOM   1452 C  C     . ASN B 2 29  ? 3.738  25.257  40.703  1.00 47.00 ? 30   ASN B C     1 
ATOM   1453 O  O     . ASN B 2 29  ? 4.608  26.099  40.581  1.00 46.07 ? 30   ASN B O     1 
ATOM   1454 C  CB    . ASN B 2 29  ? 5.022  23.118  40.507  1.00 41.54 ? 30   ASN B CB    1 
ATOM   1455 C  CG    . ASN B 2 29  ? 4.904  22.866  41.985  1.00 52.65 ? 30   ASN B CG    1 
ATOM   1456 O  OD1   . ASN B 2 29  ? 4.392  23.731  42.722  1.00 57.01 ? 30   ASN B OD1   1 
ATOM   1457 N  ND2   . ASN B 2 29  ? 5.347  21.689  42.432  1.00 43.84 ? 30   ASN B ND2   1 
ATOM   1458 N  N     . GLN B 2 30  ? 2.627  25.449  41.400  1.00 52.41 ? 31   GLN B N     1 
ATOM   1459 C  CA    . GLN B 2 30  ? 2.167  26.781  41.789  1.00 59.26 ? 31   GLN B CA    1 
ATOM   1460 C  C     . GLN B 2 30  ? 3.122  27.422  42.801  1.00 53.85 ? 31   GLN B C     1 
ATOM   1461 O  O     . GLN B 2 30  ? 3.185  28.646  42.897  1.00 54.21 ? 31   GLN B O     1 
ATOM   1462 C  CB    . GLN B 2 30  ? 0.765  26.691  42.415  1.00 59.92 ? 31   GLN B CB    1 
ATOM   1463 C  CG    . GLN B 2 30  ? -0.418 26.965  41.492  1.00 69.13 ? 31   GLN B CG    1 
ATOM   1464 C  CD    . GLN B 2 30  ? -1.703 27.167  42.305  1.00 69.30 ? 31   GLN B CD    1 
ATOM   1465 O  OE1   . GLN B 2 30  ? -2.136 26.269  43.042  1.00 84.42 ? 31   GLN B OE1   1 
ATOM   1466 N  NE2   . GLN B 2 30  ? -2.300 28.357  42.194  1.00 83.21 ? 31   GLN B NE2   1 
ATOM   1467 N  N     . SER B 2 31  ? 3.838  26.607  43.562  1.00 49.42 ? 32   SER B N     1 
ATOM   1468 C  CA    . SER B 2 31  ? 4.803  27.118  44.542  1.00 50.95 ? 32   SER B CA    1 
ATOM   1469 C  C     . SER B 2 31  ? 6.224  27.521  44.051  1.00 51.80 ? 32   SER B C     1 
ATOM   1470 O  O     . SER B 2 31  ? 7.002  28.107  44.811  1.00 51.18 ? 32   SER B O     1 
ATOM   1471 C  CB    . SER B 2 31  ? 4.921  26.116  45.669  1.00 52.19 ? 32   SER B CB    1 
ATOM   1472 O  OG    . SER B 2 31  ? 6.087  25.339  45.472  1.00 59.92 ? 32   SER B OG    1 
ATOM   1473 N  N     . SER B 2 32  ? 6.579  27.217  42.800  1.00 49.32 ? 33   SER B N     1 
ATOM   1474 C  CA    . SER B 2 32  ? 7.797  27.759  42.196  1.00 45.53 ? 33   SER B CA    1 
ATOM   1475 C  C     . SER B 2 32  ? 7.520  29.147  41.697  1.00 46.13 ? 33   SER B C     1 
ATOM   1476 O  O     . SER B 2 32  ? 6.374  29.481  41.375  1.00 44.09 ? 33   SER B O     1 
ATOM   1477 C  CB    . SER B 2 32  ? 8.277  26.935  40.977  1.00 43.99 ? 33   SER B CB    1 
ATOM   1478 O  OG    . SER B 2 32  ? 8.489  25.573  41.299  1.00 44.02 ? 33   SER B OG    1 
ATOM   1479 N  N     . LYS B 2 33  ? 8.593  29.924  41.582  1.00 47.15 ? 34   LYS B N     1 
ATOM   1480 C  CA    . LYS B 2 33  ? 8.520  31.335  41.203  1.00 52.78 ? 34   LYS B CA    1 
ATOM   1481 C  C     . LYS B 2 33  ? 7.751  31.570  39.905  1.00 50.64 ? 34   LYS B C     1 
ATOM   1482 O  O     . LYS B 2 33  ? 6.935  32.491  39.825  1.00 52.03 ? 34   LYS B O     1 
ATOM   1483 C  CB    . LYS B 2 33  ? 9.922  31.950  41.092  1.00 50.56 ? 34   LYS B CB    1 
ATOM   1484 C  CG    . LYS B 2 33  ? 9.933  33.432  40.755  1.00 55.59 ? 34   LYS B CG    1 
ATOM   1485 C  CD    . LYS B 2 33  ? 11.352 33.957  40.615  1.00 57.43 ? 34   LYS B CD    1 
ATOM   1486 C  CE    . LYS B 2 33  ? 12.223 33.551  41.806  1.00 66.44 ? 34   LYS B CE    1 
ATOM   1487 N  NZ    . LYS B 2 33  ? 13.650 34.029  41.763  1.00 64.27 ? 34   LYS B NZ    1 
ATOM   1488 N  N     . PHE B 2 34  ? 8.016  30.769  38.875  1.00 48.28 ? 35   PHE B N     1 
ATOM   1489 C  CA    . PHE B 2 34  ? 7.292  30.994  37.628  1.00 45.54 ? 35   PHE B CA    1 
ATOM   1490 C  C     . PHE B 2 34  ? 6.230  29.933  37.419  1.00 45.18 ? 35   PHE B C     1 
ATOM   1491 O  O     . PHE B 2 34  ? 5.826  29.661  36.292  1.00 44.91 ? 35   PHE B O     1 
ATOM   1492 C  CB    . PHE B 2 34  ? 8.265  31.064  36.456  1.00 47.31 ? 35   PHE B CB    1 
ATOM   1493 C  CG    . PHE B 2 34  ? 9.285  32.152  36.605  1.00 49.84 ? 35   PHE B CG    1 
ATOM   1494 C  CD1   . PHE B 2 34  ? 8.882  33.479  36.733  1.00 52.68 ? 35   PHE B CD1   1 
ATOM   1495 C  CD2   . PHE B 2 34  ? 10.638 31.855  36.664  1.00 51.07 ? 35   PHE B CD2   1 
ATOM   1496 C  CE1   . PHE B 2 34  ? 9.818  34.490  36.904  1.00 53.95 ? 35   PHE B CE1   1 
ATOM   1497 C  CE2   . PHE B 2 34  ? 11.579 32.865  36.823  1.00 51.14 ? 35   PHE B CE2   1 
ATOM   1498 C  CZ    . PHE B 2 34  ? 11.168 34.181  36.939  1.00 54.82 ? 35   PHE B CZ    1 
ATOM   1499 N  N     . LYS B 2 35  ? 5.783  29.343  38.522  1.00 43.31 ? 36   LYS B N     1 
ATOM   1500 C  CA    . LYS B 2 35  ? 4.639  28.442  38.512  1.00 44.96 ? 36   LYS B CA    1 
ATOM   1501 C  C     . LYS B 2 35  ? 4.969  27.169  37.732  1.00 41.34 ? 36   LYS B C     1 
ATOM   1502 O  O     . LYS B 2 35  ? 4.074  26.372  37.439  1.00 38.95 ? 36   LYS B O     1 
ATOM   1503 C  CB    . LYS B 2 35  ? 3.413  29.128  37.899  1.00 48.54 ? 36   LYS B CB    1 
ATOM   1504 C  CG    . LYS B 2 35  ? 2.674  30.166  38.778  1.00 53.21 ? 36   LYS B CG    1 
ATOM   1505 C  CD    . LYS B 2 35  ? 3.512  30.825  39.848  1.00 59.84 ? 36   LYS B CD    1 
ATOM   1506 C  CE    . LYS B 2 35  ? 2.864  32.129  40.337  1.00 60.52 ? 36   LYS B CE    1 
ATOM   1507 N  NZ    . LYS B 2 35  ? 3.417  33.312  39.607  1.00 71.91 ? 36   LYS B NZ    1 
ATOM   1508 N  N     . HIS B 2 36  ? 6.252  26.968  37.433  1.00 39.50 ? 37   HIS B N     1 
ATOM   1509 C  CA    . HIS B 2 36  ? 6.743  25.739  36.780  1.00 37.89 ? 37   HIS B CA    1 
ATOM   1510 C  C     . HIS B 2 36  ? 8.164  25.475  37.251  1.00 37.11 ? 37   HIS B C     1 
ATOM   1511 O  O     . HIS B 2 36  ? 8.873  26.383  37.697  1.00 36.23 ? 37   HIS B O     1 
ATOM   1512 C  CB    . HIS B 2 36  ? 6.843  25.916  35.261  1.00 35.81 ? 37   HIS B CB    1 
ATOM   1513 C  CG    . HIS B 2 36  ? 5.539  26.235  34.603  1.00 43.65 ? 37   HIS B CG    1 
ATOM   1514 N  ND1   . HIS B 2 36  ? 5.090  27.530  34.430  1.00 40.13 ? 37   HIS B ND1   1 
ATOM   1515 C  CD2   . HIS B 2 36  ? 4.582  25.421  34.092  1.00 42.92 ? 37   HIS B CD2   1 
ATOM   1516 C  CE1   . HIS B 2 36  ? 3.905  27.496  33.845  1.00 47.75 ? 37   HIS B CE1   1 
ATOM   1517 N  NE2   . HIS B 2 36  ? 3.578  26.231  33.626  1.00 47.88 ? 37   HIS B NE2   1 
ATOM   1518 N  N     . ARG B 2 37  ? 8.592  24.235  37.119  1.00 35.26 ? 38   ARG B N     1 
ATOM   1519 C  CA    . ARG B 2 37  ? 9.977  23.923  37.400  1.00 38.33 ? 38   ARG B CA    1 
ATOM   1520 C  C     . ARG B 2 37  ? 10.492 23.009  36.313  1.00 35.38 ? 38   ARG B C     1 
ATOM   1521 O  O     . ARG B 2 37  ? 9.693  22.415  35.569  1.00 37.25 ? 38   ARG B O     1 
ATOM   1522 C  CB    . ARG B 2 37  ? 10.094 23.244  38.755  1.00 35.45 ? 38   ARG B CB    1 
ATOM   1523 C  CG    . ARG B 2 37  ? 9.360  21.951  38.833  1.00 40.90 ? 38   ARG B CG    1 
ATOM   1524 C  CD    . ARG B 2 37  ? 10.259 20.792  38.353  1.00 42.78 ? 38   ARG B CD    1 
ATOM   1525 N  NE    . ARG B 2 37  ? 9.794  19.728  39.186  1.00 42.22 ? 38   ARG B NE    1 
ATOM   1526 C  CZ    . ARG B 2 37  ? 10.468 19.094  40.133  1.00 41.76 ? 38   ARG B CZ    1 
ATOM   1527 N  NH1   . ARG B 2 37  ? 11.760 19.276  40.338  1.00 38.36 ? 38   ARG B NH1   1 
ATOM   1528 N  NH2   . ARG B 2 37  ? 9.809  18.194  40.830  1.00 44.36 ? 38   ARG B NH2   1 
ATOM   1529 N  N     . LEU B 2 38  ? 11.816 22.948  36.186  1.00 35.89 ? 39   LEU B N     1 
ATOM   1530 C  CA    . LEU B 2 38  ? 12.455 22.056  35.201  1.00 34.86 ? 39   LEU B CA    1 
ATOM   1531 C  C     . LEU B 2 38  ? 12.924 20.739  35.795  1.00 36.48 ? 39   LEU B C     1 
ATOM   1532 O  O     . LEU B 2 38  ? 13.397 20.727  36.936  1.00 39.11 ? 39   LEU B O     1 
ATOM   1533 C  CB    . LEU B 2 38  ? 13.641 22.783  34.577  1.00 37.04 ? 39   LEU B CB    1 
ATOM   1534 C  CG    . LEU B 2 38  ? 13.177 24.112  33.992  1.00 40.73 ? 39   LEU B CG    1 
ATOM   1535 C  CD1   . LEU B 2 38  ? 14.391 24.818  33.422  1.00 46.19 ? 39   LEU B CD1   1 
ATOM   1536 C  CD2   . LEU B 2 38  ? 12.053 23.922  32.950  1.00 39.39 ? 39   LEU B CD2   1 
ATOM   1537 N  N     . LYS B 2 39  ? 12.808 19.639  35.043  1.00 32.82 ? 40   LYS B N     1 
ATOM   1538 C  CA    . LYS B 2 39  ? 13.309 18.369  35.488  1.00 36.88 ? 40   LYS B CA    1 
ATOM   1539 C  C     . LYS B 2 39  ? 14.173 17.858  34.358  1.00 32.99 ? 40   LYS B C     1 
ATOM   1540 O  O     . LYS B 2 39  ? 13.743 17.795  33.202  1.00 34.07 ? 40   LYS B O     1 
ATOM   1541 C  CB    . LYS B 2 39  ? 12.220 17.295  35.695  1.00 36.71 ? 40   LYS B CB    1 
ATOM   1542 C  CG    . LYS B 2 39  ? 11.291 17.407  36.898  1.00 40.44 ? 40   LYS B CG    1 
ATOM   1543 C  CD    . LYS B 2 39  ? 10.653 16.016  37.268  1.00 43.06 ? 40   LYS B CD    1 
ATOM   1544 C  CE    . LYS B 2 39  ? 9.183  16.113  37.745  1.00 57.72 ? 40   LYS B CE    1 
ATOM   1545 N  NZ    . LYS B 2 39  ? 8.230  14.926  37.413  1.00 51.90 ? 40   LYS B NZ    1 
ATOM   1546 N  N     . LEU B 2 40  ? 15.351 17.377  34.721  1.00 31.63 ? 41   LEU B N     1 
ATOM   1547 C  CA    . LEU B 2 40  ? 16.285 16.797  33.757  1.00 32.58 ? 41   LEU B CA    1 
ATOM   1548 C  C     . LEU B 2 40  ? 16.644 15.401  34.230  1.00 32.31 ? 41   LEU B C     1 
ATOM   1549 O  O     . LEU B 2 40  ? 17.054 15.238  35.367  1.00 32.82 ? 41   LEU B O     1 
ATOM   1550 C  CB    . LEU B 2 40  ? 17.549 17.664  33.701  1.00 32.83 ? 41   LEU B CB    1 
ATOM   1551 C  CG    . LEU B 2 40  ? 17.302 19.135  33.322  1.00 34.16 ? 41   LEU B CG    1 
ATOM   1552 C  CD1   . LEU B 2 40  ? 18.588 19.977  33.379  1.00 35.61 ? 41   LEU B CD1   1 
ATOM   1553 C  CD2   . LEU B 2 40  ? 16.676 19.259  31.966  1.00 35.76 ? 41   LEU B CD2   1 
ATOM   1554 N  N     . THR B 2 41  ? 16.503 14.386  33.387  1.00 31.85 ? 42   THR B N     1 
ATOM   1555 C  CA    . THR B 2 41  ? 16.719 13.000  33.844  1.00 30.70 ? 42   THR B CA    1 
ATOM   1556 C  C     . THR B 2 41  ? 17.468 12.280  32.741  1.00 32.38 ? 42   THR B C     1 
ATOM   1557 O  O     . THR B 2 41  ? 17.100 12.381  31.550  1.00 33.32 ? 42   THR B O     1 
ATOM   1558 C  CB    . THR B 2 41  ? 15.360 12.228  33.978  1.00 31.04 ? 42   THR B CB    1 
ATOM   1559 O  OG1   . THR B 2 41  ? 14.546 12.967  34.861  1.00 37.21 ? 42   THR B OG1   1 
ATOM   1560 C  CG2   . THR B 2 41  ? 15.543 10.851  34.598  1.00 30.90 ? 42   THR B CG2   1 
ATOM   1561 N  N     . PHE B 2 42  ? 18.502 11.550  33.157  1.00 29.87 ? 43   PHE B N     1 
ATOM   1562 C  CA    . PHE B 2 42  ? 19.164 10.524  32.361  1.00 27.63 ? 43   PHE B CA    1 
ATOM   1563 C  C     . PHE B 2 42  ? 18.630 9.157   32.820  1.00 27.28 ? 43   PHE B C     1 
ATOM   1564 O  O     . PHE B 2 42  ? 18.632 8.861   34.044  1.00 28.17 ? 43   PHE B O     1 
ATOM   1565 C  CB    . PHE B 2 42  ? 20.672 10.596  32.632  1.00 25.77 ? 43   PHE B CB    1 
ATOM   1566 C  CG    . PHE B 2 42  ? 21.425 9.472   32.028  1.00 28.59 ? 43   PHE B CG    1 
ATOM   1567 C  CD1   . PHE B 2 42  ? 21.593 9.407   30.659  1.00 29.86 ? 43   PHE B CD1   1 
ATOM   1568 C  CD2   . PHE B 2 42  ? 21.921 8.441   32.823  1.00 28.32 ? 43   PHE B CD2   1 
ATOM   1569 C  CE1   . PHE B 2 42  ? 22.321 8.363   30.083  1.00 31.96 ? 43   PHE B CE1   1 
ATOM   1570 C  CE2   . PHE B 2 42  ? 22.623 7.376   32.238  1.00 24.25 ? 43   PHE B CE2   1 
ATOM   1571 C  CZ    . PHE B 2 42  ? 22.838 7.356   30.871  1.00 27.53 ? 43   PHE B CZ    1 
ATOM   1572 N  N     . GLN B 2 43  ? 18.222 8.314   31.861  1.00 24.63 ? 44   GLN B N     1 
ATOM   1573 C  CA    . GLN B 2 43  ? 17.484 7.082   32.216  1.00 30.75 ? 44   GLN B CA    1 
ATOM   1574 C  C     . GLN B 2 43  ? 18.048 5.996   31.310  1.00 25.70 ? 44   GLN B C     1 
ATOM   1575 O  O     . GLN B 2 43  ? 18.274 6.253   30.122  1.00 24.33 ? 44   GLN B O     1 
ATOM   1576 C  CB    . GLN B 2 43  ? 15.980 7.244   31.902  1.00 23.36 ? 44   GLN B CB    1 
ATOM   1577 C  CG    . GLN B 2 43  ? 15.131 5.983   32.088  1.00 33.75 ? 44   GLN B CG    1 
ATOM   1578 C  CD    . GLN B 2 43  ? 13.668 6.302   31.802  1.00 32.62 ? 44   GLN B CD    1 
ATOM   1579 O  OE1   . GLN B 2 43  ? 12.907 6.623   32.709  1.00 40.24 ? 44   GLN B OE1   1 
ATOM   1580 N  NE2   . GLN B 2 43  ? 13.299 6.284   30.527  1.00 33.76 ? 44   GLN B NE2   1 
ATOM   1581 N  N     . VAL B 2 44  ? 18.206 4.793   31.855  1.00 22.13 ? 45   VAL B N     1 
ATOM   1582 C  CA    . VAL B 2 44  ? 18.511 3.665   31.006  1.00 21.91 ? 45   VAL B CA    1 
ATOM   1583 C  C     . VAL B 2 44  ? 17.518 2.594   31.427  1.00 22.91 ? 45   VAL B C     1 
ATOM   1584 O  O     . VAL B 2 44  ? 17.434 2.266   32.602  1.00 25.29 ? 45   VAL B O     1 
ATOM   1585 C  CB    . VAL B 2 44  ? 19.949 3.169   31.214  1.00 19.84 ? 45   VAL B CB    1 
ATOM   1586 C  CG1   . VAL B 2 44  ? 20.156 1.946   30.346  1.00 22.30 ? 45   VAL B CG1   1 
ATOM   1587 C  CG2   . VAL B 2 44  ? 21.017 4.298   30.892  1.00 24.01 ? 45   VAL B CG2   1 
ATOM   1588 N  N     . THR B 2 45  ? 16.743 2.106   30.474  1.00 25.03 ? 46   THR B N     1 
ATOM   1589 C  CA    . THR B 2 45  ? 15.666 1.139   30.778  1.00 23.15 ? 46   THR B CA    1 
ATOM   1590 C  C     . THR B 2 45  ? 16.139 -0.265  30.438  1.00 22.15 ? 46   THR B C     1 
ATOM   1591 O  O     . THR B 2 45  ? 16.846 -0.441  29.438  1.00 24.50 ? 46   THR B O     1 
ATOM   1592 C  CB    . THR B 2 45  ? 14.425 1.471   29.912  1.00 23.50 ? 46   THR B CB    1 
ATOM   1593 O  OG1   . THR B 2 45  ? 14.039 2.839   30.134  1.00 25.07 ? 46   THR B OG1   1 
ATOM   1594 C  CG2   . THR B 2 45  ? 13.239 0.556   30.279  1.00 23.93 ? 46   THR B CG2   1 
ATOM   1595 N  N     . GLN B 2 46  ? 15.722 -1.289  31.191  1.00 23.75 ? 47   GLN B N     1 
ATOM   1596 C  CA    . GLN B 2 46  ? 16.008 -2.654  30.759  1.00 24.93 ? 47   GLN B CA    1 
ATOM   1597 C  C     . GLN B 2 46  ? 15.022 -3.580  31.439  1.00 25.70 ? 47   GLN B C     1 
ATOM   1598 O  O     . GLN B 2 46  ? 14.621 -3.351  32.582  1.00 27.73 ? 47   GLN B O     1 
ATOM   1599 C  CB    . GLN B 2 46  ? 17.444 -3.079  31.142  1.00 23.04 ? 47   GLN B CB    1 
ATOM   1600 C  CG    . GLN B 2 46  ? 18.005 -4.274  30.351  1.00 20.86 ? 47   GLN B CG    1 
ATOM   1601 C  CD    . GLN B 2 46  ? 18.348 -3.994  28.886  1.00 26.27 ? 47   GLN B CD    1 
ATOM   1602 O  OE1   . GLN B 2 46  ? 18.678 -4.930  28.164  1.00 26.40 ? 47   GLN B OE1   1 
ATOM   1603 N  NE2   . GLN B 2 46  ? 18.293 -2.731  28.451  1.00 21.40 ? 47   GLN B NE2   1 
ATOM   1604 N  N     . LYS B 2 47  ? 14.619 -4.616  30.723  1.00 25.20 ? 48   LYS B N     1 
ATOM   1605 C  CA    . LYS B 2 47  ? 13.794 -5.685  31.303  1.00 26.98 ? 48   LYS B CA    1 
ATOM   1606 C  C     . LYS B 2 47  ? 14.331 -6.106  32.663  1.00 26.96 ? 48   LYS B C     1 
ATOM   1607 O  O     . LYS B 2 47  ? 15.549 -6.204  32.829  1.00 28.96 ? 48   LYS B O     1 
ATOM   1608 C  CB    . LYS B 2 47  ? 13.825 -6.864  30.319  1.00 29.85 ? 48   LYS B CB    1 
ATOM   1609 C  CG    . LYS B 2 47  ? 12.918 -8.000  30.723  1.00 28.50 ? 48   LYS B CG    1 
ATOM   1610 C  CD    . LYS B 2 47  ? 12.795 -8.978  29.577  1.00 42.78 ? 48   LYS B CD    1 
ATOM   1611 C  CE    . LYS B 2 47  ? 11.772 -10.074 29.968  1.00 34.94 ? 48   LYS B CE    1 
ATOM   1612 N  NZ    . LYS B 2 47  ? 11.840 -11.010 28.840  1.00 57.96 ? 48   LYS B NZ    1 
ATOM   1613 N  N     . THR B 2 48  ? 13.464 -6.360  33.644  1.00 28.86 ? 49   THR B N     1 
ATOM   1614 C  CA    . THR B 2 48  ? 13.920 -6.633  35.015  1.00 30.59 ? 49   THR B CA    1 
ATOM   1615 C  C     . THR B 2 48  ? 14.815 -7.864  35.175  1.00 30.91 ? 49   THR B C     1 
ATOM   1616 O  O     . THR B 2 48  ? 15.688 -7.929  36.072  1.00 30.41 ? 49   THR B O     1 
ATOM   1617 C  CB    . THR B 2 48  ? 12.708 -6.653  35.960  1.00 32.25 ? 49   THR B CB    1 
ATOM   1618 O  OG1   . THR B 2 48  ? 12.117 -5.354  35.894  1.00 31.70 ? 49   THR B OG1   1 
ATOM   1619 C  CG2   . THR B 2 48  ? 13.077 -6.980  37.436  1.00 34.36 ? 49   THR B CG2   1 
ATOM   1620 N  N     . GLN B 2 49  ? 14.668 -8.834  34.284  1.00 32.12 ? 50   GLN B N     1 
ATOM   1621 C  CA    . GLN B 2 49  ? 15.590 -9.945  34.356  1.00 36.94 ? 50   GLN B CA    1 
ATOM   1622 C  C     . GLN B 2 49  ? 17.044 -9.503  34.180  1.00 34.56 ? 50   GLN B C     1 
ATOM   1623 O  O     . GLN B 2 49  ? 17.959 -10.198 34.631  1.00 35.34 ? 50   GLN B O     1 
ATOM   1624 C  CB    . GLN B 2 49  ? 15.161 -11.117 33.462  1.00 40.33 ? 50   GLN B CB    1 
ATOM   1625 C  CG    . GLN B 2 49  ? 15.561 -11.039 32.037  1.00 46.25 ? 50   GLN B CG    1 
ATOM   1626 C  CD    . GLN B 2 49  ? 15.355 -12.365 31.286  1.00 49.10 ? 50   GLN B CD    1 
ATOM   1627 O  OE1   . GLN B 2 49  ? 14.255 -12.929 31.252  1.00 59.37 ? 50   GLN B OE1   1 
ATOM   1628 N  NE2   . GLN B 2 49  ? 16.426 -12.860 30.683  1.00 57.72 ? 50   GLN B NE2   1 
ATOM   1629 N  N     . ARG B 2 50  ? 17.265 -8.341  33.557  1.00 29.89 ? 51   ARG B N     1 
ATOM   1630 C  CA    . ARG B 2 50  ? 18.636 -7.861  33.315  1.00 29.29 ? 51   ARG B CA    1 
ATOM   1631 C  C     . ARG B 2 50  ? 18.912 -6.649  34.201  1.00 28.10 ? 51   ARG B C     1 
ATOM   1632 O  O     . ARG B 2 50  ? 19.795 -5.832  33.940  1.00 30.40 ? 51   ARG B O     1 
ATOM   1633 C  CB    . ARG B 2 50  ? 18.825 -7.501  31.845  1.00 26.15 ? 51   ARG B CB    1 
ATOM   1634 C  CG    . ARG B 2 50  ? 18.951 -8.743  30.942  1.00 26.73 ? 51   ARG B CG    1 
ATOM   1635 C  CD    . ARG B 2 50  ? 19.390 -8.342  29.518  1.00 29.87 ? 51   ARG B CD    1 
ATOM   1636 N  NE    . ARG B 2 50  ? 18.311 -7.626  28.842  1.00 27.59 ? 51   ARG B NE    1 
ATOM   1637 C  CZ    . ARG B 2 50  ? 17.253 -8.253  28.325  1.00 33.16 ? 51   ARG B CZ    1 
ATOM   1638 N  NH1   . ARG B 2 50  ? 17.177 -9.600  28.363  1.00 30.90 ? 51   ARG B NH1   1 
ATOM   1639 N  NH2   . ARG B 2 50  ? 16.293 -7.547  27.745  1.00 26.76 ? 51   ARG B NH2   1 
ATOM   1640 N  N     . ARG B 2 51  ? 18.172 -6.536  35.290  1.00 25.81 ? 52   ARG B N     1 
ATOM   1641 C  CA    . ARG B 2 51  ? 18.422 -5.472  36.234  1.00 28.61 ? 52   ARG B CA    1 
ATOM   1642 C  C     . ARG B 2 51  ? 19.877 -5.545  36.726  1.00 30.31 ? 52   ARG B C     1 
ATOM   1643 O  O     . ARG B 2 51  ? 20.463 -4.509  37.067  1.00 30.39 ? 52   ARG B O     1 
ATOM   1644 C  CB    . ARG B 2 51  ? 17.461 -5.680  37.392  1.00 34.53 ? 52   ARG B CB    1 
ATOM   1645 C  CG    . ARG B 2 51  ? 17.429 -4.591  38.335  1.00 42.62 ? 52   ARG B CG    1 
ATOM   1646 C  CD    . ARG B 2 51  ? 17.166 -5.198  39.682  1.00 46.10 ? 52   ARG B CD    1 
ATOM   1647 N  NE    . ARG B 2 51  ? 17.761 -4.226  40.558  1.00 47.35 ? 52   ARG B NE    1 
ATOM   1648 C  CZ    . ARG B 2 51  ? 17.069 -3.389  41.313  1.00 45.59 ? 52   ARG B CZ    1 
ATOM   1649 N  NH1   . ARG B 2 51  ? 15.747 -3.468  41.380  1.00 43.61 ? 52   ARG B NH1   1 
ATOM   1650 N  NH2   . ARG B 2 51  ? 17.724 -2.518  42.050  1.00 44.64 ? 52   ARG B NH2   1 
ATOM   1651 N  N     . TRP B 2 52  ? 20.484 -6.729  36.755  1.00 27.76 ? 53   TRP B N     1 
ATOM   1652 C  CA    . TRP B 2 52  ? 21.908 -6.802  37.170  1.00 29.77 ? 53   TRP B CA    1 
ATOM   1653 C  C     . TRP B 2 52  ? 22.797 -5.842  36.381  1.00 30.23 ? 53   TRP B C     1 
ATOM   1654 O  O     . TRP B 2 52  ? 23.760 -5.292  36.922  1.00 32.68 ? 53   TRP B O     1 
ATOM   1655 C  CB    . TRP B 2 52  ? 22.482 -8.227  37.049  1.00 33.41 ? 53   TRP B CB    1 
ATOM   1656 C  CG    . TRP B 2 52  ? 22.642 -8.710  35.612  1.00 34.02 ? 53   TRP B CG    1 
ATOM   1657 C  CD1   . TRP B 2 52  ? 21.708 -9.408  34.867  1.00 36.72 ? 53   TRP B CD1   1 
ATOM   1658 C  CD2   . TRP B 2 52  ? 23.792 -8.566  34.770  1.00 31.36 ? 53   TRP B CD2   1 
ATOM   1659 N  NE1   . TRP B 2 52  ? 22.208 -9.665  33.605  1.00 35.43 ? 53   TRP B NE1   1 
ATOM   1660 C  CE2   . TRP B 2 52  ? 23.482 -9.165  33.527  1.00 34.61 ? 53   TRP B CE2   1 
ATOM   1661 C  CE3   . TRP B 2 52  ? 25.047 -7.960  34.932  1.00 33.66 ? 53   TRP B CE3   1 
ATOM   1662 C  CZ2   . TRP B 2 52  ? 24.375 -9.166  32.452  1.00 36.49 ? 53   TRP B CZ2   1 
ATOM   1663 C  CZ3   . TRP B 2 52  ? 25.947 -7.998  33.876  1.00 37.03 ? 53   TRP B CZ3   1 
ATOM   1664 C  CH2   . TRP B 2 52  ? 25.604 -8.604  32.652  1.00 40.95 ? 53   TRP B CH2   1 
ATOM   1665 N  N     . PHE B 2 53  ? 22.469 -5.629  35.105  1.00 28.58 ? 54   PHE B N     1 
ATOM   1666 C  CA    . PHE B 2 53  ? 23.259 -4.763  34.249  1.00 27.86 ? 54   PHE B CA    1 
ATOM   1667 C  C     . PHE B 2 53  ? 23.128 -3.328  34.750  1.00 25.81 ? 54   PHE B C     1 
ATOM   1668 O  O     . PHE B 2 53  ? 24.104 -2.555  34.808  1.00 24.81 ? 54   PHE B O     1 
ATOM   1669 C  CB    . PHE B 2 53  ? 22.754 -4.947  32.813  1.00 28.78 ? 54   PHE B CB    1 
ATOM   1670 C  CG    . PHE B 2 53  ? 23.461 -4.105  31.795  1.00 33.82 ? 54   PHE B CG    1 
ATOM   1671 C  CD1   . PHE B 2 53  ? 23.065 -2.790  31.581  1.00 39.42 ? 54   PHE B CD1   1 
ATOM   1672 C  CD2   . PHE B 2 53  ? 24.474 -4.633  31.015  1.00 35.20 ? 54   PHE B CD2   1 
ATOM   1673 C  CE1   . PHE B 2 53  ? 23.692 -2.004  30.621  1.00 42.45 ? 54   PHE B CE1   1 
ATOM   1674 C  CE2   . PHE B 2 53  ? 25.081 -3.880  30.025  1.00 34.91 ? 54   PHE B CE2   1 
ATOM   1675 C  CZ    . PHE B 2 53  ? 24.702 -2.563  29.833  1.00 35.43 ? 54   PHE B CZ    1 
ATOM   1676 N  N     . LEU B 2 54  ? 21.914 -2.962  35.151  1.00 25.56 ? 55   LEU B N     1 
ATOM   1677 C  CA    . LEU B 2 54  ? 21.701 -1.618  35.706  1.00 26.90 ? 55   LEU B CA    1 
ATOM   1678 C  C     . LEU B 2 54  ? 22.342 -1.461  37.104  1.00 27.58 ? 55   LEU B C     1 
ATOM   1679 O  O     . LEU B 2 54  ? 22.888 -0.422  37.442  1.00 28.45 ? 55   LEU B O     1 
ATOM   1680 C  CB    . LEU B 2 54  ? 20.181 -1.309  35.732  1.00 27.28 ? 55   LEU B CB    1 
ATOM   1681 C  CG    . LEU B 2 54  ? 19.451 -1.442  34.371  1.00 23.36 ? 55   LEU B CG    1 
ATOM   1682 C  CD1   . LEU B 2 54  ? 17.908 -1.220  34.589  1.00 27.24 ? 55   LEU B CD1   1 
ATOM   1683 C  CD2   . LEU B 2 54  ? 19.995 -0.420  33.319  1.00 23.98 ? 55   LEU B CD2   1 
ATOM   1684 N  N     . ASP B 2 55  ? 22.282 -2.484  37.942  1.00 26.62 ? 56   ASP B N     1 
ATOM   1685 C  CA    . ASP B 2 55  ? 22.965 -2.430  39.239  1.00 27.87 ? 56   ASP B CA    1 
ATOM   1686 C  C     . ASP B 2 55  ? 24.481 -2.247  39.074  1.00 28.82 ? 56   ASP B C     1 
ATOM   1687 O  O     . ASP B 2 55  ? 25.099 -1.482  39.789  1.00 31.45 ? 56   ASP B O     1 
ATOM   1688 C  CB    . ASP B 2 55  ? 22.676 -3.697  40.057  1.00 30.14 ? 56   ASP B CB    1 
ATOM   1689 C  CG    . ASP B 2 55  ? 21.196 -3.807  40.461  1.00 33.34 ? 56   ASP B CG    1 
ATOM   1690 O  OD1   . ASP B 2 55  ? 20.518 -2.746  40.582  1.00 34.74 ? 56   ASP B OD1   1 
ATOM   1691 O  OD2   . ASP B 2 55  ? 20.719 -4.954  40.649  1.00 35.65 ? 56   ASP B OD2   1 
ATOM   1692 N  N     . LYS B 2 56  ? 25.091 -2.936  38.128  1.00 27.17 ? 57   LYS B N     1 
ATOM   1693 C  CA    . LYS B 2 56  ? 26.503 -2.687  37.854  1.00 31.54 ? 57   LYS B CA    1 
ATOM   1694 C  C     . LYS B 2 56  ? 26.749 -1.269  37.315  1.00 31.66 ? 57   LYS B C     1 
ATOM   1695 O  O     . LYS B 2 56  ? 27.765 -0.664  37.616  1.00 33.91 ? 57   LYS B O     1 
ATOM   1696 C  CB    . LYS B 2 56  ? 27.006 -3.763  36.881  1.00 34.44 ? 57   LYS B CB    1 
ATOM   1697 C  CG    . LYS B 2 56  ? 28.424 -3.598  36.394  1.00 46.52 ? 57   LYS B CG    1 
ATOM   1698 C  CD    . LYS B 2 56  ? 29.407 -4.361  37.260  1.00 57.58 ? 57   LYS B CD    1 
ATOM   1699 C  CE    . LYS B 2 56  ? 30.840 -3.846  37.028  1.00 60.11 ? 57   LYS B CE    1 
ATOM   1700 N  NZ    . LYS B 2 56  ? 31.280 -2.900  38.086  1.00 55.84 ? 57   LYS B NZ    1 
ATOM   1701 N  N     . LEU B 2 57  ? 25.835 -0.709  36.532  1.00 28.02 ? 58   LEU B N     1 
ATOM   1702 C  CA    . LEU B 2 57  ? 26.009 0.646   36.048  1.00 30.68 ? 58   LEU B CA    1 
ATOM   1703 C  C     . LEU B 2 57  ? 26.026 1.672   37.192  1.00 30.01 ? 58   LEU B C     1 
ATOM   1704 O  O     . LEU B 2 57  ? 26.788 2.663   37.158  1.00 30.28 ? 58   LEU B O     1 
ATOM   1705 C  CB    . LEU B 2 57  ? 24.842 0.987   35.130  1.00 32.98 ? 58   LEU B CB    1 
ATOM   1706 C  CG    . LEU B 2 57  ? 24.989 1.743   33.816  1.00 41.60 ? 58   LEU B CG    1 
ATOM   1707 C  CD1   . LEU B 2 57  ? 23.731 2.511   33.430  1.00 41.37 ? 58   LEU B CD1   1 
ATOM   1708 C  CD2   . LEU B 2 57  ? 26.257 2.527   33.613  1.00 39.01 ? 58   LEU B CD2   1 
ATOM   1709 N  N     . VAL B 2 58  ? 25.143 1.493   38.172  1.00 27.97 ? 59   VAL B N     1 
ATOM   1710 C  CA    . VAL B 2 58  ? 25.126 2.378   39.345  1.00 30.75 ? 59   VAL B CA    1 
ATOM   1711 C  C     . VAL B 2 58  ? 26.512 2.335   40.033  1.00 31.41 ? 59   VAL B C     1 
ATOM   1712 O  O     . VAL B 2 58  ? 27.061 3.381   40.417  1.00 31.03 ? 59   VAL B O     1 
ATOM   1713 C  CB    . VAL B 2 58  ? 24.148 1.850   40.427  1.00 34.34 ? 59   VAL B CB    1 
ATOM   1714 C  CG1   . VAL B 2 58  ? 24.415 2.543   41.736  1.00 40.94 ? 59   VAL B CG1   1 
ATOM   1715 C  CG2   . VAL B 2 58  ? 22.718 2.147   40.074  1.00 33.56 ? 59   VAL B CG2   1 
ATOM   1716 N  N     . ASP B 2 59  ? 27.077 1.137   40.198  1.00 33.64 ? 60   ASP B N     1 
ATOM   1717 C  CA    . ASP B 2 59  ? 28.442 1.018   40.769  1.00 34.75 ? 60   ASP B CA    1 
ATOM   1718 C  C     . ASP B 2 59  ? 29.472 1.799   39.926  1.00 36.02 ? 60   ASP B C     1 
ATOM   1719 O  O     . ASP B 2 59  ? 30.358 2.496   40.441  1.00 36.25 ? 60   ASP B O     1 
ATOM   1720 C  CB    . ASP B 2 59  ? 28.841 -0.462  40.781  1.00 33.67 ? 60   ASP B CB    1 
ATOM   1721 C  CG    . ASP B 2 59  ? 30.220 -0.682  41.363  1.00 41.34 ? 60   ASP B CG    1 
ATOM   1722 O  OD1   . ASP B 2 59  ? 30.469 -0.204  42.488  1.00 46.00 ? 60   ASP B OD1   1 
ATOM   1723 O  OD2   . ASP B 2 59  ? 31.052 -1.308  40.678  1.00 52.87 ? 60   ASP B OD2   1 
ATOM   1724 N  N     . GLU B 2 60  ? 29.371 1.668   38.610  1.00 33.66 ? 61   GLU B N     1 
ATOM   1725 C  CA    . GLU B 2 60  ? 30.386 2.256   37.755  1.00 34.75 ? 61   GLU B CA    1 
ATOM   1726 C  C     . GLU B 2 60  ? 30.269 3.763   37.629  1.00 34.42 ? 61   GLU B C     1 
ATOM   1727 O  O     . GLU B 2 60  ? 31.279 4.469   37.578  1.00 35.06 ? 61   GLU B O     1 
ATOM   1728 C  CB    . GLU B 2 60  ? 30.342 1.621   36.387  1.00 33.37 ? 61   GLU B CB    1 
ATOM   1729 C  CG    . GLU B 2 60  ? 30.777 0.159   36.433  1.00 36.84 ? 61   GLU B CG    1 
ATOM   1730 C  CD    . GLU B 2 60  ? 30.689 -0.438  35.062  1.00 53.89 ? 61   GLU B CD    1 
ATOM   1731 O  OE1   . GLU B 2 60  ? 29.645 -0.229  34.395  1.00 58.48 ? 61   GLU B OE1   1 
ATOM   1732 O  OE2   . GLU B 2 60  ? 31.673 -1.078  34.636  1.00 65.77 ? 61   GLU B OE2   1 
ATOM   1733 N  N     . ILE B 2 61  ? 29.046 4.262   37.526  1.00 34.71 ? 62   ILE B N     1 
ATOM   1734 C  CA    . ILE B 2 61  ? 28.801 5.710   37.520  1.00 31.29 ? 62   ILE B CA    1 
ATOM   1735 C  C     . ILE B 2 61  ? 28.999 6.307   38.923  1.00 33.89 ? 62   ILE B C     1 
ATOM   1736 O  O     . ILE B 2 61  ? 29.476 7.435   39.067  1.00 32.85 ? 62   ILE B O     1 
ATOM   1737 C  CB    . ILE B 2 61  ? 27.392 6.051   36.919  1.00 31.67 ? 62   ILE B CB    1 
ATOM   1738 C  CG1   . ILE B 2 61  ? 27.320 5.636   35.434  1.00 29.57 ? 62   ILE B CG1   1 
ATOM   1739 C  CG2   . ILE B 2 61  ? 27.057 7.558   37.099  1.00 32.34 ? 62   ILE B CG2   1 
ATOM   1740 C  CD1   . ILE B 2 61  ? 25.975 5.775   34.730  1.00 31.72 ? 62   ILE B CD1   1 
ATOM   1741 N  N     . GLY B 2 62  ? 28.629 5.563   39.963  1.00 31.04 ? 63   GLY B N     1 
ATOM   1742 C  CA    . GLY B 2 62  ? 28.976 5.966   41.320  1.00 31.59 ? 63   GLY B CA    1 
ATOM   1743 C  C     . GLY B 2 62  ? 27.898 6.836   41.906  1.00 34.52 ? 63   GLY B C     1 
ATOM   1744 O  O     . GLY B 2 62  ? 28.023 7.311   43.022  1.00 34.99 ? 63   GLY B O     1 
ATOM   1745 N  N     . VAL B 2 63  ? 26.812 7.049   41.167  1.00 34.94 ? 64   VAL B N     1 
ATOM   1746 C  CA    . VAL B 2 63  ? 25.740 7.915   41.633  1.00 33.95 ? 64   VAL B CA    1 
ATOM   1747 C  C     . VAL B 2 63  ? 24.515 7.471   40.793  1.00 33.36 ? 64   VAL B C     1 
ATOM   1748 O  O     . VAL B 2 63  ? 24.681 6.771   39.782  1.00 29.85 ? 64   VAL B O     1 
ATOM   1749 C  CB    . VAL B 2 63  ? 26.165 9.398   41.398  1.00 36.12 ? 64   VAL B CB    1 
ATOM   1750 C  CG1   . VAL B 2 63  ? 26.317 9.728   39.908  1.00 34.10 ? 64   VAL B CG1   1 
ATOM   1751 C  CG2   . VAL B 2 63  ? 25.244 10.363  42.119  1.00 44.50 ? 64   VAL B CG2   1 
ATOM   1752 N  N     . GLY B 2 64  ? 23.308 7.796   41.264  1.00 31.53 ? 65   GLY B N     1 
ATOM   1753 C  CA    . GLY B 2 64  ? 22.056 7.397   40.603  1.00 29.19 ? 65   GLY B CA    1 
ATOM   1754 C  C     . GLY B 2 64  ? 21.559 6.133   41.278  1.00 32.12 ? 65   GLY B C     1 
ATOM   1755 O  O     . GLY B 2 64  ? 22.146 5.670   42.266  1.00 31.53 ? 65   GLY B O     1 
ATOM   1756 N  N     . TYR B 2 65  ? 20.496 5.529   40.763  1.00 29.48 ? 66   TYR B N     1 
ATOM   1757 C  CA    . TYR B 2 65  ? 19.874 4.424   41.484  1.00 28.81 ? 66   TYR B CA    1 
ATOM   1758 C  C     . TYR B 2 65  ? 19.009 3.668   40.470  1.00 28.13 ? 66   TYR B C     1 
ATOM   1759 O  O     . TYR B 2 65  ? 18.788 4.147   39.347  1.00 27.82 ? 66   TYR B O     1 
ATOM   1760 C  CB    . TYR B 2 65  ? 19.058 5.008   42.668  1.00 33.21 ? 66   TYR B CB    1 
ATOM   1761 C  CG    . TYR B 2 65  ? 17.956 5.996   42.257  1.00 35.32 ? 66   TYR B CG    1 
ATOM   1762 C  CD1   . TYR B 2 65  ? 18.197 7.377   42.154  1.00 35.93 ? 66   TYR B CD1   1 
ATOM   1763 C  CD2   . TYR B 2 65  ? 16.675 5.528   41.921  1.00 37.40 ? 66   TYR B CD2   1 
ATOM   1764 C  CE1   . TYR B 2 65  ? 17.179 8.263   41.725  1.00 35.97 ? 66   TYR B CE1   1 
ATOM   1765 C  CE2   . TYR B 2 65  ? 15.658 6.401   41.527  1.00 36.41 ? 66   TYR B CE2   1 
ATOM   1766 C  CZ    . TYR B 2 65  ? 15.905 7.757   41.433  1.00 40.27 ? 66   TYR B CZ    1 
ATOM   1767 O  OH    . TYR B 2 65  ? 14.877 8.593   41.017  1.00 38.38 ? 66   TYR B OH    1 
ATOM   1768 N  N     . VAL B 2 66  ? 18.591 2.462   40.834  1.00 28.92 ? 67   VAL B N     1 
ATOM   1769 C  CA    . VAL B 2 66  ? 17.828 1.584   39.960  1.00 29.15 ? 67   VAL B CA    1 
ATOM   1770 C  C     . VAL B 2 66  ? 16.489 1.358   40.618  1.00 31.25 ? 67   VAL B C     1 
ATOM   1771 O  O     . VAL B 2 66  ? 16.429 1.124   41.816  1.00 31.52 ? 67   VAL B O     1 
ATOM   1772 C  CB    . VAL B 2 66  ? 18.503 0.204   39.762  1.00 29.97 ? 67   VAL B CB    1 
ATOM   1773 C  CG1   . VAL B 2 66  ? 17.646 -0.681  38.857  1.00 28.45 ? 67   VAL B CG1   1 
ATOM   1774 C  CG2   . VAL B 2 66  ? 19.880 0.369   39.114  1.00 30.11 ? 67   VAL B CG2   1 
ATOM   1775 N  N     . ARG B 2 67  ? 15.411 1.465   39.860  1.00 34.80 ? 68   ARG B N     1 
ATOM   1776 C  CA    . ARG B 2 67  ? 14.060 1.250   40.385  1.00 39.90 ? 68   ARG B CA    1 
ATOM   1777 C  C     . ARG B 2 67  ? 13.394 0.229   39.482  1.00 36.12 ? 68   ARG B C     1 
ATOM   1778 O  O     . ARG B 2 67  ? 13.622 0.248   38.272  1.00 31.57 ? 68   ARG B O     1 
ATOM   1779 C  CB    . ARG B 2 67  ? 13.268 2.567   40.307  1.00 39.03 ? 68   ARG B CB    1 
ATOM   1780 C  CG    . ARG B 2 67  ? 13.141 3.203   41.688  1.00 53.40 ? 68   ARG B CG    1 
ATOM   1781 C  CD    . ARG B 2 67  ? 12.043 4.317   41.785  1.00 55.41 ? 68   ARG B CD    1 
ATOM   1782 N  NE    . ARG B 2 67  ? 10.634 3.891   41.746  1.00 70.68 ? 68   ARG B NE    1 
ATOM   1783 C  CZ    . ARG B 2 67  ? 9.857  3.696   42.816  1.00 76.93 ? 68   ARG B CZ    1 
ATOM   1784 N  NH1   . ARG B 2 67  ? 10.343 3.822   44.049  1.00 78.70 ? 68   ARG B NH1   1 
ATOM   1785 N  NH2   . ARG B 2 67  ? 8.582  3.354   42.656  1.00 76.17 ? 68   ARG B NH2   1 
ATOM   1786 N  N     . ASP B 2 68  ? 12.582 -0.653  40.058  1.00 38.26 ? 69   ASP B N     1 
ATOM   1787 C  CA    . ASP B 2 68  ? 11.733 -1.559  39.277  1.00 44.47 ? 69   ASP B CA    1 
ATOM   1788 C  C     . ASP B 2 68  ? 10.367 -0.953  39.027  1.00 46.65 ? 69   ASP B C     1 
ATOM   1789 O  O     . ASP B 2 68  ? 9.793  -0.346  39.926  1.00 46.45 ? 69   ASP B O     1 
ATOM   1790 N  N     . SER B 2 69  ? 9.875  -1.089  37.798  1.00 47.32 ? 70   SER B N     1 
ATOM   1791 C  CA    . SER B 2 69  ? 8.497  -0.781  37.423  1.00 52.37 ? 70   SER B CA    1 
ATOM   1792 C  C     . SER B 2 69  ? 7.955  -2.060  36.787  1.00 51.91 ? 70   SER B C     1 
ATOM   1793 O  O     . SER B 2 69  ? 7.834  -2.168  35.549  1.00 56.48 ? 70   SER B O     1 
ATOM   1794 C  CB    . SER B 2 69  ? 8.452  0.371   36.402  1.00 52.14 ? 70   SER B CB    1 
ATOM   1795 O  OG    . SER B 2 69  ? 9.151  1.514   36.874  1.00 62.96 ? 70   SER B OG    1 
ATOM   1796 N  N     . GLY B 2 70  ? 7.746  -3.054  37.648  1.00 50.98 ? 71   GLY B N     1 
ATOM   1797 C  CA    . GLY B 2 70  ? 7.278  -4.391  37.282  1.00 47.18 ? 71   GLY B CA    1 
ATOM   1798 C  C     . GLY B 2 70  ? 8.126  -5.055  36.224  1.00 44.85 ? 71   GLY B C     1 
ATOM   1799 O  O     . GLY B 2 70  ? 9.194  -5.629  36.511  1.00 45.42 ? 71   GLY B O     1 
ATOM   1800 N  N     . SER B 2 71  ? 7.644  -4.943  34.991  1.00 40.98 ? 72   SER B N     1 
ATOM   1801 C  CA    . SER B 2 71  ? 8.206  -5.645  33.853  1.00 41.55 ? 72   SER B CA    1 
ATOM   1802 C  C     . SER B 2 71  ? 9.667  -5.200  33.528  1.00 36.54 ? 72   SER B C     1 
ATOM   1803 O  O     . SER B 2 71  ? 10.556 -5.948  33.025  1.00 30.22 ? 72   SER B O     1 
ATOM   1804 C  CB    . SER B 2 71  ? 7.302  -5.277  32.678  1.00 44.39 ? 72   SER B CB    1 
ATOM   1805 O  OG    . SER B 2 71  ? 7.701  -6.025  31.549  1.00 49.12 ? 72   SER B OG    1 
ATOM   1806 N  N     . VAL B 2 72  ? 9.881  -3.919  33.751  1.00 33.42 ? 73   VAL B N     1 
ATOM   1807 C  CA    . VAL B 2 72  ? 11.159 -3.308  33.405  1.00 32.76 ? 73   VAL B CA    1 
ATOM   1808 C  C     . VAL B 2 72  ? 11.722 -2.552  34.589  1.00 31.84 ? 73   VAL B C     1 
ATOM   1809 O  O     . VAL B 2 72  ? 11.007 -2.225  35.548  1.00 30.87 ? 73   VAL B O     1 
ATOM   1810 C  CB    . VAL B 2 72  ? 11.087 -2.432  32.129  1.00 33.26 ? 73   VAL B CB    1 
ATOM   1811 C  CG1   . VAL B 2 72  ? 10.230 -3.143  31.076  1.00 37.26 ? 73   VAL B CG1   1 
ATOM   1812 C  CG2   . VAL B 2 72  ? 10.546 -1.065  32.452  1.00 37.37 ? 73   VAL B CG2   1 
ATOM   1813 N  N     . SER B 2 73  ? 13.013 -2.257  34.526  1.00 28.44 ? 74   SER B N     1 
ATOM   1814 C  CA    . SER B 2 73  ? 13.678 -1.477  35.579  1.00 29.08 ? 74   SER B CA    1 
ATOM   1815 C  C     . SER B 2 73  ? 14.362 -0.310  34.881  1.00 25.43 ? 74   SER B C     1 
ATOM   1816 O  O     . SER B 2 73  ? 14.560 -0.360  33.655  1.00 25.85 ? 74   SER B O     1 
ATOM   1817 C  CB    . SER B 2 73  ? 14.713 -2.368  36.276  1.00 28.28 ? 74   SER B CB    1 
ATOM   1818 O  OG    . SER B 2 73  ? 14.027 -3.422  36.956  1.00 31.06 ? 74   SER B OG    1 
ATOM   1819 N  N     . ASN B 2 74  ? 14.708 0.739   35.631  1.00 25.63 ? 75   ASN B N     1 
ATOM   1820 C  CA    . ASN B 2 74  ? 15.447 1.842   35.038  1.00 25.38 ? 75   ASN B CA    1 
ATOM   1821 C  C     . ASN B 2 74  ? 16.555 2.258   35.975  1.00 29.12 ? 75   ASN B C     1 
ATOM   1822 O  O     . ASN B 2 74  ? 16.354 2.316   37.191  1.00 27.32 ? 75   ASN B O     1 
ATOM   1823 C  CB    . ASN B 2 74  ? 14.516 3.063   34.862  1.00 29.40 ? 75   ASN B CB    1 
ATOM   1824 C  CG    . ASN B 2 74  ? 13.541 2.868   33.735  1.00 33.06 ? 75   ASN B CG    1 
ATOM   1825 O  OD1   . ASN B 2 74  ? 12.446 2.351   33.941  1.00 40.78 ? 75   ASN B OD1   1 
ATOM   1826 N  ND2   . ASN B 2 74  ? 13.943 3.244   32.536  1.00 33.76 ? 75   ASN B ND2   1 
ATOM   1827 N  N     . TYR B 2 75  ? 17.729 2.544   35.410  1.00 26.92 ? 76   TYR B N     1 
ATOM   1828 C  CA    . TYR B 2 75  ? 18.727 3.376   36.070  1.00 26.22 ? 76   TYR B CA    1 
ATOM   1829 C  C     . TYR B 2 75  ? 18.371 4.848   35.864  1.00 26.68 ? 76   TYR B C     1 
ATOM   1830 O  O     . TYR B 2 75  ? 18.075 5.278   34.744  1.00 27.08 ? 76   TYR B O     1 
ATOM   1831 C  CB    . TYR B 2 75  ? 20.111 3.134   35.408  1.00 26.36 ? 76   TYR B CB    1 
ATOM   1832 C  CG    . TYR B 2 75  ? 21.119 4.144   35.927  1.00 28.14 ? 76   TYR B CG    1 
ATOM   1833 C  CD1   . TYR B 2 75  ? 21.707 3.974   37.173  1.00 30.80 ? 76   TYR B CD1   1 
ATOM   1834 C  CD2   . TYR B 2 75  ? 21.456 5.282   35.176  1.00 23.82 ? 76   TYR B CD2   1 
ATOM   1835 C  CE1   . TYR B 2 75  ? 22.614 4.935   37.657  1.00 27.34 ? 76   TYR B CE1   1 
ATOM   1836 C  CE2   . TYR B 2 75  ? 22.337 6.241   35.661  1.00 27.36 ? 76   TYR B CE2   1 
ATOM   1837 C  CZ    . TYR B 2 75  ? 22.911 6.056   36.898  1.00 27.16 ? 76   TYR B CZ    1 
ATOM   1838 O  OH    . TYR B 2 75  ? 23.803 6.993   37.376  1.00 27.25 ? 76   TYR B OH    1 
ATOM   1839 N  N     . ILE B 2 76  ? 18.384 5.625   36.943  1.00 23.65 ? 77   ILE B N     1 
ATOM   1840 C  CA    . ILE B 2 76  ? 17.998 7.031   36.877  1.00 25.03 ? 77   ILE B CA    1 
ATOM   1841 C  C     . ILE B 2 76  ? 19.077 7.887   37.481  1.00 26.30 ? 77   ILE B C     1 
ATOM   1842 O  O     . ILE B 2 76  ? 19.613 7.538   38.549  1.00 27.04 ? 77   ILE B O     1 
ATOM   1843 C  CB    . ILE B 2 76  ? 16.699 7.287   37.693  1.00 29.57 ? 77   ILE B CB    1 
ATOM   1844 C  CG1   . ILE B 2 76  ? 15.511 6.649   36.942  1.00 40.19 ? 77   ILE B CG1   1 
ATOM   1845 C  CG2   . ILE B 2 76  ? 16.370 8.791   37.757  1.00 34.72 ? 77   ILE B CG2   1 
ATOM   1846 C  CD1   . ILE B 2 76  ? 14.774 5.717   37.844  1.00 51.56 ? 77   ILE B CD1   1 
ATOM   1847 N  N     . LEU B 2 77  ? 19.467 8.945   36.770  1.00 24.53 ? 78   LEU B N     1 
ATOM   1848 C  CA    . LEU B 2 77  ? 20.328 9.949   37.397  1.00 29.52 ? 78   LEU B CA    1 
ATOM   1849 C  C     . LEU B 2 77  ? 19.705 11.323  37.159  1.00 30.00 ? 78   LEU B C     1 
ATOM   1850 O  O     . LEU B 2 77  ? 19.530 11.729  36.008  1.00 28.31 ? 78   LEU B O     1 
ATOM   1851 C  CB    . LEU B 2 77  ? 21.743 9.866   36.790  1.00 25.29 ? 78   LEU B CB    1 
ATOM   1852 C  CG    . LEU B 2 77  ? 22.734 10.959  37.204  1.00 27.99 ? 78   LEU B CG    1 
ATOM   1853 C  CD1   . LEU B 2 77  ? 23.009 10.860  38.697  1.00 26.34 ? 78   LEU B CD1   1 
ATOM   1854 C  CD2   . LEU B 2 77  ? 24.061 10.737  36.445  1.00 28.32 ? 78   LEU B CD2   1 
ATOM   1855 N  N     . SER B 2 78  ? 19.398 12.036  38.245  1.00 32.24 ? 79   SER B N     1 
ATOM   1856 C  CA    . SER B 2 78  ? 18.767 13.355  38.190  1.00 38.39 ? 79   SER B CA    1 
ATOM   1857 C  C     . SER B 2 78  ? 19.546 14.429  38.933  1.00 36.59 ? 79   SER B C     1 
ATOM   1858 O  O     . SER B 2 78  ? 19.518 15.591  38.541  1.00 38.19 ? 79   SER B O     1 
ATOM   1859 C  CB    . SER B 2 78  ? 17.354 13.313  38.801  1.00 40.11 ? 79   SER B CB    1 
ATOM   1860 O  OG    . SER B 2 78  ? 16.512 12.669  37.878  1.00 52.65 ? 79   SER B OG    1 
ATOM   1861 N  N     . GLU B 2 79  ? 20.244 14.054  39.997  1.00 34.62 ? 80   GLU B N     1 
ATOM   1862 C  CA    . GLU B 2 79  ? 20.899 15.085  40.799  1.00 34.17 ? 80   GLU B CA    1 
ATOM   1863 C  C     . GLU B 2 79  ? 21.752 15.994  39.882  1.00 32.89 ? 80   GLU B C     1 
ATOM   1864 O  O     . GLU B 2 79  ? 22.573 15.497  39.097  1.00 34.50 ? 80   GLU B O     1 
ATOM   1865 C  CB    . GLU B 2 79  ? 21.721 14.396  41.878  1.00 36.16 ? 80   GLU B CB    1 
ATOM   1866 C  CG    . GLU B 2 79  ? 22.243 15.361  42.933  1.00 45.01 ? 80   GLU B CG    1 
ATOM   1867 C  CD    . GLU B 2 79  ? 23.101 14.645  43.957  1.00 51.64 ? 80   GLU B CD    1 
ATOM   1868 O  OE1   . GLU B 2 79  ? 22.948 13.397  44.119  1.00 51.27 ? 80   GLU B OE1   1 
ATOM   1869 O  OE2   . GLU B 2 79  ? 23.926 15.338  44.585  1.00 54.62 ? 80   GLU B OE2   1 
ATOM   1870 N  N     . ILE B 2 80  ? 21.557 17.306  39.935  1.00 32.89 ? 81   ILE B N     1 
ATOM   1871 C  CA    . ILE B 2 80  ? 22.083 18.188  38.897  1.00 33.61 ? 81   ILE B CA    1 
ATOM   1872 C  C     . ILE B 2 80  ? 23.610 18.168  38.764  1.00 34.03 ? 81   ILE B C     1 
ATOM   1873 O  O     . ILE B 2 80  ? 24.138 18.086  37.654  1.00 34.33 ? 81   ILE B O     1 
ATOM   1874 C  CB    . ILE B 2 80  ? 21.640 19.666  39.075  1.00 37.44 ? 81   ILE B CB    1 
ATOM   1875 C  CG1   . ILE B 2 80  ? 20.170 19.809  38.706  1.00 45.01 ? 81   ILE B CG1   1 
ATOM   1876 C  CG2   . ILE B 2 80  ? 22.288 20.534  38.025  1.00 39.31 ? 81   ILE B CG2   1 
ATOM   1877 C  CD1   . ILE B 2 80  ? 19.969 19.726  37.184  1.00 53.62 ? 81   ILE B CD1   1 
ATOM   1878 N  N     . LYS B 2 81  ? 24.352 18.274  39.857  1.00 32.73 ? 82   LYS B N     1 
ATOM   1879 C  CA    . LYS B 2 81  ? 25.807 18.343  39.679  1.00 37.85 ? 82   LYS B CA    1 
ATOM   1880 C  C     . LYS B 2 81  ? 26.415 17.054  39.126  1.00 32.97 ? 82   LYS B C     1 
ATOM   1881 O  O     . LYS B 2 81  ? 27.260 17.113  38.203  1.00 32.23 ? 82   LYS B O     1 
ATOM   1882 C  CB    . LYS B 2 81  ? 26.501 18.750  40.987  1.00 40.91 ? 82   LYS B CB    1 
ATOM   1883 C  CG    . LYS B 2 81  ? 25.944 20.049  41.563  1.00 48.39 ? 82   LYS B CG    1 
ATOM   1884 C  CD    . LYS B 2 81  ? 26.768 20.616  42.718  1.00 48.06 ? 82   LYS B CD    1 
ATOM   1885 C  CE    . LYS B 2 81  ? 26.232 22.027  43.076  1.00 61.34 ? 82   LYS B CE    1 
ATOM   1886 N  NZ    . LYS B 2 81  ? 26.871 22.677  44.272  1.00 70.09 ? 82   LYS B NZ    1 
ATOM   1887 N  N     . PRO B 2 82  ? 26.078 15.894  39.724  1.00 29.07 ? 83   PRO B N     1 
ATOM   1888 C  CA    . PRO B 2 82  ? 26.605 14.683  39.109  1.00 30.13 ? 83   PRO B CA    1 
ATOM   1889 C  C     . PRO B 2 82  ? 26.097 14.401  37.703  1.00 32.22 ? 83   PRO B C     1 
ATOM   1890 O  O     . PRO B 2 82  ? 26.830 13.773  36.896  1.00 31.09 ? 83   PRO B O     1 
ATOM   1891 C  CB    . PRO B 2 82  ? 26.247 13.576  40.102  1.00 30.05 ? 83   PRO B CB    1 
ATOM   1892 C  CG    . PRO B 2 82  ? 25.131 14.093  40.851  1.00 30.05 ? 83   PRO B CG    1 
ATOM   1893 C  CD    . PRO B 2 82  ? 25.385 15.587  40.975  1.00 30.50 ? 83   PRO B CD    1 
ATOM   1894 N  N     . LEU B 2 83  ? 24.872 14.854  37.405  1.00 30.70 ? 84   LEU B N     1 
ATOM   1895 C  CA    . LEU B 2 83  ? 24.335 14.713  36.040  1.00 28.39 ? 84   LEU B CA    1 
ATOM   1896 C  C     . LEU B 2 83  ? 25.171 15.537  35.073  1.00 29.09 ? 84   LEU B C     1 
ATOM   1897 O  O     . LEU B 2 83  ? 25.575 15.064  33.997  1.00 29.41 ? 84   LEU B O     1 
ATOM   1898 C  CB    . LEU B 2 83  ? 22.862 15.123  35.972  1.00 31.70 ? 84   LEU B CB    1 
ATOM   1899 C  CG    . LEU B 2 83  ? 22.223 15.067  34.584  1.00 27.04 ? 84   LEU B CG    1 
ATOM   1900 C  CD1   . LEU B 2 83  ? 22.292 13.623  34.058  1.00 25.75 ? 84   LEU B CD1   1 
ATOM   1901 C  CD2   . LEU B 2 83  ? 20.748 15.537  34.727  1.00 31.26 ? 84   LEU B CD2   1 
ATOM   1902 N  N     . HIS B 2 84  ? 25.498 16.749  35.484  1.00 25.21 ? 85   HIS B N     1 
ATOM   1903 C  CA    . HIS B 2 84  ? 26.392 17.587  34.668  1.00 30.22 ? 85   HIS B CA    1 
ATOM   1904 C  C     . HIS B 2 84  ? 27.775 16.937  34.439  1.00 30.85 ? 85   HIS B C     1 
ATOM   1905 O  O     . HIS B 2 84  ? 28.323 16.904  33.320  1.00 30.71 ? 85   HIS B O     1 
ATOM   1906 C  CB    . HIS B 2 84  ? 26.598 18.925  35.382  1.00 30.49 ? 85   HIS B CB    1 
ATOM   1907 C  CG    . HIS B 2 84  ? 27.233 19.954  34.506  1.00 41.29 ? 85   HIS B CG    1 
ATOM   1908 N  ND1   . HIS B 2 84  ? 28.596 20.149  34.453  1.00 54.84 ? 85   HIS B ND1   1 
ATOM   1909 C  CD2   . HIS B 2 84  ? 26.694 20.809  33.604  1.00 51.89 ? 85   HIS B CD2   1 
ATOM   1910 C  CE1   . HIS B 2 84  ? 28.872 21.093  33.569  1.00 57.19 ? 85   HIS B CE1   1 
ATOM   1911 N  NE2   . HIS B 2 84  ? 27.735 21.508  33.037  1.00 59.55 ? 85   HIS B NE2   1 
ATOM   1912 N  N     . ASN B 2 85  ? 28.361 16.440  35.520  1.00 30.08 ? 86   ASN B N     1 
ATOM   1913 C  CA    . ASN B 2 85  ? 29.690 15.858  35.405  1.00 33.03 ? 86   ASN B CA    1 
ATOM   1914 C  C     . ASN B 2 85  ? 29.666 14.675  34.468  1.00 31.97 ? 86   ASN B C     1 
ATOM   1915 O  O     . ASN B 2 85  ? 30.575 14.508  33.672  1.00 32.60 ? 86   ASN B O     1 
ATOM   1916 C  CB    . ASN B 2 85  ? 30.212 15.384  36.757  1.00 34.55 ? 86   ASN B CB    1 
ATOM   1917 C  CG    . ASN B 2 85  ? 31.594 14.730  36.644  1.00 38.20 ? 86   ASN B CG    1 
ATOM   1918 O  OD1   . ASN B 2 85  ? 32.564 15.328  36.139  1.00 37.89 ? 86   ASN B OD1   1 
ATOM   1919 N  ND2   . ASN B 2 85  ? 31.678 13.480  37.094  1.00 37.36 ? 86   ASN B ND2   1 
ATOM   1920 N  N     . PHE B 2 86  ? 28.643 13.833  34.605  1.00 32.76 ? 87   PHE B N     1 
ATOM   1921 C  CA    . PHE B 2 86  ? 28.519 12.607  33.822  1.00 30.32 ? 87   PHE B CA    1 
ATOM   1922 C  C     . PHE B 2 86  ? 28.273 12.931  32.349  1.00 29.21 ? 87   PHE B C     1 
ATOM   1923 O  O     . PHE B 2 86  ? 28.995 12.449  31.446  1.00 29.79 ? 87   PHE B O     1 
ATOM   1924 C  CB    . PHE B 2 86  ? 27.370 11.730  34.386  1.00 27.94 ? 87   PHE B CB    1 
ATOM   1925 C  CG    . PHE B 2 86  ? 27.040 10.571  33.508  1.00 29.58 ? 87   PHE B CG    1 
ATOM   1926 C  CD1   . PHE B 2 86  ? 27.924 9.511   33.392  1.00 30.45 ? 87   PHE B CD1   1 
ATOM   1927 C  CD2   . PHE B 2 86  ? 25.828 10.517  32.811  1.00 28.97 ? 87   PHE B CD2   1 
ATOM   1928 C  CE1   . PHE B 2 86  ? 27.599 8.406   32.558  1.00 33.67 ? 87   PHE B CE1   1 
ATOM   1929 C  CE2   . PHE B 2 86  ? 25.500 9.437   31.980  1.00 31.49 ? 87   PHE B CE2   1 
ATOM   1930 C  CZ    . PHE B 2 86  ? 26.376 8.366   31.870  1.00 26.69 ? 87   PHE B CZ    1 
ATOM   1931 N  N     . LEU B 2 87  ? 27.255 13.732  32.064  1.00 28.17 ? 88   LEU B N     1 
ATOM   1932 C  CA    . LEU B 2 87  ? 26.983 14.015  30.647  1.00 27.62 ? 88   LEU B CA    1 
ATOM   1933 C  C     . LEU B 2 87  ? 28.117 14.772  29.945  1.00 31.47 ? 88   LEU B C     1 
ATOM   1934 O  O     . LEU B 2 87  ? 28.313 14.596  28.727  1.00 30.72 ? 88   LEU B O     1 
ATOM   1935 C  CB    . LEU B 2 87  ? 25.698 14.836  30.478  1.00 28.76 ? 88   LEU B CB    1 
ATOM   1936 C  CG    . LEU B 2 87  ? 24.380 14.086  30.760  1.00 28.65 ? 88   LEU B CG    1 
ATOM   1937 C  CD1   . LEU B 2 87  ? 23.181 15.098  30.553  1.00 32.35 ? 88   LEU B CD1   1 
ATOM   1938 C  CD2   . LEU B 2 87  ? 24.223 12.827  29.916  1.00 29.32 ? 88   LEU B CD2   1 
ATOM   1939 N  N     . THR B 2 88  ? 28.823 15.632  30.689  1.00 29.70 ? 89   THR B N     1 
ATOM   1940 C  CA    . THR B 2 88  ? 29.998 16.331  30.121  1.00 30.36 ? 89   THR B CA    1 
ATOM   1941 C  C     . THR B 2 88  ? 30.976 15.297  29.594  1.00 30.49 ? 89   THR B C     1 
ATOM   1942 O  O     . THR B 2 88  ? 31.504 15.449  28.516  1.00 29.75 ? 89   THR B O     1 
ATOM   1943 C  CB    . THR B 2 88  ? 30.702 17.240  31.175  1.00 28.02 ? 89   THR B CB    1 
ATOM   1944 O  OG1   . THR B 2 88  ? 29.824 18.335  31.439  1.00 32.90 ? 89   THR B OG1   1 
ATOM   1945 C  CG2   . THR B 2 88  ? 32.011 17.853  30.635  1.00 37.53 ? 89   THR B CG2   1 
ATOM   1946 N  N     . GLN B 2 89  ? 31.169 14.208  30.323  1.00 28.32 ? 90   GLN B N     1 
ATOM   1947 C  CA    . GLN B 2 89  ? 32.122 13.182  29.883  1.00 31.48 ? 90   GLN B CA    1 
ATOM   1948 C  C     . GLN B 2 89  ? 31.641 12.181  28.834  1.00 30.33 ? 90   GLN B C     1 
ATOM   1949 O  O     . GLN B 2 89  ? 32.426 11.675  28.025  1.00 30.66 ? 90   GLN B O     1 
ATOM   1950 C  CB    . GLN B 2 89  ? 32.645 12.452  31.102  1.00 30.86 ? 90   GLN B CB    1 
ATOM   1951 C  CG    . GLN B 2 89  ? 33.444 13.429  32.001  1.00 37.02 ? 90   GLN B CG    1 
ATOM   1952 C  CD    . GLN B 2 89  ? 33.970 12.702  33.181  1.00 32.56 ? 90   GLN B CD    1 
ATOM   1953 O  OE1   . GLN B 2 89  ? 34.703 11.732  33.020  1.00 29.87 ? 90   GLN B OE1   1 
ATOM   1954 N  NE2   . GLN B 2 89  ? 33.572 13.119  34.382  1.00 39.49 ? 90   GLN B NE2   1 
ATOM   1955 N  N     . LEU B 2 90  ? 30.342 11.916  28.826  1.00 30.35 ? 91   LEU B N     1 
ATOM   1956 C  CA    . LEU B 2 90  ? 29.709 11.004  27.861  1.00 28.42 ? 91   LEU B CA    1 
ATOM   1957 C  C     . LEU B 2 90  ? 29.488 11.678  26.504  1.00 27.80 ? 91   LEU B C     1 
ATOM   1958 O  O     . LEU B 2 90  ? 29.632 11.047  25.441  1.00 27.67 ? 91   LEU B O     1 
ATOM   1959 C  CB    . LEU B 2 90  ? 28.351 10.541  28.420  1.00 25.97 ? 91   LEU B CB    1 
ATOM   1960 C  CG    . LEU B 2 90  ? 27.632 9.433   27.653  1.00 30.46 ? 91   LEU B CG    1 
ATOM   1961 C  CD1   . LEU B 2 90  ? 28.487 8.153   27.765  1.00 26.18 ? 91   LEU B CD1   1 
ATOM   1962 C  CD2   . LEU B 2 90  ? 26.235 9.207   28.233  1.00 29.72 ? 91   LEU B CD2   1 
ATOM   1963 N  N     . GLN B 2 91  ? 29.125 12.954  26.522  1.00 27.18 ? 92   GLN B N     1 
ATOM   1964 C  CA    . GLN B 2 91  ? 28.582 13.530  25.279  1.00 31.05 ? 92   GLN B CA    1 
ATOM   1965 C  C     . GLN B 2 91  ? 29.531 13.444  24.075  1.00 31.77 ? 92   GLN B C     1 
ATOM   1966 O  O     . GLN B 2 91  ? 29.044 13.333  22.947  1.00 30.85 ? 92   GLN B O     1 
ATOM   1967 C  CB    . GLN B 2 91  ? 28.042 14.962  25.440  1.00 33.16 ? 92   GLN B CB    1 
ATOM   1968 C  CG    . GLN B 2 91  ? 29.084 16.029  25.681  1.00 37.59 ? 92   GLN B CG    1 
ATOM   1969 C  CD    . GLN B 2 91  ? 29.786 16.548  24.399  1.00 42.27 ? 92   GLN B CD    1 
ATOM   1970 O  OE1   . GLN B 2 91  ? 29.255 16.501  23.288  1.00 42.96 ? 92   GLN B OE1   1 
ATOM   1971 N  NE2   . GLN B 2 91  ? 31.005 17.034  24.577  1.00 45.90 ? 92   GLN B NE2   1 
ATOM   1972 N  N     . PRO B 2 92  ? 30.869 13.522  24.285  1.00 30.83 ? 93   PRO B N     1 
ATOM   1973 C  CA    . PRO B 2 92  ? 31.700 13.406  23.086  1.00 30.22 ? 93   PRO B CA    1 
ATOM   1974 C  C     . PRO B 2 92  ? 31.501 12.125  22.298  1.00 28.89 ? 93   PRO B C     1 
ATOM   1975 O  O     . PRO B 2 92  ? 31.818 12.098  21.134  1.00 29.03 ? 93   PRO B O     1 
ATOM   1976 C  CB    . PRO B 2 92  ? 33.142 13.463  23.621  1.00 32.90 ? 93   PRO B CB    1 
ATOM   1977 C  CG    . PRO B 2 92  ? 33.011 14.257  24.918  1.00 34.44 ? 93   PRO B CG    1 
ATOM   1978 C  CD    . PRO B 2 92  ? 31.686 13.751  25.502  1.00 30.42 ? 93   PRO B CD    1 
ATOM   1979 N  N     . PHE B 2 93  ? 31.012 11.063  22.934  1.00 26.67 ? 94   PHE B N     1 
ATOM   1980 C  CA    . PHE B 2 93  ? 30.973 9.728   22.330  1.00 29.48 ? 94   PHE B CA    1 
ATOM   1981 C  C     . PHE B 2 93  ? 29.564 9.390   21.859  1.00 29.19 ? 94   PHE B C     1 
ATOM   1982 O  O     . PHE B 2 93  ? 29.351 8.382   21.154  1.00 28.22 ? 94   PHE B O     1 
ATOM   1983 C  CB    . PHE B 2 93  ? 31.454 8.694   23.361  1.00 28.09 ? 94   PHE B CB    1 
ATOM   1984 C  CG    . PHE B 2 93  ? 32.835 8.979   23.855  1.00 32.93 ? 94   PHE B CG    1 
ATOM   1985 C  CD1   . PHE B 2 93  ? 33.898 8.967   22.949  1.00 34.59 ? 94   PHE B CD1   1 
ATOM   1986 C  CD2   . PHE B 2 93  ? 33.067 9.375   25.164  1.00 31.86 ? 94   PHE B CD2   1 
ATOM   1987 C  CE1   . PHE B 2 93  ? 35.196 9.307   23.367  1.00 35.90 ? 94   PHE B CE1   1 
ATOM   1988 C  CE2   . PHE B 2 93  ? 34.368 9.693   25.591  1.00 36.17 ? 94   PHE B CE2   1 
ATOM   1989 C  CZ    . PHE B 2 93  ? 35.425 9.664   24.677  1.00 36.12 ? 94   PHE B CZ    1 
ATOM   1990 N  N     . LEU B 2 94  ? 28.603 10.229  22.225  1.00 28.91 ? 95   LEU B N     1 
ATOM   1991 C  CA    . LEU B 2 94  ? 27.218 10.014  21.767  1.00 29.42 ? 95   LEU B CA    1 
ATOM   1992 C  C     . LEU B 2 94  ? 27.040 10.329  20.293  1.00 30.24 ? 95   LEU B C     1 
ATOM   1993 O  O     . LEU B 2 94  ? 27.711 11.205  19.771  1.00 31.48 ? 95   LEU B O     1 
ATOM   1994 C  CB    . LEU B 2 94  ? 26.215 10.808  22.611  1.00 27.17 ? 95   LEU B CB    1 
ATOM   1995 C  CG    . LEU B 2 94  ? 26.082 10.345  24.069  1.00 27.57 ? 95   LEU B CG    1 
ATOM   1996 C  CD1   . LEU B 2 94  ? 25.331 11.418  24.879  1.00 26.34 ? 95   LEU B CD1   1 
ATOM   1997 C  CD2   . LEU B 2 94  ? 25.412 8.938   24.191  1.00 22.56 ? 95   LEU B CD2   1 
ATOM   1998 N  N     . LYS B 2 95  ? 26.146 9.632   19.610  1.00 30.58 ? 96   LYS B N     1 
ATOM   1999 C  CA    . LYS B 2 95  ? 25.894 9.867   18.183  1.00 32.59 ? 96   LYS B CA    1 
ATOM   2000 C  C     . LYS B 2 95  ? 24.409 10.172  17.873  1.00 35.07 ? 96   LYS B C     1 
ATOM   2001 O  O     . LYS B 2 95  ? 24.113 10.900  16.921  1.00 40.05 ? 96   LYS B O     1 
ATOM   2002 C  CB    . LYS B 2 95  ? 26.324 8.631   17.390  1.00 31.10 ? 96   LYS B CB    1 
ATOM   2003 C  CG    . LYS B 2 95  ? 27.848 8.307   17.440  1.00 34.53 ? 96   LYS B CG    1 
ATOM   2004 C  CD    . LYS B 2 95  ? 28.041 7.093   16.532  1.00 35.57 ? 96   LYS B CD    1 
ATOM   2005 C  CE    . LYS B 2 95  ? 29.397 6.422   16.677  1.00 41.49 ? 96   LYS B CE    1 
ATOM   2006 N  NZ    . LYS B 2 95  ? 30.440 7.449   16.588  1.00 44.34 ? 96   LYS B NZ    1 
ATOM   2007 N  N     . LEU B 2 96  ? 23.480 9.599   18.629  1.00 28.24 ? 97   LEU B N     1 
ATOM   2008 C  CA    . LEU B 2 96  ? 22.048 9.832   18.409  1.00 30.09 ? 97   LEU B CA    1 
ATOM   2009 C  C     . LEU B 2 96  ? 21.547 10.821  19.451  1.00 30.88 ? 97   LEU B C     1 
ATOM   2010 O  O     . LEU B 2 96  ? 20.574 11.523  19.203  1.00 32.05 ? 97   LEU B O     1 
ATOM   2011 C  CB    . LEU B 2 96  ? 21.235 8.542   18.566  1.00 26.80 ? 97   LEU B CB    1 
ATOM   2012 C  CG    . LEU B 2 96  ? 21.503 7.526   17.442  1.00 26.10 ? 97   LEU B CG    1 
ATOM   2013 C  CD1   . LEU B 2 96  ? 20.583 6.279   17.591  1.00 25.07 ? 97   LEU B CD1   1 
ATOM   2014 C  CD2   . LEU B 2 96  ? 21.426 8.143   16.034  1.00 29.87 ? 97   LEU B CD2   1 
ATOM   2015 N  N     . LYS B 2 97  ? 22.196 10.871  20.612  1.00 27.79 ? 98   LYS B N     1 
ATOM   2016 C  CA    . LYS B 2 97  ? 21.661 11.697  21.696  1.00 27.36 ? 98   LYS B CA    1 
ATOM   2017 C  C     . LYS B 2 97  ? 22.636 12.771  22.119  1.00 28.83 ? 98   LYS B C     1 
ATOM   2018 O  O     . LYS B 2 97  ? 22.453 13.429  23.141  1.00 28.88 ? 98   LYS B O     1 
ATOM   2019 C  CB    . LYS B 2 97  ? 21.229 10.801  22.863  1.00 27.63 ? 98   LYS B CB    1 
ATOM   2020 C  CG    . LYS B 2 97  ? 20.039 9.874   22.464  1.00 28.95 ? 98   LYS B CG    1 
ATOM   2021 C  CD    . LYS B 2 97  ? 19.794 8.786   23.560  1.00 30.79 ? 98   LYS B CD    1 
ATOM   2022 C  CE    . LYS B 2 97  ? 18.743 7.688   23.067  1.00 30.24 ? 98   LYS B CE    1 
ATOM   2023 N  NZ    . LYS B 2 97  ? 17.391 8.289   23.179  1.00 41.27 ? 98   LYS B NZ    1 
ATOM   2024 N  N     . GLN B 2 98  ? 23.642 13.018  21.288  1.00 29.33 ? 99   GLN B N     1 
ATOM   2025 C  CA    . GLN B 2 98  ? 24.613 14.063  21.611  1.00 30.70 ? 99   GLN B CA    1 
ATOM   2026 C  C     . GLN B 2 98  ? 23.979 15.448  21.761  1.00 28.95 ? 99   GLN B C     1 
ATOM   2027 O  O     . GLN B 2 98  ? 24.329 16.202  22.666  1.00 29.29 ? 99   GLN B O     1 
ATOM   2028 C  CB    . GLN B 2 98  ? 25.689 14.135  20.507  1.00 30.12 ? 99   GLN B CB    1 
ATOM   2029 C  CG    . GLN B 2 98  ? 26.937 14.903  20.962  1.00 35.83 ? 99   GLN B CG    1 
ATOM   2030 C  CD    . GLN B 2 98  ? 28.026 14.875  19.906  1.00 35.29 ? 99   GLN B CD    1 
ATOM   2031 O  OE1   . GLN B 2 98  ? 27.835 15.356  18.793  1.00 44.83 ? 99   GLN B OE1   1 
ATOM   2032 N  NE2   . GLN B 2 98  ? 29.163 14.318  20.243  1.00 37.24 ? 99   GLN B NE2   1 
ATOM   2033 N  N     . LYS B 2 99  ? 23.104 15.819  20.825  1.00 30.36 ? 100  LYS B N     1 
ATOM   2034 C  CA    . LYS B 2 99  ? 22.492 17.140  20.834  1.00 32.40 ? 100  LYS B CA    1 
ATOM   2035 C  C     . LYS B 2 99  ? 21.676 17.288  22.106  1.00 31.95 ? 100  LYS B C     1 
ATOM   2036 O  O     . LYS B 2 99  ? 21.720 18.356  22.739  1.00 32.19 ? 100  LYS B O     1 
ATOM   2037 C  CB    . LYS B 2 99  ? 21.580 17.381  19.596  1.00 32.11 ? 100  LYS B CB    1 
ATOM   2038 C  CG    . LYS B 2 99  ? 22.321 17.640  18.298  1.00 40.43 ? 100  LYS B CG    1 
ATOM   2039 C  CD    . LYS B 2 99  ? 21.437 17.210  17.123  1.00 46.10 ? 100  LYS B CD    1 
ATOM   2040 C  CE    . LYS B 2 99  ? 21.970 17.690  15.800  1.00 47.52 ? 100  LYS B CE    1 
ATOM   2041 N  NZ    . LYS B 2 99  ? 20.775 17.968  14.918  1.00 52.14 ? 100  LYS B NZ    1 
ATOM   2042 N  N     . GLN B 2 100 ? 20.903 16.253  22.468  1.00 31.40 ? 101  GLN B N     1 
ATOM   2043 C  CA    . GLN B 2 100 ? 20.122 16.298  23.732  1.00 28.87 ? 101  GLN B CA    1 
ATOM   2044 C  C     . GLN B 2 100 ? 21.030 16.512  24.942  1.00 30.86 ? 101  GLN B C     1 
ATOM   2045 O  O     . GLN B 2 100 ? 20.733 17.333  25.821  1.00 28.39 ? 101  GLN B O     1 
ATOM   2046 C  CB    . GLN B 2 100 ? 19.285 15.027  23.930  1.00 30.30 ? 101  GLN B CB    1 
ATOM   2047 C  CG    . GLN B 2 100 ? 18.115 14.869  22.908  1.00 28.11 ? 101  GLN B CG    1 
ATOM   2048 C  CD    . GLN B 2 100 ? 18.496 13.995  21.740  1.00 24.91 ? 101  GLN B CD    1 
ATOM   2049 O  OE1   . GLN B 2 100 ? 19.576 14.191  21.157  1.00 31.06 ? 101  GLN B OE1   1 
ATOM   2050 N  NE2   . GLN B 2 100 ? 17.618 13.030  21.361  1.00 26.98 ? 101  GLN B NE2   1 
ATOM   2051 N  N     . ALA B 2 101 ? 22.162 15.806  24.988  1.00 28.87 ? 102  ALA B N     1 
ATOM   2052 C  CA    . ALA B 2 101 ? 23.071 15.953  26.142  1.00 29.77 ? 102  ALA B CA    1 
ATOM   2053 C  C     . ALA B 2 101 ? 23.646 17.375  26.215  1.00 32.09 ? 102  ALA B C     1 
ATOM   2054 O  O     . ALA B 2 101 ? 23.738 18.003  27.288  1.00 32.66 ? 102  ALA B O     1 
ATOM   2055 C  CB    . ALA B 2 101 ? 24.170 14.912  26.036  1.00 27.61 ? 102  ALA B CB    1 
ATOM   2056 N  N     . ASN B 2 102 ? 24.000 17.923  25.060  1.00 34.15 ? 103  ASN B N     1 
ATOM   2057 C  CA    . ASN B 2 102 ? 24.571 19.270  25.055  1.00 34.38 ? 103  ASN B CA    1 
ATOM   2058 C  C     . ASN B 2 102 ? 23.519 20.327  25.436  1.00 33.76 ? 103  ASN B C     1 
ATOM   2059 O  O     . ASN B 2 102 ? 23.832 21.279  26.155  1.00 31.98 ? 103  ASN B O     1 
ATOM   2060 C  CB    . ASN B 2 102 ? 25.208 19.554  23.689  1.00 35.35 ? 103  ASN B CB    1 
ATOM   2061 C  CG    . ASN B 2 102 ? 26.563 18.850  23.513  1.00 41.72 ? 103  ASN B CG    1 
ATOM   2062 O  OD1   . ASN B 2 102 ? 27.337 18.713  24.459  1.00 43.12 ? 103  ASN B OD1   1 
ATOM   2063 N  ND2   . ASN B 2 102 ? 26.853 18.414  22.301  1.00 46.83 ? 103  ASN B ND2   1 
ATOM   2064 N  N     . LEU B 2 103 ? 22.263 20.145  25.001  1.00 31.27 ? 104  LEU B N     1 
ATOM   2065 C  CA    . LEU B 2 103 ? 21.161 20.964  25.507  1.00 32.42 ? 104  LEU B CA    1 
ATOM   2066 C  C     . LEU B 2 103 ? 20.964 20.895  27.009  1.00 34.17 ? 104  LEU B C     1 
ATOM   2067 O  O     . LEU B 2 103 ? 20.787 21.935  27.674  1.00 33.72 ? 104  LEU B O     1 
ATOM   2068 C  CB    . LEU B 2 103 ? 19.851 20.707  24.764  1.00 29.00 ? 104  LEU B CB    1 
ATOM   2069 C  CG    . LEU B 2 103 ? 19.870 21.321  23.360  1.00 38.49 ? 104  LEU B CG    1 
ATOM   2070 C  CD1   . LEU B 2 103 ? 18.902 20.537  22.439  1.00 35.20 ? 104  LEU B CD1   1 
ATOM   2071 C  CD2   . LEU B 2 103 ? 19.501 22.851  23.383  1.00 36.55 ? 104  LEU B CD2   1 
ATOM   2072 N  N     . VAL B 2 104 ? 21.009 19.683  27.553  1.00 30.69 ? 105  VAL B N     1 
ATOM   2073 C  CA    . VAL B 2 104 ? 20.913 19.519  28.988  1.00 32.16 ? 105  VAL B CA    1 
ATOM   2074 C  C     . VAL B 2 104 ? 22.032 20.279  29.692  1.00 34.23 ? 105  VAL B C     1 
ATOM   2075 O  O     . VAL B 2 104 ? 21.803 20.992  30.675  1.00 33.89 ? 105  VAL B O     1 
ATOM   2076 C  CB    . VAL B 2 104 ? 20.925 18.011  29.373  1.00 35.95 ? 105  VAL B CB    1 
ATOM   2077 C  CG1   . VAL B 2 104 ? 21.111 17.812  30.925  1.00 31.91 ? 105  VAL B CG1   1 
ATOM   2078 C  CG2   . VAL B 2 104 ? 19.568 17.355  28.910  1.00 31.46 ? 105  VAL B CG2   1 
ATOM   2079 N  N     . LEU B 2 105 ? 23.252 20.157  29.190  1.00 31.43 ? 106  LEU B N     1 
ATOM   2080 C  CA    . LEU B 2 105 ? 24.360 20.899  29.794  1.00 34.65 ? 106  LEU B CA    1 
ATOM   2081 C  C     . LEU B 2 105 ? 24.166 22.422  29.716  1.00 36.84 ? 106  LEU B C     1 
ATOM   2082 O  O     . LEU B 2 105 ? 24.434 23.136  30.692  1.00 36.80 ? 106  LEU B O     1 
ATOM   2083 C  CB    . LEU B 2 105 ? 25.657 20.523  29.092  1.00 31.38 ? 106  LEU B CB    1 
ATOM   2084 C  CG    . LEU B 2 105 ? 26.046 19.075  29.326  1.00 30.79 ? 106  LEU B CG    1 
ATOM   2085 C  CD1   . LEU B 2 105 ? 27.290 18.782  28.461  1.00 34.95 ? 106  LEU B CD1   1 
ATOM   2086 C  CD2   . LEU B 2 105 ? 26.285 18.690  30.800  1.00 30.57 ? 106  LEU B CD2   1 
ATOM   2087 N  N     . LYS B 2 106 ? 23.693 22.915  28.576  1.00 36.93 ? 107  LYS B N     1 
ATOM   2088 C  CA    . LYS B 2 106 ? 23.370 24.352  28.406  1.00 41.71 ? 107  LYS B CA    1 
ATOM   2089 C  C     . LYS B 2 106 ? 22.299 24.815  29.382  1.00 40.78 ? 107  LYS B C     1 
ATOM   2090 O  O     . LYS B 2 106 ? 22.438 25.855  30.032  1.00 39.87 ? 107  LYS B O     1 
ATOM   2091 C  CB    . LYS B 2 106 ? 22.850 24.616  26.993  1.00 43.12 ? 107  LYS B CB    1 
ATOM   2092 C  CG    . LYS B 2 106 ? 22.902 26.070  26.477  1.00 40.94 ? 107  LYS B CG    1 
ATOM   2093 C  CD    . LYS B 2 106 ? 22.500 26.061  24.991  1.00 53.09 ? 107  LYS B CD    1 
ATOM   2094 C  CE    . LYS B 2 106 ? 21.773 27.327  24.534  1.00 65.76 ? 107  LYS B CE    1 
ATOM   2095 N  NZ    . LYS B 2 106 ? 22.715 28.395  24.068  1.00 73.42 ? 107  LYS B NZ    1 
ATOM   2096 N  N     . ILE B 2 107 ? 21.211 24.058  29.479  1.00 37.73 ? 108  ILE B N     1 
ATOM   2097 C  CA    . ILE B 2 107 ? 20.240 24.328  30.521  1.00 35.30 ? 108  ILE B CA    1 
ATOM   2098 C  C     . ILE B 2 107 ? 20.892 24.384  31.911  1.00 39.38 ? 108  ILE B C     1 
ATOM   2099 O  O     . ILE B 2 107 ? 20.694 25.331  32.685  1.00 40.67 ? 108  ILE B O     1 
ATOM   2100 C  CB    . ILE B 2 107 ? 19.129 23.278  30.505  1.00 34.52 ? 108  ILE B CB    1 
ATOM   2101 C  CG1   . ILE B 2 107 ? 18.336 23.404  29.205  1.00 32.64 ? 108  ILE B CG1   1 
ATOM   2102 C  CG2   . ILE B 2 107 ? 18.183 23.507  31.663  1.00 34.57 ? 108  ILE B CG2   1 
ATOM   2103 C  CD1   . ILE B 2 107 ? 17.483 22.166  28.937  1.00 30.46 ? 108  ILE B CD1   1 
ATOM   2104 N  N     . ILE B 2 108 ? 21.688 23.385  32.243  1.00 37.03 ? 109  ILE B N     1 
ATOM   2105 C  CA    . ILE B 2 108 ? 22.162 23.298  33.622  1.00 38.76 ? 109  ILE B CA    1 
ATOM   2106 C  C     . ILE B 2 108 ? 22.994 24.545  33.933  1.00 39.76 ? 109  ILE B C     1 
ATOM   2107 O  O     . ILE B 2 108 ? 22.863 25.177  34.996  1.00 39.44 ? 109  ILE B O     1 
ATOM   2108 C  CB    . ILE B 2 108 ? 22.946 22.010  33.827  1.00 34.61 ? 109  ILE B CB    1 
ATOM   2109 C  CG1   . ILE B 2 108 ? 21.968 20.857  34.016  1.00 34.03 ? 109  ILE B CG1   1 
ATOM   2110 C  CG2   . ILE B 2 108 ? 23.797 22.093  35.092  1.00 40.15 ? 109  ILE B CG2   1 
ATOM   2111 C  CD1   . ILE B 2 108 ? 22.684 19.425  34.029  1.00 39.48 ? 109  ILE B CD1   1 
ATOM   2112 N  N     . GLU B 2 109 ? 23.812 24.943  32.971  1.00 40.23 ? 110  GLU B N     1 
ATOM   2113 C  CA    . GLU B 2 109 ? 24.700 26.071  33.192  1.00 44.40 ? 110  GLU B CA    1 
ATOM   2114 C  C     . GLU B 2 109 ? 23.920 27.391  33.310  1.00 44.91 ? 110  GLU B C     1 
ATOM   2115 O  O     . GLU B 2 109 ? 24.383 28.332  33.948  1.00 45.09 ? 110  GLU B O     1 
ATOM   2116 C  CB    . GLU B 2 109 ? 25.766 26.128  32.096  1.00 46.72 ? 110  GLU B CB    1 
ATOM   2117 C  CG    . GLU B 2 109 ? 26.955 25.186  32.353  1.00 57.63 ? 110  GLU B CG    1 
ATOM   2118 C  CD    . GLU B 2 109 ? 27.492 24.545  31.060  1.00 68.96 ? 110  GLU B CD    1 
ATOM   2119 O  OE1   . GLU B 2 109 ? 27.533 25.282  30.043  1.00 72.97 ? 110  GLU B OE1   1 
ATOM   2120 O  OE2   . GLU B 2 109 ? 27.860 23.327  31.053  1.00 65.33 ? 110  GLU B OE2   1 
ATOM   2121 N  N     . GLN B 2 110 ? 22.742 27.475  32.707  1.00 43.68 ? 111  GLN B N     1 
ATOM   2122 C  CA    . GLN B 2 110 ? 21.979 28.730  32.737  1.00 48.51 ? 111  GLN B CA    1 
ATOM   2123 C  C     . GLN B 2 110 ? 20.949 28.737  33.842  1.00 48.26 ? 111  GLN B C     1 
ATOM   2124 O  O     . GLN B 2 110 ? 20.273 29.746  34.059  1.00 49.64 ? 111  GLN B O     1 
ATOM   2125 C  CB    . GLN B 2 110 ? 21.233 28.970  31.421  1.00 47.40 ? 111  GLN B CB    1 
ATOM   2126 C  CG    . GLN B 2 110 ? 22.092 29.422  30.268  1.00 58.04 ? 111  GLN B CG    1 
ATOM   2127 C  CD    . GLN B 2 110 ? 23.041 30.542  30.631  1.00 65.09 ? 111  GLN B CD    1 
ATOM   2128 O  OE1   . GLN B 2 110 ? 24.211 30.499  30.258  1.00 67.97 ? 111  GLN B OE1   1 
ATOM   2129 N  NE2   . GLN B 2 110 ? 22.546 31.544  31.358  1.00 65.36 ? 111  GLN B NE2   1 
ATOM   2130 N  N     . LEU B 2 111 ? 20.809 27.614  34.530  1.00 48.75 ? 112  LEU B N     1 
ATOM   2131 C  CA    . LEU B 2 111 ? 19.834 27.509  35.617  1.00 51.16 ? 112  LEU B CA    1 
ATOM   2132 C  C     . LEU B 2 111 ? 19.890 28.658  36.619  1.00 52.65 ? 112  LEU B C     1 
ATOM   2133 O  O     . LEU B 2 111 ? 18.852 29.232  36.939  1.00 55.26 ? 112  LEU B O     1 
ATOM   2134 C  CB    . LEU B 2 111 ? 19.947 26.177  36.362  1.00 51.55 ? 112  LEU B CB    1 
ATOM   2135 C  CG    . LEU B 2 111 ? 19.317 24.960  35.672  1.00 52.98 ? 112  LEU B CG    1 
ATOM   2136 C  CD1   . LEU B 2 111 ? 19.331 23.732  36.583  1.00 56.87 ? 112  LEU B CD1   1 
ATOM   2137 C  CD2   . LEU B 2 111 ? 17.910 25.294  35.216  1.00 53.88 ? 112  LEU B CD2   1 
ATOM   2138 N  N     . PRO B 2 112 ? 21.080 28.959  37.164  1.00 53.95 ? 113  PRO B N     1 
ATOM   2139 C  CA    . PRO B 2 112 ? 21.187 30.092  38.087  1.00 56.01 ? 113  PRO B CA    1 
ATOM   2140 C  C     . PRO B 2 112 ? 20.515 31.375  37.591  1.00 54.19 ? 113  PRO B C     1 
ATOM   2141 O  O     . PRO B 2 112 ? 19.736 31.990  38.314  1.00 53.62 ? 113  PRO B O     1 
ATOM   2142 C  CB    . PRO B 2 112 ? 22.702 30.277  38.261  1.00 57.29 ? 113  PRO B CB    1 
ATOM   2143 C  CG    . PRO B 2 112 ? 23.275 28.896  38.016  1.00 57.51 ? 113  PRO B CG    1 
ATOM   2144 C  CD    . PRO B 2 112 ? 22.362 28.247  36.990  1.00 53.48 ? 113  PRO B CD    1 
ATOM   2145 N  N     . SER B 2 113 ? 20.790 31.773  36.362  1.00 53.72 ? 114  SER B N     1 
ATOM   2146 C  CA    . SER B 2 113 ? 20.165 32.969  35.842  1.00 56.84 ? 114  SER B CA    1 
ATOM   2147 C  C     . SER B 2 113 ? 18.700 32.764  35.424  1.00 59.19 ? 114  SER B C     1 
ATOM   2148 O  O     . SER B 2 113 ? 17.944 33.723  35.317  1.00 60.36 ? 114  SER B O     1 
ATOM   2149 C  CB    . SER B 2 113 ? 20.998 33.490  34.675  1.00 58.17 ? 114  SER B CB    1 
ATOM   2150 O  OG    . SER B 2 113 ? 20.381 33.214  33.439  1.00 63.90 ? 114  SER B OG    1 
ATOM   2151 N  N     . ALA B 2 114 ? 18.292 31.518  35.185  1.00 58.26 ? 115  ALA B N     1 
ATOM   2152 C  CA    . ALA B 2 114 ? 16.928 31.228  34.756  1.00 59.80 ? 115  ALA B CA    1 
ATOM   2153 C  C     . ALA B 2 114 ? 15.965 31.602  35.871  1.00 61.21 ? 115  ALA B C     1 
ATOM   2154 O  O     . ALA B 2 114 ? 14.838 32.017  35.619  1.00 62.24 ? 115  ALA B O     1 
ATOM   2155 C  CB    . ALA B 2 114 ? 16.777 29.738  34.419  1.00 57.42 ? 115  ALA B CB    1 
ATOM   2156 N  N     . LYS B 2 115 ? 16.424 31.446  37.109  1.00 64.32 ? 116  LYS B N     1 
ATOM   2157 C  CA    . LYS B 2 115 ? 15.536 31.476  38.255  1.00 66.41 ? 116  LYS B CA    1 
ATOM   2158 C  C     . LYS B 2 115 ? 15.289 32.890  38.762  1.00 67.86 ? 116  LYS B C     1 
ATOM   2159 O  O     . LYS B 2 115 ? 14.478 33.096  39.667  1.00 66.39 ? 116  LYS B O     1 
ATOM   2160 C  CB    . LYS B 2 115 ? 16.037 30.542  39.349  1.00 66.96 ? 116  LYS B CB    1 
ATOM   2161 C  CG    . LYS B 2 115 ? 15.460 29.124  39.236  1.00 71.13 ? 116  LYS B CG    1 
ATOM   2162 C  CD    . LYS B 2 115 ? 16.374 28.060  39.837  1.00 75.46 ? 116  LYS B CD    1 
ATOM   2163 C  CE    . LYS B 2 115 ? 16.729 28.357  41.295  1.00 76.09 ? 116  LYS B CE    1 
ATOM   2164 N  NZ    . LYS B 2 115 ? 18.014 27.693  41.678  1.00 73.42 ? 116  LYS B NZ    1 
ATOM   2165 N  N     . GLU B 2 116 ? 15.945 33.869  38.145  1.00 70.54 ? 117  GLU B N     1 
ATOM   2166 C  CA    . GLU B 2 116 ? 15.660 35.268  38.468  1.00 75.07 ? 117  GLU B CA    1 
ATOM   2167 C  C     . GLU B 2 116 ? 15.008 36.139  37.391  1.00 72.90 ? 117  GLU B C     1 
ATOM   2168 O  O     . GLU B 2 116 ? 14.670 37.290  37.671  1.00 73.71 ? 117  GLU B O     1 
ATOM   2169 C  CB    . GLU B 2 116 ? 16.858 35.985  39.110  1.00 75.33 ? 117  GLU B CB    1 
ATOM   2170 C  CG    . GLU B 2 116 ? 18.236 35.494  38.667  1.00 79.18 ? 117  GLU B CG    1 
ATOM   2171 C  CD    . GLU B 2 116 ? 19.362 36.187  39.420  1.00 79.76 ? 117  GLU B CD    1 
ATOM   2172 O  OE1   . GLU B 2 116 ? 19.890 35.580  40.377  1.00 87.32 ? 117  GLU B OE1   1 
ATOM   2173 O  OE2   . GLU B 2 116 ? 19.707 37.342  39.068  1.00 87.00 ? 117  GLU B OE2   1 
ATOM   2174 N  N     . SER B 2 117 ? 14.815 35.612  36.184  1.00 69.76 ? 118  SER B N     1 
ATOM   2175 C  CA    . SER B 2 117 ? 14.212 36.409  35.104  1.00 69.67 ? 118  SER B CA    1 
ATOM   2176 C  C     . SER B 2 117 ? 13.217 35.604  34.280  1.00 67.14 ? 118  SER B C     1 
ATOM   2177 O  O     . SER B 2 117 ? 13.559 34.522  33.792  1.00 65.77 ? 118  SER B O     1 
ATOM   2178 C  CB    . SER B 2 117 ? 15.292 36.928  34.153  1.00 70.16 ? 118  SER B CB    1 
ATOM   2179 O  OG    . SER B 2 117 ? 16.555 36.984  34.813  1.00 76.21 ? 118  SER B OG    1 
ATOM   2180 N  N     . PRO B 2 118 ? 12.001 36.139  34.077  1.00 66.44 ? 119  PRO B N     1 
ATOM   2181 C  CA    . PRO B 2 118 ? 10.991 35.267  33.470  1.00 63.26 ? 119  PRO B CA    1 
ATOM   2182 C  C     . PRO B 2 118 ? 11.299 35.039  31.991  1.00 62.75 ? 119  PRO B C     1 
ATOM   2183 O  O     . PRO B 2 118 ? 10.919 34.004  31.421  1.00 59.54 ? 119  PRO B O     1 
ATOM   2184 C  CB    . PRO B 2 118 ? 9.674  36.019  33.669  1.00 63.55 ? 119  PRO B CB    1 
ATOM   2185 C  CG    . PRO B 2 118 ? 10.059 37.441  33.940  1.00 63.50 ? 119  PRO B CG    1 
ATOM   2186 C  CD    . PRO B 2 118 ? 11.513 37.511  34.318  1.00 66.33 ? 119  PRO B CD    1 
ATOM   2187 N  N     . ASP B 2 119 ? 12.000 35.981  31.369  1.00 60.36 ? 120  ASP B N     1 
ATOM   2188 C  CA    . ASP B 2 119 ? 12.317 35.779  29.973  1.00 62.21 ? 120  ASP B CA    1 
ATOM   2189 C  C     . ASP B 2 119 ? 13.529 34.874  29.762  1.00 58.11 ? 120  ASP B C     1 
ATOM   2190 O  O     . ASP B 2 119 ? 13.583 34.124  28.786  1.00 57.28 ? 120  ASP B O     1 
ATOM   2191 C  CB    . ASP B 2 119 ? 12.299 37.079  29.152  1.00 65.96 ? 120  ASP B CB    1 
ATOM   2192 C  CG    . ASP B 2 119 ? 13.498 37.958  29.419  1.00 78.29 ? 120  ASP B CG    1 
ATOM   2193 O  OD1   . ASP B 2 119 ? 14.291 37.602  30.323  1.00 90.26 ? 120  ASP B OD1   1 
ATOM   2194 O  OD2   . ASP B 2 119 ? 13.645 39.001  28.729  1.00 87.63 ? 120  ASP B OD2   1 
ATOM   2195 N  N     . LYS B 2 120 ? 14.472 34.898  30.701  1.00 53.94 ? 121  LYS B N     1 
ATOM   2196 C  CA    . LYS B 2 120 ? 15.468 33.840  30.793  1.00 52.34 ? 121  LYS B CA    1 
ATOM   2197 C  C     . LYS B 2 120 ? 14.899 32.456  31.142  1.00 49.70 ? 121  LYS B C     1 
ATOM   2198 O  O     . LYS B 2 120 ? 15.322 31.454  30.574  1.00 47.37 ? 121  LYS B O     1 
ATOM   2199 C  CB    . LYS B 2 120 ? 16.616 34.207  31.730  1.00 53.40 ? 121  LYS B CB    1 
ATOM   2200 C  CG    . LYS B 2 120 ? 17.686 33.100  31.832  1.00 59.92 ? 121  LYS B CG    1 
ATOM   2201 C  CD    . LYS B 2 120 ? 18.183 32.606  30.451  1.00 69.61 ? 121  LYS B CD    1 
ATOM   2202 C  CE    . LYS B 2 120 ? 19.699 32.803  30.249  1.00 71.94 ? 121  LYS B CE    1 
ATOM   2203 N  NZ    . LYS B 2 120 ? 20.115 34.241  30.107  1.00 71.99 ? 121  LYS B NZ    1 
ATOM   2204 N  N     . PHE B 2 121 ? 13.921 32.394  32.037  1.00 46.74 ? 122  PHE B N     1 
ATOM   2205 C  CA    . PHE B 2 121 ? 13.245 31.124  32.281  1.00 46.44 ? 122  PHE B CA    1 
ATOM   2206 C  C     . PHE B 2 121 ? 12.629 30.561  30.995  1.00 46.15 ? 122  PHE B C     1 
ATOM   2207 O  O     . PHE B 2 121 ? 12.839 29.394  30.621  1.00 46.83 ? 122  PHE B O     1 
ATOM   2208 C  CB    . PHE B 2 121 ? 12.175 31.264  33.366  1.00 45.02 ? 122  PHE B CB    1 
ATOM   2209 C  CG    . PHE B 2 121 ? 11.561 29.948  33.785  1.00 43.92 ? 122  PHE B CG    1 
ATOM   2210 C  CD1   . PHE B 2 121 ? 12.287 29.012  34.513  1.00 45.03 ? 122  PHE B CD1   1 
ATOM   2211 C  CD2   . PHE B 2 121 ? 10.259 29.642  33.435  1.00 45.30 ? 122  PHE B CD2   1 
ATOM   2212 C  CE1   . PHE B 2 121 ? 11.708 27.789  34.905  1.00 45.46 ? 122  PHE B CE1   1 
ATOM   2213 C  CE2   . PHE B 2 121 ? 9.690  28.436  33.807  1.00 43.94 ? 122  PHE B CE2   1 
ATOM   2214 C  CZ    . PHE B 2 121 ? 10.414 27.500  34.528  1.00 42.46 ? 122  PHE B CZ    1 
ATOM   2215 N  N     . LEU B 2 122 ? 11.845 31.392  30.323  1.00 43.12 ? 123  LEU B N     1 
ATOM   2216 C  CA    . LEU B 2 122 ? 11.260 31.034  29.031  1.00 45.61 ? 123  LEU B CA    1 
ATOM   2217 C  C     . LEU B 2 122 ? 12.255 30.542  27.989  1.00 43.69 ? 123  LEU B C     1 
ATOM   2218 O  O     . LEU B 2 122 ? 11.954 29.597  27.250  1.00 45.90 ? 123  LEU B O     1 
ATOM   2219 C  CB    . LEU B 2 122 ? 10.518 32.232  28.425  1.00 42.08 ? 123  LEU B CB    1 
ATOM   2220 C  CG    . LEU B 2 122 ? 8.998  32.128  28.487  1.00 53.01 ? 123  LEU B CG    1 
ATOM   2221 C  CD1   . LEU B 2 122 ? 8.497  30.842  27.848  1.00 54.87 ? 123  LEU B CD1   1 
ATOM   2222 C  CD2   . LEU B 2 122 ? 8.571  32.129  29.927  1.00 60.27 ? 123  LEU B CD2   1 
ATOM   2223 N  N     . GLU B 2 123 ? 13.387 31.229  27.858  1.00 41.28 ? 124  GLU B N     1 
ATOM   2224 C  CA    . GLU B 2 123 ? 14.404 30.830  26.893  1.00 45.97 ? 124  GLU B CA    1 
ATOM   2225 C  C     . GLU B 2 123 ? 14.901 29.428  27.225  1.00 41.81 ? 124  GLU B C     1 
ATOM   2226 O  O     . GLU B 2 123 ? 15.061 28.573  26.349  1.00 41.13 ? 124  GLU B O     1 
ATOM   2227 C  CB    . GLU B 2 123 ? 15.600 31.801  26.903  1.00 48.13 ? 124  GLU B CB    1 
ATOM   2228 C  CG    . GLU B 2 123 ? 16.755 31.312  26.005  1.00 52.03 ? 124  GLU B CG    1 
ATOM   2229 C  CD    . GLU B 2 123 ? 17.929 32.278  25.874  1.00 54.15 ? 124  GLU B CD    1 
ATOM   2230 O  OE1   . GLU B 2 123 ? 18.277 32.947  26.869  1.00 62.71 ? 124  GLU B OE1   1 
ATOM   2231 O  OE2   . GLU B 2 123 ? 18.530 32.341  24.772  1.00 67.98 ? 124  GLU B OE2   1 
ATOM   2232 N  N     . VAL B 2 124 ? 15.147 29.189  28.504  1.00 40.15 ? 125  VAL B N     1 
ATOM   2233 C  CA    . VAL B 2 124 ? 15.558 27.864  28.909  1.00 42.35 ? 125  VAL B CA    1 
ATOM   2234 C  C     . VAL B 2 124 ? 14.445 26.857  28.599  1.00 41.24 ? 125  VAL B C     1 
ATOM   2235 O  O     . VAL B 2 124 ? 14.727 25.739  28.147  1.00 42.31 ? 125  VAL B O     1 
ATOM   2236 C  CB    . VAL B 2 124 ? 16.062 27.841  30.371  1.00 43.69 ? 125  VAL B CB    1 
ATOM   2237 C  CG1   . VAL B 2 124 ? 16.360 26.453  30.829  1.00 42.19 ? 125  VAL B CG1   1 
ATOM   2238 C  CG2   . VAL B 2 124 ? 17.329 28.688  30.495  1.00 44.98 ? 125  VAL B CG2   1 
ATOM   2239 N  N     . CYS B 2 125 ? 13.185 27.245  28.781  1.00 38.77 ? 126  CYS B N     1 
ATOM   2240 C  CA    . CYS B 2 125 ? 12.091 26.328  28.455  1.00 38.58 ? 126  CYS B CA    1 
ATOM   2241 C  C     . CYS B 2 125 ? 12.083 26.005  26.974  1.00 37.44 ? 126  CYS B C     1 
ATOM   2242 O  O     . CYS B 2 125 ? 11.724 24.894  26.581  1.00 38.67 ? 126  CYS B O     1 
ATOM   2243 C  CB    . CYS B 2 125 ? 10.706 26.840  28.890  1.00 36.78 ? 126  CYS B CB    1 
ATOM   2244 S  SG    . CYS B 2 125 ? 10.431 26.876  30.643  1.00 39.47 ? 126  CYS B SG    1 
ATOM   2245 N  N     . THR B 2 126 ? 12.466 26.952  26.132  1.00 37.78 ? 127  THR B N     1 
ATOM   2246 C  CA    . THR B 2 126 ? 12.615 26.595  24.708  1.00 40.95 ? 127  THR B CA    1 
ATOM   2247 C  C     . THR B 2 126 ? 13.715 25.562  24.386  1.00 39.30 ? 127  THR B C     1 
ATOM   2248 O  O     . THR B 2 126 ? 13.605 24.773  23.431  1.00 39.33 ? 127  THR B O     1 
ATOM   2249 C  CB    . THR B 2 126 ? 12.734 27.798  23.780  1.00 40.21 ? 127  THR B CB    1 
ATOM   2250 O  OG1   . THR B 2 126 ? 14.035 28.369  23.915  1.00 42.55 ? 127  THR B OG1   1 
ATOM   2251 C  CG2   . THR B 2 126 ? 11.698 28.850  24.136  1.00 42.06 ? 127  THR B CG2   1 
ATOM   2252 N  N     . TRP B 2 127 ? 14.761 25.530  25.195  1.00 37.22 ? 128  TRP B N     1 
ATOM   2253 C  CA    . TRP B 2 127 ? 15.756 24.456  25.026  1.00 35.51 ? 128  TRP B CA    1 
ATOM   2254 C  C     . TRP B 2 127 ? 15.191 23.098  25.401  1.00 35.14 ? 128  TRP B C     1 
ATOM   2255 O  O     . TRP B 2 127 ? 15.538 22.070  24.784  1.00 34.72 ? 128  TRP B O     1 
ATOM   2256 C  CB    . TRP B 2 127 ? 17.024 24.753  25.825  1.00 37.97 ? 128  TRP B CB    1 
ATOM   2257 C  CG    . TRP B 2 127 ? 17.562 26.094  25.472  1.00 40.68 ? 128  TRP B CG    1 
ATOM   2258 C  CD1   . TRP B 2 127 ? 17.287 26.809  24.337  1.00 44.95 ? 128  TRP B CD1   1 
ATOM   2259 C  CD2   . TRP B 2 127 ? 18.449 26.904  26.255  1.00 42.37 ? 128  TRP B CD2   1 
ATOM   2260 N  NE1   . TRP B 2 127 ? 17.966 28.007  24.359  1.00 47.40 ? 128  TRP B NE1   1 
ATOM   2261 C  CE2   . TRP B 2 127 ? 18.675 28.096  25.530  1.00 47.78 ? 128  TRP B CE2   1 
ATOM   2262 C  CE3   . TRP B 2 127 ? 19.079 26.735  27.491  1.00 42.90 ? 128  TRP B CE3   1 
ATOM   2263 C  CZ2   . TRP B 2 127 ? 19.514 29.120  26.001  1.00 48.70 ? 128  TRP B CZ2   1 
ATOM   2264 C  CZ3   . TRP B 2 127 ? 19.895 27.757  27.967  1.00 44.12 ? 128  TRP B CZ3   1 
ATOM   2265 C  CH2   . TRP B 2 127 ? 20.112 28.930  27.217  1.00 44.72 ? 128  TRP B CH2   1 
ATOM   2266 N  N     . VAL B 2 128 ? 14.317 23.086  26.400  1.00 33.62 ? 129  VAL B N     1 
ATOM   2267 C  CA    . VAL B 2 128 ? 13.621 21.846  26.764  1.00 35.23 ? 129  VAL B CA    1 
ATOM   2268 C  C     . VAL B 2 128 ? 12.782 21.383  25.570  1.00 33.69 ? 129  VAL B C     1 
ATOM   2269 O  O     . VAL B 2 128 ? 12.743 20.202  25.231  1.00 33.58 ? 129  VAL B O     1 
ATOM   2270 C  CB    . VAL B 2 128 ? 12.676 22.050  27.992  1.00 35.37 ? 129  VAL B CB    1 
ATOM   2271 C  CG1   . VAL B 2 128 ? 11.799 20.833  28.180  1.00 30.87 ? 129  VAL B CG1   1 
ATOM   2272 C  CG2   . VAL B 2 128 ? 13.465 22.370  29.283  1.00 32.12 ? 129  VAL B CG2   1 
ATOM   2273 N  N     . ASP B 2 129 ? 12.100 22.313  24.926  1.00 34.44 ? 130  ASP B N     1 
ATOM   2274 C  CA    . ASP B 2 129 ? 11.290 22.001  23.733  1.00 33.22 ? 130  ASP B CA    1 
ATOM   2275 C  C     . ASP B 2 129 ? 12.181 21.325  22.677  1.00 33.55 ? 130  ASP B C     1 
ATOM   2276 O  O     . ASP B 2 129 ? 11.787 20.362  22.003  1.00 32.92 ? 130  ASP B O     1 
ATOM   2277 C  CB    . ASP B 2 129 ? 10.776 23.297  23.095  1.00 32.43 ? 130  ASP B CB    1 
ATOM   2278 C  CG    . ASP B 2 129 ? 9.633  23.980  23.861  1.00 38.47 ? 130  ASP B CG    1 
ATOM   2279 O  OD1   . ASP B 2 129 ? 8.981  23.409  24.779  1.00 33.48 ? 130  ASP B OD1   1 
ATOM   2280 O  OD2   . ASP B 2 129 ? 9.391  25.168  23.517  1.00 38.03 ? 130  ASP B OD2   1 
ATOM   2281 N  N     . GLN B 2 130 ? 13.373 21.879  22.473  1.00 31.84 ? 131  GLN B N     1 
ATOM   2282 C  CA    . GLN B 2 130 ? 14.305 21.337  21.468  1.00 30.79 ? 131  GLN B CA    1 
ATOM   2283 C  C     . GLN B 2 130 ? 14.748 19.910  21.808  1.00 32.21 ? 131  GLN B C     1 
ATOM   2284 O  O     . GLN B 2 130 ? 14.846 19.076  20.904  1.00 32.56 ? 131  GLN B O     1 
ATOM   2285 C  CB    . GLN B 2 130 ? 15.532 22.253  21.384  1.00 31.17 ? 131  GLN B CB    1 
ATOM   2286 C  CG    . GLN B 2 130 ? 15.150 23.594  20.779  1.00 33.68 ? 131  GLN B CG    1 
ATOM   2287 C  CD    . GLN B 2 130 ? 16.296 24.554  20.774  1.00 45.56 ? 131  GLN B CD    1 
ATOM   2288 O  OE1   . GLN B 2 130 ? 17.467 24.143  20.744  1.00 43.40 ? 131  GLN B OE1   1 
ATOM   2289 N  NE2   . GLN B 2 130 ? 15.975 25.850  20.853  1.00 45.48 ? 131  GLN B NE2   1 
ATOM   2290 N  N     . ILE B 2 131 ? 15.017 19.630  23.087  1.00 28.68 ? 132  ILE B N     1 
ATOM   2291 C  CA    . ILE B 2 131 ? 15.298 18.258  23.517  1.00 28.56 ? 132  ILE B CA    1 
ATOM   2292 C  C     . ILE B 2 131 ? 14.154 17.296  23.139  1.00 30.76 ? 132  ILE B C     1 
ATOM   2293 O  O     . ILE B 2 131 ? 14.366 16.244  22.491  1.00 29.25 ? 132  ILE B O     1 
ATOM   2294 C  CB    . ILE B 2 131 ? 15.576 18.219  25.036  1.00 25.38 ? 132  ILE B CB    1 
ATOM   2295 C  CG1   . ILE B 2 131 ? 16.914 18.921  25.314  1.00 26.23 ? 132  ILE B CG1   1 
ATOM   2296 C  CG2   . ILE B 2 131 ? 15.724 16.778  25.561  1.00 27.50 ? 132  ILE B CG2   1 
ATOM   2297 C  CD1   . ILE B 2 131 ? 17.170 19.192  26.843  1.00 27.21 ? 132  ILE B CD1   1 
ATOM   2298 N  N     . ALA B 2 132 ? 12.933 17.666  23.520  1.00 29.55 ? 133  ALA B N     1 
ATOM   2299 C  CA    . ALA B 2 132 ? 11.798 16.809  23.273  1.00 27.91 ? 133  ALA B CA    1 
ATOM   2300 C  C     . ALA B 2 132 ? 11.641 16.636  21.757  1.00 29.27 ? 133  ALA B C     1 
ATOM   2301 O  O     . ALA B 2 132 ? 11.253 15.556  21.297  1.00 30.43 ? 133  ALA B O     1 
ATOM   2302 C  CB    . ALA B 2 132 ? 10.520 17.421  23.912  1.00 31.61 ? 133  ALA B CB    1 
ATOM   2303 N  N     . ALA B 2 133 ? 11.929 17.666  20.975  1.00 30.53 ? 134  ALA B N     1 
ATOM   2304 C  CA    . ALA B 2 133 ? 11.803 17.563  19.505  1.00 33.63 ? 134  ALA B CA    1 
ATOM   2305 C  C     . ALA B 2 133 ? 12.776 16.546  18.903  1.00 33.65 ? 134  ALA B C     1 
ATOM   2306 O  O     . ALA B 2 133 ? 12.489 15.899  17.902  1.00 34.12 ? 134  ALA B O     1 
ATOM   2307 C  CB    . ALA B 2 133 ? 12.063 18.926  18.858  1.00 34.74 ? 134  ALA B CB    1 
ATOM   2308 N  N     . LEU B 2 134 ? 13.950 16.438  19.511  1.00 32.51 ? 135  LEU B N     1 
ATOM   2309 C  CA    . LEU B 2 134 ? 14.950 15.471  19.109  1.00 30.96 ? 135  LEU B CA    1 
ATOM   2310 C  C     . LEU B 2 134 ? 14.636 14.054  19.557  1.00 32.35 ? 135  LEU B C     1 
ATOM   2311 O  O     . LEU B 2 134 ? 15.079 13.129  18.887  1.00 30.48 ? 135  LEU B O     1 
ATOM   2312 C  CB    . LEU B 2 134 ? 16.332 15.885  19.661  1.00 29.44 ? 135  LEU B CB    1 
ATOM   2313 C  CG    . LEU B 2 134 ? 16.884 17.154  19.034  1.00 30.64 ? 135  LEU B CG    1 
ATOM   2314 C  CD1   . LEU B 2 134 ? 17.898 17.803  19.941  1.00 31.09 ? 135  LEU B CD1   1 
ATOM   2315 C  CD2   . LEU B 2 134 ? 17.528 16.798  17.661  1.00 38.49 ? 135  LEU B CD2   1 
ATOM   2316 N  N     . ASN B 2 135 ? 13.955 13.878  20.693  1.00 27.15 ? 136  ASN B N     1 
ATOM   2317 C  CA    . ASN B 2 135 ? 13.531 12.572  21.183  1.00 28.41 ? 136  ASN B CA    1 
ATOM   2318 C  C     . ASN B 2 135 ? 12.358 12.058  20.371  1.00 28.68 ? 136  ASN B C     1 
ATOM   2319 O  O     . ASN B 2 135 ? 11.798 12.798  19.566  1.00 29.61 ? 136  ASN B O     1 
ATOM   2320 C  CB    . ASN B 2 135 ? 13.100 12.700  22.656  1.00 26.43 ? 136  ASN B CB    1 
ATOM   2321 C  CG    . ASN B 2 135 ? 14.300 12.913  23.586  1.00 27.21 ? 136  ASN B CG    1 
ATOM   2322 O  OD1   . ASN B 2 135 ? 15.454 12.765  23.176  1.00 29.88 ? 136  ASN B OD1   1 
ATOM   2323 N  ND2   . ASN B 2 135 ? 14.034 13.323  24.822  1.00 25.82 ? 136  ASN B ND2   1 
ATOM   2324 N  N     . ASP B 2 136 ? 11.969 10.802  20.585  1.00 25.12 ? 137  ASP B N     1 
ATOM   2325 C  CA    . ASP B 2 136 ? 10.737 10.282  19.948  1.00 28.00 ? 137  ASP B CA    1 
ATOM   2326 C  C     . ASP B 2 136 ? 9.519  10.665  20.830  1.00 28.46 ? 137  ASP B C     1 
ATOM   2327 O  O     . ASP B 2 136 ? 8.890  9.823   21.489  1.00 26.41 ? 137  ASP B O     1 
ATOM   2328 C  CB    . ASP B 2 136 ? 10.828 8.750   19.787  1.00 26.18 ? 137  ASP B CB    1 
ATOM   2329 C  CG    . ASP B 2 136 ? 11.898 8.312   18.763  1.00 31.73 ? 137  ASP B CG    1 
ATOM   2330 O  OD1   . ASP B 2 136 ? 12.239 9.099   17.858  1.00 28.88 ? 137  ASP B OD1   1 
ATOM   2331 O  OD2   . ASP B 2 136 ? 12.397 7.160   18.822  1.00 36.28 ? 137  ASP B OD2   1 
ATOM   2332 N  N     . SER B 2 137 ? 9.223  11.959  20.896  1.00 30.49 ? 138  SER B N     1 
ATOM   2333 C  CA    . SER B 2 137 ? 8.283  12.459  21.906  1.00 31.18 ? 138  SER B CA    1 
ATOM   2334 C  C     . SER B 2 137 ? 6.877  12.097  21.428  1.00 32.12 ? 138  SER B C     1 
ATOM   2335 O  O     . SER B 2 137 ? 6.592  12.326  20.252  1.00 31.70 ? 138  SER B O     1 
ATOM   2336 C  CB    . SER B 2 137 ? 8.424  13.984  22.037  1.00 33.46 ? 138  SER B CB    1 
ATOM   2337 O  OG    . SER B 2 137 ? 7.464  14.489  22.975  1.00 29.75 ? 138  SER B OG    1 
ATOM   2338 N  N     . LYS B 2 138 ? 6.017  11.571  22.311  1.00 31.21 ? 139  LYS B N     1 
ATOM   2339 C  CA    . LYS B 2 138 ? 4.629  11.173  21.963  1.00 32.86 ? 139  LYS B CA    1 
ATOM   2340 C  C     . LYS B 2 138 ? 3.579  11.576  22.981  1.00 33.55 ? 139  LYS B C     1 
ATOM   2341 O  O     . LYS B 2 138 ? 2.404  11.561  22.656  1.00 33.43 ? 139  LYS B O     1 
ATOM   2342 C  CB    . LYS B 2 138 ? 4.505  9.651   21.731  1.00 32.53 ? 139  LYS B CB    1 
ATOM   2343 C  CG    . LYS B 2 138 ? 5.449  9.177   20.574  1.00 33.04 ? 139  LYS B CG    1 
ATOM   2344 C  CD    . LYS B 2 138 ? 5.359  7.656   20.377  1.00 35.75 ? 139  LYS B CD    1 
ATOM   2345 C  CE    . LYS B 2 138 ? 6.218  6.850   21.359  1.00 35.25 ? 139  LYS B CE    1 
ATOM   2346 N  NZ    . LYS B 2 138 ? 7.721  7.059   21.170  1.00 30.34 ? 139  LYS B NZ    1 
ATOM   2347 N  N     . THR B 2 139 ? 3.970  11.830  24.226  1.00 31.63 ? 140  THR B N     1 
ATOM   2348 C  CA    . THR B 2 139 ? 2.993  12.099  25.283  1.00 30.62 ? 140  THR B CA    1 
ATOM   2349 C  C     . THR B 2 139 ? 3.199  13.419  25.999  1.00 29.28 ? 140  THR B C     1 
ATOM   2350 O  O     . THR B 2 139 ? 2.712  13.624  27.109  1.00 30.96 ? 140  THR B O     1 
ATOM   2351 C  CB    . THR B 2 139 ? 2.874  10.984  26.350  1.00 31.15 ? 140  THR B CB    1 
ATOM   2352 O  OG1   . THR B 2 139 ? 4.113  10.799  27.028  1.00 37.95 ? 140  THR B OG1   1 
ATOM   2353 C  CG2   . THR B 2 139 ? 2.389  9.676   25.774  1.00 33.87 ? 140  THR B CG2   1 
ATOM   2354 N  N     . ARG B 2 140 ? 3.889  14.345  25.369  1.00 29.99 ? 141  ARG B N     1 
ATOM   2355 C  CA    . ARG B 2 140 ? 4.318  15.552  26.050  1.00 31.97 ? 141  ARG B CA    1 
ATOM   2356 C  C     . ARG B 2 140 ? 3.145  16.525  26.160  1.00 36.14 ? 141  ARG B C     1 
ATOM   2357 O  O     . ARG B 2 140 ? 2.346  16.603  25.234  1.00 33.41 ? 141  ARG B O     1 
ATOM   2358 C  CB    . ARG B 2 140 ? 5.433  16.179  25.224  1.00 32.80 ? 141  ARG B CB    1 
ATOM   2359 C  CG    . ARG B 2 140 ? 6.107  17.394  25.867  1.00 35.37 ? 141  ARG B CG    1 
ATOM   2360 C  CD    . ARG B 2 140 ? 7.256  17.824  24.994  1.00 35.60 ? 141  ARG B CD    1 
ATOM   2361 N  NE    . ARG B 2 140 ? 7.966  18.917  25.663  1.00 40.85 ? 141  ARG B NE    1 
ATOM   2362 C  CZ    . ARG B 2 140 ? 8.097  20.150  25.177  1.00 37.21 ? 141  ARG B CZ    1 
ATOM   2363 N  NH1   . ARG B 2 140 ? 7.627  20.450  23.974  1.00 38.83 ? 141  ARG B NH1   1 
ATOM   2364 N  NH2   . ARG B 2 140 ? 8.753  21.064  25.881  1.00 37.83 ? 141  ARG B NH2   1 
ATOM   2365 N  N     . LYS B 2 141 ? 3.054  17.260  27.267  1.00 33.89 ? 142  LYS B N     1 
ATOM   2366 C  CA    . LYS B 2 141 ? 1.944  18.186  27.514  1.00 37.38 ? 142  LYS B CA    1 
ATOM   2367 C  C     . LYS B 2 141 ? 2.473  19.601  27.767  1.00 37.09 ? 142  LYS B C     1 
ATOM   2368 O  O     . LYS B 2 141 ? 2.069  20.561  27.132  1.00 40.14 ? 142  LYS B O     1 
ATOM   2369 C  CB    . LYS B 2 141 ? 1.199  17.737  28.745  1.00 37.72 ? 142  LYS B CB    1 
ATOM   2370 C  CG    . LYS B 2 141 ? 0.132  16.685  28.517  1.00 49.84 ? 142  LYS B CG    1 
ATOM   2371 C  CD    . LYS B 2 141 ? -0.468 16.260  29.893  1.00 62.04 ? 142  LYS B CD    1 
ATOM   2372 C  CE    . LYS B 2 141 ? -1.948 16.643  30.094  1.00 60.74 ? 142  LYS B CE    1 
ATOM   2373 N  NZ    . LYS B 2 141 ? -2.685 15.719  31.039  1.00 51.45 ? 142  LYS B NZ    1 
ATOM   2374 N  N     . THR B 2 142 ? 3.396  19.767  28.697  1.00 34.39 ? 143  THR B N     1 
ATOM   2375 C  CA    . THR B 2 142 ? 3.734  21.144  29.077  1.00 34.98 ? 143  THR B CA    1 
ATOM   2376 C  C     . THR B 2 142 ? 4.925  21.632  28.268  1.00 34.81 ? 143  THR B C     1 
ATOM   2377 O  O     . THR B 2 142 ? 5.971  20.984  28.258  1.00 38.06 ? 143  THR B O     1 
ATOM   2378 C  CB    . THR B 2 142 ? 4.048  21.191  30.563  1.00 37.64 ? 143  THR B CB    1 
ATOM   2379 O  OG1   . THR B 2 142 ? 2.939  20.634  31.278  1.00 38.00 ? 143  THR B OG1   1 
ATOM   2380 C  CG2   . THR B 2 142 ? 4.258  22.600  31.019  1.00 35.35 ? 143  THR B CG2   1 
ATOM   2381 N  N     . THR B 2 143 ? 4.758  22.737  27.543  1.00 35.48 ? 144  THR B N     1 
ATOM   2382 C  CA    . THR B 2 143 ? 5.771  23.211  26.619  1.00 37.35 ? 144  THR B CA    1 
ATOM   2383 C  C     . THR B 2 143 ? 6.111  24.657  26.932  1.00 37.35 ? 144  THR B C     1 
ATOM   2384 O  O     . THR B 2 143 ? 5.510  25.239  27.821  1.00 38.45 ? 144  THR B O     1 
ATOM   2385 C  CB    . THR B 2 143 ? 5.281  23.205  25.188  1.00 35.25 ? 144  THR B CB    1 
ATOM   2386 O  OG1   . THR B 2 143 ? 4.423  24.328  25.052  1.00 40.30 ? 144  THR B OG1   1 
ATOM   2387 C  CG2   . THR B 2 143 ? 4.490  21.948  24.864  1.00 37.43 ? 144  THR B CG2   1 
ATOM   2388 N  N     . SER B 2 144 ? 7.067  25.250  26.225  1.00 37.65 ? 145  SER B N     1 
ATOM   2389 C  CA    . SER B 2 144 ? 7.462  26.607  26.597  1.00 41.45 ? 145  SER B CA    1 
ATOM   2390 C  C     . SER B 2 144 ? 6.272  27.536  26.358  1.00 46.36 ? 145  SER B C     1 
ATOM   2391 O  O     . SER B 2 144 ? 6.156  28.592  26.986  1.00 48.07 ? 145  SER B O     1 
ATOM   2392 C  CB    . SER B 2 144 ? 8.673  27.085  25.799  1.00 43.40 ? 145  SER B CB    1 
ATOM   2393 O  OG    . SER B 2 144 ? 8.382  27.153  24.407  1.00 39.15 ? 145  SER B OG    1 
ATOM   2394 N  N     . GLU B 2 145 ? 5.385  27.164  25.443  1.00 48.47 ? 146  GLU B N     1 
ATOM   2395 C  CA    . GLU B 2 145 ? 4.222  28.015  25.195  1.00 50.64 ? 146  GLU B CA    1 
ATOM   2396 C  C     . GLU B 2 145 ? 3.199  27.895  26.317  1.00 51.78 ? 146  GLU B C     1 
ATOM   2397 O  O     . GLU B 2 145 ? 2.530  28.867  26.657  1.00 54.33 ? 146  GLU B O     1 
ATOM   2398 C  CB    . GLU B 2 145 ? 3.600  27.755  23.814  1.00 51.70 ? 146  GLU B CB    1 
ATOM   2399 C  CG    . GLU B 2 145 ? 3.348  29.077  23.046  1.00 65.85 ? 146  GLU B CG    1 
ATOM   2400 C  CD    . GLU B 2 145 ? 2.212  29.943  23.639  1.00 79.17 ? 146  GLU B CD    1 
ATOM   2401 O  OE1   . GLU B 2 145 ? 1.098  29.421  23.924  1.00 86.83 ? 146  GLU B OE1   1 
ATOM   2402 O  OE2   . GLU B 2 145 ? 2.422  31.167  23.810  1.00 81.11 ? 146  GLU B OE2   1 
ATOM   2403 N  N     . THR B 2 146 ? 3.062  26.719  26.918  1.00 49.74 ? 147  THR B N     1 
ATOM   2404 C  CA    . THR B 2 146 ? 2.285  26.626  28.146  1.00 51.05 ? 147  THR B CA    1 
ATOM   2405 C  C     . THR B 2 146 ? 2.766  27.645  29.186  1.00 51.93 ? 147  THR B C     1 
ATOM   2406 O  O     . THR B 2 146 ? 1.982  28.421  29.757  1.00 51.38 ? 147  THR B O     1 
ATOM   2407 C  CB    . THR B 2 146 ? 2.346  25.209  28.715  1.00 52.57 ? 147  THR B CB    1 
ATOM   2408 O  OG1   . THR B 2 146 ? 2.174  24.267  27.647  1.00 51.60 ? 147  THR B OG1   1 
ATOM   2409 C  CG2   . THR B 2 146 ? 1.282  25.016  29.801  1.00 53.71 ? 147  THR B CG2   1 
ATOM   2410 N  N     . VAL B 2 147 ? 4.072  27.663  29.401  1.00 48.40 ? 148  VAL B N     1 
ATOM   2411 C  CA    . VAL B 2 147 ? 4.682  28.590  30.345  1.00 49.21 ? 148  VAL B CA    1 
ATOM   2412 C  C     . VAL B 2 147 ? 4.421  30.057  29.999  1.00 49.28 ? 148  VAL B C     1 
ATOM   2413 O  O     . VAL B 2 147 ? 3.983  30.830  30.872  1.00 45.23 ? 148  VAL B O     1 
ATOM   2414 C  CB    . VAL B 2 147 ? 6.198  28.331  30.482  1.00 47.46 ? 148  VAL B CB    1 
ATOM   2415 C  CG1   . VAL B 2 147 ? 6.825  29.305  31.451  1.00 49.69 ? 148  VAL B CG1   1 
ATOM   2416 C  CG2   . VAL B 2 147 ? 6.427  26.880  30.922  1.00 42.84 ? 148  VAL B CG2   1 
ATOM   2417 N  N     . ARG B 2 148 ? 4.684  30.429  28.747  1.00 51.09 ? 149  ARG B N     1 
ATOM   2418 C  CA    . ARG B 2 148 ? 4.429  31.797  28.246  1.00 56.73 ? 149  ARG B CA    1 
ATOM   2419 C  C     . ARG B 2 148 ? 2.985  32.268  28.434  1.00 57.88 ? 149  ARG B C     1 
ATOM   2420 O  O     . ARG B 2 148 ? 2.737  33.399  28.841  1.00 58.20 ? 149  ARG B O     1 
ATOM   2421 C  CB    . ARG B 2 148 ? 4.819  31.909  26.769  1.00 56.09 ? 149  ARG B CB    1 
ATOM   2422 C  CG    . ARG B 2 148 ? 4.276  33.127  26.031  1.00 64.10 ? 149  ARG B CG    1 
ATOM   2423 C  CD    . ARG B 2 148 ? 5.208  33.503  24.894  1.00 74.16 ? 149  ARG B CD    1 
ATOM   2424 N  NE    . ARG B 2 148 ? 6.533  33.829  25.418  1.00 84.62 ? 149  ARG B NE    1 
ATOM   2425 C  CZ    . ARG B 2 148 ? 7.675  33.753  24.739  1.00 91.44 ? 149  ARG B CZ    1 
ATOM   2426 N  NH1   . ARG B 2 148 ? 7.696  33.354  23.470  1.00 94.71 ? 149  ARG B NH1   1 
ATOM   2427 N  NH2   . ARG B 2 148 ? 8.810  34.079  25.344  1.00 95.02 ? 149  ARG B NH2   1 
ATOM   2428 N  N     . ALA B 2 149 ? 2.032  31.395  28.146  1.00 59.30 ? 150  ALA B N     1 
ATOM   2429 C  CA    . ALA B 2 149 ? 0.636  31.697  28.397  1.00 63.99 ? 150  ALA B CA    1 
ATOM   2430 C  C     . ALA B 2 149 ? 0.448  32.081  29.865  1.00 66.95 ? 150  ALA B C     1 
ATOM   2431 O  O     . ALA B 2 149 ? -0.261 33.045  30.196  1.00 66.71 ? 150  ALA B O     1 
ATOM   2432 C  CB    . ALA B 2 149 ? -0.227 30.496  28.053  1.00 63.12 ? 150  ALA B CB    1 
ATOM   2433 N  N     . VAL B 2 150 ? 1.067  31.311  30.753  1.00 67.66 ? 151  VAL B N     1 
ATOM   2434 C  CA    . VAL B 2 150 ? 0.627  31.328  32.139  1.00 69.64 ? 151  VAL B CA    1 
ATOM   2435 C  C     . VAL B 2 150 ? 1.253  32.547  32.790  1.00 70.26 ? 151  VAL B C     1 
ATOM   2436 O  O     . VAL B 2 150 ? 0.718  33.092  33.756  1.00 71.60 ? 151  VAL B O     1 
ATOM   2437 C  CB    . VAL B 2 150 ? 0.946  30.021  32.895  1.00 69.59 ? 151  VAL B CB    1 
ATOM   2438 C  CG1   . VAL B 2 150 ? -0.076 28.948  32.564  1.00 67.76 ? 151  VAL B CG1   1 
ATOM   2439 C  CG2   . VAL B 2 150 ? 2.339  29.524  32.539  1.00 72.91 ? 151  VAL B CG2   1 
ATOM   2440 N  N     . LEU B 2 151 ? 2.363  32.992  32.213  1.00 70.30 ? 152  LEU B N     1 
ATOM   2441 C  CA    . LEU B 2 151 ? 3.053  34.187  32.672  1.00 71.57 ? 152  LEU B CA    1 
ATOM   2442 C  C     . LEU B 2 151 ? 2.350  35.497  32.257  1.00 76.10 ? 152  LEU B C     1 
ATOM   2443 O  O     . LEU B 2 151 ? 2.307  35.863  31.071  1.00 76.25 ? 152  LEU B O     1 
ATOM   2444 C  CB    . LEU B 2 151 ? 4.537  34.140  32.278  1.00 70.75 ? 152  LEU B CB    1 
ATOM   2445 C  CG    . LEU B 2 151 ? 5.370  33.004  32.914  1.00 69.06 ? 152  LEU B CG    1 
ATOM   2446 C  CD1   . LEU B 2 151 ? 6.883  33.178  32.753  1.00 65.87 ? 152  LEU B CD1   1 
ATOM   2447 C  CD2   . LEU B 2 151 ? 5.013  32.717  34.378  1.00 66.63 ? 152  LEU B CD2   1 
ATOM   2448 N  N     . ASP B 2 152 ? 1.802  36.177  33.270  1.00 78.95 ? 153  ASP B N     1 
ATOM   2449 C  CA    . ASP B 2 152 ? 0.757  37.214  33.150  1.00 81.39 ? 153  ASP B CA    1 
ATOM   2450 C  C     . ASP B 2 152 ? 1.052  38.434  34.043  1.00 81.43 ? 153  ASP B C     1 
ATOM   2451 O  O     . ASP B 2 152 ? 1.848  39.332  33.738  1.00 80.68 ? 153  ASP B O     1 
ATOM   2452 C  CB    . ASP B 2 152 ? -0.614 36.652  33.569  1.00 81.97 ? 153  ASP B CB    1 
ATOM   2453 C  CG    . ASP B 2 152 ? -1.265 35.809  32.485  1.00 81.97 ? 153  ASP B CG    1 
ATOM   2454 O  OD1   . ASP B 2 152 ? -0.884 35.959  31.302  1.00 82.26 ? 153  ASP B OD1   1 
ATOM   2455 O  OD2   . ASP B 2 152 ? -2.150 34.990  32.823  1.00 79.86 ? 153  ASP B OD2   1 
ATOM   2456 O  OXT   . ASP B 2 152 ? 0.466  38.546  35.123  1.00 82.23 ? 153  ASP B OXT   1 
ATOM   2457 O  "O5'" . DT  C 3 1   ? 7.357  29.365  46.851  1.00 45.25 ? 1    DT  C "O5'" 1 
ATOM   2458 C  "C5'" . DT  C 3 1   ? 8.317  30.448  46.586  1.00 43.47 ? 1    DT  C "C5'" 1 
ATOM   2459 C  "C4'" . DT  C 3 1   ? 9.784  30.044  46.543  1.00 37.69 ? 1    DT  C "C4'" 1 
ATOM   2460 O  "O4'" . DT  C 3 1   ? 10.155 29.266  47.715  1.00 39.77 ? 1    DT  C "O4'" 1 
ATOM   2461 C  "C3'" . DT  C 3 1   ? 10.232 29.202  45.352  1.00 37.79 ? 1    DT  C "C3'" 1 
ATOM   2462 O  "O3'" . DT  C 3 1   ? 11.503 29.702  44.914  1.00 38.50 ? 1    DT  C "O3'" 1 
ATOM   2463 C  "C2'" . DT  C 3 1   ? 10.306 27.777  45.891  1.00 37.11 ? 1    DT  C "C2'" 1 
ATOM   2464 C  "C1'" . DT  C 3 1   ? 10.615 27.972  47.368  1.00 38.50 ? 1    DT  C "C1'" 1 
ATOM   2465 N  N1    . DT  C 3 1   ? 9.999  26.985  48.320  1.00 41.67 ? 1    DT  C N1    1 
ATOM   2466 C  C2    . DT  C 3 1   ? 10.799 25.986  48.848  1.00 38.08 ? 1    DT  C C2    1 
ATOM   2467 O  O2    . DT  C 3 1   ? 11.967 25.876  48.535  1.00 40.64 ? 1    DT  C O2    1 
ATOM   2468 N  N3    . DT  C 3 1   ? 10.174 25.122  49.713  1.00 37.24 ? 1    DT  C N3    1 
ATOM   2469 C  C4    . DT  C 3 1   ? 8.836  25.164  50.103  1.00 40.94 ? 1    DT  C C4    1 
ATOM   2470 O  O4    . DT  C 3 1   ? 8.341  24.374  50.911  1.00 41.59 ? 1    DT  C O4    1 
ATOM   2471 C  C5    . DT  C 3 1   ? 8.056  26.218  49.501  1.00 43.23 ? 1    DT  C C5    1 
ATOM   2472 C  C7    . DT  C 3 1   ? 6.607  26.335  49.849  1.00 44.35 ? 1    DT  C C7    1 
ATOM   2473 C  C6    . DT  C 3 1   ? 8.656  27.071  48.658  1.00 44.76 ? 1    DT  C C6    1 
ATOM   2474 P  P     . DC  C 3 2   ? 12.097 29.229  43.512  1.00 42.16 ? 2    DC  C P     1 
ATOM   2475 O  OP1   . DC  C 3 2   ? 13.156 30.150  43.086  1.00 49.19 ? 2    DC  C OP1   1 
ATOM   2476 O  OP2   . DC  C 3 2   ? 10.928 28.894  42.634  1.00 42.15 ? 2    DC  C OP2   1 
ATOM   2477 O  "O5'" . DC  C 3 2   ? 12.801 27.814  43.823  1.00 37.08 ? 2    DC  C "O5'" 1 
ATOM   2478 C  "C5'" . DC  C 3 2   ? 14.126 27.803  44.385  1.00 35.05 ? 2    DC  C "C5'" 1 
ATOM   2479 C  "C4'" . DC  C 3 2   ? 14.457 26.396  44.828  1.00 40.76 ? 2    DC  C "C4'" 1 
ATOM   2480 O  "O4'" . DC  C 3 2   ? 13.406 25.817  45.655  1.00 43.76 ? 2    DC  C "O4'" 1 
ATOM   2481 C  "C3'" . DC  C 3 2   ? 14.544 25.529  43.568  1.00 42.45 ? 2    DC  C "C3'" 1 
ATOM   2482 O  "O3'" . DC  C 3 2   ? 15.954 25.254  43.363  1.00 45.10 ? 2    DC  C "O3'" 1 
ATOM   2483 C  "C2'" . DC  C 3 2   ? 13.656 24.311  43.861  1.00 41.06 ? 2    DC  C "C2'" 1 
ATOM   2484 C  "C1'" . DC  C 3 2   ? 13.362 24.426  45.354  1.00 41.18 ? 2    DC  C "C1'" 1 
ATOM   2485 N  N1    . DC  C 3 2   ? 12.064 23.924  45.877  1.00 40.35 ? 2    DC  C N1    1 
ATOM   2486 C  C2    . DC  C 3 2   ? 12.097 22.900  46.841  1.00 40.15 ? 2    DC  C C2    1 
ATOM   2487 O  O2    . DC  C 3 2   ? 13.169 22.401  47.222  1.00 41.12 ? 2    DC  C O2    1 
ATOM   2488 N  N3    . DC  C 3 2   ? 10.925 22.461  47.337  1.00 42.54 ? 2    DC  C N3    1 
ATOM   2489 C  C4    . DC  C 3 2   ? 9.759  22.991  46.956  1.00 39.90 ? 2    DC  C C4    1 
ATOM   2490 N  N4    . DC  C 3 2   ? 8.690  22.460  47.557  1.00 38.55 ? 2    DC  C N4    1 
ATOM   2491 C  C5    . DC  C 3 2   ? 9.663  24.035  45.979  1.00 37.79 ? 2    DC  C C5    1 
ATOM   2492 C  C6    . DC  C 3 2   ? 10.849 24.460  45.473  1.00 40.59 ? 2    DC  C C6    1 
ATOM   2493 P  P     . DT  C 3 3   ? 16.501 24.365  42.148  1.00 52.12 ? 3    DT  C P     1 
ATOM   2494 O  OP1   . DT  C 3 3   ? 17.941 24.653  41.999  1.00 52.81 ? 3    DT  C OP1   1 
ATOM   2495 O  OP2   . DT  C 3 3   ? 15.540 24.448  41.048  1.00 53.61 ? 3    DT  C OP2   1 
ATOM   2496 O  "O5'" . DT  C 3 3   ? 16.358 22.874  42.743  1.00 42.42 ? 3    DT  C "O5'" 1 
ATOM   2497 C  "C5'" . DT  C 3 3   ? 17.222 22.534  43.813  1.00 43.46 ? 3    DT  C "C5'" 1 
ATOM   2498 C  "C4'" . DT  C 3 3   ? 16.951 21.098  44.203  1.00 48.53 ? 3    DT  C "C4'" 1 
ATOM   2499 O  "O4'" . DT  C 3 3   ? 15.637 20.937  44.802  1.00 44.82 ? 3    DT  C "O4'" 1 
ATOM   2500 C  "C3'" . DT  C 3 3   ? 17.035 20.109  43.041  1.00 50.82 ? 3    DT  C "C3'" 1 
ATOM   2501 O  "O3'" . DT  C 3 3   ? 18.204 19.369  43.408  1.00 53.95 ? 3    DT  C "O3'" 1 
ATOM   2502 C  "C2'" . DT  C 3 3   ? 15.686 19.374  43.080  1.00 48.37 ? 3    DT  C "C2'" 1 
ATOM   2503 C  "C1'" . DT  C 3 3   ? 14.959 19.778  44.361  1.00 43.50 ? 3    DT  C "C1'" 1 
ATOM   2504 N  N1    . DT  C 3 3   ? 13.451 20.021  44.377  1.00 37.98 ? 3    DT  C N1    1 
ATOM   2505 C  C2    . DT  C 3 3   ? 12.735 19.346  45.354  1.00 40.67 ? 3    DT  C C2    1 
ATOM   2506 O  O2    . DT  C 3 3   ? 13.227 18.575  46.150  1.00 42.25 ? 3    DT  C O2    1 
ATOM   2507 N  N3    . DT  C 3 3   ? 11.382 19.537  45.421  1.00 38.51 ? 3    DT  C N3    1 
ATOM   2508 C  C4    . DT  C 3 3   ? 10.684 20.388  44.611  1.00 43.15 ? 3    DT  C C4    1 
ATOM   2509 O  O4    . DT  C 3 3   ? 9.462  20.487  44.733  1.00 46.70 ? 3    DT  C O4    1 
ATOM   2510 C  C5    . DT  C 3 3   ? 11.451 21.111  43.597  1.00 44.45 ? 3    DT  C C5    1 
ATOM   2511 C  C7    . DT  C 3 3   ? 10.642 22.024  42.690  1.00 45.43 ? 3    DT  C C7    1 
ATOM   2512 C  C6    . DT  C 3 3   ? 12.789 20.899  43.500  1.00 34.05 ? 3    DT  C C6    1 
ATOM   2513 P  P     . DG  C 3 4   ? 18.806 18.194  42.480  1.00 62.98 ? 4    DG  C P     1 
ATOM   2514 O  OP1   . DG  C 3 4   ? 20.261 18.213  42.779  1.00 58.76 ? 4    DG  C OP1   1 
ATOM   2515 O  OP2   . DG  C 3 4   ? 18.168 18.368  41.142  1.00 57.23 ? 4    DG  C OP2   1 
ATOM   2516 O  "O5'" . DG  C 3 4   ? 18.083 16.913  43.106  1.00 46.97 ? 4    DG  C "O5'" 1 
ATOM   2517 C  "C5'" . DG  C 3 4   ? 18.392 16.542  44.433  1.00 46.52 ? 4    DG  C "C5'" 1 
ATOM   2518 C  "C4'" . DG  C 3 4   ? 17.442 15.416  44.772  1.00 43.56 ? 4    DG  C "C4'" 1 
ATOM   2519 O  "O4'" . DG  C 3 4   ? 16.105 15.975  44.739  1.00 45.72 ? 4    DG  C "O4'" 1 
ATOM   2520 C  "C3'" . DG  C 3 4   ? 17.442 14.338  43.688  1.00 41.10 ? 4    DG  C "C3'" 1 
ATOM   2521 O  "O3'" . DG  C 3 4   ? 17.734 13.159  44.397  1.00 42.07 ? 4    DG  C "O3'" 1 
ATOM   2522 C  "C2'" . DG  C 3 4   ? 16.021 14.326  43.135  1.00 37.97 ? 4    DG  C "C2'" 1 
ATOM   2523 C  "C1'" . DG  C 3 4   ? 15.221 15.000  44.256  1.00 36.79 ? 4    DG  C "C1'" 1 
ATOM   2524 N  N9    . DG  C 3 4   ? 14.042 15.701  43.748  1.00 38.51 ? 4    DG  C N9    1 
ATOM   2525 C  C8    . DG  C 3 4   ? 13.979 16.545  42.667  1.00 36.90 ? 4    DG  C C8    1 
ATOM   2526 N  N7    . DG  C 3 4   ? 12.781 17.048  42.484  1.00 37.10 ? 4    DG  C N7    1 
ATOM   2527 C  C5    . DG  C 3 4   ? 12.013 16.477  43.483  1.00 35.40 ? 4    DG  C C5    1 
ATOM   2528 C  C6    . DG  C 3 4   ? 10.637 16.639  43.748  1.00 35.57 ? 4    DG  C C6    1 
ATOM   2529 O  O6    . DG  C 3 4   ? 9.856  17.350  43.106  1.00 37.12 ? 4    DG  C O6    1 
ATOM   2530 N  N1    . DG  C 3 4   ? 10.200 15.909  44.848  1.00 34.39 ? 4    DG  C N1    1 
ATOM   2531 C  C2    . DG  C 3 4   ? 11.052 15.118  45.593  1.00 35.68 ? 4    DG  C C2    1 
ATOM   2532 N  N2    . DG  C 3 4   ? 10.530 14.481  46.641  1.00 35.98 ? 4    DG  C N2    1 
ATOM   2533 N  N3    . DG  C 3 4   ? 12.350 14.940  45.344  1.00 36.73 ? 4    DG  C N3    1 
ATOM   2534 C  C4    . DG  C 3 4   ? 12.769 15.667  44.280  1.00 34.92 ? 4    DG  C C4    1 
ATOM   2535 P  P     . DC  C 3 5   ? 17.750 11.678  43.849  1.00 41.36 ? 5    DC  C P     1 
ATOM   2536 O  OP1   . DC  C 3 5   ? 18.757 11.013  44.691  1.00 42.78 ? 5    DC  C OP1   1 
ATOM   2537 O  OP2   . DC  C 3 5   ? 17.818 11.731  42.376  1.00 37.95 ? 5    DC  C OP2   1 
ATOM   2538 O  "O5'" . DC  C 3 5   ? 16.308 11.123  44.271  1.00 43.41 ? 5    DC  C "O5'" 1 
ATOM   2539 C  "C5'" . DC  C 3 5   ? 15.982 11.051  45.641  1.00 44.17 ? 5    DC  C "C5'" 1 
ATOM   2540 C  "C4'" . DC  C 3 5   ? 14.538 10.594  45.805  1.00 45.54 ? 5    DC  C "C4'" 1 
ATOM   2541 O  "O4'" . DC  C 3 5   ? 13.639 11.595  45.271  1.00 42.48 ? 5    DC  C "O4'" 1 
ATOM   2542 C  "C3'" . DC  C 3 5   ? 14.209 9.286   45.105  1.00 43.96 ? 5    DC  C "C3'" 1 
ATOM   2543 O  "O3'" . DC  C 3 5   ? 13.556 8.458   46.063  1.00 47.36 ? 5    DC  C "O3'" 1 
ATOM   2544 C  "C2'" . DC  C 3 5   ? 13.310 9.716   43.961  1.00 43.01 ? 5    DC  C "C2'" 1 
ATOM   2545 C  "C1'" . DC  C 3 5   ? 12.608 10.945  44.545  1.00 43.19 ? 5    DC  C "C1'" 1 
ATOM   2546 N  N1    . DC  C 3 5   ? 12.117 11.930  43.533  1.00 43.21 ? 5    DC  C N1    1 
ATOM   2547 C  C2    . DC  C 3 5   ? 10.802 12.434  43.504  1.00 39.92 ? 5    DC  C C2    1 
ATOM   2548 O  O2    . DC  C 3 5   ? 9.969  12.056  44.348  1.00 44.43 ? 5    DC  C O2    1 
ATOM   2549 N  N3    . DC  C 3 5   ? 10.471 13.328  42.537  1.00 40.79 ? 5    DC  C N3    1 
ATOM   2550 C  C4    . DC  C 3 5   ? 11.392 13.688  41.633  1.00 42.48 ? 5    DC  C C4    1 
ATOM   2551 N  N4    . DC  C 3 5   ? 11.056 14.549  40.673  1.00 43.73 ? 5    DC  C N4    1 
ATOM   2552 C  C5    . DC  C 3 5   ? 12.710 13.151  41.644  1.00 37.36 ? 5    DC  C C5    1 
ATOM   2553 C  C6    . DC  C 3 5   ? 13.030 12.298  42.596  1.00 41.43 ? 5    DC  C C6    1 
ATOM   2554 P  P     . DC  C 3 6   ? 13.054 6.977   45.729  1.00 44.71 ? 6    DC  C P     1 
ATOM   2555 O  OP1   . DC  C 3 6   ? 13.196 6.207   46.970  1.00 47.53 ? 6    DC  C OP1   1 
ATOM   2556 O  OP2   . DC  C 3 6   ? 13.528 6.467   44.447  1.00 39.89 ? 6    DC  C OP2   1 
ATOM   2557 O  "O5'" . DC  C 3 6   ? 11.489 7.184   45.460  1.00 45.58 ? 6    DC  C "O5'" 1 
ATOM   2558 C  "C5'" . DC  C 3 6   ? 10.626 7.483   46.539  1.00 47.69 ? 6    DC  C "C5'" 1 
ATOM   2559 C  "C4'" . DC  C 3 6   ? 9.203  7.565   46.019  1.00 44.59 ? 6    DC  C "C4'" 1 
ATOM   2560 O  "O4'" . DC  C 3 6   ? 9.095  8.643   45.078  1.00 43.25 ? 6    DC  C "O4'" 1 
ATOM   2561 C  "C3'" . DC  C 3 6   ? 8.741  6.326   45.272  1.00 42.97 ? 6    DC  C "C3'" 1 
ATOM   2562 O  "O3'" . DC  C 3 6   ? 7.643  5.837   45.983  1.00 46.02 ? 6    DC  C "O3'" 1 
ATOM   2563 C  "C2'" . DC  C 3 6   ? 8.410  6.789   43.855  1.00 41.10 ? 6    DC  C "C2'" 1 
ATOM   2564 C  "C1'" . DC  C 3 6   ? 8.263  8.293   43.982  1.00 42.17 ? 6    DC  C "C1'" 1 
ATOM   2565 N  N1    . DC  C 3 6   ? 8.633  9.125   42.790  1.00 42.28 ? 6    DC  C N1    1 
ATOM   2566 C  C2    . DC  C 3 6   ? 7.648  9.882   42.144  1.00 42.33 ? 6    DC  C C2    1 
ATOM   2567 O  O2    . DC  C 3 6   ? 6.476  9.853   42.541  1.00 47.79 ? 6    DC  C O2    1 
ATOM   2568 N  N3    . DC  C 3 6   ? 7.938  10.649  41.082  1.00 38.75 ? 6    DC  C N3    1 
ATOM   2569 C  C4    . DC  C 3 6   ? 9.170  10.733  40.634  1.00 41.36 ? 6    DC  C C4    1 
ATOM   2570 N  N4    . DC  C 3 6   ? 9.337  11.553  39.565  1.00 39.15 ? 6    DC  C N4    1 
ATOM   2571 C  C5    . DC  C 3 6   ? 10.208 9.985   41.279  1.00 43.79 ? 6    DC  C C5    1 
ATOM   2572 C  C6    . DC  C 3 6   ? 9.926  9.203   42.339  1.00 43.13 ? 6    DC  C C6    1 
ATOM   2573 P  P     . DT  C 3 7   ? 6.920  4.459   45.563  1.00 51.99 ? 7    DT  C P     1 
ATOM   2574 O  OP1   . DT  C 3 7   ? 6.111  4.139   46.770  1.00 54.42 ? 7    DT  C OP1   1 
ATOM   2575 O  OP2   . DT  C 3 7   ? 7.865  3.497   44.967  1.00 48.13 ? 7    DT  C OP2   1 
ATOM   2576 O  "O5'" . DT  C 3 7   ? 5.923  4.842   44.361  1.00 45.81 ? 7    DT  C "O5'" 1 
ATOM   2577 C  "C5'" . DT  C 3 7   ? 4.939  5.836   44.622  1.00 47.75 ? 7    DT  C "C5'" 1 
ATOM   2578 C  "C4'" . DT  C 3 7   ? 4.078  6.032   43.391  1.00 46.31 ? 7    DT  C "C4'" 1 
ATOM   2579 O  "O4'" . DT  C 3 7   ? 4.774  6.924   42.495  1.00 46.80 ? 7    DT  C "O4'" 1 
ATOM   2580 C  "C3'" . DT  C 3 7   ? 3.760  4.765   42.587  1.00 49.26 ? 7    DT  C "C3'" 1 
ATOM   2581 O  "O3'" . DT  C 3 7   ? 2.343  4.543   42.680  1.00 55.13 ? 7    DT  C "O3'" 1 
ATOM   2582 C  "C2'" . DT  C 3 7   ? 4.227  5.064   41.162  1.00 42.23 ? 7    DT  C "C2'" 1 
ATOM   2583 C  "C1'" . DT  C 3 7   ? 4.418  6.575   41.169  1.00 39.86 ? 7    DT  C "C1'" 1 
ATOM   2584 N  N1    . DT  C 3 7   ? 5.538  7.090   40.328  1.00 34.74 ? 7    DT  C N1    1 
ATOM   2585 C  C2    . DT  C 3 7   ? 5.191  8.054   39.421  1.00 38.16 ? 7    DT  C C2    1 
ATOM   2586 O  O2    . DT  C 3 7   ? 4.038  8.434   39.323  1.00 38.60 ? 7    DT  C O2    1 
ATOM   2587 N  N3    . DT  C 3 7   ? 6.223  8.555   38.671  1.00 34.03 ? 7    DT  C N3    1 
ATOM   2588 C  C4    . DT  C 3 7   ? 7.537  8.153   38.748  1.00 35.61 ? 7    DT  C C4    1 
ATOM   2589 O  O4    . DT  C 3 7   ? 8.370  8.670   38.028  1.00 34.15 ? 7    DT  C O4    1 
ATOM   2590 C  C5    . DT  C 3 7   ? 7.833  7.114   39.702  1.00 36.94 ? 7    DT  C C5    1 
ATOM   2591 C  C7    . DT  C 3 7   ? 9.242  6.629   39.854  1.00 38.21 ? 7    DT  C C7    1 
ATOM   2592 C  C6    . DT  C 3 7   ? 6.840  6.635   40.473  1.00 36.64 ? 7    DT  C C6    1 
ATOM   2593 P  P     . DT  C 3 8   ? 1.547  3.391   41.901  1.00 52.91 ? 8    DT  C P     1 
ATOM   2594 O  OP1   . DT  C 3 8   ? 0.257  3.366   42.631  1.00 60.79 ? 8    DT  C OP1   1 
ATOM   2595 O  OP2   . DT  C 3 8   ? 2.421  2.211   41.686  1.00 48.58 ? 8    DT  C OP2   1 
ATOM   2596 O  "O5'" . DT  C 3 8   ? 1.332  4.029   40.449  1.00 44.65 ? 8    DT  C "O5'" 1 
ATOM   2597 C  "C5'" . DT  C 3 8   ? 0.685  5.314   40.314  1.00 42.49 ? 8    DT  C "C5'" 1 
ATOM   2598 C  "C4'" . DT  C 3 8   ? 0.626  5.634   38.822  1.00 41.16 ? 8    DT  C "C4'" 1 
ATOM   2599 O  "O4'" . DT  C 3 8   ? 1.924  6.101   38.404  1.00 43.84 ? 8    DT  C "O4'" 1 
ATOM   2600 C  "C3'" . DT  C 3 8   ? 0.368  4.467   37.859  1.00 48.18 ? 8    DT  C "C3'" 1 
ATOM   2601 O  "O3'" . DT  C 3 8   ? -0.963 4.692   37.337  1.00 44.66 ? 8    DT  C "O3'" 1 
ATOM   2602 C  "C2'" . DT  C 3 8   ? 1.486  4.513   36.783  1.00 43.58 ? 8    DT  C "C2'" 1 
ATOM   2603 C  "C1'" . DT  C 3 8   ? 2.098  5.885   37.005  1.00 39.85 ? 8    DT  C "C1'" 1 
ATOM   2604 N  N1    . DT  C 3 8   ? 3.596  5.932   36.706  1.00 35.98 ? 8    DT  C N1    1 
ATOM   2605 C  C2    . DT  C 3 8   ? 4.066  6.785   35.741  1.00 34.61 ? 8    DT  C C2    1 
ATOM   2606 O  O2    . DT  C 3 8   ? 3.301  7.488   35.110  1.00 35.39 ? 8    DT  C O2    1 
ATOM   2607 N  N3    . DT  C 3 8   ? 5.434  6.837   35.502  1.00 34.17 ? 8    DT  C N3    1 
ATOM   2608 C  C4    . DT  C 3 8   ? 6.369  6.054   36.149  1.00 31.85 ? 8    DT  C C4    1 
ATOM   2609 O  O4    . DT  C 3 8   ? 7.545  6.211   35.763  1.00 32.32 ? 8    DT  C O4    1 
ATOM   2610 C  C5    . DT  C 3 8   ? 5.819  5.143   37.147  1.00 32.17 ? 8    DT  C C5    1 
ATOM   2611 C  C7    . DT  C 3 8   ? 6.699  4.227   37.952  1.00 40.51 ? 8    DT  C C7    1 
ATOM   2612 C  C6    . DT  C 3 8   ? 4.473  5.111   37.407  1.00 33.73 ? 8    DT  C C6    1 
ATOM   2613 P  P     . DT  C 3 9   ? -1.618 3.952   36.079  1.00 46.54 ? 9    DT  C P     1 
ATOM   2614 O  OP1   . DT  C 3 9   ? -3.071 4.252   36.180  1.00 43.78 ? 9    DT  C OP1   1 
ATOM   2615 O  OP2   . DT  C 3 9   ? -1.044 2.601   35.929  1.00 41.46 ? 9    DT  C OP2   1 
ATOM   2616 O  "O5'" . DT  C 3 9   ? -1.144 4.856   34.855  1.00 36.48 ? 9    DT  C "O5'" 1 
ATOM   2617 C  "C5'" . DT  C 3 9   ? -1.541 6.221   34.762  1.00 34.34 ? 9    DT  C "C5'" 1 
ATOM   2618 C  "C4'" . DT  C 3 9   ? -1.046 6.619   33.389  1.00 34.48 ? 9    DT  C "C4'" 1 
ATOM   2619 O  "O4'" . DT  C 3 9   ? 0.417  6.501   33.319  1.00 38.26 ? 9    DT  C "O4'" 1 
ATOM   2620 C  "C3'" . DT  C 3 9   ? -1.566 5.681   32.294  1.00 30.71 ? 9    DT  C "C3'" 1 
ATOM   2621 O  "O3'" . DT  C 3 9   ? -2.207 6.595   31.419  1.00 33.22 ? 9    DT  C "O3'" 1 
ATOM   2622 C  "C2'" . DT  C 3 9   ? -0.312 5.117   31.596  1.00 29.54 ? 9    DT  C "C2'" 1 
ATOM   2623 C  "C1'" . DT  C 3 9   ? 0.796  6.086   32.012  1.00 33.60 ? 9    DT  C "C1'" 1 
ATOM   2624 N  N1    . DT  C 3 9   ? 2.213  5.594   32.201  1.00 28.57 ? 9    DT  C N1    1 
ATOM   2625 C  C2    . DT  C 3 9   ? 3.256  6.169   31.533  1.00 31.86 ? 9    DT  C C2    1 
ATOM   2626 O  O2    . DT  C 3 9   ? 3.090  7.055   30.722  1.00 27.92 ? 9    DT  C O2    1 
ATOM   2627 N  N3    . DT  C 3 9   ? 4.514  5.663   31.827  1.00 27.72 ? 9    DT  C N3    1 
ATOM   2628 C  C4    . DT  C 3 9   ? 4.837  4.660   32.707  1.00 32.72 ? 9    DT  C C4    1 
ATOM   2629 O  O4    . DT  C 3 9   ? 6.013  4.327   32.892  1.00 31.02 ? 9    DT  C O4    1 
ATOM   2630 C  C5    . DT  C 3 9   ? 3.680  4.084   33.365  1.00 31.94 ? 9    DT  C C5    1 
ATOM   2631 C  C7    . DT  C 3 9   ? 3.787  2.956   34.352  1.00 40.10 ? 9    DT  C C7    1 
ATOM   2632 C  C6    . DT  C 3 9   ? 2.476  4.574   33.081  1.00 36.01 ? 9    DT  C C6    1 
ATOM   2633 P  P     . DT  C 3 10  ? -2.960 6.009   30.119  1.00 36.96 ? 10   DT  C P     1 
ATOM   2634 O  OP1   . DT  C 3 10  ? -4.088 6.928   29.860  1.00 33.55 ? 10   DT  C OP1   1 
ATOM   2635 O  OP2   . DT  C 3 10  ? -3.161 4.545   30.303  1.00 32.36 ? 10   DT  C OP2   1 
ATOM   2636 O  "O5'" . DT  C 3 10  ? -1.905 6.225   28.944  1.00 33.50 ? 10   DT  C "O5'" 1 
ATOM   2637 C  "C5'" . DT  C 3 10  ? -1.507 7.568   28.608  1.00 31.74 ? 10   DT  C "C5'" 1 
ATOM   2638 C  "C4'" . DT  C 3 10  ? -0.442 7.472   27.521  1.00 30.77 ? 10   DT  C "C4'" 1 
ATOM   2639 O  "O4'" . DT  C 3 10  ? 0.771  6.847   28.027  1.00 30.06 ? 10   DT  C "O4'" 1 
ATOM   2640 C  "C3'" . DT  C 3 10  ? -0.913 6.627   26.332  1.00 28.88 ? 10   DT  C "C3'" 1 
ATOM   2641 O  "O3'" . DT  C 3 10  ? -0.990 7.528   25.236  1.00 34.32 ? 10   DT  C "O3'" 1 
ATOM   2642 C  "C2'" . DT  C 3 10  ? 0.153  5.535   26.128  1.00 31.53 ? 10   DT  C "C2'" 1 
ATOM   2643 C  "C1'" . DT  C 3 10  ? 1.338  6.109   26.913  1.00 28.59 ? 10   DT  C "C1'" 1 
ATOM   2644 N  N1    . DT  C 3 10  ? 2.194  5.165   27.654  1.00 25.41 ? 10   DT  C N1    1 
ATOM   2645 C  C2    . DT  C 3 10  ? 3.580  5.332   27.540  1.00 27.83 ? 10   DT  C C2    1 
ATOM   2646 O  O2    . DT  C 3 10  ? 4.118  6.118   26.777  1.00 25.44 ? 10   DT  C O2    1 
ATOM   2647 N  N3    . DT  C 3 10  ? 4.333  4.485   28.314  1.00 24.46 ? 10   DT  C N3    1 
ATOM   2648 C  C4    . DT  C 3 10  ? 3.829  3.526   29.186  1.00 24.96 ? 10   DT  C C4    1 
ATOM   2649 O  O4    . DT  C 3 10  ? 4.581  2.841   29.867  1.00 30.15 ? 10   DT  C O4    1 
ATOM   2650 C  C5    . DT  C 3 10  ? 2.378  3.432   29.287  1.00 28.27 ? 10   DT  C C5    1 
ATOM   2651 C  C7    . DT  C 3 10  ? 1.767  2.417   30.214  1.00 28.65 ? 10   DT  C C7    1 
ATOM   2652 C  C6    . DT  C 3 10  ? 1.639  4.270   28.541  1.00 23.60 ? 10   DT  C C6    1 
ATOM   2653 P  P     . DT  C 3 11  ? -1.571 7.095   23.809  1.00 40.09 ? 11   DT  C P     1 
ATOM   2654 O  OP1   . DT  C 3 11  ? -1.971 8.332   23.140  1.00 40.61 ? 11   DT  C OP1   1 
ATOM   2655 O  OP2   . DT  C 3 11  ? -2.410 5.912   24.060  1.00 33.87 ? 11   DT  C OP2   1 
ATOM   2656 O  "O5'" . DT  C 3 11  ? -0.301 6.476   23.017  1.00 39.09 ? 11   DT  C "O5'" 1 
ATOM   2657 C  "C5'" . DT  C 3 11  ? 0.811  7.310   22.562  1.00 34.65 ? 11   DT  C "C5'" 1 
ATOM   2658 C  "C4'" . DT  C 3 11  ? 1.925  6.386   22.103  1.00 31.81 ? 11   DT  C "C4'" 1 
ATOM   2659 O  "O4'" . DT  C 3 11  ? 2.417  5.576   23.217  1.00 29.76 ? 11   DT  C "O4'" 1 
ATOM   2660 C  "C3'" . DT  C 3 11  ? 1.380  5.339   21.115  1.00 30.59 ? 11   DT  C "C3'" 1 
ATOM   2661 O  "O3'" . DT  C 3 11  ? 2.077  5.552   19.908  1.00 35.03 ? 11   DT  C "O3'" 1 
ATOM   2662 C  "C2'" . DT  C 3 11  ? 1.633  3.951   21.722  1.00 32.97 ? 11   DT  C "C2'" 1 
ATOM   2663 C  "C1'" . DT  C 3 11  ? 2.762  4.298   22.678  1.00 31.86 ? 11   DT  C "C1'" 1 
ATOM   2664 N  N1    . DT  C 3 11  ? 2.986  3.404   23.822  1.00 32.13 ? 11   DT  C N1    1 
ATOM   2665 C  C2    . DT  C 3 11  ? 4.268  3.141   24.238  1.00 30.89 ? 11   DT  C C2    1 
ATOM   2666 O  O2    . DT  C 3 11  ? 5.270  3.561   23.700  1.00 30.43 ? 11   DT  C O2    1 
ATOM   2667 N  N3    . DT  C 3 11  ? 4.385  2.330   25.322  1.00 22.26 ? 11   DT  C N3    1 
ATOM   2668 C  C4    . DT  C 3 11  ? 3.322  1.774   26.008  1.00 32.84 ? 11   DT  C C4    1 
ATOM   2669 O  O4    . DT  C 3 11  ? 3.498  1.072   26.987  1.00 28.88 ? 11   DT  C O4    1 
ATOM   2670 C  C5    . DT  C 3 11  ? 1.984  2.092   25.545  1.00 30.44 ? 11   DT  C C5    1 
ATOM   2671 C  C7    . DT  C 3 11  ? 0.779  1.513   26.252  1.00 33.33 ? 11   DT  C C7    1 
ATOM   2672 C  C6    . DT  C 3 11  ? 1.872  2.889   24.488  1.00 30.67 ? 11   DT  C C6    1 
ATOM   2673 P  P     . DT  C 3 12  ? 1.704  4.852   18.498  1.00 42.44 ? 12   DT  C P     1 
ATOM   2674 O  OP1   . DT  C 3 12  ? 2.174  5.912   17.550  1.00 36.79 ? 12   DT  C OP1   1 
ATOM   2675 O  OP2   . DT  C 3 12  ? 0.296  4.357   18.709  1.00 42.59 ? 12   DT  C OP2   1 
ATOM   2676 O  "O5'" . DT  C 3 12  ? 2.452  3.450   18.317  1.00 38.89 ? 12   DT  C "O5'" 1 
ATOM   2677 C  "C5'" . DT  C 3 12  ? 3.787  3.408   17.811  1.00 42.91 ? 12   DT  C "C5'" 1 
ATOM   2678 C  "C4'" . DT  C 3 12  ? 4.767  4.155   18.705  1.00 31.75 ? 12   DT  C "C4'" 1 
ATOM   2679 O  "O4'" . DT  C 3 12  ? 4.673  3.608   20.060  1.00 35.43 ? 12   DT  C "O4'" 1 
ATOM   2680 C  "C3'" . DT  C 3 12  ? 6.196  3.816   18.247  1.00 27.29 ? 12   DT  C "C3'" 1 
ATOM   2681 O  "O3'" . DT  C 3 12  ? 7.040  4.852   18.750  1.00 28.85 ? 12   DT  C "O3'" 1 
ATOM   2682 C  "C2'" . DT  C 3 12  ? 6.543  2.514   18.998  1.00 32.95 ? 12   DT  C "C2'" 1 
ATOM   2683 C  "C1'" . DT  C 3 12  ? 5.740  2.675   20.279  1.00 35.40 ? 12   DT  C "C1'" 1 
ATOM   2684 N  N1    . DT  C 3 12  ? 5.214  1.544   21.101  1.00 35.41 ? 12   DT  C N1    1 
ATOM   2685 C  C2    . DT  C 3 12  ? 6.067  0.925   21.987  1.00 32.52 ? 12   DT  C C2    1 
ATOM   2686 O  O2    . DT  C 3 12  ? 7.229  1.220   22.018  1.00 31.30 ? 12   DT  C O2    1 
ATOM   2687 N  N3    . DT  C 3 12  ? 5.540  -0.047  22.783  1.00 28.64 ? 12   DT  C N3    1 
ATOM   2688 C  C4    . DT  C 3 12  ? 4.202  -0.377  22.789  1.00 30.61 ? 12   DT  C C4    1 
ATOM   2689 O  O4    . DT  C 3 12  ? 3.762  -1.208  23.556  1.00 31.32 ? 12   DT  C O4    1 
ATOM   2690 C  C5    . DT  C 3 12  ? 3.362  0.276   21.818  1.00 31.72 ? 12   DT  C C5    1 
ATOM   2691 C  C7    . DT  C 3 12  ? 1.917  -0.080  21.790  1.00 37.61 ? 12   DT  C C7    1 
ATOM   2692 C  C6    . DT  C 3 12  ? 3.880  1.213   21.031  1.00 35.95 ? 12   DT  C C6    1 
ATOM   2693 P  P     . DG  C 3 13  ? 8.086  5.487   17.744  1.00 31.41 ? 13   DG  C P     1 
ATOM   2694 O  OP1   . DG  C 3 13  ? 8.426  6.836   18.202  1.00 28.34 ? 13   DG  C OP1   1 
ATOM   2695 O  OP2   . DG  C 3 13  ? 7.739  5.270   16.311  1.00 27.50 ? 13   DG  C OP2   1 
ATOM   2696 O  "O5'" . DG  C 3 13  ? 9.347  4.516   18.004  1.00 30.82 ? 13   DG  C "O5'" 1 
ATOM   2697 C  "C5'" . DG  C 3 13  ? 9.981  4.574   19.296  1.00 25.30 ? 13   DG  C "C5'" 1 
ATOM   2698 C  "C4'" . DG  C 3 13  ? 10.947 3.390   19.383  1.00 26.19 ? 13   DG  C "C4'" 1 
ATOM   2699 O  "O4'" . DG  C 3 13  ? 10.164 2.182   19.344  1.00 24.54 ? 13   DG  C "O4'" 1 
ATOM   2700 C  "C3'" . DG  C 3 13  ? 11.887 3.221   18.202  1.00 25.85 ? 13   DG  C "C3'" 1 
ATOM   2701 O  "O3'" . DG  C 3 13  ? 13.077 2.593   18.779  1.00 24.02 ? 13   DG  C "O3'" 1 
ATOM   2702 C  "C2'" . DG  C 3 13  ? 11.101 2.260   17.300  1.00 23.72 ? 13   DG  C "C2'" 1 
ATOM   2703 C  "C1'" . DG  C 3 13  ? 10.599 1.264   18.323  1.00 24.98 ? 13   DG  C "C1'" 1 
ATOM   2704 N  N9    . DG  C 3 13  ? 9.339  0.597   17.993  1.00 26.57 ? 13   DG  C N9    1 
ATOM   2705 C  C8    . DG  C 3 13  ? 8.466  0.908   16.983  1.00 27.64 ? 13   DG  C C8    1 
ATOM   2706 N  N7    . DG  C 3 13  ? 7.419  0.125   17.023  1.00 25.30 ? 13   DG  C N7    1 
ATOM   2707 C  C5    . DG  C 3 13  ? 7.557  -0.695  18.144  1.00 27.63 ? 13   DG  C C5    1 
ATOM   2708 C  C6    . DG  C 3 13  ? 6.765  -1.713  18.724  1.00 30.18 ? 13   DG  C C6    1 
ATOM   2709 O  O6    . DG  C 3 13  ? 5.651  -2.162  18.415  1.00 34.12 ? 13   DG  C O6    1 
ATOM   2710 N  N1    . DG  C 3 13  ? 7.341  -2.328  19.828  1.00 29.83 ? 13   DG  C N1    1 
ATOM   2711 C  C2    . DG  C 3 13  ? 8.534  -1.957  20.349  1.00 28.63 ? 13   DG  C C2    1 
ATOM   2712 N  N2    . DG  C 3 13  ? 8.937  -2.643  21.436  1.00 33.51 ? 13   DG  C N2    1 
ATOM   2713 N  N3    . DG  C 3 13  ? 9.288  -0.998  19.837  1.00 26.04 ? 13   DG  C N3    1 
ATOM   2714 C  C4    . DG  C 3 13  ? 8.755  -0.399  18.745  1.00 29.83 ? 13   DG  C C4    1 
ATOM   2715 P  P     . DA  C 3 14  ? 14.377 2.424   17.826  1.00 24.75 ? 14   DA  C P     1 
ATOM   2716 O  OP1   . DA  C 3 14  ? 15.465 2.331   18.795  1.00 24.82 ? 14   DA  C OP1   1 
ATOM   2717 O  OP2   . DA  C 3 14  ? 14.490 3.489   16.823  1.00 23.87 ? 14   DA  C OP2   1 
ATOM   2718 O  "O5'" . DA  C 3 14  ? 14.146 0.992   17.147  1.00 23.99 ? 14   DA  C "O5'" 1 
ATOM   2719 C  "C5'" . DA  C 3 14  ? 14.793 -0.186  17.676  1.00 22.42 ? 14   DA  C "C5'" 1 
ATOM   2720 C  "C4'" . DA  C 3 14  ? 14.093 -0.731  18.903  1.00 24.60 ? 14   DA  C "C4'" 1 
ATOM   2721 O  "O4'" . DA  C 3 14  ? 12.664 -0.981  18.670  1.00 26.77 ? 14   DA  C "O4'" 1 
ATOM   2722 C  "C3'" . DA  C 3 14  ? 14.690 -2.055  19.381  1.00 25.32 ? 14   DA  C "C3'" 1 
ATOM   2723 O  "O3'" . DA  C 3 14  ? 14.601 -2.080  20.818  1.00 25.17 ? 14   DA  C "O3'" 1 
ATOM   2724 C  "C2'" . DA  C 3 14  ? 13.734 -3.093  18.754  1.00 23.08 ? 14   DA  C "C2'" 1 
ATOM   2725 C  "C1'" . DA  C 3 14  ? 12.402 -2.371  18.864  1.00 25.59 ? 14   DA  C "C1'" 1 
ATOM   2726 N  N9    . DA  C 3 14  ? 11.248 -2.715  18.002  1.00 27.53 ? 14   DA  C N9    1 
ATOM   2727 C  C8    . DA  C 3 14  ? 10.925 -2.089  16.834  1.00 30.16 ? 14   DA  C C8    1 
ATOM   2728 N  N7    . DA  C 3 14  ? 9.833  -2.550  16.264  1.00 27.64 ? 14   DA  C N7    1 
ATOM   2729 C  C5    . DA  C 3 14  ? 9.403  -3.524  17.157  1.00 29.92 ? 14   DA  C C5    1 
ATOM   2730 C  C6    . DA  C 3 14  ? 8.270  -4.360  17.160  1.00 29.94 ? 14   DA  C C6    1 
ATOM   2731 N  N6    . DA  C 3 14  ? 7.300  -4.313  16.212  1.00 29.14 ? 14   DA  C N6    1 
ATOM   2732 N  N1    . DA  C 3 14  ? 8.150  -5.240  18.182  1.00 27.75 ? 14   DA  C N1    1 
ATOM   2733 C  C2    . DA  C 3 14  ? 9.067  -5.288  19.160  1.00 31.61 ? 14   DA  C C2    1 
ATOM   2734 N  N3    . DA  C 3 14  ? 10.159 -4.512  19.254  1.00 30.39 ? 14   DA  C N3    1 
ATOM   2735 C  C4    . DA  C 3 14  ? 10.278 -3.646  18.228  1.00 27.60 ? 14   DA  C C4    1 
ATOM   2736 P  P     . DA  C 3 15  ? 15.005 -3.376  21.668  1.00 27.88 ? 15   DA  C P     1 
ATOM   2737 O  OP1   . DA  C 3 15  ? 13.845 -4.214  22.026  1.00 25.70 ? 15   DA  C OP1   1 
ATOM   2738 O  OP2   . DA  C 3 15  ? 15.753 -2.836  22.823  1.00 23.26 ? 15   DA  C OP2   1 
ATOM   2739 O  "O5'" . DA  C 3 15  ? 15.977 -4.069  20.595  1.00 26.95 ? 15   DA  C "O5'" 1 
ATOM   2740 C  "C5'" . DA  C 3 15  ? 16.466 -5.391  20.553  1.00 30.26 ? 15   DA  C "C5'" 1 
ATOM   2741 C  "C4'" . DA  C 3 15  ? 15.396 -6.470  20.558  1.00 29.86 ? 15   DA  C "C4'" 1 
ATOM   2742 O  "O4'" . DA  C 3 15  ? 14.363 -6.105  19.608  1.00 29.47 ? 15   DA  C "O4'" 1 
ATOM   2743 C  "C3'" . DA  C 3 15  ? 15.916 -7.825  20.108  1.00 31.33 ? 15   DA  C "C3'" 1 
ATOM   2744 O  "O3'" . DA  C 3 15  ? 15.690 -8.694  21.207  1.00 26.96 ? 15   DA  C "O3'" 1 
ATOM   2745 C  "C2'" . DA  C 3 15  ? 15.050 -8.216  18.882  1.00 23.07 ? 15   DA  C "C2'" 1 
ATOM   2746 C  "C1'" . DA  C 3 15  ? 13.817 -7.312  19.048  1.00 29.07 ? 15   DA  C "C1'" 1 
ATOM   2747 N  N9    . DA  C 3 15  ? 12.987 -6.996  17.867  1.00 31.68 ? 15   DA  C N9    1 
ATOM   2748 C  C8    . DA  C 3 15  ? 13.344 -6.191  16.832  1.00 31.80 ? 15   DA  C C8    1 
ATOM   2749 N  N7    . DA  C 3 15  ? 12.393 -6.063  15.923  1.00 29.40 ? 15   DA  C N7    1 
ATOM   2750 C  C5    . DA  C 3 15  ? 11.349 -6.828  16.411  1.00 28.89 ? 15   DA  C C5    1 
ATOM   2751 C  C6    . DA  C 3 15  ? 10.044 -7.065  15.917  1.00 33.10 ? 15   DA  C C6    1 
ATOM   2752 N  N6    . DA  C 3 15  ? 9.567  -6.542  14.772  1.00 27.50 ? 15   DA  C N6    1 
ATOM   2753 N  N1    . DA  C 3 15  ? 9.256  -7.889  16.630  1.00 28.50 ? 15   DA  C N1    1 
ATOM   2754 C  C2    . DA  C 3 15  ? 9.690  -8.397  17.799  1.00 30.04 ? 15   DA  C C2    1 
ATOM   2755 N  N3    . DA  C 3 15  ? 10.903 -8.213  18.367  1.00 27.62 ? 15   DA  C N3    1 
ATOM   2756 C  C4    . DA  C 3 15  ? 11.702 -7.429  17.612  1.00 28.18 ? 15   DA  C C4    1 
ATOM   2757 P  P     . DG  C 3 16  ? 16.445 -10.117 21.280  1.00 29.04 ? 16   DG  C P     1 
ATOM   2758 O  OP1   . DG  C 3 16  ? 16.438 -10.555 22.695  1.00 26.00 ? 16   DG  C OP1   1 
ATOM   2759 O  OP2   . DG  C 3 16  ? 17.738 -9.958  20.603  1.00 29.90 ? 16   DG  C OP2   1 
ATOM   2760 O  "O5'" . DG  C 3 16  ? 15.506 -11.053 20.400  1.00 28.61 ? 16   DG  C "O5'" 1 
ATOM   2761 C  "C5'" . DG  C 3 16  ? 14.246 -11.476 20.997  1.00 31.67 ? 16   DG  C "C5'" 1 
ATOM   2762 C  "C4'" . DG  C 3 16  ? 13.501 -12.258 19.924  1.00 25.91 ? 16   DG  C "C4'" 1 
ATOM   2763 O  "O4'" . DG  C 3 16  ? 13.052 -11.276 18.939  1.00 26.22 ? 16   DG  C "O4'" 1 
ATOM   2764 C  "C3'" . DG  C 3 16  ? 14.399 -13.216 19.123  1.00 25.73 ? 16   DG  C "C3'" 1 
ATOM   2765 O  "O3'" . DG  C 3 16  ? 13.713 -14.447 19.074  1.00 32.39 ? 16   DG  C "O3'" 1 
ATOM   2766 C  "C2'" . DG  C 3 16  ? 14.357 -12.681 17.688  1.00 27.34 ? 16   DG  C "C2'" 1 
ATOM   2767 C  "C1'" . DG  C 3 16  ? 13.048 -11.916 17.698  1.00 29.25 ? 16   DG  C "C1'" 1 
ATOM   2768 N  N9    . DG  C 3 16  ? 12.906 -11.007 16.561  1.00 29.33 ? 16   DG  C N9    1 
ATOM   2769 C  C8    . DG  C 3 16  ? 13.833 -10.197 15.957  1.00 29.30 ? 16   DG  C C8    1 
ATOM   2770 N  N7    . DG  C 3 16  ? 13.346 -9.551  14.930  1.00 28.80 ? 16   DG  C N7    1 
ATOM   2771 C  C5    . DG  C 3 16  ? 12.000 -9.910  14.857  1.00 32.88 ? 16   DG  C C5    1 
ATOM   2772 C  C6    . DG  C 3 16  ? 10.966 -9.578  13.945  1.00 32.24 ? 16   DG  C C6    1 
ATOM   2773 O  O6    . DG  C 3 16  ? 11.004 -8.813  12.964  1.00 33.94 ? 16   DG  C O6    1 
ATOM   2774 N  N1    . DG  C 3 16  ? 9.759  -10.225 14.242  1.00 29.79 ? 16   DG  C N1    1 
ATOM   2775 C  C2    . DG  C 3 16  ? 9.631  -11.103 15.288  1.00 29.78 ? 16   DG  C C2    1 
ATOM   2776 N  N2    . DG  C 3 16  ? 8.443  -11.675 15.499  1.00 36.89 ? 16   DG  C N2    1 
ATOM   2777 N  N3    . DG  C 3 16  ? 10.568 -11.437 16.157  1.00 31.22 ? 16   DG  C N3    1 
ATOM   2778 C  C4    . DG  C 3 16  ? 11.737 -10.819 15.861  1.00 32.07 ? 16   DG  C C4    1 
ATOM   2779 P  P     . DG  C 3 17  ? 14.457 -15.834 18.833  1.00 33.52 ? 17   DG  C P     1 
ATOM   2780 O  OP1   . DG  C 3 17  ? 13.506 -16.889 19.260  1.00 32.22 ? 17   DG  C OP1   1 
ATOM   2781 O  OP2   . DG  C 3 17  ? 15.796 -15.849 19.441  1.00 31.71 ? 17   DG  C OP2   1 
ATOM   2782 O  "O5'" . DG  C 3 17  ? 14.635 -15.805 17.240  1.00 33.96 ? 17   DG  C "O5'" 1 
ATOM   2783 C  "C5'" . DG  C 3 17  ? 13.908 -16.640 16.293  1.00 30.25 ? 17   DG  C "C5'" 1 
ATOM   2784 C  "C4'" . DG  C 3 17  ? 12.425 -16.298 16.202  1.00 31.66 ? 17   DG  C "C4'" 1 
ATOM   2785 O  "O4'" . DG  C 3 17  ? 12.283 -14.878 15.984  1.00 35.57 ? 17   DG  C "O4'" 1 
ATOM   2786 C  "C3'" . DG  C 3 17  ? 11.715 -16.866 14.977  1.00 35.20 ? 17   DG  C "C3'" 1 
ATOM   2787 O  "O3'" . DG  C 3 17  ? 11.236 -18.153 15.301  1.00 38.55 ? 17   DG  C "O3'" 1 
ATOM   2788 C  "C2'" . DG  C 3 17  ? 10.517 -15.931 14.802  1.00 26.39 ? 17   DG  C "C2'" 1 
ATOM   2789 C  "C1'" . DG  C 3 17  ? 11.144 -14.594 15.174  1.00 31.45 ? 17   DG  C "C1'" 1 
ATOM   2790 N  N9    . DG  C 3 17  ? 11.682 -13.771 14.081  1.00 31.19 ? 17   DG  C N9    1 
ATOM   2791 C  C8    . DG  C 3 17  ? 12.982 -13.356 13.926  1.00 32.59 ? 17   DG  C C8    1 
ATOM   2792 N  N7    . DG  C 3 17  ? 13.151 -12.565 12.890  1.00 32.07 ? 17   DG  C N7    1 
ATOM   2793 C  C5    . DG  C 3 17  ? 11.871 -12.465 12.331  1.00 32.07 ? 17   DG  C C5    1 
ATOM   2794 C  C6    . DG  C 3 17  ? 11.405 -11.784 11.187  1.00 31.77 ? 17   DG  C C6    1 
ATOM   2795 O  O6    . DG  C 3 17  ? 12.043 -11.035 10.434  1.00 36.07 ? 17   DG  C O6    1 
ATOM   2796 N  N1    . DG  C 3 17  ? 10.025 -11.963 10.981  1.00 30.28 ? 17   DG  C N1    1 
ATOM   2797 C  C2    . DG  C 3 17  ? 9.218  -12.725 11.778  1.00 31.93 ? 17   DG  C C2    1 
ATOM   2798 N  N2    . DG  C 3 17  ? 7.930  -12.815 11.428  1.00 39.07 ? 17   DG  C N2    1 
ATOM   2799 N  N3    . DG  C 3 17  ? 9.620  -13.379 12.844  1.00 30.17 ? 17   DG  C N3    1 
ATOM   2800 C  C4    . DG  C 3 17  ? 10.965 -13.202 13.052  1.00 34.86 ? 17   DG  C C4    1 
ATOM   2801 P  P     . DA  C 3 18  ? 11.033 -19.207 14.107  1.00 37.52 ? 18   DA  C P     1 
ATOM   2802 O  OP1   . DA  C 3 18  ? 10.696 -20.449 14.865  1.00 34.17 ? 18   DA  C OP1   1 
ATOM   2803 O  OP2   . DA  C 3 18  ? 12.229 -19.114 13.236  1.00 34.55 ? 18   DA  C OP2   1 
ATOM   2804 O  "O5'" . DA  C 3 18  ? 9.794  -18.570 13.310  1.00 38.98 ? 18   DA  C "O5'" 1 
ATOM   2805 C  "C5'" . DA  C 3 18  ? 8.465  -18.535 13.910  1.00 37.73 ? 18   DA  C "C5'" 1 
ATOM   2806 C  "C4'" . DA  C 3 18  ? 7.468  -18.329 12.774  1.00 48.39 ? 18   DA  C "C4'" 1 
ATOM   2807 O  "O4'" . DA  C 3 18  ? 7.688  -17.051 12.108  1.00 43.66 ? 18   DA  C "O4'" 1 
ATOM   2808 C  "C3'" . DA  C 3 18  ? 7.604  -19.395 11.686  1.00 46.45 ? 18   DA  C "C3'" 1 
ATOM   2809 O  "O3'" . DA  C 3 18  ? 6.311  -19.719 11.260  1.00 46.92 ? 18   DA  C "O3'" 1 
ATOM   2810 C  "C2'" . DA  C 3 18  ? 8.372  -18.693 10.567  1.00 49.80 ? 18   DA  C "C2'" 1 
ATOM   2811 C  "C1'" . DA  C 3 18  ? 8.010  -17.215 10.753  1.00 43.49 ? 18   DA  C "C1'" 1 
ATOM   2812 N  N9    . DA  C 3 18  ? 9.197  -16.407 10.425  1.00 42.04 ? 18   DA  C N9    1 
ATOM   2813 C  C8    . DA  C 3 18  ? 10.433 -16.496 11.006  1.00 37.41 ? 18   DA  C C8    1 
ATOM   2814 N  N7    . DA  C 3 18  ? 11.315 -15.680 10.479  1.00 37.01 ? 18   DA  C N7    1 
ATOM   2815 C  C5    . DA  C 3 18  ? 10.605 -14.986 9.490   1.00 36.40 ? 18   DA  C C5    1 
ATOM   2816 C  C6    . DA  C 3 18  ? 10.945 -13.984 8.540   1.00 37.64 ? 18   DA  C C6    1 
ATOM   2817 N  N6    . DA  C 3 18  ? 12.136 -13.389 8.388   1.00 33.70 ? 18   DA  C N6    1 
ATOM   2818 N  N1    . DA  C 3 18  ? 9.966  -13.556 7.706   1.00 39.25 ? 18   DA  C N1    1 
ATOM   2819 C  C2    . DA  C 3 18  ? 8.754  -14.102 7.802   1.00 39.02 ? 18   DA  C C2    1 
ATOM   2820 N  N3    . DA  C 3 18  ? 8.322  -15.042 8.638   1.00 40.28 ? 18   DA  C N3    1 
ATOM   2821 C  C4    . DA  C 3 18  ? 9.303  -15.451 9.447   1.00 39.26 ? 18   DA  C C4    1 
ATOM   2822 P  P     . DT  C 3 19  ? 6.071  -20.862 10.142  1.00 45.83 ? 19   DT  C P     1 
ATOM   2823 O  OP1   . DT  C 3 19  ? 4.664  -21.277 10.269  1.00 52.35 ? 19   DT  C OP1   1 
ATOM   2824 O  OP2   . DT  C 3 19  ? 7.141  -21.858 10.199  1.00 48.70 ? 19   DT  C OP2   1 
ATOM   2825 O  "O5'" . DT  C 3 19  ? 6.258  -20.085 8.765   1.00 48.45 ? 19   DT  C "O5'" 1 
ATOM   2826 C  "C5'" . DT  C 3 19  ? 5.174  -19.343 8.268   1.00 52.48 ? 19   DT  C "C5'" 1 
ATOM   2827 C  "C4'" . DT  C 3 19  ? 5.618  -18.638 7.005   1.00 53.58 ? 19   DT  C "C4'" 1 
ATOM   2828 O  "O4'" . DT  C 3 19  ? 6.879  -17.979 7.268   1.00 47.80 ? 19   DT  C "O4'" 1 
ATOM   2829 C  "C3'" . DT  C 3 19  ? 5.895  -19.588 5.845   1.00 56.22 ? 19   DT  C "C3'" 1 
ATOM   2830 O  "O3'" . DT  C 3 19  ? 4.903  -19.374 4.871   1.00 58.68 ? 19   DT  C "O3'" 1 
ATOM   2831 C  "C2'" . DT  C 3 19  ? 7.264  -19.157 5.319   1.00 56.42 ? 19   DT  C "C2'" 1 
ATOM   2832 C  "C1'" . DT  C 3 19  ? 7.521  -17.816 6.027   1.00 50.52 ? 19   DT  C "C1'" 1 
ATOM   2833 N  N1    . DT  C 3 19  ? 8.966  -17.440 6.260   1.00 49.11 ? 19   DT  C N1    1 
ATOM   2834 C  C2    . DT  C 3 19  ? 9.483  -16.387 5.535   1.00 45.94 ? 19   DT  C C2    1 
ATOM   2835 O  O2    . DT  C 3 19  ? 8.826  -15.762 4.735   1.00 49.31 ? 19   DT  C O2    1 
ATOM   2836 N  N3    . DT  C 3 19  ? 10.797 -16.091 5.742   1.00 40.48 ? 19   DT  C N3    1 
ATOM   2837 C  C4    . DT  C 3 19  ? 11.620 -16.736 6.635   1.00 45.84 ? 19   DT  C C4    1 
ATOM   2838 O  O4    . DT  C 3 19  ? 12.790 -16.389 6.770   1.00 48.80 ? 19   DT  C O4    1 
ATOM   2839 C  C5    . DT  C 3 19  ? 11.041 -17.825 7.388   1.00 45.99 ? 19   DT  C C5    1 
ATOM   2840 C  C7    . DT  C 3 19  ? 11.889 -18.574 8.393   1.00 49.14 ? 19   DT  C C7    1 
ATOM   2841 C  C6    . DT  C 3 19  ? 9.751  -18.129 7.170   1.00 46.57 ? 19   DT  C C6    1 
ATOM   2842 P  P     . DC  C 3 20  ? 4.975  -20.198 3.497   1.00 62.83 ? 20   DC  C P     1 
ATOM   2843 O  OP1   . DC  C 3 20  ? 3.548  -20.257 3.083   1.00 65.98 ? 20   DC  C OP1   1 
ATOM   2844 O  OP2   . DC  C 3 20  ? 5.827  -21.408 3.652   1.00 59.31 ? 20   DC  C OP2   1 
ATOM   2845 O  "O5'" . DC  C 3 20  ? 5.758  -19.209 2.514   1.00 54.34 ? 20   DC  C "O5'" 1 
ATOM   2846 C  "C5'" . DC  C 3 20  ? 5.105  -17.977 2.288   1.00 58.53 ? 20   DC  C "C5'" 1 
ATOM   2847 C  "C4'" . DC  C 3 20  ? 5.872  -17.204 1.242   1.00 61.44 ? 20   DC  C "C4'" 1 
ATOM   2848 O  "O4'" . DC  C 3 20  ? 7.171  -16.854 1.782   1.00 58.91 ? 20   DC  C "O4'" 1 
ATOM   2849 C  "C3'" . DC  C 3 20  ? 6.138  -18.003 -0.026  1.00 59.88 ? 20   DC  C "C3'" 1 
ATOM   2850 O  "O3'" . DC  C 3 20  ? 5.908  -17.090 -1.088  1.00 66.72 ? 20   DC  C "O3'" 1 
ATOM   2851 C  "C2'" . DC  C 3 20  ? 7.599  -18.432 0.120   1.00 56.00 ? 20   DC  C "C2'" 1 
ATOM   2852 C  "C1'" . DC  C 3 20  ? 8.183  -17.232 0.877   1.00 52.92 ? 20   DC  C "C1'" 1 
ATOM   2853 N  N1    . DC  C 3 20  ? 9.407  -17.539 1.683   1.00 46.67 ? 20   DC  C N1    1 
ATOM   2854 C  C2    . DC  C 3 20  ? 10.572 -16.790 1.495   1.00 46.92 ? 20   DC  C C2    1 
ATOM   2855 O  O2    . DC  C 3 20  ? 10.580 -15.875 0.658   1.00 51.68 ? 20   DC  C O2    1 
ATOM   2856 N  N3    . DC  C 3 20  ? 11.690 -17.099 2.186   1.00 41.21 ? 20   DC  C N3    1 
ATOM   2857 C  C4    . DC  C 3 20  ? 11.619 -18.085 3.071   1.00 46.53 ? 20   DC  C C4    1 
ATOM   2858 N  N4    . DC  C 3 20  ? 12.724 -18.315 3.763   1.00 43.51 ? 20   DC  C N4    1 
ATOM   2859 C  C5    . DC  C 3 20  ? 10.448 -18.860 3.315   1.00 49.41 ? 20   DC  C C5    1 
ATOM   2860 C  C6    . DC  C 3 20  ? 9.359  -18.557 2.596   1.00 48.54 ? 20   DC  C C6    1 
ATOM   2861 P  P     . DC  C 3 21  ? 5.928  -17.538 -2.618  1.00 72.35 ? 21   DC  C P     1 
ATOM   2862 O  OP1   . DC  C 3 21  ? 4.866  -16.673 -3.200  1.00 71.14 ? 21   DC  C OP1   1 
ATOM   2863 O  OP2   . DC  C 3 21  ? 5.857  -19.024 -2.670  1.00 73.95 ? 21   DC  C OP2   1 
ATOM   2864 O  "O5'" . DC  C 3 21  ? 7.389  -17.145 -3.174  1.00 69.27 ? 21   DC  C "O5'" 1 
ATOM   2865 C  "C5'" . DC  C 3 21  ? 7.819  -15.793 -3.172  1.00 65.36 ? 21   DC  C "C5'" 1 
ATOM   2866 C  "C4'" . DC  C 3 21  ? 9.158  -15.613 -3.868  1.00 66.34 ? 21   DC  C "C4'" 1 
ATOM   2867 O  "O4'" . DC  C 3 21  ? 10.268 -15.899 -2.976  1.00 61.66 ? 21   DC  C "O4'" 1 
ATOM   2868 C  "C3'" . DC  C 3 21  ? 9.433  -16.390 -5.157  1.00 63.65 ? 21   DC  C "C3'" 1 
ATOM   2869 O  "O3'" . DC  C 3 21  ? 9.931  -15.436 -6.077  1.00 70.19 ? 21   DC  C "O3'" 1 
ATOM   2870 C  "C2'" . DC  C 3 21  ? 10.555 -17.361 -4.799  1.00 56.14 ? 21   DC  C "C2'" 1 
ATOM   2871 C  "C1'" . DC  C 3 21  ? 11.276 -16.597 -3.690  1.00 54.03 ? 21   DC  C "C1'" 1 
ATOM   2872 N  N1    . DC  C 3 21  ? 11.965 -17.393 -2.629  1.00 48.58 ? 21   DC  C N1    1 
ATOM   2873 C  C2    . DC  C 3 21  ? 13.334 -17.212 -2.352  1.00 48.49 ? 21   DC  C C2    1 
ATOM   2874 O  O2    . DC  C 3 21  ? 13.988 -16.412 -3.029  1.00 46.54 ? 21   DC  C O2    1 
ATOM   2875 N  N3    . DC  C 3 21  ? 13.916 -17.944 -1.362  1.00 41.20 ? 21   DC  C N3    1 
ATOM   2876 C  C4    . DC  C 3 21  ? 13.195 -18.802 -0.645  1.00 44.45 ? 21   DC  C C4    1 
ATOM   2877 N  N4    . DC  C 3 21  ? 13.808 -19.491 0.326   1.00 47.14 ? 21   DC  C N4    1 
ATOM   2878 C  C5    . DC  C 3 21  ? 11.802 -18.979 -0.889  1.00 48.87 ? 21   DC  C C5    1 
ATOM   2879 C  C6    . DC  C 3 21  ? 11.233 -18.261 -1.870  1.00 48.76 ? 21   DC  C C6    1 
ATOM   2880 P  P     . DT  C 3 22  ? 10.030 -15.778 -7.635  1.00 73.71 ? 22   DT  C P     1 
ATOM   2881 O  OP1   . DT  C 3 22  ? 9.672  -14.488 -8.277  1.00 72.43 ? 22   DT  C OP1   1 
ATOM   2882 O  OP2   . DT  C 3 22  ? 9.289  -17.040 -7.891  1.00 72.16 ? 22   DT  C OP2   1 
ATOM   2883 O  "O5'" . DT  C 3 22  ? 11.576 -16.074 -7.880  1.00 68.09 ? 22   DT  C "O5'" 1 
ATOM   2884 C  "C5'" . DT  C 3 22  ? 12.531 -15.041 -7.649  1.00 65.55 ? 22   DT  C "C5'" 1 
ATOM   2885 C  "C4'" . DT  C 3 22  ? 13.915 -15.656 -7.770  1.00 66.11 ? 22   DT  C "C4'" 1 
ATOM   2886 O  "O4'" . DT  C 3 22  ? 14.329 -16.305 -6.527  1.00 60.53 ? 22   DT  C "O4'" 1 
ATOM   2887 C  "C3'" . DT  C 3 22  ? 14.041 -16.724 -8.862  1.00 66.00 ? 22   DT  C "C3'" 1 
ATOM   2888 O  "O3'" . DT  C 3 22  ? 15.347 -16.582 -9.402  1.00 70.25 ? 22   DT  C "O3'" 1 
ATOM   2889 C  "C2'" . DT  C 3 22  ? 14.003 -18.009 -8.037  1.00 61.73 ? 22   DT  C "C2'" 1 
ATOM   2890 C  "C1'" . DT  C 3 22  ? 14.885 -17.569 -6.862  1.00 57.77 ? 22   DT  C "C1'" 1 
ATOM   2891 N  N1    . DT  C 3 22  ? 14.887 -18.498 -5.667  1.00 53.93 ? 22   DT  C N1    1 
ATOM   2892 C  C2    . DT  C 3 22  ? 15.980 -18.564 -4.803  1.00 51.81 ? 22   DT  C C2    1 
ATOM   2893 O  O2    . DT  C 3 22  ? 17.017 -17.913 -4.920  1.00 50.87 ? 22   DT  C O2    1 
ATOM   2894 N  N3    . DT  C 3 22  ? 15.825 -19.464 -3.764  1.00 52.40 ? 22   DT  C N3    1 
ATOM   2895 C  C4    . DT  C 3 22  ? 14.711 -20.242 -3.494  1.00 52.56 ? 22   DT  C C4    1 
ATOM   2896 O  O4    . DT  C 3 22  ? 14.673 -21.011 -2.533  1.00 55.98 ? 22   DT  C O4    1 
ATOM   2897 C  C5    . DT  C 3 22  ? 13.606 -20.113 -4.420  1.00 52.52 ? 22   DT  C C5    1 
ATOM   2898 C  C7    . DT  C 3 22  ? 12.364 -20.939 -4.229  1.00 52.74 ? 22   DT  C C7    1 
ATOM   2899 C  C6    . DT  C 3 22  ? 13.749 -19.262 -5.452  1.00 49.83 ? 22   DT  C C6    1 
ATOM   2900 P  P     . DA  C 3 23  ? 15.730 -16.123 -10.891 1.00 71.93 ? 23   DA  C P     1 
ATOM   2901 O  OP1   . DA  C 3 23  ? 14.956 -14.934 -11.309 1.00 72.36 ? 23   DA  C OP1   1 
ATOM   2902 O  OP2   . DA  C 3 23  ? 15.673 -17.365 -11.699 1.00 70.41 ? 23   DA  C OP2   1 
ATOM   2903 O  "O5'" . DA  C 3 23  ? 17.246 -15.645 -10.654 1.00 66.65 ? 23   DA  C "O5'" 1 
ATOM   2904 C  "C5'" . DA  C 3 23  ? 18.276 -15.946 -11.582 1.00 70.15 ? 23   DA  C "C5'" 1 
ATOM   2905 C  "C4'" . DA  C 3 23  ? 19.522 -16.505 -10.915 1.00 70.78 ? 23   DA  C "C4'" 1 
ATOM   2906 O  "O4'" . DA  C 3 23  ? 19.244 -16.786 -9.514  1.00 70.80 ? 23   DA  C "O4'" 1 
ATOM   2907 C  "C3'" . DA  C 3 23  ? 19.986 -17.814 -11.552 1.00 75.46 ? 23   DA  C "C3'" 1 
ATOM   2908 O  "O3'" . DA  C 3 23  ? 21.042 -17.622 -12.520 1.00 77.71 ? 23   DA  C "O3'" 1 
ATOM   2909 C  "C2'" . DA  C 3 23  ? 20.551 -18.570 -10.361 1.00 70.53 ? 23   DA  C "C2'" 1 
ATOM   2910 C  "C1'" . DA  C 3 23  ? 19.740 -18.075 -9.175  1.00 57.15 ? 23   DA  C "C1'" 1 
ATOM   2911 N  N9    . DA  C 3 23  ? 18.681 -18.969 -8.702  1.00 50.66 ? 23   DA  C N9    1 
ATOM   2912 C  C8    . DA  C 3 23  ? 17.438 -19.218 -9.231  1.00 50.79 ? 23   DA  C C8    1 
ATOM   2913 N  N7    . DA  C 3 23  ? 16.706 -20.050 -8.523  1.00 48.39 ? 23   DA  C N7    1 
ATOM   2914 C  C5    . DA  C 3 23  ? 17.522 -20.361 -7.442  1.00 47.72 ? 23   DA  C C5    1 
ATOM   2915 C  C6    . DA  C 3 23  ? 17.343 -21.190 -6.310  1.00 49.58 ? 23   DA  C C6    1 
ATOM   2916 N  N6    . DA  C 3 23  ? 16.244 -21.918 -6.049  1.00 48.84 ? 23   DA  C N6    1 
ATOM   2917 N  N1    . DA  C 3 23  ? 18.369 -21.257 -5.448  1.00 48.55 ? 23   DA  C N1    1 
ATOM   2918 C  C2    . DA  C 3 23  ? 19.486 -20.543 -5.667  1.00 48.89 ? 23   DA  C C2    1 
ATOM   2919 N  N3    . DA  C 3 23  ? 19.757 -19.725 -6.686  1.00 43.97 ? 23   DA  C N3    1 
ATOM   2920 C  C4    . DA  C 3 23  ? 18.728 -19.694 -7.539  1.00 46.87 ? 23   DA  C C4    1 
ATOM   2921 P  P     . DA  C 3 24  ? 22.330 -16.815 -12.028 1.00 76.59 ? 24   DA  C P     1 
ATOM   2922 O  OP1   . DA  C 3 24  ? 21.915 -16.035 -10.832 1.00 76.59 ? 24   DA  C OP1   1 
ATOM   2923 O  OP2   . DA  C 3 24  ? 22.973 -16.171 -13.186 1.00 79.23 ? 24   DA  C OP2   1 
ATOM   2924 O  "O5'" . DA  C 3 24  ? 23.298 -17.951 -11.477 1.00 63.82 ? 24   DA  C "O5'" 1 
ATOM   2925 C  "C5'" . DA  C 3 24  ? 23.924 -17.715 -10.245 1.00 58.13 ? 24   DA  C "C5'" 1 
ATOM   2926 C  "C4'" . DA  C 3 24  ? 24.279 -19.056 -9.645  1.00 55.51 ? 24   DA  C "C4'" 1 
ATOM   2927 O  "O4'" . DA  C 3 24  ? 23.090 -19.725 -9.151  1.00 51.93 ? 24   DA  C "O4'" 1 
ATOM   2928 C  "C3'" . DA  C 3 24  ? 24.893 -19.983 -10.695 1.00 52.43 ? 24   DA  C "C3'" 1 
ATOM   2929 O  "O3'" . DA  C 3 24  ? 26.072 -20.567 -10.161 1.00 56.10 ? 24   DA  C "O3'" 1 
ATOM   2930 C  "C2'" . DA  C 3 24  ? 23.781 -20.980 -11.001 1.00 50.14 ? 24   DA  C "C2'" 1 
ATOM   2931 C  "C1'" . DA  C 3 24  ? 23.171 -21.066 -9.614  1.00 45.90 ? 24   DA  C "C1'" 1 
ATOM   2932 N  N9    . DA  C 3 24  ? 21.821 -21.576 -9.626  1.00 42.62 ? 24   DA  C N9    1 
ATOM   2933 C  C8    . DA  C 3 24  ? 20.871 -21.429 -10.588 1.00 43.80 ? 24   DA  C C8    1 
ATOM   2934 N  N7    . DA  C 3 24  ? 19.731 -22.012 -10.268 1.00 47.85 ? 24   DA  C N7    1 
ATOM   2935 C  C5    . DA  C 3 24  ? 19.978 -22.581 -9.022  1.00 43.41 ? 24   DA  C C5    1 
ATOM   2936 C  C6    . DA  C 3 24  ? 19.173 -23.350 -8.155  1.00 41.44 ? 24   DA  C C6    1 
ATOM   2937 N  N6    . DA  C 3 24  ? 17.899 -23.682 -8.430  1.00 41.01 ? 24   DA  C N6    1 
ATOM   2938 N  N1    . DA  C 3 24  ? 19.731 -23.754 -6.995  1.00 37.67 ? 24   DA  C N1    1 
ATOM   2939 C  C2    . DA  C 3 24  ? 21.004 -23.420 -6.708  1.00 41.64 ? 24   DA  C C2    1 
ATOM   2940 N  N3    . DA  C 3 24  ? 21.869 -22.703 -7.456  1.00 37.60 ? 24   DA  C N3    1 
ATOM   2941 C  C4    . DA  C 3 24  ? 21.273 -22.325 -8.611  1.00 43.35 ? 24   DA  C C4    1 
ATOM   2942 O  "O5'" . DT  D 4 1   ? 18.196 -32.426 -1.541  1.00 57.89 ? 1    DT  E "O5'" 1 
ATOM   2943 C  "C5'" . DT  D 4 1   ? 18.122 -31.415 -2.535  1.00 40.02 ? 1    DT  E "C5'" 1 
ATOM   2944 C  "C4'" . DT  D 4 1   ? 19.424 -30.661 -2.430  1.00 44.73 ? 1    DT  E "C4'" 1 
ATOM   2945 O  "O4'" . DT  D 4 1   ? 19.441 -29.656 -3.479  1.00 43.37 ? 1    DT  E "O4'" 1 
ATOM   2946 C  "C3'" . DT  D 4 1   ? 19.552 -29.885 -1.125  1.00 42.04 ? 1    DT  E "C3'" 1 
ATOM   2947 O  "O3'" . DT  D 4 1   ? 20.913 -29.977 -0.668  1.00 44.02 ? 1    DT  E "O3'" 1 
ATOM   2948 C  "C2'" . DT  D 4 1   ? 19.137 -28.452 -1.528  1.00 44.69 ? 1    DT  E "C2'" 1 
ATOM   2949 C  "C1'" . DT  D 4 1   ? 19.634 -28.355 -2.966  1.00 39.59 ? 1    DT  E "C1'" 1 
ATOM   2950 N  N1    . DT  D 4 1   ? 18.810 -27.521 -3.884  1.00 36.36 ? 1    DT  E N1    1 
ATOM   2951 C  C2    . DT  D 4 1   ? 19.430 -26.509 -4.612  1.00 38.26 ? 1    DT  E C2    1 
ATOM   2952 O  O2    . DT  D 4 1   ? 20.629 -26.246 -4.534  1.00 39.35 ? 1    DT  E O2    1 
ATOM   2953 N  N3    . DT  D 4 1   ? 18.591 -25.800 -5.446  1.00 36.99 ? 1    DT  E N3    1 
ATOM   2954 C  C4    . DT  D 4 1   ? 17.244 -26.019 -5.629  1.00 40.10 ? 1    DT  E C4    1 
ATOM   2955 O  O4    . DT  D 4 1   ? 16.592 -25.321 -6.400  1.00 42.95 ? 1    DT  E O4    1 
ATOM   2956 C  C5    . DT  D 4 1   ? 16.670 -27.105 -4.849  1.00 41.38 ? 1    DT  E C5    1 
ATOM   2957 C  C7    . DT  D 4 1   ? 15.205 -27.396 -4.974  1.00 40.19 ? 1    DT  E C7    1 
ATOM   2958 C  C6    . DT  D 4 1   ? 17.469 -27.817 -4.033  1.00 36.59 ? 1    DT  E C6    1 
ATOM   2959 P  P     . DT  D 4 2   ? 21.345 -29.312 0.725   1.00 44.77 ? 2    DT  E P     1 
ATOM   2960 O  OP1   . DT  D 4 2   ? 22.662 -29.834 1.138   1.00 44.19 ? 2    DT  E OP1   1 
ATOM   2961 O  OP2   . DT  D 4 2   ? 20.166 -29.288 1.626   1.00 40.29 ? 2    DT  E OP2   1 
ATOM   2962 O  "O5'" . DT  D 4 2   ? 21.630 -27.800 0.311   1.00 45.53 ? 2    DT  E "O5'" 1 
ATOM   2963 C  "C5'" . DT  D 4 2   ? 22.828 -27.502 -0.376  1.00 45.92 ? 2    DT  E "C5'" 1 
ATOM   2964 C  "C4'" . DT  D 4 2   ? 22.791 -26.017 -0.656  1.00 43.85 ? 2    DT  E "C4'" 1 
ATOM   2965 O  "O4'" . DT  D 4 2   ? 21.600 -25.787 -1.436  1.00 42.97 ? 2    DT  E "O4'" 1 
ATOM   2966 C  "C3'" . DT  D 4 2   ? 22.547 -25.137 0.577   1.00 47.82 ? 2    DT  E "C3'" 1 
ATOM   2967 O  "O3'" . DT  D 4 2   ? 23.826 -24.706 1.027   1.00 54.77 ? 2    DT  E "O3'" 1 
ATOM   2968 C  "C2'" . DT  D 4 2   ? 21.706 -23.981 0.041   1.00 43.59 ? 2    DT  E "C2'" 1 
ATOM   2969 C  "C1'" . DT  D 4 2   ? 21.417 -24.387 -1.394  1.00 41.71 ? 2    DT  E "C1'" 1 
ATOM   2970 N  N1    . DT  D 4 2   ? 20.070 -24.150 -1.896  1.00 40.65 ? 2    DT  E N1    1 
ATOM   2971 C  C2    . DT  D 4 2   ? 19.953 -23.253 -2.917  1.00 37.47 ? 2    DT  E C2    1 
ATOM   2972 O  O2    . DT  D 4 2   ? 20.890 -22.637 -3.362  1.00 43.48 ? 2    DT  E O2    1 
ATOM   2973 N  N3    . DT  D 4 2   ? 18.685 -23.085 -3.373  1.00 39.41 ? 2    DT  E N3    1 
ATOM   2974 C  C4    . DT  D 4 2   ? 17.550 -23.737 -2.935  1.00 40.91 ? 2    DT  E C4    1 
ATOM   2975 O  O4    . DT  D 4 2   ? 16.470 -23.482 -3.477  1.00 45.23 ? 2    DT  E O4    1 
ATOM   2976 C  C5    . DT  D 4 2   ? 17.758 -24.693 -1.867  1.00 39.56 ? 2    DT  E C5    1 
ATOM   2977 C  C7    . DT  D 4 2   ? 16.653 -25.508 -1.259  1.00 37.28 ? 2    DT  E C7    1 
ATOM   2978 C  C6    . DT  D 4 2   ? 18.994 -24.860 -1.410  1.00 38.23 ? 2    DT  E C6    1 
ATOM   2979 P  P     . DA  D 4 3   ? 24.036 -23.785 2.313   1.00 62.65 ? 3    DA  E P     1 
ATOM   2980 O  OP1   . DA  D 4 3   ? 25.357 -24.161 2.858   1.00 68.37 ? 3    DA  E OP1   1 
ATOM   2981 O  OP2   . DA  D 4 3   ? 22.806 -23.697 3.139   1.00 57.17 ? 3    DA  E OP2   1 
ATOM   2982 O  "O5'" . DA  D 4 3   ? 24.128 -22.290 1.735   1.00 52.60 ? 3    DA  E "O5'" 1 
ATOM   2983 C  "C5'" . DA  D 4 3   ? 25.003 -21.895 0.721   1.00 51.58 ? 3    DA  E "C5'" 1 
ATOM   2984 C  "C4'" . DA  D 4 3   ? 24.579 -20.494 0.324   1.00 52.14 ? 3    DA  E "C4'" 1 
ATOM   2985 O  "O4'" . DA  D 4 3   ? 23.283 -20.556 -0.325  1.00 51.69 ? 3    DA  E "O4'" 1 
ATOM   2986 C  "C3'" . DA  D 4 3   ? 24.491 -19.492 1.477   1.00 51.29 ? 3    DA  E "C3'" 1 
ATOM   2987 O  "O3'" . DA  D 4 3   ? 25.449 -18.437 1.211   1.00 56.38 ? 3    DA  E "O3'" 1 
ATOM   2988 C  "C2'" . DA  D 4 3   ? 23.014 -19.106 1.487   1.00 48.57 ? 3    DA  E "C2'" 1 
ATOM   2989 C  "C1'" . DA  D 4 3   ? 22.424 -19.551 0.151   1.00 46.88 ? 3    DA  E "C1'" 1 
ATOM   2990 N  N9    . DA  D 4 3   ? 21.090 -20.152 0.191   1.00 41.77 ? 3    DA  E N9    1 
ATOM   2991 C  C8    . DA  D 4 3   ? 20.612 -21.065 1.098   1.00 46.86 ? 3    DA  E C8    1 
ATOM   2992 N  N7    . DA  D 4 3   ? 19.372 -21.462 0.885   1.00 42.74 ? 3    DA  E N7    1 
ATOM   2993 C  C5    . DA  D 4 3   ? 19.019 -20.772 -0.270  1.00 42.11 ? 3    DA  E C5    1 
ATOM   2994 C  C6    . DA  D 4 3   ? 17.833 -20.754 -1.012  1.00 42.33 ? 3    DA  E C6    1 
ATOM   2995 N  N6    . DA  D 4 3   ? 16.744 -21.452 -0.676  1.00 43.55 ? 3    DA  E N6    1 
ATOM   2996 N  N1    . DA  D 4 3   ? 17.796 -19.962 -2.105  1.00 47.17 ? 3    DA  E N1    1 
ATOM   2997 C  C2    . DA  D 4 3   ? 18.892 -19.244 -2.407  1.00 44.43 ? 3    DA  E C2    1 
ATOM   2998 N  N3    . DA  D 4 3   ? 20.065 -19.180 -1.778  1.00 43.14 ? 3    DA  E N3    1 
ATOM   2999 C  C4    . DA  D 4 3   ? 20.057 -19.962 -0.697  1.00 40.93 ? 3    DA  E C4    1 
ATOM   3000 P  P     . DG  D 4 4   ? 25.752 -17.122 2.107   1.00 55.55 ? 4    DG  E P     1 
ATOM   3001 O  OP1   . DG  D 4 4   ? 27.030 -16.533 1.636   1.00 54.39 ? 4    DG  E OP1   1 
ATOM   3002 O  OP2   . DG  D 4 4   ? 25.605 -17.381 3.561   1.00 44.51 ? 4    DG  E OP2   1 
ATOM   3003 O  "O5'" . DG  D 4 4   ? 24.534 -16.214 1.600   1.00 46.88 ? 4    DG  E "O5'" 1 
ATOM   3004 C  "C5'" . DG  D 4 4   ? 24.573 -15.659 0.282   1.00 46.22 ? 4    DG  E "C5'" 1 
ATOM   3005 C  "C4'" . DG  D 4 4   ? 23.256 -14.961 0.069   1.00 49.97 ? 4    DG  E "C4'" 1 
ATOM   3006 O  "O4'" . DG  D 4 4   ? 22.265 -16.004 0.182   1.00 49.90 ? 4    DG  E "O4'" 1 
ATOM   3007 C  "C3'" . DG  D 4 4   ? 22.910 -13.937 1.166   1.00 53.82 ? 4    DG  E "C3'" 1 
ATOM   3008 O  "O3'" . DG  D 4 4   ? 22.949 -12.642 0.555   1.00 53.20 ? 4    DG  E "O3'" 1 
ATOM   3009 C  "C2'" . DG  D 4 4   ? 21.526 -14.398 1.630   1.00 51.76 ? 4    DG  E "C2'" 1 
ATOM   3010 C  "C1'" . DG  D 4 4   ? 21.078 -15.334 0.499   1.00 47.39 ? 4    DG  E "C1'" 1 
ATOM   3011 N  N9    . DG  D 4 4   ? 20.046 -16.290 0.882   1.00 47.45 ? 4    DG  E N9    1 
ATOM   3012 C  C8    . DG  D 4 4   ? 20.066 -17.114 1.986   1.00 43.88 ? 4    DG  E C8    1 
ATOM   3013 N  N7    . DG  D 4 4   ? 18.974 -17.832 2.094   1.00 48.35 ? 4    DG  E N7    1 
ATOM   3014 C  C5    . DG  D 4 4   ? 18.200 -17.467 0.992   1.00 45.67 ? 4    DG  E C5    1 
ATOM   3015 C  C6    . DG  D 4 4   ? 16.926 -17.919 0.590   1.00 45.18 ? 4    DG  E C6    1 
ATOM   3016 O  O6    . DG  D 4 4   ? 16.239 -18.779 1.150   1.00 47.06 ? 4    DG  E O6    1 
ATOM   3017 N  N1    . DG  D 4 4   ? 16.478 -17.282 -0.571  1.00 43.83 ? 4    DG  E N1    1 
ATOM   3018 C  C2    . DG  D 4 4   ? 17.177 -16.334 -1.273  1.00 44.57 ? 4    DG  E C2    1 
ATOM   3019 N  N2    . DG  D 4 4   ? 16.573 -15.820 -2.367  1.00 45.44 ? 4    DG  E N2    1 
ATOM   3020 N  N3    . DG  D 4 4   ? 18.387 -15.910 -0.908  1.00 44.43 ? 4    DG  E N3    1 
ATOM   3021 C  C4    . DG  D 4 4   ? 18.838 -16.514 0.229   1.00 47.92 ? 4    DG  E C4    1 
ATOM   3022 P  P     . DG  D 4 5   ? 22.482 -11.272 1.256   1.00 50.78 ? 5    DG  E P     1 
ATOM   3023 O  OP1   . DG  D 4 5   ? 23.245 -10.223 0.561   1.00 49.09 ? 5    DG  E OP1   1 
ATOM   3024 O  OP2   . DG  D 4 5   ? 22.510 -11.434 2.733   1.00 50.24 ? 5    DG  E OP2   1 
ATOM   3025 O  "O5'" . DG  D 4 5   ? 20.969 -11.187 0.736   1.00 54.61 ? 5    DG  E "O5'" 1 
ATOM   3026 C  "C5'" . DG  D 4 5   ? 20.777 -10.983 -0.684  1.00 52.02 ? 5    DG  E "C5'" 1 
ATOM   3027 C  "C4'" . DG  D 4 5   ? 19.298 -11.109 -0.981  1.00 51.54 ? 5    DG  E "C4'" 1 
ATOM   3028 O  "O4'" . DG  D 4 5   ? 18.785 -12.337 -0.387  1.00 48.41 ? 5    DG  E "O4'" 1 
ATOM   3029 C  "C3'" . DG  D 4 5   ? 18.491 -9.971  -0.370  1.00 47.90 ? 5    DG  E "C3'" 1 
ATOM   3030 O  "O3'" . DG  D 4 5   ? 17.738 -9.378  -1.433  1.00 54.03 ? 5    DG  E "O3'" 1 
ATOM   3031 C  "C2'" . DG  D 4 5   ? 17.640 -10.695 0.680   1.00 47.54 ? 5    DG  E "C2'" 1 
ATOM   3032 C  "C1'" . DG  D 4 5   ? 17.475 -12.098 0.078   1.00 43.71 ? 5    DG  E "C1'" 1 
ATOM   3033 N  N9    . DG  D 4 5   ? 17.098 -13.186 0.989   1.00 41.24 ? 5    DG  E N9    1 
ATOM   3034 C  C8    . DG  D 4 5   ? 17.842 -13.684 2.048   1.00 44.25 ? 5    DG  E C8    1 
ATOM   3035 N  N7    . DG  D 4 5   ? 17.258 -14.662 2.715   1.00 43.04 ? 5    DG  E N7    1 
ATOM   3036 C  C5    . DG  D 4 5   ? 16.041 -14.815 2.034   1.00 45.02 ? 5    DG  E C5    1 
ATOM   3037 C  C6    . DG  D 4 5   ? 14.987 -15.732 2.307   1.00 46.77 ? 5    DG  E C6    1 
ATOM   3038 O  O6    . DG  D 4 5   ? 14.956 -16.601 3.207   1.00 42.65 ? 5    DG  E O6    1 
ATOM   3039 N  N1    . DG  D 4 5   ? 13.900 -15.606 1.429   1.00 40.35 ? 5    DG  E N1    1 
ATOM   3040 C  C2    . DG  D 4 5   ? 13.870 -14.686 0.395   1.00 43.39 ? 5    DG  E C2    1 
ATOM   3041 N  N2    . DG  D 4 5   ? 12.722 -14.759 -0.287  1.00 43.64 ? 5    DG  E N2    1 
ATOM   3042 N  N3    . DG  D 4 5   ? 14.846 -13.780 0.105   1.00 43.85 ? 5    DG  E N3    1 
ATOM   3043 C  C4    . DG  D 4 5   ? 15.913 -13.913 0.976   1.00 45.04 ? 5    DG  E C4    1 
ATOM   3044 P  P     . DA  D 4 6   ? 16.708 -8.176  -1.178  1.00 53.66 ? 6    DA  E P     1 
ATOM   3045 O  OP1   . DA  D 4 6   ? 16.548 -7.441  -2.461  1.00 56.55 ? 6    DA  E OP1   1 
ATOM   3046 O  OP2   . DA  D 4 6   ? 17.122 -7.401  0.003   1.00 56.20 ? 6    DA  E OP2   1 
ATOM   3047 O  "O5'" . DA  D 4 6   ? 15.322 -8.910  -0.821  1.00 49.05 ? 6    DA  E "O5'" 1 
ATOM   3048 C  "C5'" . DA  D 4 6   ? 14.598 -9.504  -1.893  1.00 52.20 ? 6    DA  E "C5'" 1 
ATOM   3049 C  "C4'" . DA  D 4 6   ? 13.184 -9.841  -1.480  1.00 53.40 ? 6    DA  E "C4'" 1 
ATOM   3050 O  "O4'" . DA  D 4 6   ? 13.280 -10.864 -0.463  1.00 50.29 ? 6    DA  E "O4'" 1 
ATOM   3051 C  "C3'" . DA  D 4 6   ? 12.453 -8.671  -0.832  1.00 54.40 ? 6    DA  E "C3'" 1 
ATOM   3052 O  "O3'" . DA  D 4 6   ? 11.166 -8.561  -1.416  1.00 58.56 ? 6    DA  E "O3'" 1 
ATOM   3053 C  "C2'" . DA  D 4 6   ? 12.381 -9.054  0.648   1.00 51.69 ? 6    DA  E "C2'" 1 
ATOM   3054 C  "C1'" . DA  D 4 6   ? 12.380 -10.581 0.583   1.00 46.92 ? 6    DA  E "C1'" 1 
ATOM   3055 N  N9    . DA  D 4 6   ? 12.921 -11.299 1.731   1.00 44.80 ? 6    DA  E N9    1 
ATOM   3056 C  C8    . DA  D 4 6   ? 14.172 -11.121 2.260   1.00 44.99 ? 6    DA  E C8    1 
ATOM   3057 N  N7    . DA  D 4 6   ? 14.421 -11.906 3.285   1.00 45.12 ? 6    DA  E N7    1 
ATOM   3058 C  C5    . DA  D 4 6   ? 13.268 -12.664 3.422   1.00 43.88 ? 6    DA  E C5    1 
ATOM   3059 C  C6    . DA  D 4 6   ? 12.899 -13.672 4.343   1.00 46.27 ? 6    DA  E C6    1 
ATOM   3060 N  N6    . DA  D 4 6   ? 13.709 -14.123 5.303   1.00 43.71 ? 6    DA  E N6    1 
ATOM   3061 N  N1    . DA  D 4 6   ? 11.672 -14.222 4.242   1.00 45.70 ? 6    DA  E N1    1 
ATOM   3062 C  C2    . DA  D 4 6   ? 10.861 -13.774 3.261   1.00 45.83 ? 6    DA  E C2    1 
ATOM   3063 N  N3    . DA  D 4 6   ? 11.097 -12.827 2.336   1.00 47.83 ? 6    DA  E N3    1 
ATOM   3064 C  C4    . DA  D 4 6   ? 12.329 -12.291 2.479   1.00 44.30 ? 6    DA  E C4    1 
ATOM   3065 P  P     . DT  D 4 7   ? 10.154 -7.352  -1.038  1.00 65.28 ? 7    DT  E P     1 
ATOM   3066 O  OP1   . DT  D 4 7   ? 9.336  -7.181  -2.273  1.00 66.43 ? 7    DT  E OP1   1 
ATOM   3067 O  OP2   . DT  D 4 7   ? 10.945 -6.226  -0.464  1.00 62.07 ? 7    DT  E OP2   1 
ATOM   3068 O  "O5'" . DT  D 4 7   ? 9.211  -8.012  0.084   1.00 58.47 ? 7    DT  E "O5'" 1 
ATOM   3069 C  "C5'" . DT  D 4 7   ? 8.424  -9.112  -0.354  1.00 56.71 ? 7    DT  E "C5'" 1 
ATOM   3070 C  "C4'" . DT  D 4 7   ? 7.620  -9.732  0.774   1.00 51.35 ? 7    DT  E "C4'" 1 
ATOM   3071 O  "O4'" . DT  D 4 7   ? 8.489  -10.407 1.726   1.00 47.54 ? 7    DT  E "O4'" 1 
ATOM   3072 C  "C3'" . DT  D 4 7   ? 6.802  -8.733  1.577   1.00 49.67 ? 7    DT  E "C3'" 1 
ATOM   3073 O  "O3'" . DT  D 4 7   ? 5.423  -9.122  1.536   1.00 55.14 ? 7    DT  E "O3'" 1 
ATOM   3074 C  "C2'" . DT  D 4 7   ? 7.405  -8.795  2.978   1.00 48.84 ? 7    DT  E "C2'" 1 
ATOM   3075 C  "C1'" . DT  D 4 7   ? 7.968  -10.211 3.034   1.00 45.18 ? 7    DT  E "C1'" 1 
ATOM   3076 N  N1    . DT  D 4 7   ? 9.117  -10.448 4.000   1.00 40.44 ? 7    DT  E N1    1 
ATOM   3077 C  C2    . DT  D 4 7   ? 9.012  -11.507 4.877   1.00 42.26 ? 7    DT  E C2    1 
ATOM   3078 O  O2    . DT  D 4 7   ? 8.028  -12.244 4.933   1.00 44.55 ? 7    DT  E O2    1 
ATOM   3079 N  N3    . DT  D 4 7   ? 10.093 -11.674 5.705   1.00 35.71 ? 7    DT  E N3    1 
ATOM   3080 C  C4    . DT  D 4 7   ? 11.228 -10.895 5.705   1.00 35.00 ? 7    DT  E C4    1 
ATOM   3081 O  O4    . DT  D 4 7   ? 12.152 -11.099 6.463   1.00 38.87 ? 7    DT  E O4    1 
ATOM   3082 C  C5    . DT  D 4 7   ? 11.295 -9.819  4.757   1.00 40.53 ? 7    DT  E C5    1 
ATOM   3083 C  C7    . DT  D 4 7   ? 12.524 -8.961  4.746   1.00 40.58 ? 7    DT  E C7    1 
ATOM   3084 C  C6    . DT  D 4 7   ? 10.239 -9.647  3.949   1.00 39.70 ? 7    DT  E C6    1 
ATOM   3085 P  P     . DC  D 4 8   ? 4.373  -8.179  2.294   1.00 61.89 ? 8    DC  E P     1 
ATOM   3086 O  OP1   . DC  D 4 8   ? 3.029  -8.528  1.793   1.00 58.58 ? 8    DC  E OP1   1 
ATOM   3087 O  OP2   . DC  D 4 8   ? 4.920  -6.786  2.368   1.00 56.32 ? 8    DC  E OP2   1 
ATOM   3088 O  "O5'" . DC  D 4 8   ? 4.382  -8.791  3.768   1.00 56.95 ? 8    DC  E "O5'" 1 
ATOM   3089 C  "C5'" . DC  D 4 8   ? 3.993  -10.152 3.874   1.00 52.03 ? 8    DC  E "C5'" 1 
ATOM   3090 C  "C4'" . DC  D 4 8   ? 4.212  -10.679 5.273   1.00 48.56 ? 8    DC  E "C4'" 1 
ATOM   3091 O  "O4'" . DC  D 4 8   ? 5.612  -10.499 5.608   1.00 46.60 ? 8    DC  E "O4'" 1 
ATOM   3092 C  "C3'" . DC  D 4 8   ? 3.459  -9.916  6.346   1.00 48.30 ? 8    DC  E "C3'" 1 
ATOM   3093 O  "O3'" . DC  D 4 8   ? 2.271  -10.632 6.613   1.00 57.05 ? 8    DC  E "O3'" 1 
ATOM   3094 C  "C2'" . DC  D 4 8   ? 4.369  -9.983  7.580   1.00 49.38 ? 8    DC  E "C2'" 1 
ATOM   3095 C  "C1'" . DC  D 4 8   ? 5.663  -10.567 7.019   1.00 41.08 ? 8    DC  E "C1'" 1 
ATOM   3096 N  N1    . DC  D 4 8   ? 6.991  -10.025 7.419   1.00 41.32 ? 8    DC  E N1    1 
ATOM   3097 C  C2    . DC  D 4 8   ? 7.624  -10.716 8.450   1.00 41.19 ? 8    DC  E C2    1 
ATOM   3098 O  O2    . DC  D 4 8   ? 7.044  -11.670 8.977   1.00 41.14 ? 8    DC  E O2    1 
ATOM   3099 N  N3    . DC  D 4 8   ? 8.844  -10.333 8.835   1.00 35.47 ? 8    DC  E N3    1 
ATOM   3100 C  C4    . DC  D 4 8   ? 9.446  -9.310  8.250   1.00 32.59 ? 8    DC  E C4    1 
ATOM   3101 N  N4    . DC  D 4 8   ? 10.664 -9.023  8.716   1.00 34.38 ? 8    DC  E N4    1 
ATOM   3102 C  C5    . DC  D 4 8   ? 8.848  -8.565  7.193   1.00 36.99 ? 8    DC  E C5    1 
ATOM   3103 C  C6    . DC  D 4 8   ? 7.610  -8.982  6.802   1.00 39.36 ? 8    DC  E C6    1 
ATOM   3104 P  P     . DC  D 4 9   ? 1.207  -10.051 7.672   1.00 60.58 ? 9    DC  E P     1 
ATOM   3105 O  OP1   . DC  D 4 9   ? -0.084 -10.724 7.386   1.00 61.29 ? 9    DC  E OP1   1 
ATOM   3106 O  OP2   . DC  D 4 9   ? 1.378  -8.579  7.787   1.00 54.18 ? 9    DC  E OP2   1 
ATOM   3107 O  "O5'" . DC  D 4 9   ? 1.650  -10.582 9.107   1.00 50.17 ? 9    DC  E "O5'" 1 
ATOM   3108 C  "C5'" . DC  D 4 9   ? 1.749  -11.972 9.286   1.00 47.13 ? 9    DC  E "C5'" 1 
ATOM   3109 C  "C4'" . DC  D 4 9   ? 2.386  -12.194 10.634  1.00 44.84 ? 9    DC  E "C4'" 1 
ATOM   3110 O  "O4'" . DC  D 4 9   ? 3.771  -11.742 10.672  1.00 45.12 ? 9    DC  E "O4'" 1 
ATOM   3111 C  "C3'" . DC  D 4 9   ? 1.647  -11.389 11.691  1.00 40.87 ? 9    DC  E "C3'" 1 
ATOM   3112 O  "O3'" . DC  D 4 9   ? 1.111  -12.391 12.530  1.00 40.95 ? 9    DC  E "O3'" 1 
ATOM   3113 C  "C2'" . DC  D 4 9   ? 2.734  -10.499 12.323  1.00 43.22 ? 9    DC  E "C2'" 1 
ATOM   3114 C  "C1'" . DC  D 4 9   ? 4.034  -11.210 11.969  1.00 41.21 ? 9    DC  E "C1'" 1 
ATOM   3115 N  N1    . DC  D 4 9   ? 5.254  -10.321 11.869  1.00 38.86 ? 9    DC  E N1    1 
ATOM   3116 C  C2    . DC  D 4 9   ? 6.332  -10.503 12.741  1.00 33.08 ? 9    DC  E C2    1 
ATOM   3117 O  O2    . DC  D 4 9   ? 6.299  -11.373 13.606  1.00 36.87 ? 9    DC  E O2    1 
ATOM   3118 N  N3    . DC  D 4 9   ? 7.421  -9.730  12.632  1.00 32.81 ? 9    DC  E N3    1 
ATOM   3119 C  C4    . DC  D 4 9   ? 7.442  -8.781  11.693  1.00 37.65 ? 9    DC  E C4    1 
ATOM   3120 N  N4    . DC  D 4 9   ? 8.539  -8.042  11.614  1.00 33.13 ? 9    DC  E N4    1 
ATOM   3121 C  C5    . DC  D 4 9   ? 6.354  -8.542  10.792  1.00 39.99 ? 9    DC  E C5    1 
ATOM   3122 C  C6    . DC  D 4 9   ? 5.299  -9.347  10.910  1.00 42.21 ? 9    DC  E C6    1 
ATOM   3123 P  P     . DT  D 4 10  ? 0.180  -11.981 13.761  1.00 51.44 ? 10   DT  E P     1 
ATOM   3124 O  OP1   . DT  D 4 10  ? -0.746 -13.111 13.985  1.00 50.98 ? 10   DT  E OP1   1 
ATOM   3125 O  OP2   . DT  D 4 10  ? -0.317 -10.614 13.473  1.00 42.71 ? 10   DT  E OP2   1 
ATOM   3126 O  "O5'" . DT  D 4 10  ? 1.267  -11.958 14.957  1.00 43.66 ? 10   DT  E "O5'" 1 
ATOM   3127 C  "C5'" . DT  D 4 10  ? 1.933  -13.177 15.281  1.00 42.65 ? 10   DT  E "C5'" 1 
ATOM   3128 C  "C4'" . DT  D 4 10  ? 2.865  -12.894 16.446  1.00 44.04 ? 10   DT  E "C4'" 1 
ATOM   3129 O  "O4'" . DT  D 4 10  ? 3.909  -11.943 16.086  1.00 37.77 ? 10   DT  E "O4'" 1 
ATOM   3130 C  "C3'" . DT  D 4 10  ? 2.113  -12.301 17.645  1.00 39.84 ? 10   DT  E "C3'" 1 
ATOM   3131 O  "O3'" . DT  D 4 10  ? 2.398  -13.188 18.690  1.00 38.12 ? 10   DT  E "O3'" 1 
ATOM   3132 C  "C2'" . DT  D 4 10  ? 2.677  -10.877 17.808  1.00 38.89 ? 10   DT  E "C2'" 1 
ATOM   3133 C  "C1'" . DT  D 4 10  ? 4.064  -11.004 17.183  1.00 37.54 ? 10   DT  E "C1'" 1 
ATOM   3134 N  N1    . DT  D 4 10  ? 4.724  -9.824  16.513  1.00 34.23 ? 10   DT  E N1    1 
ATOM   3135 C  C2    . DT  D 4 10  ? 6.061  -9.589  16.725  1.00 34.08 ? 10   DT  E C2    1 
ATOM   3136 O  O2    . DT  D 4 10  ? 6.689  -10.233 17.531  1.00 31.10 ? 10   DT  E O2    1 
ATOM   3137 N  N3    . DT  D 4 10  ? 6.618  -8.553  16.021  1.00 29.82 ? 10   DT  E N3    1 
ATOM   3138 C  C4    . DT  D 4 10  ? 5.972  -7.804  15.074  1.00 31.06 ? 10   DT  E C4    1 
ATOM   3139 O  O4    . DT  D 4 10  ? 6.560  -6.929  14.436  1.00 31.76 ? 10   DT  E O4    1 
ATOM   3140 C  C5    . DT  D 4 10  ? 4.562  -8.116  14.869  1.00 35.92 ? 10   DT  E C5    1 
ATOM   3141 C  C7    . DT  D 4 10  ? 3.767  -7.315  13.883  1.00 37.60 ? 10   DT  E C7    1 
ATOM   3142 C  C6    . DT  D 4 10  ? 3.991  -9.102  15.571  1.00 31.24 ? 10   DT  E C6    1 
ATOM   3143 P  P     . DT  D 4 11  ? 1.637  -13.170 20.080  1.00 47.09 ? 11   DT  E P     1 
ATOM   3144 O  OP1   . DT  D 4 11  ? 1.907  -14.505 20.652  1.00 37.51 ? 11   DT  E OP1   1 
ATOM   3145 O  OP2   . DT  D 4 11  ? 0.373  -12.435 19.906  1.00 38.18 ? 11   DT  E OP2   1 
ATOM   3146 O  "O5'" . DT  D 4 11  ? 2.509  -12.209 21.027  1.00 43.01 ? 11   DT  E "O5'" 1 
ATOM   3147 C  "C5'" . DT  D 4 11  ? 3.856  -12.585 21.350  1.00 41.58 ? 11   DT  E "C5'" 1 
ATOM   3148 C  "C4'" . DT  D 4 11  ? 4.517  -11.335 21.905  1.00 34.72 ? 11   DT  E "C4'" 1 
ATOM   3149 O  "O4'" . DT  D 4 11  ? 4.817  -10.357 20.878  1.00 34.00 ? 11   DT  E "O4'" 1 
ATOM   3150 C  "C3'" . DT  D 4 11  ? 3.658  -10.574 22.920  1.00 37.77 ? 11   DT  E "C3'" 1 
ATOM   3151 O  "O3'" . DT  D 4 11  ? 4.370  -10.611 24.163  1.00 40.46 ? 11   DT  E "O3'" 1 
ATOM   3152 C  "C2'" . DT  D 4 11  ? 3.496  -9.166  22.327  1.00 36.99 ? 11   DT  E "C2'" 1 
ATOM   3153 C  "C1'" . DT  D 4 11  ? 4.755  -9.075  21.488  1.00 32.74 ? 11   DT  E "C1'" 1 
ATOM   3154 N  N1    . DT  D 4 11  ? 4.716  -8.134  20.358  1.00 31.47 ? 11   DT  E N1    1 
ATOM   3155 C  C2    . DT  D 4 11  ? 5.920  -7.561  20.011  1.00 31.42 ? 11   DT  E C2    1 
ATOM   3156 O  O2    . DT  D 4 11  ? 6.954  -7.790  20.615  1.00 33.70 ? 11   DT  E O2    1 
ATOM   3157 N  N3    . DT  D 4 11  ? 5.872  -6.731  18.933  1.00 27.89 ? 11   DT  E N3    1 
ATOM   3158 C  C4    . DT  D 4 11  ? 4.736  -6.449  18.197  1.00 32.22 ? 11   DT  E C4    1 
ATOM   3159 O  O4    . DT  D 4 11  ? 4.771  -5.688  17.238  1.00 31.12 ? 11   DT  E O4    1 
ATOM   3160 C  C5    . DT  D 4 11  ? 3.497  -7.071  18.616  1.00 28.62 ? 11   DT  E C5    1 
ATOM   3161 C  C7    . DT  D 4 11  ? 2.242  -6.803  17.825  1.00 34.71 ? 11   DT  E C7    1 
ATOM   3162 C  C6    . DT  D 4 11  ? 3.534  -7.887  19.670  1.00 30.23 ? 11   DT  E C6    1 
ATOM   3163 P  P     . DC  D 4 12  ? 3.706  -10.259 25.575  1.00 50.11 ? 12   DC  E P     1 
ATOM   3164 O  OP1   . DC  D 4 12  ? 4.525  -11.048 26.510  1.00 42.85 ? 12   DC  E OP1   1 
ATOM   3165 O  OP2   . DC  D 4 12  ? 2.228  -10.468 25.499  1.00 48.31 ? 12   DC  E OP2   1 
ATOM   3166 O  "O5'" . DC  D 4 12  ? 3.803  -8.684  25.791  1.00 41.68 ? 12   DC  E "O5'" 1 
ATOM   3167 C  "C5'" . DC  D 4 12  ? 5.006  -8.160  26.390  1.00 41.73 ? 12   DC  E "C5'" 1 
ATOM   3168 C  "C4'" . DC  D 4 12  ? 6.260  -8.346  25.547  1.00 33.03 ? 12   DC  E "C4'" 1 
ATOM   3169 O  "O4'" . DC  D 4 12  ? 6.082  -7.880  24.186  1.00 35.50 ? 12   DC  E "O4'" 1 
ATOM   3170 C  "C3'" . DC  D 4 12  ? 7.498  -7.589  26.088  1.00 33.65 ? 12   DC  E "C3'" 1 
ATOM   3171 O  "O3'" . DC  D 4 12  ? 8.663  -8.362  25.751  1.00 29.23 ? 12   DC  E "O3'" 1 
ATOM   3172 C  "C2'" . DC  D 4 12  ? 7.517  -6.285  25.280  1.00 31.30 ? 12   DC  E "C2'" 1 
ATOM   3173 C  "C1'" . DC  D 4 12  ? 6.862  -6.701  23.972  1.00 33.82 ? 12   DC  E "C1'" 1 
ATOM   3174 N  N1    . DC  D 4 12  ? 5.996  -5.792  23.169  1.00 35.12 ? 12   DC  E N1    1 
ATOM   3175 C  C2    . DC  D 4 12  ? 6.648  -4.931  22.306  1.00 36.04 ? 12   DC  E C2    1 
ATOM   3176 O  O2    . DC  D 4 12  ? 7.869  -4.927  22.339  1.00 33.36 ? 12   DC  E O2    1 
ATOM   3177 N  N3    . DC  D 4 12  ? 5.947  -4.146  21.464  1.00 33.49 ? 12   DC  E N3    1 
ATOM   3178 C  C4    . DC  D 4 12  ? 4.628  -4.240  21.483  1.00 32.87 ? 12   DC  E C4    1 
ATOM   3179 N  N4    . DC  D 4 12  ? 4.067  -3.437  20.605  1.00 33.12 ? 12   DC  E N4    1 
ATOM   3180 C  C5    . DC  D 4 12  ? 3.881  -5.106  22.342  1.00 31.96 ? 12   DC  E C5    1 
ATOM   3181 C  C6    . DC  D 4 12  ? 4.617  -5.876  23.170  1.00 32.42 ? 12   DC  E C6    1 
ATOM   3182 P  P     . DA  D 4 13  ? 9.863  -8.625  26.771  1.00 32.77 ? 13   DA  E P     1 
ATOM   3183 O  OP1   . DA  D 4 13  ? 10.528 -9.859  26.282  1.00 32.21 ? 13   DA  E OP1   1 
ATOM   3184 O  OP2   . DA  D 4 13  ? 9.360  -8.569  28.156  1.00 32.23 ? 13   DA  E OP2   1 
ATOM   3185 O  "O5'" . DA  D 4 13  ? 10.823 -7.385  26.500  1.00 30.43 ? 13   DA  E "O5'" 1 
ATOM   3186 C  "C5'" . DA  D 4 13  ? 11.508 -7.283  25.225  1.00 27.76 ? 13   DA  E "C5'" 1 
ATOM   3187 C  "C4'" . DA  D 4 13  ? 12.094 -5.886  25.239  1.00 28.35 ? 13   DA  E "C4'" 1 
ATOM   3188 O  "O4'" . DA  D 4 13  ? 11.014 -4.943  25.279  1.00 28.78 ? 13   DA  E "O4'" 1 
ATOM   3189 C  "C3'" . DA  D 4 13  ? 12.875 -5.454  26.486  1.00 26.48 ? 13   DA  E "C3'" 1 
ATOM   3190 O  "O3'" . DA  D 4 13  ? 13.854 -4.509  26.042  1.00 26.49 ? 13   DA  E "O3'" 1 
ATOM   3191 C  "C2'" . DA  D 4 13  ? 11.857 -4.710  27.375  1.00 24.31 ? 13   DA  E "C2'" 1 
ATOM   3192 C  "C1'" . DA  D 4 13  ? 11.134 -3.937  26.296  1.00 27.36 ? 13   DA  E "C1'" 1 
ATOM   3193 N  N9    . DA  D 4 13  ? 9.721  -3.662  26.521  1.00 25.99 ? 13   DA  E N9    1 
ATOM   3194 C  C8    . DA  D 4 13  ? 8.902  -4.194  27.472  1.00 27.55 ? 13   DA  E C8    1 
ATOM   3195 N  N7    . DA  D 4 13  ? 7.659  -3.767  27.355  1.00 26.38 ? 13   DA  E N7    1 
ATOM   3196 C  C5    . DA  D 4 13  ? 7.661  -2.917  26.250  1.00 29.17 ? 13   DA  E C5    1 
ATOM   3197 C  C6    . DA  D 4 13  ? 6.665  -2.183  25.578  1.00 29.87 ? 13   DA  E C6    1 
ATOM   3198 N  N6    . DA  D 4 13  ? 5.389  -2.216  25.976  1.00 30.33 ? 13   DA  E N6    1 
ATOM   3199 N  N1    . DA  D 4 13  ? 6.995  -1.416  24.500  1.00 30.14 ? 13   DA  E N1    1 
ATOM   3200 C  C2    . DA  D 4 13  ? 8.290  -1.413  24.072  1.00 28.16 ? 13   DA  E C2    1 
ATOM   3201 N  N3    . DA  D 4 13  ? 9.302  -2.094  24.650  1.00 24.17 ? 13   DA  E N3    1 
ATOM   3202 C  C4    . DA  D 4 13  ? 8.945  -2.824  25.735  1.00 26.90 ? 13   DA  E C4    1 
ATOM   3203 P  P     . DA  D 4 14  ? 15.002 -3.976  27.047  1.00 26.23 ? 14   DA  E P     1 
ATOM   3204 O  OP1   . DA  D 4 14  ? 16.096 -3.470  26.199  1.00 26.47 ? 14   DA  E OP1   1 
ATOM   3205 O  OP2   . DA  D 4 14  ? 15.256 -5.035  28.050  1.00 26.56 ? 14   DA  E OP2   1 
ATOM   3206 O  "O5'" . DA  D 4 14  ? 14.358 -2.682  27.755  1.00 24.31 ? 14   DA  E "O5'" 1 
ATOM   3207 C  "C5'" . DA  D 4 14  ? 14.595 -1.361  27.256  1.00 23.92 ? 14   DA  E "C5'" 1 
ATOM   3208 C  "C4'" . DA  D 4 14  ? 13.832 -1.065  25.982  1.00 29.33 ? 14   DA  E "C4'" 1 
ATOM   3209 O  "O4'" . DA  D 4 14  ? 12.385 -1.164  26.150  1.00 29.19 ? 14   DA  E "O4'" 1 
ATOM   3210 C  "C3'" . DA  D 4 14  ? 14.103 0.369   25.514  1.00 24.90 ? 14   DA  E "C3'" 1 
ATOM   3211 O  "O3'" . DA  D 4 14  ? 14.057 0.410   24.115  1.00 25.05 ? 14   DA  E "O3'" 1 
ATOM   3212 C  "C2'" . DA  D 4 14  ? 12.924 1.113   26.154  1.00 23.23 ? 14   DA  E "C2'" 1 
ATOM   3213 C  "C1'" . DA  D 4 14  ? 11.806 0.114   25.912  1.00 25.09 ? 14   DA  E "C1'" 1 
ATOM   3214 N  N9    . DA  D 4 14  ? 10.575 0.119   26.712  1.00 31.42 ? 14   DA  E N9    1 
ATOM   3215 C  C8    . DA  D 4 14  ? 10.357 -0.632  27.850  1.00 30.16 ? 14   DA  E C8    1 
ATOM   3216 N  N7    . DA  D 4 14  ? 9.133  -0.481  28.330  1.00 26.40 ? 14   DA  E N7    1 
ATOM   3217 C  C5    . DA  D 4 14  ? 8.521  0.356   27.392  1.00 27.30 ? 14   DA  E C5    1 
ATOM   3218 C  C6    . DA  D 4 14  ? 7.190  0.839   27.288  1.00 26.78 ? 14   DA  E C6    1 
ATOM   3219 N  N6    . DA  D 4 14  ? 6.258  0.533   28.202  1.00 25.49 ? 14   DA  E N6    1 
ATOM   3220 N  N1    . DA  D 4 14  ? 6.874  1.634   26.239  1.00 27.83 ? 14   DA  E N1    1 
ATOM   3221 C  C2    . DA  D 4 14  ? 7.859  1.926   25.363  1.00 29.67 ? 14   DA  E C2    1 
ATOM   3222 N  N3    . DA  D 4 14  ? 9.148  1.515   25.329  1.00 29.34 ? 14   DA  E N3    1 
ATOM   3223 C  C4    . DA  D 4 14  ? 9.387  0.712   26.378  1.00 30.51 ? 14   DA  E C4    1 
ATOM   3224 P  P     . DA  D 4 15  ? 14.219 1.825   23.300  1.00 28.38 ? 15   DA  E P     1 
ATOM   3225 O  OP1   . DA  D 4 15  ? 12.857 2.267   22.895  1.00 26.05 ? 15   DA  E OP1   1 
ATOM   3226 O  OP2   . DA  D 4 15  ? 15.114 1.496   22.195  1.00 25.47 ? 15   DA  E OP2   1 
ATOM   3227 O  "O5'" . DA  D 4 15  ? 14.862 2.756   24.444  1.00 24.37 ? 15   DA  E "O5'" 1 
ATOM   3228 C  "C5'" . DA  D 4 15  ? 14.986 4.164   24.441  1.00 28.50 ? 15   DA  E "C5'" 1 
ATOM   3229 C  "C4'" . DA  D 4 15  ? 13.668 4.909   24.372  1.00 25.59 ? 15   DA  E "C4'" 1 
ATOM   3230 O  "O4'" . DA  D 4 15  ? 12.668 4.261   25.172  1.00 25.98 ? 15   DA  E "O4'" 1 
ATOM   3231 C  "C3'" . DA  D 4 15  ? 13.678 6.361   24.846  1.00 26.03 ? 15   DA  E "C3'" 1 
ATOM   3232 O  "O3'" . DA  D 4 15  ? 13.267 7.139   23.687  1.00 24.70 ? 15   DA  E "O3'" 1 
ATOM   3233 C  "C2'" . DA  D 4 15  ? 12.725 6.437   26.068  1.00 22.66 ? 15   DA  E "C2'" 1 
ATOM   3234 C  "C1'" . DA  D 4 15  ? 11.782 5.272   25.747  1.00 24.14 ? 15   DA  E "C1'" 1 
ATOM   3235 N  N9    . DA  D 4 15  ? 11.023 4.700   26.858  1.00 34.13 ? 15   DA  E N9    1 
ATOM   3236 C  C8    . DA  D 4 15  ? 11.525 4.068   27.949  1.00 27.21 ? 15   DA  E C8    1 
ATOM   3237 N  N7    . DA  D 4 15  ? 10.577 3.659   28.765  1.00 31.98 ? 15   DA  E N7    1 
ATOM   3238 C  C5    . DA  D 4 15  ? 9.390  4.088   28.203  1.00 28.71 ? 15   DA  E C5    1 
ATOM   3239 C  C6    . DA  D 4 15  ? 8.040  3.955   28.606  1.00 31.01 ? 15   DA  E C6    1 
ATOM   3240 N  N6    . DA  D 4 15  ? 7.637  3.308   29.712  1.00 25.10 ? 15   DA  E N6    1 
ATOM   3241 N  N1    . DA  D 4 15  ? 7.116  4.493   27.790  1.00 25.36 ? 15   DA  E N1    1 
ATOM   3242 C  C2    . DA  D 4 15  ? 7.502  5.132   26.671  1.00 25.73 ? 15   DA  E C2    1 
ATOM   3243 N  N3    . DA  D 4 15  ? 8.745  5.295   26.188  1.00 28.57 ? 15   DA  E N3    1 
ATOM   3244 C  C4    . DA  D 4 15  ? 9.655  4.744   27.023  1.00 39.81 ? 15   DA  E C4    1 
ATOM   3245 P  P     . DA  D 4 16  ? 13.598 8.693   23.624  1.00 25.61 ? 16   DA  E P     1 
ATOM   3246 O  OP1   . DA  D 4 16  ? 13.611 9.141   22.216  1.00 25.92 ? 16   DA  E OP1   1 
ATOM   3247 O  OP2   . DA  D 4 16  ? 14.808 8.928   24.471  1.00 26.16 ? 16   DA  E OP2   1 
ATOM   3248 O  "O5'" . DA  D 4 16  ? 12.392 9.349   24.442  1.00 26.73 ? 16   DA  E "O5'" 1 
ATOM   3249 C  "C5'" . DA  D 4 16  ? 11.079 9.233   23.838  1.00 27.50 ? 16   DA  E "C5'" 1 
ATOM   3250 C  "C4'" . DA  D 4 16  ? 10.051 9.840   24.786  1.00 24.11 ? 16   DA  E "C4'" 1 
ATOM   3251 O  "O4'" . DA  D 4 16  ? 9.744  8.809   25.771  1.00 26.51 ? 16   DA  E "O4'" 1 
ATOM   3252 C  "C3'" . DA  D 4 16  ? 10.557 11.053  25.593  1.00 29.27 ? 16   DA  E "C3'" 1 
ATOM   3253 O  "O3'" . DA  D 4 16  ? 9.575  12.090  25.519  1.00 28.78 ? 16   DA  E "O3'" 1 
ATOM   3254 C  "C2'" . DA  D 4 16  ? 10.607 10.591  27.053  1.00 24.60 ? 16   DA  E "C2'" 1 
ATOM   3255 C  "C1'" . DA  D 4 16  ? 9.576  9.468   27.012  1.00 27.29 ? 16   DA  E "C1'" 1 
ATOM   3256 N  N9    . DA  D 4 16  ? 9.611  8.561   28.149  1.00 25.81 ? 16   DA  E N9    1 
ATOM   3257 C  C8    . DA  D 4 16  ? 10.694 8.082   28.853  1.00 31.41 ? 16   DA  E C8    1 
ATOM   3258 N  N7    . DA  D 4 16  ? 10.357 7.292   29.852  1.00 31.03 ? 16   DA  E N7    1 
ATOM   3259 C  C5    . DA  D 4 16  ? 8.960  7.249   29.799  1.00 27.44 ? 16   DA  E C5    1 
ATOM   3260 C  C6    . DA  D 4 16  ? 7.987  6.652   30.613  1.00 28.23 ? 16   DA  E C6    1 
ATOM   3261 N  N6    . DA  D 4 16  ? 8.306  5.874   31.674  1.00 24.32 ? 16   DA  E N6    1 
ATOM   3262 N  N1    . DA  D 4 16  ? 6.683  6.823   30.234  1.00 28.12 ? 16   DA  E N1    1 
ATOM   3263 C  C2    . DA  D 4 16  ? 6.361  7.605   29.177  1.00 30.11 ? 16   DA  E C2    1 
ATOM   3264 N  N3    . DA  D 4 16  ? 7.211  8.269   28.372  1.00 29.04 ? 16   DA  E N3    1 
ATOM   3265 C  C4    . DA  D 4 16  ? 8.494  8.037   28.757  1.00 29.32 ? 16   DA  E C4    1 
ATOM   3266 P  P     . DA  D 4 17  ? 9.826  13.626  25.756  1.00 30.65 ? 17   DA  E P     1 
ATOM   3267 O  OP1   . DA  D 4 17  ? 8.658  14.336  25.188  1.00 30.77 ? 17   DA  E OP1   1 
ATOM   3268 O  OP2   . DA  D 4 17  ? 11.179 13.961  25.270  1.00 28.84 ? 17   DA  E OP2   1 
ATOM   3269 O  "O5'" . DA  D 4 17  ? 9.953  13.690  27.356  1.00 27.33 ? 17   DA  E "O5'" 1 
ATOM   3270 C  "C5'" . DA  D 4 17  ? 8.989  14.264  28.205  1.00 27.88 ? 17   DA  E "C5'" 1 
ATOM   3271 C  "C4'" . DA  D 4 17  ? 7.660  13.510  28.131  1.00 32.03 ? 17   DA  E "C4'" 1 
ATOM   3272 O  "O4'" . DA  D 4 17  ? 7.805  12.080  28.349  1.00 33.88 ? 17   DA  E "O4'" 1 
ATOM   3273 C  "C3'" . DA  D 4 17  ? 6.725  13.902  29.297  1.00 34.37 ? 17   DA  E "C3'" 1 
ATOM   3274 O  "O3'" . DA  D 4 17  ? 5.883  14.980  28.957  1.00 32.44 ? 17   DA  E "O3'" 1 
ATOM   3275 C  "C2'" . DA  D 4 17  ? 5.814  12.697  29.455  1.00 37.82 ? 17   DA  E "C2'" 1 
ATOM   3276 C  "C1'" . DA  D 4 17  ? 6.819  11.582  29.221  1.00 32.69 ? 17   DA  E "C1'" 1 
ATOM   3277 N  N9    . DA  D 4 17  ? 7.435  10.956  30.392  1.00 29.33 ? 17   DA  E N9    1 
ATOM   3278 C  C8    . DA  D 4 17  ? 8.779  10.940  30.650  1.00 30.71 ? 17   DA  E C8    1 
ATOM   3279 N  N7    . DA  D 4 17  ? 9.066  10.243  31.720  1.00 31.20 ? 17   DA  E N7    1 
ATOM   3280 C  C5    . DA  D 4 17  ? 7.847  9.734   32.160  1.00 30.32 ? 17   DA  E C5    1 
ATOM   3281 C  C6    . DA  D 4 17  ? 7.479  8.911   33.242  1.00 31.90 ? 17   DA  E C6    1 
ATOM   3282 N  N6    . DA  D 4 17  ? 8.328  8.376   34.124  1.00 26.65 ? 17   DA  E N6    1 
ATOM   3283 N  N1    . DA  D 4 17  ? 6.172  8.589   33.396  1.00 31.22 ? 17   DA  E N1    1 
ATOM   3284 C  C2    . DA  D 4 17  ? 5.260  9.098   32.540  1.00 30.33 ? 17   DA  E C2    1 
ATOM   3285 N  N3    . DA  D 4 17  ? 5.493  9.897   31.473  1.00 28.57 ? 17   DA  E N3    1 
ATOM   3286 C  C4    . DA  D 4 17  ? 6.823  10.164  31.335  1.00 31.27 ? 17   DA  E C4    1 
ATOM   3287 P  P     . DA  D 4 18  ? 5.412  15.997  30.097  1.00 32.77 ? 18   DA  E P     1 
ATOM   3288 O  OP1   . DA  D 4 18  ? 4.795  17.172  29.376  1.00 32.17 ? 18   DA  E OP1   1 
ATOM   3289 O  OP2   . DA  D 4 18  ? 6.484  16.280  31.105  1.00 32.67 ? 18   DA  E OP2   1 
ATOM   3290 O  "O5'" . DA  D 4 18  ? 4.351  15.148  30.897  1.00 31.29 ? 18   DA  E "O5'" 1 
ATOM   3291 C  "C5'" . DA  D 4 18  ? 3.100  14.810  30.269  1.00 35.63 ? 18   DA  E "C5'" 1 
ATOM   3292 C  "C4'" . DA  D 4 18  ? 2.254  14.112  31.310  1.00 40.67 ? 18   DA  E "C4'" 1 
ATOM   3293 O  "O4'" . DA  D 4 18  ? 2.773  12.844  31.788  1.00 42.28 ? 18   DA  E "O4'" 1 
ATOM   3294 C  "C3'" . DA  D 4 18  ? 2.028  15.022  32.508  1.00 49.12 ? 18   DA  E "C3'" 1 
ATOM   3295 O  "O3'" . DA  D 4 18  ? 0.636  15.203  32.704  1.00 45.73 ? 18   DA  E "O3'" 1 
ATOM   3296 C  "C2'" . DA  D 4 18  ? 2.553  14.273  33.721  1.00 45.10 ? 18   DA  E "C2'" 1 
ATOM   3297 C  "C1'" . DA  D 4 18  ? 2.859  12.869  33.212  1.00 42.76 ? 18   DA  E "C1'" 1 
ATOM   3298 N  N9    . DA  D 4 18  ? 4.226  12.588  33.683  1.00 37.01 ? 18   DA  E N9    1 
ATOM   3299 C  C8    . DA  D 4 18  ? 5.413  13.130  33.244  1.00 36.96 ? 18   DA  E C8    1 
ATOM   3300 N  N7    . DA  D 4 18  ? 6.456  12.638  33.904  1.00 32.69 ? 18   DA  E N7    1 
ATOM   3301 C  C5    . DA  D 4 18  ? 5.907  11.791  34.862  1.00 33.18 ? 18   DA  E C5    1 
ATOM   3302 C  C6    . DA  D 4 18  ? 6.441  10.965  35.876  1.00 36.92 ? 18   DA  E C6    1 
ATOM   3303 N  N6    . DA  D 4 18  ? 7.761  10.871  36.128  1.00 32.24 ? 18   DA  E N6    1 
ATOM   3304 N  N1    . DA  D 4 18  ? 5.581  10.256  36.652  1.00 37.32 ? 18   DA  E N1    1 
ATOM   3305 C  C2    . DA  D 4 18  ? 4.273  10.342  36.379  1.00 39.47 ? 18   DA  E C2    1 
ATOM   3306 N  N3    . DA  D 4 18  ? 3.642  11.065  35.446  1.00 35.99 ? 18   DA  E N3    1 
ATOM   3307 C  C4    . DA  D 4 18  ? 4.526  11.777  34.735  1.00 40.36 ? 18   DA  E C4    1 
ATOM   3308 P  P     . DG  D 4 19  ? 0.160  16.329  33.746  1.00 50.20 ? 19   DG  E P     1 
ATOM   3309 O  OP1   . DG  D 4 19  ? -1.257 16.478  33.352  1.00 49.37 ? 19   DG  E OP1   1 
ATOM   3310 O  OP2   . DG  D 4 19  ? 1.061  17.478  33.775  1.00 48.25 ? 19   DG  E OP2   1 
ATOM   3311 O  "O5'" . DG  D 4 19  ? 0.215  15.744  35.219  1.00 45.82 ? 19   DG  E "O5'" 1 
ATOM   3312 C  "C5'" . DG  D 4 19  ? -0.571 14.616  35.530  1.00 52.38 ? 19   DG  E "C5'" 1 
ATOM   3313 C  "C4'" . DG  D 4 19  ? -0.156 14.142  36.916  1.00 55.37 ? 19   DG  E "C4'" 1 
ATOM   3314 O  "O4'" . DG  D 4 19  ? 1.256  13.905  36.769  1.00 53.14 ? 19   DG  E "O4'" 1 
ATOM   3315 C  "C3'" . DG  D 4 19  ? -0.205 15.170  38.045  1.00 57.21 ? 19   DG  E "C3'" 1 
ATOM   3316 O  "O3'" . DG  D 4 19  ? -1.174 14.785  39.025  1.00 62.78 ? 19   DG  E "O3'" 1 
ATOM   3317 C  "C2'" . DG  D 4 19  ? 1.188  15.118  38.666  1.00 52.87 ? 19   DG  E "C2'" 1 
ATOM   3318 C  "C1'" . DG  D 4 19  ? 1.746  13.821  38.068  1.00 52.74 ? 19   DG  E "C1'" 1 
ATOM   3319 N  N9    . DG  D 4 19  ? 3.194  13.808  37.935  1.00 49.12 ? 19   DG  E N9    1 
ATOM   3320 C  C8    . DG  D 4 19  ? 3.972  14.523  37.047  1.00 46.83 ? 19   DG  E C8    1 
ATOM   3321 N  N7    . DG  D 4 19  ? 5.249  14.295  37.231  1.00 49.96 ? 19   DG  E N7    1 
ATOM   3322 C  C5    . DG  D 4 19  ? 5.311  13.372  38.282  1.00 46.51 ? 19   DG  E C5    1 
ATOM   3323 C  C6    . DG  D 4 19  ? 6.409  12.745  38.937  1.00 46.66 ? 19   DG  E C6    1 
ATOM   3324 O  O6    . DG  D 4 19  ? 7.598  12.905  38.685  1.00 50.68 ? 19   DG  E O6    1 
ATOM   3325 N  N1    . DG  D 4 19  ? 6.038  11.871  39.979  1.00 47.60 ? 19   DG  E N1    1 
ATOM   3326 C  C2    . DG  D 4 19  ? 4.716  11.658  40.339  1.00 50.03 ? 19   DG  E C2    1 
ATOM   3327 N  N2    . DG  D 4 19  ? 4.474  10.796  41.357  1.00 52.48 ? 19   DG  E N2    1 
ATOM   3328 N  N3    . DG  D 4 19  ? 3.675  12.235  39.725  1.00 45.65 ? 19   DG  E N3    1 
ATOM   3329 C  C4    . DG  D 4 19  ? 4.043  13.076  38.729  1.00 42.86 ? 19   DG  E C4    1 
ATOM   3330 P  P     . DG  D 4 20  ? -1.547 15.805  40.211  1.00 62.59 ? 20   DG  E P     1 
ATOM   3331 O  OP1   . DG  D 4 20  ? -3.016 15.679  40.386  1.00 58.43 ? 20   DG  E OP1   1 
ATOM   3332 O  OP2   . DG  D 4 20  ? -0.987 17.157  39.966  1.00 56.80 ? 20   DG  E OP2   1 
ATOM   3333 O  "O5'" . DG  D 4 20  ? -0.687 15.260  41.440  1.00 58.23 ? 20   DG  E "O5'" 1 
ATOM   3334 C  "C5'" . DG  D 4 20  ? -0.384 13.887  41.552  1.00 56.54 ? 20   DG  E "C5'" 1 
ATOM   3335 C  "C4'" . DG  D 4 20  ? 0.541  13.655  42.737  1.00 57.96 ? 20   DG  E "C4'" 1 
ATOM   3336 O  "O4'" . DG  D 4 20  ? 1.911  13.490  42.296  1.00 54.79 ? 20   DG  E "O4'" 1 
ATOM   3337 C  "C3'" . DG  D 4 20  ? 0.541  14.690  43.862  1.00 59.10 ? 20   DG  E "C3'" 1 
ATOM   3338 O  "O3'" . DG  D 4 20  ? 0.239  13.994  45.079  1.00 62.88 ? 20   DG  E "O3'" 1 
ATOM   3339 C  "C2'" . DG  D 4 20  ? 1.954  15.279  43.824  1.00 55.30 ? 20   DG  E "C2'" 1 
ATOM   3340 C  "C1'" . DG  D 4 20  ? 2.788  14.175  43.180  1.00 48.13 ? 20   DG  E "C1'" 1 
ATOM   3341 N  N9    . DG  D 4 20  ? 3.932  14.630  42.378  1.00 40.39 ? 20   DG  E N9    1 
ATOM   3342 C  C8    . DG  D 4 20  ? 3.962  15.494  41.296  1.00 40.77 ? 20   DG  E C8    1 
ATOM   3343 N  N7    . DG  D 4 20  ? 5.179  15.662  40.822  1.00 41.89 ? 20   DG  E N7    1 
ATOM   3344 C  C5    . DG  D 4 20  ? 6.004  14.854  41.613  1.00 36.40 ? 20   DG  E C5    1 
ATOM   3345 C  C6    . DG  D 4 20  ? 7.427  14.628  41.602  1.00 45.12 ? 20   DG  E C6    1 
ATOM   3346 O  O6    . DG  D 4 20  ? 8.346  15.078  40.864  1.00 44.98 ? 20   DG  E O6    1 
ATOM   3347 N  N1    . DG  D 4 20  ? 7.832  13.762  42.627  1.00 38.89 ? 20   DG  E N1    1 
ATOM   3348 C  C2    . DG  D 4 20  ? 6.975  13.181  43.523  1.00 43.17 ? 20   DG  E C2    1 
ATOM   3349 N  N2    . DG  D 4 20  ? 7.615  12.426  44.403  1.00 34.57 ? 20   DG  E N2    1 
ATOM   3350 N  N3    . DG  D 4 20  ? 5.640  13.371  43.558  1.00 43.15 ? 20   DG  E N3    1 
ATOM   3351 C  C4    . DG  D 4 20  ? 5.235  14.224  42.573  1.00 36.49 ? 20   DG  E C4    1 
ATOM   3352 P  P     . DC  D 4 21  ? 0.267  14.629  46.566  1.00 63.16 ? 21   DC  E P     1 
ATOM   3353 O  OP1   . DC  D 4 21  ? -0.684 13.794  47.343  1.00 63.07 ? 21   DC  E OP1   1 
ATOM   3354 O  OP2   . DC  D 4 21  ? 0.169  16.101  46.501  1.00 59.43 ? 21   DC  E OP2   1 
ATOM   3355 O  "O5'" . DC  D 4 21  ? 1.720  14.308  47.133  1.00 56.54 ? 21   DC  E "O5'" 1 
ATOM   3356 C  "C5'" . DC  D 4 21  ? 2.012  12.952  47.347  1.00 56.04 ? 21   DC  E "C5'" 1 
ATOM   3357 C  "C4'" . DC  D 4 21  ? 3.275  12.865  48.178  1.00 55.45 ? 21   DC  E "C4'" 1 
ATOM   3358 O  "O4'" . DC  D 4 21  ? 4.355  13.310  47.339  1.00 53.24 ? 21   DC  E "O4'" 1 
ATOM   3359 C  "C3'" . DC  D 4 21  ? 3.348  13.765  49.401  1.00 55.20 ? 21   DC  E "C3'" 1 
ATOM   3360 O  "O3'" . DC  D 4 21  ? 4.034  12.977  50.332  1.00 56.63 ? 21   DC  E "O3'" 1 
ATOM   3361 C  "C2'" . DC  D 4 21  ? 4.223  14.949  48.988  1.00 50.09 ? 21   DC  E "C2'" 1 
ATOM   3362 C  "C1'" . DC  D 4 21  ? 5.147  14.283  47.980  1.00 45.92 ? 21   DC  E "C1'" 1 
ATOM   3363 N  N1    . DC  D 4 21  ? 5.618  15.136  46.873  1.00 38.90 ? 21   DC  E N1    1 
ATOM   3364 C  C2    . DC  D 4 21  ? 6.976  15.192  46.550  1.00 37.86 ? 21   DC  E C2    1 
ATOM   3365 O  O2    . DC  D 4 21  ? 7.761  14.519  47.221  1.00 37.69 ? 21   DC  E O2    1 
ATOM   3366 N  N3    . DC  D 4 21  ? 7.391  15.987  45.521  1.00 34.33 ? 21   DC  E N3    1 
ATOM   3367 C  C4    . DC  D 4 21  ? 6.512  16.685  44.811  1.00 37.00 ? 21   DC  E C4    1 
ATOM   3368 N  N4    . DC  D 4 21  ? 6.946  17.451  43.804  1.00 32.83 ? 21   DC  E N4    1 
ATOM   3369 C  C5    . DC  D 4 21  ? 5.122  16.644  45.122  1.00 36.69 ? 21   DC  E C5    1 
ATOM   3370 C  C6    . DC  D 4 21  ? 4.724  15.860  46.144  1.00 38.04 ? 21   DC  E C6    1 
ATOM   3371 P  P     . DA  D 4 22  ? 4.004  13.386  51.862  1.00 56.75 ? 22   DA  E P     1 
ATOM   3372 O  OP1   . DA  D 4 22  ? 3.946  12.078  52.568  1.00 54.92 ? 22   DA  E OP1   1 
ATOM   3373 O  OP2   . DA  D 4 22  ? 3.011  14.454  52.035  1.00 55.72 ? 22   DA  E OP2   1 
ATOM   3374 O  "O5'" . DA  D 4 22  ? 5.424  14.049  52.167  1.00 54.65 ? 22   DA  E "O5'" 1 
ATOM   3375 C  "C5'" . DA  D 4 22  ? 6.585  13.263  51.987  1.00 54.18 ? 22   DA  E "C5'" 1 
ATOM   3376 C  "C4'" . DA  D 4 22  ? 7.819  14.123  52.207  1.00 55.09 ? 22   DA  E "C4'" 1 
ATOM   3377 O  "O4'" . DA  D 4 22  ? 8.142  14.830  50.975  1.00 52.63 ? 22   DA  E "O4'" 1 
ATOM   3378 C  "C3'" . DA  D 4 22  ? 7.639  15.216  53.263  1.00 49.89 ? 22   DA  E "C3'" 1 
ATOM   3379 O  "O3'" . DA  D 4 22  ? 8.891  15.524  53.786  1.00 56.30 ? 22   DA  E "O3'" 1 
ATOM   3380 C  "C2'" . DA  D 4 22  ? 7.231  16.439  52.454  1.00 50.17 ? 22   DA  E "C2'" 1 
ATOM   3381 C  "C1'" . DA  D 4 22  ? 8.150  16.204  51.263  1.00 46.59 ? 22   DA  E "C1'" 1 
ATOM   3382 N  N9    . DA  D 4 22  ? 7.711  17.006  50.154  1.00 44.81 ? 22   DA  E N9    1 
ATOM   3383 C  C8    . DA  D 4 22  ? 6.475  17.542  49.918  1.00 48.61 ? 22   DA  E C8    1 
ATOM   3384 N  N7    . DA  D 4 22  ? 6.377  18.275  48.835  1.00 46.32 ? 22   DA  E N7    1 
ATOM   3385 C  C5    . DA  D 4 22  ? 7.680  18.202  48.368  1.00 45.21 ? 22   DA  E C5    1 
ATOM   3386 C  C6    . DA  D 4 22  ? 8.262  18.776  47.256  1.00 40.66 ? 22   DA  E C6    1 
ATOM   3387 N  N6    . DA  D 4 22  ? 7.547  19.533  46.412  1.00 40.60 ? 22   DA  E N6    1 
ATOM   3388 N  N1    . DA  D 4 22  ? 9.575  18.494  47.059  1.00 51.90 ? 22   DA  E N1    1 
ATOM   3389 C  C2    . DA  D 4 22  ? 10.248 17.717  47.923  1.00 48.82 ? 22   DA  E C2    1 
ATOM   3390 N  N3    . DA  D 4 22  ? 9.811  17.109  49.022  1.00 38.36 ? 22   DA  E N3    1 
ATOM   3391 C  C4    . DA  D 4 22  ? 8.520  17.430  49.158  1.00 44.57 ? 22   DA  E C4    1 
ATOM   3392 P  P     . DG  D 4 23  ? 9.226  15.186  55.297  1.00 54.06 ? 23   DG  E P     1 
ATOM   3393 O  OP1   . DG  D 4 23  ? 8.911  13.738  55.382  1.00 58.80 ? 23   DG  E OP1   1 
ATOM   3394 O  OP2   . DG  D 4 23  ? 8.583  16.254  56.113  1.00 56.16 ? 23   DG  E OP2   1 
ATOM   3395 O  "O5'" . DG  D 4 23  ? 10.808 15.372  55.358  1.00 53.36 ? 23   DG  E "O5'" 1 
ATOM   3396 C  "C5'" . DG  D 4 23  ? 11.627 14.491  54.615  1.00 47.77 ? 23   DG  E "C5'" 1 
ATOM   3397 C  "C4'" . DG  D 4 23  ? 12.741 15.278  53.972  1.00 46.98 ? 23   DG  E "C4'" 1 
ATOM   3398 O  "O4'" . DG  D 4 23  ? 12.212 16.209  52.987  1.00 44.50 ? 23   DG  E "O4'" 1 
ATOM   3399 C  "C3'" . DG  D 4 23  ? 13.464 16.128  54.996  1.00 47.96 ? 23   DG  E "C3'" 1 
ATOM   3400 O  "O3'" . DG  D 4 23  ? 14.855 16.044  54.731  1.00 55.56 ? 23   DG  E "O3'" 1 
ATOM   3401 C  "C2'" . DG  D 4 23  ? 12.851 17.515  54.814  1.00 44.70 ? 23   DG  E "C2'" 1 
ATOM   3402 C  "C1'" . DG  D 4 23  ? 12.581 17.536  53.314  1.00 44.08 ? 23   DG  E "C1'" 1 
ATOM   3403 N  N9    . DG  D 4 23  ? 11.500 18.353  52.765  1.00 40.99 ? 23   DG  E N9    1 
ATOM   3404 C  C8    . DG  D 4 23  ? 10.230 18.533  53.256  1.00 44.36 ? 23   DG  E C8    1 
ATOM   3405 N  N7    . DG  D 4 23  ? 9.485  19.274  52.478  1.00 45.94 ? 23   DG  E N7    1 
ATOM   3406 C  C5    . DG  D 4 23  ? 10.311 19.600  51.403  1.00 39.68 ? 23   DG  E C5    1 
ATOM   3407 C  C6    . DG  D 4 23  ? 10.064 20.382  50.250  1.00 38.81 ? 23   DG  E C6    1 
ATOM   3408 O  O6    . DG  D 4 23  ? 9.024  20.966  49.943  1.00 44.25 ? 23   DG  E O6    1 
ATOM   3409 N  N1    . DG  D 4 23  ? 11.153 20.492  49.395  1.00 38.51 ? 23   DG  E N1    1 
ATOM   3410 C  C2    . DG  D 4 23  ? 12.338 19.871  49.667  1.00 38.28 ? 23   DG  E C2    1 
ATOM   3411 N  N2    . DG  D 4 23  ? 13.304 20.041  48.767  1.00 49.71 ? 23   DG  E N2    1 
ATOM   3412 N  N3    . DG  D 4 23  ? 12.607 19.128  50.726  1.00 39.53 ? 23   DG  E N3    1 
ATOM   3413 C  C4    . DG  D 4 23  ? 11.540 19.027  51.560  1.00 41.27 ? 23   DG  E C4    1 
ATOM   3414 P  P     . DA  D 4 24  ? 15.926 16.668  55.750  1.00 58.10 ? 24   DA  E P     1 
ATOM   3415 O  OP1   . DA  D 4 24  ? 17.009 15.658  55.854  1.00 59.84 ? 24   DA  E OP1   1 
ATOM   3416 O  OP2   . DA  D 4 24  ? 15.182 17.187  56.929  1.00 54.89 ? 24   DA  E OP2   1 
ATOM   3417 O  "O5'" . DA  D 4 24  ? 16.485 17.913  54.920  1.00 56.86 ? 24   DA  E "O5'" 1 
ATOM   3418 C  "C5'" . DA  D 4 24  ? 17.161 17.755  53.670  1.00 55.60 ? 24   DA  E "C5'" 1 
ATOM   3419 C  "C4'" . DA  D 4 24  ? 17.168 19.119  52.995  1.00 55.06 ? 24   DA  E "C4'" 1 
ATOM   3420 O  "O4'" . DA  D 4 24  ? 15.782 19.540  52.844  1.00 50.01 ? 24   DA  E "O4'" 1 
ATOM   3421 C  "C3'" . DA  D 4 24  ? 17.853 20.252  53.777  1.00 55.76 ? 24   DA  E "C3'" 1 
ATOM   3422 O  "O3'" . DA  D 4 24  ? 18.782 20.961  52.918  1.00 59.37 ? 24   DA  E "O3'" 1 
ATOM   3423 C  "C2'" . DA  D 4 24  ? 16.697 21.147  54.250  1.00 49.89 ? 24   DA  E "C2'" 1 
ATOM   3424 C  "C1'" . DA  D 4 24  ? 15.712 20.941  53.105  1.00 45.40 ? 24   DA  E "C1'" 1 
ATOM   3425 N  N9    . DA  D 4 24  ? 14.306 21.323  53.322  1.00 40.60 ? 24   DA  E N9    1 
ATOM   3426 C  C8    . DA  D 4 24  ? 13.509 21.046  54.390  1.00 39.76 ? 24   DA  E C8    1 
ATOM   3427 N  N7    . DA  D 4 24  ? 12.289 21.528  54.276  1.00 44.60 ? 24   DA  E N7    1 
ATOM   3428 C  C5    . DA  D 4 24  ? 12.264 22.101  53.022  1.00 40.19 ? 24   DA  E C5    1 
ATOM   3429 C  C6    . DA  D 4 24  ? 11.263 22.767  52.305  1.00 38.06 ? 24   DA  E C6    1 
ATOM   3430 N  N6    . DA  D 4 24  ? 10.021 22.979  52.748  1.00 37.18 ? 24   DA  E N6    1 
ATOM   3431 N  N1    . DA  D 4 24  ? 11.602 23.249  51.108  1.00 38.46 ? 24   DA  E N1    1 
ATOM   3432 C  C2    . DA  D 4 24  ? 12.843 23.067  50.656  1.00 37.03 ? 24   DA  E C2    1 
ATOM   3433 N  N3    . DA  D 4 24  ? 13.858 22.442  51.222  1.00 36.82 ? 24   DA  E N3    1 
ATOM   3434 C  C4    . DA  D 4 24  ? 13.493 21.972  52.423  1.00 38.18 ? 24   DA  E C4    1 
HETATM 3435 CA CA    . CA  E 5 .   ? 16.631 2.525   20.705  1.00 25.22 ? 1154 CA  A CA    1 
HETATM 3436 CA CA    . CA  F 5 .   ? 17.397 -3.345  24.348  1.00 25.24 ? 1155 CA  A CA    1 
HETATM 3437 O  O     . HOH G 6 .   ? 42.528 -12.144 9.431   1.00 62.62 ? 1001 HOH A O     1 
HETATM 3438 O  O     . HOH G 6 .   ? 34.904 2.047   11.222  1.00 62.31 ? 1002 HOH A O     1 
HETATM 3439 O  O     . HOH G 6 .   ? 43.442 0.189   19.480  1.00 45.57 ? 1003 HOH A O     1 
HETATM 3440 O  O     . HOH G 6 .   ? 38.147 -0.708  9.234   1.00 62.42 ? 1004 HOH A O     1 
HETATM 3441 O  O     . HOH G 6 .   ? 44.878 -6.153  14.979  1.00 56.13 ? 1005 HOH A O     1 
HETATM 3442 O  O     . HOH G 6 .   ? 33.399 -8.257  8.113   1.00 43.84 ? 1006 HOH A O     1 
HETATM 3443 O  O     . HOH G 6 .   ? 36.776 0.490   11.594  1.00 41.20 ? 1007 HOH A O     1 
HETATM 3444 O  O     . HOH G 6 .   ? 40.222 3.612   18.037  1.00 49.84 ? 1008 HOH A O     1 
HETATM 3445 O  O     . HOH G 6 .   ? 41.975 0.133   17.204  1.00 45.03 ? 1009 HOH A O     1 
HETATM 3446 O  O     . HOH G 6 .   ? 43.714 -2.059  21.246  1.00 47.74 ? 1010 HOH A O     1 
HETATM 3447 O  O     . HOH G 6 .   ? 33.011 5.522   18.342  1.00 45.95 ? 1011 HOH A O     1 
HETATM 3448 O  O     . HOH G 6 .   ? 7.405  -30.563 11.509  1.00 61.81 ? 1012 HOH A O     1 
HETATM 3449 O  O     . HOH G 6 .   ? 19.014 -4.818  25.441  1.00 22.05 ? 1013 HOH A O     1 
HETATM 3450 O  O     . HOH G 6 .   ? 18.185 -21.268 29.591  1.00 58.15 ? 1014 HOH A O     1 
HETATM 3451 O  O     . HOH G 6 .   ? 14.425 -14.638 9.283   1.00 47.72 ? 1015 HOH A O     1 
HETATM 3452 O  O     . HOH G 6 .   ? 9.709  -22.179 5.466   1.00 54.78 ? 1016 HOH A O     1 
HETATM 3453 O  O     . HOH G 6 .   ? 9.151  -34.724 5.844   1.00 57.93 ? 1017 HOH A O     1 
HETATM 3454 O  O     . HOH G 6 .   ? 10.665 -31.578 -1.866  1.00 58.24 ? 1018 HOH A O     1 
HETATM 3455 O  O     . HOH G 6 .   ? 21.254 -38.049 3.742   1.00 60.68 ? 1019 HOH A O     1 
HETATM 3456 O  O     . HOH G 6 .   ? 10.309 -30.015 7.344   1.00 53.40 ? 1020 HOH A O     1 
HETATM 3457 O  O     . HOH G 6 .   ? 20.256 -29.137 5.674   1.00 59.75 ? 1021 HOH A O     1 
HETATM 3458 O  O     . HOH G 6 .   ? 9.413  -29.170 10.000  1.00 61.72 ? 1022 HOH A O     1 
HETATM 3459 O  O     . HOH G 6 .   ? 29.649 -21.083 22.721  1.00 54.36 ? 1023 HOH A O     1 
HETATM 3460 O  O     . HOH G 6 .   ? 21.630 -25.301 6.932   1.00 38.76 ? 1024 HOH A O     1 
HETATM 3461 O  O     . HOH G 6 .   ? 22.509 -17.554 7.658   1.00 45.79 ? 1025 HOH A O     1 
HETATM 3462 O  O     . HOH G 6 .   ? 18.213 -15.790 11.538  1.00 32.52 ? 1026 HOH A O     1 
HETATM 3463 O  O     . HOH G 6 .   ? 15.101 -10.995 11.424  1.00 45.48 ? 1027 HOH A O     1 
HETATM 3464 O  O     . HOH G 6 .   ? 16.949 -5.788  16.663  1.00 26.76 ? 1028 HOH A O     1 
HETATM 3465 O  O     . HOH G 6 .   ? 17.604 -30.752 23.632  1.00 45.26 ? 1029 HOH A O     1 
HETATM 3466 O  O     . HOH G 6 .   ? 19.970 -19.633 28.699  1.00 50.53 ? 1030 HOH A O     1 
HETATM 3467 O  O     . HOH G 6 .   ? 7.246  9.277   14.136  1.00 51.81 ? 1031 HOH A O     1 
HETATM 3468 O  O     . HOH G 6 .   ? 17.506 8.807   7.994   1.00 43.35 ? 1032 HOH A O     1 
HETATM 3469 O  O     . HOH G 6 .   ? 10.401 7.260   11.232  1.00 37.70 ? 1033 HOH A O     1 
HETATM 3470 O  O     . HOH G 6 .   ? 14.209 9.555   1.607   1.00 65.48 ? 1034 HOH A O     1 
HETATM 3471 O  O     . HOH G 6 .   ? 17.822 11.583  12.774  1.00 36.71 ? 1035 HOH A O     1 
HETATM 3472 O  O     . HOH G 6 .   ? 21.923 1.407   2.461   1.00 43.93 ? 1036 HOH A O     1 
HETATM 3473 O  O     . HOH G 6 .   ? 18.070 2.300   3.445   1.00 38.59 ? 1037 HOH A O     1 
HETATM 3474 O  O     . HOH G 6 .   ? 34.969 -1.552  6.128   1.00 61.30 ? 1038 HOH A O     1 
HETATM 3475 O  O     . HOH G 6 .   ? 28.422 -6.443  -0.145  1.00 61.36 ? 1039 HOH A O     1 
HETATM 3476 O  O     . HOH G 6 .   ? 24.175 -2.607  1.298   1.00 39.69 ? 1040 HOH A O     1 
HETATM 3477 O  O     . HOH G 6 .   ? 19.902 -11.534 4.107   1.00 46.28 ? 1041 HOH A O     1 
HETATM 3478 O  O     . HOH G 6 .   ? 21.586 -1.212  1.942   1.00 35.97 ? 1042 HOH A O     1 
HETATM 3479 O  O     . HOH G 6 .   ? 15.729 -3.764  1.108   1.00 60.95 ? 1043 HOH A O     1 
HETATM 3480 O  O     . HOH G 6 .   ? 14.006 -1.103  1.653   1.00 51.59 ? 1044 HOH A O     1 
HETATM 3481 O  O     . HOH G 6 .   ? 13.825 4.523   3.455   1.00 44.31 ? 1045 HOH A O     1 
HETATM 3482 O  O     . HOH G 6 .   ? 8.489  5.567   11.995  1.00 37.71 ? 1046 HOH A O     1 
HETATM 3483 O  O     . HOH G 6 .   ? 8.736  3.358   14.753  1.00 30.59 ? 1047 HOH A O     1 
HETATM 3484 O  O     . HOH G 6 .   ? 26.012 -9.286  2.793   1.00 63.38 ? 1048 HOH A O     1 
HETATM 3485 O  O     . HOH G 6 .   ? 35.968 -16.851 15.672  1.00 49.10 ? 1049 HOH A O     1 
HETATM 3486 O  O     . HOH G 6 .   ? 39.429 -6.146  15.552  1.00 45.99 ? 1050 HOH A O     1 
HETATM 3487 O  O     . HOH G 6 .   ? 32.849 -7.774  27.185  1.00 43.00 ? 1051 HOH A O     1 
HETATM 3488 O  O     . HOH G 6 .   ? 35.671 -10.239 26.549  1.00 67.83 ? 1052 HOH A O     1 
HETATM 3489 O  O     . HOH G 6 .   ? 32.923 -3.995  26.424  1.00 45.27 ? 1053 HOH A O     1 
HETATM 3490 O  O     . HOH G 6 .   ? 28.631 -9.564  30.649  1.00 47.24 ? 1054 HOH A O     1 
HETATM 3491 O  O     . HOH G 6 .   ? 21.626 -11.027 27.779  1.00 43.46 ? 1055 HOH A O     1 
HETATM 3492 O  O     . HOH G 6 .   ? 18.395 -7.442  24.296  1.00 36.50 ? 1056 HOH A O     1 
HETATM 3493 O  O     . HOH G 6 .   ? 29.905 -14.553 27.868  1.00 55.47 ? 1057 HOH A O     1 
HETATM 3494 O  O     . HOH G 6 .   ? 23.687 -19.782 29.783  1.00 54.45 ? 1058 HOH A O     1 
HETATM 3495 O  O     . HOH G 6 .   ? 28.313 -18.869 24.305  1.00 44.01 ? 1059 HOH A O     1 
HETATM 3496 O  O     . HOH G 6 .   ? 19.741 -11.345 25.349  1.00 52.41 ? 1060 HOH A O     1 
HETATM 3497 O  O     . HOH G 6 .   ? 32.967 -19.543 19.644  1.00 46.09 ? 1061 HOH A O     1 
HETATM 3498 O  O     . HOH G 6 .   ? 30.494 -17.941 25.381  1.00 48.54 ? 1062 HOH A O     1 
HETATM 3499 O  O     . HOH G 6 .   ? 34.718 -16.866 20.196  1.00 56.82 ? 1063 HOH A O     1 
HETATM 3500 O  O     . HOH G 6 .   ? 29.395 -23.153 23.950  1.00 56.37 ? 1064 HOH A O     1 
HETATM 3501 O  O     . HOH G 6 .   ? 27.314 -24.634 23.752  1.00 64.30 ? 1065 HOH A O     1 
HETATM 3502 O  O     . HOH G 6 .   ? 31.585 -25.076 22.900  1.00 62.01 ? 1066 HOH A O     1 
HETATM 3503 O  O     . HOH G 6 .   ? 32.421 -25.428 16.464  1.00 54.45 ? 1067 HOH A O     1 
HETATM 3504 O  O     . HOH G 6 .   ? 29.516 -39.876 6.247   1.00 71.22 ? 1068 HOH A O     1 
HETATM 3505 O  O     . HOH G 6 .   ? 15.271 -22.789 23.538  1.00 45.00 ? 1069 HOH A O     1 
HETATM 3506 O  O     . HOH G 6 .   ? 17.969 -27.750 23.352  1.00 50.33 ? 1070 HOH A O     1 
HETATM 3507 O  O     . HOH G 6 .   ? 21.219 -20.863 26.684  1.00 43.73 ? 1071 HOH A O     1 
HETATM 3508 O  O     . HOH G 6 .   ? 14.062 -17.053 25.572  1.00 33.15 ? 1072 HOH A O     1 
HETATM 3509 O  O     . HOH G 6 .   ? 16.574 -15.808 29.177  1.00 56.19 ? 1073 HOH A O     1 
HETATM 3510 O  O     . HOH G 6 .   ? 20.116 -13.676 28.217  1.00 46.22 ? 1074 HOH A O     1 
HETATM 3511 O  O     . HOH G 6 .   ? 15.260 -15.726 27.221  1.00 29.37 ? 1075 HOH A O     1 
HETATM 3512 O  O     . HOH G 6 .   ? 14.723 -7.801  23.796  1.00 30.81 ? 1076 HOH A O     1 
HETATM 3513 O  O     . HOH G 6 .   ? 11.165 -14.351 26.385  1.00 38.57 ? 1077 HOH A O     1 
HETATM 3514 O  O     . HOH G 6 .   ? 12.240 -19.953 23.075  1.00 50.84 ? 1078 HOH A O     1 
HETATM 3515 O  O     . HOH G 6 .   ? 9.464  -18.134 21.923  1.00 38.58 ? 1079 HOH A O     1 
HETATM 3516 O  O     . HOH G 6 .   ? 10.683 -14.607 19.325  1.00 34.22 ? 1080 HOH A O     1 
HETATM 3517 O  O     . HOH G 6 .   ? 9.633  -12.612 18.494  1.00 43.48 ? 1081 HOH A O     1 
HETATM 3518 O  O     . HOH G 6 .   ? 5.564  -18.132 15.593  1.00 41.55 ? 1082 HOH A O     1 
HETATM 3519 O  O     . HOH G 6 .   ? 13.643 -21.737 14.592  1.00 34.27 ? 1083 HOH A O     1 
HETATM 3520 O  O     . HOH G 6 .   ? 7.756  -26.071 12.393  1.00 52.36 ? 1084 HOH A O     1 
HETATM 3521 O  O     . HOH G 6 .   ? 12.645 -35.956 24.425  1.00 51.48 ? 1085 HOH A O     1 
HETATM 3522 O  O     . HOH G 6 .   ? 9.968  -32.673 23.030  1.00 73.22 ? 1086 HOH A O     1 
HETATM 3523 O  O     . HOH G 6 .   ? 8.114  -32.060 13.744  1.00 59.79 ? 1087 HOH A O     1 
HETATM 3524 O  O     . HOH G 6 .   ? 11.370 -33.786 9.589   1.00 61.63 ? 1088 HOH A O     1 
HETATM 3525 O  O     . HOH G 6 .   ? 8.842  -39.332 10.836  1.00 66.94 ? 1089 HOH A O     1 
HETATM 3526 O  O     . HOH H 6 .   ? 29.834 15.490  40.574  1.00 49.79 ? 1001 HOH B O     1 
HETATM 3527 O  O     . HOH H 6 .   ? 30.649 9.331   41.453  1.00 53.46 ? 1002 HOH B O     1 
HETATM 3528 O  O     . HOH H 6 .   ? 30.062 12.950  40.371  1.00 60.44 ? 1003 HOH B O     1 
HETATM 3529 O  O     . HOH H 6 .   ? 37.552 9.587   39.900  1.00 56.14 ? 1004 HOH B O     1 
HETATM 3530 O  O     . HOH H 6 .   ? 35.948 6.298   37.473  1.00 59.47 ? 1005 HOH B O     1 
HETATM 3531 O  O     . HOH H 6 .   ? 43.068 0.742   29.242  1.00 44.45 ? 1006 HOH B O     1 
HETATM 3532 O  O     . HOH H 6 .   ? 37.603 9.820   30.164  1.00 38.08 ? 1007 HOH B O     1 
HETATM 3533 O  O     . HOH H 6 .   ? 29.242 11.620  37.839  1.00 51.15 ? 1008 HOH B O     1 
HETATM 3534 O  O     . HOH H 6 .   ? 34.920 0.423   34.229  1.00 59.48 ? 1009 HOH B O     1 
HETATM 3535 O  O     . HOH H 6 .   ? 35.613 4.523   34.734  1.00 36.40 ? 1010 HOH B O     1 
HETATM 3536 O  O     . HOH H 6 .   ? 39.284 11.348  23.387  1.00 50.87 ? 1011 HOH B O     1 
HETATM 3537 O  O     . HOH H 6 .   ? 40.184 0.334   29.385  1.00 48.30 ? 1012 HOH B O     1 
HETATM 3538 O  O     . HOH H 6 .   ? 40.181 -2.257  29.090  1.00 62.90 ? 1013 HOH B O     1 
HETATM 3539 O  O     . HOH H 6 .   ? 33.649 -1.093  28.307  1.00 59.53 ? 1014 HOH B O     1 
HETATM 3540 O  O     . HOH H 6 .   ? 17.495 7.054   45.876  1.00 63.54 ? 1015 HOH B O     1 
HETATM 3541 O  O     . HOH H 6 .   ? 17.833 4.316   19.784  1.00 18.81 ? 1016 HOH B O     1 
HETATM 3542 O  O     . HOH H 6 .   ? 12.546 15.871  26.837  1.00 27.10 ? 1017 HOH B O     1 
HETATM 3543 O  O     . HOH H 6 .   ? 13.052 14.668  33.334  1.00 27.13 ? 1018 HOH B O     1 
HETATM 3544 O  O     . HOH H 6 .   ? 20.802 7.160   45.601  1.00 54.85 ? 1019 HOH B O     1 
HETATM 3545 O  O     . HOH H 6 .   ? 24.692 9.443   45.595  1.00 50.84 ? 1020 HOH B O     1 
HETATM 3546 O  O     . HOH H 6 .   ? 2.880  19.191  38.015  1.00 54.24 ? 1021 HOH B O     1 
HETATM 3547 O  O     . HOH H 6 .   ? 5.170  18.996  41.949  1.00 44.00 ? 1022 HOH B O     1 
HETATM 3548 O  O     . HOH H 6 .   ? 35.129 16.691  32.548  1.00 50.62 ? 1023 HOH B O     1 
HETATM 3549 O  O     . HOH H 6 .   ? 3.153  27.382  48.417  1.00 59.36 ? 1024 HOH B O     1 
HETATM 3550 O  O     . HOH H 6 .   ? 10.767 25.743  41.924  1.00 47.47 ? 1025 HOH B O     1 
HETATM 3551 O  O     . HOH H 6 .   ? 10.116 28.881  38.651  1.00 47.14 ? 1026 HOH B O     1 
HETATM 3552 O  O     . HOH H 6 .   ? 1.262  26.471  36.914  1.00 49.19 ? 1027 HOH B O     1 
HETATM 3553 O  O     . HOH H 6 .   ? 0.769  24.916  33.138  1.00 56.46 ? 1028 HOH B O     1 
HETATM 3554 O  O     . HOH H 6 .   ? 29.996 21.063  23.293  1.00 65.11 ? 1029 HOH B O     1 
HETATM 3555 O  O     . HOH H 6 .   ? 30.849 19.775  27.320  1.00 49.60 ? 1030 HOH B O     1 
HETATM 3556 O  O     . HOH H 6 .   ? 24.886 24.096  19.236  1.00 54.42 ? 1031 HOH B O     1 
HETATM 3557 O  O     . HOH H 6 .   ? 13.344 24.579  37.804  1.00 49.27 ? 1032 HOH B O     1 
HETATM 3558 O  O     . HOH H 6 .   ? 16.581 22.071  37.196  1.00 51.00 ? 1033 HOH B O     1 
HETATM 3559 O  O     . HOH H 6 .   ? 15.074 19.572  39.547  1.00 54.11 ? 1034 HOH B O     1 
HETATM 3560 O  O     . HOH H 6 .   ? 16.208 17.555  37.575  1.00 47.04 ? 1035 HOH B O     1 
HETATM 3561 O  O     . HOH H 6 .   ? 11.179 8.599   33.571  1.00 51.36 ? 1036 HOH B O     1 
HETATM 3562 O  O     . HOH H 6 .   ? 15.056 4.635   28.424  1.00 24.00 ? 1037 HOH B O     1 
HETATM 3563 O  O     . HOH H 6 .   ? 15.070 18.971  15.975  1.00 40.70 ? 1038 HOH B O     1 
HETATM 3564 O  O     . HOH H 6 .   ? 13.336 22.069  17.643  1.00 48.37 ? 1039 HOH B O     1 
HETATM 3565 O  O     . HOH H 6 .   ? 17.834 21.338  18.161  1.00 51.77 ? 1040 HOH B O     1 
HETATM 3566 O  O     . HOH H 6 .   ? 15.907 -9.862  38.174  1.00 42.72 ? 1041 HOH B O     1 
HETATM 3567 O  O     . HOH H 6 .   ? 7.494  16.274  18.975  1.00 47.98 ? 1042 HOH B O     1 
HETATM 3568 O  O     . HOH H 6 .   ? 18.701 -11.845 29.673  1.00 38.74 ? 1043 HOH B O     1 
HETATM 3569 O  O     . HOH H 6 .   ? 19.105 -9.237  37.014  1.00 36.01 ? 1044 HOH B O     1 
HETATM 3570 O  O     . HOH H 6 .   ? 12.121 -9.816  33.484  1.00 40.01 ? 1045 HOH B O     1 
HETATM 3571 O  O     . HOH H 6 .   ? -0.556 11.164  28.005  1.00 50.49 ? 1046 HOH B O     1 
HETATM 3572 O  O     . HOH H 6 .   ? 9.268  28.749  21.015  1.00 55.89 ? 1047 HOH B O     1 
HETATM 3573 O  O     . HOH H 6 .   ? 14.774 -1.616  43.559  1.00 56.29 ? 1048 HOH B O     1 
HETATM 3574 O  O     . HOH H 6 .   ? 21.645 -11.245 31.002  1.00 43.08 ? 1049 HOH B O     1 
HETATM 3575 O  O     . HOH H 6 .   ? 24.682 -1.431  42.385  1.00 52.48 ? 1050 HOH B O     1 
HETATM 3576 O  O     . HOH H 6 .   ? 21.290 -0.931  42.378  1.00 43.32 ? 1051 HOH B O     1 
HETATM 3577 O  O     . HOH H 6 .   ? 27.181 4.083   43.601  1.00 59.10 ? 1052 HOH B O     1 
HETATM 3578 O  O     . HOH H 6 .   ? 30.834 3.179   43.148  1.00 47.41 ? 1053 HOH B O     1 
HETATM 3579 O  O     . HOH H 6 .   ? 27.920 -1.200  31.931  1.00 49.01 ? 1054 HOH B O     1 
HETATM 3580 O  O     . HOH H 6 .   ? 33.590 3.500   35.803  1.00 54.01 ? 1055 HOH B O     1 
HETATM 3581 O  O     . HOH H 6 .   ? 30.638 8.383   43.754  1.00 59.91 ? 1056 HOH B O     1 
HETATM 3582 O  O     . HOH H 6 .   ? 27.056 8.564   45.347  1.00 55.14 ? 1057 HOH B O     1 
HETATM 3583 O  O     . HOH H 6 .   ? 21.780 3.484   44.234  1.00 40.93 ? 1058 HOH B O     1 
HETATM 3584 O  O     . HOH H 6 .   ? 24.520 5.601   43.945  1.00 45.78 ? 1059 HOH B O     1 
HETATM 3585 O  O     . HOH H 6 .   ? 22.693 8.899   43.845  1.00 51.12 ? 1060 HOH B O     1 
HETATM 3586 O  O     . HOH H 6 .   ? 15.534 11.151  40.950  1.00 39.88 ? 1061 HOH B O     1 
HETATM 3587 O  O     . HOH H 6 .   ? 12.653 7.303   40.256  1.00 58.06 ? 1062 HOH B O     1 
HETATM 3588 O  O     . HOH H 6 .   ? 19.892 1.485   43.190  1.00 32.88 ? 1063 HOH B O     1 
HETATM 3589 O  O     . HOH H 6 .   ? 11.653 3.265   46.990  1.00 57.30 ? 1064 HOH B O     1 
HETATM 3590 O  O     . HOH H 6 .   ? 9.535  2.678   39.989  1.00 46.72 ? 1065 HOH B O     1 
HETATM 3591 O  O     . HOH H 6 .   ? 12.363 -0.853  42.835  1.00 52.81 ? 1066 HOH B O     1 
HETATM 3592 O  O     . HOH H 6 .   ? 10.801 3.314   37.688  1.00 54.83 ? 1067 HOH B O     1 
HETATM 3593 O  O     . HOH H 6 .   ? 23.404 18.691  42.561  1.00 34.36 ? 1068 HOH B O     1 
HETATM 3594 O  O     . HOH H 6 .   ? 29.043 18.915  38.126  1.00 45.79 ? 1069 HOH B O     1 
HETATM 3595 O  O     . HOH H 6 .   ? 29.011 12.619  37.922  1.00 53.65 ? 1070 HOH B O     1 
HETATM 3596 O  O     . HOH H 6 .   ? 30.948 19.367  35.052  1.00 54.00 ? 1071 HOH B O     1 
HETATM 3597 O  O     . HOH H 6 .   ? 33.134 17.583  34.452  1.00 58.29 ? 1072 HOH B O     1 
HETATM 3598 O  O     . HOH H 6 .   ? 30.073 20.567  30.302  1.00 44.30 ? 1073 HOH B O     1 
HETATM 3599 O  O     . HOH H 6 .   ? 36.379 12.003  30.947  1.00 37.54 ? 1074 HOH B O     1 
HETATM 3600 O  O     . HOH H 6 .   ? 35.005 12.450  28.070  1.00 37.15 ? 1075 HOH B O     1 
HETATM 3601 O  O     . HOH H 6 .   ? 31.256 7.682   19.471  1.00 39.90 ? 1076 HOH B O     1 
HETATM 3602 O  O     . HOH H 6 .   ? 30.158 11.226  18.586  1.00 38.14 ? 1077 HOH B O     1 
HETATM 3603 O  O     . HOH H 6 .   ? 33.106 5.177   15.945  1.00 64.69 ? 1078 HOH B O     1 
HETATM 3604 O  O     . HOH H 6 .   ? 18.594 10.902  17.343  1.00 43.80 ? 1079 HOH B O     1 
HETATM 3605 O  O     . HOH H 6 .   ? 16.237 6.568   20.668  1.00 36.86 ? 1080 HOH B O     1 
HETATM 3606 O  O     . HOH H 6 .   ? 19.188 20.018  15.582  1.00 48.62 ? 1081 HOH B O     1 
HETATM 3607 O  O     . HOH H 6 .   ? 22.549 14.102  18.395  1.00 41.56 ? 1082 HOH B O     1 
HETATM 3608 O  O     . HOH H 6 .   ? 22.794 20.425  21.073  1.00 37.51 ? 1083 HOH B O     1 
HETATM 3609 O  O     . HOH H 6 .   ? 16.908 10.369  19.532  1.00 57.96 ? 1084 HOH B O     1 
HETATM 3610 O  O     . HOH H 6 .   ? 28.578 20.827  25.754  1.00 56.28 ? 1085 HOH B O     1 
HETATM 3611 O  O     . HOH H 6 .   ? 26.402 22.442  25.858  1.00 46.90 ? 1086 HOH B O     1 
HETATM 3612 O  O     . HOH H 6 .   ? 25.444 19.287  20.018  1.00 50.30 ? 1087 HOH B O     1 
HETATM 3613 O  O     . HOH H 6 .   ? 23.311 23.025  23.020  1.00 45.95 ? 1088 HOH B O     1 
HETATM 3614 O  O     . HOH H 6 .   ? 26.359 28.291  35.596  1.00 54.69 ? 1089 HOH B O     1 
HETATM 3615 O  O     . HOH H 6 .   ? 22.547 31.757  27.737  1.00 61.21 ? 1090 HOH B O     1 
HETATM 3616 O  O     . HOH H 6 .   ? 21.291 33.113  25.366  1.00 59.15 ? 1091 HOH B O     1 
HETATM 3617 O  O     . HOH H 6 .   ? 10.255 26.115  21.243  1.00 41.15 ? 1092 HOH B O     1 
HETATM 3618 O  O     . HOH H 6 .   ? 11.458 22.656  19.284  1.00 44.20 ? 1093 HOH B O     1 
HETATM 3619 O  O     . HOH H 6 .   ? 15.340 20.353  18.293  1.00 40.93 ? 1094 HOH B O     1 
HETATM 3620 O  O     . HOH H 6 .   ? 13.059 26.229  20.318  1.00 46.10 ? 1095 HOH B O     1 
HETATM 3621 O  O     . HOH H 6 .   ? 16.574 13.184  16.709  1.00 36.76 ? 1096 HOH B O     1 
HETATM 3622 O  O     . HOH H 6 .   ? 11.146 13.689  17.542  1.00 29.34 ? 1097 HOH B O     1 
HETATM 3623 O  O     . HOH H 6 .   ? 9.613  14.571  18.866  1.00 30.13 ? 1098 HOH B O     1 
HETATM 3624 O  O     . HOH H 6 .   ? 12.719 5.843   21.061  1.00 27.30 ? 1099 HOH B O     1 
HETATM 3625 O  O     . HOH H 6 .   ? 4.644  14.473  22.278  1.00 33.43 ? 1100 HOH B O     1 
HETATM 3626 O  O     . HOH H 6 .   ? 8.228  11.361  17.868  1.00 45.91 ? 1101 HOH B O     1 
HETATM 3627 O  O     . HOH H 6 .   ? 6.728  11.265  25.056  1.00 27.83 ? 1102 HOH B O     1 
HETATM 3628 O  O     . HOH H 6 .   ? 0.395  13.366  28.301  1.00 51.81 ? 1103 HOH B O     1 
HETATM 3629 O  O     . HOH H 6 .   ? 5.514  18.956  22.211  1.00 45.82 ? 1104 HOH B O     1 
HETATM 3630 O  O     . HOH H 6 .   ? 9.221  18.299  27.937  1.00 34.03 ? 1105 HOH B O     1 
HETATM 3631 O  O     . HOH H 6 .   ? 7.407  19.014  29.649  1.00 31.99 ? 1106 HOH B O     1 
HETATM 3632 O  O     . HOH H 6 .   ? 2.868  18.724  32.086  1.00 51.45 ? 1107 HOH B O     1 
HETATM 3633 O  O     . HOH H 6 .   ? 0.414  21.791  31.432  1.00 46.67 ? 1108 HOH B O     1 
HETATM 3634 O  O     . HOH H 6 .   ? 7.917  29.487  23.217  1.00 52.78 ? 1109 HOH B O     1 
HETATM 3635 O  O     . HOH H 6 .   ? 6.210  36.102  21.472  1.00 61.85 ? 1110 HOH B O     1 
HETATM 3636 O  O     . HOH I 6 .   ? 15.753 31.436  43.559  1.00 61.34 ? 1001 HOH C O     1 
HETATM 3637 O  O     . HOH I 6 .   ? 12.038 28.902  40.019  1.00 57.16 ? 1002 HOH C O     1 
HETATM 3638 O  O     . HOH I 6 .   ? 14.619 26.761  48.001  1.00 40.16 ? 1003 HOH C O     1 
HETATM 3639 O  O     . HOH I 6 .   ? 16.826 25.188  47.937  1.00 59.68 ? 1004 HOH C O     1 
HETATM 3640 O  O     . HOH I 6 .   ? 1.815  -2.500  33.735  1.00 61.83 ? 1005 HOH C O     1 
HETATM 3641 O  O     . HOH I 6 .   ? 15.131 17.433  47.220  1.00 38.84 ? 1006 HOH C O     1 
HETATM 3642 O  O     . HOH I 6 .   ? 16.025 22.007  47.389  1.00 50.84 ? 1007 HOH C O     1 
HETATM 3643 O  O     . HOH I 6 .   ? 11.459 5.525   36.382  1.00 69.24 ? 1008 HOH C O     1 
HETATM 3644 O  O     . HOH I 6 .   ? 19.750 9.506   49.065  1.00 69.75 ? 1009 HOH C O     1 
HETATM 3645 O  O     . HOH I 6 .   ? 10.031 -22.562 -1.365  1.00 55.48 ? 1010 HOH C O     1 
HETATM 3646 O  O     . HOH I 6 .   ? 1.083  -0.421  13.427  1.00 71.77 ? 1011 HOH C O     1 
HETATM 3647 O  O     . HOH I 6 .   ? 13.594 13.547  47.379  1.00 65.10 ? 1012 HOH C O     1 
HETATM 3648 O  O     . HOH I 6 .   ? 3.616  -1.950  29.899  1.00 57.34 ? 1013 HOH C O     1 
HETATM 3649 O  O     . HOH I 6 .   ? 2.037  -0.022  33.005  1.00 58.33 ? 1014 HOH C O     1 
HETATM 3650 O  O     . HOH I 6 .   ? -4.156 0.109   33.056  1.00 60.77 ? 1015 HOH C O     1 
HETATM 3651 O  O     . HOH I 6 .   ? 20.028 11.320  40.847  1.00 29.69 ? 1016 HOH C O     1 
HETATM 3652 O  O     . HOH I 6 .   ? 9.729  11.143  46.966  1.00 41.09 ? 1017 HOH C O     1 
HETATM 3653 O  O     . HOH I 6 .   ? 19.256 11.596  46.901  1.00 55.75 ? 1018 HOH C O     1 
HETATM 3654 O  O     . HOH I 6 .   ? 13.329 15.207  39.061  1.00 55.76 ? 1019 HOH C O     1 
HETATM 3655 O  O     . HOH I 6 .   ? -0.254 -1.345  28.933  1.00 53.53 ? 1020 HOH C O     1 
HETATM 3656 O  O     . HOH I 6 .   ? -0.632 -1.232  23.553  1.00 53.96 ? 1021 HOH C O     1 
HETATM 3657 O  O     . HOH I 6 .   ? 1.512  0.704   15.749  1.00 69.46 ? 1022 HOH C O     1 
HETATM 3658 O  O     . HOH I 6 .   ? 4.803  8.831   16.700  1.00 51.07 ? 1023 HOH C O     1 
HETATM 3659 O  O     . HOH I 6 .   ? 14.220 3.290   43.987  1.00 56.78 ? 1024 HOH C O     1 
HETATM 3660 O  O     . HOH I 6 .   ? 11.117 8.431   37.466  1.00 49.97 ? 1025 HOH C O     1 
HETATM 3661 O  O     . HOH I 6 .   ? 9.539  -21.577 1.274   1.00 53.15 ? 1026 HOH C O     1 
HETATM 3662 O  O     . HOH I 6 .   ? 1.087  9.254   34.426  1.00 39.49 ? 1027 HOH C O     1 
HETATM 3663 O  O     . HOH I 6 .   ? 9.470  4.464   35.632  1.00 46.07 ? 1028 HOH C O     1 
HETATM 3664 O  O     . HOH I 6 .   ? 17.637 -24.023 -13.967 1.00 51.28 ? 1029 HOH C O     1 
HETATM 3665 O  O     . HOH I 6 .   ? -0.017 1.957   33.471  1.00 50.00 ? 1030 HOH C O     1 
HETATM 3666 O  O     . HOH I 6 .   ? 7.123  2.772   34.494  1.00 41.10 ? 1031 HOH C O     1 
HETATM 3667 O  O     . HOH I 6 .   ? -1.666 3.179   28.189  1.00 34.82 ? 1032 HOH C O     1 
HETATM 3668 O  O     . HOH I 6 .   ? -5.029 2.836   29.258  1.00 34.82 ? 1033 HOH C O     1 
HETATM 3669 O  O     . HOH I 6 .   ? -2.111 2.380   31.507  1.00 50.10 ? 1034 HOH C O     1 
HETATM 3670 O  O     . HOH I 6 .   ? 0.928  9.681   29.844  1.00 41.98 ? 1035 HOH C O     1 
HETATM 3671 O  O     . HOH I 6 .   ? 4.273  0.561   31.398  1.00 41.12 ? 1036 HOH C O     1 
HETATM 3672 O  O     . HOH I 6 .   ? 5.027  7.163   24.360  1.00 37.23 ? 1037 HOH C O     1 
HETATM 3673 O  O     . HOH I 6 .   ? -4.167 9.346   30.485  1.00 42.31 ? 1038 HOH C O     1 
HETATM 3674 O  O     . HOH I 6 .   ? -0.872 11.184  24.371  1.00 64.88 ? 1039 HOH C O     1 
HETATM 3675 O  O     . HOH I 6 .   ? -2.712 3.232   26.110  1.00 46.24 ? 1040 HOH C O     1 
HETATM 3676 O  O     . HOH I 6 .   ? 2.362  -0.936  28.049  1.00 36.22 ? 1041 HOH C O     1 
HETATM 3677 O  O     . HOH I 6 .   ? -1.138 2.777   20.276  1.00 45.73 ? 1042 HOH C O     1 
HETATM 3678 O  O     . HOH I 6 .   ? 1.822  -0.103  17.926  1.00 57.08 ? 1043 HOH C O     1 
HETATM 3679 O  O     . HOH I 6 .   ? 1.476  -2.194  24.319  1.00 51.84 ? 1044 HOH C O     1 
HETATM 3680 O  O     . HOH I 6 .   ? 9.626  1.006   21.495  1.00 28.27 ? 1045 HOH C O     1 
HETATM 3681 O  O     . HOH I 6 .   ? 7.319  9.137   17.224  1.00 40.61 ? 1046 HOH C O     1 
HETATM 3682 O  O     . HOH I 6 .   ? 5.284  1.206   15.400  1.00 44.67 ? 1047 HOH C O     1 
HETATM 3683 O  O     . HOH I 6 .   ? 5.555  5.589   14.997  1.00 44.36 ? 1048 HOH C O     1 
HETATM 3684 O  O     . HOH I 6 .   ? 10.278 -3.691  23.068  1.00 45.13 ? 1049 HOH C O     1 
HETATM 3685 O  O     . HOH I 6 .   ? 7.836  -2.299  14.355  1.00 45.46 ? 1050 HOH C O     1 
HETATM 3686 O  O     . HOH I 6 .   ? 16.514 -5.494  23.806  1.00 28.00 ? 1051 HOH C O     1 
HETATM 3687 O  O     . HOH I 6 .   ? 9.827  -4.794  12.084  1.00 54.18 ? 1052 HOH C O     1 
HETATM 3688 O  O     . HOH I 6 .   ? 11.760 -2.474  22.724  1.00 27.97 ? 1053 HOH C O     1 
HETATM 3689 O  O     . HOH I 6 .   ? 11.726 -5.634  21.310  1.00 27.51 ? 1054 HOH C O     1 
HETATM 3690 O  O     . HOH I 6 .   ? 16.048 -0.604  22.510  1.00 14.40 ? 1055 HOH C O     1 
HETATM 3691 O  O     . HOH I 6 .   ? 10.660 -10.005 20.528  1.00 50.55 ? 1056 HOH C O     1 
HETATM 3692 O  O     . HOH I 6 .   ? 12.457 -5.420  13.186  1.00 29.83 ? 1057 HOH C O     1 
HETATM 3693 O  O     . HOH I 6 .   ? 17.900 -9.776  24.838  1.00 41.43 ? 1058 HOH C O     1 
HETATM 3694 O  O     . HOH I 6 .   ? 20.215 -11.025 20.596  1.00 26.50 ? 1059 HOH C O     1 
HETATM 3695 O  O     . HOH I 6 .   ? 7.532  -14.762 13.974  1.00 61.12 ? 1060 HOH C O     1 
HETATM 3696 O  O     . HOH I 6 .   ? 17.586 -17.205 17.936  1.00 26.70 ? 1061 HOH C O     1 
HETATM 3697 O  O     . HOH I 6 .   ? 11.756 -20.883 11.302  1.00 43.37 ? 1062 HOH C O     1 
HETATM 3698 O  O     . HOH I 6 .   ? 4.124  -16.049 11.350  1.00 62.81 ? 1063 HOH C O     1 
HETATM 3699 O  O     . HOH I 6 .   ? 6.299  -24.501 10.431  1.00 50.57 ? 1064 HOH C O     1 
HETATM 3700 O  O     . HOH I 6 .   ? 9.227  -21.315 8.246   1.00 55.02 ? 1065 HOH C O     1 
HETATM 3701 O  O     . HOH I 6 .   ? 4.944  -14.989 5.490   1.00 46.02 ? 1066 HOH C O     1 
HETATM 3702 O  O     . HOH I 6 .   ? 2.114  -17.250 8.986   1.00 57.91 ? 1067 HOH C O     1 
HETATM 3703 O  O     . HOH I 6 .   ? 8.098  -21.935 3.526   1.00 68.17 ? 1068 HOH C O     1 
HETATM 3704 O  O     . HOH I 6 .   ? 12.386 -21.204 1.863   1.00 45.34 ? 1069 HOH C O     1 
HETATM 3705 O  O     . HOH I 6 .   ? 7.967  -19.913 -2.975  1.00 52.20 ? 1070 HOH C O     1 
HETATM 3706 O  O     . HOH I 6 .   ? 21.342 -20.084 -13.610 1.00 58.46 ? 1071 HOH C O     1 
HETATM 3707 O  O     . HOH I 6 .   ? 12.725 -24.112 -5.847  1.00 57.97 ? 1072 HOH C O     1 
HETATM 3708 O  O     . HOH I 6 .   ? 28.425 -21.805 -10.874 1.00 59.88 ? 1073 HOH C O     1 
HETATM 3709 O  O     . HOH I 6 .   ? 16.764 -23.219 -10.644 1.00 63.79 ? 1074 HOH C O     1 
HETATM 3710 O  O     . HOH J 6 .   ? 22.962 -26.791 -4.342  1.00 43.21 ? 1001 HOH E O     1 
HETATM 3711 O  O     . HOH J 6 .   ? 23.083 -21.008 -3.764  1.00 55.28 ? 1002 HOH E O     1 
HETATM 3712 O  O     . HOH J 6 .   ? 30.758 -18.878 2.512   1.00 55.42 ? 1003 HOH E O     1 
HETATM 3713 O  O     . HOH J 6 .   ? 26.988 -22.715 4.244   1.00 67.66 ? 1004 HOH E O     1 
HETATM 3714 O  O     . HOH J 6 .   ? -1.794 -6.781  18.376  1.00 44.85 ? 1005 HOH E O     1 
HETATM 3715 O  O     . HOH J 6 .   ? 29.562 -16.430 2.810   1.00 45.29 ? 1006 HOH E O     1 
HETATM 3716 O  O     . HOH J 6 .   ? -4.372 -10.278 15.966  1.00 67.69 ? 1007 HOH E O     1 
HETATM 3717 O  O     . HOH J 6 .   ? 22.383 -7.671  -0.387  1.00 56.87 ? 1008 HOH E O     1 
HETATM 3718 O  O     . HOH J 6 .   ? 24.337 -10.485 4.482   1.00 28.90 ? 1009 HOH E O     1 
HETATM 3719 O  O     . HOH J 6 .   ? -0.810 -8.943  17.516  1.00 43.81 ? 1010 HOH E O     1 
HETATM 3720 O  O     . HOH J 6 .   ? 16.932 -12.450 6.183   1.00 60.01 ? 1011 HOH E O     1 
HETATM 3721 O  O     . HOH J 6 .   ? 20.074 -6.570  -0.442  1.00 55.18 ? 1012 HOH E O     1 
HETATM 3722 O  O     . HOH J 6 .   ? 9.147  -13.184 0.446   1.00 51.00 ? 1013 HOH E O     1 
HETATM 3723 O  O     . HOH J 6 .   ? 6.908  -0.183  32.358  1.00 53.19 ? 1014 HOH E O     1 
HETATM 3724 O  O     . HOH J 6 .   ? -3.784 20.744  31.901  1.00 55.10 ? 1015 HOH E O     1 
HETATM 3725 O  O     . HOH J 6 .   ? 9.034  -6.077  9.915   1.00 55.52 ? 1016 HOH E O     1 
HETATM 3726 O  O     . HOH J 6 .   ? 2.947  -6.185  6.455   1.00 55.38 ? 1017 HOH E O     1 
HETATM 3727 O  O     . HOH J 6 .   ? 0.439  -15.464 9.916   1.00 51.58 ? 1018 HOH E O     1 
HETATM 3728 O  O     . HOH J 6 .   ? 7.810  -10.954 19.899  1.00 40.44 ? 1019 HOH E O     1 
HETATM 3729 O  O     . HOH J 6 .   ? -3.121 -9.135  13.743  1.00 67.37 ? 1020 HOH E O     1 
HETATM 3730 O  O     . HOH J 6 .   ? 5.993  -4.995  12.860  1.00 37.69 ? 1021 HOH E O     1 
HETATM 3731 O  O     . HOH J 6 .   ? 5.125  -14.052 14.405  1.00 42.69 ? 1022 HOH E O     1 
HETATM 3732 O  O     . HOH J 6 .   ? 2.289  -15.515 23.308  1.00 56.53 ? 1023 HOH E O     1 
HETATM 3733 O  O     . HOH J 6 .   ? 0.447  -9.209  20.356  1.00 44.16 ? 1024 HOH E O     1 
HETATM 3734 O  O     . HOH J 6 .   ? 3.078  -3.882  16.018  1.00 42.50 ? 1025 HOH E O     1 
HETATM 3735 O  O     . HOH J 6 .   ? -1.785 -12.214 18.562  1.00 45.39 ? 1026 HOH E O     1 
HETATM 3736 O  O     . HOH J 6 .   ? 1.082  -3.667  20.400  1.00 48.92 ? 1027 HOH E O     1 
HETATM 3737 O  O     . HOH J 6 .   ? -0.299 -10.873 24.166  1.00 54.11 ? 1028 HOH E O     1 
HETATM 3738 O  O     . HOH J 6 .   ? 9.971  -12.378 27.095  1.00 45.83 ? 1029 HOH E O     1 
HETATM 3739 O  O     . HOH J 6 .   ? 6.108  -4.251  29.380  1.00 59.77 ? 1030 HOH E O     1 
HETATM 3740 O  O     . HOH J 6 .   ? 7.145  -9.493  29.326  1.00 46.66 ? 1031 HOH E O     1 
HETATM 3741 O  O     . HOH J 6 .   ? 9.693  -6.491  29.816  1.00 31.75 ? 1032 HOH E O     1 
HETATM 3742 O  O     . HOH J 6 .   ? 7.293  -1.311  30.233  1.00 40.78 ? 1033 HOH E O     1 
HETATM 3743 O  O     . HOH J 6 .   ? 10.288 2.700   23.141  1.00 25.81 ? 1034 HOH E O     1 
HETATM 3744 O  O     . HOH J 6 .   ? 15.143 4.422   21.252  1.00 26.25 ? 1035 HOH E O     1 
HETATM 3745 O  O     . HOH J 6 .   ? 8.444  1.713   32.111  1.00 52.83 ? 1036 HOH E O     1 
HETATM 3746 O  O     . HOH J 6 .   ? 7.945  7.128   24.284  1.00 45.98 ? 1037 HOH E O     1 
HETATM 3747 O  O     . HOH J 6 .   ? 10.747 2.979   31.494  1.00 26.35 ? 1038 HOH E O     1 
HETATM 3748 O  O     . HOH J 6 .   ? 11.330 0.083   22.020  1.00 27.81 ? 1039 HOH E O     1 
HETATM 3749 O  O     . HOH J 6 .   ? 10.560 5.057   32.955  1.00 30.27 ? 1040 HOH E O     1 
HETATM 3750 O  O     . HOH J 6 .   ? 6.098  9.206   26.099  1.00 34.61 ? 1041 HOH E O     1 
HETATM 3751 O  O     . HOH J 6 .   ? 15.114 8.644   20.014  1.00 41.69 ? 1042 HOH E O     1 
HETATM 3752 O  O     . HOH J 6 .   ? 16.819 10.807  24.567  1.00 24.57 ? 1043 HOH E O     1 
HETATM 3753 O  O     . HOH J 6 .   ? 3.345  10.398  30.120  1.00 44.09 ? 1044 HOH E O     1 
HETATM 3754 O  O     . HOH J 6 .   ? 9.667  12.554  35.354  1.00 45.27 ? 1045 HOH E O     1 
HETATM 3755 O  O     . HOH J 6 .   ? 5.790  17.755  33.043  1.00 37.64 ? 1046 HOH E O     1 
HETATM 3756 O  O     . HOH J 6 .   ? 6.280  15.779  35.768  1.00 49.01 ? 1047 HOH E O     1 
HETATM 3757 O  O     . HOH J 6 .   ? -0.867 20.203  33.627  1.00 53.97 ? 1048 HOH E O     1 
HETATM 3758 O  O     . HOH J 6 .   ? 5.559  17.479  38.855  1.00 49.65 ? 1049 HOH E O     1 
HETATM 3759 O  O     . HOH J 6 .   ? 1.236  17.883  40.537  1.00 54.30 ? 1050 HOH E O     1 
HETATM 3760 O  O     . HOH J 6 .   ? 11.636 15.816  50.216  1.00 47.46 ? 1051 HOH E O     1 
HETATM 3761 O  O     . HOH J 6 .   ? 5.489  21.081  45.675  1.00 50.11 ? 1052 HOH E O     1 
HETATM 3762 O  O     . HOH J 6 .   ? 15.097 17.764  50.193  1.00 63.80 ? 1053 HOH E O     1 
HETATM 3763 O  O     . HOH J 6 .   ? 6.598  20.512  52.158  1.00 62.25 ? 1054 HOH E O     1 
HETATM 3764 O  O     . HOH J 6 .   ? 16.184 22.871  49.861  1.00 45.18 ? 1055 HOH E O     1 
HETATM 3765 O  O     . HOH J 6 .   ? 18.670 22.364  50.578  1.00 52.67 ? 1056 HOH E O     1 
HETATM 3766 O  O     . HOH J 6 .   ? 17.239 17.197  58.818  1.00 60.11 ? 1057 HOH E O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . ASN A 1   ? 0.8985 0.8818 0.9140 0.0216  -0.0033 -0.0273 2    ASN A N     
2    C  CA    . ASN A 1   ? 0.9015 0.8849 0.8943 0.0116  0.0020  -0.0216 2    ASN A CA    
3    C  C     . ASN A 1   ? 0.8933 0.8810 0.8742 0.0299  0.0070  -0.0227 2    ASN A C     
4    O  O     . ASN A 1   ? 0.8871 0.8675 0.8719 0.0289  0.0083  -0.0263 2    ASN A O     
5    C  CB    . ASN A 1   ? 0.8986 0.9056 0.8942 0.0071  0.0048  -0.0250 2    ASN A CB    
6    C  CG    . ASN A 1   ? 0.9505 0.9527 0.9532 -0.0082 0.0097  0.0113  2    ASN A CG    
7    O  OD1   . ASN A 1   ? 0.9851 1.0554 0.9910 -0.0193 -0.0132 -0.0074 2    ASN A OD1   
8    N  ND2   . ASN A 1   ? 0.9200 0.9854 0.9233 -0.0039 -0.0283 0.0224  2    ASN A ND2   
9    N  N     . THR A 2   ? 0.8632 0.8651 0.8272 0.0305  0.0072  -0.0208 3    THR A N     
10   C  CA    . THR A 2   ? 0.8356 0.8464 0.7874 0.0252  0.0042  -0.0101 3    THR A CA    
11   C  C     . THR A 2   ? 0.7987 0.7998 0.7359 0.0218  0.0169  -0.0267 3    THR A C     
12   O  O     . THR A 2   ? 0.7994 0.7714 0.6579 0.0280  0.0446  -0.0156 3    THR A O     
13   C  CB    . THR A 2   ? 0.8175 0.8393 0.7969 0.0146  -0.0058 -0.0149 3    THR A CB    
14   O  OG1   . THR A 2   ? 0.8401 0.8813 0.8001 -0.0203 -0.0226 0.0096  3    THR A OG1   
15   C  CG2   . THR A 2   ? 0.7407 0.8526 0.7739 0.0272  0.0273  -0.0020 3    THR A CG2   
16   N  N     . LYS A 3   ? 0.7744 0.7515 0.7183 0.0257  0.0338  -0.0277 4    LYS A N     
17   C  CA    . LYS A 3   ? 0.7112 0.7116 0.7058 0.0189  0.0324  -0.0267 4    LYS A CA    
18   C  C     . LYS A 3   ? 0.6465 0.6552 0.6576 0.0094  0.0681  -0.0149 4    LYS A C     
19   O  O     . LYS A 3   ? 0.6403 0.6145 0.6571 0.0185  0.1056  -0.0249 4    LYS A O     
20   C  CB    . LYS A 3   ? 0.7083 0.7503 0.7197 0.0029  0.0290  -0.0108 4    LYS A CB    
21   C  CG    . LYS A 3   ? 0.7807 0.8322 0.7980 -0.0052 -0.0280 -0.0097 4    LYS A CG    
22   C  CD    . LYS A 3   ? 0.7605 0.9233 0.9506 -0.0279 -0.0362 0.0160  4    LYS A CD    
23   C  CE    . LYS A 3   ? 0.8832 1.0686 1.0030 0.0069  -0.0166 -0.0329 4    LYS A CE    
24   N  NZ    . LYS A 3   ? 1.0164 1.1304 1.1350 0.0051  0.0034  -0.0408 4    LYS A NZ    
25   N  N     . TYR A 4   ? 0.5615 0.5969 0.5830 0.0335  0.0523  -0.0200 5    TYR A N     
26   C  CA    . TYR A 4   ? 0.4530 0.5838 0.4809 0.0237  0.0545  0.0045  5    TYR A CA    
27   C  C     . TYR A 4   ? 0.4517 0.6062 0.5131 0.0332  0.0683  0.0098  5    TYR A C     
28   O  O     . TYR A 4   ? 0.4354 0.6647 0.4664 0.0696  0.0733  -0.0170 5    TYR A O     
29   C  CB    . TYR A 4   ? 0.4316 0.5647 0.4532 0.0350  0.0394  -0.0069 5    TYR A CB    
30   C  CG    . TYR A 4   ? 0.3850 0.5081 0.4649 0.0259  0.0848  -0.0339 5    TYR A CG    
31   C  CD1   . TYR A 4   ? 0.3854 0.5232 0.4361 0.0737  0.0734  -0.0547 5    TYR A CD1   
32   C  CD2   . TYR A 4   ? 0.2587 0.5080 0.5104 0.1183  0.1290  -0.0523 5    TYR A CD2   
33   C  CE1   . TYR A 4   ? 0.2592 0.4711 0.5133 0.0731  0.0257  0.0129  5    TYR A CE1   
34   C  CE2   . TYR A 4   ? 0.3375 0.5456 0.4628 0.0701  0.0999  -0.0064 5    TYR A CE2   
35   C  CZ    . TYR A 4   ? 0.4199 0.5576 0.5217 0.0423  0.0262  -0.0561 5    TYR A CZ    
36   O  OH    . TYR A 4   ? 0.4067 0.6041 0.4863 0.0624  0.0110  -0.0246 5    TYR A OH    
37   N  N     . ASN A 5   ? 0.4105 0.6151 0.5122 0.0073  0.0821  0.0065  6    ASN A N     
38   C  CA    . ASN A 5   ? 0.4785 0.6377 0.5148 -0.0134 0.0527  0.0046  6    ASN A CA    
39   C  C     . ASN A 5   ? 0.4901 0.6330 0.5142 0.0123  0.0513  -0.0016 6    ASN A C     
40   O  O     . ASN A 5   ? 0.4883 0.6811 0.4703 -0.0087 0.0541  0.0236  6    ASN A O     
41   C  CB    . ASN A 5   ? 0.5326 0.6380 0.5541 0.0131  0.0385  0.0279  6    ASN A CB    
42   C  CG    . ASN A 5   ? 0.6179 0.7624 0.6517 0.0097  0.0029  -0.0192 6    ASN A CG    
43   O  OD1   . ASN A 5   ? 0.6260 0.7993 0.5322 -0.0458 -0.0379 0.0014  6    ASN A OD1   
44   N  ND2   . ASN A 5   ? 0.7960 0.8903 0.6234 0.0093  0.0133  0.0313  6    ASN A ND2   
45   N  N     . LYS A 6   ? 0.4082 0.5891 0.4733 0.0219  0.0197  -0.0163 7    LYS A N     
46   C  CA    . LYS A 6   ? 0.4296 0.5596 0.4931 0.0209  0.0037  -0.0020 7    LYS A CA    
47   C  C     . LYS A 6   ? 0.3301 0.5055 0.4472 0.0187  -0.0247 0.0208  7    LYS A C     
48   O  O     . LYS A 6   ? 0.2973 0.5397 0.4931 0.0283  -0.0131 0.0139  7    LYS A O     
49   C  CB    . LYS A 6   ? 0.4289 0.5847 0.4980 0.0368  -0.0460 -0.0083 7    LYS A CB    
50   C  CG    . LYS A 6   ? 0.4889 0.5793 0.5225 0.0100  0.0116  0.0120  7    LYS A CG    
51   C  CD    . LYS A 6   ? 0.4997 0.6423 0.5855 0.0412  -0.0507 0.0162  7    LYS A CD    
52   C  CE    . LYS A 6   ? 0.7096 0.7211 0.7488 -0.0130 0.0252  0.0313  7    LYS A CE    
53   N  NZ    . LYS A 6   ? 0.5917 0.7167 0.8921 -0.0781 -0.0083 0.0185  7    LYS A NZ    
54   N  N     . GLU A 7   ? 0.2440 0.4959 0.3756 0.0088  -0.0295 -0.0303 8    GLU A N     
55   C  CA    . GLU A 7   ? 0.3971 0.4676 0.4338 0.0018  -0.0197 -0.0227 8    GLU A CA    
56   C  C     . GLU A 7   ? 0.3548 0.4675 0.4015 -0.0072 -0.0049 -0.0295 8    GLU A C     
57   O  O     . GLU A 7   ? 0.3389 0.4246 0.4001 -0.0218 0.0043  -0.0169 8    GLU A O     
58   C  CB    . GLU A 7   ? 0.3994 0.4738 0.3888 -0.0314 -0.0324 -0.0546 8    GLU A CB    
59   C  CG    . GLU A 7   ? 0.4427 0.5457 0.5121 -0.0382 0.0094  -0.0417 8    GLU A CG    
60   C  CD    . GLU A 7   ? 0.5841 0.6156 0.6449 -0.0483 -0.0021 -0.0186 8    GLU A CD    
61   O  OE1   . GLU A 7   ? 0.8376 0.9072 0.8680 0.0078  -0.0249 0.0651  8    GLU A OE1   
62   O  OE2   . GLU A 7   ? 0.6475 0.8836 0.8489 -0.0845 -0.0505 -0.0264 8    GLU A OE2   
63   N  N     . PHE A 8   ? 0.3271 0.4706 0.3561 0.0014  0.0288  0.0012  9    PHE A N     
64   C  CA    . PHE A 8   ? 0.3819 0.4720 0.3743 0.0013  0.0032  0.0021  9    PHE A CA    
65   C  C     . PHE A 8   ? 0.3907 0.4546 0.4022 0.0106  0.0371  0.0149  9    PHE A C     
66   O  O     . PHE A 8   ? 0.3670 0.3822 0.4013 0.0229  -0.0151 0.0329  9    PHE A O     
67   C  CB    . PHE A 8   ? 0.3937 0.4892 0.3687 0.0054  0.0246  -0.0079 9    PHE A CB    
68   C  CG    . PHE A 8   ? 0.4391 0.4473 0.3994 0.0309  0.0343  0.0075  9    PHE A CG    
69   C  CD1   . PHE A 8   ? 0.4659 0.5377 0.4479 -0.0091 0.0085  -0.0007 9    PHE A CD1   
70   C  CD2   . PHE A 8   ? 0.3946 0.4621 0.4048 -0.0128 0.0140  0.0277  9    PHE A CD2   
71   C  CE1   . PHE A 8   ? 0.5149 0.4289 0.5013 -0.0344 0.0134  0.0047  9    PHE A CE1   
72   C  CE2   . PHE A 8   ? 0.4241 0.4586 0.4009 -0.0005 0.0521  0.0483  9    PHE A CE2   
73   C  CZ    . PHE A 8   ? 0.4201 0.4304 0.3893 0.0080  0.0369  0.0288  9    PHE A CZ    
74   N  N     . LEU A 9   ? 0.3573 0.4478 0.3599 0.0235  0.0723  0.0148  10   LEU A N     
75   C  CA    . LEU A 9   ? 0.3832 0.4466 0.4274 0.0330  0.0253  -0.0160 10   LEU A CA    
76   C  C     . LEU A 9   ? 0.3738 0.4379 0.4162 0.0266  0.0190  -0.0184 10   LEU A C     
77   O  O     . LEU A 9   ? 0.3616 0.4273 0.4268 0.0126  -0.0126 -0.0103 10   LEU A O     
78   C  CB    . LEU A 9   ? 0.3408 0.4694 0.3989 0.0403  0.0663  -0.0282 10   LEU A CB    
79   C  CG    . LEU A 9   ? 0.4093 0.4525 0.3910 0.0299  0.0013  -0.0324 10   LEU A CG    
80   C  CD1   . LEU A 9   ? 0.3812 0.4563 0.3607 -0.0020 0.0433  -0.0211 10   LEU A CD1   
81   C  CD2   . LEU A 9   ? 0.3749 0.4770 0.4394 -0.0109 0.0457  -0.0435 10   LEU A CD2   
82   N  N     . LEU A 10  ? 0.2965 0.4242 0.4321 0.0442  0.0381  -0.0301 11   LEU A N     
83   C  CA    . LEU A 10  ? 0.3400 0.4331 0.4404 -0.0108 0.0069  -0.0260 11   LEU A CA    
84   C  C     . LEU A 10  ? 0.3835 0.4435 0.4113 -0.0480 0.0226  -0.0584 11   LEU A C     
85   O  O     . LEU A 10  ? 0.3076 0.4121 0.3333 -0.0301 -0.0223 -0.0205 11   LEU A O     
86   C  CB    . LEU A 10  ? 0.3555 0.4217 0.4877 -0.0504 0.0486  -0.0088 11   LEU A CB    
87   C  CG    . LEU A 10  ? 0.3511 0.4588 0.4641 -0.0755 0.0047  0.0421  11   LEU A CG    
88   C  CD1   . LEU A 10  ? 0.2572 0.4565 0.4310 0.0442  0.0403  -0.0696 11   LEU A CD1   
89   C  CD2   . LEU A 10  ? 0.4195 0.3262 0.3664 0.0534  0.0392  -0.0075 11   LEU A CD2   
90   N  N     . TYR A 11  ? 0.4271 0.4123 0.3836 -0.0646 0.0036  -0.0285 12   TYR A N     
91   C  CA    . TYR A 11  ? 0.4200 0.4191 0.4177 -0.0376 0.0558  -0.0170 12   TYR A CA    
92   C  C     . TYR A 11  ? 0.3484 0.3235 0.3540 0.0158  0.0055  0.0178  12   TYR A C     
93   O  O     . TYR A 11  ? 0.4014 0.3708 0.3659 0.0183  0.0187  0.0052  12   TYR A O     
94   C  CB    . TYR A 11  ? 0.3339 0.3967 0.3860 0.0244  0.0154  -0.0232 12   TYR A CB    
95   C  CG    . TYR A 11  ? 0.2905 0.2497 0.3408 -0.0193 0.0350  0.0074  12   TYR A CG    
96   C  CD1   . TYR A 11  ? 0.3447 0.4156 0.2868 -0.0011 0.0077  -0.0200 12   TYR A CD1   
97   C  CD2   . TYR A 11  ? 0.2627 0.3450 0.4265 -0.0601 0.0056  -0.0268 12   TYR A CD2   
98   C  CE1   . TYR A 11  ? 0.3500 0.3631 0.3754 -0.0214 -0.0070 0.0677  12   TYR A CE1   
99   C  CE2   . TYR A 11  ? 0.3254 0.3462 0.3858 0.0271  0.0311  -0.0136 12   TYR A CE2   
100  C  CZ    . TYR A 11  ? 0.3240 0.3495 0.3410 0.0310  0.0036  0.0240  12   TYR A CZ    
101  O  OH    . TYR A 11  ? 0.3626 0.4064 0.3603 -0.0058 -0.0401 0.0217  12   TYR A OH    
102  N  N     . LEU A 12  ? 0.3224 0.3815 0.3808 0.0111  0.0065  0.0141  13   LEU A N     
103  C  CA    . LEU A 12  ? 0.3267 0.3305 0.3418 0.0059  0.0066  -0.0047 13   LEU A CA    
104  C  C     . LEU A 12  ? 0.3402 0.3481 0.3335 0.0185  0.0198  0.0008  13   LEU A C     
105  O  O     . LEU A 12  ? 0.3061 0.2856 0.2868 0.0277  0.0045  0.0286  13   LEU A O     
106  C  CB    . LEU A 12  ? 0.3328 0.3848 0.3005 0.0311  0.0048  0.0011  13   LEU A CB    
107  C  CG    . LEU A 12  ? 0.3387 0.3711 0.4030 0.0152  0.0356  0.0213  13   LEU A CG    
108  C  CD1   . LEU A 12  ? 0.3446 0.3691 0.3580 -0.0134 0.0563  -0.0020 13   LEU A CD1   
109  C  CD2   . LEU A 12  ? 0.4046 0.4337 0.4525 -0.0020 0.0230  -0.0402 13   LEU A CD2   
110  N  N     . ALA A 13  ? 0.2577 0.3141 0.2713 0.0373  0.0226  -0.0017 14   ALA A N     
111  C  CA    . ALA A 13  ? 0.2428 0.3357 0.2801 0.0516  0.0130  0.0444  14   ALA A CA    
112  C  C     . ALA A 13  ? 0.3071 0.3787 0.3493 0.0320  -0.0018 0.0126  14   ALA A C     
113  O  O     . ALA A 13  ? 0.2893 0.3769 0.4008 0.0508  0.0024  0.0160  14   ALA A O     
114  C  CB    . ALA A 13  ? 0.2555 0.3895 0.3480 0.0223  0.0216  0.0498  14   ALA A CB    
115  N  N     . GLY A 14  ? 0.2190 0.3120 0.3157 0.0534  0.0015  0.0017  15   GLY A N     
116  C  CA    . GLY A 14  ? 0.2588 0.3421 0.2241 0.0471  0.0042  -0.0080 15   GLY A CA    
117  C  C     . GLY A 14  ? 0.3046 0.3554 0.3272 0.0242  -0.0059 -0.0013 15   GLY A C     
118  O  O     . GLY A 14  ? 0.2375 0.3871 0.2961 0.0164  -0.0409 0.0295  15   GLY A O     
119  N  N     . PHE A 15  ? 0.3029 0.3372 0.2745 0.0480  -0.0086 -0.0084 16   PHE A N     
120  C  CA    . PHE A 15  ? 0.3145 0.3588 0.3230 0.0127  -0.0090 0.0041  16   PHE A CA    
121  C  C     . PHE A 15  ? 0.3683 0.3775 0.3232 0.0275  -0.0083 -0.0040 16   PHE A C     
122  O  O     . PHE A 15  ? 0.2952 0.3691 0.3763 0.0198  0.0063  -0.0036 16   PHE A O     
123  C  CB    . PHE A 15  ? 0.3315 0.3188 0.2959 0.0424  -0.0375 0.0469  16   PHE A CB    
124  C  CG    . PHE A 15  ? 0.2496 0.3208 0.3099 0.0382  -0.0184 -0.0055 16   PHE A CG    
125  C  CD1   . PHE A 15  ? 0.2449 0.4376 0.3533 -0.0007 0.0144  0.0067  16   PHE A CD1   
126  C  CD2   . PHE A 15  ? 0.3024 0.2906 0.3374 0.0067  -0.0414 0.0140  16   PHE A CD2   
127  C  CE1   . PHE A 15  ? 0.3563 0.3143 0.4272 -0.0065 -0.0010 0.0031  16   PHE A CE1   
128  C  CE2   . PHE A 15  ? 0.3388 0.3749 0.3762 -0.0224 -0.0511 0.0055  16   PHE A CE2   
129  C  CZ    . PHE A 15  ? 0.2191 0.3940 0.4003 0.0440  -0.0034 0.0026  16   PHE A CZ    
130  N  N     . VAL A 16  ? 0.2538 0.3512 0.3166 0.0488  -0.0165 -0.0049 17   VAL A N     
131  C  CA    . VAL A 16  ? 0.2794 0.3043 0.3269 0.0101  0.0259  0.0171  17   VAL A CA    
132  C  C     . VAL A 16  ? 0.3098 0.3314 0.3034 0.0373  0.0135  -0.0044 17   VAL A C     
133  O  O     . VAL A 16  ? 0.3278 0.3910 0.3308 0.0169  0.0281  0.0427  17   VAL A O     
134  C  CB    . VAL A 16  ? 0.2787 0.3002 0.3330 0.0247  0.0375  0.0300  17   VAL A CB    
135  C  CG1   . VAL A 16  ? 0.3227 0.2779 0.3707 0.0096  -0.0047 -0.0227 17   VAL A CG1   
136  C  CG2   . VAL A 16  ? 0.2267 0.4299 0.2825 0.0797  0.0616  -0.0140 17   VAL A CG2   
137  N  N     . ASP A 17  ? 0.2799 0.3392 0.3273 0.0035  -0.0062 -0.0120 18   ASP A N     
138  C  CA    . ASP A 17  ? 0.2617 0.2920 0.3077 0.0332  0.0156  0.0106  18   ASP A CA    
139  C  C     . ASP A 17  ? 0.2864 0.3353 0.3340 0.0269  -0.0082 0.0017  18   ASP A C     
140  O  O     . ASP A 17  ? 0.3079 0.3057 0.2967 0.0285  0.0060  -0.0262 18   ASP A O     
141  C  CB    . ASP A 17  ? 0.3068 0.2687 0.3214 0.0942  -0.0019 0.0179  18   ASP A CB    
142  C  CG    . ASP A 17  ? 0.3407 0.4024 0.3856 0.0576  -0.0064 -0.0096 18   ASP A CG    
143  O  OD1   . ASP A 17  ? 0.3600 0.3259 0.4310 0.0576  -0.0039 -0.0352 18   ASP A OD1   
144  O  OD2   . ASP A 17  ? 0.3164 0.3739 0.4507 0.0393  0.0001  -0.0008 18   ASP A OD2   
145  N  N     . GLY A 18  ? 0.2692 0.2790 0.3296 0.0236  -0.0173 -0.0093 19   GLY A N     
146  C  CA    . GLY A 18  ? 0.2536 0.3486 0.2698 0.0707  -0.0511 0.0106  19   GLY A CA    
147  C  C     . GLY A 18  ? 0.2935 0.3123 0.3396 0.0191  -0.0525 -0.0048 19   GLY A C     
148  O  O     . GLY A 18  ? 0.3488 0.4502 0.3342 0.0119  -0.0257 0.0184  19   GLY A O     
149  N  N     . ASP A 19  ? 0.2628 0.2963 0.3013 0.0279  0.0151  0.0250  20   ASP A N     
150  C  CA    . ASP A 19  ? 0.3106 0.2708 0.2989 -0.0071 -0.0029 0.0046  20   ASP A CA    
151  C  C     . ASP A 19  ? 0.3098 0.2640 0.3144 0.0074  0.0077  -0.0068 20   ASP A C     
152  O  O     . ASP A 19  ? 0.3280 0.3178 0.3491 0.0096  0.0430  0.0190  20   ASP A O     
153  C  CB    . ASP A 19  ? 0.2652 0.3175 0.3186 0.0176  0.0283  -0.0164 20   ASP A CB    
154  C  CG    . ASP A 19  ? 0.2844 0.3058 0.3077 -0.0387 0.0074  -0.0086 20   ASP A CG    
155  O  OD1   . ASP A 19  ? 0.3216 0.3083 0.3290 0.0594  0.0000  -0.0126 20   ASP A OD1   
156  O  OD2   . ASP A 19  ? 0.2906 0.2802 0.3050 0.0314  -0.0099 0.0000  20   ASP A OD2   
157  N  N     . GLY A 20  ? 0.3026 0.2843 0.3379 0.0049  0.0113  0.0047  21   GLY A N     
158  C  CA    . GLY A 20  ? 0.2956 0.2487 0.2784 0.0019  0.0310  -0.0236 21   GLY A CA    
159  C  C     . GLY A 20  ? 0.3547 0.3069 0.3351 0.0363  0.0301  -0.0172 21   GLY A C     
160  O  O     . GLY A 20  ? 0.3248 0.2940 0.3483 0.0440  0.0102  0.0042  21   GLY A O     
161  N  N     . SER A 21  ? 0.3260 0.3295 0.3590 0.0179  0.0003  -0.0168 22   SER A N     
162  C  CA    . SER A 21  ? 0.3659 0.3250 0.3740 0.0198  0.0110  0.0125  22   SER A CA    
163  C  C     . SER A 21  ? 0.3821 0.3851 0.3752 0.0228  0.0386  0.0059  22   SER A C     
164  O  O     . SER A 21  ? 0.3988 0.3603 0.4050 0.0934  0.0691  -0.0004 22   SER A O     
165  C  CB    . SER A 21  ? 0.3731 0.3668 0.3960 -0.0093 0.0312  -0.0044 22   SER A CB    
166  O  OG    . SER A 21  ? 0.3766 0.3624 0.4086 -0.0358 -0.0164 -0.0082 22   SER A OG    
167  N  N     . ILE A 22  ? 0.3751 0.3208 0.4060 0.0014  0.0118  -0.0045 23   ILE A N     
168  C  CA    . ILE A 22  ? 0.3617 0.3424 0.3881 0.0451  0.0178  -0.0210 23   ILE A CA    
169  C  C     . ILE A 22  ? 0.4423 0.3471 0.4111 0.0533  0.0267  -0.0143 23   ILE A C     
170  O  O     . ILE A 22  ? 0.4509 0.3842 0.3493 0.0615  0.0236  -0.0510 23   ILE A O     
171  C  CB    . ILE A 22  ? 0.4091 0.3559 0.4380 0.0501  0.0103  -0.0096 23   ILE A CB    
172  C  CG1   . ILE A 22  ? 0.4131 0.3397 0.4933 0.0381  -0.0361 0.0077  23   ILE A CG1   
173  C  CG2   . ILE A 22  ? 0.3944 0.2748 0.3964 0.1123  0.0602  0.0094  23   ILE A CG2   
174  C  CD1   . ILE A 22  ? 0.4004 0.4831 0.4915 0.0320  -0.0133 0.0390  23   ILE A CD1   
175  N  N     . ILE A 23  ? 0.4386 0.3760 0.4072 0.0346  0.0345  -0.0184 24   ILE A N     
176  C  CA    . ILE A 23  ? 0.4734 0.4056 0.4425 0.0280  0.0425  -0.0271 24   ILE A CA    
177  C  C     . ILE A 23  ? 0.5177 0.4005 0.4408 -0.0089 0.0536  -0.0416 24   ILE A C     
178  O  O     . ILE A 23  ? 0.5501 0.3707 0.4164 0.0048  0.0734  -0.0721 24   ILE A O     
179  C  CB    . ILE A 23  ? 0.4494 0.3986 0.4408 0.0199  0.0099  -0.0103 24   ILE A CB    
180  C  CG1   . ILE A 23  ? 0.4413 0.4397 0.5007 -0.0017 0.0192  -0.0222 24   ILE A CG1   
181  C  CG2   . ILE A 23  ? 0.5010 0.3319 0.3555 0.0386  0.0171  -0.0238 24   ILE A CG2   
182  C  CD1   . ILE A 23  ? 0.3909 0.4317 0.4410 0.0477  0.0382  -0.0256 24   ILE A CD1   
183  N  N     . ALA A 24  ? 0.5258 0.4087 0.4626 -0.0021 0.0356  -0.0524 25   ALA A N     
184  C  CA    . ALA A 24  ? 0.4500 0.3207 0.4169 0.0149  0.0292  -0.0172 25   ALA A CA    
185  C  C     . ALA A 24  ? 0.4526 0.3345 0.3952 0.0410  0.0135  -0.0238 25   ALA A C     
186  O  O     . ALA A 24  ? 0.4244 0.3336 0.3779 -0.0131 -0.0016 -0.0250 25   ALA A O     
187  C  CB    . ALA A 24  ? 0.4367 0.3484 0.4039 0.0200  -0.0248 -0.0064 25   ALA A CB    
188  N  N     . GLN A 25  ? 0.4422 0.3638 0.4298 0.0079  0.0312  -0.0038 26   GLN A N     
189  C  CA    . GLN A 25  ? 0.4771 0.3619 0.4338 0.0313  0.0181  -0.0328 26   GLN A CA    
190  C  C     . GLN A 25  ? 0.4948 0.3932 0.4241 -0.0108 -0.0110 -0.0373 26   GLN A C     
191  O  O     . GLN A 25  ? 0.5505 0.3701 0.4516 0.0096  0.0134  -0.0803 26   GLN A O     
192  C  CB    . GLN A 25  ? 0.4591 0.3448 0.3528 0.0003  0.0164  -0.0321 26   GLN A CB    
193  C  CG    . GLN A 25  ? 0.4976 0.3346 0.3926 -0.0024 0.0355  -0.0059 26   GLN A CG    
194  C  CD    . GLN A 25  ? 0.4890 0.4134 0.5011 0.0064  -0.0140 -0.0206 26   GLN A CD    
195  O  OE1   . GLN A 25  ? 0.5050 0.4537 0.4537 -0.0066 -0.0291 -0.0425 26   GLN A OE1   
196  N  NE2   . GLN A 25  ? 0.4157 0.3875 0.3908 -0.0441 0.0119  -0.0027 26   GLN A NE2   
197  N  N     . ILE A 26  ? 0.5150 0.4304 0.4513 -0.0023 -0.0046 -0.0257 27   ILE A N     
198  C  CA    . ILE A 26  ? 0.5158 0.3511 0.4412 0.0066  -0.0069 -0.0428 27   ILE A CA    
199  C  C     . ILE A 26  ? 0.5468 0.4298 0.4797 -0.0188 0.0177  -0.0375 27   ILE A C     
200  O  O     . ILE A 26  ? 0.6015 0.5061 0.4669 -0.0319 0.0098  -0.0660 27   ILE A O     
201  C  CB    . ILE A 26  ? 0.5130 0.3689 0.4521 -0.0135 -0.0063 -0.0646 27   ILE A CB    
202  C  CG1   . ILE A 26  ? 0.5668 0.3130 0.4471 0.0543  0.0295  -0.0609 27   ILE A CG1   
203  C  CG2   . ILE A 26  ? 0.5493 0.3827 0.4130 0.0136  -0.0134 -0.0468 27   ILE A CG2   
204  C  CD1   . ILE A 26  ? 0.5774 0.3629 0.4168 -0.0086 0.0191  -0.0632 27   ILE A CD1   
205  N  N     . GLU A 27  ? 0.5589 0.3957 0.4893 0.0010  0.0249  -0.0710 28   GLU A N     
206  C  CA    . GLU A 27  ? 0.5818 0.5081 0.5523 0.0020  0.0110  -0.0281 28   GLU A CA    
207  C  C     . GLU A 27  ? 0.5668 0.5203 0.5485 -0.0092 0.0129  -0.0420 28   GLU A C     
208  O  O     . GLU A 27  ? 0.6311 0.5036 0.6098 -0.0235 0.0196  -0.0516 28   GLU A O     
209  C  CB    . GLU A 27  ? 0.5430 0.4790 0.5108 0.0074  0.0064  -0.0066 28   GLU A CB    
210  C  CG    . GLU A 27  ? 0.6357 0.6185 0.5630 -0.0059 -0.0183 -0.0308 28   GLU A CG    
211  C  CD    . GLU A 27  ? 0.6423 0.6072 0.5996 -0.0004 -0.0141 -0.0008 28   GLU A CD    
212  O  OE1   . GLU A 27  ? 0.7376 0.6791 0.7063 -0.0381 -0.0017 0.0166  28   GLU A OE1   
213  O  OE2   . GLU A 27  ? 0.6962 0.7068 0.5974 0.0462  0.0275  -0.0106 28   GLU A OE2   
214  N  N     . PRO A 28  ? 0.5960 0.5814 0.5601 0.0009  0.0224  -0.0248 29   PRO A N     
215  C  CA    . PRO A 28  ? 0.6165 0.5692 0.5641 0.0051  0.0314  -0.0395 29   PRO A CA    
216  C  C     . PRO A 28  ? 0.6681 0.5693 0.5845 0.0190  0.0276  -0.0515 29   PRO A C     
217  O  O     . PRO A 28  ? 0.6914 0.5361 0.5486 0.0718  0.0319  -0.0821 29   PRO A O     
218  C  CB    . PRO A 28  ? 0.6282 0.5895 0.6149 -0.0050 0.0326  -0.0223 29   PRO A CB    
219  C  CG    . PRO A 28  ? 0.5662 0.5970 0.5841 0.0100  0.0432  -0.0494 29   PRO A CG    
220  C  CD    . PRO A 28  ? 0.5871 0.5582 0.5658 0.0235  0.0134  -0.0272 29   PRO A CD    
221  N  N     . ASN A 29  ? 0.6738 0.5444 0.5669 0.0403  0.0421  -0.0641 30   ASN A N     
222  C  CA    . ASN A 29  ? 0.7109 0.5529 0.6075 0.0242  0.0337  -0.0741 30   ASN A CA    
223  C  C     . ASN A 29  ? 0.6801 0.5475 0.6047 0.0339  0.0390  -0.0985 30   ASN A C     
224  O  O     . ASN A 29  ? 0.6747 0.4578 0.5635 0.0289  0.0383  -0.1723 30   ASN A O     
225  C  CB    . ASN A 29  ? 0.7225 0.5571 0.5814 0.0215  0.0266  -0.0562 30   ASN A CB    
226  C  CG    . ASN A 29  ? 0.8050 0.5952 0.6308 -0.0037 0.0384  -0.0379 30   ASN A CG    
227  O  OD1   . ASN A 29  ? 0.7901 0.6445 0.5821 -0.0539 -0.0339 -0.0654 30   ASN A OD1   
228  N  ND2   . ASN A 29  ? 0.7747 0.5402 0.6224 -0.0001 0.0855  -0.0698 30   ASN A ND2   
229  N  N     . GLN A 30  ? 0.6711 0.5774 0.6096 0.0100  0.0309  -0.0941 31   GLN A N     
230  C  CA    . GLN A 30  ? 0.7283 0.6839 0.6965 -0.0030 0.0351  -0.0582 31   GLN A CA    
231  C  C     . GLN A 30  ? 0.7081 0.6655 0.6912 -0.0042 0.0270  -0.0564 31   GLN A C     
232  O  O     . GLN A 30  ? 0.7093 0.6819 0.6805 -0.0182 0.0429  -0.0938 31   GLN A O     
233  C  CB    . GLN A 30  ? 0.7546 0.7055 0.7423 -0.0138 0.0248  -0.0512 31   GLN A CB    
234  C  CG    . GLN A 30  ? 0.8771 0.8837 0.8676 -0.0334 0.0462  -0.0139 31   GLN A CG    
235  C  CD    . GLN A 30  ? 1.0150 0.9116 0.9728 -0.0199 -0.0241 0.0161  31   GLN A CD    
236  O  OE1   . GLN A 30  ? 1.0473 1.0314 1.0575 0.0008  -0.0315 0.0029  31   GLN A OE1   
237  N  NE2   . GLN A 30  ? 1.0130 0.8993 0.9640 -0.0087 -0.0386 -0.0022 31   GLN A NE2   
238  N  N     . SER A 31  ? 0.6846 0.6495 0.6402 -0.0116 0.0097  -0.0641 32   SER A N     
239  C  CA    . SER A 31  ? 0.7156 0.6381 0.6250 -0.0186 0.0147  -0.0564 32   SER A CA    
240  C  C     . SER A 31  ? 0.7170 0.6320 0.6387 -0.0189 0.0390  -0.0557 32   SER A C     
241  O  O     . SER A 31  ? 0.7924 0.6462 0.6156 -0.0493 0.0447  -0.0781 32   SER A O     
242  C  CB    . SER A 31  ? 0.7375 0.6436 0.6265 -0.0184 0.0322  -0.0650 32   SER A CB    
243  O  OG    . SER A 31  ? 0.8318 0.7337 0.7327 0.0058  0.0253  -0.0652 32   SER A OG    
244  N  N     . TYR A 32  ? 0.6958 0.5928 0.5935 -0.0031 0.0248  -0.0486 33   TYR A N     
245  C  CA    . TYR A 32  ? 0.6822 0.5716 0.6151 0.0080  0.0243  -0.0430 33   TYR A CA    
246  C  C     . TYR A 32  ? 0.7062 0.6123 0.6630 0.0051  0.0319  -0.0410 33   TYR A C     
247  O  O     . TYR A 32  ? 0.7260 0.5367 0.6346 0.0068  0.0625  -0.0925 33   TYR A O     
248  C  CB    . TYR A 32  ? 0.6891 0.5811 0.6040 0.0250  0.0158  -0.0184 33   TYR A CB    
249  C  CG    . TYR A 32  ? 0.7159 0.5579 0.6008 -0.0131 0.0140  -0.0458 33   TYR A CG    
250  C  CD1   . TYR A 32  ? 0.6847 0.5775 0.6007 -0.0171 0.0369  -0.0445 33   TYR A CD1   
251  C  CD2   . TYR A 32  ? 0.6635 0.6412 0.5601 0.0066  0.0151  -0.0336 33   TYR A CD2   
252  C  CE1   . TYR A 32  ? 0.7101 0.5887 0.5583 0.0231  -0.0116 0.0415  33   TYR A CE1   
253  C  CE2   . TYR A 32  ? 0.6630 0.6662 0.4802 0.0244  0.0476  -0.0270 33   TYR A CE2   
254  C  CZ    . TYR A 32  ? 0.7374 0.5616 0.5795 0.0121  0.0130  0.0022  33   TYR A CZ    
255  O  OH    . TYR A 32  ? 0.7751 0.5408 0.5971 0.0511  0.0391  -0.0968 33   TYR A OH    
256  N  N     . LYS A 33  ? 0.7312 0.6767 0.7295 0.0108  0.0365  -0.0248 34   LYS A N     
257  C  CA    . LYS A 33  ? 0.7813 0.7348 0.8002 0.0076  0.0235  -0.0061 34   LYS A CA    
258  C  C     . LYS A 33  ? 0.7912 0.7466 0.7824 0.0118  0.0169  -0.0142 34   LYS A C     
259  O  O     . LYS A 33  ? 0.8312 0.8109 0.8541 0.0083  0.0134  -0.0073 34   LYS A O     
260  C  CB    . LYS A 33  ? 0.7862 0.7732 0.8085 0.0088  0.0085  -0.0103 34   LYS A CB    
261  C  CG    . LYS A 33  ? 0.8768 0.8134 0.9031 0.0216  0.0023  -0.0429 34   LYS A CG    
262  C  CD    . LYS A 33  ? 0.9126 0.9056 0.9694 0.0195  -0.0145 -0.0352 34   LYS A CD    
263  C  CE    . LYS A 33  ? 0.9824 0.9790 0.9857 0.0088  -0.0210 -0.0131 34   LYS A CE    
264  N  NZ    . LYS A 33  ? 1.0032 0.9737 1.0600 -0.0106 -0.0036 -0.0177 34   LYS A NZ    
265  N  N     . PHE A 34  ? 0.7581 0.7052 0.7477 0.0178  0.0223  -0.0177 35   PHE A N     
266  C  CA    . PHE A 34  ? 0.7358 0.6557 0.7095 0.0116  0.0296  -0.0155 35   PHE A CA    
267  C  C     . PHE A 34  ? 0.7051 0.5970 0.6536 -0.0137 0.0388  -0.0223 35   PHE A C     
268  O  O     . PHE A 34  ? 0.7190 0.5369 0.6554 -0.0176 0.0758  -0.0434 35   PHE A O     
269  C  CB    . PHE A 34  ? 0.7619 0.7018 0.7249 0.0017  0.0078  -0.0053 35   PHE A CB    
270  C  CG    . PHE A 34  ? 0.8214 0.7886 0.8348 0.0142  0.0185  -0.0150 35   PHE A CG    
271  C  CD1   . PHE A 34  ? 0.8751 0.8359 0.9057 0.0103  -0.0055 -0.0085 35   PHE A CD1   
272  C  CD2   . PHE A 34  ? 0.8596 0.8510 0.8659 0.0090  -0.0245 -0.0259 35   PHE A CD2   
273  C  CE1   . PHE A 34  ? 0.8820 0.8813 0.9238 0.0042  0.0166  -0.0183 35   PHE A CE1   
274  C  CE2   . PHE A 34  ? 0.9142 0.9144 0.9224 0.0193  -0.0114 -0.0280 35   PHE A CE2   
275  C  CZ    . PHE A 34  ? 0.8475 0.8256 0.8994 0.0447  -0.0011 -0.0258 35   PHE A CZ    
276  N  N     . LYS A 35  ? 0.6235 0.5357 0.5586 -0.0154 0.0409  -0.0591 36   LYS A N     
277  C  CA    . LYS A 35  ? 0.6565 0.5057 0.5457 -0.0297 0.0306  -0.0699 36   LYS A CA    
278  C  C     . LYS A 35  ? 0.6482 0.5085 0.5368 -0.0145 0.0285  -0.0513 36   LYS A C     
279  O  O     . LYS A 35  ? 0.6500 0.4514 0.4854 -0.0258 0.0132  -0.0931 36   LYS A O     
280  C  CB    . LYS A 35  ? 0.6342 0.5461 0.5509 -0.0371 0.0250  -0.0583 36   LYS A CB    
281  C  CG    . LYS A 35  ? 0.6869 0.5552 0.5606 -0.0400 0.0359  -0.0399 36   LYS A CG    
282  C  CD    . LYS A 35  ? 0.7287 0.5089 0.6232 -0.0473 -0.0085 -0.0444 36   LYS A CD    
283  C  CE    . LYS A 35  ? 0.7630 0.4526 0.7687 0.0055  0.0127  -0.1057 36   LYS A CE    
284  N  NZ    . LYS A 35  ? 0.8396 0.5161 0.8792 -0.0160 0.0222  -0.0529 36   LYS A NZ    
285  N  N     . HIS A 36  ? 0.5898 0.4635 0.4512 -0.0166 0.0053  -0.0611 37   HIS A N     
286  C  CA    . HIS A 36  ? 0.6076 0.4975 0.5243 0.0125  0.0252  -0.0405 37   HIS A CA    
287  C  C     . HIS A 36  ? 0.5977 0.4866 0.5199 0.0232  0.0270  -0.0382 37   HIS A C     
288  O  O     . HIS A 36  ? 0.6273 0.4517 0.5553 0.0500  0.0469  -0.0447 37   HIS A O     
289  C  CB    . HIS A 36  ? 0.6187 0.5069 0.5312 0.0353  0.0136  -0.0509 37   HIS A CB    
290  C  CG    . HIS A 36  ? 0.6172 0.4897 0.5632 -0.0248 0.0541  -0.0281 37   HIS A CG    
291  N  ND1   . HIS A 36  ? 0.7233 0.4926 0.6425 -0.0119 0.1069  -0.0474 37   HIS A ND1   
292  C  CD2   . HIS A 36  ? 0.7062 0.5862 0.6073 -0.0374 0.0375  -0.0531 37   HIS A CD2   
293  C  CE1   . HIS A 36  ? 0.6521 0.5212 0.5555 -0.0151 0.0233  -0.0426 37   HIS A CE1   
294  N  NE2   . HIS A 36  ? 0.6750 0.5082 0.5531 -0.0060 0.0424  0.0195  37   HIS A NE2   
295  N  N     . ARG A 37  ? 0.5941 0.4899 0.4720 -0.0048 0.0019  -0.0529 38   ARG A N     
296  C  CA    . ARG A 37  ? 0.5763 0.4630 0.4904 0.0123  0.0049  -0.0617 38   ARG A CA    
297  C  C     . ARG A 37  ? 0.5624 0.4950 0.4811 0.0103  0.0070  -0.0406 38   ARG A C     
298  O  O     . ARG A 37  ? 0.5977 0.5004 0.5223 -0.0056 0.0154  -0.0850 38   ARG A O     
299  C  CB    . ARG A 37  ? 0.6022 0.5446 0.4544 -0.0213 -0.0047 -0.0843 38   ARG A CB    
300  C  CG    . ARG A 37  ? 0.5947 0.5994 0.5879 0.0324  -0.0082 -0.0614 38   ARG A CG    
301  C  CD    . ARG A 37  ? 0.6963 0.7026 0.7086 -0.0490 0.0330  -0.0402 38   ARG A CD    
302  N  NE    . ARG A 37  ? 0.7640 0.6940 0.7171 -0.0345 -0.0066 -0.0411 38   ARG A NE    
303  C  CZ    . ARG A 37  ? 0.7069 0.5390 0.6265 -0.0132 -0.0242 -0.0878 38   ARG A CZ    
304  N  NH1   . ARG A 37  ? 0.6514 0.6695 0.7186 -0.0064 -0.0577 -0.0592 38   ARG A NH1   
305  N  NH2   . ARG A 37  ? 0.6601 0.5994 0.6058 -0.0251 0.0126  -0.1462 38   ARG A NH2   
306  N  N     . LEU A 38  ? 0.5774 0.4224 0.4692 0.0197  0.0227  -0.0314 39   LEU A N     
307  C  CA    . LEU A 38  ? 0.5802 0.3975 0.4720 0.0180  0.0156  -0.0030 39   LEU A CA    
308  C  C     . LEU A 38  ? 0.5978 0.4166 0.4590 0.0263  0.0414  -0.0163 39   LEU A C     
309  O  O     . LEU A 38  ? 0.6027 0.3777 0.4207 0.0328  0.0658  -0.0518 39   LEU A O     
310  C  CB    . LEU A 38  ? 0.5672 0.4057 0.5195 0.0175  0.0165  -0.0024 39   LEU A CB    
311  C  CG    . LEU A 38  ? 0.5609 0.4884 0.5660 0.0123  0.0086  0.0298  39   LEU A CG    
312  C  CD1   . LEU A 38  ? 0.5801 0.5724 0.6394 -0.0218 -0.0540 0.0263  39   LEU A CD1   
313  C  CD2   . LEU A 38  ? 0.5684 0.6337 0.5097 0.0360  0.0253  0.0341  39   LEU A CD2   
314  N  N     . LYS A 39  ? 0.5696 0.4359 0.4599 0.0385  0.0238  -0.0032 40   LYS A N     
315  C  CA    . LYS A 39  ? 0.5340 0.4102 0.4585 0.0322  0.0135  -0.0242 40   LYS A CA    
316  C  C     . LYS A 39  ? 0.5220 0.3889 0.4614 0.0416  0.0183  -0.0210 40   LYS A C     
317  O  O     . LYS A 39  ? 0.5515 0.3817 0.4647 0.0044  0.0466  -0.0679 40   LYS A O     
318  C  CB    . LYS A 39  ? 0.5508 0.4608 0.5042 0.0632  0.0252  -0.0188 40   LYS A CB    
319  C  CG    . LYS A 39  ? 0.6750 0.6578 0.5641 0.0468  0.0366  0.0256  40   LYS A CG    
320  C  CD    . LYS A 39  ? 0.7373 0.8155 0.7335 0.0250  -0.0320 -0.0063 40   LYS A CD    
321  C  CE    . LYS A 39  ? 0.8009 0.8747 0.8305 0.0426  -0.0508 -0.0221 40   LYS A CE    
322  N  NZ    . LYS A 39  ? 0.8273 0.9099 0.8993 0.0338  -0.0360 -0.0159 40   LYS A NZ    
323  N  N     . LEU A 40  ? 0.5079 0.3552 0.4544 0.0383  0.0334  -0.0312 41   LEU A N     
324  C  CA    . LEU A 40  ? 0.5118 0.3644 0.4431 0.0363  0.0135  0.0024  41   LEU A CA    
325  C  C     . LEU A 40  ? 0.5400 0.4192 0.4387 0.0147  0.0162  -0.0225 41   LEU A C     
326  O  O     . LEU A 40  ? 0.5192 0.3363 0.4005 0.0307  0.0598  -0.0425 41   LEU A O     
327  C  CB    . LEU A 40  ? 0.5553 0.4237 0.4693 0.0345  0.0376  0.0163  41   LEU A CB    
328  C  CG    . LEU A 40  ? 0.6401 0.4918 0.6342 0.0317  0.0393  0.0324  41   LEU A CG    
329  C  CD1   . LEU A 40  ? 0.7170 0.3666 0.5756 0.0590  0.0875  -0.0333 41   LEU A CD1   
330  C  CD2   . LEU A 40  ? 0.6206 0.3261 0.6869 0.0377  0.0394  -0.0395 41   LEU A CD2   
331  N  N     . THR A 41  ? 0.5026 0.4051 0.4445 0.0628  0.0570  -0.0036 42   THR A N     
332  C  CA    . THR A 41  ? 0.4838 0.3599 0.4438 0.0205  0.0236  -0.0009 42   THR A CA    
333  C  C     . THR A 41  ? 0.5041 0.3957 0.4270 0.0288  0.0203  -0.0001 42   THR A C     
334  O  O     . THR A 41  ? 0.5383 0.3519 0.4841 0.0324  0.0467  0.0045  42   THR A O     
335  C  CB    . THR A 41  ? 0.5178 0.3319 0.4445 0.0215  -0.0284 0.0162  42   THR A CB    
336  O  OG1   . THR A 41  ? 0.4990 0.4710 0.5047 0.0282  -0.0502 0.0330  42   THR A OG1   
337  C  CG2   . THR A 41  ? 0.5302 0.3136 0.4472 0.0108  0.0167  0.0090  42   THR A CG2   
338  N  N     . PHE A 42  ? 0.4609 0.3691 0.4090 0.0164  0.0454  0.0065  43   PHE A N     
339  C  CA    . PHE A 42  ? 0.4562 0.3858 0.3491 0.0199  0.0310  0.0119  43   PHE A CA    
340  C  C     . PHE A 42  ? 0.4650 0.3697 0.3645 0.0429  0.0411  -0.0031 43   PHE A C     
341  O  O     . PHE A 42  ? 0.4604 0.3666 0.3577 0.0680  0.0564  -0.0142 43   PHE A O     
342  C  CB    . PHE A 42  ? 0.4103 0.3554 0.3600 0.0032  0.0327  0.0317  43   PHE A CB    
343  C  CG    . PHE A 42  ? 0.4881 0.4451 0.3998 0.0307  0.0200  0.0167  43   PHE A CG    
344  C  CD1   . PHE A 42  ? 0.4092 0.4532 0.4408 0.0365  -0.0221 -0.0120 43   PHE A CD1   
345  C  CD2   . PHE A 42  ? 0.5260 0.3722 0.4276 -0.0084 0.0375  0.0038  43   PHE A CD2   
346  C  CE1   . PHE A 42  ? 0.4081 0.3846 0.4950 0.0378  0.0341  0.0170  43   PHE A CE1   
347  C  CE2   . PHE A 42  ? 0.3376 0.4258 0.3906 0.0421  0.0128  -0.0001 43   PHE A CE2   
348  C  CZ    . PHE A 42  ? 0.4231 0.3993 0.3617 0.0629  0.0523  0.0068  43   PHE A CZ    
349  N  N     . LYS A 43  ? 0.4245 0.3811 0.3577 0.0129  0.0218  0.0210  44   LYS A N     
350  C  CA    . LYS A 43  ? 0.3833 0.3957 0.4193 0.0264  0.0184  -0.0278 44   LYS A CA    
351  C  C     . LYS A 43  ? 0.3891 0.3732 0.3679 0.0328  -0.0024 -0.0076 44   LYS A C     
352  O  O     . LYS A 43  ? 0.4113 0.3601 0.3818 0.0503  0.0429  -0.0678 44   LYS A O     
353  C  CB    . LYS A 43  ? 0.4436 0.3965 0.4680 0.0055  -0.0255 -0.0185 44   LYS A CB    
354  C  CG    . LYS A 43  ? 0.4148 0.5011 0.4502 0.0096  0.0681  -0.0334 44   LYS A CG    
355  C  CD    . LYS A 43  ? 0.4225 0.4905 0.6003 -0.0424 -0.0421 -0.0087 44   LYS A CD    
356  C  CE    . LYS A 43  ? 0.4927 0.5299 0.4443 -0.0229 0.0094  0.0121  44   LYS A CE    
357  N  NZ    . LYS A 43  ? 0.6047 0.6774 0.4735 0.0152  0.0153  0.0351  44   LYS A NZ    
358  N  N     . VAL A 44  ? 0.3527 0.3521 0.3350 0.0441  -0.0067 -0.0188 45   VAL A N     
359  C  CA    . VAL A 44  ? 0.3158 0.3324 0.3685 0.0371  -0.0022 -0.0120 45   VAL A CA    
360  C  C     . VAL A 44  ? 0.3032 0.3110 0.3410 0.0312  -0.0143 -0.0168 45   VAL A C     
361  O  O     . VAL A 44  ? 0.3519 0.2750 0.3885 0.0396  0.0268  0.0306  45   VAL A O     
362  C  CB    . VAL A 44  ? 0.3074 0.2847 0.3520 0.0576  -0.0035 -0.0149 45   VAL A CB    
363  C  CG1   . VAL A 44  ? 0.3132 0.3332 0.3247 -0.0016 0.0772  0.0167  45   VAL A CG1   
364  C  CG2   . VAL A 44  ? 0.2233 0.3875 0.3396 0.0991  -0.0415 0.0153  45   VAL A CG2   
365  N  N     . THR A 45  ? 0.2868 0.3279 0.3481 0.0110  0.0142  -0.0270 46   THR A N     
366  C  CA    . THR A 45  ? 0.2634 0.3405 0.3361 0.0380  -0.0151 0.0372  46   THR A CA    
367  C  C     . THR A 45  ? 0.3264 0.3944 0.3606 0.0355  -0.0082 -0.0183 46   THR A C     
368  O  O     . THR A 45  ? 0.3358 0.3384 0.3038 0.0686  -0.0388 -0.0132 46   THR A O     
369  C  CB    . THR A 45  ? 0.2848 0.3749 0.3813 0.0328  -0.0086 -0.0010 46   THR A CB    
370  O  OG1   . THR A 45  ? 0.3927 0.3764 0.3566 0.0497  -0.0404 0.0080  46   THR A OG1   
371  C  CG2   . THR A 45  ? 0.1996 0.3205 0.3442 0.0314  -0.0372 0.0150  46   THR A CG2   
372  N  N     . GLN A 46  ? 0.3100 0.3281 0.3220 0.0532  -0.0148 0.0042  47   GLN A N     
373  C  CA    . GLN A 46  ? 0.3083 0.3421 0.3568 0.0241  -0.0219 -0.0050 47   GLN A CA    
374  C  C     . GLN A 46  ? 0.3063 0.3076 0.3196 0.0477  -0.0657 0.0137  47   GLN A C     
375  O  O     . GLN A 46  ? 0.3167 0.4193 0.2910 0.0519  -0.0192 0.0084  47   GLN A O     
376  C  CB    . GLN A 46  ? 0.2440 0.2801 0.2868 0.0118  -0.0288 -0.0363 47   GLN A CB    
377  C  CG    . GLN A 46  ? 0.3144 0.2787 0.2770 0.1125  -0.0550 -0.0084 47   GLN A CG    
378  C  CD    . GLN A 46  ? 0.2850 0.3496 0.3552 -0.0115 -0.0398 -0.0353 47   GLN A CD    
379  O  OE1   . GLN A 46  ? 0.3127 0.3425 0.3194 0.0698  -0.0476 -0.0337 47   GLN A OE1   
380  N  NE2   . GLN A 46  ? 0.3018 0.3960 0.4012 -0.0518 -0.0466 -0.0311 47   GLN A NE2   
381  N  N     . LYS A 47  ? 0.3520 0.3658 0.3595 0.0213  -0.0254 -0.0223 48   LYS A N     
382  C  CA    . LYS A 47  ? 0.3397 0.3360 0.3344 0.0498  -0.0797 -0.0105 48   LYS A CA    
383  C  C     . LYS A 47  ? 0.2980 0.3057 0.3250 0.0348  -0.0634 -0.0431 48   LYS A C     
384  O  O     . LYS A 47  ? 0.3345 0.3651 0.3166 -0.0009 -0.0715 -0.0257 48   LYS A O     
385  C  CB    . LYS A 47  ? 0.4448 0.3552 0.3642 -0.0088 -0.0323 -0.0370 48   LYS A CB    
386  C  CG    . LYS A 47  ? 0.4530 0.4068 0.4307 0.0211  -0.0257 -0.0381 48   LYS A CG    
387  C  CD    . LYS A 47  ? 0.4235 0.5340 0.3915 0.0104  -0.0863 -0.0388 48   LYS A CD    
388  C  CE    . LYS A 47  ? 0.4959 0.4051 0.4483 0.1967  -0.0279 0.0009  48   LYS A CE    
389  N  NZ    . LYS A 47  ? 0.6488 0.6406 0.7281 0.0879  -0.0842 0.0385  48   LYS A NZ    
390  N  N     . THR A 48  ? 0.4039 0.3877 0.3551 0.0352  -0.0210 -0.0036 49   THR A N     
391  C  CA    . THR A 48  ? 0.3828 0.4054 0.3693 0.0136  -0.0550 -0.0015 49   THR A CA    
392  C  C     . THR A 48  ? 0.4219 0.4276 0.4199 0.0230  -0.0306 -0.0018 49   THR A C     
393  O  O     . THR A 48  ? 0.3696 0.4279 0.3260 0.0616  -0.0597 0.0578  49   THR A O     
394  C  CB    . THR A 48  ? 0.4368 0.3941 0.3976 -0.0220 -0.0206 -0.0028 49   THR A CB    
395  O  OG1   . THR A 48  ? 0.3294 0.3843 0.4151 0.0110  -0.1118 -0.0082 49   THR A OG1   
396  C  CG2   . THR A 48  ? 0.4697 0.3794 0.3852 -0.0356 -0.0502 -0.0358 49   THR A CG2   
397  N  N     . GLN A 49  ? 0.4032 0.4128 0.3966 0.0473  -0.0543 -0.0187 50   GLN A N     
398  C  CA    . GLN A 49  ? 0.4071 0.4156 0.4744 0.0293  -0.0450 -0.0005 50   GLN A CA    
399  C  C     . GLN A 49  ? 0.4360 0.3997 0.4329 0.0299  0.0053  0.0040  50   GLN A C     
400  O  O     . GLN A 49  ? 0.4320 0.3237 0.3995 0.0487  0.0064  -0.0010 50   GLN A O     
401  C  CB    . GLN A 49  ? 0.4797 0.4978 0.5147 -0.0003 -0.0178 -0.0112 50   GLN A CB    
402  C  CG    . GLN A 49  ? 0.5428 0.6237 0.5987 0.0468  -0.0206 0.0010  50   GLN A CG    
403  C  CD    . GLN A 49  ? 0.6463 0.6065 0.7973 0.0144  -0.0036 -0.0072 50   GLN A CD    
404  O  OE1   . GLN A 49  ? 0.6448 0.7105 0.8732 0.0296  0.0427  0.0102  50   GLN A OE1   
405  N  NE2   . GLN A 49  ? 0.7064 0.7158 0.7118 -0.0248 0.0175  -0.0822 50   GLN A NE2   
406  N  N     . ARG A 50  ? 0.3942 0.3795 0.3204 0.0563  -0.0219 -0.0050 51   ARG A N     
407  C  CA    . ARG A 50  ? 0.3651 0.4075 0.3605 0.0546  0.0023  -0.0296 51   ARG A CA    
408  C  C     . ARG A 50  ? 0.3979 0.4157 0.3904 0.0391  -0.0190 -0.0183 51   ARG A C     
409  O  O     . ARG A 50  ? 0.3875 0.3752 0.3772 0.0112  -0.0365 -0.0057 51   ARG A O     
410  C  CB    . ARG A 50  ? 0.3115 0.3983 0.3382 0.0704  -0.0460 -0.0068 51   ARG A CB    
411  C  CG    . ARG A 50  ? 0.3615 0.4115 0.3192 0.0497  -0.0125 -0.0338 51   ARG A CG    
412  C  CD    . ARG A 50  ? 0.3754 0.4134 0.3171 -0.0085 -0.0081 0.0266  51   ARG A CD    
413  N  NE    . ARG A 50  ? 0.3983 0.4604 0.3178 -0.0198 -0.0103 0.0157  51   ARG A NE    
414  C  CZ    . ARG A 50  ? 0.3127 0.3679 0.3499 -0.0322 -0.0418 -0.0003 51   ARG A CZ    
415  N  NH1   . ARG A 50  ? 0.3303 0.3531 0.3191 0.0159  0.0140  -0.0093 51   ARG A NH1   
416  N  NH2   . ARG A 50  ? 0.3384 0.3420 0.2927 0.0049  -0.0283 0.0073  51   ARG A NH2   
417  N  N     . ARG A 51  ? 0.3895 0.4202 0.3682 0.0414  -0.0482 -0.0231 52   ARG A N     
418  C  CA    . ARG A 51  ? 0.4213 0.4514 0.4109 0.0289  -0.0495 -0.0049 52   ARG A CA    
419  C  C     . ARG A 51  ? 0.4506 0.4302 0.3845 0.0382  -0.0317 0.0107  52   ARG A C     
420  O  O     . ARG A 51  ? 0.4565 0.4145 0.3865 0.0378  -0.0275 0.0245  52   ARG A O     
421  C  CB    . ARG A 51  ? 0.4318 0.4278 0.4108 0.0158  -0.0276 -0.0183 52   ARG A CB    
422  C  CG    . ARG A 51  ? 0.6496 0.7032 0.6158 0.0010  0.0178  0.0724  52   ARG A CG    
423  C  CD    . ARG A 51  ? 0.8273 0.9358 0.9342 0.0158  -0.0294 0.0371  52   ARG A CD    
424  N  NE    . ARG A 51  ? 1.0186 0.9496 1.0934 0.0022  0.0144  0.0127  52   ARG A NE    
425  C  CZ    . ARG A 51  ? 1.0241 1.0052 1.1133 0.0204  0.0069  0.0353  52   ARG A CZ    
426  N  NH1   . ARG A 51  ? 0.8849 0.8054 1.0010 0.0099  -0.0294 0.0588  52   ARG A NH1   
427  N  NH2   . ARG A 51  ? 1.1007 1.0186 1.1449 -0.0062 0.0156  0.0358  52   ARG A NH2   
428  N  N     . TRP A 52  ? 0.4317 0.4113 0.4180 0.0449  -0.0634 0.0165  53   TRP A N     
429  C  CA    . TRP A 52  ? 0.4471 0.3860 0.3755 0.0283  -0.0008 0.0348  53   TRP A CA    
430  C  C     . TRP A 52  ? 0.4449 0.3978 0.3989 0.0269  -0.0061 0.0113  53   TRP A C     
431  O  O     . TRP A 52  ? 0.4108 0.3808 0.4244 -0.0029 -0.0159 0.0577  53   TRP A O     
432  C  CB    . TRP A 52  ? 0.5150 0.4304 0.4494 0.0243  0.0326  0.0075  53   TRP A CB    
433  C  CG    . TRP A 52  ? 0.5453 0.4046 0.4734 -0.0097 0.0244  -0.0182 53   TRP A CG    
434  C  CD1   . TRP A 52  ? 0.5478 0.4221 0.4907 -0.0305 0.0495  -0.0031 53   TRP A CD1   
435  C  CD2   . TRP A 52  ? 0.4987 0.3796 0.4480 0.0181  0.0163  0.0440  53   TRP A CD2   
436  N  NE1   . TRP A 52  ? 0.5227 0.3059 0.4620 -0.0116 0.0188  -0.0265 53   TRP A NE1   
437  C  CE2   . TRP A 52  ? 0.5278 0.3359 0.5306 0.0113  0.0011  0.0061  53   TRP A CE2   
438  C  CE3   . TRP A 52  ? 0.5084 0.4647 0.5046 -0.0059 0.0239  0.0118  53   TRP A CE3   
439  C  CZ2   . TRP A 52  ? 0.5663 0.3827 0.5101 0.0037  0.0074  0.0337  53   TRP A CZ2   
440  C  CZ3   . TRP A 52  ? 0.5908 0.3985 0.5129 0.0063  0.0071  0.0053  53   TRP A CZ3   
441  C  CH2   . TRP A 52  ? 0.5414 0.4287 0.5243 0.0154  0.0250  0.0213  53   TRP A CH2   
442  N  N     . PHE A 53  ? 0.4133 0.3597 0.3605 0.0306  0.0066  0.0417  54   PHE A N     
443  C  CA    . PHE A 53  ? 0.3804 0.3758 0.2888 0.0176  -0.0054 0.0105  54   PHE A CA    
444  C  C     . PHE A 53  ? 0.3883 0.3715 0.3617 0.0183  -0.0088 0.0398  54   PHE A C     
445  O  O     . PHE A 53  ? 0.3796 0.4110 0.3407 0.0067  0.0056  0.0256  54   PHE A O     
446  C  CB    . PHE A 53  ? 0.3891 0.4603 0.3273 0.0556  -0.0334 0.0016  54   PHE A CB    
447  C  CG    . PHE A 53  ? 0.4034 0.4289 0.3561 0.0327  -0.0236 0.0113  54   PHE A CG    
448  C  CD1   . PHE A 53  ? 0.4903 0.5212 0.5160 0.1141  -0.0239 -0.0471 54   PHE A CD1   
449  C  CD2   . PHE A 53  ? 0.4750 0.5454 0.5125 0.0158  -0.0415 0.0296  54   PHE A CD2   
450  C  CE1   . PHE A 53  ? 0.4636 0.3928 0.4002 0.0660  -0.0215 -0.0215 54   PHE A CE1   
451  C  CE2   . PHE A 53  ? 0.5102 0.6530 0.5006 -0.0255 -0.0812 0.0362  54   PHE A CE2   
452  C  CZ    . PHE A 53  ? 0.4590 0.5397 0.4024 0.0348  -0.0751 0.0172  54   PHE A CZ    
453  N  N     . LEU A 54  ? 0.3624 0.3744 0.3127 0.0029  -0.0155 -0.0076 55   LEU A N     
454  C  CA    . LEU A 54  ? 0.3316 0.3092 0.3523 -0.0109 0.0126  0.0112  55   LEU A CA    
455  C  C     . LEU A 54  ? 0.3952 0.3694 0.3490 -0.0070 -0.0026 0.0128  55   LEU A C     
456  O  O     . LEU A 54  ? 0.4219 0.3868 0.3285 0.0186  0.0075  0.0338  55   LEU A O     
457  C  CB    . LEU A 54  ? 0.3488 0.3535 0.3117 -0.0082 0.0031  0.0209  55   LEU A CB    
458  C  CG    . LEU A 54  ? 0.3078 0.3715 0.3495 0.0172  0.0125  0.0716  55   LEU A CG    
459  C  CD1   . LEU A 54  ? 0.2670 0.3819 0.3524 0.0356  0.0362  0.0013  55   LEU A CD1   
460  C  CD2   . LEU A 54  ? 0.3579 0.3924 0.3116 0.0192  0.0183  0.0143  55   LEU A CD2   
461  N  N     . ASP A 55  ? 0.4279 0.4054 0.3960 0.0098  0.0142  0.0034  56   ASP A N     
462  C  CA    . ASP A 55  ? 0.4158 0.4258 0.3618 -0.0056 0.0147  0.0600  56   ASP A CA    
463  C  C     . ASP A 55  ? 0.4430 0.4049 0.3761 -0.0187 0.0415  0.0552  56   ASP A C     
464  O  O     . ASP A 55  ? 0.4742 0.3816 0.4253 -0.0406 0.0245  0.0435  56   ASP A O     
465  C  CB    . ASP A 55  ? 0.4257 0.4562 0.3857 0.0155  0.0224  0.0138  56   ASP A CB    
466  C  CG    . ASP A 55  ? 0.5155 0.4691 0.4839 0.0061  -0.0203 0.0020  56   ASP A CG    
467  O  OD1   . ASP A 55  ? 0.5533 0.4273 0.3432 0.0224  0.0121  0.0131  56   ASP A OD1   
468  O  OD2   . ASP A 55  ? 0.4715 0.5233 0.5283 0.0542  -0.0815 -0.0462 56   ASP A OD2   
469  N  N     . LYS A 56  ? 0.4355 0.4072 0.3336 -0.0418 0.0618  0.0295  57   LYS A N     
470  C  CA    . LYS A 56  ? 0.4497 0.4598 0.4367 -0.0059 0.0180  0.0172  57   LYS A CA    
471  C  C     . LYS A 56  ? 0.4353 0.4673 0.4525 -0.0259 0.0281  0.0180  57   LYS A C     
472  O  O     . LYS A 56  ? 0.4351 0.4036 0.4942 -0.0344 0.0502  0.0224  57   LYS A O     
473  C  CB    . LYS A 56  ? 0.4026 0.4949 0.3804 -0.0223 -0.0134 -0.0419 57   LYS A CB    
474  C  CG    . LYS A 56  ? 0.5926 0.5918 0.5400 -0.0184 0.0494  0.0024  57   LYS A CG    
475  C  CD    . LYS A 56  ? 0.6403 0.5482 0.5529 -0.0330 -0.0083 0.0052  57   LYS A CD    
476  C  CE    . LYS A 56  ? 0.7486 0.6875 0.7196 -0.0506 -0.0499 0.0031  57   LYS A CE    
477  N  NZ    . LYS A 56  ? 0.8283 0.7038 0.7595 -0.0256 -0.0197 -0.0331 57   LYS A NZ    
478  N  N     . LEU A 57  ? 0.4456 0.4506 0.3953 -0.0100 0.0532  0.0132  58   LEU A N     
479  C  CA    . LEU A 57  ? 0.3985 0.4803 0.4252 -0.0041 0.0189  0.0492  58   LEU A CA    
480  C  C     . LEU A 57  ? 0.4319 0.4380 0.4191 -0.0130 -0.0010 0.0532  58   LEU A C     
481  O  O     . LEU A 57  ? 0.4277 0.5632 0.4141 0.0034  0.0173  0.0931  58   LEU A O     
482  C  CB    . LEU A 57  ? 0.4587 0.4723 0.4723 -0.0497 -0.0063 0.0556  58   LEU A CB    
483  C  CG    . LEU A 57  ? 0.3597 0.5904 0.4668 -0.0382 -0.0767 0.0471  58   LEU A CG    
484  C  CD1   . LEU A 57  ? 0.5100 0.5981 0.5361 -0.1125 -0.0501 0.0723  58   LEU A CD1   
485  C  CD2   . LEU A 57  ? 0.4122 0.5773 0.4036 -0.0167 -0.0273 0.0694  58   LEU A CD2   
486  N  N     . VAL A 58  ? 0.3913 0.4048 0.4350 -0.0252 0.0059  0.0495  59   VAL A N     
487  C  CA    . VAL A 58  ? 0.3811 0.4185 0.3946 0.0064  0.0213  0.0402  59   VAL A CA    
488  C  C     . VAL A 58  ? 0.4395 0.4364 0.4004 -0.0027 -0.0013 0.0244  59   VAL A C     
489  O  O     . VAL A 58  ? 0.4479 0.4226 0.4227 -0.0099 0.0375  0.0299  59   VAL A O     
490  C  CB    . VAL A 58  ? 0.4304 0.4582 0.4126 -0.0421 0.0425  0.0200  59   VAL A CB    
491  C  CG1   . VAL A 58  ? 0.4811 0.4280 0.4852 0.0245  0.0080  0.0284  59   VAL A CG1   
492  C  CG2   . VAL A 58  ? 0.3320 0.5379 0.3866 0.0114  0.0049  0.0485  59   VAL A CG2   
493  N  N     . ASP A 59  ? 0.4468 0.4235 0.4086 0.0162  0.0219  0.0343  60   ASP A N     
494  C  CA    . ASP A 59  ? 0.4253 0.4655 0.4444 0.0045  0.0053  0.0455  60   ASP A CA    
495  C  C     . ASP A 59  ? 0.4600 0.4734 0.4545 -0.0050 0.0387  0.0209  60   ASP A C     
496  O  O     . ASP A 59  ? 0.3893 0.4483 0.3746 0.0071  0.0733  0.0465  60   ASP A O     
497  C  CB    . ASP A 59  ? 0.4819 0.5197 0.4847 -0.0023 0.0019  0.0575  60   ASP A CB    
498  C  CG    . ASP A 59  ? 0.6005 0.6686 0.6348 -0.0330 -0.0002 0.0871  60   ASP A CG    
499  O  OD1   . ASP A 59  ? 0.6301 0.7733 0.7613 0.0200  -0.0243 0.1724  60   ASP A OD1   
500  O  OD2   . ASP A 59  ? 0.9532 0.9178 0.8015 -0.0266 -0.0463 0.1067  60   ASP A OD2   
501  N  N     . GLU A 60  ? 0.4415 0.4250 0.3833 -0.0151 0.0224  0.0364  61   GLU A N     
502  C  CA    . GLU A 60  ? 0.4410 0.4711 0.4614 -0.0035 0.0178  0.0176  61   GLU A CA    
503  C  C     . GLU A 60  ? 0.4214 0.4236 0.4355 -0.0051 0.0297  0.0094  61   GLU A C     
504  O  O     . GLU A 60  ? 0.4647 0.4309 0.4540 -0.0376 0.0170  0.0403  61   GLU A O     
505  C  CB    . GLU A 60  ? 0.4154 0.4582 0.3972 -0.0199 -0.0243 -0.0176 61   GLU A CB    
506  C  CG    . GLU A 60  ? 0.4953 0.5057 0.4831 0.0537  0.0234  -0.0126 61   GLU A CG    
507  C  CD    . GLU A 60  ? 0.6662 0.6845 0.5935 -0.0191 0.0239  -0.0497 61   GLU A CD    
508  O  OE1   . GLU A 60  ? 0.7847 0.7129 0.7351 -0.0856 0.0279  -0.0842 61   GLU A OE1   
509  O  OE2   . GLU A 60  ? 0.6910 0.7992 0.5926 -0.0415 0.0456  -0.0046 61   GLU A OE2   
510  N  N     . ILE A 61  ? 0.4123 0.4559 0.4450 0.0177  0.0204  -0.0063 62   ILE A N     
511  C  CA    . ILE A 61  ? 0.4166 0.4394 0.4053 -0.0052 0.0563  0.0126  62   ILE A CA    
512  C  C     . ILE A 61  ? 0.4501 0.4714 0.4700 0.0119  0.0282  0.0000  62   ILE A C     
513  O  O     . ILE A 61  ? 0.3763 0.5308 0.4055 0.0453  0.0556  0.0148  62   ILE A O     
514  C  CB    . ILE A 61  ? 0.4445 0.4353 0.4623 -0.0072 -0.0001 -0.0082 62   ILE A CB    
515  C  CG1   . ILE A 61  ? 0.3347 0.4127 0.4209 -0.0617 0.0600  0.0143  62   ILE A CG1   
516  C  CG2   . ILE A 61  ? 0.3972 0.3880 0.4652 0.0108  0.0463  -0.0227 62   ILE A CG2   
517  C  CD1   . ILE A 61  ? 0.4218 0.4013 0.3813 -0.0361 0.0708  0.0293  62   ILE A CD1   
518  N  N     . GLY A 62  ? 0.4015 0.4865 0.3808 0.0146  0.0296  0.0126  63   GLY A N     
519  C  CA    . GLY A 62  ? 0.4735 0.5123 0.4685 -0.0023 0.0369  0.0055  63   GLY A CA    
520  C  C     . GLY A 62  ? 0.4578 0.5163 0.4366 0.0027  0.0146  0.0120  63   GLY A C     
521  O  O     . GLY A 62  ? 0.4357 0.5346 0.4085 -0.0180 0.0688  0.0020  63   GLY A O     
522  N  N     . VAL A 63  ? 0.4564 0.4979 0.4598 0.0043  0.0442  0.0203  64   VAL A N     
523  C  CA    . VAL A 63  ? 0.4712 0.4924 0.4500 0.0278  0.0130  0.0240  64   VAL A CA    
524  C  C     . VAL A 63  ? 0.4382 0.4704 0.4435 0.0028  -0.0017 0.0143  64   VAL A C     
525  O  O     . VAL A 63  ? 0.3369 0.4714 0.3824 0.0034  -0.0072 -0.0253 64   VAL A O     
526  C  CB    . VAL A 63  ? 0.5689 0.5170 0.4862 0.0062  0.0037  0.0305  64   VAL A CB    
527  C  CG1   . VAL A 63  ? 0.4971 0.5043 0.5078 0.0183  0.0577  0.0298  64   VAL A CG1   
528  C  CG2   . VAL A 63  ? 0.5580 0.5435 0.5948 0.0152  -0.0170 0.0385  64   VAL A CG2   
529  N  N     . GLY A 64  ? 0.4473 0.4739 0.3888 -0.0079 -0.0388 -0.0120 65   GLY A N     
530  C  CA    . GLY A 64  ? 0.4498 0.4495 0.4323 -0.0023 0.0135  0.0126  65   GLY A CA    
531  C  C     . GLY A 64  ? 0.4580 0.4545 0.4161 -0.0059 0.0217  0.0277  65   GLY A C     
532  O  O     . GLY A 64  ? 0.4635 0.4250 0.3785 -0.0131 0.0498  0.0107  65   GLY A O     
533  N  N     . TYR A 65  ? 0.3982 0.4210 0.3750 0.0006  0.0278  -0.0077 66   TYR A N     
534  C  CA    . TYR A 65  ? 0.4489 0.4584 0.4101 0.0141  0.0249  -0.0198 66   TYR A CA    
535  C  C     . TYR A 65  ? 0.4797 0.4298 0.3922 0.0289  0.0272  -0.0280 66   TYR A C     
536  O  O     . TYR A 65  ? 0.4899 0.3767 0.4021 0.0420  0.0149  0.0032  66   TYR A O     
537  C  CB    . TYR A 65  ? 0.4808 0.4925 0.4402 -0.0006 0.0160  -0.0195 66   TYR A CB    
538  C  CG    . TYR A 65  ? 0.4732 0.4148 0.4001 -0.0086 -0.0348 -0.0693 66   TYR A CG    
539  C  CD1   . TYR A 65  ? 0.5362 0.4486 0.4082 -0.0088 0.0097  -0.0276 66   TYR A CD1   
540  C  CD2   . TYR A 65  ? 0.5920 0.4947 0.4346 -0.0039 -0.0590 -0.0117 66   TYR A CD2   
541  C  CE1   . TYR A 65  ? 0.5740 0.4569 0.5710 -0.0389 -0.0055 -0.0631 66   TYR A CE1   
542  C  CE2   . TYR A 65  ? 0.5341 0.4705 0.4987 0.0263  -0.0260 -0.0189 66   TYR A CE2   
543  C  CZ    . TYR A 65  ? 0.5373 0.4953 0.5369 0.0105  -0.0126 -0.0140 66   TYR A CZ    
544  O  OH    . TYR A 65  ? 0.5874 0.4657 0.4940 -0.0046 0.0140  -0.0202 66   TYR A OH    
545  N  N     . VAL A 66  ? 0.4406 0.3711 0.3807 0.0264  0.0067  -0.0163 67   VAL A N     
546  C  CA    . VAL A 66  ? 0.4237 0.4199 0.3915 0.0274  -0.0182 0.0017  67   VAL A CA    
547  C  C     . VAL A 66  ? 0.4487 0.4179 0.4108 -0.0092 -0.0163 -0.0136 67   VAL A C     
548  O  O     . VAL A 66  ? 0.4924 0.4785 0.3692 -0.0261 0.0032  -0.0057 67   VAL A O     
549  C  CB    . VAL A 66  ? 0.3714 0.3767 0.3902 0.0364  -0.0157 -0.0099 67   VAL A CB    
550  C  CG1   . VAL A 66  ? 0.4415 0.4468 0.3357 0.0980  -0.0174 0.0487  67   VAL A CG1   
551  C  CG2   . VAL A 66  ? 0.3847 0.4206 0.3534 0.0342  0.0437  0.0246  67   VAL A CG2   
552  N  N     . ARG A 67  ? 0.4642 0.3311 0.3967 -0.0218 -0.0036 -0.0260 68   ARG A N     
553  C  CA    . ARG A 67  ? 0.5168 0.4534 0.5005 0.0141  -0.0163 -0.0198 68   ARG A CA    
554  C  C     . ARG A 67  ? 0.5139 0.4684 0.4911 0.0314  -0.0323 -0.0317 68   ARG A C     
555  O  O     . ARG A 67  ? 0.4536 0.4484 0.4352 0.0863  -0.0325 -0.0430 68   ARG A O     
556  C  CB    . ARG A 67  ? 0.5170 0.4562 0.5926 -0.0289 -0.0576 -0.0665 68   ARG A CB    
557  C  CG    . ARG A 67  ? 0.7252 0.7393 0.8272 -0.0080 0.0102  -0.0271 68   ARG A CG    
558  C  CD    . ARG A 67  ? 0.9257 0.9129 0.9082 -0.0372 -0.0630 -0.0134 68   ARG A CD    
559  N  NE    . ARG A 67  ? 0.9528 0.9439 1.0488 -0.0257 -0.0542 0.0198  68   ARG A NE    
560  C  CZ    . ARG A 67  ? 0.9778 0.9573 1.0113 -0.0066 -0.0351 -0.0004 68   ARG A CZ    
561  N  NH1   . ARG A 67  ? 0.9932 0.8691 1.0001 0.0167  0.0062  -0.0019 68   ARG A NH1   
562  N  NH2   . ARG A 67  ? 0.9513 0.9482 1.0185 0.0015  -0.0494 -0.0098 68   ARG A NH2   
563  N  N     . ASP A 68  ? 0.5445 0.5140 0.4939 0.0315  -0.0565 -0.0539 69   ASP A N     
564  C  CA    . ASP A 68  ? 0.5961 0.5821 0.5645 0.0220  -0.0499 -0.0428 69   ASP A CA    
565  C  C     . ASP A 68  ? 0.6284 0.6172 0.6031 0.0265  -0.0197 -0.0250 69   ASP A C     
566  O  O     . ASP A 68  ? 0.6031 0.6917 0.5871 0.0024  -0.0694 -0.0758 69   ASP A O     
567  C  CB    . ASP A 68  ? 0.6402 0.6015 0.6248 0.0375  -0.0273 0.0003  69   ASP A CB    
568  C  CG    . ASP A 68  ? 0.7154 0.6869 0.6535 0.0325  0.0147  0.0039  69   ASP A CG    
569  O  OD1   . ASP A 68  ? 0.6650 0.7751 0.7883 0.0115  -0.0273 0.0693  69   ASP A OD1   
570  O  OD2   . ASP A 68  ? 0.8662 0.7276 0.6965 0.0140  0.0271  0.0006  69   ASP A OD2   
571  N  N     . GLU A 69  ? 0.6326 0.6052 0.5889 0.0290  -0.0433 -0.0322 70   GLU A N     
572  C  CA    . GLU A 69  ? 0.6450 0.6581 0.6464 0.0218  -0.0112 -0.0168 70   GLU A CA    
573  C  C     . GLU A 69  ? 0.6165 0.6191 0.6387 0.0238  -0.0108 -0.0096 70   GLU A C     
574  O  O     . GLU A 69  ? 0.5989 0.6564 0.6835 0.0279  0.0080  -0.0131 70   GLU A O     
575  C  CB    . GLU A 69  ? 0.6423 0.6539 0.6425 0.0315  -0.0148 -0.0067 70   GLU A CB    
576  C  CG    . GLU A 69  ? 0.8600 0.8109 0.8050 0.0066  -0.0045 0.0011  70   GLU A CG    
577  C  CD    . GLU A 69  ? 0.9216 0.9977 0.9788 0.0190  -0.0128 0.0282  70   GLU A CD    
578  O  OE1   . GLU A 69  ? 1.0489 1.0620 1.0518 -0.0094 -0.0021 0.0281  70   GLU A OE1   
579  O  OE2   . GLU A 69  ? 0.9695 1.0756 1.0121 -0.0086 0.0210  0.0109  70   GLU A OE2   
580  N  N     . GLY A 70  ? 0.5954 0.6167 0.6225 0.0218  -0.0319 -0.0214 71   GLY A N     
581  C  CA    . GLY A 70  ? 0.5867 0.5910 0.6026 0.0421  -0.0443 -0.0085 71   GLY A CA    
582  C  C     . GLY A 70  ? 0.5451 0.5759 0.5825 0.0355  -0.0195 -0.0209 71   GLY A C     
583  O  O     . GLY A 70  ? 0.6146 0.4451 0.5479 0.0390  -0.0445 -0.0092 71   GLY A O     
584  N  N     . SER A 71  ? 0.4220 0.5758 0.5579 0.0408  -0.0297 -0.0136 72   SER A N     
585  C  CA    . SER A 71  ? 0.4213 0.5912 0.5348 0.0741  0.0098  -0.0224 72   SER A CA    
586  C  C     . SER A 71  ? 0.3946 0.4973 0.4784 0.0425  -0.0475 -0.0206 72   SER A C     
587  O  O     . SER A 71  ? 0.3154 0.4258 0.4447 0.1587  -0.0555 -0.0173 72   SER A O     
588  C  CB    . SER A 71  ? 0.4300 0.6340 0.5825 0.0398  0.0156  -0.0242 72   SER A CB    
589  O  OG    . SER A 71  ? 0.5518 0.7573 0.7151 0.0040  0.0064  -0.0556 72   SER A OG    
590  N  N     . VAL A 72  ? 0.3681 0.3992 0.4427 0.0350  -0.0183 -0.0558 73   VAL A N     
591  C  CA    . VAL A 72  ? 0.4059 0.4235 0.4460 0.0495  0.0053  0.0040  73   VAL A CA    
592  C  C     . VAL A 72  ? 0.4039 0.4021 0.4058 0.0470  0.0114  -0.0305 73   VAL A C     
593  O  O     . VAL A 72  ? 0.3321 0.4318 0.4269 0.0155  -0.0196 -0.0389 73   VAL A O     
594  C  CB    . VAL A 72  ? 0.4065 0.4259 0.3783 -0.0140 0.0141  -0.0106 73   VAL A CB    
595  C  CG1   . VAL A 72  ? 0.4517 0.3039 0.4212 0.0278  0.0282  0.0557  73   VAL A CG1   
596  C  CG2   . VAL A 72  ? 0.4127 0.3769 0.5083 0.0168  0.0444  -0.0279 73   VAL A CG2   
597  N  N     . SER A 73  ? 0.3760 0.3604 0.3852 0.0208  -0.0063 -0.0089 74   SER A N     
598  C  CA    . SER A 73  ? 0.3668 0.3907 0.3813 0.0312  -0.0127 0.0197  74   SER A CA    
599  C  C     . SER A 73  ? 0.4001 0.3652 0.3780 0.0432  -0.0140 0.0160  74   SER A C     
600  O  O     . SER A 73  ? 0.3210 0.3929 0.3554 -0.0052 -0.0254 -0.0156 74   SER A O     
601  C  CB    . SER A 73  ? 0.3685 0.3409 0.3701 0.0301  -0.0428 0.0872  74   SER A CB    
602  O  OG    . SER A 73  ? 0.4624 0.3806 0.4064 0.0383  0.0006  0.0408  74   SER A OG    
603  N  N     . ASN A 74  ? 0.3696 0.3770 0.3926 0.0072  -0.0163 0.0314  75   ASN A N     
604  C  CA    . ASN A 74  ? 0.3562 0.3356 0.4066 0.0128  0.0071  0.0077  75   ASN A CA    
605  C  C     . ASN A 74  ? 0.3351 0.3527 0.3616 0.0060  0.0020  0.0084  75   ASN A C     
606  O  O     . ASN A 74  ? 0.3575 0.3689 0.3479 0.0253  -0.0214 -0.0244 75   ASN A O     
607  C  CB    . ASN A 74  ? 0.3522 0.3916 0.4135 -0.0258 0.0118  0.0446  75   ASN A CB    
608  C  CG    . ASN A 74  ? 0.4456 0.4209 0.4377 -0.0043 0.0032  0.0242  75   ASN A CG    
609  O  OD1   . ASN A 74  ? 0.4872 0.5903 0.5528 -0.0315 -0.0104 0.0257  75   ASN A OD1   
610  N  ND2   . ASN A 74  ? 0.4057 0.3526 0.4407 0.0474  0.0019  -0.0196 75   ASN A ND2   
611  N  N     . TYR A 75  ? 0.3095 0.3413 0.3316 0.0034  0.0045  0.0040  76   TYR A N     
612  C  CA    . TYR A 75  ? 0.3357 0.3447 0.3370 -0.0035 -0.0293 -0.0135 76   TYR A CA    
613  C  C     . TYR A 75  ? 0.3514 0.3958 0.3654 -0.0042 -0.0022 -0.0135 76   TYR A C     
614  O  O     . TYR A 75  ? 0.3640 0.3698 0.3465 -0.0004 0.0404  0.0061  76   TYR A O     
615  C  CB    . TYR A 75  ? 0.3060 0.3662 0.3208 -0.0016 -0.0254 0.0066  76   TYR A CB    
616  C  CG    . TYR A 75  ? 0.3940 0.4046 0.3498 0.0355  -0.0153 0.0051  76   TYR A CG    
617  C  CD1   . TYR A 75  ? 0.2864 0.3008 0.3666 -0.0239 0.0272  -0.0197 76   TYR A CD1   
618  C  CD2   . TYR A 75  ? 0.4604 0.4110 0.3799 0.0206  0.0209  0.0086  76   TYR A CD2   
619  C  CE1   . TYR A 75  ? 0.3770 0.3277 0.3784 0.0139  -0.0456 0.0195  76   TYR A CE1   
620  C  CE2   . TYR A 75  ? 0.3734 0.4115 0.3531 -0.0272 0.0034  0.0190  76   TYR A CE2   
621  C  CZ    . TYR A 75  ? 0.3136 0.3167 0.3024 0.0223  0.0107  0.0025  76   TYR A CZ    
622  O  OH    . TYR A 75  ? 0.2993 0.3998 0.3369 0.0456  -0.0023 0.0193  76   TYR A OH    
623  N  N     . ILE A 76  ? 0.4013 0.3841 0.3726 -0.0137 0.0114  -0.0282 77   ILE A N     
624  C  CA    . ILE A 76  ? 0.3925 0.3749 0.3884 0.0288  0.0164  -0.0131 77   ILE A CA    
625  C  C     . ILE A 76  ? 0.3576 0.3861 0.3769 0.0085  -0.0077 -0.0044 77   ILE A C     
626  O  O     . ILE A 76  ? 0.3377 0.3496 0.3452 0.0482  0.0297  -0.0265 77   ILE A O     
627  C  CB    . ILE A 76  ? 0.3492 0.3744 0.4353 0.0205  -0.0021 -0.0241 77   ILE A CB    
628  C  CG1   . ILE A 76  ? 0.4331 0.4654 0.4651 -0.0037 0.0540  0.0293  77   ILE A CG1   
629  C  CG2   . ILE A 76  ? 0.3894 0.4061 0.4262 0.0275  -0.0093 0.0030  77   ILE A CG2   
630  C  CD1   . ILE A 76  ? 0.4632 0.4305 0.4520 0.0016  0.0450  0.0172  77   ILE A CD1   
631  N  N     . LEU A 77  ? 0.4048 0.3809 0.3846 0.0231  0.0335  -0.0192 78   LEU A N     
632  C  CA    . LEU A 77  ? 0.3997 0.4388 0.4321 0.0320  0.0216  0.0034  78   LEU A CA    
633  C  C     . LEU A 77  ? 0.4535 0.4086 0.4449 0.0445  0.0173  -0.0127 78   LEU A C     
634  O  O     . LEU A 77  ? 0.4239 0.3893 0.3901 0.0724  0.0152  -0.0364 78   LEU A O     
635  C  CB    . LEU A 77  ? 0.3872 0.4319 0.4099 0.0162  0.0152  -0.0230 78   LEU A CB    
636  C  CG    . LEU A 77  ? 0.4009 0.4997 0.3840 0.0113  0.0148  -0.0173 78   LEU A CG    
637  C  CD1   . LEU A 77  ? 0.3584 0.4394 0.3863 0.0739  0.0450  0.0008  78   LEU A CD1   
638  C  CD2   . LEU A 77  ? 0.3454 0.5136 0.4224 0.0686  0.0466  0.0350  78   LEU A CD2   
639  N  N     . SER A 78  ? 0.4645 0.4977 0.4729 0.0490  0.0267  -0.0125 79   SER A N     
640  C  CA    . SER A 78  ? 0.5530 0.5067 0.5252 0.0285  0.0286  -0.0100 79   SER A CA    
641  C  C     . SER A 78  ? 0.5697 0.5251 0.5163 0.0442  0.0619  -0.0083 79   SER A C     
642  O  O     . SER A 78  ? 0.6015 0.5221 0.4598 0.0583  0.0583  -0.0037 79   SER A O     
643  C  CB    . SER A 78  ? 0.6050 0.5594 0.5172 0.0102  0.0063  0.0064  79   SER A CB    
644  O  OG    . SER A 78  ? 0.6994 0.6496 0.6847 0.0194  -0.0374 -0.0091 79   SER A OG    
645  N  N     . GLU A 79  ? 0.5737 0.5230 0.5218 0.0671  0.0768  0.0063  80   GLU A N     
646  C  CA    . GLU A 79  ? 0.5957 0.5372 0.5377 0.0472  0.0545  0.0035  80   GLU A CA    
647  C  C     . GLU A 79  ? 0.5679 0.5016 0.5485 0.0519  0.0643  -0.0005 80   GLU A C     
648  O  O     . GLU A 79  ? 0.5522 0.4373 0.5418 0.0787  0.0249  0.0292  80   GLU A O     
649  C  CB    . GLU A 79  ? 0.6055 0.5844 0.5347 0.0368  0.1053  -0.0294 80   GLU A CB    
650  C  CG    . GLU A 79  ? 0.7960 0.7344 0.6405 0.0124  0.0157  0.0002  80   GLU A CG    
651  C  CD    . GLU A 79  ? 0.8795 0.8043 0.8139 -0.0348 0.0656  0.0246  80   GLU A CD    
652  O  OE1   . GLU A 79  ? 0.9451 0.7982 0.7192 0.0021  0.0359  0.0180  80   GLU A OE1   
653  O  OE2   . GLU A 79  ? 0.9309 0.8979 0.8430 0.0120  0.0806  0.0387  80   GLU A OE2   
654  N  N     . ILE A 80  ? 0.5734 0.4739 0.5491 0.0353  0.0604  0.0111  81   ILE A N     
655  C  CA    . ILE A 80  ? 0.5783 0.4774 0.5311 0.0537  0.0396  0.0014  81   ILE A CA    
656  C  C     . ILE A 80  ? 0.5866 0.4587 0.5157 0.0510  0.0481  0.0052  81   ILE A C     
657  O  O     . ILE A 80  ? 0.6325 0.5204 0.5167 0.0837  0.0823  0.0060  81   ILE A O     
658  C  CB    . ILE A 80  ? 0.6052 0.5017 0.5734 0.0228  0.0095  0.0351  81   ILE A CB    
659  C  CG1   . ILE A 80  ? 0.6598 0.6075 0.6294 0.0090  0.0418  -0.0046 81   ILE A CG1   
660  C  CG2   . ILE A 80  ? 0.6734 0.5717 0.5388 0.0131  -0.0233 0.0506  81   ILE A CG2   
661  C  CD1   . ILE A 80  ? 0.8633 0.6954 0.6486 -0.0059 0.0316  -0.0325 81   ILE A CD1   
662  N  N     . LYS A 81  ? 0.5614 0.5235 0.5675 0.0597  0.0467  -0.0066 82   LYS A N     
663  C  CA    . LYS A 81  ? 0.5527 0.5484 0.5568 0.0484  0.0277  -0.0118 82   LYS A CA    
664  C  C     . LYS A 81  ? 0.4908 0.5245 0.5077 0.0704  0.0268  -0.0011 82   LYS A C     
665  O  O     . LYS A 81  ? 0.4955 0.4678 0.5576 0.1529  0.0413  -0.0125 82   LYS A O     
666  C  CB    . LYS A 81  ? 0.5886 0.6033 0.6062 0.0205  0.0545  0.0107  82   LYS A CB    
667  C  CG    . LYS A 81  ? 0.7005 0.7544 0.7029 -0.0020 -0.0143 0.0086  82   LYS A CG    
668  C  CD    . LYS A 81  ? 0.8880 0.8432 0.8515 -0.0027 -0.0199 0.0281  82   LYS A CD    
669  C  CE    . LYS A 81  ? 0.8492 0.8593 0.8328 0.0034  -0.0438 0.0237  82   LYS A CE    
670  N  NZ    . LYS A 81  ? 0.8710 0.8795 0.9721 -0.0001 -0.0061 0.0016  82   LYS A NZ    
671  N  N     . PRO A 82  ? 0.5048 0.5101 0.4879 0.0522  0.0152  -0.0073 83   PRO A N     
672  C  CA    . PRO A 82  ? 0.5020 0.4780 0.4982 0.0620  0.0388  0.0050  83   PRO A CA    
673  C  C     . PRO A 82  ? 0.4823 0.4638 0.4900 0.0615  0.0228  0.0069  83   PRO A C     
674  O  O     . PRO A 82  ? 0.4314 0.4938 0.5091 0.0620  0.0854  -0.0217 83   PRO A O     
675  C  CB    . PRO A 82  ? 0.4927 0.4908 0.4476 0.0630  0.0002  -0.0058 83   PRO A CB    
676  C  CG    . PRO A 82  ? 0.5381 0.4726 0.6228 0.0263  0.0009  0.0130  83   PRO A CG    
677  C  CD    . PRO A 82  ? 0.4559 0.5106 0.5428 0.0828  0.0148  -0.0165 83   PRO A CD    
678  N  N     . LEU A 83  ? 0.4764 0.4358 0.5130 0.0576  0.0334  0.0414  84   LEU A N     
679  C  CA    . LEU A 83  ? 0.4495 0.4241 0.5026 0.0652  0.0037  -0.0069 84   LEU A CA    
680  C  C     . LEU A 83  ? 0.5566 0.4795 0.5265 0.0510  0.0113  0.0004  84   LEU A C     
681  O  O     . LEU A 83  ? 0.4933 0.4065 0.5119 0.1175  0.0653  -0.0247 84   LEU A O     
682  C  CB    . LEU A 83  ? 0.5087 0.4251 0.4817 0.0452  0.0248  0.0184  84   LEU A CB    
683  C  CG    . LEU A 83  ? 0.4877 0.3711 0.4854 -0.0028 0.0112  -0.0541 84   LEU A CG    
684  C  CD1   . LEU A 83  ? 0.4381 0.3748 0.3727 0.0509  -0.0087 -0.0752 84   LEU A CD1   
685  C  CD2   . LEU A 83  ? 0.4099 0.4527 0.4348 0.0218  0.0115  -0.0354 84   LEU A CD2   
686  N  N     . ARG A 84  ? 0.5428 0.4379 0.5651 0.1182  0.0131  -0.0319 85   ARG A N     
687  C  CA    . ARG A 84  ? 0.6437 0.5971 0.6218 0.0645  -0.0024 -0.0182 85   ARG A CA    
688  C  C     . ARG A 84  ? 0.5407 0.5041 0.5613 0.1176  0.0261  -0.0249 85   ARG A C     
689  O  O     . ARG A 84  ? 0.4977 0.5630 0.5299 0.1666  0.0540  -0.0199 85   ARG A O     
690  C  CB    . ARG A 84  ? 0.6100 0.5157 0.5555 0.1182  0.0219  -0.0396 85   ARG A CB    
691  C  CG    . ARG A 84  ? 0.6864 0.7320 0.7033 0.0449  0.0307  -0.0218 85   ARG A CG    
692  C  CD    . ARG A 84  ? 0.7028 0.6535 0.7893 0.1091  0.0245  -0.0563 85   ARG A CD    
693  N  NE    . ARG A 84  ? 0.9814 1.0048 1.0886 0.0315  0.0123  -0.0461 85   ARG A NE    
694  C  CZ    . ARG A 84  ? 0.9166 0.9693 1.0757 0.0302  0.0325  -0.0558 85   ARG A CZ    
695  N  NH1   . ARG A 84  ? 0.8959 0.8886 0.9838 0.0741  0.0281  -0.0621 85   ARG A NH1   
696  N  NH2   . ARG A 84  ? 0.8832 0.9254 1.0029 0.0419  0.0168  -0.0130 85   ARG A NH2   
697  N  N     . ASN A 85  ? 0.5522 0.4928 0.5683 0.1145  0.0138  -0.0035 86   ASN A N     
698  C  CA    . ASN A 85  ? 0.4745 0.4815 0.5407 0.0998  0.0166  -0.0216 86   ASN A CA    
699  C  C     . ASN A 85  ? 0.4816 0.5324 0.5218 0.0744  0.0020  -0.0256 86   ASN A C     
700  O  O     . ASN A 85  ? 0.4029 0.5398 0.4687 0.0832  -0.0102 -0.0148 86   ASN A O     
701  C  CB    . ASN A 85  ? 0.5143 0.4960 0.5286 0.0769  0.0055  -0.0353 86   ASN A CB    
702  C  CG    . ASN A 85  ? 0.5991 0.6347 0.6240 0.0465  0.0243  0.0059  86   ASN A CG    
703  O  OD1   . ASN A 85  ? 0.6657 0.6165 0.7465 0.1517  -0.0055 0.0389  86   ASN A OD1   
704  N  ND2   . ASN A 85  ? 0.6605 0.6081 0.6174 0.0930  0.0286  0.0345  86   ASN A ND2   
705  N  N     . PHE A 86  ? 0.4529 0.4962 0.5410 0.0957  0.0177  -0.0180 87   PHE A N     
706  C  CA    . PHE A 86  ? 0.4442 0.4817 0.4853 0.0796  0.0004  0.0055  87   PHE A CA    
707  C  C     . PHE A 86  ? 0.4025 0.4904 0.5051 0.0987  0.0146  0.0066  87   PHE A C     
708  O  O     . PHE A 86  ? 0.3594 0.4834 0.5049 0.1131  -0.0068 -0.0197 87   PHE A O     
709  C  CB    . PHE A 86  ? 0.4468 0.3942 0.4795 0.1087  0.0058  0.0360  87   PHE A CB    
710  C  CG    . PHE A 86  ? 0.4801 0.4603 0.4944 0.0508  0.0197  -0.0103 87   PHE A CG    
711  C  CD1   . PHE A 86  ? 0.4592 0.3577 0.4565 0.0512  0.0161  -0.0361 87   PHE A CD1   
712  C  CD2   . PHE A 86  ? 0.3649 0.4041 0.4030 0.0499  -0.0258 0.0232  87   PHE A CD2   
713  C  CE1   . PHE A 86  ? 0.4272 0.4892 0.4089 0.0503  0.0234  -0.0025 87   PHE A CE1   
714  C  CE2   . PHE A 86  ? 0.5366 0.4512 0.3209 0.0291  0.0035  -0.0129 87   PHE A CE2   
715  C  CZ    . PHE A 86  ? 0.4291 0.4555 0.4259 0.0468  0.0173  0.0367  87   PHE A CZ    
716  N  N     . LEU A 87  ? 0.3965 0.4453 0.4839 0.0886  0.0355  0.0256  88   LEU A N     
717  C  CA    . LEU A 87  ? 0.4494 0.4569 0.4696 0.0978  0.0306  -0.0170 88   LEU A CA    
718  C  C     . LEU A 87  ? 0.4388 0.4754 0.5003 0.0872  0.0275  -0.0129 88   LEU A C     
719  O  O     . LEU A 87  ? 0.4309 0.4872 0.4896 0.1081  0.0478  0.0000  88   LEU A O     
720  C  CB    . LEU A 87  ? 0.3900 0.4152 0.4150 0.0823  0.0505  -0.0138 88   LEU A CB    
721  C  CG    . LEU A 87  ? 0.4633 0.4262 0.4563 0.0506  0.0324  -0.0359 88   LEU A CG    
722  C  CD1   . LEU A 87  ? 0.4368 0.5379 0.5146 0.0150  0.0174  -0.0227 88   LEU A CD1   
723  C  CD2   . LEU A 87  ? 0.3697 0.4596 0.5097 0.0412  0.0346  -0.0168 88   LEU A CD2   
724  N  N     . THR A 88  ? 0.4563 0.5409 0.5511 0.0566  0.0534  0.0017  89   THR A N     
725  C  CA    . THR A 88  ? 0.4269 0.5372 0.5443 0.0779  0.0123  -0.0112 89   THR A CA    
726  C  C     . THR A 88  ? 0.4178 0.5407 0.5166 0.0885  0.0378  -0.0170 89   THR A C     
727  O  O     . THR A 88  ? 0.4433 0.5860 0.5803 0.1281  0.0292  0.0361  89   THR A O     
728  C  CB    . THR A 88  ? 0.4217 0.5365 0.5626 0.0454  0.0064  -0.0526 89   THR A CB    
729  O  OG1   . THR A 88  ? 0.5257 0.4878 0.5986 0.1210  0.0277  -0.0261 89   THR A OG1   
730  C  CG2   . THR A 88  ? 0.4544 0.5594 0.5540 0.0990  0.0006  -0.0198 89   THR A CG2   
731  N  N     . GLN A 89  ? 0.3662 0.5056 0.4811 0.0774  0.0722  -0.0193 90   GLN A N     
732  C  CA    . GLN A 89  ? 0.4120 0.4857 0.5168 0.0459  0.0387  -0.0032 90   GLN A CA    
733  C  C     . GLN A 89  ? 0.3953 0.4714 0.4511 0.0373  0.0191  0.0214  90   GLN A C     
734  O  O     . GLN A 89  ? 0.3115 0.5149 0.5095 0.0659  0.0108  -0.0174 90   GLN A O     
735  C  CB    . GLN A 89  ? 0.4345 0.5272 0.4820 0.0621  0.0591  0.0316  90   GLN A CB    
736  C  CG    . GLN A 89  ? 0.5161 0.5438 0.5896 0.0519  0.0283  0.0100  90   GLN A CG    
737  C  CD    . GLN A 89  ? 0.3955 0.6043 0.5015 0.0637  0.0697  -0.0022 90   GLN A CD    
738  O  OE1   . GLN A 89  ? 0.4280 0.6338 0.5230 0.0615  0.0457  0.0179  90   GLN A OE1   
739  N  NE2   . GLN A 89  ? 0.5257 0.5900 0.5894 0.0424  0.0271  -0.0642 90   GLN A NE2   
740  N  N     . LEU A 90  ? 0.3754 0.4357 0.4824 0.0552  0.0093  0.0424  91   LEU A N     
741  C  CA    . LEU A 90  ? 0.3526 0.4339 0.4173 0.0689  0.0010  0.0279  91   LEU A CA    
742  C  C     . LEU A 90  ? 0.3712 0.4820 0.4521 0.0647  -0.0213 0.0026  91   LEU A C     
743  O  O     . LEU A 90  ? 0.3957 0.4933 0.4666 0.0669  -0.0386 0.0133  91   LEU A O     
744  C  CB    . LEU A 90  ? 0.2938 0.4746 0.4035 0.0645  -0.0292 0.0316  91   LEU A CB    
745  C  CG    . LEU A 90  ? 0.3179 0.4314 0.4452 0.0518  -0.0211 0.0085  91   LEU A CG    
746  C  CD1   . LEU A 90  ? 0.2897 0.3782 0.2986 0.0135  -0.0328 -0.0903 91   LEU A CD1   
747  C  CD2   . LEU A 90  ? 0.3745 0.3817 0.3832 0.0470  0.0048  0.0603  91   LEU A CD2   
748  N  N     . GLN A 91  ? 0.4051 0.4404 0.4786 0.0675  -0.0134 0.0309  92   GLN A N     
749  C  CA    . GLN A 91  ? 0.4386 0.4817 0.5080 0.0712  0.0126  0.0202  92   GLN A CA    
750  C  C     . GLN A 91  ? 0.4790 0.4641 0.5193 0.0463  -0.0073 0.0171  92   GLN A C     
751  O  O     . GLN A 91  ? 0.4102 0.4283 0.5455 0.0353  -0.0203 0.0246  92   GLN A O     
752  C  CB    . GLN A 91  ? 0.5543 0.5088 0.5364 -0.0265 -0.0106 0.0078  92   GLN A CB    
753  C  CG    . GLN A 91  ? 0.6295 0.5850 0.5771 0.0096  0.0250  0.0344  92   GLN A CG    
754  C  CD    . GLN A 91  ? 0.5983 0.5567 0.6301 0.0366  -0.0062 0.0366  92   GLN A CD    
755  O  OE1   . GLN A 91  ? 0.7687 0.7850 0.7555 0.0369  0.0550  -0.0181 92   GLN A OE1   
756  N  NE2   . GLN A 91  ? 0.7497 0.5296 0.6546 0.0182  0.0037  0.0709  92   GLN A NE2   
757  N  N     . PRO A 92  ? 0.5109 0.5134 0.5275 0.0406  -0.0016 0.0448  93   PRO A N     
758  C  CA    . PRO A 92  ? 0.5290 0.5261 0.5285 0.0536  -0.0070 0.0085  93   PRO A CA    
759  C  C     . PRO A 92  ? 0.5330 0.5562 0.5082 0.0380  -0.0130 0.0217  93   PRO A C     
760  O  O     . PRO A 92  ? 0.4672 0.5493 0.4839 0.1282  -0.1177 0.0498  93   PRO A O     
761  C  CB    . PRO A 92  ? 0.5238 0.5328 0.5469 0.0354  -0.0096 0.0144  93   PRO A CB    
762  C  CG    . PRO A 92  ? 0.5571 0.5749 0.5240 0.0406  0.0028  0.0215  93   PRO A CG    
763  C  CD    . PRO A 92  ? 0.5091 0.5544 0.5361 0.0649  0.0027  0.0200  93   PRO A CD    
764  N  N     . PHE A 93  ? 0.4499 0.5135 0.4374 0.0503  -0.0233 0.0468  94   PHE A N     
765  C  CA    . PHE A 93  ? 0.4512 0.4952 0.4405 0.0081  0.0031  0.0249  94   PHE A CA    
766  C  C     . PHE A 93  ? 0.3991 0.4537 0.4157 0.0242  -0.0175 0.0131  94   PHE A C     
767  O  O     . PHE A 93  ? 0.2694 0.4895 0.4068 0.0165  -0.0343 0.0374  94   PHE A O     
768  C  CB    . PHE A 93  ? 0.4428 0.4961 0.4611 -0.0049 0.0190  0.0445  94   PHE A CB    
769  C  CG    . PHE A 93  ? 0.3974 0.5210 0.5064 0.0393  -0.0228 0.0467  94   PHE A CG    
770  C  CD1   . PHE A 93  ? 0.5090 0.5157 0.6179 -0.0154 0.0166  0.0187  94   PHE A CD1   
771  C  CD2   . PHE A 93  ? 0.4421 0.5508 0.5221 0.0407  -0.0198 0.0716  94   PHE A CD2   
772  C  CE1   . PHE A 93  ? 0.5453 0.6547 0.6807 -0.0205 0.0153  -0.0309 94   PHE A CE1   
773  C  CE2   . PHE A 93  ? 0.4359 0.6744 0.4994 0.0023  -0.0488 0.0405  94   PHE A CE2   
774  C  CZ    . PHE A 93  ? 0.4798 0.6190 0.6178 -0.0447 0.0344  -0.0214 94   PHE A CZ    
775  N  N     . LEU A 94  ? 0.4292 0.4276 0.4448 0.0281  -0.0101 0.0379  95   LEU A N     
776  C  CA    . LEU A 94  ? 0.3555 0.4141 0.4215 0.0598  -0.0074 0.0365  95   LEU A CA    
777  C  C     . LEU A 94  ? 0.4026 0.4714 0.4455 0.0543  -0.0260 0.0075  95   LEU A C     
778  O  O     . LEU A 94  ? 0.3587 0.5015 0.4325 0.0926  -0.0027 0.0360  95   LEU A O     
779  C  CB    . LEU A 94  ? 0.3964 0.3789 0.4035 0.0810  0.0060  -0.0228 95   LEU A CB    
780  C  CG    . LEU A 94  ? 0.3165 0.3453 0.4052 0.1010  -0.0302 -0.0011 95   LEU A CG    
781  C  CD1   . LEU A 94  ? 0.3488 0.3495 0.4526 0.0058  0.0023  0.0375  95   LEU A CD1   
782  C  CD2   . LEU A 94  ? 0.3513 0.3879 0.4389 0.0741  0.0244  0.0212  95   LEU A CD2   
783  N  N     . LYS A 95  ? 0.3888 0.4234 0.4454 0.0801  0.0256  -0.0080 96   LYS A N     
784  C  CA    . LYS A 95  ? 0.4176 0.4153 0.4491 0.0440  -0.0284 0.0415  96   LYS A CA    
785  C  C     . LYS A 95  ? 0.4332 0.4573 0.4608 0.0200  -0.0165 0.0665  96   LYS A C     
786  O  O     . LYS A 95  ? 0.4714 0.5483 0.5155 0.0219  -0.0463 0.1344  96   LYS A O     
787  C  CB    . LYS A 95  ? 0.4007 0.4372 0.4010 0.0170  -0.0251 0.0104  96   LYS A CB    
788  C  CG    . LYS A 95  ? 0.4309 0.4273 0.5502 0.0325  -0.0316 -0.0148 96   LYS A CG    
789  C  CD    . LYS A 95  ? 0.4478 0.5127 0.4923 -0.0096 0.0082  -0.0558 96   LYS A CD    
790  C  CE    . LYS A 95  ? 0.4524 0.5444 0.6015 -0.0135 0.0060  0.0627  96   LYS A CE    
791  N  NZ    . LYS A 95  ? 0.4737 0.5386 0.5441 -0.0227 0.0163  0.0646  96   LYS A NZ    
792  N  N     . LEU A 96  ? 0.3854 0.4372 0.4319 0.0302  -0.0271 0.0465  97   LEU A N     
793  C  CA    . LEU A 96  ? 0.4127 0.4156 0.4349 0.0236  0.0081  0.0231  97   LEU A CA    
794  C  C     . LEU A 96  ? 0.4165 0.3921 0.4715 0.0356  0.0213  0.0135  97   LEU A C     
795  O  O     . LEU A 96  ? 0.4607 0.3377 0.4990 0.0176  0.0697  0.0427  97   LEU A O     
796  C  CB    . LEU A 96  ? 0.3774 0.3837 0.3591 0.0499  0.0300  0.0227  97   LEU A CB    
797  C  CG    . LEU A 96  ? 0.4136 0.3752 0.3676 -0.0049 0.0033  0.0077  97   LEU A CG    
798  C  CD1   . LEU A 96  ? 0.3329 0.3230 0.3540 0.1034  0.0841  0.0267  97   LEU A CD1   
799  C  CD2   . LEU A 96  ? 0.4532 0.3847 0.4144 0.0627  -0.0280 0.0887  97   LEU A CD2   
800  N  N     . LYS A 97  ? 0.3737 0.3784 0.3790 0.0558  0.0115  0.0057  98   LYS A N     
801  C  CA    . LYS A 97  ? 0.3671 0.3759 0.4006 0.0618  -0.0169 -0.0008 98   LYS A CA    
802  C  C     . LYS A 97  ? 0.4065 0.3887 0.4141 0.0383  -0.0027 0.0017  98   LYS A C     
803  O  O     . LYS A 97  ? 0.3670 0.3566 0.3343 0.0909  -0.0289 0.0050  98   LYS A O     
804  C  CB    . LYS A 97  ? 0.4024 0.4041 0.4184 0.0059  -0.0003 -0.0293 98   LYS A CB    
805  C  CG    . LYS A 97  ? 0.3420 0.2778 0.3825 0.1029  -0.0079 0.0018  98   LYS A CG    
806  C  CD    . LYS A 97  ? 0.4065 0.4144 0.4121 0.0056  -0.0187 -0.0088 98   LYS A CD    
807  C  CE    . LYS A 97  ? 0.3144 0.5071 0.3989 -0.0072 0.0220  -0.0102 98   LYS A CE    
808  N  NZ    . LYS A 97  ? 0.5487 0.5038 0.5362 -0.0111 0.0414  -0.0209 98   LYS A NZ    
809  N  N     . GLN A 98  ? 0.3913 0.3695 0.3780 0.0178  -0.0266 -0.0003 99   GLN A N     
810  C  CA    . GLN A 98  ? 0.3962 0.4239 0.4454 0.0310  -0.0140 -0.0112 99   GLN A CA    
811  C  C     . GLN A 98  ? 0.4215 0.4422 0.4569 0.0291  -0.0004 0.0356  99   GLN A C     
812  O  O     . GLN A 98  ? 0.3998 0.4166 0.4024 0.0592  -0.0048 0.0480  99   GLN A O     
813  C  CB    . GLN A 98  ? 0.3884 0.4984 0.4433 0.0325  -0.0367 -0.0180 99   GLN A CB    
814  C  CG    . GLN A 98  ? 0.4800 0.5438 0.4766 0.0296  -0.0399 0.0050  99   GLN A CG    
815  C  CD    . GLN A 98  ? 0.5117 0.5831 0.5758 0.0013  -0.0577 0.0106  99   GLN A CD    
816  O  OE1   . GLN A 98  ? 0.6714 0.6973 0.6346 0.0152  -0.0320 0.0492  99   GLN A OE1   
817  N  NE2   . GLN A 98  ? 0.4224 0.6396 0.4999 -0.0358 -0.0794 0.0651  99   GLN A NE2   
818  N  N     . LYS A 99  ? 0.4437 0.4255 0.4004 0.0358  0.0384  0.0338  100  LYS A N     
819  C  CA    . LYS A 99  ? 0.4725 0.4112 0.3976 0.0125  0.0034  0.0510  100  LYS A CA    
820  C  C     . LYS A 99  ? 0.4999 0.4117 0.4345 0.0238  0.0296  0.0345  100  LYS A C     
821  O  O     . LYS A 99  ? 0.5592 0.3981 0.4384 0.0793  0.0032  0.0767  100  LYS A O     
822  C  CB    . LYS A 99  ? 0.4669 0.4140 0.4278 0.0153  0.0338  0.0346  100  LYS A CB    
823  C  CG    . LYS A 99  ? 0.5272 0.5249 0.4007 0.0081  0.0234  0.0500  100  LYS A CG    
824  C  CD    . LYS A 99  ? 0.6296 0.6657 0.4117 0.0073  0.0038  0.0514  100  LYS A CD    
825  C  CE    . LYS A 99  ? 0.6753 0.6754 0.4834 0.0046  -0.0213 0.0076  100  LYS A CE    
826  N  NZ    . LYS A 99  ? 0.7286 0.8028 0.6431 -0.0197 0.0365  0.0379  100  LYS A NZ    
827  N  N     . GLN A 100 ? 0.4271 0.3696 0.3971 0.0385  -0.0016 0.0451  101  GLN A N     
828  C  CA    . GLN A 100 ? 0.4284 0.4198 0.4311 0.0324  0.0103  0.0374  101  GLN A CA    
829  C  C     . GLN A 100 ? 0.4182 0.4337 0.4456 0.0728  -0.0193 0.0262  101  GLN A C     
830  O  O     . GLN A 100 ? 0.4370 0.3987 0.3853 0.0781  0.0381  0.0277  101  GLN A O     
831  C  CB    . GLN A 100 ? 0.3839 0.3950 0.4288 0.0599  0.0093  0.0106  101  GLN A CB    
832  C  CG    . GLN A 100 ? 0.4029 0.4274 0.4089 -0.0091 -0.0069 -0.0282 101  GLN A CG    
833  C  CD    . GLN A 100 ? 0.4287 0.3988 0.4317 0.0169  0.0155  0.0186  101  GLN A CD    
834  O  OE1   . GLN A 100 ? 0.4758 0.4028 0.3479 0.0052  0.0388  0.0309  101  GLN A OE1   
835  N  NE2   . GLN A 100 ? 0.3930 0.3570 0.4342 0.0601  0.0160  -0.0115 101  GLN A NE2   
836  N  N     . ALA A 101 ? 0.3769 0.3948 0.4597 0.0750  0.0056  0.0588  102  ALA A N     
837  C  CA    . ALA A 101 ? 0.4864 0.4740 0.4378 0.0683  0.0000  0.0239  102  ALA A CA    
838  C  C     . ALA A 101 ? 0.4980 0.4734 0.4397 0.0877  -0.0079 0.0219  102  ALA A C     
839  O  O     . ALA A 101 ? 0.4650 0.4726 0.4126 0.0964  -0.0038 0.0061  102  ALA A O     
840  C  CB    . ALA A 101 ? 0.4255 0.4350 0.3900 0.0713  0.0414  0.0384  102  ALA A CB    
841  N  N     . ASN A 102 ? 0.5543 0.5275 0.4760 0.0653  -0.0181 0.0013  103  ASN A N     
842  C  CA    . ASN A 102 ? 0.5351 0.4983 0.4879 0.0785  -0.0212 -0.0056 103  ASN A CA    
843  C  C     . ASN A 102 ? 0.5626 0.4827 0.4938 0.0767  -0.0170 0.0290  103  ASN A C     
844  O  O     . ASN A 102 ? 0.5461 0.5061 0.4472 0.1288  -0.0023 -0.0210 103  ASN A O     
845  C  CB    . ASN A 102 ? 0.5063 0.5453 0.5349 0.0678  -0.0065 0.0145  103  ASN A CB    
846  C  CG    . ASN A 102 ? 0.6294 0.6671 0.6225 0.0574  -0.0405 0.0008  103  ASN A CG    
847  O  OD1   . ASN A 102 ? 0.5804 0.6957 0.6969 0.0901  0.0244  0.0339  103  ASN A OD1   
848  N  ND2   . ASN A 102 ? 0.6539 0.8080 0.6422 0.1076  0.0089  -0.0731 103  ASN A ND2   
849  N  N     . LEU A 103 ? 0.5416 0.4284 0.4641 0.1087  -0.0009 0.0126  104  LEU A N     
850  C  CA    . LEU A 103 ? 0.5187 0.4387 0.4613 0.0589  0.0012  0.0377  104  LEU A CA    
851  C  C     . LEU A 103 ? 0.5443 0.4430 0.4903 0.0592  -0.0036 0.0282  104  LEU A C     
852  O  O     . LEU A 103 ? 0.5531 0.4232 0.4865 0.0948  -0.0041 0.0452  104  LEU A O     
853  C  CB    . LEU A 103 ? 0.5298 0.4383 0.4542 0.0513  -0.0160 0.0281  104  LEU A CB    
854  C  CG    . LEU A 103 ? 0.5840 0.4256 0.5405 0.0417  0.0433  0.0612  104  LEU A CG    
855  C  CD1   . LEU A 103 ? 0.4530 0.2892 0.4987 0.0204  0.0137  0.0189  104  LEU A CD1   
856  C  CD2   . LEU A 103 ? 0.5103 0.2671 0.5155 0.0337  0.0447  -0.0273 104  LEU A CD2   
857  N  N     . VAL A 104 ? 0.5143 0.4371 0.4517 0.0765  0.0265  0.0409  105  VAL A N     
858  C  CA    . VAL A 104 ? 0.4995 0.4294 0.4568 0.0692  0.0210  0.0227  105  VAL A CA    
859  C  C     . VAL A 104 ? 0.5195 0.4427 0.4637 0.0648  0.0327  0.0080  105  VAL A C     
860  O  O     . VAL A 104 ? 0.5326 0.4394 0.4985 0.1327  0.0492  0.0137  105  VAL A O     
861  C  CB    . VAL A 104 ? 0.4379 0.4184 0.4051 0.0791  0.0210  0.0230  105  VAL A CB    
862  C  CG1   . VAL A 104 ? 0.4473 0.4180 0.4990 0.0767  0.0002  -0.0268 105  VAL A CG1   
863  C  CG2   . VAL A 104 ? 0.4359 0.3979 0.3615 0.0550  0.0191  -0.0429 105  VAL A CG2   
864  N  N     . LEU A 105 ? 0.4954 0.3973 0.5012 0.0655  0.0354  0.0275  106  LEU A N     
865  C  CA    . LEU A 105 ? 0.5290 0.4604 0.5257 0.0538  0.0487  0.0108  106  LEU A CA    
866  C  C     . LEU A 105 ? 0.5535 0.4920 0.5441 0.0618  0.0474  0.0107  106  LEU A C     
867  O  O     . LEU A 105 ? 0.5573 0.5229 0.6086 0.0831  0.0222  0.0178  106  LEU A O     
868  C  CB    . LEU A 105 ? 0.5010 0.4335 0.4732 0.0236  0.0657  -0.0103 106  LEU A CB    
869  C  CG    . LEU A 105 ? 0.4923 0.4631 0.4569 0.0467  0.0486  0.0241  106  LEU A CG    
870  C  CD1   . LEU A 105 ? 0.5246 0.4492 0.5356 0.0026  0.0360  -0.0069 106  LEU A CD1   
871  C  CD2   . LEU A 105 ? 0.4630 0.3996 0.5474 0.1227  0.0179  0.0595  106  LEU A CD2   
872  N  N     . LYS A 106 ? 0.5334 0.4755 0.4971 0.0705  0.0526  0.0400  107  LYS A N     
873  C  CA    . LYS A 106 ? 0.5831 0.5018 0.5608 0.0409  0.0375  0.0034  107  LYS A CA    
874  C  C     . LYS A 106 ? 0.5961 0.5328 0.5585 0.0526  0.0359  -0.0080 107  LYS A C     
875  O  O     . LYS A 106 ? 0.5335 0.4619 0.6268 0.1853  0.0317  -0.0190 107  LYS A O     
876  C  CB    . LYS A 106 ? 0.5731 0.4056 0.5316 0.0482  0.0613  0.0542  107  LYS A CB    
877  C  CG    . LYS A 106 ? 0.6591 0.5354 0.6890 0.0638  0.0189  0.0434  107  LYS A CG    
878  C  CD    . LYS A 106 ? 0.8177 0.6874 0.7497 0.0457  0.0349  0.0240  107  LYS A CD    
879  C  CE    . LYS A 106 ? 0.8853 0.7827 0.8309 -0.0205 0.0323  0.0565  107  LYS A CE    
880  N  NZ    . LYS A 106 ? 0.9910 0.9475 0.8725 0.0015  0.0035  0.0427  107  LYS A NZ    
881  N  N     . ILE A 107 ? 0.5319 0.4849 0.5308 0.0829  0.0401  -0.0383 108  ILE A N     
882  C  CA    . ILE A 107 ? 0.5194 0.5065 0.5458 0.0628  0.0480  -0.0021 108  ILE A CA    
883  C  C     . ILE A 107 ? 0.5824 0.5324 0.5761 0.0501  0.0363  -0.0382 108  ILE A C     
884  O  O     . ILE A 107 ? 0.5692 0.4890 0.6308 0.0917  0.0733  -0.0338 108  ILE A O     
885  C  CB    . ILE A 107 ? 0.5352 0.5299 0.5443 0.0443  0.0325  -0.0056 108  ILE A CB    
886  C  CG1   . ILE A 107 ? 0.5404 0.3889 0.4865 0.0698  0.0404  0.0210  108  ILE A CG1   
887  C  CG2   . ILE A 107 ? 0.5458 0.5159 0.5409 0.0872  0.0279  -0.0519 108  ILE A CG2   
888  C  CD1   . ILE A 107 ? 0.5210 0.5697 0.5189 0.0539  0.0626  0.0086  108  ILE A CD1   
889  N  N     . THR A 108 ? 0.5882 0.5456 0.6167 0.0545  0.0638  -0.0206 109  THR A N     
890  C  CA    . THR A 108 ? 0.6442 0.6104 0.6294 0.0430  0.0576  -0.0080 109  THR A CA    
891  C  C     . THR A 108 ? 0.6913 0.6712 0.6873 0.0429  0.0418  -0.0238 109  THR A C     
892  O  O     . THR A 108 ? 0.6354 0.6801 0.6758 0.0663  0.0571  -0.0275 109  THR A O     
893  C  CB    . THR A 108 ? 0.6259 0.6050 0.6202 0.0639  0.0743  0.0151  109  THR A CB    
894  O  OG1   . THR A 108 ? 0.7188 0.5768 0.5739 0.0066  0.0992  0.0749  109  THR A OG1   
895  C  CG2   . THR A 108 ? 0.7301 0.6778 0.6586 0.0267  0.0368  0.0184  109  THR A CG2   
896  N  N     . GLU A 109 ? 0.7345 0.7172 0.7154 0.0430  0.0208  -0.0129 110  GLU A N     
897  C  CA    . GLU A 109 ? 0.8190 0.7980 0.8038 0.0329  0.0236  -0.0182 110  GLU A CA    
898  C  C     . GLU A 109 ? 0.7923 0.7608 0.7741 0.0395  0.0248  -0.0030 110  GLU A C     
899  O  O     . GLU A 109 ? 0.8264 0.7238 0.8085 0.0537  0.0349  -0.0065 110  GLU A O     
900  C  CB    . GLU A 109 ? 0.8028 0.8110 0.7699 0.0401  0.0123  -0.0081 110  GLU A CB    
901  C  CG    . GLU A 109 ? 0.8945 0.9085 0.9080 0.0323  0.0050  -0.0073 110  GLU A CG    
902  C  CD    . GLU A 109 ? 0.8809 0.9522 0.8894 0.0243  -0.0139 -0.0091 110  GLU A CD    
903  O  OE1   . GLU A 109 ? 0.9948 1.1069 1.0742 0.0051  0.0066  0.0073  110  GLU A OE1   
904  O  OE2   . GLU A 109 ? 0.9730 1.0825 1.0097 0.0165  0.0197  -0.0086 110  GLU A OE2   
905  N  N     . GLN A 110 ? 0.7529 0.7398 0.7471 0.0450  0.0301  -0.0251 111  GLN A N     
906  C  CA    . GLN A 110 ? 0.7731 0.7452 0.7653 0.0458  0.0275  -0.0308 111  GLN A CA    
907  C  C     . GLN A 110 ? 0.7971 0.7489 0.7817 0.0406  0.0258  -0.0357 111  GLN A C     
908  O  O     . GLN A 110 ? 0.8214 0.7859 0.7999 0.0512  0.0415  -0.0583 111  GLN A O     
909  C  CB    . GLN A 110 ? 0.7494 0.7288 0.7586 0.0529  0.0264  -0.0363 111  GLN A CB    
910  C  CG    . GLN A 110 ? 0.7748 0.7472 0.7238 0.0420  0.0387  -0.0276 111  GLN A CG    
911  C  CD    . GLN A 110 ? 0.7860 0.7608 0.8060 0.0229  -0.0167 -0.0393 111  GLN A CD    
912  O  OE1   . GLN A 110 ? 0.8830 0.8070 0.8856 0.1072  0.0424  -0.0552 111  GLN A OE1   
913  N  NE2   . GLN A 110 ? 0.7480 0.8003 0.7991 0.0965  -0.0436 -0.0057 111  GLN A NE2   
914  N  N     . LEU A 111 ? 0.8135 0.7445 0.7841 0.0471  0.0246  -0.0537 112  LEU A N     
915  C  CA    . LEU A 111 ? 0.8367 0.7568 0.7873 0.0383  0.0139  -0.0562 112  LEU A CA    
916  C  C     . LEU A 111 ? 0.8649 0.8074 0.8546 0.0396  0.0202  -0.0482 112  LEU A C     
917  O  O     . LEU A 111 ? 0.8368 0.7922 0.8632 0.0442  0.0262  -0.0566 112  LEU A O     
918  C  CB    . LEU A 111 ? 0.8264 0.7367 0.7369 0.0438  0.0226  -0.0633 112  LEU A CB    
919  C  CG    . LEU A 111 ? 0.7221 0.6991 0.6999 0.0600  -0.0057 -0.0059 112  LEU A CG    
920  C  CD1   . LEU A 111 ? 0.7567 0.6738 0.5673 0.0225  0.0475  -0.0252 112  LEU A CD1   
921  C  CD2   . LEU A 111 ? 0.6568 0.5377 0.5796 0.0356  0.0797  -0.0345 112  LEU A CD2   
922  N  N     . PRO A 112 ? 0.8854 0.8506 0.8984 0.0229  0.0234  -0.0365 113  PRO A N     
923  C  CA    . PRO A 112 ? 0.9142 0.8958 0.9253 0.0245  0.0218  -0.0381 113  PRO A CA    
924  C  C     . PRO A 112 ? 0.9310 0.9055 0.9302 0.0357  0.0212  -0.0340 113  PRO A C     
925  O  O     . PRO A 112 ? 0.9259 0.9199 0.9210 0.0580  0.0089  -0.0363 113  PRO A O     
926  C  CB    . PRO A 112 ? 0.9198 0.9106 0.9406 0.0104  0.0163  -0.0446 113  PRO A CB    
927  C  CG    . PRO A 112 ? 0.9231 0.8838 0.9335 0.0102  0.0139  -0.0366 113  PRO A CG    
928  C  CD    . PRO A 112 ? 0.8866 0.8528 0.9032 0.0209  0.0073  -0.0355 113  PRO A CD    
929  N  N     . SER A 113 ? 0.9668 0.9335 0.9316 0.0417  0.0190  -0.0334 114  SER A N     
930  C  CA    . SER A 113 ? 0.9878 0.9544 0.9618 0.0223  0.0094  -0.0163 114  SER A CA    
931  C  C     . SER A 113 ? 1.0099 0.9684 0.9919 0.0126  0.0146  -0.0060 114  SER A C     
932  O  O     . SER A 113 ? 1.0218 0.9585 1.0075 0.0154  0.0170  0.0056  114  SER A O     
933  C  CB    . SER A 113 ? 1.0077 0.9562 0.9524 0.0236  0.0039  -0.0166 114  SER A CB    
934  O  OG    . SER A 113 ? 0.9928 0.9751 0.9599 0.0248  -0.0443 -0.0110 114  SER A OG    
935  N  N     . ALA A 114 ? 1.0118 0.9597 1.0031 0.0107  0.0088  -0.0074 115  ALA A N     
936  C  CA    . ALA A 114 ? 1.0181 0.9824 1.0075 0.0163  0.0090  -0.0036 115  ALA A CA    
937  C  C     . ALA A 114 ? 1.0483 0.9999 1.0319 0.0185  0.0110  -0.0015 115  ALA A C     
938  O  O     . ALA A 114 ? 1.0498 0.9955 1.0273 0.0194  0.0186  0.0142  115  ALA A O     
939  C  CB    . ALA A 114 ? 1.0075 1.0003 0.9891 0.0015  0.0036  -0.0090 115  ALA A CB    
940  N  N     . LYS A 115 ? 1.1043 1.0485 1.0657 0.0212  0.0058  -0.0056 116  LYS A N     
941  C  CA    . LYS A 115 ? 1.1324 1.0800 1.0909 0.0136  -0.0055 -0.0056 116  LYS A CA    
942  C  C     . LYS A 115 ? 1.1464 1.0910 1.1109 0.0101  -0.0030 -0.0048 116  LYS A C     
943  O  O     . LYS A 115 ? 1.1616 1.0886 1.1221 0.0010  -0.0053 -0.0050 116  LYS A O     
944  C  CB    . LYS A 115 ? 1.1309 1.0802 1.0794 0.0182  -0.0131 0.0015  116  LYS A CB    
945  N  N     . GLU A 116 ? 1.1394 1.0994 1.1239 0.0150  -0.0020 -0.0050 117  GLU A N     
946  C  CA    . GLU A 116 ? 1.1279 1.0960 1.1224 0.0094  0.0004  -0.0050 117  GLU A CA    
947  C  C     . GLU A 116 ? 1.1122 1.0990 1.1103 0.0086  0.0043  -0.0091 117  GLU A C     
948  O  O     . GLU A 116 ? 1.1135 1.0989 1.1159 0.0032  0.0083  -0.0147 117  GLU A O     
949  C  CB    . GLU A 116 ? 1.1318 1.0928 1.1262 0.0131  0.0019  -0.0106 117  GLU A CB    
950  N  N     . SER A 117 ? 1.0916 1.0884 1.0919 0.0139  0.0012  -0.0162 118  SER A N     
951  C  CA    . SER A 117 ? 1.0785 1.0754 1.0931 0.0110  -0.0009 -0.0191 118  SER A CA    
952  C  C     . SER A 117 ? 1.0633 1.0739 1.0718 0.0009  0.0045  -0.0055 118  SER A C     
953  O  O     . SER A 117 ? 1.0298 1.0633 1.0565 0.0081  0.0107  0.0002  118  SER A O     
954  C  CB    . SER A 117 ? 1.0860 1.0840 1.1034 0.0145  -0.0041 -0.0220 118  SER A CB    
955  O  OG    . SER A 117 ? 1.1226 1.0850 1.1468 0.0291  -0.0160 -0.0407 118  SER A OG    
956  N  N     . PRO A 118 ? 1.0753 1.0750 1.0607 -0.0031 0.0044  -0.0066 119  PRO A N     
957  C  CA    . PRO A 118 ? 1.0739 1.0726 1.0688 -0.0050 0.0000  -0.0027 119  PRO A CA    
958  C  C     . PRO A 118 ? 1.0735 1.0583 1.0597 -0.0025 -0.0030 0.0019  119  PRO A C     
959  O  O     . PRO A 118 ? 1.0909 1.0900 1.0959 -0.0093 -0.0050 0.0120  119  PRO A O     
960  C  CB    . PRO A 118 ? 1.0736 1.0717 1.0706 -0.0061 -0.0039 -0.0006 119  PRO A CB    
961  C  CG    . PRO A 118 ? 1.0611 1.0533 1.0437 0.0083  0.0053  -0.0023 119  PRO A CG    
962  C  CD    . PRO A 118 ? 1.0766 1.0594 1.0570 0.0008  0.0082  -0.0084 119  PRO A CD    
963  N  N     . ASP A 119 ? 1.0412 1.0163 1.0321 0.0020  0.0010  -0.0008 120  ASP A N     
964  C  CA    . ASP A 119 ? 0.9960 0.9316 1.0067 0.0073  -0.0048 -0.0066 120  ASP A CA    
965  C  C     . ASP A 119 ? 0.9421 0.8598 0.9566 0.0267  -0.0075 -0.0051 120  ASP A C     
966  O  O     . ASP A 119 ? 0.8886 0.7190 0.9491 0.0479  -0.0338 -0.0228 120  ASP A O     
967  C  CB    . ASP A 119 ? 1.0322 0.9736 1.0241 0.0054  0.0040  -0.0038 120  ASP A CB    
968  C  CG    . ASP A 119 ? 1.0932 0.9899 1.0689 -0.0184 0.0175  -0.0013 120  ASP A CG    
969  O  OD1   . ASP A 119 ? 1.1275 1.0346 1.0991 -0.0227 0.0406  0.0016  120  ASP A OD1   
970  O  OD2   . ASP A 119 ? 1.1398 1.0314 1.0902 -0.0034 0.0446  -0.0319 120  ASP A OD2   
971  N  N     . LYS A 120 ? 0.8799 0.7903 0.9232 0.0320  -0.0062 -0.0009 121  LYS A N     
972  C  CA    . LYS A 120 ? 0.8497 0.8027 0.8886 0.0337  0.0000  -0.0075 121  LYS A CA    
973  C  C     . LYS A 120 ? 0.8348 0.7801 0.8522 0.0282  -0.0029 -0.0096 121  LYS A C     
974  O  O     . LYS A 120 ? 0.8193 0.7749 0.8343 0.0373  0.0111  -0.0104 121  LYS A O     
975  C  CB    . LYS A 120 ? 0.8492 0.8062 0.8874 0.0243  0.0016  -0.0123 121  LYS A CB    
976  C  CG    . LYS A 120 ? 0.8464 0.8286 0.9078 0.0267  -0.0017 -0.0087 121  LYS A CG    
977  C  CD    . LYS A 120 ? 0.9032 0.8711 0.9084 0.0133  -0.0125 0.0035  121  LYS A CD    
978  C  CE    . LYS A 120 ? 0.8865 0.8561 0.9296 0.0115  -0.0388 0.0125  121  LYS A CE    
979  N  NZ    . LYS A 120 ? 0.9166 0.9075 0.9155 -0.0208 -0.0533 -0.0327 121  LYS A NZ    
980  N  N     . PHE A 121 ? 0.8073 0.7390 0.8228 0.0362  0.0050  -0.0231 122  PHE A N     
981  C  CA    . PHE A 121 ? 0.7867 0.7293 0.7585 0.0114  0.0021  -0.0145 122  PHE A CA    
982  C  C     . PHE A 121 ? 0.7905 0.7135 0.7691 0.0155  0.0158  -0.0116 122  PHE A C     
983  O  O     . PHE A 121 ? 0.8107 0.7429 0.7308 0.0026  0.0320  -0.0299 122  PHE A O     
984  C  CB    . PHE A 121 ? 0.7769 0.6867 0.7527 0.0148  -0.0013 -0.0157 122  PHE A CB    
985  C  CG    . PHE A 121 ? 0.7271 0.6813 0.6651 0.0065  -0.0084 -0.0183 122  PHE A CG    
986  C  CD1   . PHE A 121 ? 0.6811 0.5958 0.7003 0.0000  0.0059  -0.0528 122  PHE A CD1   
987  C  CD2   . PHE A 121 ? 0.6897 0.6012 0.6483 -0.0233 -0.0039 -0.0278 122  PHE A CD2   
988  C  CE1   . PHE A 121 ? 0.6791 0.5917 0.6229 -0.0445 -0.0214 -0.0038 122  PHE A CE1   
989  C  CE2   . PHE A 121 ? 0.6617 0.5706 0.5880 -0.0019 -0.0254 -0.0195 122  PHE A CE2   
990  C  CZ    . PHE A 121 ? 0.6369 0.6051 0.5905 -0.0108 0.0028  -0.0515 122  PHE A CZ    
991  N  N     . LEU A 122 ? 0.7701 0.6342 0.7433 0.0072  0.0139  -0.0277 123  LEU A N     
992  C  CA    . LEU A 122 ? 0.7776 0.6405 0.7490 -0.0015 0.0057  0.0070  123  LEU A CA    
993  C  C     . LEU A 122 ? 0.7501 0.5924 0.7324 -0.0017 0.0038  0.0194  123  LEU A C     
994  O  O     . LEU A 122 ? 0.7431 0.5645 0.7075 -0.0201 0.0153  0.0282  123  LEU A O     
995  C  CB    . LEU A 122 ? 0.7771 0.6574 0.7709 -0.0061 0.0046  -0.0014 123  LEU A CB    
996  C  CG    . LEU A 122 ? 0.8418 0.7935 0.8337 -0.0058 0.0084  -0.0067 123  LEU A CG    
997  C  CD1   . LEU A 122 ? 0.9686 0.9162 0.8777 -0.0090 -0.0029 -0.0194 123  LEU A CD1   
998  C  CD2   . LEU A 122 ? 0.9199 0.8360 0.8452 0.0047  -0.0098 0.0188  123  LEU A CD2   
999  N  N     . GLU A 123 ? 0.7267 0.5108 0.7274 0.0003  0.0119  0.0152  124  GLU A N     
1000 C  CA    . GLU A 123 ? 0.7221 0.5429 0.6850 0.0204  -0.0085 0.0222  124  GLU A CA    
1001 C  C     . GLU A 123 ? 0.7297 0.5398 0.6638 0.0444  0.0037  0.0222  124  GLU A C     
1002 O  O     . GLU A 123 ? 0.7562 0.5310 0.6662 0.0559  0.0087  0.0286  124  GLU A O     
1003 C  CB    . GLU A 123 ? 0.7241 0.5020 0.7152 0.0343  -0.0008 0.0109  124  GLU A CB    
1004 C  CG    . GLU A 123 ? 0.7498 0.6231 0.7058 0.0401  -0.0319 -0.0031 124  GLU A CG    
1005 C  CD    . GLU A 123 ? 0.8296 0.7950 0.8606 0.0459  0.0056  0.0028  124  GLU A CD    
1006 O  OE1   . GLU A 123 ? 0.9612 0.8276 0.8384 0.0407  -0.0440 -0.0269 124  GLU A OE1   
1007 O  OE2   . GLU A 123 ? 0.9056 0.8300 0.8697 0.0386  -0.0373 -0.0001 124  GLU A OE2   
1008 N  N     . VAL A 124 ? 0.7065 0.5428 0.6626 0.0484  0.0077  0.0322  125  VAL A N     
1009 C  CA    . VAL A 124 ? 0.6681 0.5258 0.5909 0.0342  0.0163  0.0228  125  VAL A CA    
1010 C  C     . VAL A 124 ? 0.6252 0.4728 0.5689 0.0357  0.0011  0.0215  125  VAL A C     
1011 O  O     . VAL A 124 ? 0.6043 0.5488 0.4944 0.0507  0.0356  0.0071  125  VAL A O     
1012 C  CB    . VAL A 124 ? 0.6703 0.5633 0.6182 0.0316  0.0200  0.0368  125  VAL A CB    
1013 C  CG1   . VAL A 124 ? 0.6848 0.5022 0.5537 0.0011  0.0301  -0.0159 125  VAL A CG1   
1014 C  CG2   . VAL A 124 ? 0.6960 0.5913 0.5819 0.0465  0.0178  -0.0202 125  VAL A CG2   
1015 N  N     . CYS A 125 ? 0.6335 0.3943 0.5601 0.0701  0.0045  0.0254  126  CYS A N     
1016 C  CA    . CYS A 125 ? 0.6164 0.4769 0.5633 0.0324  -0.0100 0.0223  126  CYS A CA    
1017 C  C     . CYS A 125 ? 0.6237 0.5031 0.5620 0.0403  -0.0207 0.0283  126  CYS A C     
1018 O  O     . CYS A 125 ? 0.5476 0.5348 0.5440 0.0561  -0.0464 0.0373  126  CYS A O     
1019 C  CB    . CYS A 125 ? 0.6522 0.4561 0.5302 0.0382  -0.0338 0.0359  126  CYS A CB    
1020 S  SG    . CYS A 125 ? 0.6808 0.4181 0.5521 0.0321  -0.0140 -0.0478 126  CYS A SG    
1021 N  N     . THR A 126 ? 0.6197 0.4841 0.5952 0.0565  -0.0221 0.0248  127  THR A N     
1022 C  CA    . THR A 126 ? 0.6212 0.4759 0.5532 0.0360  -0.0142 0.0295  127  THR A CA    
1023 C  C     . THR A 126 ? 0.6213 0.5111 0.5789 0.0325  -0.0084 0.0415  127  THR A C     
1024 O  O     . THR A 126 ? 0.7002 0.4560 0.5584 0.0214  -0.0030 0.0353  127  THR A O     
1025 C  CB    . THR A 126 ? 0.6184 0.5158 0.5853 0.0411  -0.0078 0.0256  127  THR A CB    
1026 O  OG1   . THR A 126 ? 0.6403 0.4737 0.6067 0.0334  -0.0254 0.0529  127  THR A OG1   
1027 C  CG2   . THR A 126 ? 0.6042 0.4557 0.5663 0.0286  -0.0250 0.0361  127  THR A CG2   
1028 N  N     . TRP A 127 ? 0.6011 0.5103 0.5339 0.0383  -0.0044 0.0390  128  TRP A N     
1029 C  CA    . TRP A 127 ? 0.5838 0.4829 0.5546 0.0345  -0.0073 0.0269  128  TRP A CA    
1030 C  C     . TRP A 127 ? 0.5847 0.4581 0.5271 0.0233  -0.0037 0.0219  128  TRP A C     
1031 O  O     . TRP A 127 ? 0.6147 0.4304 0.5124 0.0072  0.0151  0.0297  128  TRP A O     
1032 C  CB    . TRP A 127 ? 0.6072 0.5388 0.6090 0.0369  0.0000  0.0311  128  TRP A CB    
1033 C  CG    . TRP A 127 ? 0.6348 0.5461 0.6327 0.0625  -0.0020 0.0482  128  TRP A CG    
1034 C  CD1   . TRP A 127 ? 0.6562 0.6408 0.6880 0.0406  -0.0030 0.0444  128  TRP A CD1   
1035 C  CD2   . TRP A 127 ? 0.6184 0.6087 0.6672 0.0758  -0.0042 0.0621  128  TRP A CD2   
1036 N  NE1   . TRP A 127 ? 0.7494 0.5695 0.6908 0.0804  -0.0034 0.1485  128  TRP A NE1   
1037 C  CE2   . TRP A 127 ? 0.6978 0.6599 0.7170 0.0750  0.0302  0.0706  128  TRP A CE2   
1038 C  CE3   . TRP A 127 ? 0.5986 0.5787 0.6488 0.0474  -0.0036 0.0443  128  TRP A CE3   
1039 C  CZ2   . TRP A 127 ? 0.7016 0.6194 0.7137 0.0770  0.0135  0.0732  128  TRP A CZ2   
1040 C  CZ3   . TRP A 127 ? 0.6836 0.6343 0.6857 0.0603  0.0172  0.0599  128  TRP A CZ3   
1041 C  CH2   . TRP A 127 ? 0.6887 0.6552 0.7362 0.0778  0.0090  0.0337  128  TRP A CH2   
1042 N  N     . VAL A 128 ? 0.5566 0.4523 0.5231 0.0378  0.0024  0.0161  129  VAL A N     
1043 C  CA    . VAL A 128 ? 0.5291 0.4281 0.4809 0.0355  0.0229  0.0072  129  VAL A CA    
1044 C  C     . VAL A 128 ? 0.5403 0.4436 0.5052 0.0163  0.0048  0.0177  129  VAL A C     
1045 O  O     . VAL A 128 ? 0.4929 0.3441 0.4062 0.0231  -0.0109 0.0154  129  VAL A O     
1046 C  CB    . VAL A 128 ? 0.4909 0.4437 0.5128 0.0222  0.0262  0.0163  129  VAL A CB    
1047 C  CG1   . VAL A 128 ? 0.4555 0.4465 0.3718 0.0932  0.0305  -0.0567 129  VAL A CG1   
1048 C  CG2   . VAL A 128 ? 0.6285 0.3398 0.5277 0.0162  0.0369  -0.0042 129  VAL A CG2   
1049 N  N     . ASP A 129 ? 0.5647 0.4463 0.4959 0.0021  0.0193  0.0294  130  ASP A N     
1050 C  CA    . ASP A 129 ? 0.5644 0.4670 0.5198 0.0000  0.0178  0.0048  130  ASP A CA    
1051 C  C     . ASP A 129 ? 0.5481 0.4113 0.5010 -0.0029 0.0243  0.0162  130  ASP A C     
1052 O  O     . ASP A 129 ? 0.5538 0.3608 0.4965 0.0054  -0.0086 -0.0262 130  ASP A O     
1053 C  CB    . ASP A 129 ? 0.5642 0.4483 0.5480 -0.0125 0.0171  0.0323  130  ASP A CB    
1054 C  CG    . ASP A 129 ? 0.6376 0.4899 0.5684 0.0214  -0.0002 0.0151  130  ASP A CG    
1055 O  OD1   . ASP A 129 ? 0.7236 0.4058 0.4926 0.0170  0.0407  -0.0175 130  ASP A OD1   
1056 O  OD2   . ASP A 129 ? 0.6718 0.4674 0.6458 0.0910  0.0584  0.0429  130  ASP A OD2   
1057 N  N     . GLN A 130 ? 0.5040 0.3402 0.4548 0.0059  0.0186  0.0392  131  GLN A N     
1058 C  CA    . GLN A 130 ? 0.5571 0.3719 0.4491 0.0042  0.0022  0.0321  131  GLN A CA    
1059 C  C     . GLN A 130 ? 0.5570 0.3608 0.4273 0.0145  0.0235  0.0469  131  GLN A C     
1060 O  O     . GLN A 130 ? 0.5466 0.3294 0.3852 -0.0143 -0.0056 0.0629  131  GLN A O     
1061 C  CB    . GLN A 130 ? 0.5197 0.3512 0.4354 0.0270  0.0169  0.0372  131  GLN A CB    
1062 C  CG    . GLN A 130 ? 0.6636 0.5021 0.5704 -0.0112 -0.0092 0.0476  131  GLN A CG    
1063 C  CD    . GLN A 130 ? 0.6771 0.6335 0.6680 0.0644  -0.0157 0.0101  131  GLN A CD    
1064 O  OE1   . GLN A 130 ? 0.8110 0.8215 0.7038 0.0773  -0.0053 0.0569  131  GLN A OE1   
1065 N  NE2   . GLN A 130 ? 0.7623 0.7908 0.7331 0.0114  -0.0383 0.0384  131  GLN A NE2   
1066 N  N     . ILE A 131 ? 0.5535 0.4449 0.4198 0.0216  -0.0041 0.0333  132  ILE A N     
1067 C  CA    . ILE A 131 ? 0.4844 0.4048 0.3865 0.0243  0.0196  0.0377  132  ILE A CA    
1068 C  C     . ILE A 131 ? 0.4939 0.4405 0.4150 0.0168  0.0180  0.0264  132  ILE A C     
1069 O  O     . ILE A 131 ? 0.4638 0.4467 0.4519 0.0243  0.0286  0.0447  132  ILE A O     
1070 C  CB    . ILE A 131 ? 0.4746 0.3930 0.4280 0.0133  0.0212  0.0519  132  ILE A CB    
1071 C  CG1   . ILE A 131 ? 0.4476 0.4799 0.3670 0.0476  0.0013  0.0007  132  ILE A CG1   
1072 C  CG2   . ILE A 131 ? 0.4483 0.3366 0.4208 0.0663  0.0319  -0.0204 132  ILE A CG2   
1073 C  CD1   . ILE A 131 ? 0.4511 0.3970 0.3839 0.0340  0.0279  0.0298  132  ILE A CD1   
1074 N  N     . ALA A 132 ? 0.4777 0.4769 0.4244 0.0480  0.0308  0.0245  133  ALA A N     
1075 C  CA    . ALA A 132 ? 0.4811 0.4513 0.4285 0.0076  0.0364  -0.0035 133  ALA A CA    
1076 C  C     . ALA A 132 ? 0.5170 0.4671 0.4679 0.0059  0.0234  0.0215  133  ALA A C     
1077 O  O     . ALA A 132 ? 0.4613 0.4737 0.4108 -0.0053 0.0397  -0.0044 133  ALA A O     
1078 C  CB    . ALA A 132 ? 0.5019 0.4892 0.4731 0.0304  0.0398  0.0004  133  ALA A CB    
1079 N  N     . ALA A 133 ? 0.5389 0.4090 0.4575 0.0403  0.0010  0.0151  134  ALA A N     
1080 C  CA    . ALA A 133 ? 0.5445 0.3939 0.4525 0.0143  0.0067  0.0043  134  ALA A CA    
1081 C  C     . ALA A 133 ? 0.5425 0.4316 0.4707 0.0314  0.0081  0.0037  134  ALA A C     
1082 O  O     . ALA A 133 ? 0.6028 0.4381 0.4423 0.0108  0.0284  -0.0231 134  ALA A O     
1083 C  CB    . ALA A 133 ? 0.5526 0.3942 0.4652 0.0087  -0.0297 0.0337  134  ALA A CB    
1084 N  N     . LEU A 134 ? 0.4807 0.4266 0.4401 0.0203  0.0172  0.0251  135  LEU A N     
1085 C  CA    . LEU A 134 ? 0.4431 0.3583 0.4244 0.0445  0.0054  0.0068  135  LEU A CA    
1086 C  C     . LEU A 134 ? 0.4453 0.4037 0.4073 0.0049  -0.0055 0.0107  135  LEU A C     
1087 O  O     . LEU A 134 ? 0.4629 0.3107 0.3692 0.0703  -0.0047 0.0296  135  LEU A O     
1088 C  CB    . LEU A 134 ? 0.4298 0.3657 0.4173 0.0178  -0.0012 0.0233  135  LEU A CB    
1089 C  CG    . LEU A 134 ? 0.3909 0.4380 0.3879 0.0609  0.0269  -0.0059 135  LEU A CG    
1090 C  CD1   . LEU A 134 ? 0.4075 0.3552 0.4219 0.0971  0.0426  0.0117  135  LEU A CD1   
1091 C  CD2   . LEU A 134 ? 0.5428 0.4924 0.4436 0.0581  -0.0392 -0.0099 135  LEU A CD2   
1092 N  N     . ASN A 135 ? 0.4230 0.3696 0.4225 0.0069  -0.0034 0.0366  136  ASN A N     
1093 C  CA    . ASN A 135 ? 0.4272 0.4021 0.4129 0.0162  0.0071  0.0202  136  ASN A CA    
1094 C  C     . ASN A 135 ? 0.4425 0.3994 0.4116 -0.0067 -0.0172 -0.0109 136  ASN A C     
1095 O  O     . ASN A 135 ? 0.5035 0.3327 0.3775 0.0000  0.0114  0.0444  136  ASN A O     
1096 C  CB    . ASN A 135 ? 0.3973 0.3341 0.3809 0.0385  -0.0076 0.0032  136  ASN A CB    
1097 C  CG    . ASN A 135 ? 0.4518 0.3296 0.3997 0.0118  0.0219  0.0333  136  ASN A CG    
1098 O  OD1   . ASN A 135 ? 0.3743 0.3640 0.3372 0.0459  0.0185  -0.0022 136  ASN A OD1   
1099 N  ND2   . ASN A 135 ? 0.3748 0.3336 0.3417 -0.0208 -0.0515 -0.0067 136  ASN A ND2   
1100 N  N     . ASP A 136 ? 0.4362 0.3684 0.4056 -0.0020 -0.0266 -0.0147 137  ASP A N     
1101 C  CA    . ASP A 136 ? 0.4362 0.4226 0.4349 -0.0048 -0.0103 0.0008  137  ASP A CA    
1102 C  C     . ASP A 136 ? 0.4148 0.3911 0.4045 -0.0048 -0.0050 -0.0107 137  ASP A C     
1103 O  O     . ASP A 136 ? 0.3959 0.3734 0.3250 -0.0244 0.0193  -0.0130 137  ASP A O     
1104 C  CB    . ASP A 136 ? 0.3734 0.4008 0.3882 0.0220  -0.0258 -0.0535 137  ASP A CB    
1105 C  CG    . ASP A 136 ? 0.4753 0.4293 0.4596 -0.0070 -0.0289 0.0210  137  ASP A CG    
1106 O  OD1   . ASP A 136 ? 0.4693 0.3998 0.4485 0.0247  -0.0633 -0.0038 137  ASP A OD1   
1107 O  OD2   . ASP A 136 ? 0.4326 0.3926 0.4433 -0.0032 -0.0067 -0.0382 137  ASP A OD2   
1108 N  N     . SER A 137 ? 0.4445 0.4249 0.4429 0.0059  0.0304  -0.0226 138  SER A N     
1109 C  CA    . SER A 137 ? 0.4609 0.4078 0.4347 -0.0016 0.0040  -0.0352 138  SER A CA    
1110 C  C     . SER A 137 ? 0.4718 0.4338 0.4271 -0.0006 -0.0019 -0.0282 138  SER A C     
1111 O  O     . SER A 137 ? 0.4752 0.4501 0.4742 -0.0082 0.0256  -0.0340 138  SER A O     
1112 C  CB    . SER A 137 ? 0.4770 0.4142 0.4605 -0.0005 -0.0231 -0.0370 138  SER A CB    
1113 O  OG    . SER A 137 ? 0.4665 0.4062 0.4377 -0.0913 -0.0226 -0.0242 138  SER A OG    
1114 N  N     . LYS A 138 ? 0.4917 0.4322 0.4702 0.0080  -0.0020 -0.0450 139  LYS A N     
1115 C  CA    . LYS A 138 ? 0.4695 0.4504 0.4464 -0.0244 0.0005  -0.0639 139  LYS A CA    
1116 C  C     . LYS A 138 ? 0.4880 0.4895 0.4485 -0.0504 -0.0051 -0.0673 139  LYS A C     
1117 O  O     . LYS A 138 ? 0.4347 0.4340 0.3791 -0.0966 0.0099  -0.0932 139  LYS A O     
1118 C  CB    . LYS A 138 ? 0.4486 0.4752 0.4170 -0.0252 0.0203  -0.0643 139  LYS A CB    
1119 C  CG    . LYS A 138 ? 0.5027 0.4676 0.4762 0.0058  -0.0239 -0.0603 139  LYS A CG    
1120 C  CD    . LYS A 138 ? 0.4701 0.4068 0.5354 -0.0038 0.0006  -0.0481 139  LYS A CD    
1121 C  CE    . LYS A 138 ? 0.5149 0.4183 0.4193 0.0145  0.0096  0.0276  139  LYS A CE    
1122 N  NZ    . LYS A 138 ? 0.4995 0.4280 0.4100 0.0123  0.1572  -0.0091 139  LYS A NZ    
1123 N  N     . THR A 139 ? 0.5321 0.4380 0.4494 -0.0374 0.0111  -0.0657 140  THR A N     
1124 C  CA    . THR A 139 ? 0.5070 0.4450 0.4808 -0.0420 -0.0117 -0.0423 140  THR A CA    
1125 C  C     . THR A 139 ? 0.4656 0.4653 0.4794 -0.0226 -0.0008 -0.0393 140  THR A C     
1126 O  O     . THR A 139 ? 0.4894 0.4867 0.5459 -0.0205 0.0119  -0.0298 140  THR A O     
1127 C  CB    . THR A 139 ? 0.4337 0.4522 0.4866 -0.0116 0.0072  -0.0361 140  THR A CB    
1128 O  OG1   . THR A 139 ? 0.4377 0.4226 0.5487 -0.0772 0.0331  -0.0382 140  THR A OG1   
1129 C  CG2   . THR A 139 ? 0.4209 0.4925 0.5150 -0.0131 0.0078  -0.0725 140  THR A CG2   
1130 N  N     . ARG A 140 ? 0.5106 0.3723 0.4941 -0.0474 -0.0027 -0.0379 141  ARG A N     
1131 C  CA    . ARG A 140 ? 0.4928 0.4732 0.5167 -0.0257 0.0032  -0.0424 141  ARG A CA    
1132 C  C     . ARG A 140 ? 0.5163 0.4632 0.5231 -0.0527 0.0185  -0.0433 141  ARG A C     
1133 O  O     . ARG A 140 ? 0.4714 0.4794 0.5328 -0.0630 0.0202  -0.0832 141  ARG A O     
1134 C  CB    . ARG A 140 ? 0.4825 0.4779 0.4918 -0.0268 -0.0224 -0.0292 141  ARG A CB    
1135 C  CG    . ARG A 140 ? 0.4543 0.4714 0.5726 0.0214  0.0453  -0.0197 141  ARG A CG    
1136 C  CD    . ARG A 140 ? 0.5657 0.4974 0.5325 -0.0227 -0.0353 -0.0135 141  ARG A CD    
1137 N  NE    . ARG A 140 ? 0.5058 0.6458 0.5638 -0.0420 -0.0415 -0.1815 141  ARG A NE    
1138 C  CZ    . ARG A 140 ? 0.6575 0.5297 0.7550 0.0260  -0.0193 -0.0808 141  ARG A CZ    
1139 N  NH1   . ARG A 140 ? 0.7389 0.6259 0.8545 -0.0254 -0.0923 -0.1502 141  ARG A NH1   
1140 N  NH2   . ARG A 140 ? 0.7097 0.4564 0.7311 -0.0745 -0.1236 -0.0218 141  ARG A NH2   
1141 N  N     . LYS A 141 ? 0.4918 0.4635 0.4775 -0.0441 0.0020  -0.0404 142  LYS A N     
1142 C  CA    . LYS A 141 ? 0.5606 0.4631 0.5310 -0.0292 0.0136  -0.0401 142  LYS A CA    
1143 C  C     . LYS A 141 ? 0.5854 0.5042 0.5261 -0.0247 0.0300  -0.0257 142  LYS A C     
1144 O  O     . LYS A 141 ? 0.6342 0.4876 0.4677 -0.0572 0.0824  -0.0089 142  LYS A O     
1145 C  CB    . LYS A 141 ? 0.5731 0.3977 0.5324 -0.0417 -0.0069 -0.0090 142  LYS A CB    
1146 C  CG    . LYS A 141 ? 0.5336 0.5597 0.6191 -0.0312 -0.0422 -0.0568 142  LYS A CG    
1147 C  CD    . LYS A 141 ? 0.6264 0.5939 0.5825 -0.0188 -0.0209 -0.0247 142  LYS A CD    
1148 C  CE    . LYS A 141 ? 0.6297 0.7465 0.7114 0.0131  -0.0181 0.0206  142  LYS A CE    
1149 N  NZ    . LYS A 141 ? 0.6844 0.7634 0.7590 -0.0346 -0.0451 -0.0008 142  LYS A NZ    
1150 N  N     . THR A 142 ? 0.5424 0.4321 0.4794 -0.0152 0.0742  -0.0521 143  THR A N     
1151 C  CA    . THR A 142 ? 0.5653 0.4957 0.5102 -0.0072 0.0389  -0.0260 143  THR A CA    
1152 C  C     . THR A 142 ? 0.5588 0.4489 0.4737 0.0059  0.0464  -0.0298 143  THR A C     
1153 O  O     . THR A 142 ? 0.6125 0.4455 0.5178 0.0342  0.0663  0.0016  143  THR A O     
1154 C  CB    . THR A 142 ? 0.5267 0.4934 0.4955 0.0269  0.0337  -0.0454 143  THR A CB    
1155 O  OG1   . THR A 142 ? 0.5794 0.6043 0.4869 -0.0539 0.0036  -0.0273 143  THR A OG1   
1156 C  CG2   . THR A 142 ? 0.5779 0.5082 0.4739 -0.0363 -0.0104 -0.0783 143  THR A CG2   
1157 N  N     . THR A 143 ? 0.6006 0.3834 0.5005 -0.0303 0.0447  -0.0501 144  THR A N     
1158 C  CA    . THR A 143 ? 0.5827 0.4310 0.5522 -0.0282 0.0427  -0.0058 144  THR A CA    
1159 C  C     . THR A 143 ? 0.5977 0.4790 0.5486 -0.0166 0.0428  0.0031  144  THR A C     
1160 O  O     . THR A 143 ? 0.6472 0.4592 0.5416 0.0010  0.0440  -0.0323 144  THR A O     
1161 C  CB    . THR A 143 ? 0.6172 0.4485 0.5795 -0.0160 0.0427  -0.0105 144  THR A CB    
1162 O  OG1   . THR A 143 ? 0.6509 0.4780 0.5908 -0.0674 0.0589  0.0096  144  THR A OG1   
1163 C  CG2   . THR A 143 ? 0.5688 0.4067 0.6159 -0.0126 0.0390  -0.0416 144  THR A CG2   
1164 N  N     . SER A 144 ? 0.5653 0.4984 0.5612 -0.0027 0.0227  0.0257  145  SER A N     
1165 C  CA    . SER A 144 ? 0.6429 0.4854 0.5962 -0.0034 0.0404  -0.0144 145  SER A CA    
1166 C  C     . SER A 144 ? 0.6769 0.5884 0.6588 -0.0182 0.0303  -0.0122 145  SER A C     
1167 O  O     . SER A 144 ? 0.7025 0.5099 0.6949 -0.0326 0.0365  -0.0472 145  SER A O     
1168 C  CB    . SER A 144 ? 0.6108 0.4735 0.5397 0.0146  0.0356  0.0027  145  SER A CB    
1169 O  OG    . SER A 144 ? 0.7225 0.4009 0.5722 0.0698  0.0376  0.0591  145  SER A OG    
1170 N  N     . GLU A 145 ? 0.6734 0.5950 0.6284 -0.0095 0.0387  -0.0012 146  GLU A N     
1171 C  CA    . GLU A 145 ? 0.7234 0.6258 0.6569 -0.0224 0.0144  -0.0021 146  GLU A CA    
1172 C  C     . GLU A 145 ? 0.7370 0.6184 0.6586 -0.0249 0.0153  -0.0021 146  GLU A C     
1173 O  O     . GLU A 145 ? 0.7960 0.6064 0.6266 -0.0307 0.0338  0.0201  146  GLU A O     
1174 C  CB    . GLU A 145 ? 0.7317 0.6463 0.7050 -0.0201 0.0309  -0.0026 146  GLU A CB    
1175 C  CG    . GLU A 145 ? 0.8214 0.7483 0.8247 -0.0177 0.0001  0.0263  146  GLU A CG    
1176 C  CD    . GLU A 145 ? 0.9421 0.8785 0.9947 -0.0106 0.0067  0.0218  146  GLU A CD    
1177 O  OE1   . GLU A 145 ? 0.9637 0.8064 1.0445 -0.0557 -0.0167 0.0378  146  GLU A OE1   
1178 O  OE2   . GLU A 145 ? 0.9368 0.9634 1.0172 0.0476  0.0090  0.0172  146  GLU A OE2   
1179 N  N     . THR A 146 ? 0.7050 0.5596 0.6452 -0.0156 0.0023  -0.0266 147  THR A N     
1180 C  CA    . THR A 146 ? 0.7464 0.5927 0.6504 0.0068  0.0038  0.0021  147  THR A CA    
1181 C  C     . THR A 146 ? 0.7581 0.6114 0.7016 0.0076  -0.0124 0.0122  147  THR A C     
1182 O  O     . THR A 146 ? 0.7614 0.5719 0.6691 0.0114  -0.0224 0.0241  147  THR A O     
1183 C  CB    . THR A 146 ? 0.7573 0.6150 0.6830 0.0178  0.0084  -0.0076 147  THR A CB    
1184 O  OG1   . THR A 146 ? 0.7709 0.5723 0.5806 0.0110  -0.0221 -0.0372 147  THR A OG1   
1185 C  CG2   . THR A 146 ? 0.7884 0.6085 0.6753 -0.0139 -0.0165 -0.0037 147  THR A CG2   
1186 N  N     . VAL A 147 ? 0.7495 0.6109 0.7122 -0.0067 -0.0027 0.0081  148  VAL A N     
1187 C  CA    . VAL A 147 ? 0.7427 0.5818 0.6696 -0.0201 -0.0012 0.0036  148  VAL A CA    
1188 C  C     . VAL A 147 ? 0.7941 0.6446 0.7073 -0.0166 0.0230  0.0198  148  VAL A C     
1189 O  O     . VAL A 147 ? 0.7824 0.5342 0.6622 -0.0598 -0.0054 0.0172  148  VAL A O     
1190 C  CB    . VAL A 147 ? 0.7257 0.5912 0.6584 -0.0017 -0.0086 0.0074  148  VAL A CB    
1191 C  CG1   . VAL A 147 ? 0.7234 0.4837 0.6676 -0.0153 -0.0249 0.0044  148  VAL A CG1   
1192 C  CG2   . VAL A 147 ? 0.6004 0.4389 0.4904 -0.0610 -0.0594 -0.0639 148  VAL A CG2   
1193 N  N     . ARG A 148 ? 0.8589 0.7522 0.7511 -0.0127 0.0203  0.0101  149  ARG A N     
1194 C  CA    . ARG A 148 ? 0.8932 0.8114 0.7879 -0.0140 0.0250  0.0222  149  ARG A CA    
1195 C  C     . ARG A 148 ? 0.9170 0.8407 0.8354 -0.0266 0.0379  0.0244  149  ARG A C     
1196 O  O     . ARG A 148 ? 0.9595 0.7971 0.8108 -0.0486 0.0409  0.0669  149  ARG A O     
1197 C  CB    . ARG A 148 ? 0.8778 0.8197 0.8376 0.0055  0.0156  0.0309  149  ARG A CB    
1198 C  CG    . ARG A 148 ? 0.9100 0.8782 0.8661 -0.0091 -0.0005 -0.0145 149  ARG A CG    
1199 C  CD    . ARG A 148 ? 0.9171 0.8353 0.9310 0.0232  -0.0312 0.0004  149  ARG A CD    
1200 N  NE    . ARG A 148 ? 0.9710 0.8998 0.9396 0.0276  -0.0286 -0.0086 149  ARG A NE    
1201 C  CZ    . ARG A 148 ? 0.9668 0.9461 0.9579 0.0280  -0.0305 -0.0096 149  ARG A CZ    
1202 N  NH1   . ARG A 148 ? 1.0407 0.9915 1.0224 0.0268  -0.0178 -0.0083 149  ARG A NH1   
1203 N  NH2   . ARG A 148 ? 0.9275 0.8895 0.8799 0.0198  -0.0230 -0.0178 149  ARG A NH2   
1204 N  N     . ALA A 149 ? 0.9472 0.8801 0.8578 -0.0079 0.0153  0.0035  150  ALA A N     
1205 C  CA    . ALA A 149 ? 0.9536 0.8875 0.8859 -0.0075 0.0121  0.0004  150  ALA A CA    
1206 C  C     . ALA A 149 ? 0.9690 0.8838 0.8789 -0.0158 0.0219  0.0100  150  ALA A C     
1207 O  O     . ALA A 149 ? 0.9881 0.8675 0.8155 -0.0236 0.0333  0.0183  150  ALA A O     
1208 C  CB    . ALA A 149 ? 0.9345 0.9069 0.8839 -0.0062 0.0103  -0.0053 150  ALA A CB    
1209 N  N     . VAL A 150 ? 0.9602 0.8636 0.9053 -0.0115 0.0177  0.0161  151  VAL A N     
1210 C  CA    . VAL A 150 ? 0.9848 0.8731 0.9424 0.0045  0.0179  0.0099  151  VAL A CA    
1211 C  C     . VAL A 150 ? 1.0240 0.9353 0.9941 0.0015  0.0110  0.0033  151  VAL A C     
1212 O  O     . VAL A 150 ? 1.0459 0.9426 1.0322 0.0136  -0.0026 0.0125  151  VAL A O     
1213 C  CB    . VAL A 150 ? 0.9782 0.8756 0.9283 0.0186  0.0132  0.0044  151  VAL A CB    
1214 C  CG1   . VAL A 150 ? 0.9813 0.8930 0.9374 -0.0108 0.0127  0.0103  151  VAL A CG1   
1215 C  CG2   . VAL A 150 ? 0.9548 0.7900 0.9486 0.0358  0.0156  0.0157  151  VAL A CG2   
1216 N  N     . LEU A 151 ? 1.0189 0.9375 0.9910 -0.0075 0.0170  -0.0054 152  LEU A N     
1217 C  CA    . LEU A 151 ? 1.0339 0.9602 1.0064 -0.0130 0.0093  -0.0029 152  LEU A CA    
1218 C  C     . LEU A 151 ? 1.0444 1.0018 1.0244 -0.0114 -0.0003 -0.0038 152  LEU A C     
1219 O  O     . LEU A 151 ? 1.0172 1.0182 1.0270 -0.0051 0.0052  -0.0067 152  LEU A O     
1220 C  CB    . LEU A 151 ? 1.0413 0.9463 1.0118 -0.0030 0.0026  -0.0044 152  LEU A CB    
1221 C  CG    . LEU A 151 ? 1.0401 0.9269 1.0053 -0.0066 -0.0088 -0.0034 152  LEU A CG    
1222 C  CD1   . LEU A 151 ? 1.0310 0.9314 1.0007 0.0169  0.0163  -0.0129 152  LEU A CD1   
1223 C  CD2   . LEU A 151 ? 1.0210 0.9268 1.0029 -0.0142 0.0211  -0.0007 152  LEU A CD2   
1224 N  N     . ASP A 152 ? 1.0687 1.0038 1.0421 -0.0128 -0.0072 -0.0003 153  ASP A N     
1225 C  CA    . ASP A 152 ? 1.0961 1.0260 1.0660 -0.0138 -0.0131 0.0018  153  ASP A CA    
1226 C  C     . ASP A 152 ? 1.1033 1.0242 1.0875 -0.0050 -0.0250 -0.0034 153  ASP A C     
1227 O  O     . ASP A 152 ? 1.0951 1.0135 1.1013 0.0049  -0.0358 -0.0006 153  ASP A O     
1228 C  CB    . ASP A 152 ? 1.1025 1.0300 1.0602 -0.0156 -0.0060 0.0027  153  ASP A CB    
1229 C  CG    . ASP A 152 ? 1.0932 1.0639 1.0456 0.0019  -0.0080 0.0134  153  ASP A CG    
1230 O  OD1   . ASP A 152 ? 1.0035 1.0361 0.9865 -0.0033 -0.0616 0.0338  153  ASP A OD1   
1231 O  OD2   . ASP A 152 ? 1.0968 1.0993 1.0354 -0.0022 0.0235  -0.0059 153  ASP A OD2   
1232 O  OXT   . ASP A 152 ? 1.1181 1.0077 1.0968 -0.0127 -0.0286 -0.0126 153  ASP A OXT   
1233 N  N     . ASN B 1   ? 0.8886 0.8023 0.8574 0.0215  -0.0061 -0.0162 2    ASN B N     
1234 C  CA    . ASN B 1   ? 0.8729 0.8151 0.8434 0.0139  -0.0039 -0.0153 2    ASN B CA    
1235 C  C     . ASN B 1   ? 0.8232 0.7954 0.8132 -0.0019 -0.0063 -0.0171 2    ASN B C     
1236 O  O     . ASN B 1   ? 0.7931 0.8202 0.8287 -0.0173 -0.0228 -0.0399 2    ASN B O     
1237 C  CB    . ASN B 1   ? 0.9098 0.8335 0.8687 0.0100  -0.0028 -0.0065 2    ASN B CB    
1238 C  CG    . ASN B 1   ? 0.9714 0.9219 0.9521 0.0187  0.0082  0.0017  2    ASN B CG    
1239 O  OD1   . ASN B 1   ? 1.0108 0.9466 0.9368 0.0356  0.0462  -0.0084 2    ASN B OD1   
1240 N  ND2   . ASN B 1   ? 1.0887 1.0131 1.0131 0.0167  -0.0006 0.0338  2    ASN B ND2   
1241 N  N     . THR B 2   ? 0.7515 0.7263 0.7447 -0.0095 -0.0045 -0.0088 3    THR B N     
1242 C  CA    . THR B 2   ? 0.6972 0.6915 0.6967 -0.0119 0.0035  -0.0027 3    THR B CA    
1243 C  C     . THR B 2   ? 0.6397 0.6365 0.6642 -0.0050 -0.0031 -0.0133 3    THR B C     
1244 O  O     . THR B 2   ? 0.5680 0.6576 0.5941 0.0255  -0.0002 -0.0406 3    THR B O     
1245 C  CB    . THR B 2   ? 0.6999 0.7127 0.7350 -0.0021 0.0168  0.0143  3    THR B CB    
1246 O  OG1   . THR B 2   ? 0.7806 0.7639 0.7401 -0.0102 -0.0145 0.0302  3    THR B OG1   
1247 C  CG2   . THR B 2   ? 0.7439 0.7258 0.7176 -0.0155 -0.0178 -0.0314 3    THR B CG2   
1248 N  N     . LYS B 3   ? 0.5694 0.5993 0.6047 -0.0081 -0.0059 -0.0083 4    LYS B N     
1249 C  CA    . LYS B 3   ? 0.5293 0.5893 0.6014 -0.0090 -0.0165 -0.0033 4    LYS B CA    
1250 C  C     . LYS B 3   ? 0.4684 0.5585 0.5274 -0.0052 -0.0243 -0.0067 4    LYS B C     
1251 O  O     . LYS B 3   ? 0.4914 0.6180 0.5620 -0.0135 -0.0599 -0.0272 4    LYS B O     
1252 C  CB    . LYS B 3   ? 0.5248 0.6125 0.6229 0.0037  0.0177  -0.0060 4    LYS B CB    
1253 C  CG    . LYS B 3   ? 0.5803 0.6091 0.6504 -0.0282 -0.0033 -0.0203 4    LYS B CG    
1254 C  CD    . LYS B 3   ? 0.6333 0.7147 0.7106 0.0520  -0.0386 0.0043  4    LYS B CD    
1255 C  CE    . LYS B 3   ? 0.7728 0.8138 0.8000 0.0340  -0.0054 0.0204  4    LYS B CE    
1256 N  NZ    . LYS B 3   ? 0.8343 0.7912 0.8848 -0.0045 -0.0011 0.0437  4    LYS B NZ    
1257 N  N     . TYR B 4   ? 0.3674 0.5233 0.4771 0.0041  -0.0196 -0.0123 5    TYR B N     
1258 C  CA    . TYR B 4   ? 0.3221 0.4433 0.4218 0.0157  -0.0309 -0.0268 5    TYR B CA    
1259 C  C     . TYR B 4   ? 0.3408 0.4745 0.4329 -0.0250 -0.0344 -0.0085 5    TYR B C     
1260 O  O     . TYR B 4   ? 0.3541 0.4806 0.4398 -0.0337 0.0023  -0.0239 5    TYR B O     
1261 C  CB    . TYR B 4   ? 0.2452 0.4217 0.3719 0.0515  -0.0588 0.0011  5    TYR B CB    
1262 C  CG    . TYR B 4   ? 0.3099 0.4388 0.3661 0.0025  -0.0648 -0.0394 5    TYR B CG    
1263 C  CD1   . TYR B 4   ? 0.3221 0.4707 0.3951 -0.0155 0.0064  -0.0058 5    TYR B CD1   
1264 C  CD2   . TYR B 4   ? 0.3494 0.4105 0.4130 -0.0101 -0.0608 -0.0677 5    TYR B CD2   
1265 C  CE1   . TYR B 4   ? 0.2904 0.4378 0.3926 0.0138  0.0182  -0.0429 5    TYR B CE1   
1266 C  CE2   . TYR B 4   ? 0.3033 0.4538 0.4395 0.0024  -0.0186 0.0251  5    TYR B CE2   
1267 C  CZ    . TYR B 4   ? 0.3319 0.4203 0.3457 -0.0067 0.0116  -0.0186 5    TYR B CZ    
1268 O  OH    . TYR B 4   ? 0.3052 0.3939 0.4569 -0.0017 0.0302  -0.0275 5    TYR B OH    
1269 N  N     . ASN B 5   ? 0.2695 0.4535 0.4352 -0.0067 -0.0301 -0.0648 6    ASN B N     
1270 C  CA    . ASN B 5   ? 0.3364 0.4861 0.4390 -0.0322 -0.0498 -0.0352 6    ASN B CA    
1271 C  C     . ASN B 5   ? 0.3805 0.4518 0.4245 -0.0161 -0.0054 0.0103  6    ASN B C     
1272 O  O     . ASN B 5   ? 0.3153 0.5419 0.4462 0.0469  0.0335  -0.0244 6    ASN B O     
1273 C  CB    . ASN B 5   ? 0.4043 0.4544 0.4780 0.0014  -0.0077 -0.0537 6    ASN B CB    
1274 C  CG    . ASN B 5   ? 0.5545 0.7333 0.6351 -0.0662 -0.0175 -0.0271 6    ASN B CG    
1275 O  OD1   . ASN B 5   ? 0.5625 0.7928 0.5406 -0.0545 -0.0879 -0.0291 6    ASN B OD1   
1276 N  ND2   . ASN B 5   ? 0.6528 0.9793 0.6819 -0.0285 0.0180  -0.0333 6    ASN B ND2   
1277 N  N     . LYS B 6   ? 0.3085 0.4203 0.4254 0.0167  0.0017  -0.0149 7    LYS B N     
1278 C  CA    . LYS B 6   ? 0.3696 0.4511 0.3936 -0.0100 0.0278  0.0182  7    LYS B CA    
1279 C  C     . LYS B 6   ? 0.3369 0.4469 0.3993 -0.0232 0.0155  0.0317  7    LYS B C     
1280 O  O     . LYS B 6   ? 0.3075 0.4501 0.3579 -0.0313 0.0100  0.0225  7    LYS B O     
1281 C  CB    . LYS B 6   ? 0.3740 0.5315 0.4413 0.0016  0.0391  0.0219  7    LYS B CB    
1282 C  CG    . LYS B 6   ? 0.4554 0.5452 0.4676 0.0044  0.0557  0.0523  7    LYS B CG    
1283 C  CD    . LYS B 6   ? 0.4351 0.5362 0.5722 -0.0063 0.0757  0.1057  7    LYS B CD    
1284 C  CE    . LYS B 6   ? 0.5635 0.7461 0.6749 -0.0227 0.0303  0.0174  7    LYS B CE    
1285 N  NZ    . LYS B 6   ? 0.6235 0.7726 0.6966 -0.0377 0.1174  0.0380  7    LYS B NZ    
1286 N  N     . GLU B 7   ? 0.2678 0.4388 0.4345 -0.0062 -0.0026 0.0148  8    GLU B N     
1287 C  CA    . GLU B 7   ? 0.3387 0.4352 0.4406 -0.0143 0.0180  0.0138  8    GLU B CA    
1288 C  C     . GLU B 7   ? 0.3040 0.4073 0.4239 0.0061  0.0119  0.0110  8    GLU B C     
1289 O  O     . GLU B 7   ? 0.2553 0.4392 0.3858 -0.0049 0.0257  0.0041  8    GLU B O     
1290 C  CB    . GLU B 7   ? 0.2984 0.4431 0.4360 0.0315  0.0016  0.0219  8    GLU B CB    
1291 C  CG    . GLU B 7   ? 0.5080 0.5349 0.6048 0.0049  -0.0337 0.0072  8    GLU B CG    
1292 C  CD    . GLU B 7   ? 0.6978 0.6134 0.8140 0.0620  -0.0009 -0.0350 8    GLU B CD    
1293 O  OE1   . GLU B 7   ? 0.7860 0.7420 0.9491 -0.0100 -0.0319 0.0051  8    GLU B OE1   
1294 O  OE2   . GLU B 7   ? 0.7458 0.5805 0.8848 0.0177  -0.0469 -0.0460 8    GLU B OE2   
1295 N  N     . PHE B 8   ? 0.3242 0.3892 0.4189 0.0181  0.0165  0.0425  9    PHE B N     
1296 C  CA    . PHE B 8   ? 0.3517 0.4148 0.3999 0.0218  0.0411  0.0053  9    PHE B CA    
1297 C  C     . PHE B 8   ? 0.3396 0.3846 0.3709 0.0128  0.0144  0.0080  9    PHE B C     
1298 O  O     . PHE B 8   ? 0.3473 0.3613 0.3631 0.0371  0.0013  0.0321  9    PHE B O     
1299 C  CB    . PHE B 8   ? 0.3511 0.4336 0.3679 -0.0169 0.0346  0.0164  9    PHE B CB    
1300 C  CG    . PHE B 8   ? 0.3859 0.4721 0.3831 0.0200  0.0105  -0.0019 9    PHE B CG    
1301 C  CD1   . PHE B 8   ? 0.3725 0.4632 0.4541 -0.0206 0.0207  0.0246  9    PHE B CD1   
1302 C  CD2   . PHE B 8   ? 0.3224 0.4999 0.3518 0.0285  -0.0203 0.0010  9    PHE B CD2   
1303 C  CE1   . PHE B 8   ? 0.3336 0.4046 0.3610 0.0360  0.0356  0.0771  9    PHE B CE1   
1304 C  CE2   . PHE B 8   ? 0.3622 0.5197 0.3838 0.0131  0.0093  0.0195  9    PHE B CE2   
1305 C  CZ    . PHE B 8   ? 0.3832 0.4904 0.4146 0.0224  0.0396  0.0009  9    PHE B CZ    
1306 N  N     . LEU B 9   ? 0.2862 0.3627 0.3831 -0.0257 0.0316  0.0159  10   LEU B N     
1307 C  CA    . LEU B 9   ? 0.3246 0.3454 0.3696 -0.0254 0.0142  0.0013  10   LEU B CA    
1308 C  C     . LEU B 9   ? 0.3087 0.3652 0.4223 -0.0223 0.0035  -0.0179 10   LEU B C     
1309 O  O     . LEU B 9   ? 0.3132 0.3715 0.3794 0.0185  -0.0057 0.0012  10   LEU B O     
1310 C  CB    . LEU B 9   ? 0.3156 0.3733 0.3890 -0.0296 0.0225  -0.0285 10   LEU B CB    
1311 C  CG    . LEU B 9   ? 0.2635 0.3968 0.3667 -0.0200 0.0424  -0.0484 10   LEU B CG    
1312 C  CD1   . LEU B 9   ? 0.3495 0.3077 0.3453 -0.0107 -0.0110 0.0188  10   LEU B CD1   
1313 C  CD2   . LEU B 9   ? 0.3230 0.3480 0.4333 0.0527  -0.0046 -0.0161 10   LEU B CD2   
1314 N  N     . LEU B 10  ? 0.2756 0.3471 0.4101 -0.0093 -0.0069 -0.0293 11   LEU B N     
1315 C  CA    . LEU B 10  ? 0.3176 0.3772 0.4086 -0.0095 0.0059  -0.0067 11   LEU B CA    
1316 C  C     . LEU B 10  ? 0.3108 0.3846 0.3668 0.0020  0.0403  -0.0019 11   LEU B C     
1317 O  O     . LEU B 10  ? 0.3393 0.4192 0.2933 0.0101  0.0320  -0.0006 11   LEU B O     
1318 C  CB    . LEU B 10  ? 0.2883 0.4230 0.3798 -0.0060 0.0837  -0.0167 11   LEU B CB    
1319 C  CG    . LEU B 10  ? 0.3313 0.4166 0.4562 0.0089  0.0356  0.0301  11   LEU B CG    
1320 C  CD1   . LEU B 10  ? 0.3051 0.4759 0.3367 0.0189  0.0461  -0.0099 11   LEU B CD1   
1321 C  CD2   . LEU B 10  ? 0.3385 0.4797 0.3770 -0.0165 0.0851  0.0114  11   LEU B CD2   
1322 N  N     . TYR B 11  ? 0.2702 0.3335 0.3136 0.0416  0.0333  0.0139  12   TYR B N     
1323 C  CA    . TYR B 11  ? 0.2863 0.3155 0.3447 0.0278  0.0449  0.0285  12   TYR B CA    
1324 C  C     . TYR B 11  ? 0.3318 0.3699 0.3703 -0.0027 0.0230  0.0205  12   TYR B C     
1325 O  O     . TYR B 11  ? 0.2862 0.4080 0.3365 0.0319  0.0230  0.0144  12   TYR B O     
1326 C  CB    . TYR B 11  ? 0.3270 0.3257 0.3696 0.0215  0.0496  0.0291  12   TYR B CB    
1327 C  CG    . TYR B 11  ? 0.3349 0.3564 0.3456 -0.0345 0.0166  0.0398  12   TYR B CG    
1328 C  CD1   . TYR B 11  ? 0.3517 0.3226 0.3306 0.0228  0.0179  0.0317  12   TYR B CD1   
1329 C  CD2   . TYR B 11  ? 0.3375 0.3662 0.3904 0.0232  0.0234  0.0048  12   TYR B CD2   
1330 C  CE1   . TYR B 11  ? 0.2990 0.4279 0.3336 0.0391  -0.0504 0.0587  12   TYR B CE1   
1331 C  CE2   . TYR B 11  ? 0.3441 0.4036 0.3744 -0.0040 -0.0133 0.0191  12   TYR B CE2   
1332 C  CZ    . TYR B 11  ? 0.4046 0.3641 0.4078 0.0055  -0.0061 0.0782  12   TYR B CZ    
1333 O  OH    . TYR B 11  ? 0.3338 0.3326 0.3861 -0.0073 0.0093  0.0191  12   TYR B OH    
1334 N  N     . LEU B 12  ? 0.3320 0.3175 0.3477 -0.0169 -0.0068 -0.0084 13   LEU B N     
1335 C  CA    . LEU B 12  ? 0.3062 0.3375 0.3486 0.0048  0.0311  0.0015  13   LEU B CA    
1336 C  C     . LEU B 12  ? 0.2801 0.3091 0.3348 -0.0052 0.0557  -0.0137 13   LEU B C     
1337 O  O     . LEU B 12  ? 0.3129 0.3539 0.3635 -0.0197 -0.0015 0.0290  13   LEU B O     
1338 C  CB    . LEU B 12  ? 0.3238 0.3574 0.4220 -0.0119 0.0342  -0.0088 13   LEU B CB    
1339 C  CG    . LEU B 12  ? 0.2934 0.3010 0.2973 -0.0313 -0.0187 -0.0539 13   LEU B CG    
1340 C  CD1   . LEU B 12  ? 0.2648 0.3870 0.3275 -0.0248 -0.0344 0.0622  13   LEU B CD1   
1341 C  CD2   . LEU B 12  ? 0.3167 0.3886 0.2561 0.0441  0.0176  -0.0290 13   LEU B CD2   
1342 N  N     . ALA B 13  ? 0.2995 0.3214 0.3301 -0.0035 0.0255  -0.0124 14   ALA B N     
1343 C  CA    . ALA B 13  ? 0.3177 0.3350 0.3404 -0.0074 0.0154  0.0036  14   ALA B CA    
1344 C  C     . ALA B 13  ? 0.3253 0.3653 0.3598 -0.0113 0.0285  -0.0005 14   ALA B C     
1345 O  O     . ALA B 13  ? 0.3138 0.3663 0.3363 0.0138  0.0136  0.0164  14   ALA B O     
1346 C  CB    . ALA B 13  ? 0.3282 0.3297 0.3870 -0.0271 0.0481  0.0247  14   ALA B CB    
1347 N  N     . GLY B 14  ? 0.3275 0.3181 0.2935 -0.0491 0.0509  0.0098  15   GLY B N     
1348 C  CA    . GLY B 14  ? 0.2248 0.2996 0.2813 -0.0800 0.0135  0.0080  15   GLY B CA    
1349 C  C     . GLY B 14  ? 0.3183 0.3346 0.3765 0.0154  0.0240  -0.0356 15   GLY B C     
1350 O  O     . GLY B 14  ? 0.2862 0.3370 0.3076 -0.0202 0.0059  0.0256  15   GLY B O     
1351 N  N     . PHE B 15  ? 0.2885 0.3310 0.3560 0.0678  0.0016  -0.0020 16   PHE B N     
1352 C  CA    . PHE B 15  ? 0.3164 0.3502 0.3274 0.0569  -0.0258 0.0278  16   PHE B CA    
1353 C  C     . PHE B 15  ? 0.2889 0.3261 0.2865 0.0472  0.0249  0.0192  16   PHE B C     
1354 O  O     . PHE B 15  ? 0.2987 0.3221 0.3474 0.0350  0.0087  0.0011  16   PHE B O     
1355 C  CB    . PHE B 15  ? 0.2598 0.2965 0.2386 0.0421  -0.0320 0.0562  16   PHE B CB    
1356 C  CG    . PHE B 15  ? 0.3737 0.3716 0.3509 0.0367  -0.0843 0.0211  16   PHE B CG    
1357 C  CD1   . PHE B 15  ? 0.3199 0.3815 0.3816 0.0098  -0.0546 0.0235  16   PHE B CD1   
1358 C  CD2   . PHE B 15  ? 0.3416 0.3856 0.3767 -0.0557 -0.1037 0.0007  16   PHE B CD2   
1359 C  CE1   . PHE B 15  ? 0.4890 0.3535 0.3543 0.0307  0.0245  0.0278  16   PHE B CE1   
1360 C  CE2   . PHE B 15  ? 0.2824 0.3321 0.2700 0.0378  -0.0086 -0.0444 16   PHE B CE2   
1361 C  CZ    . PHE B 15  ? 0.2634 0.2846 0.3888 -0.0211 0.0246  0.0510  16   PHE B CZ    
1362 N  N     . VAL B 16  ? 0.2459 0.2833 0.3104 0.0323  0.0010  0.0275  17   VAL B N     
1363 C  CA    . VAL B 16  ? 0.3133 0.2672 0.3033 0.0245  0.0268  0.0116  17   VAL B CA    
1364 C  C     . VAL B 16  ? 0.3177 0.2804 0.3317 0.0179  0.0158  -0.0110 17   VAL B C     
1365 O  O     . VAL B 16  ? 0.3344 0.3296 0.3213 -0.0225 0.0461  0.0406  17   VAL B O     
1366 C  CB    . VAL B 16  ? 0.2952 0.2728 0.2987 0.0419  -0.0014 -0.0063 17   VAL B CB    
1367 C  CG1   . VAL B 16  ? 0.3439 0.2311 0.3742 -0.0065 0.0122  0.0058  17   VAL B CG1   
1368 C  CG2   . VAL B 16  ? 0.2328 0.2789 0.2916 0.0002  -0.0227 -0.0139 17   VAL B CG2   
1369 N  N     . ASP B 17  ? 0.2396 0.2585 0.3304 0.0028  0.0066  0.0038  18   ASP B N     
1370 C  CA    . ASP B 17  ? 0.3023 0.2945 0.2792 -0.0078 -0.0038 0.0153  18   ASP B CA    
1371 C  C     . ASP B 17  ? 0.3271 0.3568 0.3482 -0.0046 -0.0039 0.0110  18   ASP B C     
1372 O  O     . ASP B 17  ? 0.3128 0.3454 0.3557 0.0239  -0.0071 0.0621  18   ASP B O     
1373 C  CB    . ASP B 17  ? 0.3125 0.2658 0.3361 -0.0349 0.0134  0.0127  18   ASP B CB    
1374 C  CG    . ASP B 17  ? 0.3940 0.3848 0.3373 -0.0230 -0.0210 -0.0196 18   ASP B CG    
1375 O  OD1   . ASP B 17  ? 0.3296 0.4048 0.3271 0.0009  0.0197  -0.0157 18   ASP B OD1   
1376 O  OD2   . ASP B 17  ? 0.3686 0.3783 0.3748 -0.0268 -0.0513 -0.0094 18   ASP B OD2   
1377 N  N     . ALA B 18  ? 0.2706 0.3065 0.3503 0.0279  0.0085  -0.0033 19   ALA B N     
1378 C  CA    . ALA B 18  ? 0.3159 0.3233 0.3448 0.0210  0.0212  0.0101  19   ALA B CA    
1379 C  C     . ALA B 18  ? 0.3551 0.3252 0.3696 -0.0018 0.0129  -0.0048 19   ALA B C     
1380 O  O     . ALA B 18  ? 0.3701 0.3796 0.3402 -0.0138 -0.0080 -0.0276 19   ALA B O     
1381 C  CB    . ALA B 18  ? 0.3537 0.4366 0.4106 -0.0011 -0.0018 -0.0285 19   ALA B CB    
1382 N  N     . ASP B 19  ? 0.2616 0.3186 0.3162 0.0217  0.0164  0.0130  20   ASP B N     
1383 C  CA    . ASP B 19  ? 0.3093 0.3429 0.3091 -0.0050 -0.0056 0.0051  20   ASP B CA    
1384 C  C     . ASP B 19  ? 0.2833 0.3462 0.3102 0.0191  -0.0143 0.0104  20   ASP B C     
1385 O  O     . ASP B 19  ? 0.2438 0.3570 0.3356 0.0128  -0.0242 0.0036  20   ASP B O     
1386 C  CB    . ASP B 19  ? 0.2545 0.2713 0.2465 0.0472  -0.0378 -0.0029 20   ASP B CB    
1387 C  CG    . ASP B 19  ? 0.3154 0.3680 0.3564 0.0384  -0.0248 -0.0119 20   ASP B CG    
1388 O  OD1   . ASP B 19  ? 0.3039 0.3402 0.3226 -0.0111 -0.0211 -0.0108 20   ASP B OD1   
1389 O  OD2   . ASP B 19  ? 0.3361 0.3327 0.3065 -0.0167 -0.0388 0.0208  20   ASP B OD2   
1390 N  N     . GLY B 20  ? 0.2570 0.3217 0.2915 0.0280  -0.0020 0.0130  21   GLY B N     
1391 C  CA    . GLY B 20  ? 0.2546 0.3116 0.3173 -0.0111 -0.0426 -0.0095 21   GLY B CA    
1392 C  C     . GLY B 20  ? 0.2814 0.3315 0.3293 -0.0048 0.0054  -0.0178 21   GLY B C     
1393 O  O     . GLY B 20  ? 0.2643 0.3642 0.3588 0.0093  -0.0081 -0.0213 21   GLY B O     
1394 N  N     . SER B 21  ? 0.2749 0.3694 0.3888 -0.0254 0.0038  -0.0037 22   SER B N     
1395 C  CA    . SER B 21  ? 0.2921 0.3281 0.3883 -0.0023 -0.0173 -0.0117 22   SER B CA    
1396 C  C     . SER B 21  ? 0.3047 0.3685 0.3474 -0.0065 -0.0057 -0.0006 22   SER B C     
1397 O  O     . SER B 21  ? 0.3483 0.3375 0.3719 0.0041  -0.0018 -0.0406 22   SER B O     
1398 C  CB    . SER B 21  ? 0.3300 0.4282 0.3726 0.0169  -0.0270 0.0221  22   SER B CB    
1399 O  OG    . SER B 21  ? 0.3263 0.3974 0.3721 0.0537  -0.0014 -0.0359 22   SER B OG    
1400 N  N     . ILE B 22  ? 0.2841 0.3324 0.3506 0.0334  -0.0404 -0.0137 23   ILE B N     
1401 C  CA    . ILE B 22  ? 0.3173 0.3463 0.3981 0.0157  -0.0035 -0.0215 23   ILE B CA    
1402 C  C     . ILE B 22  ? 0.3523 0.3044 0.3851 0.0133  -0.0196 -0.0313 23   ILE B C     
1403 O  O     . ILE B 22  ? 0.4100 0.2903 0.4004 0.0344  -0.0046 0.0005  23   ILE B O     
1404 C  CB    . ILE B 22  ? 0.3793 0.3591 0.3861 0.0120  0.0113  -0.0133 23   ILE B CB    
1405 C  CG1   . ILE B 22  ? 0.3287 0.3841 0.4367 0.0423  0.0279  0.0326  23   ILE B CG1   
1406 C  CG2   . ILE B 22  ? 0.4126 0.3072 0.4609 -0.0015 0.0363  0.0045  23   ILE B CG2   
1407 C  CD1   . ILE B 22  ? 0.4209 0.4383 0.4691 0.0074  0.0299  -0.0061 23   ILE B CD1   
1408 N  N     . ILE B 23  ? 0.3607 0.3487 0.4174 0.0208  -0.0315 -0.0279 24   ILE B N     
1409 C  CA    . ILE B 23  ? 0.3506 0.3737 0.4197 0.0280  -0.0210 -0.0528 24   ILE B CA    
1410 C  C     . ILE B 23  ? 0.4082 0.3957 0.4323 0.0112  -0.0363 -0.0421 24   ILE B C     
1411 O  O     . ILE B 23  ? 0.4917 0.4178 0.3842 0.0598  -0.0552 -0.0976 24   ILE B O     
1412 C  CB    . ILE B 23  ? 0.3315 0.3219 0.4320 0.0281  -0.0007 -0.0740 24   ILE B CB    
1413 C  CG1   . ILE B 23  ? 0.3578 0.3503 0.4973 -0.0060 0.0195  -0.0258 24   ILE B CG1   
1414 C  CG2   . ILE B 23  ? 0.3349 0.3458 0.3819 0.0342  -0.0149 -0.0705 24   ILE B CG2   
1415 C  CD1   . ILE B 23  ? 0.3292 0.4243 0.3913 0.0540  -0.0289 0.0146  24   ILE B CD1   
1416 N  N     . ALA B 24  ? 0.3448 0.3907 0.3958 0.0350  -0.0384 -0.0329 25   ALA B N     
1417 C  CA    . ALA B 24  ? 0.3782 0.3888 0.4040 0.0068  -0.0181 -0.0030 25   ALA B CA    
1418 C  C     . ALA B 24  ? 0.3836 0.3724 0.4023 0.0347  0.0039  -0.0154 25   ALA B C     
1419 O  O     . ALA B 24  ? 0.3446 0.3799 0.4225 0.0506  0.0114  -0.0490 25   ALA B O     
1420 C  CB    . ALA B 24  ? 0.3913 0.3684 0.4034 0.0315  -0.0219 0.0281  25   ALA B CB    
1421 N  N     . GLN B 25  ? 0.3694 0.3643 0.4163 0.0036  0.0073  0.0056  26   GLN B N     
1422 C  CA    . GLN B 25  ? 0.3556 0.3350 0.4088 0.0550  0.0010  -0.0338 26   GLN B CA    
1423 C  C     . GLN B 25  ? 0.3938 0.4162 0.4096 0.0362  -0.0107 -0.0580 26   GLN B C     
1424 O  O     . GLN B 25  ? 0.3315 0.4243 0.4196 0.0568  0.0155  -0.1053 26   GLN B O     
1425 C  CB    . GLN B 25  ? 0.3121 0.3992 0.3874 0.0091  -0.0185 -0.0505 26   GLN B CB    
1426 C  CG    . GLN B 25  ? 0.2653 0.3519 0.4259 0.0447  -0.0413 0.0099  26   GLN B CG    
1427 C  CD    . GLN B 25  ? 0.3628 0.3793 0.3918 0.0116  0.0156  -0.0442 26   GLN B CD    
1428 O  OE1   . GLN B 25  ? 0.3847 0.3419 0.5209 0.0831  -0.0033 -0.0578 26   GLN B OE1   
1429 N  NE2   . GLN B 25  ? 0.3380 0.4259 0.4168 0.0267  -0.0416 -0.0533 26   GLN B NE2   
1430 N  N     . ILE B 26  ? 0.3877 0.4186 0.4308 0.0547  0.0001  -0.0806 27   ILE B N     
1431 C  CA    . ILE B 26  ? 0.3987 0.4189 0.4429 0.0374  0.0063  -0.0756 27   ILE B CA    
1432 C  C     . ILE B 26  ? 0.4299 0.4910 0.4719 0.0254  0.0085  -0.0669 27   ILE B C     
1433 O  O     . ILE B 26  ? 0.3737 0.5019 0.4792 0.0109  0.0007  -0.0985 27   ILE B O     
1434 C  CB    . ILE B 26  ? 0.4167 0.4072 0.4215 0.0633  -0.0032 -0.0751 27   ILE B CB    
1435 C  CG1   . ILE B 26  ? 0.4771 0.3920 0.4296 0.0500  0.0167  -0.0338 27   ILE B CG1   
1436 C  CG2   . ILE B 26  ? 0.3915 0.4229 0.5083 0.1114  -0.0118 -0.0449 27   ILE B CG2   
1437 C  CD1   . ILE B 26  ? 0.3647 0.4500 0.4162 0.0533  -0.0201 -0.0774 27   ILE B CD1   
1438 N  N     . GLU B 27  ? 0.4083 0.4134 0.4470 0.0526  -0.0275 -0.0541 28   GLU B N     
1439 C  CA    . GLU B 27  ? 0.3915 0.4026 0.4813 0.0449  -0.0207 -0.0431 28   GLU B CA    
1440 C  C     . GLU B 27  ? 0.4735 0.5175 0.5190 0.0223  -0.0182 -0.0924 28   GLU B C     
1441 O  O     . GLU B 27  ? 0.4669 0.5158 0.5275 0.0469  -0.0011 -0.1229 28   GLU B O     
1442 C  CB    . GLU B 27  ? 0.4514 0.4329 0.4647 0.0795  -0.0758 -0.0278 28   GLU B CB    
1443 N  N     . PRO B 28  ? 0.4669 0.5526 0.5731 0.0301  -0.0118 -0.1017 29   PRO B N     
1444 C  CA    . PRO B 28  ? 0.4581 0.5674 0.5717 0.0002  -0.0109 -0.0979 29   PRO B CA    
1445 C  C     . PRO B 28  ? 0.4899 0.5564 0.6023 0.0091  0.0171  -0.0782 29   PRO B C     
1446 O  O     . PRO B 28  ? 0.5211 0.4708 0.5967 -0.0232 0.0835  -0.1446 29   PRO B O     
1447 C  CB    . PRO B 28  ? 0.4825 0.6175 0.5982 0.0041  -0.0313 -0.0800 29   PRO B CB    
1448 C  CG    . PRO B 28  ? 0.5112 0.5903 0.5923 0.0366  -0.0348 -0.1004 29   PRO B CG    
1449 C  CD    . PRO B 28  ? 0.4255 0.5967 0.5790 0.0462  -0.0502 -0.1048 29   PRO B CD    
1450 N  N     . ASN B 29  ? 0.4921 0.5568 0.5766 -0.0001 0.0179  -0.1113 30   ASN B N     
1451 C  CA    . ASN B 29  ? 0.5686 0.5975 0.5837 0.0187  0.0193  -0.0966 30   ASN B CA    
1452 C  C     . ASN B 29  ? 0.5786 0.6043 0.6029 0.0003  0.0082  -0.1063 30   ASN B C     
1453 O  O     . ASN B 29  ? 0.5050 0.6458 0.5996 0.0235  0.0076  -0.1272 30   ASN B O     
1454 C  CB    . ASN B 29  ? 0.6206 0.4856 0.4717 0.0251  0.0088  -0.1625 30   ASN B CB    
1455 C  CG    . ASN B 29  ? 0.7472 0.6244 0.6288 0.0315  0.0212  -0.0311 30   ASN B CG    
1456 O  OD1   . ASN B 29  ? 0.6775 0.6978 0.7905 0.0454  0.0463  -0.1215 30   ASN B OD1   
1457 N  ND2   . ASN B 29  ? 0.6412 0.5236 0.5007 0.0529  -0.0339 -0.0835 30   ASN B ND2   
1458 N  N     . GLN B 30  ? 0.6241 0.7045 0.6627 0.0077  0.0179  -0.0861 31   GLN B N     
1459 C  CA    . GLN B 30  ? 0.7221 0.7694 0.7600 -0.0081 0.0149  -0.0786 31   GLN B CA    
1460 C  C     . GLN B 30  ? 0.6429 0.7235 0.6796 -0.0023 0.0232  -0.0779 31   GLN B C     
1461 O  O     . GLN B 30  ? 0.6749 0.7070 0.6777 -0.0216 0.0047  -0.0913 31   GLN B O     
1462 C  CB    . GLN B 30  ? 0.6885 0.7935 0.7946 0.0024  0.0068  -0.0675 31   GLN B CB    
1463 C  CG    . GLN B 30  ? 0.8177 0.9030 0.9057 0.0018  -0.0046 -0.0234 31   GLN B CG    
1464 C  CD    . GLN B 30  ? 0.8210 0.8859 0.9259 0.0110  0.0414  -0.0285 31   GLN B CD    
1465 O  OE1   . GLN B 30  ? 1.0448 1.0675 1.0951 0.0061  0.0424  0.0065  31   GLN B OE1   
1466 N  NE2   . GLN B 30  ? 1.0378 1.0337 1.0899 0.0278  0.0167  0.0273  31   GLN B NE2   
1467 N  N     . SER B 31  ? 0.6196 0.6523 0.6057 0.0222  0.0488  -0.0988 32   SER B N     
1468 C  CA    . SER B 31  ? 0.6293 0.7020 0.6044 -0.0021 0.0366  -0.0730 32   SER B CA    
1469 C  C     . SER B 31  ? 0.6437 0.7267 0.5976 0.0031  0.0080  -0.0912 32   SER B C     
1470 O  O     . SER B 31  ? 0.6493 0.7486 0.5465 -0.0158 0.0505  -0.1273 32   SER B O     
1471 C  CB    . SER B 31  ? 0.6633 0.6940 0.6257 0.0197  0.0299  -0.0653 32   SER B CB    
1472 O  OG    . SER B 31  ? 0.7217 0.8053 0.7495 -0.0269 0.0469  -0.0500 32   SER B OG    
1473 N  N     . SER B 32  ? 0.6101 0.7183 0.5453 0.0037  0.0280  -0.1083 33   SER B N     
1474 C  CA    . SER B 32  ? 0.5887 0.6213 0.5196 -0.0056 -0.0033 -0.0859 33   SER B CA    
1475 C  C     . SER B 32  ? 0.5918 0.6120 0.5487 0.0058  -0.0040 -0.1070 33   SER B C     
1476 O  O     . SER B 32  ? 0.5604 0.6166 0.4981 -0.0211 0.0212  -0.1541 33   SER B O     
1477 C  CB    . SER B 32  ? 0.5649 0.5922 0.5141 0.0203  0.0221  -0.0898 33   SER B CB    
1478 O  OG    . SER B 32  ? 0.5778 0.6098 0.4849 0.0493  -0.0064 -0.0965 33   SER B OG    
1479 N  N     . LYS B 33  ? 0.5809 0.6200 0.5905 0.0083  0.0019  -0.0491 34   LYS B N     
1480 C  CA    . LYS B 33  ? 0.6615 0.6733 0.6706 0.0191  -0.0184 -0.0309 34   LYS B CA    
1481 C  C     . LYS B 33  ? 0.6370 0.6449 0.6420 0.0230  -0.0282 -0.0437 34   LYS B C     
1482 O  O     . LYS B 33  ? 0.6532 0.6557 0.6679 0.0603  -0.0216 -0.0655 34   LYS B O     
1483 C  CB    . LYS B 33  ? 0.6200 0.6385 0.6624 -0.0039 -0.0308 -0.0367 34   LYS B CB    
1484 C  CG    . LYS B 33  ? 0.7394 0.6511 0.7217 0.0351  -0.0439 0.0197  34   LYS B CG    
1485 C  CD    . LYS B 33  ? 0.7077 0.7250 0.7492 -0.0019 -0.0137 0.0103  34   LYS B CD    
1486 C  CE    . LYS B 33  ? 0.8679 0.7892 0.8672 0.0048  -0.0013 0.0057  34   LYS B CE    
1487 N  NZ    . LYS B 33  ? 0.7675 0.8116 0.8625 -0.0044 -0.0204 -0.0087 34   LYS B NZ    
1488 N  N     . PHE B 34  ? 0.6257 0.5863 0.6221 0.0256  -0.0041 -0.0612 35   PHE B N     
1489 C  CA    . PHE B 34  ? 0.5870 0.5581 0.5850 0.0177  -0.0094 -0.0597 35   PHE B CA    
1490 C  C     . PHE B 34  ? 0.5604 0.5602 0.5958 0.0461  0.0010  -0.0493 35   PHE B C     
1491 O  O     . PHE B 34  ? 0.5312 0.5481 0.6270 0.0152  -0.0112 -0.0601 35   PHE B O     
1492 C  CB    . PHE B 34  ? 0.6290 0.5615 0.6070 0.0139  0.0003  -0.0444 35   PHE B CB    
1493 C  CG    . PHE B 34  ? 0.6445 0.6285 0.6208 0.0063  -0.0230 -0.0556 35   PHE B CG    
1494 C  CD1   . PHE B 34  ? 0.7016 0.6148 0.6849 -0.0037 -0.0299 0.0044  35   PHE B CD1   
1495 C  CD2   . PHE B 34  ? 0.6571 0.6335 0.6495 0.0337  -0.0027 -0.0455 35   PHE B CD2   
1496 C  CE1   . PHE B 34  ? 0.6896 0.6270 0.7333 0.0337  -0.0253 0.0223  35   PHE B CE1   
1497 C  CE2   . PHE B 34  ? 0.6117 0.6575 0.6736 0.0352  -0.0296 -0.0240 35   PHE B CE2   
1498 C  CZ    . PHE B 34  ? 0.6802 0.6573 0.7454 -0.0235 -0.0337 -0.0194 35   PHE B CZ    
1499 N  N     . LYS B 35  ? 0.5179 0.5200 0.6076 0.0626  0.0016  -0.0751 36   LYS B N     
1500 C  CA    . LYS B 35  ? 0.5371 0.5463 0.6246 0.0664  -0.0008 -0.0876 36   LYS B CA    
1501 C  C     . LYS B 35  ? 0.4812 0.5096 0.5796 0.0619  0.0004  -0.1221 36   LYS B C     
1502 O  O     . LYS B 35  ? 0.3929 0.4722 0.6148 0.1203  -0.0024 -0.1779 36   LYS B O     
1503 C  CB    . LYS B 35  ? 0.5564 0.6409 0.6469 0.0766  -0.0116 -0.0764 36   LYS B CB    
1504 C  CG    . LYS B 35  ? 0.5836 0.6643 0.7735 0.0836  -0.0127 -0.1034 36   LYS B CG    
1505 C  CD    . LYS B 35  ? 0.7111 0.7357 0.8268 0.0438  -0.0275 -0.0845 36   LYS B CD    
1506 C  CE    . LYS B 35  ? 0.7502 0.7032 0.8458 0.0494  -0.0144 -0.0733 36   LYS B CE    
1507 N  NZ    . LYS B 35  ? 0.9049 0.8769 0.9503 0.0097  -0.0229 -0.0143 36   LYS B NZ    
1508 N  N     . HIS B 36  ? 0.4580 0.5171 0.5257 0.0317  -0.0067 -0.0728 37   HIS B N     
1509 C  CA    . HIS B 36  ? 0.4390 0.5024 0.4981 0.0537  -0.0259 -0.0702 37   HIS B CA    
1510 C  C     . HIS B 36  ? 0.4349 0.4783 0.4969 0.0412  -0.0152 -0.0754 37   HIS B C     
1511 O  O     . HIS B 36  ? 0.3847 0.4653 0.5264 0.0905  -0.0062 -0.1050 37   HIS B O     
1512 C  CB    . HIS B 36  ? 0.4031 0.4938 0.4636 0.0120  -0.0119 -0.0672 37   HIS B CB    
1513 C  CG    . HIS B 36  ? 0.5268 0.5603 0.5713 0.0415  -0.0282 -0.0255 37   HIS B CG    
1514 N  ND1   . HIS B 36  ? 0.4806 0.4897 0.5545 0.0164  -0.0727 -0.0172 37   HIS B ND1   
1515 C  CD2   . HIS B 36  ? 0.5453 0.4882 0.5973 0.0383  -0.0314 0.0000  37   HIS B CD2   
1516 C  CE1   . HIS B 36  ? 0.6068 0.5933 0.6140 -0.0257 -0.0826 -0.0063 37   HIS B CE1   
1517 N  NE2   . HIS B 36  ? 0.5702 0.6489 0.6000 -0.0178 -0.1257 -0.0099 37   HIS B NE2   
1518 N  N     . ARG B 37  ? 0.4132 0.4855 0.4407 0.0445  0.0064  -0.1285 38   ARG B N     
1519 C  CA    . ARG B 37  ? 0.4535 0.5292 0.4735 0.0415  0.0093  -0.0749 38   ARG B CA    
1520 C  C     . ARG B 37  ? 0.4387 0.4521 0.4534 0.0517  0.0113  -0.1055 38   ARG B C     
1521 O  O     . ARG B 37  ? 0.4223 0.5124 0.4805 0.0535  0.0017  -0.0665 38   ARG B O     
1522 C  CB    . ARG B 37  ? 0.4562 0.4606 0.4300 0.0909  0.0507  -0.1456 38   ARG B CB    
1523 C  CG    . ARG B 37  ? 0.5088 0.5473 0.4978 0.0107  0.0546  -0.0675 38   ARG B CG    
1524 C  CD    . ARG B 37  ? 0.5560 0.5284 0.5410 0.0096  0.0124  -0.0482 38   ARG B CD    
1525 N  NE    . ARG B 37  ? 0.6253 0.3465 0.6324 -0.0246 0.0005  -0.0731 38   ARG B NE    
1526 C  CZ    . ARG B 37  ? 0.5073 0.4869 0.5925 0.0149  -0.0123 -0.0344 38   ARG B CZ    
1527 N  NH1   . ARG B 37  ? 0.5595 0.4669 0.4309 -0.0834 0.0489  -0.1641 38   ARG B NH1   
1528 N  NH2   . ARG B 37  ? 0.5502 0.5098 0.6254 0.0206  0.0285  0.0813  38   ARG B NH2   
1529 N  N     . LEU B 38  ? 0.4374 0.4631 0.4630 0.0509  -0.0170 -0.0976 39   LEU B N     
1530 C  CA    . LEU B 38  ? 0.4299 0.4765 0.4181 0.0346  -0.0120 -0.0654 39   LEU B CA    
1531 C  C     . LEU B 38  ? 0.4399 0.5041 0.4418 0.0290  -0.0205 -0.0805 39   LEU B C     
1532 O  O     . LEU B 38  ? 0.4829 0.5180 0.4850 0.0831  -0.0206 -0.1057 39   LEU B O     
1533 C  CB    . LEU B 38  ? 0.4532 0.4861 0.4679 0.0330  0.0060  -0.0696 39   LEU B CB    
1534 C  CG    . LEU B 38  ? 0.4976 0.5162 0.5335 -0.0089 -0.0409 0.0006  39   LEU B CG    
1535 C  CD1   . LEU B 38  ? 0.5231 0.6162 0.6155 -0.0080 0.0032  0.0227  39   LEU B CD1   
1536 C  CD2   . LEU B 38  ? 0.4261 0.5768 0.4935 -0.0400 0.0016  -0.0214 39   LEU B CD2   
1537 N  N     . LYS B 39  ? 0.3736 0.4632 0.4103 0.0288  -0.0521 -0.0587 40   LYS B N     
1538 C  CA    . LYS B 39  ? 0.4581 0.4679 0.4751 0.0172  -0.0091 -0.0509 40   LYS B CA    
1539 C  C     . LYS B 39  ? 0.4049 0.4559 0.3926 0.0336  0.0221  -0.0276 40   LYS B C     
1540 O  O     . LYS B 39  ? 0.4182 0.4499 0.4264 0.1147  0.0559  -0.0720 40   LYS B O     
1541 C  CB    . LYS B 39  ? 0.3699 0.5257 0.4989 -0.0347 -0.0105 -0.0073 40   LYS B CB    
1542 C  CG    . LYS B 39  ? 0.5858 0.4761 0.4743 0.0199  -0.0045 -0.0752 40   LYS B CG    
1543 C  CD    . LYS B 39  ? 0.5500 0.5031 0.5830 -0.0449 -0.0058 -0.0832 40   LYS B CD    
1544 C  CE    . LYS B 39  ? 0.7187 0.6886 0.7856 -0.0338 -0.0122 -0.0043 40   LYS B CE    
1545 N  NZ    . LYS B 39  ? 0.6767 0.6111 0.6842 0.0150  -0.0314 0.0280  40   LYS B NZ    
1546 N  N     . LEU B 40  ? 0.3965 0.4063 0.3989 0.0062  0.0017  -0.0311 41   LEU B N     
1547 C  CA    . LEU B 40  ? 0.3997 0.4162 0.4218 0.0261  0.0127  -0.0205 41   LEU B CA    
1548 C  C     . LEU B 40  ? 0.4354 0.3861 0.4059 0.0337  -0.0303 -0.0246 41   LEU B C     
1549 O  O     . LEU B 40  ? 0.3982 0.4232 0.4252 0.0786  -0.0268 -0.0248 41   LEU B O     
1550 C  CB    . LEU B 40  ? 0.4131 0.3582 0.4761 0.0016  -0.0101 -0.0506 41   LEU B CB    
1551 C  CG    . LEU B 40  ? 0.4376 0.3885 0.4716 -0.0009 -0.0222 0.0120  41   LEU B CG    
1552 C  CD1   . LEU B 40  ? 0.4423 0.3938 0.5168 -0.0126 0.0508  0.0316  41   LEU B CD1   
1553 C  CD2   . LEU B 40  ? 0.5349 0.3510 0.4726 -0.0113 -0.0065 -0.0006 41   LEU B CD2   
1554 N  N     . THR B 41  ? 0.4141 0.3948 0.4013 -0.0014 -0.0608 -0.0215 42   THR B N     
1555 C  CA    . THR B 41  ? 0.3739 0.3933 0.3992 0.0184  -0.0386 -0.0247 42   THR B CA    
1556 C  C     . THR B 41  ? 0.3571 0.4639 0.4093 0.0431  -0.0200 -0.0168 42   THR B C     
1557 O  O     . THR B 41  ? 0.3738 0.4962 0.3959 0.0709  -0.0006 -0.0588 42   THR B O     
1558 C  CB    . THR B 41  ? 0.3981 0.3778 0.4032 0.0328  0.0173  0.0168  42   THR B CB    
1559 O  OG1   . THR B 41  ? 0.4435 0.5362 0.4340 0.0355  0.0095  0.0406  42   THR B OG1   
1560 C  CG2   . THR B 41  ? 0.3758 0.3774 0.4206 -0.0075 -0.0200 -0.0129 42   THR B CG2   
1561 N  N     . PHE B 42  ? 0.3499 0.4032 0.3818 0.0580  -0.0279 -0.0272 43   PHE B N     
1562 C  CA    . PHE B 42  ? 0.3033 0.3782 0.3680 0.0065  -0.0124 -0.0286 43   PHE B CA    
1563 C  C     . PHE B 42  ? 0.2885 0.3654 0.3824 0.0312  0.0090  -0.0170 43   PHE B C     
1564 O  O     . PHE B 42  ? 0.3080 0.3894 0.3727 -0.0133 -0.0179 -0.0154 43   PHE B O     
1565 C  CB    . PHE B 42  ? 0.2944 0.3611 0.3234 0.0389  0.0072  -0.0466 43   PHE B CB    
1566 C  CG    . PHE B 42  ? 0.3065 0.3999 0.3799 0.0189  -0.0028 -0.0019 43   PHE B CG    
1567 C  CD1   . PHE B 42  ? 0.3563 0.4016 0.3763 -0.0017 -0.0226 -0.0187 43   PHE B CD1   
1568 C  CD2   . PHE B 42  ? 0.3682 0.2906 0.4169 0.0378  -0.0301 -0.0395 43   PHE B CD2   
1569 C  CE1   . PHE B 42  ? 0.4171 0.4300 0.3669 0.0200  -0.0129 -0.0496 43   PHE B CE1   
1570 C  CE2   . PHE B 42  ? 0.1712 0.3951 0.3552 0.0119  -0.0118 -0.0568 43   PHE B CE2   
1571 C  CZ    . PHE B 42  ? 0.3362 0.3917 0.3181 0.0125  0.0170  -0.0114 43   PHE B CZ    
1572 N  N     . GLN B 43  ? 0.2303 0.3344 0.3708 -0.0279 0.0173  0.0049  44   GLN B N     
1573 C  CA    . GLN B 43  ? 0.4091 0.3420 0.4172 0.0275  -0.0085 -0.0443 44   GLN B CA    
1574 C  C     . GLN B 43  ? 0.2617 0.3410 0.3735 -0.0022 -0.0086 -0.0091 44   GLN B C     
1575 O  O     . GLN B 43  ? 0.2791 0.3048 0.3405 -0.0148 0.0119  -0.0158 44   GLN B O     
1576 C  CB    . GLN B 43  ? 0.2762 0.2042 0.4069 -0.1377 0.0946  0.0055  44   GLN B CB    
1577 C  CG    . GLN B 43  ? 0.3294 0.4680 0.4848 0.0363  0.0003  -0.0695 44   GLN B CG    
1578 C  CD    . GLN B 43  ? 0.3243 0.4668 0.4483 -0.0134 0.0172  -0.0260 44   GLN B CD    
1579 O  OE1   . GLN B 43  ? 0.5174 0.4807 0.5308 -0.0462 0.0102  -0.0551 44   GLN B OE1   
1580 N  NE2   . GLN B 43  ? 0.3161 0.4840 0.4825 0.0098  0.0321  -0.0270 44   GLN B NE2   
1581 N  N     . VAL B 44  ? 0.2273 0.2927 0.3205 -0.0197 -0.0111 -0.0276 45   VAL B N     
1582 C  CA    . VAL B 44  ? 0.2506 0.2524 0.3292 -0.0280 -0.0019 0.0147  45   VAL B CA    
1583 C  C     . VAL B 44  ? 0.2451 0.2957 0.3296 -0.0100 -0.0057 -0.0140 45   VAL B C     
1584 O  O     . VAL B 44  ? 0.2675 0.3595 0.3337 -0.0160 -0.0056 -0.0045 45   VAL B O     
1585 C  CB    . VAL B 44  ? 0.2488 0.2218 0.2829 -0.0442 0.0135  -0.0092 45   VAL B CB    
1586 C  CG1   . VAL B 44  ? 0.2306 0.2885 0.3281 0.0067  -0.0009 0.0150  45   VAL B CG1   
1587 C  CG2   . VAL B 44  ? 0.2508 0.3340 0.3274 -0.0451 0.0123  -0.0046 45   VAL B CG2   
1588 N  N     . THR B 45  ? 0.2926 0.3142 0.3438 -0.0185 -0.0207 -0.0144 46   THR B N     
1589 C  CA    . THR B 45  ? 0.2484 0.3139 0.3173 -0.0215 -0.0297 0.0014  46   THR B CA    
1590 C  C     . THR B 45  ? 0.2464 0.2919 0.3032 -0.0136 -0.0313 0.0000  46   THR B C     
1591 O  O     . THR B 45  ? 0.2793 0.3358 0.3155 -0.0020 -0.0150 0.0404  46   THR B O     
1592 C  CB    . THR B 45  ? 0.2438 0.2911 0.3580 -0.0291 -0.0572 -0.0081 46   THR B CB    
1593 O  OG1   . THR B 45  ? 0.2767 0.3439 0.3316 0.0143  0.0003  -0.0305 46   THR B OG1   
1594 C  CG2   . THR B 45  ? 0.2431 0.3337 0.3324 -0.0448 -0.0379 -0.0336 46   THR B CG2   
1595 N  N     . GLN B 46  ? 0.2633 0.3088 0.3300 0.0275  -0.0105 0.0118  47   GLN B N     
1596 C  CA    . GLN B 46  ? 0.2777 0.3064 0.3630 -0.0265 -0.0057 -0.0056 47   GLN B CA    
1597 C  C     . GLN B 46  ? 0.3296 0.3166 0.3302 -0.0218 0.0330  0.0127  47   GLN B C     
1598 O  O     . GLN B 46  ? 0.3318 0.4033 0.3182 -0.0236 -0.0141 0.0511  47   GLN B O     
1599 C  CB    . GLN B 46  ? 0.2889 0.3143 0.2720 0.0273  -0.0087 -0.0104 47   GLN B CB    
1600 C  CG    . GLN B 46  ? 0.2805 0.2134 0.2986 -0.0087 0.0022  0.0398  47   GLN B CG    
1601 C  CD    . GLN B 46  ? 0.3053 0.3423 0.3504 -0.0122 0.0059  -0.0227 47   GLN B CD    
1602 O  OE1   . GLN B 46  ? 0.2948 0.3691 0.3389 -0.0161 0.0208  -0.0112 47   GLN B OE1   
1603 N  NE2   . GLN B 46  ? 0.2367 0.2974 0.2787 -0.0108 -0.0011 -0.0088 47   GLN B NE2   
1604 N  N     . LYS B 47  ? 0.3143 0.3049 0.3383 -0.0606 0.0266  -0.0051 48   LYS B N     
1605 C  CA    . LYS B 47  ? 0.3672 0.3086 0.3493 -0.0628 0.0232  0.0105  48   LYS B CA    
1606 C  C     . LYS B 47  ? 0.3499 0.3061 0.3684 -0.0265 0.0451  -0.0041 48   LYS B C     
1607 O  O     . LYS B 47  ? 0.3677 0.3845 0.3480 -0.0287 0.0370  0.0141  48   LYS B O     
1608 C  CB    . LYS B 47  ? 0.4005 0.3531 0.3804 -0.0555 0.0403  0.0095  48   LYS B CB    
1609 C  CG    . LYS B 47  ? 0.3977 0.2235 0.4617 -0.1064 -0.0434 -0.0089 48   LYS B CG    
1610 C  CD    . LYS B 47  ? 0.6280 0.4716 0.5259 -0.0141 0.0102  -0.0259 48   LYS B CD    
1611 C  CE    . LYS B 47  ? 0.5538 0.2762 0.4974 -0.1593 -0.0667 -0.0520 48   LYS B CE    
1612 N  NZ    . LYS B 47  ? 0.7870 0.6808 0.7345 -0.0489 -0.0450 0.0055  48   LYS B NZ    
1613 N  N     . THR B 48  ? 0.4028 0.3501 0.3434 0.0024  0.0301  0.0331  49   THR B N     
1614 C  CA    . THR B 48  ? 0.3524 0.4306 0.3791 -0.0186 0.0197  -0.0012 49   THR B CA    
1615 C  C     . THR B 48  ? 0.3770 0.4010 0.3963 -0.0139 0.0068  0.0001  49   THR B C     
1616 O  O     . THR B 48  ? 0.3967 0.3789 0.3797 0.0270  0.0095  0.0317  49   THR B O     
1617 C  CB    . THR B 48  ? 0.3974 0.4484 0.3795 0.0114  0.0294  0.0017  49   THR B CB    
1618 O  OG1   . THR B 48  ? 0.3722 0.4423 0.3898 0.0062  0.0035  -0.0176 49   THR B OG1   
1619 C  CG2   . THR B 48  ? 0.4256 0.5151 0.3647 0.0023  0.0390  -0.0206 49   THR B CG2   
1620 N  N     . GLN B 49  ? 0.3595 0.4328 0.4280 -0.0322 -0.0127 -0.0012 50   GLN B N     
1621 C  CA    . GLN B 49  ? 0.4536 0.4343 0.5157 -0.0484 -0.0005 0.0233  50   GLN B CA    
1622 C  C     . GLN B 49  ? 0.4526 0.4178 0.4424 -0.0064 -0.0113 0.0229  50   GLN B C     
1623 O  O     . GLN B 49  ? 0.4492 0.4142 0.4791 -0.0515 -0.0094 0.0614  50   GLN B O     
1624 C  CB    . GLN B 49  ? 0.5130 0.5042 0.5149 -0.0230 -0.0252 0.0112  50   GLN B CB    
1625 C  CG    . GLN B 49  ? 0.5621 0.6021 0.5928 -0.0992 0.0370  -0.0087 50   GLN B CG    
1626 C  CD    . GLN B 49  ? 0.6240 0.5737 0.6676 -0.0238 0.0041  -0.0427 50   GLN B CD    
1627 O  OE1   . GLN B 49  ? 0.7191 0.7084 0.8279 -0.0222 0.0110  -0.0147 50   GLN B OE1   
1628 N  NE2   . GLN B 49  ? 0.7420 0.7846 0.6663 -0.0031 0.0355  -0.1293 50   GLN B NE2   
1629 N  N     . ARG B 50  ? 0.3987 0.3290 0.4079 -0.0503 -0.0097 0.0137  51   ARG B N     
1630 C  CA    . ARG B 50  ? 0.3708 0.3747 0.3674 0.0035  0.0092  0.0025  51   ARG B CA    
1631 C  C     . ARG B 50  ? 0.3304 0.3818 0.3554 0.0003  -0.0160 0.0193  51   ARG B C     
1632 O  O     . ARG B 50  ? 0.3803 0.3902 0.3842 0.0051  0.0124  0.0368  51   ARG B O     
1633 C  CB    . ARG B 50  ? 0.3162 0.3503 0.3269 0.0214  0.0378  0.0030  51   ARG B CB    
1634 C  CG    . ARG B 50  ? 0.3552 0.3348 0.3255 -0.0163 0.0077  -0.0151 51   ARG B CG    
1635 C  CD    . ARG B 50  ? 0.4200 0.3718 0.3431 -0.0018 0.0163  0.0492  51   ARG B CD    
1636 N  NE    . ARG B 50  ? 0.3274 0.3669 0.3539 -0.0738 -0.0148 -0.0300 51   ARG B NE    
1637 C  CZ    . ARG B 50  ? 0.3944 0.4494 0.4160 0.0078  0.0077  0.0062  51   ARG B CZ    
1638 N  NH1   . ARG B 50  ? 0.4651 0.4079 0.3008 0.0453  0.0150  0.0060  51   ARG B NH1   
1639 N  NH2   . ARG B 50  ? 0.3745 0.3597 0.2824 0.0258  0.0106  0.0163  51   ARG B NH2   
1640 N  N     . ARG B 51  ? 0.2851 0.3662 0.3294 0.0268  0.0328  0.0094  52   ARG B N     
1641 C  CA    . ARG B 51  ? 0.3233 0.4133 0.3502 -0.0091 0.0231  0.0099  52   ARG B CA    
1642 C  C     . ARG B 51  ? 0.3877 0.4003 0.3634 0.0012  0.0147  -0.0021 52   ARG B C     
1643 O  O     . ARG B 51  ? 0.3791 0.4093 0.3661 0.0293  0.0210  0.0426  52   ARG B O     
1644 C  CB    . ARG B 51  ? 0.3656 0.4875 0.4588 0.0297  0.0436  -0.0840 52   ARG B CB    
1645 C  CG    . ARG B 51  ? 0.5351 0.5671 0.5170 0.0204  -0.0035 -0.0031 52   ARG B CG    
1646 C  CD    . ARG B 51  ? 0.5882 0.6551 0.5081 -0.0045 -0.0068 0.0981  52   ARG B CD    
1647 N  NE    . ARG B 51  ? 0.6564 0.6435 0.4993 -0.0353 0.0077  0.0057  52   ARG B NE    
1648 C  CZ    . ARG B 51  ? 0.5302 0.5954 0.6063 0.0431  -0.0264 0.0169  52   ARG B CZ    
1649 N  NH1   . ARG B 51  ? 0.4966 0.6342 0.5261 -0.0168 -0.0079 -0.0563 52   ARG B NH1   
1650 N  NH2   . ARG B 51  ? 0.5548 0.4896 0.6516 -0.0385 -0.0063 0.0815  52   ARG B NH2   
1651 N  N     . TRP B 52  ? 0.3706 0.3249 0.3592 0.0249  -0.0026 0.0435  53   TRP B N     
1652 C  CA    . TRP B 52  ? 0.4073 0.3414 0.3822 -0.0073 0.0135  0.0402  53   TRP B CA    
1653 C  C     . TRP B 52  ? 0.3828 0.3725 0.3932 0.0084  -0.0018 0.0208  53   TRP B C     
1654 O  O     . TRP B 52  ? 0.4035 0.3854 0.4525 0.0038  0.0312  0.0221  53   TRP B O     
1655 C  CB    . TRP B 52  ? 0.4646 0.3813 0.4236 0.0151  -0.0118 0.0403  53   TRP B CB    
1656 C  CG    . TRP B 52  ? 0.4905 0.3684 0.4334 0.0210  -0.0186 0.0105  53   TRP B CG    
1657 C  CD1   . TRP B 52  ? 0.4918 0.4528 0.4506 0.0761  -0.0194 0.0178  53   TRP B CD1   
1658 C  CD2   . TRP B 52  ? 0.4148 0.3274 0.4493 0.0394  -0.0380 0.0254  53   TRP B CD2   
1659 N  NE1   . TRP B 52  ? 0.4549 0.3995 0.4917 0.0655  -0.0243 0.0232  53   TRP B NE1   
1660 C  CE2   . TRP B 52  ? 0.4677 0.3819 0.4651 0.0753  -0.0015 0.0374  53   TRP B CE2   
1661 C  CE3   . TRP B 52  ? 0.4722 0.3677 0.4388 0.0675  -0.0202 0.0919  53   TRP B CE3   
1662 C  CZ2   . TRP B 52  ? 0.4447 0.4421 0.4997 0.0446  -0.0044 0.0222  53   TRP B CZ2   
1663 C  CZ3   . TRP B 52  ? 0.5155 0.4318 0.4593 0.0450  0.0055  0.0230  53   TRP B CZ3   
1664 C  CH2   . TRP B 52  ? 0.5673 0.4763 0.5123 -0.0115 0.0087  0.0510  53   TRP B CH2   
1665 N  N     . PHE B 53  ? 0.3802 0.3564 0.3491 0.0070  -0.0020 0.0334  54   PHE B N     
1666 C  CA    . PHE B 53  ? 0.3702 0.3648 0.3235 0.0269  -0.0167 0.0325  54   PHE B CA    
1667 C  C     . PHE B 53  ? 0.3377 0.3417 0.3012 0.0107  -0.0207 0.0192  54   PHE B C     
1668 O  O     . PHE B 53  ? 0.2938 0.3115 0.3371 0.0496  -0.0290 0.0654  54   PHE B O     
1669 C  CB    . PHE B 53  ? 0.3813 0.3878 0.3243 -0.0163 -0.0362 -0.0011 54   PHE B CB    
1670 C  CG    . PHE B 53  ? 0.4511 0.4450 0.3885 -0.0175 -0.0259 -0.0022 54   PHE B CG    
1671 C  CD1   . PHE B 53  ? 0.4966 0.5132 0.4877 -0.0370 0.0128  -0.0016 54   PHE B CD1   
1672 C  CD2   . PHE B 53  ? 0.4689 0.3916 0.4769 -0.0546 0.0265  -0.0869 54   PHE B CD2   
1673 C  CE1   . PHE B 53  ? 0.5046 0.6056 0.5023 0.0125  0.0255  0.0721  54   PHE B CE1   
1674 C  CE2   . PHE B 53  ? 0.4834 0.4008 0.4422 -0.0162 -0.0331 0.0110  54   PHE B CE2   
1675 C  CZ    . PHE B 53  ? 0.4366 0.5166 0.3928 -0.0158 0.0171  -0.0132 54   PHE B CZ    
1676 N  N     . LEU B 54  ? 0.3245 0.3267 0.3199 -0.0065 -0.0247 0.0136  55   LEU B N     
1677 C  CA    . LEU B 54  ? 0.3114 0.3758 0.3347 0.0189  -0.0172 -0.0011 55   LEU B CA    
1678 C  C     . LEU B 54  ? 0.3111 0.3660 0.3707 0.0050  -0.0264 -0.0043 55   LEU B C     
1679 O  O     . LEU B 54  ? 0.3525 0.3710 0.3571 -0.0297 0.0040  0.0371  55   LEU B O     
1680 C  CB    . LEU B 54  ? 0.3297 0.3435 0.3631 0.0228  -0.0680 0.0066  55   LEU B CB    
1681 C  CG    . LEU B 54  ? 0.2464 0.3598 0.2813 -0.0277 -0.0350 0.0578  55   LEU B CG    
1682 C  CD1   . LEU B 54  ? 0.2966 0.3926 0.3456 -0.0470 -0.0299 -0.0033 55   LEU B CD1   
1683 C  CD2   . LEU B 54  ? 0.2695 0.3495 0.2921 -0.0176 -0.0401 0.0507  55   LEU B CD2   
1684 N  N     . ASP B 55  ? 0.3046 0.3625 0.3442 -0.0177 -0.0155 0.0127  56   ASP B N     
1685 C  CA    . ASP B 55  ? 0.3268 0.3927 0.3392 -0.0231 -0.0091 0.0248  56   ASP B CA    
1686 C  C     . ASP B 55  ? 0.3740 0.3655 0.3554 -0.0014 -0.0186 0.0338  56   ASP B C     
1687 O  O     . ASP B 55  ? 0.4176 0.4127 0.3645 0.0121  0.0019  -0.0005 56   ASP B O     
1688 C  CB    . ASP B 55  ? 0.3588 0.3897 0.3966 -0.0233 -0.0109 0.0464  56   ASP B CB    
1689 C  CG    . ASP B 55  ? 0.4007 0.4510 0.4150 -0.0041 -0.0186 0.0187  56   ASP B CG    
1690 O  OD1   . ASP B 55  ? 0.3895 0.4556 0.4748 0.0057  0.0630  -0.0004 56   ASP B OD1   
1691 O  OD2   . ASP B 55  ? 0.4683 0.4839 0.4021 -0.0498 0.0688  -0.0789 56   ASP B OD2   
1692 N  N     . LYS B 56  ? 0.3327 0.3611 0.3386 0.0208  -0.0030 0.0506  57   LYS B N     
1693 C  CA    . LYS B 56  ? 0.3764 0.3959 0.4259 0.0085  -0.0076 0.0370  57   LYS B CA    
1694 C  C     . LYS B 56  ? 0.3567 0.4236 0.4226 0.0146  -0.0051 -0.0190 57   LYS B C     
1695 O  O     . LYS B 56  ? 0.3614 0.4171 0.5098 0.0272  -0.0654 0.0303  57   LYS B O     
1696 C  CB    . LYS B 56  ? 0.3703 0.4895 0.4488 0.0061  0.0134  0.0125  57   LYS B CB    
1697 C  CG    . LYS B 56  ? 0.5152 0.6059 0.6465 0.0097  -0.0001 0.0312  57   LYS B CG    
1698 C  CD    . LYS B 56  ? 0.6682 0.7902 0.7292 0.0497  -0.0601 0.0746  57   LYS B CD    
1699 C  CE    . LYS B 56  ? 0.7554 0.7402 0.7880 -0.0102 -0.0139 0.0398  57   LYS B CE    
1700 N  NZ    . LYS B 56  ? 0.7467 0.6591 0.7156 -0.0306 -0.0452 0.0811  57   LYS B NZ    
1701 N  N     . LEU B 57  ? 0.2978 0.4027 0.3640 0.0143  -0.0304 0.0273  58   LEU B N     
1702 C  CA    . LEU B 57  ? 0.3317 0.4306 0.4032 0.0173  -0.0282 0.0473  58   LEU B CA    
1703 C  C     . LEU B 57  ? 0.3525 0.4346 0.3529 0.0083  -0.0487 0.0548  58   LEU B C     
1704 O  O     . LEU B 57  ? 0.3417 0.4341 0.3744 0.0059  -0.0479 0.0703  58   LEU B O     
1705 C  CB    . LEU B 57  ? 0.3195 0.5270 0.4062 -0.0020 -0.0323 0.0602  58   LEU B CB    
1706 C  CG    . LEU B 57  ? 0.4614 0.5998 0.5193 0.0113  -0.0601 0.0889  58   LEU B CG    
1707 C  CD1   . LEU B 57  ? 0.3617 0.6518 0.5581 0.0681  0.0557  0.0230  58   LEU B CD1   
1708 C  CD2   . LEU B 57  ? 0.4761 0.5787 0.4273 -0.0114 -0.0478 0.1030  58   LEU B CD2   
1709 N  N     . VAL B 58  ? 0.2977 0.3958 0.3692 0.0126  -0.0488 0.0475  59   VAL B N     
1710 C  CA    . VAL B 58  ? 0.3389 0.4735 0.3558 -0.0063 -0.0158 0.0007  59   VAL B CA    
1711 C  C     . VAL B 58  ? 0.3606 0.4532 0.3796 -0.0048 -0.0107 -0.0062 59   VAL B C     
1712 O  O     . VAL B 58  ? 0.3573 0.4906 0.3311 -0.0115 -0.0173 -0.0040 59   VAL B O     
1713 C  CB    . VAL B 58  ? 0.3617 0.5168 0.4262 -0.0118 0.0080  -0.0320 59   VAL B CB    
1714 C  CG1   . VAL B 58  ? 0.4409 0.6839 0.4306 -0.0473 -0.0155 -0.0007 59   VAL B CG1   
1715 C  CG2   . VAL B 58  ? 0.3512 0.5118 0.4121 0.0039  -0.0627 -0.0052 59   VAL B CG2   
1716 N  N     . ASP B 59  ? 0.3581 0.4901 0.4298 0.0083  -0.0274 0.0336  60   ASP B N     
1717 C  CA    . ASP B 59  ? 0.3675 0.4921 0.4607 0.0049  -0.0180 0.0290  60   ASP B CA    
1718 C  C     . ASP B 59  ? 0.4138 0.4778 0.4770 -0.0123 -0.0318 0.0125  60   ASP B C     
1719 O  O     . ASP B 59  ? 0.4087 0.5217 0.4467 -0.0017 -0.0208 0.0255  60   ASP B O     
1720 C  CB    . ASP B 59  ? 0.3351 0.4658 0.4784 -0.0096 -0.0450 0.0255  60   ASP B CB    
1721 C  CG    . ASP B 59  ? 0.4643 0.5731 0.5334 0.0325  -0.0256 0.0033  60   ASP B CG    
1722 O  OD1   . ASP B 59  ? 0.4840 0.6957 0.5679 0.0803  -0.1304 0.0172  60   ASP B OD1   
1723 O  OD2   . ASP B 59  ? 0.4698 0.7624 0.7764 0.0948  -0.0799 -0.0082 60   ASP B OD2   
1724 N  N     . GLU B 60  ? 0.3807 0.4747 0.4233 -0.0291 -0.0311 0.0289  61   GLU B N     
1725 C  CA    . GLU B 60  ? 0.4151 0.4420 0.4631 -0.0117 -0.0118 0.0114  61   GLU B CA    
1726 C  C     . GLU B 60  ? 0.3778 0.4498 0.4802 0.0009  -0.0221 0.0201  61   GLU B C     
1727 O  O     . GLU B 60  ? 0.3501 0.4711 0.5108 0.0149  -0.0381 0.0186  61   GLU B O     
1728 C  CB    . GLU B 60  ? 0.3616 0.4480 0.4581 -0.0119 -0.0455 -0.0037 61   GLU B CB    
1729 C  CG    . GLU B 60  ? 0.4109 0.4596 0.5289 0.0338  -0.0172 0.0023  61   GLU B CG    
1730 C  CD    . GLU B 60  ? 0.6745 0.7138 0.6592 0.0237  -0.0032 -0.0537 61   GLU B CD    
1731 O  OE1   . GLU B 60  ? 0.7722 0.7326 0.7170 0.0349  0.0534  -0.0038 61   GLU B OE1   
1732 O  OE2   . GLU B 60  ? 0.8163 0.7868 0.8959 0.1003  -0.0189 0.0153  61   GLU B OE2   
1733 N  N     . ILE B 61  ? 0.3566 0.4562 0.5058 -0.0037 0.0152  0.0160  62   ILE B N     
1734 C  CA    . ILE B 61  ? 0.3438 0.4155 0.4294 -0.0030 -0.0044 0.0112  62   ILE B CA    
1735 C  C     . ILE B 61  ? 0.3773 0.4425 0.4676 -0.0177 -0.0197 0.0171  62   ILE B C     
1736 O  O     . ILE B 61  ? 0.3487 0.4632 0.4359 -0.0287 -0.0129 -0.0162 62   ILE B O     
1737 C  CB    . ILE B 61  ? 0.3545 0.3698 0.4789 0.0012  -0.0104 -0.0178 62   ILE B CB    
1738 C  CG1   . ILE B 61  ? 0.2784 0.4858 0.3591 0.0103  -0.0518 0.0445  62   ILE B CG1   
1739 C  CG2   . ILE B 61  ? 0.3259 0.4141 0.4885 0.0366  -0.0329 0.0085  62   ILE B CG2   
1740 C  CD1   . ILE B 61  ? 0.3586 0.4322 0.4143 -0.0202 0.0048  0.0306  62   ILE B CD1   
1741 N  N     . GLY B 62  ? 0.3132 0.4586 0.4077 0.0043  -0.0287 0.0275  63   GLY B N     
1742 C  CA    . GLY B 62  ? 0.3570 0.4185 0.4246 0.0015  -0.0349 0.0138  63   GLY B CA    
1743 C  C     . GLY B 62  ? 0.3856 0.4954 0.4303 -0.0147 -0.0472 0.0024  63   GLY B C     
1744 O  O     . GLY B 62  ? 0.3364 0.5527 0.4404 -0.0138 -0.1147 0.0007  63   GLY B O     
1745 N  N     . VAL B 63  ? 0.4088 0.4833 0.4353 0.0016  -0.0594 0.0115  64   VAL B N     
1746 C  CA    . VAL B 63  ? 0.3996 0.4398 0.4505 -0.0215 -0.0570 -0.0120 64   VAL B CA    
1747 C  C     . VAL B 63  ? 0.3844 0.4534 0.4297 -0.0202 -0.0343 -0.0190 64   VAL B C     
1748 O  O     . VAL B 63  ? 0.3268 0.4090 0.3984 -0.0265 -0.0352 0.0080  64   VAL B O     
1749 C  CB    . VAL B 63  ? 0.4786 0.4639 0.4296 0.0125  -0.0421 -0.0047 64   VAL B CB    
1750 C  CG1   . VAL B 63  ? 0.4932 0.3490 0.4534 -0.0454 -0.0399 0.0126  64   VAL B CG1   
1751 C  CG2   . VAL B 63  ? 0.5718 0.5560 0.5628 -0.0080 -0.0227 -0.0277 64   VAL B CG2   
1752 N  N     . GLY B 64  ? 0.3577 0.4369 0.4032 -0.0280 -0.0363 -0.0570 65   GLY B N     
1753 C  CA    . GLY B 64  ? 0.3537 0.4060 0.3492 -0.0069 -0.0014 -0.0356 65   GLY B CA    
1754 C  C     . GLY B 64  ? 0.3924 0.4509 0.3772 -0.0164 -0.0179 -0.0068 65   GLY B C     
1755 O  O     . GLY B 64  ? 0.3769 0.4761 0.3448 -0.0218 -0.0718 0.0063  65   GLY B O     
1756 N  N     . TYR B 65  ? 0.3717 0.4311 0.3173 -0.0108 -0.0092 -0.0205 66   TYR B N     
1757 C  CA    . TYR B 65  ? 0.3513 0.4079 0.3354 -0.0027 0.0061  -0.0300 66   TYR B CA    
1758 C  C     . TYR B 65  ? 0.3644 0.3567 0.3476 0.0041  0.0176  -0.0294 66   TYR B C     
1759 O  O     . TYR B 65  ? 0.3335 0.3365 0.3871 -0.0070 -0.0269 -0.0183 66   TYR B O     
1760 C  CB    . TYR B 65  ? 0.3912 0.4921 0.3784 0.0166  -0.0006 -0.0343 66   TYR B CB    
1761 C  CG    . TYR B 65  ? 0.4680 0.4248 0.4491 0.0117  -0.0098 0.0091  66   TYR B CG    
1762 C  CD1   . TYR B 65  ? 0.4986 0.4716 0.3947 0.0314  -0.0671 -0.1092 66   TYR B CD1   
1763 C  CD2   . TYR B 65  ? 0.4639 0.5209 0.4362 0.0047  -0.0004 -0.0307 66   TYR B CD2   
1764 C  CE1   . TYR B 65  ? 0.5161 0.4510 0.3996 0.0000  -0.0588 -0.0873 66   TYR B CE1   
1765 C  CE2   . TYR B 65  ? 0.4338 0.5026 0.4466 -0.0004 -0.0201 -0.0431 66   TYR B CE2   
1766 C  CZ    . TYR B 65  ? 0.4835 0.5421 0.5041 0.0227  -0.0456 0.0051  66   TYR B CZ    
1767 O  OH    . TYR B 65  ? 0.4141 0.5594 0.4844 0.0464  -0.0121 -0.0250 66   TYR B OH    
1768 N  N     . VAL B 66  ? 0.3591 0.4027 0.3369 0.0119  0.0108  -0.0249 67   VAL B N     
1769 C  CA    . VAL B 66  ? 0.3640 0.3942 0.3491 -0.0062 -0.0027 -0.0196 67   VAL B CA    
1770 C  C     . VAL B 66  ? 0.4060 0.4289 0.3522 -0.0069 0.0023  -0.0072 67   VAL B C     
1771 O  O     . VAL B 66  ? 0.4381 0.4221 0.3374 0.0414  -0.0255 0.0360  67   VAL B O     
1772 C  CB    . VAL B 66  ? 0.3596 0.3823 0.3968 -0.0017 -0.0137 -0.0251 67   VAL B CB    
1773 C  CG1   . VAL B 66  ? 0.3405 0.3542 0.3861 -0.0679 0.0158  0.0192  67   VAL B CG1   
1774 C  CG2   . VAL B 66  ? 0.3092 0.4182 0.4164 0.0018  0.0498  -0.0021 67   VAL B CG2   
1775 N  N     . ARG B 67  ? 0.4648 0.4430 0.4142 -0.0016 -0.0193 -0.0391 68   ARG B N     
1776 C  CA    . ARG B 67  ? 0.4949 0.5227 0.4982 -0.0157 0.0175  -0.0416 68   ARG B CA    
1777 C  C     . ARG B 67  ? 0.4658 0.4523 0.4540 -0.0110 0.0313  -0.0376 68   ARG B C     
1778 O  O     . ARG B 67  ? 0.3970 0.4075 0.3948 -0.0785 0.0190  -0.0404 68   ARG B O     
1779 C  CB    . ARG B 67  ? 0.5074 0.4366 0.5389 0.0036  -0.0030 -0.0533 68   ARG B CB    
1780 C  CG    . ARG B 67  ? 0.7043 0.6288 0.6957 0.0146  0.0422  -0.0366 68   ARG B CG    
1781 C  CD    . ARG B 67  ? 0.6595 0.6959 0.7498 0.0636  0.0356  -0.0477 68   ARG B CD    
1782 N  NE    . ARG B 67  ? 0.8220 0.8923 0.9709 0.0076  0.0010  -0.0004 68   ARG B NE    
1783 C  CZ    . ARG B 67  ? 0.9600 0.9710 0.9920 -0.0192 0.0049  0.0021  68   ARG B CZ    
1784 N  NH1   . ARG B 67  ? 0.9807 1.0158 0.9936 0.0023  -0.0023 -0.0116 68   ARG B NH1   
1785 N  NH2   . ARG B 67  ? 0.9366 0.9806 0.9769 -0.0588 0.0170  0.0127  68   ARG B NH2   
1786 N  N     . ASP B 68  ? 0.4926 0.4982 0.4628 0.0050  0.0609  -0.0648 69   ASP B N     
1787 C  CA    . ASP B 68  ? 0.5575 0.6036 0.5283 0.0094  0.0261  -0.0545 69   ASP B CA    
1788 C  C     . ASP B 68  ? 0.5873 0.6305 0.5547 0.0201  0.0182  -0.0527 69   ASP B C     
1789 O  O     . ASP B 68  ? 0.5759 0.6421 0.5467 0.0016  0.0045  -0.0422 69   ASP B O     
1790 N  N     . SER B 69  ? 0.6303 0.6089 0.5584 -0.0003 0.0132  -0.0330 70   SER B N     
1791 C  CA    . SER B 69  ? 0.6987 0.6554 0.6355 -0.0243 0.0102  -0.0266 70   SER B CA    
1792 C  C     . SER B 69  ? 0.6966 0.6290 0.6468 -0.0484 0.0062  -0.0218 70   SER B C     
1793 O  O     . SER B 69  ? 0.7520 0.6646 0.7291 -0.0586 -0.0251 -0.0217 70   SER B O     
1794 C  CB    . SER B 69  ? 0.7172 0.5997 0.6641 -0.0284 -0.0105 -0.0295 70   SER B CB    
1795 O  OG    . SER B 69  ? 0.7727 0.8249 0.7943 -0.0298 0.0202  -0.0169 70   SER B OG    
1796 N  N     . GLY B 70  ? 0.6675 0.6482 0.6210 -0.0507 0.0347  -0.0370 71   GLY B N     
1797 C  CA    . GLY B 70  ? 0.5718 0.6054 0.6152 -0.0467 0.0378  -0.0245 71   GLY B CA    
1798 C  C     . GLY B 70  ? 0.5423 0.5919 0.5697 -0.0543 0.0272  -0.0243 71   GLY B C     
1799 O  O     . GLY B 70  ? 0.5611 0.5910 0.5736 -0.0507 0.0728  -0.0179 71   GLY B O     
1800 N  N     . SER B 71  ? 0.3980 0.5841 0.5748 -0.0630 0.0316  -0.0182 72   SER B N     
1801 C  CA    . SER B 71  ? 0.4496 0.5998 0.5292 -0.0400 0.0205  -0.0438 72   SER B CA    
1802 C  C     . SER B 71  ? 0.3948 0.4794 0.5139 -0.0374 0.0023  -0.0472 72   SER B C     
1803 O  O     . SER B 71  ? 0.3394 0.3416 0.4672 -0.0651 -0.0053 0.0180  72   SER B O     
1804 C  CB    . SER B 71  ? 0.4827 0.6412 0.5626 -0.0496 -0.0024 -0.0421 72   SER B CB    
1805 O  OG    . SER B 71  ? 0.5587 0.6830 0.6245 -0.0018 0.0475  -0.1492 72   SER B OG    
1806 N  N     . VAL B 72  ? 0.3395 0.4498 0.4804 0.0154  0.0148  -0.0351 73   VAL B N     
1807 C  CA    . VAL B 72  ? 0.3744 0.4350 0.4352 -0.0110 -0.0063 -0.0102 73   VAL B CA    
1808 C  C     . VAL B 72  ? 0.3879 0.4339 0.3880 -0.0085 0.0191  -0.0291 73   VAL B C     
1809 O  O     . VAL B 72  ? 0.2902 0.4615 0.4209 -0.0182 0.0082  -0.0380 73   VAL B O     
1810 C  CB    . VAL B 72  ? 0.3811 0.4391 0.4434 0.0144  -0.0397 -0.0553 73   VAL B CB    
1811 C  CG1   . VAL B 72  ? 0.4884 0.5450 0.3822 0.0576  -0.0198 -0.0383 73   VAL B CG1   
1812 C  CG2   . VAL B 72  ? 0.4221 0.4494 0.5482 0.0154  -0.0605 0.0050  73   VAL B CG2   
1813 N  N     . SER B 73  ? 0.3430 0.3899 0.3475 -0.0176 -0.0242 -0.0154 74   SER B N     
1814 C  CA    . SER B 73  ? 0.3697 0.3728 0.3624 -0.0286 -0.0097 0.0193  74   SER B CA    
1815 C  C     . SER B 73  ? 0.3393 0.2992 0.3274 -0.0607 -0.0068 0.0054  74   SER B C     
1816 O  O     . SER B 73  ? 0.2688 0.3684 0.3449 -0.0810 -0.0037 -0.0001 74   SER B O     
1817 C  CB    . SER B 73  ? 0.3470 0.3661 0.3612 -0.0459 -0.0124 0.0795  74   SER B CB    
1818 O  OG    . SER B 73  ? 0.4265 0.3811 0.3724 -0.0156 -0.0646 0.0734  74   SER B OG    
1819 N  N     . ASN B 74  ? 0.3065 0.3435 0.3236 0.0018  -0.0123 0.0227  75   ASN B N     
1820 C  CA    . ASN B 74  ? 0.2947 0.3072 0.3622 -0.0218 -0.0391 0.0125  75   ASN B CA    
1821 C  C     . ASN B 74  ? 0.3254 0.4234 0.3574 -0.0047 -0.0101 0.0130  75   ASN B C     
1822 O  O     . ASN B 74  ? 0.2622 0.4496 0.3262 -0.0268 -0.0380 -0.0234 75   ASN B O     
1823 C  CB    . ASN B 74  ? 0.3073 0.4110 0.3986 -0.0085 -0.0573 0.0457  75   ASN B CB    
1824 C  CG    . ASN B 74  ? 0.4100 0.4186 0.4276 0.0170  -0.0310 0.0047  75   ASN B CG    
1825 O  OD1   . ASN B 74  ? 0.5083 0.5478 0.4930 -0.0267 -0.0442 0.0390  75   ASN B OD1   
1826 N  ND2   . ASN B 74  ? 0.5144 0.3723 0.3958 0.0336  -0.0679 0.0125  75   ASN B ND2   
1827 N  N     . TYR B 75  ? 0.2924 0.3684 0.3617 -0.0150 0.0015  0.0174  76   TYR B N     
1828 C  CA    . TYR B 75  ? 0.2790 0.3894 0.3276 -0.0115 -0.0304 0.0048  76   TYR B CA    
1829 C  C     . TYR B 75  ? 0.2539 0.3828 0.3768 -0.0213 -0.0095 -0.0136 76   TYR B C     
1830 O  O     . TYR B 75  ? 0.3582 0.3393 0.3313 -0.0324 -0.0199 0.0073  76   TYR B O     
1831 C  CB    . TYR B 75  ? 0.2455 0.4253 0.3305 0.0142  -0.0195 0.0000  76   TYR B CB    
1832 C  CG    . TYR B 75  ? 0.3541 0.3667 0.3483 -0.0105 -0.0078 -0.0353 76   TYR B CG    
1833 C  CD1   . TYR B 75  ? 0.3546 0.4070 0.4087 0.0044  -0.0058 -0.0241 76   TYR B CD1   
1834 C  CD2   . TYR B 75  ? 0.2869 0.2914 0.3267 0.0349  -0.0368 -0.0086 76   TYR B CD2   
1835 C  CE1   . TYR B 75  ? 0.2855 0.3796 0.3737 -0.0210 -0.0272 -0.0075 76   TYR B CE1   
1836 C  CE2   . TYR B 75  ? 0.3055 0.3527 0.3814 0.0469  -0.0161 0.0271  76   TYR B CE2   
1837 C  CZ    . TYR B 75  ? 0.3134 0.3735 0.3449 -0.0074 -0.0245 -0.0164 76   TYR B CZ    
1838 O  OH    . TYR B 75  ? 0.3803 0.3056 0.3494 -0.0081 -0.0196 0.0057  76   TYR B OH    
1839 N  N     . ILE B 76  ? 0.2259 0.3617 0.3107 -0.0063 0.0041  -0.0134 77   ILE B N     
1840 C  CA    . ILE B 76  ? 0.2567 0.3483 0.3459 -0.0085 -0.0172 0.0035  77   ILE B CA    
1841 C  C     . ILE B 76  ? 0.3280 0.3215 0.3495 0.0110  0.0021  -0.0128 77   ILE B C     
1842 O  O     . ILE B 76  ? 0.3581 0.3461 0.3230 -0.0073 -0.0386 -0.0295 77   ILE B O     
1843 C  CB    . ILE B 76  ? 0.3566 0.3928 0.3738 -0.0198 -0.0122 -0.0169 77   ILE B CB    
1844 C  CG1   . ILE B 76  ? 0.3978 0.4960 0.6332 -0.0634 0.0253  -0.0543 77   ILE B CG1   
1845 C  CG2   . ILE B 76  ? 0.4500 0.4407 0.4284 0.0033  -0.0321 -0.0542 77   ILE B CG2   
1846 C  CD1   . ILE B 76  ? 0.5299 0.6924 0.7368 -0.0540 0.0522  -0.0145 77   ILE B CD1   
1847 N  N     . LEU B 77  ? 0.2702 0.3097 0.3521 0.0240  -0.0118 -0.0235 78   LEU B N     
1848 C  CA    . LEU B 77  ? 0.3474 0.3591 0.4150 -0.0178 0.0008  -0.0036 78   LEU B CA    
1849 C  C     . LEU B 77  ? 0.3310 0.3910 0.4178 0.0056  -0.0059 -0.0189 78   LEU B C     
1850 O  O     . LEU B 77  ? 0.3083 0.3829 0.3841 0.0327  0.0033  -0.0533 78   LEU B O     
1851 C  CB    . LEU B 77  ? 0.2826 0.3174 0.3607 0.0066  -0.0404 -0.0021 78   LEU B CB    
1852 C  CG    . LEU B 77  ? 0.3635 0.3635 0.3365 -0.0368 -0.0148 -0.0060 78   LEU B CG    
1853 C  CD1   . LEU B 77  ? 0.3425 0.3235 0.3347 0.0262  -0.0828 0.0057  78   LEU B CD1   
1854 C  CD2   . LEU B 77  ? 0.3433 0.3593 0.3732 -0.0312 -0.0376 -0.0205 78   LEU B CD2   
1855 N  N     . SER B 78  ? 0.3705 0.4228 0.4316 -0.0084 -0.0126 -0.0433 79   SER B N     
1856 C  CA    . SER B 78  ? 0.4469 0.5068 0.5047 -0.0263 -0.0263 -0.0295 79   SER B CA    
1857 C  C     . SER B 78  ? 0.4574 0.4786 0.4539 -0.0211 -0.0072 -0.0382 79   SER B C     
1858 O  O     . SER B 78  ? 0.5219 0.4341 0.4949 0.0137  -0.0289 -0.0386 79   SER B O     
1859 C  CB    . SER B 78  ? 0.4222 0.5750 0.5265 -0.0039 -0.0585 -0.0464 79   SER B CB    
1860 O  OG    . SER B 78  ? 0.5048 0.7453 0.7502 -0.0298 -0.0044 -0.0826 79   SER B OG    
1861 N  N     . GLU B 79  ? 0.4533 0.4247 0.4373 -0.0132 0.0182  -0.0221 80   GLU B N     
1862 C  CA    . GLU B 79  ? 0.4154 0.4687 0.4142 -0.0231 -0.0243 -0.0343 80   GLU B CA    
1863 C  C     . GLU B 79  ? 0.4097 0.4195 0.4204 -0.0224 -0.0332 -0.0307 80   GLU B C     
1864 O  O     . GLU B 79  ? 0.3968 0.4579 0.4562 -0.0351 -0.0004 -0.0361 80   GLU B O     
1865 C  CB    . GLU B 79  ? 0.4891 0.4125 0.4721 0.0125  -0.0203 -0.0381 80   GLU B CB    
1866 C  CG    . GLU B 79  ? 0.5923 0.6042 0.5134 0.0015  -0.0333 -0.0375 80   GLU B CG    
1867 C  CD    . GLU B 79  ? 0.6840 0.6478 0.6304 0.0058  -0.0390 0.0445  80   GLU B CD    
1868 O  OE1   . GLU B 79  ? 0.6717 0.6660 0.6099 -0.0371 -0.0375 0.0981  80   GLU B OE1   
1869 O  OE2   . GLU B 79  ? 0.7308 0.6695 0.6750 -0.0602 -0.0378 0.0023  80   GLU B OE2   
1870 N  N     . ILE B 80  ? 0.3730 0.4303 0.4464 0.0060  -0.0206 -0.0185 81   ILE B N     
1871 C  CA    . ILE B 80  ? 0.4165 0.4194 0.4410 0.0052  -0.0021 -0.0094 81   ILE B CA    
1872 C  C     . ILE B 80  ? 0.4303 0.4241 0.4386 -0.0043 -0.0212 -0.0136 81   ILE B C     
1873 O  O     . ILE B 80  ? 0.4423 0.4430 0.4188 -0.0504 -0.0650 -0.0561 81   ILE B O     
1874 C  CB    . ILE B 80  ? 0.4192 0.4844 0.5188 0.0134  0.0274  0.0210  81   ILE B CB    
1875 C  CG1   . ILE B 80  ? 0.5679 0.5832 0.5589 0.0054  -0.0510 -0.0027 81   ILE B CG1   
1876 C  CG2   . ILE B 80  ? 0.5059 0.4673 0.5202 0.0370  -0.0025 0.0115  81   ILE B CG2   
1877 C  CD1   . ILE B 80  ? 0.7273 0.6932 0.6166 0.0345  -0.0272 0.0224  81   ILE B CD1   
1878 N  N     . LYS B 81  ? 0.3864 0.3879 0.4689 -0.0095 -0.0210 -0.0154 82   LYS B N     
1879 C  CA    . LYS B 81  ? 0.4695 0.4831 0.4856 0.0088  -0.0291 -0.0210 82   LYS B CA    
1880 C  C     . LYS B 81  ? 0.4057 0.4529 0.3942 -0.0119 -0.0391 -0.0289 82   LYS B C     
1881 O  O     . LYS B 81  ? 0.3135 0.4758 0.4352 -0.0274 -0.0757 -0.0209 82   LYS B O     
1882 C  CB    . LYS B 81  ? 0.5297 0.5158 0.5086 0.0137  -0.0498 -0.0473 82   LYS B CB    
1883 C  CG    . LYS B 81  ? 0.6531 0.5759 0.6094 0.0112  -0.0300 -0.0287 82   LYS B CG    
1884 C  CD    . LYS B 81  ? 0.7123 0.5474 0.5664 -0.0398 -0.0356 -0.0487 82   LYS B CD    
1885 C  CE    . LYS B 81  ? 0.8409 0.7366 0.7529 0.0460  -0.0042 -0.0777 82   LYS B CE    
1886 N  NZ    . LYS B 81  ? 0.9711 0.8813 0.8106 -0.0128 -0.0357 -0.1043 82   LYS B NZ    
1887 N  N     . PRO B 82  ? 0.3173 0.4155 0.3716 -0.0148 -0.0019 -0.0193 83   PRO B N     
1888 C  CA    . PRO B 82  ? 0.3575 0.3981 0.3890 -0.0056 -0.0125 -0.0026 83   PRO B CA    
1889 C  C     . PRO B 82  ? 0.3687 0.4444 0.4111 -0.0054 -0.0477 -0.0229 83   PRO B C     
1890 O  O     . PRO B 82  ? 0.3193 0.4421 0.4197 -0.0098 -0.1005 -0.0401 83   PRO B O     
1891 C  CB    . PRO B 82  ? 0.3494 0.4044 0.3879 0.0058  0.0128  0.0258  83   PRO B CB    
1892 C  CG    . PRO B 82  ? 0.3918 0.3471 0.4029 0.0417  0.0430  -0.0281 83   PRO B CG    
1893 C  CD    . PRO B 82  ? 0.3732 0.3906 0.3948 -0.0331 0.0166  -0.0023 83   PRO B CD    
1894 N  N     . LEU B 83  ? 0.3554 0.4259 0.3849 0.0385  -0.0293 -0.0274 84   LEU B N     
1895 C  CA    . LEU B 83  ? 0.3032 0.3938 0.3818 0.0143  -0.0524 -0.0102 84   LEU B CA    
1896 C  C     . LEU B 83  ? 0.3383 0.3951 0.3718 0.0261  -0.0482 0.0005  84   LEU B C     
1897 O  O     . LEU B 83  ? 0.3604 0.3778 0.3792 -0.0240 -0.0644 0.0086  84   LEU B O     
1898 C  CB    . LEU B 83  ? 0.3724 0.4087 0.4234 0.0093  -0.0602 -0.0520 84   LEU B CB    
1899 C  CG    . LEU B 83  ? 0.3013 0.3949 0.3311 0.0637  -0.0569 -0.0291 84   LEU B CG    
1900 C  CD1   . LEU B 83  ? 0.2858 0.3587 0.3337 0.0192  -0.0545 -0.0813 84   LEU B CD1   
1901 C  CD2   . LEU B 83  ? 0.3015 0.4623 0.4239 0.0213  -0.0332 -0.0366 84   LEU B CD2   
1902 N  N     . HIS B 84  ? 0.2902 0.2838 0.3836 -0.0052 0.0058  0.0106  85   HIS B N     
1903 C  CA    . HIS B 84  ? 0.3575 0.3686 0.4221 0.0072  -0.0135 -0.0200 85   HIS B CA    
1904 C  C     . HIS B 84  ? 0.3772 0.3657 0.4290 -0.0363 -0.0067 -0.0239 85   HIS B C     
1905 O  O     . HIS B 84  ? 0.3520 0.3755 0.4392 -0.0612 -0.0194 0.0063  85   HIS B O     
1906 C  CB    . HIS B 84  ? 0.3989 0.3139 0.4456 -0.0452 -0.0361 -0.0324 85   HIS B CB    
1907 C  CG    . HIS B 84  ? 0.5294 0.5010 0.5382 -0.0660 0.0059  -0.0117 85   HIS B CG    
1908 N  ND1   . HIS B 84  ? 0.6421 0.7059 0.7354 0.0181  0.0028  0.0190  85   HIS B ND1   
1909 C  CD2   . HIS B 84  ? 0.6749 0.6080 0.6886 -0.0256 -0.0144 0.0272  85   HIS B CD2   
1910 C  CE1   . HIS B 84  ? 0.7056 0.6478 0.8193 0.0069  0.0016  0.0233  85   HIS B CE1   
1911 N  NE2   . HIS B 84  ? 0.7743 0.6951 0.7930 -0.0541 -0.0257 0.0294  85   HIS B NE2   
1912 N  N     . ASN B 85  ? 0.3707 0.3305 0.4416 -0.0069 -0.0152 0.0122  86   ASN B N     
1913 C  CA    . ASN B 85  ? 0.3858 0.3951 0.4740 -0.0161 -0.0156 -0.0091 86   ASN B CA    
1914 C  C     . ASN B 85  ? 0.3858 0.3913 0.4377 -0.0162 -0.0007 -0.0086 86   ASN B C     
1915 O  O     . ASN B 85  ? 0.3865 0.3949 0.4572 -0.0394 0.0062  -0.0408 86   ASN B O     
1916 C  CB    . ASN B 85  ? 0.4129 0.4214 0.4782 0.0020  -0.0171 0.0129  86   ASN B CB    
1917 C  CG    . ASN B 85  ? 0.4374 0.4617 0.5521 0.0299  0.0088  0.0239  86   ASN B CG    
1918 O  OD1   . ASN B 85  ? 0.3571 0.5061 0.5762 0.0169  0.0057  0.0040  86   ASN B OD1   
1919 N  ND2   . ASN B 85  ? 0.3517 0.5306 0.5372 0.0478  -0.0514 0.0343  86   ASN B ND2   
1920 N  N     . PHE B 86  ? 0.4032 0.3812 0.4602 -0.0330 -0.0356 -0.0190 87   PHE B N     
1921 C  CA    . PHE B 86  ? 0.3753 0.3692 0.4073 -0.0318 -0.0153 0.0036  87   PHE B CA    
1922 C  C     . PHE B 86  ? 0.3408 0.3491 0.4200 -0.0368 -0.0095 0.0009  87   PHE B C     
1923 O  O     . PHE B 86  ? 0.2755 0.4037 0.4526 -0.0015 -0.0586 0.0140  87   PHE B O     
1924 C  CB    . PHE B 86  ? 0.3326 0.3130 0.4159 -0.0596 -0.0439 0.0036  87   PHE B CB    
1925 C  CG    . PHE B 86  ? 0.3997 0.3444 0.3798 -0.0228 -0.0050 0.0156  87   PHE B CG    
1926 C  CD1   . PHE B 86  ? 0.3967 0.4147 0.3454 -0.0103 0.0186  0.0234  87   PHE B CD1   
1927 C  CD2   . PHE B 86  ? 0.3888 0.3642 0.3474 0.0301  0.0391  0.0094  87   PHE B CD2   
1928 C  CE1   . PHE B 86  ? 0.4616 0.4299 0.3878 -0.0114 -0.0431 -0.0231 87   PHE B CE1   
1929 C  CE2   . PHE B 86  ? 0.3481 0.4044 0.4438 0.0037  0.0226  0.0220  87   PHE B CE2   
1930 C  CZ    . PHE B 86  ? 0.3635 0.3261 0.3242 0.0223  0.0113  0.0372  87   PHE B CZ    
1931 N  N     . LEU B 87  ? 0.3052 0.3375 0.4276 -0.0227 0.0019  0.0188  88   LEU B N     
1932 C  CA    . LEU B 87  ? 0.2920 0.3576 0.3996 -0.0164 0.0034  0.0073  88   LEU B CA    
1933 C  C     . LEU B 87  ? 0.3688 0.3802 0.4464 0.0190  0.0053  -0.0041 88   LEU B C     
1934 O  O     . LEU B 87  ? 0.3906 0.3657 0.4109 -0.0079 0.0037  0.0426  88   LEU B O     
1935 C  CB    . LEU B 87  ? 0.2863 0.3657 0.4407 0.0186  0.0308  -0.0104 88   LEU B CB    
1936 C  CG    . LEU B 87  ? 0.3089 0.3379 0.4417 0.0013  0.0336  -0.0421 88   LEU B CG    
1937 C  CD1   . LEU B 87  ? 0.2403 0.4779 0.5109 0.0186  -0.0316 0.0158  88   LEU B CD1   
1938 C  CD2   . LEU B 87  ? 0.3769 0.3834 0.3537 -0.0048 -0.0430 -0.0316 88   LEU B CD2   
1939 N  N     . THR B 88  ? 0.3097 0.3482 0.4704 -0.0223 -0.0200 -0.0131 89   THR B N     
1940 C  CA    . THR B 88  ? 0.3726 0.3533 0.4275 -0.0158 0.0157  0.0014  89   THR B CA    
1941 C  C     . THR B 88  ? 0.3707 0.3871 0.4007 -0.0399 -0.0072 -0.0035 89   THR B C     
1942 O  O     . THR B 88  ? 0.3468 0.3584 0.4248 -0.0608 0.0335  0.0696  89   THR B O     
1943 C  CB    . THR B 88  ? 0.2811 0.3314 0.4519 -0.0472 0.0355  -0.0161 89   THR B CB    
1944 O  OG1   . THR B 88  ? 0.4191 0.3658 0.4651 -0.0344 0.0541  -0.0167 89   THR B OG1   
1945 C  CG2   . THR B 88  ? 0.4310 0.5119 0.4828 -0.0185 0.0477  -0.0071 89   THR B CG2   
1946 N  N     . GLN B 89  ? 0.3678 0.3182 0.3897 -0.0258 -0.0333 0.0179  90   GLN B N     
1947 C  CA    . GLN B 89  ? 0.3514 0.4364 0.4083 -0.0178 -0.0267 -0.0092 90   GLN B CA    
1948 C  C     . GLN B 89  ? 0.3459 0.3813 0.4250 -0.0111 -0.0113 -0.0139 90   GLN B C     
1949 O  O     . GLN B 89  ? 0.2564 0.4706 0.4377 -0.0316 0.0099  -0.0265 90   GLN B O     
1950 C  CB    . GLN B 89  ? 0.3880 0.3575 0.4268 -0.0158 -0.0524 0.0086  90   GLN B CB    
1951 C  CG    . GLN B 89  ? 0.4423 0.5241 0.4401 -0.0171 -0.0192 0.0090  90   GLN B CG    
1952 C  CD    . GLN B 89  ? 0.3572 0.4786 0.4012 -0.0076 -0.0773 -0.0353 90   GLN B CD    
1953 O  OE1   . GLN B 89  ? 0.2898 0.4408 0.4043 -0.0497 -0.0377 -0.0330 90   GLN B OE1   
1954 N  NE2   . GLN B 89  ? 0.4264 0.5648 0.5089 0.0191  -0.0207 -0.0184 90   GLN B NE2   
1955 N  N     . LEU B 90  ? 0.3299 0.4111 0.4119 -0.0178 -0.0004 -0.0028 91   LEU B N     
1956 C  CA    . LEU B 90  ? 0.3359 0.3659 0.3780 -0.0275 -0.0047 -0.0157 91   LEU B CA    
1957 C  C     . LEU B 90  ? 0.3229 0.3587 0.3746 -0.0139 0.0049  -0.0187 91   LEU B C     
1958 O  O     . LEU B 90  ? 0.2565 0.3867 0.4079 -0.0306 0.0375  -0.0036 91   LEU B O     
1959 C  CB    . LEU B 90  ? 0.3298 0.3047 0.3521 -0.0162 0.0135  0.0072  91   LEU B CB    
1960 C  CG    . LEU B 90  ? 0.3637 0.3619 0.4316 0.0135  -0.0232 0.0413  91   LEU B CG    
1961 C  CD1   . LEU B 90  ? 0.3169 0.3269 0.3508 -0.0032 0.0387  -0.0500 91   LEU B CD1   
1962 C  CD2   . LEU B 90  ? 0.3369 0.3899 0.4023 -0.0532 0.0103  -0.0080 91   LEU B CD2   
1963 N  N     . GLN B 91  ? 0.2870 0.3617 0.3840 -0.0262 0.0084  0.0103  92   GLN B N     
1964 C  CA    . GLN B 91  ? 0.3983 0.3860 0.3952 0.0060  0.0200  -0.0018 92   GLN B CA    
1965 C  C     . GLN B 91  ? 0.3979 0.3955 0.4138 -0.0059 0.0074  -0.0024 92   GLN B C     
1966 O  O     . GLN B 91  ? 0.3655 0.4178 0.3888 0.0000  0.0166  -0.0280 92   GLN B O     
1967 C  CB    . GLN B 91  ? 0.3865 0.4091 0.4641 -0.0041 0.0080  -0.0158 92   GLN B CB    
1968 C  CG    . GLN B 91  ? 0.4918 0.4160 0.5202 0.0036  0.0613  -0.0199 92   GLN B CG    
1969 C  CD    . GLN B 91  ? 0.5660 0.4747 0.5652 -0.0416 0.0030  0.0686  92   GLN B CD    
1970 O  OE1   . GLN B 91  ? 0.6095 0.4969 0.5258 -0.0762 0.0663  0.0401  92   GLN B OE1   
1971 N  NE2   . GLN B 91  ? 0.5231 0.5563 0.6643 -0.0173 0.0359  0.1039  92   GLN B NE2   
1972 N  N     . PRO B 92  ? 0.3551 0.4120 0.4041 -0.0094 -0.0102 0.0046  93   PRO B N     
1973 C  CA    . PRO B 92  ? 0.3428 0.3956 0.4096 -0.0112 -0.0135 -0.0027 93   PRO B CA    
1974 C  C     . PRO B 92  ? 0.3132 0.3952 0.3889 -0.0128 -0.0159 0.0270  93   PRO B C     
1975 O  O     . PRO B 92  ? 0.3498 0.3613 0.3918 -0.0659 0.0666  0.0584  93   PRO B O     
1976 C  CB    . PRO B 92  ? 0.3822 0.4208 0.4468 -0.0361 -0.0077 -0.0049 93   PRO B CB    
1977 C  CG    . PRO B 92  ? 0.3999 0.4679 0.4408 -0.0008 0.0181  -0.0240 93   PRO B CG    
1978 C  CD    . PRO B 92  ? 0.2805 0.4293 0.4459 -0.0351 -0.0004 -0.0380 93   PRO B CD    
1979 N  N     . PHE B 93  ? 0.2768 0.3516 0.3848 -0.0300 0.0271  0.0315  94   PHE B N     
1980 C  CA    . PHE B 93  ? 0.3113 0.3934 0.4153 -0.0221 -0.0090 -0.0022 94   PHE B CA    
1981 C  C     . PHE B 93  ? 0.3183 0.3918 0.3990 0.0044  -0.0128 0.0182  94   PHE B C     
1982 O  O     . PHE B 93  ? 0.2513 0.4266 0.3943 -0.0158 -0.0069 0.0046  94   PHE B O     
1983 C  CB    . PHE B 93  ? 0.2752 0.3617 0.4302 -0.0234 -0.0037 0.0159  94   PHE B CB    
1984 C  CG    . PHE B 93  ? 0.3487 0.4295 0.4728 -0.0138 -0.0354 -0.0180 94   PHE B CG    
1985 C  CD1   . PHE B 93  ? 0.3358 0.4546 0.5238 0.0401  0.0215  -0.0239 94   PHE B CD1   
1986 C  CD2   . PHE B 93  ? 0.3170 0.4711 0.4223 -0.0057 -0.0435 0.0221  94   PHE B CD2   
1987 C  CE1   . PHE B 93  ? 0.3198 0.5438 0.5003 0.0343  -0.0238 -0.0731 94   PHE B CE1   
1988 C  CE2   . PHE B 93  ? 0.3368 0.5160 0.5212 0.0082  0.0137  -0.0318 94   PHE B CE2   
1989 C  CZ    . PHE B 93  ? 0.3128 0.5588 0.5006 0.0172  -0.0305 -0.0378 94   PHE B CZ    
1990 N  N     . LEU B 94  ? 0.3333 0.4022 0.3628 0.0005  0.0291  0.0097  95   LEU B N     
1991 C  CA    . LEU B 94  ? 0.3323 0.4204 0.3648 0.0161  -0.0139 0.0060  95   LEU B CA    
1992 C  C     . LEU B 94  ? 0.3452 0.4146 0.3890 0.0053  0.0173  0.0166  95   LEU B C     
1993 O  O     . LEU B 94  ? 0.3462 0.4151 0.4346 -0.0233 -0.0147 0.0056  95   LEU B O     
1994 C  CB    . LEU B 94  ? 0.2916 0.4077 0.3330 0.0370  -0.0192 0.0000  95   LEU B CB    
1995 C  CG    . LEU B 94  ? 0.3531 0.3024 0.3918 -0.0142 0.0408  0.0260  95   LEU B CG    
1996 C  CD1   . LEU B 94  ? 0.3221 0.3682 0.3103 0.0658  -0.0152 0.0054  95   LEU B CD1   
1997 C  CD2   . LEU B 94  ? 0.2940 0.2106 0.3526 -0.0194 -0.0055 0.0334  95   LEU B CD2   
1998 N  N     . LYS B 95  ? 0.3273 0.4467 0.3877 -0.0544 -0.0045 0.0115  96   LYS B N     
1999 C  CA    . LYS B 95  ? 0.3478 0.4466 0.4435 0.0029  0.0023  0.0356  96   LYS B CA    
2000 C  C     . LYS B 95  ? 0.3799 0.4923 0.4602 0.0065  -0.0141 0.0558  96   LYS B C     
2001 O  O     . LYS B 95  ? 0.3437 0.5621 0.6160 -0.0027 0.0021  0.0939  96   LYS B O     
2002 C  CB    . LYS B 95  ? 0.3253 0.4289 0.4272 0.0155  0.0416  0.0388  96   LYS B CB    
2003 C  CG    . LYS B 95  ? 0.3543 0.4352 0.5224 0.0012  -0.0172 0.0122  96   LYS B CG    
2004 C  CD    . LYS B 95  ? 0.3500 0.5104 0.4910 0.0425  0.0799  0.0109  96   LYS B CD    
2005 C  CE    . LYS B 95  ? 0.4410 0.5490 0.5862 0.0076  -0.0070 0.0440  96   LYS B CE    
2006 N  NZ    . LYS B 95  ? 0.4025 0.6600 0.6221 0.0621  0.0463  0.0467  96   LYS B NZ    
2007 N  N     . LEU B 96  ? 0.3136 0.3780 0.3811 -0.0269 -0.0033 0.0411  97   LEU B N     
2008 C  CA    . LEU B 96  ? 0.4035 0.3494 0.3903 0.0089  -0.0018 -0.0064 97   LEU B CA    
2009 C  C     . LEU B 96  ? 0.3984 0.3750 0.3999 -0.0097 -0.0011 -0.0103 97   LEU B C     
2010 O  O     . LEU B 96  ? 0.4674 0.3744 0.3757 0.0622  -0.0405 -0.0583 97   LEU B O     
2011 C  CB    . LEU B 96  ? 0.3788 0.3253 0.3140 -0.0026 0.0144  -0.0324 97   LEU B CB    
2012 C  CG    . LEU B 96  ? 0.3581 0.3196 0.3139 0.0134  0.0023  0.0038  97   LEU B CG    
2013 C  CD1   . LEU B 96  ? 0.3322 0.3075 0.3125 0.0033  -0.0801 0.0586  97   LEU B CD1   
2014 C  CD2   . LEU B 96  ? 0.4023 0.3717 0.3608 -0.0370 0.0576  0.0705  97   LEU B CD2   
2015 N  N     . LYS B 97  ? 0.3762 0.3403 0.3393 -0.0293 0.0072  -0.0022 98   LYS B N     
2016 C  CA    . LYS B 97  ? 0.3371 0.3465 0.3557 -0.0197 0.0058  0.0119  98   LYS B CA    
2017 C  C     . LYS B 97  ? 0.3672 0.3556 0.3726 0.0198  0.0110  0.0207  98   LYS B C     
2018 O  O     . LYS B 97  ? 0.3506 0.3586 0.3879 -0.0082 0.0212  0.0179  98   LYS B O     
2019 C  CB    . LYS B 97  ? 0.3419 0.3942 0.3134 -0.0280 0.0549  -0.0277 98   LYS B CB    
2020 C  CG    . LYS B 97  ? 0.2886 0.3351 0.4762 0.0137  0.0570  -0.0096 98   LYS B CG    
2021 C  CD    . LYS B 97  ? 0.3574 0.4127 0.3998 -0.0317 -0.0261 0.0502  98   LYS B CD    
2022 C  CE    . LYS B 97  ? 0.2267 0.5122 0.4098 -0.0316 -0.0205 0.0030  98   LYS B CE    
2023 N  NZ    . LYS B 97  ? 0.5149 0.5644 0.4888 0.0324  -0.0616 0.0502  98   LYS B NZ    
2024 N  N     . GLN B 98  ? 0.3518 0.3703 0.3924 0.0056  0.0322  0.0218  99   GLN B N     
2025 C  CA    . GLN B 98  ? 0.3767 0.3596 0.4302 -0.0142 -0.0098 0.0295  99   GLN B CA    
2026 C  C     . GLN B 98  ? 0.3334 0.3943 0.3720 -0.0032 0.0217  -0.0149 99   GLN B C     
2027 O  O     . GLN B 98  ? 0.3602 0.3472 0.4054 -0.0097 0.0049  0.0296  99   GLN B O     
2028 C  CB    . GLN B 98  ? 0.3065 0.3886 0.4491 -0.0391 0.0297  -0.0006 99   GLN B CB    
2029 C  CG    . GLN B 98  ? 0.4423 0.4094 0.5095 -0.0076 0.0070  0.0137  99   GLN B CG    
2030 C  CD    . GLN B 98  ? 0.3936 0.4220 0.5251 -0.0696 0.0260  0.0325  99   GLN B CD    
2031 O  OE1   . GLN B 98  ? 0.5352 0.6270 0.5412 -0.0017 0.0169  0.0586  99   GLN B OE1   
2032 N  NE2   . GLN B 98  ? 0.4107 0.4415 0.5625 0.0902  -0.0431 0.0540  99   GLN B NE2   
2033 N  N     . LYS B 99  ? 0.3832 0.3727 0.3975 -0.0024 -0.0019 0.0185  100  LYS B N     
2034 C  CA    . LYS B 99  ? 0.4126 0.4104 0.4078 0.0024  -0.0059 0.0222  100  LYS B CA    
2035 C  C     . LYS B 99  ? 0.4370 0.4025 0.3742 -0.0112 0.0059  0.0315  100  LYS B C     
2036 O  O     . LYS B 99  ? 0.4381 0.3541 0.4307 -0.0034 -0.0109 0.0790  100  LYS B O     
2037 C  CB    . LYS B 99  ? 0.4516 0.4382 0.3302 -0.0040 0.0182  0.0341  100  LYS B CB    
2038 C  CG    . LYS B 99  ? 0.5307 0.5564 0.4490 -0.0075 0.0037  0.0127  100  LYS B CG    
2039 C  CD    . LYS B 99  ? 0.5727 0.6896 0.4892 0.0042  0.0049  0.0289  100  LYS B CD    
2040 C  CE    . LYS B 99  ? 0.6546 0.6578 0.4928 -0.0152 -0.0573 0.0000  100  LYS B CE    
2041 N  NZ    . LYS B 99  ? 0.6937 0.7035 0.5838 0.0598  -0.0762 0.0185  100  LYS B NZ    
2042 N  N     . GLN B 100 ? 0.3873 0.4022 0.4035 -0.0006 -0.0136 0.0572  101  GLN B N     
2043 C  CA    . GLN B 100 ? 0.3475 0.3710 0.3784 0.0027  -0.0192 0.0103  101  GLN B CA    
2044 C  C     . GLN B 100 ? 0.3778 0.3939 0.4007 -0.0084 -0.0004 0.0049  101  GLN B C     
2045 O  O     . GLN B 100 ? 0.3494 0.3421 0.3869 0.0113  0.0012  0.0207  101  GLN B O     
2046 C  CB    . GLN B 100 ? 0.3347 0.4205 0.3961 -0.0286 -0.0192 0.0185  101  GLN B CB    
2047 C  CG    . GLN B 100 ? 0.3143 0.4037 0.3499 -0.0098 -0.0196 -0.0320 101  GLN B CG    
2048 C  CD    . GLN B 100 ? 0.3315 0.2499 0.3650 0.0417  -0.0233 0.0031  101  GLN B CD    
2049 O  OE1   . GLN B 100 ? 0.4274 0.3777 0.3749 0.0539  0.0221  0.0169  101  GLN B OE1   
2050 N  NE2   . GLN B 100 ? 0.3206 0.3274 0.3771 0.0215  -0.0123 -0.0160 101  GLN B NE2   
2051 N  N     . ALA B 101 ? 0.3235 0.3647 0.4084 -0.0076 -0.0154 0.0118  102  ALA B N     
2052 C  CA    . ALA B 101 ? 0.3504 0.3711 0.4095 0.0002  0.0130  0.0001  102  ALA B CA    
2053 C  C     . ALA B 101 ? 0.3829 0.4032 0.4332 0.0050  0.0064  -0.0038 102  ALA B C     
2054 O  O     . ALA B 101 ? 0.4012 0.3919 0.4475 -0.0164 -0.0164 0.0172  102  ALA B O     
2055 C  CB    . ALA B 101 ? 0.2657 0.3883 0.3947 0.0175  -0.0488 0.0447  102  ALA B CB    
2056 N  N     . ASN B 102 ? 0.4279 0.3728 0.4965 0.0070  0.0206  0.0136  103  ASN B N     
2057 C  CA    . ASN B 102 ? 0.4141 0.3900 0.5020 -0.0079 0.0106  0.0043  103  ASN B CA    
2058 C  C     . ASN B 102 ? 0.4252 0.4018 0.4556 -0.0029 0.0074  -0.0039 103  ASN B C     
2059 O  O     . ASN B 102 ? 0.3635 0.3874 0.4641 -0.0432 -0.0576 0.0065  103  ASN B O     
2060 C  CB    . ASN B 102 ? 0.4472 0.4315 0.4645 0.0191  -0.0175 0.0175  103  ASN B CB    
2061 C  CG    . ASN B 102 ? 0.4927 0.5511 0.5414 -0.0016 0.0320  -0.0127 103  ASN B CG    
2062 O  OD1   . ASN B 102 ? 0.4625 0.5672 0.6083 0.0256  0.0109  0.0012  103  ASN B OD1   
2063 N  ND2   . ASN B 102 ? 0.5974 0.5795 0.6023 -0.0985 0.0058  -0.0507 103  ASN B ND2   
2064 N  N     . LEU B 103 ? 0.3928 0.3467 0.4483 -0.0066 -0.0133 -0.0036 104  LEU B N     
2065 C  CA    . LEU B 103 ? 0.3989 0.3963 0.4367 -0.0085 -0.0189 -0.0034 104  LEU B CA    
2066 C  C     . LEU B 103 ? 0.4046 0.4075 0.4859 0.0047  -0.0068 0.0063  104  LEU B C     
2067 O  O     . LEU B 103 ? 0.4203 0.3902 0.4705 0.0083  -0.0178 0.0417  104  LEU B O     
2068 C  CB    . LEU B 103 ? 0.3350 0.3208 0.4459 -0.0196 -0.0016 -0.0075 104  LEU B CB    
2069 C  CG    . LEU B 103 ? 0.5217 0.4335 0.5070 -0.0005 -0.0344 -0.0277 104  LEU B CG    
2070 C  CD1   . LEU B 103 ? 0.4803 0.4037 0.4534 -0.0334 0.0143  -0.0120 104  LEU B CD1   
2071 C  CD2   . LEU B 103 ? 0.5238 0.3358 0.5289 0.0067  0.0357  0.0030  104  LEU B CD2   
2072 N  N     . VAL B 104 ? 0.3128 0.3778 0.4753 -0.0184 -0.0278 0.0061  105  VAL B N     
2073 C  CA    . VAL B 104 ? 0.3696 0.4086 0.4437 -0.0182 -0.0095 -0.0097 105  VAL B CA    
2074 C  C     . VAL B 104 ? 0.3994 0.4197 0.4812 -0.0099 0.0249  -0.0244 105  VAL B C     
2075 O  O     . VAL B 104 ? 0.3301 0.4713 0.4859 0.0142  -0.0147 -0.0415 105  VAL B O     
2076 C  CB    . VAL B 104 ? 0.4410 0.4353 0.4895 -0.0284 -0.0492 -0.0205 105  VAL B CB    
2077 C  CG1   . VAL B 104 ? 0.3348 0.4521 0.4253 0.0385  -0.0410 -0.0368 105  VAL B CG1   
2078 C  CG2   . VAL B 104 ? 0.3294 0.4020 0.4637 -0.0262 -0.0286 0.0096  105  VAL B CG2   
2079 N  N     . LEU B 105 ? 0.3759 0.3279 0.4902 0.0059  0.0154  -0.0035 106  LEU B N     
2080 C  CA    . LEU B 105 ? 0.4167 0.4128 0.4870 0.0150  -0.0056 -0.0228 106  LEU B CA    
2081 C  C     . LEU B 105 ? 0.4705 0.4329 0.4962 -0.0020 0.0000  -0.0087 106  LEU B C     
2082 O  O     . LEU B 105 ? 0.4349 0.4532 0.5098 0.0016  -0.0832 -0.0148 106  LEU B O     
2083 C  CB    . LEU B 105 ? 0.3513 0.3988 0.4421 0.0170  -0.0025 -0.0328 106  LEU B CB    
2084 C  CG    . LEU B 105 ? 0.3731 0.3909 0.4057 -0.0022 -0.0040 -0.0319 106  LEU B CG    
2085 C  CD1   . LEU B 105 ? 0.3744 0.4115 0.5418 0.0885  0.0428  -0.0149 106  LEU B CD1   
2086 C  CD2   . LEU B 105 ? 0.3992 0.3702 0.3918 -0.0539 0.0451  -0.0316 106  LEU B CD2   
2087 N  N     . LYS B 106 ? 0.4463 0.4668 0.4900 -0.0105 -0.0271 0.0026  107  LYS B N     
2088 C  CA    . LYS B 106 ? 0.5565 0.4882 0.5400 -0.0012 0.0005  -0.0103 107  LYS B CA    
2089 C  C     . LYS B 106 ? 0.5296 0.4757 0.5439 -0.0182 -0.0237 -0.0184 107  LYS B C     
2090 O  O     . LYS B 106 ? 0.5155 0.4392 0.5599 -0.0569 -0.0193 -0.0362 107  LYS B O     
2091 C  CB    . LYS B 106 ? 0.5915 0.4994 0.5475 0.0231  0.0047  0.0061  107  LYS B CB    
2092 C  CG    . LYS B 106 ? 0.5702 0.4448 0.5402 0.0166  0.0166  -0.0144 107  LYS B CG    
2093 C  CD    . LYS B 106 ? 0.7187 0.6285 0.6696 0.0292  0.0164  0.0355  107  LYS B CD    
2094 C  CE    . LYS B 106 ? 0.8603 0.7697 0.8682 0.0442  0.0320  0.0472  107  LYS B CE    
2095 N  NZ    . LYS B 106 ? 0.9446 0.8620 0.9827 -0.0171 0.0458  0.0049  107  LYS B NZ    
2096 N  N     . ILE B 107 ? 0.4873 0.4440 0.5023 -0.0201 -0.0280 -0.0087 108  ILE B N     
2097 C  CA    . ILE B 107 ? 0.4445 0.4515 0.4450 -0.0153 -0.0461 -0.0309 108  ILE B CA    
2098 C  C     . ILE B 107 ? 0.5068 0.4897 0.4998 0.0113  -0.0355 -0.0416 108  ILE B C     
2099 O  O     . ILE B 107 ? 0.5224 0.4859 0.5368 0.0172  -0.0503 -0.0872 108  ILE B O     
2100 C  CB    . ILE B 107 ? 0.4632 0.4474 0.4009 -0.0178 -0.0279 -0.0060 108  ILE B CB    
2101 C  CG1   . ILE B 107 ? 0.3539 0.4647 0.4214 -0.0626 -0.0665 -0.0250 108  ILE B CG1   
2102 C  CG2   . ILE B 107 ? 0.4027 0.4111 0.4996 0.0081  -0.0194 -0.0083 108  ILE B CG2   
2103 C  CD1   . ILE B 107 ? 0.3467 0.3978 0.4128 0.0642  -0.0322 -0.0330 108  ILE B CD1   
2104 N  N     . ILE B 108 ? 0.4912 0.4385 0.4772 -0.0107 -0.0384 -0.0240 109  ILE B N     
2105 C  CA    . ILE B 108 ? 0.4848 0.4571 0.5308 0.0011  -0.0412 -0.0321 109  ILE B CA    
2106 C  C     . ILE B 108 ? 0.4788 0.4990 0.5327 -0.0021 -0.0306 -0.0400 109  ILE B C     
2107 O  O     . ILE B 108 ? 0.4132 0.5627 0.5225 -0.0134 -0.0409 -0.0554 109  ILE B O     
2108 C  CB    . ILE B 108 ? 0.4507 0.3815 0.4827 0.0065  -0.0413 -0.0292 109  ILE B CB    
2109 C  CG1   . ILE B 108 ? 0.4139 0.3888 0.4902 0.0271  -0.0677 -0.0489 109  ILE B CG1   
2110 C  CG2   . ILE B 108 ? 0.4802 0.4393 0.6057 -0.0011 -0.0174 -0.0251 109  ILE B CG2   
2111 C  CD1   . ILE B 108 ? 0.5363 0.3918 0.5717 -0.0054 -0.0503 -0.0455 109  ILE B CD1   
2112 N  N     . GLU B 109 ? 0.4914 0.4913 0.5458 0.0210  -0.0290 -0.0267 110  GLU B N     
2113 C  CA    . GLU B 109 ? 0.5680 0.5152 0.6037 0.0013  -0.0135 -0.0361 110  GLU B CA    
2114 C  C     . GLU B 109 ? 0.5765 0.5385 0.5912 0.0016  -0.0304 -0.0294 110  GLU B C     
2115 O  O     . GLU B 109 ? 0.5827 0.5226 0.6077 0.0318  -0.0321 -0.0701 110  GLU B O     
2116 C  CB    . GLU B 109 ? 0.5940 0.5656 0.6155 -0.0104 -0.0174 -0.0267 110  GLU B CB    
2117 C  CG    . GLU B 109 ? 0.7483 0.6380 0.8032 0.0289  0.0090  -0.0139 110  GLU B CG    
2118 C  CD    . GLU B 109 ? 0.9331 0.8251 0.8616 0.0094  0.0121  0.0107  110  GLU B CD    
2119 O  OE1   . GLU B 109 ? 0.9905 0.8937 0.8882 -0.0363 -0.0203 0.0702  110  GLU B OE1   
2120 O  OE2   . GLU B 109 ? 0.8890 0.7558 0.8371 0.0118  -0.0718 0.0615  110  GLU B OE2   
2121 N  N     . GLN B 110 ? 0.5477 0.5167 0.5952 -0.0087 -0.0324 -0.0273 111  GLN B N     
2122 C  CA    . GLN B 110 ? 0.6204 0.5882 0.6346 -0.0064 -0.0205 -0.0355 111  GLN B CA    
2123 C  C     . GLN B 110 ? 0.6332 0.5950 0.6054 -0.0018 -0.0193 -0.0328 111  GLN B C     
2124 O  O     . GLN B 110 ? 0.6405 0.6318 0.6136 0.0025  -0.0388 -0.0202 111  GLN B O     
2125 C  CB    . GLN B 110 ? 0.6124 0.5769 0.6113 0.0000  -0.0255 -0.0312 111  GLN B CB    
2126 C  CG    . GLN B 110 ? 0.7334 0.7171 0.7545 -0.0483 -0.0117 -0.0101 111  GLN B CG    
2127 C  CD    . GLN B 110 ? 0.7848 0.7960 0.8921 -0.0475 0.0041  -0.0100 111  GLN B CD    
2128 O  OE1   . GLN B 110 ? 0.7537 0.8683 0.9605 -0.0747 0.0471  0.0168  111  GLN B OE1   
2129 N  NE2   . GLN B 110 ? 0.8337 0.7735 0.8761 -0.0594 0.0041  -0.0083 111  GLN B NE2   
2130 N  N     . LEU B 111 ? 0.6401 0.5712 0.6408 0.0080  -0.0212 -0.0409 112  LEU B N     
2131 C  CA    . LEU B 111 ? 0.6613 0.6221 0.6604 0.0000  0.0003  -0.0389 112  LEU B CA    
2132 C  C     . LEU B 111 ? 0.6730 0.6394 0.6880 0.0062  -0.0037 -0.0311 112  LEU B C     
2133 O  O     . LEU B 111 ? 0.7224 0.6657 0.7115 0.0051  -0.0177 -0.0449 112  LEU B O     
2134 C  CB    . LEU B 111 ? 0.6744 0.6181 0.6661 0.0088  -0.0011 -0.0353 112  LEU B CB    
2135 C  CG    . LEU B 111 ? 0.6822 0.6602 0.6704 -0.0196 -0.0217 -0.0327 112  LEU B CG    
2136 C  CD1   . LEU B 111 ? 0.7367 0.6593 0.7647 -0.0197 0.0013  -0.0165 112  LEU B CD1   
2137 C  CD2   . LEU B 111 ? 0.6723 0.7068 0.6679 0.0075  0.0193  -0.0871 112  LEU B CD2   
2138 N  N     . PRO B 112 ? 0.6816 0.6631 0.7050 -0.0070 -0.0039 -0.0422 113  PRO B N     
2139 C  CA    . PRO B 112 ? 0.7016 0.6999 0.7265 -0.0042 -0.0026 -0.0407 113  PRO B CA    
2140 C  C     . PRO B 112 ? 0.6857 0.6753 0.6977 -0.0126 -0.0150 -0.0408 113  PRO B C     
2141 O  O     . PRO B 112 ? 0.6928 0.6700 0.6744 -0.0193 -0.0185 -0.0607 113  PRO B O     
2142 C  CB    . PRO B 112 ? 0.7029 0.7110 0.7628 0.0001  -0.0104 -0.0466 113  PRO B CB    
2143 C  CG    . PRO B 112 ? 0.7275 0.7144 0.7430 0.0033  -0.0112 -0.0372 113  PRO B CG    
2144 C  CD    . PRO B 112 ? 0.6625 0.6708 0.6987 0.0009  -0.0106 -0.0340 113  PRO B CD    
2145 N  N     . SER B 113 ? 0.6794 0.6754 0.6861 -0.0428 -0.0223 -0.0398 114  SER B N     
2146 C  CA    . SER B 113 ? 0.7440 0.6880 0.7276 -0.0376 -0.0118 -0.0408 114  SER B CA    
2147 C  C     . SER B 113 ? 0.7706 0.7161 0.7620 -0.0044 0.0106  -0.0310 114  SER B C     
2148 O  O     . SER B 113 ? 0.8170 0.6947 0.7815 0.0145  0.0097  -0.0548 114  SER B O     
2149 C  CB    . SER B 113 ? 0.7553 0.7044 0.7504 -0.0494 -0.0140 -0.0321 114  SER B CB    
2150 O  OG    . SER B 113 ? 0.8419 0.7962 0.7896 -0.0416 -0.0141 -0.0297 114  SER B OG    
2151 N  N     . ALA B 114 ? 0.7552 0.7149 0.7435 -0.0065 0.0121  -0.0519 115  ALA B N     
2152 C  CA    . ALA B 114 ? 0.7727 0.7411 0.7582 -0.0018 0.0166  -0.0332 115  ALA B CA    
2153 C  C     . ALA B 114 ? 0.7871 0.7513 0.7873 0.0101  0.0076  -0.0359 115  ALA B C     
2154 O  O     . ALA B 114 ? 0.8000 0.7694 0.7954 0.0054  0.0028  -0.0364 115  ALA B O     
2155 C  CB    . ALA B 114 ? 0.7425 0.7165 0.7226 0.0129  0.0246  -0.0425 115  ALA B CB    
2156 N  N     . LYS B 115 ? 0.8228 0.7892 0.8316 0.0092  0.0134  -0.0161 116  LYS B N     
2157 C  CA    . LYS B 115 ? 0.8722 0.8190 0.8321 0.0074  0.0154  -0.0146 116  LYS B CA    
2158 C  C     . LYS B 115 ? 0.8935 0.8351 0.8498 -0.0046 0.0093  -0.0145 116  LYS B C     
2159 O  O     . LYS B 115 ? 0.9195 0.7814 0.8217 0.0008  0.0081  -0.0260 116  LYS B O     
2160 C  CB    . LYS B 115 ? 0.8595 0.8454 0.8391 0.0150  0.0124  -0.0152 116  LYS B CB    
2161 C  CG    . LYS B 115 ? 0.9233 0.8885 0.8908 0.0122  0.0057  0.0017  116  LYS B CG    
2162 C  CD    . LYS B 115 ? 0.9574 0.9194 0.9902 0.0199  -0.0104 -0.0016 116  LYS B CD    
2163 C  CE    . LYS B 115 ? 0.9653 0.9346 0.9909 0.0010  -0.0243 -0.0004 116  LYS B CE    
2164 N  NZ    . LYS B 115 ? 0.9246 0.8779 0.9870 -0.0405 -0.0605 -0.0244 116  LYS B NZ    
2165 N  N     . GLU B 116 ? 0.9184 0.8729 0.8887 -0.0108 0.0004  -0.0097 117  GLU B N     
2166 C  CA    . GLU B 116 ? 0.9605 0.9333 0.9585 -0.0040 -0.0090 -0.0080 117  GLU B CA    
2167 C  C     . GLU B 116 ? 0.9435 0.9004 0.9260 -0.0036 -0.0023 -0.0095 117  GLU B C     
2168 O  O     . GLU B 116 ? 0.9685 0.8945 0.9377 0.0116  0.0076  -0.0252 117  GLU B O     
2169 C  CB    . GLU B 116 ? 0.9556 0.9397 0.9667 -0.0235 -0.0116 -0.0027 117  GLU B CB    
2170 C  CG    . GLU B 116 ? 1.0004 0.9799 1.0280 -0.0096 -0.0086 -0.0036 117  GLU B CG    
2171 C  CD    . GLU B 116 ? 0.9945 1.0061 1.0298 -0.0145 -0.0336 0.0092  117  GLU B CD    
2172 O  OE1   . GLU B 116 ? 1.1238 1.0808 1.1131 -0.0164 -0.0131 0.0134  117  GLU B OE1   
2173 O  OE2   . GLU B 116 ? 1.0456 1.1445 1.1154 -0.0240 -0.0276 0.0226  117  GLU B OE2   
2174 N  N     . SER B 117 ? 0.8992 0.8652 0.8859 -0.0128 0.0003  -0.0255 118  SER B N     
2175 C  CA    . SER B 117 ? 0.8898 0.8595 0.8976 -0.0200 -0.0009 -0.0241 118  SER B CA    
2176 C  C     . SER B 117 ? 0.8487 0.8348 0.8673 -0.0124 -0.0139 -0.0173 118  SER B C     
2177 O  O     . SER B 117 ? 0.8090 0.8371 0.8526 -0.0436 -0.0276 -0.0321 118  SER B O     
2178 C  CB    . SER B 117 ? 0.8929 0.8521 0.9206 -0.0277 0.0035  -0.0193 118  SER B CB    
2179 O  OG    . SER B 117 ? 0.9537 0.9471 0.9945 -0.0001 0.0131  0.0057  118  SER B OG    
2180 N  N     . PRO B 118 ? 0.8655 0.8062 0.8527 0.0050  -0.0094 -0.0178 119  PRO B N     
2181 C  CA    . PRO B 118 ? 0.8325 0.7621 0.8088 0.0081  -0.0139 -0.0161 119  PRO B CA    
2182 C  C     . PRO B 118 ? 0.8315 0.7551 0.7973 -0.0024 -0.0145 -0.0076 119  PRO B C     
2183 O  O     . PRO B 118 ? 0.8174 0.6977 0.7468 0.0223  -0.0033 -0.0264 119  PRO B O     
2184 C  CB    . PRO B 118 ? 0.8219 0.7785 0.8142 0.0018  -0.0072 0.0000  119  PRO B CB    
2185 C  CG    . PRO B 118 ? 0.8243 0.7594 0.8290 0.0343  -0.0056 -0.0221 119  PRO B CG    
2186 C  CD    . PRO B 118 ? 0.8725 0.7928 0.8549 0.0098  -0.0196 -0.0222 119  PRO B CD    
2187 N  N     . ASP B 119 ? 0.7997 0.7178 0.7758 -0.0097 -0.0073 -0.0123 120  ASP B N     
2188 C  CA    . ASP B 119 ? 0.8177 0.7590 0.7869 -0.0203 -0.0025 0.0028  120  ASP B CA    
2189 C  C     . ASP B 119 ? 0.7774 0.7012 0.7292 -0.0288 -0.0014 0.0123  120  ASP B C     
2190 O  O     . ASP B 119 ? 0.7917 0.6556 0.7290 -0.0333 0.0101  0.0260  120  ASP B O     
2191 C  CB    . ASP B 119 ? 0.8743 0.8046 0.8271 -0.0270 0.0044  -0.0005 120  ASP B CB    
2192 C  CG    . ASP B 119 ? 1.0145 0.9755 0.9843 -0.0324 -0.0027 -0.0089 120  ASP B CG    
2193 O  OD1   . ASP B 119 ? 1.1424 1.1610 1.1260 0.0299  -0.0269 0.0204  120  ASP B OD1   
2194 O  OD2   . ASP B 119 ? 1.2016 1.0723 1.0553 0.0278  -0.0129 0.0433  120  ASP B OD2   
2195 N  N     . LYS B 120 ? 0.7249 0.6486 0.6758 -0.0312 -0.0048 -0.0076 121  LYS B N     
2196 C  CA    . LYS B 120 ? 0.6652 0.6523 0.6709 -0.0232 -0.0056 -0.0040 121  LYS B CA    
2197 C  C     . LYS B 120 ? 0.6356 0.6169 0.6357 -0.0045 -0.0192 0.0022  121  LYS B C     
2198 O  O     . LYS B 120 ? 0.5754 0.5745 0.6499 -0.0054 -0.0157 0.0152  121  LYS B O     
2199 C  CB    . LYS B 120 ? 0.6769 0.6845 0.6676 -0.0092 -0.0016 -0.0164 121  LYS B CB    
2200 C  CG    . LYS B 120 ? 0.7410 0.7578 0.7778 -0.0118 0.0108  -0.0117 121  LYS B CG    
2201 C  CD    . LYS B 120 ? 0.8602 0.9092 0.8751 -0.0066 0.0337  -0.0248 121  LYS B CD    
2202 C  CE    . LYS B 120 ? 0.8759 0.9232 0.9341 -0.0101 0.0349  -0.0019 121  LYS B CE    
2203 N  NZ    . LYS B 120 ? 0.8665 0.9253 0.9431 -0.0039 0.0558  -0.0101 121  LYS B NZ    
2204 N  N     . PHE B 121 ? 0.6138 0.5779 0.5840 -0.0076 -0.0201 -0.0037 122  PHE B N     
2205 C  CA    . PHE B 121 ? 0.6062 0.5640 0.5943 0.0094  -0.0136 -0.0038 122  PHE B CA    
2206 C  C     . PHE B 121 ? 0.6097 0.5380 0.6055 0.0345  -0.0207 -0.0007 122  PHE B C     
2207 O  O     . PHE B 121 ? 0.6519 0.5104 0.6169 0.0709  -0.0349 -0.0058 122  PHE B O     
2208 C  CB    . PHE B 121 ? 0.5768 0.5594 0.5743 0.0099  -0.0115 -0.0212 122  PHE B CB    
2209 C  CG    . PHE B 121 ? 0.5583 0.5287 0.5816 0.0041  -0.0225 -0.0337 122  PHE B CG    
2210 C  CD1   . PHE B 121 ? 0.6199 0.4840 0.6070 -0.0202 -0.0059 -0.0128 122  PHE B CD1   
2211 C  CD2   . PHE B 121 ? 0.5343 0.5325 0.6544 0.0148  0.0006  -0.0372 122  PHE B CD2   
2212 C  CE1   . PHE B 121 ? 0.5329 0.5521 0.6420 0.0244  0.0480  -0.0181 122  PHE B CE1   
2213 C  CE2   . PHE B 121 ? 0.4926 0.5670 0.6100 0.0019  -0.0168 -0.0114 122  PHE B CE2   
2214 C  CZ    . PHE B 121 ? 0.5474 0.5520 0.5138 -0.0083 -0.0026 -0.0104 122  PHE B CZ    
2215 N  N     . LEU B 122 ? 0.6211 0.4375 0.5796 0.0531  -0.0385 0.0317  123  LEU B N     
2216 C  CA    . LEU B 122 ? 0.6276 0.5194 0.5859 0.0249  -0.0411 -0.0121 123  LEU B CA    
2217 C  C     . LEU B 122 ? 0.5931 0.4678 0.5988 0.0380  -0.0415 -0.0094 123  LEU B C     
2218 O  O     . LEU B 122 ? 0.6181 0.5064 0.6193 0.0125  -0.0771 -0.0524 123  LEU B O     
2219 C  CB    . LEU B 122 ? 0.6003 0.4687 0.5298 0.0535  -0.0404 -0.0112 123  LEU B CB    
2220 C  CG    . LEU B 122 ? 0.6701 0.6726 0.6714 0.0194  -0.0225 -0.0444 123  LEU B CG    
2221 C  CD1   . LEU B 122 ? 0.7393 0.6490 0.6964 0.0492  -0.0907 -0.0312 123  LEU B CD1   
2222 C  CD2   . LEU B 122 ? 0.7550 0.8114 0.7234 0.0254  -0.0381 -0.0073 123  LEU B CD2   
2223 N  N     . GLU B 123 ? 0.5466 0.4590 0.5626 0.0052  -0.0617 -0.0160 124  GLU B N     
2224 C  CA    . GLU B 123 ? 0.6041 0.5578 0.5845 0.0110  -0.0173 -0.0105 124  GLU B CA    
2225 C  C     . GLU B 123 ? 0.5592 0.5067 0.5227 0.0187  -0.0077 -0.0230 124  GLU B C     
2226 O  O     . GLU B 123 ? 0.5420 0.5224 0.4981 0.0423  0.0009  -0.0079 124  GLU B O     
2227 C  CB    . GLU B 123 ? 0.6259 0.5796 0.6230 -0.0063 -0.0032 0.0048  124  GLU B CB    
2228 C  CG    . GLU B 123 ? 0.6536 0.6720 0.6512 0.0049  0.0000  -0.0447 124  GLU B CG    
2229 C  CD    . GLU B 123 ? 0.7014 0.6719 0.6842 -0.0147 -0.0006 -0.0065 124  GLU B CD    
2230 O  OE1   . GLU B 123 ? 0.8541 0.7669 0.7616 0.0051  -0.0270 -0.0396 124  GLU B OE1   
2231 O  OE2   . GLU B 123 ? 0.8416 0.8902 0.8509 0.0040  0.0171  0.0179  124  GLU B OE2   
2232 N  N     . VAL B 124 ? 0.5091 0.4831 0.5331 0.0267  -0.0038 -0.0128 125  VAL B N     
2233 C  CA    . VAL B 124 ? 0.5551 0.5195 0.5345 0.0074  -0.0060 -0.0255 125  VAL B CA    
2234 C  C     . VAL B 124 ? 0.5270 0.5038 0.5360 0.0229  -0.0002 -0.0246 125  VAL B C     
2235 O  O     . VAL B 124 ? 0.5535 0.5212 0.5329 0.0253  -0.0074 -0.0128 125  VAL B O     
2236 C  CB    . VAL B 124 ? 0.5672 0.5382 0.5547 0.0104  -0.0054 -0.0264 125  VAL B CB    
2237 C  CG1   . VAL B 124 ? 0.5599 0.5083 0.5345 -0.0188 -0.0084 -0.0269 125  VAL B CG1   
2238 C  CG2   . VAL B 124 ? 0.5276 0.6077 0.5735 -0.0355 -0.0029 -0.0168 125  VAL B CG2   
2239 N  N     . CYS B 125 ? 0.4929 0.4585 0.5216 0.0308  -0.0140 -0.0357 126  CYS B N     
2240 C  CA    . CYS B 125 ? 0.4896 0.4498 0.5262 0.0623  -0.0207 -0.0134 126  CYS B CA    
2241 C  C     . CYS B 125 ? 0.4556 0.4708 0.4961 0.0556  -0.0304 -0.0276 126  CYS B C     
2242 O  O     . CYS B 125 ? 0.5009 0.4408 0.5273 0.1074  -0.0456 0.0180  126  CYS B O     
2243 C  CB    . CYS B 125 ? 0.4367 0.4866 0.4742 0.0666  -0.0070 -0.0220 126  CYS B CB    
2244 S  SG    . CYS B 125 ? 0.5251 0.4583 0.5159 0.0272  -0.0222 -0.1123 126  CYS B SG    
2245 N  N     . THR B 126 ? 0.4817 0.4546 0.4989 0.0396  -0.0266 -0.0223 127  THR B N     
2246 C  CA    . THR B 126 ? 0.5162 0.4947 0.5450 0.0358  -0.0221 -0.0202 127  THR B CA    
2247 C  C     . THR B 126 ? 0.4895 0.4679 0.5355 0.0421  -0.0375 -0.0052 127  THR B C     
2248 O  O     . THR B 126 ? 0.5387 0.4611 0.4944 0.0545  -0.0533 -0.0313 127  THR B O     
2249 C  CB    . THR B 126 ? 0.4951 0.4926 0.5400 0.0292  -0.0349 -0.0009 127  THR B CB    
2250 O  OG1   . THR B 126 ? 0.4951 0.5570 0.5644 0.0621  0.0244  0.0507  127  THR B OG1   
2251 C  CG2   . THR B 126 ? 0.5389 0.4788 0.5803 0.0174  0.0110  -0.0081 127  THR B CG2   
2252 N  N     . TRP B 127 ? 0.4661 0.4410 0.5069 0.0224  -0.0724 -0.0033 128  TRP B N     
2253 C  CA    . TRP B 127 ? 0.4516 0.4290 0.4685 0.0174  -0.0540 -0.0115 128  TRP B CA    
2254 C  C     . TRP B 127 ? 0.4372 0.4451 0.4527 0.0357  -0.0634 0.0021  128  TRP B C     
2255 O  O     . TRP B 127 ? 0.4373 0.3921 0.4898 0.0405  -0.0547 -0.0267 128  TRP B O     
2256 C  CB    . TRP B 127 ? 0.4465 0.5047 0.4915 0.0113  -0.0521 0.0171  128  TRP B CB    
2257 C  CG    . TRP B 127 ? 0.5787 0.4589 0.5079 0.0065  -0.0368 -0.0126 128  TRP B CG    
2258 C  CD1   . TRP B 127 ? 0.6441 0.5149 0.5487 -0.0066 -0.0210 -0.0386 128  TRP B CD1   
2259 C  CD2   . TRP B 127 ? 0.5513 0.5241 0.5342 -0.0332 -0.0312 0.0011  128  TRP B CD2   
2260 N  NE1   . TRP B 127 ? 0.6689 0.5799 0.5520 -0.0296 -0.0119 0.0203  128  TRP B NE1   
2261 C  CE2   . TRP B 127 ? 0.6187 0.5731 0.6235 -0.0212 -0.0450 -0.0093 128  TRP B CE2   
2262 C  CE3   . TRP B 127 ? 0.5848 0.4689 0.5759 0.0119  -0.0495 0.0033  128  TRP B CE3   
2263 C  CZ2   . TRP B 127 ? 0.6387 0.5833 0.6282 -0.0282 -0.0386 -0.0172 128  TRP B CZ2   
2264 C  CZ3   . TRP B 127 ? 0.5303 0.5608 0.5851 -0.0148 -0.0476 0.0163  128  TRP B CZ3   
2265 C  CH2   . TRP B 127 ? 0.5929 0.5045 0.6015 -0.0025 -0.0466 -0.0190 128  TRP B CH2   
2266 N  N     . VAL B 128 ? 0.4218 0.4299 0.4256 0.0069  -0.0446 0.0240  129  VAL B N     
2267 C  CA    . VAL B 128 ? 0.4291 0.4551 0.4545 0.0283  -0.0335 0.0090  129  VAL B CA    
2268 C  C     . VAL B 128 ? 0.4219 0.4328 0.4252 0.0286  -0.0093 0.0114  129  VAL B C     
2269 O  O     . VAL B 128 ? 0.3981 0.4032 0.4745 0.0429  -0.0548 0.0458  129  VAL B O     
2270 C  CB    . VAL B 128 ? 0.4346 0.4781 0.4312 0.0010  -0.0061 0.0121  129  VAL B CB    
2271 C  CG1   . VAL B 128 ? 0.3411 0.3826 0.4491 0.0518  -0.0340 0.0725  129  VAL B CG1   
2272 C  CG2   . VAL B 128 ? 0.4224 0.3614 0.4364 0.0242  -0.0150 0.0065  129  VAL B CG2   
2273 N  N     . ASP B 129 ? 0.4744 0.4242 0.4098 0.0400  0.0052  0.0198  130  ASP B N     
2274 C  CA    . ASP B 129 ? 0.4248 0.4155 0.4217 0.0295  -0.0234 0.0083  130  ASP B CA    
2275 C  C     . ASP B 129 ? 0.4453 0.3880 0.4411 0.0353  -0.0139 0.0148  130  ASP B C     
2276 O  O     . ASP B 129 ? 0.3825 0.3914 0.4768 0.0479  -0.0513 -0.0358 130  ASP B O     
2277 C  CB    . ASP B 129 ? 0.4693 0.3532 0.4096 0.0703  -0.0101 0.0187  130  ASP B CB    
2278 C  CG    . ASP B 129 ? 0.5095 0.4615 0.4904 0.0071  -0.0143 0.0027  130  ASP B CG    
2279 O  OD1   . ASP B 129 ? 0.4874 0.3402 0.4442 0.0706  -0.0012 -0.0403 130  ASP B OD1   
2280 O  OD2   . ASP B 129 ? 0.5915 0.3608 0.4925 0.0948  -0.0360 -0.0450 130  ASP B OD2   
2281 N  N     . GLN B 130 ? 0.3908 0.3737 0.4449 0.0651  -0.0029 0.0205  131  GLN B N     
2282 C  CA    . GLN B 130 ? 0.4155 0.3213 0.4327 0.0373  0.0120  -0.0005 131  GLN B CA    
2283 C  C     . GLN B 130 ? 0.4332 0.3763 0.4142 0.0433  -0.0054 -0.0005 131  GLN B C     
2284 O  O     . GLN B 130 ? 0.4905 0.3339 0.4127 0.0695  -0.0274 0.0287  131  GLN B O     
2285 C  CB    . GLN B 130 ? 0.4115 0.3522 0.4207 0.0430  0.0139  0.0221  131  GLN B CB    
2286 C  CG    . GLN B 130 ? 0.4481 0.3471 0.4844 -0.0373 0.0114  -0.0245 131  GLN B CG    
2287 C  CD    . GLN B 130 ? 0.5932 0.5211 0.6165 -0.0219 -0.0355 0.0209  131  GLN B CD    
2288 O  OE1   . GLN B 130 ? 0.5881 0.4284 0.6323 0.0092  -0.0059 0.0801  131  GLN B OE1   
2289 N  NE2   . GLN B 130 ? 0.6071 0.4580 0.6629 -0.0229 -0.0940 -0.0457 131  GLN B NE2   
2290 N  N     . ILE B 131 ? 0.3837 0.3411 0.3647 0.0270  -0.0219 -0.0010 132  ILE B N     
2291 C  CA    . ILE B 131 ? 0.3729 0.3486 0.3634 -0.0001 -0.0466 -0.0083 132  ILE B CA    
2292 C  C     . ILE B 131 ? 0.3958 0.4082 0.3644 0.0299  -0.0389 -0.0170 132  ILE B C     
2293 O  O     . ILE B 131 ? 0.3768 0.3755 0.3589 0.0515  -0.0619 -0.0123 132  ILE B O     
2294 C  CB    . ILE B 131 ? 0.3525 0.3229 0.2887 -0.0198 -0.0190 -0.0234 132  ILE B CB    
2295 C  CG1   . ILE B 131 ? 0.3283 0.3546 0.3136 -0.0181 -0.0544 -0.0341 132  ILE B CG1   
2296 C  CG2   . ILE B 131 ? 0.3219 0.3342 0.3887 0.0290  -0.0731 -0.0041 132  ILE B CG2   
2297 C  CD1   . ILE B 131 ? 0.4008 0.3437 0.2892 0.0168  -0.0439 -0.0376 132  ILE B CD1   
2298 N  N     . ALA B 132 ? 0.3768 0.3898 0.3559 0.0335  -0.0273 -0.0102 133  ALA B N     
2299 C  CA    . ALA B 132 ? 0.3178 0.3859 0.3567 0.0302  -0.0056 -0.0248 133  ALA B CA    
2300 C  C     . ALA B 132 ? 0.3375 0.4031 0.3714 0.0353  0.0053  0.0018  133  ALA B C     
2301 O  O     . ALA B 132 ? 0.3560 0.4386 0.3613 0.0357  -0.0231 -0.0101 133  ALA B O     
2302 C  CB    . ALA B 132 ? 0.4080 0.4006 0.3924 0.0221  0.0023  0.0009  133  ALA B CB    
2303 N  N     . ALA B 133 ? 0.3599 0.4047 0.3952 0.0408  0.0080  -0.0040 134  ALA B N     
2304 C  CA    . ALA B 133 ? 0.4286 0.4165 0.4325 0.0455  -0.0122 0.0176  134  ALA B CA    
2305 C  C     . ALA B 133 ? 0.4253 0.4255 0.4277 0.0247  -0.0036 -0.0194 134  ALA B C     
2306 O  O     . ALA B 133 ? 0.4418 0.4366 0.4180 0.0545  -0.0175 -0.0069 134  ALA B O     
2307 C  CB    . ALA B 133 ? 0.4238 0.4214 0.4747 -0.0057 0.0114  0.0082  134  ALA B CB    
2308 N  N     . LEU B 134 ? 0.3860 0.4039 0.4452 0.0194  -0.0049 -0.0035 135  LEU B N     
2309 C  CA    . LEU B 134 ? 0.3739 0.3760 0.4261 -0.0167 0.0087  -0.0013 135  LEU B CA    
2310 C  C     . LEU B 134 ? 0.4149 0.3910 0.4231 0.0345  -0.0088 -0.0219 135  LEU B C     
2311 O  O     . LEU B 134 ? 0.4340 0.3582 0.3657 0.0250  0.0025  -0.0348 135  LEU B O     
2312 C  CB    . LEU B 134 ? 0.3250 0.4153 0.3781 0.0436  -0.0246 -0.0317 135  LEU B CB    
2313 C  CG    . LEU B 134 ? 0.3472 0.4383 0.3786 -0.0272 -0.0015 -0.0091 135  LEU B CG    
2314 C  CD1   . LEU B 134 ? 0.4543 0.2880 0.4387 -0.0204 0.0279  -0.0021 135  LEU B CD1   
2315 C  CD2   . LEU B 134 ? 0.4937 0.5003 0.4684 -0.0101 0.0495  0.0373  135  LEU B CD2   
2316 N  N     . ASN B 135 ? 0.2941 0.3495 0.3876 0.0093  -0.0103 0.0143  136  ASN B N     
2317 C  CA    . ASN B 135 ? 0.3705 0.3626 0.3464 0.0069  -0.0499 0.0126  136  ASN B CA    
2318 C  C     . ASN B 135 ? 0.3815 0.3486 0.3595 -0.0181 -0.0194 -0.0003 136  ASN B C     
2319 O  O     . ASN B 135 ? 0.4079 0.3635 0.3534 0.0240  -0.0493 0.0265  136  ASN B O     
2320 C  CB    . ASN B 135 ? 0.3430 0.3214 0.3399 -0.0278 -0.0151 -0.0082 136  ASN B CB    
2321 C  CG    . ASN B 135 ? 0.3397 0.3825 0.3116 0.0066  -0.0416 -0.0214 136  ASN B CG    
2322 O  OD1   . ASN B 135 ? 0.3694 0.4185 0.3471 0.0610  -0.0720 0.0224  136  ASN B OD1   
2323 N  ND2   . ASN B 135 ? 0.3217 0.3452 0.3140 -0.0281 -0.0503 -0.0371 136  ASN B ND2   
2324 N  N     . ASP B 136 ? 0.3107 0.3190 0.3246 0.0223  -0.0135 0.0023  137  ASP B N     
2325 C  CA    . ASP B 136 ? 0.3397 0.3691 0.3551 -0.0199 -0.0259 -0.0261 137  ASP B CA    
2326 C  C     . ASP B 136 ? 0.3276 0.3650 0.3887 0.0077  -0.0391 -0.0304 137  ASP B C     
2327 O  O     . ASP B 136 ? 0.2772 0.3813 0.3447 0.0425  -0.0515 -0.0192 137  ASP B O     
2328 C  CB    . ASP B 136 ? 0.3358 0.3494 0.3094 0.0211  -0.0246 -0.0184 137  ASP B CB    
2329 C  CG    . ASP B 136 ? 0.4302 0.3886 0.3867 0.0054  -0.0008 0.0240  137  ASP B CG    
2330 O  OD1   . ASP B 136 ? 0.3629 0.3408 0.3935 0.0230  0.0691  -0.0101 137  ASP B OD1   
2331 O  OD2   . ASP B 136 ? 0.4884 0.4504 0.4397 0.0289  0.0097  0.0022  137  ASP B OD2   
2332 N  N     . SER B 137 ? 0.3602 0.3994 0.3985 0.0234  -0.0445 -0.0180 138  SER B N     
2333 C  CA    . SER B 137 ? 0.3632 0.4039 0.4176 0.0324  -0.0203 -0.0257 138  SER B CA    
2334 C  C     . SER B 137 ? 0.3829 0.4206 0.4167 0.0265  -0.0181 -0.0072 138  SER B C     
2335 O  O     . SER B 137 ? 0.3406 0.4834 0.3804 0.0163  -0.0816 0.0047  138  SER B O     
2336 C  CB    . SER B 137 ? 0.4143 0.4320 0.4250 0.0333  0.0040  -0.0382 138  SER B CB    
2337 O  OG    . SER B 137 ? 0.3468 0.3780 0.4053 0.0767  -0.0299 -0.0805 138  SER B OG    
2338 N  N     . LYS B 138 ? 0.3660 0.3979 0.4218 0.0435  -0.0056 -0.0128 139  LYS B N     
2339 C  CA    . LYS B 138 ? 0.3951 0.4239 0.4294 0.0460  0.0252  -0.0625 139  LYS B CA    
2340 C  C     . LYS B 138 ? 0.3946 0.4543 0.4256 0.0324  -0.0050 -0.0299 139  LYS B C     
2341 O  O     . LYS B 138 ? 0.4347 0.4579 0.3774 0.0911  -0.0097 -0.0486 139  LYS B O     
2342 C  CB    . LYS B 138 ? 0.3849 0.4600 0.3910 0.0161  0.0120  -0.0225 139  LYS B CB    
2343 C  CG    . LYS B 138 ? 0.3608 0.4558 0.4385 0.0898  0.0177  -0.1084 139  LYS B CG    
2344 C  CD    . LYS B 138 ? 0.3608 0.4816 0.5158 0.0395  0.0159  -0.0822 139  LYS B CD    
2345 C  CE    . LYS B 138 ? 0.5002 0.4184 0.4205 0.0163  -0.0029 0.0063  139  LYS B CE    
2346 N  NZ    . LYS B 138 ? 0.3327 0.4793 0.3407 0.0327  0.0025  -0.0269 139  LYS B NZ    
2347 N  N     . THR B 139 ? 0.3587 0.4209 0.4222 0.0420  -0.0282 -0.0487 140  THR B N     
2348 C  CA    . THR B 139 ? 0.3688 0.3966 0.3978 0.0207  -0.0108 -0.0265 140  THR B CA    
2349 C  C     . THR B 139 ? 0.3253 0.4201 0.3669 0.0188  -0.0344 -0.0233 140  THR B C     
2350 O  O     . THR B 139 ? 0.3012 0.4334 0.4414 0.0500  -0.0038 -0.0282 140  THR B O     
2351 C  CB    . THR B 139 ? 0.3726 0.4129 0.3980 0.0180  -0.0558 -0.0257 140  THR B CB    
2352 O  OG1   . THR B 139 ? 0.4304 0.5151 0.4961 0.0156  -0.0348 -0.0119 140  THR B OG1   
2353 C  CG2   . THR B 139 ? 0.4859 0.3494 0.4515 0.0060  -0.0387 0.0071  140  THR B CG2   
2354 N  N     . ARG B 140 ? 0.3585 0.3947 0.3863 0.0276  -0.0254 -0.0285 141  ARG B N     
2355 C  CA    . ARG B 140 ? 0.3849 0.3830 0.4465 0.0437  -0.0412 -0.0622 141  ARG B CA    
2356 C  C     . ARG B 140 ? 0.4368 0.4707 0.4654 0.0351  -0.0395 -0.0494 141  ARG B C     
2357 O  O     . ARG B 140 ? 0.4006 0.4344 0.4340 0.0792  -0.0557 -0.0927 141  ARG B O     
2358 C  CB    . ARG B 140 ? 0.4417 0.3743 0.4301 -0.0116 -0.0135 -0.0521 141  ARG B CB    
2359 C  CG    . ARG B 140 ? 0.3774 0.4445 0.5220 0.0037  -0.0344 -0.0311 141  ARG B CG    
2360 C  CD    . ARG B 140 ? 0.3937 0.4266 0.5321 -0.0305 -0.0052 -0.0057 141  ARG B CD    
2361 N  NE    . ARG B 140 ? 0.4445 0.5622 0.5452 0.0053  -0.0040 -0.0250 141  ARG B NE    
2362 C  CZ    . ARG B 140 ? 0.4272 0.4720 0.5144 0.0693  0.0116  -0.0116 141  ARG B CZ    
2363 N  NH1   . ARG B 140 ? 0.4788 0.4893 0.5070 0.1374  -0.0788 -0.0350 141  ARG B NH1   
2364 N  NH2   . ARG B 140 ? 0.4624 0.4499 0.5251 0.0641  -0.0478 -0.0399 141  ARG B NH2   
2365 N  N     . LYS B 141 ? 0.4250 0.4096 0.4530 0.0401  -0.0290 -0.0889 142  LYS B N     
2366 C  CA    . LYS B 141 ? 0.4457 0.4827 0.4918 0.0212  -0.0230 -0.0594 142  LYS B CA    
2367 C  C     . LYS B 141 ? 0.4754 0.4723 0.4614 0.0695  -0.0268 -0.0736 142  LYS B C     
2368 O  O     . LYS B 141 ? 0.4808 0.5558 0.4886 0.0921  -0.1275 -0.0123 142  LYS B O     
2369 C  CB    . LYS B 141 ? 0.4689 0.4671 0.4971 0.0338  0.0074  -0.0479 142  LYS B CB    
2370 C  CG    . LYS B 141 ? 0.5841 0.6720 0.6374 -0.0152 0.0155  -0.0307 142  LYS B CG    
2371 C  CD    . LYS B 141 ? 0.7349 0.8394 0.7829 -0.0059 0.0345  0.0506  142  LYS B CD    
2372 C  CE    . LYS B 141 ? 0.7000 0.8141 0.7935 0.0057  0.0547  0.0360  142  LYS B CE    
2373 N  NZ    . LYS B 141 ? 0.5132 0.6975 0.7441 0.0372  0.0417  -0.0187 142  LYS B NZ    
2374 N  N     . THR B 142 ? 0.4037 0.4502 0.4527 0.0577  -0.0472 -0.0835 143  THR B N     
2375 C  CA    . THR B 142 ? 0.4164 0.4421 0.4705 0.0504  -0.0556 -0.0596 143  THR B CA    
2376 C  C     . THR B 142 ? 0.4449 0.4324 0.4453 0.0383  -0.0558 -0.0486 143  THR B C     
2377 O  O     . THR B 142 ? 0.4352 0.5077 0.5031 0.0493  -0.0530 -0.0649 143  THR B O     
2378 C  CB    . THR B 142 ? 0.4737 0.4711 0.4854 0.0172  -0.0248 -0.0447 143  THR B CB    
2379 O  OG1   . THR B 142 ? 0.4386 0.5100 0.4952 0.0654  -0.0384 -0.0852 143  THR B OG1   
2380 C  CG2   . THR B 142 ? 0.3922 0.3978 0.5531 -0.0051 -0.0389 -0.0971 143  THR B CG2   
2381 N  N     . THR B 143 ? 0.3902 0.4366 0.5210 0.0772  -0.0370 -0.0779 144  THR B N     
2382 C  CA    . THR B 143 ? 0.4591 0.4425 0.5175 0.0465  -0.0464 -0.0381 144  THR B CA    
2383 C  C     . THR B 143 ? 0.4541 0.4445 0.5205 0.0686  -0.0543 -0.0310 144  THR B C     
2384 O  O     . THR B 143 ? 0.4250 0.5011 0.5347 0.0488  -0.0629 -0.0261 144  THR B O     
2385 C  CB    . THR B 143 ? 0.4064 0.4126 0.5202 0.0637  -0.1114 -0.0226 144  THR B CB    
2386 O  OG1   . THR B 143 ? 0.5278 0.4595 0.5436 0.0888  -0.0784 -0.0758 144  THR B OG1   
2387 C  CG2   . THR B 143 ? 0.4511 0.3997 0.5711 0.0262  -0.0628 -0.0177 144  THR B CG2   
2388 N  N     . SER B 144 ? 0.4287 0.4748 0.5270 0.0866  -0.0597 -0.0037 145  SER B N     
2389 C  CA    . SER B 144 ? 0.5014 0.4968 0.5764 0.0689  -0.0452 -0.0200 145  SER B CA    
2390 C  C     . SER B 144 ? 0.5766 0.5640 0.6209 0.0592  -0.0545 -0.0226 145  SER B C     
2391 O  O     . SER B 144 ? 0.5782 0.6197 0.6286 0.1191  -0.0724 -0.0494 145  SER B O     
2392 C  CB    . SER B 144 ? 0.5353 0.5299 0.5836 0.0592  -0.0463 -0.0165 145  SER B CB    
2393 O  OG    . SER B 144 ? 0.4879 0.3949 0.6046 0.1166  -0.0451 0.0066  145  SER B OG    
2394 N  N     . GLU B 145 ? 0.5799 0.6124 0.6491 0.0349  -0.0612 -0.0111 146  GLU B N     
2395 C  CA    . GLU B 145 ? 0.6274 0.6321 0.6644 0.0448  -0.0438 -0.0022 146  GLU B CA    
2396 C  C     . GLU B 145 ? 0.6479 0.6388 0.6807 0.0541  -0.0584 -0.0209 146  GLU B C     
2397 O  O     . GLU B 145 ? 0.7291 0.6366 0.6985 0.0608  -0.0540 -0.0375 146  GLU B O     
2398 C  CB    . GLU B 145 ? 0.6125 0.6516 0.7003 0.0554  -0.0591 0.0057  146  GLU B CB    
2399 C  CG    . GLU B 145 ? 0.8309 0.8605 0.8105 0.0216  -0.0484 0.0210  146  GLU B CG    
2400 C  CD    . GLU B 145 ? 1.0012 0.9722 1.0347 0.0364  -0.0419 -0.0056 146  GLU B CD    
2401 O  OE1   . GLU B 145 ? 1.0769 1.1182 1.1040 0.0024  -0.0073 0.0400  146  GLU B OE1   
2402 O  OE2   . GLU B 145 ? 1.0155 1.0010 1.0650 -0.0058 -0.0944 0.0104  146  GLU B OE2   
2403 N  N     . THR B 146 ? 0.6258 0.6020 0.6620 0.0644  -0.0374 -0.0071 147  THR B N     
2404 C  CA    . THR B 146 ? 0.6194 0.6328 0.6873 0.0548  -0.0387 -0.0230 147  THR B CA    
2405 C  C     . THR B 146 ? 0.6200 0.6588 0.6941 0.0624  -0.0269 -0.0230 147  THR B C     
2406 O  O     . THR B 146 ? 0.5727 0.6634 0.7160 0.1168  -0.0686 -0.0161 147  THR B O     
2407 C  CB    . THR B 146 ? 0.6292 0.6776 0.6904 0.0282  -0.0297 -0.0191 147  THR B CB    
2408 O  OG1   . THR B 146 ? 0.6439 0.6039 0.7126 0.0660  -0.0281 -0.0547 147  THR B OG1   
2409 C  CG2   . THR B 146 ? 0.6232 0.7027 0.7145 0.0068  0.0060  -0.0161 147  THR B CG2   
2410 N  N     . VAL B 147 ? 0.5595 0.5982 0.6811 0.0923  -0.0575 -0.0289 148  VAL B N     
2411 C  CA    . VAL B 147 ? 0.6005 0.5864 0.6826 0.1067  -0.0211 -0.0353 148  VAL B CA    
2412 C  C     . VAL B 147 ? 0.6214 0.5686 0.6823 0.1040  -0.0277 -0.0094 148  VAL B C     
2413 O  O     . VAL B 147 ? 0.5458 0.4753 0.6973 0.1841  -0.0504 -0.0071 148  VAL B O     
2414 C  CB    . VAL B 147 ? 0.5799 0.5767 0.6464 0.0798  -0.0496 -0.0333 148  VAL B CB    
2415 C  CG1   . VAL B 147 ? 0.6354 0.5451 0.7076 0.0898  -0.0214 -0.0423 148  VAL B CG1   
2416 C  CG2   . VAL B 147 ? 0.5373 0.5673 0.5232 0.0890  -0.0300 -0.0227 148  VAL B CG2   
2417 N  N     . ARG B 148 ? 0.6181 0.6248 0.6983 0.0937  -0.0190 -0.0097 149  ARG B N     
2418 C  CA    . ARG B 148 ? 0.7149 0.6782 0.7623 0.0582  -0.0111 0.0018  149  ARG B CA    
2419 C  C     . ARG B 148 ? 0.7379 0.6961 0.7649 0.0652  -0.0312 -0.0083 149  ARG B C     
2420 O  O     . ARG B 148 ? 0.7345 0.7061 0.7705 0.0791  -0.0698 -0.0005 149  ARG B O     
2421 C  CB    . ARG B 148 ? 0.7016 0.6869 0.7426 0.0595  -0.0194 0.0022  149  ARG B CB    
2422 C  CG    . ARG B 148 ? 0.8185 0.7461 0.8708 0.0339  0.0017  -0.0051 149  ARG B CG    
2423 C  CD    . ARG B 148 ? 0.9474 0.9088 0.9614 0.0025  0.0341  0.0095  149  ARG B CD    
2424 N  NE    . ARG B 148 ? 1.0553 1.0805 1.0791 0.0068  -0.0219 0.0013  149  ARG B NE    
2425 C  CZ    . ARG B 148 ? 1.1200 1.1826 1.1715 0.0004  0.0041  0.0016  149  ARG B CZ    
2426 N  NH1   . ARG B 148 ? 1.1809 1.2336 1.1840 -0.0084 -0.0031 -0.0209 149  ARG B NH1   
2427 N  NH2   . ARG B 148 ? 1.1336 1.2349 1.2418 -0.0189 -0.0127 -0.0112 149  ARG B NH2   
2428 N  N     . ALA B 149 ? 0.7653 0.7138 0.7739 0.0609  -0.0150 -0.0267 150  ALA B N     
2429 C  CA    . ALA B 149 ? 0.8210 0.7919 0.8183 0.0515  0.0000  -0.0275 150  ALA B CA    
2430 C  C     . ALA B 149 ? 0.8721 0.8327 0.8387 0.0532  -0.0051 -0.0124 150  ALA B C     
2431 O  O     . ALA B 149 ? 0.8660 0.8375 0.8311 0.0823  -0.0172 -0.0056 150  ALA B O     
2432 C  CB    . ALA B 149 ? 0.8070 0.7669 0.8241 0.0598  0.0120  -0.0362 150  ALA B CB    
2433 N  N     . VAL B 150 ? 0.8534 0.8465 0.8708 0.0601  -0.0127 -0.0079 151  VAL B N     
2434 C  CA    . VAL B 150 ? 0.8744 0.8813 0.8903 0.0438  -0.0106 -0.0082 151  VAL B CA    
2435 C  C     . VAL B 150 ? 0.8899 0.8853 0.8942 0.0300  -0.0139 -0.0105 151  VAL B C     
2436 O  O     . VAL B 150 ? 0.9096 0.9025 0.9084 0.0238  -0.0216 -0.0180 151  VAL B O     
2437 C  CB    . VAL B 150 ? 0.8621 0.8827 0.8993 0.0366  -0.0112 -0.0014 151  VAL B CB    
2438 C  CG1   . VAL B 150 ? 0.7996 0.8736 0.9013 0.0569  0.0017  0.0106  151  VAL B CG1   
2439 C  CG2   . VAL B 150 ? 0.9056 0.9091 0.9553 0.0273  0.0047  -0.0152 151  VAL B CG2   
2440 N  N     . LEU B 151 ? 0.9064 0.8763 0.8881 0.0317  0.0012  -0.0070 152  LEU B N     
2441 C  CA    . LEU B 151 ? 0.9233 0.8772 0.9187 0.0220  -0.0028 -0.0160 152  LEU B CA    
2442 C  C     . LEU B 151 ? 0.9762 0.9440 0.9710 0.0286  0.0005  -0.0042 152  LEU B C     
2443 O  O     . LEU B 151 ? 0.9873 0.9460 0.9637 0.0140  0.0239  -0.0013 152  LEU B O     
2444 C  CB    . LEU B 151 ? 0.9181 0.8633 0.9065 0.0278  -0.0150 -0.0127 152  LEU B CB    
2445 C  CG    . LEU B 151 ? 0.9236 0.8141 0.8861 0.0010  -0.0022 -0.0384 152  LEU B CG    
2446 C  CD1   . LEU B 151 ? 0.9014 0.7354 0.8657 0.0212  -0.0468 0.0033  152  LEU B CD1   
2447 C  CD2   . LEU B 151 ? 0.8873 0.7627 0.8816 0.0154  -0.0177 -0.0320 152  LEU B CD2   
2448 N  N     . ASP B 152 ? 1.0083 0.9772 1.0142 0.0207  -0.0019 -0.0184 153  ASP B N     
2449 C  CA    . ASP B 152 ? 1.0212 1.0131 1.0580 0.0097  -0.0012 -0.0175 153  ASP B CA    
2450 C  C     . ASP B 152 ? 1.0314 1.0210 1.0416 0.0135  0.0097  -0.0236 153  ASP B C     
2451 O  O     . ASP B 152 ? 1.0251 1.0007 1.0395 0.0092  0.0056  -0.0299 153  ASP B O     
2452 C  CB    . ASP B 152 ? 1.0263 1.0236 1.0646 0.0045  0.0009  -0.0171 153  ASP B CB    
2453 C  CG    . ASP B 152 ? 1.0245 1.0330 1.0568 0.0010  -0.0015 -0.0027 153  ASP B CG    
2454 O  OD1   . ASP B 152 ? 1.0927 1.0420 0.9907 0.0217  -0.0363 0.0038  153  ASP B OD1   
2455 O  OD2   . ASP B 152 ? 0.9234 1.0286 1.0821 0.0035  0.0218  -0.0271 153  ASP B OD2   
2456 O  OXT   . ASP B 152 ? 1.0374 1.0505 1.0365 0.0189  0.0114  -0.0120 153  ASP B OXT   
2457 O  "O5'" . DT  C 1   ? 0.7722 0.5751 0.3718 0.0618  0.0502  -0.1266 1    DT  C "O5'" 
2458 C  "C5'" . DT  C 1   ? 0.5921 0.5446 0.5151 0.0377  -0.0268 -0.1026 1    DT  C "C5'" 
2459 C  "C4'" . DT  C 1   ? 0.5396 0.5142 0.3783 0.0139  -0.0195 -0.0597 1    DT  C "C4'" 
2460 O  "O4'" . DT  C 1   ? 0.5328 0.5426 0.4354 -0.0182 -0.0781 -0.0709 1    DT  C "O4'" 
2461 C  "C3'" . DT  C 1   ? 0.5066 0.4663 0.4628 0.0017  -0.0389 -0.0278 1    DT  C "C3'" 
2462 O  "O3'" . DT  C 1   ? 0.4382 0.5215 0.5030 0.0274  -0.0960 -0.0146 1    DT  C "O3'" 
2463 C  "C2'" . DT  C 1   ? 0.5197 0.4721 0.4181 0.0353  -0.0927 -0.0216 1    DT  C "C2'" 
2464 C  "C1'" . DT  C 1   ? 0.5623 0.4384 0.4619 -0.0002 -0.0136 -0.0575 1    DT  C "C1'" 
2465 N  N1    . DT  C 1   ? 0.5416 0.5447 0.4969 -0.0013 0.0004  -0.0499 1    DT  C N1    
2466 C  C2    . DT  C 1   ? 0.4820 0.5114 0.4533 -0.0276 -0.0465 -0.0292 1    DT  C C2    
2467 O  O2    . DT  C 1   ? 0.4689 0.5518 0.5231 0.0006  -0.0767 -0.0446 1    DT  C O2    
2468 N  N3    . DT  C 1   ? 0.4840 0.4792 0.4517 -0.0420 -0.0641 -0.0484 1    DT  C N3    
2469 C  C4    . DT  C 1   ? 0.5425 0.4468 0.5663 -0.0140 0.0144  -0.0121 1    DT  C C4    
2470 O  O4    . DT  C 1   ? 0.5557 0.5034 0.5210 -0.0478 0.0200  -0.0764 1    DT  C O4    
2471 C  C5    . DT  C 1   ? 0.5209 0.5592 0.5621 0.0036  0.0271  -0.0047 1    DT  C C5    
2472 C  C7    . DT  C 1   ? 0.5377 0.5546 0.5927 0.0188  0.0053  0.0084  1    DT  C C7    
2473 C  C6    . DT  C 1   ? 0.5856 0.5508 0.5643 0.0301  0.0225  -0.0262 1    DT  C C6    
2474 P  P     . DC  C 2   ? 0.5190 0.5566 0.5262 -0.0138 -0.0616 0.0198  2    DC  C P     
2475 O  OP1   . DC  C 2   ? 0.6092 0.6230 0.6368 0.0075  -0.0738 -0.0067 2    DC  C OP1   
2476 O  OP2   . DC  C 2   ? 0.4316 0.6257 0.5439 0.0838  -0.0769 0.0464  2    DC  C OP2   
2477 O  "O5'" . DC  C 2   ? 0.4455 0.4206 0.5425 -0.0315 -0.1066 -0.0224 2    DC  C "O5'" 
2478 C  "C5'" . DC  C 2   ? 0.4847 0.3698 0.4772 -0.0330 -0.0740 -0.0387 2    DC  C "C5'" 
2479 C  "C4'" . DC  C 2   ? 0.5362 0.4706 0.5418 0.0342  0.0060  -0.0485 2    DC  C "C4'" 
2480 O  "O4'" . DC  C 2   ? 0.6232 0.5696 0.4697 -0.0130 -0.0124 -0.0321 2    DC  C "O4'" 
2481 C  "C3'" . DC  C 2   ? 0.5728 0.5379 0.5022 0.0077  0.0071  -0.0571 2    DC  C "C3'" 
2482 O  "O3'" . DC  C 2   ? 0.6325 0.5524 0.5286 0.0074  0.0926  -0.0655 2    DC  C "O3'" 
2483 C  "C2'" . DC  C 2   ? 0.4476 0.5850 0.5274 -0.0017 0.0146  -0.0662 2    DC  C "C2'" 
2484 C  "C1'" . DC  C 2   ? 0.5217 0.5383 0.5047 -0.0299 -0.0095 -0.0334 2    DC  C "C1'" 
2485 N  N1    . DC  C 2   ? 0.5561 0.5123 0.4647 0.0128  0.0041  -0.0806 2    DC  C N1    
2486 C  C2    . DC  C 2   ? 0.5301 0.4758 0.5195 0.0261  -0.0243 -0.0336 2    DC  C C2    
2487 O  O2    . DC  C 2   ? 0.6026 0.4345 0.5252 0.0002  -0.0162 -0.0522 2    DC  C O2    
2488 N  N3    . DC  C 2   ? 0.5845 0.4673 0.5643 0.0063  -0.0144 -0.0538 2    DC  C N3    
2489 C  C4    . DC  C 2   ? 0.5344 0.4748 0.5066 -0.0498 -0.0277 -0.0347 2    DC  C C4    
2490 N  N4    . DC  C 2   ? 0.5330 0.4689 0.4628 0.0212  -0.0263 -0.0644 2    DC  C N4    
2491 C  C5    . DC  C 2   ? 0.5784 0.3640 0.4932 -0.0098 -0.0043 -0.0640 2    DC  C C5    
2492 C  C6    . DC  C 2   ? 0.5731 0.4847 0.4842 0.0054  -0.0329 -0.0706 2    DC  C C6    
2493 P  P     . DT  C 3   ? 0.7101 0.6434 0.6267 0.0173  0.0627  -0.0387 3    DT  C P     
2494 O  OP1   . DT  C 3   ? 0.7150 0.6420 0.6492 -0.0506 0.0564  -0.0483 3    DT  C OP1   
2495 O  OP2   . DT  C 3   ? 0.7299 0.7423 0.5645 0.0689  -0.0098 -0.0022 3    DT  C OP2   
2496 O  "O5'" . DT  C 3   ? 0.6773 0.4353 0.4990 0.0042  0.0715  -0.0940 3    DT  C "O5'" 
2497 C  "C5'" . DT  C 3   ? 0.5996 0.5599 0.4916 0.0145  0.0471  -0.0177 3    DT  C "C5'" 
2498 C  "C4'" . DT  C 3   ? 0.7031 0.5639 0.5770 -0.0455 -0.0220 0.0095  3    DT  C "C4'" 
2499 O  "O4'" . DT  C 3   ? 0.6571 0.4953 0.5504 0.0065  -0.0004 -0.0352 3    DT  C "O4'" 
2500 C  "C3'" . DT  C 3   ? 0.7263 0.5821 0.6224 -0.0445 0.0032  -0.0050 3    DT  C "C3'" 
2501 O  "O3'" . DT  C 3   ? 0.7858 0.6355 0.6286 0.0126  0.0132  -0.0482 3    DT  C "O3'" 
2502 C  "C2'" . DT  C 3   ? 0.7546 0.5139 0.5692 -0.0473 -0.0360 -0.0851 3    DT  C "C2'" 
2503 C  "C1'" . DT  C 3   ? 0.5933 0.5243 0.5352 -0.0497 0.0073  0.0121  3    DT  C "C1'" 
2504 N  N1    . DT  C 3   ? 0.5645 0.3909 0.4875 -0.0416 -0.0806 -0.0637 3    DT  C N1    
2505 C  C2    . DT  C 3   ? 0.5785 0.4700 0.4967 -0.0115 -0.0082 -0.0907 3    DT  C C2    
2506 O  O2    . DT  C 3   ? 0.6312 0.4565 0.5174 -0.0001 -0.0263 -0.0733 3    DT  C O2    
2507 N  N3    . DT  C 3   ? 0.5812 0.3431 0.5388 0.0001  -0.0700 -0.1390 3    DT  C N3    
2508 C  C4    . DT  C 3   ? 0.6183 0.5318 0.4892 -0.0204 -0.0083 -0.1236 3    DT  C C4    
2509 O  O4    . DT  C 3   ? 0.5636 0.5898 0.6208 -0.0534 -0.0004 -0.1095 3    DT  C O4    
2510 C  C5    . DT  C 3   ? 0.5992 0.5129 0.5765 -0.0407 -0.0439 -0.0498 3    DT  C C5    
2511 C  C7    . DT  C 3   ? 0.6471 0.5809 0.4980 0.0037  -0.0160 -0.0227 3    DT  C C7    
2512 C  C6    . DT  C 3   ? 0.4980 0.3198 0.4759 -0.0273 -0.0346 -0.1192 3    DT  C C6    
2513 P  P     . DG  C 4   ? 0.8459 0.6607 0.8863 0.0408  -0.0284 0.0052  4    DG  C P     
2514 O  OP1   . DG  C 4   ? 0.7151 0.6410 0.8765 0.0341  0.0830  0.0008  4    DG  C OP1   
2515 O  OP2   . DG  C 4   ? 0.8938 0.6612 0.6191 0.0747  0.0436  -0.0862 4    DG  C OP2   
2516 O  "O5'" . DG  C 4   ? 0.7249 0.3755 0.6839 0.0440  0.0171  -0.0747 4    DG  C "O5'" 
2517 C  "C5'" . DG  C 4   ? 0.5879 0.5273 0.6521 0.0385  0.0352  -0.1157 4    DG  C "C5'" 
2518 C  "C4'" . DG  C 4   ? 0.5481 0.4804 0.6263 0.0161  0.0104  -0.0982 4    DG  C "C4'" 
2519 O  "O4'" . DG  C 4   ? 0.5343 0.5143 0.6884 -0.0150 0.0281  -0.1330 4    DG  C "O4'" 
2520 C  "C3'" . DG  C 4   ? 0.5095 0.5294 0.5225 0.0061  -0.0115 -0.0392 4    DG  C "C3'" 
2521 O  "O3'" . DG  C 4   ? 0.5171 0.5454 0.5357 -0.0088 0.0433  -0.0185 4    DG  C "O3'" 
2522 C  "C2'" . DG  C 4   ? 0.4125 0.4729 0.5572 -0.0030 0.0340  -0.0738 4    DG  C "C2'" 
2523 C  "C1'" . DG  C 4   ? 0.4376 0.4386 0.5214 0.0200  0.0107  -0.1295 4    DG  C "C1'" 
2524 N  N9    . DG  C 4   ? 0.5005 0.4649 0.4976 0.0022  0.0042  -0.0803 4    DG  C N9    
2525 C  C8    . DG  C 4   ? 0.4804 0.4371 0.4843 -0.0158 -0.0086 -0.0550 4    DG  C C8    
2526 N  N7    . DG  C 4   ? 0.4498 0.4315 0.5283 -0.0340 0.0185  -0.0727 4    DG  C N7    
2527 C  C5    . DG  C 4   ? 0.4745 0.4395 0.4308 0.0366  0.0383  -0.0224 4    DG  C C5    
2528 C  C6    . DG  C 4   ? 0.4355 0.4446 0.4714 0.0296  -0.0170 -0.0225 4    DG  C C6    
2529 O  O6    . DG  C 4   ? 0.4775 0.4772 0.4556 0.0168  0.0061  -0.1039 4    DG  C O6    
2530 N  N1    . DG  C 4   ? 0.4115 0.4319 0.4633 0.0566  0.0315  -0.0814 4    DG  C N1    
2531 C  C2    . DG  C 4   ? 0.4587 0.4207 0.4761 -0.0292 -0.0004 -0.0457 4    DG  C C2    
2532 N  N2    . DG  C 4   ? 0.4606 0.4541 0.4521 0.0002  0.0325  -0.0784 4    DG  C N2    
2533 N  N3    . DG  C 4   ? 0.4902 0.4633 0.4421 0.0246  -0.0268 -0.0899 4    DG  C N3    
2534 C  C4    . DG  C 4   ? 0.4052 0.4662 0.4552 0.0009  0.0127  -0.0781 4    DG  C C4    
2535 P  P     . DC  C 5   ? 0.4995 0.5357 0.5363 -0.0288 0.0180  -0.0220 5    DC  C P     
2536 O  OP1   . DC  C 5   ? 0.5115 0.4975 0.6164 -0.0187 -0.0192 -0.0441 5    DC  C OP1   
2537 O  OP2   . DC  C 5   ? 0.4736 0.4870 0.4812 -0.0709 0.0445  -0.0448 5    DC  C OP2   
2538 O  "O5'" . DC  C 5   ? 0.5999 0.5287 0.5205 -0.0596 0.0464  -0.0634 5    DC  C "O5'" 
2539 C  "C5'" . DC  C 5   ? 0.5779 0.5657 0.5344 -0.0255 0.0480  -0.0272 5    DC  C "C5'" 
2540 C  "C4'" . DC  C 5   ? 0.5556 0.5749 0.5995 -0.0003 0.0085  -0.0358 5    DC  C "C4'" 
2541 O  "O4'" . DC  C 5   ? 0.4534 0.6544 0.5061 -0.0124 0.0708  -0.0884 5    DC  C "O4'" 
2542 C  "C3'" . DC  C 5   ? 0.5109 0.5583 0.6009 -0.0219 -0.0052 -0.0039 5    DC  C "C3'" 
2543 O  "O3'" . DC  C 5   ? 0.5412 0.6515 0.6068 -0.0064 -0.0165 0.0017  5    DC  C "O3'" 
2544 C  "C2'" . DC  C 5   ? 0.5221 0.5832 0.5287 -0.0222 0.0515  -0.0143 5    DC  C "C2'" 
2545 C  "C1'" . DC  C 5   ? 0.5802 0.5234 0.5370 -0.0348 0.0035  -0.0517 5    DC  C "C1'" 
2546 N  N1    . DC  C 5   ? 0.5408 0.5305 0.5703 -0.0345 0.0158  -0.0607 5    DC  C N1    
2547 C  C2    . DC  C 5   ? 0.5651 0.4675 0.4839 -0.0193 0.0388  -0.0691 5    DC  C C2    
2548 O  O2    . DC  C 5   ? 0.6109 0.5472 0.5300 -0.0144 0.1077  -0.0890 5    DC  C O2    
2549 N  N3    . DC  C 5   ? 0.6217 0.4452 0.4828 -0.1085 0.0662  -0.1021 5    DC  C N3    
2550 C  C4    . DC  C 5   ? 0.5863 0.4594 0.5681 -0.0713 0.0286  -0.0606 5    DC  C C4    
2551 N  N4    . DC  C 5   ? 0.6085 0.4684 0.5844 0.0157  0.0050  -0.0590 5    DC  C N4    
2552 C  C5    . DC  C 5   ? 0.5185 0.3687 0.5322 -0.0918 0.0099  -0.0405 5    DC  C C5    
2553 C  C6    . DC  C 5   ? 0.5493 0.4916 0.5332 -0.0663 0.0073  0.0146  5    DC  C C6    
2554 P  P     . DC  C 6   ? 0.4937 0.6036 0.6013 -0.0440 0.0012  0.0326  6    DC  C P     
2555 O  OP1   . DC  C 6   ? 0.5506 0.6123 0.6429 -0.0426 -0.0711 0.0706  6    DC  C OP1   
2556 O  OP2   . DC  C 6   ? 0.4449 0.4227 0.6477 0.0128  0.0111  -0.0103 6    DC  C OP2   
2557 O  "O5'" . DC  C 6   ? 0.5584 0.5891 0.5843 -0.0284 0.0053  0.0004  6    DC  C "O5'" 
2558 C  "C5'" . DC  C 6   ? 0.5692 0.6292 0.6133 -0.0177 0.0317  -0.0580 6    DC  C "C5'" 
2559 C  "C4'" . DC  C 6   ? 0.5825 0.5665 0.5452 -0.0171 -0.0160 -0.0300 6    DC  C "C4'" 
2560 O  "O4'" . DC  C 6   ? 0.5149 0.5140 0.6142 -0.0356 0.0129  -0.0357 6    DC  C "O4'" 
2561 C  "C3'" . DC  C 6   ? 0.5066 0.5940 0.5320 -0.0611 -0.0545 -0.0378 6    DC  C "C3'" 
2562 O  "O3'" . DC  C 6   ? 0.5639 0.6377 0.5469 -0.0874 -0.0437 -0.0202 6    DC  C "O3'" 
2563 C  "C2'" . DC  C 6   ? 0.5030 0.5524 0.5060 -0.1009 -0.0094 -0.0353 6    DC  C "C2'" 
2564 C  "C1'" . DC  C 6   ? 0.5305 0.5470 0.5245 -0.0325 0.0253  -0.0558 6    DC  C "C1'" 
2565 N  N1    . DC  C 6   ? 0.5567 0.5129 0.5366 -0.0475 0.0136  -0.1105 6    DC  C N1    
2566 C  C2    . DC  C 6   ? 0.6090 0.4806 0.5185 -0.0542 -0.0236 -0.1024 6    DC  C C2    
2567 O  O2    . DC  C 6   ? 0.6358 0.5534 0.6263 -0.0031 0.0490  -0.1260 6    DC  C O2    
2568 N  N3    . DC  C 6   ? 0.5989 0.3792 0.4938 -0.1242 0.0440  -0.1373 6    DC  C N3    
2569 C  C4    . DC  C 6   ? 0.6093 0.4468 0.5152 -0.0213 0.0137  -0.1238 6    DC  C C4    
2570 N  N4    . DC  C 6   ? 0.5725 0.4595 0.4555 -0.0576 -0.0064 -0.1204 6    DC  C N4    
2571 C  C5    . DC  C 6   ? 0.6036 0.5247 0.5355 -0.0564 0.0236  -0.0399 6    DC  C C5    
2572 C  C6    . DC  C 6   ? 0.5797 0.5649 0.4941 -0.0326 0.0208  -0.0963 6    DC  C C6    
2573 P  P     . DT  C 7   ? 0.6109 0.6692 0.6950 -0.0893 -0.0576 -0.0165 7    DT  C P     
2574 O  OP1   . DT  C 7   ? 0.7053 0.7156 0.6466 -0.0854 -0.0792 0.0202  7    DT  C OP1   
2575 O  OP2   . DT  C 7   ? 0.5477 0.5675 0.7136 -0.0270 -0.1116 -0.0385 7    DT  C OP2   
2576 O  "O5'" . DT  C 7   ? 0.6630 0.5551 0.5222 -0.0021 -0.0353 0.0340  7    DT  C "O5'" 
2577 C  "C5'" . DT  C 7   ? 0.5417 0.6576 0.6149 -0.0165 0.0010  0.0224  7    DT  C "C5'" 
2578 C  "C4'" . DT  C 7   ? 0.6048 0.6192 0.5352 -0.0433 0.0098  0.0212  7    DT  C "C4'" 
2579 O  "O4'" . DT  C 7   ? 0.5265 0.6638 0.5877 -0.1147 0.0210  -0.0383 7    DT  C "O4'" 
2580 C  "C3'" . DT  C 7   ? 0.5993 0.7225 0.5497 -0.0589 0.0125  -0.0167 7    DT  C "C3'" 
2581 O  "O3'" . DT  C 7   ? 0.7299 0.8083 0.5564 -0.1161 0.0000  -0.0223 7    DT  C "O3'" 
2582 C  "C2'" . DT  C 7   ? 0.5034 0.5658 0.5354 -0.0939 -0.0125 -0.0034 7    DT  C "C2'" 
2583 C  "C1'" . DT  C 7   ? 0.4736 0.5547 0.4860 -0.0254 0.0641  -0.0407 7    DT  C "C1'" 
2584 N  N1    . DT  C 7   ? 0.4629 0.4284 0.4284 -0.0501 0.0154  -0.0575 7    DT  C N1    
2585 C  C2    . DT  C 7   ? 0.4745 0.4998 0.4753 0.0177  0.0185  -0.0186 7    DT  C C2    
2586 O  O2    . DT  C 7   ? 0.4253 0.5329 0.5083 0.0243  0.0322  -0.0273 7    DT  C O2    
2587 N  N3    . DT  C 7   ? 0.3567 0.4378 0.4981 -0.0441 -0.0294 -0.0868 7    DT  C N3    
2588 C  C4    . DT  C 7   ? 0.4226 0.4998 0.4306 0.0087  0.0177  -0.0409 7    DT  C C4    
2589 O  O4    . DT  C 7   ? 0.3479 0.4510 0.4986 0.0000  -0.0087 -0.0619 7    DT  C O4    
2590 C  C5    . DT  C 7   ? 0.4297 0.4862 0.4876 -0.0063 -0.0053 -0.0358 7    DT  C C5    
2591 C  C7    . DT  C 7   ? 0.4492 0.4800 0.5226 0.0287  -0.0091 -0.0528 7    DT  C C7    
2592 C  C6    . DT  C 7   ? 0.4513 0.4347 0.5060 -0.0345 -0.0123 -0.0551 7    DT  C C6    
2593 P  P     . DT  C 8   ? 0.5747 0.7697 0.6657 -0.1174 -0.0650 0.0059  8    DT  C P     
2594 O  OP1   . DT  C 8   ? 0.7758 0.8782 0.6555 -0.0680 -0.0430 0.0376  8    DT  C OP1   
2595 O  OP2   . DT  C 8   ? 0.6343 0.6249 0.5866 -0.1190 -0.1698 0.0423  8    DT  C OP2   
2596 O  "O5'" . DT  C 8   ? 0.5539 0.5730 0.5693 -0.1078 -0.0564 0.0215  8    DT  C "O5'" 
2597 C  "C5'" . DT  C 8   ? 0.4479 0.5872 0.5790 -0.0869 -0.0095 0.0018  8    DT  C "C5'" 
2598 C  "C4'" . DT  C 8   ? 0.4415 0.6170 0.5053 -0.0772 -0.0382 -0.0005 8    DT  C "C4'" 
2599 O  "O4'" . DT  C 8   ? 0.4901 0.6095 0.5659 -0.0229 0.0186  -0.0760 8    DT  C "O4'" 
2600 C  "C3'" . DT  C 8   ? 0.5660 0.7144 0.5500 -0.0092 0.0749  0.0031  8    DT  C "C3'" 
2601 O  "O3'" . DT  C 8   ? 0.4927 0.6968 0.5071 -0.0979 -0.0110 -0.0688 8    DT  C "O3'" 
2602 C  "C2'" . DT  C 8   ? 0.3917 0.6825 0.5817 0.0283  -0.0052 -0.0666 8    DT  C "C2'" 
2603 C  "C1'" . DT  C 8   ? 0.4251 0.5864 0.5026 -0.0281 0.0223  -0.0222 8    DT  C "C1'" 
2604 N  N1    . DT  C 8   ? 0.3919 0.5214 0.4536 0.0379  0.0213  -0.0321 8    DT  C N1    
2605 C  C2    . DT  C 8   ? 0.3579 0.4878 0.4691 0.0413  0.0214  0.0195  8    DT  C C2    
2606 O  O2    . DT  C 8   ? 0.3779 0.4786 0.4881 0.0377  0.0601  0.0262  8    DT  C O2    
2607 N  N3    . DT  C 8   ? 0.3345 0.5121 0.4515 -0.0118 0.0098  -0.0565 8    DT  C N3    
2608 C  C4    . DT  C 8   ? 0.3430 0.4552 0.4120 -0.0077 -0.0016 -0.0360 8    DT  C C4    
2609 O  O4    . DT  C 8   ? 0.3267 0.4766 0.4244 0.0612  -0.0429 -0.0465 8    DT  C O4    
2610 C  C5    . DT  C 8   ? 0.3498 0.4493 0.4230 0.0518  -0.0206 -0.0110 8    DT  C C5    
2611 C  C7    . DT  C 8   ? 0.4310 0.5355 0.5727 -0.0018 -0.0015 -0.0116 8    DT  C C7    
2612 C  C6    . DT  C 8   ? 0.3615 0.5061 0.4137 0.0174  0.0545  -0.0658 8    DT  C C6    
2613 P  P     . DT  C 9   ? 0.5062 0.6900 0.5719 -0.0034 -0.0194 -0.0111 9    DT  C P     
2614 O  OP1   . DT  C 9   ? 0.4290 0.8239 0.4104 -0.0469 -0.0205 0.0066  9    DT  C OP1   
2615 O  OP2   . DT  C 9   ? 0.4957 0.5279 0.5517 -0.0527 -0.0188 0.0574  9    DT  C OP2   
2616 O  "O5'" . DT  C 9   ? 0.3611 0.5806 0.4443 -0.0446 0.0282  0.0043  9    DT  C "O5'" 
2617 C  "C5'" . DT  C 9   ? 0.3856 0.4731 0.4458 0.0101  -0.0114 -0.0233 9    DT  C "C5'" 
2618 C  "C4'" . DT  C 9   ? 0.3374 0.5241 0.4482 -0.0110 0.0111  0.0026  9    DT  C "C4'" 
2619 O  "O4'" . DT  C 9   ? 0.4340 0.4988 0.5208 0.0291  0.0088  -0.0226 9    DT  C "O4'" 
2620 C  "C3'" . DT  C 9   ? 0.3205 0.4425 0.4036 0.0395  0.0106  -0.0013 9    DT  C "C3'" 
2621 O  "O3'" . DT  C 9   ? 0.3086 0.5417 0.4116 0.0271  0.0154  0.0254  9    DT  C "O3'" 
2622 C  "C2'" . DT  C 9   ? 0.3187 0.4078 0.3958 -0.0155 0.0014  -0.0692 9    DT  C "C2'" 
2623 C  "C1'" . DT  C 9   ? 0.3561 0.4923 0.4281 0.0301  0.0399  -0.0456 9    DT  C "C1'" 
2624 N  N1    . DT  C 9   ? 0.3560 0.3708 0.3585 -0.0138 0.0027  -0.0484 9    DT  C N1    
2625 C  C2    . DT  C 9   ? 0.3717 0.3578 0.4810 -0.0109 0.0151  -0.0340 9    DT  C C2    
2626 O  O2    . DT  C 9   ? 0.2930 0.3878 0.3798 0.0102  -0.0424 -0.0341 9    DT  C O2    
2627 N  N3    . DT  C 9   ? 0.3636 0.3272 0.3623 -0.0070 0.0080  -0.0131 9    DT  C N3    
2628 C  C4    . DT  C 9   ? 0.4141 0.4440 0.3851 0.0412  0.0465  -0.0322 9    DT  C C4    
2629 O  O4    . DT  C 9   ? 0.3995 0.4162 0.3629 0.0324  -0.0387 -0.0835 9    DT  C O4    
2630 C  C5    . DT  C 9   ? 0.4004 0.4346 0.3785 0.0287  -0.0019 -0.0278 9    DT  C C5    
2631 C  C7    . DT  C 9   ? 0.5013 0.5533 0.4688 0.0290  0.0269  0.0289  9    DT  C C7    
2632 C  C6    . DT  C 9   ? 0.4368 0.5038 0.4274 0.0248  -0.0191 -0.0144 9    DT  C C6    
2633 P  P     . DT  C 10  ? 0.4370 0.4835 0.4835 0.0134  -0.0461 0.0178  10   DT  C P     
2634 O  OP1   . DT  C 10  ? 0.3329 0.4240 0.5175 -0.0080 -0.0419 -0.0803 10   DT  C OP1   
2635 O  OP2   . DT  C 10  ? 0.2921 0.4052 0.5322 -0.0232 -0.0504 -0.0157 10   DT  C OP2   
2636 O  "O5'" . DT  C 10  ? 0.3263 0.4834 0.4631 -0.0127 -0.0664 0.0062  10   DT  C "O5'" 
2637 C  "C5'" . DT  C 10  ? 0.3614 0.4212 0.4233 -0.0024 -0.0206 0.0242  10   DT  C "C5'" 
2638 C  "C4'" . DT  C 10  ? 0.3744 0.4365 0.3582 0.0251  0.0037  -0.0559 10   DT  C "C4'" 
2639 O  "O4'" . DT  C 10  ? 0.3573 0.4032 0.3817 -0.0206 -0.0055 -0.0401 10   DT  C "O4'" 
2640 C  "C3'" . DT  C 10  ? 0.3291 0.3541 0.4140 0.0313  -0.0025 -0.0214 10   DT  C "C3'" 
2641 O  "O3'" . DT  C 10  ? 0.4051 0.4620 0.4368 0.0621  0.0326  -0.0739 10   DT  C "O3'" 
2642 C  "C2'" . DT  C 10  ? 0.3665 0.3991 0.4321 0.0190  -0.0038 -0.0552 10   DT  C "C2'" 
2643 C  "C1'" . DT  C 10  ? 0.3280 0.3788 0.3794 0.0182  -0.0131 -0.0501 10   DT  C "C1'" 
2644 N  N1    . DT  C 10  ? 0.2944 0.3071 0.3640 0.0122  -0.0148 -0.0788 10   DT  C N1    
2645 C  C2    . DT  C 10  ? 0.3546 0.3396 0.3630 -0.0235 0.0205  -0.0262 10   DT  C C2    
2646 O  O2    . DT  C 10  ? 0.2532 0.3443 0.3689 -0.0737 -0.0013 -0.0424 10   DT  C O2    
2647 N  N3    . DT  C 10  ? 0.2569 0.3274 0.3451 -0.0177 0.0104  0.0106  10   DT  C N3    
2648 C  C4    . DT  C 10  ? 0.3226 0.2928 0.3328 0.0476  0.0430  -0.0414 10   DT  C C4    
2649 O  O4    . DT  C 10  ? 0.3426 0.3861 0.4165 0.0263  -0.0057 -0.0205 10   DT  C O4    
2650 C  C5    . DT  C 10  ? 0.3319 0.3706 0.3715 -0.0103 0.0154  0.0309  10   DT  C C5    
2651 C  C7    . DT  C 10  ? 0.2616 0.3944 0.4325 -0.0115 -0.0044 0.0162  10   DT  C C7    
2652 C  C6    . DT  C 10  ? 0.2382 0.3619 0.2965 -0.0135 0.0139  -0.0403 10   DT  C C6    
2653 P  P     . DT  C 11  ? 0.4741 0.5715 0.4773 0.0222  0.0313  -0.0547 11   DT  C P     
2654 O  OP1   . DT  C 11  ? 0.4607 0.6168 0.4652 0.1200  0.0640  -0.0381 11   DT  C OP1   
2655 O  OP2   . DT  C 11  ? 0.3973 0.5358 0.3535 -0.0055 0.0082  -0.1075 11   DT  C OP2   
2656 O  "O5'" . DT  C 11  ? 0.4682 0.5620 0.4548 0.0386  -0.0188 -0.0885 11   DT  C "O5'" 
2657 C  "C5'" . DT  C 11  ? 0.4344 0.4816 0.4005 0.0411  0.0094  -0.0596 11   DT  C "C5'" 
2658 C  "C4'" . DT  C 11  ? 0.3525 0.4241 0.4320 0.0275  0.0285  -0.0272 11   DT  C "C4'" 
2659 O  "O4'" . DT  C 11  ? 0.2542 0.4965 0.3799 -0.0369 -0.0728 -0.0957 11   DT  C "O4'" 
2660 C  "C3'" . DT  C 11  ? 0.3580 0.4028 0.4014 -0.0303 -0.0169 -0.0384 11   DT  C "C3'" 
2661 O  "O3'" . DT  C 11  ? 0.3179 0.5451 0.4679 0.1319  -0.0368 -0.0720 11   DT  C "O3'" 
2662 C  "C2'" . DT  C 11  ? 0.3114 0.4810 0.4600 0.0372  -0.0061 -0.0485 11   DT  C "C2'" 
2663 C  "C1'" . DT  C 11  ? 0.3407 0.4257 0.4441 -0.0387 -0.0132 -0.0260 11   DT  C "C1'" 
2664 N  N1    . DT  C 11  ? 0.3980 0.4048 0.4177 -0.0541 0.0109  -0.0559 11   DT  C N1    
2665 C  C2    . DT  C 11  ? 0.3811 0.3817 0.4107 -0.0376 0.0446  -0.0052 11   DT  C C2    
2666 O  O2    . DT  C 11  ? 0.2893 0.4619 0.4050 0.0079  -0.0323 -0.0381 11   DT  C O2    
2667 N  N3    . DT  C 11  ? 0.1860 0.3543 0.3055 -0.0513 -0.0389 -0.0735 11   DT  C N3    
2668 C  C4    . DT  C 11  ? 0.4046 0.4187 0.4244 0.0029  0.0063  -0.0318 11   DT  C C4    
2669 O  O4    . DT  C 11  ? 0.3204 0.3792 0.3976 0.0004  0.0342  -0.0081 11   DT  C O4    
2670 C  C5    . DT  C 11  ? 0.3414 0.4231 0.3918 -0.0006 0.0042  -0.0542 11   DT  C C5    
2671 C  C7    . DT  C 11  ? 0.3203 0.4150 0.5309 -0.0062 -0.0340 -0.0629 11   DT  C C7    
2672 C  C6    . DT  C 11  ? 0.3644 0.4083 0.3924 -0.0500 0.0009  -0.0519 11   DT  C C6    
2673 P  P     . DT  C 12  ? 0.4230 0.6213 0.5679 0.0019  -0.0236 -0.0675 12   DT  C P     
2674 O  OP1   . DT  C 12  ? 0.4279 0.6032 0.3666 0.1173  -0.0726 0.0464  12   DT  C OP1   
2675 O  OP2   . DT  C 12  ? 0.4743 0.7187 0.4250 0.0439  -0.0118 -0.0452 12   DT  C OP2   
2676 O  "O5'" . DT  C 12  ? 0.4603 0.5874 0.4297 -0.0285 -0.0045 -0.1259 12   DT  C "O5'" 
2677 C  "C5'" . DT  C 12  ? 0.5140 0.6335 0.4826 -0.0548 0.0379  -0.0764 12   DT  C "C5'" 
2678 C  "C4'" . DT  C 12  ? 0.2706 0.4596 0.4758 -0.0591 0.0025  -0.0191 12   DT  C "C4'" 
2679 O  "O4'" . DT  C 12  ? 0.4632 0.4208 0.4620 -0.0509 0.0277  -0.1137 12   DT  C "O4'" 
2680 C  "C3'" . DT  C 12  ? 0.2883 0.2966 0.4518 0.0106  0.0070  -0.0020 12   DT  C "C3'" 
2681 O  "O3'" . DT  C 12  ? 0.2695 0.3944 0.4321 0.0496  -0.0254 0.0130  12   DT  C "O3'" 
2682 C  "C2'" . DT  C 12  ? 0.3587 0.4271 0.4659 0.0018  0.0018  -0.0316 12   DT  C "C2'" 
2683 C  "C1'" . DT  C 12  ? 0.4614 0.4089 0.4746 -0.0437 -0.0399 0.0102  12   DT  C "C1'" 
2684 N  N1    . DT  C 12  ? 0.4314 0.5180 0.3959 0.0181  0.0486  -0.0432 12   DT  C N1    
2685 C  C2    . DT  C 12  ? 0.4406 0.4173 0.3776 -0.0291 -0.0107 0.0022  12   DT  C C2    
2686 O  O2    . DT  C 12  ? 0.3088 0.4582 0.4220 -0.0139 0.0184  0.0300  12   DT  C O2    
2687 N  N3    . DT  C 12  ? 0.3685 0.3763 0.3434 -0.0736 0.0048  -0.0821 12   DT  C N3    
2688 C  C4    . DT  C 12  ? 0.3778 0.3343 0.4509 0.0146  -0.0265 -0.0073 12   DT  C C4    
2689 O  O4    . DT  C 12  ? 0.3180 0.4010 0.4709 -0.0749 -0.0042 -0.0451 12   DT  C O4    
2690 C  C5    . DT  C 12  ? 0.3493 0.3855 0.4701 0.0071  0.0357  0.0014  12   DT  C C5    
2691 C  C7    . DT  C 12  ? 0.4162 0.4554 0.5573 0.0005  -0.0634 0.0161  12   DT  C C7    
2692 C  C6    . DT  C 12  ? 0.4301 0.4512 0.4845 0.0465  0.0367  -0.0048 12   DT  C C6    
2693 P  P     . DG  C 13  ? 0.3754 0.4075 0.4105 0.0072  -0.0250 -0.0009 13   DG  C P     
2694 O  OP1   . DG  C 13  ? 0.2338 0.3645 0.4784 0.1076  -0.0355 -0.0355 13   DG  C OP1   
2695 O  OP2   . DG  C 13  ? 0.3085 0.3677 0.3687 0.0521  -0.0505 0.0204  13   DG  C OP2   
2696 O  "O5'" . DG  C 13  ? 0.3774 0.3885 0.4048 -0.0092 0.0334  -0.0171 13   DG  C "O5'" 
2697 C  "C5'" . DG  C 13  ? 0.3494 0.2870 0.3249 0.0100  -0.0904 -0.0379 13   DG  C "C5'" 
2698 C  "C4'" . DG  C 13  ? 0.2924 0.3036 0.3987 0.0325  -0.0101 0.0070  13   DG  C "C4'" 
2699 O  "O4'" . DG  C 13  ? 0.3197 0.3033 0.3091 0.0280  -0.0118 -0.0064 13   DG  C "O4'" 
2700 C  "C3'" . DG  C 13  ? 0.3322 0.3578 0.2918 0.0509  -0.0088 -0.0808 13   DG  C "C3'" 
2701 O  "O3'" . DG  C 13  ? 0.2516 0.3188 0.3422 0.0253  -0.0255 -0.0473 13   DG  C "O3'" 
2702 C  "C2'" . DG  C 13  ? 0.2919 0.3167 0.2923 0.0495  0.0358  0.0327  13   DG  C "C2'" 
2703 C  "C1'" . DG  C 13  ? 0.2817 0.3838 0.2833 0.0264  -0.0033 -0.0707 13   DG  C "C1'" 
2704 N  N9    . DG  C 13  ? 0.3519 0.3125 0.3452 -0.0193 -0.0013 -0.0500 13   DG  C N9    
2705 C  C8    . DG  C 13  ? 0.3133 0.3768 0.3599 0.0350  0.0170  -0.0353 13   DG  C C8    
2706 N  N7    . DG  C 13  ? 0.3146 0.3403 0.3060 0.0356  -0.0519 -0.0615 13   DG  C N7    
2707 C  C5    . DG  C 13  ? 0.3510 0.3071 0.3915 0.0313  -0.0103 -0.0234 13   DG  C C5    
2708 C  C6    . DG  C 13  ? 0.3837 0.3934 0.3694 -0.0271 -0.0615 -0.0735 13   DG  C C6    
2709 O  O6    . DG  C 13  ? 0.3333 0.4389 0.5240 0.0472  -0.0097 -0.0943 13   DG  C O6    
2710 N  N1    . DG  C 13  ? 0.3307 0.4007 0.4019 -0.0238 -0.0245 -0.0357 13   DG  C N1    
2711 C  C2    . DG  C 13  ? 0.3805 0.4147 0.2924 -0.0390 -0.0566 0.0011  13   DG  C C2    
2712 N  N2    . DG  C 13  ? 0.4341 0.4102 0.4286 -0.0025 0.0159  -0.0457 13   DG  C N2    
2713 N  N3    . DG  C 13  ? 0.3703 0.3195 0.2993 0.0028  -0.0141 -0.0296 13   DG  C N3    
2714 C  C4    . DG  C 13  ? 0.3973 0.3576 0.3783 0.0179  -0.0201 -0.0404 13   DG  C C4    
2715 P  P     . DA  C 14  ? 0.2769 0.3504 0.3131 0.0096  -0.0086 -0.0037 14   DA  C P     
2716 O  OP1   . DA  C 14  ? 0.2596 0.3663 0.3169 0.0451  -0.0112 -0.0081 14   DA  C OP1   
2717 O  OP2   . DA  C 14  ? 0.2430 0.3502 0.3136 0.0401  -0.0038 -0.0202 14   DA  C OP2   
2718 O  "O5'" . DA  C 14  ? 0.2772 0.2962 0.3379 0.0034  -0.0549 -0.0093 14   DA  C "O5'" 
2719 C  "C5'" . DA  C 14  ? 0.2371 0.3392 0.2755 0.0989  0.0183  0.0304  14   DA  C "C5'" 
2720 C  "C4'" . DA  C 14  ? 0.2781 0.2948 0.3618 0.0288  -0.0163 0.0427  14   DA  C "C4'" 
2721 O  "O4'" . DA  C 14  ? 0.3413 0.3532 0.3224 -0.0287 -0.0232 -0.0329 14   DA  C "O4'" 
2722 C  "C3'" . DA  C 14  ? 0.3670 0.2525 0.3426 -0.0073 -0.0273 0.0037  14   DA  C "C3'" 
2723 O  "O3'" . DA  C 14  ? 0.2906 0.3125 0.3530 -0.0498 -0.0231 -0.0229 14   DA  C "O3'" 
2724 C  "C2'" . DA  C 14  ? 0.2587 0.2724 0.3455 0.0297  -0.0563 0.0040  14   DA  C "C2'" 
2725 C  "C1'" . DA  C 14  ? 0.3155 0.2987 0.3580 -0.0208 -0.0034 -0.0030 14   DA  C "C1'" 
2726 N  N9    . DA  C 14  ? 0.3385 0.3611 0.3461 0.0221  -0.0089 -0.0024 14   DA  C N9    
2727 C  C8    . DA  C 14  ? 0.3187 0.4431 0.3840 0.0256  0.0142  -0.0209 14   DA  C C8    
2728 N  N7    . DA  C 14  ? 0.3161 0.4293 0.3046 0.0139  0.0182  -0.0501 14   DA  C N7    
2729 C  C5    . DA  C 14  ? 0.4096 0.3096 0.4174 0.0353  -0.0118 -0.0077 14   DA  C C5    
2730 C  C6    . DA  C 14  ? 0.3656 0.4020 0.3698 -0.0059 -0.0107 -0.0288 14   DA  C C6    
2731 N  N6    . DA  C 14  ? 0.3716 0.3949 0.3407 -0.0050 -0.0001 -0.0461 14   DA  C N6    
2732 N  N1    . DA  C 14  ? 0.3149 0.3999 0.3393 0.0228  -0.0182 -0.0333 14   DA  C N1    
2733 C  C2    . DA  C 14  ? 0.3618 0.4393 0.3996 -0.0305 0.0405  -0.0485 14   DA  C C2    
2734 N  N3    . DA  C 14  ? 0.2845 0.4734 0.3966 0.0224  -0.0434 -0.0396 14   DA  C N3    
2735 C  C4    . DA  C 14  ? 0.3064 0.3724 0.3696 -0.0151 -0.0258 -0.0141 14   DA  C C4    
2736 P  P     . DA  C 15  ? 0.3330 0.3556 0.3706 0.0065  -0.0019 0.0149  15   DA  C P     
2737 O  OP1   . DA  C 15  ? 0.3082 0.3475 0.3205 0.0047  -0.0054 -0.0120 15   DA  C OP1   
2738 O  OP2   . DA  C 15  ? 0.2490 0.3378 0.2967 0.0093  0.0229  -0.0043 15   DA  C OP2   
2739 O  "O5'" . DA  C 15  ? 0.3384 0.3056 0.3800 -0.0801 -0.0680 -0.0235 15   DA  C "O5'" 
2740 C  "C5'" . DA  C 15  ? 0.3236 0.4017 0.4243 0.0323  -0.0298 0.0456  15   DA  C "C5'" 
2741 C  "C4'" . DA  C 15  ? 0.3927 0.2883 0.4535 -0.0158 -0.0343 -0.0357 15   DA  C "C4'" 
2742 O  "O4'" . DA  C 15  ? 0.4110 0.2815 0.4270 0.0240  0.0687  -0.1101 15   DA  C "O4'" 
2743 C  "C3'" . DA  C 15  ? 0.4201 0.3615 0.4088 0.0126  0.0121  -0.0529 15   DA  C "C3'" 
2744 O  "O3'" . DA  C 15  ? 0.3115 0.3678 0.3449 -0.0340 0.0183  0.0096  15   DA  C "O3'" 
2745 C  "C2'" . DA  C 15  ? 0.2240 0.3101 0.3423 0.0874  0.0251  -0.0440 15   DA  C "C2'" 
2746 C  "C1'" . DA  C 15  ? 0.3403 0.3452 0.4188 -0.0102 0.0035  -0.0759 15   DA  C "C1'" 
2747 N  N9    . DA  C 15  ? 0.3987 0.3954 0.4093 0.0270  0.0341  0.0033  15   DA  C N9    
2748 C  C8    . DA  C 15  ? 0.4103 0.3843 0.4136 -0.0211 0.0206  -0.0530 15   DA  C C8    
2749 N  N7    . DA  C 15  ? 0.4252 0.3337 0.3580 -0.0161 0.0354  -0.0193 15   DA  C N7    
2750 C  C5    . DA  C 15  ? 0.3493 0.3621 0.3862 -0.0217 0.0825  -0.0618 15   DA  C C5    
2751 C  C6    . DA  C 15  ? 0.4315 0.4632 0.3627 -0.0170 -0.0024 -0.0104 15   DA  C C6    
2752 N  N6    . DA  C 15  ? 0.3036 0.3735 0.3675 0.0122  -0.0186 -0.0284 15   DA  C N6    
2753 N  N1    . DA  C 15  ? 0.3332 0.3678 0.3817 0.0001  0.0096  -0.0132 15   DA  C N1    
2754 C  C2    . DA  C 15  ? 0.3537 0.3937 0.3940 0.0207  0.0159  -0.0567 15   DA  C C2    
2755 N  N3    . DA  C 15  ? 0.2993 0.3454 0.4046 -0.0374 -0.0131 -0.0464 15   DA  C N3    
2756 C  C4    . DA  C 15  ? 0.3811 0.3440 0.3453 0.0141  0.0394  -0.0300 15   DA  C C4    
2757 P  P     . DG  C 16  ? 0.3649 0.3528 0.3855 -0.0169 0.0064  0.0232  16   DG  C P     
2758 O  OP1   . DG  C 16  ? 0.3362 0.3224 0.3290 -0.0390 0.0064  -0.0221 16   DG  C OP1   
2759 O  OP2   . DG  C 16  ? 0.3894 0.3531 0.3933 0.0143  0.0047  -0.0439 16   DG  C OP2   
2760 O  "O5'" . DG  C 16  ? 0.3960 0.3200 0.3710 -0.0041 0.0174  -0.0386 16   DG  C "O5'" 
2761 C  "C5'" . DG  C 16  ? 0.4483 0.3863 0.3686 -0.0073 0.0021  -0.0394 16   DG  C "C5'" 
2762 C  "C4'" . DG  C 16  ? 0.3546 0.3059 0.3239 0.0387  -0.0206 -0.0088 16   DG  C "C4'" 
2763 O  "O4'" . DG  C 16  ? 0.3217 0.3263 0.3480 0.0202  0.0126  -0.0231 16   DG  C "O4'" 
2764 C  "C3'" . DG  C 16  ? 0.4282 0.2968 0.2523 0.0477  0.0696  -0.0303 16   DG  C "C3'" 
2765 O  "O3'" . DG  C 16  ? 0.4662 0.3986 0.3656 0.0155  0.0502  -0.0082 16   DG  C "O3'" 
2766 C  "C2'" . DG  C 16  ? 0.3216 0.4046 0.3123 0.0078  0.0737  0.0189  16   DG  C "C2'" 
2767 C  "C1'" . DG  C 16  ? 0.4009 0.3447 0.3655 0.0541  0.0189  -0.0264 16   DG  C "C1'" 
2768 N  N9    . DG  C 16  ? 0.3899 0.3915 0.3327 0.0238  0.0357  -0.0296 16   DG  C N9    
2769 C  C8    . DG  C 16  ? 0.3449 0.3572 0.4111 -0.0027 0.0473  -0.0243 16   DG  C C8    
2770 N  N7    . DG  C 16  ? 0.3674 0.3545 0.3720 -0.0337 0.0157  -0.0293 16   DG  C N7    
2771 C  C5    . DG  C 16  ? 0.4277 0.4005 0.4208 0.0040  0.0055  -0.0214 16   DG  C C5    
2772 C  C6    . DG  C 16  ? 0.4386 0.3525 0.4336 0.0337  0.0064  -0.0009 16   DG  C C6    
2773 O  O6    . DG  C 16  ? 0.4247 0.4351 0.4297 0.0321  0.0301  -0.0233 16   DG  C O6    
2774 N  N1    . DG  C 16  ? 0.3948 0.4010 0.3358 -0.0041 -0.0153 -0.0379 16   DG  C N1    
2775 C  C2    . DG  C 16  ? 0.3122 0.3961 0.4230 0.0024  0.0566  -0.0216 16   DG  C C2    
2776 N  N2    . DG  C 16  ? 0.4021 0.4939 0.5056 0.0006  -0.0212 -0.0524 16   DG  C N2    
2777 N  N3    . DG  C 16  ? 0.3489 0.4350 0.4023 -0.0013 0.0201  -0.0039 16   DG  C N3    
2778 C  C4    . DG  C 16  ? 0.4388 0.4189 0.3606 -0.0411 0.0100  -0.0415 16   DG  C C4    
2779 P  P     . DG  C 17  ? 0.4208 0.4061 0.4465 -0.0150 0.0400  -0.0187 17   DG  C P     
2780 O  OP1   . DG  C 17  ? 0.4262 0.4272 0.3707 -0.0078 0.0312  -0.0509 17   DG  C OP1   
2781 O  OP2   . DG  C 17  ? 0.4580 0.3640 0.3828 0.0272  -0.0220 -0.0654 17   DG  C OP2   
2782 O  "O5'" . DG  C 17  ? 0.4002 0.4727 0.4172 0.0103  0.0017  -0.0036 17   DG  C "O5'" 
2783 C  "C5'" . DG  C 17  ? 0.3856 0.3565 0.4073 0.0202  -0.0274 -0.0128 17   DG  C "C5'" 
2784 C  "C4'" . DG  C 17  ? 0.3956 0.4119 0.3954 0.0110  -0.0376 0.0502  17   DG  C "C4'" 
2785 O  "O4'" . DG  C 17  ? 0.4633 0.4215 0.4666 0.0535  -0.0369 -0.0343 17   DG  C "O4'" 
2786 C  "C3'" . DG  C 17  ? 0.4447 0.4469 0.4458 0.0208  -0.0474 0.0080  17   DG  C "C3'" 
2787 O  "O3'" . DG  C 17  ? 0.5708 0.4532 0.4405 0.0203  0.0043  0.0035  17   DG  C "O3'" 
2788 C  "C2'" . DG  C 17  ? 0.3169 0.3085 0.3770 -0.0416 0.0340  -0.0455 17   DG  C "C2'" 
2789 C  "C1'" . DG  C 17  ? 0.4228 0.3550 0.4168 -0.0356 -0.0108 -0.0149 17   DG  C "C1'" 
2790 N  N9    . DG  C 17  ? 0.4605 0.2771 0.4472 -0.0229 -0.0444 -0.0456 17   DG  C N9    
2791 C  C8    . DG  C 17  ? 0.4257 0.3918 0.4207 0.0255  0.0037  -0.0569 17   DG  C C8    
2792 N  N7    . DG  C 17  ? 0.4062 0.4095 0.4028 0.0322  0.0120  -0.0628 17   DG  C N7    
2793 C  C5    . DG  C 17  ? 0.4324 0.3907 0.3954 0.0027  -0.0215 -0.0651 17   DG  C C5    
2794 C  C6    . DG  C 17  ? 0.4170 0.3931 0.3971 0.0146  0.0225  -0.0649 17   DG  C C6    
2795 O  O6    . DG  C 17  ? 0.4651 0.4759 0.4293 0.0243  0.0618  -0.0646 17   DG  C O6    
2796 N  N1    . DG  C 17  ? 0.3879 0.3365 0.4260 -0.0045 -0.0112 -0.0714 17   DG  C N1    
2797 C  C2    . DG  C 17  ? 0.3559 0.4192 0.4379 0.0253  -0.0284 -0.0238 17   DG  C C2    
2798 N  N2    . DG  C 17  ? 0.4702 0.4937 0.5204 -0.0246 0.0072  -0.0257 17   DG  C N2    
2799 N  N3    . DG  C 17  ? 0.4276 0.3413 0.3773 -0.0244 -0.0206 -0.1031 17   DG  C N3    
2800 C  C4    . DG  C 17  ? 0.4565 0.4281 0.4397 -0.0053 0.0076  -0.0623 17   DG  C C4    
2801 P  P     . DA  C 18  ? 0.4970 0.4431 0.4854 -0.0464 0.0327  -0.0107 18   DA  C P     
2802 O  OP1   . DA  C 18  ? 0.6347 0.1938 0.4697 -0.0178 0.0330  -0.0792 18   DA  C OP1   
2803 O  OP2   . DA  C 18  ? 0.4842 0.3918 0.4368 0.0104  -0.0128 -0.0847 18   DA  C OP2   
2804 O  "O5'" . DA  C 18  ? 0.5083 0.4972 0.4755 -0.0281 -0.0344 -0.0657 18   DA  C "O5'" 
2805 C  "C5'" . DA  C 18  ? 0.4800 0.4904 0.4630 0.0150  -0.0370 -0.0455 18   DA  C "C5'" 
2806 C  "C4'" . DA  C 18  ? 0.6313 0.5778 0.6293 0.0252  0.0070  -0.0342 18   DA  C "C4'" 
2807 O  "O4'" . DA  C 18  ? 0.5236 0.5697 0.5653 0.0256  0.0771  -0.0110 18   DA  C "O4'" 
2808 C  "C3'" . DA  C 18  ? 0.5972 0.6045 0.5630 -0.0312 -0.0177 -0.0682 18   DA  C "C3'" 
2809 O  "O3'" . DA  C 18  ? 0.6626 0.5189 0.6011 -0.0529 0.0038  -0.0519 18   DA  C "O3'" 
2810 C  "C2'" . DA  C 18  ? 0.6967 0.6144 0.5809 -0.0204 -0.0393 0.0030  18   DA  C "C2'" 
2811 C  "C1'" . DA  C 18  ? 0.5832 0.5373 0.5316 -0.0253 0.0063  -0.0114 18   DA  C "C1'" 
2812 N  N9    . DA  C 18  ? 0.5398 0.5657 0.4916 -0.0502 -0.0142 -0.0149 18   DA  C N9    
2813 C  C8    . DA  C 18  ? 0.4447 0.4706 0.5059 0.0102  0.0151  -0.0459 18   DA  C C8    
2814 N  N7    . DA  C 18  ? 0.5786 0.4117 0.4158 0.0240  0.0268  -0.0075 18   DA  C N7    
2815 C  C5    . DA  C 18  ? 0.5023 0.4468 0.4336 0.0318  -0.0012 -0.0762 18   DA  C C5    
2816 C  C6    . DA  C 18  ? 0.5349 0.4131 0.4818 0.0224  -0.0143 -0.0642 18   DA  C C6    
2817 N  N6    . DA  C 18  ? 0.3652 0.4268 0.4881 0.0150  0.0034  -0.0977 18   DA  C N6    
2818 N  N1    . DA  C 18  ? 0.5498 0.4573 0.4842 0.0103  -0.0135 -0.0685 18   DA  C N1    
2819 C  C2    . DA  C 18  ? 0.5184 0.4860 0.4781 -0.0167 -0.0222 -0.0431 18   DA  C C2    
2820 N  N3    . DA  C 18  ? 0.5070 0.5007 0.5224 -0.0266 -0.0521 -0.0307 18   DA  C N3    
2821 C  C4    . DA  C 18  ? 0.5272 0.4697 0.4946 -0.0150 -0.0277 -0.0128 18   DA  C C4    
2822 P  P     . DT  C 19  ? 0.6205 0.5581 0.5624 -0.0291 -0.0562 -0.1273 19   DT  C P     
2823 O  OP1   . DT  C 19  ? 0.7066 0.6729 0.6093 -0.0280 0.0666  -0.0936 19   DT  C OP1   
2824 O  OP2   . DT  C 19  ? 0.6452 0.6206 0.5844 0.0208  -0.0420 -0.0948 19   DT  C OP2   
2825 O  "O5'" . DT  C 19  ? 0.6646 0.6072 0.5689 0.0110  0.0015  -0.1048 19   DT  C "O5'" 
2826 C  "C5'" . DT  C 19  ? 0.7075 0.6834 0.6030 0.0241  -0.0094 -0.0385 19   DT  C "C5'" 
2827 C  "C4'" . DT  C 19  ? 0.7121 0.6998 0.6237 -0.0205 0.0309  -0.0454 19   DT  C "C4'" 
2828 O  "O4'" . DT  C 19  ? 0.6830 0.6283 0.5047 0.0320  0.0202  -0.1375 19   DT  C "O4'" 
2829 C  "C3'" . DT  C 19  ? 0.7596 0.7078 0.6686 -0.0290 -0.0263 -0.0538 19   DT  C "C3'" 
2830 O  "O3'" . DT  C 19  ? 0.8040 0.6994 0.7262 -0.0447 -0.0550 -0.0831 19   DT  C "O3'" 
2831 C  "C2'" . DT  C 19  ? 0.7016 0.7633 0.6786 -0.0100 0.0060  -0.0433 19   DT  C "C2'" 
2832 C  "C1'" . DT  C 19  ? 0.6499 0.6171 0.6524 0.0287  0.0209  -0.0653 19   DT  C "C1'" 
2833 N  N1    . DT  C 19  ? 0.6613 0.5936 0.6110 0.0183  0.0109  -0.0576 19   DT  C N1    
2834 C  C2    . DT  C 19  ? 0.6431 0.5241 0.5783 0.0174  -0.0059 -0.0618 19   DT  C C2    
2835 O  O2    . DT  C 19  ? 0.7266 0.5579 0.5888 0.0767  0.0153  -0.0707 19   DT  C O2    
2836 N  N3    . DT  C 19  ? 0.5728 0.4584 0.5067 0.0375  -0.0344 -0.0850 19   DT  C N3    
2837 C  C4    . DT  C 19  ? 0.6220 0.5245 0.5949 0.0404  -0.0004 -0.0339 19   DT  C C4    
2838 O  O4    . DT  C 19  ? 0.6868 0.4840 0.6831 0.0112  0.0281  -0.1018 19   DT  C O4    
2839 C  C5    . DT  C 19  ? 0.6007 0.5181 0.6286 0.0134  -0.0102 -0.0531 19   DT  C C5    
2840 C  C7    . DT  C 19  ? 0.6810 0.5407 0.6453 0.0215  -0.0049 -0.0690 19   DT  C C7    
2841 C  C6    . DT  C 19  ? 0.6196 0.5781 0.5714 0.0456  -0.0059 -0.0815 19   DT  C C6    
2842 P  P     . DC  C 20  ? 0.8791 0.8180 0.6902 -0.0412 -0.0735 -0.0648 20   DC  C P     
2843 O  OP1   . DC  C 20  ? 0.8584 0.8451 0.8034 -0.0287 -0.0389 -0.0421 20   DC  C OP1   
2844 O  OP2   . DC  C 20  ? 0.7746 0.6987 0.7801 -0.0229 -0.0367 -0.0427 20   DC  C OP2   
2845 O  "O5'" . DC  C 20  ? 0.7974 0.6984 0.5686 -0.0624 -0.0713 -0.0455 20   DC  C "O5'" 
2846 C  "C5'" . DC  C 20  ? 0.7971 0.7634 0.6632 -0.0587 -0.0441 -0.0340 20   DC  C "C5'" 
2847 C  "C4'" . DC  C 20  ? 0.7931 0.8249 0.7165 -0.0527 -0.0166 -0.0262 20   DC  C "C4'" 
2848 O  "O4'" . DC  C 20  ? 0.7517 0.7966 0.6899 -0.0086 -0.0020 -0.0702 20   DC  C "O4'" 
2849 C  "C3'" . DC  C 20  ? 0.7638 0.7845 0.7268 -0.0559 0.0123  -0.0213 20   DC  C "C3'" 
2850 O  "O3'" . DC  C 20  ? 0.8676 0.8690 0.7982 -0.0121 -0.0200 0.0017  20   DC  C "O3'" 
2851 C  "C2'" . DC  C 20  ? 0.7401 0.7320 0.6556 0.0068  -0.0205 -0.0275 20   DC  C "C2'" 
2852 C  "C1'" . DC  C 20  ? 0.6697 0.6807 0.6602 0.0264  -0.0465 -0.0345 20   DC  C "C1'" 
2853 N  N1    . DC  C 20  ? 0.6523 0.5675 0.5532 0.0456  -0.0034 -0.0612 20   DC  C N1    
2854 C  C2    . DC  C 20  ? 0.6766 0.5930 0.5131 0.0050  -0.0001 -0.0629 20   DC  C C2    
2855 O  O2    . DC  C 20  ? 0.7582 0.5826 0.6228 0.0169  -0.0447 -0.0235 20   DC  C O2    
2856 N  N3    . DC  C 20  ? 0.7030 0.4544 0.4083 0.0681  -0.0473 -0.0775 20   DC  C N3    
2857 C  C4    . DC  C 20  ? 0.6404 0.5401 0.5872 0.0252  0.0183  -0.0532 20   DC  C C4    
2858 N  N4    . DC  C 20  ? 0.5858 0.4933 0.5739 0.0754  0.0249  -0.0727 20   DC  C N4    
2859 C  C5    . DC  C 20  ? 0.6660 0.6110 0.6000 0.0307  -0.0151 -0.0320 20   DC  C C5    
2860 C  C6    . DC  C 20  ? 0.7041 0.6036 0.5363 0.0620  -0.0163 -0.0415 20   DC  C C6    
2861 P  P     . DC  C 21  ? 0.9462 0.9475 0.8549 -0.0488 -0.0672 0.0061  21   DC  C P     
2862 O  OP1   . DC  C 21  ? 0.9237 0.8978 0.8813 -0.0248 -0.0399 0.0014  21   DC  C OP1   
2863 O  OP2   . DC  C 21  ? 0.9943 0.9232 0.8921 -0.0212 -0.0260 -0.0027 21   DC  C OP2   
2864 O  "O5'" . DC  C 21  ? 0.8938 0.9339 0.8039 -0.0449 -0.0330 0.0106  21   DC  C "O5'" 
2865 C  "C5'" . DC  C 21  ? 0.8185 0.9080 0.7565 0.0081  -0.0239 0.0117  21   DC  C "C5'" 
2866 C  "C4'" . DC  C 21  ? 0.8234 0.8992 0.7978 0.0079  -0.0336 -0.0046 21   DC  C "C4'" 
2867 O  "O4'" . DC  C 21  ? 0.7880 0.7980 0.7565 0.0024  -0.0658 -0.0631 21   DC  C "O4'" 
2868 C  "C3'" . DC  C 21  ? 0.8244 0.8484 0.7454 0.0133  -0.0367 -0.0173 21   DC  C "C3'" 
2869 O  "O3'" . DC  C 21  ? 0.9197 0.9678 0.7792 -0.0010 -0.0362 0.0021  21   DC  C "O3'" 
2870 C  "C2'" . DC  C 21  ? 0.7855 0.7041 0.6434 0.0274  -0.0053 -0.0511 21   DC  C "C2'" 
2871 C  "C1'" . DC  C 21  ? 0.7071 0.6646 0.6810 0.0158  -0.0418 -0.0367 21   DC  C "C1'" 
2872 N  N1    . DC  C 21  ? 0.6826 0.5531 0.6101 0.0155  0.0171  -0.0522 21   DC  C N1    
2873 C  C2    . DC  C 21  ? 0.6776 0.5658 0.5988 -0.0037 -0.0007 -0.0524 21   DC  C C2    
2874 O  O2    . DC  C 21  ? 0.6604 0.6111 0.4967 -0.0533 0.0541  -0.0242 21   DC  C O2    
2875 N  N3    . DC  C 21  ? 0.6337 0.4223 0.5091 0.0272  0.0051  -0.0907 21   DC  C N3    
2876 C  C4    . DC  C 21  ? 0.6095 0.5064 0.5729 0.0218  0.0314  -0.0765 21   DC  C C4    
2877 N  N4    . DC  C 21  ? 0.6813 0.5384 0.5713 0.0223  0.0463  -0.0611 21   DC  C N4    
2878 C  C5    . DC  C 21  ? 0.7067 0.5722 0.5779 0.0056  0.0203  -0.0536 21   DC  C C5    
2879 C  C6    . DC  C 21  ? 0.7208 0.5379 0.5937 0.0120  0.0074  -0.0848 21   DC  C C6    
2880 P  P     . DT  C 22  ? 0.9587 1.0090 0.8327 -0.0042 -0.0068 0.0360  22   DT  C P     
2881 O  OP1   . DT  C 22  ? 0.9387 0.9878 0.8253 -0.0191 -0.0263 0.0315  22   DT  C OP1   
2882 O  OP2   . DT  C 22  ? 0.9752 0.9264 0.8399 0.0078  -0.0081 0.0018  22   DT  C OP2   
2883 O  "O5'" . DT  C 22  ? 0.8845 0.9143 0.7882 0.0275  -0.0408 0.0549  22   DT  C "O5'" 
2884 C  "C5'" . DT  C 22  ? 0.8798 0.8594 0.7513 0.0239  -0.0251 0.0040  22   DT  C "C5'" 
2885 C  "C4'" . DT  C 22  ? 0.8880 0.8414 0.7824 0.0229  0.0015  0.0111  22   DT  C "C4'" 
2886 O  "O4'" . DT  C 22  ? 0.8432 0.7678 0.6889 -0.0095 -0.0188 -0.0427 22   DT  C "O4'" 
2887 C  "C3'" . DT  C 22  ? 0.9004 0.8454 0.7617 0.0074  -0.0032 0.0075  22   DT  C "C3'" 
2888 O  "O3'" . DT  C 22  ? 0.9661 0.8784 0.8247 0.0085  0.0552  0.0194  22   DT  C "O3'" 
2889 C  "C2'" . DT  C 22  ? 0.8340 0.7602 0.7512 0.0099  -0.0046 -0.0309 22   DT  C "C2'" 
2890 C  "C1'" . DT  C 22  ? 0.8156 0.7055 0.6739 0.0142  0.0052  0.0009  22   DT  C "C1'" 
2891 N  N1    . DT  C 22  ? 0.7391 0.6657 0.6441 0.0326  0.0364  -0.0539 22   DT  C N1    
2892 C  C2    . DT  C 22  ? 0.6952 0.6534 0.6197 0.0238  0.0449  -0.0312 22   DT  C C2    
2893 O  O2    . DT  C 22  ? 0.7159 0.6195 0.5973 0.0133  0.0557  -0.1290 22   DT  C O2    
2894 N  N3    . DT  C 22  ? 0.7309 0.6269 0.6329 0.0156  0.0564  -0.0883 22   DT  C N3    
2895 C  C4    . DT  C 22  ? 0.7780 0.6084 0.6106 0.0009  0.0058  -0.0643 22   DT  C C4    
2896 O  O4    . DT  C 22  ? 0.8255 0.6704 0.6309 0.0147  0.0273  -0.0774 22   DT  C O4    
2897 C  C5    . DT  C 22  ? 0.7253 0.6290 0.6410 0.0055  0.0269  -0.0397 22   DT  C C5    
2898 C  C7    . DT  C 22  ? 0.7201 0.6687 0.6150 0.0193  0.0272  -0.0567 22   DT  C C7    
2899 C  C6    . DT  C 22  ? 0.7373 0.5144 0.6414 0.0317  -0.0080 -0.0496 22   DT  C C6    
2900 P  P     . DA  C 23  ? 1.0196 0.9312 0.7821 0.0441  0.0240  -0.0097 23   DA  C P     
2901 O  OP1   . DA  C 23  ? 0.9648 0.9171 0.8674 0.0292  0.0367  0.0411  23   DA  C OP1   
2902 O  OP2   . DA  C 23  ? 1.0316 0.8426 0.8009 0.0160  0.0088  0.0652  23   DA  C OP2   
2903 O  "O5'" . DA  C 23  ? 0.9199 0.8657 0.7468 0.0047  0.0605  0.0353  23   DA  C "O5'" 
2904 C  "C5'" . DA  C 23  ? 0.9266 0.8745 0.8641 0.0224  0.0231  0.0133  23   DA  C "C5'" 
2905 C  "C4'" . DA  C 23  ? 0.9265 0.8870 0.8758 0.0349  0.0098  0.0172  23   DA  C "C4'" 
2906 O  "O4'" . DA  C 23  ? 0.9213 0.8648 0.9036 0.0340  -0.0132 0.0272  23   DA  C "O4'" 
2907 C  "C3'" . DA  C 23  ? 1.0026 0.9189 0.9454 0.0408  0.0044  0.0293  23   DA  C "C3'" 
2908 O  "O3'" . DA  C 23  ? 0.9912 0.9649 0.9964 0.0294  0.0146  0.0217  23   DA  C "O3'" 
2909 C  "C2'" . DA  C 23  ? 0.9666 0.8468 0.8665 0.0277  0.0260  0.0001  23   DA  C "C2'" 
2910 C  "C1'" . DA  C 23  ? 0.7440 0.6791 0.7482 0.0185  0.0424  -0.0088 23   DA  C "C1'" 
2911 N  N9    . DA  C 23  ? 0.7103 0.5520 0.6623 0.0473  0.0111  -0.0485 23   DA  C N9    
2912 C  C8    . DA  C 23  ? 0.7255 0.5627 0.6415 0.0290  0.0429  -0.0660 23   DA  C C8    
2913 N  N7    . DA  C 23  ? 0.6852 0.4929 0.6602 0.0663  0.0522  -0.0742 23   DA  C N7    
2914 C  C5    . DA  C 23  ? 0.6944 0.5135 0.6050 0.0173  0.0176  -0.0633 23   DA  C C5    
2915 C  C6    . DA  C 23  ? 0.7001 0.5620 0.6217 0.0134  0.0147  -0.0719 23   DA  C C6    
2916 N  N6    . DA  C 23  ? 0.6416 0.6154 0.5987 0.0296  0.0217  -0.0742 23   DA  C N6    
2917 N  N1    . DA  C 23  ? 0.6696 0.5306 0.6444 0.0446  0.0343  -0.0558 23   DA  C N1    
2918 C  C2    . DA  C 23  ? 0.6706 0.5236 0.6632 0.0716  0.0718  -0.0674 23   DA  C C2    
2919 N  N3    . DA  C 23  ? 0.6147 0.4658 0.5897 0.0574  0.0356  -0.0630 23   DA  C N3    
2920 C  C4    . DA  C 23  ? 0.6556 0.5093 0.6157 0.0538  0.0229  -0.0462 23   DA  C C4    
2921 P  P     . DA  C 24  ? 0.9791 0.9217 1.0091 0.0763  0.0559  0.0252  24   DA  C P     
2922 O  OP1   . DA  C 24  ? 1.0964 0.8093 1.0043 0.0297  -0.0112 -0.0147 24   DA  C OP1   
2923 O  OP2   . DA  C 24  ? 1.0207 0.9685 1.0211 0.0324  0.0385  0.0360  24   DA  C OP2   
2924 O  "O5'" . DA  C 24  ? 0.8768 0.7250 0.8229 0.0646  0.0269  -0.0102 24   DA  C "O5'" 
2925 C  "C5'" . DA  C 24  ? 0.7797 0.6603 0.7686 0.0662  0.0439  -0.0256 24   DA  C "C5'" 
2926 C  "C4'" . DA  C 24  ? 0.7245 0.6628 0.7216 -0.0109 0.0453  -0.0120 24   DA  C "C4'" 
2927 O  "O4'" . DA  C 24  ? 0.6479 0.6490 0.6760 0.0309  0.0523  -0.0155 24   DA  C "O4'" 
2928 C  "C3'" . DA  C 24  ? 0.6961 0.5941 0.7018 0.0321  0.0437  -0.0352 24   DA  C "C3'" 
2929 O  "O3'" . DA  C 24  ? 0.7385 0.7108 0.6823 0.0586  0.0392  0.0378  24   DA  C "O3'" 
2930 C  "C2'" . DA  C 24  ? 0.7064 0.5965 0.6020 0.0022  0.0528  -0.0350 24   DA  C "C2'" 
2931 C  "C1'" . DA  C 24  ? 0.6244 0.5106 0.6089 -0.0170 0.0613  -0.0528 24   DA  C "C1'" 
2932 N  N9    . DA  C 24  ? 0.5992 0.4644 0.5558 0.0085  0.0044  -0.0708 24   DA  C N9    
2933 C  C8    . DA  C 24  ? 0.6502 0.4330 0.5809 0.0140  -0.0111 -0.0164 24   DA  C C8    
2934 N  N7    . DA  C 24  ? 0.6978 0.5186 0.6016 -0.0075 0.0019  0.0079  24   DA  C N7    
2935 C  C5    . DA  C 24  ? 0.6528 0.4842 0.5121 -0.0336 -0.0055 -0.0397 24   DA  C C5    
2936 C  C6    . DA  C 24  ? 0.5500 0.5018 0.5225 0.0023  0.0536  -0.0614 24   DA  C C6    
2937 N  N6    . DA  C 24  ? 0.5891 0.4417 0.5275 0.0256  -0.0163 -0.0992 24   DA  C N6    
2938 N  N1    . DA  C 24  ? 0.5205 0.4487 0.4619 0.0178  0.0136  -0.0475 24   DA  C N1    
2939 C  C2    . DA  C 24  ? 0.5792 0.4625 0.5402 0.0030  0.0568  -0.0736 24   DA  C C2    
2940 N  N3    . DA  C 24  ? 0.6118 0.3191 0.4977 0.0031  0.0181  -0.0625 24   DA  C N3    
2941 C  C4    . DA  C 24  ? 0.6156 0.4856 0.5458 0.0013  0.0090  -0.0202 24   DA  C C4    
2942 O  "O5'" . DT  D 1   ? 0.9247 0.6187 0.6559 0.0190  -0.0110 -0.0528 1    DT  E "O5'" 
2943 C  "C5'" . DT  D 1   ? 0.7110 0.4672 0.3421 -0.1040 0.0040  -0.0263 1    DT  E "C5'" 
2944 C  "C4'" . DT  D 1   ? 0.6772 0.5476 0.4747 -0.0179 0.0186  -0.0070 1    DT  E "C4'" 
2945 O  "O4'" . DT  D 1   ? 0.6927 0.5309 0.4241 -0.0494 0.0983  -0.0111 1    DT  E "O4'" 
2946 C  "C3'" . DT  D 1   ? 0.6283 0.4932 0.4756 -0.0074 -0.0237 -0.0189 1    DT  E "C3'" 
2947 O  "O3'" . DT  D 1   ? 0.5946 0.5439 0.5340 0.0389  -0.0026 0.0226  1    DT  E "O3'" 
2948 C  "C2'" . DT  D 1   ? 0.6933 0.4916 0.5129 0.0201  -0.0022 -0.0305 1    DT  E "C2'" 
2949 C  "C1'" . DT  D 1   ? 0.6251 0.4508 0.4282 0.0211  0.0159  0.0115  1    DT  E "C1'" 
2950 N  N1    . DT  D 1   ? 0.4936 0.4214 0.4662 0.0151  0.0268  -0.0563 1    DT  E N1    
2951 C  C2    . DT  D 1   ? 0.5419 0.5043 0.4073 0.0182  -0.0040 -0.0218 1    DT  E C2    
2952 O  O2    . DT  D 1   ? 0.5554 0.5022 0.4373 -0.0352 0.0468  -0.0534 1    DT  E O2    
2953 N  N3    . DT  D 1   ? 0.4835 0.4231 0.4986 0.0218  0.0639  -0.0412 1    DT  E N3    
2954 C  C4    . DT  D 1   ? 0.5630 0.4787 0.4816 0.0233  0.0047  -0.0381 1    DT  E C4    
2955 O  O4    . DT  D 1   ? 0.6092 0.5018 0.5206 0.0531  -0.0287 -0.0241 1    DT  E O4    
2956 C  C5    . DT  D 1   ? 0.5736 0.5091 0.4894 -0.0033 0.0171  -0.0251 1    DT  E C5    
2957 C  C7    . DT  D 1   ? 0.5509 0.4868 0.4891 0.0137  0.0109  -0.0266 1    DT  E C7    
2958 C  C6    . DT  D 1   ? 0.4770 0.4791 0.4342 0.0350  0.0597  -0.0510 1    DT  E C6    
2959 P  P     . DT  D 2   ? 0.5717 0.5574 0.5719 -0.0043 -0.0209 0.0146  2    DT  E P     
2960 O  OP1   . DT  D 2   ? 0.6265 0.5015 0.5509 0.1248  0.0519  0.0309  2    DT  E OP1   
2961 O  OP2   . DT  D 2   ? 0.5613 0.4609 0.5086 -0.0758 -0.0715 -0.0309 2    DT  E OP2   
2962 O  "O5'" . DT  D 2   ? 0.6108 0.4947 0.6242 0.0151  0.0391  -0.0150 2    DT  E "O5'" 
2963 C  "C5'" . DT  D 2   ? 0.6048 0.5472 0.5925 -0.0017 0.0017  0.0145  2    DT  E "C5'" 
2964 C  "C4'" . DT  D 2   ? 0.6436 0.5106 0.5119 0.0432  -0.0027 -0.0452 2    DT  E "C4'" 
2965 O  "O4'" . DT  D 2   ? 0.5892 0.5151 0.5281 0.0293  0.0348  -0.0513 2    DT  E "O4'" 
2966 C  "C3'" . DT  D 2   ? 0.6814 0.5245 0.6108 0.0405  -0.0097 -0.0478 2    DT  E "C3'" 
2967 O  "O3'" . DT  D 2   ? 0.7823 0.5686 0.7300 0.0183  -0.0246 -0.0467 2    DT  E "O3'" 
2968 C  "C2'" . DT  D 2   ? 0.5961 0.5479 0.5121 0.0378  -0.0109 -0.0990 2    DT  E "C2'" 
2969 C  "C1'" . DT  D 2   ? 0.5890 0.4721 0.5237 0.0213  0.0191  -0.0604 2    DT  E "C1'" 
2970 N  N1    . DT  D 2   ? 0.5739 0.4633 0.5072 0.0236  0.0416  -0.0247 2    DT  E N1    
2971 C  C2    . DT  D 2   ? 0.5346 0.4023 0.4868 -0.0061 0.0445  -0.1027 2    DT  E C2    
2972 O  O2    . DT  D 2   ? 0.6377 0.5563 0.4580 -0.0614 0.0939  -0.1247 2    DT  E O2    
2973 N  N3    . DT  D 2   ? 0.5618 0.4679 0.4675 0.0167  -0.0110 -0.0823 2    DT  E N3    
2974 C  C4    . DT  D 2   ? 0.5375 0.4736 0.5432 0.0081  0.0635  -0.0633 2    DT  E C4    
2975 O  O4    . DT  D 2   ? 0.5853 0.5453 0.5877 0.0026  0.0431  -0.0621 2    DT  E O4    
2976 C  C5    . DT  D 2   ? 0.5100 0.5016 0.4912 0.0018  0.0169  -0.0606 2    DT  E C5    
2977 C  C7    . DT  D 2   ? 0.5968 0.3360 0.4833 -0.0250 0.0363  -0.0744 2    DT  E C7    
2978 C  C6    . DT  D 2   ? 0.5059 0.4373 0.5092 0.0729  0.0610  -0.1132 2    DT  E C6    
2979 P  P     . DA  D 3   ? 0.8520 0.7146 0.8138 -0.0457 -0.0465 -0.0175 3    DA  E P     
2980 O  OP1   . DA  D 3   ? 0.9150 0.7513 0.9311 0.0426  -0.0874 -0.0050 3    DA  E OP1   
2981 O  OP2   . DA  D 3   ? 0.9107 0.5997 0.6615 -0.0538 -0.0009 -0.0348 3    DA  E OP2   
2982 O  "O5'" . DA  D 3   ? 0.7873 0.5475 0.6636 0.0524  0.0157  -0.0487 3    DA  E "O5'" 
2983 C  "C5'" . DA  D 3   ? 0.7163 0.6106 0.6330 0.0051  0.0248  -0.0254 3    DA  E "C5'" 
2984 C  "C4'" . DA  D 3   ? 0.6957 0.6486 0.6368 0.0062  0.0061  -0.0455 3    DA  E "C4'" 
2985 O  "O4'" . DA  D 3   ? 0.6434 0.6544 0.6660 0.0179  0.0698  -0.0374 3    DA  E "O4'" 
2986 C  "C3'" . DA  D 3   ? 0.6938 0.5734 0.6813 0.0039  0.0097  -0.0560 3    DA  E "C3'" 
2987 O  "O3'" . DA  D 3   ? 0.7868 0.6279 0.7274 0.0063  -0.0042 -0.0527 3    DA  E "O3'" 
2988 C  "C2'" . DA  D 3   ? 0.6483 0.5681 0.6288 0.0169  0.0348  -0.0770 3    DA  E "C2'" 
2989 C  "C1'" . DA  D 3   ? 0.6302 0.5276 0.6233 0.0307  0.0564  -0.0666 3    DA  E "C1'" 
2990 N  N9    . DA  D 3   ? 0.5810 0.5058 0.5002 0.0557  0.0747  -0.0921 3    DA  E N9    
2991 C  C8    . DA  D 3   ? 0.5987 0.5331 0.6485 0.0373  0.0450  -0.0550 3    DA  E C8    
2992 N  N7    . DA  D 3   ? 0.5869 0.4379 0.5990 0.1006  0.0681  -0.0998 3    DA  E N7    
2993 C  C5    . DA  D 3   ? 0.5912 0.4770 0.5315 0.0618  0.0560  -0.0905 3    DA  E C5    
2994 C  C6    . DA  D 3   ? 0.6035 0.4517 0.5529 0.0580  0.0124  -0.0197 3    DA  E C6    
2995 N  N6    . DA  D 3   ? 0.6310 0.4408 0.5826 0.0393  0.0339  -0.0475 3    DA  E N6    
2996 N  N1    . DA  D 3   ? 0.6657 0.5323 0.5942 0.0415  0.0931  -0.0618 3    DA  E N1    
2997 C  C2    . DA  D 3   ? 0.5750 0.4815 0.6316 0.0329  0.0560  -0.0706 3    DA  E C2    
2998 N  N3    . DA  D 3   ? 0.6737 0.4342 0.5311 0.0595  0.0472  -0.0556 3    DA  E N3    
2999 C  C4    . DA  D 3   ? 0.6075 0.4243 0.5233 0.1009  0.0834  -0.0676 3    DA  E C4    
3000 P  P     . DG  D 4   ? 0.8059 0.5937 0.7110 0.0219  -0.0084 -0.0508 4    DG  E P     
3001 O  OP1   . DG  D 4   ? 0.7222 0.5995 0.7446 0.0199  0.0119  0.0120  4    DG  E OP1   
3002 O  OP2   . DG  D 4   ? 0.7240 0.3436 0.6235 0.1742  0.0352  -0.0160 4    DG  E OP2   
3003 O  "O5'" . DG  D 4   ? 0.7171 0.4442 0.6199 0.0093  -0.0175 -0.0798 4    DG  E "O5'" 
3004 C  "C5'" . DG  D 4   ? 0.6576 0.5374 0.5611 0.0050  0.0092  -0.0213 4    DG  E "C5'" 
3005 C  "C4'" . DG  D 4   ? 0.6595 0.5743 0.6646 -0.0188 0.0081  -0.0363 4    DG  E "C4'" 
3006 O  "O4'" . DG  D 4   ? 0.7040 0.5465 0.6454 0.0096  0.0233  -0.1029 4    DG  E "O4'" 
3007 C  "C3'" . DG  D 4   ? 0.6624 0.6258 0.7565 0.0184  0.0209  -0.0179 4    DG  E "C3'" 
3008 O  "O3'" . DG  D 4   ? 0.7251 0.5914 0.7046 0.0713  0.0290  -0.0304 4    DG  E "O3'" 
3009 C  "C2'" . DG  D 4   ? 0.6853 0.5960 0.6853 0.0102  0.0390  -0.0059 4    DG  E "C2'" 
3010 C  "C1'" . DG  D 4   ? 0.5981 0.5488 0.6535 0.0123  0.0138  -0.0329 4    DG  E "C1'" 
3011 N  N9    . DG  D 4   ? 0.6155 0.5429 0.6445 0.0394  0.0108  -0.0491 4    DG  E N9    
3012 C  C8    . DG  D 4   ? 0.6088 0.4624 0.5959 0.0308  0.0084  -0.0602 4    DG  E C8    
3013 N  N7    . DG  D 4   ? 0.6641 0.5378 0.6350 0.0460  0.0036  -0.0471 4    DG  E N7    
3014 C  C5    . DG  D 4   ? 0.6114 0.5088 0.6149 0.0226  -0.0143 -0.0400 4    DG  E C5    
3015 C  C6    . DG  D 4   ? 0.6047 0.5627 0.5492 0.0153  0.0104  -0.0314 4    DG  E C6    
3016 O  O6    . DG  D 4   ? 0.6476 0.5540 0.5864 -0.0031 0.0684  -0.0897 4    DG  E O6    
3017 N  N1    . DG  D 4   ? 0.6056 0.4852 0.5744 0.0491  0.0094  -0.0639 4    DG  E N1    
3018 C  C2    . DG  D 4   ? 0.6303 0.5155 0.5474 0.0288  0.0147  -0.0829 4    DG  E C2    
3019 N  N2    . DG  D 4   ? 0.6381 0.5146 0.5736 0.0622  0.0223  -0.0939 4    DG  E N2    
3020 N  N3    . DG  D 4   ? 0.5497 0.5651 0.5730 0.0361  -0.0081 -0.0759 4    DG  E N3    
3021 C  C4    . DG  D 4   ? 0.6267 0.5736 0.6202 0.0070  -0.0013 -0.0196 4    DG  E C4    
3022 P  P     . DG  D 5   ? 0.7214 0.5610 0.6468 0.0468  -0.0229 -0.0277 5    DG  E P     
3023 O  OP1   . DG  D 5   ? 0.7631 0.4785 0.6234 -0.0291 0.0232  -0.0717 5    DG  E OP1   
3024 O  OP2   . DG  D 5   ? 0.7003 0.5774 0.6312 0.0221  -0.0201 -0.0814 5    DG  E OP2   
3025 O  "O5'" . DG  D 5   ? 0.7810 0.6423 0.6515 0.0749  -0.0161 -0.0568 5    DG  E "O5'" 
3026 C  "C5'" . DG  D 5   ? 0.7132 0.5574 0.7058 0.0691  -0.0388 -0.0354 5    DG  E "C5'" 
3027 C  "C4'" . DG  D 5   ? 0.6977 0.5997 0.6606 0.0467  0.0006  -0.0308 5    DG  E "C4'" 
3028 O  "O4'" . DG  D 5   ? 0.6391 0.5345 0.6655 0.0512  0.0452  -0.0786 5    DG  E "O4'" 
3029 C  "C3'" . DG  D 5   ? 0.6304 0.5417 0.6475 0.0668  -0.0169 -0.0009 5    DG  E "C3'" 
3030 O  "O3'" . DG  D 5   ? 0.7565 0.6859 0.6104 0.0678  -0.0031 -0.0100 5    DG  E "O3'" 
3031 C  "C2'" . DG  D 5   ? 0.5584 0.5943 0.6534 0.0562  -0.0038 -0.0226 5    DG  E "C2'" 
3032 C  "C1'" . DG  D 5   ? 0.5742 0.5073 0.5793 0.0580  0.0599  -0.0482 5    DG  E "C1'" 
3033 N  N9    . DG  D 5   ? 0.5742 0.4429 0.5495 0.0649  0.0554  -0.0270 5    DG  E N9    
3034 C  C8    . DG  D 5   ? 0.5731 0.5128 0.5954 0.0516  0.0039  -0.0428 5    DG  E C8    
3035 N  N7    . DG  D 5   ? 0.5938 0.5928 0.4487 0.0581  -0.0222 -0.0303 5    DG  E N7    
3036 C  C5    . DG  D 5   ? 0.5846 0.5342 0.5917 0.0365  0.0290  -0.0485 5    DG  E C5    
3037 C  C6    . DG  D 5   ? 0.6582 0.5384 0.5803 0.0341  0.0487  -0.0230 5    DG  E C6    
3038 O  O6    . DG  D 5   ? 0.6150 0.4811 0.5243 0.1029  0.0756  0.0093  5    DG  E O6    
3039 N  N1    . DG  D 5   ? 0.6037 0.4456 0.4836 0.0771  0.0118  -0.0129 5    DG  E N1    
3040 C  C2    . DG  D 5   ? 0.5768 0.5031 0.5686 0.0532  0.0014  -0.0900 5    DG  E C2    
3041 N  N2    . DG  D 5   ? 0.5578 0.5216 0.5786 0.0742  -0.0185 -0.0665 5    DG  E N2    
3042 N  N3    . DG  D 5   ? 0.6284 0.4453 0.5923 0.0673  0.0182  0.0558  5    DG  E N3    
3043 C  C4    . DG  D 5   ? 0.5771 0.5467 0.5874 0.0081  -0.0318 -0.0312 5    DG  E C4    
3044 P  P     . DA  D 6   ? 0.7042 0.6966 0.6380 0.0462  -0.0546 0.0253  6    DA  E P     
3045 O  OP1   . DA  D 6   ? 0.7640 0.7242 0.6603 0.0188  -0.0078 0.0441  6    DA  E OP1   
3046 O  OP2   . DA  D 6   ? 0.7271 0.6667 0.7415 0.0599  -0.0415 -0.0203 6    DA  E OP2   
3047 O  "O5'" . DA  D 6   ? 0.6891 0.6392 0.5353 0.0643  0.0340  -0.0300 6    DA  E "O5'" 
3048 C  "C5'" . DA  D 6   ? 0.6589 0.6839 0.6403 -0.0020 -0.0103 -0.0205 6    DA  E "C5'" 
3049 C  "C4'" . DA  D 6   ? 0.7008 0.6510 0.6772 0.0258  0.0330  -0.0283 6    DA  E "C4'" 
3050 O  "O4'" . DA  D 6   ? 0.6813 0.5824 0.6469 0.0497  -0.0088 -0.0661 6    DA  E "O4'" 
3051 C  "C3'" . DA  D 6   ? 0.6950 0.6578 0.7139 0.0707  0.0204  -0.0056 6    DA  E "C3'" 
3052 O  "O3'" . DA  D 6   ? 0.7715 0.7050 0.7485 0.0719  -0.0421 -0.0076 6    DA  E "O3'" 
3053 C  "C2'" . DA  D 6   ? 0.6757 0.6512 0.6369 0.0246  -0.0170 -0.0198 6    DA  E "C2'" 
3054 C  "C1'" . DA  D 6   ? 0.6281 0.5717 0.5829 0.0252  0.0018  -0.0373 6    DA  E "C1'" 
3055 N  N9    . DA  D 6   ? 0.5647 0.5691 0.5684 0.0376  0.0108  -0.0464 6    DA  E N9    
3056 C  C8    . DA  D 6   ? 0.5839 0.5783 0.5473 0.0315  0.0211  -0.0715 6    DA  E C8    
3057 N  N7    . DA  D 6   ? 0.5375 0.5643 0.6126 0.0683  0.0280  -0.0480 6    DA  E N7    
3058 C  C5    . DA  D 6   ? 0.5840 0.5244 0.5585 0.0134  0.0230  -0.0821 6    DA  E C5    
3059 C  C6    . DA  D 6   ? 0.6395 0.5368 0.5816 0.0282  0.0040  -0.0839 6    DA  E C6    
3060 N  N6    . DA  D 6   ? 0.6187 0.5385 0.5034 0.0353  -0.0189 -0.1087 6    DA  E N6    
3061 N  N1    . DA  D 6   ? 0.6206 0.5324 0.5831 0.0023  0.0046  -0.0764 6    DA  E N1    
3062 C  C2    . DA  D 6   ? 0.6212 0.4970 0.6231 0.0245  0.0092  -0.0522 6    DA  E C2    
3063 N  N3    . DA  D 6   ? 0.6057 0.6131 0.5984 0.0392  -0.0017 -0.0527 6    DA  E N3    
3064 C  C4    . DA  D 6   ? 0.5768 0.5174 0.5890 -0.0110 0.0094  -0.0777 6    DA  E C4    
3065 P  P     . DT  D 7   ? 0.8005 0.7955 0.8842 0.1261  -0.0201 -0.0054 7    DT  E P     
3066 O  OP1   . DT  D 7   ? 0.8445 0.7012 0.9783 0.1351  -0.0202 0.0382  7    DT  E OP1   
3067 O  OP2   . DT  D 7   ? 0.7987 0.6612 0.8984 0.1179  0.0195  -0.0102 7    DT  E OP2   
3068 O  "O5'" . DT  D 7   ? 0.7234 0.6295 0.8688 0.0910  -0.0303 0.0391  7    DT  E "O5'" 
3069 C  "C5'" . DT  D 7   ? 0.7222 0.6988 0.7338 0.0365  -0.0078 0.0256  7    DT  E "C5'" 
3070 C  "C4'" . DT  D 7   ? 0.6650 0.6701 0.6157 0.0745  -0.0157 0.0102  7    DT  E "C4'" 
3071 O  "O4'" . DT  D 7   ? 0.6413 0.6344 0.5305 0.0775  -0.0513 -0.0304 7    DT  E "O4'" 
3072 C  "C3'" . DT  D 7   ? 0.6385 0.6690 0.5795 0.0896  -0.0386 0.0140  7    DT  E "C3'" 
3073 O  "O3'" . DT  D 7   ? 0.7385 0.7104 0.6461 0.0372  0.0069  -0.0202 7    DT  E "O3'" 
3074 C  "C2'" . DT  D 7   ? 0.6386 0.6214 0.5957 0.0714  -0.0230 -0.0581 7    DT  E "C2'" 
3075 C  "C1'" . DT  D 7   ? 0.6151 0.5836 0.5178 0.0695  -0.0623 -0.0135 7    DT  E "C1'" 
3076 N  N1    . DT  D 7   ? 0.5633 0.4832 0.4899 0.0099  -0.0407 -0.0560 7    DT  E N1    
3077 C  C2    . DT  D 7   ? 0.5435 0.5480 0.5141 0.0135  0.0035  -0.0184 7    DT  E C2    
3078 O  O2    . DT  D 7   ? 0.5760 0.5147 0.6017 0.0166  -0.0269 -0.0654 7    DT  E O2    
3079 N  N3    . DT  D 7   ? 0.4688 0.4113 0.4765 0.0235  0.0030  -0.0312 7    DT  E N3    
3080 C  C4    . DT  D 7   ? 0.4891 0.4169 0.4236 0.0404  -0.0080 -0.0109 7    DT  E C4    
3081 O  O4    . DT  D 7   ? 0.5590 0.4183 0.4995 0.0550  -0.0160 -0.0913 7    DT  E O4    
3082 C  C5    . DT  D 7   ? 0.5724 0.4989 0.4687 -0.0020 0.0035  -0.0403 7    DT  E C5    
3083 C  C7    . DT  D 7   ? 0.5461 0.5554 0.4400 -0.0077 0.0422  0.0335  7    DT  E C7    
3084 C  C6    . DT  D 7   ? 0.5201 0.4915 0.4964 0.0323  0.0214  -0.0025 7    DT  E C6    
3085 P  P     . DC  D 8   ? 0.7117 0.8610 0.7786 0.0482  -0.0045 0.0233  8    DC  E P     
3086 O  OP1   . DC  D 8   ? 0.7386 0.8282 0.6590 0.0331  -0.0309 0.0656  8    DC  E OP1   
3087 O  OP2   . DC  D 8   ? 0.7516 0.7188 0.6694 0.0681  0.0432  0.0419  8    DC  E OP2   
3088 O  "O5'" . DC  D 8   ? 0.7059 0.7435 0.7145 0.0439  0.0172  0.0317  8    DC  E "O5'" 
3089 C  "C5'" . DC  D 8   ? 0.6168 0.7109 0.6490 0.0086  -0.0220 -0.0140 8    DC  E "C5'" 
3090 C  "C4'" . DC  D 8   ? 0.5819 0.6922 0.5708 0.0113  -0.0509 0.0015  8    DC  E "C4'" 
3091 O  "O4'" . DC  D 8   ? 0.5928 0.5942 0.5835 0.0184  -0.0284 -0.0421 8    DC  E "O4'" 
3092 C  "C3'" . DC  D 8   ? 0.5546 0.7172 0.5633 0.0331  -0.0372 0.0045  8    DC  E "C3'" 
3093 O  "O3'" . DC  D 8   ? 0.6798 0.8353 0.6524 0.0232  -0.0614 -0.0080 8    DC  E "O3'" 
3094 C  "C2'" . DC  D 8   ? 0.5788 0.7106 0.5866 0.0353  -0.0303 -0.0435 8    DC  E "C2'" 
3095 C  "C1'" . DC  D 8   ? 0.4821 0.5637 0.5150 0.0294  -0.0663 -0.0484 8    DC  E "C1'" 
3096 N  N1    . DC  D 8   ? 0.5169 0.5392 0.5140 -0.0179 -0.0190 -0.0297 8    DC  E N1    
3097 C  C2    . DC  D 8   ? 0.4973 0.5236 0.5439 0.0096  -0.0473 -0.0208 8    DC  E C2    
3098 O  O2    . DC  D 8   ? 0.4611 0.5786 0.5234 0.0514  -0.0097 0.0072  8    DC  E O2    
3099 N  N3    . DC  D 8   ? 0.4433 0.4559 0.4482 0.0200  -0.0194 -0.0460 8    DC  E N3    
3100 C  C4    . DC  D 8   ? 0.4547 0.3977 0.3859 0.0714  -0.0049 -0.0467 8    DC  E C4    
3101 N  N4    . DC  D 8   ? 0.4673 0.4067 0.4323 -0.0088 -0.0616 -0.0434 8    DC  E N4    
3102 C  C5    . DC  D 8   ? 0.4554 0.5410 0.4091 0.0998  -0.0884 -0.0528 8    DC  E C5    
3103 C  C6    . DC  D 8   ? 0.5098 0.4845 0.5011 -0.0323 -0.0065 -0.0493 8    DC  E C6    
3104 P  P     . DC  D 9   ? 0.6917 0.8868 0.7231 -0.0037 -0.0346 0.0179  9    DC  E P     
3105 O  OP1   . DC  D 9   ? 0.7423 0.9322 0.6542 -0.0280 -0.0544 0.0501  9    DC  E OP1   
3106 O  OP2   . DC  D 9   ? 0.6528 0.7304 0.6753 0.1209  -0.0212 0.0864  9    DC  E OP2   
3107 O  "O5'" . DC  D 9   ? 0.5958 0.7093 0.6008 0.0338  -0.0334 0.0390  9    DC  E "O5'" 
3108 C  "C5'" . DC  D 9   ? 0.5593 0.6393 0.5918 -0.0042 -0.0112 -0.0434 9    DC  E "C5'" 
3109 C  "C4'" . DC  D 9   ? 0.5347 0.6567 0.5121 0.0211  -0.0282 -0.0418 9    DC  E "C4'" 
3110 O  "O4'" . DC  D 9   ? 0.5552 0.6048 0.5540 0.0046  -0.0031 -0.0485 9    DC  E "O4'" 
3111 C  "C3'" . DC  D 9   ? 0.5172 0.5980 0.4376 -0.0139 -0.0748 -0.0607 9    DC  E "C3'" 
3112 O  "O3'" . DC  D 9   ? 0.5047 0.6013 0.4498 -0.0565 -0.0605 -0.1090 9    DC  E "O3'" 
3113 C  "C2'" . DC  D 9   ? 0.5289 0.5565 0.5567 0.0197  -0.0189 -0.0551 9    DC  E "C2'" 
3114 C  "C1'" . DC  D 9   ? 0.4826 0.5812 0.5017 -0.0140 -0.0024 -0.0693 9    DC  E "C1'" 
3115 N  N1    . DC  D 9   ? 0.4936 0.5086 0.4743 0.0220  -0.0246 -0.0396 9    DC  E N1    
3116 C  C2    . DC  D 9   ? 0.4402 0.4032 0.4133 0.0398  0.0393  -0.0574 9    DC  E C2    
3117 O  O2    . DC  D 9   ? 0.4890 0.4876 0.4242 0.0414  -0.0159 -0.0297 9    DC  E O2    
3118 N  N3    . DC  D 9   ? 0.4242 0.4915 0.3308 0.0305  -0.0459 -0.0549 9    DC  E N3    
3119 C  C4    . DC  D 9   ? 0.5146 0.4516 0.4642 0.0479  -0.0055 -0.0359 9    DC  E C4    
3120 N  N4    . DC  D 9   ? 0.4251 0.3810 0.4524 0.0334  -0.0720 -0.0913 9    DC  E N4    
3121 C  C5    . DC  D 9   ? 0.5114 0.5646 0.4434 -0.0005 -0.0148 -0.0588 9    DC  E C5    
3122 C  C6    . DC  D 9   ? 0.4815 0.5916 0.5304 0.0048  0.0019  0.0036  9    DC  E C6    
3123 P  P     . DT  D 10  ? 0.6337 0.6747 0.6458 -0.0049 -0.0380 -0.0087 10   DT  E P     
3124 O  OP1   . DT  D 10  ? 0.6188 0.6518 0.6664 -0.0311 0.0027  -0.0863 10   DT  E OP1   
3125 O  OP2   . DT  D 10  ? 0.4164 0.6646 0.5416 -0.0329 -0.1592 -0.1193 10   DT  E OP2   
3126 O  "O5'" . DT  D 10  ? 0.5408 0.5849 0.5330 0.0088  -0.0360 -0.1057 10   DT  E "O5'" 
3127 C  "C5'" . DT  D 10  ? 0.4497 0.6173 0.5533 -0.0179 -0.0337 -0.0127 10   DT  E "C5'" 
3128 C  "C4'" . DT  D 10  ? 0.5785 0.5640 0.5306 -0.0344 0.0090  -0.0418 10   DT  E "C4'" 
3129 O  "O4'" . DT  D 10  ? 0.4519 0.5123 0.4707 -0.0523 0.0023  -0.0633 10   DT  E "O4'" 
3130 C  "C3'" . DT  D 10  ? 0.4864 0.4861 0.5411 -0.0425 -0.0161 -0.0356 10   DT  E "C3'" 
3131 O  "O3'" . DT  D 10  ? 0.4564 0.4596 0.5323 -0.0786 -0.0138 -0.1111 10   DT  E "O3'" 
3132 C  "C2'" . DT  D 10  ? 0.4511 0.4797 0.5465 -0.0393 0.0342  -0.0379 10   DT  E "C2'" 
3133 C  "C1'" . DT  D 10  ? 0.4974 0.4327 0.4962 -0.0101 0.0346  -0.0646 10   DT  E "C1'" 
3134 N  N1    . DT  D 10  ? 0.4484 0.4333 0.4189 -0.0142 0.0233  -0.0842 10   DT  E N1    
3135 C  C2    . DT  D 10  ? 0.4378 0.4332 0.4239 0.0134  0.0149  -0.0404 10   DT  E C2    
3136 O  O2    . DT  D 10  ? 0.2868 0.4581 0.4365 -0.0113 -0.0297 -0.0629 10   DT  E O2    
3137 N  N3    . DT  D 10  ? 0.3615 0.3455 0.4260 0.0145  0.0189  -0.0554 10   DT  E N3    
3138 C  C4    . DT  D 10  ? 0.4147 0.3250 0.4402 0.0102  -0.0103 -0.1222 10   DT  E C4    
3139 O  O4    . DT  D 10  ? 0.3675 0.4154 0.4237 -0.0023 -0.0091 -0.1025 10   DT  E O4    
3140 C  C5    . DT  D 10  ? 0.4720 0.4304 0.4624 0.0020  0.0147  -0.0308 10   DT  E C5    
3141 C  C7    . DT  D 10  ? 0.4471 0.4900 0.4914 0.0548  -0.0084 -0.0631 10   DT  E C7    
3142 C  C6    . DT  D 10  ? 0.3982 0.3698 0.4189 0.0050  0.0483  -0.0915 10   DT  E C6    
3143 P  P     . DT  D 11  ? 0.5868 0.6035 0.5987 -0.0724 0.0070  -0.0403 11   DT  E P     
3144 O  OP1   . DT  D 11  ? 0.4348 0.4385 0.5519 -0.1767 -0.1257 -0.1586 11   DT  E OP1   
3145 O  OP2   . DT  D 11  ? 0.4927 0.4953 0.4623 -0.1094 -0.0821 -0.1610 11   DT  E OP2   
3146 O  "O5'" . DT  D 11  ? 0.5044 0.5494 0.5804 0.0036  0.0464  -0.1075 11   DT  E "O5'" 
3147 C  "C5'" . DT  D 11  ? 0.5447 0.5065 0.5284 0.0094  0.0353  -0.0481 11   DT  E "C5'" 
3148 C  "C4'" . DT  D 11  ? 0.3783 0.4934 0.4474 -0.0115 0.0536  -0.0086 11   DT  E "C4'" 
3149 O  "O4'" . DT  D 11  ? 0.3619 0.4492 0.4807 0.0093  0.0487  -0.0165 11   DT  E "O4'" 
3150 C  "C3'" . DT  D 11  ? 0.4988 0.4508 0.4853 -0.0057 0.0169  -0.0676 11   DT  E "C3'" 
3151 O  "O3'" . DT  D 11  ? 0.4470 0.5884 0.5018 -0.0745 0.0659  -0.0396 11   DT  E "O3'" 
3152 C  "C2'" . DT  D 11  ? 0.3788 0.5086 0.5180 -0.0061 0.0463  -0.0610 11   DT  E "C2'" 
3153 C  "C1'" . DT  D 11  ? 0.4088 0.4115 0.4236 0.0133  0.0279  -0.0087 11   DT  E "C1'" 
3154 N  N1    . DT  D 11  ? 0.3743 0.4233 0.3978 0.0361  0.0198  -0.0636 11   DT  E N1    
3155 C  C2    . DT  D 11  ? 0.4077 0.3905 0.3955 -0.0096 -0.0276 -0.0437 11   DT  E C2    
3156 O  O2    . DT  D 11  ? 0.3669 0.4705 0.4428 -0.0232 -0.0319 -0.0604 11   DT  E O2    
3157 N  N3    . DT  D 11  ? 0.3429 0.3310 0.3855 -0.0368 -0.0389 -0.0085 11   DT  E N3    
3158 C  C4    . DT  D 11  ? 0.3913 0.3769 0.4558 0.0241  -0.0118 0.0034  11   DT  E C4    
3159 O  O4    . DT  D 11  ? 0.3298 0.4277 0.4249 -0.0059 -0.0219 -0.0236 11   DT  E O4    
3160 C  C5    . DT  D 11  ? 0.3323 0.3180 0.4369 -0.0419 -0.0699 -0.0357 11   DT  E C5    
3161 C  C7    . DT  D 11  ? 0.3649 0.4285 0.5254 0.0665  0.0044  -0.0261 11   DT  E C7    
3162 C  C6    . DT  D 11  ? 0.3749 0.3997 0.3737 -0.0298 -0.0594 -0.0516 11   DT  E C6    
3163 P  P     . DC  D 12  ? 0.5544 0.7361 0.6134 -0.0646 0.0091  -0.0415 12   DC  E P     
3164 O  OP1   . DC  D 12  ? 0.5293 0.5732 0.5255 -0.1575 -0.0176 -0.0304 12   DC  E OP1   
3165 O  OP2   . DC  D 12  ? 0.5313 0.8019 0.5022 -0.0909 0.1013  -0.0630 12   DC  E OP2   
3166 O  "O5'" . DC  D 12  ? 0.4110 0.5940 0.5784 -0.0300 0.0579  -0.0840 12   DC  E "O5'" 
3167 C  "C5'" . DC  D 12  ? 0.4406 0.6109 0.5340 0.0518  0.0124  -0.0655 12   DC  E "C5'" 
3168 C  "C4'" . DC  D 12  ? 0.3343 0.4526 0.4678 -0.0496 -0.0361 -0.0433 12   DC  E "C4'" 
3169 O  "O4'" . DC  D 12  ? 0.4702 0.4276 0.4508 -0.0322 -0.0125 -0.0949 12   DC  E "O4'" 
3170 C  "C3'" . DC  D 12  ? 0.3128 0.4348 0.5309 -0.0593 0.0135  -0.0045 12   DC  E "C3'" 
3171 O  "O3'" . DC  D 12  ? 0.3057 0.3931 0.4118 -0.0801 0.0098  0.0109  12   DC  E "O3'" 
3172 C  "C2'" . DC  D 12  ? 0.4428 0.3463 0.4001 0.0171  -0.0069 -0.0699 12   DC  E "C2'" 
3173 C  "C1'" . DC  D 12  ? 0.3983 0.4377 0.4486 0.0055  0.0068  -0.0026 12   DC  E "C1'" 
3174 N  N1    . DC  D 12  ? 0.4909 0.4603 0.3832 -0.0230 -0.0050 -0.0176 12   DC  E N1    
3175 C  C2    . DC  D 12  ? 0.4424 0.4688 0.4581 -0.0063 0.0279  -0.0092 12   DC  E C2    
3176 O  O2    . DC  D 12  ? 0.3579 0.4662 0.4432 -0.0444 -0.0620 0.0115  12   DC  E O2    
3177 N  N3    . DC  D 12  ? 0.4220 0.4425 0.4076 0.0530  0.0396  -0.0835 12   DC  E N3    
3178 C  C4    . DC  D 12  ? 0.4185 0.3571 0.4733 0.0088  -0.0025 0.0236  12   DC  E C4    
3179 N  N4    . DC  D 12  ? 0.3693 0.4221 0.4670 0.0005  -0.0200 -0.0201 12   DC  E N4    
3180 C  C5    . DC  D 12  ? 0.4261 0.3841 0.4041 0.0019  0.0437  -0.0426 12   DC  E C5    
3181 C  C6    . DC  D 12  ? 0.4037 0.3900 0.4379 -0.0121 0.0079  -0.0270 12   DC  E C6    
3182 P  P     . DA  D 13  ? 0.4161 0.3905 0.4383 0.0127  0.0365  -0.0177 13   DA  E P     
3183 O  OP1   . DA  D 13  ? 0.4522 0.2645 0.5071 -0.0058 0.0120  0.0003  13   DA  E OP1   
3184 O  OP2   . DA  D 13  ? 0.3824 0.4256 0.4165 -0.1157 0.0083  0.0195  13   DA  E OP2   
3185 O  "O5'" . DA  D 13  ? 0.3954 0.3736 0.3872 -0.0293 0.0170  -0.0223 13   DA  E "O5'" 
3186 C  "C5'" . DA  D 13  ? 0.3810 0.3610 0.3126 -0.0028 0.0423  0.0215  13   DA  E "C5'" 
3187 C  "C4'" . DA  D 13  ? 0.3686 0.3330 0.3753 -0.0086 -0.0054 0.0038  13   DA  E "C4'" 
3188 O  "O4'" . DA  D 13  ? 0.3173 0.4132 0.3629 -0.0380 0.0093  0.0166  13   DA  E "O4'" 
3189 C  "C3'" . DA  D 13  ? 0.3891 0.3566 0.2603 -0.0030 0.0125  -0.0725 13   DA  E "C3'" 
3190 O  "O3'" . DA  D 13  ? 0.3313 0.3642 0.3109 0.0206  0.0183  -0.0075 13   DA  E "O3'" 
3191 C  "C2'" . DA  D 13  ? 0.2889 0.3197 0.3150 -0.0119 -0.0248 0.0052  13   DA  E "C2'" 
3192 C  "C1'" . DA  D 13  ? 0.3316 0.3460 0.3616 0.0169  0.0116  -0.0730 13   DA  E "C1'" 
3193 N  N9    . DA  D 13  ? 0.3061 0.3769 0.3045 0.0176  -0.0088 -0.0334 13   DA  E N9    
3194 C  C8    . DA  D 13  ? 0.2978 0.3465 0.4024 0.0139  -0.0217 -0.0399 13   DA  E C8    
3195 N  N7    . DA  D 13  ? 0.3193 0.3723 0.3108 -0.0339 0.0426  -0.0762 13   DA  E N7    
3196 C  C5    . DA  D 13  ? 0.3603 0.3769 0.3709 0.0186  0.0256  -0.0003 13   DA  E C5    
3197 C  C6    . DA  D 13  ? 0.3470 0.4071 0.3805 0.0203  0.0450  -0.0611 13   DA  E C6    
3198 N  N6    . DA  D 13  ? 0.2928 0.4074 0.4521 0.0175  0.0357  -0.0637 13   DA  E N6    
3199 N  N1    . DA  D 13  ? 0.3681 0.3827 0.3941 -0.0351 -0.0064 -0.0435 13   DA  E N1    
3200 C  C2    . DA  D 13  ? 0.3025 0.3537 0.4135 0.0255  -0.0346 -0.0871 13   DA  E C2    
3201 N  N3    . DA  D 13  ? 0.2677 0.2900 0.3604 -0.0234 0.0356  -0.0469 13   DA  E N3    
3202 C  C4    . DA  D 13  ? 0.3399 0.3519 0.3303 -0.0037 -0.0171 -0.0518 13   DA  E C4    
3203 P  P     . DA  D 14  ? 0.3134 0.3383 0.3447 -0.0333 0.0009  -0.0223 14   DA  E P     
3204 O  OP1   . DA  D 14  ? 0.3224 0.3984 0.2849 -0.0255 0.0074  0.0309  14   DA  E OP1   
3205 O  OP2   . DA  D 14  ? 0.3086 0.3546 0.3456 0.0101  0.0117  -0.0539 14   DA  E OP2   
3206 O  "O5'" . DA  D 14  ? 0.2565 0.3447 0.3222 -0.0200 -0.0283 0.0116  14   DA  E "O5'" 
3207 C  "C5'" . DA  D 14  ? 0.2379 0.2944 0.3764 -0.0708 -0.0346 0.0709  14   DA  E "C5'" 
3208 C  "C4'" . DA  D 14  ? 0.3344 0.3718 0.4080 -0.0396 0.0006  0.0506  14   DA  E "C4'" 
3209 O  "O4'" . DA  D 14  ? 0.3489 0.3751 0.3849 0.0083  -0.0057 -0.0264 14   DA  E "O4'" 
3210 C  "C3'" . DA  D 14  ? 0.2862 0.2873 0.3723 0.0266  -0.0292 0.0254  14   DA  E "C3'" 
3211 O  "O3'" . DA  D 14  ? 0.1953 0.3429 0.4136 0.0172  0.0190  0.0167  14   DA  E "O3'" 
3212 C  "C2'" . DA  D 14  ? 0.2944 0.2648 0.3232 -0.0200 0.0295  -0.0312 14   DA  E "C2'" 
3213 C  "C1'" . DA  D 14  ? 0.3250 0.3278 0.3004 -0.0014 -0.0218 0.0306  14   DA  E "C1'" 
3214 N  N9    . DA  D 14  ? 0.4399 0.3741 0.3798 -0.0297 -0.0197 -0.0892 14   DA  E N9    
3215 C  C8    . DA  D 14  ? 0.3803 0.4251 0.3405 -0.0639 -0.0358 -0.0389 14   DA  E C8    
3216 N  N7    . DA  D 14  ? 0.3433 0.3435 0.3160 -0.0523 -0.0384 -0.0164 14   DA  E N7    
3217 C  C5    . DA  D 14  ? 0.2801 0.3771 0.3800 -0.0029 -0.0598 -0.0343 14   DA  E C5    
3218 C  C6    . DA  D 14  ? 0.3668 0.3445 0.3061 0.0505  -0.0052 -0.0348 14   DA  E C6    
3219 N  N6    . DA  D 14  ? 0.2942 0.3215 0.3528 -0.0462 0.0005  -0.0523 14   DA  E N6    
3220 N  N1    . DA  D 14  ? 0.3422 0.3890 0.3260 -0.0342 0.0042  -0.0453 14   DA  E N1    
3221 C  C2    . DA  D 14  ? 0.3591 0.4148 0.3531 -0.0093 -0.0188 -0.0582 14   DA  E C2    
3222 N  N3    . DA  D 14  ? 0.3104 0.3887 0.4156 0.0255  -0.0072 -0.0373 14   DA  E N3    
3223 C  C4    . DA  D 14  ? 0.4185 0.3866 0.3540 -0.0331 -0.0312 -0.0550 14   DA  E C4    
3224 P  P     . DA  D 15  ? 0.3501 0.3525 0.3754 -0.0020 -0.0015 0.0008  15   DA  E P     
3225 O  OP1   . DA  D 15  ? 0.3645 0.3071 0.3181 0.0110  0.0291  -0.0431 15   DA  E OP1   
3226 O  OP2   . DA  D 15  ? 0.3224 0.3596 0.2855 -0.0082 -0.0224 -0.0098 15   DA  E OP2   
3227 O  "O5'" . DA  D 15  ? 0.2128 0.3453 0.3676 0.0253  0.0285  0.0137  15   DA  E "O5'" 
3228 C  "C5'" . DA  D 15  ? 0.3662 0.3379 0.3787 -0.0280 -0.0217 -0.0080 15   DA  E "C5'" 
3229 C  "C4'" . DA  D 15  ? 0.3336 0.2640 0.3747 -0.0399 0.0602  0.0593  15   DA  E "C4'" 
3230 O  "O4'" . DA  D 15  ? 0.3234 0.3292 0.3344 0.0413  -0.0555 -0.0351 15   DA  E "O4'" 
3231 C  "C3'" . DA  D 15  ? 0.3268 0.3590 0.3033 0.0212  0.0254  -0.0176 15   DA  E "C3'" 
3232 O  "O3'" . DA  D 15  ? 0.2844 0.3155 0.3383 0.0042  -0.0197 -0.0053 15   DA  E "O3'" 
3233 C  "C2'" . DA  D 15  ? 0.2526 0.2771 0.3312 -0.0888 -0.0049 0.0071  15   DA  E "C2'" 
3234 C  "C1'" . DA  D 15  ? 0.2409 0.2853 0.3910 0.0298  -0.0070 -0.0600 15   DA  E "C1'" 
3235 N  N9    . DA  D 15  ? 0.4754 0.3436 0.4775 -0.0561 -0.0445 -0.0018 15   DA  E N9    
3236 C  C8    . DA  D 15  ? 0.3374 0.3069 0.3896 0.0190  0.0441  -0.0253 15   DA  E C8    
3237 N  N7    . DA  D 15  ? 0.4486 0.4535 0.3130 -0.0094 0.0486  -0.0086 15   DA  E N7    
3238 C  C5    . DA  D 15  ? 0.4271 0.2878 0.3758 -0.0071 0.0278  -0.0639 15   DA  E C5    
3239 C  C6    . DA  D 15  ? 0.4071 0.3740 0.3970 0.0365  -0.0096 -0.0119 15   DA  E C6    
3240 N  N6    . DA  D 15  ? 0.3046 0.3262 0.3228 0.0163  0.0311  -0.0617 15   DA  E N6    
3241 N  N1    . DA  D 15  ? 0.2869 0.3192 0.3575 0.0018  0.0064  -0.0218 15   DA  E N1    
3242 C  C2    . DA  D 15  ? 0.2458 0.4269 0.3048 -0.0377 0.0712  -0.0612 15   DA  E C2    
3243 N  N3    . DA  D 15  ? 0.3027 0.4098 0.3729 -0.0268 0.0596  -0.0721 15   DA  E N3    
3244 C  C4    . DA  D 15  ? 0.5954 0.4275 0.4895 0.0137  0.0262  -0.0222 15   DA  E C4    
3245 P  P     . DA  D 16  ? 0.3088 0.3221 0.3421 -0.0015 -0.0175 0.0078  16   DA  E P     
3246 O  OP1   . DA  D 16  ? 0.2742 0.3715 0.3391 0.0718  0.0321  -0.0146 16   DA  E OP1   
3247 O  OP2   . DA  D 16  ? 0.3039 0.3397 0.3499 0.0126  -0.0475 -0.0220 16   DA  E OP2   
3248 O  "O5'" . DA  D 16  ? 0.2756 0.3176 0.4224 -0.0100 -0.0193 -0.0113 16   DA  E "O5'" 
3249 C  "C5'" . DA  D 16  ? 0.3010 0.4156 0.3282 0.0034  0.0000  -0.0286 16   DA  E "C5'" 
3250 C  "C4'" . DA  D 16  ? 0.2794 0.3004 0.3361 -0.0109 0.0258  -0.0229 16   DA  E "C4'" 
3251 O  "O4'" . DA  D 16  ? 0.2827 0.3712 0.3530 0.0402  -0.0116 -0.0415 16   DA  E "O4'" 
3252 C  "C3'" . DA  D 16  ? 0.3504 0.3857 0.3760 0.0432  -0.0372 -0.0128 16   DA  E "C3'" 
3253 O  "O3'" . DA  D 16  ? 0.3473 0.3611 0.3849 -0.0095 -0.0393 0.0137  16   DA  E "O3'" 
3254 C  "C2'" . DA  D 16  ? 0.3750 0.2793 0.2802 0.0012  -0.0449 0.0148  16   DA  E "C2'" 
3255 C  "C1'" . DA  D 16  ? 0.3046 0.3942 0.3380 -0.0432 -0.0330 -0.0018 16   DA  E "C1'" 
3256 N  N9    . DA  D 16  ? 0.2940 0.3146 0.3718 -0.0229 -0.0410 -0.0458 16   DA  E N9    
3257 C  C8    . DA  D 16  ? 0.3968 0.4129 0.3835 -0.0097 -0.0044 -0.0178 16   DA  E C8    
3258 N  N7    . DA  D 16  ? 0.3761 0.3943 0.4084 0.0158  0.0125  -0.0007 16   DA  E N7    
3259 C  C5    . DA  D 16  ? 0.3072 0.3622 0.3729 -0.0339 -0.0541 0.0028  16   DA  E C5    
3260 C  C6    . DA  D 16  ? 0.3541 0.3482 0.3701 0.0043  -0.0214 0.0163  16   DA  E C6    
3261 N  N6    . DA  D 16  ? 0.2573 0.3679 0.2986 0.0188  -0.0426 -0.0533 16   DA  E N6    
3262 N  N1    . DA  D 16  ? 0.3379 0.3590 0.3713 0.0474  0.0321  -0.0394 16   DA  E N1    
3263 C  C2    . DA  D 16  ? 0.4583 0.3832 0.3025 -0.0059 0.0689  -0.0362 16   DA  E C2    
3264 N  N3    . DA  D 16  ? 0.3639 0.3550 0.3841 -0.0264 0.0308  -0.0401 16   DA  E N3    
3265 C  C4    . DA  D 16  ? 0.3823 0.3947 0.3369 -0.0240 0.0066  -0.0038 16   DA  E C4    
3266 P  P     . DA  D 17  ? 0.3595 0.3994 0.4055 0.0317  -0.0249 -0.0036 17   DA  E P     
3267 O  OP1   . DA  D 17  ? 0.4157 0.3602 0.3933 0.0425  -0.0067 -0.0040 17   DA  E OP1   
3268 O  OP2   . DA  D 17  ? 0.4105 0.3679 0.3174 -0.0220 0.0068  -0.0120 17   DA  E OP2   
3269 O  "O5'" . DA  D 17  ? 0.2822 0.4077 0.3484 -0.0037 0.0263  -0.0050 17   DA  E "O5'" 
3270 C  "C5'" . DA  D 17  ? 0.3283 0.3770 0.3541 0.0185  -0.0232 -0.0260 17   DA  E "C5'" 
3271 C  "C4'" . DA  D 17  ? 0.3716 0.4811 0.3642 -0.0437 0.0086  0.0326  17   DA  E "C4'" 
3272 O  "O4'" . DA  D 17  ? 0.4443 0.4619 0.3811 -0.0514 0.0104  -0.0388 17   DA  E "O4'" 
3273 C  "C3'" . DA  D 17  ? 0.4719 0.3978 0.4360 -0.0246 -0.0037 0.0376  17   DA  E "C3'" 
3274 O  "O3'" . DA  D 17  ? 0.4201 0.4473 0.3650 -0.0078 0.0000  -0.0140 17   DA  E "O3'" 
3275 C  "C2'" . DA  D 17  ? 0.4214 0.5313 0.4843 0.0048  0.0347  0.0266  17   DA  E "C2'" 
3276 C  "C1'" . DA  D 17  ? 0.4591 0.3993 0.3836 0.0080  -0.0801 0.0156  17   DA  E "C1'" 
3277 N  N9    . DA  D 17  ? 0.3224 0.3506 0.4412 0.0522  0.0091  -0.0426 17   DA  E N9    
3278 C  C8    . DA  D 17  ? 0.3644 0.4119 0.3904 -0.0082 -0.0535 -0.0249 17   DA  E C8    
3279 N  N7    . DA  D 17  ? 0.4016 0.4196 0.3642 0.0233  0.0251  -0.0475 17   DA  E N7    
3280 C  C5    . DA  D 17  ? 0.3396 0.3821 0.4302 0.0138  0.0218  -0.0462 17   DA  E C5    
3281 C  C6    . DA  D 17  ? 0.4155 0.4304 0.3660 0.0503  -0.0014 -0.0219 17   DA  E C6    
3282 N  N6    . DA  D 17  ? 0.2620 0.3821 0.3684 0.0348  -0.0643 -0.0855 17   DA  E N6    
3283 N  N1    . DA  D 17  ? 0.4206 0.3954 0.3699 0.0200  -0.0429 -0.0769 17   DA  E N1    
3284 C  C2    . DA  D 17  ? 0.4475 0.3400 0.3649 0.0009  -0.0724 0.0062  17   DA  E C2    
3285 N  N3    . DA  D 17  ? 0.3621 0.3520 0.3713 0.0095  -0.0220 -0.0327 17   DA  E N3    
3286 C  C4    . DA  D 17  ? 0.3985 0.4113 0.3781 -0.0020 -0.0077 0.0003  17   DA  E C4    
3287 P  P     . DA  D 18  ? 0.4043 0.4182 0.4226 0.0513  -0.0391 -0.0307 18   DA  E P     
3288 O  OP1   . DA  D 18  ? 0.4346 0.3982 0.3893 0.0555  0.0353  -0.0981 18   DA  E OP1   
3289 O  OP2   . DA  D 18  ? 0.4187 0.4325 0.3901 0.0660  -0.0146 -0.0999 18   DA  E OP2   
3290 O  "O5'" . DA  D 18  ? 0.4194 0.4211 0.3484 0.0157  -0.0023 -0.0492 18   DA  E "O5'" 
3291 C  "C5'" . DA  D 18  ? 0.4661 0.4472 0.4405 0.0146  -0.0501 -0.0889 18   DA  E "C5'" 
3292 C  "C4'" . DA  D 18  ? 0.4797 0.5825 0.4828 -0.0519 -0.0144 -0.0745 18   DA  E "C4'" 
3293 O  "O4'" . DA  D 18  ? 0.4274 0.6521 0.5268 -0.0616 -0.0781 -0.0791 18   DA  E "O4'" 
3294 C  "C3'" . DA  D 18  ? 0.6210 0.6836 0.5615 -0.0063 0.0134  -0.0465 18   DA  E "C3'" 
3295 O  "O3'" . DA  D 18  ? 0.5300 0.6808 0.5264 0.0616  0.0239  0.0040  18   DA  E "O3'" 
3296 C  "C2'" . DA  D 18  ? 0.4942 0.6737 0.5455 0.0987  -0.0050 -0.0731 18   DA  E "C2'" 
3297 C  "C1'" . DA  D 18  ? 0.4925 0.6018 0.5304 0.0419  -0.0459 0.0147  18   DA  E "C1'" 
3298 N  N9    . DA  D 18  ? 0.3482 0.5503 0.5076 0.0351  0.0111  -0.0089 18   DA  E N9    
3299 C  C8    . DA  D 18  ? 0.3924 0.5367 0.4752 -0.0064 -0.0034 -0.0099 18   DA  E C8    
3300 N  N7    . DA  D 18  ? 0.4059 0.3551 0.4808 0.0101  -0.0059 -0.0442 18   DA  E N7    
3301 C  C5    . DA  D 18  ? 0.4071 0.4137 0.4398 -0.0098 0.0198  -0.0513 18   DA  E C5    
3302 C  C6    . DA  D 18  ? 0.4912 0.4524 0.4588 -0.0745 0.0726  -0.0893 18   DA  E C6    
3303 N  N6    . DA  D 18  ? 0.3868 0.4154 0.4227 -0.0222 -0.0506 -0.0512 18   DA  E N6    
3304 N  N1    . DA  D 18  ? 0.4495 0.4745 0.4938 -0.0154 0.0426  -0.0528 18   DA  E N1    
3305 C  C2    . DA  D 18  ? 0.4644 0.5523 0.4827 0.0143  0.0448  0.0151  18   DA  E C2    
3306 N  N3    . DA  D 18  ? 0.2865 0.6382 0.4426 0.0120  -0.0253 -0.0191 18   DA  E N3    
3307 C  C4    . DA  D 18  ? 0.5222 0.4706 0.5406 -0.0212 0.0404  -0.0370 18   DA  E C4    
3308 P  P     . DG  D 19  ? 0.5673 0.6802 0.6597 0.0453  0.0715  -0.0103 19   DG  E P     
3309 O  OP1   . DG  D 19  ? 0.5555 0.7489 0.5711 0.1105  -0.0580 -0.0277 19   DG  E OP1   
3310 O  OP2   . DG  D 19  ? 0.6704 0.6464 0.5164 0.0118  -0.0185 -0.1239 19   DG  E OP2   
3311 O  "O5'" . DG  D 19  ? 0.4968 0.6664 0.5777 0.0712  -0.0097 -0.0181 19   DG  E "O5'" 
3312 C  "C5'" . DG  D 19  ? 0.5656 0.7287 0.6959 0.0179  0.0109  0.0131  19   DG  E "C5'" 
3313 C  "C4'" . DG  D 19  ? 0.6729 0.7559 0.6748 0.0303  -0.0177 -0.0258 19   DG  E "C4'" 
3314 O  "O4'" . DG  D 19  ? 0.7216 0.6703 0.6272 0.0561  -0.0155 -0.0980 19   DG  E "O4'" 
3315 C  "C3'" . DG  D 19  ? 0.7110 0.7951 0.6675 0.0605  0.0320  -0.0285 19   DG  E "C3'" 
3316 O  "O3'" . DG  D 19  ? 0.7943 0.8283 0.7626 0.0559  0.0512  -0.0443 19   DG  E "O3'" 
3317 C  "C2'" . DG  D 19  ? 0.6919 0.7075 0.6092 0.0103  0.0122  -0.0619 19   DG  E "C2'" 
3318 C  "C1'" . DG  D 19  ? 0.6912 0.6688 0.6439 0.0110  0.0007  -0.0596 19   DG  E "C1'" 
3319 N  N9    . DG  D 19  ? 0.6487 0.6062 0.6114 0.0090  0.0321  -0.0636 19   DG  E N9    
3320 C  C8    . DG  D 19  ? 0.7059 0.5389 0.5344 0.0156  0.0377  -0.0954 19   DG  E C8    
3321 N  N7    . DG  D 19  ? 0.7643 0.5958 0.5378 -0.0102 0.0268  -0.0723 19   DG  E N7    
3322 C  C5    . DG  D 19  ? 0.7194 0.5352 0.5125 0.0101  0.0019  -0.0695 19   DG  E C5    
3323 C  C6    . DG  D 19  ? 0.6427 0.5408 0.5892 0.0249  0.0527  -0.1191 19   DG  E C6    
3324 O  O6    . DG  D 19  ? 0.6306 0.6456 0.6493 -0.0096 0.0706  -0.1309 19   DG  E O6    
3325 N  N1    . DG  D 19  ? 0.6821 0.4945 0.6319 0.0148  0.0228  -0.0817 19   DG  E N1    
3326 C  C2    . DG  D 19  ? 0.7345 0.5527 0.6136 0.0134  0.0277  -0.0113 19   DG  E C2    
3327 N  N2    . DG  D 19  ? 0.7698 0.6313 0.5926 0.0182  0.0118  -0.0476 19   DG  E N2    
3328 N  N3    . DG  D 19  ? 0.6367 0.5472 0.5505 0.0311  0.0132  -0.0602 19   DG  E N3    
3329 C  C4    . DG  D 19  ? 0.6111 0.4972 0.5201 0.0069  -0.0079 -0.0412 19   DG  E C4    
3330 P  P     . DG  D 20  ? 0.8115 0.8945 0.6720 0.0213  0.0850  -0.0344 20   DG  E P     
3331 O  OP1   . DG  D 20  ? 0.7364 0.8322 0.6515 -0.0191 0.0292  -0.0271 20   DG  E OP1   
3332 O  OP2   . DG  D 20  ? 0.6645 0.8093 0.6843 0.0175  0.0466  -0.0045 20   DG  E OP2   
3333 O  "O5'" . DG  D 20  ? 0.7317 0.7893 0.6914 0.0500  0.0504  0.0004  20   DG  E "O5'" 
3334 C  "C5'" . DG  D 20  ? 0.7040 0.7579 0.6863 0.0151  0.0628  0.0039  20   DG  E "C5'" 
3335 C  "C4'" . DG  D 20  ? 0.7060 0.7828 0.7133 -0.0124 0.0120  -0.0280 20   DG  E "C4'" 
3336 O  "O4'" . DG  D 20  ? 0.6717 0.7339 0.6758 -0.0388 -0.0089 -0.0416 20   DG  E "O4'" 
3337 C  "C3'" . DG  D 20  ? 0.7442 0.8132 0.6881 -0.0152 -0.0042 -0.0340 20   DG  E "C3'" 
3338 O  "O3'" . DG  D 20  ? 0.7588 0.9130 0.7170 -0.0073 0.0182  -0.0281 20   DG  E "O3'" 
3339 C  "C2'" . DG  D 20  ? 0.7004 0.7830 0.6178 -0.0136 0.0056  -0.0629 20   DG  E "C2'" 
3340 C  "C1'" . DG  D 20  ? 0.5837 0.6233 0.6214 0.0006  -0.0342 -0.0377 20   DG  E "C1'" 
3341 N  N9    . DG  D 20  ? 0.5160 0.4992 0.5192 -0.0693 -0.0475 -0.0799 20   DG  E N9    
3342 C  C8    . DG  D 20  ? 0.5553 0.5689 0.4245 -0.0185 -0.0469 -0.0659 20   DG  E C8    
3343 N  N7    . DG  D 20  ? 0.5640 0.5770 0.4504 -0.0076 -0.0565 -0.0211 20   DG  E N7    
3344 C  C5    . DG  D 20  ? 0.4718 0.4911 0.4198 -0.0106 -0.0485 -0.0580 20   DG  E C5    
3345 C  C6    . DG  D 20  ? 0.6242 0.5464 0.5435 0.0023  0.0430  -0.0467 20   DG  E C6    
3346 O  O6    . DG  D 20  ? 0.6995 0.4465 0.5629 -0.1069 0.0984  -0.0822 20   DG  E O6    
3347 N  N1    . DG  D 20  ? 0.5585 0.4234 0.4956 0.0170  0.0330  -0.0987 20   DG  E N1    
3348 C  C2    . DG  D 20  ? 0.6161 0.5036 0.5206 0.0297  -0.0062 -0.0261 20   DG  E C2    
3349 N  N2    . DG  D 20  ? 0.4421 0.4236 0.4477 0.0273  -0.1170 -0.0470 20   DG  E N2    
3350 N  N3    . DG  D 20  ? 0.5465 0.5813 0.5115 0.0233  -0.0049 -0.0088 20   DG  E N3    
3351 C  C4    . DG  D 20  ? 0.4666 0.4487 0.4709 0.0140  -0.0638 -0.0654 20   DG  E C4    
3352 P  P     . DC  D 21  ? 0.7695 0.9486 0.6814 -0.0212 -0.0036 -0.0185 21   DC  E P     
3353 O  OP1   . DC  D 21  ? 0.7930 0.9970 0.6062 -0.0291 -0.0705 0.0357  21   DC  E OP1   
3354 O  OP2   . DC  D 21  ? 0.7527 0.8417 0.6635 0.0419  0.0078  -0.0385 21   DC  E OP2   
3355 O  "O5'" . DC  D 21  ? 0.6637 0.8519 0.6326 -0.0002 -0.0360 0.0139  21   DC  E "O5'" 
3356 C  "C5'" . DC  D 21  ? 0.6691 0.8100 0.6501 -0.0156 -0.0172 0.0187  21   DC  E "C5'" 
3357 C  "C4'" . DC  D 21  ? 0.6425 0.7808 0.6834 -0.0234 -0.0025 -0.0065 21   DC  E "C4'" 
3358 O  "O4'" . DC  D 21  ? 0.6370 0.7459 0.6397 0.0021  -0.0303 -0.0080 21   DC  E "O4'" 
3359 C  "C3'" . DC  D 21  ? 0.6784 0.7236 0.6950 -0.0169 -0.0086 0.0138  21   DC  E "C3'" 
3360 O  "O3'" . DC  D 21  ? 0.6925 0.7758 0.6832 -0.0329 0.0220  0.0408  21   DC  E "O3'" 
3361 C  "C2'" . DC  D 21  ? 0.5977 0.6671 0.6381 -0.0215 -0.0012 -0.0208 21   DC  E "C2'" 
3362 C  "C1'" . DC  D 21  ? 0.5961 0.5505 0.5978 -0.0120 -0.0281 -0.0107 21   DC  E "C1'" 
3363 N  N1    . DC  D 21  ? 0.5142 0.5019 0.4619 -0.0170 -0.0189 -0.0313 21   DC  E N1    
3364 C  C2    . DC  D 21  ? 0.4800 0.4937 0.4649 0.0264  -0.0210 -0.0576 21   DC  E C2    
3365 O  O2    . DC  D 21  ? 0.4383 0.5810 0.4127 0.0256  -0.0109 -0.0694 21   DC  E O2    
3366 N  N3    . DC  D 21  ? 0.4003 0.4299 0.4738 0.0114  -0.0069 -0.0922 21   DC  E N3    
3367 C  C4    . DC  D 21  ? 0.4536 0.4699 0.4823 -0.0092 0.0116  -0.0179 21   DC  E C4    
3368 N  N4    . DC  D 21  ? 0.4388 0.3934 0.4150 -0.0718 0.0326  -0.1022 21   DC  E N4    
3369 C  C5    . DC  D 21  ? 0.4329 0.4733 0.4877 0.0030  0.0220  -0.0901 21   DC  E C5    
3370 C  C6    . DC  D 21  ? 0.4660 0.4754 0.5037 0.0426  -0.0197 -0.0179 21   DC  E C6    
3371 P  P     . DA  D 22  ? 0.7341 0.7372 0.6848 -0.0671 -0.0211 0.0305  22   DA  E P     
3372 O  OP1   . DA  D 22  ? 0.6705 0.7419 0.6743 -0.1222 -0.0626 0.0348  22   DA  E OP1   
3373 O  OP2   . DA  D 22  ? 0.6528 0.7743 0.6900 -0.0018 -0.0041 0.0096  22   DA  E OP2   
3374 O  "O5'" . DA  D 22  ? 0.6455 0.7617 0.6692 -0.0965 0.0014  0.0076  22   DA  E "O5'" 
3375 C  "C5'" . DA  D 22  ? 0.7289 0.6504 0.6791 -0.0295 -0.0165 0.0087  22   DA  E "C5'" 
3376 C  "C4'" . DA  D 22  ? 0.7371 0.6860 0.6698 -0.0301 0.0028  -0.0081 22   DA  E "C4'" 
3377 O  "O4'" . DA  D 22  ? 0.7438 0.7206 0.5352 -0.0046 0.0169  -0.1123 22   DA  E "O4'" 
3378 C  "C3'" . DA  D 22  ? 0.6525 0.6905 0.5524 -0.0218 -0.0192 -0.0082 22   DA  E "C3'" 
3379 O  "O3'" . DA  D 22  ? 0.7437 0.7445 0.6510 -0.0456 0.0252  0.0385  22   DA  E "O3'" 
3380 C  "C2'" . DA  D 22  ? 0.6554 0.6438 0.6070 -0.0429 -0.0129 -0.0409 22   DA  E "C2'" 
3381 C  "C1'" . DA  D 22  ? 0.6199 0.5666 0.5837 -0.0279 -0.0097 -0.0044 22   DA  E "C1'" 
3382 N  N9    . DA  D 22  ? 0.5813 0.6035 0.5176 -0.0445 0.0219  -0.0431 22   DA  E N9    
3383 C  C8    . DA  D 22  ? 0.6136 0.6343 0.5988 0.0031  0.0503  -0.0266 22   DA  E C8    
3384 N  N7    . DA  D 22  ? 0.6145 0.5574 0.5879 -0.0315 0.0684  -0.0862 22   DA  E N7    
3385 C  C5    . DA  D 22  ? 0.6481 0.4949 0.5748 -0.0258 0.0105  -0.1050 22   DA  E C5    
3386 C  C6    . DA  D 22  ? 0.5910 0.4984 0.4553 -0.0167 0.0368  -0.1106 22   DA  E C6    
3387 N  N6    . DA  D 22  ? 0.5137 0.4505 0.5783 0.0637  -0.0308 -0.1490 22   DA  E N6    
3388 N  N1    . DA  D 22  ? 0.7026 0.6195 0.6498 0.0300  -0.0772 -0.1220 22   DA  E N1    
3389 C  C2    . DA  D 22  ? 0.7151 0.5773 0.5622 0.0191  -0.0171 -0.0891 22   DA  E C2    
3390 N  N3    . DA  D 22  ? 0.5107 0.4427 0.5042 -0.0216 0.0385  -0.1614 22   DA  E N3    
3391 C  C4    . DA  D 22  ? 0.5532 0.5561 0.5839 -0.0581 -0.0174 -0.1030 22   DA  E C4    
3392 P  P     . DG  D 23  ? 0.7394 0.7285 0.5860 -0.0266 -0.0450 0.0321  23   DG  E P     
3393 O  OP1   . DG  D 23  ? 0.8193 0.7231 0.6914 -0.0260 0.0398  0.0672  23   DG  E OP1   
3394 O  OP2   . DG  D 23  ? 0.7122 0.8552 0.5662 -0.0031 -0.0117 0.0444  23   DG  E OP2   
3395 O  "O5'" . DG  D 23  ? 0.7364 0.7074 0.5836 0.0073  -0.0011 0.0068  23   DG  E "O5'" 
3396 C  "C5'" . DG  D 23  ? 0.7140 0.6175 0.4834 -0.0143 -0.0661 -0.0267 23   DG  E "C5'" 
3397 C  "C4'" . DG  D 23  ? 0.6575 0.6082 0.5192 -0.0078 -0.0355 -0.0233 23   DG  E "C4'" 
3398 O  "O4'" . DG  D 23  ? 0.6857 0.5357 0.4691 -0.0301 -0.0472 -0.0230 23   DG  E "O4'" 
3399 C  "C3'" . DG  D 23  ? 0.6608 0.6526 0.5088 -0.0064 -0.0376 -0.0258 23   DG  E "C3'" 
3400 O  "O3'" . DG  D 23  ? 0.7210 0.7636 0.6264 -0.0498 -0.0102 -0.0410 23   DG  E "O3'" 
3401 C  "C2'" . DG  D 23  ? 0.6845 0.5511 0.4627 -0.0337 -0.0048 -0.0129 23   DG  E "C2'" 
3402 C  "C1'" . DG  D 23  ? 0.6440 0.5359 0.4947 -0.0712 -0.0133 -0.0037 23   DG  E "C1'" 
3403 N  N9    . DG  D 23  ? 0.5206 0.5099 0.5269 -0.0550 0.0081  -0.0040 23   DG  E N9    
3404 C  C8    . DG  D 23  ? 0.5896 0.5070 0.5889 -0.0331 -0.0221 -0.0168 23   DG  E C8    
3405 N  N7    . DG  D 23  ? 0.6847 0.4798 0.5809 -0.0683 -0.0471 -0.0449 23   DG  E N7    
3406 C  C5    . DG  D 23  ? 0.5391 0.4686 0.4998 -0.0074 -0.0281 -0.0565 23   DG  E C5    
3407 C  C6    . DG  D 23  ? 0.5482 0.4022 0.5240 -0.0484 -0.0010 -0.1071 23   DG  E C6    
3408 O  O6    . DG  D 23  ? 0.6217 0.4705 0.5889 0.0190  -0.0977 -0.0269 23   DG  E O6    
3409 N  N1    . DG  D 23  ? 0.5239 0.4128 0.5263 -0.0881 0.0176  -0.1431 23   DG  E N1    
3410 C  C2    . DG  D 23  ? 0.5728 0.4098 0.4717 -0.0479 -0.0167 -0.0629 23   DG  E C2    
3411 N  N2    . DG  D 23  ? 0.6916 0.6176 0.5793 -0.0503 0.0166  -0.0224 23   DG  E N2    
3412 N  N3    . DG  D 23  ? 0.6504 0.4560 0.3954 -0.0449 0.0242  -0.1032 23   DG  E N3    
3413 C  C4    . DG  D 23  ? 0.5356 0.5155 0.5168 -0.0551 -0.0142 -0.0807 23   DG  E C4    
3414 P  P     . DA  D 24  ? 0.6908 0.8357 0.6807 -0.0356 -0.0610 -0.0121 24   DA  E P     
3415 O  OP1   . DA  D 24  ? 0.7792 0.7752 0.7192 -0.0240 -0.0521 0.0029  24   DA  E OP1   
3416 O  OP2   . DA  D 24  ? 0.6868 0.7982 0.6005 -0.0372 -0.1015 -0.1062 24   DA  E OP2   
3417 O  "O5'" . DA  D 24  ? 0.6906 0.7321 0.7376 -0.0747 -0.0455 -0.0232 24   DA  E "O5'" 
3418 C  "C5'" . DA  D 24  ? 0.7256 0.6729 0.7139 -0.0307 -0.0700 0.0055  24   DA  E "C5'" 
3419 C  "C4'" . DA  D 24  ? 0.7040 0.5907 0.7972 -0.0304 -0.0428 -0.0092 24   DA  E "C4'" 
3420 O  "O4'" . DA  D 24  ? 0.6767 0.4300 0.7932 -0.0122 -0.1081 -0.0082 24   DA  E "O4'" 
3421 C  "C3'" . DA  D 24  ? 0.6683 0.6606 0.7895 -0.0027 -0.0304 -0.0269 24   DA  E "C3'" 
3422 O  "O3'" . DA  D 24  ? 0.6890 0.7477 0.8190 -0.0029 -0.0111 0.0391  24   DA  E "O3'" 
3423 C  "C2'" . DA  D 24  ? 0.6001 0.5782 0.7171 -0.0258 -0.0477 -0.0434 24   DA  E "C2'" 
3424 C  "C1'" . DA  D 24  ? 0.5715 0.5210 0.6321 0.0156  -0.0560 -0.0202 24   DA  E "C1'" 
3425 N  N9    . DA  D 24  ? 0.6009 0.4259 0.5156 0.0122  -0.0213 -0.0149 24   DA  E N9    
3426 C  C8    . DA  D 24  ? 0.4579 0.4967 0.5558 -0.0397 -0.0248 -0.0283 24   DA  E C8    
3427 N  N7    . DA  D 24  ? 0.6158 0.4917 0.5872 -0.0831 -0.0492 -0.0131 24   DA  E N7    
3428 C  C5    . DA  D 24  ? 0.5567 0.4564 0.5139 -0.0524 -0.0246 -0.0257 24   DA  E C5    
3429 C  C6    . DA  D 24  ? 0.5464 0.4119 0.4877 -0.0318 -0.0304 -0.0666 24   DA  E C6    
3430 N  N6    . DA  D 24  ? 0.5340 0.4539 0.4248 -0.0322 0.0442  -0.0927 24   DA  E N6    
3431 N  N1    . DA  D 24  ? 0.5900 0.4018 0.4693 -0.0178 0.0123  -0.0876 24   DA  E N1    
3432 C  C2    . DA  D 24  ? 0.4646 0.4641 0.4782 -0.0215 -0.0828 -0.0472 24   DA  E C2    
3433 N  N3    . DA  D 24  ? 0.5059 0.4547 0.4384 -0.0596 -0.0536 -0.0366 24   DA  E N3    
3434 C  C4    . DA  D 24  ? 0.5081 0.4531 0.4893 -0.0534 -0.0406 -0.0492 24   DA  E C4    
3435 CA CA    . CA  E .   ? 0.2818 0.3401 0.3361 0.0135  -0.0117 0.0145  1154 CA  A CA    
3436 CA CA    . CA  F .   ? 0.2825 0.3527 0.3236 0.0016  0.0037  -0.0062 1155 CA  A CA    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   2   2   ASN ASN A . n 
A 1 2   THR 2   3   3   THR THR A . n 
A 1 3   LYS 3   4   4   LYS LYS A . n 
A 1 4   TYR 4   5   5   TYR TYR A . n 
A 1 5   ASN 5   6   6   ASN ASN A . n 
A 1 6   LYS 6   7   7   LYS LYS A . n 
A 1 7   GLU 7   8   8   GLU GLU A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   LEU 9   10  10  LEU LEU A . n 
A 1 10  LEU 10  11  11  LEU LEU A . n 
A 1 11  TYR 11  12  12  TYR TYR A . n 
A 1 12  LEU 12  13  13  LEU LEU A . n 
A 1 13  ALA 13  14  14  ALA ALA A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  PHE 15  16  16  PHE PHE A . n 
A 1 16  VAL 16  17  17  VAL VAL A . n 
A 1 17  ASP 17  18  18  ASP ASP A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ASP 19  20  20  ASP ASP A . n 
A 1 20  GLY 20  21  21  GLY GLY A . n 
A 1 21  SER 21  22  22  SER SER A . n 
A 1 22  ILE 22  23  23  ILE ILE A . n 
A 1 23  ILE 23  24  24  ILE ILE A . n 
A 1 24  ALA 24  25  25  ALA ALA A . n 
A 1 25  GLN 25  26  26  GLN GLN A . n 
A 1 26  ILE 26  27  27  ILE ILE A . n 
A 1 27  GLU 27  28  28  GLU GLU A . n 
A 1 28  PRO 28  29  29  PRO PRO A . n 
A 1 29  ASN 29  30  30  ASN ASN A . n 
A 1 30  GLN 30  31  31  GLN GLN A . n 
A 1 31  SER 31  32  32  SER SER A . n 
A 1 32  TYR 32  33  33  TYR TYR A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  PHE 34  35  35  PHE PHE A . n 
A 1 35  LYS 35  36  36  LYS LYS A . n 
A 1 36  HIS 36  37  37  HIS HIS A . n 
A 1 37  ARG 37  38  38  ARG ARG A . n 
A 1 38  LEU 38  39  39  LEU LEU A . n 
A 1 39  LYS 39  40  40  LYS LYS A . n 
A 1 40  LEU 40  41  41  LEU LEU A . n 
A 1 41  THR 41  42  42  THR THR A . n 
A 1 42  PHE 42  43  43  PHE PHE A . n 
A 1 43  LYS 43  44  44  LYS LYS A . n 
A 1 44  VAL 44  45  45  VAL VAL A . n 
A 1 45  THR 45  46  46  THR THR A . n 
A 1 46  GLN 46  47  47  GLN GLN A . n 
A 1 47  LYS 47  48  48  LYS LYS A . n 
A 1 48  THR 48  49  49  THR THR A . n 
A 1 49  GLN 49  50  50  GLN GLN A . n 
A 1 50  ARG 50  51  51  ARG ARG A . n 
A 1 51  ARG 51  52  52  ARG ARG A . n 
A 1 52  TRP 52  53  53  TRP TRP A . n 
A 1 53  PHE 53  54  54  PHE PHE A . n 
A 1 54  LEU 54  55  55  LEU LEU A . n 
A 1 55  ASP 55  56  56  ASP ASP A . n 
A 1 56  LYS 56  57  57  LYS LYS A . n 
A 1 57  LEU 57  58  58  LEU LEU A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  ASP 59  60  60  ASP ASP A . n 
A 1 60  GLU 60  61  61  GLU GLU A . n 
A 1 61  ILE 61  62  62  ILE ILE A . n 
A 1 62  GLY 62  63  63  GLY GLY A . n 
A 1 63  VAL 63  64  64  VAL VAL A . n 
A 1 64  GLY 64  65  65  GLY GLY A . n 
A 1 65  TYR 65  66  66  TYR TYR A . n 
A 1 66  VAL 66  67  67  VAL VAL A . n 
A 1 67  ARG 67  68  68  ARG ARG A . n 
A 1 68  ASP 68  69  69  ASP ASP A . n 
A 1 69  GLU 69  70  70  GLU GLU A . n 
A 1 70  GLY 70  71  71  GLY GLY A . n 
A 1 71  SER 71  72  72  SER SER A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  SER 73  74  74  SER SER A . n 
A 1 74  ASN 74  75  75  ASN ASN A . n 
A 1 75  TYR 75  76  76  TYR TYR A . n 
A 1 76  ILE 76  77  77  ILE ILE A . n 
A 1 77  LEU 77  78  78  LEU LEU A . n 
A 1 78  SER 78  79  79  SER SER A . n 
A 1 79  GLU 79  80  80  GLU GLU A . n 
A 1 80  ILE 80  81  81  ILE ILE A . n 
A 1 81  LYS 81  82  82  LYS LYS A . n 
A 1 82  PRO 82  83  83  PRO PRO A . n 
A 1 83  LEU 83  84  84  LEU LEU A . n 
A 1 84  ARG 84  85  85  ARG ARG A . n 
A 1 85  ASN 85  86  86  ASN ASN A . n 
A 1 86  PHE 86  87  87  PHE PHE A . n 
A 1 87  LEU 87  88  88  LEU LEU A . n 
A 1 88  THR 88  89  89  THR THR A . n 
A 1 89  GLN 89  90  90  GLN GLN A . n 
A 1 90  LEU 90  91  91  LEU LEU A . n 
A 1 91  GLN 91  92  92  GLN GLN A . n 
A 1 92  PRO 92  93  93  PRO PRO A . n 
A 1 93  PHE 93  94  94  PHE PHE A . n 
A 1 94  LEU 94  95  95  LEU LEU A . n 
A 1 95  LYS 95  96  96  LYS LYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  LYS 97  98  98  LYS LYS A . n 
A 1 98  GLN 98  99  99  GLN GLN A . n 
A 1 99  LYS 99  100 100 LYS LYS A . n 
A 1 100 GLN 100 101 101 GLN GLN A . n 
A 1 101 ALA 101 102 102 ALA ALA A . n 
A 1 102 ASN 102 103 103 ASN ASN A . n 
A 1 103 LEU 103 104 104 LEU LEU A . n 
A 1 104 VAL 104 105 105 VAL VAL A . n 
A 1 105 LEU 105 106 106 LEU LEU A . n 
A 1 106 LYS 106 107 107 LYS LYS A . n 
A 1 107 ILE 107 108 108 ILE ILE A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 GLU 109 110 110 GLU GLU A . n 
A 1 110 GLN 110 111 111 GLN GLN A . n 
A 1 111 LEU 111 112 112 LEU LEU A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 SER 113 114 114 SER SER A . n 
A 1 114 ALA 114 115 115 ALA ALA A . n 
A 1 115 LYS 115 116 116 LYS LYS A . n 
A 1 116 GLU 116 117 117 GLU GLU A . n 
A 1 117 SER 117 118 118 SER SER A . n 
A 1 118 PRO 118 119 119 PRO PRO A . n 
A 1 119 ASP 119 120 120 ASP ASP A . n 
A 1 120 LYS 120 121 121 LYS LYS A . n 
A 1 121 PHE 121 122 122 PHE PHE A . n 
A 1 122 LEU 122 123 123 LEU LEU A . n 
A 1 123 GLU 123 124 124 GLU GLU A . n 
A 1 124 VAL 124 125 125 VAL VAL A . n 
A 1 125 CYS 125 126 126 CYS CYS A . n 
A 1 126 THR 126 127 127 THR THR A . n 
A 1 127 TRP 127 128 128 TRP TRP A . n 
A 1 128 VAL 128 129 129 VAL VAL A . n 
A 1 129 ASP 129 130 130 ASP ASP A . n 
A 1 130 GLN 130 131 131 GLN GLN A . n 
A 1 131 ILE 131 132 132 ILE ILE A . n 
A 1 132 ALA 132 133 133 ALA ALA A . n 
A 1 133 ALA 133 134 134 ALA ALA A . n 
A 1 134 LEU 134 135 135 LEU LEU A . n 
A 1 135 ASN 135 136 136 ASN ASN A . n 
A 1 136 ASP 136 137 137 ASP ASP A . n 
A 1 137 SER 137 138 138 SER SER A . n 
A 1 138 LYS 138 139 139 LYS LYS A . n 
A 1 139 THR 139 140 140 THR THR A . n 
A 1 140 ARG 140 141 141 ARG ARG A . n 
A 1 141 LYS 141 142 142 LYS LYS A . n 
A 1 142 THR 142 143 143 THR THR A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 SER 144 145 145 SER SER A . n 
A 1 145 GLU 145 146 146 GLU GLU A . n 
A 1 146 THR 146 147 147 THR THR A . n 
A 1 147 VAL 147 148 148 VAL VAL A . n 
A 1 148 ARG 148 149 149 ARG ARG A . n 
A 1 149 ALA 149 150 150 ALA ALA A . n 
A 1 150 VAL 150 151 151 VAL VAL A . n 
A 1 151 LEU 151 152 152 LEU LEU A . n 
A 1 152 ASP 152 153 153 ASP ASP A . n 
B 2 1   ASN 1   2   2   ASN ASN B . n 
B 2 2   THR 2   3   3   THR THR B . n 
B 2 3   LYS 3   4   4   LYS LYS B . n 
B 2 4   TYR 4   5   5   TYR TYR B . n 
B 2 5   ASN 5   6   6   ASN ASN B . n 
B 2 6   LYS 6   7   7   LYS LYS B . n 
B 2 7   GLU 7   8   8   GLU GLU B . n 
B 2 8   PHE 8   9   9   PHE PHE B . n 
B 2 9   LEU 9   10  10  LEU LEU B . n 
B 2 10  LEU 10  11  11  LEU LEU B . n 
B 2 11  TYR 11  12  12  TYR TYR B . n 
B 2 12  LEU 12  13  13  LEU LEU B . n 
B 2 13  ALA 13  14  14  ALA ALA B . n 
B 2 14  GLY 14  15  15  GLY GLY B . n 
B 2 15  PHE 15  16  16  PHE PHE B . n 
B 2 16  VAL 16  17  17  VAL VAL B . n 
B 2 17  ASP 17  18  18  ASP ASP B . n 
B 2 18  ALA 18  19  19  ALA ALA B . n 
B 2 19  ASP 19  20  20  ASP ASP B . n 
B 2 20  GLY 20  21  21  GLY GLY B . n 
B 2 21  SER 21  22  22  SER SER B . n 
B 2 22  ILE 22  23  23  ILE ILE B . n 
B 2 23  ILE 23  24  24  ILE ILE B . n 
B 2 24  ALA 24  25  25  ALA ALA B . n 
B 2 25  GLN 25  26  26  GLN GLN B . n 
B 2 26  ILE 26  27  27  ILE ILE B . n 
B 2 27  GLU 27  28  28  GLU GLU B . n 
B 2 28  PRO 28  29  29  PRO PRO B . n 
B 2 29  ASN 29  30  30  ASN ASN B . n 
B 2 30  GLN 30  31  31  GLN GLN B . n 
B 2 31  SER 31  32  32  SER SER B . n 
B 2 32  SER 32  33  33  SER SER B . n 
B 2 33  LYS 33  34  34  LYS LYS B . n 
B 2 34  PHE 34  35  35  PHE PHE B . n 
B 2 35  LYS 35  36  36  LYS LYS B . n 
B 2 36  HIS 36  37  37  HIS HIS B . n 
B 2 37  ARG 37  38  38  ARG ARG B . n 
B 2 38  LEU 38  39  39  LEU LEU B . n 
B 2 39  LYS 39  40  40  LYS LYS B . n 
B 2 40  LEU 40  41  41  LEU LEU B . n 
B 2 41  THR 41  42  42  THR THR B . n 
B 2 42  PHE 42  43  43  PHE PHE B . n 
B 2 43  GLN 43  44  44  GLN GLN B . n 
B 2 44  VAL 44  45  45  VAL VAL B . n 
B 2 45  THR 45  46  46  THR THR B . n 
B 2 46  GLN 46  47  47  GLN GLN B . n 
B 2 47  LYS 47  48  48  LYS LYS B . n 
B 2 48  THR 48  49  49  THR THR B . n 
B 2 49  GLN 49  50  50  GLN GLN B . n 
B 2 50  ARG 50  51  51  ARG ARG B . n 
B 2 51  ARG 51  52  52  ARG ARG B . n 
B 2 52  TRP 52  53  53  TRP TRP B . n 
B 2 53  PHE 53  54  54  PHE PHE B . n 
B 2 54  LEU 54  55  55  LEU LEU B . n 
B 2 55  ASP 55  56  56  ASP ASP B . n 
B 2 56  LYS 56  57  57  LYS LYS B . n 
B 2 57  LEU 57  58  58  LEU LEU B . n 
B 2 58  VAL 58  59  59  VAL VAL B . n 
B 2 59  ASP 59  60  60  ASP ASP B . n 
B 2 60  GLU 60  61  61  GLU GLU B . n 
B 2 61  ILE 61  62  62  ILE ILE B . n 
B 2 62  GLY 62  63  63  GLY GLY B . n 
B 2 63  VAL 63  64  64  VAL VAL B . n 
B 2 64  GLY 64  65  65  GLY GLY B . n 
B 2 65  TYR 65  66  66  TYR TYR B . n 
B 2 66  VAL 66  67  67  VAL VAL B . n 
B 2 67  ARG 67  68  68  ARG ARG B . n 
B 2 68  ASP 68  69  69  ASP ASP B . n 
B 2 69  SER 69  70  70  SER SER B . n 
B 2 70  GLY 70  71  71  GLY GLY B . n 
B 2 71  SER 71  72  72  SER SER B . n 
B 2 72  VAL 72  73  73  VAL VAL B . n 
B 2 73  SER 73  74  74  SER SER B . n 
B 2 74  ASN 74  75  75  ASN ASN B . n 
B 2 75  TYR 75  76  76  TYR TYR B . n 
B 2 76  ILE 76  77  77  ILE ILE B . n 
B 2 77  LEU 77  78  78  LEU LEU B . n 
B 2 78  SER 78  79  79  SER SER B . n 
B 2 79  GLU 79  80  80  GLU GLU B . n 
B 2 80  ILE 80  81  81  ILE ILE B . n 
B 2 81  LYS 81  82  82  LYS LYS B . n 
B 2 82  PRO 82  83  83  PRO PRO B . n 
B 2 83  LEU 83  84  84  LEU LEU B . n 
B 2 84  HIS 84  85  85  HIS HIS B . n 
B 2 85  ASN 85  86  86  ASN ASN B . n 
B 2 86  PHE 86  87  87  PHE PHE B . n 
B 2 87  LEU 87  88  88  LEU LEU B . n 
B 2 88  THR 88  89  89  THR THR B . n 
B 2 89  GLN 89  90  90  GLN GLN B . n 
B 2 90  LEU 90  91  91  LEU LEU B . n 
B 2 91  GLN 91  92  92  GLN GLN B . n 
B 2 92  PRO 92  93  93  PRO PRO B . n 
B 2 93  PHE 93  94  94  PHE PHE B . n 
B 2 94  LEU 94  95  95  LEU LEU B . n 
B 2 95  LYS 95  96  96  LYS LYS B . n 
B 2 96  LEU 96  97  97  LEU LEU B . n 
B 2 97  LYS 97  98  98  LYS LYS B . n 
B 2 98  GLN 98  99  99  GLN GLN B . n 
B 2 99  LYS 99  100 100 LYS LYS B . n 
B 2 100 GLN 100 101 101 GLN GLN B . n 
B 2 101 ALA 101 102 102 ALA ALA B . n 
B 2 102 ASN 102 103 103 ASN ASN B . n 
B 2 103 LEU 103 104 104 LEU LEU B . n 
B 2 104 VAL 104 105 105 VAL VAL B . n 
B 2 105 LEU 105 106 106 LEU LEU B . n 
B 2 106 LYS 106 107 107 LYS LYS B . n 
B 2 107 ILE 107 108 108 ILE ILE B . n 
B 2 108 ILE 108 109 109 ILE ILE B . n 
B 2 109 GLU 109 110 110 GLU GLU B . n 
B 2 110 GLN 110 111 111 GLN GLN B . n 
B 2 111 LEU 111 112 112 LEU LEU B . n 
B 2 112 PRO 112 113 113 PRO PRO B . n 
B 2 113 SER 113 114 114 SER SER B . n 
B 2 114 ALA 114 115 115 ALA ALA B . n 
B 2 115 LYS 115 116 116 LYS LYS B . n 
B 2 116 GLU 116 117 117 GLU GLU B . n 
B 2 117 SER 117 118 118 SER SER B . n 
B 2 118 PRO 118 119 119 PRO PRO B . n 
B 2 119 ASP 119 120 120 ASP ASP B . n 
B 2 120 LYS 120 121 121 LYS LYS B . n 
B 2 121 PHE 121 122 122 PHE PHE B . n 
B 2 122 LEU 122 123 123 LEU LEU B . n 
B 2 123 GLU 123 124 124 GLU GLU B . n 
B 2 124 VAL 124 125 125 VAL VAL B . n 
B 2 125 CYS 125 126 126 CYS CYS B . n 
B 2 126 THR 126 127 127 THR THR B . n 
B 2 127 TRP 127 128 128 TRP TRP B . n 
B 2 128 VAL 128 129 129 VAL VAL B . n 
B 2 129 ASP 129 130 130 ASP ASP B . n 
B 2 130 GLN 130 131 131 GLN GLN B . n 
B 2 131 ILE 131 132 132 ILE ILE B . n 
B 2 132 ALA 132 133 133 ALA ALA B . n 
B 2 133 ALA 133 134 134 ALA ALA B . n 
B 2 134 LEU 134 135 135 LEU LEU B . n 
B 2 135 ASN 135 136 136 ASN ASN B . n 
B 2 136 ASP 136 137 137 ASP ASP B . n 
B 2 137 SER 137 138 138 SER SER B . n 
B 2 138 LYS 138 139 139 LYS LYS B . n 
B 2 139 THR 139 140 140 THR THR B . n 
B 2 140 ARG 140 141 141 ARG ARG B . n 
B 2 141 LYS 141 142 142 LYS LYS B . n 
B 2 142 THR 142 143 143 THR THR B . n 
B 2 143 THR 143 144 144 THR THR B . n 
B 2 144 SER 144 145 145 SER SER B . n 
B 2 145 GLU 145 146 146 GLU GLU B . n 
B 2 146 THR 146 147 147 THR THR B . n 
B 2 147 VAL 147 148 148 VAL VAL B . n 
B 2 148 ARG 148 149 149 ARG ARG B . n 
B 2 149 ALA 149 150 150 ALA ALA B . n 
B 2 150 VAL 150 151 151 VAL VAL B . n 
B 2 151 LEU 151 152 152 LEU LEU B . n 
B 2 152 ASP 152 153 153 ASP ASP B . n 
C 3 1   DT  1   1   1   DT  DT  C . n 
C 3 2   DC  2   2   2   DC  DC  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DC  5   5   5   DC  DC  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DT  7   7   7   DT  DT  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DT  9   9   9   DT  DT  C . n 
C 3 10  DT  10  10  10  DT  DT  C . n 
C 3 11  DT  11  11  11  DT  DT  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DG  13  13  13  DG  DG  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DA  15  15  15  DA  DA  C . n 
C 3 16  DG  16  16  16  DG  DG  C . n 
C 3 17  DG  17  17  17  DG  DG  C . n 
C 3 18  DA  18  18  18  DA  DA  C . n 
C 3 19  DT  19  19  19  DT  DT  C . n 
C 3 20  DC  20  20  20  DC  DC  C . n 
C 3 21  DC  21  21  21  DC  DC  C . n 
C 3 22  DT  22  22  22  DT  DT  C . n 
C 3 23  DA  23  23  23  DA  DA  C . n 
C 3 24  DA  24  24  24  DA  DA  C . n 
D 4 1   DT  1   1   1   DT  DT  E . n 
D 4 2   DT  2   2   2   DT  DT  E . n 
D 4 3   DA  3   3   3   DA  DA  E . n 
D 4 4   DG  4   4   4   DG  DG  E . n 
D 4 5   DG  5   5   5   DG  DG  E . n 
D 4 6   DA  6   6   6   DA  DA  E . n 
D 4 7   DT  7   7   7   DT  DT  E . n 
D 4 8   DC  8   8   8   DC  DC  E . n 
D 4 9   DC  9   9   9   DC  DC  E . n 
D 4 10  DT  10  10  10  DT  DT  E . n 
D 4 11  DT  11  11  11  DT  DT  E . n 
D 4 12  DC  12  12  12  DC  DC  E . n 
D 4 13  DA  13  13  13  DA  DA  E . n 
D 4 14  DA  14  14  14  DA  DA  E . n 
D 4 15  DA  15  15  15  DA  DA  E . n 
D 4 16  DA  16  16  16  DA  DA  E . n 
D 4 17  DA  17  17  17  DA  DA  E . n 
D 4 18  DA  18  18  18  DA  DA  E . n 
D 4 19  DG  19  19  19  DG  DG  E . n 
D 4 20  DG  20  20  20  DG  DG  E . n 
D 4 21  DC  21  21  21  DC  DC  E . n 
D 4 22  DA  22  22  22  DA  DA  E . n 
D 4 23  DG  23  23  23  DG  DG  E . n 
D 4 24  DA  24  24  24  DA  DA  E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 CA  1   1154 1154 CA  CA  A . 
F 5 CA  1   1155 1155 CA  CA  A . 
G 6 HOH 1   1001 1001 HOH HOH A . 
G 6 HOH 2   1002 1002 HOH HOH A . 
G 6 HOH 3   1003 1003 HOH HOH A . 
G 6 HOH 4   1004 1004 HOH HOH A . 
G 6 HOH 5   1005 1005 HOH HOH A . 
G 6 HOH 6   1006 1006 HOH HOH A . 
G 6 HOH 7   1007 1007 HOH HOH A . 
G 6 HOH 8   1008 1008 HOH HOH A . 
G 6 HOH 9   1009 1009 HOH HOH A . 
G 6 HOH 10  1010 1010 HOH HOH A . 
G 6 HOH 11  1011 1011 HOH HOH A . 
G 6 HOH 12  1012 1012 HOH HOH A . 
G 6 HOH 13  1013 1013 HOH HOH A . 
G 6 HOH 14  1014 1014 HOH HOH A . 
G 6 HOH 15  1015 1015 HOH HOH A . 
G 6 HOH 16  1016 1016 HOH HOH A . 
G 6 HOH 17  1017 1017 HOH HOH A . 
G 6 HOH 18  1018 1018 HOH HOH A . 
G 6 HOH 19  1019 1019 HOH HOH A . 
G 6 HOH 20  1020 1020 HOH HOH A . 
G 6 HOH 21  1021 1021 HOH HOH A . 
G 6 HOH 22  1022 1022 HOH HOH A . 
G 6 HOH 23  1023 1023 HOH HOH A . 
G 6 HOH 24  1024 1024 HOH HOH A . 
G 6 HOH 25  1025 1025 HOH HOH A . 
G 6 HOH 26  1026 1026 HOH HOH A . 
G 6 HOH 27  1027 1027 HOH HOH A . 
G 6 HOH 28  1028 1028 HOH HOH A . 
G 6 HOH 29  1029 1029 HOH HOH A . 
G 6 HOH 30  1030 1030 HOH HOH A . 
G 6 HOH 31  1031 1031 HOH HOH A . 
G 6 HOH 32  1032 1032 HOH HOH A . 
G 6 HOH 33  1033 1033 HOH HOH A . 
G 6 HOH 34  1034 1034 HOH HOH A . 
G 6 HOH 35  1035 1035 HOH HOH A . 
G 6 HOH 36  1036 1036 HOH HOH A . 
G 6 HOH 37  1037 1037 HOH HOH A . 
G 6 HOH 38  1038 1038 HOH HOH A . 
G 6 HOH 39  1039 1039 HOH HOH A . 
G 6 HOH 40  1040 1040 HOH HOH A . 
G 6 HOH 41  1041 1041 HOH HOH A . 
G 6 HOH 42  1042 1042 HOH HOH A . 
G 6 HOH 43  1043 1043 HOH HOH A . 
G 6 HOH 44  1044 1044 HOH HOH A . 
G 6 HOH 45  1045 1045 HOH HOH A . 
G 6 HOH 46  1046 1046 HOH HOH A . 
G 6 HOH 47  1047 1047 HOH HOH A . 
G 6 HOH 48  1048 1048 HOH HOH A . 
G 6 HOH 49  1049 1049 HOH HOH A . 
G 6 HOH 50  1050 1050 HOH HOH A . 
G 6 HOH 51  1051 1051 HOH HOH A . 
G 6 HOH 52  1052 1052 HOH HOH A . 
G 6 HOH 53  1053 1053 HOH HOH A . 
G 6 HOH 54  1054 1054 HOH HOH A . 
G 6 HOH 55  1055 1055 HOH HOH A . 
G 6 HOH 56  1056 1056 HOH HOH A . 
G 6 HOH 57  1057 1057 HOH HOH A . 
G 6 HOH 58  1058 1058 HOH HOH A . 
G 6 HOH 59  1059 1059 HOH HOH A . 
G 6 HOH 60  1060 1060 HOH HOH A . 
G 6 HOH 61  1061 1061 HOH HOH A . 
G 6 HOH 62  1062 1062 HOH HOH A . 
G 6 HOH 63  1063 1063 HOH HOH A . 
G 6 HOH 64  1064 1064 HOH HOH A . 
G 6 HOH 65  1065 1065 HOH HOH A . 
G 6 HOH 66  1066 1066 HOH HOH A . 
G 6 HOH 67  1067 1067 HOH HOH A . 
G 6 HOH 68  1068 1068 HOH HOH A . 
G 6 HOH 69  1069 1069 HOH HOH A . 
G 6 HOH 70  1070 1070 HOH HOH A . 
G 6 HOH 71  1071 1071 HOH HOH A . 
G 6 HOH 72  1072 1072 HOH HOH A . 
G 6 HOH 73  1073 1073 HOH HOH A . 
G 6 HOH 74  1074 1074 HOH HOH A . 
G 6 HOH 75  1075 1075 HOH HOH A . 
G 6 HOH 76  1076 1076 HOH HOH A . 
G 6 HOH 77  1077 1077 HOH HOH A . 
G 6 HOH 78  1078 1078 HOH HOH A . 
G 6 HOH 79  1079 1079 HOH HOH A . 
G 6 HOH 80  1080 1080 HOH HOH A . 
G 6 HOH 81  1081 1081 HOH HOH A . 
G 6 HOH 82  1082 1082 HOH HOH A . 
G 6 HOH 83  1083 1083 HOH HOH A . 
G 6 HOH 84  1084 1084 HOH HOH A . 
G 6 HOH 85  1085 1085 HOH HOH A . 
G 6 HOH 86  1086 1086 HOH HOH A . 
G 6 HOH 87  1087 1087 HOH HOH A . 
G 6 HOH 88  1088 1088 HOH HOH A . 
G 6 HOH 89  1089 1089 HOH HOH A . 
H 6 HOH 1   1001 1001 HOH HOH B . 
H 6 HOH 2   1002 1002 HOH HOH B . 
H 6 HOH 3   1003 1003 HOH HOH B . 
H 6 HOH 4   1004 1004 HOH HOH B . 
H 6 HOH 5   1005 1005 HOH HOH B . 
H 6 HOH 6   1006 1006 HOH HOH B . 
H 6 HOH 7   1007 1007 HOH HOH B . 
H 6 HOH 8   1008 1008 HOH HOH B . 
H 6 HOH 9   1009 1009 HOH HOH B . 
H 6 HOH 10  1010 1010 HOH HOH B . 
H 6 HOH 11  1011 1011 HOH HOH B . 
H 6 HOH 12  1012 1012 HOH HOH B . 
H 6 HOH 13  1013 1013 HOH HOH B . 
H 6 HOH 14  1014 1014 HOH HOH B . 
H 6 HOH 15  1015 1015 HOH HOH B . 
H 6 HOH 16  1016 1016 HOH HOH B . 
H 6 HOH 17  1017 1017 HOH HOH B . 
H 6 HOH 18  1018 1018 HOH HOH B . 
H 6 HOH 19  1019 1019 HOH HOH B . 
H 6 HOH 20  1020 1020 HOH HOH B . 
H 6 HOH 21  1021 1021 HOH HOH B . 
H 6 HOH 22  1022 1022 HOH HOH B . 
H 6 HOH 23  1023 1023 HOH HOH B . 
H 6 HOH 24  1024 1024 HOH HOH B . 
H 6 HOH 25  1025 1025 HOH HOH B . 
H 6 HOH 26  1026 1026 HOH HOH B . 
H 6 HOH 27  1027 1027 HOH HOH B . 
H 6 HOH 28  1028 1028 HOH HOH B . 
H 6 HOH 29  1029 1029 HOH HOH B . 
H 6 HOH 30  1030 1030 HOH HOH B . 
H 6 HOH 31  1031 1031 HOH HOH B . 
H 6 HOH 32  1032 1032 HOH HOH B . 
H 6 HOH 33  1033 1033 HOH HOH B . 
H 6 HOH 34  1034 1034 HOH HOH B . 
H 6 HOH 35  1035 1035 HOH HOH B . 
H 6 HOH 36  1036 1036 HOH HOH B . 
H 6 HOH 37  1037 1037 HOH HOH B . 
H 6 HOH 38  1038 1038 HOH HOH B . 
H 6 HOH 39  1039 1039 HOH HOH B . 
H 6 HOH 40  1040 1040 HOH HOH B . 
H 6 HOH 41  1041 1041 HOH HOH B . 
H 6 HOH 42  1042 1042 HOH HOH B . 
H 6 HOH 43  1043 1043 HOH HOH B . 
H 6 HOH 44  1044 1044 HOH HOH B . 
H 6 HOH 45  1045 1045 HOH HOH B . 
H 6 HOH 46  1046 1046 HOH HOH B . 
H 6 HOH 47  1047 1047 HOH HOH B . 
H 6 HOH 48  1048 1048 HOH HOH B . 
H 6 HOH 49  1049 1049 HOH HOH B . 
H 6 HOH 50  1050 1050 HOH HOH B . 
H 6 HOH 51  1051 1051 HOH HOH B . 
H 6 HOH 52  1052 1052 HOH HOH B . 
H 6 HOH 53  1053 1053 HOH HOH B . 
H 6 HOH 54  1054 1054 HOH HOH B . 
H 6 HOH 55  1055 1055 HOH HOH B . 
H 6 HOH 56  1056 1056 HOH HOH B . 
H 6 HOH 57  1057 1057 HOH HOH B . 
H 6 HOH 58  1058 1058 HOH HOH B . 
H 6 HOH 59  1059 1059 HOH HOH B . 
H 6 HOH 60  1060 1060 HOH HOH B . 
H 6 HOH 61  1061 1061 HOH HOH B . 
H 6 HOH 62  1062 1062 HOH HOH B . 
H 6 HOH 63  1063 1063 HOH HOH B . 
H 6 HOH 64  1064 1064 HOH HOH B . 
H 6 HOH 65  1065 1065 HOH HOH B . 
H 6 HOH 66  1066 1066 HOH HOH B . 
H 6 HOH 67  1067 1067 HOH HOH B . 
H 6 HOH 68  1068 1068 HOH HOH B . 
H 6 HOH 69  1069 1069 HOH HOH B . 
H 6 HOH 70  1070 1070 HOH HOH B . 
H 6 HOH 71  1071 1071 HOH HOH B . 
H 6 HOH 72  1072 1072 HOH HOH B . 
H 6 HOH 73  1073 1073 HOH HOH B . 
H 6 HOH 74  1074 1074 HOH HOH B . 
H 6 HOH 75  1075 1075 HOH HOH B . 
H 6 HOH 76  1076 1076 HOH HOH B . 
H 6 HOH 77  1077 1077 HOH HOH B . 
H 6 HOH 78  1078 1078 HOH HOH B . 
H 6 HOH 79  1079 1079 HOH HOH B . 
H 6 HOH 80  1080 1080 HOH HOH B . 
H 6 HOH 81  1081 1081 HOH HOH B . 
H 6 HOH 82  1082 1082 HOH HOH B . 
H 6 HOH 83  1083 1083 HOH HOH B . 
H 6 HOH 84  1084 1084 HOH HOH B . 
H 6 HOH 85  1085 1085 HOH HOH B . 
H 6 HOH 86  1086 1086 HOH HOH B . 
H 6 HOH 87  1087 1087 HOH HOH B . 
H 6 HOH 88  1088 1088 HOH HOH B . 
H 6 HOH 89  1089 1089 HOH HOH B . 
H 6 HOH 90  1090 1090 HOH HOH B . 
H 6 HOH 91  1091 1091 HOH HOH B . 
H 6 HOH 92  1092 1092 HOH HOH B . 
H 6 HOH 93  1093 1093 HOH HOH B . 
H 6 HOH 94  1094 1094 HOH HOH B . 
H 6 HOH 95  1095 1095 HOH HOH B . 
H 6 HOH 96  1096 1096 HOH HOH B . 
H 6 HOH 97  1097 1097 HOH HOH B . 
H 6 HOH 98  1098 1098 HOH HOH B . 
H 6 HOH 99  1099 1099 HOH HOH B . 
H 6 HOH 100 1100 1100 HOH HOH B . 
H 6 HOH 101 1101 1101 HOH HOH B . 
H 6 HOH 102 1102 1102 HOH HOH B . 
H 6 HOH 103 1103 1103 HOH HOH B . 
H 6 HOH 104 1104 1104 HOH HOH B . 
H 6 HOH 105 1105 1105 HOH HOH B . 
H 6 HOH 106 1106 1106 HOH HOH B . 
H 6 HOH 107 1107 1107 HOH HOH B . 
H 6 HOH 108 1108 1108 HOH HOH B . 
H 6 HOH 109 1109 1109 HOH HOH B . 
H 6 HOH 110 1110 1110 HOH HOH B . 
I 6 HOH 1   1001 1001 HOH HOH C . 
I 6 HOH 2   1002 1002 HOH HOH C . 
I 6 HOH 3   1003 1003 HOH HOH C . 
I 6 HOH 4   1004 1004 HOH HOH C . 
I 6 HOH 5   1005 1005 HOH HOH C . 
I 6 HOH 6   1006 1006 HOH HOH C . 
I 6 HOH 7   1007 1007 HOH HOH C . 
I 6 HOH 8   1008 1008 HOH HOH C . 
I 6 HOH 9   1009 1009 HOH HOH C . 
I 6 HOH 10  1010 1010 HOH HOH C . 
I 6 HOH 11  1011 1011 HOH HOH C . 
I 6 HOH 12  1012 1012 HOH HOH C . 
I 6 HOH 13  1013 1013 HOH HOH C . 
I 6 HOH 14  1014 1014 HOH HOH C . 
I 6 HOH 15  1015 1015 HOH HOH C . 
I 6 HOH 16  1016 1016 HOH HOH C . 
I 6 HOH 17  1017 1017 HOH HOH C . 
I 6 HOH 18  1018 1018 HOH HOH C . 
I 6 HOH 19  1019 1019 HOH HOH C . 
I 6 HOH 20  1020 1020 HOH HOH C . 
I 6 HOH 21  1021 1021 HOH HOH C . 
I 6 HOH 22  1022 1022 HOH HOH C . 
I 6 HOH 23  1023 1023 HOH HOH C . 
I 6 HOH 24  1024 1024 HOH HOH C . 
I 6 HOH 25  1025 1025 HOH HOH C . 
I 6 HOH 26  1026 1026 HOH HOH C . 
I 6 HOH 27  1027 1027 HOH HOH C . 
I 6 HOH 28  1028 1028 HOH HOH C . 
I 6 HOH 29  1029 1029 HOH HOH C . 
I 6 HOH 30  1030 1030 HOH HOH C . 
I 6 HOH 31  1031 1031 HOH HOH C . 
I 6 HOH 32  1032 1032 HOH HOH C . 
I 6 HOH 33  1033 1033 HOH HOH C . 
I 6 HOH 34  1034 1034 HOH HOH C . 
I 6 HOH 35  1035 1035 HOH HOH C . 
I 6 HOH 36  1036 1036 HOH HOH C . 
I 6 HOH 37  1037 1037 HOH HOH C . 
I 6 HOH 38  1038 1038 HOH HOH C . 
I 6 HOH 39  1039 1039 HOH HOH C . 
I 6 HOH 40  1040 1040 HOH HOH C . 
I 6 HOH 41  1041 1041 HOH HOH C . 
I 6 HOH 42  1042 1042 HOH HOH C . 
I 6 HOH 43  1043 1043 HOH HOH C . 
I 6 HOH 44  1044 1044 HOH HOH C . 
I 6 HOH 45  1045 1045 HOH HOH C . 
I 6 HOH 46  1046 1046 HOH HOH C . 
I 6 HOH 47  1047 1047 HOH HOH C . 
I 6 HOH 48  1048 1048 HOH HOH C . 
I 6 HOH 49  1049 1049 HOH HOH C . 
I 6 HOH 50  1050 1050 HOH HOH C . 
I 6 HOH 51  1051 1051 HOH HOH C . 
I 6 HOH 52  1052 1052 HOH HOH C . 
I 6 HOH 53  1053 1053 HOH HOH C . 
I 6 HOH 54  1054 1054 HOH HOH C . 
I 6 HOH 55  1055 1055 HOH HOH C . 
I 6 HOH 56  1056 1056 HOH HOH C . 
I 6 HOH 57  1057 1057 HOH HOH C . 
I 6 HOH 58  1058 1058 HOH HOH C . 
I 6 HOH 59  1059 1059 HOH HOH C . 
I 6 HOH 60  1060 1060 HOH HOH C . 
I 6 HOH 61  1061 1061 HOH HOH C . 
I 6 HOH 62  1062 1062 HOH HOH C . 
I 6 HOH 63  1063 1063 HOH HOH C . 
I 6 HOH 64  1064 1064 HOH HOH C . 
I 6 HOH 65  1065 1065 HOH HOH C . 
I 6 HOH 66  1066 1066 HOH HOH C . 
I 6 HOH 67  1067 1067 HOH HOH C . 
I 6 HOH 68  1068 1068 HOH HOH C . 
I 6 HOH 69  1069 1069 HOH HOH C . 
I 6 HOH 70  1070 1070 HOH HOH C . 
I 6 HOH 71  1071 1071 HOH HOH C . 
I 6 HOH 72  1072 1072 HOH HOH C . 
I 6 HOH 73  1073 1073 HOH HOH C . 
I 6 HOH 74  1074 1074 HOH HOH C . 
J 6 HOH 1   1001 1001 HOH HOH E . 
J 6 HOH 2   1002 1002 HOH HOH E . 
J 6 HOH 3   1003 1003 HOH HOH E . 
J 6 HOH 4   1004 1004 HOH HOH E . 
J 6 HOH 5   1005 1005 HOH HOH E . 
J 6 HOH 6   1006 1006 HOH HOH E . 
J 6 HOH 7   1007 1007 HOH HOH E . 
J 6 HOH 8   1008 1008 HOH HOH E . 
J 6 HOH 9   1009 1009 HOH HOH E . 
J 6 HOH 10  1010 1010 HOH HOH E . 
J 6 HOH 11  1011 1011 HOH HOH E . 
J 6 HOH 12  1012 1012 HOH HOH E . 
J 6 HOH 13  1013 1013 HOH HOH E . 
J 6 HOH 14  1014 1014 HOH HOH E . 
J 6 HOH 15  1015 1015 HOH HOH E . 
J 6 HOH 16  1016 1016 HOH HOH E . 
J 6 HOH 17  1017 1017 HOH HOH E . 
J 6 HOH 18  1018 1018 HOH HOH E . 
J 6 HOH 19  1019 1019 HOH HOH E . 
J 6 HOH 20  1020 1020 HOH HOH E . 
J 6 HOH 21  1021 1021 HOH HOH E . 
J 6 HOH 22  1022 1022 HOH HOH E . 
J 6 HOH 23  1023 1023 HOH HOH E . 
J 6 HOH 24  1024 1024 HOH HOH E . 
J 6 HOH 25  1025 1025 HOH HOH E . 
J 6 HOH 26  1026 1026 HOH HOH E . 
J 6 HOH 27  1027 1027 HOH HOH E . 
J 6 HOH 28  1028 1028 HOH HOH E . 
J 6 HOH 29  1029 1029 HOH HOH E . 
J 6 HOH 30  1030 1030 HOH HOH E . 
J 6 HOH 31  1031 1031 HOH HOH E . 
J 6 HOH 32  1032 1032 HOH HOH E . 
J 6 HOH 33  1033 1033 HOH HOH E . 
J 6 HOH 34  1034 1034 HOH HOH E . 
J 6 HOH 35  1035 1035 HOH HOH E . 
J 6 HOH 36  1036 1036 HOH HOH E . 
J 6 HOH 37  1037 1037 HOH HOH E . 
J 6 HOH 38  1038 1038 HOH HOH E . 
J 6 HOH 39  1039 1039 HOH HOH E . 
J 6 HOH 40  1040 1040 HOH HOH E . 
J 6 HOH 41  1041 1041 HOH HOH E . 
J 6 HOH 42  1042 1042 HOH HOH E . 
J 6 HOH 43  1043 1043 HOH HOH E . 
J 6 HOH 44  1044 1044 HOH HOH E . 
J 6 HOH 45  1045 1045 HOH HOH E . 
J 6 HOH 46  1046 1046 HOH HOH E . 
J 6 HOH 47  1047 1047 HOH HOH E . 
J 6 HOH 48  1048 1048 HOH HOH E . 
J 6 HOH 49  1049 1049 HOH HOH E . 
J 6 HOH 50  1050 1050 HOH HOH E . 
J 6 HOH 51  1051 1051 HOH HOH E . 
J 6 HOH 52  1052 1052 HOH HOH E . 
J 6 HOH 53  1053 1053 HOH HOH E . 
J 6 HOH 54  1054 1054 HOH HOH E . 
J 6 HOH 55  1055 1055 HOH HOH E . 
J 6 HOH 56  1056 1056 HOH HOH E . 
J 6 HOH 57  1057 1057 HOH HOH E . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10860 ? 
1 MORE         -95.2 ? 
1 'SSA (A^2)'  18020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OP2 ? D DA  15 ? E DA  15   ? 1_555 99.5  ? 
2  OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? J HOH .  ? E HOH 1035 ? 1_555 86.7  ? 
3  OP2 ? D DA  15 ? E DA  15   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? J HOH .  ? E HOH 1035 ? 1_555 78.9  ? 
4  OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 93.8  ? 
5  OP2 ? D DA  15 ? E DA  15   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 76.1  ? 
6  O   ? J HOH .  ? E HOH 1035 ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 154.7 ? 
7  OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 84.4  ? 
8  OP2 ? D DA  15 ? E DA  15   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 125.6 ? 
9  O   ? J HOH .  ? E HOH 1035 ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 154.9 ? 
10 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 49.6  ? 
11 OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? B ALA 18 ? B ALA 19   ? 1_555 178.6 ? 
12 OP2 ? D DA  15 ? E DA  15   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? B ALA 18 ? B ALA 19   ? 1_555 81.9  ? 
13 O   ? J HOH .  ? E HOH 1035 ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? B ALA 18 ? B ALA 19   ? 1_555 93.2  ? 
14 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? B ALA 18 ? B ALA 19   ? 1_555 86.9  ? 
15 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? B ALA 18 ? B ALA 19   ? 1_555 95.1  ? 
16 OP1 ? C DA  14 ? C DA  14   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 89.9  ? 
17 OP2 ? D DA  15 ? E DA  15   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 155.4 ? 
18 O   ? J HOH .  ? E HOH 1035 ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 79.0  ? 
19 OD1 ? A ASP 19 ? A ASP 20   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 126.2 ? 
20 OD2 ? A ASP 19 ? A ASP 20   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 77.6  ? 
21 O   ? B ALA 18 ? B ALA 19   ? 1_555 CA ? E CA . ? A CA 1154 ? 1_555 O   ? H HOH .  ? B HOH 1016 ? 1_555 88.7  ? 
22 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 86.9  ? 
23 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? I HOH .  ? C HOH 1051 ? 1_555 95.6  ? 
24 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? I HOH .  ? C HOH 1051 ? 1_555 154.4 ? 
25 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 93.8  ? 
26 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 48.9  ? 
27 O   ? I HOH .  ? C HOH 1051 ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 155.2 ? 
28 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP1 ? D DA  14 ? E DA  14   ? 1_555 177.1 ? 
29 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP1 ? D DA  14 ? E DA  14   ? 1_555 93.1  ? 
30 O   ? I HOH .  ? C HOH 1051 ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP1 ? D DA  14 ? E DA  14   ? 1_555 85.6  ? 
31 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP1 ? D DA  14 ? E DA  14   ? 1_555 84.1  ? 
32 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? G HOH .  ? A HOH 1013 ? 1_555 88.7  ? 
33 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? G HOH .  ? A HOH 1013 ? 1_555 126.9 ? 
34 O   ? I HOH .  ? C HOH 1051 ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? G HOH .  ? A HOH 1013 ? 1_555 78.7  ? 
35 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? G HOH .  ? A HOH 1013 ? 1_555 78.7  ? 
36 OP1 ? D DA  14 ? E DA  14   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 O   ? G HOH .  ? A HOH 1013 ? 1_555 88.9  ? 
37 O   ? A GLY 18 ? A GLY 19   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 84.6  ? 
38 OD1 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 77.4  ? 
39 O   ? I HOH .  ? C HOH 1051 ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 77.5  ? 
40 OD2 ? B ASP 19 ? B ASP 20   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 126.2 ? 
41 OP1 ? D DA  14 ? E DA  14   ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 98.2  ? 
42 O   ? G HOH .  ? A HOH 1013 ? 1_555 CA ? F CA . ? A CA 1155 ? 1_555 OP2 ? C DA  15 ? C DA  15   ? 1_555 154.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-28 
2 'Structure model' 1 1 2012-06-20 
3 'Structure model' 1 2 2019-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'       
2  2 'Structure model' 'Derived calculations'      
3  2 'Structure model' 'Non-polymer description'   
4  2 'Structure model' Other                       
5  2 'Structure model' 'Structure summary'         
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' 'Data collection'           
8  3 'Structure model' 'Experimental preparation'  
9  3 'Structure model' Other                       
10 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_PDB_rev            
2 3 'Structure model' database_PDB_rev_record     
3 3 'Structure model' exptl_crystal_grow          
4 3 'Structure model' pdbx_database_proc          
5 3 'Structure model' pdbx_database_status        
6 3 'Structure model' pdbx_entity_src_syn         
7 3 'Structure model' pdbx_seq_map_depositor_info 
8 3 'Structure model' struct_biol                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                       
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval'      
3 3 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC    refinement       5.2.0019 ? 1 ? ? ? ? 
HKL-2000  'data reduction' .        ? 2 ? ? ? ? 
SCALEPACK 'data scaling'   .        ? 3 ? ? ? ? 
MOLREP    phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 1008 ? ? O   B HOH 1070 ? ? 1.03 
2 1 O   C HOH 1049 ? ? O   C HOH 1053 ? ? 1.95 
3 1 O   C HOH 1045 ? ? O   E HOH 1039 ? ? 2.01 
4 1 NH1 A ARG 68   ? ? OP2 E DT  7    ? ? 2.05 
5 1 OG1 B THR 143  ? ? O   B HOH 1107 ? ? 2.08 
6 1 O   A LEU 152  ? ? O   A HOH 1089 ? ? 2.13 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NZ 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     100 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OP2 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    DA 
_pdbx_validate_symm_contact.auth_seq_id_2     24 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_655 
_pdbx_validate_symm_contact.dist              1.92 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    A ARG 141 ? ? CZ    A ARG 141 ? ? NH2   A ARG 141 ? ? 117.02 120.30 -3.28 0.50 N 
2  1 NE    B ARG 38  ? ? CZ    B ARG 38  ? ? NH2   B ARG 38  ? ? 116.85 120.30 -3.45 0.50 N 
3  1 N1    C DT  3   ? ? C2    C DT  3   ? ? N3    C DT  3   ? ? 118.50 114.60 3.90  0.60 N 
4  1 N3    C DT  3   ? ? C2    C DT  3   ? ? O2    C DT  3   ? ? 117.25 122.30 -5.05 0.60 N 
5  1 "C3'" C DG  4   ? ? "O3'" C DG  4   ? ? P     C DC  5   ? ? 127.83 119.70 8.13  1.20 Y 
6  1 C5    C DC  6   ? ? C4    C DC  6   ? ? N4    C DC  6   ? ? 125.50 120.20 5.30  0.70 N 
7  1 N1    C DT  8   ? ? C2    C DT  8   ? ? N3    C DT  8   ? ? 118.80 114.60 4.20  0.60 N 
8  1 N3    C DT  8   ? ? C4    C DT  8   ? ? O4    C DT  8   ? ? 114.96 119.90 -4.94 0.60 N 
9  1 C5    C DT  8   ? ? C4    C DT  8   ? ? O4    C DT  8   ? ? 130.21 124.90 5.31  0.70 N 
10 1 C6    C DT  8   ? ? C5    C DT  8   ? ? C7    C DT  8   ? ? 117.30 122.90 -5.60 0.60 N 
11 1 "O5'" C DT  9   ? ? "C5'" C DT  9   ? ? "C4'" C DT  9   ? ? 102.72 109.40 -6.68 0.80 N 
12 1 "O4'" C DT  9   ? ? "C1'" C DT  9   ? ? N1    C DT  9   ? ? 103.28 108.00 -4.72 0.70 N 
13 1 C4    C DT  9   ? ? C5    C DT  9   ? ? C7    C DT  9   ? ? 122.64 119.00 3.64  0.60 N 
14 1 C6    C DT  9   ? ? C5    C DT  9   ? ? C7    C DT  9   ? ? 118.76 122.90 -4.14 0.60 N 
15 1 "O4'" C DT  10  ? ? "C1'" C DT  10  ? ? N1    C DT  10  ? ? 99.59  108.00 -8.41 0.70 N 
16 1 "O5'" C DT  12  ? ? P     C DT  12  ? ? OP2   C DT  12  ? ? 99.49  105.70 -6.21 0.90 N 
17 1 N1    C DT  12  ? ? "C1'" C DT  12  ? ? "C2'" C DT  12  ? ? 124.71 114.30 10.41 1.40 N 
18 1 C2    C DT  12  ? ? N3    C DT  12  ? ? C4    C DT  12  ? ? 123.29 127.20 -3.91 0.60 N 
19 1 "O4'" C DG  13  ? ? "C1'" C DG  13  ? ? "C2'" C DG  13  ? ? 99.20  105.90 -6.70 0.80 N 
20 1 "O4'" C DG  13  ? ? "C1'" C DG  13  ? ? N9    C DG  13  ? ? 100.97 108.00 -7.03 0.70 N 
21 1 C4    C DG  13  ? ? C5    C DG  13  ? ? N7    C DG  13  ? ? 108.14 110.80 -2.66 0.40 N 
22 1 C6    C DG  13  ? ? C5    C DG  13  ? ? N7    C DG  13  ? ? 134.18 130.40 3.78  0.60 N 
23 1 N1    C DG  13  ? ? C6    C DG  13  ? ? O6    C DG  13  ? ? 114.22 119.90 -5.68 0.60 N 
24 1 N1    C DA  14  ? ? C2    C DA  14  ? ? N3    C DA  14  ? ? 125.89 129.30 -3.41 0.50 N 
25 1 "O4'" C DA  15  ? ? "C1'" C DA  15  ? ? N9    C DA  15  ? ? 110.18 108.30 1.88  0.30 N 
26 1 "O4'" C DG  16  ? ? "C1'" C DG  16  ? ? N9    C DG  16  ? ? 113.97 108.30 5.67  0.30 N 
27 1 C4    C DG  16  ? ? C5    C DG  16  ? ? N7    C DG  16  ? ? 108.39 110.80 -2.41 0.40 N 
28 1 N3    C DG  16  ? ? C2    C DG  16  ? ? N2    C DG  16  ? ? 114.76 119.90 -5.14 0.70 N 
29 1 "O4'" C DG  17  ? ? "C4'" C DG  17  ? ? "C3'" C DG  17  ? ? 101.49 104.50 -3.01 0.40 N 
30 1 "O4'" C DC  21  ? ? "C1'" C DC  21  ? ? N1    C DC  21  ? ? 103.43 108.00 -4.57 0.70 N 
31 1 "O4'" C DT  22  ? ? "C1'" C DT  22  ? ? N1    C DT  22  ? ? 111.12 108.30 2.82  0.30 N 
32 1 "C3'" C DT  22  ? ? "O3'" C DT  22  ? ? P     C DA  23  ? ? 126.93 119.70 7.23  1.20 Y 
33 1 "O4'" C DA  23  ? ? "C1'" C DA  23  ? ? N9    C DA  23  ? ? 112.22 108.30 3.92  0.30 N 
34 1 "O4'" E DT  1   ? ? "C1'" E DT  1   ? ? N1    E DT  1   ? ? 102.50 108.00 -5.50 0.70 N 
35 1 C4    E DT  2   ? ? C5    E DT  2   ? ? C7    E DT  2   ? ? 123.44 119.00 4.44  0.60 N 
36 1 C6    E DT  2   ? ? C5    E DT  2   ? ? C7    E DT  2   ? ? 118.50 122.90 -4.40 0.60 N 
37 1 "C3'" E DA  3   ? ? "O3'" E DA  3   ? ? P     E DG  4   ? ? 127.80 119.70 8.10  1.20 Y 
38 1 "O4'" E DG  4   ? ? "C1'" E DG  4   ? ? N9    E DG  4   ? ? 110.24 108.30 1.94  0.30 N 
39 1 "O4'" E DG  5   ? ? "C1'" E DG  5   ? ? "C2'" E DG  5   ? ? 100.62 105.90 -5.28 0.80 N 
40 1 C5    E DT  7   ? ? C4    E DT  7   ? ? O4    E DT  7   ? ? 120.22 124.90 -4.68 0.70 N 
41 1 "O4'" E DT  10  ? ? "C1'" E DT  10  ? ? N1    E DT  10  ? ? 102.53 108.00 -5.47 0.70 N 
42 1 OP1   E DT  11  ? ? P     E DT  11  ? ? OP2   E DT  11  ? ? 130.82 119.60 11.22 1.50 N 
43 1 N1    E DC  12  ? ? "C1'" E DC  12  ? ? "C2'" E DC  12  ? ? 123.15 114.30 8.85  1.40 N 
44 1 N3    E DC  12  ? ? C4    E DC  12  ? ? C5    E DC  12  ? ? 124.93 121.90 3.03  0.40 N 
45 1 N3    E DC  12  ? ? C4    E DC  12  ? ? N4    E DC  12  ? ? 111.86 118.00 -6.14 0.70 N 
46 1 "O5'" E DA  13  ? ? "C5'" E DA  13  ? ? "C4'" E DA  13  ? ? 103.85 109.40 -5.55 0.80 N 
47 1 "O4'" E DA  13  ? ? "C4'" E DA  13  ? ? "C3'" E DA  13  ? ? 100.11 104.50 -4.39 0.40 N 
48 1 "C1'" E DA  13  ? ? "O4'" E DA  13  ? ? "C4'" E DA  13  ? ? 114.68 110.30 4.38  0.70 N 
49 1 "O4'" E DA  13  ? ? "C1'" E DA  13  ? ? "C2'" E DA  13  ? ? 100.80 105.90 -5.10 0.80 N 
50 1 "O4'" E DA  13  ? ? "C1'" E DA  13  ? ? N9    E DA  13  ? ? 99.24  108.00 -8.76 0.70 N 
51 1 N1    E DA  13  ? ? C2    E DA  13  ? ? N3    E DA  13  ? ? 125.20 129.30 -4.10 0.50 N 
52 1 C2    E DA  13  ? ? N3    E DA  13  ? ? C4    E DA  13  ? ? 114.64 110.60 4.04  0.50 N 
53 1 "O4'" E DA  16  ? ? "C1'" E DA  16  ? ? N9    E DA  16  ? ? 113.09 108.30 4.79  0.30 N 
54 1 "O4'" E DA  17  ? ? "C4'" E DA  17  ? ? "C3'" E DA  17  ? ? 101.35 104.50 -3.15 0.40 N 
55 1 "O4'" E DA  17  ? ? "C1'" E DA  17  ? ? N9    E DA  17  ? ? 110.62 108.30 2.32  0.30 N 
56 1 "O4'" E DA  18  ? ? "C1'" E DA  18  ? ? N9    E DA  18  ? ? 111.82 108.30 3.52  0.30 N 
57 1 "O4'" E DG  19  ? ? "C1'" E DG  19  ? ? "C2'" E DG  19  ? ? 100.66 105.90 -5.24 0.80 N 
58 1 N1    E DG  20  ? ? C6    E DG  20  ? ? O6    E DG  20  ? ? 115.96 119.90 -3.94 0.60 N 
59 1 "O4'" E DC  21  ? ? "C1'" E DC  21  ? ? N1    E DC  21  ? ? 103.74 108.00 -4.26 0.70 N 
60 1 "C3'" E DA  22  ? ? "C2'" E DA  22  ? ? "C1'" E DA  22  ? ? 97.47  102.40 -4.93 0.80 N 
61 1 "O4'" E DA  22  ? ? "C1'" E DA  22  ? ? N9    E DA  22  ? ? 112.71 108.30 4.41  0.30 N 
62 1 C2    E DA  22  ? ? N3    E DA  22  ? ? C4    E DA  22  ? ? 106.95 110.60 -3.65 0.50 N 
63 1 N3    E DA  22  ? ? C4    E DA  22  ? ? C5    E DA  22  ? ? 131.30 126.80 4.50  0.70 N 
64 1 C4    E DA  22  ? ? C5    E DA  22  ? ? N7    E DA  22  ? ? 113.99 110.70 3.29  0.50 N 
65 1 C5    E DA  22  ? ? N7    E DA  22  ? ? C8    E DA  22  ? ? 100.29 103.90 -3.61 0.50 N 
66 1 N1    E DA  22  ? ? C6    E DA  22  ? ? N6    E DA  22  ? ? 122.82 118.60 4.22  0.60 N 
67 1 C6    E DG  23  ? ? N1    E DG  23  ? ? C2    E DG  23  ? ? 121.46 125.10 -3.64 0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 30  ? ? -167.55 118.36 
2 1 LYS A 36  ? ? 59.47   8.38   
3 1 LYS A 116 ? ? -85.57  39.39  
4 1 GLU A 117 ? ? -152.60 -4.05  
5 1 ASP A 120 ? ? 76.34   -43.05 
6 1 ARG A 149 ? ? -62.32  59.24  
7 1 VAL A 151 ? ? -62.41  3.87   
8 1 ASN B 30  ? ? -165.96 113.89 
9 1 LYS B 142 ? ? -123.45 -52.98 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ARG 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    149 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    150 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            144.20 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? B HOH 1031 ? 6.75 . 
2 1 O ? C HOH 1005 ? 6.25 . 
3 1 O ? C HOH 1011 ? 6.39 . 
4 1 O ? E HOH 1005 ? 6.25 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 116 ? CG  ? A LYS 115 CG  
2  1 Y 1 A LYS 116 ? CD  ? A LYS 115 CD  
3  1 Y 1 A LYS 116 ? CE  ? A LYS 115 CE  
4  1 Y 1 A LYS 116 ? NZ  ? A LYS 115 NZ  
5  1 Y 1 A GLU 117 ? CG  ? A GLU 116 CG  
6  1 Y 1 A GLU 117 ? CD  ? A GLU 116 CD  
7  1 Y 1 A GLU 117 ? OE1 ? A GLU 116 OE1 
8  1 Y 1 A GLU 117 ? OE2 ? A GLU 116 OE2 
9  1 Y 1 B GLU 28  ? CG  ? B GLU 27  CG  
10 1 Y 1 B GLU 28  ? CD  ? B GLU 27  CD  
11 1 Y 1 B GLU 28  ? OE1 ? B GLU 27  OE1 
12 1 Y 1 B GLU 28  ? OE2 ? B GLU 27  OE2 
13 1 Y 1 B ASP 69  ? CB  ? B ASP 68  CB  
14 1 Y 1 B ASP 69  ? CG  ? B ASP 68  CG  
15 1 Y 1 B ASP 69  ? OD1 ? B ASP 68  OD1 
16 1 Y 1 B ASP 69  ? OD2 ? B ASP 68  OD2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2VBJ 'double helix'        
2VBJ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 1  1_555 D DA 24 1_555 -0.334 -0.183 0.255  -20.028 -16.196 -0.717 1  C_DT1:DA24_E  C 1  ? E 24 ? 20 1 
1 C DC 2  1_555 D DG 23 1_555 0.207  -0.131 0.178  -16.912 -13.051 0.108  2  C_DC2:DG23_E  C 2  ? E 23 ? 19 1 
1 C DT 3  1_555 D DA 22 1_555 -0.652 -0.338 -0.078 -8.684  -0.109  -3.178 3  C_DT3:DA22_E  C 3  ? E 22 ? 20 1 
1 C DG 4  1_555 D DC 21 1_555 -0.182 -0.108 0.089  6.034   0.331   0.077  4  C_DG4:DC21_E  C 4  ? E 21 ? 19 1 
1 C DC 5  1_555 D DG 20 1_555 0.486  -0.341 -0.272 8.268   -3.975  3.165  5  C_DC5:DG20_E  C 5  ? E 20 ? 19 1 
1 C DC 6  1_555 D DG 19 1_555 0.125  -0.498 0.041  2.933   -7.031  -2.416 6  C_DC6:DG19_E  C 6  ? E 19 ? 19 1 
1 C DT 7  1_555 D DA 18 1_555 -0.118 -0.166 -0.124 6.613   -13.477 3.366  7  C_DT7:DA18_E  C 7  ? E 18 ? 20 1 
1 C DT 8  1_555 D DA 17 1_555 0.153  -0.114 0.090  2.122   -15.389 -1.219 8  C_DT8:DA17_E  C 8  ? E 17 ? 20 1 
1 C DT 9  1_555 D DA 16 1_555 0.026  -0.060 -0.032 -0.468  -13.325 0.152  9  C_DT9:DA16_E  C 9  ? E 16 ? 20 1 
1 C DT 10 1_555 D DA 15 1_555 0.008  -0.075 -0.122 4.605   -17.054 3.086  10 C_DT10:DA15_E C 10 ? E 15 ? 20 1 
1 C DT 11 1_555 D DA 14 1_555 -0.189 -0.139 0.163  13.488  -10.357 0.947  11 C_DT11:DA14_E C 11 ? E 14 ? 20 1 
1 C DT 12 1_555 D DA 13 1_555 -0.289 -0.211 0.153  6.926   -22.721 2.230  12 C_DT12:DA13_E C 12 ? E 13 ? 20 1 
1 C DG 13 1_555 D DC 12 1_555 -0.089 -0.099 0.256  -6.844  -24.066 4.456  13 C_DG13:DC12_E C 13 ? E 12 ? 19 1 
1 C DA 14 1_555 D DT 11 1_555 0.224  -0.066 -0.005 -16.454 -12.325 1.188  14 C_DA14:DT11_E C 14 ? E 11 ? 20 1 
1 C DA 15 1_555 D DT 10 1_555 0.049  -0.114 -0.024 -4.758  -15.397 2.728  15 C_DA15:DT10_E C 15 ? E 10 ? 20 1 
1 C DG 16 1_555 D DC 9  1_555 0.001  -0.083 0.290  5.449   -9.481  -0.139 16 C_DG16:DC9_E  C 16 ? E 9  ? 19 1 
1 C DG 17 1_555 D DC 8  1_555 -0.268 -0.111 0.339  -1.325  -16.980 0.180  17 C_DG17:DC8_E  C 17 ? E 8  ? 19 1 
1 C DA 18 1_555 D DT 7  1_555 0.239  -0.133 -0.122 -4.159  -9.449  3.884  18 C_DA18:DT7_E  C 18 ? E 7  ? 20 1 
1 C DT 19 1_555 D DA 6  1_555 0.053  -0.343 -0.021 2.441   -8.044  3.423  19 C_DT19:DA6_E  C 19 ? E 6  ? 20 1 
1 C DC 20 1_555 D DG 5  1_555 0.401  -0.246 -0.148 -6.305  -7.515  0.872  20 C_DC20:DG5_E  C 20 ? E 5  ? 19 1 
1 C DC 21 1_555 D DG 4  1_555 0.079  -0.272 0.344  -13.562 -1.227  -3.939 21 C_DC21:DG4_E  C 21 ? E 4  ? 19 1 
1 C DT 22 1_555 D DA 3  1_555 -0.332 -0.302 -0.180 1.547   -2.168  1.014  22 C_DT22:DA3_E  C 22 ? E 3  ? 20 1 
1 C DA 23 1_555 D DT 2  1_555 0.112  -0.122 0.064  11.257  -12.113 5.944  23 C_DA23:DT2_E  C 23 ? E 2  ? 20 1 
1 C DA 24 1_555 D DT 1  1_555 0.139  -0.121 0.074  16.738  -13.631 -0.353 24 C_DA24:DT1_E  C 24 ? E 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 1  1_555 D DA 24 1_555 C DC 2  1_555 D DG 23 1_555 -0.236 0.033  3.261 0.855  -4.341  37.817 0.599  0.470  3.232 -6.670  
-1.314 38.065 1  CC_DT1DC2:DG23DA24_EE   C 1  ? E 24 ? C 2  ? E 23 ? 
1 C DC 2  1_555 D DG 23 1_555 C DT 3  1_555 D DA 22 1_555 0.377  0.425  3.173 1.902  -0.112  32.945 0.767  -0.350 3.188 -0.198  
-3.350 32.999 2  CC_DC2DT3:DA22DG23_EE   C 2  ? E 23 ? C 3  ? E 22 ? 
1 C DT 3  1_555 D DA 22 1_555 C DG 4  1_555 D DC 21 1_555 -0.114 0.452  3.140 -2.495 -0.182  32.642 0.832  -0.211 3.137 -0.324  
4.431  32.735 3  CC_DT3DG4:DC21DA22_EE   C 3  ? E 22 ? C 4  ? E 21 ? 
1 C DG 4  1_555 D DC 21 1_555 C DC 5  1_555 D DG 20 1_555 0.613  -0.238 3.351 2.890  -0.181  39.848 -0.328 -0.555 3.387 -0.265  
-4.234 39.949 4  CC_DG4DC5:DG20DC21_EE   C 4  ? E 21 ? C 5  ? E 20 ? 
1 C DC 5  1_555 D DG 20 1_555 C DC 6  1_555 D DG 19 1_555 -0.462 -1.134 3.444 -4.019 4.539   30.773 -2.986 0.069  3.279 8.451   
7.482  31.351 5  CC_DC5DC6:DG19DG20_EE   C 5  ? E 20 ? C 6  ? E 19 ? 
1 C DC 6  1_555 D DG 19 1_555 C DT 7  1_555 D DA 18 1_555 0.102  -1.005 3.263 1.032  4.285   28.792 -2.913 0.018  3.086 8.553   
-2.061 29.120 6  CC_DC6DT7:DA18DG19_EE   C 6  ? E 19 ? C 7  ? E 18 ? 
1 C DT 7  1_555 D DA 18 1_555 C DT 8  1_555 D DA 17 1_555 0.283  -0.965 3.429 -1.781 3.419   35.607 -2.076 -0.725 3.308 5.570   
2.902  35.809 7  CC_DT7DT8:DA17DA18_EE   C 7  ? E 18 ? C 8  ? E 17 ? 
1 C DT 8  1_555 D DA 17 1_555 C DT 9  1_555 D DA 16 1_555 -0.675 -0.871 3.410 0.514  -2.930  29.947 -1.047 1.412  3.466 -5.653  
-0.992 30.091 8  CC_DT8DT9:DA16DA17_EE   C 8  ? E 17 ? C 9  ? E 16 ? 
1 C DT 9  1_555 D DA 16 1_555 C DT 10 1_555 D DA 15 1_555 -0.452 -0.292 3.198 -1.668 3.485   31.683 -1.149 0.527  3.168 6.354   
3.040  31.912 9  CC_DT9DT10:DA15DA16_EE  C 9  ? E 16 ? C 10 ? E 15 ? 
1 C DT 10 1_555 D DA 15 1_555 C DT 11 1_555 D DA 14 1_555 0.120  0.143  3.289 -4.171 4.110   30.149 -0.543 -1.052 3.234 7.808   
7.925  30.699 10 CC_DT10DT11:DA14DA15_EE C 10 ? E 15 ? C 11 ? E 14 ? 
1 C DT 11 1_555 D DA 14 1_555 C DT 12 1_555 D DA 13 1_555 -0.060 -0.370 3.523 1.795  -9.111  28.872 1.306  0.513  3.466 -17.703 
-3.488 30.298 11 CC_DT11DT12:DA13DA14_EE C 11 ? E 14 ? C 12 ? E 13 ? 
1 C DT 12 1_555 D DA 13 1_555 C DG 13 1_555 D DC 12 1_555 0.204  2.702  4.128 -0.208 -14.307 56.751 3.650  -0.222 3.415 -14.793 
0.215  58.381 12 CC_DT12DG13:DC12DA13_EE C 12 ? E 13 ? C 13 ? E 12 ? 
1 C DG 13 1_555 D DC 12 1_555 C DA 14 1_555 D DT 11 1_555 -0.149 -0.234 3.585 -0.585 -8.230  31.001 1.217  0.154  3.532 -15.065 
1.071  32.054 13 CC_DG13DA14:DT11DC12_EE C 13 ? E 12 ? C 14 ? E 11 ? 
1 C DA 14 1_555 D DT 11 1_555 C DA 15 1_555 D DT 10 1_555 -0.084 0.222  3.136 2.702  3.248   30.402 -0.194 0.670  3.123 6.156   
-5.122 30.687 14 CC_DA14DA15:DT10DT11_EE C 14 ? E 11 ? C 15 ? E 10 ? 
1 C DA 15 1_555 D DT 10 1_555 C DG 16 1_555 D DC 9  1_555 0.513  -0.376 3.069 -1.373 2.025   30.939 -1.066 -1.204 3.014 3.788   
2.569  31.033 15 CC_DA15DG16:DC9DT10_EE  C 15 ? E 10 ? C 16 ? E 9  ? 
1 C DG 16 1_555 D DC 9  1_555 C DG 17 1_555 D DC 8  1_555 0.866  -1.111 3.438 0.937  -1.584  28.815 -1.854 -1.515 3.518 -3.180  
-1.880 28.872 16 CC_DG16DG17:DC8DC9_EE   C 16 ? E 9  ? C 17 ? E 8  ? 
1 C DG 17 1_555 D DC 8  1_555 C DA 18 1_555 D DT 7  1_555 -0.638 -1.000 3.328 3.464  3.360   36.688 -2.026 1.470  3.156 5.310   
-5.474 36.993 17 CC_DG17DA18:DT7DC8_EE   C 17 ? E 8  ? C 18 ? E 7  ? 
1 C DA 18 1_555 D DT 7  1_555 C DT 19 1_555 D DA 6  1_555 0.277  -1.015 3.142 -0.515 -1.173  28.608 -1.797 -0.672 3.175 -2.372  
1.041  28.636 18 CC_DA18DT19:DA6DT7_EE   C 18 ? E 7  ? C 19 ? E 6  ? 
1 C DT 19 1_555 D DA 6  1_555 C DC 20 1_555 D DG 5  1_555 -0.127 -0.794 3.521 1.611  1.392   40.128 -1.325 0.381  3.485 2.028   
-2.346 40.182 19 CC_DT19DC20:DG5DA6_EE   C 19 ? E 6  ? C 20 ? E 5  ? 
1 C DC 20 1_555 D DG 5  1_555 C DC 21 1_555 D DG 4  1_555 -0.673 -1.077 3.548 -2.342 5.158   32.630 -2.818 0.759  3.382 9.095   
4.129  33.105 20 CC_DC20DC21:DG4DG5_EE   C 20 ? E 5  ? C 21 ? E 4  ? 
1 C DC 21 1_555 D DG 4  1_555 C DT 22 1_555 D DA 3  1_555 -0.074 -0.257 2.980 3.550  1.061   24.279 -0.901 1.169  2.926 2.504   
-8.378 24.556 21 CC_DC21DT22:DA3DG4_EE   C 21 ? E 4  ? C 22 ? E 3  ? 
1 C DT 22 1_555 D DA 3  1_555 C DA 23 1_555 D DT 2  1_555 -0.399 1.467  3.131 -3.915 4.172   42.829 1.591  0.165  3.276 5.683   
5.332  43.192 22 CC_DT22DA23:DT2DA3_EE   C 22 ? E 3  ? C 23 ? E 2  ? 
1 C DA 23 1_555 D DT 2  1_555 C DA 24 1_555 D DT 1  1_555 -0.363 0.017  3.149 -0.317 0.555   30.684 -0.073 0.625  3.153 1.049   
0.600  30.691 23 CC_DA23DA24:DT1DT2_EE   C 23 ? E 2  ? C 24 ? E 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'CALCIUM ION' CA  
6 water         HOH 
#