data_2VGB
# 
_entry.id   2VGB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VGB         
PDBE  EBI-34402    
WWPDB D_1290034402 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2007-11-20 
_pdbx_database_PDB_obs_spr.pdb_id           2VGB 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1LIU 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1LIY unspecified 'HUMAN ERYTHROCYTE PYRUVATE KINASE: ARG479HIS MUTANT' 
PDB 1LIU unspecified 'HUMAN ERYTHROCYTE PYRUVATE KINASE'                   
PDB 1LIW unspecified 'HUMAN ERYTHROCYTE PYRUVATE KINASE: THR384MET MUTANT' 
PDB 1LIX unspecified 'HUMAN ERYTHROCYTE PYRUVATE KINASE: ARG486TRP MUTANT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VGB 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Valentini, G.' 1  ? 
'Chiarelli, L.' 2  ? 
'Fortin, R.'    3  ? 
'Dolzan, M.'    4  ? 
'Galizzi, A.'   5  ? 
'Abraham, D.J.' 6  ? 
'Wang, C.'      7  ? 
'Bianchi, P.'   8  ? 
'Zanella, A.'   9  ? 
'Mattevi, A.'   10 ? 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Function of Human Erythrocyte Pyruvate Kinase. Molecular Basis of Nonspherocytic Hemolytic Anemia.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                23807 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11960989 
_citation.pdbx_database_id_DOI      10.1074/JBC.M202107200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Valentini, G.'   1  ? 
primary 'Chiarelli, L.R.' 2  ? 
primary 'Fortin, R.'      3  ? 
primary 'Dolzan, M.'      4  ? 
primary 'Galizzi, A.'     5  ? 
primary 'Abraham, D.J.'   6  ? 
primary 'Wang, C.'        7  ? 
primary 'Bianchi, P.'     8  ? 
primary 'Zanella, A.'     9  ? 
primary 'Mattevi, A.'     10 ? 
# 
_cell.entry_id           2VGB 
_cell.length_a           74.413 
_cell.length_b           172.058 
_cell.length_c           85.512 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.46 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VGB 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PYRUVATE KINASE ISOZYMES R/L'           56974.324 4  2.7.1.40 ? 'RESIDUES 47-574' ? 
2 non-polymer man 1,6-di-O-phosphono-beta-D-fructofuranose 340.116   4  ?        ? ?                 ? 
3 non-polymer man '2-PHOSPHOGLYCOLIC ACID'                 156.031   4  ?        ? ?                 ? 
4 non-polymer syn 'POTASSIUM ION'                          39.098    4  ?        ? ?                 ? 
5 non-polymer syn 'MANGANESE (II) ION'                     54.938    4  ?        ? ?                 ? 
6 water       nat water                                    18.015    65 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'R-TYPE/L-TYPE PYRUVATE KINASE, RED CELL/LIVER PYRUVATE KINASE, PYRUVATE KINASE 1, PYRUVATE KINASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEY
HAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPN
IVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFAS
FVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKP
VVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAP
LSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWA
DDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEY
HAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPN
IVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFAS
FVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKP
VVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAP
LSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWA
DDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   THR n 
1 3   GLN n 
1 4   GLU n 
1 5   LEU n 
1 6   GLY n 
1 7   THR n 
1 8   ALA n 
1 9   PHE n 
1 10  PHE n 
1 11  GLN n 
1 12  GLN n 
1 13  GLN n 
1 14  GLN n 
1 15  LEU n 
1 16  PRO n 
1 17  ALA n 
1 18  ALA n 
1 19  MET n 
1 20  ALA n 
1 21  ASP n 
1 22  THR n 
1 23  PHE n 
1 24  LEU n 
1 25  GLU n 
1 26  HIS n 
1 27  LEU n 
1 28  CYS n 
1 29  LEU n 
1 30  LEU n 
1 31  ASP n 
1 32  ILE n 
1 33  ASP n 
1 34  SER n 
1 35  GLU n 
1 36  PRO n 
1 37  VAL n 
1 38  ALA n 
1 39  ALA n 
1 40  ARG n 
1 41  SER n 
1 42  THR n 
1 43  SER n 
1 44  ILE n 
1 45  ILE n 
1 46  ALA n 
1 47  THR n 
1 48  ILE n 
1 49  GLY n 
1 50  PRO n 
1 51  ALA n 
1 52  SER n 
1 53  ARG n 
1 54  SER n 
1 55  VAL n 
1 56  GLU n 
1 57  ARG n 
1 58  LEU n 
1 59  LYS n 
1 60  GLU n 
1 61  MET n 
1 62  ILE n 
1 63  LYS n 
1 64  ALA n 
1 65  GLY n 
1 66  MET n 
1 67  ASN n 
1 68  ILE n 
1 69  ALA n 
1 70  ARG n 
1 71  LEU n 
1 72  ASN n 
1 73  PHE n 
1 74  SER n 
1 75  HIS n 
1 76  GLY n 
1 77  SER n 
1 78  HIS n 
1 79  GLU n 
1 80  TYR n 
1 81  HIS n 
1 82  ALA n 
1 83  GLU n 
1 84  SER n 
1 85  ILE n 
1 86  ALA n 
1 87  ASN n 
1 88  VAL n 
1 89  ARG n 
1 90  GLU n 
1 91  ALA n 
1 92  VAL n 
1 93  GLU n 
1 94  SER n 
1 95  PHE n 
1 96  ALA n 
1 97  GLY n 
1 98  SER n 
1 99  PRO n 
1 100 LEU n 
1 101 SER n 
1 102 TYR n 
1 103 ARG n 
1 104 PRO n 
1 105 VAL n 
1 106 ALA n 
1 107 ILE n 
1 108 ALA n 
1 109 LEU n 
1 110 ASP n 
1 111 THR n 
1 112 LYS n 
1 113 GLY n 
1 114 PRO n 
1 115 GLU n 
1 116 ILE n 
1 117 ARG n 
1 118 THR n 
1 119 GLY n 
1 120 ILE n 
1 121 LEU n 
1 122 GLN n 
1 123 GLY n 
1 124 GLY n 
1 125 PRO n 
1 126 GLU n 
1 127 SER n 
1 128 GLU n 
1 129 VAL n 
1 130 GLU n 
1 131 LEU n 
1 132 VAL n 
1 133 LYS n 
1 134 GLY n 
1 135 SER n 
1 136 GLN n 
1 137 VAL n 
1 138 LEU n 
1 139 VAL n 
1 140 THR n 
1 141 VAL n 
1 142 ASP n 
1 143 PRO n 
1 144 ALA n 
1 145 PHE n 
1 146 ARG n 
1 147 THR n 
1 148 ARG n 
1 149 GLY n 
1 150 ASN n 
1 151 ALA n 
1 152 ASN n 
1 153 THR n 
1 154 VAL n 
1 155 TRP n 
1 156 VAL n 
1 157 ASP n 
1 158 TYR n 
1 159 PRO n 
1 160 ASN n 
1 161 ILE n 
1 162 VAL n 
1 163 ARG n 
1 164 VAL n 
1 165 VAL n 
1 166 PRO n 
1 167 VAL n 
1 168 GLY n 
1 169 GLY n 
1 170 ARG n 
1 171 ILE n 
1 172 TYR n 
1 173 ILE n 
1 174 ASP n 
1 175 ASP n 
1 176 GLY n 
1 177 LEU n 
1 178 ILE n 
1 179 SER n 
1 180 LEU n 
1 181 VAL n 
1 182 VAL n 
1 183 GLN n 
1 184 LYS n 
1 185 ILE n 
1 186 GLY n 
1 187 PRO n 
1 188 GLU n 
1 189 GLY n 
1 190 LEU n 
1 191 VAL n 
1 192 THR n 
1 193 GLN n 
1 194 VAL n 
1 195 GLU n 
1 196 ASN n 
1 197 GLY n 
1 198 GLY n 
1 199 VAL n 
1 200 LEU n 
1 201 GLY n 
1 202 SER n 
1 203 ARG n 
1 204 LYS n 
1 205 GLY n 
1 206 VAL n 
1 207 ASN n 
1 208 LEU n 
1 209 PRO n 
1 210 GLY n 
1 211 ALA n 
1 212 GLN n 
1 213 VAL n 
1 214 ASP n 
1 215 LEU n 
1 216 PRO n 
1 217 GLY n 
1 218 LEU n 
1 219 SER n 
1 220 GLU n 
1 221 GLN n 
1 222 ASP n 
1 223 VAL n 
1 224 ARG n 
1 225 ASP n 
1 226 LEU n 
1 227 ARG n 
1 228 PHE n 
1 229 GLY n 
1 230 VAL n 
1 231 GLU n 
1 232 HIS n 
1 233 GLY n 
1 234 VAL n 
1 235 ASP n 
1 236 ILE n 
1 237 VAL n 
1 238 PHE n 
1 239 ALA n 
1 240 SER n 
1 241 PHE n 
1 242 VAL n 
1 243 ARG n 
1 244 LYS n 
1 245 ALA n 
1 246 SER n 
1 247 ASP n 
1 248 VAL n 
1 249 ALA n 
1 250 ALA n 
1 251 VAL n 
1 252 ARG n 
1 253 ALA n 
1 254 ALA n 
1 255 LEU n 
1 256 GLY n 
1 257 PRO n 
1 258 GLU n 
1 259 GLY n 
1 260 HIS n 
1 261 GLY n 
1 262 ILE n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 LYS n 
1 268 ILE n 
1 269 GLU n 
1 270 ASN n 
1 271 HIS n 
1 272 GLU n 
1 273 GLY n 
1 274 VAL n 
1 275 LYS n 
1 276 ARG n 
1 277 PHE n 
1 278 ASP n 
1 279 GLU n 
1 280 ILE n 
1 281 LEU n 
1 282 GLU n 
1 283 VAL n 
1 284 SER n 
1 285 ASP n 
1 286 GLY n 
1 287 ILE n 
1 288 MET n 
1 289 VAL n 
1 290 ALA n 
1 291 ARG n 
1 292 GLY n 
1 293 ASP n 
1 294 LEU n 
1 295 GLY n 
1 296 ILE n 
1 297 GLU n 
1 298 ILE n 
1 299 PRO n 
1 300 ALA n 
1 301 GLU n 
1 302 LYS n 
1 303 VAL n 
1 304 PHE n 
1 305 LEU n 
1 306 ALA n 
1 307 GLN n 
1 308 LYS n 
1 309 MET n 
1 310 MET n 
1 311 ILE n 
1 312 GLY n 
1 313 ARG n 
1 314 CYS n 
1 315 ASN n 
1 316 LEU n 
1 317 ALA n 
1 318 GLY n 
1 319 LYS n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 CYS n 
1 324 ALA n 
1 325 THR n 
1 326 GLN n 
1 327 MET n 
1 328 LEU n 
1 329 GLU n 
1 330 SER n 
1 331 MET n 
1 332 ILE n 
1 333 THR n 
1 334 LYS n 
1 335 PRO n 
1 336 ARG n 
1 337 PRO n 
1 338 THR n 
1 339 ARG n 
1 340 ALA n 
1 341 GLU n 
1 342 THR n 
1 343 SER n 
1 344 ASP n 
1 345 VAL n 
1 346 ALA n 
1 347 ASN n 
1 348 ALA n 
1 349 VAL n 
1 350 LEU n 
1 351 ASP n 
1 352 GLY n 
1 353 ALA n 
1 354 ASP n 
1 355 CYS n 
1 356 ILE n 
1 357 MET n 
1 358 LEU n 
1 359 SER n 
1 360 GLY n 
1 361 GLU n 
1 362 THR n 
1 363 ALA n 
1 364 LYS n 
1 365 GLY n 
1 366 ASN n 
1 367 PHE n 
1 368 PRO n 
1 369 VAL n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 LYS n 
1 374 MET n 
1 375 GLN n 
1 376 HIS n 
1 377 ALA n 
1 378 ILE n 
1 379 ALA n 
1 380 ARG n 
1 381 GLU n 
1 382 ALA n 
1 383 GLU n 
1 384 ALA n 
1 385 ALA n 
1 386 VAL n 
1 387 TYR n 
1 388 HIS n 
1 389 ARG n 
1 390 GLN n 
1 391 LEU n 
1 392 PHE n 
1 393 GLU n 
1 394 GLU n 
1 395 LEU n 
1 396 ARG n 
1 397 ARG n 
1 398 ALA n 
1 399 ALA n 
1 400 PRO n 
1 401 LEU n 
1 402 SER n 
1 403 ARG n 
1 404 ASP n 
1 405 PRO n 
1 406 THR n 
1 407 GLU n 
1 408 VAL n 
1 409 THR n 
1 410 ALA n 
1 411 ILE n 
1 412 GLY n 
1 413 ALA n 
1 414 VAL n 
1 415 GLU n 
1 416 ALA n 
1 417 ALA n 
1 418 PHE n 
1 419 LYS n 
1 420 CYS n 
1 421 CYS n 
1 422 ALA n 
1 423 ALA n 
1 424 ALA n 
1 425 ILE n 
1 426 ILE n 
1 427 VAL n 
1 428 LEU n 
1 429 THR n 
1 430 THR n 
1 431 THR n 
1 432 GLY n 
1 433 ARG n 
1 434 SER n 
1 435 ALA n 
1 436 GLN n 
1 437 LEU n 
1 438 LEU n 
1 439 SER n 
1 440 ARG n 
1 441 TYR n 
1 442 ARG n 
1 443 PRO n 
1 444 ARG n 
1 445 ALA n 
1 446 ALA n 
1 447 VAL n 
1 448 ILE n 
1 449 ALA n 
1 450 VAL n 
1 451 THR n 
1 452 ARG n 
1 453 SER n 
1 454 ALA n 
1 455 GLN n 
1 456 ALA n 
1 457 ALA n 
1 458 ARG n 
1 459 GLN n 
1 460 VAL n 
1 461 HIS n 
1 462 LEU n 
1 463 CYS n 
1 464 ARG n 
1 465 GLY n 
1 466 VAL n 
1 467 PHE n 
1 468 PRO n 
1 469 LEU n 
1 470 LEU n 
1 471 TYR n 
1 472 ARG n 
1 473 GLU n 
1 474 PRO n 
1 475 PRO n 
1 476 GLU n 
1 477 ALA n 
1 478 ILE n 
1 479 TRP n 
1 480 ALA n 
1 481 ASP n 
1 482 ASP n 
1 483 VAL n 
1 484 ASP n 
1 485 ARG n 
1 486 ARG n 
1 487 VAL n 
1 488 GLN n 
1 489 PHE n 
1 490 GLY n 
1 491 ILE n 
1 492 GLU n 
1 493 SER n 
1 494 GLY n 
1 495 LYS n 
1 496 LEU n 
1 497 ARG n 
1 498 GLY n 
1 499 PHE n 
1 500 LEU n 
1 501 ARG n 
1 502 VAL n 
1 503 GLY n 
1 504 ASP n 
1 505 LEU n 
1 506 VAL n 
1 507 ILE n 
1 508 VAL n 
1 509 VAL n 
1 510 THR n 
1 511 GLY n 
1 512 TRP n 
1 513 ARG n 
1 514 PRO n 
1 515 GLY n 
1 516 SER n 
1 517 GLY n 
1 518 TYR n 
1 519 THR n 
1 520 ASN n 
1 521 ILE n 
1 522 MET n 
1 523 ARG n 
1 524 VAL n 
1 525 LEU n 
1 526 SER n 
1 527 ILE n 
1 528 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KPYR_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P30613 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VGB A 1 ? 528 ? P30613 47 ? 574 ? 47 574 
2 1 2VGB B 1 ? 528 ? P30613 47 ? 574 ? 47 574 
3 1 2VGB C 1 ? 528 ? P30613 47 ? 574 ? 47 574 
4 1 2VGB D 1 ? 528 ? P30613 47 ? 574 ? 47 574 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ?                         'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?                         'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?                         'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?                         'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ?                         'C3 H7 N O2 S'   121.158 
FBP 'D-saccharide, beta linking' n 1,6-di-O-phosphono-beta-D-fructofuranose FRUCTOSE-1,6-BISPHOSPHATE 'C6 H14 O12 P2'  340.116 
GLN 'L-peptide linking'          y GLUTAMINE                                ?                         'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?                         'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ?                         'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ?                         'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ?                         'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ?                         'C6 H13 N O2'    131.173 
K   non-polymer                  . 'POTASSIUM ION'                          ?                         'K 1'            39.098  
LEU 'L-peptide linking'          y LEUCINE                                  ?                         'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?                         'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ?                         'C5 H11 N O2 S'  149.211 
MN  non-polymer                  . 'MANGANESE (II) ION'                     ?                         'Mn 2'           54.938  
PGA non-polymer                  . '2-PHOSPHOGLYCOLIC ACID'                 ?                         'C2 H5 O6 P'     156.031 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?                         'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ?                         'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ?                         'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ?                         'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?                         'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?                         'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ?                         'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VGB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_percent_sol   50.46 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;RECOMBINANT WILD-TYPE RPK WAS CRYSTALLIZED USING THE VAPOR DIFFUSION METHOD AT 22 C. WELL SOLUTIONS CONSISTED OF 50 MM MES/KOH, PH 6.4, 10 MM MNSO4, AND 10-14% W/V PEG8000. HANGING DROPS WERE FORMED BY MIXING EQUAL VOLUMES OF 12 MG/ML PROTEIN IN 50 MM KCL, 5 MM FBP, 5 MM PHOSPHOGLYCOLATE, 20 MM POTASSIUM PHOSPHATE, PH 7.0, AND WELL SOLUTIONS.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_collection_date         ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.type                         ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1. 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        ESRF 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             1. 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VGB 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   55091 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.1 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   86.5 
_reflns_shell.Rmerge_I_obs           0.24 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VGB 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     52174 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.73 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2780 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.915 
_refine.correlation_coeff_Fo_to_Fc_free          0.881 
_refine.B_iso_mean                               40.86 
_refine.aniso_B[1][1]                            -0.14000 
_refine.aniso_B[2][2]                            0.20000 
_refine.aniso_B[3][3]                            -0.05000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.12000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1PKN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.416 
_refine.overall_SU_ML                            0.332 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             35.492 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15423 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         124 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               15612 
_refine_hist.d_res_high                       2.73 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 15782 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.513  1.977  ? 21409 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.423  5.000  ? 2029  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.011 23.014 ? 657   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.809 15.000 ? 2668  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       23.116 15.000 ? 158   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 2490  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 11775 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.257  0.200  ? 7652  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.322  0.200  ? 10829 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.163  0.200  ? 658   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.540  0.200  ? 116   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.315  0.200  ? 8     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.399  1.500  ? 10104 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.785  2.000  ? 16275 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.546  3.000  ? 5710  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.564  4.500  ? 5134  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2066 0.07 0.05 'tight positional'  1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 2066 0.06 0.05 'tight positional'  1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 2066 0.06 0.05 'tight positional'  1 3  'X-RAY DIFFRACTION' ? ? ? 
4 D 2066 0.05 0.05 'tight positional'  1 4  'X-RAY DIFFRACTION' ? ? ? 
1 A 1112 0.04 0.05 'tight positional'  3 5  'X-RAY DIFFRACTION' ? ? ? 
2 B 1112 0.04 0.05 'tight positional'  3 6  'X-RAY DIFFRACTION' ? ? ? 
3 C 1112 0.05 0.05 'tight positional'  3 7  'X-RAY DIFFRACTION' ? ? ? 
4 D 1112 0.05 0.05 'tight positional'  3 8  'X-RAY DIFFRACTION' ? ? ? 
1 A 20   0.28 0.50 'medium positional' 1 9  'X-RAY DIFFRACTION' ? ? ? 
2 B 20   0.62 0.50 'medium positional' 1 10 'X-RAY DIFFRACTION' ? ? ? 
3 C 20   0.43 0.50 'medium positional' 1 11 'X-RAY DIFFRACTION' ? ? ? 
4 D 20   0.35 0.50 'medium positional' 1 12 'X-RAY DIFFRACTION' ? ? ? 
1 A 541  0.40 0.50 'medium positional' 2 13 'X-RAY DIFFRACTION' ? ? ? 
2 B 541  0.30 0.50 'medium positional' 2 14 'X-RAY DIFFRACTION' ? ? ? 
3 C 541  0.23 0.50 'medium positional' 2 15 'X-RAY DIFFRACTION' ? ? ? 
4 D 541  0.25 0.50 'medium positional' 2 16 'X-RAY DIFFRACTION' ? ? ? 
1 A 9    0.26 0.50 'medium positional' 3 17 'X-RAY DIFFRACTION' ? ? ? 
2 B 9    0.24 0.50 'medium positional' 3 18 'X-RAY DIFFRACTION' ? ? ? 
3 C 9    0.19 0.50 'medium positional' 3 19 'X-RAY DIFFRACTION' ? ? ? 
4 D 9    0.35 0.50 'medium positional' 3 20 'X-RAY DIFFRACTION' ? ? ? 
1 A 2066 0.09 0.50 'tight thermal'     1 21 'X-RAY DIFFRACTION' ? ? ? 
2 B 2066 0.09 0.50 'tight thermal'     1 22 'X-RAY DIFFRACTION' ? ? ? 
3 C 2066 0.10 0.50 'tight thermal'     1 23 'X-RAY DIFFRACTION' ? ? ? 
4 D 2066 0.10 0.50 'tight thermal'     1 24 'X-RAY DIFFRACTION' ? ? ? 
1 A 1112 0.08 0.50 'tight thermal'     3 25 'X-RAY DIFFRACTION' ? ? ? 
2 B 1112 0.07 0.50 'tight thermal'     3 26 'X-RAY DIFFRACTION' ? ? ? 
3 C 1112 0.09 0.50 'tight thermal'     3 27 'X-RAY DIFFRACTION' ? ? ? 
4 D 1112 0.08 0.50 'tight thermal'     3 28 'X-RAY DIFFRACTION' ? ? ? 
1 A 20   0.83 2.00 'medium thermal'    1 29 'X-RAY DIFFRACTION' ? ? ? 
2 B 20   1.25 2.00 'medium thermal'    1 30 'X-RAY DIFFRACTION' ? ? ? 
3 C 20   1.17 2.00 'medium thermal'    1 31 'X-RAY DIFFRACTION' ? ? ? 
4 D 20   0.81 2.00 'medium thermal'    1 32 'X-RAY DIFFRACTION' ? ? ? 
1 A 541  0.41 2.00 'medium thermal'    2 33 'X-RAY DIFFRACTION' ? ? ? 
2 B 541  0.36 2.00 'medium thermal'    2 34 'X-RAY DIFFRACTION' ? ? ? 
3 C 541  0.44 2.00 'medium thermal'    2 35 'X-RAY DIFFRACTION' ? ? ? 
4 D 541  0.46 2.00 'medium thermal'    2 36 'X-RAY DIFFRACTION' ? ? ? 
1 A 9    0.28 2.00 'medium thermal'    3 37 'X-RAY DIFFRACTION' ? ? ? 
2 B 9    0.46 2.00 'medium thermal'    3 38 'X-RAY DIFFRACTION' ? ? ? 
3 C 9    0.31 2.00 'medium thermal'    3 39 'X-RAY DIFFRACTION' ? ? ? 
4 D 9    0.38 2.00 'medium thermal'    3 40 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.73 
_refine_ls_shell.d_res_low                        2.79 
_refine_ls_shell.number_reflns_R_work             3194 
_refine_ls_shell.R_factor_R_work                  0.3340 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3840 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             151 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
1 A 2 
2 B 2 
3 C 2 
4 D 2 
1 A 3 
2 B 3 
3 C 3 
4 D 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 57  A 161 1 1 ? ? ? ? ? ? ? ? 1 ? 
2 B 57  B 161 1 1 ? ? ? ? ? ? ? ? 1 ? 
3 C 57  C 161 1 1 ? ? ? ? ? ? ? ? 1 ? 
4 D 57  D 161 1 1 ? ? ? ? ? ? ? ? 1 ? 
1 A 261 A 430 2 1 ? ? ? ? ? ? ? ? 1 ? 
2 B 261 B 430 2 1 ? ? ? ? ? ? ? ? 1 ? 
3 C 261 C 430 2 1 ? ? ? ? ? ? ? ? 1 ? 
4 D 261 D 430 2 1 ? ? ? ? ? ? ? ? 1 ? 
1 A 580 A 580 3 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 580 B 580 3 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 580 C 580 3 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 580 D 580 3 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 162 A 260 1 4 ? ? ? ? ? ? ? ? 2 ? 
2 B 162 B 260 1 4 ? ? ? ? ? ? ? ? 2 ? 
3 C 162 C 260 1 4 ? ? ? ? ? ? ? ? 2 ? 
4 D 162 D 260 1 4 ? ? ? ? ? ? ? ? 2 ? 
1 A 431 A 573 1 1 ? ? ? ? ? ? ? ? 3 ? 
2 B 431 B 573 1 1 ? ? ? ? ? ? ? ? 3 ? 
3 C 431 C 573 1 1 ? ? ? ? ? ? ? ? 3 ? 
4 D 431 D 573 1 1 ? ? ? ? ? ? ? ? 3 ? 
1 A 581 A 581 2 4 ? ? ? ? ? ? ? ? 3 ? 
2 B 581 B 581 2 4 ? ? ? ? ? ? ? ? 3 ? 
3 C 581 C 581 2 4 ? ? ? ? ? ? ? ? 3 ? 
4 D 581 D 581 2 4 ? ? ? ? ? ? ? ? 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  2VGB 
_struct.title                     'HUMAN ERYTHROCYTE PYRUVATE KINASE' 
_struct.pdbx_descriptor           'PYRUVATE KINASE ISOZYMES R/L (E.C.2.7.1.40)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VGB 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;METAL-BINDING, PHOSPHORYLATION, PYRUVATE KINASE IN THE ACTIVE R-STATE, KINASE, PYRUVATE, MAGNESIUM, GLYCOLYSIS, TRANSFERASE, DISEASE MUTATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 2 ? 
N N N 3 ? 
O N N 4 ? 
P N N 5 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 4 ? 
T N N 5 ? 
U N N 6 ? 
V N N 6 ? 
W N N 6 ? 
X N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 14  ? MET A 19  ? GLN A 60  MET A 65  1 ? 6  
HELX_P HELX_P2  2  THR A 22  ? CYS A 28  ? THR A 68  CYS A 74  1 ? 7  
HELX_P HELX_P3  3  GLY A 49  ? ARG A 53  ? GLY A 95  ARG A 99  5 ? 5  
HELX_P HELX_P4  4  SER A 54  ? GLY A 65  ? SER A 100 GLY A 111 1 ? 12 
HELX_P HELX_P5  5  SER A 77  ? SER A 94  ? SER A 123 SER A 140 1 ? 18 
HELX_P HELX_P6  6  ASP A 142 ? THR A 147 ? ASP A 188 THR A 193 5 ? 6  
HELX_P HELX_P7  7  ASN A 160 ? VAL A 165 ? ASN A 206 VAL A 211 1 ? 6  
HELX_P HELX_P8  8  SER A 219 ? HIS A 232 ? SER A 265 HIS A 278 1 ? 14 
HELX_P HELX_P9  9  LYS A 244 ? GLY A 256 ? LYS A 290 GLY A 302 1 ? 13 
HELX_P HELX_P10 10 PRO A 257 ? HIS A 260 ? PRO A 303 HIS A 306 5 ? 4  
HELX_P HELX_P11 11 ASN A 270 ? ARG A 276 ? ASN A 316 ARG A 322 1 ? 7  
HELX_P HELX_P12 12 ARG A 276 ? SER A 284 ? ARG A 322 SER A 330 1 ? 9  
HELX_P HELX_P13 13 ARG A 291 ? ILE A 298 ? ARG A 337 ILE A 344 1 ? 8  
HELX_P HELX_P14 14 PRO A 299 ? GLU A 301 ? PRO A 345 GLU A 347 5 ? 3  
HELX_P HELX_P15 15 LYS A 302 ? GLY A 318 ? LYS A 348 GLY A 364 1 ? 17 
HELX_P HELX_P16 16 LEU A 328 ? THR A 333 ? LEU A 374 THR A 379 5 ? 6  
HELX_P HELX_P17 17 THR A 338 ? GLY A 352 ? THR A 384 GLY A 398 1 ? 15 
HELX_P HELX_P18 18 SER A 359 ? LYS A 364 ? SER A 405 LYS A 410 1 ? 6  
HELX_P HELX_P19 19 PHE A 367 ? VAL A 386 ? PHE A 413 VAL A 432 1 ? 20 
HELX_P HELX_P20 20 TYR A 387 ? ALA A 399 ? TYR A 433 ALA A 445 1 ? 13 
HELX_P HELX_P21 21 ASP A 404 ? CYS A 420 ? ASP A 450 CYS A 466 1 ? 17 
HELX_P HELX_P22 22 GLY A 432 ? ARG A 440 ? GLY A 478 ARG A 486 1 ? 9  
HELX_P HELX_P23 23 SER A 453 ? VAL A 460 ? SER A 499 VAL A 506 1 ? 8  
HELX_P HELX_P24 24 HIS A 461 ? CYS A 463 ? HIS A 507 CYS A 509 5 ? 3  
HELX_P HELX_P25 25 ILE A 478 ? ARG A 497 ? ILE A 524 ARG A 543 1 ? 20 
HELX_P HELX_P26 26 GLN B 14  ? MET B 19  ? GLN B 60  MET B 65  1 ? 6  
HELX_P HELX_P27 27 THR B 22  ? CYS B 28  ? THR B 68  CYS B 74  1 ? 7  
HELX_P HELX_P28 28 GLY B 49  ? ARG B 53  ? GLY B 95  ARG B 99  5 ? 5  
HELX_P HELX_P29 29 SER B 54  ? GLY B 65  ? SER B 100 GLY B 111 1 ? 12 
HELX_P HELX_P30 30 SER B 77  ? SER B 94  ? SER B 123 SER B 140 1 ? 18 
HELX_P HELX_P31 31 ASN B 160 ? VAL B 165 ? ASN B 206 VAL B 211 1 ? 6  
HELX_P HELX_P32 32 SER B 219 ? HIS B 232 ? SER B 265 HIS B 278 1 ? 14 
HELX_P HELX_P33 33 LYS B 244 ? GLY B 256 ? LYS B 290 GLY B 302 1 ? 13 
HELX_P HELX_P34 34 PRO B 257 ? HIS B 260 ? PRO B 303 HIS B 306 5 ? 4  
HELX_P HELX_P35 35 ASN B 270 ? ARG B 276 ? ASN B 316 ARG B 322 1 ? 7  
HELX_P HELX_P36 36 ARG B 276 ? SER B 284 ? ARG B 322 SER B 330 1 ? 9  
HELX_P HELX_P37 37 ARG B 291 ? ILE B 298 ? ARG B 337 ILE B 344 1 ? 8  
HELX_P HELX_P38 38 PRO B 299 ? GLU B 301 ? PRO B 345 GLU B 347 5 ? 3  
HELX_P HELX_P39 39 LYS B 302 ? GLY B 318 ? LYS B 348 GLY B 364 1 ? 17 
HELX_P HELX_P40 40 LEU B 328 ? THR B 333 ? LEU B 374 THR B 379 5 ? 6  
HELX_P HELX_P41 41 THR B 338 ? GLY B 352 ? THR B 384 GLY B 398 1 ? 15 
HELX_P HELX_P42 42 SER B 359 ? LYS B 364 ? SER B 405 LYS B 410 1 ? 6  
HELX_P HELX_P43 43 PHE B 367 ? ALA B 385 ? PHE B 413 ALA B 431 1 ? 19 
HELX_P HELX_P44 44 TYR B 387 ? ALA B 399 ? TYR B 433 ALA B 445 1 ? 13 
HELX_P HELX_P45 45 ASP B 404 ? CYS B 420 ? ASP B 450 CYS B 466 1 ? 17 
HELX_P HELX_P46 46 GLY B 432 ? TYR B 441 ? GLY B 478 TYR B 487 1 ? 10 
HELX_P HELX_P47 47 SER B 453 ? VAL B 460 ? SER B 499 VAL B 506 1 ? 8  
HELX_P HELX_P48 48 HIS B 461 ? CYS B 463 ? HIS B 507 CYS B 509 5 ? 3  
HELX_P HELX_P49 49 ILE B 478 ? ARG B 497 ? ILE B 524 ARG B 543 1 ? 20 
HELX_P HELX_P50 50 GLN C 14  ? MET C 19  ? GLN C 60  MET C 65  1 ? 6  
HELX_P HELX_P51 51 THR C 22  ? CYS C 28  ? THR C 68  CYS C 74  1 ? 7  
HELX_P HELX_P52 52 GLY C 49  ? ARG C 53  ? GLY C 95  ARG C 99  5 ? 5  
HELX_P HELX_P53 53 SER C 54  ? GLY C 65  ? SER C 100 GLY C 111 1 ? 12 
HELX_P HELX_P54 54 SER C 77  ? SER C 94  ? SER C 123 SER C 140 1 ? 18 
HELX_P HELX_P55 55 ASP C 142 ? ARG C 146 ? ASP C 188 ARG C 192 5 ? 5  
HELX_P HELX_P56 56 ASN C 160 ? VAL C 165 ? ASN C 206 VAL C 211 1 ? 6  
HELX_P HELX_P57 57 SER C 219 ? HIS C 232 ? SER C 265 HIS C 278 1 ? 14 
HELX_P HELX_P58 58 LYS C 244 ? GLY C 256 ? LYS C 290 GLY C 302 1 ? 13 
HELX_P HELX_P59 59 PRO C 257 ? HIS C 260 ? PRO C 303 HIS C 306 5 ? 4  
HELX_P HELX_P60 60 ASN C 270 ? ARG C 276 ? ASN C 316 ARG C 322 1 ? 7  
HELX_P HELX_P61 61 ARG C 276 ? SER C 284 ? ARG C 322 SER C 330 1 ? 9  
HELX_P HELX_P62 62 ARG C 291 ? ILE C 298 ? ARG C 337 ILE C 344 1 ? 8  
HELX_P HELX_P63 63 PRO C 299 ? GLU C 301 ? PRO C 345 GLU C 347 5 ? 3  
HELX_P HELX_P64 64 LYS C 302 ? GLY C 318 ? LYS C 348 GLY C 364 1 ? 17 
HELX_P HELX_P65 65 LEU C 328 ? THR C 333 ? LEU C 374 THR C 379 5 ? 6  
HELX_P HELX_P66 66 THR C 338 ? GLY C 352 ? THR C 384 GLY C 398 1 ? 15 
HELX_P HELX_P67 67 SER C 359 ? LYS C 364 ? SER C 405 LYS C 410 1 ? 6  
HELX_P HELX_P68 68 PHE C 367 ? VAL C 386 ? PHE C 413 VAL C 432 1 ? 20 
HELX_P HELX_P69 69 TYR C 387 ? ALA C 399 ? TYR C 433 ALA C 445 1 ? 13 
HELX_P HELX_P70 70 ASP C 404 ? CYS C 421 ? ASP C 450 CYS C 467 1 ? 18 
HELX_P HELX_P71 71 GLY C 432 ? ARG C 440 ? GLY C 478 ARG C 486 1 ? 9  
HELX_P HELX_P72 72 SER C 453 ? VAL C 460 ? SER C 499 VAL C 506 1 ? 8  
HELX_P HELX_P73 73 HIS C 461 ? CYS C 463 ? HIS C 507 CYS C 509 5 ? 3  
HELX_P HELX_P74 74 ILE C 478 ? ARG C 497 ? ILE C 524 ARG C 543 1 ? 20 
HELX_P HELX_P75 75 GLN D 14  ? MET D 19  ? GLN D 60  MET D 65  1 ? 6  
HELX_P HELX_P76 76 THR D 22  ? CYS D 28  ? THR D 68  CYS D 74  1 ? 7  
HELX_P HELX_P77 77 GLY D 49  ? ARG D 53  ? GLY D 95  ARG D 99  5 ? 5  
HELX_P HELX_P78 78 SER D 54  ? GLY D 65  ? SER D 100 GLY D 111 1 ? 12 
HELX_P HELX_P79 79 SER D 77  ? SER D 94  ? SER D 123 SER D 140 1 ? 18 
HELX_P HELX_P80 80 ASP D 142 ? THR D 147 ? ASP D 188 THR D 193 5 ? 6  
HELX_P HELX_P81 81 ASN D 160 ? VAL D 165 ? ASN D 206 VAL D 211 1 ? 6  
HELX_P HELX_P82 82 SER D 219 ? HIS D 232 ? SER D 265 HIS D 278 1 ? 14 
HELX_P HELX_P83 83 LYS D 244 ? GLY D 256 ? LYS D 290 GLY D 302 1 ? 13 
HELX_P HELX_P84 84 PRO D 257 ? HIS D 260 ? PRO D 303 HIS D 306 5 ? 4  
HELX_P HELX_P85 85 ASN D 270 ? ARG D 276 ? ASN D 316 ARG D 322 1 ? 7  
HELX_P HELX_P86 86 ARG D 276 ? SER D 284 ? ARG D 322 SER D 330 1 ? 9  
HELX_P HELX_P87 87 ARG D 291 ? ILE D 298 ? ARG D 337 ILE D 344 1 ? 8  
HELX_P HELX_P88 88 LYS D 302 ? GLY D 318 ? LYS D 348 GLY D 364 1 ? 17 
HELX_P HELX_P89 89 LEU D 328 ? THR D 333 ? LEU D 374 THR D 379 5 ? 6  
HELX_P HELX_P90 90 THR D 338 ? GLY D 352 ? THR D 384 GLY D 398 1 ? 15 
HELX_P HELX_P91 91 SER D 359 ? LYS D 364 ? SER D 405 LYS D 410 1 ? 6  
HELX_P HELX_P92 92 PHE D 367 ? ALA D 385 ? PHE D 413 ALA D 431 1 ? 19 
HELX_P HELX_P93 93 TYR D 387 ? ALA D 399 ? TYR D 433 ALA D 445 1 ? 13 
HELX_P HELX_P94 94 ASP D 404 ? CYS D 420 ? ASP D 450 CYS D 466 1 ? 17 
HELX_P HELX_P95 95 GLY D 432 ? ARG D 440 ? GLY D 478 ARG D 486 1 ? 9  
HELX_P HELX_P96 96 SER D 453 ? VAL D 460 ? SER D 499 VAL D 506 1 ? 8  
HELX_P HELX_P97 97 HIS D 461 ? CYS D 463 ? HIS D 507 CYS D 509 5 ? 3  
HELX_P HELX_P98 98 ILE D 478 ? ARG D 497 ? ILE D 524 ARG D 543 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASN 72  OD1 ? ? ? 1_555 G K  . K  ? ? A ASN 118 A K  582 1_555 ? ? ? ? ? ? ? 3.145 ? ? 
metalc2  metalc ? ? A SER 74  OG  ? ? ? 1_555 G K  . K  ? ? A SER 120 A K  582 1_555 ? ? ? ? ? ? ? 3.442 ? ? 
metalc3  metalc ? ? A ASP 110 OD1 ? ? ? 1_555 G K  . K  ? ? A ASP 156 A K  582 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc4  metalc ? ? A THR 111 O   ? ? ? 1_555 G K  . K  ? ? A THR 157 A K  582 1_555 ? ? ? ? ? ? ? 3.028 ? ? 
metalc5  metalc ? ? A GLU 269 OE2 ? ? ? 1_555 H MN . MN ? ? A GLU 315 A MN 583 1_555 ? ? ? ? ? ? ? 1.608 ? ? 
metalc6  metalc ? ? A ASP 293 OD2 ? ? ? 1_555 H MN . MN ? ? A ASP 339 A MN 583 1_555 ? ? ? ? ? ? ? 1.870 ? ? 
metalc7  metalc ? ? F PGA .   O2P ? ? ? 1_555 G K  . K  ? ? A PGA 581 A K  582 1_555 ? ? ? ? ? ? ? 3.136 ? ? 
metalc8  metalc ? ? F PGA .   O1P ? ? ? 1_555 H MN . MN ? ? A PGA 581 A MN 583 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc9  metalc ? ? F PGA .   O1  ? ? ? 1_555 H MN . MN ? ? A PGA 581 A MN 583 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc10 metalc ? ? F PGA .   O4P ? ? ? 1_555 H MN . MN ? ? A PGA 581 A MN 583 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc11 metalc ? ? B ASN 72  OD1 ? ? ? 1_555 K K  . K  ? ? B ASN 118 B K  586 1_555 ? ? ? ? ? ? ? 3.208 ? ? 
metalc12 metalc ? ? B ASP 110 OD1 ? ? ? 1_555 K K  . K  ? ? B ASP 156 B K  586 1_555 ? ? ? ? ? ? ? 2.619 ? ? 
metalc13 metalc ? ? B THR 111 O   ? ? ? 1_555 K K  . K  ? ? B THR 157 B K  586 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc14 metalc ? ? B GLU 269 OE2 ? ? ? 1_555 L MN . MN ? ? B GLU 315 B MN 587 1_555 ? ? ? ? ? ? ? 1.753 ? ? 
metalc15 metalc ? ? B ASP 293 OD2 ? ? ? 1_555 L MN . MN ? ? B ASP 339 B MN 587 1_555 ? ? ? ? ? ? ? 1.785 ? ? 
metalc16 metalc ? ? J PGA .   O2P ? ? ? 1_555 K K  . K  ? ? B PGA 581 B K  586 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc17 metalc ? ? J PGA .   O1  ? ? ? 1_555 L MN . MN ? ? B PGA 581 B MN 587 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc18 metalc ? ? J PGA .   O4P ? ? ? 1_555 L MN . MN ? ? B PGA 581 B MN 587 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc19 metalc ? ? J PGA .   O1P ? ? ? 1_555 L MN . MN ? ? B PGA 581 B MN 587 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc20 metalc ? ? C ASN 72  OD1 ? ? ? 1_555 O K  . K  ? ? C ASN 118 C K  590 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc21 metalc ? ? C ASP 110 OD1 ? ? ? 1_555 O K  . K  ? ? C ASP 156 C K  590 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc22 metalc ? ? C THR 111 O   ? ? ? 1_555 O K  . K  ? ? C THR 157 C K  590 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc23 metalc ? ? C GLU 269 OE2 ? ? ? 1_555 P MN . MN ? ? C GLU 315 C MN 591 1_555 ? ? ? ? ? ? ? 1.567 ? ? 
metalc24 metalc ? ? C ASP 293 OD2 ? ? ? 1_555 P MN . MN ? ? C ASP 339 C MN 591 1_555 ? ? ? ? ? ? ? 1.720 ? ? 
metalc25 metalc ? ? N PGA .   O2P ? ? ? 1_555 O K  . K  ? ? C PGA 581 C K  590 1_555 ? ? ? ? ? ? ? 2.968 ? ? 
metalc26 metalc ? ? N PGA .   O1  ? ? ? 1_555 P MN . MN ? ? C PGA 581 C MN 591 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc27 metalc ? ? N PGA .   O4P ? ? ? 1_555 P MN . MN ? ? C PGA 581 C MN 591 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc28 metalc ? ? N PGA .   O1P ? ? ? 1_555 P MN . MN ? ? C PGA 581 C MN 591 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc29 metalc ? ? D ASN 72  OD1 ? ? ? 1_555 S K  . K  ? ? D ASN 118 D K  594 1_555 ? ? ? ? ? ? ? 2.966 ? ? 
metalc30 metalc ? ? D ASP 110 OD1 ? ? ? 1_555 S K  . K  ? ? D ASP 156 D K  594 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc31 metalc ? ? D THR 111 O   ? ? ? 1_555 S K  . K  ? ? D THR 157 D K  594 1_555 ? ? ? ? ? ? ? 3.036 ? ? 
metalc32 metalc ? ? D GLU 269 OE2 ? ? ? 1_555 T MN . MN ? ? D GLU 315 D MN 595 1_555 ? ? ? ? ? ? ? 1.522 ? ? 
metalc33 metalc ? ? D ASP 293 OD2 ? ? ? 1_555 T MN . MN ? ? D ASP 339 D MN 595 1_555 ? ? ? ? ? ? ? 1.834 ? ? 
metalc34 metalc ? ? R PGA .   O2P ? ? ? 1_555 S K  . K  ? ? D PGA 581 D K  594 1_555 ? ? ? ? ? ? ? 2.890 ? ? 
metalc35 metalc ? ? R PGA .   O1  ? ? ? 1_555 T MN . MN ? ? D PGA 581 D MN 595 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc36 metalc ? ? R PGA .   O1P ? ? ? 1_555 T MN . MN ? ? D PGA 581 D MN 595 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 10 ? 
AB ? 2  ? 
AC ? 6  ? 
AD ? 10 ? 
BA ? 9  ? 
BB ? 2  ? 
BC ? 6  ? 
CA ? 9  ? 
CB ? 2  ? 
CC ? 6  ? 
CD ? 10 ? 
DA ? 17 ? 
DB ? 2  ? 
DC ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? parallel      
AA 2  3  ? parallel      
AA 3  4  ? parallel      
AA 4  5  ? parallel      
AA 5  6  ? parallel      
AA 6  7  ? parallel      
AA 7  8  ? parallel      
AA 8  9  ? parallel      
AB 1  2  ? anti-parallel 
AC 1  2  ? parallel      
AC 2  3  ? anti-parallel 
AC 3  4  ? anti-parallel 
AC 4  5  ? anti-parallel 
AC 5  6  ? anti-parallel 
AD 1  2  ? parallel      
AD 2  3  ? parallel      
AD 3  4  ? parallel      
AD 4  5  ? anti-parallel 
AD 5  6  ? anti-parallel 
AD 6  7  ? anti-parallel 
AD 7  8  ? parallel      
AD 8  9  ? parallel      
AD 9  10 ? parallel      
BA 1  2  ? parallel      
BA 2  3  ? parallel      
BA 3  4  ? parallel      
BA 4  5  ? parallel      
BA 5  6  ? parallel      
BA 6  7  ? parallel      
BA 7  8  ? parallel      
BA 8  9  ? parallel      
BB 1  2  ? anti-parallel 
BC 1  2  ? parallel      
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BC 4  5  ? anti-parallel 
BC 5  6  ? anti-parallel 
CA 1  2  ? parallel      
CA 2  3  ? parallel      
CA 3  4  ? parallel      
CA 4  5  ? parallel      
CA 5  6  ? parallel      
CA 6  7  ? parallel      
CA 7  8  ? parallel      
CA 8  9  ? parallel      
CB 1  2  ? anti-parallel 
CC 1  2  ? parallel      
CC 2  3  ? anti-parallel 
CC 3  4  ? anti-parallel 
CC 4  5  ? anti-parallel 
CC 5  6  ? anti-parallel 
CD 1  2  ? parallel      
CD 2  3  ? parallel      
CD 3  4  ? parallel      
CD 4  5  ? anti-parallel 
CD 5  6  ? anti-parallel 
CD 6  7  ? anti-parallel 
CD 7  8  ? parallel      
CD 8  9  ? parallel      
CD 9  10 ? parallel      
DA 1  2  ? parallel      
DA 2  3  ? parallel      
DA 4  5  ? parallel      
DA 6  7  ? parallel      
DA 8  9  ? parallel      
DA 10 11 ? parallel      
DA 12 13 ? parallel      
DA 14 15 ? parallel      
DA 16 17 ? parallel      
DB 1  2  ? anti-parallel 
DC 1  2  ? parallel      
DC 2  3  ? anti-parallel 
DC 3  4  ? anti-parallel 
DC 4  5  ? anti-parallel 
DC 5  6  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  SER A 43  ? THR A 47  ? SER A 89  THR A 93  
AA 2  CYS A 355 ? LEU A 358 ? CYS A 401 LEU A 404 
AA 3  VAL A 321 ? ALA A 324 ? VAL A 367 ALA A 370 
AA 4  GLY A 286 ? ALA A 290 ? GLY A 332 ALA A 336 
AA 5  LYS A 263 ? ILE A 268 ? LYS A 309 ILE A 314 
AA 6  ILE A 236 ? ALA A 239 ? ILE A 282 ALA A 285 
AA 7  ALA A 106 ? ASP A 110 ? ALA A 152 ASP A 156 
AA 8  MET A 66  ? ASN A 72  ? MET A 112 ASN A 118 
AA 9  SER A 43  ? THR A 47  ? SER A 89  THR A 93  
AA 10 SER A 43  ? THR A 47  ? SER A 89  THR A 93  
AB 1  VAL A 129 ? LEU A 131 ? VAL A 175 LEU A 177 
AB 2  GLY A 198 ? LEU A 200 ? GLY A 244 LEU A 246 
AC 1  THR A 153 ? TRP A 155 ? THR A 199 TRP A 201 
AC 2  GLN A 136 ? THR A 140 ? GLN A 182 THR A 186 
AC 3  GLY A 189 ? ASN A 196 ? GLY A 235 ASN A 242 
AC 4  ILE A 178 ? ILE A 185 ? ILE A 224 ILE A 231 
AC 5  ARG A 170 ? ILE A 173 ? ARG A 216 ILE A 219 
AC 6  VAL A 206 ? ASN A 207 ? VAL A 252 ASN A 253 
AD 1  VAL A 466 ? LEU A 470 ? VAL A 512 LEU A 516 
AD 2  ALA A 446 ? THR A 451 ? ALA A 492 THR A 497 
AD 3  ALA A 424 ? LEU A 428 ? ALA A 470 LEU A 474 
AD 4  LEU A 505 ? GLY A 511 ? LEU A 551 GLY A 557 
AD 5  THR A 519 ? SER A 526 ? THR A 565 SER A 572 
AD 6  THR B 519 ? SER B 526 ? THR B 565 SER B 572 
AD 7  LEU B 505 ? GLY B 511 ? LEU B 551 GLY B 557 
AD 8  ALA B 424 ? LEU B 428 ? ALA B 470 LEU B 474 
AD 9  ALA B 446 ? THR B 451 ? ALA B 492 THR B 497 
AD 10 VAL B 466 ? LEU B 470 ? VAL B 512 LEU B 516 
BA 1  SER B 43  ? THR B 47  ? SER B 89  THR B 93  
BA 2  CYS B 355 ? LEU B 358 ? CYS B 401 LEU B 404 
BA 3  VAL B 321 ? ALA B 324 ? VAL B 367 ALA B 370 
BA 4  GLY B 286 ? ALA B 290 ? GLY B 332 ALA B 336 
BA 5  LYS B 263 ? ILE B 268 ? LYS B 309 ILE B 314 
BA 6  ILE B 236 ? ALA B 239 ? ILE B 282 ALA B 285 
BA 7  ALA B 106 ? ASP B 110 ? ALA B 152 ASP B 156 
BA 8  MET B 66  ? ASN B 72  ? MET B 112 ASN B 118 
BA 9  SER B 43  ? THR B 47  ? SER B 89  THR B 93  
BB 1  GLU B 130 ? LEU B 131 ? GLU B 176 LEU B 177 
BB 2  GLY B 198 ? VAL B 199 ? GLY B 244 VAL B 245 
BC 1  THR B 153 ? TRP B 155 ? THR B 199 TRP B 201 
BC 2  GLN B 136 ? THR B 140 ? GLN B 182 THR B 186 
BC 3  THR B 192 ? ASN B 196 ? THR B 238 ASN B 242 
BC 4  ILE B 178 ? VAL B 181 ? ILE B 224 VAL B 227 
BC 5  ARG B 170 ? ILE B 173 ? ARG B 216 ILE B 219 
BC 6  VAL B 206 ? ASN B 207 ? VAL B 252 ASN B 253 
CA 1  SER C 43  ? THR C 47  ? SER C 89  THR C 93  
CA 2  CYS C 355 ? LEU C 358 ? CYS C 401 LEU C 404 
CA 3  VAL C 321 ? ALA C 324 ? VAL C 367 ALA C 370 
CA 4  GLY C 286 ? ALA C 290 ? GLY C 332 ALA C 336 
CA 5  LYS C 263 ? ILE C 268 ? LYS C 309 ILE C 314 
CA 6  ILE C 236 ? ALA C 239 ? ILE C 282 ALA C 285 
CA 7  ALA C 106 ? ASP C 110 ? ALA C 152 ASP C 156 
CA 8  MET C 66  ? ASN C 72  ? MET C 112 ASN C 118 
CA 9  SER C 43  ? THR C 47  ? SER C 89  THR C 93  
CB 1  VAL C 129 ? LEU C 131 ? VAL C 175 LEU C 177 
CB 2  GLY C 198 ? LEU C 200 ? GLY C 244 LEU C 246 
CC 1  THR C 153 ? TRP C 155 ? THR C 199 TRP C 201 
CC 2  GLN C 136 ? THR C 140 ? GLN C 182 THR C 186 
CC 3  GLY C 189 ? ASN C 196 ? GLY C 235 ASN C 242 
CC 4  ILE C 178 ? GLY C 186 ? ILE C 224 GLY C 232 
CC 5  ARG C 170 ? ILE C 173 ? ARG C 216 ILE C 219 
CC 6  VAL C 206 ? ASN C 207 ? VAL C 252 ASN C 253 
CD 1  VAL C 466 ? LEU C 470 ? VAL C 512 LEU C 516 
CD 2  ALA C 446 ? THR C 451 ? ALA C 492 THR C 497 
CD 3  ALA C 424 ? LEU C 428 ? ALA C 470 LEU C 474 
CD 4  LEU C 505 ? GLY C 511 ? LEU C 551 GLY C 557 
CD 5  THR C 519 ? SER C 526 ? THR C 565 SER C 572 
CD 6  THR D 519 ? SER D 526 ? THR D 565 SER D 572 
CD 7  LEU D 505 ? GLY D 511 ? LEU D 551 GLY D 557 
CD 8  ALA D 424 ? LEU D 428 ? ALA D 470 LEU D 474 
CD 9  ALA D 446 ? THR D 451 ? ALA D 492 THR D 497 
CD 10 VAL D 466 ? LEU D 470 ? VAL D 512 LEU D 516 
DA 1  SER D 43  ? THR D 47  ? SER D 89  THR D 93  
DA 2  CYS D 355 ? LEU D 358 ? CYS D 401 LEU D 404 
DA 3  VAL D 321 ? ALA D 324 ? VAL D 367 ALA D 370 
DA 4  MET D 66  ? ASN D 72  ? MET D 112 ASN D 118 
DA 5  SER D 43  ? THR D 47  ? SER D 89  THR D 93  
DA 6  ALA D 106 ? ASP D 110 ? ALA D 152 ASP D 156 
DA 7  MET D 66  ? ASN D 72  ? MET D 112 ASN D 118 
DA 8  ILE D 236 ? ALA D 239 ? ILE D 282 ALA D 285 
DA 9  ALA D 106 ? ASP D 110 ? ALA D 152 ASP D 156 
DA 10 LYS D 263 ? ILE D 268 ? LYS D 309 ILE D 314 
DA 11 ILE D 236 ? ALA D 239 ? ILE D 282 ALA D 285 
DA 12 GLY D 286 ? ALA D 290 ? GLY D 332 ALA D 336 
DA 13 LYS D 263 ? ILE D 268 ? LYS D 309 ILE D 314 
DA 14 VAL D 321 ? ALA D 324 ? VAL D 367 ALA D 370 
DA 15 GLY D 286 ? ALA D 290 ? GLY D 332 ALA D 336 
DA 16 CYS D 355 ? LEU D 358 ? CYS D 401 LEU D 404 
DA 17 SER D 43  ? THR D 47  ? SER D 89  THR D 93  
DB 1  VAL D 129 ? LEU D 131 ? VAL D 175 LEU D 177 
DB 2  GLY D 198 ? LEU D 200 ? GLY D 244 LEU D 246 
DC 1  THR D 153 ? TRP D 155 ? THR D 199 TRP D 201 
DC 2  GLN D 136 ? THR D 140 ? GLN D 182 THR D 186 
DC 3  GLY D 189 ? ASN D 196 ? GLY D 235 ASN D 242 
DC 4  ILE D 178 ? GLY D 186 ? ILE D 224 GLY D 232 
DC 5  ARG D 170 ? ILE D 173 ? ARG D 216 ILE D 219 
DC 6  VAL D 206 ? ASN D 207 ? VAL D 252 ASN D 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N ILE A 45  ? N ILE A 91  O ILE A 356 ? O ILE A 402 
AA 2  3  N MET A 357 ? N MET A 403 O CYS A 323 ? O CYS A 369 
AA 3  4  N VAL A 322 ? N VAL A 368 O ILE A 287 ? O ILE A 333 
AA 4  5  N MET A 288 ? N MET A 334 O SER A 266 ? O SER A 312 
AA 5  6  N ILE A 265 ? N ILE A 311 O VAL A 237 ? O VAL A 283 
AA 6  7  N PHE A 238 ? N PHE A 284 O LEU A 109 ? O LEU A 155 
AA 7  8  N ALA A 106 ? N ALA A 152 O ASN A 67  ? O ASN A 113 
AA 8  9  N ASN A 67  ? N ASN A 113 O ILE A 44  ? O ILE A 90  
AB 1  2  N LEU A 131 ? N LEU A 177 O GLY A 198 ? O GLY A 244 
AC 1  2  N VAL A 154 ? N VAL A 200 O LEU A 138 ? O LEU A 184 
AC 2  3  N VAL A 139 ? N VAL A 185 O LEU A 190 ? O LEU A 236 
AC 3  4  N GLU A 195 ? N GLU A 241 O SER A 179 ? O SER A 225 
AC 4  5  N LEU A 180 ? N LEU A 226 O ILE A 171 ? O ILE A 217 
AC 5  6  N TYR A 172 ? N TYR A 218 O ASN A 207 ? O ASN A 253 
AD 1  2  N PHE A 467 ? N PHE A 513 O VAL A 447 ? O VAL A 493 
AD 2  3  N ILE A 448 ? N ILE A 494 O ILE A 425 ? O ILE A 471 
AD 3  4  N ILE A 426 ? N ILE A 472 O ILE A 507 ? O ILE A 553 
AD 4  5  O THR A 510 ? O THR A 556 N ASN A 520 ? N ASN A 566 
AD 5  6  N VAL A 524 ? N VAL A 570 O ASN B 520 ? O ASN B 566 
AD 6  7  N LEU B 525 ? N LEU B 571 O VAL B 506 ? O VAL B 552 
AD 7  8  N ILE B 507 ? N ILE B 553 O ALA B 424 ? O ALA B 470 
AD 8  9  N ILE B 425 ? N ILE B 471 O ALA B 446 ? O ALA B 492 
AD 9  10 N ALA B 449 ? N ALA B 495 O PHE B 467 ? O PHE B 513 
BA 1  2  N ILE B 45  ? N ILE B 91  O ILE B 356 ? O ILE B 402 
BA 2  3  N MET B 357 ? N MET B 403 O CYS B 323 ? O CYS B 369 
BA 3  4  N VAL B 322 ? N VAL B 368 O ILE B 287 ? O ILE B 333 
BA 4  5  N MET B 288 ? N MET B 334 O SER B 266 ? O SER B 312 
BA 5  6  N ILE B 265 ? N ILE B 311 O VAL B 237 ? O VAL B 283 
BA 6  7  N PHE B 238 ? N PHE B 284 O LEU B 109 ? O LEU B 155 
BA 7  8  N ALA B 106 ? N ALA B 152 O ASN B 67  ? O ASN B 113 
BA 8  9  N ASN B 67  ? N ASN B 113 O ILE B 44  ? O ILE B 90  
BB 1  2  N LEU B 131 ? N LEU B 177 O GLY B 198 ? O GLY B 244 
BC 1  2  N VAL B 154 ? N VAL B 200 O LEU B 138 ? O LEU B 184 
BC 2  3  N VAL B 137 ? N VAL B 183 O THR B 192 ? O THR B 238 
BC 3  4  N GLU B 195 ? N GLU B 241 O SER B 179 ? O SER B 225 
BC 4  5  N LEU B 180 ? N LEU B 226 O ILE B 171 ? O ILE B 217 
BC 5  6  N TYR B 172 ? N TYR B 218 O ASN B 207 ? O ASN B 253 
CA 1  2  N ILE C 45  ? N ILE C 91  O ILE C 356 ? O ILE C 402 
CA 2  3  N MET C 357 ? N MET C 403 O CYS C 323 ? O CYS C 369 
CA 3  4  N VAL C 322 ? N VAL C 368 O ILE C 287 ? O ILE C 333 
CA 4  5  N MET C 288 ? N MET C 334 O SER C 266 ? O SER C 312 
CA 5  6  N ILE C 265 ? N ILE C 311 O VAL C 237 ? O VAL C 283 
CA 6  7  N PHE C 238 ? N PHE C 284 O LEU C 109 ? O LEU C 155 
CA 7  8  N ALA C 106 ? N ALA C 152 O ASN C 67  ? O ASN C 113 
CA 8  9  N ASN C 67  ? N ASN C 113 O ILE C 44  ? O ILE C 90  
CB 1  2  N LEU C 131 ? N LEU C 177 O GLY C 198 ? O GLY C 244 
CC 1  2  N VAL C 154 ? N VAL C 200 O LEU C 138 ? O LEU C 184 
CC 2  3  N VAL C 139 ? N VAL C 185 O LEU C 190 ? O LEU C 236 
CC 3  4  N GLU C 195 ? N GLU C 241 O SER C 179 ? O SER C 225 
CC 4  5  N LEU C 180 ? N LEU C 226 O ILE C 171 ? O ILE C 217 
CC 5  6  N TYR C 172 ? N TYR C 218 O ASN C 207 ? O ASN C 253 
CD 1  2  N PHE C 467 ? N PHE C 513 O VAL C 447 ? O VAL C 493 
CD 2  3  N ILE C 448 ? N ILE C 494 O ILE C 425 ? O ILE C 471 
CD 3  4  N ILE C 426 ? N ILE C 472 O ILE C 507 ? O ILE C 553 
CD 4  5  O THR C 510 ? O THR C 556 N ASN C 520 ? N ASN C 566 
CD 5  6  N VAL C 524 ? N VAL C 570 O ASN D 520 ? O ASN D 566 
CD 6  7  N LEU D 525 ? N LEU D 571 O VAL D 506 ? O VAL D 552 
CD 7  8  N ILE D 507 ? N ILE D 553 O ALA D 424 ? O ALA D 470 
CD 8  9  N ILE D 425 ? N ILE D 471 O ALA D 446 ? O ALA D 492 
CD 9  10 N ALA D 449 ? N ALA D 495 O PHE D 467 ? O PHE D 513 
DA 1  2  N ILE D 45  ? N ILE D 91  O ILE D 356 ? O ILE D 402 
DA 2  3  N MET D 357 ? N MET D 403 O CYS D 323 ? O CYS D 369 
DA 4  5  N ASN D 67  ? N ASN D 113 O ILE D 44  ? O ILE D 90  
DA 6  7  N ALA D 106 ? N ALA D 152 O ASN D 67  ? O ASN D 113 
DA 8  9  N PHE D 238 ? N PHE D 284 O LEU D 109 ? O LEU D 155 
DA 10 11 N ILE D 265 ? N ILE D 311 O VAL D 237 ? O VAL D 283 
DA 12 13 N MET D 288 ? N MET D 334 O SER D 266 ? O SER D 312 
DA 14 15 N VAL D 322 ? N VAL D 368 O ILE D 287 ? O ILE D 333 
DA 16 17 N ILE D 356 ? N ILE D 402 O SER D 43  ? O SER D 89  
DB 1  2  N LEU D 131 ? N LEU D 177 O GLY D 198 ? O GLY D 244 
DC 1  2  N VAL D 154 ? N VAL D 200 O LEU D 138 ? O LEU D 184 
DC 2  3  N VAL D 139 ? N VAL D 185 O LEU D 190 ? O LEU D 236 
DC 3  4  N GLU D 195 ? N GLU D 241 O SER D 179 ? O SER D 225 
DC 4  5  N LEU D 180 ? N LEU D 226 O ILE D 171 ? O ILE D 217 
DC 5  6  N TYR D 172 ? N TYR D 218 O ASN D 207 ? O ASN D 253 
# 
_database_PDB_matrix.entry_id          2VGB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VGB 
_atom_sites.fract_transf_matrix[1][1]   0.013439 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000577 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005812 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011705 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
K  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLN A 1 11  ? 0.225   -3.189  45.173  1.00 54.11  ? 57   GLN A N   1 
ATOM   2     C  CA  . GLN A 1 11  ? 1.221   -4.173  44.690  1.00 54.45  ? 57   GLN A CA  1 
ATOM   3     C  C   . GLN A 1 11  ? 2.644   -3.666  44.911  1.00 54.13  ? 57   GLN A C   1 
ATOM   4     O  O   . GLN A 1 11  ? 2.870   -2.501  45.263  1.00 54.16  ? 57   GLN A O   1 
ATOM   5     C  CB  . GLN A 1 11  ? 1.003   -4.501  43.205  1.00 54.71  ? 57   GLN A CB  1 
ATOM   6     C  CG  . GLN A 1 11  ? -0.173  -5.447  42.921  1.00 57.44  ? 57   GLN A CG  1 
ATOM   7     C  CD  . GLN A 1 11  ? 0.025   -6.890  43.451  1.00 60.72  ? 57   GLN A CD  1 
ATOM   8     O  OE1 . GLN A 1 11  ? 1.157   -7.379  43.590  1.00 61.39  ? 57   GLN A OE1 1 
ATOM   9     N  NE2 . GLN A 1 11  ? -1.091  -7.573  43.728  1.00 60.49  ? 57   GLN A NE2 1 
ATOM   10    N  N   . GLN A 1 12  ? 3.595   -4.562  44.682  1.00 53.46  ? 58   GLN A N   1 
ATOM   11    C  CA  . GLN A 1 12  ? 4.977   -4.324  44.985  1.00 53.03  ? 58   GLN A CA  1 
ATOM   12    C  C   . GLN A 1 12  ? 5.743   -4.345  43.670  1.00 52.33  ? 58   GLN A C   1 
ATOM   13    O  O   . GLN A 1 12  ? 5.149   -4.550  42.601  1.00 52.43  ? 58   GLN A O   1 
ATOM   14    C  CB  . GLN A 1 12  ? 5.467   -5.414  45.940  1.00 53.47  ? 58   GLN A CB  1 
ATOM   15    C  CG  . GLN A 1 12  ? 4.603   -5.556  47.206  1.00 55.72  ? 58   GLN A CG  1 
ATOM   16    C  CD  . GLN A 1 12  ? 4.216   -7.005  47.496  1.00 59.69  ? 58   GLN A CD  1 
ATOM   17    O  OE1 . GLN A 1 12  ? 3.822   -7.763  46.589  1.00 60.12  ? 58   GLN A OE1 1 
ATOM   18    N  NE2 . GLN A 1 12  ? 4.316   -7.396  48.767  1.00 59.95  ? 58   GLN A NE2 1 
ATOM   19    N  N   . GLN A 1 13  ? 7.051   -4.120  43.746  1.00 51.38  ? 59   GLN A N   1 
ATOM   20    C  CA  . GLN A 1 13  ? 7.935   -4.144  42.579  1.00 50.90  ? 59   GLN A CA  1 
ATOM   21    C  C   . GLN A 1 13  ? 7.517   -3.230  41.425  1.00 50.37  ? 59   GLN A C   1 
ATOM   22    O  O   . GLN A 1 13  ? 7.953   -3.455  40.280  1.00 50.73  ? 59   GLN A O   1 
ATOM   23    C  CB  . GLN A 1 13  ? 8.074   -5.559  42.017  1.00 51.08  ? 59   GLN A CB  1 
ATOM   24    C  CG  . GLN A 1 13  ? 8.561   -6.615  42.967  1.00 52.42  ? 59   GLN A CG  1 
ATOM   25    C  CD  . GLN A 1 13  ? 8.693   -7.958  42.276  1.00 54.45  ? 59   GLN A CD  1 
ATOM   26    O  OE1 . GLN A 1 13  ? 9.584   -8.159  41.447  1.00 54.80  ? 59   GLN A OE1 1 
ATOM   27    N  NE2 . GLN A 1 13  ? 7.790   -8.879  42.597  1.00 54.63  ? 59   GLN A NE2 1 
ATOM   28    N  N   . GLN A 1 14  ? 6.699   -2.213  41.704  1.00 49.59  ? 60   GLN A N   1 
ATOM   29    C  CA  . GLN A 1 14  ? 6.187   -1.339  40.647  1.00 49.55  ? 60   GLN A CA  1 
ATOM   30    C  C   . GLN A 1 14  ? 5.508   -2.169  39.555  1.00 49.67  ? 60   GLN A C   1 
ATOM   31    O  O   . GLN A 1 14  ? 5.815   -1.997  38.360  1.00 49.55  ? 60   GLN A O   1 
ATOM   32    C  CB  . GLN A 1 14  ? 7.321   -0.513  39.998  1.00 49.28  ? 60   GLN A CB  1 
ATOM   33    C  CG  . GLN A 1 14  ? 8.171   0.347   40.939  1.00 48.97  ? 60   GLN A CG  1 
ATOM   34    C  CD  . GLN A 1 14  ? 7.407   1.519   41.565  1.00 48.10  ? 60   GLN A CD  1 
ATOM   35    O  OE1 . GLN A 1 14  ? 6.336   1.900   41.103  1.00 47.65  ? 60   GLN A OE1 1 
ATOM   36    N  NE2 . GLN A 1 14  ? 7.960   2.082   42.628  1.00 48.18  ? 60   GLN A NE2 1 
ATOM   37    N  N   . LEU A 1 15  ? 4.629   -3.085  39.963  1.00 49.56  ? 61   LEU A N   1 
ATOM   38    C  CA  . LEU A 1 15  ? 3.952   -3.950  39.003  1.00 49.79  ? 61   LEU A CA  1 
ATOM   39    C  C   . LEU A 1 15  ? 2.915   -3.174  38.191  1.00 49.03  ? 61   LEU A C   1 
ATOM   40    O  O   . LEU A 1 15  ? 2.887   -3.299  36.967  1.00 48.87  ? 61   LEU A O   1 
ATOM   41    C  CB  . LEU A 1 15  ? 3.378   -5.239  39.646  1.00 50.38  ? 61   LEU A CB  1 
ATOM   42    C  CG  . LEU A 1 15  ? 4.073   -6.593  39.330  1.00 52.30  ? 61   LEU A CG  1 
ATOM   43    C  CD1 . LEU A 1 15  ? 5.504   -6.454  38.804  1.00 53.07  ? 61   LEU A CD1 1 
ATOM   44    C  CD2 . LEU A 1 15  ? 4.018   -7.597  40.519  1.00 52.90  ? 61   LEU A CD2 1 
ATOM   45    N  N   . PRO A 1 16  ? 2.072   -2.358  38.851  1.00 48.51  ? 62   PRO A N   1 
ATOM   46    C  CA  . PRO A 1 16  ? 1.166   -1.574  38.010  1.00 48.20  ? 62   PRO A CA  1 
ATOM   47    C  C   . PRO A 1 16  ? 1.943   -0.893  36.884  1.00 47.91  ? 62   PRO A C   1 
ATOM   48    O  O   . PRO A 1 16  ? 1.507   -0.896  35.728  1.00 48.02  ? 62   PRO A O   1 
ATOM   49    C  CB  . PRO A 1 16  ? 0.578   -0.555  38.987  1.00 47.91  ? 62   PRO A CB  1 
ATOM   50    C  CG  . PRO A 1 16  ? 0.532   -1.309  40.276  1.00 47.98  ? 62   PRO A CG  1 
ATOM   51    C  CD  . PRO A 1 16  ? 1.831   -2.108  40.285  1.00 48.44  ? 62   PRO A CD  1 
ATOM   52    N  N   . ALA A 1 17  ? 3.113   -0.362  37.209  1.00 47.67  ? 63   ALA A N   1 
ATOM   53    C  CA  . ALA A 1 17  ? 3.893   0.354   36.220  1.00 47.92  ? 63   ALA A CA  1 
ATOM   54    C  C   . ALA A 1 17  ? 4.449   -0.573  35.141  1.00 48.29  ? 63   ALA A C   1 
ATOM   55    O  O   . ALA A 1 17  ? 4.615   -0.161  34.000  1.00 48.28  ? 63   ALA A O   1 
ATOM   56    C  CB  . ALA A 1 17  ? 4.993   1.110   36.879  1.00 47.82  ? 63   ALA A CB  1 
ATOM   57    N  N   . ALA A 1 18  ? 4.742   -1.819  35.511  1.00 48.71  ? 64   ALA A N   1 
ATOM   58    C  CA  . ALA A 1 18  ? 5.197   -2.837  34.560  1.00 48.81  ? 64   ALA A CA  1 
ATOM   59    C  C   . ALA A 1 18  ? 4.100   -3.220  33.542  1.00 49.00  ? 64   ALA A C   1 
ATOM   60    O  O   . ALA A 1 18  ? 4.392   -3.527  32.392  1.00 49.08  ? 64   ALA A O   1 
ATOM   61    C  CB  . ALA A 1 18  ? 5.705   -4.078  35.320  1.00 48.57  ? 64   ALA A CB  1 
ATOM   62    N  N   . MET A 1 19  ? 2.844   -3.178  33.971  1.00 49.38  ? 65   MET A N   1 
ATOM   63    C  CA  . MET A 1 19  ? 1.716   -3.579  33.119  1.00 50.27  ? 65   MET A CA  1 
ATOM   64    C  C   . MET A 1 19  ? 1.232   -2.474  32.172  1.00 50.01  ? 65   MET A C   1 
ATOM   65    O  O   . MET A 1 19  ? 0.230   -2.669  31.464  1.00 50.14  ? 65   MET A O   1 
ATOM   66    C  CB  . MET A 1 19  ? 0.516   -4.088  33.960  1.00 50.75  ? 65   MET A CB  1 
ATOM   67    C  CG  . MET A 1 19  ? 0.851   -5.136  35.049  1.00 53.20  ? 65   MET A CG  1 
ATOM   68    S  SD  . MET A 1 19  ? 1.374   -6.802  34.500  1.00 58.47  ? 65   MET A SD  1 
ATOM   69    C  CE  . MET A 1 19  ? 3.062   -6.626  33.992  1.00 54.83  ? 65   MET A CE  1 
ATOM   70    N  N   . ALA A 1 20  ? 1.922   -1.328  32.160  1.00 49.69  ? 66   ALA A N   1 
ATOM   71    C  CA  . ALA A 1 20  ? 1.517   -0.184  31.329  1.00 49.09  ? 66   ALA A CA  1 
ATOM   72    C  C   . ALA A 1 20  ? 1.751   -0.438  29.847  1.00 48.83  ? 66   ALA A C   1 
ATOM   73    O  O   . ALA A 1 20  ? 2.724   -1.108  29.478  1.00 48.73  ? 66   ALA A O   1 
ATOM   74    C  CB  . ALA A 1 20  ? 2.237   1.057   31.755  1.00 49.20  ? 66   ALA A CB  1 
ATOM   75    N  N   . ASP A 1 21  ? 0.852   0.113   29.022  1.00 48.38  ? 67   ASP A N   1 
ATOM   76    C  CA  . ASP A 1 21  ? 0.845   -0.093  27.576  1.00 48.17  ? 67   ASP A CA  1 
ATOM   77    C  C   . ASP A 1 21  ? 1.777   0.855   26.822  1.00 47.19  ? 67   ASP A C   1 
ATOM   78    O  O   . ASP A 1 21  ? 2.074   0.623   25.659  1.00 46.95  ? 67   ASP A O   1 
ATOM   79    C  CB  . ASP A 1 21  ? -0.575  0.057   27.029  1.00 49.04  ? 67   ASP A CB  1 
ATOM   80    C  CG  . ASP A 1 21  ? -1.495  -1.114  27.411  1.00 52.23  ? 67   ASP A CG  1 
ATOM   81    O  OD1 . ASP A 1 21  ? -2.354  -0.938  28.318  1.00 54.57  ? 67   ASP A OD1 1 
ATOM   82    O  OD2 . ASP A 1 21  ? -1.373  -2.206  26.790  1.00 55.66  ? 67   ASP A OD2 1 
ATOM   83    N  N   . THR A 1 22  ? 2.210   1.934   27.471  1.00 46.22  ? 68   THR A N   1 
ATOM   84    C  CA  . THR A 1 22  ? 3.139   2.899   26.866  1.00 45.46  ? 68   THR A CA  1 
ATOM   85    C  C   . THR A 1 22  ? 4.207   3.289   27.886  1.00 44.79  ? 68   THR A C   1 
ATOM   86    O  O   . THR A 1 22  ? 4.049   3.037   29.082  1.00 45.03  ? 68   THR A O   1 
ATOM   87    C  CB  . THR A 1 22  ? 2.434   4.199   26.352  1.00 45.51  ? 68   THR A CB  1 
ATOM   88    O  OG1 . THR A 1 22  ? 1.953   4.976   27.455  1.00 45.70  ? 68   THR A OG1 1 
ATOM   89    C  CG2 . THR A 1 22  ? 1.271   3.893   25.426  1.00 46.43  ? 68   THR A CG2 1 
ATOM   90    N  N   . PHE A 1 23  ? 5.286   3.909   27.430  1.00 43.36  ? 69   PHE A N   1 
ATOM   91    C  CA  . PHE A 1 23  ? 6.308   4.344   28.358  1.00 42.08  ? 69   PHE A CA  1 
ATOM   92    C  C   . PHE A 1 23  ? 5.808   5.482   29.227  1.00 41.75  ? 69   PHE A C   1 
ATOM   93    O  O   . PHE A 1 23  ? 6.181   5.583   30.401  1.00 41.31  ? 69   PHE A O   1 
ATOM   94    C  CB  . PHE A 1 23  ? 7.572   4.793   27.638  1.00 41.78  ? 69   PHE A CB  1 
ATOM   95    C  CG  . PHE A 1 23  ? 8.677   5.168   28.573  1.00 39.89  ? 69   PHE A CG  1 
ATOM   96    C  CD1 . PHE A 1 23  ? 9.120   6.471   28.665  1.00 38.78  ? 69   PHE A CD1 1 
ATOM   97    C  CD2 . PHE A 1 23  ? 9.257   4.212   29.389  1.00 38.13  ? 69   PHE A CD2 1 
ATOM   98    C  CE1 . PHE A 1 23  ? 10.150  6.817   29.552  1.00 36.80  ? 69   PHE A CE1 1 
ATOM   99    C  CE2 . PHE A 1 23  ? 10.272  4.546   30.251  1.00 36.57  ? 69   PHE A CE2 1 
ATOM   100   C  CZ  . PHE A 1 23  ? 10.722  5.859   30.330  1.00 34.98  ? 69   PHE A CZ  1 
ATOM   101   N  N   . LEU A 1 24  ? 4.986   6.344   28.632  1.00 41.23  ? 70   LEU A N   1 
ATOM   102   C  CA  . LEU A 1 24  ? 4.391   7.457   29.354  1.00 41.13  ? 70   LEU A CA  1 
ATOM   103   C  C   . LEU A 1 24  ? 3.479   6.972   30.475  1.00 41.48  ? 70   LEU A C   1 
ATOM   104   O  O   . LEU A 1 24  ? 3.613   7.399   31.603  1.00 41.60  ? 70   LEU A O   1 
ATOM   105   C  CB  . LEU A 1 24  ? 3.617   8.379   28.404  1.00 40.54  ? 70   LEU A CB  1 
ATOM   106   C  CG  . LEU A 1 24  ? 3.129   9.724   28.958  1.00 38.40  ? 70   LEU A CG  1 
ATOM   107   C  CD1 . LEU A 1 24  ? 4.294   10.630  29.365  1.00 33.36  ? 70   LEU A CD1 1 
ATOM   108   C  CD2 . LEU A 1 24  ? 2.227   10.421  27.953  1.00 35.53  ? 70   LEU A CD2 1 
ATOM   109   N  N   . GLU A 1 25  ? 2.552   6.085   30.151  1.00 42.20  ? 71   GLU A N   1 
ATOM   110   C  CA  . GLU A 1 25  ? 1.665   5.501   31.146  1.00 42.91  ? 71   GLU A CA  1 
ATOM   111   C  C   . GLU A 1 25  ? 2.525   4.836   32.221  1.00 42.21  ? 71   GLU A C   1 
ATOM   112   O  O   . GLU A 1 25  ? 2.197   4.880   33.409  1.00 42.22  ? 71   GLU A O   1 
ATOM   113   C  CB  . GLU A 1 25  ? 0.711   4.488   30.499  1.00 43.34  ? 71   GLU A CB  1 
ATOM   114   C  CG  . GLU A 1 25  ? -0.528  4.149   31.340  1.00 47.08  ? 71   GLU A CG  1 
ATOM   115   C  CD  . GLU A 1 25  ? -1.358  2.940   30.795  1.00 52.04  ? 71   GLU A CD  1 
ATOM   116   O  OE1 . GLU A 1 25  ? -1.015  2.357   29.720  1.00 53.14  ? 71   GLU A OE1 1 
ATOM   117   O  OE2 . GLU A 1 25  ? -2.367  2.575   31.456  1.00 51.62  ? 71   GLU A OE2 1 
ATOM   118   N  N   . HIS A 1 26  ? 3.635   4.247   31.800  1.00 41.48  ? 72   HIS A N   1 
ATOM   119   C  CA  . HIS A 1 26  ? 4.549   3.600   32.734  1.00 41.08  ? 72   HIS A CA  1 
ATOM   120   C  C   . HIS A 1 26  ? 5.023   4.622   33.748  1.00 40.47  ? 72   HIS A C   1 
ATOM   121   O  O   . HIS A 1 26  ? 4.691   4.529   34.932  1.00 41.18  ? 72   HIS A O   1 
ATOM   122   C  CB  . HIS A 1 26  ? 5.715   2.962   32.003  1.00 41.17  ? 72   HIS A CB  1 
ATOM   123   C  CG  . HIS A 1 26  ? 6.869   2.597   32.881  1.00 42.18  ? 72   HIS A CG  1 
ATOM   124   N  ND1 . HIS A 1 26  ? 6.862   1.485   33.699  1.00 44.05  ? 72   HIS A ND1 1 
ATOM   125   C  CD2 . HIS A 1 26  ? 8.097   3.163   33.024  1.00 42.45  ? 72   HIS A CD2 1 
ATOM   126   C  CE1 . HIS A 1 26  ? 8.034   1.391   34.315  1.00 44.12  ? 72   HIS A CE1 1 
ATOM   127   N  NE2 . HIS A 1 26  ? 8.799   2.398   33.925  1.00 41.84  ? 72   HIS A NE2 1 
ATOM   128   N  N   . LEU A 1 27  ? 5.756   5.622   33.280  1.00 39.14  ? 73   LEU A N   1 
ATOM   129   C  CA  . LEU A 1 27  ? 6.150   6.738   34.128  1.00 37.47  ? 73   LEU A CA  1 
ATOM   130   C  C   . LEU A 1 27  ? 5.032   7.207   35.039  1.00 37.39  ? 73   LEU A C   1 
ATOM   131   O  O   . LEU A 1 27  ? 5.237   7.317   36.226  1.00 37.76  ? 73   LEU A O   1 
ATOM   132   C  CB  . LEU A 1 27  ? 6.625   7.901   33.281  1.00 36.60  ? 73   LEU A CB  1 
ATOM   133   C  CG  . LEU A 1 27  ? 7.849   7.702   32.402  1.00 35.26  ? 73   LEU A CG  1 
ATOM   134   C  CD1 . LEU A 1 27  ? 8.029   8.961   31.613  1.00 33.29  ? 73   LEU A CD1 1 
ATOM   135   C  CD2 . LEU A 1 27  ? 9.077   7.428   33.205  1.00 31.38  ? 73   LEU A CD2 1 
ATOM   136   N  N   . CYS A 1 28  ? 3.853   7.461   34.487  1.00 37.25  ? 74   CYS A N   1 
ATOM   137   C  CA  . CYS A 1 28  ? 2.713   7.942   35.251  1.00 37.64  ? 74   CYS A CA  1 
ATOM   138   C  C   . CYS A 1 28  ? 2.258   7.053   36.411  1.00 37.55  ? 74   CYS A C   1 
ATOM   139   O  O   . CYS A 1 28  ? 1.421   7.467   37.213  1.00 37.75  ? 74   CYS A O   1 
ATOM   140   C  CB  . CYS A 1 28  ? 1.524   8.135   34.320  1.00 37.59  ? 74   CYS A CB  1 
ATOM   141   S  SG  . CYS A 1 28  ? 1.614   9.613   33.354  1.00 40.19  ? 74   CYS A SG  1 
ATOM   142   N  N   . LEU A 1 29  ? 2.758   5.823   36.469  1.00 37.58  ? 75   LEU A N   1 
ATOM   143   C  CA  . LEU A 1 29  ? 2.267   4.835   37.442  1.00 37.40  ? 75   LEU A CA  1 
ATOM   144   C  C   . LEU A 1 29  ? 3.339   4.422   38.461  1.00 37.48  ? 75   LEU A C   1 
ATOM   145   O  O   . LEU A 1 29  ? 3.059   3.667   39.393  1.00 38.00  ? 75   LEU A O   1 
ATOM   146   C  CB  . LEU A 1 29  ? 1.678   3.602   36.730  1.00 37.26  ? 75   LEU A CB  1 
ATOM   147   C  CG  . LEU A 1 29  ? 0.350   3.675   35.936  1.00 37.49  ? 75   LEU A CG  1 
ATOM   148   C  CD1 . LEU A 1 29  ? 0.057   2.355   35.229  1.00 35.44  ? 75   LEU A CD1 1 
ATOM   149   C  CD2 . LEU A 1 29  ? -0.862  4.097   36.774  1.00 37.60  ? 75   LEU A CD2 1 
ATOM   150   N  N   . LEU A 1 30  ? 4.561   4.923   38.291  1.00 36.87  ? 76   LEU A N   1 
ATOM   151   C  CA  . LEU A 1 30  ? 5.588   4.728   39.281  1.00 36.42  ? 76   LEU A CA  1 
ATOM   152   C  C   . LEU A 1 30  ? 5.015   5.123   40.653  1.00 37.32  ? 76   LEU A C   1 
ATOM   153   O  O   . LEU A 1 30  ? 4.301   6.111   40.768  1.00 37.66  ? 76   LEU A O   1 
ATOM   154   C  CB  . LEU A 1 30  ? 6.842   5.505   38.889  1.00 35.83  ? 76   LEU A CB  1 
ATOM   155   C  CG  . LEU A 1 30  ? 7.541   4.960   37.638  1.00 34.15  ? 76   LEU A CG  1 
ATOM   156   C  CD1 . LEU A 1 30  ? 8.792   5.733   37.300  1.00 29.77  ? 76   LEU A CD1 1 
ATOM   157   C  CD2 . LEU A 1 30  ? 7.884   3.454   37.769  1.00 34.31  ? 76   LEU A CD2 1 
ATOM   158   N  N   . ASP A 1 31  ? 5.256   4.297   41.667  1.00 38.12  ? 77   ASP A N   1 
ATOM   159   C  CA  . ASP A 1 31  ? 4.628   4.451   42.970  1.00 38.32  ? 77   ASP A CA  1 
ATOM   160   C  C   . ASP A 1 31  ? 5.683   4.412   44.059  1.00 38.66  ? 77   ASP A C   1 
ATOM   161   O  O   . ASP A 1 31  ? 6.339   3.402   44.255  1.00 39.20  ? 77   ASP A O   1 
ATOM   162   C  CB  . ASP A 1 31  ? 3.607   3.338   43.195  1.00 38.33  ? 77   ASP A CB  1 
ATOM   163   C  CG  . ASP A 1 31  ? 2.685   3.595   44.399  1.00 38.19  ? 77   ASP A CG  1 
ATOM   164   O  OD1 . ASP A 1 31  ? 2.996   4.461   45.240  1.00 36.49  ? 77   ASP A OD1 1 
ATOM   165   O  OD2 . ASP A 1 31  ? 1.638   2.911   44.495  1.00 39.49  ? 77   ASP A OD2 1 
ATOM   166   N  N   . ILE A 1 32  ? 5.827   5.518   44.775  1.00 39.03  ? 78   ILE A N   1 
ATOM   167   C  CA  . ILE A 1 32  ? 6.780   5.624   45.874  1.00 39.32  ? 78   ILE A CA  1 
ATOM   168   C  C   . ILE A 1 32  ? 6.468   4.711   47.058  1.00 40.20  ? 78   ILE A C   1 
ATOM   169   O  O   . ILE A 1 32  ? 7.335   4.475   47.893  1.00 40.58  ? 78   ILE A O   1 
ATOM   170   C  CB  . ILE A 1 32  ? 6.936   7.101   46.391  1.00 39.21  ? 78   ILE A CB  1 
ATOM   171   C  CG1 . ILE A 1 32  ? 5.598   7.671   46.899  1.00 37.60  ? 78   ILE A CG1 1 
ATOM   172   C  CG2 . ILE A 1 32  ? 7.618   7.994   45.322  1.00 38.31  ? 78   ILE A CG2 1 
ATOM   173   C  CD1 . ILE A 1 32  ? 5.754   8.728   47.977  1.00 36.24  ? 78   ILE A CD1 1 
ATOM   174   N  N   . ASP A 1 33  ? 5.234   4.222   47.142  1.00 40.97  ? 79   ASP A N   1 
ATOM   175   C  CA  . ASP A 1 33  ? 4.857   3.275   48.187  1.00 42.00  ? 79   ASP A CA  1 
ATOM   176   C  C   . ASP A 1 33  ? 4.912   1.814   47.733  1.00 42.41  ? 79   ASP A C   1 
ATOM   177   O  O   . ASP A 1 33  ? 4.511   0.912   48.471  1.00 43.22  ? 79   ASP A O   1 
ATOM   178   C  CB  . ASP A 1 33  ? 3.463   3.607   48.725  1.00 41.94  ? 79   ASP A CB  1 
ATOM   179   C  CG  . ASP A 1 33  ? 3.459   4.845   49.587  1.00 43.41  ? 79   ASP A CG  1 
ATOM   180   O  OD1 . ASP A 1 33  ? 4.563   5.259   50.024  1.00 42.03  ? 79   ASP A OD1 1 
ATOM   181   O  OD2 . ASP A 1 33  ? 2.335   5.376   49.848  1.00 45.53  ? 79   ASP A OD2 1 
ATOM   182   N  N   . SER A 1 34  ? 5.370   1.567   46.519  1.00 42.69  ? 80   SER A N   1 
ATOM   183   C  CA  . SER A 1 34  ? 5.527   0.199   46.080  1.00 43.41  ? 80   SER A CA  1 
ATOM   184   C  C   . SER A 1 34  ? 6.939   -0.260  46.426  1.00 43.95  ? 80   SER A C   1 
ATOM   185   O  O   . SER A 1 34  ? 7.902   0.069   45.717  1.00 44.20  ? 80   SER A O   1 
ATOM   186   C  CB  . SER A 1 34  ? 5.272   0.097   44.590  1.00 43.42  ? 80   SER A CB  1 
ATOM   187   O  OG  . SER A 1 34  ? 4.977   -1.238  44.236  1.00 44.40  ? 80   SER A OG  1 
ATOM   188   N  N   . GLU A 1 35  ? 7.065   -0.995  47.529  1.00 44.31  ? 81   GLU A N   1 
ATOM   189   C  CA  . GLU A 1 35  ? 8.390   -1.390  48.003  1.00 44.81  ? 81   GLU A CA  1 
ATOM   190   C  C   . GLU A 1 35  ? 9.044   -2.353  47.042  1.00 44.16  ? 81   GLU A C   1 
ATOM   191   O  O   . GLU A 1 35  ? 8.382   -3.281  46.563  1.00 43.71  ? 81   GLU A O   1 
ATOM   192   C  CB  . GLU A 1 35  ? 8.369   -1.954  49.441  1.00 45.10  ? 81   GLU A CB  1 
ATOM   193   C  CG  . GLU A 1 35  ? 7.992   -0.925  50.532  1.00 48.69  ? 81   GLU A CG  1 
ATOM   194   C  CD  . GLU A 1 35  ? 8.626   0.481   50.350  1.00 52.97  ? 81   GLU A CD  1 
ATOM   195   O  OE1 . GLU A 1 35  ? 9.716   0.615   49.736  1.00 55.07  ? 81   GLU A OE1 1 
ATOM   196   O  OE2 . GLU A 1 35  ? 8.030   1.466   50.835  1.00 55.18  ? 81   GLU A OE2 1 
ATOM   197   N  N   . PRO A 1 36  ? 10.350  -2.144  46.770  1.00 44.16  ? 82   PRO A N   1 
ATOM   198   C  CA  . PRO A 1 36  ? 11.076  -3.070  45.899  1.00 44.38  ? 82   PRO A CA  1 
ATOM   199   C  C   . PRO A 1 36  ? 11.031  -4.387  46.632  1.00 45.12  ? 82   PRO A C   1 
ATOM   200   O  O   . PRO A 1 36  ? 10.795  -4.406  47.858  1.00 45.72  ? 82   PRO A O   1 
ATOM   201   C  CB  . PRO A 1 36  ? 12.512  -2.531  45.902  1.00 43.83  ? 82   PRO A CB  1 
ATOM   202   C  CG  . PRO A 1 36  ? 12.393  -1.146  46.328  1.00 44.09  ? 82   PRO A CG  1 
ATOM   203   C  CD  . PRO A 1 36  ? 11.233  -1.100  47.303  1.00 43.75  ? 82   PRO A CD  1 
ATOM   204   N  N   . VAL A 1 37  ? 11.226  -5.484  45.924  1.00 45.60  ? 83   VAL A N   1 
ATOM   205   C  CA  . VAL A 1 37  ? 11.118  -6.788  46.572  1.00 46.00  ? 83   VAL A CA  1 
ATOM   206   C  C   . VAL A 1 37  ? 11.889  -7.742  45.704  1.00 46.21  ? 83   VAL A C   1 
ATOM   207   O  O   . VAL A 1 37  ? 11.336  -8.443  44.870  1.00 46.76  ? 83   VAL A O   1 
ATOM   208   C  CB  . VAL A 1 37  ? 9.620   -7.165  46.847  1.00 45.98  ? 83   VAL A CB  1 
ATOM   209   C  CG1 . VAL A 1 37  ? 9.213   -8.508  46.240  1.00 45.23  ? 83   VAL A CG1 1 
ATOM   210   C  CG2 . VAL A 1 37  ? 9.322   -7.086  48.366  1.00 45.97  ? 83   VAL A CG2 1 
ATOM   211   N  N   . ALA A 1 38  ? 13.197  -7.695  45.865  1.00 46.00  ? 84   ALA A N   1 
ATOM   212   C  CA  . ALA A 1 38  ? 14.097  -8.394  44.984  1.00 45.74  ? 84   ALA A CA  1 
ATOM   213   C  C   . ALA A 1 38  ? 15.486  -7.978  45.400  1.00 46.07  ? 84   ALA A C   1 
ATOM   214   O  O   . ALA A 1 38  ? 15.698  -6.863  45.927  1.00 47.13  ? 84   ALA A O   1 
ATOM   215   C  CB  . ALA A 1 38  ? 13.842  -8.018  43.549  1.00 44.93  ? 84   ALA A CB  1 
ATOM   216   N  N   . ALA A 1 39  ? 16.424  -8.901  45.221  1.00 45.48  ? 85   ALA A N   1 
ATOM   217   C  CA  . ALA A 1 39  ? 17.832  -8.617  45.361  1.00 44.41  ? 85   ALA A CA  1 
ATOM   218   C  C   . ALA A 1 39  ? 18.119  -7.524  44.366  1.00 43.85  ? 85   ALA A C   1 
ATOM   219   O  O   . ALA A 1 39  ? 17.498  -7.484  43.327  1.00 43.54  ? 85   ALA A O   1 
ATOM   220   C  CB  . ALA A 1 39  ? 18.599  -9.835  45.007  1.00 44.44  ? 85   ALA A CB  1 
ATOM   221   N  N   . ARG A 1 40  ? 19.018  -6.609  44.682  1.00 43.70  ? 86   ARG A N   1 
ATOM   222   C  CA  . ARG A 1 40  ? 19.356  -5.614  43.693  1.00 44.00  ? 86   ARG A CA  1 
ATOM   223   C  C   . ARG A 1 40  ? 20.292  -6.229  42.682  1.00 44.16  ? 86   ARG A C   1 
ATOM   224   O  O   . ARG A 1 40  ? 21.230  -6.925  43.034  1.00 44.37  ? 86   ARG A O   1 
ATOM   225   C  CB  . ARG A 1 40  ? 19.971  -4.359  44.288  1.00 43.87  ? 86   ARG A CB  1 
ATOM   226   C  CG  . ARG A 1 40  ? 21.116  -4.591  45.180  1.00 44.25  ? 86   ARG A CG  1 
ATOM   227   C  CD  . ARG A 1 40  ? 21.966  -3.370  45.202  1.00 44.30  ? 86   ARG A CD  1 
ATOM   228   N  NE  . ARG A 1 40  ? 23.191  -3.643  44.474  1.00 42.81  ? 86   ARG A NE  1 
ATOM   229   C  CZ  . ARG A 1 40  ? 24.252  -4.223  45.010  1.00 40.25  ? 86   ARG A CZ  1 
ATOM   230   N  NH1 . ARG A 1 40  ? 24.259  -4.583  46.288  1.00 34.41  ? 86   ARG A NH1 1 
ATOM   231   N  NH2 . ARG A 1 40  ? 25.303  -4.420  44.240  1.00 40.49  ? 86   ARG A NH2 1 
ATOM   232   N  N   . SER A 1 41  ? 20.028  -5.974  41.416  1.00 44.23  ? 87   SER A N   1 
ATOM   233   C  CA  . SER A 1 41  ? 20.761  -6.630  40.383  1.00 44.56  ? 87   SER A CA  1 
ATOM   234   C  C   . SER A 1 41  ? 21.976  -5.832  39.907  1.00 44.31  ? 87   SER A C   1 
ATOM   235   O  O   . SER A 1 41  ? 22.941  -6.432  39.415  1.00 44.68  ? 87   SER A O   1 
ATOM   236   C  CB  . SER A 1 41  ? 19.826  -7.069  39.248  1.00 45.01  ? 87   SER A CB  1 
ATOM   237   O  OG  . SER A 1 41  ? 18.795  -6.129  38.971  1.00 47.19  ? 87   SER A OG  1 
ATOM   238   N  N   . THR A 1 42  ? 21.977  -4.506  40.084  1.00 43.56  ? 88   THR A N   1 
ATOM   239   C  CA  . THR A 1 42  ? 23.170  -3.705  39.689  1.00 42.51  ? 88   THR A CA  1 
ATOM   240   C  C   . THR A 1 42  ? 24.346  -3.853  40.672  1.00 42.22  ? 88   THR A C   1 
ATOM   241   O  O   . THR A 1 42  ? 24.266  -3.486  41.864  1.00 41.37  ? 88   THR A O   1 
ATOM   242   C  CB  . THR A 1 42  ? 22.841  -2.224  39.501  1.00 42.48  ? 88   THR A CB  1 
ATOM   243   O  OG1 . THR A 1 42  ? 21.642  -2.093  38.731  1.00 42.09  ? 88   THR A OG1 1 
ATOM   244   C  CG2 . THR A 1 42  ? 23.965  -1.517  38.777  1.00 42.50  ? 88   THR A CG2 1 
ATOM   245   N  N   . SER A 1 43  ? 25.440  -4.407  40.180  1.00 42.22  ? 89   SER A N   1 
ATOM   246   C  CA  . SER A 1 43  ? 26.583  -4.641  41.056  1.00 42.14  ? 89   SER A CA  1 
ATOM   247   C  C   . SER A 1 43  ? 27.268  -3.333  41.350  1.00 41.86  ? 89   SER A C   1 
ATOM   248   O  O   . SER A 1 43  ? 27.238  -2.421  40.528  1.00 42.56  ? 89   SER A O   1 
ATOM   249   C  CB  . SER A 1 43  ? 27.534  -5.674  40.457  1.00 41.77  ? 89   SER A CB  1 
ATOM   250   O  OG  . SER A 1 43  ? 26.796  -6.860  40.119  1.00 42.99  ? 89   SER A OG  1 
ATOM   251   N  N   . ILE A 1 44  ? 27.834  -3.234  42.550  1.00 41.01  ? 90   ILE A N   1 
ATOM   252   C  CA  . ILE A 1 44  ? 28.487  -2.023  43.007  1.00 39.60  ? 90   ILE A CA  1 
ATOM   253   C  C   . ILE A 1 44  ? 29.991  -2.231  43.044  1.00 40.03  ? 90   ILE A C   1 
ATOM   254   O  O   . ILE A 1 44  ? 30.494  -3.175  43.669  1.00 40.63  ? 90   ILE A O   1 
ATOM   255   C  CB  . ILE A 1 44  ? 28.016  -1.644  44.399  1.00 39.29  ? 90   ILE A CB  1 
ATOM   256   C  CG1 . ILE A 1 44  ? 26.499  -1.323  44.363  1.00 37.64  ? 90   ILE A CG1 1 
ATOM   257   C  CG2 . ILE A 1 44  ? 28.923  -0.508  44.946  1.00 37.17  ? 90   ILE A CG2 1 
ATOM   258   C  CD1 . ILE A 1 44  ? 25.813  -1.202  45.691  1.00 32.51  ? 90   ILE A CD1 1 
ATOM   259   N  N   . ILE A 1 45  ? 30.703  -1.347  42.373  1.00 39.49  ? 91   ILE A N   1 
ATOM   260   C  CA  . ILE A 1 45  ? 32.133  -1.363  42.405  1.00 39.05  ? 91   ILE A CA  1 
ATOM   261   C  C   . ILE A 1 45  ? 32.574  -0.323  43.420  1.00 39.02  ? 91   ILE A C   1 
ATOM   262   O  O   . ILE A 1 45  ? 32.203  0.815   43.306  1.00 39.90  ? 91   ILE A O   1 
ATOM   263   C  CB  . ILE A 1 45  ? 32.676  -1.057  40.987  1.00 38.93  ? 91   ILE A CB  1 
ATOM   264   C  CG1 . ILE A 1 45  ? 32.152  -2.102  39.993  1.00 37.59  ? 91   ILE A CG1 1 
ATOM   265   C  CG2 . ILE A 1 45  ? 34.180  -0.978  40.981  1.00 38.16  ? 91   ILE A CG2 1 
ATOM   266   C  CD1 . ILE A 1 45  ? 32.492  -1.822  38.557  1.00 35.67  ? 91   ILE A CD1 1 
ATOM   267   N  N   . ALA A 1 46  ? 33.365  -0.700  44.406  1.00 39.01  ? 92   ALA A N   1 
ATOM   268   C  CA  . ALA A 1 46  ? 33.919  0.255   45.360  1.00 39.18  ? 92   ALA A CA  1 
ATOM   269   C  C   . ALA A 1 46  ? 35.449  0.393   45.210  1.00 39.76  ? 92   ALA A C   1 
ATOM   270   O  O   . ALA A 1 46  ? 36.173  -0.627  45.135  1.00 39.85  ? 92   ALA A O   1 
ATOM   271   C  CB  . ALA A 1 46  ? 33.554  -0.162  46.778  1.00 38.37  ? 92   ALA A CB  1 
ATOM   272   N  N   . THR A 1 47  ? 35.934  1.636   45.165  1.00 39.99  ? 93   THR A N   1 
ATOM   273   C  CA  . THR A 1 47  ? 37.381  1.856   45.075  1.00 40.51  ? 93   THR A CA  1 
ATOM   274   C  C   . THR A 1 47  ? 37.980  1.759   46.475  1.00 40.63  ? 93   THR A C   1 
ATOM   275   O  O   . THR A 1 47  ? 37.417  2.303   47.436  1.00 40.79  ? 93   THR A O   1 
ATOM   276   C  CB  . THR A 1 47  ? 37.743  3.218   44.419  1.00 40.59  ? 93   THR A CB  1 
ATOM   277   O  OG1 . THR A 1 47  ? 37.088  3.340   43.149  1.00 40.88  ? 93   THR A OG1 1 
ATOM   278   C  CG2 . THR A 1 47  ? 39.240  3.323   44.220  1.00 39.56  ? 93   THR A CG2 1 
ATOM   279   N  N   . ILE A 1 48  ? 39.106  1.056   46.572  1.00 40.78  ? 94   ILE A N   1 
ATOM   280   C  CA  . ILE A 1 48  ? 39.832  0.881   47.845  1.00 40.56  ? 94   ILE A CA  1 
ATOM   281   C  C   . ILE A 1 48  ? 40.825  2.025   48.114  1.00 40.67  ? 94   ILE A C   1 
ATOM   282   O  O   . ILE A 1 48  ? 41.642  2.389   47.257  1.00 40.68  ? 94   ILE A O   1 
ATOM   283   C  CB  . ILE A 1 48  ? 40.557  -0.487  47.892  1.00 40.32  ? 94   ILE A CB  1 
ATOM   284   C  CG1 . ILE A 1 48  ? 39.567  -1.618  47.639  1.00 39.81  ? 94   ILE A CG1 1 
ATOM   285   C  CG2 . ILE A 1 48  ? 41.231  -0.713  49.240  1.00 39.96  ? 94   ILE A CG2 1 
ATOM   286   C  CD1 . ILE A 1 48  ? 38.447  -1.730  48.729  1.00 37.86  ? 94   ILE A CD1 1 
ATOM   287   N  N   . GLY A 1 49  ? 40.713  2.611   49.300  1.00 40.57  ? 95   GLY A N   1 
ATOM   288   C  CA  . GLY A 1 49  ? 41.640  3.650   49.754  1.00 40.36  ? 95   GLY A CA  1 
ATOM   289   C  C   . GLY A 1 49  ? 41.825  3.636   51.268  1.00 40.15  ? 95   GLY A C   1 
ATOM   290   O  O   . GLY A 1 49  ? 41.431  2.680   51.949  1.00 40.73  ? 95   GLY A O   1 
ATOM   291   N  N   . PRO A 1 50  ? 42.428  4.694   51.815  1.00 39.60  ? 96   PRO A N   1 
ATOM   292   C  CA  . PRO A 1 50  ? 42.624  4.747   53.268  1.00 39.14  ? 96   PRO A CA  1 
ATOM   293   C  C   . PRO A 1 50  ? 41.291  4.560   54.029  1.00 38.86  ? 96   PRO A C   1 
ATOM   294   O  O   . PRO A 1 50  ? 41.277  4.024   55.143  1.00 39.11  ? 96   PRO A O   1 
ATOM   295   C  CB  . PRO A 1 50  ? 43.170  6.158   53.511  1.00 39.04  ? 96   PRO A CB  1 
ATOM   296   C  CG  . PRO A 1 50  ? 43.622  6.659   52.189  1.00 39.24  ? 96   PRO A CG  1 
ATOM   297   C  CD  . PRO A 1 50  ? 42.952  5.876   51.109  1.00 39.37  ? 96   PRO A CD  1 
ATOM   298   N  N   . ALA A 1 51  ? 40.180  4.966   53.427  1.00 37.74  ? 97   ALA A N   1 
ATOM   299   C  CA  . ALA A 1 51  ? 38.912  4.908   54.136  1.00 37.75  ? 97   ALA A CA  1 
ATOM   300   C  C   . ALA A 1 51  ? 38.366  3.520   54.190  1.00 38.02  ? 97   ALA A C   1 
ATOM   301   O  O   . ALA A 1 51  ? 37.485  3.261   55.017  1.00 37.88  ? 97   ALA A O   1 
ATOM   302   C  CB  . ALA A 1 51  ? 37.878  5.827   53.517  1.00 37.44  ? 97   ALA A CB  1 
ATOM   303   N  N   . SER A 1 52  ? 38.893  2.643   53.327  1.00 38.15  ? 98   SER A N   1 
ATOM   304   C  CA  . SER A 1 52  ? 38.282  1.335   53.045  1.00 38.84  ? 98   SER A CA  1 
ATOM   305   C  C   . SER A 1 52  ? 39.280  0.199   52.843  1.00 39.10  ? 98   SER A C   1 
ATOM   306   O  O   . SER A 1 52  ? 39.109  -0.649  51.962  1.00 39.80  ? 98   SER A O   1 
ATOM   307   C  CB  . SER A 1 52  ? 37.460  1.425   51.772  1.00 38.93  ? 98   SER A CB  1 
ATOM   308   O  OG  . SER A 1 52  ? 38.336  1.654   50.695  1.00 39.79  ? 98   SER A OG  1 
ATOM   309   N  N   . ARG A 1 53  ? 40.307  0.158   53.673  1.00 39.24  ? 99   ARG A N   1 
ATOM   310   C  CA  . ARG A 1 53  ? 41.371  -0.780  53.488  1.00 38.74  ? 99   ARG A CA  1 
ATOM   311   C  C   . ARG A 1 53  ? 41.487  -1.710  54.678  1.00 39.04  ? 99   ARG A C   1 
ATOM   312   O  O   . ARG A 1 53  ? 42.013  -2.824  54.555  1.00 39.15  ? 99   ARG A O   1 
ATOM   313   C  CB  . ARG A 1 53  ? 42.643  -0.006  53.345  1.00 38.81  ? 99   ARG A CB  1 
ATOM   314   C  CG  . ARG A 1 53  ? 43.458  -0.455  52.219  1.00 38.77  ? 99   ARG A CG  1 
ATOM   315   C  CD  . ARG A 1 53  ? 44.475  0.593   51.884  1.00 38.51  ? 99   ARG A CD  1 
ATOM   316   N  NE  . ARG A 1 53  ? 45.700  -0.037  51.405  1.00 40.47  ? 99   ARG A NE  1 
ATOM   317   C  CZ  . ARG A 1 53  ? 46.724  -0.309  52.194  1.00 39.28  ? 99   ARG A CZ  1 
ATOM   318   N  NH1 . ARG A 1 53  ? 46.650  0.020   53.467  1.00 39.71  ? 99   ARG A NH1 1 
ATOM   319   N  NH2 . ARG A 1 53  ? 47.811  -0.880  51.717  1.00 37.97  ? 99   ARG A NH2 1 
ATOM   320   N  N   . SER A 1 54  ? 40.992  -1.260  55.832  1.00 38.78  ? 100  SER A N   1 
ATOM   321   C  CA  . SER A 1 54  ? 40.972  -2.103  57.014  1.00 38.71  ? 100  SER A CA  1 
ATOM   322   C  C   . SER A 1 54  ? 39.974  -3.233  56.829  1.00 38.80  ? 100  SER A C   1 
ATOM   323   O  O   . SER A 1 54  ? 38.850  -3.009  56.408  1.00 38.70  ? 100  SER A O   1 
ATOM   324   C  CB  . SER A 1 54  ? 40.621  -1.304  58.262  1.00 38.40  ? 100  SER A CB  1 
ATOM   325   O  OG  . SER A 1 54  ? 39.266  -1.477  58.578  1.00 39.35  ? 100  SER A OG  1 
ATOM   326   N  N   . VAL A 1 55  ? 40.411  -4.445  57.147  1.00 39.41  ? 101  VAL A N   1 
ATOM   327   C  CA  . VAL A 1 55  ? 39.565  -5.631  57.148  1.00 39.88  ? 101  VAL A CA  1 
ATOM   328   C  C   . VAL A 1 55  ? 38.169  -5.384  57.761  1.00 40.73  ? 101  VAL A C   1 
ATOM   329   O  O   . VAL A 1 55  ? 37.163  -5.785  57.176  1.00 40.74  ? 101  VAL A O   1 
ATOM   330   C  CB  . VAL A 1 55  ? 40.279  -6.806  57.865  1.00 39.68  ? 101  VAL A CB  1 
ATOM   331   C  CG1 . VAL A 1 55  ? 39.310  -7.944  58.161  1.00 39.17  ? 101  VAL A CG1 1 
ATOM   332   C  CG2 . VAL A 1 55  ? 41.454  -7.300  57.042  1.00 38.88  ? 101  VAL A CG2 1 
ATOM   333   N  N   . GLU A 1 56  ? 38.097  -4.723  58.919  1.00 41.46  ? 102  GLU A N   1 
ATOM   334   C  CA  . GLU A 1 56  ? 36.804  -4.544  59.572  1.00 42.56  ? 102  GLU A CA  1 
ATOM   335   C  C   . GLU A 1 56  ? 35.861  -3.621  58.795  1.00 43.05  ? 102  GLU A C   1 
ATOM   336   O  O   . GLU A 1 56  ? 34.616  -3.798  58.795  1.00 43.38  ? 102  GLU A O   1 
ATOM   337   C  CB  . GLU A 1 56  ? 36.960  -4.084  61.017  1.00 42.81  ? 102  GLU A CB  1 
ATOM   338   C  CG  . GLU A 1 56  ? 37.292  -5.242  61.992  1.00 45.40  ? 102  GLU A CG  1 
ATOM   339   C  CD  . GLU A 1 56  ? 36.351  -6.493  61.862  1.00 47.75  ? 102  GLU A CD  1 
ATOM   340   O  OE1 . GLU A 1 56  ? 35.203  -6.371  61.366  1.00 48.04  ? 102  GLU A OE1 1 
ATOM   341   O  OE2 . GLU A 1 56  ? 36.770  -7.653  62.278  1.00 46.53  ? 102  GLU A OE2 1 
ATOM   342   N  N   . ARG A 1 57  ? 36.457  -2.633  58.135  1.00 42.62  ? 103  ARG A N   1 
ATOM   343   C  CA  . ARG A 1 57  ? 35.710  -1.755  57.284  1.00 42.19  ? 103  ARG A CA  1 
ATOM   344   C  C   . ARG A 1 57  ? 35.226  -2.599  56.101  1.00 41.48  ? 103  ARG A C   1 
ATOM   345   O  O   . ARG A 1 57  ? 34.033  -2.661  55.834  1.00 41.49  ? 103  ARG A O   1 
ATOM   346   C  CB  . ARG A 1 57  ? 36.587  -0.586  56.838  1.00 42.69  ? 103  ARG A CB  1 
ATOM   347   C  CG  . ARG A 1 57  ? 35.828  0.612   56.275  1.00 44.96  ? 103  ARG A CG  1 
ATOM   348   C  CD  . ARG A 1 57  ? 35.909  1.835   57.194  1.00 49.16  ? 103  ARG A CD  1 
ATOM   349   N  NE  . ARG A 1 57  ? 34.700  2.038   57.975  1.00 51.39  ? 103  ARG A NE  1 
ATOM   350   C  CZ  . ARG A 1 57  ? 34.606  1.832   59.282  1.00 53.66  ? 103  ARG A CZ  1 
ATOM   351   N  NH1 . ARG A 1 57  ? 35.657  1.420   59.971  1.00 53.93  ? 103  ARG A NH1 1 
ATOM   352   N  NH2 . ARG A 1 57  ? 33.448  2.041   59.896  1.00 54.88  ? 103  ARG A NH2 1 
ATOM   353   N  N   . LEU A 1 58  ? 36.140  -3.283  55.418  1.00 40.56  ? 104  LEU A N   1 
ATOM   354   C  CA  . LEU A 1 58  ? 35.761  -4.130  54.291  1.00 39.64  ? 104  LEU A CA  1 
ATOM   355   C  C   . LEU A 1 58  ? 34.575  -5.039  54.613  1.00 39.72  ? 104  LEU A C   1 
ATOM   356   O  O   . LEU A 1 58  ? 33.648  -5.155  53.815  1.00 39.22  ? 104  LEU A O   1 
ATOM   357   C  CB  . LEU A 1 58  ? 36.933  -4.964  53.769  1.00 39.06  ? 104  LEU A CB  1 
ATOM   358   C  CG  . LEU A 1 58  ? 37.869  -4.496  52.650  1.00 37.90  ? 104  LEU A CG  1 
ATOM   359   C  CD1 . LEU A 1 58  ? 37.303  -3.395  51.814  1.00 35.06  ? 104  LEU A CD1 1 
ATOM   360   C  CD2 . LEU A 1 58  ? 39.186  -4.070  53.217  1.00 38.07  ? 104  LEU A CD2 1 
ATOM   361   N  N   . LYS A 1 59  ? 34.602  -5.681  55.781  1.00 40.11  ? 105  LYS A N   1 
ATOM   362   C  CA  . LYS A 1 59  ? 33.483  -6.534  56.197  1.00 40.44  ? 105  LYS A CA  1 
ATOM   363   C  C   . LYS A 1 59  ? 32.164  -5.757  56.160  1.00 40.97  ? 105  LYS A C   1 
ATOM   364   O  O   . LYS A 1 59  ? 31.176  -6.236  55.617  1.00 40.54  ? 105  LYS A O   1 
ATOM   365   C  CB  . LYS A 1 59  ? 33.716  -7.142  57.578  1.00 40.27  ? 105  LYS A CB  1 
ATOM   366   C  CG  . LYS A 1 59  ? 34.652  -8.325  57.612  1.00 39.50  ? 105  LYS A CG  1 
ATOM   367   C  CD  . LYS A 1 59  ? 34.888  -8.763  59.039  1.00 40.29  ? 105  LYS A CD  1 
ATOM   368   C  CE  . LYS A 1 59  ? 36.191  -9.563  59.190  1.00 41.77  ? 105  LYS A CE  1 
ATOM   369   N  NZ  . LYS A 1 59  ? 36.466  -10.080 60.571  1.00 39.46  ? 105  LYS A NZ  1 
ATOM   370   N  N   . GLU A 1 60  ? 32.169  -4.544  56.703  1.00 41.79  ? 106  GLU A N   1 
ATOM   371   C  CA  . GLU A 1 60  ? 30.979  -3.697  56.657  1.00 43.10  ? 106  GLU A CA  1 
ATOM   372   C  C   . GLU A 1 60  ? 30.527  -3.412  55.227  1.00 42.71  ? 106  GLU A C   1 
ATOM   373   O  O   . GLU A 1 60  ? 29.341  -3.451  54.928  1.00 42.86  ? 106  GLU A O   1 
ATOM   374   C  CB  . GLU A 1 60  ? 31.222  -2.390  57.408  1.00 43.35  ? 106  GLU A CB  1 
ATOM   375   C  CG  . GLU A 1 60  ? 31.036  -2.512  58.892  1.00 48.11  ? 106  GLU A CG  1 
ATOM   376   C  CD  . GLU A 1 60  ? 31.255  -1.197  59.585  1.00 55.32  ? 106  GLU A CD  1 
ATOM   377   O  OE1 . GLU A 1 60  ? 32.437  -0.759  59.642  1.00 57.25  ? 106  GLU A OE1 1 
ATOM   378   O  OE2 . GLU A 1 60  ? 30.242  -0.611  60.059  1.00 57.69  ? 106  GLU A OE2 1 
ATOM   379   N  N   . MET A 1 61  ? 31.489  -3.140  54.351  1.00 42.51  ? 107  MET A N   1 
ATOM   380   C  CA  . MET A 1 61  ? 31.187  -2.772  52.980  1.00 41.80  ? 107  MET A CA  1 
ATOM   381   C  C   . MET A 1 61  ? 30.634  -3.927  52.201  1.00 41.64  ? 107  MET A C   1 
ATOM   382   O  O   . MET A 1 61  ? 29.770  -3.746  51.344  1.00 42.19  ? 107  MET A O   1 
ATOM   383   C  CB  . MET A 1 61  ? 32.418  -2.234  52.301  1.00 41.79  ? 107  MET A CB  1 
ATOM   384   C  CG  . MET A 1 61  ? 32.676  -0.795  52.672  1.00 41.83  ? 107  MET A CG  1 
ATOM   385   S  SD  . MET A 1 61  ? 34.270  -0.287  52.042  1.00 43.97  ? 107  MET A SD  1 
ATOM   386   C  CE  . MET A 1 61  ? 33.912  -0.230  50.287  1.00 44.02  ? 107  MET A CE  1 
ATOM   387   N  N   . ILE A 1 62  ? 31.119  -5.126  52.501  1.00 41.27  ? 108  ILE A N   1 
ATOM   388   C  CA  . ILE A 1 62  ? 30.565  -6.320  51.900  1.00 40.41  ? 108  ILE A CA  1 
ATOM   389   C  C   . ILE A 1 62  ? 29.118  -6.448  52.354  1.00 40.47  ? 108  ILE A C   1 
ATOM   390   O  O   . ILE A 1 62  ? 28.211  -6.471  51.518  1.00 40.37  ? 108  ILE A O   1 
ATOM   391   C  CB  . ILE A 1 62  ? 31.367  -7.543  52.256  1.00 40.42  ? 108  ILE A CB  1 
ATOM   392   C  CG1 . ILE A 1 62  ? 32.810  -7.360  51.758  1.00 40.00  ? 108  ILE A CG1 1 
ATOM   393   C  CG2 . ILE A 1 62  ? 30.702  -8.796  51.680  1.00 40.21  ? 108  ILE A CG2 1 
ATOM   394   C  CD1 . ILE A 1 62  ? 33.681  -8.612  51.872  1.00 38.11  ? 108  ILE A CD1 1 
ATOM   395   N  N   . LYS A 1 63  ? 28.901  -6.484  53.672  1.00 40.38  ? 109  LYS A N   1 
ATOM   396   C  CA  . LYS A 1 63  ? 27.542  -6.550  54.239  1.00 40.12  ? 109  LYS A CA  1 
ATOM   397   C  C   . LYS A 1 63  ? 26.616  -5.537  53.577  1.00 39.89  ? 109  LYS A C   1 
ATOM   398   O  O   . LYS A 1 63  ? 25.448  -5.821  53.375  1.00 39.85  ? 109  LYS A O   1 
ATOM   399   C  CB  . LYS A 1 63  ? 27.542  -6.280  55.740  1.00 40.36  ? 109  LYS A CB  1 
ATOM   400   C  CG  . LYS A 1 63  ? 28.307  -7.291  56.576  1.00 42.39  ? 109  LYS A CG  1 
ATOM   401   C  CD  . LYS A 1 63  ? 28.172  -7.076  58.103  1.00 44.84  ? 109  LYS A CD  1 
ATOM   402   C  CE  . LYS A 1 63  ? 27.108  -8.015  58.688  1.00 47.04  ? 109  LYS A CE  1 
ATOM   403   N  NZ  . LYS A 1 63  ? 27.257  -8.307  60.159  1.00 48.04  ? 109  LYS A NZ  1 
ATOM   404   N  N   . ALA A 1 64  ? 27.138  -4.361  53.228  1.00 39.27  ? 110  ALA A N   1 
ATOM   405   C  CA  . ALA A 1 64  ? 26.300  -3.292  52.736  1.00 38.79  ? 110  ALA A CA  1 
ATOM   406   C  C   . ALA A 1 64  ? 26.015  -3.421  51.241  1.00 39.38  ? 110  ALA A C   1 
ATOM   407   O  O   . ALA A 1 64  ? 25.060  -2.811  50.746  1.00 39.92  ? 110  ALA A O   1 
ATOM   408   C  CB  . ALA A 1 64  ? 26.923  -1.969  53.041  1.00 38.37  ? 110  ALA A CB  1 
ATOM   409   N  N   . GLY A 1 65  ? 26.829  -4.185  50.507  1.00 39.03  ? 111  GLY A N   1 
ATOM   410   C  CA  . GLY A 1 65  ? 26.511  -4.430  49.104  1.00 38.38  ? 111  GLY A CA  1 
ATOM   411   C  C   . GLY A 1 65  ? 27.654  -4.457  48.106  1.00 38.20  ? 111  GLY A C   1 
ATOM   412   O  O   . GLY A 1 65  ? 27.430  -4.789  46.925  1.00 37.12  ? 111  GLY A O   1 
ATOM   413   N  N   . MET A 1 66  ? 28.866  -4.115  48.558  1.00 37.95  ? 112  MET A N   1 
ATOM   414   C  CA  . MET A 1 66  ? 30.005  -4.096  47.645  1.00 38.48  ? 112  MET A CA  1 
ATOM   415   C  C   . MET A 1 66  ? 30.082  -5.440  46.960  1.00 38.90  ? 112  MET A C   1 
ATOM   416   O  O   . MET A 1 66  ? 29.858  -6.475  47.619  1.00 39.32  ? 112  MET A O   1 
ATOM   417   C  CB  . MET A 1 66  ? 31.302  -3.838  48.373  1.00 38.33  ? 112  MET A CB  1 
ATOM   418   C  CG  . MET A 1 66  ? 32.466  -3.813  47.429  1.00 39.66  ? 112  MET A CG  1 
ATOM   419   S  SD  . MET A 1 66  ? 34.010  -3.574  48.266  1.00 43.10  ? 112  MET A SD  1 
ATOM   420   C  CE  . MET A 1 66  ? 34.176  -5.115  49.162  1.00 37.73  ? 112  MET A CE  1 
ATOM   421   N  N   . ASN A 1 67  ? 30.346  -5.429  45.648  1.00 38.71  ? 113  ASN A N   1 
ATOM   422   C  CA  . ASN A 1 67  ? 30.525  -6.673  44.893  1.00 38.54  ? 113  ASN A CA  1 
ATOM   423   C  C   . ASN A 1 67  ? 31.880  -6.717  44.182  1.00 39.12  ? 113  ASN A C   1 
ATOM   424   O  O   . ASN A 1 67  ? 32.354  -7.787  43.810  1.00 39.55  ? 113  ASN A O   1 
ATOM   425   C  CB  . ASN A 1 67  ? 29.435  -6.900  43.832  1.00 38.09  ? 113  ASN A CB  1 
ATOM   426   C  CG  . ASN A 1 67  ? 28.021  -6.714  44.347  1.00 36.98  ? 113  ASN A CG  1 
ATOM   427   O  OD1 . ASN A 1 67  ? 27.278  -5.877  43.845  1.00 38.63  ? 113  ASN A OD1 1 
ATOM   428   N  ND2 . ASN A 1 67  ? 27.630  -7.509  45.298  1.00 33.81  ? 113  ASN A ND2 1 
ATOM   429   N  N   . ILE A 1 68  ? 32.483  -5.558  43.960  1.00 39.29  ? 114  ILE A N   1 
ATOM   430   C  CA  . ILE A 1 68  ? 33.743  -5.507  43.250  1.00 39.23  ? 114  ILE A CA  1 
ATOM   431   C  C   . ILE A 1 68  ? 34.685  -4.539  43.946  1.00 39.64  ? 114  ILE A C   1 
ATOM   432   O  O   . ILE A 1 68  ? 34.320  -3.414  44.213  1.00 40.68  ? 114  ILE A O   1 
ATOM   433   C  CB  . ILE A 1 68  ? 33.538  -5.115  41.779  1.00 38.86  ? 114  ILE A CB  1 
ATOM   434   C  CG1 . ILE A 1 68  ? 32.574  -6.096  41.114  1.00 38.96  ? 114  ILE A CG1 1 
ATOM   435   C  CG2 . ILE A 1 68  ? 34.894  -5.100  41.020  1.00 38.38  ? 114  ILE A CG2 1 
ATOM   436   C  CD1 . ILE A 1 68  ? 32.331  -5.845  39.602  1.00 39.94  ? 114  ILE A CD1 1 
ATOM   437   N  N   . ALA A 1 69  ? 35.894  -4.969  44.273  1.00 39.49  ? 115  ALA A N   1 
ATOM   438   C  CA  . ALA A 1 69  ? 36.835  -4.016  44.805  1.00 39.26  ? 115  ALA A CA  1 
ATOM   439   C  C   . ALA A 1 69  ? 37.670  -3.531  43.636  1.00 39.29  ? 115  ALA A C   1 
ATOM   440   O  O   . ALA A 1 69  ? 38.092  -4.308  42.802  1.00 39.25  ? 115  ALA A O   1 
ATOM   441   C  CB  . ALA A 1 69  ? 37.673  -4.619  45.858  1.00 39.10  ? 115  ALA A CB  1 
ATOM   442   N  N   . ARG A 1 70  ? 37.842  -2.223  43.563  1.00 39.23  ? 116  ARG A N   1 
ATOM   443   C  CA  . ARG A 1 70  ? 38.582  -1.608  42.523  1.00 39.07  ? 116  ARG A CA  1 
ATOM   444   C  C   . ARG A 1 70  ? 39.887  -1.051  43.100  1.00 39.44  ? 116  ARG A C   1 
ATOM   445   O  O   . ARG A 1 70  ? 39.851  -0.197  43.997  1.00 39.74  ? 116  ARG A O   1 
ATOM   446   C  CB  . ARG A 1 70  ? 37.743  -0.496  41.908  1.00 38.90  ? 116  ARG A CB  1 
ATOM   447   C  CG  . ARG A 1 70  ? 38.477  0.276   40.818  1.00 38.99  ? 116  ARG A CG  1 
ATOM   448   C  CD  . ARG A 1 70  ? 37.761  1.526   40.432  1.00 36.83  ? 116  ARG A CD  1 
ATOM   449   N  NE  . ARG A 1 70  ? 38.541  2.288   39.470  1.00 36.94  ? 116  ARG A NE  1 
ATOM   450   C  CZ  . ARG A 1 70  ? 39.033  3.504   39.694  1.00 36.33  ? 116  ARG A CZ  1 
ATOM   451   N  NH1 . ARG A 1 70  ? 38.812  4.149   40.850  1.00 36.61  ? 116  ARG A NH1 1 
ATOM   452   N  NH2 . ARG A 1 70  ? 39.719  4.096   38.746  1.00 34.37  ? 116  ARG A NH2 1 
ATOM   453   N  N   . LEU A 1 71  ? 41.022  -1.547  42.599  1.00 38.94  ? 117  LEU A N   1 
ATOM   454   C  CA  . LEU A 1 71  ? 42.334  -1.024  42.979  1.00 38.65  ? 117  LEU A CA  1 
ATOM   455   C  C   . LEU A 1 71  ? 42.853  -0.046  41.916  1.00 39.18  ? 117  LEU A C   1 
ATOM   456   O  O   . LEU A 1 71  ? 43.118  -0.407  40.750  1.00 39.44  ? 117  LEU A O   1 
ATOM   457   C  CB  . LEU A 1 71  ? 43.376  -2.134  43.115  1.00 38.05  ? 117  LEU A CB  1 
ATOM   458   C  CG  . LEU A 1 71  ? 43.016  -3.488  43.698  1.00 37.46  ? 117  LEU A CG  1 
ATOM   459   C  CD1 . LEU A 1 71  ? 44.286  -4.366  43.647  1.00 35.76  ? 117  LEU A CD1 1 
ATOM   460   C  CD2 . LEU A 1 71  ? 42.461  -3.382  45.100  1.00 35.06  ? 117  LEU A CD2 1 
ATOM   461   N  N   . ASN A 1 72  ? 43.060  1.188   42.336  1.00 39.05  ? 118  ASN A N   1 
ATOM   462   C  CA  . ASN A 1 72  ? 43.410  2.235   41.414  1.00 38.73  ? 118  ASN A CA  1 
ATOM   463   C  C   . ASN A 1 72  ? 44.890  2.399   41.357  1.00 38.99  ? 118  ASN A C   1 
ATOM   464   O  O   . ASN A 1 72  ? 45.464  3.086   42.191  1.00 38.95  ? 118  ASN A O   1 
ATOM   465   C  CB  . ASN A 1 72  ? 42.772  3.524   41.893  1.00 38.92  ? 118  ASN A CB  1 
ATOM   466   C  CG  . ASN A 1 72  ? 43.091  4.677   41.013  1.00 39.86  ? 118  ASN A CG  1 
ATOM   467   O  OD1 . ASN A 1 72  ? 43.815  4.530   40.026  1.00 43.31  ? 118  ASN A OD1 1 
ATOM   468   N  ND2 . ASN A 1 72  ? 42.546  5.854   41.345  1.00 37.76  ? 118  ASN A ND2 1 
ATOM   469   N  N   . PHE A 1 73  ? 45.508  1.786   40.352  1.00 39.79  ? 119  PHE A N   1 
ATOM   470   C  CA  . PHE A 1 73  ? 46.969  1.780   40.221  1.00 40.04  ? 119  PHE A CA  1 
ATOM   471   C  C   . PHE A 1 73  ? 47.582  3.111   39.825  1.00 40.78  ? 119  PHE A C   1 
ATOM   472   O  O   . PHE A 1 73  ? 48.792  3.221   39.656  1.00 41.45  ? 119  PHE A O   1 
ATOM   473   C  CB  . PHE A 1 73  ? 47.431  0.668   39.283  1.00 39.82  ? 119  PHE A CB  1 
ATOM   474   C  CG  . PHE A 1 73  ? 47.755  -0.609  39.994  1.00 39.39  ? 119  PHE A CG  1 
ATOM   475   C  CD1 . PHE A 1 73  ? 46.740  -1.402  40.523  1.00 40.85  ? 119  PHE A CD1 1 
ATOM   476   C  CD2 . PHE A 1 73  ? 49.069  -1.003  40.161  1.00 36.72  ? 119  PHE A CD2 1 
ATOM   477   C  CE1 . PHE A 1 73  ? 47.046  -2.575  41.196  1.00 41.03  ? 119  PHE A CE1 1 
ATOM   478   C  CE2 . PHE A 1 73  ? 49.381  -2.176  40.820  1.00 37.27  ? 119  PHE A CE2 1 
ATOM   479   C  CZ  . PHE A 1 73  ? 48.373  -2.972  41.332  1.00 39.20  ? 119  PHE A CZ  1 
ATOM   480   N  N   . SER A 1 74  ? 46.755  4.134   39.695  1.00 41.13  ? 120  SER A N   1 
ATOM   481   C  CA  . SER A 1 74  ? 47.254  5.479   39.542  1.00 41.29  ? 120  SER A CA  1 
ATOM   482   C  C   . SER A 1 74  ? 48.004  5.957   40.812  1.00 41.82  ? 120  SER A C   1 
ATOM   483   O  O   . SER A 1 74  ? 48.680  6.981   40.792  1.00 41.95  ? 120  SER A O   1 
ATOM   484   C  CB  . SER A 1 74  ? 46.067  6.387   39.305  1.00 41.16  ? 120  SER A CB  1 
ATOM   485   O  OG  . SER A 1 74  ? 46.182  7.036   38.065  1.00 41.78  ? 120  SER A OG  1 
ATOM   486   N  N   . HIS A 1 75  ? 47.840  5.236   41.918  1.00 41.97  ? 121  HIS A N   1 
ATOM   487   C  CA  . HIS A 1 75  ? 48.374  5.634   43.214  1.00 42.28  ? 121  HIS A CA  1 
ATOM   488   C  C   . HIS A 1 75  ? 48.730  4.392   44.001  1.00 42.58  ? 121  HIS A C   1 
ATOM   489   O  O   . HIS A 1 75  ? 48.009  3.382   43.935  1.00 43.35  ? 121  HIS A O   1 
ATOM   490   C  CB  . HIS A 1 75  ? 47.342  6.403   44.036  1.00 42.28  ? 121  HIS A CB  1 
ATOM   491   C  CG  . HIS A 1 75  ? 46.798  7.609   43.345  1.00 43.62  ? 121  HIS A CG  1 
ATOM   492   N  ND1 . HIS A 1 75  ? 47.541  8.758   43.166  1.00 43.85  ? 121  HIS A ND1 1 
ATOM   493   C  CD2 . HIS A 1 75  ? 45.585  7.842   42.781  1.00 43.50  ? 121  HIS A CD2 1 
ATOM   494   C  CE1 . HIS A 1 75  ? 46.800  9.655   42.539  1.00 44.51  ? 121  HIS A CE1 1 
ATOM   495   N  NE2 . HIS A 1 75  ? 45.605  9.129   42.301  1.00 43.92  ? 121  HIS A NE2 1 
ATOM   496   N  N   . GLY A 1 76  ? 49.817  4.473   44.768  1.00 42.01  ? 122  GLY A N   1 
ATOM   497   C  CA  . GLY A 1 76  ? 50.222  3.361   45.593  1.00 41.86  ? 122  GLY A CA  1 
ATOM   498   C  C   . GLY A 1 76  ? 51.151  2.407   44.865  1.00 42.01  ? 122  GLY A C   1 
ATOM   499   O  O   . GLY A 1 76  ? 51.115  2.275   43.633  1.00 42.50  ? 122  GLY A O   1 
ATOM   500   N  N   . SER A 1 77  ? 51.998  1.759   45.658  1.00 41.34  ? 123  SER A N   1 
ATOM   501   C  CA  . SER A 1 77  ? 53.017  0.861   45.170  1.00 40.61  ? 123  SER A CA  1 
ATOM   502   C  C   . SER A 1 77  ? 52.440  -0.547  45.072  1.00 40.46  ? 123  SER A C   1 
ATOM   503   O  O   . SER A 1 77  ? 51.264  -0.777  45.437  1.00 40.01  ? 123  SER A O   1 
ATOM   504   C  CB  . SER A 1 77  ? 54.194  0.872   46.137  1.00 40.41  ? 123  SER A CB  1 
ATOM   505   O  OG  . SER A 1 77  ? 53.805  0.332   47.388  1.00 40.31  ? 123  SER A OG  1 
ATOM   506   N  N   . HIS A 1 78  ? 53.264  -1.480  44.579  1.00 40.02  ? 124  HIS A N   1 
ATOM   507   C  CA  . HIS A 1 78  ? 52.842  -2.866  44.454  1.00 39.90  ? 124  HIS A CA  1 
ATOM   508   C  C   . HIS A 1 78  ? 52.536  -3.442  45.825  1.00 40.55  ? 124  HIS A C   1 
ATOM   509   O  O   . HIS A 1 78  ? 51.489  -4.070  46.023  1.00 40.50  ? 124  HIS A O   1 
ATOM   510   C  CB  . HIS A 1 78  ? 53.914  -3.686  43.764  1.00 39.50  ? 124  HIS A CB  1 
ATOM   511   C  CG  . HIS A 1 78  ? 53.915  -3.553  42.276  1.00 38.30  ? 124  HIS A CG  1 
ATOM   512   N  ND1 . HIS A 1 78  ? 53.178  -2.593  41.612  1.00 38.39  ? 124  HIS A ND1 1 
ATOM   513   C  CD2 . HIS A 1 78  ? 54.588  -4.242  41.323  1.00 37.47  ? 124  HIS A CD2 1 
ATOM   514   C  CE1 . HIS A 1 78  ? 53.375  -2.717  40.312  1.00 37.54  ? 124  HIS A CE1 1 
ATOM   515   N  NE2 . HIS A 1 78  ? 54.232  -3.705  40.111  1.00 37.54  ? 124  HIS A NE2 1 
ATOM   516   N  N   . GLU A 1 79  ? 53.448  -3.199  46.769  1.00 41.16  ? 125  GLU A N   1 
ATOM   517   C  CA  . GLU A 1 79  ? 53.294  -3.668  48.132  1.00 41.93  ? 125  GLU A CA  1 
ATOM   518   C  C   . GLU A 1 79  ? 51.943  -3.180  48.655  1.00 41.82  ? 125  GLU A C   1 
ATOM   519   O  O   . GLU A 1 79  ? 51.185  -3.938  49.252  1.00 42.03  ? 125  GLU A O   1 
ATOM   520   C  CB  . GLU A 1 79  ? 54.447  -3.169  49.003  1.00 42.14  ? 125  GLU A CB  1 
ATOM   521   C  CG  . GLU A 1 79  ? 55.856  -3.555  48.501  1.00 45.41  ? 125  GLU A CG  1 
ATOM   522   C  CD  . GLU A 1 79  ? 56.259  -2.881  47.162  1.00 49.45  ? 125  GLU A CD  1 
ATOM   523   O  OE1 . GLU A 1 79  ? 55.911  -1.700  46.937  1.00 50.71  ? 125  GLU A OE1 1 
ATOM   524   O  OE2 . GLU A 1 79  ? 56.925  -3.537  46.328  1.00 51.60  ? 125  GLU A OE2 1 
ATOM   525   N  N   . TYR A 1 80  ? 51.629  -1.924  48.366  1.00 41.70  ? 126  TYR A N   1 
ATOM   526   C  CA  . TYR A 1 80  ? 50.428  -1.281  48.866  1.00 41.65  ? 126  TYR A CA  1 
ATOM   527   C  C   . TYR A 1 80  ? 49.168  -1.946  48.359  1.00 41.56  ? 126  TYR A C   1 
ATOM   528   O  O   . TYR A 1 80  ? 48.192  -2.054  49.086  1.00 42.07  ? 126  TYR A O   1 
ATOM   529   C  CB  . TYR A 1 80  ? 50.430  0.204   48.491  1.00 41.83  ? 126  TYR A CB  1 
ATOM   530   C  CG  . TYR A 1 80  ? 49.151  0.941   48.838  1.00 42.60  ? 126  TYR A CG  1 
ATOM   531   C  CD1 . TYR A 1 80  ? 49.000  1.591   50.065  1.00 42.66  ? 126  TYR A CD1 1 
ATOM   532   C  CD2 . TYR A 1 80  ? 48.085  0.980   47.944  1.00 43.05  ? 126  TYR A CD2 1 
ATOM   533   C  CE1 . TYR A 1 80  ? 47.844  2.255   50.380  1.00 41.03  ? 126  TYR A CE1 1 
ATOM   534   C  CE2 . TYR A 1 80  ? 46.910  1.649   48.262  1.00 42.84  ? 126  TYR A CE2 1 
ATOM   535   C  CZ  . TYR A 1 80  ? 46.804  2.279   49.482  1.00 42.98  ? 126  TYR A CZ  1 
ATOM   536   O  OH  . TYR A 1 80  ? 45.632  2.941   49.789  1.00 45.59  ? 126  TYR A OH  1 
ATOM   537   N  N   . HIS A 1 81  ? 49.182  -2.373  47.104  1.00 41.53  ? 127  HIS A N   1 
ATOM   538   C  CA  . HIS A 1 81  ? 48.030  -3.050  46.513  1.00 40.91  ? 127  HIS A CA  1 
ATOM   539   C  C   . HIS A 1 81  ? 47.968  -4.493  46.927  1.00 40.96  ? 127  HIS A C   1 
ATOM   540   O  O   . HIS A 1 81  ? 46.874  -5.053  46.955  1.00 41.56  ? 127  HIS A O   1 
ATOM   541   C  CB  . HIS A 1 81  ? 48.036  -2.935  44.993  1.00 40.78  ? 127  HIS A CB  1 
ATOM   542   C  CG  . HIS A 1 81  ? 47.886  -1.532  44.520  1.00 40.33  ? 127  HIS A CG  1 
ATOM   543   N  ND1 . HIS A 1 81  ? 46.713  -0.819  44.678  1.00 40.41  ? 127  HIS A ND1 1 
ATOM   544   C  CD2 . HIS A 1 81  ? 48.774  -0.684  43.951  1.00 41.42  ? 127  HIS A CD2 1 
ATOM   545   C  CE1 . HIS A 1 81  ? 46.881  0.403   44.208  1.00 40.46  ? 127  HIS A CE1 1 
ATOM   546   N  NE2 . HIS A 1 81  ? 48.123  0.511   43.765  1.00 42.51  ? 127  HIS A NE2 1 
ATOM   547   N  N   . ALA A 1 82  ? 49.119  -5.086  47.260  1.00 40.55  ? 128  ALA A N   1 
ATOM   548   C  CA  . ALA A 1 82  ? 49.145  -6.449  47.757  1.00 40.59  ? 128  ALA A CA  1 
ATOM   549   C  C   . ALA A 1 82  ? 48.418  -6.508  49.106  1.00 40.68  ? 128  ALA A C   1 
ATOM   550   O  O   . ALA A 1 82  ? 47.610  -7.418  49.364  1.00 41.11  ? 128  ALA A O   1 
ATOM   551   C  CB  . ALA A 1 82  ? 50.563  -6.956  47.860  1.00 40.30  ? 128  ALA A CB  1 
ATOM   552   N  N   . GLU A 1 83  ? 48.668  -5.501  49.936  1.00 40.48  ? 129  GLU A N   1 
ATOM   553   C  CA  . GLU A 1 83  ? 48.009  -5.376  51.230  1.00 40.39  ? 129  GLU A CA  1 
ATOM   554   C  C   . GLU A 1 83  ? 46.508  -5.251  51.056  1.00 40.50  ? 129  GLU A C   1 
ATOM   555   O  O   . GLU A 1 83  ? 45.727  -5.793  51.848  1.00 40.52  ? 129  GLU A O   1 
ATOM   556   C  CB  . GLU A 1 83  ? 48.554  -4.174  51.994  1.00 40.22  ? 129  GLU A CB  1 
ATOM   557   C  CG  . GLU A 1 83  ? 49.977  -4.348  52.507  1.00 40.79  ? 129  GLU A CG  1 
ATOM   558   C  CD  . GLU A 1 83  ? 50.634  -3.056  52.966  1.00 41.19  ? 129  GLU A CD  1 
ATOM   559   O  OE1 . GLU A 1 83  ? 50.061  -1.961  52.761  1.00 39.25  ? 129  GLU A OE1 1 
ATOM   560   O  OE2 . GLU A 1 83  ? 51.743  -3.150  53.533  1.00 41.82  ? 129  GLU A OE2 1 
ATOM   561   N  N   . SER A 1 84  ? 46.108  -4.532  50.012  1.00 40.64  ? 130  SER A N   1 
ATOM   562   C  CA  . SER A 1 84  ? 44.700  -4.341  49.702  1.00 40.79  ? 130  SER A CA  1 
ATOM   563   C  C   . SER A 1 84  ? 44.042  -5.640  49.312  1.00 40.70  ? 130  SER A C   1 
ATOM   564   O  O   . SER A 1 84  ? 42.980  -5.995  49.849  1.00 40.99  ? 130  SER A O   1 
ATOM   565   C  CB  . SER A 1 84  ? 44.552  -3.350  48.579  1.00 40.56  ? 130  SER A CB  1 
ATOM   566   O  OG  . SER A 1 84  ? 44.774  -2.061  49.091  1.00 42.01  ? 130  SER A OG  1 
ATOM   567   N  N   . ILE A 1 85  ? 44.690  -6.354  48.394  1.00 40.08  ? 131  ILE A N   1 
ATOM   568   C  CA  . ILE A 1 85  ? 44.194  -7.641  47.964  1.00 39.22  ? 131  ILE A CA  1 
ATOM   569   C  C   . ILE A 1 85  ? 44.044  -8.518  49.201  1.00 39.41  ? 131  ILE A C   1 
ATOM   570   O  O   . ILE A 1 85  ? 42.943  -9.002  49.473  1.00 39.50  ? 131  ILE A O   1 
ATOM   571   C  CB  . ILE A 1 85  ? 45.100  -8.252  46.901  1.00 38.69  ? 131  ILE A CB  1 
ATOM   572   C  CG1 . ILE A 1 85  ? 44.891  -7.503  45.584  1.00 37.68  ? 131  ILE A CG1 1 
ATOM   573   C  CG2 . ILE A 1 85  ? 44.805  -9.727  46.737  1.00 37.81  ? 131  ILE A CG2 1 
ATOM   574   C  CD1 . ILE A 1 85  ? 46.021  -7.629  44.566  1.00 35.76  ? 131  ILE A CD1 1 
ATOM   575   N  N   . ALA A 1 86  ? 45.126  -8.640  49.978  1.00 39.14  ? 132  ALA A N   1 
ATOM   576   C  CA  . ALA A 1 86  ? 45.142  -9.474  51.181  1.00 39.08  ? 132  ALA A CA  1 
ATOM   577   C  C   . ALA A 1 86  ? 43.947  -9.166  52.101  1.00 39.27  ? 132  ALA A C   1 
ATOM   578   O  O   . ALA A 1 86  ? 43.316  -10.084 52.653  1.00 39.46  ? 132  ALA A O   1 
ATOM   579   C  CB  . ALA A 1 86  ? 46.470  -9.329  51.934  1.00 38.29  ? 132  ALA A CB  1 
ATOM   580   N  N   . ASN A 1 87  ? 43.621  -7.887  52.247  1.00 38.78  ? 133  ASN A N   1 
ATOM   581   C  CA  . ASN A 1 87  ? 42.658  -7.517  53.245  1.00 38.66  ? 133  ASN A CA  1 
ATOM   582   C  C   . ASN A 1 87  ? 41.273  -7.818  52.760  1.00 38.94  ? 133  ASN A C   1 
ATOM   583   O  O   . ASN A 1 87  ? 40.445  -8.290  53.539  1.00 39.28  ? 133  ASN A O   1 
ATOM   584   C  CB  . ASN A 1 87  ? 42.790  -6.043  53.616  1.00 38.68  ? 133  ASN A CB  1 
ATOM   585   C  CG  . ASN A 1 87  ? 44.013  -5.747  54.494  1.00 38.06  ? 133  ASN A CG  1 
ATOM   586   O  OD1 . ASN A 1 87  ? 44.288  -4.585  54.779  1.00 36.49  ? 133  ASN A OD1 1 
ATOM   587   N  ND2 . ASN A 1 87  ? 44.746  -6.787  54.919  1.00 37.12  ? 133  ASN A ND2 1 
ATOM   588   N  N   . VAL A 1 88  ? 41.032  -7.542  51.477  1.00 38.78  ? 134  VAL A N   1 
ATOM   589   C  CA  . VAL A 1 88  ? 39.772  -7.878  50.824  1.00 38.27  ? 134  VAL A CA  1 
ATOM   590   C  C   . VAL A 1 88  ? 39.541  -9.369  51.014  1.00 38.49  ? 134  VAL A C   1 
ATOM   591   O  O   . VAL A 1 88  ? 38.554  -9.768  51.626  1.00 38.67  ? 134  VAL A O   1 
ATOM   592   C  CB  . VAL A 1 88  ? 39.775  -7.530  49.300  1.00 38.48  ? 134  VAL A CB  1 
ATOM   593   C  CG1 . VAL A 1 88  ? 38.552  -8.117  48.591  1.00 37.59  ? 134  VAL A CG1 1 
ATOM   594   C  CG2 . VAL A 1 88  ? 39.824  -6.020  49.062  1.00 37.78  ? 134  VAL A CG2 1 
ATOM   595   N  N   . ARG A 1 89  ? 40.477  -10.188 50.527  1.00 38.07  ? 135  ARG A N   1 
ATOM   596   C  CA  . ARG A 1 89  ? 40.330  -11.627 50.577  1.00 37.21  ? 135  ARG A CA  1 
ATOM   597   C  C   . ARG A 1 89  ? 40.036  -12.093 51.992  1.00 37.75  ? 135  ARG A C   1 
ATOM   598   O  O   . ARG A 1 89  ? 39.221  -13.015 52.184  1.00 37.84  ? 135  ARG A O   1 
ATOM   599   C  CB  . ARG A 1 89  ? 41.553  -12.306 49.982  1.00 36.37  ? 135  ARG A CB  1 
ATOM   600   C  CG  . ARG A 1 89  ? 41.515  -12.220 48.484  1.00 34.22  ? 135  ARG A CG  1 
ATOM   601   C  CD  . ARG A 1 89  ? 42.685  -12.840 47.810  1.00 32.65  ? 135  ARG A CD  1 
ATOM   602   N  NE  . ARG A 1 89  ? 42.581  -12.646 46.367  1.00 33.92  ? 135  ARG A NE  1 
ATOM   603   C  CZ  . ARG A 1 89  ? 43.613  -12.618 45.523  1.00 32.35  ? 135  ARG A CZ  1 
ATOM   604   N  NH1 . ARG A 1 89  ? 44.860  -12.764 45.960  1.00 30.38  ? 135  ARG A NH1 1 
ATOM   605   N  NH2 . ARG A 1 89  ? 43.391  -12.432 44.234  1.00 30.73  ? 135  ARG A NH2 1 
ATOM   606   N  N   . GLU A 1 90  ? 40.662  -11.428 52.974  1.00 38.04  ? 136  GLU A N   1 
ATOM   607   C  CA  . GLU A 1 90  ? 40.428  -11.761 54.378  1.00 38.45  ? 136  GLU A CA  1 
ATOM   608   C  C   . GLU A 1 90  ? 38.996  -11.404 54.754  1.00 38.72  ? 136  GLU A C   1 
ATOM   609   O  O   . GLU A 1 90  ? 38.257  -12.242 55.308  1.00 39.26  ? 136  GLU A O   1 
ATOM   610   C  CB  . GLU A 1 90  ? 41.420  -11.082 55.312  1.00 38.23  ? 136  GLU A CB  1 
ATOM   611   C  CG  . GLU A 1 90  ? 41.356  -11.620 56.728  1.00 39.03  ? 136  GLU A CG  1 
ATOM   612   C  CD  . GLU A 1 90  ? 42.344  -10.963 57.669  1.00 40.75  ? 136  GLU A CD  1 
ATOM   613   O  OE1 . GLU A 1 90  ? 43.353  -10.391 57.203  1.00 41.45  ? 136  GLU A OE1 1 
ATOM   614   O  OE2 . GLU A 1 90  ? 42.113  -11.020 58.888  1.00 41.22  ? 136  GLU A OE2 1 
ATOM   615   N  N   . ALA A 1 91  ? 38.596  -10.178 54.441  1.00 38.32  ? 137  ALA A N   1 
ATOM   616   C  CA  . ALA A 1 91  ? 37.254  -9.754  54.760  1.00 38.34  ? 137  ALA A CA  1 
ATOM   617   C  C   . ALA A 1 91  ? 36.280  -10.725 54.117  1.00 38.70  ? 137  ALA A C   1 
ATOM   618   O  O   . ALA A 1 91  ? 35.324  -11.170 54.748  1.00 39.06  ? 137  ALA A O   1 
ATOM   619   C  CB  . ALA A 1 91  ? 37.015  -8.360  54.289  1.00 37.80  ? 137  ALA A CB  1 
ATOM   620   N  N   . VAL A 1 92  ? 36.560  -11.098 52.878  1.00 39.20  ? 138  VAL A N   1 
ATOM   621   C  CA  . VAL A 1 92  ? 35.634  -11.904 52.102  1.00 39.68  ? 138  VAL A CA  1 
ATOM   622   C  C   . VAL A 1 92  ? 35.495  -13.303 52.669  1.00 39.94  ? 138  VAL A C   1 
ATOM   623   O  O   . VAL A 1 92  ? 34.378  -13.785 52.833  1.00 40.69  ? 138  VAL A O   1 
ATOM   624   C  CB  . VAL A 1 92  ? 36.008  -11.970 50.595  1.00 39.81  ? 138  VAL A CB  1 
ATOM   625   C  CG1 . VAL A 1 92  ? 34.952  -12.727 49.835  1.00 39.52  ? 138  VAL A CG1 1 
ATOM   626   C  CG2 . VAL A 1 92  ? 36.123  -10.582 49.999  1.00 39.90  ? 138  VAL A CG2 1 
ATOM   627   N  N   . GLU A 1 93  ? 36.623  -13.936 52.992  1.00 39.73  ? 139  GLU A N   1 
ATOM   628   C  CA  . GLU A 1 93  ? 36.616  -15.314 53.501  1.00 39.27  ? 139  GLU A CA  1 
ATOM   629   C  C   . GLU A 1 93  ? 36.167  -15.404 54.945  1.00 39.09  ? 139  GLU A C   1 
ATOM   630   O  O   . GLU A 1 93  ? 36.034  -16.493 55.461  1.00 39.32  ? 139  GLU A O   1 
ATOM   631   C  CB  . GLU A 1 93  ? 37.984  -16.009 53.345  1.00 38.93  ? 139  GLU A CB  1 
ATOM   632   C  CG  . GLU A 1 93  ? 38.592  -16.020 51.942  1.00 39.48  ? 139  GLU A CG  1 
ATOM   633   C  CD  . GLU A 1 93  ? 37.597  -16.398 50.848  1.00 42.04  ? 139  GLU A CD  1 
ATOM   634   O  OE1 . GLU A 1 93  ? 37.175  -17.567 50.787  1.00 39.98  ? 139  GLU A OE1 1 
ATOM   635   O  OE2 . GLU A 1 93  ? 37.230  -15.517 50.033  1.00 44.47  ? 139  GLU A OE2 1 
ATOM   636   N  N   . SER A 1 94  ? 35.937  -14.274 55.606  1.00 39.11  ? 140  SER A N   1 
ATOM   637   C  CA  . SER A 1 94  ? 35.439  -14.310 56.993  1.00 39.12  ? 140  SER A CA  1 
ATOM   638   C  C   . SER A 1 94  ? 34.000  -14.838 57.036  1.00 39.30  ? 140  SER A C   1 
ATOM   639   O  O   . SER A 1 94  ? 33.517  -15.253 58.083  1.00 38.60  ? 140  SER A O   1 
ATOM   640   C  CB  . SER A 1 94  ? 35.550  -12.932 57.673  1.00 38.83  ? 140  SER A CB  1 
ATOM   641   O  OG  . SER A 1 94  ? 34.644  -11.985 57.128  1.00 38.53  ? 140  SER A OG  1 
ATOM   642   N  N   . PHE A 1 95  ? 33.344  -14.817 55.873  1.00 39.94  ? 141  PHE A N   1 
ATOM   643   C  CA  . PHE A 1 95  ? 31.954  -15.251 55.723  1.00 40.37  ? 141  PHE A CA  1 
ATOM   644   C  C   . PHE A 1 95  ? 31.831  -16.652 55.145  1.00 41.38  ? 141  PHE A C   1 
ATOM   645   O  O   . PHE A 1 95  ? 30.720  -17.092 54.795  1.00 41.72  ? 141  PHE A O   1 
ATOM   646   C  CB  . PHE A 1 95  ? 31.200  -14.321 54.787  1.00 39.64  ? 141  PHE A CB  1 
ATOM   647   C  CG  . PHE A 1 95  ? 31.172  -12.921 55.233  1.00 37.47  ? 141  PHE A CG  1 
ATOM   648   C  CD1 . PHE A 1 95  ? 32.145  -12.037 54.784  1.00 35.74  ? 141  PHE A CD1 1 
ATOM   649   C  CD2 . PHE A 1 95  ? 30.168  -12.469 56.088  1.00 35.11  ? 141  PHE A CD2 1 
ATOM   650   C  CE1 . PHE A 1 95  ? 32.124  -10.705 55.177  1.00 35.91  ? 141  PHE A CE1 1 
ATOM   651   C  CE2 . PHE A 1 95  ? 30.134  -11.153 56.499  1.00 34.36  ? 141  PHE A CE2 1 
ATOM   652   C  CZ  . PHE A 1 95  ? 31.113  -10.260 56.049  1.00 35.04  ? 141  PHE A CZ  1 
ATOM   653   N  N   . ALA A 1 96  ? 32.963  -17.345 55.024  1.00 42.06  ? 142  ALA A N   1 
ATOM   654   C  CA  . ALA A 1 96  ? 32.967  -18.689 54.455  1.00 42.50  ? 142  ALA A CA  1 
ATOM   655   C  C   . ALA A 1 96  ? 32.373  -19.733 55.413  1.00 43.03  ? 142  ALA A C   1 
ATOM   656   O  O   . ALA A 1 96  ? 32.171  -20.882 55.020  1.00 43.33  ? 142  ALA A O   1 
ATOM   657   C  CB  . ALA A 1 96  ? 34.373  -19.067 54.025  1.00 42.09  ? 142  ALA A CB  1 
ATOM   658   N  N   . GLY A 1 97  ? 32.097  -19.320 56.656  1.00 43.68  ? 143  GLY A N   1 
ATOM   659   C  CA  . GLY A 1 97  ? 31.463  -20.177 57.676  1.00 44.08  ? 143  GLY A CA  1 
ATOM   660   C  C   . GLY A 1 97  ? 30.106  -20.726 57.244  1.00 44.34  ? 143  GLY A C   1 
ATOM   661   O  O   . GLY A 1 97  ? 29.605  -21.693 57.815  1.00 44.18  ? 143  GLY A O   1 
ATOM   662   N  N   . SER A 1 98  ? 29.521  -20.113 56.215  1.00 44.59  ? 144  SER A N   1 
ATOM   663   C  CA  . SER A 1 98  ? 28.236  -20.542 55.715  1.00 44.68  ? 144  SER A CA  1 
ATOM   664   C  C   . SER A 1 98  ? 28.150  -20.410 54.219  1.00 44.61  ? 144  SER A C   1 
ATOM   665   O  O   . SER A 1 98  ? 27.818  -19.320 53.721  1.00 44.45  ? 144  SER A O   1 
ATOM   666   C  CB  . SER A 1 98  ? 27.138  -19.694 56.336  1.00 45.02  ? 144  SER A CB  1 
ATOM   667   O  OG  . SER A 1 98  ? 26.932  -20.145 57.687  1.00 45.67  ? 144  SER A OG  1 
ATOM   668   N  N   . PRO A 1 99  ? 28.385  -21.526 53.494  1.00 44.60  ? 145  PRO A N   1 
ATOM   669   C  CA  . PRO A 1 99  ? 28.372  -21.554 52.019  1.00 44.65  ? 145  PRO A CA  1 
ATOM   670   C  C   . PRO A 1 99  ? 27.058  -21.029 51.407  1.00 44.63  ? 145  PRO A C   1 
ATOM   671   O  O   . PRO A 1 99  ? 27.090  -20.438 50.331  1.00 44.65  ? 145  PRO A O   1 
ATOM   672   C  CB  . PRO A 1 99  ? 28.546  -23.046 51.685  1.00 44.75  ? 145  PRO A CB  1 
ATOM   673   C  CG  . PRO A 1 99  ? 29.046  -23.689 52.909  1.00 44.31  ? 145  PRO A CG  1 
ATOM   674   C  CD  . PRO A 1 99  ? 28.615  -22.863 54.073  1.00 44.51  ? 145  PRO A CD  1 
ATOM   675   N  N   . LEU A 1 100 ? 25.931  -21.248 52.098  1.00 44.68  ? 146  LEU A N   1 
ATOM   676   C  CA  . LEU A 1 100 ? 24.604  -20.817 51.639  1.00 44.68  ? 146  LEU A CA  1 
ATOM   677   C  C   . LEU A 1 100 ? 24.461  -19.302 51.630  1.00 44.80  ? 146  LEU A C   1 
ATOM   678   O  O   . LEU A 1 100 ? 23.576  -18.758 50.952  1.00 45.55  ? 146  LEU A O   1 
ATOM   679   C  CB  . LEU A 1 100 ? 23.490  -21.452 52.489  1.00 44.57  ? 146  LEU A CB  1 
ATOM   680   C  CG  . LEU A 1 100 ? 23.394  -22.990 52.486  1.00 44.50  ? 146  LEU A CG  1 
ATOM   681   C  CD1 . LEU A 1 100 ? 22.366  -23.477 53.495  1.00 43.93  ? 146  LEU A CD1 1 
ATOM   682   C  CD2 . LEU A 1 100 ? 23.068  -23.522 51.095  1.00 43.97  ? 146  LEU A CD2 1 
ATOM   683   N  N   . SER A 1 101 ? 25.357  -18.620 52.339  1.00 44.34  ? 147  SER A N   1 
ATOM   684   C  CA  . SER A 1 101 ? 25.234  -17.179 52.542  1.00 43.97  ? 147  SER A CA  1 
ATOM   685   C  C   . SER A 1 101 ? 26.447  -16.361 52.027  1.00 43.65  ? 147  SER A C   1 
ATOM   686   O  O   . SER A 1 101 ? 26.333  -15.143 51.764  1.00 43.54  ? 147  SER A O   1 
ATOM   687   C  CB  . SER A 1 101 ? 24.909  -16.906 54.023  1.00 43.82  ? 147  SER A CB  1 
ATOM   688   O  OG  . SER A 1 101 ? 25.361  -15.632 54.437  1.00 44.46  ? 147  SER A OG  1 
ATOM   689   N  N   . TYR A 1 102 ? 27.587  -17.043 51.884  1.00 42.99  ? 148  TYR A N   1 
ATOM   690   C  CA  . TYR A 1 102 ? 28.832  -16.499 51.310  1.00 42.17  ? 148  TYR A CA  1 
ATOM   691   C  C   . TYR A 1 102 ? 28.636  -15.611 50.079  1.00 42.12  ? 148  TYR A C   1 
ATOM   692   O  O   . TYR A 1 102 ? 27.986  -16.016 49.120  1.00 42.60  ? 148  TYR A O   1 
ATOM   693   C  CB  . TYR A 1 102 ? 29.720  -17.670 50.915  1.00 41.68  ? 148  TYR A CB  1 
ATOM   694   C  CG  . TYR A 1 102 ? 31.025  -17.299 50.280  1.00 41.16  ? 148  TYR A CG  1 
ATOM   695   C  CD1 . TYR A 1 102 ? 32.079  -16.808 51.058  1.00 40.00  ? 148  TYR A CD1 1 
ATOM   696   C  CD2 . TYR A 1 102 ? 31.232  -17.466 48.904  1.00 40.81  ? 148  TYR A CD2 1 
ATOM   697   C  CE1 . TYR A 1 102 ? 33.307  -16.484 50.485  1.00 39.36  ? 148  TYR A CE1 1 
ATOM   698   C  CE2 . TYR A 1 102 ? 32.457  -17.135 48.316  1.00 39.72  ? 148  TYR A CE2 1 
ATOM   699   C  CZ  . TYR A 1 102 ? 33.484  -16.648 49.118  1.00 39.33  ? 148  TYR A CZ  1 
ATOM   700   O  OH  . TYR A 1 102 ? 34.688  -16.321 48.555  1.00 38.93  ? 148  TYR A OH  1 
ATOM   701   N  N   . ARG A 1 103 ? 29.214  -14.410 50.109  1.00 41.63  ? 149  ARG A N   1 
ATOM   702   C  CA  . ARG A 1 103 ? 29.153  -13.470 48.986  1.00 41.20  ? 149  ARG A CA  1 
ATOM   703   C  C   . ARG A 1 103 ? 30.513  -13.302 48.289  1.00 40.28  ? 149  ARG A C   1 
ATOM   704   O  O   . ARG A 1 103 ? 31.413  -12.675 48.834  1.00 40.67  ? 149  ARG A O   1 
ATOM   705   C  CB  . ARG A 1 103 ? 28.684  -12.102 49.483  1.00 41.64  ? 149  ARG A CB  1 
ATOM   706   C  CG  . ARG A 1 103 ? 27.182  -11.925 49.651  1.00 43.42  ? 149  ARG A CG  1 
ATOM   707   C  CD  . ARG A 1 103 ? 26.917  -10.700 50.532  1.00 47.74  ? 149  ARG A CD  1 
ATOM   708   N  NE  . ARG A 1 103 ? 27.351  -10.929 51.919  1.00 50.81  ? 149  ARG A NE  1 
ATOM   709   C  CZ  . ARG A 1 103 ? 26.610  -10.680 53.003  1.00 52.64  ? 149  ARG A CZ  1 
ATOM   710   N  NH1 . ARG A 1 103 ? 25.389  -10.155 52.883  1.00 52.78  ? 149  ARG A NH1 1 
ATOM   711   N  NH2 . ARG A 1 103 ? 27.094  -10.945 54.211  1.00 51.41  ? 149  ARG A NH2 1 
ATOM   712   N  N   . PRO A 1 104 ? 30.671  -13.849 47.082  1.00 39.54  ? 150  PRO A N   1 
ATOM   713   C  CA  . PRO A 1 104 ? 31.950  -13.639 46.374  1.00 39.53  ? 150  PRO A CA  1 
ATOM   714   C  C   . PRO A 1 104 ? 32.212  -12.154 46.124  1.00 39.44  ? 150  PRO A C   1 
ATOM   715   O  O   . PRO A 1 104 ? 31.265  -11.393 45.894  1.00 40.24  ? 150  PRO A O   1 
ATOM   716   C  CB  . PRO A 1 104 ? 31.732  -14.331 45.025  1.00 39.26  ? 150  PRO A CB  1 
ATOM   717   C  CG  . PRO A 1 104 ? 30.544  -15.224 45.220  1.00 39.87  ? 150  PRO A CG  1 
ATOM   718   C  CD  . PRO A 1 104 ? 29.715  -14.663 46.316  1.00 39.22  ? 150  PRO A CD  1 
ATOM   719   N  N   . VAL A 1 105 ? 33.463  -11.726 46.166  1.00 38.49  ? 151  VAL A N   1 
ATOM   720   C  CA  . VAL A 1 105 ? 33.771  -10.349 45.807  1.00 37.53  ? 151  VAL A CA  1 
ATOM   721   C  C   . VAL A 1 105 ? 34.858  -10.341 44.739  1.00 37.32  ? 151  VAL A C   1 
ATOM   722   O  O   . VAL A 1 105 ? 35.892  -10.942 44.914  1.00 37.28  ? 151  VAL A O   1 
ATOM   723   C  CB  . VAL A 1 105 ? 34.199  -9.529  47.037  1.00 37.56  ? 151  VAL A CB  1 
ATOM   724   C  CG1 . VAL A 1 105 ? 34.916  -8.254  46.628  1.00 35.96  ? 151  VAL A CG1 1 
ATOM   725   C  CG2 . VAL A 1 105 ? 32.990  -9.221  47.928  1.00 36.45  ? 151  VAL A CG2 1 
ATOM   726   N  N   . ALA A 1 106 ? 34.606  -9.686  43.614  1.00 37.26  ? 152  ALA A N   1 
ATOM   727   C  CA  . ALA A 1 106 ? 35.596  -9.588  42.555  1.00 36.93  ? 152  ALA A CA  1 
ATOM   728   C  C   . ALA A 1 106 ? 36.653  -8.570  42.956  1.00 37.04  ? 152  ALA A C   1 
ATOM   729   O  O   . ALA A 1 106 ? 36.429  -7.772  43.851  1.00 37.62  ? 152  ALA A O   1 
ATOM   730   C  CB  . ALA A 1 106 ? 34.946  -9.193  41.277  1.00 36.36  ? 152  ALA A CB  1 
ATOM   731   N  N   . ILE A 1 107 ? 37.813  -8.628  42.318  1.00 36.98  ? 153  ILE A N   1 
ATOM   732   C  CA  . ILE A 1 107 ? 38.848  -7.627  42.515  1.00 36.82  ? 153  ILE A CA  1 
ATOM   733   C  C   . ILE A 1 107 ? 39.325  -7.141  41.146  1.00 37.48  ? 153  ILE A C   1 
ATOM   734   O  O   . ILE A 1 107 ? 39.833  -7.939  40.325  1.00 37.74  ? 153  ILE A O   1 
ATOM   735   C  CB  . ILE A 1 107 ? 40.047  -8.211  43.288  1.00 36.75  ? 153  ILE A CB  1 
ATOM   736   C  CG1 . ILE A 1 107 ? 39.648  -8.596  44.711  1.00 34.75  ? 153  ILE A CG1 1 
ATOM   737   C  CG2 . ILE A 1 107 ? 41.253  -7.244  43.307  1.00 36.32  ? 153  ILE A CG2 1 
ATOM   738   C  CD1 . ILE A 1 107 ? 40.794  -9.244  45.454  1.00 31.33  ? 153  ILE A CD1 1 
ATOM   739   N  N   . ALA A 1 108 ? 39.185  -5.838  40.919  1.00 37.31  ? 154  ALA A N   1 
ATOM   740   C  CA  . ALA A 1 108 ? 39.506  -5.261  39.633  1.00 37.13  ? 154  ALA A CA  1 
ATOM   741   C  C   . ALA A 1 108 ? 40.691  -4.356  39.738  1.00 37.20  ? 154  ALA A C   1 
ATOM   742   O  O   . ALA A 1 108 ? 40.701  -3.429  40.555  1.00 38.06  ? 154  ALA A O   1 
ATOM   743   C  CB  . ALA A 1 108 ? 38.346  -4.509  39.084  1.00 37.24  ? 154  ALA A CB  1 
ATOM   744   N  N   . LEU A 1 109 ? 41.690  -4.616  38.898  1.00 36.58  ? 155  LEU A N   1 
ATOM   745   C  CA  . LEU A 1 109 ? 42.872  -3.786  38.842  1.00 36.29  ? 155  LEU A CA  1 
ATOM   746   C  C   . LEU A 1 109 ? 42.630  -2.656  37.880  1.00 36.35  ? 155  LEU A C   1 
ATOM   747   O  O   . LEU A 1 109 ? 42.386  -2.907  36.713  1.00 37.15  ? 155  LEU A O   1 
ATOM   748   C  CB  . LEU A 1 109 ? 44.054  -4.604  38.356  1.00 36.11  ? 155  LEU A CB  1 
ATOM   749   C  CG  . LEU A 1 109 ? 45.363  -3.849  38.256  1.00 35.91  ? 155  LEU A CG  1 
ATOM   750   C  CD1 . LEU A 1 109 ? 46.481  -4.842  38.367  1.00 36.18  ? 155  LEU A CD1 1 
ATOM   751   C  CD2 . LEU A 1 109 ? 45.425  -3.062  36.955  1.00 35.36  ? 155  LEU A CD2 1 
ATOM   752   N  N   . ASP A 1 110 ? 42.701  -1.414  38.351  1.00 36.38  ? 156  ASP A N   1 
ATOM   753   C  CA  . ASP A 1 110 ? 42.483  -0.249  37.469  1.00 36.42  ? 156  ASP A CA  1 
ATOM   754   C  C   . ASP A 1 110 ? 43.784  0.410   37.028  1.00 36.35  ? 156  ASP A C   1 
ATOM   755   O  O   . ASP A 1 110 ? 44.533  0.957   37.843  1.00 36.53  ? 156  ASP A O   1 
ATOM   756   C  CB  . ASP A 1 110 ? 41.560  0.797   38.098  1.00 36.20  ? 156  ASP A CB  1 
ATOM   757   C  CG  . ASP A 1 110 ? 41.302  1.970   37.169  1.00 36.34  ? 156  ASP A CG  1 
ATOM   758   O  OD1 . ASP A 1 110 ? 42.271  2.538   36.602  1.00 35.88  ? 156  ASP A OD1 1 
ATOM   759   O  OD2 . ASP A 1 110 ? 40.106  2.330   37.001  1.00 34.89  ? 156  ASP A OD2 1 
ATOM   760   N  N   . THR A 1 111 ? 44.021  0.385   35.726  1.00 36.18  ? 157  THR A N   1 
ATOM   761   C  CA  . THR A 1 111 ? 45.313  0.741   35.179  1.00 36.55  ? 157  THR A CA  1 
ATOM   762   C  C   . THR A 1 111 ? 45.623  2.237   35.245  1.00 37.29  ? 157  THR A C   1 
ATOM   763   O  O   . THR A 1 111 ? 44.710  3.065   35.201  1.00 37.94  ? 157  THR A O   1 
ATOM   764   C  CB  . THR A 1 111 ? 45.404  0.252   33.755  1.00 36.29  ? 157  THR A CB  1 
ATOM   765   O  OG1 . THR A 1 111 ? 46.639  -0.456  33.583  1.00 36.38  ? 157  THR A OG1 1 
ATOM   766   C  CG2 . THR A 1 111 ? 45.330  1.370   32.787  1.00 35.52  ? 157  THR A CG2 1 
ATOM   767   N  N   . LYS A 1 112 ? 46.895  2.603   35.380  1.00 37.82  ? 158  LYS A N   1 
ATOM   768   C  CA  . LYS A 1 112 ? 47.210  4.025   35.419  1.00 38.14  ? 158  LYS A CA  1 
ATOM   769   C  C   . LYS A 1 112 ? 47.081  4.625   34.036  1.00 38.47  ? 158  LYS A C   1 
ATOM   770   O  O   . LYS A 1 112 ? 46.359  5.589   33.823  1.00 39.38  ? 158  LYS A O   1 
ATOM   771   C  CB  . LYS A 1 112 ? 48.591  4.315   35.977  1.00 38.44  ? 158  LYS A CB  1 
ATOM   772   C  CG  . LYS A 1 112 ? 48.950  5.796   35.867  1.00 39.10  ? 158  LYS A CG  1 
ATOM   773   C  CD  . LYS A 1 112 ? 50.453  6.025   35.936  1.00 39.86  ? 158  LYS A CD  1 
ATOM   774   C  CE  . LYS A 1 112 ? 50.822  6.552   37.336  1.00 42.44  ? 158  LYS A CE  1 
ATOM   775   N  NZ  . LYS A 1 112 ? 52.267  6.243   37.770  1.00 42.95  ? 158  LYS A NZ  1 
ATOM   776   N  N   . GLY A 1 113 ? 47.789  4.062   33.079  1.00 38.36  ? 159  GLY A N   1 
ATOM   777   C  CA  . GLY A 1 113 ? 47.658  4.551   31.724  1.00 38.51  ? 159  GLY A CA  1 
ATOM   778   C  C   . GLY A 1 113 ? 48.376  5.875   31.481  1.00 38.88  ? 159  GLY A C   1 
ATOM   779   O  O   . GLY A 1 113 ? 49.125  6.352   32.338  1.00 38.95  ? 159  GLY A O   1 
ATOM   780   N  N   . PRO A 1 114 ? 48.152  6.478   30.299  1.00 39.12  ? 160  PRO A N   1 
ATOM   781   C  CA  . PRO A 1 114 ? 48.881  7.689   29.918  1.00 39.44  ? 160  PRO A CA  1 
ATOM   782   C  C   . PRO A 1 114 ? 48.406  8.959   30.647  1.00 39.79  ? 160  PRO A C   1 
ATOM   783   O  O   . PRO A 1 114 ? 48.019  9.915   29.981  1.00 40.99  ? 160  PRO A O   1 
ATOM   784   C  CB  . PRO A 1 114 ? 48.611  7.812   28.399  1.00 39.35  ? 160  PRO A CB  1 
ATOM   785   C  CG  . PRO A 1 114 ? 47.425  6.957   28.111  1.00 38.98  ? 160  PRO A CG  1 
ATOM   786   C  CD  . PRO A 1 114 ? 47.187  6.035   29.267  1.00 39.20  ? 160  PRO A CD  1 
ATOM   787   N  N   . GLU A 1 115 ? 48.427  8.983   31.982  1.00 39.41  ? 161  GLU A N   1 
ATOM   788   C  CA  . GLU A 1 115 ? 48.055  10.202  32.737  1.00 39.07  ? 161  GLU A CA  1 
ATOM   789   C  C   . GLU A 1 115 ? 49.057  11.349  32.461  1.00 39.12  ? 161  GLU A C   1 
ATOM   790   O  O   . GLU A 1 115 ? 50.214  11.069  32.127  1.00 39.15  ? 161  GLU A O   1 
ATOM   791   C  CB  . GLU A 1 115 ? 47.963  9.902   34.237  1.00 38.84  ? 161  GLU A CB  1 
ATOM   792   C  CG  . GLU A 1 115 ? 46.708  9.113   34.635  1.00 39.13  ? 161  GLU A CG  1 
ATOM   793   C  CD  . GLU A 1 115 ? 46.458  9.141   36.123  1.00 38.62  ? 161  GLU A CD  1 
ATOM   794   O  OE1 . GLU A 1 115 ? 47.376  9.571   36.854  1.00 38.60  ? 161  GLU A OE1 1 
ATOM   795   O  OE2 . GLU A 1 115 ? 45.350  8.730   36.549  1.00 37.54  ? 161  GLU A OE2 1 
ATOM   796   N  N   . ILE A 1 116 ? 48.602  12.618  32.505  1.00 39.30  ? 162  ILE A N   1 
ATOM   797   C  CA  . ILE A 1 116 ? 49.485  13.825  32.438  1.00 39.16  ? 162  ILE A CA  1 
ATOM   798   C  C   . ILE A 1 116 ? 49.380  14.656  33.741  1.00 39.41  ? 162  ILE A C   1 
ATOM   799   O  O   . ILE A 1 116 ? 48.274  14.847  34.263  1.00 39.36  ? 162  ILE A O   1 
ATOM   800   C  CB  . ILE A 1 116 ? 49.155  14.754  31.232  1.00 39.10  ? 162  ILE A CB  1 
ATOM   801   C  CG1 . ILE A 1 116 ? 49.686  14.185  29.906  1.00 38.55  ? 162  ILE A CG1 1 
ATOM   802   C  CG2 . ILE A 1 116 ? 49.737  16.152  31.450  1.00 39.33  ? 162  ILE A CG2 1 
ATOM   803   C  CD1 . ILE A 1 116 ? 49.378  15.067  28.663  1.00 35.88  ? 162  ILE A CD1 1 
ATOM   804   N  N   . ARG A 1 117 ? 50.512  15.150  34.259  1.00 39.48  ? 163  ARG A N   1 
ATOM   805   C  CA  . ARG A 1 117 ? 50.549  15.698  35.626  1.00 39.71  ? 163  ARG A CA  1 
ATOM   806   C  C   . ARG A 1 117 ? 51.372  16.973  35.821  1.00 40.14  ? 163  ARG A C   1 
ATOM   807   O  O   . ARG A 1 117 ? 52.270  17.279  35.023  1.00 40.27  ? 163  ARG A O   1 
ATOM   808   C  CB  . ARG A 1 117 ? 51.022  14.630  36.623  1.00 39.46  ? 163  ARG A CB  1 
ATOM   809   C  CG  . ARG A 1 117 ? 50.143  13.413  36.666  1.00 39.45  ? 163  ARG A CG  1 
ATOM   810   C  CD  . ARG A 1 117 ? 50.304  12.606  37.923  1.00 39.94  ? 163  ARG A CD  1 
ATOM   811   N  NE  . ARG A 1 117 ? 49.150  11.725  38.135  1.00 40.17  ? 163  ARG A NE  1 
ATOM   812   C  CZ  . ARG A 1 117 ? 48.048  12.062  38.810  1.00 40.91  ? 163  ARG A CZ  1 
ATOM   813   N  NH1 . ARG A 1 117 ? 47.918  13.263  39.361  1.00 41.42  ? 163  ARG A NH1 1 
ATOM   814   N  NH2 . ARG A 1 117 ? 47.063  11.192  38.946  1.00 41.56  ? 163  ARG A NH2 1 
ATOM   815   N  N   . THR A 1 118 ? 51.052  17.704  36.896  1.00 40.40  ? 164  THR A N   1 
ATOM   816   C  CA  . THR A 1 118 ? 51.782  18.911  37.282  1.00 40.94  ? 164  THR A CA  1 
ATOM   817   C  C   . THR A 1 118 ? 52.935  18.534  38.201  1.00 41.11  ? 164  THR A C   1 
ATOM   818   O  O   . THR A 1 118 ? 53.072  17.372  38.592  1.00 41.17  ? 164  THR A O   1 
ATOM   819   C  CB  . THR A 1 118 ? 50.891  19.973  38.005  1.00 41.20  ? 164  THR A CB  1 
ATOM   820   O  OG1 . THR A 1 118 ? 50.380  19.444  39.243  1.00 42.31  ? 164  THR A OG1 1 
ATOM   821   C  CG2 . THR A 1 118 ? 49.739  20.442  37.111  1.00 41.27  ? 164  THR A CG2 1 
ATOM   822   N  N   . GLY A 1 119 ? 53.756  19.518  38.552  1.00 41.01  ? 165  GLY A N   1 
ATOM   823   C  CA  . GLY A 1 119 ? 54.948  19.255  39.338  1.00 41.28  ? 165  GLY A CA  1 
ATOM   824   C  C   . GLY A 1 119 ? 54.753  19.383  40.834  1.00 41.48  ? 165  GLY A C   1 
ATOM   825   O  O   . GLY A 1 119 ? 53.635  19.594  41.318  1.00 41.38  ? 165  GLY A O   1 
ATOM   826   N  N   . ILE A 1 120 ? 55.858  19.245  41.563  1.00 41.69  ? 166  ILE A N   1 
ATOM   827   C  CA  . ILE A 1 120 ? 55.862  19.410  43.006  1.00 42.00  ? 166  ILE A CA  1 
ATOM   828   C  C   . ILE A 1 120 ? 56.012  20.896  43.276  1.00 42.49  ? 166  ILE A C   1 
ATOM   829   O  O   . ILE A 1 120 ? 56.638  21.622  42.498  1.00 42.40  ? 166  ILE A O   1 
ATOM   830   C  CB  . ILE A 1 120 ? 56.964  18.561  43.701  1.00 41.82  ? 166  ILE A CB  1 
ATOM   831   C  CG1 . ILE A 1 120 ? 56.763  17.067  43.404  1.00 41.81  ? 166  ILE A CG1 1 
ATOM   832   C  CG2 . ILE A 1 120 ? 56.933  18.741  45.217  1.00 41.40  ? 166  ILE A CG2 1 
ATOM   833   C  CD1 . ILE A 1 120 ? 57.201  16.593  41.991  1.00 41.89  ? 166  ILE A CD1 1 
ATOM   834   N  N   . LEU A 1 121 ? 55.399  21.335  44.371  1.00 43.43  ? 167  LEU A N   1 
ATOM   835   C  CA  . LEU A 1 121 ? 55.225  22.748  44.678  1.00 44.13  ? 167  LEU A CA  1 
ATOM   836   C  C   . LEU A 1 121 ? 56.459  23.355  45.331  1.00 44.71  ? 167  LEU A C   1 
ATOM   837   O  O   . LEU A 1 121 ? 57.358  22.633  45.790  1.00 44.62  ? 167  LEU A O   1 
ATOM   838   C  CB  . LEU A 1 121 ? 54.009  22.916  45.593  1.00 44.04  ? 167  LEU A CB  1 
ATOM   839   C  CG  . LEU A 1 121 ? 53.026  24.034  45.262  1.00 44.25  ? 167  LEU A CG  1 
ATOM   840   C  CD1 . LEU A 1 121 ? 52.699  24.026  43.774  1.00 44.12  ? 167  LEU A CD1 1 
ATOM   841   C  CD2 . LEU A 1 121 ? 51.762  23.876  46.094  1.00 44.57  ? 167  LEU A CD2 1 
ATOM   842   N  N   . GLN A 1 122 ? 56.492  24.689  45.363  1.00 45.55  ? 168  GLN A N   1 
ATOM   843   C  CA  . GLN A 1 122 ? 57.562  25.421  46.028  1.00 46.39  ? 168  GLN A CA  1 
ATOM   844   C  C   . GLN A 1 122 ? 57.508  25.174  47.547  1.00 47.04  ? 168  GLN A C   1 
ATOM   845   O  O   . GLN A 1 122 ? 56.689  25.771  48.260  1.00 47.21  ? 168  GLN A O   1 
ATOM   846   C  CB  . GLN A 1 122 ? 57.492  26.917  45.689  1.00 46.25  ? 168  GLN A CB  1 
ATOM   847   C  CG  . GLN A 1 122 ? 58.808  27.679  45.880  1.00 46.17  ? 168  GLN A CG  1 
ATOM   848   C  CD  . GLN A 1 122 ? 58.771  29.102  45.326  1.00 45.70  ? 168  GLN A CD  1 
ATOM   849   O  OE1 . GLN A 1 122 ? 59.715  29.909  45.606  1.00 44.97  ? 168  GLN A OE1 1 
ATOM   850   N  NE2 . GLN A 1 122 ? 57.682  29.411  44.539  1.00 45.75  ? 168  GLN A NE2 1 
ATOM   851   N  N   . GLY A 1 123 ? 58.375  24.265  48.012  1.00 47.61  ? 169  GLY A N   1 
ATOM   852   C  CA  . GLY A 1 123 ? 58.509  23.894  49.428  1.00 47.73  ? 169  GLY A CA  1 
ATOM   853   C  C   . GLY A 1 123 ? 57.353  23.109  50.035  1.00 47.92  ? 169  GLY A C   1 
ATOM   854   O  O   . GLY A 1 123 ? 57.278  22.964  51.258  1.00 47.74  ? 169  GLY A O   1 
ATOM   855   N  N   . GLY A 1 124 ? 56.456  22.591  49.195  1.00 48.13  ? 170  GLY A N   1 
ATOM   856   C  CA  . GLY A 1 124 ? 55.221  21.998  49.706  1.00 48.52  ? 170  GLY A CA  1 
ATOM   857   C  C   . GLY A 1 124 ? 54.660  20.719  49.089  1.00 48.72  ? 170  GLY A C   1 
ATOM   858   O  O   . GLY A 1 124 ? 53.783  20.782  48.213  1.00 48.72  ? 170  GLY A O   1 
ATOM   859   N  N   . PRO A 1 125 ? 55.148  19.544  49.552  1.00 48.81  ? 171  PRO A N   1 
ATOM   860   C  CA  . PRO A 1 125 ? 54.458  18.268  49.285  1.00 48.65  ? 171  PRO A CA  1 
ATOM   861   C  C   . PRO A 1 125 ? 53.013  18.220  49.831  1.00 48.49  ? 171  PRO A C   1 
ATOM   862   O  O   . PRO A 1 125 ? 52.202  17.439  49.330  1.00 48.77  ? 171  PRO A O   1 
ATOM   863   C  CB  . PRO A 1 125 ? 55.348  17.230  49.984  1.00 48.83  ? 171  PRO A CB  1 
ATOM   864   C  CG  . PRO A 1 125 ? 56.706  17.891  50.093  1.00 48.81  ? 171  PRO A CG  1 
ATOM   865   C  CD  . PRO A 1 125 ? 56.401  19.346  50.312  1.00 48.70  ? 171  PRO A CD  1 
ATOM   866   N  N   . GLU A 1 126 ? 52.690  19.044  50.832  1.00 48.11  ? 172  GLU A N   1 
ATOM   867   C  CA  . GLU A 1 126 ? 51.292  19.201  51.283  1.00 47.59  ? 172  GLU A CA  1 
ATOM   868   C  C   . GLU A 1 126 ? 50.706  20.613  51.067  1.00 47.24  ? 172  GLU A C   1 
ATOM   869   O  O   . GLU A 1 126 ? 49.483  20.769  50.979  1.00 47.16  ? 172  GLU A O   1 
ATOM   870   C  CB  . GLU A 1 126 ? 51.105  18.776  52.750  1.00 47.56  ? 172  GLU A CB  1 
ATOM   871   C  CG  . GLU A 1 126 ? 51.588  17.372  53.095  1.00 47.15  ? 172  GLU A CG  1 
ATOM   872   C  CD  . GLU A 1 126 ? 52.976  17.366  53.720  1.00 46.80  ? 172  GLU A CD  1 
ATOM   873   O  OE1 . GLU A 1 126 ? 53.559  18.456  53.932  1.00 46.40  ? 172  GLU A OE1 1 
ATOM   874   O  OE2 . GLU A 1 126 ? 53.487  16.264  54.008  1.00 46.48  ? 172  GLU A OE2 1 
ATOM   875   N  N   . SER A 1 127 ? 51.569  21.628  50.976  1.00 46.64  ? 173  SER A N   1 
ATOM   876   C  CA  . SER A 1 127 ? 51.114  23.026  50.881  1.00 46.09  ? 173  SER A CA  1 
ATOM   877   C  C   . SER A 1 127 ? 50.370  23.346  49.574  1.00 45.45  ? 173  SER A C   1 
ATOM   878   O  O   . SER A 1 127 ? 50.317  22.524  48.654  1.00 45.37  ? 173  SER A O   1 
ATOM   879   C  CB  . SER A 1 127 ? 52.273  24.008  51.132  1.00 46.27  ? 173  SER A CB  1 
ATOM   880   O  OG  . SER A 1 127 ? 53.150  24.089  50.019  1.00 46.62  ? 173  SER A OG  1 
ATOM   881   N  N   . GLU A 1 128 ? 49.792  24.542  49.505  1.00 44.69  ? 174  GLU A N   1 
ATOM   882   C  CA  . GLU A 1 128 ? 48.864  24.877  48.433  1.00 44.01  ? 174  GLU A CA  1 
ATOM   883   C  C   . GLU A 1 128 ? 49.130  26.232  47.819  1.00 43.64  ? 174  GLU A C   1 
ATOM   884   O  O   . GLU A 1 128 ? 49.415  27.185  48.536  1.00 43.82  ? 174  GLU A O   1 
ATOM   885   C  CB  . GLU A 1 128 ? 47.437  24.882  48.968  1.00 43.77  ? 174  GLU A CB  1 
ATOM   886   C  CG  . GLU A 1 128 ? 46.948  23.543  49.440  1.00 43.53  ? 174  GLU A CG  1 
ATOM   887   C  CD  . GLU A 1 128 ? 45.510  23.597  49.885  1.00 43.69  ? 174  GLU A CD  1 
ATOM   888   O  OE1 . GLU A 1 128 ? 45.072  24.669  50.355  1.00 43.28  ? 174  GLU A OE1 1 
ATOM   889   O  OE2 . GLU A 1 128 ? 44.809  22.571  49.748  1.00 44.12  ? 174  GLU A OE2 1 
ATOM   890   N  N   . VAL A 1 129 ? 49.010  26.319  46.496  1.00 43.07  ? 175  VAL A N   1 
ATOM   891   C  CA  . VAL A 1 129 ? 49.025  27.603  45.797  1.00 42.57  ? 175  VAL A CA  1 
ATOM   892   C  C   . VAL A 1 129 ? 47.618  27.949  45.286  1.00 42.38  ? 175  VAL A C   1 
ATOM   893   O  O   . VAL A 1 129 ? 46.854  27.045  44.927  1.00 42.12  ? 175  VAL A O   1 
ATOM   894   C  CB  . VAL A 1 129 ? 50.000  27.586  44.614  1.00 42.47  ? 175  VAL A CB  1 
ATOM   895   C  CG1 . VAL A 1 129 ? 49.771  28.781  43.731  1.00 42.32  ? 175  VAL A CG1 1 
ATOM   896   C  CG2 . VAL A 1 129 ? 51.439  27.547  45.094  1.00 42.73  ? 175  VAL A CG2 1 
ATOM   897   N  N   . GLU A 1 130 ? 47.284  29.247  45.271  1.00 42.12  ? 176  GLU A N   1 
ATOM   898   C  CA  . GLU A 1 130 ? 46.041  29.738  44.644  1.00 41.86  ? 176  GLU A CA  1 
ATOM   899   C  C   . GLU A 1 130 ? 46.279  30.440  43.303  1.00 41.54  ? 176  GLU A C   1 
ATOM   900   O  O   . GLU A 1 130 ? 46.999  31.442  43.222  1.00 41.75  ? 176  GLU A O   1 
ATOM   901   C  CB  . GLU A 1 130 ? 45.228  30.652  45.575  1.00 41.73  ? 176  GLU A CB  1 
ATOM   902   C  CG  . GLU A 1 130 ? 43.744  30.765  45.164  1.00 42.56  ? 176  GLU A CG  1 
ATOM   903   C  CD  . GLU A 1 130 ? 43.138  32.165  45.360  1.00 43.63  ? 176  GLU A CD  1 
ATOM   904   O  OE1 . GLU A 1 130 ? 42.095  32.466  44.714  1.00 43.78  ? 176  GLU A OE1 1 
ATOM   905   O  OE2 . GLU A 1 130 ? 43.693  32.964  46.154  1.00 43.71  ? 176  GLU A OE2 1 
ATOM   906   N  N   . LEU A 1 131 ? 45.650  29.902  42.262  1.00 41.23  ? 177  LEU A N   1 
ATOM   907   C  CA  . LEU A 1 131 ? 45.673  30.486  40.927  1.00 41.05  ? 177  LEU A CA  1 
ATOM   908   C  C   . LEU A 1 131 ? 44.475  31.429  40.772  1.00 41.00  ? 177  LEU A C   1 
ATOM   909   O  O   . LEU A 1 131 ? 43.353  30.973  40.521  1.00 41.31  ? 177  LEU A O   1 
ATOM   910   C  CB  . LEU A 1 131 ? 45.622  29.370  39.876  1.00 40.87  ? 177  LEU A CB  1 
ATOM   911   C  CG  . LEU A 1 131 ? 46.833  28.466  39.554  1.00 40.97  ? 177  LEU A CG  1 
ATOM   912   C  CD1 . LEU A 1 131 ? 47.541  28.913  38.282  1.00 40.98  ? 177  LEU A CD1 1 
ATOM   913   C  CD2 . LEU A 1 131 ? 47.840  28.289  40.699  1.00 40.48  ? 177  LEU A CD2 1 
ATOM   914   N  N   . VAL A 1 132 ? 44.708  32.735  40.942  1.00 40.67  ? 178  VAL A N   1 
ATOM   915   C  CA  . VAL A 1 132 ? 43.620  33.730  40.944  1.00 40.27  ? 178  VAL A CA  1 
ATOM   916   C  C   . VAL A 1 132 ? 43.088  33.945  39.529  1.00 40.18  ? 178  VAL A C   1 
ATOM   917   O  O   . VAL A 1 132 ? 43.873  34.156  38.594  1.00 40.33  ? 178  VAL A O   1 
ATOM   918   C  CB  . VAL A 1 132 ? 44.083  35.108  41.517  1.00 40.23  ? 178  VAL A CB  1 
ATOM   919   C  CG1 . VAL A 1 132 ? 42.921  36.088  41.578  1.00 39.91  ? 178  VAL A CG1 1 
ATOM   920   C  CG2 . VAL A 1 132 ? 44.704  34.956  42.903  1.00 40.06  ? 178  VAL A CG2 1 
ATOM   921   N  N   . LYS A 1 133 ? 41.763  33.888  39.382  1.00 39.77  ? 179  LYS A N   1 
ATOM   922   C  CA  . LYS A 1 133 ? 41.076  34.218  38.122  1.00 39.66  ? 179  LYS A CA  1 
ATOM   923   C  C   . LYS A 1 133 ? 41.635  35.501  37.487  1.00 39.57  ? 179  LYS A C   1 
ATOM   924   O  O   . LYS A 1 133 ? 41.765  36.519  38.162  1.00 39.61  ? 179  LYS A O   1 
ATOM   925   C  CB  . LYS A 1 133 ? 39.570  34.379  38.374  1.00 39.48  ? 179  LYS A CB  1 
ATOM   926   C  CG  . LYS A 1 133 ? 38.706  34.247  37.139  1.00 39.50  ? 179  LYS A CG  1 
ATOM   927   C  CD  . LYS A 1 133 ? 37.241  34.096  37.515  1.00 41.01  ? 179  LYS A CD  1 
ATOM   928   C  CE  . LYS A 1 133 ? 36.366  33.909  36.274  1.00 41.60  ? 179  LYS A CE  1 
ATOM   929   N  NZ  . LYS A 1 133 ? 34.904  33.917  36.603  1.00 42.00  ? 179  LYS A NZ  1 
ATOM   930   N  N   . GLY A 1 134 ? 41.984  35.439  36.203  1.00 39.56  ? 180  GLY A N   1 
ATOM   931   C  CA  . GLY A 1 134 ? 42.501  36.608  35.479  1.00 39.63  ? 180  GLY A CA  1 
ATOM   932   C  C   . GLY A 1 134 ? 44.013  36.857  35.460  1.00 39.75  ? 180  GLY A C   1 
ATOM   933   O  O   . GLY A 1 134 ? 44.493  37.684  34.668  1.00 39.64  ? 180  GLY A O   1 
ATOM   934   N  N   . SER A 1 135 ? 44.764  36.158  36.318  1.00 39.70  ? 181  SER A N   1 
ATOM   935   C  CA  . SER A 1 135 ? 46.206  36.393  36.456  1.00 39.77  ? 181  SER A CA  1 
ATOM   936   C  C   . SER A 1 135 ? 47.044  35.615  35.437  1.00 39.86  ? 181  SER A C   1 
ATOM   937   O  O   . SER A 1 135 ? 46.575  34.633  34.859  1.00 39.58  ? 181  SER A O   1 
ATOM   938   C  CB  . SER A 1 135 ? 46.677  36.103  37.888  1.00 39.72  ? 181  SER A CB  1 
ATOM   939   O  OG  . SER A 1 135 ? 46.433  34.758  38.263  1.00 40.35  ? 181  SER A OG  1 
ATOM   940   N  N   . GLN A 1 136 ? 48.274  36.083  35.217  1.00 40.17  ? 182  GLN A N   1 
ATOM   941   C  CA  . GLN A 1 136 ? 49.212  35.468  34.280  1.00 40.60  ? 182  GLN A CA  1 
ATOM   942   C  C   . GLN A 1 136 ? 49.852  34.220  34.853  1.00 41.06  ? 182  GLN A C   1 
ATOM   943   O  O   . GLN A 1 136 ? 50.421  34.255  35.949  1.00 41.30  ? 182  GLN A O   1 
ATOM   944   C  CB  . GLN A 1 136 ? 50.317  36.448  33.901  1.00 40.66  ? 182  GLN A CB  1 
ATOM   945   C  CG  . GLN A 1 136 ? 50.376  36.814  32.418  1.00 41.11  ? 182  GLN A CG  1 
ATOM   946   C  CD  . GLN A 1 136 ? 49.401  37.915  32.019  1.00 40.70  ? 182  GLN A CD  1 
ATOM   947   O  OE1 . GLN A 1 136 ? 49.810  38.925  31.431  1.00 39.96  ? 182  GLN A OE1 1 
ATOM   948   N  NE2 . GLN A 1 136 ? 48.105  37.721  32.327  1.00 40.39  ? 182  GLN A NE2 1 
ATOM   949   N  N   . VAL A 1 137 ? 49.771  33.124  34.096  1.00 41.33  ? 183  VAL A N   1 
ATOM   950   C  CA  . VAL A 1 137 ? 50.326  31.837  34.509  1.00 41.20  ? 183  VAL A CA  1 
ATOM   951   C  C   . VAL A 1 137 ? 51.195  31.220  33.421  1.00 41.37  ? 183  VAL A C   1 
ATOM   952   O  O   . VAL A 1 137 ? 50.734  30.976  32.301  1.00 41.21  ? 183  VAL A O   1 
ATOM   953   C  CB  . VAL A 1 137 ? 49.216  30.861  34.959  1.00 41.15  ? 183  VAL A CB  1 
ATOM   954   C  CG1 . VAL A 1 137 ? 49.726  29.422  34.990  1.00 40.84  ? 183  VAL A CG1 1 
ATOM   955   C  CG2 . VAL A 1 137 ? 48.705  31.274  36.324  1.00 40.65  ? 183  VAL A CG2 1 
ATOM   956   N  N   . LEU A 1 138 ? 52.462  30.995  33.773  1.00 41.82  ? 184  LEU A N   1 
ATOM   957   C  CA  . LEU A 1 138 ? 53.455  30.387  32.887  1.00 42.08  ? 184  LEU A CA  1 
ATOM   958   C  C   . LEU A 1 138 ? 53.434  28.883  33.106  1.00 42.44  ? 184  LEU A C   1 
ATOM   959   O  O   . LEU A 1 138 ? 53.562  28.402  34.240  1.00 42.89  ? 184  LEU A O   1 
ATOM   960   C  CB  . LEU A 1 138 ? 54.849  30.944  33.185  1.00 41.98  ? 184  LEU A CB  1 
ATOM   961   C  CG  . LEU A 1 138 ? 56.100  30.430  32.444  1.00 42.73  ? 184  LEU A CG  1 
ATOM   962   C  CD1 . LEU A 1 138 ? 55.992  30.671  30.942  1.00 43.32  ? 184  LEU A CD1 1 
ATOM   963   C  CD2 . LEU A 1 138 ? 57.414  31.056  32.984  1.00 41.85  ? 184  LEU A CD2 1 
ATOM   964   N  N   . VAL A 1 139 ? 53.229  28.140  32.026  1.00 42.48  ? 185  VAL A N   1 
ATOM   965   C  CA  . VAL A 1 139 ? 53.337  26.694  32.083  1.00 42.16  ? 185  VAL A CA  1 
ATOM   966   C  C   . VAL A 1 139 ? 54.629  26.319  31.365  1.00 42.02  ? 185  VAL A C   1 
ATOM   967   O  O   . VAL A 1 139 ? 54.698  26.384  30.136  1.00 41.71  ? 185  VAL A O   1 
ATOM   968   C  CB  . VAL A 1 139 ? 52.140  25.992  31.433  1.00 41.87  ? 185  VAL A CB  1 
ATOM   969   C  CG1 . VAL A 1 139 ? 52.223  24.503  31.657  1.00 42.04  ? 185  VAL A CG1 1 
ATOM   970   C  CG2 . VAL A 1 139 ? 50.863  26.512  32.000  1.00 42.11  ? 185  VAL A CG2 1 
ATOM   971   N  N   . THR A 1 140 ? 55.650  25.968  32.147  1.00 41.97  ? 186  THR A N   1 
ATOM   972   C  CA  . THR A 1 140 ? 56.910  25.486  31.591  1.00 42.27  ? 186  THR A CA  1 
ATOM   973   C  C   . THR A 1 140 ? 56.908  23.983  31.478  1.00 41.94  ? 186  THR A C   1 
ATOM   974   O  O   . THR A 1 140 ? 56.074  23.296  32.072  1.00 42.29  ? 186  THR A O   1 
ATOM   975   C  CB  . THR A 1 140 ? 58.150  25.864  32.437  1.00 42.34  ? 186  THR A CB  1 
ATOM   976   O  OG1 . THR A 1 140 ? 57.890  25.556  33.821  1.00 42.21  ? 186  THR A OG1 1 
ATOM   977   C  CG2 . THR A 1 140 ? 58.511  27.353  32.257  1.00 43.21  ? 186  THR A CG2 1 
ATOM   978   N  N   . VAL A 1 141 ? 57.854  23.497  30.686  1.00 41.26  ? 187  VAL A N   1 
ATOM   979   C  CA  . VAL A 1 141 ? 58.190  22.093  30.611  1.00 40.59  ? 187  VAL A CA  1 
ATOM   980   C  C   . VAL A 1 141 ? 59.671  22.016  30.979  1.00 40.06  ? 187  VAL A C   1 
ATOM   981   O  O   . VAL A 1 141 ? 60.319  20.975  30.843  1.00 40.29  ? 187  VAL A O   1 
ATOM   982   C  CB  . VAL A 1 141 ? 57.917  21.521  29.190  1.00 40.74  ? 187  VAL A CB  1 
ATOM   983   C  CG1 . VAL A 1 141 ? 56.426  21.554  28.876  1.00 40.18  ? 187  VAL A CG1 1 
ATOM   984   C  CG2 . VAL A 1 141 ? 58.733  22.267  28.103  1.00 40.86  ? 187  VAL A CG2 1 
ATOM   985   N  N   . ASP A 1 142 ? 60.186  23.146  31.459  1.00 39.08  ? 188  ASP A N   1 
ATOM   986   C  CA  . ASP A 1 142 ? 61.583  23.301  31.823  1.00 38.08  ? 188  ASP A CA  1 
ATOM   987   C  C   . ASP A 1 142 ? 61.955  22.392  32.994  1.00 37.48  ? 188  ASP A C   1 
ATOM   988   O  O   . ASP A 1 142 ? 61.446  22.576  34.117  1.00 37.36  ? 188  ASP A O   1 
ATOM   989   C  CB  . ASP A 1 142 ? 61.858  24.763  32.174  1.00 38.17  ? 188  ASP A CB  1 
ATOM   990   C  CG  . ASP A 1 142 ? 63.343  25.071  32.307  1.00 37.51  ? 188  ASP A CG  1 
ATOM   991   O  OD1 . ASP A 1 142 ? 64.135  24.186  32.697  1.00 37.05  ? 188  ASP A OD1 1 
ATOM   992   O  OD2 . ASP A 1 142 ? 63.713  26.226  32.031  1.00 36.97  ? 188  ASP A OD2 1 
ATOM   993   N  N   . PRO A 1 143 ? 62.859  21.416  32.729  1.00 36.86  ? 189  PRO A N   1 
ATOM   994   C  CA  . PRO A 1 143 ? 63.348  20.393  33.658  1.00 36.25  ? 189  PRO A CA  1 
ATOM   995   C  C   . PRO A 1 143 ? 63.624  20.888  35.099  1.00 35.69  ? 189  PRO A C   1 
ATOM   996   O  O   . PRO A 1 143 ? 63.273  20.136  36.117  1.00 35.52  ? 189  PRO A O   1 
ATOM   997   C  CB  . PRO A 1 143 ? 64.676  19.905  33.001  1.00 36.64  ? 189  PRO A CB  1 
ATOM   998   C  CG  . PRO A 1 143 ? 64.864  20.825  31.763  1.00 36.82  ? 189  PRO A CG  1 
ATOM   999   C  CD  . PRO A 1 143 ? 63.494  21.270  31.396  1.00 36.84  ? 189  PRO A CD  1 
ATOM   1000  N  N   . ALA A 1 144 ? 64.076  22.221  35.119  1.00 35.16  ? 190  ALA A N   1 
ATOM   1001  C  CA  . ALA A 1 144 ? 64.477  22.837  36.382  1.00 34.75  ? 190  ALA A CA  1 
ATOM   1002  C  C   . ALA A 1 144 ? 63.300  23.081  37.319  1.00 34.53  ? 190  ALA A C   1 
ATOM   1003  O  O   . ALA A 1 144 ? 63.412  22.865  38.531  1.00 34.34  ? 190  ALA A O   1 
ATOM   1004  C  CB  . ALA A 1 144 ? 65.226  24.147  36.113  1.00 34.63  ? 190  ALA A CB  1 
ATOM   1005  N  N   . PHE A 1 145 ? 62.177  23.505  36.731  1.00 34.39  ? 191  PHE A N   1 
ATOM   1006  C  CA  . PHE A 1 145 ? 61.021  24.044  37.451  1.00 34.25  ? 191  PHE A CA  1 
ATOM   1007  C  C   . PHE A 1 145 ? 60.020  22.977  37.930  1.00 34.33  ? 191  PHE A C   1 
ATOM   1008  O  O   . PHE A 1 145 ? 59.008  23.304  38.558  1.00 34.19  ? 191  PHE A O   1 
ATOM   1009  C  CB  . PHE A 1 145 ? 60.315  25.085  36.568  1.00 34.31  ? 191  PHE A CB  1 
ATOM   1010  C  CG  . PHE A 1 145 ? 61.087  26.370  36.383  1.00 34.08  ? 191  PHE A CG  1 
ATOM   1011  C  CD1 . PHE A 1 145 ? 62.313  26.386  35.709  1.00 34.90  ? 191  PHE A CD1 1 
ATOM   1012  C  CD2 . PHE A 1 145 ? 60.573  27.571  36.860  1.00 34.07  ? 191  PHE A CD2 1 
ATOM   1013  C  CE1 . PHE A 1 145 ? 63.039  27.585  35.535  1.00 35.11  ? 191  PHE A CE1 1 
ATOM   1014  C  CE2 . PHE A 1 145 ? 61.269  28.771  36.690  1.00 35.37  ? 191  PHE A CE2 1 
ATOM   1015  C  CZ  . PHE A 1 145 ? 62.518  28.780  36.025  1.00 35.60  ? 191  PHE A CZ  1 
ATOM   1016  N  N   . ARG A 1 146 ? 60.308  21.709  37.627  1.00 34.57  ? 192  ARG A N   1 
ATOM   1017  C  CA  . ARG A 1 146 ? 59.537  20.548  38.123  1.00 34.95  ? 192  ARG A CA  1 
ATOM   1018  C  C   . ARG A 1 146 ? 59.278  20.609  39.635  1.00 35.06  ? 192  ARG A C   1 
ATOM   1019  O  O   . ARG A 1 146 ? 58.424  19.888  40.164  1.00 34.96  ? 192  ARG A O   1 
ATOM   1020  C  CB  . ARG A 1 146 ? 60.268  19.243  37.746  1.00 35.04  ? 192  ARG A CB  1 
ATOM   1021  C  CG  . ARG A 1 146 ? 59.791  17.956  38.450  1.00 35.68  ? 192  ARG A CG  1 
ATOM   1022  C  CD  . ARG A 1 146 ? 60.929  16.926  38.622  1.00 36.22  ? 192  ARG A CD  1 
ATOM   1023  N  NE  . ARG A 1 146 ? 60.374  15.607  38.917  1.00 38.33  ? 192  ARG A NE  1 
ATOM   1024  C  CZ  . ARG A 1 146 ? 60.980  14.435  38.695  1.00 40.03  ? 192  ARG A CZ  1 
ATOM   1025  N  NH1 . ARG A 1 146 ? 62.206  14.370  38.176  1.00 40.26  ? 192  ARG A NH1 1 
ATOM   1026  N  NH2 . ARG A 1 146 ? 60.348  13.305  39.001  1.00 40.21  ? 192  ARG A NH2 1 
ATOM   1027  N  N   . THR A 1 147 ? 60.017  21.491  40.305  1.00 35.25  ? 193  THR A N   1 
ATOM   1028  C  CA  . THR A 1 147 ? 59.985  21.631  41.755  1.00 35.60  ? 193  THR A CA  1 
ATOM   1029  C  C   . THR A 1 147 ? 59.688  23.072  42.226  1.00 35.90  ? 193  THR A C   1 
ATOM   1030  O  O   . THR A 1 147 ? 59.286  23.275  43.378  1.00 35.94  ? 193  THR A O   1 
ATOM   1031  C  CB  . THR A 1 147 ? 61.311  21.122  42.375  1.00 35.59  ? 193  THR A CB  1 
ATOM   1032  O  OG1 . THR A 1 147 ? 61.368  21.484  43.761  1.00 36.19  ? 193  THR A OG1 1 
ATOM   1033  C  CG2 . THR A 1 147 ? 62.524  21.716  41.653  1.00 35.49  ? 193  THR A CG2 1 
ATOM   1034  N  N   . ARG A 1 148 ? 59.871  24.048  41.326  1.00 36.15  ? 194  ARG A N   1 
ATOM   1035  C  CA  . ARG A 1 148 ? 59.795  25.494  41.635  1.00 36.17  ? 194  ARG A CA  1 
ATOM   1036  C  C   . ARG A 1 148 ? 58.454  26.176  41.272  1.00 36.26  ? 194  ARG A C   1 
ATOM   1037  O  O   . ARG A 1 148 ? 58.447  27.254  40.649  1.00 35.86  ? 194  ARG A O   1 
ATOM   1038  C  CB  . ARG A 1 148 ? 60.920  26.247  40.904  1.00 36.12  ? 194  ARG A CB  1 
ATOM   1039  C  CG  . ARG A 1 148 ? 62.336  26.107  41.438  1.00 35.48  ? 194  ARG A CG  1 
ATOM   1040  C  CD  . ARG A 1 148 ? 63.317  26.614  40.361  1.00 35.46  ? 194  ARG A CD  1 
ATOM   1041  N  NE  . ARG A 1 148 ? 63.907  27.936  40.621  1.00 36.51  ? 194  ARG A NE  1 
ATOM   1042  C  CZ  . ARG A 1 148 ? 63.269  29.109  40.577  1.00 37.12  ? 194  ARG A CZ  1 
ATOM   1043  N  NH1 . ARG A 1 148 ? 61.972  29.187  40.306  1.00 37.66  ? 194  ARG A NH1 1 
ATOM   1044  N  NH2 . ARG A 1 148 ? 63.937  30.228  40.831  1.00 37.45  ? 194  ARG A NH2 1 
ATOM   1045  N  N   . GLY A 1 149 ? 57.336  25.569  41.672  1.00 36.52  ? 195  GLY A N   1 
ATOM   1046  C  CA  . GLY A 1 149 ? 56.000  26.084  41.321  1.00 37.19  ? 195  GLY A CA  1 
ATOM   1047  C  C   . GLY A 1 149 ? 55.370  27.076  42.297  1.00 37.59  ? 195  GLY A C   1 
ATOM   1048  O  O   . GLY A 1 149 ? 55.494  26.920  43.517  1.00 37.64  ? 195  GLY A O   1 
ATOM   1049  N  N   . ASN A 1 150 ? 54.689  28.094  41.758  1.00 37.96  ? 196  ASN A N   1 
ATOM   1050  C  CA  . ASN A 1 150 ? 53.958  29.088  42.576  1.00 38.38  ? 196  ASN A CA  1 
ATOM   1051  C  C   . ASN A 1 150 ? 52.640  29.574  41.943  1.00 38.55  ? 196  ASN A C   1 
ATOM   1052  O  O   . ASN A 1 150 ? 52.138  28.960  40.997  1.00 38.20  ? 196  ASN A O   1 
ATOM   1053  C  CB  . ASN A 1 150 ? 54.865  30.278  42.906  1.00 38.30  ? 196  ASN A CB  1 
ATOM   1054  C  CG  . ASN A 1 150 ? 55.504  30.877  41.673  1.00 38.55  ? 196  ASN A CG  1 
ATOM   1055  O  OD1 . ASN A 1 150 ? 55.022  30.690  40.554  1.00 38.11  ? 196  ASN A OD1 1 
ATOM   1056  N  ND2 . ASN A 1 150 ? 56.606  31.597  41.868  1.00 39.64  ? 196  ASN A ND2 1 
ATOM   1057  N  N   . ALA A 1 151 ? 52.101  30.685  42.452  1.00 39.15  ? 197  ALA A N   1 
ATOM   1058  C  CA  . ALA A 1 151 ? 50.826  31.238  41.955  1.00 39.67  ? 197  ALA A CA  1 
ATOM   1059  C  C   . ALA A 1 151 ? 50.852  31.692  40.493  1.00 39.83  ? 197  ALA A C   1 
ATOM   1060  O  O   . ALA A 1 151 ? 49.796  31.937  39.894  1.00 39.98  ? 197  ALA A O   1 
ATOM   1061  C  CB  . ALA A 1 151 ? 50.329  32.367  42.859  1.00 39.86  ? 197  ALA A CB  1 
ATOM   1062  N  N   . ASN A 1 152 ? 52.049  31.795  39.925  1.00 39.87  ? 198  ASN A N   1 
ATOM   1063  C  CA  . ASN A 1 152 ? 52.189  32.212  38.543  1.00 40.01  ? 198  ASN A CA  1 
ATOM   1064  C  C   . ASN A 1 152 ? 52.970  31.236  37.653  1.00 40.07  ? 198  ASN A C   1 
ATOM   1065  O  O   . ASN A 1 152 ? 52.998  31.406  36.433  1.00 40.54  ? 198  ASN A O   1 
ATOM   1066  C  CB  . ASN A 1 152 ? 52.775  33.630  38.470  1.00 40.25  ? 198  ASN A CB  1 
ATOM   1067  C  CG  . ASN A 1 152 ? 51.804  34.708  38.997  1.00 40.43  ? 198  ASN A CG  1 
ATOM   1068  O  OD1 . ASN A 1 152 ? 50.578  34.598  38.839  1.00 40.95  ? 198  ASN A OD1 1 
ATOM   1069  N  ND2 . ASN A 1 152 ? 52.358  35.753  39.620  1.00 39.45  ? 198  ASN A ND2 1 
ATOM   1070  N  N   . THR A 1 153 ? 53.586  30.214  38.250  1.00 39.76  ? 199  THR A N   1 
ATOM   1071  C  CA  . THR A 1 153 ? 54.371  29.235  37.488  1.00 39.52  ? 199  THR A CA  1 
ATOM   1072  C  C   . THR A 1 153 ? 53.927  27.801  37.782  1.00 39.54  ? 199  THR A C   1 
ATOM   1073  O  O   . THR A 1 153 ? 54.110  27.317  38.901  1.00 39.80  ? 199  THR A O   1 
ATOM   1074  C  CB  . THR A 1 153 ? 55.910  29.352  37.792  1.00 39.46  ? 199  THR A CB  1 
ATOM   1075  O  OG1 . THR A 1 153 ? 56.347  30.693  37.573  1.00 39.14  ? 199  THR A OG1 1 
ATOM   1076  C  CG2 . THR A 1 153 ? 56.746  28.405  36.912  1.00 38.76  ? 199  THR A CG2 1 
ATOM   1077  N  N   . VAL A 1 154 ? 53.361  27.115  36.789  1.00 39.34  ? 200  VAL A N   1 
ATOM   1078  C  CA  . VAL A 1 154 ? 53.057  25.686  36.946  1.00 39.26  ? 200  VAL A CA  1 
ATOM   1079  C  C   . VAL A 1 154 ? 53.850  24.912  35.905  1.00 39.35  ? 200  VAL A C   1 
ATOM   1080  O  O   . VAL A 1 154 ? 53.882  25.303  34.735  1.00 39.48  ? 200  VAL A O   1 
ATOM   1081  C  CB  . VAL A 1 154 ? 51.526  25.325  36.877  1.00 38.89  ? 200  VAL A CB  1 
ATOM   1082  C  CG1 . VAL A 1 154 ? 50.650  26.470  37.358  1.00 38.29  ? 200  VAL A CG1 1 
ATOM   1083  C  CG2 . VAL A 1 154 ? 51.123  24.911  35.487  1.00 38.99  ? 200  VAL A CG2 1 
ATOM   1084  N  N   . TRP A 1 155 ? 54.504  23.838  36.352  1.00 39.14  ? 201  TRP A N   1 
ATOM   1085  C  CA  . TRP A 1 155 ? 55.311  22.986  35.487  1.00 38.91  ? 201  TRP A CA  1 
ATOM   1086  C  C   . TRP A 1 155 ? 54.577  21.689  35.213  1.00 39.01  ? 201  TRP A C   1 
ATOM   1087  O  O   . TRP A 1 155 ? 53.830  21.195  36.065  1.00 39.28  ? 201  TRP A O   1 
ATOM   1088  C  CB  . TRP A 1 155 ? 56.659  22.686  36.141  1.00 38.93  ? 201  TRP A CB  1 
ATOM   1089  C  CG  . TRP A 1 155 ? 57.543  21.763  35.339  1.00 38.82  ? 201  TRP A CG  1 
ATOM   1090  C  CD1 . TRP A 1 155 ? 58.506  22.124  34.437  1.00 38.39  ? 201  TRP A CD1 1 
ATOM   1091  C  CD2 . TRP A 1 155 ? 57.537  20.328  35.369  1.00 38.46  ? 201  TRP A CD2 1 
ATOM   1092  N  NE1 . TRP A 1 155 ? 59.107  21.002  33.910  1.00 38.62  ? 201  TRP A NE1 1 
ATOM   1093  C  CE2 . TRP A 1 155 ? 58.532  19.888  34.462  1.00 38.54  ? 201  TRP A CE2 1 
ATOM   1094  C  CE3 . TRP A 1 155 ? 56.792  19.374  36.074  1.00 37.37  ? 201  TRP A CE3 1 
ATOM   1095  C  CZ2 . TRP A 1 155 ? 58.794  18.534  34.235  1.00 38.22  ? 201  TRP A CZ2 1 
ATOM   1096  C  CZ3 . TRP A 1 155 ? 57.060  18.028  35.854  1.00 38.14  ? 201  TRP A CZ3 1 
ATOM   1097  C  CH2 . TRP A 1 155 ? 58.055  17.620  34.942  1.00 37.70  ? 201  TRP A CH2 1 
ATOM   1098  N  N   . VAL A 1 156 ? 54.809  21.122  34.035  1.00 38.75  ? 202  VAL A N   1 
ATOM   1099  C  CA  . VAL A 1 156 ? 54.047  19.972  33.607  1.00 38.91  ? 202  VAL A CA  1 
ATOM   1100  C  C   . VAL A 1 156 ? 54.969  18.898  32.987  1.00 38.93  ? 202  VAL A C   1 
ATOM   1101  O  O   . VAL A 1 156 ? 55.981  19.235  32.360  1.00 39.00  ? 202  VAL A O   1 
ATOM   1102  C  CB  . VAL A 1 156 ? 52.843  20.446  32.713  1.00 38.90  ? 202  VAL A CB  1 
ATOM   1103  C  CG1 . VAL A 1 156 ? 53.164  20.409  31.226  1.00 38.99  ? 202  VAL A CG1 1 
ATOM   1104  C  CG2 . VAL A 1 156 ? 51.604  19.644  33.028  1.00 39.36  ? 202  VAL A CG2 1 
ATOM   1105  N  N   . ASP A 1 157 ? 54.640  17.614  33.191  1.00 38.82  ? 203  ASP A N   1 
ATOM   1106  C  CA  . ASP A 1 157 ? 55.538  16.495  32.788  1.00 38.42  ? 203  ASP A CA  1 
ATOM   1107  C  C   . ASP A 1 157 ? 55.407  16.019  31.343  1.00 37.93  ? 203  ASP A C   1 
ATOM   1108  O  O   . ASP A 1 157 ? 55.749  14.886  31.017  1.00 37.50  ? 203  ASP A O   1 
ATOM   1109  C  CB  . ASP A 1 157 ? 55.450  15.302  33.766  1.00 38.66  ? 203  ASP A CB  1 
ATOM   1110  C  CG  . ASP A 1 157 ? 54.087  14.591  33.754  1.00 39.41  ? 203  ASP A CG  1 
ATOM   1111  O  OD1 . ASP A 1 157 ? 53.888  13.775  34.676  1.00 40.58  ? 203  ASP A OD1 1 
ATOM   1112  O  OD2 . ASP A 1 157 ? 53.231  14.812  32.861  1.00 39.72  ? 203  ASP A OD2 1 
ATOM   1113  N  N   . TYR A 1 158 ? 54.921  16.902  30.482  1.00 37.87  ? 204  TYR A N   1 
ATOM   1114  C  CA  . TYR A 1 158 ? 54.675  16.577  29.089  1.00 37.76  ? 204  TYR A CA  1 
ATOM   1115  C  C   . TYR A 1 158 ? 55.279  17.699  28.249  1.00 37.71  ? 204  TYR A C   1 
ATOM   1116  O  O   . TYR A 1 158 ? 54.607  18.684  27.935  1.00 37.46  ? 204  TYR A O   1 
ATOM   1117  C  CB  . TYR A 1 158 ? 53.165  16.418  28.858  1.00 37.89  ? 204  TYR A CB  1 
ATOM   1118  C  CG  . TYR A 1 158 ? 52.756  16.027  27.452  1.00 37.65  ? 204  TYR A CG  1 
ATOM   1119  C  CD1 . TYR A 1 158 ? 52.846  14.709  27.016  1.00 37.26  ? 204  TYR A CD1 1 
ATOM   1120  C  CD2 . TYR A 1 158 ? 52.240  16.979  26.573  1.00 38.00  ? 204  TYR A CD2 1 
ATOM   1121  C  CE1 . TYR A 1 158 ? 52.462  14.353  25.728  1.00 38.36  ? 204  TYR A CE1 1 
ATOM   1122  C  CE2 . TYR A 1 158 ? 51.844  16.639  25.293  1.00 38.67  ? 204  TYR A CE2 1 
ATOM   1123  C  CZ  . TYR A 1 158 ? 51.958  15.322  24.866  1.00 39.15  ? 204  TYR A CZ  1 
ATOM   1124  O  OH  . TYR A 1 158 ? 51.569  14.983  23.576  1.00 38.84  ? 204  TYR A OH  1 
ATOM   1125  N  N   . PRO A 1 159 ? 56.577  17.572  27.914  1.00 37.82  ? 205  PRO A N   1 
ATOM   1126  C  CA  . PRO A 1 159 ? 57.244  18.609  27.138  1.00 37.79  ? 205  PRO A CA  1 
ATOM   1127  C  C   . PRO A 1 159 ? 56.383  19.174  25.996  1.00 37.87  ? 205  PRO A C   1 
ATOM   1128  O  O   . PRO A 1 159 ? 56.386  20.386  25.782  1.00 37.92  ? 205  PRO A O   1 
ATOM   1129  C  CB  . PRO A 1 159 ? 58.482  17.889  26.597  1.00 37.69  ? 205  PRO A CB  1 
ATOM   1130  C  CG  . PRO A 1 159 ? 58.812  16.909  27.674  1.00 37.60  ? 205  PRO A CG  1 
ATOM   1131  C  CD  . PRO A 1 159 ? 57.498  16.466  28.253  1.00 37.83  ? 205  PRO A CD  1 
ATOM   1132  N  N   . ASN A 1 160 ? 55.628  18.310  25.311  1.00 37.86  ? 206  ASN A N   1 
ATOM   1133  C  CA  . ASN A 1 160 ? 54.949  18.676  24.055  1.00 37.92  ? 206  ASN A CA  1 
ATOM   1134  C  C   . ASN A 1 160 ? 53.730  19.609  24.161  1.00 37.85  ? 206  ASN A C   1 
ATOM   1135  O  O   . ASN A 1 160 ? 53.218  20.082  23.135  1.00 37.52  ? 206  ASN A O   1 
ATOM   1136  C  CB  . ASN A 1 160 ? 54.604  17.427  23.237  1.00 37.85  ? 206  ASN A CB  1 
ATOM   1137  C  CG  . ASN A 1 160 ? 55.840  16.690  22.747  1.00 38.72  ? 206  ASN A CG  1 
ATOM   1138  O  OD1 . ASN A 1 160 ? 56.868  17.298  22.387  1.00 38.46  ? 206  ASN A OD1 1 
ATOM   1139  N  ND2 . ASN A 1 160 ? 55.744  15.365  22.717  1.00 39.43  ? 206  ASN A ND2 1 
ATOM   1140  N  N   . ILE A 1 161 ? 53.294  19.887  25.391  1.00 37.86  ? 207  ILE A N   1 
ATOM   1141  C  CA  . ILE A 1 161 ? 52.125  20.742  25.641  1.00 37.91  ? 207  ILE A CA  1 
ATOM   1142  C  C   . ILE A 1 161 ? 52.258  22.098  24.948  1.00 38.02  ? 207  ILE A C   1 
ATOM   1143  O  O   . ILE A 1 161 ? 51.286  22.620  24.390  1.00 37.78  ? 207  ILE A O   1 
ATOM   1144  C  CB  . ILE A 1 161 ? 51.846  20.924  27.163  1.00 37.87  ? 207  ILE A CB  1 
ATOM   1145  C  CG1 . ILE A 1 161 ? 50.370  21.215  27.399  1.00 36.77  ? 207  ILE A CG1 1 
ATOM   1146  C  CG2 . ILE A 1 161 ? 52.796  21.974  27.803  1.00 37.69  ? 207  ILE A CG2 1 
ATOM   1147  C  CD1 . ILE A 1 161 ? 49.999  21.296  28.846  1.00 37.42  ? 207  ILE A CD1 1 
ATOM   1148  N  N   . VAL A 1 162 ? 53.476  22.640  24.991  1.00 38.38  ? 208  VAL A N   1 
ATOM   1149  C  CA  . VAL A 1 162 ? 53.851  23.886  24.306  1.00 38.64  ? 208  VAL A CA  1 
ATOM   1150  C  C   . VAL A 1 162 ? 53.569  23.821  22.804  1.00 38.96  ? 208  VAL A C   1 
ATOM   1151  O  O   . VAL A 1 162 ? 53.172  24.821  22.203  1.00 38.90  ? 208  VAL A O   1 
ATOM   1152  C  CB  . VAL A 1 162 ? 55.351  24.279  24.554  1.00 38.55  ? 208  VAL A CB  1 
ATOM   1153  C  CG1 . VAL A 1 162 ? 55.648  24.382  26.055  1.00 38.29  ? 208  VAL A CG1 1 
ATOM   1154  C  CG2 . VAL A 1 162 ? 56.321  23.306  23.870  1.00 38.18  ? 208  VAL A CG2 1 
ATOM   1155  N  N   . ARG A 1 163 ? 53.742  22.623  22.234  1.00 39.43  ? 209  ARG A N   1 
ATOM   1156  C  CA  . ARG A 1 163 ? 53.647  22.371  20.788  1.00 39.70  ? 209  ARG A CA  1 
ATOM   1157  C  C   . ARG A 1 163 ? 52.226  21.969  20.314  1.00 39.50  ? 209  ARG A C   1 
ATOM   1158  O  O   . ARG A 1 163 ? 51.935  22.007  19.107  1.00 39.18  ? 209  ARG A O   1 
ATOM   1159  C  CB  . ARG A 1 163 ? 54.713  21.325  20.396  1.00 39.83  ? 209  ARG A CB  1 
ATOM   1160  C  CG  . ARG A 1 163 ? 54.302  20.307  19.333  1.00 41.02  ? 209  ARG A CG  1 
ATOM   1161  C  CD  . ARG A 1 163 ? 54.470  18.865  19.835  1.00 42.84  ? 209  ARG A CD  1 
ATOM   1162  N  NE  . ARG A 1 163 ? 54.180  17.868  18.766  1.00 43.89  ? 209  ARG A NE  1 
ATOM   1163  C  CZ  . ARG A 1 163 ? 54.570  16.583  18.808  1.00 44.11  ? 209  ARG A CZ  1 
ATOM   1164  N  NH1 . ARG A 1 163 ? 55.274  16.102  19.829  1.00 44.70  ? 209  ARG A NH1 1 
ATOM   1165  N  NH2 . ARG A 1 163 ? 54.350  15.766  17.749  1.00 43.39  ? 209  ARG A NH2 1 
ATOM   1166  N  N   . VAL A 1 164 ? 51.344  21.615  21.256  1.00 39.29  ? 210  VAL A N   1 
ATOM   1167  C  CA  . VAL A 1 164 ? 50.032  21.063  20.895  1.00 39.22  ? 210  VAL A CA  1 
ATOM   1168  C  C   . VAL A 1 164 ? 48.843  21.973  21.191  1.00 38.88  ? 210  VAL A C   1 
ATOM   1169  O  O   . VAL A 1 164 ? 47.805  21.878  20.524  1.00 38.68  ? 210  VAL A O   1 
ATOM   1170  C  CB  . VAL A 1 164 ? 49.789  19.689  21.546  1.00 39.33  ? 210  VAL A CB  1 
ATOM   1171  C  CG1 . VAL A 1 164 ? 48.592  19.006  20.904  1.00 40.14  ? 210  VAL A CG1 1 
ATOM   1172  C  CG2 . VAL A 1 164 ? 51.015  18.799  21.386  1.00 40.42  ? 210  VAL A CG2 1 
ATOM   1173  N  N   . VAL A 1 165 ? 48.980  22.838  22.193  1.00 38.90  ? 211  VAL A N   1 
ATOM   1174  C  CA  . VAL A 1 165 ? 47.892  23.767  22.550  1.00 38.85  ? 211  VAL A CA  1 
ATOM   1175  C  C   . VAL A 1 165 ? 48.104  25.145  21.894  1.00 39.05  ? 211  VAL A C   1 
ATOM   1176  O  O   . VAL A 1 165 ? 48.976  25.911  22.330  1.00 39.29  ? 211  VAL A O   1 
ATOM   1177  C  CB  . VAL A 1 165 ? 47.705  23.937  24.092  1.00 38.72  ? 211  VAL A CB  1 
ATOM   1178  C  CG1 . VAL A 1 165 ? 46.339  24.524  24.388  1.00 38.53  ? 211  VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A 1 165 ? 47.872  22.613  24.829  1.00 37.96  ? 211  VAL A CG2 1 
ATOM   1180  N  N   . PRO A 1 166 ? 47.304  25.467  20.848  1.00 39.04  ? 212  PRO A N   1 
ATOM   1181  C  CA  . PRO A 1 166 ? 47.493  26.731  20.120  1.00 38.95  ? 212  PRO A CA  1 
ATOM   1182  C  C   . PRO A 1 166 ? 46.875  27.924  20.853  1.00 38.83  ? 212  PRO A C   1 
ATOM   1183  O  O   . PRO A 1 166 ? 45.954  27.746  21.655  1.00 39.00  ? 212  PRO A O   1 
ATOM   1184  C  CB  . PRO A 1 166 ? 46.758  26.482  18.797  1.00 39.01  ? 212  PRO A CB  1 
ATOM   1185  C  CG  . PRO A 1 166 ? 45.635  25.536  19.175  1.00 39.10  ? 212  PRO A CG  1 
ATOM   1186  C  CD  . PRO A 1 166 ? 46.174  24.677  20.305  1.00 39.02  ? 212  PRO A CD  1 
ATOM   1187  N  N   . VAL A 1 167 ? 47.378  29.122  20.569  1.00 38.75  ? 213  VAL A N   1 
ATOM   1188  C  CA  . VAL A 1 167 ? 46.828  30.363  21.122  1.00 38.67  ? 213  VAL A CA  1 
ATOM   1189  C  C   . VAL A 1 167 ? 45.295  30.344  21.079  1.00 38.71  ? 213  VAL A C   1 
ATOM   1190  O  O   . VAL A 1 167 ? 44.692  30.185  20.015  1.00 38.65  ? 213  VAL A O   1 
ATOM   1191  C  CB  . VAL A 1 167 ? 47.337  31.607  20.353  1.00 38.73  ? 213  VAL A CB  1 
ATOM   1192  C  CG1 . VAL A 1 167 ? 47.052  32.882  21.147  1.00 38.57  ? 213  VAL A CG1 1 
ATOM   1193  C  CG2 . VAL A 1 167 ? 48.822  31.483  20.022  1.00 38.49  ? 213  VAL A CG2 1 
ATOM   1194  N  N   . GLY A 1 168 ? 44.670  30.489  22.241  1.00 38.85  ? 214  GLY A N   1 
ATOM   1195  C  CA  . GLY A 1 168 ? 43.214  30.396  22.343  1.00 39.00  ? 214  GLY A CA  1 
ATOM   1196  C  C   . GLY A 1 168 ? 42.700  29.031  22.773  1.00 39.11  ? 214  GLY A C   1 
ATOM   1197  O  O   . GLY A 1 168 ? 41.496  28.863  22.983  1.00 39.02  ? 214  GLY A O   1 
ATOM   1198  N  N   . GLY A 1 169 ? 43.605  28.055  22.898  1.00 39.29  ? 215  GLY A N   1 
ATOM   1199  C  CA  . GLY A 1 169 ? 43.254  26.718  23.397  1.00 39.53  ? 215  GLY A CA  1 
ATOM   1200  C  C   . GLY A 1 169 ? 43.112  26.709  24.913  1.00 39.76  ? 215  GLY A C   1 
ATOM   1201  O  O   . GLY A 1 169 ? 43.636  27.603  25.590  1.00 39.80  ? 215  GLY A O   1 
ATOM   1202  N  N   . ARG A 1 170 ? 42.392  25.713  25.444  1.00 39.94  ? 216  ARG A N   1 
ATOM   1203  C  CA  . ARG A 1 170 ? 42.245  25.526  26.896  1.00 39.85  ? 216  ARG A CA  1 
ATOM   1204  C  C   . ARG A 1 170 ? 43.295  24.571  27.502  1.00 39.90  ? 216  ARG A C   1 
ATOM   1205  O  O   . ARG A 1 170 ? 43.933  23.788  26.776  1.00 40.37  ? 216  ARG A O   1 
ATOM   1206  C  CB  . ARG A 1 170 ? 40.847  25.030  27.220  1.00 39.90  ? 216  ARG A CB  1 
ATOM   1207  C  CG  . ARG A 1 170 ? 40.375  25.415  28.625  1.00 40.63  ? 216  ARG A CG  1 
ATOM   1208  C  CD  . ARG A 1 170 ? 38.869  25.308  28.774  1.00 40.00  ? 216  ARG A CD  1 
ATOM   1209  N  NE  . ARG A 1 170 ? 38.151  25.537  27.519  1.00 40.26  ? 216  ARG A NE  1 
ATOM   1210  C  CZ  . ARG A 1 170 ? 37.612  26.694  27.145  1.00 40.61  ? 216  ARG A CZ  1 
ATOM   1211  N  NH1 . ARG A 1 170 ? 37.690  27.770  27.919  1.00 40.39  ? 216  ARG A NH1 1 
ATOM   1212  N  NH2 . ARG A 1 170 ? 36.985  26.771  25.983  1.00 41.19  ? 216  ARG A NH2 1 
ATOM   1213  N  N   . ILE A 1 171 ? 43.496  24.671  28.820  1.00 39.37  ? 217  ILE A N   1 
ATOM   1214  C  CA  . ILE A 1 171 ? 44.284  23.708  29.602  1.00 38.63  ? 217  ILE A CA  1 
ATOM   1215  C  C   . ILE A 1 171 ? 43.632  23.556  30.987  1.00 38.35  ? 217  ILE A C   1 
ATOM   1216  O  O   . ILE A 1 171 ? 43.678  24.475  31.820  1.00 38.24  ? 217  ILE A O   1 
ATOM   1217  C  CB  . ILE A 1 171 ? 45.788  24.091  29.713  1.00 38.35  ? 217  ILE A CB  1 
ATOM   1218  C  CG1 . ILE A 1 171 ? 46.495  23.843  28.377  1.00 38.81  ? 217  ILE A CG1 1 
ATOM   1219  C  CG2 . ILE A 1 171 ? 46.463  23.244  30.774  1.00 37.84  ? 217  ILE A CG2 1 
ATOM   1220  C  CD1 . ILE A 1 171 ? 47.834  24.600  28.162  1.00 38.81  ? 217  ILE A CD1 1 
ATOM   1221  N  N   . TYR A 1 172 ? 43.006  22.399  31.208  1.00 37.84  ? 218  TYR A N   1 
ATOM   1222  C  CA  . TYR A 1 172 ? 42.290  22.123  32.450  1.00 37.16  ? 218  TYR A CA  1 
ATOM   1223  C  C   . TYR A 1 172 ? 43.234  21.495  33.444  1.00 36.96  ? 218  TYR A C   1 
ATOM   1224  O  O   . TYR A 1 172 ? 44.064  20.658  33.082  1.00 37.00  ? 218  TYR A O   1 
ATOM   1225  C  CB  . TYR A 1 172 ? 41.113  21.185  32.206  1.00 36.90  ? 218  TYR A CB  1 
ATOM   1226  C  CG  . TYR A 1 172 ? 39.821  21.840  31.731  1.00 36.98  ? 218  TYR A CG  1 
ATOM   1227  C  CD1 . TYR A 1 172 ? 39.473  21.837  30.386  1.00 36.43  ? 218  TYR A CD1 1 
ATOM   1228  C  CD2 . TYR A 1 172 ? 38.933  22.424  32.637  1.00 36.75  ? 218  TYR A CD2 1 
ATOM   1229  C  CE1 . TYR A 1 172 ? 38.298  22.405  29.948  1.00 36.59  ? 218  TYR A CE1 1 
ATOM   1230  C  CE2 . TYR A 1 172 ? 37.738  23.010  32.203  1.00 36.30  ? 218  TYR A CE2 1 
ATOM   1231  C  CZ  . TYR A 1 172 ? 37.423  22.994  30.859  1.00 36.03  ? 218  TYR A CZ  1 
ATOM   1232  O  OH  . TYR A 1 172 ? 36.253  23.572  30.414  1.00 33.35  ? 218  TYR A OH  1 
ATOM   1233  N  N   . ILE A 1 173 ? 43.117  21.901  34.700  1.00 36.67  ? 219  ILE A N   1 
ATOM   1234  C  CA  . ILE A 1 173 ? 44.009  21.378  35.728  1.00 36.08  ? 219  ILE A CA  1 
ATOM   1235  C  C   . ILE A 1 173 ? 43.245  20.910  36.947  1.00 35.88  ? 219  ILE A C   1 
ATOM   1236  O  O   . ILE A 1 173 ? 42.287  21.548  37.376  1.00 35.07  ? 219  ILE A O   1 
ATOM   1237  C  CB  . ILE A 1 173 ? 45.137  22.372  36.120  1.00 35.85  ? 219  ILE A CB  1 
ATOM   1238  C  CG1 . ILE A 1 173 ? 46.097  22.574  34.958  1.00 34.79  ? 219  ILE A CG1 1 
ATOM   1239  C  CG2 . ILE A 1 173 ? 45.922  21.871  37.318  1.00 35.25  ? 219  ILE A CG2 1 
ATOM   1240  C  CD1 . ILE A 1 173 ? 47.074  23.677  35.206  1.00 34.94  ? 219  ILE A CD1 1 
ATOM   1241  N  N   . ASP A 1 174 ? 43.711  19.778  37.477  1.00 36.09  ? 220  ASP A N   1 
ATOM   1242  C  CA  . ASP A 1 174 ? 43.150  19.105  38.638  1.00 36.45  ? 220  ASP A CA  1 
ATOM   1243  C  C   . ASP A 1 174 ? 41.654  18.815  38.526  1.00 36.63  ? 220  ASP A C   1 
ATOM   1244  O  O   . ASP A 1 174 ? 40.832  19.533  39.100  1.00 36.75  ? 220  ASP A O   1 
ATOM   1245  C  CB  . ASP A 1 174 ? 43.430  19.882  39.915  1.00 36.19  ? 220  ASP A CB  1 
ATOM   1246  C  CG  . ASP A 1 174 ? 42.932  19.156  41.140  1.00 36.80  ? 220  ASP A CG  1 
ATOM   1247  O  OD1 . ASP A 1 174 ? 43.011  17.910  41.170  1.00 37.12  ? 220  ASP A OD1 1 
ATOM   1248  O  OD2 . ASP A 1 174 ? 42.464  19.823  42.081  1.00 38.41  ? 220  ASP A OD2 1 
ATOM   1249  N  N   . ASP A 1 175 ? 41.312  17.769  37.777  1.00 36.80  ? 221  ASP A N   1 
ATOM   1250  C  CA  . ASP A 1 175 ? 39.952  17.263  37.742  1.00 37.09  ? 221  ASP A CA  1 
ATOM   1251  C  C   . ASP A 1 175 ? 39.068  18.182  36.890  1.00 37.11  ? 221  ASP A C   1 
ATOM   1252  O  O   . ASP A 1 175 ? 37.836  18.059  36.869  1.00 37.37  ? 221  ASP A O   1 
ATOM   1253  C  CB  . ASP A 1 175 ? 39.422  17.152  39.178  1.00 37.45  ? 221  ASP A CB  1 
ATOM   1254  C  CG  . ASP A 1 175 ? 39.079  15.724  39.565  1.00 38.83  ? 221  ASP A CG  1 
ATOM   1255  O  OD1 . ASP A 1 175 ? 39.542  14.784  38.852  1.00 38.51  ? 221  ASP A OD1 1 
ATOM   1256  O  OD2 . ASP A 1 175 ? 38.340  15.549  40.583  1.00 40.53  ? 221  ASP A OD2 1 
ATOM   1257  N  N   . GLY A 1 176 ? 39.715  19.092  36.173  1.00 36.97  ? 222  GLY A N   1 
ATOM   1258  C  CA  . GLY A 1 176 ? 39.030  20.066  35.337  1.00 36.92  ? 222  GLY A CA  1 
ATOM   1259  C  C   . GLY A 1 176 ? 38.453  21.228  36.122  1.00 36.86  ? 222  GLY A C   1 
ATOM   1260  O  O   . GLY A 1 176 ? 37.515  21.888  35.659  1.00 37.09  ? 222  GLY A O   1 
ATOM   1261  N  N   . LEU A 1 177 ? 38.999  21.471  37.313  1.00 36.50  ? 223  LEU A N   1 
ATOM   1262  C  CA  . LEU A 1 177 ? 38.483  22.520  38.179  1.00 36.36  ? 223  LEU A CA  1 
ATOM   1263  C  C   . LEU A 1 177 ? 39.197  23.816  37.906  1.00 36.56  ? 223  LEU A C   1 
ATOM   1264  O  O   . LEU A 1 177 ? 38.642  24.873  38.125  1.00 36.84  ? 223  LEU A O   1 
ATOM   1265  C  CB  . LEU A 1 177 ? 38.584  22.127  39.653  1.00 36.04  ? 223  LEU A CB  1 
ATOM   1266  C  CG  . LEU A 1 177 ? 37.665  20.974  40.075  1.00 35.42  ? 223  LEU A CG  1 
ATOM   1267  C  CD1 . LEU A 1 177 ? 38.223  20.219  41.272  1.00 34.83  ? 223  LEU A CD1 1 
ATOM   1268  C  CD2 . LEU A 1 177 ? 36.252  21.460  40.338  1.00 33.87  ? 223  LEU A CD2 1 
ATOM   1269  N  N   . ILE A 1 178 ? 40.428  23.716  37.417  1.00 37.13  ? 224  ILE A N   1 
ATOM   1270  C  CA  . ILE A 1 178 ? 41.226  24.867  36.983  1.00 37.34  ? 224  ILE A CA  1 
ATOM   1271  C  C   . ILE A 1 178 ? 41.313  24.953  35.463  1.00 37.29  ? 224  ILE A C   1 
ATOM   1272  O  O   . ILE A 1 178 ? 41.570  23.963  34.770  1.00 36.87  ? 224  ILE A O   1 
ATOM   1273  C  CB  . ILE A 1 178 ? 42.653  24.817  37.547  1.00 37.49  ? 224  ILE A CB  1 
ATOM   1274  C  CG1 . ILE A 1 178 ? 42.620  24.728  39.076  1.00 38.70  ? 224  ILE A CG1 1 
ATOM   1275  C  CG2 . ILE A 1 178 ? 43.486  25.993  37.057  1.00 37.40  ? 224  ILE A CG2 1 
ATOM   1276  C  CD1 . ILE A 1 178 ? 42.197  25.991  39.769  1.00 39.65  ? 224  ILE A CD1 1 
ATOM   1277  N  N   . SER A 1 179 ? 41.128  26.170  34.969  1.00 37.51  ? 225  SER A N   1 
ATOM   1278  C  CA  . SER A 1 179 ? 41.004  26.439  33.551  1.00 37.36  ? 225  SER A CA  1 
ATOM   1279  C  C   . SER A 1 179 ? 42.023  27.495  33.098  1.00 37.34  ? 225  SER A C   1 
ATOM   1280  O  O   . SER A 1 179 ? 42.047  28.602  33.617  1.00 37.15  ? 225  SER A O   1 
ATOM   1281  C  CB  . SER A 1 179 ? 39.577  26.889  33.273  1.00 37.02  ? 225  SER A CB  1 
ATOM   1282  O  OG  . SER A 1 179 ? 39.338  26.941  31.889  1.00 36.96  ? 225  SER A OG  1 
ATOM   1283  N  N   . LEU A 1 180 ? 42.878  27.134  32.149  1.00 37.45  ? 226  LEU A N   1 
ATOM   1284  C  CA  . LEU A 1 180 ? 43.844  28.086  31.597  1.00 38.11  ? 226  LEU A CA  1 
ATOM   1285  C  C   . LEU A 1 180 ? 43.659  28.264  30.092  1.00 38.42  ? 226  LEU A C   1 
ATOM   1286  O  O   . LEU A 1 180 ? 43.398  27.297  29.387  1.00 38.87  ? 226  LEU A O   1 
ATOM   1287  C  CB  . LEU A 1 180 ? 45.285  27.663  31.909  1.00 37.71  ? 226  LEU A CB  1 
ATOM   1288  C  CG  . LEU A 1 180 ? 45.775  27.651  33.364  1.00 37.45  ? 226  LEU A CG  1 
ATOM   1289  C  CD1 . LEU A 1 180 ? 47.216  27.092  33.466  1.00 36.69  ? 226  LEU A CD1 1 
ATOM   1290  C  CD2 . LEU A 1 180 ? 45.680  29.024  34.017  1.00 36.48  ? 226  LEU A CD2 1 
ATOM   1291  N  N   . VAL A 1 181 ? 43.770  29.498  29.605  1.00 38.76  ? 227  VAL A N   1 
ATOM   1292  C  CA  . VAL A 1 181 ? 43.692  29.762  28.154  1.00 39.04  ? 227  VAL A CA  1 
ATOM   1293  C  C   . VAL A 1 181 ? 45.011  30.361  27.640  1.00 39.15  ? 227  VAL A C   1 
ATOM   1294  O  O   . VAL A 1 181 ? 45.497  31.364  28.174  1.00 38.81  ? 227  VAL A O   1 
ATOM   1295  C  CB  . VAL A 1 181 ? 42.465  30.663  27.732  1.00 38.95  ? 227  VAL A CB  1 
ATOM   1296  C  CG1 . VAL A 1 181 ? 42.111  30.420  26.275  1.00 38.90  ? 227  VAL A CG1 1 
ATOM   1297  C  CG2 . VAL A 1 181 ? 41.228  30.415  28.600  1.00 38.66  ? 227  VAL A CG2 1 
ATOM   1298  N  N   . VAL A 1 182 ? 45.584  29.728  26.617  1.00 39.57  ? 228  VAL A N   1 
ATOM   1299  C  CA  . VAL A 1 182 ? 46.866  30.162  26.038  1.00 40.12  ? 228  VAL A CA  1 
ATOM   1300  C  C   . VAL A 1 182 ? 46.681  31.472  25.272  1.00 40.68  ? 228  VAL A C   1 
ATOM   1301  O  O   . VAL A 1 182 ? 46.004  31.520  24.239  1.00 40.69  ? 228  VAL A O   1 
ATOM   1302  C  CB  . VAL A 1 182 ? 47.501  29.084  25.115  1.00 39.84  ? 228  VAL A CB  1 
ATOM   1303  C  CG1 . VAL A 1 182 ? 48.911  29.456  24.758  1.00 39.45  ? 228  VAL A CG1 1 
ATOM   1304  C  CG2 . VAL A 1 182 ? 47.504  27.737  25.795  1.00 40.17  ? 228  VAL A CG2 1 
ATOM   1305  N  N   . GLN A 1 183 ? 47.269  32.540  25.797  1.00 41.32  ? 229  GLN A N   1 
ATOM   1306  C  CA  . GLN A 1 183 ? 47.137  33.845  25.170  1.00 42.10  ? 229  GLN A CA  1 
ATOM   1307  C  C   . GLN A 1 183 ? 48.442  34.295  24.525  1.00 42.58  ? 229  GLN A C   1 
ATOM   1308  O  O   . GLN A 1 183 ? 48.438  35.217  23.709  1.00 42.63  ? 229  GLN A O   1 
ATOM   1309  C  CB  . GLN A 1 183 ? 46.594  34.884  26.153  1.00 42.15  ? 229  GLN A CB  1 
ATOM   1310  C  CG  . GLN A 1 183 ? 47.463  35.155  27.367  1.00 42.56  ? 229  GLN A CG  1 
ATOM   1311  C  CD  . GLN A 1 183 ? 46.713  35.901  28.452  1.00 43.32  ? 229  GLN A CD  1 
ATOM   1312  O  OE1 . GLN A 1 183 ? 47.292  36.292  29.465  1.00 43.80  ? 229  GLN A OE1 1 
ATOM   1313  N  NE2 . GLN A 1 183 ? 45.416  36.107  28.242  1.00 43.63  ? 229  GLN A NE2 1 
ATOM   1314  N  N   . LYS A 1 184 ? 49.542  33.646  24.911  1.00 43.13  ? 230  LYS A N   1 
ATOM   1315  C  CA  . LYS A 1 184 ? 50.820  33.728  24.204  1.00 43.69  ? 230  LYS A CA  1 
ATOM   1316  C  C   . LYS A 1 184 ? 51.591  32.423  24.322  1.00 44.07  ? 230  LYS A C   1 
ATOM   1317  O  O   . LYS A 1 184 ? 51.731  31.865  25.417  1.00 44.01  ? 230  LYS A O   1 
ATOM   1318  C  CB  . LYS A 1 184 ? 51.700  34.882  24.710  1.00 43.74  ? 230  LYS A CB  1 
ATOM   1319  C  CG  . LYS A 1 184 ? 51.371  36.272  24.146  1.00 44.03  ? 230  LYS A CG  1 
ATOM   1320  C  CD  . LYS A 1 184 ? 51.234  36.270  22.622  1.00 44.72  ? 230  LYS A CD  1 
ATOM   1321  C  CE  . LYS A 1 184 ? 50.389  37.456  22.154  1.00 45.31  ? 230  LYS A CE  1 
ATOM   1322  N  NZ  . LYS A 1 184 ? 49.965  37.334  20.723  1.00 45.78  ? 230  LYS A NZ  1 
ATOM   1323  N  N   . ILE A 1 185 ? 52.074  31.937  23.177  1.00 44.72  ? 231  ILE A N   1 
ATOM   1324  C  CA  . ILE A 1 185 ? 53.083  30.876  23.140  1.00 45.03  ? 231  ILE A CA  1 
ATOM   1325  C  C   . ILE A 1 185 ? 54.470  31.546  23.081  1.00 45.04  ? 231  ILE A C   1 
ATOM   1326  O  O   . ILE A 1 185 ? 54.762  32.328  22.165  1.00 44.84  ? 231  ILE A O   1 
ATOM   1327  C  CB  . ILE A 1 185 ? 52.808  29.842  21.977  1.00 45.04  ? 231  ILE A CB  1 
ATOM   1328  C  CG1 . ILE A 1 185 ? 53.802  28.658  21.990  1.00 45.37  ? 231  ILE A CG1 1 
ATOM   1329  C  CG2 . ILE A 1 185 ? 52.666  30.523  20.609  1.00 45.45  ? 231  ILE A CG2 1 
ATOM   1330  C  CD1 . ILE A 1 185 ? 55.126  28.843  21.232  1.00 45.09  ? 231  ILE A CD1 1 
ATOM   1331  N  N   . GLY A 1 186 ? 55.297  31.269  24.090  1.00 45.16  ? 232  GLY A N   1 
ATOM   1332  C  CA  . GLY A 1 186 ? 56.615  31.898  24.207  1.00 45.26  ? 232  GLY A CA  1 
ATOM   1333  C  C   . GLY A 1 186 ? 57.755  30.900  24.114  1.00 45.33  ? 232  GLY A C   1 
ATOM   1334  O  O   . GLY A 1 186 ? 57.509  29.695  23.990  1.00 45.53  ? 232  GLY A O   1 
ATOM   1335  N  N   . PRO A 1 187 ? 59.009  31.390  24.217  1.00 45.28  ? 233  PRO A N   1 
ATOM   1336  C  CA  . PRO A 1 187 ? 60.222  30.608  23.945  1.00 45.31  ? 233  PRO A CA  1 
ATOM   1337  C  C   . PRO A 1 187 ? 60.562  29.569  25.017  1.00 45.30  ? 233  PRO A C   1 
ATOM   1338  O  O   . PRO A 1 187 ? 61.548  28.833  24.864  1.00 45.47  ? 233  PRO A O   1 
ATOM   1339  C  CB  . PRO A 1 187 ? 61.318  31.676  23.879  1.00 45.19  ? 233  PRO A CB  1 
ATOM   1340  C  CG  . PRO A 1 187 ? 60.843  32.749  24.774  1.00 45.25  ? 233  PRO A CG  1 
ATOM   1341  C  CD  . PRO A 1 187 ? 59.336  32.764  24.644  1.00 45.35  ? 233  PRO A CD  1 
ATOM   1342  N  N   . GLU A 1 188 ? 59.764  29.522  26.088  1.00 45.19  ? 234  GLU A N   1 
ATOM   1343  C  CA  . GLU A 1 188 ? 59.918  28.511  27.152  1.00 45.18  ? 234  GLU A CA  1 
ATOM   1344  C  C   . GLU A 1 188 ? 58.608  28.172  27.904  1.00 44.78  ? 234  GLU A C   1 
ATOM   1345  O  O   . GLU A 1 188 ? 58.575  27.274  28.767  1.00 44.77  ? 234  GLU A O   1 
ATOM   1346  C  CB  . GLU A 1 188 ? 61.052  28.885  28.132  1.00 45.46  ? 234  GLU A CB  1 
ATOM   1347  C  CG  . GLU A 1 188 ? 61.331  30.395  28.303  1.00 46.25  ? 234  GLU A CG  1 
ATOM   1348  C  CD  . GLU A 1 188 ? 60.157  31.160  28.946  1.00 47.10  ? 234  GLU A CD  1 
ATOM   1349  O  OE1 . GLU A 1 188 ? 59.308  30.517  29.714  1.00 46.99  ? 234  GLU A OE1 1 
ATOM   1350  O  OE2 . GLU A 1 188 ? 60.098  32.416  28.681  1.00 47.54  ? 234  GLU A OE2 1 
ATOM   1351  N  N   . GLY A 1 189 ? 57.533  28.878  27.563  1.00 44.00  ? 235  GLY A N   1 
ATOM   1352  C  CA  . GLY A 1 189 ? 56.267  28.641  28.227  1.00 43.36  ? 235  GLY A CA  1 
ATOM   1353  C  C   . GLY A 1 189 ? 55.053  29.251  27.567  1.00 42.79  ? 235  GLY A C   1 
ATOM   1354  O  O   . GLY A 1 189 ? 55.149  30.240  26.832  1.00 42.99  ? 235  GLY A O   1 
ATOM   1355  N  N   . LEU A 1 190 ? 53.908  28.640  27.834  1.00 41.97  ? 236  LEU A N   1 
ATOM   1356  C  CA  . LEU A 1 190 ? 52.640  29.161  27.369  1.00 41.65  ? 236  LEU A CA  1 
ATOM   1357  C  C   . LEU A 1 190 ? 52.122  30.185  28.371  1.00 41.44  ? 236  LEU A C   1 
ATOM   1358  O  O   . LEU A 1 190 ? 51.734  29.837  29.499  1.00 41.37  ? 236  LEU A O   1 
ATOM   1359  C  CB  . LEU A 1 190 ? 51.611  28.026  27.171  1.00 41.59  ? 236  LEU A CB  1 
ATOM   1360  C  CG  . LEU A 1 190 ? 52.009  26.811  26.314  1.00 41.14  ? 236  LEU A CG  1 
ATOM   1361  C  CD1 . LEU A 1 190 ? 50.804  25.952  25.964  1.00 38.96  ? 236  LEU A CD1 1 
ATOM   1362  C  CD2 . LEU A 1 190 ? 52.749  27.233  25.040  1.00 39.70  ? 236  LEU A CD2 1 
ATOM   1363  N  N   . VAL A 1 191 ? 52.133  31.451  27.959  1.00 41.06  ? 237  VAL A N   1 
ATOM   1364  C  CA  . VAL A 1 191 ? 51.535  32.524  28.756  1.00 40.74  ? 237  VAL A CA  1 
ATOM   1365  C  C   . VAL A 1 191 ? 50.015  32.347  28.736  1.00 40.45  ? 237  VAL A C   1 
ATOM   1366  O  O   . VAL A 1 191 ? 49.354  32.562  27.715  1.00 40.18  ? 237  VAL A O   1 
ATOM   1367  C  CB  . VAL A 1 191 ? 51.945  33.939  28.263  1.00 40.79  ? 237  VAL A CB  1 
ATOM   1368  C  CG1 . VAL A 1 191 ? 51.589  35.007  29.311  1.00 40.53  ? 237  VAL A CG1 1 
ATOM   1369  C  CG2 . VAL A 1 191 ? 53.443  33.990  27.936  1.00 41.04  ? 237  VAL A CG2 1 
ATOM   1370  N  N   . THR A 1 192 ? 49.484  31.918  29.875  1.00 40.36  ? 238  THR A N   1 
ATOM   1371  C  CA  . THR A 1 192 ? 48.064  31.603  30.006  1.00 40.16  ? 238  THR A CA  1 
ATOM   1372  C  C   . THR A 1 192 ? 47.367  32.596  30.921  1.00 40.18  ? 238  THR A C   1 
ATOM   1373  O  O   . THR A 1 192 ? 47.936  33.049  31.913  1.00 40.24  ? 238  THR A O   1 
ATOM   1374  C  CB  . THR A 1 192 ? 47.838  30.162  30.551  1.00 40.11  ? 238  THR A CB  1 
ATOM   1375  O  OG1 . THR A 1 192 ? 48.492  30.003  31.820  1.00 39.22  ? 238  THR A OG1 1 
ATOM   1376  C  CG2 . THR A 1 192 ? 48.368  29.126  29.578  1.00 39.83  ? 238  THR A CG2 1 
ATOM   1377  N  N   . GLN A 1 193 ? 46.138  32.950  30.570  1.00 40.19  ? 239  GLN A N   1 
ATOM   1378  C  CA  . GLN A 1 193 ? 45.247  33.630  31.506  1.00 40.17  ? 239  GLN A CA  1 
ATOM   1379  C  C   . GLN A 1 193 ? 44.430  32.578  32.261  1.00 39.93  ? 239  GLN A C   1 
ATOM   1380  O  O   . GLN A 1 193 ? 44.035  31.563  31.681  1.00 39.70  ? 239  GLN A O   1 
ATOM   1381  C  CB  . GLN A 1 193 ? 44.325  34.574  30.752  1.00 40.27  ? 239  GLN A CB  1 
ATOM   1382  C  CG  . GLN A 1 193 ? 43.321  35.315  31.614  1.00 40.67  ? 239  GLN A CG  1 
ATOM   1383  C  CD  . GLN A 1 193 ? 42.790  36.557  30.927  1.00 41.01  ? 239  GLN A CD  1 
ATOM   1384  O  OE1 . GLN A 1 193 ? 42.490  36.539  29.727  1.00 41.76  ? 239  GLN A OE1 1 
ATOM   1385  N  NE2 . GLN A 1 193 ? 42.677  37.652  31.683  1.00 40.93  ? 239  GLN A NE2 1 
ATOM   1386  N  N   . VAL A 1 194 ? 44.192  32.810  33.550  1.00 39.83  ? 240  VAL A N   1 
ATOM   1387  C  CA  . VAL A 1 194 ? 43.407  31.867  34.347  1.00 39.85  ? 240  VAL A CA  1 
ATOM   1388  C  C   . VAL A 1 194 ? 41.937  32.060  34.031  1.00 39.97  ? 240  VAL A C   1 
ATOM   1389  O  O   . VAL A 1 194 ? 41.354  33.087  34.393  1.00 40.11  ? 240  VAL A O   1 
ATOM   1390  C  CB  . VAL A 1 194 ? 43.598  32.042  35.874  1.00 39.82  ? 240  VAL A CB  1 
ATOM   1391  C  CG1 . VAL A 1 194 ? 42.802  30.981  36.626  1.00 39.62  ? 240  VAL A CG1 1 
ATOM   1392  C  CG2 . VAL A 1 194 ? 45.060  31.979  36.270  1.00 39.43  ? 240  VAL A CG2 1 
ATOM   1393  N  N   . GLU A 1 195 ? 41.337  31.090  33.346  1.00 40.07  ? 241  GLU A N   1 
ATOM   1394  C  CA  . GLU A 1 195 ? 39.899  31.150  33.108  1.00 40.11  ? 241  GLU A CA  1 
ATOM   1395  C  C   . GLU A 1 195 ? 39.169  30.851  34.403  1.00 40.02  ? 241  GLU A C   1 
ATOM   1396  O  O   . GLU A 1 195 ? 38.463  31.706  34.919  1.00 40.30  ? 241  GLU A O   1 
ATOM   1397  C  CB  . GLU A 1 195 ? 39.454  30.209  31.992  1.00 40.17  ? 241  GLU A CB  1 
ATOM   1398  C  CG  . GLU A 1 195 ? 37.955  30.284  31.719  1.00 40.25  ? 241  GLU A CG  1 
ATOM   1399  C  CD  . GLU A 1 195 ? 37.526  29.509  30.487  1.00 40.45  ? 241  GLU A CD  1 
ATOM   1400  O  OE1 . GLU A 1 195 ? 37.911  28.324  30.342  1.00 39.43  ? 241  GLU A OE1 1 
ATOM   1401  O  OE2 . GLU A 1 195 ? 36.785  30.091  29.663  1.00 40.90  ? 241  GLU A OE2 1 
ATOM   1402  N  N   . ASN A 1 196 ? 39.355  29.650  34.934  1.00 40.00  ? 242  ASN A N   1 
ATOM   1403  C  CA  . ASN A 1 196 ? 38.767  29.303  36.211  1.00 40.30  ? 242  ASN A CA  1 
ATOM   1404  C  C   . ASN A 1 196 ? 39.816  29.189  37.273  1.00 40.65  ? 242  ASN A C   1 
ATOM   1405  O  O   . ASN A 1 196 ? 40.836  28.525  37.075  1.00 41.19  ? 242  ASN A O   1 
ATOM   1406  C  CB  . ASN A 1 196 ? 37.981  28.008  36.107  1.00 40.43  ? 242  ASN A CB  1 
ATOM   1407  C  CG  . ASN A 1 196 ? 36.653  28.205  35.430  1.00 40.38  ? 242  ASN A CG  1 
ATOM   1408  O  OD1 . ASN A 1 196 ? 35.986  29.225  35.630  1.00 40.12  ? 242  ASN A OD1 1 
ATOM   1409  N  ND2 . ASN A 1 196 ? 36.264  27.241  34.613  1.00 40.78  ? 242  ASN A ND2 1 
ATOM   1410  N  N   . GLY A 1 197 ? 39.576  29.844  38.404  1.00 40.89  ? 243  GLY A N   1 
ATOM   1411  C  CA  . GLY A 1 197 ? 40.572  29.876  39.487  1.00 40.78  ? 243  GLY A CA  1 
ATOM   1412  C  C   . GLY A 1 197 ? 40.390  28.775  40.513  1.00 40.37  ? 243  GLY A C   1 
ATOM   1413  O  O   . GLY A 1 197 ? 39.482  27.941  40.382  1.00 40.54  ? 243  GLY A O   1 
ATOM   1414  N  N   . GLY A 1 198 ? 41.249  28.770  41.532  1.00 39.92  ? 244  GLY A N   1 
ATOM   1415  C  CA  . GLY A 1 198 ? 41.167  27.767  42.594  1.00 39.50  ? 244  GLY A CA  1 
ATOM   1416  C  C   . GLY A 1 198 ? 42.472  27.246  43.185  1.00 39.32  ? 244  GLY A C   1 
ATOM   1417  O  O   . GLY A 1 198 ? 43.558  27.367  42.604  1.00 38.86  ? 244  GLY A O   1 
ATOM   1418  N  N   . VAL A 1 199 ? 42.329  26.630  44.353  1.00 39.13  ? 245  VAL A N   1 
ATOM   1419  C  CA  . VAL A 1 199 ? 43.440  26.128  45.144  1.00 38.75  ? 245  VAL A CA  1 
ATOM   1420  C  C   . VAL A 1 199 ? 44.089  24.898  44.478  1.00 38.58  ? 245  VAL A C   1 
ATOM   1421  O  O   . VAL A 1 199 ? 43.481  23.827  44.383  1.00 38.34  ? 245  VAL A O   1 
ATOM   1422  C  CB  . VAL A 1 199 ? 42.953  25.803  46.585  1.00 38.78  ? 245  VAL A CB  1 
ATOM   1423  C  CG1 . VAL A 1 199 ? 44.093  25.314  47.442  1.00 38.74  ? 245  VAL A CG1 1 
ATOM   1424  C  CG2 . VAL A 1 199 ? 42.293  27.028  47.227  1.00 38.28  ? 245  VAL A CG2 1 
ATOM   1425  N  N   . LEU A 1 200 ? 45.327  25.058  44.017  1.00 38.26  ? 246  LEU A N   1 
ATOM   1426  C  CA  . LEU A 1 200 ? 46.037  23.979  43.323  1.00 38.01  ? 246  LEU A CA  1 
ATOM   1427  C  C   . LEU A 1 200 ? 47.021  23.258  44.248  1.00 38.19  ? 246  LEU A C   1 
ATOM   1428  O  O   . LEU A 1 200 ? 47.705  23.901  45.054  1.00 38.36  ? 246  LEU A O   1 
ATOM   1429  C  CB  . LEU A 1 200 ? 46.758  24.541  42.097  1.00 37.65  ? 246  LEU A CB  1 
ATOM   1430  C  CG  . LEU A 1 200 ? 47.872  23.739  41.438  1.00 37.08  ? 246  LEU A CG  1 
ATOM   1431  C  CD1 . LEU A 1 200 ? 47.305  22.586  40.647  1.00 36.56  ? 246  LEU A CD1 1 
ATOM   1432  C  CD2 . LEU A 1 200 ? 48.671  24.649  40.532  1.00 37.52  ? 246  LEU A CD2 1 
ATOM   1433  N  N   . GLY A 1 201 ? 47.085  21.929  44.130  1.00 38.11  ? 247  GLY A N   1 
ATOM   1434  C  CA  . GLY A 1 201 ? 48.028  21.118  44.905  1.00 37.82  ? 247  GLY A CA  1 
ATOM   1435  C  C   . GLY A 1 201 ? 49.241  20.651  44.108  1.00 37.88  ? 247  GLY A C   1 
ATOM   1436  O  O   . GLY A 1 201 ? 49.612  21.263  43.096  1.00 37.69  ? 247  GLY A O   1 
ATOM   1437  N  N   . SER A 1 202 ? 49.864  19.567  44.578  1.00 37.85  ? 248  SER A N   1 
ATOM   1438  C  CA  . SER A 1 202 ? 51.084  19.036  43.972  1.00 37.83  ? 248  SER A CA  1 
ATOM   1439  C  C   . SER A 1 202 ? 50.773  17.814  43.132  1.00 38.03  ? 248  SER A C   1 
ATOM   1440  O  O   . SER A 1 202 ? 50.147  16.864  43.613  1.00 38.02  ? 248  SER A O   1 
ATOM   1441  C  CB  . SER A 1 202 ? 52.115  18.653  45.041  1.00 37.71  ? 248  SER A CB  1 
ATOM   1442  O  OG  . SER A 1 202 ? 52.500  19.768  45.823  1.00 37.83  ? 248  SER A OG  1 
ATOM   1443  N  N   . ARG A 1 203 ? 51.231  17.849  41.881  1.00 37.99  ? 249  ARG A N   1 
ATOM   1444  C  CA  . ARG A 1 203 ? 51.204  16.696  41.000  1.00 38.02  ? 249  ARG A CA  1 
ATOM   1445  C  C   . ARG A 1 203 ? 49.762  16.365  40.658  1.00 38.14  ? 249  ARG A C   1 
ATOM   1446  O  O   . ARG A 1 203 ? 49.272  15.253  40.904  1.00 37.99  ? 249  ARG A O   1 
ATOM   1447  C  CB  . ARG A 1 203 ? 51.919  15.482  41.634  1.00 38.00  ? 249  ARG A CB  1 
ATOM   1448  C  CG  . ARG A 1 203 ? 53.427  15.649  41.874  1.00 38.44  ? 249  ARG A CG  1 
ATOM   1449  C  CD  . ARG A 1 203 ? 54.206  14.325  41.735  1.00 38.97  ? 249  ARG A CD  1 
ATOM   1450  N  NE  . ARG A 1 203 ? 54.082  13.766  40.381  1.00 39.80  ? 249  ARG A NE  1 
ATOM   1451  C  CZ  . ARG A 1 203 ? 53.767  12.501  40.085  1.00 39.56  ? 249  ARG A CZ  1 
ATOM   1452  N  NH1 . ARG A 1 203 ? 53.571  11.602  41.044  1.00 38.76  ? 249  ARG A NH1 1 
ATOM   1453  N  NH2 . ARG A 1 203 ? 53.664  12.127  38.812  1.00 39.00  ? 249  ARG A NH2 1 
ATOM   1454  N  N   . LYS A 1 204 ? 49.063  17.336  40.097  1.00 38.17  ? 250  LYS A N   1 
ATOM   1455  C  CA  . LYS A 1 204 ? 47.669  17.083  39.777  1.00 38.31  ? 250  LYS A CA  1 
ATOM   1456  C  C   . LYS A 1 204 ? 47.443  16.900  38.299  1.00 37.79  ? 250  LYS A C   1 
ATOM   1457  O  O   . LYS A 1 204 ? 48.267  17.319  37.502  1.00 37.79  ? 250  LYS A O   1 
ATOM   1458  C  CB  . LYS A 1 204 ? 46.743  18.095  40.452  1.00 38.55  ? 250  LYS A CB  1 
ATOM   1459  C  CG  . LYS A 1 204 ? 46.490  17.658  41.914  1.00 39.16  ? 250  LYS A CG  1 
ATOM   1460  C  CD  . LYS A 1 204 ? 45.846  18.722  42.787  1.00 39.89  ? 250  LYS A CD  1 
ATOM   1461  C  CE  . LYS A 1 204 ? 45.989  18.351  44.257  1.00 39.92  ? 250  LYS A CE  1 
ATOM   1462  N  NZ  . LYS A 1 204 ? 45.670  16.931  44.470  1.00 39.93  ? 250  LYS A NZ  1 
ATOM   1463  N  N   . GLY A 1 205 ? 46.349  16.222  37.957  1.00 37.46  ? 251  GLY A N   1 
ATOM   1464  C  CA  . GLY A 1 205 ? 46.086  15.782  36.584  1.00 36.77  ? 251  GLY A CA  1 
ATOM   1465  C  C   . GLY A 1 205 ? 45.705  16.894  35.632  1.00 36.37  ? 251  GLY A C   1 
ATOM   1466  O  O   . GLY A 1 205 ? 44.839  17.715  35.935  1.00 36.53  ? 251  GLY A O   1 
ATOM   1467  N  N   . VAL A 1 206 ? 46.357  16.901  34.476  1.00 36.04  ? 252  VAL A N   1 
ATOM   1468  C  CA  . VAL A 1 206 ? 46.168  17.914  33.456  1.00 35.81  ? 252  VAL A CA  1 
ATOM   1469  C  C   . VAL A 1 206 ? 45.543  17.242  32.246  1.00 35.82  ? 252  VAL A C   1 
ATOM   1470  O  O   . VAL A 1 206 ? 45.881  16.104  31.919  1.00 35.78  ? 252  VAL A O   1 
ATOM   1471  C  CB  . VAL A 1 206 ? 47.523  18.552  33.068  1.00 36.09  ? 252  VAL A CB  1 
ATOM   1472  C  CG1 . VAL A 1 206 ? 47.371  19.552  31.920  1.00 37.02  ? 252  VAL A CG1 1 
ATOM   1473  C  CG2 . VAL A 1 206 ? 48.157  19.241  34.268  1.00 36.03  ? 252  VAL A CG2 1 
ATOM   1474  N  N   . ASN A 1 207 ? 44.626  17.951  31.594  1.00 35.93  ? 253  ASN A N   1 
ATOM   1475  C  CA  . ASN A 1 207 ? 43.927  17.462  30.406  1.00 36.21  ? 253  ASN A CA  1 
ATOM   1476  C  C   . ASN A 1 207 ? 44.011  18.464  29.250  1.00 36.62  ? 253  ASN A C   1 
ATOM   1477  O  O   . ASN A 1 207 ? 44.158  19.669  29.482  1.00 36.90  ? 253  ASN A O   1 
ATOM   1478  C  CB  . ASN A 1 207 ? 42.470  17.205  30.739  1.00 36.12  ? 253  ASN A CB  1 
ATOM   1479  C  CG  . ASN A 1 207 ? 42.288  16.119  31.781  1.00 36.31  ? 253  ASN A CG  1 
ATOM   1480  O  OD1 . ASN A 1 207 ? 41.939  14.981  31.438  1.00 36.12  ? 253  ASN A OD1 1 
ATOM   1481  N  ND2 . ASN A 1 207 ? 42.500  16.462  33.064  1.00 35.03  ? 253  ASN A ND2 1 
ATOM   1482  N  N   . LEU A 1 208 ? 43.923  17.979  28.011  1.00 36.76  ? 254  LEU A N   1 
ATOM   1483  C  CA  . LEU A 1 208 ? 44.092  18.860  26.842  1.00 37.17  ? 254  LEU A CA  1 
ATOM   1484  C  C   . LEU A 1 208 ? 43.086  18.569  25.729  1.00 37.70  ? 254  LEU A C   1 
ATOM   1485  O  O   . LEU A 1 208 ? 43.433  17.931  24.727  1.00 37.68  ? 254  LEU A O   1 
ATOM   1486  C  CB  . LEU A 1 208 ? 45.522  18.786  26.285  1.00 36.93  ? 254  LEU A CB  1 
ATOM   1487  C  CG  . LEU A 1 208 ? 46.708  18.858  27.249  1.00 36.43  ? 254  LEU A CG  1 
ATOM   1488  C  CD1 . LEU A 1 208 ? 47.986  18.577  26.494  1.00 36.86  ? 254  LEU A CD1 1 
ATOM   1489  C  CD2 . LEU A 1 208 ? 46.773  20.199  27.928  1.00 35.85  ? 254  LEU A CD2 1 
ATOM   1490  N  N   . PRO A 1 209 ? 41.844  19.068  25.886  1.00 38.20  ? 255  PRO A N   1 
ATOM   1491  C  CA  . PRO A 1 209 ? 40.762  18.742  24.953  1.00 38.78  ? 255  PRO A CA  1 
ATOM   1492  C  C   . PRO A 1 209 ? 41.010  19.381  23.588  1.00 39.22  ? 255  PRO A C   1 
ATOM   1493  O  O   . PRO A 1 209 ? 41.516  20.501  23.531  1.00 39.01  ? 255  PRO A O   1 
ATOM   1494  C  CB  . PRO A 1 209 ? 39.517  19.356  25.614  1.00 38.65  ? 255  PRO A CB  1 
ATOM   1495  C  CG  . PRO A 1 209 ? 39.944  19.778  26.979  1.00 38.37  ? 255  PRO A CG  1 
ATOM   1496  C  CD  . PRO A 1 209 ? 41.403  20.006  26.933  1.00 37.91  ? 255  PRO A CD  1 
ATOM   1497  N  N   . GLY A 1 210 ? 40.670  18.665  22.512  1.00 39.82  ? 256  GLY A N   1 
ATOM   1498  C  CA  . GLY A 1 210 ? 40.894  19.138  21.135  1.00 40.77  ? 256  GLY A CA  1 
ATOM   1499  C  C   . GLY A 1 210 ? 42.345  19.014  20.684  1.00 41.42  ? 256  GLY A C   1 
ATOM   1500  O  O   . GLY A 1 210 ? 42.640  18.862  19.487  1.00 41.07  ? 256  GLY A O   1 
ATOM   1501  N  N   . ALA A 1 211 ? 43.252  19.097  21.655  1.00 41.99  ? 257  ALA A N   1 
ATOM   1502  C  CA  . ALA A 1 211 ? 44.658  18.839  21.427  1.00 42.57  ? 257  ALA A CA  1 
ATOM   1503  C  C   . ALA A 1 211 ? 44.901  17.323  21.495  1.00 42.94  ? 257  ALA A C   1 
ATOM   1504  O  O   . ALA A 1 211 ? 44.548  16.666  22.488  1.00 42.87  ? 257  ALA A O   1 
ATOM   1505  C  CB  . ALA A 1 211 ? 45.489  19.586  22.454  1.00 42.50  ? 257  ALA A CB  1 
ATOM   1506  N  N   . GLN A 1 212 ? 45.471  16.779  20.418  1.00 43.34  ? 258  GLN A N   1 
ATOM   1507  C  CA  . GLN A 1 212 ? 45.742  15.342  20.286  1.00 43.84  ? 258  GLN A CA  1 
ATOM   1508  C  C   . GLN A 1 212 ? 47.013  14.934  21.037  1.00 44.21  ? 258  GLN A C   1 
ATOM   1509  O  O   . GLN A 1 212 ? 48.024  15.636  20.977  1.00 44.47  ? 258  GLN A O   1 
ATOM   1510  C  CB  . GLN A 1 212 ? 45.855  14.967  18.804  1.00 43.87  ? 258  GLN A CB  1 
ATOM   1511  C  CG  . GLN A 1 212 ? 46.962  15.710  18.034  1.00 43.88  ? 258  GLN A CG  1 
ATOM   1512  C  CD  . GLN A 1 212 ? 46.491  16.221  16.685  1.00 44.36  ? 258  GLN A CD  1 
ATOM   1513  O  OE1 . GLN A 1 212 ? 46.815  15.619  15.630  1.00 44.89  ? 258  GLN A OE1 1 
ATOM   1514  N  NE2 . GLN A 1 212 ? 45.715  17.341  16.708  1.00 44.36  ? 258  GLN A NE2 1 
ATOM   1515  N  N   . VAL A 1 213 ? 46.957  13.796  21.735  1.00 44.75  ? 259  VAL A N   1 
ATOM   1516  C  CA  . VAL A 1 213 ? 48.068  13.337  22.589  1.00 45.06  ? 259  VAL A CA  1 
ATOM   1517  C  C   . VAL A 1 213 ? 48.782  12.146  21.930  1.00 45.31  ? 259  VAL A C   1 
ATOM   1518  O  O   . VAL A 1 213 ? 48.226  11.519  21.022  1.00 45.25  ? 259  VAL A O   1 
ATOM   1519  C  CB  . VAL A 1 213 ? 47.574  12.984  24.038  1.00 45.15  ? 259  VAL A CB  1 
ATOM   1520  C  CG1 . VAL A 1 213 ? 48.749  12.784  25.001  1.00 45.13  ? 259  VAL A CG1 1 
ATOM   1521  C  CG2 . VAL A 1 213 ? 46.647  14.074  24.578  1.00 44.76  ? 259  VAL A CG2 1 
ATOM   1522  N  N   . ASP A 1 214 ? 50.004  11.842  22.381  1.00 45.67  ? 260  ASP A N   1 
ATOM   1523  C  CA  . ASP A 1 214 ? 50.832  10.790  21.757  1.00 46.20  ? 260  ASP A CA  1 
ATOM   1524  C  C   . ASP A 1 214 ? 51.591  9.822   22.711  1.00 46.40  ? 260  ASP A C   1 
ATOM   1525  O  O   . ASP A 1 214 ? 52.490  9.080   22.270  1.00 46.57  ? 260  ASP A O   1 
ATOM   1526  C  CB  . ASP A 1 214 ? 51.788  11.408  20.712  1.00 46.29  ? 260  ASP A CB  1 
ATOM   1527  C  CG  . ASP A 1 214 ? 52.516  12.654  21.226  1.00 46.76  ? 260  ASP A CG  1 
ATOM   1528  O  OD1 . ASP A 1 214 ? 52.573  12.859  22.463  1.00 46.66  ? 260  ASP A OD1 1 
ATOM   1529  O  OD2 . ASP A 1 214 ? 53.037  13.426  20.383  1.00 47.08  ? 260  ASP A OD2 1 
ATOM   1530  N  N   . LEU A 1 215 ? 51.215  9.829   23.997  1.00 46.48  ? 261  LEU A N   1 
ATOM   1531  C  CA  . LEU A 1 215 ? 51.726  8.905   25.035  1.00 46.68  ? 261  LEU A CA  1 
ATOM   1532  C  C   . LEU A 1 215 ? 51.122  7.499   24.798  1.00 46.60  ? 261  LEU A C   1 
ATOM   1533  O  O   . LEU A 1 215 ? 49.973  7.400   24.354  1.00 46.68  ? 261  LEU A O   1 
ATOM   1534  C  CB  . LEU A 1 215 ? 51.372  9.452   26.436  1.00 46.67  ? 261  LEU A CB  1 
ATOM   1535  C  CG  . LEU A 1 215 ? 52.297  9.222   27.655  1.00 47.30  ? 261  LEU A CG  1 
ATOM   1536  C  CD1 . LEU A 1 215 ? 53.768  9.589   27.359  1.00 48.62  ? 261  LEU A CD1 1 
ATOM   1537  C  CD2 . LEU A 1 215 ? 51.816  9.964   28.911  1.00 48.19  ? 261  LEU A CD2 1 
ATOM   1538  N  N   . PRO A 1 216 ? 51.895  6.417   25.058  1.00 46.47  ? 262  PRO A N   1 
ATOM   1539  C  CA  . PRO A 1 216 ? 51.350  5.071   24.785  1.00 46.48  ? 262  PRO A CA  1 
ATOM   1540  C  C   . PRO A 1 216 ? 50.227  4.695   25.736  1.00 46.74  ? 262  PRO A C   1 
ATOM   1541  O  O   . PRO A 1 216 ? 50.155  5.214   26.869  1.00 46.85  ? 262  PRO A O   1 
ATOM   1542  C  CB  . PRO A 1 216 ? 52.537  4.132   25.009  1.00 46.41  ? 262  PRO A CB  1 
ATOM   1543  C  CG  . PRO A 1 216 ? 53.551  4.928   25.793  1.00 46.56  ? 262  PRO A CG  1 
ATOM   1544  C  CD  . PRO A 1 216 ? 53.264  6.386   25.611  1.00 46.32  ? 262  PRO A CD  1 
ATOM   1545  N  N   . GLY A 1 217 ? 49.361  3.795   25.277  1.00 46.63  ? 263  GLY A N   1 
ATOM   1546  C  CA  . GLY A 1 217 ? 48.280  3.298   26.136  1.00 46.78  ? 263  GLY A CA  1 
ATOM   1547  C  C   . GLY A 1 217 ? 48.845  2.429   27.249  1.00 46.62  ? 263  GLY A C   1 
ATOM   1548  O  O   . GLY A 1 217 ? 48.262  2.322   28.335  1.00 47.22  ? 263  GLY A O   1 
ATOM   1549  N  N   . LEU A 1 218 ? 49.999  1.822   26.962  1.00 45.88  ? 264  LEU A N   1 
ATOM   1550  C  CA  . LEU A 1 218 ? 50.630  0.897   27.883  1.00 44.74  ? 264  LEU A CA  1 
ATOM   1551  C  C   . LEU A 1 218 ? 52.096  1.252   28.020  1.00 44.32  ? 264  LEU A C   1 
ATOM   1552  O  O   . LEU A 1 218 ? 52.883  1.058   27.092  1.00 44.31  ? 264  LEU A O   1 
ATOM   1553  C  CB  . LEU A 1 218 ? 50.452  -0.536  27.388  1.00 44.46  ? 264  LEU A CB  1 
ATOM   1554  C  CG  . LEU A 1 218 ? 49.847  -1.519  28.395  1.00 43.81  ? 264  LEU A CG  1 
ATOM   1555  C  CD1 . LEU A 1 218 ? 48.455  -1.101  28.826  1.00 42.35  ? 264  LEU A CD1 1 
ATOM   1556  C  CD2 . LEU A 1 218 ? 49.810  -2.936  27.794  1.00 43.86  ? 264  LEU A CD2 1 
ATOM   1557  N  N   . SER A 1 219 ? 52.442  1.792   29.185  1.00 43.68  ? 265  SER A N   1 
ATOM   1558  C  CA  . SER A 1 219 ? 53.800  2.188   29.513  1.00 43.50  ? 265  SER A CA  1 
ATOM   1559  C  C   . SER A 1 219 ? 54.524  1.032   30.176  1.00 43.57  ? 265  SER A C   1 
ATOM   1560  O  O   . SER A 1 219 ? 53.905  0.014   30.524  1.00 43.24  ? 265  SER A O   1 
ATOM   1561  C  CB  . SER A 1 219 ? 53.763  3.343   30.493  1.00 43.23  ? 265  SER A CB  1 
ATOM   1562  O  OG  . SER A 1 219 ? 53.139  2.915   31.696  1.00 43.94  ? 265  SER A OG  1 
ATOM   1563  N  N   . GLU A 1 220 ? 55.833  1.192   30.369  1.00 43.61  ? 266  GLU A N   1 
ATOM   1564  C  CA  . GLU A 1 220 ? 56.573  0.179   31.090  1.00 43.85  ? 266  GLU A CA  1 
ATOM   1565  C  C   . GLU A 1 220 ? 55.843  -0.131  32.423  1.00 43.65  ? 266  GLU A C   1 
ATOM   1566  O  O   . GLU A 1 220 ? 55.553  -1.300  32.713  1.00 43.69  ? 266  GLU A O   1 
ATOM   1567  C  CB  . GLU A 1 220 ? 58.046  0.558   31.251  1.00 43.74  ? 266  GLU A CB  1 
ATOM   1568  C  CG  . GLU A 1 220 ? 58.966  -0.564  30.746  1.00 46.13  ? 266  GLU A CG  1 
ATOM   1569  C  CD  . GLU A 1 220 ? 60.419  -0.128  30.434  1.00 48.88  ? 266  GLU A CD  1 
ATOM   1570  O  OE1 . GLU A 1 220 ? 61.010  0.662   31.212  1.00 49.67  ? 266  GLU A OE1 1 
ATOM   1571  O  OE2 . GLU A 1 220 ? 60.992  -0.604  29.419  1.00 48.66  ? 266  GLU A OE2 1 
ATOM   1572  N  N   . GLN A 1 221 ? 55.472  0.892   33.191  1.00 43.31  ? 267  GLN A N   1 
ATOM   1573  C  CA  . GLN A 1 221 ? 54.756  0.633   34.438  1.00 43.47  ? 267  GLN A CA  1 
ATOM   1574  C  C   . GLN A 1 221 ? 53.468  -0.169  34.266  1.00 43.23  ? 267  GLN A C   1 
ATOM   1575  O  O   . GLN A 1 221 ? 53.310  -1.191  34.907  1.00 43.28  ? 267  GLN A O   1 
ATOM   1576  C  CB  . GLN A 1 221 ? 54.462  1.910   35.225  1.00 43.84  ? 267  GLN A CB  1 
ATOM   1577  C  CG  . GLN A 1 221 ? 54.037  1.644   36.686  1.00 45.09  ? 267  GLN A CG  1 
ATOM   1578  C  CD  . GLN A 1 221 ? 55.115  0.890   37.492  1.00 47.52  ? 267  GLN A CD  1 
ATOM   1579  O  OE1 . GLN A 1 221 ? 56.326  1.057   37.262  1.00 49.32  ? 267  GLN A OE1 1 
ATOM   1580  N  NE2 . GLN A 1 221 ? 54.675  0.046   38.425  1.00 47.25  ? 267  GLN A NE2 1 
ATOM   1581  N  N   . ASP A 1 222 ? 52.550  0.271   33.413  1.00 42.89  ? 268  ASP A N   1 
ATOM   1582  C  CA  . ASP A 1 222 ? 51.307  -0.499  33.203  1.00 42.87  ? 268  ASP A CA  1 
ATOM   1583  C  C   . ASP A 1 222 ? 51.581  -2.004  33.039  1.00 42.66  ? 268  ASP A C   1 
ATOM   1584  O  O   . ASP A 1 222 ? 51.022  -2.826  33.766  1.00 43.05  ? 268  ASP A O   1 
ATOM   1585  C  CB  . ASP A 1 222 ? 50.518  0.050   32.022  1.00 42.81  ? 268  ASP A CB  1 
ATOM   1586  C  CG  . ASP A 1 222 ? 50.224  1.528   32.163  1.00 44.28  ? 268  ASP A CG  1 
ATOM   1587  O  OD1 . ASP A 1 222 ? 49.409  1.892   33.032  1.00 45.40  ? 268  ASP A OD1 1 
ATOM   1588  O  OD2 . ASP A 1 222 ? 50.807  2.338   31.415  1.00 45.28  ? 268  ASP A OD2 1 
ATOM   1589  N  N   . VAL A 1 223 ? 52.474  -2.346  32.107  1.00 42.26  ? 269  VAL A N   1 
ATOM   1590  C  CA  . VAL A 1 223 ? 52.889  -3.736  31.869  1.00 41.58  ? 269  VAL A CA  1 
ATOM   1591  C  C   . VAL A 1 223 ? 53.289  -4.409  33.186  1.00 41.45  ? 269  VAL A C   1 
ATOM   1592  O  O   . VAL A 1 223 ? 52.791  -5.496  33.493  1.00 41.43  ? 269  VAL A O   1 
ATOM   1593  C  CB  . VAL A 1 223 ? 54.020  -3.856  30.759  1.00 41.56  ? 269  VAL A CB  1 
ATOM   1594  C  CG1 . VAL A 1 223 ? 54.801  -5.198  30.852  1.00 40.82  ? 269  VAL A CG1 1 
ATOM   1595  C  CG2 . VAL A 1 223 ? 53.426  -3.668  29.377  1.00 40.16  ? 269  VAL A CG2 1 
ATOM   1596  N  N   . ARG A 1 224 ? 54.162  -3.757  33.957  1.00 41.08  ? 270  ARG A N   1 
ATOM   1597  C  CA  . ARG A 1 224 ? 54.531  -4.264  35.276  1.00 41.20  ? 270  ARG A CA  1 
ATOM   1598  C  C   . ARG A 1 224 ? 53.274  -4.447  36.143  1.00 40.83  ? 270  ARG A C   1 
ATOM   1599  O  O   . ARG A 1 224 ? 53.087  -5.482  36.780  1.00 40.90  ? 270  ARG A O   1 
ATOM   1600  C  CB  . ARG A 1 224 ? 55.514  -3.322  35.979  1.00 41.18  ? 270  ARG A CB  1 
ATOM   1601  C  CG  . ARG A 1 224 ? 56.975  -3.652  35.784  1.00 42.47  ? 270  ARG A CG  1 
ATOM   1602  C  CD  . ARG A 1 224 ? 57.838  -2.701  36.601  1.00 45.85  ? 270  ARG A CD  1 
ATOM   1603  N  NE  . ARG A 1 224 ? 57.937  -1.384  35.973  1.00 48.70  ? 270  ARG A NE  1 
ATOM   1604  C  CZ  . ARG A 1 224 ? 59.050  -0.901  35.424  1.00 51.34  ? 270  ARG A CZ  1 
ATOM   1605  N  NH1 . ARG A 1 224 ? 60.179  -1.616  35.448  1.00 53.21  ? 270  ARG A NH1 1 
ATOM   1606  N  NH2 . ARG A 1 224 ? 59.043  0.310   34.865  1.00 51.82  ? 270  ARG A NH2 1 
ATOM   1607  N  N   . ASP A 1 225 ? 52.409  -3.439  36.145  1.00 40.53  ? 271  ASP A N   1 
ATOM   1608  C  CA  . ASP A 1 225 ? 51.214  -3.470  36.955  1.00 40.28  ? 271  ASP A CA  1 
ATOM   1609  C  C   . ASP A 1 225 ? 50.346  -4.648  36.522  1.00 40.43  ? 271  ASP A C   1 
ATOM   1610  O  O   . ASP A 1 225 ? 49.787  -5.364  37.371  1.00 40.21  ? 271  ASP A O   1 
ATOM   1611  C  CB  . ASP A 1 225 ? 50.459  -2.142  36.852  1.00 40.05  ? 271  ASP A CB  1 
ATOM   1612  C  CG  . ASP A 1 225 ? 51.169  -1.012  37.563  1.00 39.37  ? 271  ASP A CG  1 
ATOM   1613  O  OD1 . ASP A 1 225 ? 52.234  -1.245  38.137  1.00 37.67  ? 271  ASP A OD1 1 
ATOM   1614  O  OD2 . ASP A 1 225 ? 50.657  0.118   37.574  1.00 41.42  ? 271  ASP A OD2 1 
ATOM   1615  N  N   . LEU A 1 226 ? 50.269  -4.883  35.208  1.00 40.13  ? 272  LEU A N   1 
ATOM   1616  C  CA  . LEU A 1 226 ? 49.424  -5.956  34.719  1.00 39.96  ? 272  LEU A CA  1 
ATOM   1617  C  C   . LEU A 1 226 ? 49.968  -7.300  35.161  1.00 40.21  ? 272  LEU A C   1 
ATOM   1618  O  O   . LEU A 1 226 ? 49.238  -8.091  35.758  1.00 39.98  ? 272  LEU A O   1 
ATOM   1619  C  CB  . LEU A 1 226 ? 49.167  -5.855  33.218  1.00 39.40  ? 272  LEU A CB  1 
ATOM   1620  C  CG  . LEU A 1 226 ? 48.261  -4.683  32.821  1.00 39.12  ? 272  LEU A CG  1 
ATOM   1621  C  CD1 . LEU A 1 226 ? 48.420  -4.344  31.351  1.00 39.92  ? 272  LEU A CD1 1 
ATOM   1622  C  CD2 . LEU A 1 226 ? 46.773  -4.915  33.160  1.00 38.19  ? 272  LEU A CD2 1 
ATOM   1623  N  N   . ARG A 1 227 ? 51.261  -7.528  34.923  1.00 40.79  ? 273  ARG A N   1 
ATOM   1624  C  CA  . ARG A 1 227 ? 51.941  -8.753  35.383  1.00 41.40  ? 273  ARG A CA  1 
ATOM   1625  C  C   . ARG A 1 227 ? 51.715  -9.010  36.874  1.00 41.22  ? 273  ARG A C   1 
ATOM   1626  O  O   . ARG A 1 227 ? 51.536  -10.158 37.285  1.00 41.05  ? 273  ARG A O   1 
ATOM   1627  C  CB  . ARG A 1 227 ? 53.445  -8.701  35.113  1.00 41.64  ? 273  ARG A CB  1 
ATOM   1628  C  CG  . ARG A 1 227 ? 53.867  -8.225  33.723  1.00 43.83  ? 273  ARG A CG  1 
ATOM   1629  C  CD  . ARG A 1 227 ? 53.155  -8.956  32.590  1.00 46.58  ? 273  ARG A CD  1 
ATOM   1630  N  NE  . ARG A 1 227 ? 53.865  -10.147 32.088  1.00 48.66  ? 273  ARG A NE  1 
ATOM   1631  C  CZ  . ARG A 1 227 ? 53.531  -11.419 32.344  1.00 49.54  ? 273  ARG A CZ  1 
ATOM   1632  N  NH1 . ARG A 1 227 ? 52.505  -11.736 33.130  1.00 49.43  ? 273  ARG A NH1 1 
ATOM   1633  N  NH2 . ARG A 1 227 ? 54.235  -12.397 31.806  1.00 48.72  ? 273  ARG A NH2 1 
ATOM   1634  N  N   . PHE A 1 228 ? 51.732  -7.931  37.660  1.00 41.10  ? 274  PHE A N   1 
ATOM   1635  C  CA  . PHE A 1 228 ? 51.365  -7.956  39.071  1.00 41.29  ? 274  PHE A CA  1 
ATOM   1636  C  C   . PHE A 1 228 ? 49.957  -8.526  39.243  1.00 41.45  ? 274  PHE A C   1 
ATOM   1637  O  O   . PHE A 1 228 ? 49.758  -9.452  40.043  1.00 41.69  ? 274  PHE A O   1 
ATOM   1638  C  CB  . PHE A 1 228 ? 51.464  -6.544  39.695  1.00 41.06  ? 274  PHE A CB  1 
ATOM   1639  C  CG  . PHE A 1 228 ? 51.092  -6.491  41.150  1.00 41.25  ? 274  PHE A CG  1 
ATOM   1640  C  CD1 . PHE A 1 228 ? 52.067  -6.590  42.127  1.00 39.88  ? 274  PHE A CD1 1 
ATOM   1641  C  CD2 . PHE A 1 228 ? 49.730  -6.353  41.551  1.00 42.46  ? 274  PHE A CD2 1 
ATOM   1642  C  CE1 . PHE A 1 228 ? 51.716  -6.543  43.477  1.00 40.04  ? 274  PHE A CE1 1 
ATOM   1643  C  CE2 . PHE A 1 228 ? 49.360  -6.311  42.915  1.00 41.36  ? 274  PHE A CE2 1 
ATOM   1644  C  CZ  . PHE A 1 228 ? 50.344  -6.397  43.875  1.00 40.85  ? 274  PHE A CZ  1 
ATOM   1645  N  N   . GLY A 1 229 ? 48.998  -7.983  38.487  1.00 41.57  ? 275  GLY A N   1 
ATOM   1646  C  CA  . GLY A 1 229 ? 47.604  -8.425  38.560  1.00 41.55  ? 275  GLY A CA  1 
ATOM   1647  C  C   . GLY A 1 229 ? 47.473  -9.912  38.303  1.00 41.63  ? 275  GLY A C   1 
ATOM   1648  O  O   . GLY A 1 229 ? 46.707  -10.610 38.974  1.00 41.93  ? 275  GLY A O   1 
ATOM   1649  N  N   . VAL A 1 230 ? 48.242  -10.406 37.342  1.00 41.31  ? 276  VAL A N   1 
ATOM   1650  C  CA  . VAL A 1 230 ? 48.210  -11.825 37.051  1.00 41.20  ? 276  VAL A CA  1 
ATOM   1651  C  C   . VAL A 1 230 ? 48.639  -12.589 38.283  1.00 41.25  ? 276  VAL A C   1 
ATOM   1652  O  O   . VAL A 1 230 ? 47.883  -13.406 38.788  1.00 41.37  ? 276  VAL A O   1 
ATOM   1653  C  CB  . VAL A 1 230 ? 49.097  -12.213 35.857  1.00 41.16  ? 276  VAL A CB  1 
ATOM   1654  C  CG1 . VAL A 1 230 ? 49.012  -13.701 35.610  1.00 40.30  ? 276  VAL A CG1 1 
ATOM   1655  C  CG2 . VAL A 1 230 ? 48.665  -11.463 34.628  1.00 41.01  ? 276  VAL A CG2 1 
ATOM   1656  N  N   . GLU A 1 231 ? 49.845  -12.295 38.765  1.00 41.34  ? 277  GLU A N   1 
ATOM   1657  C  CA  . GLU A 1 231 ? 50.445  -13.004 39.903  1.00 41.60  ? 277  GLU A CA  1 
ATOM   1658  C  C   . GLU A 1 231 ? 49.563  -13.030 41.157  1.00 41.24  ? 277  GLU A C   1 
ATOM   1659  O  O   . GLU A 1 231 ? 49.621  -13.996 41.934  1.00 41.18  ? 277  GLU A O   1 
ATOM   1660  C  CB  . GLU A 1 231 ? 51.809  -12.420 40.262  1.00 41.73  ? 277  GLU A CB  1 
ATOM   1661  C  CG  . GLU A 1 231 ? 52.870  -12.569 39.190  1.00 44.03  ? 277  GLU A CG  1 
ATOM   1662  C  CD  . GLU A 1 231 ? 54.244  -12.031 39.629  1.00 47.40  ? 277  GLU A CD  1 
ATOM   1663  O  OE1 . GLU A 1 231 ? 54.306  -11.261 40.642  1.00 47.54  ? 277  GLU A OE1 1 
ATOM   1664  O  OE2 . GLU A 1 231 ? 55.256  -12.382 38.958  1.00 48.04  ? 277  GLU A OE2 1 
ATOM   1665  N  N   . HIS A 1 232 ? 48.756  -11.987 41.356  1.00 40.47  ? 278  HIS A N   1 
ATOM   1666  C  CA  . HIS A 1 232 ? 47.909  -11.933 42.532  1.00 39.93  ? 278  HIS A CA  1 
ATOM   1667  C  C   . HIS A 1 232 ? 46.475  -12.291 42.238  1.00 39.57  ? 278  HIS A C   1 
ATOM   1668  O  O   . HIS A 1 232 ? 45.624  -12.176 43.105  1.00 39.75  ? 278  HIS A O   1 
ATOM   1669  C  CB  . HIS A 1 232 ? 48.021  -10.571 43.219  1.00 39.99  ? 278  HIS A CB  1 
ATOM   1670  C  CG  . HIS A 1 232 ? 49.393  -10.290 43.753  1.00 40.43  ? 278  HIS A CG  1 
ATOM   1671  N  ND1 . HIS A 1 232 ? 49.741  -10.506 45.069  1.00 40.53  ? 278  HIS A ND1 1 
ATOM   1672  C  CD2 . HIS A 1 232 ? 50.512  -9.846  43.140  1.00 40.98  ? 278  HIS A CD2 1 
ATOM   1673  C  CE1 . HIS A 1 232 ? 51.011  -10.197 45.244  1.00 41.26  ? 278  HIS A CE1 1 
ATOM   1674  N  NE2 . HIS A 1 232 ? 51.501  -9.789  44.090  1.00 41.69  ? 278  HIS A NE2 1 
ATOM   1675  N  N   . GLY A 1 233 ? 46.215  -12.724 41.014  1.00 38.96  ? 279  GLY A N   1 
ATOM   1676  C  CA  . GLY A 1 233 ? 44.937  -13.327 40.679  1.00 38.49  ? 279  GLY A CA  1 
ATOM   1677  C  C   . GLY A 1 233 ? 43.789  -12.345 40.668  1.00 38.70  ? 279  GLY A C   1 
ATOM   1678  O  O   . GLY A 1 233 ? 42.658  -12.675 41.061  1.00 38.99  ? 279  GLY A O   1 
ATOM   1679  N  N   . VAL A 1 234 ? 44.056  -11.119 40.230  1.00 38.29  ? 280  VAL A N   1 
ATOM   1680  C  CA  . VAL A 1 234 ? 42.967  -10.202 40.023  1.00 37.99  ? 280  VAL A CA  1 
ATOM   1681  C  C   . VAL A 1 234 ? 42.035  -10.833 39.004  1.00 38.40  ? 280  VAL A C   1 
ATOM   1682  O  O   . VAL A 1 234 ? 42.444  -11.700 38.237  1.00 38.81  ? 280  VAL A O   1 
ATOM   1683  C  CB  . VAL A 1 234 ? 43.424  -8.833  39.534  1.00 37.85  ? 280  VAL A CB  1 
ATOM   1684  C  CG1 . VAL A 1 234 ? 44.265  -8.136  40.571  1.00 36.51  ? 280  VAL A CG1 1 
ATOM   1685  C  CG2 . VAL A 1 234 ? 44.151  -8.957  38.220  1.00 38.19  ? 280  VAL A CG2 1 
ATOM   1686  N  N   . ASP A 1 235 ? 40.785  -10.376 39.000  1.00 38.81  ? 281  ASP A N   1 
ATOM   1687  C  CA  . ASP A 1 235 ? 39.711  -10.960 38.203  1.00 38.92  ? 281  ASP A CA  1 
ATOM   1688  C  C   . ASP A 1 235 ? 39.392  -10.158 36.946  1.00 38.78  ? 281  ASP A C   1 
ATOM   1689  O  O   . ASP A 1 235 ? 38.852  -10.706 35.975  1.00 38.84  ? 281  ASP A O   1 
ATOM   1690  C  CB  . ASP A 1 235 ? 38.458  -11.056 39.065  1.00 39.04  ? 281  ASP A CB  1 
ATOM   1691  C  CG  . ASP A 1 235 ? 38.651  -11.954 40.243  1.00 41.96  ? 281  ASP A CG  1 
ATOM   1692  O  OD1 . ASP A 1 235 ? 39.492  -11.654 41.108  1.00 47.76  ? 281  ASP A OD1 1 
ATOM   1693  O  OD2 . ASP A 1 235 ? 37.987  -12.991 40.311  1.00 44.98  ? 281  ASP A OD2 1 
ATOM   1694  N  N   . ILE A 1 236 ? 39.729  -8.866  36.968  1.00 38.35  ? 282  ILE A N   1 
ATOM   1695  C  CA  . ILE A 1 236 ? 39.217  -7.913  36.001  1.00 37.80  ? 282  ILE A CA  1 
ATOM   1696  C  C   . ILE A 1 236 ? 40.181  -6.758  35.855  1.00 37.75  ? 282  ILE A C   1 
ATOM   1697  O  O   . ILE A 1 236 ? 40.679  -6.236  36.837  1.00 37.72  ? 282  ILE A O   1 
ATOM   1698  C  CB  . ILE A 1 236 ? 37.842  -7.309  36.477  1.00 37.80  ? 282  ILE A CB  1 
ATOM   1699  C  CG1 . ILE A 1 236 ? 36.782  -8.406  36.641  1.00 36.64  ? 282  ILE A CG1 1 
ATOM   1700  C  CG2 . ILE A 1 236 ? 37.357  -6.223  35.511  1.00 38.08  ? 282  ILE A CG2 1 
ATOM   1701  C  CD1 . ILE A 1 236 ? 35.580  -8.021  37.524  1.00 33.86  ? 282  ILE A CD1 1 
ATOM   1702  N  N   . VAL A 1 237 ? 40.412  -6.333  34.628  1.00 37.61  ? 283  VAL A N   1 
ATOM   1703  C  CA  . VAL A 1 237 ? 41.233  -5.169  34.394  1.00 37.61  ? 283  VAL A CA  1 
ATOM   1704  C  C   . VAL A 1 237 ? 40.363  -4.042  33.877  1.00 38.01  ? 283  VAL A C   1 
ATOM   1705  O  O   . VAL A 1 237 ? 39.729  -4.181  32.831  1.00 38.66  ? 283  VAL A O   1 
ATOM   1706  C  CB  . VAL A 1 237 ? 42.338  -5.484  33.356  1.00 37.44  ? 283  VAL A CB  1 
ATOM   1707  C  CG1 . VAL A 1 237 ? 43.057  -4.220  32.905  1.00 36.59  ? 283  VAL A CG1 1 
ATOM   1708  C  CG2 . VAL A 1 237 ? 43.310  -6.459  33.936  1.00 36.50  ? 283  VAL A CG2 1 
ATOM   1709  N  N   . PHE A 1 238 ? 40.318  -2.929  34.595  1.00 37.88  ? 284  PHE A N   1 
ATOM   1710  C  CA  . PHE A 1 238 ? 39.709  -1.741  34.045  1.00 37.83  ? 284  PHE A CA  1 
ATOM   1711  C  C   . PHE A 1 238 ? 40.851  -1.030  33.333  1.00 38.41  ? 284  PHE A C   1 
ATOM   1712  O  O   . PHE A 1 238 ? 41.738  -0.500  33.991  1.00 39.05  ? 284  PHE A O   1 
ATOM   1713  C  CB  . PHE A 1 238 ? 39.150  -0.853  35.149  1.00 37.46  ? 284  PHE A CB  1 
ATOM   1714  C  CG  . PHE A 1 238 ? 37.979  -1.430  35.886  1.00 37.09  ? 284  PHE A CG  1 
ATOM   1715  C  CD1 . PHE A 1 238 ? 37.142  -2.372  35.307  1.00 36.94  ? 284  PHE A CD1 1 
ATOM   1716  C  CD2 . PHE A 1 238 ? 37.679  -0.986  37.173  1.00 37.55  ? 284  PHE A CD2 1 
ATOM   1717  C  CE1 . PHE A 1 238 ? 36.028  -2.864  36.008  1.00 36.66  ? 284  PHE A CE1 1 
ATOM   1718  C  CE2 . PHE A 1 238 ? 36.557  -1.477  37.881  1.00 36.02  ? 284  PHE A CE2 1 
ATOM   1719  C  CZ  . PHE A 1 238 ? 35.754  -2.423  37.304  1.00 36.26  ? 284  PHE A CZ  1 
ATOM   1720  N  N   . ALA A 1 239 ? 40.855  -1.052  32.003  1.00 38.55  ? 285  ALA A N   1 
ATOM   1721  C  CA  . ALA A 1 239 ? 41.982  -0.550  31.221  1.00 38.86  ? 285  ALA A CA  1 
ATOM   1722  C  C   . ALA A 1 239 ? 41.808  0.924   30.848  1.00 39.58  ? 285  ALA A C   1 
ATOM   1723  O  O   . ALA A 1 239 ? 40.894  1.287   30.097  1.00 40.09  ? 285  ALA A O   1 
ATOM   1724  C  CB  . ALA A 1 239 ? 42.167  -1.385  29.980  1.00 38.56  ? 285  ALA A CB  1 
ATOM   1725  N  N   . SER A 1 240 ? 42.691  1.773   31.367  1.00 40.02  ? 286  SER A N   1 
ATOM   1726  C  CA  . SER A 1 240 ? 42.530  3.222   31.218  1.00 40.27  ? 286  SER A CA  1 
ATOM   1727  C  C   . SER A 1 240 ? 42.884  3.696   29.831  1.00 40.45  ? 286  SER A C   1 
ATOM   1728  O  O   . SER A 1 240 ? 43.682  3.074   29.138  1.00 40.43  ? 286  SER A O   1 
ATOM   1729  C  CB  . SER A 1 240 ? 43.390  3.984   32.233  1.00 40.39  ? 286  SER A CB  1 
ATOM   1730  O  OG  . SER A 1 240 ? 43.013  3.691   33.567  1.00 40.37  ? 286  SER A OG  1 
ATOM   1731  N  N   . PHE A 1 241 ? 42.265  4.810   29.456  1.00 40.90  ? 287  PHE A N   1 
ATOM   1732  C  CA  . PHE A 1 241 ? 42.485  5.512   28.173  1.00 40.91  ? 287  PHE A CA  1 
ATOM   1733  C  C   . PHE A 1 241 ? 42.489  4.691   26.874  1.00 40.75  ? 287  PHE A C   1 
ATOM   1734  O  O   . PHE A 1 241 ? 43.293  4.936   25.963  1.00 40.72  ? 287  PHE A O   1 
ATOM   1735  C  CB  . PHE A 1 241 ? 43.677  6.475   28.282  1.00 40.84  ? 287  PHE A CB  1 
ATOM   1736  C  CG  . PHE A 1 241 ? 43.479  7.528   29.351  1.00 40.78  ? 287  PHE A CG  1 
ATOM   1737  C  CD1 . PHE A 1 241 ? 43.944  7.308   30.659  1.00 40.15  ? 287  PHE A CD1 1 
ATOM   1738  C  CD2 . PHE A 1 241 ? 42.787  8.708   29.064  1.00 41.21  ? 287  PHE A CD2 1 
ATOM   1739  C  CE1 . PHE A 1 241 ? 43.752  8.263   31.660  1.00 40.60  ? 287  PHE A CE1 1 
ATOM   1740  C  CE2 . PHE A 1 241 ? 42.588  9.670   30.046  1.00 41.92  ? 287  PHE A CE2 1 
ATOM   1741  C  CZ  . PHE A 1 241 ? 43.070  9.455   31.349  1.00 41.00  ? 287  PHE A CZ  1 
ATOM   1742  N  N   . VAL A 1 242 ? 41.536  3.767   26.773  1.00 40.59  ? 288  VAL A N   1 
ATOM   1743  C  CA  . VAL A 1 242 ? 41.442  2.901   25.603  1.00 40.73  ? 288  VAL A CA  1 
ATOM   1744  C  C   . VAL A 1 242 ? 40.891  3.683   24.421  1.00 41.18  ? 288  VAL A C   1 
ATOM   1745  O  O   . VAL A 1 242 ? 39.727  4.127   24.450  1.00 41.20  ? 288  VAL A O   1 
ATOM   1746  C  CB  . VAL A 1 242 ? 40.564  1.669   25.850  1.00 40.37  ? 288  VAL A CB  1 
ATOM   1747  C  CG1 . VAL A 1 242 ? 40.382  0.899   24.563  1.00 40.01  ? 288  VAL A CG1 1 
ATOM   1748  C  CG2 . VAL A 1 242 ? 41.201  0.777   26.890  1.00 40.72  ? 288  VAL A CG2 1 
ATOM   1749  N  N   . ARG A 1 243 ? 41.738  3.852   23.397  1.00 41.45  ? 289  ARG A N   1 
ATOM   1750  C  CA  . ARG A 1 243 ? 41.378  4.659   22.224  1.00 42.20  ? 289  ARG A CA  1 
ATOM   1751  C  C   . ARG A 1 243 ? 41.088  3.875   20.935  1.00 42.18  ? 289  ARG A C   1 
ATOM   1752  O  O   . ARG A 1 243 ? 40.518  4.432   19.986  1.00 42.39  ? 289  ARG A O   1 
ATOM   1753  C  CB  . ARG A 1 243 ? 42.423  5.740   21.909  1.00 42.55  ? 289  ARG A CB  1 
ATOM   1754  C  CG  . ARG A 1 243 ? 43.538  5.900   22.896  1.00 45.41  ? 289  ARG A CG  1 
ATOM   1755  C  CD  . ARG A 1 243 ? 44.684  6.711   22.277  1.00 50.70  ? 289  ARG A CD  1 
ATOM   1756  N  NE  . ARG A 1 243 ? 45.301  7.552   23.316  1.00 56.56  ? 289  ARG A NE  1 
ATOM   1757  C  CZ  . ARG A 1 243 ? 45.014  8.846   23.523  1.00 57.70  ? 289  ARG A CZ  1 
ATOM   1758  N  NH1 . ARG A 1 243 ? 44.127  9.482   22.740  1.00 57.11  ? 289  ARG A NH1 1 
ATOM   1759  N  NH2 . ARG A 1 243 ? 45.635  9.512   24.507  1.00 57.83  ? 289  ARG A NH2 1 
ATOM   1760  N  N   . LYS A 1 244 ? 41.495  2.608   20.885  1.00 42.01  ? 290  LYS A N   1 
ATOM   1761  C  CA  . LYS A 1 244 ? 41.369  1.801   19.665  1.00 41.62  ? 290  LYS A CA  1 
ATOM   1762  C  C   . LYS A 1 244 ? 41.609  0.338   19.991  1.00 41.54  ? 290  LYS A C   1 
ATOM   1763  O  O   . LYS A 1 244 ? 42.288  0.025   20.968  1.00 41.79  ? 290  LYS A O   1 
ATOM   1764  C  CB  . LYS A 1 244 ? 42.377  2.270   18.611  1.00 41.43  ? 290  LYS A CB  1 
ATOM   1765  C  CG  . LYS A 1 244 ? 43.751  2.563   19.196  1.00 42.77  ? 290  LYS A CG  1 
ATOM   1766  C  CD  . LYS A 1 244 ? 44.809  2.988   18.189  1.00 43.95  ? 290  LYS A CD  1 
ATOM   1767  C  CE  . LYS A 1 244 ? 46.040  3.444   18.973  1.00 44.63  ? 290  LYS A CE  1 
ATOM   1768  N  NZ  . LYS A 1 244 ? 47.297  3.379   18.192  1.00 46.38  ? 290  LYS A NZ  1 
ATOM   1769  N  N   . ALA A 1 245 ? 41.068  -0.553  19.167  1.00 41.48  ? 291  ALA A N   1 
ATOM   1770  C  CA  . ALA A 1 245 ? 41.197  -2.002  19.364  1.00 41.43  ? 291  ALA A CA  1 
ATOM   1771  C  C   . ALA A 1 245 ? 42.593  -2.481  19.792  1.00 41.57  ? 291  ALA A C   1 
ATOM   1772  O  O   . ALA A 1 245 ? 42.711  -3.260  20.731  1.00 41.68  ? 291  ALA A O   1 
ATOM   1773  C  CB  . ALA A 1 245 ? 40.739  -2.754  18.105  1.00 41.26  ? 291  ALA A CB  1 
ATOM   1774  N  N   . SER A 1 246 ? 43.643  -2.019  19.112  1.00 41.82  ? 292  SER A N   1 
ATOM   1775  C  CA  . SER A 1 246 ? 45.006  -2.426  19.457  1.00 42.14  ? 292  SER A CA  1 
ATOM   1776  C  C   . SER A 1 246 ? 45.380  -2.121  20.919  1.00 41.99  ? 292  SER A C   1 
ATOM   1777  O  O   . SER A 1 246 ? 46.260  -2.766  21.485  1.00 42.21  ? 292  SER A O   1 
ATOM   1778  C  CB  . SER A 1 246 ? 46.022  -1.761  18.536  1.00 42.10  ? 292  SER A CB  1 
ATOM   1779  O  OG  . SER A 1 246 ? 46.339  -0.484  19.051  1.00 44.10  ? 292  SER A OG  1 
ATOM   1780  N  N   . ASP A 1 247 ? 44.732  -1.133  21.523  1.00 41.72  ? 293  ASP A N   1 
ATOM   1781  C  CA  . ASP A 1 247 ? 44.973  -0.840  22.926  1.00 41.62  ? 293  ASP A CA  1 
ATOM   1782  C  C   . ASP A 1 247 ? 44.643  -2.019  23.836  1.00 41.45  ? 293  ASP A C   1 
ATOM   1783  O  O   . ASP A 1 247 ? 45.399  -2.325  24.754  1.00 41.56  ? 293  ASP A O   1 
ATOM   1784  C  CB  . ASP A 1 247 ? 44.183  0.383   23.360  1.00 41.86  ? 293  ASP A CB  1 
ATOM   1785  C  CG  . ASP A 1 247 ? 44.796  1.675   22.869  1.00 42.61  ? 293  ASP A CG  1 
ATOM   1786  O  OD1 . ASP A 1 247 ? 45.968  1.678   22.408  1.00 42.62  ? 293  ASP A OD1 1 
ATOM   1787  O  OD2 . ASP A 1 247 ? 44.094  2.701   22.951  1.00 44.22  ? 293  ASP A OD2 1 
ATOM   1788  N  N   . VAL A 1 248 ? 43.515  -2.677  23.585  1.00 40.98  ? 294  VAL A N   1 
ATOM   1789  C  CA  . VAL A 1 248 ? 43.157  -3.860  24.359  1.00 40.64  ? 294  VAL A CA  1 
ATOM   1790  C  C   . VAL A 1 248 ? 44.007  -5.085  23.979  1.00 40.37  ? 294  VAL A C   1 
ATOM   1791  O  O   . VAL A 1 248 ? 44.386  -5.882  24.839  1.00 40.33  ? 294  VAL A O   1 
ATOM   1792  C  CB  . VAL A 1 248 ? 41.620  -4.129  24.391  1.00 40.70  ? 294  VAL A CB  1 
ATOM   1793  C  CG1 . VAL A 1 248 ? 40.889  -3.364  23.299  1.00 40.74  ? 294  VAL A CG1 1 
ATOM   1794  C  CG2 . VAL A 1 248 ? 41.308  -5.620  24.392  1.00 40.47  ? 294  VAL A CG2 1 
ATOM   1795  N  N   . ALA A 1 249 ? 44.349  -5.209  22.704  1.00 40.04  ? 295  ALA A N   1 
ATOM   1796  C  CA  . ALA A 1 249 ? 45.275  -6.246  22.294  1.00 39.21  ? 295  ALA A CA  1 
ATOM   1797  C  C   . ALA A 1 249 ? 46.524  -6.119  23.163  1.00 39.09  ? 295  ALA A C   1 
ATOM   1798  O  O   . ALA A 1 249 ? 46.989  -7.117  23.729  1.00 38.95  ? 295  ALA A O   1 
ATOM   1799  C  CB  . ALA A 1 249 ? 45.602  -6.133  20.817  1.00 38.82  ? 295  ALA A CB  1 
ATOM   1800  N  N   . ALA A 1 250 ? 47.036  -4.891  23.299  1.00 38.89  ? 296  ALA A N   1 
ATOM   1801  C  CA  . ALA A 1 250 ? 48.228  -4.640  24.094  1.00 38.94  ? 296  ALA A CA  1 
ATOM   1802  C  C   . ALA A 1 250 ? 48.019  -5.129  25.527  1.00 39.37  ? 296  ALA A C   1 
ATOM   1803  O  O   . ALA A 1 250 ? 48.828  -5.908  26.040  1.00 39.66  ? 296  ALA A O   1 
ATOM   1804  C  CB  . ALA A 1 250 ? 48.611  -3.172  24.053  1.00 38.44  ? 296  ALA A CB  1 
ATOM   1805  N  N   . VAL A 1 251 ? 46.912  -4.710  26.153  1.00 39.72  ? 297  VAL A N   1 
ATOM   1806  C  CA  . VAL A 1 251 ? 46.536  -5.185  27.489  1.00 39.82  ? 297  VAL A CA  1 
ATOM   1807  C  C   . VAL A 1 251 ? 46.545  -6.718  27.521  1.00 40.50  ? 297  VAL A C   1 
ATOM   1808  O  O   . VAL A 1 251 ? 47.096  -7.318  28.446  1.00 40.75  ? 297  VAL A O   1 
ATOM   1809  C  CB  . VAL A 1 251 ? 45.136  -4.662  27.954  1.00 39.96  ? 297  VAL A CB  1 
ATOM   1810  C  CG1 . VAL A 1 251 ? 44.702  -5.320  29.260  1.00 39.03  ? 297  VAL A CG1 1 
ATOM   1811  C  CG2 . VAL A 1 251 ? 45.122  -3.153  28.134  1.00 39.71  ? 297  VAL A CG2 1 
ATOM   1812  N  N   . ARG A 1 252 ? 45.945  -7.343  26.512  1.00 40.97  ? 298  ARG A N   1 
ATOM   1813  C  CA  . ARG A 1 252 ? 45.901  -8.798  26.444  1.00 41.53  ? 298  ARG A CA  1 
ATOM   1814  C  C   . ARG A 1 252 ? 47.299  -9.385  26.440  1.00 41.68  ? 298  ARG A C   1 
ATOM   1815  O  O   . ARG A 1 252 ? 47.586  -10.290 27.221  1.00 42.05  ? 298  ARG A O   1 
ATOM   1816  C  CB  . ARG A 1 252 ? 45.146  -9.272  25.205  1.00 41.81  ? 298  ARG A CB  1 
ATOM   1817  C  CG  . ARG A 1 252 ? 44.184  -10.416 25.490  1.00 42.98  ? 298  ARG A CG  1 
ATOM   1818  C  CD  . ARG A 1 252 ? 42.942  -10.273 24.617  1.00 43.32  ? 298  ARG A CD  1 
ATOM   1819  N  NE  . ARG A 1 252 ? 41.718  -10.205 25.416  1.00 44.51  ? 298  ARG A NE  1 
ATOM   1820  C  CZ  . ARG A 1 252 ? 40.553  -9.738  24.957  1.00 46.41  ? 298  ARG A CZ  1 
ATOM   1821  N  NH1 . ARG A 1 252 ? 40.461  -9.304  23.702  1.00 46.09  ? 298  ARG A NH1 1 
ATOM   1822  N  NH2 . ARG A 1 252 ? 39.477  -9.697  25.746  1.00 45.61  ? 298  ARG A NH2 1 
ATOM   1823  N  N   . ALA A 1 253 ? 48.168  -8.873  25.571  1.00 41.87  ? 299  ALA A N   1 
ATOM   1824  C  CA  . ALA A 1 253 ? 49.545  -9.376  25.485  1.00 41.83  ? 299  ALA A CA  1 
ATOM   1825  C  C   . ALA A 1 253 ? 50.231  -9.281  26.848  1.00 41.97  ? 299  ALA A C   1 
ATOM   1826  O  O   . ALA A 1 253 ? 50.867  -10.246 27.302  1.00 41.94  ? 299  ALA A O   1 
ATOM   1827  C  CB  . ALA A 1 253 ? 50.359  -8.611  24.418  1.00 41.52  ? 299  ALA A CB  1 
ATOM   1828  N  N   . ALA A 1 254 ? 50.085  -8.123  27.493  1.00 41.96  ? 300  ALA A N   1 
ATOM   1829  C  CA  . ALA A 1 254 ? 50.766  -7.847  28.760  1.00 42.21  ? 300  ALA A CA  1 
ATOM   1830  C  C   . ALA A 1 254 ? 50.254  -8.779  29.851  1.00 42.29  ? 300  ALA A C   1 
ATOM   1831  O  O   . ALA A 1 254 ? 51.025  -9.280  30.680  1.00 42.31  ? 300  ALA A O   1 
ATOM   1832  C  CB  . ALA A 1 254 ? 50.555  -6.392  29.172  1.00 42.31  ? 300  ALA A CB  1 
ATOM   1833  N  N   . LEU A 1 255 ? 48.939  -8.992  29.844  1.00 42.24  ? 301  LEU A N   1 
ATOM   1834  C  CA  . LEU A 1 255 ? 48.287  -9.867  30.792  1.00 42.41  ? 301  LEU A CA  1 
ATOM   1835  C  C   . LEU A 1 255 ? 48.916  -11.253 30.725  1.00 43.01  ? 301  LEU A C   1 
ATOM   1836  O  O   . LEU A 1 255 ? 48.888  -12.002 31.700  1.00 43.23  ? 301  LEU A O   1 
ATOM   1837  C  CB  . LEU A 1 255 ? 46.801  -9.941  30.465  1.00 42.37  ? 301  LEU A CB  1 
ATOM   1838  C  CG  . LEU A 1 255 ? 45.807  -9.755  31.614  1.00 42.53  ? 301  LEU A CG  1 
ATOM   1839  C  CD1 . LEU A 1 255 ? 46.048  -8.460  32.351  1.00 41.83  ? 301  LEU A CD1 1 
ATOM   1840  C  CD2 . LEU A 1 255 ? 44.417  -9.772  31.057  1.00 43.48  ? 301  LEU A CD2 1 
ATOM   1841  N  N   . GLY A 1 256 ? 49.492  -11.587 29.568  1.00 43.73  ? 302  GLY A N   1 
ATOM   1842  C  CA  . GLY A 1 256 ? 50.197  -12.856 29.395  1.00 44.49  ? 302  GLY A CA  1 
ATOM   1843  C  C   . GLY A 1 256 ? 49.287  -14.072 29.435  1.00 45.17  ? 302  GLY A C   1 
ATOM   1844  O  O   . GLY A 1 256 ? 48.066  -13.960 29.621  1.00 45.43  ? 302  GLY A O   1 
ATOM   1845  N  N   . PRO A 1 257 ? 49.881  -15.251 29.266  1.00 45.58  ? 303  PRO A N   1 
ATOM   1846  C  CA  . PRO A 1 257 ? 49.139  -16.494 29.125  1.00 46.01  ? 303  PRO A CA  1 
ATOM   1847  C  C   . PRO A 1 257 ? 48.551  -16.962 30.421  1.00 46.40  ? 303  PRO A C   1 
ATOM   1848  O  O   . PRO A 1 257 ? 47.543  -17.670 30.423  1.00 47.06  ? 303  PRO A O   1 
ATOM   1849  C  CB  . PRO A 1 257 ? 50.205  -17.503 28.733  1.00 46.02  ? 303  PRO A CB  1 
ATOM   1850  C  CG  . PRO A 1 257 ? 51.450  -16.694 28.458  1.00 46.06  ? 303  PRO A CG  1 
ATOM   1851  C  CD  . PRO A 1 257 ? 51.334  -15.459 29.216  1.00 45.72  ? 303  PRO A CD  1 
ATOM   1852  N  N   . GLU A 1 258 ? 49.186  -16.588 31.522  1.00 46.67  ? 304  GLU A N   1 
ATOM   1853  C  CA  . GLU A 1 258 ? 48.679  -16.949 32.840  1.00 46.81  ? 304  GLU A CA  1 
ATOM   1854  C  C   . GLU A 1 258 ? 47.336  -16.232 33.113  1.00 46.60  ? 304  GLU A C   1 
ATOM   1855  O  O   . GLU A 1 258 ? 46.729  -16.418 34.174  1.00 46.61  ? 304  GLU A O   1 
ATOM   1856  C  CB  . GLU A 1 258 ? 49.706  -16.624 33.935  1.00 46.85  ? 304  GLU A CB  1 
ATOM   1857  C  CG  . GLU A 1 258 ? 51.193  -16.695 33.518  1.00 48.74  ? 304  GLU A CG  1 
ATOM   1858  C  CD  . GLU A 1 258 ? 51.932  -17.946 34.021  1.00 51.37  ? 304  GLU A CD  1 
ATOM   1859  O  OE1 . GLU A 1 258 ? 51.576  -18.480 35.097  1.00 52.09  ? 304  GLU A OE1 1 
ATOM   1860  O  OE2 . GLU A 1 258 ? 52.890  -18.380 33.343  1.00 52.98  ? 304  GLU A OE2 1 
ATOM   1861  N  N   . GLY A 1 259 ? 46.860  -15.430 32.159  1.00 46.35  ? 305  GLY A N   1 
ATOM   1862  C  CA  . GLY A 1 259 ? 45.673  -14.612 32.403  1.00 46.49  ? 305  GLY A CA  1 
ATOM   1863  C  C   . GLY A 1 259 ? 44.662  -14.378 31.290  1.00 46.67  ? 305  GLY A C   1 
ATOM   1864  O  O   . GLY A 1 259 ? 44.213  -13.254 31.098  1.00 46.87  ? 305  GLY A O   1 
ATOM   1865  N  N   . HIS A 1 260 ? 44.288  -15.422 30.555  1.00 47.03  ? 306  HIS A N   1 
ATOM   1866  C  CA  . HIS A 1 260 ? 43.165  -15.320 29.607  1.00 47.08  ? 306  HIS A CA  1 
ATOM   1867  C  C   . HIS A 1 260 ? 41.867  -15.212 30.308  1.00 46.47  ? 306  HIS A C   1 
ATOM   1868  O  O   . HIS A 1 260 ? 40.925  -14.647 29.759  1.00 47.02  ? 306  HIS A O   1 
ATOM   1869  C  CB  . HIS A 1 260 ? 43.000  -16.584 28.809  1.00 47.74  ? 306  HIS A CB  1 
ATOM   1870  C  CG  . HIS A 1 260 ? 43.754  -16.577 27.543  1.00 50.10  ? 306  HIS A CG  1 
ATOM   1871  N  ND1 . HIS A 1 260 ? 44.866  -17.359 27.363  1.00 52.28  ? 306  HIS A ND1 1 
ATOM   1872  C  CD2 . HIS A 1 260 ? 43.575  -15.869 26.403  1.00 51.65  ? 306  HIS A CD2 1 
ATOM   1873  C  CE1 . HIS A 1 260 ? 45.323  -17.157 26.144  1.00 52.80  ? 306  HIS A CE1 1 
ATOM   1874  N  NE2 . HIS A 1 260 ? 44.570  -16.242 25.548  1.00 53.03  ? 306  HIS A NE2 1 
ATOM   1875  N  N   . GLY A 1 261 ? 41.795  -15.823 31.494  1.00 45.67  ? 307  GLY A N   1 
ATOM   1876  C  CA  . GLY A 1 261 ? 40.559  -15.880 32.267  1.00 44.78  ? 307  GLY A CA  1 
ATOM   1877  C  C   . GLY A 1 261 ? 40.065  -14.493 32.634  1.00 44.24  ? 307  GLY A C   1 
ATOM   1878  O  O   . GLY A 1 261 ? 38.845  -14.284 32.784  1.00 44.41  ? 307  GLY A O   1 
ATOM   1879  N  N   . ILE A 1 262 ? 41.018  -13.563 32.757  1.00 43.54  ? 308  ILE A N   1 
ATOM   1880  C  CA  . ILE A 1 262 ? 40.792  -12.201 33.222  1.00 43.34  ? 308  ILE A CA  1 
ATOM   1881  C  C   . ILE A 1 262 ? 39.926  -11.396 32.244  1.00 43.26  ? 308  ILE A C   1 
ATOM   1882  O  O   . ILE A 1 262 ? 40.276  -11.262 31.077  1.00 43.96  ? 308  ILE A O   1 
ATOM   1883  C  CB  . ILE A 1 262 ? 42.138  -11.487 33.481  1.00 43.33  ? 308  ILE A CB  1 
ATOM   1884  C  CG1 . ILE A 1 262 ? 42.921  -12.239 34.564  1.00 43.47  ? 308  ILE A CG1 1 
ATOM   1885  C  CG2 . ILE A 1 262 ? 41.934  -10.017 33.859  1.00 42.58  ? 308  ILE A CG2 1 
ATOM   1886  C  CD1 . ILE A 1 262 ? 43.966  -11.405 35.300  1.00 43.72  ? 308  ILE A CD1 1 
ATOM   1887  N  N   . LYS A 1 263 ? 38.788  -10.899 32.722  1.00 42.55  ? 309  LYS A N   1 
ATOM   1888  C  CA  . LYS A 1 263 ? 37.900  -10.040 31.935  1.00 42.04  ? 309  LYS A CA  1 
ATOM   1889  C  C   . LYS A 1 263 ? 38.495  -8.656  31.785  1.00 41.61  ? 309  LYS A C   1 
ATOM   1890  O  O   . LYS A 1 263 ? 38.942  -8.039  32.767  1.00 42.09  ? 309  LYS A O   1 
ATOM   1891  C  CB  . LYS A 1 263 ? 36.515  -9.900  32.603  1.00 42.09  ? 309  LYS A CB  1 
ATOM   1892  C  CG  . LYS A 1 263 ? 35.776  -11.204 32.833  1.00 42.78  ? 309  LYS A CG  1 
ATOM   1893  C  CD  . LYS A 1 263 ? 35.736  -12.016 31.555  1.00 43.44  ? 309  LYS A CD  1 
ATOM   1894  C  CE  . LYS A 1 263 ? 34.765  -13.157 31.658  1.00 45.40  ? 309  LYS A CE  1 
ATOM   1895  N  NZ  . LYS A 1 263 ? 34.269  -13.542 30.304  1.00 46.13  ? 309  LYS A NZ  1 
ATOM   1896  N  N   . ILE A 1 264 ? 38.462  -8.150  30.561  1.00 40.80  ? 310  ILE A N   1 
ATOM   1897  C  CA  . ILE A 1 264 ? 39.026  -6.850  30.241  1.00 39.81  ? 310  ILE A CA  1 
ATOM   1898  C  C   . ILE A 1 264 ? 37.910  -5.847  30.025  1.00 39.46  ? 310  ILE A C   1 
ATOM   1899  O  O   . ILE A 1 264 ? 37.061  -6.036  29.169  1.00 39.75  ? 310  ILE A O   1 
ATOM   1900  C  CB  . ILE A 1 264 ? 39.935  -6.951  29.019  1.00 39.55  ? 310  ILE A CB  1 
ATOM   1901  C  CG1 . ILE A 1 264 ? 41.118  -7.856  29.369  1.00 39.69  ? 310  ILE A CG1 1 
ATOM   1902  C  CG2 . ILE A 1 264 ? 40.391  -5.573  28.548  1.00 39.17  ? 310  ILE A CG2 1 
ATOM   1903  C  CD1 . ILE A 1 264 ? 42.390  -7.524  28.651  1.00 41.07  ? 310  ILE A CD1 1 
ATOM   1904  N  N   . ILE A 1 265 ? 37.908  -4.788  30.821  1.00 39.02  ? 311  ILE A N   1 
ATOM   1905  C  CA  . ILE A 1 265 ? 36.924  -3.724  30.691  1.00 38.83  ? 311  ILE A CA  1 
ATOM   1906  C  C   . ILE A 1 265 ? 37.599  -2.459  30.152  1.00 38.95  ? 311  ILE A C   1 
ATOM   1907  O  O   . ILE A 1 265 ? 38.384  -1.833  30.847  1.00 39.55  ? 311  ILE A O   1 
ATOM   1908  C  CB  . ILE A 1 265 ? 36.242  -3.402  32.058  1.00 38.55  ? 311  ILE A CB  1 
ATOM   1909  C  CG1 . ILE A 1 265 ? 35.587  -4.645  32.691  1.00 37.90  ? 311  ILE A CG1 1 
ATOM   1910  C  CG2 . ILE A 1 265 ? 35.269  -2.273  31.902  1.00 38.16  ? 311  ILE A CG2 1 
ATOM   1911  C  CD1 . ILE A 1 265 ? 34.573  -5.369  31.853  1.00 37.08  ? 311  ILE A CD1 1 
ATOM   1912  N  N   . SER A 1 266 ? 37.306  -2.061  28.926  1.00 38.91  ? 312  SER A N   1 
ATOM   1913  C  CA  . SER A 1 266 ? 37.942  -0.844  28.409  1.00 39.12  ? 312  SER A CA  1 
ATOM   1914  C  C   . SER A 1 266 ? 37.200  0.365   28.928  1.00 39.35  ? 312  SER A C   1 
ATOM   1915  O  O   . SER A 1 266 ? 35.972  0.466   28.749  1.00 39.16  ? 312  SER A O   1 
ATOM   1916  C  CB  . SER A 1 266 ? 37.980  -0.818  26.884  1.00 38.50  ? 312  SER A CB  1 
ATOM   1917  O  OG  . SER A 1 266 ? 38.325  -2.087  26.389  1.00 39.26  ? 312  SER A OG  1 
ATOM   1918  N  N   . LYS A 1 267 ? 37.944  1.250   29.602  1.00 39.22  ? 313  LYS A N   1 
ATOM   1919  C  CA  . LYS A 1 267 ? 37.403  2.541   30.039  1.00 38.87  ? 313  LYS A CA  1 
ATOM   1920  C  C   . LYS A 1 267 ? 37.517  3.494   28.860  1.00 39.05  ? 313  LYS A C   1 
ATOM   1921  O  O   . LYS A 1 267 ? 38.580  3.578   28.175  1.00 39.15  ? 313  LYS A O   1 
ATOM   1922  C  CB  . LYS A 1 267 ? 38.140  3.127   31.238  1.00 38.70  ? 313  LYS A CB  1 
ATOM   1923  C  CG  . LYS A 1 267 ? 38.721  2.135   32.193  1.00 37.70  ? 313  LYS A CG  1 
ATOM   1924  C  CD  . LYS A 1 267 ? 38.900  2.727   33.600  1.00 38.10  ? 313  LYS A CD  1 
ATOM   1925  C  CE  . LYS A 1 267 ? 39.872  3.908   33.641  1.00 36.88  ? 313  LYS A CE  1 
ATOM   1926  N  NZ  . LYS A 1 267 ? 40.737  3.893   34.866  1.00 34.07  ? 313  LYS A NZ  1 
ATOM   1927  N  N   . ILE A 1 268 ? 36.402  4.181   28.621  1.00 38.78  ? 314  ILE A N   1 
ATOM   1928  C  CA  . ILE A 1 268 ? 36.273  5.152   27.542  1.00 38.47  ? 314  ILE A CA  1 
ATOM   1929  C  C   . ILE A 1 268 ? 36.366  6.552   28.167  1.00 38.65  ? 314  ILE A C   1 
ATOM   1930  O  O   . ILE A 1 268 ? 35.465  7.007   28.897  1.00 38.73  ? 314  ILE A O   1 
ATOM   1931  C  CB  . ILE A 1 268 ? 34.960  4.917   26.760  1.00 38.36  ? 314  ILE A CB  1 
ATOM   1932  C  CG1 . ILE A 1 268 ? 34.934  3.499   26.152  1.00 38.47  ? 314  ILE A CG1 1 
ATOM   1933  C  CG2 . ILE A 1 268 ? 34.746  5.979   25.695  1.00 37.78  ? 314  ILE A CG2 1 
ATOM   1934  C  CD1 . ILE A 1 268 ? 35.941  3.238   25.008  1.00 39.54  ? 314  ILE A CD1 1 
ATOM   1935  N  N   . GLU A 1 269 ? 37.490  7.211   27.906  1.00 38.58  ? 315  GLU A N   1 
ATOM   1936  C  CA  . GLU A 1 269 ? 37.832  8.418   28.620  1.00 38.39  ? 315  GLU A CA  1 
ATOM   1937  C  C   . GLU A 1 269 ? 38.040  9.620   27.698  1.00 38.36  ? 315  GLU A C   1 
ATOM   1938  O  O   . GLU A 1 269 ? 38.244  10.736  28.176  1.00 38.70  ? 315  GLU A O   1 
ATOM   1939  C  CB  . GLU A 1 269 ? 39.059  8.161   29.504  1.00 38.77  ? 315  GLU A CB  1 
ATOM   1940  C  CG  . GLU A 1 269 ? 38.786  7.210   30.691  1.00 39.48  ? 315  GLU A CG  1 
ATOM   1941  C  CD  . GLU A 1 269 ? 39.937  7.140   31.680  1.00 42.53  ? 315  GLU A CD  1 
ATOM   1942  O  OE1 . GLU A 1 269 ? 40.964  6.517   31.305  1.00 43.09  ? 315  GLU A OE1 1 
ATOM   1943  O  OE2 . GLU A 1 269 ? 39.831  7.684   32.824  1.00 41.63  ? 315  GLU A OE2 1 
ATOM   1944  N  N   . ASN A 1 270 ? 37.970  9.425   26.384  1.00 37.88  ? 316  ASN A N   1 
ATOM   1945  C  CA  . ASN A 1 270 ? 38.151  10.562  25.486  1.00 37.62  ? 316  ASN A CA  1 
ATOM   1946  C  C   . ASN A 1 270 ? 37.438  10.503  24.153  1.00 37.52  ? 316  ASN A C   1 
ATOM   1947  O  O   . ASN A 1 270 ? 36.807  9.502   23.812  1.00 37.69  ? 316  ASN A O   1 
ATOM   1948  C  CB  . ASN A 1 270 ? 39.633  10.858  25.275  1.00 37.88  ? 316  ASN A CB  1 
ATOM   1949  C  CG  . ASN A 1 270 ? 40.401  9.685   24.639  1.00 38.61  ? 316  ASN A CG  1 
ATOM   1950  O  OD1 . ASN A 1 270 ? 39.848  8.844   23.912  1.00 39.05  ? 316  ASN A OD1 1 
ATOM   1951  N  ND2 . ASN A 1 270 ? 41.698  9.645   24.904  1.00 39.25  ? 316  ASN A ND2 1 
ATOM   1952  N  N   . HIS A 1 271 ? 37.554  11.587  23.398  1.00 37.63  ? 317  HIS A N   1 
ATOM   1953  C  CA  . HIS A 1 271 ? 36.831  11.730  22.142  1.00 38.08  ? 317  HIS A CA  1 
ATOM   1954  C  C   . HIS A 1 271 ? 37.122  10.585  21.177  1.00 38.20  ? 317  HIS A C   1 
ATOM   1955  O  O   . HIS A 1 271 ? 36.201  9.926   20.685  1.00 38.49  ? 317  HIS A O   1 
ATOM   1956  C  CB  . HIS A 1 271 ? 37.124  13.074  21.481  1.00 37.99  ? 317  HIS A CB  1 
ATOM   1957  C  CG  . HIS A 1 271 ? 36.211  13.385  20.343  1.00 39.44  ? 317  HIS A CG  1 
ATOM   1958  N  ND1 . HIS A 1 271 ? 36.531  13.091  19.037  1.00 41.67  ? 317  HIS A ND1 1 
ATOM   1959  C  CD2 . HIS A 1 271 ? 34.982  13.952  20.312  1.00 40.71  ? 317  HIS A CD2 1 
ATOM   1960  C  CE1 . HIS A 1 271 ? 35.535  13.462  18.251  1.00 42.51  ? 317  HIS A CE1 1 
ATOM   1961  N  NE2 . HIS A 1 271 ? 34.586  13.994  18.999  1.00 41.17  ? 317  HIS A NE2 1 
ATOM   1962  N  N   . GLU A 1 272 ? 38.391  10.321  20.923  1.00 38.16  ? 318  GLU A N   1 
ATOM   1963  C  CA  . GLU A 1 272 ? 38.725  9.250   20.015  1.00 38.49  ? 318  GLU A CA  1 
ATOM   1964  C  C   . GLU A 1 272 ? 38.098  7.945   20.458  1.00 38.11  ? 318  GLU A C   1 
ATOM   1965  O  O   . GLU A 1 272 ? 37.485  7.247   19.660  1.00 37.75  ? 318  GLU A O   1 
ATOM   1966  C  CB  . GLU A 1 272 ? 40.233  9.085   19.881  1.00 39.07  ? 318  GLU A CB  1 
ATOM   1967  C  CG  . GLU A 1 272 ? 40.590  7.877   19.038  1.00 40.63  ? 318  GLU A CG  1 
ATOM   1968  C  CD  . GLU A 1 272 ? 41.938  7.995   18.371  1.00 43.57  ? 318  GLU A CD  1 
ATOM   1969  O  OE1 . GLU A 1 272 ? 42.863  8.594   18.970  1.00 44.58  ? 318  GLU A OE1 1 
ATOM   1970  O  OE2 . GLU A 1 272 ? 42.085  7.474   17.248  1.00 45.01  ? 318  GLU A OE2 1 
ATOM   1971  N  N   . GLY A 1 273 ? 38.260  7.618   21.735  1.00 37.99  ? 319  GLY A N   1 
ATOM   1972  C  CA  . GLY A 1 273 ? 37.621  6.446   22.315  1.00 38.43  ? 319  GLY A CA  1 
ATOM   1973  C  C   . GLY A 1 273 ? 36.128  6.424   22.053  1.00 38.90  ? 319  GLY A C   1 
ATOM   1974  O  O   . GLY A 1 273 ? 35.569  5.387   21.703  1.00 39.36  ? 319  GLY A O   1 
ATOM   1975  N  N   . VAL A 1 274 ? 35.473  7.567   22.205  1.00 39.15  ? 320  VAL A N   1 
ATOM   1976  C  CA  . VAL A 1 274 ? 34.047  7.622   21.926  1.00 39.60  ? 320  VAL A CA  1 
ATOM   1977  C  C   . VAL A 1 274 ? 33.803  7.310   20.447  1.00 40.02  ? 320  VAL A C   1 
ATOM   1978  O  O   . VAL A 1 274 ? 32.946  6.497   20.099  1.00 40.06  ? 320  VAL A O   1 
ATOM   1979  C  CB  . VAL A 1 274 ? 33.406  8.964   22.385  1.00 39.71  ? 320  VAL A CB  1 
ATOM   1980  C  CG1 . VAL A 1 274 ? 32.021  9.129   21.787  1.00 38.25  ? 320  VAL A CG1 1 
ATOM   1981  C  CG2 . VAL A 1 274 ? 33.344  9.015   23.910  1.00 38.78  ? 320  VAL A CG2 1 
ATOM   1982  N  N   . LYS A 1 275 ? 34.598  7.923   19.585  1.00 40.57  ? 321  LYS A N   1 
ATOM   1983  C  CA  . LYS A 1 275 ? 34.430  7.725   18.151  1.00 41.37  ? 321  LYS A CA  1 
ATOM   1984  C  C   . LYS A 1 275 ? 34.728  6.313   17.649  1.00 41.18  ? 321  LYS A C   1 
ATOM   1985  O  O   . LYS A 1 275 ? 34.101  5.850   16.698  1.00 41.34  ? 321  LYS A O   1 
ATOM   1986  C  CB  . LYS A 1 275 ? 35.226  8.760   17.353  1.00 41.90  ? 321  LYS A CB  1 
ATOM   1987  C  CG  . LYS A 1 275 ? 34.492  10.110  17.264  1.00 44.01  ? 321  LYS A CG  1 
ATOM   1988  C  CD  . LYS A 1 275 ? 33.355  10.076  16.207  1.00 46.45  ? 321  LYS A CD  1 
ATOM   1989  C  CE  . LYS A 1 275 ? 32.021  10.549  16.816  1.00 47.31  ? 321  LYS A CE  1 
ATOM   1990  N  NZ  . LYS A 1 275 ? 30.910  10.347  15.862  1.00 48.76  ? 321  LYS A NZ  1 
ATOM   1991  N  N   . ARG A 1 276 ? 35.658  5.616   18.289  1.00 40.92  ? 322  ARG A N   1 
ATOM   1992  C  CA  . ARG A 1 276 ? 36.010  4.281   17.822  1.00 40.69  ? 322  ARG A CA  1 
ATOM   1993  C  C   . ARG A 1 276 ? 35.431  3.202   18.716  1.00 40.58  ? 322  ARG A C   1 
ATOM   1994  O  O   . ARG A 1 276 ? 35.839  2.046   18.674  1.00 40.47  ? 322  ARG A O   1 
ATOM   1995  C  CB  . ARG A 1 276 ? 37.517  4.181   17.649  1.00 40.86  ? 322  ARG A CB  1 
ATOM   1996  C  CG  . ARG A 1 276 ? 38.027  5.320   16.785  1.00 41.78  ? 322  ARG A CG  1 
ATOM   1997  C  CD  . ARG A 1 276 ? 39.480  5.283   16.667  1.00 42.62  ? 322  ARG A CD  1 
ATOM   1998  N  NE  . ARG A 1 276 ? 39.864  4.140   15.851  1.00 46.09  ? 322  ARG A NE  1 
ATOM   1999  C  CZ  . ARG A 1 276 ? 41.117  3.752   15.628  1.00 47.90  ? 322  ARG A CZ  1 
ATOM   2000  N  NH1 . ARG A 1 276 ? 42.136  4.409   16.173  1.00 48.03  ? 322  ARG A NH1 1 
ATOM   2001  N  NH2 . ARG A 1 276 ? 41.348  2.692   14.869  1.00 48.15  ? 322  ARG A NH2 1 
ATOM   2002  N  N   . PHE A 1 277 ? 34.423  3.601   19.485  1.00 40.41  ? 323  PHE A N   1 
ATOM   2003  C  CA  . PHE A 1 277 ? 33.751  2.727   20.403  1.00 40.19  ? 323  PHE A CA  1 
ATOM   2004  C  C   . PHE A 1 277 ? 33.381  1.366   19.803  1.00 40.58  ? 323  PHE A C   1 
ATOM   2005  O  O   . PHE A 1 277 ? 33.631  0.337   20.434  1.00 40.95  ? 323  PHE A O   1 
ATOM   2006  C  CB  . PHE A 1 277 ? 32.504  3.397   20.932  1.00 39.83  ? 323  PHE A CB  1 
ATOM   2007  C  CG  . PHE A 1 277 ? 31.734  2.540   21.860  1.00 38.65  ? 323  PHE A CG  1 
ATOM   2008  C  CD1 . PHE A 1 277 ? 32.033  2.541   23.196  1.00 37.00  ? 323  PHE A CD1 1 
ATOM   2009  C  CD2 . PHE A 1 277 ? 30.735  1.711   21.395  1.00 38.59  ? 323  PHE A CD2 1 
ATOM   2010  C  CE1 . PHE A 1 277 ? 31.327  1.752   24.079  1.00 38.64  ? 323  PHE A CE1 1 
ATOM   2011  C  CE2 . PHE A 1 277 ? 30.014  0.900   22.273  1.00 38.90  ? 323  PHE A CE2 1 
ATOM   2012  C  CZ  . PHE A 1 277 ? 30.299  0.917   23.613  1.00 38.60  ? 323  PHE A CZ  1 
ATOM   2013  N  N   . ASP A 1 278 ? 32.778  1.347   18.611  1.00 40.61  ? 324  ASP A N   1 
ATOM   2014  C  CA  . ASP A 1 278 ? 32.325  0.079   18.034  1.00 40.96  ? 324  ASP A CA  1 
ATOM   2015  C  C   . ASP A 1 278 ? 33.465  -0.923  17.943  1.00 40.67  ? 324  ASP A C   1 
ATOM   2016  O  O   . ASP A 1 278 ? 33.310  -2.099  18.292  1.00 40.66  ? 324  ASP A O   1 
ATOM   2017  C  CB  . ASP A 1 278 ? 31.643  0.267   16.675  1.00 41.23  ? 324  ASP A CB  1 
ATOM   2018  C  CG  . ASP A 1 278 ? 30.211  0.816   16.798  1.00 43.41  ? 324  ASP A CG  1 
ATOM   2019  O  OD1 . ASP A 1 278 ? 29.553  0.656   17.856  1.00 44.39  ? 324  ASP A OD1 1 
ATOM   2020  O  OD2 . ASP A 1 278 ? 29.735  1.411   15.819  1.00 45.82  ? 324  ASP A OD2 1 
ATOM   2021  N  N   . GLU A 1 279 ? 34.627  -0.451  17.502  1.00 40.43  ? 325  GLU A N   1 
ATOM   2022  C  CA  . GLU A 1 279 ? 35.740  -1.346  17.312  1.00 40.03  ? 325  GLU A CA  1 
ATOM   2023  C  C   . GLU A 1 279 ? 36.228  -1.810  18.675  1.00 39.64  ? 325  GLU A C   1 
ATOM   2024  O  O   . GLU A 1 279 ? 36.530  -2.974  18.866  1.00 40.08  ? 325  GLU A O   1 
ATOM   2025  C  CB  . GLU A 1 279 ? 36.834  -0.694  16.457  1.00 40.05  ? 325  GLU A CB  1 
ATOM   2026  C  CG  . GLU A 1 279 ? 37.921  0.052   17.224  1.00 40.71  ? 325  GLU A CG  1 
ATOM   2027  C  CD  . GLU A 1 279 ? 38.958  0.660   16.306  1.00 41.50  ? 325  GLU A CD  1 
ATOM   2028  O  OE1 . GLU A 1 279 ? 38.567  1.355   15.350  1.00 42.04  ? 325  GLU A OE1 1 
ATOM   2029  O  OE2 . GLU A 1 279 ? 40.167  0.447   16.539  1.00 41.92  ? 325  GLU A OE2 1 
ATOM   2030  N  N   . ILE A 1 280 ? 36.240  -0.899  19.631  1.00 39.48  ? 326  ILE A N   1 
ATOM   2031  C  CA  . ILE A 1 280 ? 36.687  -1.207  20.982  1.00 39.04  ? 326  ILE A CA  1 
ATOM   2032  C  C   . ILE A 1 280 ? 35.784  -2.224  21.663  1.00 39.20  ? 326  ILE A C   1 
ATOM   2033  O  O   . ILE A 1 280 ? 36.282  -3.119  22.345  1.00 39.29  ? 326  ILE A O   1 
ATOM   2034  C  CB  . ILE A 1 280 ? 36.830  0.069   21.829  1.00 38.90  ? 326  ILE A CB  1 
ATOM   2035  C  CG1 . ILE A 1 280 ? 37.875  0.991   21.187  1.00 38.99  ? 326  ILE A CG1 1 
ATOM   2036  C  CG2 . ILE A 1 280 ? 37.196  -0.272  23.278  1.00 37.00  ? 326  ILE A CG2 1 
ATOM   2037  C  CD1 . ILE A 1 280 ? 37.628  2.463   21.456  1.00 38.38  ? 326  ILE A CD1 1 
ATOM   2038  N  N   . LEU A 1 281 ? 34.476  -2.118  21.454  1.00 39.33  ? 327  LEU A N   1 
ATOM   2039  C  CA  . LEU A 1 281 ? 33.533  -2.998  22.144  1.00 39.97  ? 327  LEU A CA  1 
ATOM   2040  C  C   . LEU A 1 281 ? 33.707  -4.424  21.678  1.00 40.64  ? 327  LEU A C   1 
ATOM   2041  O  O   . LEU A 1 281 ? 33.744  -5.352  22.486  1.00 41.03  ? 327  LEU A O   1 
ATOM   2042  C  CB  . LEU A 1 281 ? 32.086  -2.574  21.895  1.00 39.66  ? 327  LEU A CB  1 
ATOM   2043  C  CG  . LEU A 1 281 ? 31.052  -2.809  22.990  1.00 39.08  ? 327  LEU A CG  1 
ATOM   2044  C  CD1 . LEU A 1 281 ? 29.699  -3.034  22.320  1.00 39.39  ? 327  LEU A CD1 1 
ATOM   2045  C  CD2 . LEU A 1 281 ? 31.384  -3.959  23.919  1.00 38.64  ? 327  LEU A CD2 1 
ATOM   2046  N  N   . GLU A 1 282 ? 33.824  -4.585  20.368  1.00 41.40  ? 328  GLU A N   1 
ATOM   2047  C  CA  . GLU A 1 282 ? 33.880  -5.892  19.738  1.00 41.91  ? 328  GLU A CA  1 
ATOM   2048  C  C   . GLU A 1 282 ? 34.995  -6.752  20.300  1.00 41.41  ? 328  GLU A C   1 
ATOM   2049  O  O   . GLU A 1 282 ? 34.920  -7.981  20.309  1.00 41.40  ? 328  GLU A O   1 
ATOM   2050  C  CB  . GLU A 1 282 ? 34.101  -5.712  18.250  1.00 42.02  ? 328  GLU A CB  1 
ATOM   2051  C  CG  . GLU A 1 282 ? 33.410  -6.746  17.428  1.00 44.44  ? 328  GLU A CG  1 
ATOM   2052  C  CD  . GLU A 1 282 ? 33.719  -6.585  15.965  1.00 49.01  ? 328  GLU A CD  1 
ATOM   2053  O  OE1 . GLU A 1 282 ? 34.724  -5.890  15.633  1.00 48.88  ? 328  GLU A OE1 1 
ATOM   2054  O  OE2 . GLU A 1 282 ? 32.965  -7.162  15.141  1.00 51.00  ? 328  GLU A OE2 1 
ATOM   2055  N  N   . VAL A 1 283 ? 36.016  -6.077  20.791  1.00 41.17  ? 329  VAL A N   1 
ATOM   2056  C  CA  . VAL A 1 283 ? 37.264  -6.709  21.195  1.00 41.00  ? 329  VAL A CA  1 
ATOM   2057  C  C   . VAL A 1 283 ? 37.447  -6.787  22.726  1.00 41.17  ? 329  VAL A C   1 
ATOM   2058  O  O   . VAL A 1 283 ? 38.371  -7.443  23.206  1.00 41.21  ? 329  VAL A O   1 
ATOM   2059  C  CB  . VAL A 1 283 ? 38.424  -5.965  20.499  1.00 40.99  ? 329  VAL A CB  1 
ATOM   2060  C  CG1 . VAL A 1 283 ? 39.510  -5.594  21.454  1.00 40.50  ? 329  VAL A CG1 1 
ATOM   2061  C  CG2 . VAL A 1 283 ? 38.927  -6.760  19.311  1.00 40.18  ? 329  VAL A CG2 1 
ATOM   2062  N  N   . SER A 1 284 ? 36.552  -6.129  23.471  1.00 40.91  ? 330  SER A N   1 
ATOM   2063  C  CA  . SER A 1 284 ? 36.607  -6.078  24.926  1.00 40.83  ? 330  SER A CA  1 
ATOM   2064  C  C   . SER A 1 284 ? 35.520  -6.949  25.536  1.00 40.86  ? 330  SER A C   1 
ATOM   2065  O  O   . SER A 1 284 ? 34.567  -7.330  24.865  1.00 40.79  ? 330  SER A O   1 
ATOM   2066  C  CB  . SER A 1 284 ? 36.433  -4.634  25.405  1.00 40.96  ? 330  SER A CB  1 
ATOM   2067  O  OG  . SER A 1 284 ? 37.251  -3.763  24.641  1.00 41.06  ? 330  SER A OG  1 
ATOM   2068  N  N   . ASP A 1 285 ? 35.655  -7.249  26.817  1.00 40.85  ? 331  ASP A N   1 
ATOM   2069  C  CA  . ASP A 1 285 ? 34.635  -8.005  27.500  1.00 41.43  ? 331  ASP A CA  1 
ATOM   2070  C  C   . ASP A 1 285 ? 33.538  -7.089  27.996  1.00 41.55  ? 331  ASP A C   1 
ATOM   2071  O  O   . ASP A 1 285 ? 32.421  -7.538  28.289  1.00 42.01  ? 331  ASP A O   1 
ATOM   2072  C  CB  . ASP A 1 285 ? 35.236  -8.769  28.675  1.00 41.72  ? 331  ASP A CB  1 
ATOM   2073  C  CG  . ASP A 1 285 ? 36.244  -9.818  28.235  1.00 42.62  ? 331  ASP A CG  1 
ATOM   2074  O  OD1 . ASP A 1 285 ? 35.905  -10.671 27.395  1.00 43.53  ? 331  ASP A OD1 1 
ATOM   2075  O  OD2 . ASP A 1 285 ? 37.383  -9.801  28.732  1.00 44.99  ? 331  ASP A OD2 1 
ATOM   2076  N  N   . GLY A 1 286 ? 33.867  -5.806  28.092  1.00 41.31  ? 332  GLY A N   1 
ATOM   2077  C  CA  . GLY A 1 286 ? 32.939  -4.808  28.606  1.00 40.94  ? 332  GLY A CA  1 
ATOM   2078  C  C   . GLY A 1 286 ? 33.451  -3.389  28.481  1.00 40.54  ? 332  GLY A C   1 
ATOM   2079  O  O   . GLY A 1 286 ? 34.531  -3.139  27.953  1.00 40.94  ? 332  GLY A O   1 
ATOM   2080  N  N   . ILE A 1 287 ? 32.659  -2.452  28.974  1.00 40.28  ? 333  ILE A N   1 
ATOM   2081  C  CA  . ILE A 1 287 ? 32.985  -1.036  28.861  1.00 39.67  ? 333  ILE A CA  1 
ATOM   2082  C  C   . ILE A 1 287 ? 32.794  -0.322  30.215  1.00 39.42  ? 333  ILE A C   1 
ATOM   2083  O  O   . ILE A 1 287 ? 31.916  -0.700  31.000  1.00 38.98  ? 333  ILE A O   1 
ATOM   2084  C  CB  . ILE A 1 287 ? 32.119  -0.387  27.751  1.00 39.32  ? 333  ILE A CB  1 
ATOM   2085  C  CG1 . ILE A 1 287 ? 32.536  -0.889  26.375  1.00 39.18  ? 333  ILE A CG1 1 
ATOM   2086  C  CG2 . ILE A 1 287 ? 32.131  1.131   27.812  1.00 39.10  ? 333  ILE A CG2 1 
ATOM   2087  C  CD1 . ILE A 1 287 ? 33.929  -0.432  25.876  1.00 38.71  ? 333  ILE A CD1 1 
ATOM   2088  N  N   . MET A 1 288 ? 33.663  0.663   30.475  1.00 39.20  ? 334  MET A N   1 
ATOM   2089  C  CA  . MET A 1 288 ? 33.478  1.648   31.542  1.00 39.06  ? 334  MET A CA  1 
ATOM   2090  C  C   . MET A 1 288 ? 33.248  3.059   30.992  1.00 38.69  ? 334  MET A C   1 
ATOM   2091  O  O   . MET A 1 288 ? 34.093  3.605   30.270  1.00 38.50  ? 334  MET A O   1 
ATOM   2092  C  CB  . MET A 1 288 ? 34.667  1.686   32.511  1.00 39.02  ? 334  MET A CB  1 
ATOM   2093  C  CG  . MET A 1 288 ? 34.311  2.508   33.768  1.00 39.82  ? 334  MET A CG  1 
ATOM   2094  S  SD  . MET A 1 288 ? 35.650  3.250   34.737  1.00 38.93  ? 334  MET A SD  1 
ATOM   2095  C  CE  . MET A 1 288 ? 36.219  1.799   35.628  1.00 38.61  ? 334  MET A CE  1 
ATOM   2096  N  N   . VAL A 1 289 ? 32.104  3.644   31.343  1.00 38.03  ? 335  VAL A N   1 
ATOM   2097  C  CA  . VAL A 1 289 ? 31.832  5.010   30.952  1.00 37.37  ? 335  VAL A CA  1 
ATOM   2098  C  C   . VAL A 1 289 ? 32.593  5.853   31.935  1.00 38.15  ? 335  VAL A C   1 
ATOM   2099  O  O   . VAL A 1 289 ? 32.077  6.140   33.037  1.00 37.76  ? 335  VAL A O   1 
ATOM   2100  C  CB  . VAL A 1 289 ? 30.320  5.360   30.936  1.00 36.88  ? 335  VAL A CB  1 
ATOM   2101  C  CG1 . VAL A 1 289 ? 30.106  6.789   30.515  1.00 35.25  ? 335  VAL A CG1 1 
ATOM   2102  C  CG2 . VAL A 1 289 ? 29.582  4.468   29.967  1.00 34.99  ? 335  VAL A CG2 1 
ATOM   2103  N  N   . ALA A 1 290 ? 33.833  6.204   31.545  1.00 38.72  ? 336  ALA A N   1 
ATOM   2104  C  CA  . ALA A 1 290 ? 34.771  6.895   32.443  1.00 38.80  ? 336  ALA A CA  1 
ATOM   2105  C  C   . ALA A 1 290 ? 34.494  8.398   32.455  1.00 38.98  ? 336  ALA A C   1 
ATOM   2106  O  O   . ALA A 1 290 ? 35.231  9.182   31.847  1.00 39.73  ? 336  ALA A O   1 
ATOM   2107  C  CB  . ALA A 1 290 ? 36.179  6.616   32.039  1.00 38.55  ? 336  ALA A CB  1 
ATOM   2108  N  N   . ARG A 1 291 ? 33.434  8.794   33.150  1.00 38.75  ? 337  ARG A N   1 
ATOM   2109  C  CA  . ARG A 1 291 ? 32.924  10.156  33.086  1.00 38.58  ? 337  ARG A CA  1 
ATOM   2110  C  C   . ARG A 1 291 ? 33.933  11.222  33.447  1.00 38.73  ? 337  ARG A C   1 
ATOM   2111  O  O   . ARG A 1 291 ? 34.002  12.240  32.776  1.00 38.75  ? 337  ARG A O   1 
ATOM   2112  C  CB  . ARG A 1 291 ? 31.704  10.311  33.975  1.00 38.58  ? 337  ARG A CB  1 
ATOM   2113  C  CG  . ARG A 1 291 ? 30.440  9.709   33.420  1.00 37.22  ? 337  ARG A CG  1 
ATOM   2114  C  CD  . ARG A 1 291 ? 29.743  9.147   34.604  1.00 35.95  ? 337  ARG A CD  1 
ATOM   2115  N  NE  . ARG A 1 291 ? 28.356  9.547   34.652  1.00 33.35  ? 337  ARG A NE  1 
ATOM   2116  C  CZ  . ARG A 1 291 ? 27.690  9.762   35.779  1.00 31.67  ? 337  ARG A CZ  1 
ATOM   2117  N  NH1 . ARG A 1 291 ? 28.287  9.654   36.950  1.00 31.07  ? 337  ARG A NH1 1 
ATOM   2118  N  NH2 . ARG A 1 291 ? 26.428  10.136  35.728  1.00 33.51  ? 337  ARG A NH2 1 
ATOM   2119  N  N   . GLY A 1 292 ? 34.687  10.992  34.523  1.00 39.14  ? 338  GLY A N   1 
ATOM   2120  C  CA  . GLY A 1 292 ? 35.725  11.925  34.990  1.00 38.99  ? 338  GLY A CA  1 
ATOM   2121  C  C   . GLY A 1 292 ? 36.515  12.540  33.856  1.00 39.26  ? 338  GLY A C   1 
ATOM   2122  O  O   . GLY A 1 292 ? 36.326  13.727  33.559  1.00 39.23  ? 338  GLY A O   1 
ATOM   2123  N  N   . ASP A 1 293 ? 37.375  11.731  33.219  1.00 38.78  ? 339  ASP A N   1 
ATOM   2124  C  CA  . ASP A 1 293 ? 38.193  12.198  32.126  1.00 39.12  ? 339  ASP A CA  1 
ATOM   2125  C  C   . ASP A 1 293 ? 37.319  12.622  30.971  1.00 39.35  ? 339  ASP A C   1 
ATOM   2126  O  O   . ASP A 1 293 ? 37.502  13.718  30.411  1.00 39.37  ? 339  ASP A O   1 
ATOM   2127  C  CB  . ASP A 1 293 ? 39.208  11.135  31.674  1.00 39.27  ? 339  ASP A CB  1 
ATOM   2128  C  CG  . ASP A 1 293 ? 40.403  10.998  32.633  1.00 40.18  ? 339  ASP A CG  1 
ATOM   2129  O  OD1 . ASP A 1 293 ? 41.197  11.959  32.669  1.00 35.83  ? 339  ASP A OD1 1 
ATOM   2130  O  OD2 . ASP A 1 293 ? 40.542  9.948   33.345  1.00 40.52  ? 339  ASP A OD2 1 
ATOM   2131  N  N   . LEU A 1 294 ? 36.366  11.763  30.609  1.00 39.47  ? 340  LEU A N   1 
ATOM   2132  C  CA  . LEU A 1 294 ? 35.447  12.066  29.496  1.00 39.06  ? 340  LEU A CA  1 
ATOM   2133  C  C   . LEU A 1 294 ? 34.842  13.450  29.631  1.00 38.97  ? 340  LEU A C   1 
ATOM   2134  O  O   . LEU A 1 294 ? 34.692  14.153  28.650  1.00 39.10  ? 340  LEU A O   1 
ATOM   2135  C  CB  . LEU A 1 294 ? 34.324  11.045  29.418  1.00 38.76  ? 340  LEU A CB  1 
ATOM   2136  C  CG  . LEU A 1 294 ? 33.602  10.932  28.083  1.00 39.01  ? 340  LEU A CG  1 
ATOM   2137  C  CD1 . LEU A 1 294 ? 34.601  10.702  26.885  1.00 37.29  ? 340  LEU A CD1 1 
ATOM   2138  C  CD2 . LEU A 1 294 ? 32.572  9.828   28.164  1.00 37.39  ? 340  LEU A CD2 1 
ATOM   2139  N  N   . GLY A 1 295 ? 34.506  13.836  30.857  1.00 39.05  ? 341  GLY A N   1 
ATOM   2140  C  CA  . GLY A 1 295 ? 33.890  15.119  31.116  1.00 38.99  ? 341  GLY A CA  1 
ATOM   2141  C  C   . GLY A 1 295 ? 34.842  16.292  31.043  1.00 39.08  ? 341  GLY A C   1 
ATOM   2142  O  O   . GLY A 1 295 ? 34.439  17.422  31.245  1.00 39.58  ? 341  GLY A O   1 
ATOM   2143  N  N   . ILE A 1 296 ? 36.114  16.027  30.769  1.00 39.15  ? 342  ILE A N   1 
ATOM   2144  C  CA  . ILE A 1 296 ? 37.122  17.082  30.641  1.00 38.64  ? 342  ILE A CA  1 
ATOM   2145  C  C   . ILE A 1 296 ? 37.602  17.125  29.208  1.00 38.31  ? 342  ILE A C   1 
ATOM   2146  O  O   . ILE A 1 296 ? 37.942  18.189  28.690  1.00 37.64  ? 342  ILE A O   1 
ATOM   2147  C  CB  . ILE A 1 296 ? 38.325  16.855  31.568  1.00 38.20  ? 342  ILE A CB  1 
ATOM   2148  C  CG1 . ILE A 1 296 ? 37.862  16.601  32.992  1.00 39.12  ? 342  ILE A CG1 1 
ATOM   2149  C  CG2 . ILE A 1 296 ? 39.156  18.066  31.598  1.00 38.56  ? 342  ILE A CG2 1 
ATOM   2150  C  CD1 . ILE A 1 296 ? 38.982  16.343  33.966  1.00 38.64  ? 342  ILE A CD1 1 
ATOM   2151  N  N   . GLU A 1 297 ? 37.614  15.952  28.584  1.00 38.38  ? 343  GLU A N   1 
ATOM   2152  C  CA  . GLU A 1 297 ? 38.082  15.791  27.219  1.00 38.75  ? 343  GLU A CA  1 
ATOM   2153  C  C   . GLU A 1 297 ? 37.063  16.304  26.227  1.00 38.77  ? 343  GLU A C   1 
ATOM   2154  O  O   . GLU A 1 297 ? 37.412  16.943  25.242  1.00 39.39  ? 343  GLU A O   1 
ATOM   2155  C  CB  . GLU A 1 297 ? 38.421  14.328  26.933  1.00 38.66  ? 343  GLU A CB  1 
ATOM   2156  C  CG  . GLU A 1 297 ? 39.552  13.769  27.793  1.00 39.01  ? 343  GLU A CG  1 
ATOM   2157  C  CD  . GLU A 1 297 ? 40.933  14.264  27.362  1.00 40.14  ? 343  GLU A CD  1 
ATOM   2158  O  OE1 . GLU A 1 297 ? 41.744  14.583  28.255  1.00 40.43  ? 343  GLU A OE1 1 
ATOM   2159  O  OE2 . GLU A 1 297 ? 41.223  14.333  26.140  1.00 40.48  ? 343  GLU A OE2 1 
ATOM   2160  N  N   . ILE A 1 298 ? 35.803  16.009  26.485  1.00 38.87  ? 344  ILE A N   1 
ATOM   2161  C  CA  . ILE A 1 298 ? 34.712  16.557  25.696  1.00 38.79  ? 344  ILE A CA  1 
ATOM   2162  C  C   . ILE A 1 298 ? 33.917  17.495  26.612  1.00 38.86  ? 344  ILE A C   1 
ATOM   2163  O  O   . ILE A 1 298 ? 34.062  17.434  27.848  1.00 39.14  ? 344  ILE A O   1 
ATOM   2164  C  CB  . ILE A 1 298 ? 33.800  15.448  25.139  1.00 38.99  ? 344  ILE A CB  1 
ATOM   2165  C  CG1 . ILE A 1 298 ? 32.940  14.821  26.258  1.00 38.41  ? 344  ILE A CG1 1 
ATOM   2166  C  CG2 . ILE A 1 298 ? 34.631  14.408  24.374  1.00 38.22  ? 344  ILE A CG2 1 
ATOM   2167  C  CD1 . ILE A 1 298 ? 31.833  13.935  25.742  1.00 37.67  ? 344  ILE A CD1 1 
ATOM   2168  N  N   . PRO A 1 299 ? 33.107  18.391  26.019  1.00 38.35  ? 345  PRO A N   1 
ATOM   2169  C  CA  . PRO A 1 299 ? 32.344  19.304  26.848  1.00 38.00  ? 345  PRO A CA  1 
ATOM   2170  C  C   . PRO A 1 299 ? 31.519  18.542  27.865  1.00 37.66  ? 345  PRO A C   1 
ATOM   2171  O  O   . PRO A 1 299 ? 30.961  17.496  27.539  1.00 37.87  ? 345  PRO A O   1 
ATOM   2172  C  CB  . PRO A 1 299 ? 31.450  20.020  25.836  1.00 38.20  ? 345  PRO A CB  1 
ATOM   2173  C  CG  . PRO A 1 299 ? 32.255  19.981  24.561  1.00 38.22  ? 345  PRO A CG  1 
ATOM   2174  C  CD  . PRO A 1 299 ? 32.885  18.633  24.582  1.00 38.01  ? 345  PRO A CD  1 
ATOM   2175  N  N   . ALA A 1 300 ? 31.494  19.058  29.097  1.00 37.14  ? 346  ALA A N   1 
ATOM   2176  C  CA  . ALA A 1 300 ? 30.623  18.570  30.157  1.00 36.55  ? 346  ALA A CA  1 
ATOM   2177  C  C   . ALA A 1 300 ? 29.152  18.381  29.757  1.00 36.57  ? 346  ALA A C   1 
ATOM   2178  O  O   . ALA A 1 300 ? 28.550  17.440  30.228  1.00 37.14  ? 346  ALA A O   1 
ATOM   2179  C  CB  . ALA A 1 300 ? 30.717  19.466  31.349  1.00 35.90  ? 346  ALA A CB  1 
ATOM   2180  N  N   . GLU A 1 301 ? 28.597  19.253  28.902  1.00 36.20  ? 347  GLU A N   1 
ATOM   2181  C  CA  . GLU A 1 301 ? 27.230  19.102  28.378  1.00 36.29  ? 347  GLU A CA  1 
ATOM   2182  C  C   . GLU A 1 301 ? 26.978  17.811  27.627  1.00 36.00  ? 347  GLU A C   1 
ATOM   2183  O  O   . GLU A 1 301 ? 25.817  17.454  27.410  1.00 35.95  ? 347  GLU A O   1 
ATOM   2184  C  CB  . GLU A 1 301 ? 26.857  20.198  27.364  1.00 36.59  ? 347  GLU A CB  1 
ATOM   2185  C  CG  . GLU A 1 301 ? 27.205  21.595  27.696  1.00 38.94  ? 347  GLU A CG  1 
ATOM   2186  C  CD  . GLU A 1 301 ? 28.661  21.880  27.434  1.00 40.58  ? 347  GLU A CD  1 
ATOM   2187  O  OE1 . GLU A 1 301 ? 28.970  22.413  26.345  1.00 39.88  ? 347  GLU A OE1 1 
ATOM   2188  O  OE2 . GLU A 1 301 ? 29.476  21.544  28.312  1.00 40.37  ? 347  GLU A OE2 1 
ATOM   2189  N  N   . LYS A 1 302 ? 28.032  17.136  27.191  1.00 35.85  ? 348  LYS A N   1 
ATOM   2190  C  CA  . LYS A 1 302 ? 27.881  16.093  26.192  1.00 36.13  ? 348  LYS A CA  1 
ATOM   2191  C  C   . LYS A 1 302 ? 28.084  14.698  26.728  1.00 36.66  ? 348  LYS A C   1 
ATOM   2192  O  O   . LYS A 1 302 ? 27.672  13.733  26.098  1.00 37.29  ? 348  LYS A O   1 
ATOM   2193  C  CB  . LYS A 1 302 ? 28.797  16.355  24.989  1.00 36.35  ? 348  LYS A CB  1 
ATOM   2194  C  CG  . LYS A 1 302 ? 28.286  17.473  24.112  1.00 36.72  ? 348  LYS A CG  1 
ATOM   2195  C  CD  . LYS A 1 302 ? 29.062  17.584  22.841  1.00 38.19  ? 348  LYS A CD  1 
ATOM   2196  C  CE  . LYS A 1 302 ? 28.398  18.560  21.896  1.00 39.61  ? 348  LYS A CE  1 
ATOM   2197  N  NZ  . LYS A 1 302 ? 27.147  17.977  21.277  1.00 41.77  ? 348  LYS A NZ  1 
ATOM   2198  N  N   . VAL A 1 303 ? 28.718  14.577  27.888  1.00 36.97  ? 349  VAL A N   1 
ATOM   2199  C  CA  . VAL A 1 303 ? 28.882  13.269  28.523  1.00 36.87  ? 349  VAL A CA  1 
ATOM   2200  C  C   . VAL A 1 303 ? 27.597  12.443  28.575  1.00 37.21  ? 349  VAL A C   1 
ATOM   2201  O  O   . VAL A 1 303 ? 27.589  11.314  28.106  1.00 38.10  ? 349  VAL A O   1 
ATOM   2202  C  CB  . VAL A 1 303 ? 29.515  13.361  29.930  1.00 36.78  ? 349  VAL A CB  1 
ATOM   2203  C  CG1 . VAL A 1 303 ? 29.776  11.987  30.478  1.00 35.46  ? 349  VAL A CG1 1 
ATOM   2204  C  CG2 . VAL A 1 303 ? 30.819  14.134  29.863  1.00 36.06  ? 349  VAL A CG2 1 
ATOM   2205  N  N   . PHE A 1 304 ? 26.505  12.990  29.099  1.00 37.06  ? 350  PHE A N   1 
ATOM   2206  C  CA  . PHE A 1 304 ? 25.242  12.197  29.165  1.00 36.36  ? 350  PHE A CA  1 
ATOM   2207  C  C   . PHE A 1 304 ? 24.914  11.485  27.847  1.00 36.21  ? 350  PHE A C   1 
ATOM   2208  O  O   . PHE A 1 304 ? 24.417  10.353  27.853  1.00 36.11  ? 350  PHE A O   1 
ATOM   2209  C  CB  . PHE A 1 304 ? 24.040  13.018  29.677  1.00 35.75  ? 350  PHE A CB  1 
ATOM   2210  C  CG  . PHE A 1 304 ? 23.353  13.794  28.623  1.00 33.95  ? 350  PHE A CG  1 
ATOM   2211  C  CD1 . PHE A 1 304 ? 23.834  15.028  28.238  1.00 34.16  ? 350  PHE A CD1 1 
ATOM   2212  C  CD2 . PHE A 1 304 ? 22.240  13.271  27.984  1.00 34.18  ? 350  PHE A CD2 1 
ATOM   2213  C  CE1 . PHE A 1 304 ? 23.215  15.741  27.235  1.00 33.49  ? 350  PHE A CE1 1 
ATOM   2214  C  CE2 . PHE A 1 304 ? 21.620  13.955  26.976  1.00 32.30  ? 350  PHE A CE2 1 
ATOM   2215  C  CZ  . PHE A 1 304 ? 22.097  15.203  26.604  1.00 33.99  ? 350  PHE A CZ  1 
ATOM   2216  N  N   . LEU A 1 305 ? 25.220  12.146  26.731  1.00 36.14  ? 351  LEU A N   1 
ATOM   2217  C  CA  . LEU A 1 305 ? 25.061  11.536  25.425  1.00 36.20  ? 351  LEU A CA  1 
ATOM   2218  C  C   . LEU A 1 305 ? 26.043  10.375  25.234  1.00 36.95  ? 351  LEU A C   1 
ATOM   2219  O  O   . LEU A 1 305 ? 25.670  9.317   24.726  1.00 37.37  ? 351  LEU A O   1 
ATOM   2220  C  CB  . LEU A 1 305 ? 25.247  12.554  24.318  1.00 35.91  ? 351  LEU A CB  1 
ATOM   2221  C  CG  . LEU A 1 305 ? 24.339  13.769  24.273  1.00 35.03  ? 351  LEU A CG  1 
ATOM   2222  C  CD1 . LEU A 1 305 ? 25.015  14.873  23.470  1.00 33.19  ? 351  LEU A CD1 1 
ATOM   2223  C  CD2 . LEU A 1 305 ? 23.006  13.374  23.666  1.00 33.70  ? 351  LEU A CD2 1 
ATOM   2224  N  N   . ALA A 1 306 ? 27.291  10.538  25.647  1.00 37.11  ? 352  ALA A N   1 
ATOM   2225  C  CA  . ALA A 1 306 ? 28.208  9.425   25.458  1.00 37.66  ? 352  ALA A CA  1 
ATOM   2226  C  C   . ALA A 1 306 ? 27.786  8.274   26.354  1.00 37.81  ? 352  ALA A C   1 
ATOM   2227  O  O   . ALA A 1 306 ? 27.755  7.111   25.916  1.00 38.36  ? 352  ALA A O   1 
ATOM   2228  C  CB  . ALA A 1 306 ? 29.660  9.820   25.709  1.00 37.53  ? 352  ALA A CB  1 
ATOM   2229  N  N   . GLN A 1 307 ? 27.440  8.596   27.598  1.00 37.70  ? 353  GLN A N   1 
ATOM   2230  C  CA  . GLN A 1 307 ? 26.952  7.581   28.533  1.00 37.28  ? 353  GLN A CA  1 
ATOM   2231  C  C   . GLN A 1 307 ? 25.750  6.810   27.971  1.00 37.42  ? 353  GLN A C   1 
ATOM   2232  O  O   . GLN A 1 307 ? 25.772  5.571   27.909  1.00 37.52  ? 353  GLN A O   1 
ATOM   2233  C  CB  . GLN A 1 307 ? 26.632  8.159   29.915  1.00 36.65  ? 353  GLN A CB  1 
ATOM   2234  C  CG  . GLN A 1 307 ? 25.745  7.258   30.745  1.00 35.77  ? 353  GLN A CG  1 
ATOM   2235  C  CD  . GLN A 1 307 ? 25.521  7.770   32.145  1.00 36.56  ? 353  GLN A CD  1 
ATOM   2236  O  OE1 . GLN A 1 307 ? 26.319  8.536   32.664  1.00 39.35  ? 353  GLN A OE1 1 
ATOM   2237  N  NE2 . GLN A 1 307 ? 24.448  7.330   32.783  1.00 36.16  ? 353  GLN A NE2 1 
ATOM   2238  N  N   . LYS A 1 308 ? 24.714  7.509   27.537  1.00 37.45  ? 354  LYS A N   1 
ATOM   2239  C  CA  . LYS A 1 308 ? 23.523  6.758   27.120  1.00 37.81  ? 354  LYS A CA  1 
ATOM   2240  C  C   . LYS A 1 308 ? 23.757  5.937   25.841  1.00 38.34  ? 354  LYS A C   1 
ATOM   2241  O  O   . LYS A 1 308 ? 23.203  4.838   25.704  1.00 38.38  ? 354  LYS A O   1 
ATOM   2242  C  CB  . LYS A 1 308 ? 22.294  7.644   27.025  1.00 37.49  ? 354  LYS A CB  1 
ATOM   2243  C  CG  . LYS A 1 308 ? 21.840  8.136   28.396  1.00 35.68  ? 354  LYS A CG  1 
ATOM   2244  C  CD  . LYS A 1 308 ? 21.088  9.419   28.258  1.00 34.60  ? 354  LYS A CD  1 
ATOM   2245  C  CE  . LYS A 1 308 ? 20.633  9.856   29.599  1.00 36.33  ? 354  LYS A CE  1 
ATOM   2246  N  NZ  . LYS A 1 308 ? 19.468  9.022   30.046  1.00 35.66  ? 354  LYS A NZ  1 
ATOM   2247  N  N   . MET A 1 309 ? 24.602  6.456   24.938  1.00 38.32  ? 355  MET A N   1 
ATOM   2248  C  CA  . MET A 1 309 ? 24.932  5.774   23.679  1.00 37.93  ? 355  MET A CA  1 
ATOM   2249  C  C   . MET A 1 309 ? 25.751  4.522   23.921  1.00 38.08  ? 355  MET A C   1 
ATOM   2250  O  O   . MET A 1 309 ? 25.444  3.460   23.373  1.00 38.17  ? 355  MET A O   1 
ATOM   2251  C  CB  . MET A 1 309 ? 25.698  6.702   22.752  1.00 38.32  ? 355  MET A CB  1 
ATOM   2252  C  CG  . MET A 1 309 ? 26.202  6.074   21.445  1.00 38.34  ? 355  MET A CG  1 
ATOM   2253  S  SD  . MET A 1 309 ? 27.784  5.190   21.627  1.00 38.06  ? 355  MET A SD  1 
ATOM   2254  C  CE  . MET A 1 309 ? 28.942  6.535   21.575  1.00 35.27  ? 355  MET A CE  1 
ATOM   2255  N  N   . MET A 1 310 ? 26.798  4.631   24.731  1.00 37.89  ? 356  MET A N   1 
ATOM   2256  C  CA  . MET A 1 310 ? 27.559  3.429   25.136  1.00 37.73  ? 356  MET A CA  1 
ATOM   2257  C  C   . MET A 1 310 ? 26.736  2.379   25.894  1.00 37.56  ? 356  MET A C   1 
ATOM   2258  O  O   . MET A 1 310 ? 26.779  1.201   25.542  1.00 37.69  ? 356  MET A O   1 
ATOM   2259  C  CB  . MET A 1 310 ? 28.812  3.805   25.899  1.00 37.51  ? 356  MET A CB  1 
ATOM   2260  C  CG  . MET A 1 310 ? 29.675  4.660   25.036  1.00 38.79  ? 356  MET A CG  1 
ATOM   2261  S  SD  . MET A 1 310 ? 31.281  4.912   25.667  1.00 43.19  ? 356  MET A SD  1 
ATOM   2262  C  CE  . MET A 1 310 ? 31.074  6.330   26.733  1.00 39.01  ? 356  MET A CE  1 
ATOM   2263  N  N   . ILE A 1 311 ? 25.964  2.794   26.901  1.00 36.85  ? 357  ILE A N   1 
ATOM   2264  C  CA  . ILE A 1 311 ? 25.151  1.828   27.635  1.00 36.18  ? 357  ILE A CA  1 
ATOM   2265  C  C   . ILE A 1 311 ? 24.176  1.127   26.670  1.00 36.69  ? 357  ILE A C   1 
ATOM   2266  O  O   . ILE A 1 311 ? 23.961  -0.088  26.717  1.00 36.24  ? 357  ILE A O   1 
ATOM   2267  C  CB  . ILE A 1 311 ? 24.415  2.490   28.834  1.00 35.85  ? 357  ILE A CB  1 
ATOM   2268  C  CG1 . ILE A 1 311 ? 25.439  2.983   29.858  1.00 35.29  ? 357  ILE A CG1 1 
ATOM   2269  C  CG2 . ILE A 1 311 ? 23.379  1.552   29.447  1.00 33.67  ? 357  ILE A CG2 1 
ATOM   2270  C  CD1 . ILE A 1 311 ? 24.861  3.299   31.206  1.00 33.56  ? 357  ILE A CD1 1 
ATOM   2271  N  N   . GLY A 1 312 ? 23.611  1.912   25.768  1.00 37.47  ? 358  GLY A N   1 
ATOM   2272  C  CA  . GLY A 1 312 ? 22.667  1.377   24.800  1.00 38.06  ? 358  GLY A CA  1 
ATOM   2273  C  C   . GLY A 1 312 ? 23.338  0.301   23.984  1.00 38.66  ? 358  GLY A C   1 
ATOM   2274  O  O   . GLY A 1 312 ? 22.857  -0.830  23.946  1.00 38.13  ? 358  GLY A O   1 
ATOM   2275  N  N   . ARG A 1 313 ? 24.454  0.674   23.344  1.00 39.19  ? 359  ARG A N   1 
ATOM   2276  C  CA  . ARG A 1 313 ? 25.251  -0.228  22.514  1.00 39.39  ? 359  ARG A CA  1 
ATOM   2277  C  C   . ARG A 1 313 ? 25.711  -1.499  23.243  1.00 40.19  ? 359  ARG A C   1 
ATOM   2278  O  O   . ARG A 1 313 ? 25.532  -2.598  22.719  1.00 40.25  ? 359  ARG A O   1 
ATOM   2279  C  CB  . ARG A 1 313 ? 26.417  0.522   21.874  1.00 38.94  ? 359  ARG A CB  1 
ATOM   2280  C  CG  . ARG A 1 313 ? 26.120  0.900   20.456  1.00 39.21  ? 359  ARG A CG  1 
ATOM   2281  C  CD  . ARG A 1 313 ? 26.318  2.360   20.129  1.00 38.57  ? 359  ARG A CD  1 
ATOM   2282  N  NE  . ARG A 1 313 ? 27.575  2.609   19.424  1.00 39.04  ? 359  ARG A NE  1 
ATOM   2283  C  CZ  . ARG A 1 313 ? 27.785  3.584   18.532  1.00 38.81  ? 359  ARG A CZ  1 
ATOM   2284  N  NH1 . ARG A 1 313 ? 26.826  4.427   18.169  1.00 36.39  ? 359  ARG A NH1 1 
ATOM   2285  N  NH2 . ARG A 1 313 ? 28.978  3.708   17.991  1.00 38.46  ? 359  ARG A NH2 1 
ATOM   2286  N  N   . CYS A 1 314 ? 26.269  -1.367  24.447  1.00 40.92  ? 360  CYS A N   1 
ATOM   2287  C  CA  . CYS A 1 314 ? 26.547  -2.541  25.286  1.00 41.85  ? 360  CYS A CA  1 
ATOM   2288  C  C   . CYS A 1 314 ? 25.294  -3.394  25.509  1.00 42.02  ? 360  CYS A C   1 
ATOM   2289  O  O   . CYS A 1 314 ? 25.284  -4.586  25.172  1.00 42.55  ? 360  CYS A O   1 
ATOM   2290  C  CB  . CYS A 1 314 ? 27.160  -2.149  26.626  1.00 42.01  ? 360  CYS A CB  1 
ATOM   2291  S  SG  . CYS A 1 314 ? 28.857  -1.494  26.523  1.00 44.88  ? 360  CYS A SG  1 
ATOM   2292  N  N   . ASN A 1 315 ? 24.221  -2.806  26.038  1.00 41.92  ? 361  ASN A N   1 
ATOM   2293  C  CA  . ASN A 1 315 ? 22.973  -3.573  26.148  1.00 42.27  ? 361  ASN A CA  1 
ATOM   2294  C  C   . ASN A 1 315 ? 22.715  -4.400  24.869  1.00 42.83  ? 361  ASN A C   1 
ATOM   2295  O  O   . ASN A 1 315 ? 22.386  -5.580  24.946  1.00 42.94  ? 361  ASN A O   1 
ATOM   2296  C  CB  . ASN A 1 315 ? 21.753  -2.686  26.448  1.00 42.02  ? 361  ASN A CB  1 
ATOM   2297  C  CG  . ASN A 1 315 ? 21.679  -2.225  27.886  1.00 41.40  ? 361  ASN A CG  1 
ATOM   2298  O  OD1 . ASN A 1 315 ? 20.709  -1.606  28.270  1.00 44.48  ? 361  ASN A OD1 1 
ATOM   2299  N  ND2 . ASN A 1 315 ? 22.698  -2.501  28.671  1.00 39.28  ? 361  ASN A ND2 1 
ATOM   2300  N  N   . LEU A 1 316 ? 22.879  -3.773  23.703  1.00 43.53  ? 362  LEU A N   1 
ATOM   2301  C  CA  . LEU A 1 316 ? 22.690  -4.438  22.409  1.00 43.99  ? 362  LEU A CA  1 
ATOM   2302  C  C   . LEU A 1 316 ? 23.688  -5.570  22.210  1.00 44.31  ? 362  LEU A C   1 
ATOM   2303  O  O   . LEU A 1 316 ? 23.302  -6.658  21.804  1.00 45.13  ? 362  LEU A O   1 
ATOM   2304  C  CB  . LEU A 1 316 ? 22.863  -3.448  21.262  1.00 43.93  ? 362  LEU A CB  1 
ATOM   2305  C  CG  . LEU A 1 316 ? 22.071  -3.745  20.004  1.00 44.94  ? 362  LEU A CG  1 
ATOM   2306  C  CD1 . LEU A 1 316 ? 20.825  -2.901  20.072  1.00 46.06  ? 362  LEU A CD1 1 
ATOM   2307  C  CD2 . LEU A 1 316 ? 22.867  -3.439  18.715  1.00 45.46  ? 362  LEU A CD2 1 
ATOM   2308  N  N   . ALA A 1 317 ? 24.969  -5.320  22.480  1.00 43.95  ? 363  ALA A N   1 
ATOM   2309  C  CA  . ALA A 1 317 ? 25.989  -6.327  22.237  1.00 43.40  ? 363  ALA A CA  1 
ATOM   2310  C  C   . ALA A 1 317 ? 25.913  -7.466  23.244  1.00 43.47  ? 363  ALA A C   1 
ATOM   2311  O  O   . ALA A 1 317 ? 26.442  -8.542  22.985  1.00 43.76  ? 363  ALA A O   1 
ATOM   2312  C  CB  . ALA A 1 317 ? 27.365  -5.697  22.251  1.00 43.11  ? 363  ALA A CB  1 
ATOM   2313  N  N   . GLY A 1 318 ? 25.244  -7.232  24.377  1.00 43.20  ? 364  GLY A N   1 
ATOM   2314  C  CA  . GLY A 1 318 ? 25.222  -8.187  25.491  1.00 42.97  ? 364  GLY A CA  1 
ATOM   2315  C  C   . GLY A 1 318 ? 26.461  -8.158  26.402  1.00 43.12  ? 364  GLY A C   1 
ATOM   2316  O  O   . GLY A 1 318 ? 26.780  -9.148  27.064  1.00 43.71  ? 364  GLY A O   1 
ATOM   2317  N  N   . LYS A 1 319 ? 27.164  -7.029  26.464  1.00 42.32  ? 365  LYS A N   1 
ATOM   2318  C  CA  . LYS A 1 319 ? 28.368  -6.958  27.263  1.00 41.56  ? 365  LYS A CA  1 
ATOM   2319  C  C   . LYS A 1 319 ? 28.167  -6.066  28.496  1.00 41.72  ? 365  LYS A C   1 
ATOM   2320  O  O   . LYS A 1 319 ? 27.377  -5.123  28.453  1.00 41.74  ? 365  LYS A O   1 
ATOM   2321  C  CB  . LYS A 1 319 ? 29.541  -6.488  26.403  1.00 41.40  ? 365  LYS A CB  1 
ATOM   2322  C  CG  . LYS A 1 319 ? 29.844  -7.434  25.225  1.00 40.76  ? 365  LYS A CG  1 
ATOM   2323  C  CD  . LYS A 1 319 ? 31.276  -7.314  24.752  1.00 40.04  ? 365  LYS A CD  1 
ATOM   2324  C  CE  . LYS A 1 319 ? 31.555  -8.311  23.652  1.00 40.26  ? 365  LYS A CE  1 
ATOM   2325  N  NZ  . LYS A 1 319 ? 32.822  -8.015  22.919  1.00 41.75  ? 365  LYS A NZ  1 
ATOM   2326  N  N   . PRO A 1 320 ? 28.890  -6.351  29.606  1.00 41.67  ? 366  PRO A N   1 
ATOM   2327  C  CA  . PRO A 1 320 ? 28.766  -5.537  30.802  1.00 41.52  ? 366  PRO A CA  1 
ATOM   2328  C  C   . PRO A 1 320 ? 29.127  -4.087  30.493  1.00 42.03  ? 366  PRO A C   1 
ATOM   2329  O  O   . PRO A 1 320 ? 30.110  -3.838  29.760  1.00 42.23  ? 366  PRO A O   1 
ATOM   2330  C  CB  . PRO A 1 320 ? 29.873  -6.085  31.691  1.00 41.54  ? 366  PRO A CB  1 
ATOM   2331  C  CG  . PRO A 1 320 ? 30.081  -7.440  31.235  1.00 41.01  ? 366  PRO A CG  1 
ATOM   2332  C  CD  . PRO A 1 320 ? 29.908  -7.404  29.779  1.00 41.02  ? 366  PRO A CD  1 
ATOM   2333  N  N   . VAL A 1 321 ? 28.360  -3.141  31.037  1.00 41.76  ? 367  VAL A N   1 
ATOM   2334  C  CA  . VAL A 1 321 ? 28.772  -1.749  31.003  1.00 41.34  ? 367  VAL A CA  1 
ATOM   2335  C  C   . VAL A 1 321 ? 28.696  -1.133  32.380  1.00 41.48  ? 367  VAL A C   1 
ATOM   2336  O  O   . VAL A 1 321 ? 27.700  -1.322  33.105  1.00 41.77  ? 367  VAL A O   1 
ATOM   2337  C  CB  . VAL A 1 321 ? 27.946  -0.916  30.048  1.00 41.65  ? 367  VAL A CB  1 
ATOM   2338  C  CG1 . VAL A 1 321 ? 26.481  -0.884  30.484  1.00 41.35  ? 367  VAL A CG1 1 
ATOM   2339  C  CG2 . VAL A 1 321 ? 28.535  0.478   29.938  1.00 39.77  ? 367  VAL A CG2 1 
ATOM   2340  N  N   . VAL A 1 322 ? 29.762  -0.401  32.717  1.00 40.97  ? 368  VAL A N   1 
ATOM   2341  C  CA  . VAL A 1 322 ? 29.917  0.282   33.987  1.00 40.55  ? 368  VAL A CA  1 
ATOM   2342  C  C   . VAL A 1 322 ? 29.778  1.792   33.842  1.00 40.78  ? 368  VAL A C   1 
ATOM   2343  O  O   . VAL A 1 322 ? 30.403  2.402   32.972  1.00 41.18  ? 368  VAL A O   1 
ATOM   2344  C  CB  . VAL A 1 322 ? 31.301  0.061   34.537  1.00 40.58  ? 368  VAL A CB  1 
ATOM   2345  C  CG1 . VAL A 1 322 ? 31.385  0.640   35.940  1.00 40.30  ? 368  VAL A CG1 1 
ATOM   2346  C  CG2 . VAL A 1 322 ? 31.642  -1.411  34.551  1.00 41.24  ? 368  VAL A CG2 1 
ATOM   2347  N  N   . CYS A 1 323 ? 28.995  2.384   34.738  1.00 40.72  ? 369  CYS A N   1 
ATOM   2348  C  CA  . CYS A 1 323 ? 28.882  3.833   34.904  1.00 40.64  ? 369  CYS A CA  1 
ATOM   2349  C  C   . CYS A 1 323 ? 29.771  4.317   36.066  1.00 40.52  ? 369  CYS A C   1 
ATOM   2350  O  O   . CYS A 1 323 ? 29.768  3.737   37.159  1.00 41.02  ? 369  CYS A O   1 
ATOM   2351  C  CB  . CYS A 1 323 ? 27.431  4.204   35.216  1.00 40.47  ? 369  CYS A CB  1 
ATOM   2352  S  SG  . CYS A 1 323 ? 27.210  5.940   35.201  1.00 41.87  ? 369  CYS A SG  1 
ATOM   2353  N  N   . ALA A 1 324 ? 30.510  5.397   35.860  1.00 39.79  ? 370  ALA A N   1 
ATOM   2354  C  CA  . ALA A 1 324 ? 31.532  5.750   36.835  1.00 38.53  ? 370  ALA A CA  1 
ATOM   2355  C  C   . ALA A 1 324 ? 31.714  7.247   37.107  1.00 38.00  ? 370  ALA A C   1 
ATOM   2356  O  O   . ALA A 1 324 ? 31.445  8.104   36.245  1.00 38.09  ? 370  ALA A O   1 
ATOM   2357  C  CB  . ALA A 1 324 ? 32.876  5.102   36.446  1.00 38.06  ? 370  ALA A CB  1 
ATOM   2358  N  N   . THR A 1 325 ? 32.149  7.529   38.333  1.00 36.92  ? 371  THR A N   1 
ATOM   2359  C  CA  . THR A 1 325 ? 32.757  8.770   38.722  1.00 36.28  ? 371  THR A CA  1 
ATOM   2360  C  C   . THR A 1 325 ? 31.762  9.803   39.171  1.00 36.67  ? 371  THR A C   1 
ATOM   2361  O  O   . THR A 1 325 ? 30.883  10.214  38.437  1.00 36.69  ? 371  THR A O   1 
ATOM   2362  C  CB  . THR A 1 325 ? 33.694  9.315   37.629  1.00 36.33  ? 371  THR A CB  1 
ATOM   2363  O  OG1 . THR A 1 325 ? 34.632  8.281   37.258  1.00 36.16  ? 371  THR A OG1 1 
ATOM   2364  C  CG2 . THR A 1 325 ? 34.435  10.549  38.117  1.00 34.29  ? 371  THR A CG2 1 
ATOM   2365  N  N   . GLN A 1 326 ? 31.934  10.227  40.415  1.00 37.23  ? 372  GLN A N   1 
ATOM   2366  C  CA  . GLN A 1 326 ? 31.150  11.316  40.988  1.00 37.41  ? 372  GLN A CA  1 
ATOM   2367  C  C   . GLN A 1 326 ? 29.660  10.980  41.141  1.00 37.54  ? 372  GLN A C   1 
ATOM   2368  O  O   . GLN A 1 326 ? 28.825  11.878  41.199  1.00 37.41  ? 372  GLN A O   1 
ATOM   2369  C  CB  . GLN A 1 326 ? 31.373  12.603  40.177  1.00 36.79  ? 372  GLN A CB  1 
ATOM   2370  C  CG  . GLN A 1 326 ? 32.758  13.195  40.363  1.00 37.10  ? 372  GLN A CG  1 
ATOM   2371  C  CD  . GLN A 1 326 ? 32.935  14.511  39.666  1.00 41.05  ? 372  GLN A CD  1 
ATOM   2372  O  OE1 . GLN A 1 326 ? 32.004  15.076  39.080  1.00 42.24  ? 372  GLN A OE1 1 
ATOM   2373  N  NE2 . GLN A 1 326 ? 34.127  15.024  39.730  1.00 42.90  ? 372  GLN A NE2 1 
ATOM   2374  N  N   . MET A 1 327 ? 29.317  9.697   41.201  1.00 38.08  ? 373  MET A N   1 
ATOM   2375  C  CA  . MET A 1 327 ? 27.884  9.379   41.293  1.00 38.92  ? 373  MET A CA  1 
ATOM   2376  C  C   . MET A 1 327 ? 27.319  9.856   42.626  1.00 38.80  ? 373  MET A C   1 
ATOM   2377  O  O   . MET A 1 327 ? 26.140  10.108  42.730  1.00 39.41  ? 373  MET A O   1 
ATOM   2378  C  CB  . MET A 1 327 ? 27.573  7.879   41.047  1.00 38.89  ? 373  MET A CB  1 
ATOM   2379  C  CG  . MET A 1 327 ? 28.060  7.343   39.694  1.00 39.65  ? 373  MET A CG  1 
ATOM   2380  S  SD  . MET A 1 327 ? 27.381  5.713   39.296  1.00 41.46  ? 373  MET A SD  1 
ATOM   2381  C  CE  . MET A 1 327 ? 25.785  6.187   38.644  1.00 36.30  ? 373  MET A CE  1 
ATOM   2382  N  N   . LEU A 1 328 ? 28.177  10.023  43.626  1.00 38.98  ? 374  LEU A N   1 
ATOM   2383  C  CA  . LEU A 1 328 ? 27.749  10.429  44.974  1.00 39.28  ? 374  LEU A CA  1 
ATOM   2384  C  C   . LEU A 1 328 ? 28.781  11.323  45.705  1.00 40.00  ? 374  LEU A C   1 
ATOM   2385  O  O   . LEU A 1 328 ? 28.976  11.160  46.906  1.00 40.24  ? 374  LEU A O   1 
ATOM   2386  C  CB  . LEU A 1 328 ? 27.461  9.166   45.815  1.00 38.57  ? 374  LEU A CB  1 
ATOM   2387  C  CG  . LEU A 1 328 ? 26.077  8.528   46.070  1.00 38.65  ? 374  LEU A CG  1 
ATOM   2388  C  CD1 . LEU A 1 328 ? 24.989  8.724   44.987  1.00 35.18  ? 374  LEU A CD1 1 
ATOM   2389  C  CD2 . LEU A 1 328 ? 26.223  7.041   46.437  1.00 36.39  ? 374  LEU A CD2 1 
ATOM   2390  N  N   . GLU A 1 329 ? 29.440  12.245  44.991  1.00 40.75  ? 375  GLU A N   1 
ATOM   2391  C  CA  . GLU A 1 329 ? 30.622  13.002  45.502  1.00 41.02  ? 375  GLU A CA  1 
ATOM   2392  C  C   . GLU A 1 329 ? 30.413  13.660  46.825  1.00 40.30  ? 375  GLU A C   1 
ATOM   2393  O  O   . GLU A 1 329 ? 31.273  13.561  47.701  1.00 40.63  ? 375  GLU A O   1 
ATOM   2394  C  CB  . GLU A 1 329 ? 31.049  14.105  44.548  1.00 41.40  ? 375  GLU A CB  1 
ATOM   2395  C  CG  . GLU A 1 329 ? 31.919  13.637  43.492  1.00 44.45  ? 375  GLU A CG  1 
ATOM   2396  C  CD  . GLU A 1 329 ? 33.350  13.649  43.913  1.00 47.55  ? 375  GLU A CD  1 
ATOM   2397  O  OE1 . GLU A 1 329 ? 33.777  14.710  44.429  1.00 49.56  ? 375  GLU A OE1 1 
ATOM   2398  O  OE2 . GLU A 1 329 ? 34.048  12.621  43.703  1.00 46.37  ? 375  GLU A OE2 1 
ATOM   2399  N  N   . SER A 1 330 ? 29.292  14.358  46.968  1.00 39.25  ? 376  SER A N   1 
ATOM   2400  C  CA  . SER A 1 330 ? 29.020  15.050  48.226  1.00 38.66  ? 376  SER A CA  1 
ATOM   2401  C  C   . SER A 1 330 ? 29.211  14.138  49.435  1.00 38.13  ? 376  SER A C   1 
ATOM   2402  O  O   . SER A 1 330 ? 29.662  14.583  50.489  1.00 37.93  ? 376  SER A O   1 
ATOM   2403  C  CB  . SER A 1 330 ? 27.648  15.723  48.247  1.00 38.65  ? 376  SER A CB  1 
ATOM   2404  O  OG  . SER A 1 330 ? 26.582  14.789  48.381  1.00 39.84  ? 376  SER A OG  1 
ATOM   2405  N  N   . MET A 1 331 ? 28.918  12.852  49.270  1.00 37.81  ? 377  MET A N   1 
ATOM   2406  C  CA  . MET A 1 331 ? 29.116  11.882  50.369  1.00 37.66  ? 377  MET A CA  1 
ATOM   2407  C  C   . MET A 1 331 ? 30.568  11.672  50.791  1.00 37.97  ? 377  MET A C   1 
ATOM   2408  O  O   . MET A 1 331 ? 30.783  11.248  51.918  1.00 38.52  ? 377  MET A O   1 
ATOM   2409  C  CB  . MET A 1 331 ? 28.425  10.532  50.128  1.00 37.13  ? 377  MET A CB  1 
ATOM   2410  C  CG  . MET A 1 331 ? 26.910  10.652  49.973  1.00 36.87  ? 377  MET A CG  1 
ATOM   2411  S  SD  . MET A 1 331 ? 26.017  9.095   50.148  1.00 37.11  ? 377  MET A SD  1 
ATOM   2412  C  CE  . MET A 1 331 ? 26.174  8.789   51.903  1.00 33.70  ? 377  MET A CE  1 
ATOM   2413  N  N   . ILE A 1 332 ? 31.561  11.978  49.938  1.00 37.93  ? 378  ILE A N   1 
ATOM   2414  C  CA  . ILE A 1 332 ? 32.959  12.060  50.427  1.00 37.95  ? 378  ILE A CA  1 
ATOM   2415  C  C   . ILE A 1 332 ? 33.002  12.858  51.733  1.00 38.78  ? 378  ILE A C   1 
ATOM   2416  O  O   . ILE A 1 332 ? 33.844  12.616  52.586  1.00 39.22  ? 378  ILE A O   1 
ATOM   2417  C  CB  . ILE A 1 332 ? 33.926  12.781  49.437  1.00 37.52  ? 378  ILE A CB  1 
ATOM   2418  C  CG1 . ILE A 1 332 ? 34.326  11.878  48.288  1.00 37.06  ? 378  ILE A CG1 1 
ATOM   2419  C  CG2 . ILE A 1 332 ? 35.192  13.224  50.118  1.00 36.21  ? 378  ILE A CG2 1 
ATOM   2420  C  CD1 . ILE A 1 332 ? 34.742  12.655  47.080  1.00 34.48  ? 378  ILE A CD1 1 
ATOM   2421  N  N   . THR A 1 333 ? 32.058  13.783  51.891  1.00 39.29  ? 379  THR A N   1 
ATOM   2422  C  CA  . THR A 1 333 ? 32.135  14.784  52.933  1.00 39.64  ? 379  THR A CA  1 
ATOM   2423  C  C   . THR A 1 333 ? 30.881  14.901  53.776  1.00 39.34  ? 379  THR A C   1 
ATOM   2424  O  O   . THR A 1 333 ? 30.935  15.448  54.852  1.00 38.60  ? 379  THR A O   1 
ATOM   2425  C  CB  . THR A 1 333 ? 32.521  16.123  52.297  1.00 40.20  ? 379  THR A CB  1 
ATOM   2426  O  OG1 . THR A 1 333 ? 33.933  16.283  52.427  1.00 39.76  ? 379  THR A OG1 1 
ATOM   2427  C  CG2 . THR A 1 333 ? 31.809  17.300  52.936  1.00 41.51  ? 379  THR A CG2 1 
ATOM   2428  N  N   . LYS A 1 334 ? 29.770  14.351  53.290  1.00 39.78  ? 380  LYS A N   1 
ATOM   2429  C  CA  . LYS A 1 334 ? 28.450  14.536  53.918  1.00 39.74  ? 380  LYS A CA  1 
ATOM   2430  C  C   . LYS A 1 334 ? 27.717  13.212  54.027  1.00 39.31  ? 380  LYS A C   1 
ATOM   2431  O  O   . LYS A 1 334 ? 27.856  12.357  53.163  1.00 39.63  ? 380  LYS A O   1 
ATOM   2432  C  CB  . LYS A 1 334 ? 27.607  15.534  53.131  1.00 39.73  ? 380  LYS A CB  1 
ATOM   2433  C  CG  . LYS A 1 334 ? 28.236  16.895  53.043  1.00 41.91  ? 380  LYS A CG  1 
ATOM   2434  C  CD  . LYS A 1 334 ? 27.515  17.784  52.074  1.00 46.43  ? 380  LYS A CD  1 
ATOM   2435  C  CE  . LYS A 1 334 ? 26.324  18.433  52.776  1.00 50.57  ? 380  LYS A CE  1 
ATOM   2436  N  NZ  . LYS A 1 334 ? 25.439  19.269  51.883  1.00 51.93  ? 380  LYS A NZ  1 
ATOM   2437  N  N   . PRO A 1 335 ? 26.889  13.050  55.078  1.00 38.86  ? 381  PRO A N   1 
ATOM   2438  C  CA  . PRO A 1 335 ? 26.258  11.758  55.318  1.00 38.49  ? 381  PRO A CA  1 
ATOM   2439  C  C   . PRO A 1 335 ? 25.057  11.499  54.412  1.00 38.49  ? 381  PRO A C   1 
ATOM   2440  O  O   . PRO A 1 335 ? 24.525  10.381  54.421  1.00 38.99  ? 381  PRO A O   1 
ATOM   2441  C  CB  . PRO A 1 335 ? 25.771  11.862  56.758  1.00 38.23  ? 381  PRO A CB  1 
ATOM   2442  C  CG  . PRO A 1 335 ? 26.049  13.219  57.193  1.00 38.36  ? 381  PRO A CG  1 
ATOM   2443  C  CD  . PRO A 1 335 ? 26.436  14.050  56.052  1.00 38.31  ? 381  PRO A CD  1 
ATOM   2444  N  N   . ARG A 1 336 ? 24.623  12.512  53.654  1.00 38.04  ? 382  ARG A N   1 
ATOM   2445  C  CA  . ARG A 1 336 ? 23.554  12.342  52.662  1.00 37.39  ? 382  ARG A CA  1 
ATOM   2446  C  C   . ARG A 1 336 ? 23.990  12.808  51.262  1.00 36.72  ? 382  ARG A C   1 
ATOM   2447  O  O   . ARG A 1 336 ? 24.845  13.693  51.121  1.00 37.39  ? 382  ARG A O   1 
ATOM   2448  C  CB  . ARG A 1 336 ? 22.285  13.053  53.099  1.00 37.44  ? 382  ARG A CB  1 
ATOM   2449  C  CG  . ARG A 1 336 ? 21.869  12.732  54.509  1.00 38.88  ? 382  ARG A CG  1 
ATOM   2450  C  CD  . ARG A 1 336 ? 21.491  11.303  54.656  1.00 42.13  ? 382  ARG A CD  1 
ATOM   2451  N  NE  . ARG A 1 336 ? 20.039  11.168  54.747  1.00 46.92  ? 382  ARG A NE  1 
ATOM   2452  C  CZ  . ARG A 1 336 ? 19.304  10.252  54.110  1.00 47.73  ? 382  ARG A CZ  1 
ATOM   2453  N  NH1 . ARG A 1 336 ? 19.860  9.331   53.324  1.00 44.10  ? 382  ARG A NH1 1 
ATOM   2454  N  NH2 . ARG A 1 336 ? 17.995  10.240  54.298  1.00 48.80  ? 382  ARG A NH2 1 
ATOM   2455  N  N   . PRO A 1 337 ? 23.424  12.198  50.219  1.00 35.52  ? 383  PRO A N   1 
ATOM   2456  C  CA  . PRO A 1 337 ? 23.685  12.671  48.878  1.00 34.89  ? 383  PRO A CA  1 
ATOM   2457  C  C   . PRO A 1 337 ? 22.821  13.858  48.485  1.00 34.29  ? 383  PRO A C   1 
ATOM   2458  O  O   . PRO A 1 337 ? 21.820  14.144  49.158  1.00 34.06  ? 383  PRO A O   1 
ATOM   2459  C  CB  . PRO A 1 337 ? 23.340  11.468  48.023  1.00 35.50  ? 383  PRO A CB  1 
ATOM   2460  C  CG  . PRO A 1 337 ? 22.413  10.626  48.877  1.00 35.02  ? 383  PRO A CG  1 
ATOM   2461  C  CD  . PRO A 1 337 ? 22.520  11.041  50.263  1.00 35.19  ? 383  PRO A CD  1 
ATOM   2462  N  N   . THR A 1 338 ? 23.217  14.534  47.411  1.00 33.75  ? 384  THR A N   1 
ATOM   2463  C  CA  . THR A 1 338 ? 22.490  15.662  46.863  1.00 33.78  ? 384  THR A CA  1 
ATOM   2464  C  C   . THR A 1 338 ? 21.404  15.071  46.006  1.00 34.57  ? 384  THR A C   1 
ATOM   2465  O  O   . THR A 1 338 ? 21.460  13.879  45.649  1.00 34.44  ? 384  THR A O   1 
ATOM   2466  C  CB  . THR A 1 338 ? 23.389  16.600  45.993  1.00 34.10  ? 384  THR A CB  1 
ATOM   2467  O  OG1 . THR A 1 338 ? 23.747  15.962  44.751  1.00 34.13  ? 384  THR A OG1 1 
ATOM   2468  C  CG2 . THR A 1 338 ? 24.670  17.021  46.757  1.00 32.24  ? 384  THR A CG2 1 
ATOM   2469  N  N   . ARG A 1 339 ? 20.402  15.872  45.662  1.00 34.93  ? 385  ARG A N   1 
ATOM   2470  C  CA  . ARG A 1 339 ? 19.307  15.299  44.913  1.00 35.20  ? 385  ARG A CA  1 
ATOM   2471  C  C   . ARG A 1 339 ? 19.758  14.829  43.529  1.00 35.88  ? 385  ARG A C   1 
ATOM   2472  O  O   . ARG A 1 339 ? 19.155  13.909  42.959  1.00 36.39  ? 385  ARG A O   1 
ATOM   2473  C  CB  . ARG A 1 339 ? 18.136  16.241  44.836  1.00 34.86  ? 385  ARG A CB  1 
ATOM   2474  C  CG  . ARG A 1 339 ? 17.732  16.838  46.168  1.00 35.09  ? 385  ARG A CG  1 
ATOM   2475  C  CD  . ARG A 1 339 ? 16.956  15.863  47.044  1.00 34.98  ? 385  ARG A CD  1 
ATOM   2476  N  NE  . ARG A 1 339 ? 16.590  16.433  48.348  1.00 34.51  ? 385  ARG A NE  1 
ATOM   2477  C  CZ  . ARG A 1 339 ? 17.468  16.818  49.284  1.00 32.05  ? 385  ARG A CZ  1 
ATOM   2478  N  NH1 . ARG A 1 339 ? 18.786  16.737  49.061  1.00 29.63  ? 385  ARG A NH1 1 
ATOM   2479  N  NH2 . ARG A 1 339 ? 17.033  17.320  50.434  1.00 30.45  ? 385  ARG A NH2 1 
ATOM   2480  N  N   . ALA A 1 340 ? 20.832  15.428  43.011  1.00 36.26  ? 386  ALA A N   1 
ATOM   2481  C  CA  . ALA A 1 340 ? 21.307  15.092  41.671  1.00 37.12  ? 386  ALA A CA  1 
ATOM   2482  C  C   . ALA A 1 340 ? 21.983  13.745  41.691  1.00 37.79  ? 386  ALA A C   1 
ATOM   2483  O  O   . ALA A 1 340 ? 21.878  12.966  40.752  1.00 39.01  ? 386  ALA A O   1 
ATOM   2484  C  CB  . ALA A 1 340 ? 22.239  16.128  41.154  1.00 37.02  ? 386  ALA A CB  1 
ATOM   2485  N  N   . GLU A 1 341 ? 22.656  13.450  42.781  1.00 38.14  ? 387  GLU A N   1 
ATOM   2486  C  CA  . GLU A 1 341 ? 23.401  12.197  42.895  1.00 38.38  ? 387  GLU A CA  1 
ATOM   2487  C  C   . GLU A 1 341 ? 22.452  10.992  42.928  1.00 38.48  ? 387  GLU A C   1 
ATOM   2488  O  O   . GLU A 1 341 ? 22.605  10.051  42.148  1.00 38.81  ? 387  GLU A O   1 
ATOM   2489  C  CB  . GLU A 1 341 ? 24.344  12.292  44.091  1.00 38.29  ? 387  GLU A CB  1 
ATOM   2490  C  CG  . GLU A 1 341 ? 25.218  13.554  43.920  1.00 39.21  ? 387  GLU A CG  1 
ATOM   2491  C  CD  . GLU A 1 341 ? 26.075  13.945  45.108  1.00 41.54  ? 387  GLU A CD  1 
ATOM   2492  O  OE1 . GLU A 1 341 ? 25.586  13.889  46.258  1.00 42.56  ? 387  GLU A OE1 1 
ATOM   2493  O  OE2 . GLU A 1 341 ? 27.246  14.345  44.865  1.00 42.36  ? 387  GLU A OE2 1 
ATOM   2494  N  N   . THR A 1 342 ? 21.442  11.059  43.785  1.00 38.34  ? 388  THR A N   1 
ATOM   2495  C  CA  . THR A 1 342 ? 20.372  10.115  43.790  1.00 38.07  ? 388  THR A CA  1 
ATOM   2496  C  C   . THR A 1 342 ? 19.830  9.876   42.376  1.00 38.23  ? 388  THR A C   1 
ATOM   2497  O  O   . THR A 1 342 ? 19.830  8.744   41.884  1.00 38.13  ? 388  THR A O   1 
ATOM   2498  C  CB  . THR A 1 342 ? 19.251  10.603  44.770  1.00 38.53  ? 388  THR A CB  1 
ATOM   2499  O  OG1 . THR A 1 342 ? 19.522  10.081  46.089  1.00 38.99  ? 388  THR A OG1 1 
ATOM   2500  C  CG2 . THR A 1 342 ? 17.789  10.189  44.297  1.00 38.26  ? 388  THR A CG2 1 
ATOM   2501  N  N   . SER A 1 343 ? 19.381  10.922  41.699  1.00 38.05  ? 389  SER A N   1 
ATOM   2502  C  CA  . SER A 1 343 ? 18.831  10.687  40.388  1.00 38.43  ? 389  SER A CA  1 
ATOM   2503  C  C   . SER A 1 343 ? 19.922  10.184  39.416  1.00 38.73  ? 389  SER A C   1 
ATOM   2504  O  O   . SER A 1 343 ? 19.628  9.392   38.530  1.00 39.51  ? 389  SER A O   1 
ATOM   2505  C  CB  . SER A 1 343 ? 18.093  11.917  39.866  1.00 38.56  ? 389  SER A CB  1 
ATOM   2506  O  OG  . SER A 1 343 ? 18.873  12.620  38.924  1.00 40.09  ? 389  SER A OG  1 
ATOM   2507  N  N   . ASP A 1 344 ? 21.176  10.604  39.592  1.00 37.62  ? 390  ASP A N   1 
ATOM   2508  C  CA  . ASP A 1 344 ? 22.209  10.045  38.774  1.00 37.39  ? 390  ASP A CA  1 
ATOM   2509  C  C   . ASP A 1 344 ? 22.276  8.517   38.828  1.00 38.07  ? 390  ASP A C   1 
ATOM   2510  O  O   . ASP A 1 344 ? 22.392  7.845   37.788  1.00 38.82  ? 390  ASP A O   1 
ATOM   2511  C  CB  . ASP A 1 344 ? 23.585  10.579  39.117  1.00 37.32  ? 390  ASP A CB  1 
ATOM   2512  C  CG  . ASP A 1 344 ? 24.575  10.236  38.044  1.00 34.72  ? 390  ASP A CG  1 
ATOM   2513  O  OD1 . ASP A 1 344 ? 24.128  10.289  36.901  1.00 35.00  ? 390  ASP A OD1 1 
ATOM   2514  O  OD2 . ASP A 1 344 ? 25.726  9.852   38.296  1.00 29.87  ? 390  ASP A OD2 1 
ATOM   2515  N  N   . VAL A 1 345 ? 22.266  7.976   40.034  1.00 37.63  ? 391  VAL A N   1 
ATOM   2516  C  CA  . VAL A 1 345 ? 22.313  6.545   40.206  1.00 37.41  ? 391  VAL A CA  1 
ATOM   2517  C  C   . VAL A 1 345 ? 21.086  5.924   39.558  1.00 37.31  ? 391  VAL A C   1 
ATOM   2518  O  O   . VAL A 1 345 ? 21.230  5.020   38.717  1.00 37.04  ? 391  VAL A O   1 
ATOM   2519  C  CB  . VAL A 1 345 ? 22.415  6.147   41.710  1.00 37.77  ? 391  VAL A CB  1 
ATOM   2520  C  CG1 . VAL A 1 345 ? 22.385  4.638   41.895  1.00 37.37  ? 391  VAL A CG1 1 
ATOM   2521  C  CG2 . VAL A 1 345 ? 23.695  6.733   42.314  1.00 36.83  ? 391  VAL A CG2 1 
ATOM   2522  N  N   . ALA A 1 346 ? 19.888  6.398   39.921  1.00 37.01  ? 392  ALA A N   1 
ATOM   2523  C  CA  . ALA A 1 346 ? 18.681  5.808   39.332  1.00 37.00  ? 392  ALA A CA  1 
ATOM   2524  C  C   . ALA A 1 346 ? 18.810  5.803   37.804  1.00 37.22  ? 392  ALA A C   1 
ATOM   2525  O  O   . ALA A 1 346 ? 18.637  4.741   37.165  1.00 37.47  ? 392  ALA A O   1 
ATOM   2526  C  CB  . ALA A 1 346 ? 17.426  6.497   39.774  1.00 36.06  ? 392  ALA A CB  1 
ATOM   2527  N  N   . ASN A 1 347 ? 19.184  6.948   37.222  1.00 36.95  ? 393  ASN A N   1 
ATOM   2528  C  CA  . ASN A 1 347 ? 19.225  7.032   35.763  1.00 37.03  ? 393  ASN A CA  1 
ATOM   2529  C  C   . ASN A 1 347 ? 20.303  6.143   35.112  1.00 37.14  ? 393  ASN A C   1 
ATOM   2530  O  O   . ASN A 1 347 ? 20.172  5.773   33.949  1.00 37.33  ? 393  ASN A O   1 
ATOM   2531  C  CB  . ASN A 1 347 ? 19.304  8.473   35.241  1.00 36.61  ? 393  ASN A CB  1 
ATOM   2532  C  CG  . ASN A 1 347 ? 18.000  9.227   35.382  1.00 37.70  ? 393  ASN A CG  1 
ATOM   2533  O  OD1 . ASN A 1 347 ? 16.930  8.773   34.955  1.00 38.62  ? 393  ASN A OD1 1 
ATOM   2534  N  ND2 . ASN A 1 347 ? 18.081  10.404  36.007  1.00 38.76  ? 393  ASN A ND2 1 
ATOM   2535  N  N   . ALA A 1 348 ? 21.349  5.791   35.856  1.00 37.02  ? 394  ALA A N   1 
ATOM   2536  C  CA  . ALA A 1 348 ? 22.395  4.912   35.334  1.00 37.20  ? 394  ALA A CA  1 
ATOM   2537  C  C   . ALA A 1 348 ? 21.771  3.559   35.124  1.00 37.71  ? 394  ALA A C   1 
ATOM   2538  O  O   . ALA A 1 348 ? 21.957  2.928   34.084  1.00 38.30  ? 394  ALA A O   1 
ATOM   2539  C  CB  . ALA A 1 348 ? 23.548  4.814   36.287  1.00 36.21  ? 394  ALA A CB  1 
ATOM   2540  N  N   . VAL A 1 349 ? 21.005  3.144   36.129  1.00 38.14  ? 395  VAL A N   1 
ATOM   2541  C  CA  . VAL A 1 349 ? 20.277  1.880   36.118  1.00 37.84  ? 395  VAL A CA  1 
ATOM   2542  C  C   . VAL A 1 349 ? 19.213  1.905   35.026  1.00 37.87  ? 395  VAL A C   1 
ATOM   2543  O  O   . VAL A 1 349 ? 19.120  0.979   34.244  1.00 38.20  ? 395  VAL A O   1 
ATOM   2544  C  CB  . VAL A 1 349 ? 19.639  1.576   37.501  1.00 37.88  ? 395  VAL A CB  1 
ATOM   2545  C  CG1 . VAL A 1 349 ? 18.576  0.487   37.378  1.00 37.78  ? 395  VAL A CG1 1 
ATOM   2546  C  CG2 . VAL A 1 349 ? 20.731  1.166   38.530  1.00 37.12  ? 395  VAL A CG2 1 
ATOM   2547  N  N   . LEU A 1 350 ? 18.437  2.973   34.954  1.00 37.65  ? 396  LEU A N   1 
ATOM   2548  C  CA  . LEU A 1 350 ? 17.391  3.052   33.964  1.00 37.35  ? 396  LEU A CA  1 
ATOM   2549  C  C   . LEU A 1 350 ? 18.017  3.109   32.592  1.00 37.18  ? 396  LEU A C   1 
ATOM   2550  O  O   . LEU A 1 350 ? 17.448  2.652   31.626  1.00 36.50  ? 396  LEU A O   1 
ATOM   2551  C  CB  . LEU A 1 350 ? 16.524  4.287   34.226  1.00 37.28  ? 396  LEU A CB  1 
ATOM   2552  C  CG  . LEU A 1 350 ? 15.181  4.158   34.935  1.00 37.64  ? 396  LEU A CG  1 
ATOM   2553  C  CD1 . LEU A 1 350 ? 14.891  2.776   35.492  1.00 40.07  ? 396  LEU A CD1 1 
ATOM   2554  C  CD2 . LEU A 1 350 ? 15.138  5.162   36.014  1.00 36.56  ? 396  LEU A CD2 1 
ATOM   2555  N  N   . ASP A 1 351 ? 19.205  3.692   32.502  1.00 38.05  ? 397  ASP A N   1 
ATOM   2556  C  CA  . ASP A 1 351 ? 19.917  3.723   31.224  1.00 38.65  ? 397  ASP A CA  1 
ATOM   2557  C  C   . ASP A 1 351 ? 20.156  2.274   30.792  1.00 39.22  ? 397  ASP A C   1 
ATOM   2558  O  O   . ASP A 1 351 ? 19.934  1.922   29.646  1.00 39.30  ? 397  ASP A O   1 
ATOM   2559  C  CB  . ASP A 1 351 ? 21.223  4.538   31.316  1.00 38.41  ? 397  ASP A CB  1 
ATOM   2560  C  CG  . ASP A 1 351 ? 20.974  6.069   31.320  1.00 38.69  ? 397  ASP A CG  1 
ATOM   2561  O  OD1 . ASP A 1 351 ? 19.961  6.536   30.721  1.00 37.91  ? 397  ASP A OD1 1 
ATOM   2562  O  OD2 . ASP A 1 351 ? 21.798  6.805   31.916  1.00 39.74  ? 397  ASP A OD2 1 
ATOM   2563  N  N   . GLY A 1 352 ? 20.572  1.442   31.749  1.00 39.54  ? 398  GLY A N   1 
ATOM   2564  C  CA  . GLY A 1 352 ? 20.738  0.015   31.570  1.00 39.98  ? 398  GLY A CA  1 
ATOM   2565  C  C   . GLY A 1 352 ? 22.137  -0.441  31.968  1.00 40.69  ? 398  GLY A C   1 
ATOM   2566  O  O   . GLY A 1 352 ? 22.692  -1.377  31.402  1.00 41.51  ? 398  GLY A O   1 
ATOM   2567  N  N   . ALA A 1 353 ? 22.729  0.216   32.947  1.00 41.19  ? 399  ALA A N   1 
ATOM   2568  C  CA  . ALA A 1 353 ? 24.121  -0.051  33.288  1.00 41.14  ? 399  ALA A CA  1 
ATOM   2569  C  C   . ALA A 1 353 ? 24.222  -1.331  34.075  1.00 41.30  ? 399  ALA A C   1 
ATOM   2570  O  O   . ALA A 1 353 ? 23.378  -1.633  34.917  1.00 41.50  ? 399  ALA A O   1 
ATOM   2571  C  CB  . ALA A 1 353 ? 24.706  1.090   34.075  1.00 40.75  ? 399  ALA A CB  1 
ATOM   2572  N  N   . ASP A 1 354 ? 25.271  -2.094  33.814  1.00 41.48  ? 400  ASP A N   1 
ATOM   2573  C  CA  . ASP A 1 354 ? 25.441  -3.303  34.581  1.00 41.54  ? 400  ASP A CA  1 
ATOM   2574  C  C   . ASP A 1 354 ? 25.977  -3.009  35.969  1.00 41.91  ? 400  ASP A C   1 
ATOM   2575  O  O   . ASP A 1 354 ? 25.524  -3.614  36.935  1.00 42.78  ? 400  ASP A O   1 
ATOM   2576  C  CB  . ASP A 1 354 ? 26.304  -4.308  33.827  1.00 41.45  ? 400  ASP A CB  1 
ATOM   2577  C  CG  . ASP A 1 354 ? 25.561  -4.926  32.660  1.00 41.84  ? 400  ASP A CG  1 
ATOM   2578  O  OD1 . ASP A 1 354 ? 24.753  -5.848  32.872  1.00 40.49  ? 400  ASP A OD1 1 
ATOM   2579  O  OD2 . ASP A 1 354 ? 25.763  -4.465  31.525  1.00 43.09  ? 400  ASP A OD2 1 
ATOM   2580  N  N   . CYS A 1 355 ? 26.929  -2.082  36.073  1.00 41.50  ? 401  CYS A N   1 
ATOM   2581  C  CA  . CYS A 1 355 ? 27.514  -1.750  37.362  1.00 41.24  ? 401  CYS A CA  1 
ATOM   2582  C  C   . CYS A 1 355 ? 27.566  -0.250  37.582  1.00 40.88  ? 401  CYS A C   1 
ATOM   2583  O  O   . CYS A 1 355 ? 27.641  0.527   36.618  1.00 41.73  ? 401  CYS A O   1 
ATOM   2584  C  CB  . CYS A 1 355 ? 28.941  -2.287  37.453  1.00 41.25  ? 401  CYS A CB  1 
ATOM   2585  S  SG  . CYS A 1 355 ? 29.123  -4.011  37.053  1.00 44.21  ? 401  CYS A SG  1 
ATOM   2586  N  N   . ILE A 1 356 ? 27.568  0.159   38.848  1.00 39.78  ? 402  ILE A N   1 
ATOM   2587  C  CA  . ILE A 1 356 ? 27.767  1.553   39.211  1.00 38.56  ? 402  ILE A CA  1 
ATOM   2588  C  C   . ILE A 1 356 ? 28.963  1.594   40.141  1.00 39.19  ? 402  ILE A C   1 
ATOM   2589  O  O   . ILE A 1 356 ? 29.175  0.685   40.943  1.00 39.50  ? 402  ILE A O   1 
ATOM   2590  C  CB  . ILE A 1 356 ? 26.511  2.161   39.852  1.00 38.37  ? 402  ILE A CB  1 
ATOM   2591  C  CG1 . ILE A 1 356 ? 25.980  1.260   40.978  1.00 36.64  ? 402  ILE A CG1 1 
ATOM   2592  C  CG2 . ILE A 1 356 ? 25.421  2.344   38.800  1.00 36.68  ? 402  ILE A CG2 1 
ATOM   2593  C  CD1 . ILE A 1 356 ? 24.674  1.691   41.611  1.00 32.89  ? 402  ILE A CD1 1 
ATOM   2594  N  N   . MET A 1 357 ? 29.778  2.634   40.020  1.00 39.54  ? 403  MET A N   1 
ATOM   2595  C  CA  . MET A 1 357 ? 31.059  2.688   40.733  1.00 38.80  ? 403  MET A CA  1 
ATOM   2596  C  C   . MET A 1 357 ? 31.032  3.754   41.830  1.00 38.97  ? 403  MET A C   1 
ATOM   2597  O  O   . MET A 1 357 ? 30.145  4.617   41.832  1.00 39.44  ? 403  MET A O   1 
ATOM   2598  C  CB  . MET A 1 357 ? 32.192  2.984   39.732  1.00 38.30  ? 403  MET A CB  1 
ATOM   2599  C  CG  . MET A 1 357 ? 33.548  2.582   40.230  1.00 37.18  ? 403  MET A CG  1 
ATOM   2600  S  SD  . MET A 1 357 ? 34.634  2.361   38.840  1.00 39.12  ? 403  MET A SD  1 
ATOM   2601  C  CE  . MET A 1 357 ? 35.560  3.926   38.841  1.00 38.34  ? 403  MET A CE  1 
ATOM   2602  N  N   . LEU A 1 358 ? 32.013  3.683   42.736  1.00 38.51  ? 404  LEU A N   1 
ATOM   2603  C  CA  . LEU A 1 358 ? 32.304  4.721   43.712  1.00 37.89  ? 404  LEU A CA  1 
ATOM   2604  C  C   . LEU A 1 358 ? 33.822  4.946   43.732  1.00 38.21  ? 404  LEU A C   1 
ATOM   2605  O  O   . LEU A 1 358 ? 34.586  4.000   43.596  1.00 38.23  ? 404  LEU A O   1 
ATOM   2606  C  CB  . LEU A 1 358 ? 31.827  4.274   45.074  1.00 37.23  ? 404  LEU A CB  1 
ATOM   2607  C  CG  . LEU A 1 358 ? 30.323  4.125   45.250  1.00 37.47  ? 404  LEU A CG  1 
ATOM   2608  C  CD1 . LEU A 1 358 ? 30.039  3.350   46.531  1.00 34.47  ? 404  LEU A CD1 1 
ATOM   2609  C  CD2 . LEU A 1 358 ? 29.681  5.505   45.285  1.00 36.38  ? 404  LEU A CD2 1 
ATOM   2610  N  N   . SER A 1 359 ? 34.272  6.185   43.917  1.00 38.23  ? 405  SER A N   1 
ATOM   2611  C  CA  . SER A 1 359 ? 35.718  6.451   43.953  1.00 37.92  ? 405  SER A CA  1 
ATOM   2612  C  C   . SER A 1 359 ? 36.090  7.213   45.224  1.00 38.69  ? 405  SER A C   1 
ATOM   2613  O  O   . SER A 1 359 ? 36.235  6.608   46.291  1.00 39.60  ? 405  SER A O   1 
ATOM   2614  C  CB  . SER A 1 359 ? 36.148  7.219   42.712  1.00 37.39  ? 405  SER A CB  1 
ATOM   2615  O  OG  . SER A 1 359 ? 35.865  6.451   41.568  1.00 34.79  ? 405  SER A OG  1 
ATOM   2616  N  N   . GLY A 1 360 ? 36.225  8.533   45.143  1.00 38.41  ? 406  GLY A N   1 
ATOM   2617  C  CA  . GLY A 1 360 ? 36.347  9.302   46.361  1.00 38.58  ? 406  GLY A CA  1 
ATOM   2618  C  C   . GLY A 1 360 ? 35.422  8.788   47.477  1.00 38.97  ? 406  GLY A C   1 
ATOM   2619  O  O   . GLY A 1 360 ? 35.848  8.718   48.670  1.00 38.63  ? 406  GLY A O   1 
ATOM   2620  N  N   . GLU A 1 361 ? 34.178  8.419   47.121  1.00 38.25  ? 407  GLU A N   1 
ATOM   2621  C  CA  . GLU A 1 361 ? 33.179  8.141   48.154  1.00 38.36  ? 407  GLU A CA  1 
ATOM   2622  C  C   . GLU A 1 361 ? 33.619  7.018   49.062  1.00 38.80  ? 407  GLU A C   1 
ATOM   2623  O  O   . GLU A 1 361 ? 33.328  7.049   50.272  1.00 39.59  ? 407  GLU A O   1 
ATOM   2624  C  CB  . GLU A 1 361 ? 31.782  7.868   47.604  1.00 38.21  ? 407  GLU A CB  1 
ATOM   2625  C  CG  . GLU A 1 361 ? 31.285  8.914   46.637  1.00 38.08  ? 407  GLU A CG  1 
ATOM   2626  C  CD  . GLU A 1 361 ? 31.768  8.692   45.182  1.00 39.99  ? 407  GLU A CD  1 
ATOM   2627  O  OE1 . GLU A 1 361 ? 32.985  8.302   44.936  1.00 36.06  ? 407  GLU A OE1 1 
ATOM   2628  O  OE2 . GLU A 1 361 ? 30.898  8.915   44.284  1.00 40.60  ? 407  GLU A OE2 1 
ATOM   2629  N  N   . THR A 1 362 ? 34.325  6.031   48.504  1.00 38.61  ? 408  THR A N   1 
ATOM   2630  C  CA  . THR A 1 362 ? 34.774  4.892   49.316  1.00 38.59  ? 408  THR A CA  1 
ATOM   2631  C  C   . THR A 1 362 ? 36.277  4.864   49.570  1.00 38.80  ? 408  THR A C   1 
ATOM   2632  O  O   . THR A 1 362 ? 36.738  4.242   50.530  1.00 39.05  ? 408  THR A O   1 
ATOM   2633  C  CB  . THR A 1 362 ? 34.395  3.519   48.707  1.00 38.76  ? 408  THR A CB  1 
ATOM   2634  O  OG1 . THR A 1 362 ? 34.939  3.390   47.383  1.00 39.24  ? 408  THR A OG1 1 
ATOM   2635  C  CG2 . THR A 1 362 ? 32.886  3.301   48.713  1.00 37.28  ? 408  THR A CG2 1 
ATOM   2636  N  N   . ALA A 1 363 ? 37.044  5.512   48.703  1.00 38.73  ? 409  ALA A N   1 
ATOM   2637  C  CA  . ALA A 1 363 ? 38.482  5.491   48.838  1.00 38.60  ? 409  ALA A CA  1 
ATOM   2638  C  C   . ALA A 1 363 ? 38.985  6.399   49.978  1.00 38.97  ? 409  ALA A C   1 
ATOM   2639  O  O   . ALA A 1 363 ? 39.869  5.964   50.739  1.00 39.45  ? 409  ALA A O   1 
ATOM   2640  C  CB  . ALA A 1 363 ? 39.138  5.843   47.516  1.00 38.13  ? 409  ALA A CB  1 
ATOM   2641  N  N   . LYS A 1 364 ? 38.448  7.627   50.103  1.00 39.05  ? 410  LYS A N   1 
ATOM   2642  C  CA  . LYS A 1 364 ? 38.972  8.602   51.079  1.00 39.62  ? 410  LYS A CA  1 
ATOM   2643  C  C   . LYS A 1 364 ? 37.966  9.205   52.000  1.00 38.50  ? 410  LYS A C   1 
ATOM   2644  O  O   . LYS A 1 364 ? 38.341  9.750   53.028  1.00 38.77  ? 410  LYS A O   1 
ATOM   2645  C  CB  . LYS A 1 364 ? 39.595  9.798   50.387  1.00 40.07  ? 410  LYS A CB  1 
ATOM   2646  C  CG  . LYS A 1 364 ? 40.274  9.447   49.143  1.00 44.98  ? 410  LYS A CG  1 
ATOM   2647  C  CD  . LYS A 1 364 ? 39.487  10.075  48.051  1.00 51.89  ? 410  LYS A CD  1 
ATOM   2648  C  CE  . LYS A 1 364 ? 39.936  11.339  47.927  1.00 53.19  ? 410  LYS A CE  1 
ATOM   2649  N  NZ  . LYS A 1 364 ? 40.823  11.879  46.427  1.00 54.21  ? 410  LYS A NZ  1 
ATOM   2650  N  N   . GLY A 1 365 ? 36.706  9.174   51.601  1.00 37.35  ? 411  GLY A N   1 
ATOM   2651  C  CA  . GLY A 1 365 ? 35.707  9.964   52.282  1.00 36.45  ? 411  GLY A CA  1 
ATOM   2652  C  C   . GLY A 1 365 ? 35.353  9.479   53.662  1.00 35.64  ? 411  GLY A C   1 
ATOM   2653  O  O   . GLY A 1 365 ? 35.757  8.431   54.087  1.00 35.00  ? 411  GLY A O   1 
ATOM   2654  N  N   . ASN A 1 366 ? 34.555  10.266  54.350  1.00 35.91  ? 412  ASN A N   1 
ATOM   2655  C  CA  . ASN A 1 366 ? 34.175  9.962   55.713  1.00 36.03  ? 412  ASN A CA  1 
ATOM   2656  C  C   . ASN A 1 366 ? 32.970  9.038   55.817  1.00 35.99  ? 412  ASN A C   1 
ATOM   2657  O  O   . ASN A 1 366 ? 32.576  8.684   56.914  1.00 35.98  ? 412  ASN A O   1 
ATOM   2658  C  CB  . ASN A 1 366 ? 33.954  11.263  56.514  1.00 36.31  ? 412  ASN A CB  1 
ATOM   2659  C  CG  . ASN A 1 366 ? 35.251  12.013  56.774  1.00 37.10  ? 412  ASN A CG  1 
ATOM   2660  O  OD1 . ASN A 1 366 ? 36.285  11.406  57.000  1.00 40.79  ? 412  ASN A OD1 1 
ATOM   2661  N  ND2 . ASN A 1 366 ? 35.204  13.330  56.694  1.00 34.46  ? 412  ASN A ND2 1 
ATOM   2662  N  N   . PHE A 1 367 ? 32.398  8.616   54.688  1.00 36.30  ? 413  PHE A N   1 
ATOM   2663  C  CA  . PHE A 1 367 ? 31.196  7.757   54.745  1.00 36.08  ? 413  PHE A CA  1 
ATOM   2664  C  C   . PHE A 1 367 ? 31.162  6.620   53.730  1.00 35.93  ? 413  PHE A C   1 
ATOM   2665  O  O   . PHE A 1 367 ? 30.138  6.459   53.050  1.00 35.94  ? 413  PHE A O   1 
ATOM   2666  C  CB  . PHE A 1 367 ? 29.924  8.594   54.606  1.00 35.77  ? 413  PHE A CB  1 
ATOM   2667  C  CG  . PHE A 1 367 ? 29.814  9.651   55.623  1.00 36.68  ? 413  PHE A CG  1 
ATOM   2668  C  CD1 . PHE A 1 367 ? 30.245  10.940  55.348  1.00 37.31  ? 413  PHE A CD1 1 
ATOM   2669  C  CD2 . PHE A 1 367 ? 29.340  9.359   56.897  1.00 36.33  ? 413  PHE A CD2 1 
ATOM   2670  C  CE1 . PHE A 1 367 ? 30.168  11.938  56.332  1.00 37.31  ? 413  PHE A CE1 1 
ATOM   2671  C  CE2 . PHE A 1 367 ? 29.260  10.363  57.873  1.00 35.68  ? 413  PHE A CE2 1 
ATOM   2672  C  CZ  . PHE A 1 367 ? 29.668  11.643  57.587  1.00 35.08  ? 413  PHE A CZ  1 
ATOM   2673  N  N   . PRO A 1 368 ? 32.238  5.797   53.659  1.00 35.57  ? 414  PRO A N   1 
ATOM   2674  C  CA  . PRO A 1 368 ? 32.346  4.770   52.607  1.00 35.32  ? 414  PRO A CA  1 
ATOM   2675  C  C   . PRO A 1 368 ? 31.221  3.714   52.657  1.00 35.33  ? 414  PRO A C   1 
ATOM   2676  O  O   . PRO A 1 368 ? 30.655  3.330   51.616  1.00 35.30  ? 414  PRO A O   1 
ATOM   2677  C  CB  . PRO A 1 368 ? 33.700  4.108   52.904  1.00 35.32  ? 414  PRO A CB  1 
ATOM   2678  C  CG  . PRO A 1 368 ? 33.973  4.408   54.311  1.00 34.78  ? 414  PRO A CG  1 
ATOM   2679  C  CD  . PRO A 1 368 ? 33.383  5.742   54.589  1.00 34.82  ? 414  PRO A CD  1 
ATOM   2680  N  N   . VAL A 1 369 ? 30.901  3.251   53.856  1.00 35.08  ? 415  VAL A N   1 
ATOM   2681  C  CA  . VAL A 1 369 ? 29.818  2.312   54.027  1.00 34.92  ? 415  VAL A CA  1 
ATOM   2682  C  C   . VAL A 1 369 ? 28.463  2.929   53.747  1.00 35.42  ? 415  VAL A C   1 
ATOM   2683  O  O   . VAL A 1 369 ? 27.675  2.342   53.022  1.00 35.86  ? 415  VAL A O   1 
ATOM   2684  C  CB  . VAL A 1 369 ? 29.855  1.717   55.419  1.00 35.11  ? 415  VAL A CB  1 
ATOM   2685  C  CG1 . VAL A 1 369 ? 28.625  0.838   55.691  1.00 32.41  ? 415  VAL A CG1 1 
ATOM   2686  C  CG2 . VAL A 1 369 ? 31.124  0.929   55.551  1.00 34.45  ? 415  VAL A CG2 1 
ATOM   2687  N  N   . GLU A 1 370 ? 28.200  4.112   54.286  1.00 35.46  ? 416  GLU A N   1 
ATOM   2688  C  CA  . GLU A 1 370 ? 26.962  4.807   53.944  1.00 36.27  ? 416  GLU A CA  1 
ATOM   2689  C  C   . GLU A 1 370 ? 26.826  4.961   52.424  1.00 36.29  ? 416  GLU A C   1 
ATOM   2690  O  O   . GLU A 1 370 ? 25.745  4.712   51.869  1.00 36.11  ? 416  GLU A O   1 
ATOM   2691  C  CB  . GLU A 1 370 ? 26.840  6.151   54.670  1.00 36.13  ? 416  GLU A CB  1 
ATOM   2692  C  CG  . GLU A 1 370 ? 26.732  6.031   56.195  1.00 38.36  ? 416  GLU A CG  1 
ATOM   2693  C  CD  . GLU A 1 370 ? 28.097  5.878   56.898  1.00 43.70  ? 416  GLU A CD  1 
ATOM   2694  O  OE1 . GLU A 1 370 ? 29.167  5.788   56.203  1.00 44.97  ? 416  GLU A OE1 1 
ATOM   2695  O  OE2 . GLU A 1 370 ? 28.103  5.837   58.161  1.00 44.57  ? 416  GLU A OE2 1 
ATOM   2696  N  N   . ALA A 1 371 ? 27.930  5.312   51.755  1.00 36.30  ? 417  ALA A N   1 
ATOM   2697  C  CA  . ALA A 1 371 ? 27.924  5.497   50.305  1.00 36.52  ? 417  ALA A CA  1 
ATOM   2698  C  C   . ALA A 1 371 ? 27.494  4.218   49.602  1.00 36.96  ? 417  ALA A C   1 
ATOM   2699  O  O   . ALA A 1 371 ? 26.728  4.247   48.641  1.00 37.24  ? 417  ALA A O   1 
ATOM   2700  C  CB  . ALA A 1 371 ? 29.306  5.955   49.801  1.00 36.47  ? 417  ALA A CB  1 
ATOM   2701  N  N   . VAL A 1 372 ? 27.989  3.086   50.085  1.00 37.32  ? 418  VAL A N   1 
ATOM   2702  C  CA  . VAL A 1 372 ? 27.661  1.817   49.452  1.00 37.25  ? 418  VAL A CA  1 
ATOM   2703  C  C   . VAL A 1 372 ? 26.198  1.485   49.746  1.00 37.40  ? 418  VAL A C   1 
ATOM   2704  O  O   . VAL A 1 372 ? 25.471  1.049   48.849  1.00 37.55  ? 418  VAL A O   1 
ATOM   2705  C  CB  . VAL A 1 372 ? 28.600  0.675   49.893  1.00 37.36  ? 418  VAL A CB  1 
ATOM   2706  C  CG1 . VAL A 1 372 ? 28.088  -0.633  49.398  1.00 37.37  ? 418  VAL A CG1 1 
ATOM   2707  C  CG2 . VAL A 1 372 ? 30.002  0.892   49.347  1.00 37.60  ? 418  VAL A CG2 1 
ATOM   2708  N  N   . LYS A 1 373 ? 25.750  1.716   50.979  1.00 37.04  ? 419  LYS A N   1 
ATOM   2709  C  CA  . LYS A 1 373 ? 24.334  1.505   51.309  1.00 37.13  ? 419  LYS A CA  1 
ATOM   2710  C  C   . LYS A 1 373 ? 23.384  2.321   50.422  1.00 37.29  ? 419  LYS A C   1 
ATOM   2711  O  O   . LYS A 1 373 ? 22.307  1.844   50.058  1.00 37.07  ? 419  LYS A O   1 
ATOM   2712  C  CB  . LYS A 1 373 ? 24.052  1.828   52.758  1.00 37.42  ? 419  LYS A CB  1 
ATOM   2713  C  CG  . LYS A 1 373 ? 24.608  0.848   53.769  1.00 37.98  ? 419  LYS A CG  1 
ATOM   2714  C  CD  . LYS A 1 373 ? 24.069  1.215   55.117  1.00 39.89  ? 419  LYS A CD  1 
ATOM   2715  C  CE  . LYS A 1 373 ? 24.794  0.559   56.280  1.00 42.91  ? 419  LYS A CE  1 
ATOM   2716  N  NZ  . LYS A 1 373 ? 23.847  0.562   57.467  1.00 44.30  ? 419  LYS A NZ  1 
ATOM   2717  N  N   . MET A 1 374 ? 23.794  3.535   50.054  1.00 37.59  ? 420  MET A N   1 
ATOM   2718  C  CA  . MET A 1 374 ? 22.981  4.366   49.174  1.00 37.72  ? 420  MET A CA  1 
ATOM   2719  C  C   . MET A 1 374 ? 22.901  3.791   47.775  1.00 37.65  ? 420  MET A C   1 
ATOM   2720  O  O   . MET A 1 374 ? 21.801  3.677   47.253  1.00 37.87  ? 420  MET A O   1 
ATOM   2721  C  CB  . MET A 1 374 ? 23.460  5.832   49.138  1.00 38.20  ? 420  MET A CB  1 
ATOM   2722  C  CG  . MET A 1 374 ? 22.462  6.778   48.484  1.00 37.61  ? 420  MET A CG  1 
ATOM   2723  S  SD  . MET A 1 374 ? 21.123  7.166   49.590  1.00 39.38  ? 420  MET A SD  1 
ATOM   2724  C  CE  . MET A 1 374 ? 19.785  6.752   48.517  1.00 38.27  ? 420  MET A CE  1 
ATOM   2725  N  N   . GLN A 1 375 ? 24.026  3.443   47.147  1.00 37.34  ? 421  GLN A N   1 
ATOM   2726  C  CA  . GLN A 1 375 ? 23.919  2.876   45.804  1.00 37.69  ? 421  GLN A CA  1 
ATOM   2727  C  C   . GLN A 1 375 ? 23.021  1.648   45.875  1.00 38.40  ? 421  GLN A C   1 
ATOM   2728  O  O   . GLN A 1 375 ? 22.193  1.409   45.004  1.00 38.83  ? 421  GLN A O   1 
ATOM   2729  C  CB  . GLN A 1 375 ? 25.262  2.529   45.192  1.00 37.42  ? 421  GLN A CB  1 
ATOM   2730  C  CG  . GLN A 1 375 ? 26.086  3.740   44.898  1.00 37.39  ? 421  GLN A CG  1 
ATOM   2731  C  CD  . GLN A 1 375 ? 27.087  3.539   43.775  1.00 38.05  ? 421  GLN A CD  1 
ATOM   2732  O  OE1 . GLN A 1 375 ? 27.341  4.449   42.983  1.00 39.12  ? 421  GLN A OE1 1 
ATOM   2733  N  NE2 . GLN A 1 375 ? 27.652  2.353   43.698  1.00 37.95  ? 421  GLN A NE2 1 
ATOM   2734  N  N   . HIS A 1 376 ? 23.140  0.889   46.948  1.00 38.92  ? 422  HIS A N   1 
ATOM   2735  C  CA  . HIS A 1 376 ? 22.262  -0.260  47.095  1.00 39.24  ? 422  HIS A CA  1 
ATOM   2736  C  C   . HIS A 1 376 ? 20.782  0.175   47.123  1.00 39.66  ? 422  HIS A C   1 
ATOM   2737  O  O   . HIS A 1 376 ? 19.954  -0.373  46.416  1.00 40.43  ? 422  HIS A O   1 
ATOM   2738  C  CB  . HIS A 1 376 ? 22.637  -1.116  48.314  1.00 38.66  ? 422  HIS A CB  1 
ATOM   2739  C  CG  . HIS A 1 376 ? 21.619  -2.159  48.653  1.00 37.60  ? 422  HIS A CG  1 
ATOM   2740  N  ND1 . HIS A 1 376 ? 21.592  -3.404  48.054  1.00 36.49  ? 422  HIS A ND1 1 
ATOM   2741  C  CD2 . HIS A 1 376 ? 20.582  -2.143  49.528  1.00 37.10  ? 422  HIS A CD2 1 
ATOM   2742  C  CE1 . HIS A 1 376 ? 20.572  -4.098  48.531  1.00 36.83  ? 422  HIS A CE1 1 
ATOM   2743  N  NE2 . HIS A 1 376 ? 19.940  -3.355  49.425  1.00 35.85  ? 422  HIS A NE2 1 
ATOM   2744  N  N   . ALA A 1 377 ? 20.448  1.171   47.922  1.00 40.22  ? 423  ALA A N   1 
ATOM   2745  C  CA  . ALA A 1 377 ? 19.048  1.557   48.113  1.00 40.54  ? 423  ALA A CA  1 
ATOM   2746  C  C   . ALA A 1 377 ? 18.395  2.083   46.834  1.00 40.99  ? 423  ALA A C   1 
ATOM   2747  O  O   . ALA A 1 377 ? 17.275  1.698   46.486  1.00 41.38  ? 423  ALA A O   1 
ATOM   2748  C  CB  . ALA A 1 377 ? 18.963  2.579   49.205  1.00 40.27  ? 423  ALA A CB  1 
ATOM   2749  N  N   . ILE A 1 378 ? 19.110  2.955   46.133  1.00 41.27  ? 424  ILE A N   1 
ATOM   2750  C  CA  . ILE A 1 378 ? 18.621  3.499   44.870  1.00 41.15  ? 424  ILE A CA  1 
ATOM   2751  C  C   . ILE A 1 378 ? 18.511  2.414   43.803  1.00 41.47  ? 424  ILE A C   1 
ATOM   2752  O  O   . ILE A 1 378 ? 17.461  2.291   43.158  1.00 41.84  ? 424  ILE A O   1 
ATOM   2753  C  CB  . ILE A 1 378 ? 19.521  4.620   44.308  1.00 41.03  ? 424  ILE A CB  1 
ATOM   2754  C  CG1 . ILE A 1 378 ? 19.803  5.697   45.360  1.00 39.29  ? 424  ILE A CG1 1 
ATOM   2755  C  CG2 . ILE A 1 378 ? 18.861  5.244   43.094  1.00 41.45  ? 424  ILE A CG2 1 
ATOM   2756  C  CD1 . ILE A 1 378 ? 21.103  6.457   45.127  1.00 35.57  ? 424  ILE A CD1 1 
ATOM   2757  N  N   . ALA A 1 379 ? 19.575  1.630   43.601  1.00 40.97  ? 425  ALA A N   1 
ATOM   2758  C  CA  . ALA A 1 379 ? 19.528  0.613   42.546  1.00 40.50  ? 425  ALA A CA  1 
ATOM   2759  C  C   . ALA A 1 379 ? 18.303  -0.284  42.680  1.00 40.06  ? 425  ALA A C   1 
ATOM   2760  O  O   . ALA A 1 379 ? 17.707  -0.646  41.697  1.00 39.52  ? 425  ALA A O   1 
ATOM   2761  C  CB  . ALA A 1 379 ? 20.805  -0.199  42.495  1.00 40.62  ? 425  ALA A CB  1 
ATOM   2762  N  N   . ARG A 1 380 ? 17.901  -0.598  43.901  1.00 40.23  ? 426  ARG A N   1 
ATOM   2763  C  CA  . ARG A 1 380 ? 16.725  -1.461  44.084  1.00 40.68  ? 426  ARG A CA  1 
ATOM   2764  C  C   . ARG A 1 380 ? 15.423  -0.824  43.604  1.00 40.68  ? 426  ARG A C   1 
ATOM   2765  O  O   . ARG A 1 380 ? 14.625  -1.455  42.907  1.00 41.51  ? 426  ARG A O   1 
ATOM   2766  C  CB  . ARG A 1 380 ? 16.594  -1.920  45.518  1.00 40.58  ? 426  ARG A CB  1 
ATOM   2767  C  CG  . ARG A 1 380 ? 17.679  -2.899  45.914  1.00 42.15  ? 426  ARG A CG  1 
ATOM   2768  C  CD  . ARG A 1 380 ? 17.156  -3.905  46.882  1.00 43.68  ? 426  ARG A CD  1 
ATOM   2769  N  NE  . ARG A 1 380 ? 16.352  -3.245  47.913  1.00 44.28  ? 426  ARG A NE  1 
ATOM   2770  C  CZ  . ARG A 1 380 ? 15.297  -3.798  48.492  1.00 46.37  ? 426  ARG A CZ  1 
ATOM   2771  N  NH1 . ARG A 1 380 ? 14.891  -5.028  48.135  1.00 45.57  ? 426  ARG A NH1 1 
ATOM   2772  N  NH2 . ARG A 1 380 ? 14.642  -3.120  49.422  1.00 46.16  ? 426  ARG A NH2 1 
ATOM   2773  N  N   . GLU A 1 381 ? 15.210  0.429   43.970  1.00 40.15  ? 427  GLU A N   1 
ATOM   2774  C  CA  . GLU A 1 381 ? 14.108  1.192   43.430  1.00 39.30  ? 427  GLU A CA  1 
ATOM   2775  C  C   . GLU A 1 381 ? 14.137  1.283   41.920  1.00 39.31  ? 427  GLU A C   1 
ATOM   2776  O  O   . GLU A 1 381 ? 13.151  0.981   41.275  1.00 39.30  ? 427  GLU A O   1 
ATOM   2777  C  CB  . GLU A 1 381 ? 14.141  2.594   44.008  1.00 39.17  ? 427  GLU A CB  1 
ATOM   2778  C  CG  . GLU A 1 381 ? 14.068  2.632   45.521  1.00 37.54  ? 427  GLU A CG  1 
ATOM   2779  C  CD  . GLU A 1 381 ? 12.730  2.184   46.040  1.00 35.39  ? 427  GLU A CD  1 
ATOM   2780  O  OE1 . GLU A 1 381 ? 11.761  2.065   45.252  1.00 37.59  ? 427  GLU A OE1 1 
ATOM   2781  O  OE2 . GLU A 1 381 ? 12.643  1.934   47.254  1.00 34.28  ? 427  GLU A OE2 1 
ATOM   2782  N  N   . ALA A 1 382 ? 15.282  1.694   41.359  1.00 39.47  ? 428  ALA A N   1 
ATOM   2783  C  CA  . ALA A 1 382 ? 15.405  1.905   39.915  1.00 38.91  ? 428  ALA A CA  1 
ATOM   2784  C  C   . ALA A 1 382 ? 15.209  0.616   39.128  1.00 38.87  ? 428  ALA A C   1 
ATOM   2785  O  O   . ALA A 1 382 ? 14.505  0.593   38.134  1.00 38.94  ? 428  ALA A O   1 
ATOM   2786  C  CB  . ALA A 1 382 ? 16.686  2.540   39.601  1.00 38.74  ? 428  ALA A CB  1 
ATOM   2787  N  N   . GLU A 1 383 ? 15.786  -0.476  39.608  1.00 39.29  ? 429  GLU A N   1 
ATOM   2788  C  CA  . GLU A 1 383 ? 15.599  -1.788  38.975  1.00 39.67  ? 429  GLU A CA  1 
ATOM   2789  C  C   . GLU A 1 383 ? 14.135  -2.204  38.840  1.00 40.45  ? 429  GLU A C   1 
ATOM   2790  O  O   . GLU A 1 383 ? 13.737  -2.685  37.773  1.00 40.81  ? 429  GLU A O   1 
ATOM   2791  C  CB  . GLU A 1 383 ? 16.420  -2.850  39.675  1.00 39.11  ? 429  GLU A CB  1 
ATOM   2792  C  CG  . GLU A 1 383 ? 17.878  -2.747  39.311  1.00 39.47  ? 429  GLU A CG  1 
ATOM   2793  C  CD  . GLU A 1 383 ? 18.772  -3.140  40.451  1.00 40.00  ? 429  GLU A CD  1 
ATOM   2794  O  OE1 . GLU A 1 383 ? 18.308  -3.951  41.287  1.00 40.29  ? 429  GLU A OE1 1 
ATOM   2795  O  OE2 . GLU A 1 383 ? 19.922  -2.643  40.492  1.00 39.83  ? 429  GLU A OE2 1 
ATOM   2796  N  N   . ALA A 1 384 ? 13.345  -1.982  39.899  1.00 40.75  ? 430  ALA A N   1 
ATOM   2797  C  CA  . ALA A 1 384 ? 11.893  -2.168  39.870  1.00 41.01  ? 430  ALA A CA  1 
ATOM   2798  C  C   . ALA A 1 384 ? 11.164  -1.218  38.932  1.00 41.44  ? 430  ALA A C   1 
ATOM   2799  O  O   . ALA A 1 384 ? 10.037  -1.511  38.523  1.00 42.05  ? 430  ALA A O   1 
ATOM   2800  C  CB  . ALA A 1 384 ? 11.317  -2.046  41.252  1.00 40.76  ? 430  ALA A CB  1 
ATOM   2801  N  N   . ALA A 1 385 ? 11.789  -0.091  38.592  1.00 41.58  ? 431  ALA A N   1 
ATOM   2802  C  CA  . ALA A 1 385 ? 11.166  0.883   37.675  1.00 42.37  ? 431  ALA A CA  1 
ATOM   2803  C  C   . ALA A 1 385 ? 11.522  0.711   36.175  1.00 42.92  ? 431  ALA A C   1 
ATOM   2804  O  O   . ALA A 1 385 ? 10.981  1.425   35.321  1.00 43.58  ? 431  ALA A O   1 
ATOM   2805  C  CB  . ALA A 1 385 ? 11.450  2.304   38.127  1.00 41.96  ? 431  ALA A CB  1 
ATOM   2806  N  N   . VAL A 1 386 ? 12.404  -0.231  35.854  1.00 42.97  ? 432  VAL A N   1 
ATOM   2807  C  CA  . VAL A 1 386 ? 12.648  -0.565  34.457  1.00 43.07  ? 432  VAL A CA  1 
ATOM   2808  C  C   . VAL A 1 386 ? 11.354  -1.021  33.782  1.00 43.52  ? 432  VAL A C   1 
ATOM   2809  O  O   . VAL A 1 386 ? 10.631  -1.852  34.315  1.00 44.31  ? 432  VAL A O   1 
ATOM   2810  C  CB  . VAL A 1 386 ? 13.711  -1.682  34.315  1.00 43.02  ? 432  VAL A CB  1 
ATOM   2811  C  CG1 . VAL A 1 386 ? 13.746  -2.193  32.895  1.00 41.94  ? 432  VAL A CG1 1 
ATOM   2812  C  CG2 . VAL A 1 386 ? 15.101  -1.182  34.760  1.00 42.38  ? 432  VAL A CG2 1 
ATOM   2813  N  N   . TYR A 1 387 ? 11.067  -0.478  32.605  1.00 43.74  ? 433  TYR A N   1 
ATOM   2814  C  CA  . TYR A 1 387 ? 9.900   -0.877  31.825  1.00 43.28  ? 433  TYR A CA  1 
ATOM   2815  C  C   . TYR A 1 387 ? 10.269  -2.075  30.984  1.00 43.41  ? 433  TYR A C   1 
ATOM   2816  O  O   . TYR A 1 387 ? 10.480  -1.931  29.778  1.00 43.83  ? 433  TYR A O   1 
ATOM   2817  C  CB  . TYR A 1 387 ? 9.500   0.290   30.918  1.00 43.36  ? 433  TYR A CB  1 
ATOM   2818  C  CG  . TYR A 1 387 ? 8.183   0.143   30.171  1.00 42.64  ? 433  TYR A CG  1 
ATOM   2819  C  CD1 . TYR A 1 387 ? 7.054   -0.368  30.800  1.00 43.11  ? 433  TYR A CD1 1 
ATOM   2820  C  CD2 . TYR A 1 387 ? 8.066   0.555   28.831  1.00 43.15  ? 433  TYR A CD2 1 
ATOM   2821  C  CE1 . TYR A 1 387 ? 5.829   -0.495  30.104  1.00 43.19  ? 433  TYR A CE1 1 
ATOM   2822  C  CE2 . TYR A 1 387 ? 6.854   0.441   28.135  1.00 43.16  ? 433  TYR A CE2 1 
ATOM   2823  C  CZ  . TYR A 1 387 ? 5.743   -0.078  28.784  1.00 43.70  ? 433  TYR A CZ  1 
ATOM   2824  O  OH  . TYR A 1 387 ? 4.546   -0.186  28.126  1.00 45.15  ? 433  TYR A OH  1 
ATOM   2825  N  N   . HIS A 1 388 ? 10.373  -3.251  31.609  1.00 43.66  ? 434  HIS A N   1 
ATOM   2826  C  CA  . HIS A 1 388 ? 10.859  -4.462  30.918  1.00 44.04  ? 434  HIS A CA  1 
ATOM   2827  C  C   . HIS A 1 388 ? 10.108  -4.723  29.622  1.00 44.44  ? 434  HIS A C   1 
ATOM   2828  O  O   . HIS A 1 388 ? 10.732  -5.013  28.573  1.00 44.69  ? 434  HIS A O   1 
ATOM   2829  C  CB  . HIS A 1 388 ? 10.767  -5.673  31.822  1.00 43.86  ? 434  HIS A CB  1 
ATOM   2830  C  CG  . HIS A 1 388 ? 11.473  -5.482  33.122  1.00 45.13  ? 434  HIS A CG  1 
ATOM   2831  N  ND1 . HIS A 1 388 ? 12.844  -5.600  33.249  1.00 45.82  ? 434  HIS A ND1 1 
ATOM   2832  C  CD2 . HIS A 1 388 ? 11.008  -5.128  34.343  1.00 46.57  ? 434  HIS A CD2 1 
ATOM   2833  C  CE1 . HIS A 1 388 ? 13.189  -5.354  34.503  1.00 46.43  ? 434  HIS A CE1 1 
ATOM   2834  N  NE2 . HIS A 1 388 ? 12.094  -5.067  35.186  1.00 46.69  ? 434  HIS A NE2 1 
ATOM   2835  N  N   . ARG A 1 389 ? 8.780   -4.580  29.680  1.00 44.55  ? 435  ARG A N   1 
ATOM   2836  C  CA  . ARG A 1 389 ? 7.958   -4.789  28.501  1.00 44.73  ? 435  ARG A CA  1 
ATOM   2837  C  C   . ARG A 1 389 ? 8.667   -4.220  27.269  1.00 44.40  ? 435  ARG A C   1 
ATOM   2838  O  O   . ARG A 1 389 ? 9.065   -4.976  26.401  1.00 44.65  ? 435  ARG A O   1 
ATOM   2839  C  CB  . ARG A 1 389 ? 6.545   -4.223  28.675  1.00 44.72  ? 435  ARG A CB  1 
ATOM   2840  C  CG  . ARG A 1 389 ? 5.694   -4.346  27.424  1.00 45.46  ? 435  ARG A CG  1 
ATOM   2841  C  CD  . ARG A 1 389 ? 4.343   -3.700  27.607  1.00 49.17  ? 435  ARG A CD  1 
ATOM   2842  N  NE  . ARG A 1 389 ? 3.421   -4.595  28.310  1.00 52.08  ? 435  ARG A NE  1 
ATOM   2843  C  CZ  . ARG A 1 389 ? 2.110   -4.672  28.087  1.00 52.99  ? 435  ARG A CZ  1 
ATOM   2844  N  NH1 . ARG A 1 389 ? 1.519   -3.898  27.167  1.00 52.48  ? 435  ARG A NH1 1 
ATOM   2845  N  NH2 . ARG A 1 389 ? 1.391   -5.542  28.787  1.00 53.13  ? 435  ARG A NH2 1 
ATOM   2846  N  N   . GLN A 1 390 ? 8.872   -2.910  27.221  1.00 44.05  ? 436  GLN A N   1 
ATOM   2847  C  CA  . GLN A 1 390 ? 9.591   -2.317  26.101  1.00 44.40  ? 436  GLN A CA  1 
ATOM   2848  C  C   . GLN A 1 390 ? 10.994  -2.901  25.998  1.00 44.10  ? 436  GLN A C   1 
ATOM   2849  O  O   . GLN A 1 390 ? 11.421  -3.304  24.912  1.00 44.00  ? 436  GLN A O   1 
ATOM   2850  C  CB  . GLN A 1 390 ? 9.657   -0.788  26.221  1.00 44.56  ? 436  GLN A CB  1 
ATOM   2851  C  CG  . GLN A 1 390 ? 10.142  -0.076  24.955  1.00 46.10  ? 436  GLN A CG  1 
ATOM   2852  C  CD  . GLN A 1 390 ? 10.032  1.450   25.048  1.00 48.92  ? 436  GLN A CD  1 
ATOM   2853  O  OE1 . GLN A 1 390 ? 8.969   2.023   24.829  1.00 50.06  ? 436  GLN A OE1 1 
ATOM   2854  N  NE2 . GLN A 1 390 ? 11.142  2.107   25.366  1.00 51.78  ? 436  GLN A NE2 1 
ATOM   2855  N  N   . LEU A 1 391 ? 11.688  -2.973  27.137  1.00 43.98  ? 437  LEU A N   1 
ATOM   2856  C  CA  . LEU A 1 391 ? 13.091  -3.364  27.159  1.00 44.00  ? 437  LEU A CA  1 
ATOM   2857  C  C   . LEU A 1 391 ? 13.286  -4.730  26.479  1.00 44.05  ? 437  LEU A C   1 
ATOM   2858  O  O   . LEU A 1 391 ? 14.054  -4.880  25.513  1.00 43.74  ? 437  LEU A O   1 
ATOM   2859  C  CB  . LEU A 1 391 ? 13.635  -3.349  28.598  1.00 43.65  ? 437  LEU A CB  1 
ATOM   2860  C  CG  . LEU A 1 391 ? 15.156  -3.658  28.743  1.00 43.50  ? 437  LEU A CG  1 
ATOM   2861  C  CD1 . LEU A 1 391 ? 16.037  -2.765  27.863  1.00 41.97  ? 437  LEU A CD1 1 
ATOM   2862  C  CD2 . LEU A 1 391 ? 15.621  -3.587  30.191  1.00 39.70  ? 437  LEU A CD2 1 
ATOM   2863  N  N   . PHE A 1 392 ? 12.537  -5.705  26.976  1.00 44.20  ? 438  PHE A N   1 
ATOM   2864  C  CA  . PHE A 1 392 ? 12.580  -7.053  26.429  1.00 44.61  ? 438  PHE A CA  1 
ATOM   2865  C  C   . PHE A 1 392 ? 12.228  -7.059  24.950  1.00 44.60  ? 438  PHE A C   1 
ATOM   2866  O  O   . PHE A 1 392 ? 12.988  -7.597  24.142  1.00 44.76  ? 438  PHE A O   1 
ATOM   2867  C  CB  . PHE A 1 392 ? 11.642  -7.985  27.195  1.00 44.54  ? 438  PHE A CB  1 
ATOM   2868  C  CG  . PHE A 1 392 ? 11.852  -9.442  26.886  1.00 45.11  ? 438  PHE A CG  1 
ATOM   2869  C  CD1 . PHE A 1 392 ? 13.105  -9.912  26.435  1.00 46.18  ? 438  PHE A CD1 1 
ATOM   2870  C  CD2 . PHE A 1 392 ? 10.814  -10.362 27.077  1.00 43.98  ? 438  PHE A CD2 1 
ATOM   2871  C  CE1 . PHE A 1 392 ? 13.304  -11.275 26.152  1.00 43.75  ? 438  PHE A CE1 1 
ATOM   2872  C  CE2 . PHE A 1 392 ? 11.010  -11.709 26.808  1.00 42.78  ? 438  PHE A CE2 1 
ATOM   2873  C  CZ  . PHE A 1 392 ? 12.254  -12.166 26.340  1.00 41.72  ? 438  PHE A CZ  1 
ATOM   2874  N  N   . GLU A 1 393 ? 11.101  -6.443  24.598  1.00 44.37  ? 439  GLU A N   1 
ATOM   2875  C  CA  . GLU A 1 393 ? 10.680  -6.401  23.205  1.00 44.75  ? 439  GLU A CA  1 
ATOM   2876  C  C   . GLU A 1 393 ? 11.819  -5.928  22.335  1.00 44.60  ? 439  GLU A C   1 
ATOM   2877  O  O   . GLU A 1 393 ? 12.207  -6.615  21.387  1.00 44.55  ? 439  GLU A O   1 
ATOM   2878  C  CB  . GLU A 1 393 ? 9.468   -5.501  23.001  1.00 44.95  ? 439  GLU A CB  1 
ATOM   2879  C  CG  . GLU A 1 393 ? 8.139   -6.181  23.346  1.00 47.77  ? 439  GLU A CG  1 
ATOM   2880  C  CD  . GLU A 1 393 ? 6.945   -5.498  22.676  1.00 51.38  ? 439  GLU A CD  1 
ATOM   2881  O  OE1 . GLU A 1 393 ? 7.179   -4.726  21.709  1.00 51.89  ? 439  GLU A OE1 1 
ATOM   2882  O  OE2 . GLU A 1 393 ? 5.780   -5.735  23.108  1.00 52.63  ? 439  GLU A OE2 1 
ATOM   2883  N  N   . GLU A 1 394 ? 12.394  -4.784  22.699  1.00 44.62  ? 440  GLU A N   1 
ATOM   2884  C  CA  . GLU A 1 394 ? 13.405  -4.158  21.869  1.00 44.53  ? 440  GLU A CA  1 
ATOM   2885  C  C   . GLU A 1 394 ? 14.644  -5.038  21.702  1.00 44.77  ? 440  GLU A C   1 
ATOM   2886  O  O   . GLU A 1 394 ? 15.173  -5.139  20.578  1.00 44.59  ? 440  GLU A O   1 
ATOM   2887  C  CB  . GLU A 1 394 ? 13.751  -2.784  22.408  1.00 44.35  ? 440  GLU A CB  1 
ATOM   2888  C  CG  . GLU A 1 394 ? 12.526  -1.907  22.489  1.00 44.84  ? 440  GLU A CG  1 
ATOM   2889  C  CD  . GLU A 1 394 ? 12.844  -0.436  22.434  1.00 46.38  ? 440  GLU A CD  1 
ATOM   2890  O  OE1 . GLU A 1 394 ? 13.884  -0.007  23.012  1.00 48.59  ? 440  GLU A OE1 1 
ATOM   2891  O  OE2 . GLU A 1 394 ? 12.049  0.290   21.804  1.00 46.12  ? 440  GLU A OE2 1 
ATOM   2892  N  N   . LEU A 1 395 ? 15.079  -5.691  22.793  1.00 44.95  ? 441  LEU A N   1 
ATOM   2893  C  CA  . LEU A 1 395 ? 16.271  -6.547  22.738  1.00 45.19  ? 441  LEU A CA  1 
ATOM   2894  C  C   . LEU A 1 395 ? 16.015  -7.720  21.805  1.00 45.89  ? 441  LEU A C   1 
ATOM   2895  O  O   . LEU A 1 395 ? 16.740  -7.889  20.830  1.00 46.50  ? 441  LEU A O   1 
ATOM   2896  C  CB  . LEU A 1 395 ? 16.728  -6.996  24.118  1.00 44.57  ? 441  LEU A CB  1 
ATOM   2897  C  CG  . LEU A 1 395 ? 17.220  -5.881  25.059  1.00 43.75  ? 441  LEU A CG  1 
ATOM   2898  C  CD1 . LEU A 1 395 ? 17.231  -6.346  26.501  1.00 41.96  ? 441  LEU A CD1 1 
ATOM   2899  C  CD2 . LEU A 1 395 ? 18.595  -5.371  24.698  1.00 41.27  ? 441  LEU A CD2 1 
ATOM   2900  N  N   . ARG A 1 396 ? 14.961  -8.492  22.052  1.00 46.38  ? 442  ARG A N   1 
ATOM   2901  C  CA  . ARG A 1 396 ? 14.613  -9.566  21.129  1.00 47.36  ? 442  ARG A CA  1 
ATOM   2902  C  C   . ARG A 1 396 ? 14.709  -8.996  19.721  1.00 47.58  ? 442  ARG A C   1 
ATOM   2903  O  O   . ARG A 1 396 ? 15.555  -9.416  18.925  1.00 48.01  ? 442  ARG A O   1 
ATOM   2904  C  CB  . ARG A 1 396 ? 13.182  -10.096 21.362  1.00 47.46  ? 442  ARG A CB  1 
ATOM   2905  C  CG  . ARG A 1 396 ? 12.831  -10.329 22.808  1.00 48.71  ? 442  ARG A CG  1 
ATOM   2906  C  CD  . ARG A 1 396 ? 11.684  -11.312 22.977  1.00 51.42  ? 442  ARG A CD  1 
ATOM   2907  N  NE  . ARG A 1 396 ? 10.372  -10.740 22.675  1.00 51.40  ? 442  ARG A NE  1 
ATOM   2908  C  CZ  . ARG A 1 396 ? 9.651   -11.054 21.599  1.00 52.76  ? 442  ARG A CZ  1 
ATOM   2909  N  NH1 . ARG A 1 396 ? 10.120  -11.940 20.712  1.00 52.48  ? 442  ARG A NH1 1 
ATOM   2910  N  NH2 . ARG A 1 396 ? 8.457   -10.485 21.404  1.00 52.42  ? 442  ARG A NH2 1 
ATOM   2911  N  N   . ARG A 1 397 ? 13.845  -8.015  19.454  1.00 47.52  ? 443  ARG A N   1 
ATOM   2912  C  CA  . ARG A 1 397 ? 13.666  -7.417  18.150  1.00 47.44  ? 443  ARG A CA  1 
ATOM   2913  C  C   . ARG A 1 397 ? 15.012  -7.071  17.511  1.00 47.24  ? 443  ARG A C   1 
ATOM   2914  O  O   . ARG A 1 397 ? 15.240  -7.347  16.323  1.00 47.14  ? 443  ARG A O   1 
ATOM   2915  C  CB  . ARG A 1 397 ? 12.815  -6.157  18.299  1.00 47.67  ? 443  ARG A CB  1 
ATOM   2916  C  CG  . ARG A 1 397 ? 11.622  -6.062  17.362  1.00 48.71  ? 443  ARG A CG  1 
ATOM   2917  C  CD  . ARG A 1 397 ? 10.925  -4.686  17.479  1.00 51.05  ? 443  ARG A CD  1 
ATOM   2918  N  NE  . ARG A 1 397 ? 10.096  -4.404  16.299  1.00 54.10  ? 443  ARG A NE  1 
ATOM   2919  C  CZ  . ARG A 1 397 ? 8.781   -4.180  16.312  1.00 55.10  ? 443  ARG A CZ  1 
ATOM   2920  N  NH1 . ARG A 1 397 ? 8.098   -4.159  17.459  1.00 55.80  ? 443  ARG A NH1 1 
ATOM   2921  N  NH2 . ARG A 1 397 ? 8.152   -3.950  15.167  1.00 53.80  ? 443  ARG A NH2 1 
ATOM   2922  N  N   . ALA A 1 398 ? 15.910  -6.486  18.295  1.00 46.68  ? 444  ALA A N   1 
ATOM   2923  C  CA  . ALA A 1 398 ? 17.182  -6.046  17.746  1.00 46.45  ? 444  ALA A CA  1 
ATOM   2924  C  C   . ALA A 1 398 ? 18.196  -7.178  17.572  1.00 46.20  ? 444  ALA A C   1 
ATOM   2925  O  O   . ALA A 1 398 ? 18.904  -7.221  16.569  1.00 46.51  ? 444  ALA A O   1 
ATOM   2926  C  CB  . ALA A 1 398 ? 17.763  -4.935  18.584  1.00 46.61  ? 444  ALA A CB  1 
ATOM   2927  N  N   . ALA A 1 399 ? 18.275  -8.069  18.554  1.00 45.41  ? 445  ALA A N   1 
ATOM   2928  C  CA  . ALA A 1 399 ? 19.243  -9.158  18.546  1.00 45.11  ? 445  ALA A CA  1 
ATOM   2929  C  C   . ALA A 1 399 ? 19.011  -10.111 17.364  1.00 45.13  ? 445  ALA A C   1 
ATOM   2930  O  O   . ALA A 1 399 ? 17.883  -10.566 17.140  1.00 45.22  ? 445  ALA A O   1 
ATOM   2931  C  CB  . ALA A 1 399 ? 19.199  -9.910  19.867  1.00 44.82  ? 445  ALA A CB  1 
ATOM   2932  N  N   . PRO A 1 400 ? 20.081  -10.416 16.594  1.00 45.01  ? 446  PRO A N   1 
ATOM   2933  C  CA  . PRO A 1 400 ? 19.908  -11.255 15.391  1.00 44.45  ? 446  PRO A CA  1 
ATOM   2934  C  C   . PRO A 1 400 ? 19.506  -12.678 15.788  1.00 43.99  ? 446  PRO A C   1 
ATOM   2935  O  O   . PRO A 1 400 ? 19.656  -13.047 16.950  1.00 43.87  ? 446  PRO A O   1 
ATOM   2936  C  CB  . PRO A 1 400 ? 21.304  -11.242 14.743  1.00 44.26  ? 446  PRO A CB  1 
ATOM   2937  C  CG  . PRO A 1 400 ? 22.265  -10.962 15.872  1.00 44.67  ? 446  PRO A CG  1 
ATOM   2938  C  CD  . PRO A 1 400 ? 21.497  -10.039 16.817  1.00 44.96  ? 446  PRO A CD  1 
ATOM   2939  N  N   . LEU A 1 401 ? 18.983  -13.457 14.848  1.00 43.81  ? 447  LEU A N   1 
ATOM   2940  C  CA  . LEU A 1 401 ? 18.717  -14.871 15.087  1.00 43.72  ? 447  LEU A CA  1 
ATOM   2941  C  C   . LEU A 1 401 ? 19.961  -15.502 15.672  1.00 43.62  ? 447  LEU A C   1 
ATOM   2942  O  O   . LEU A 1 401 ? 21.040  -14.918 15.613  1.00 44.07  ? 447  LEU A O   1 
ATOM   2943  C  CB  . LEU A 1 401 ? 18.362  -15.589 13.787  1.00 43.92  ? 447  LEU A CB  1 
ATOM   2944  C  CG  . LEU A 1 401 ? 17.336  -14.951 12.843  1.00 44.63  ? 447  LEU A CG  1 
ATOM   2945  C  CD1 . LEU A 1 401 ? 17.124  -15.889 11.656  1.00 45.69  ? 447  LEU A CD1 1 
ATOM   2946  C  CD2 . LEU A 1 401 ? 16.008  -14.611 13.540  1.00 44.61  ? 447  LEU A CD2 1 
ATOM   2947  N  N   . SER A 1 402 ? 19.822  -16.687 16.246  1.00 43.30  ? 448  SER A N   1 
ATOM   2948  C  CA  . SER A 1 402 ? 20.967  -17.354 16.829  1.00 43.03  ? 448  SER A CA  1 
ATOM   2949  C  C   . SER A 1 402 ? 20.819  -18.838 16.740  1.00 42.75  ? 448  SER A C   1 
ATOM   2950  O  O   . SER A 1 402 ? 19.724  -19.361 16.847  1.00 43.22  ? 448  SER A O   1 
ATOM   2951  C  CB  . SER A 1 402 ? 21.154  -16.972 18.288  1.00 43.10  ? 448  SER A CB  1 
ATOM   2952  O  OG  . SER A 1 402 ? 22.330  -17.591 18.816  1.00 44.36  ? 448  SER A OG  1 
ATOM   2953  N  N   . ARG A 1 403 ? 21.952  -19.500 16.573  1.00 42.34  ? 449  ARG A N   1 
ATOM   2954  C  CA  . ARG A 1 403 ? 22.009  -20.926 16.384  1.00 41.95  ? 449  ARG A CA  1 
ATOM   2955  C  C   . ARG A 1 403 ? 22.677  -21.597 17.588  1.00 41.50  ? 449  ARG A C   1 
ATOM   2956  O  O   . ARG A 1 403 ? 22.675  -22.816 17.698  1.00 41.65  ? 449  ARG A O   1 
ATOM   2957  C  CB  . ARG A 1 403 ? 22.793  -21.225 15.110  1.00 42.11  ? 449  ARG A CB  1 
ATOM   2958  C  CG  . ARG A 1 403 ? 22.325  -22.444 14.361  1.00 43.46  ? 449  ARG A CG  1 
ATOM   2959  C  CD  . ARG A 1 403 ? 21.480  -22.052 13.150  1.00 45.31  ? 449  ARG A CD  1 
ATOM   2960  N  NE  . ARG A 1 403 ? 20.910  -23.230 12.500  1.00 46.60  ? 449  ARG A NE  1 
ATOM   2961  C  CZ  . ARG A 1 403 ? 19.627  -23.371 12.187  1.00 47.48  ? 449  ARG A CZ  1 
ATOM   2962  N  NH1 . ARG A 1 403 ? 18.760  -22.393 12.443  1.00 47.64  ? 449  ARG A NH1 1 
ATOM   2963  N  NH2 . ARG A 1 403 ? 19.216  -24.491 11.599  1.00 47.24  ? 449  ARG A NH2 1 
ATOM   2964  N  N   . ASP A 1 404 ? 23.252  -20.800 18.482  1.00 40.89  ? 450  ASP A N   1 
ATOM   2965  C  CA  . ASP A 1 404 ? 23.903  -21.330 19.668  1.00 40.72  ? 450  ASP A CA  1 
ATOM   2966  C  C   . ASP A 1 404 ? 22.857  -21.776 20.680  1.00 40.28  ? 450  ASP A C   1 
ATOM   2967  O  O   . ASP A 1 404 ? 22.109  -20.958 21.205  1.00 40.75  ? 450  ASP A O   1 
ATOM   2968  C  CB  . ASP A 1 404 ? 24.834  -20.279 20.278  1.00 40.91  ? 450  ASP A CB  1 
ATOM   2969  C  CG  . ASP A 1 404 ? 25.353  -20.666 21.665  1.00 41.80  ? 450  ASP A CG  1 
ATOM   2970  O  OD1 . ASP A 1 404 ? 25.400  -21.872 22.009  1.00 42.82  ? 450  ASP A OD1 1 
ATOM   2971  O  OD2 . ASP A 1 404 ? 25.725  -19.742 22.416  1.00 43.88  ? 450  ASP A OD2 1 
ATOM   2972  N  N   . PRO A 1 405 ? 22.800  -23.082 20.956  1.00 39.69  ? 451  PRO A N   1 
ATOM   2973  C  CA  . PRO A 1 405 ? 21.796  -23.621 21.862  1.00 39.57  ? 451  PRO A CA  1 
ATOM   2974  C  C   . PRO A 1 405 ? 21.705  -22.901 23.204  1.00 39.62  ? 451  PRO A C   1 
ATOM   2975  O  O   . PRO A 1 405 ? 20.605  -22.741 23.745  1.00 39.80  ? 451  PRO A O   1 
ATOM   2976  C  CB  . PRO A 1 405 ? 22.253  -25.063 22.037  1.00 39.50  ? 451  PRO A CB  1 
ATOM   2977  C  CG  . PRO A 1 405 ? 22.880  -25.381 20.710  1.00 39.14  ? 451  PRO A CG  1 
ATOM   2978  C  CD  . PRO A 1 405 ? 23.651  -24.148 20.400  1.00 39.49  ? 451  PRO A CD  1 
ATOM   2979  N  N   . THR A 1 406 ? 22.845  -22.445 23.718  1.00 39.76  ? 452  THR A N   1 
ATOM   2980  C  CA  . THR A 1 406 ? 22.888  -21.688 24.960  1.00 39.78  ? 452  THR A CA  1 
ATOM   2981  C  C   . THR A 1 406 ? 22.043  -20.407 24.885  1.00 40.09  ? 452  THR A C   1 
ATOM   2982  O  O   . THR A 1 406 ? 21.211  -20.169 25.772  1.00 40.11  ? 452  THR A O   1 
ATOM   2983  C  CB  . THR A 1 406 ? 24.324  -21.349 25.345  1.00 39.73  ? 452  THR A CB  1 
ATOM   2984  O  OG1 . THR A 1 406 ? 25.151  -22.500 25.139  1.00 40.84  ? 452  THR A OG1 1 
ATOM   2985  C  CG2 . THR A 1 406 ? 24.402  -20.902 26.804  1.00 39.13  ? 452  THR A CG2 1 
ATOM   2986  N  N   . GLU A 1 407 ? 22.252  -19.590 23.850  1.00 39.95  ? 453  GLU A N   1 
ATOM   2987  C  CA  . GLU A 1 407 ? 21.434  -18.387 23.672  1.00 40.37  ? 453  GLU A CA  1 
ATOM   2988  C  C   . GLU A 1 407 ? 19.960  -18.754 23.615  1.00 39.85  ? 453  GLU A C   1 
ATOM   2989  O  O   . GLU A 1 407 ? 19.133  -18.157 24.317  1.00 40.41  ? 453  GLU A O   1 
ATOM   2990  C  CB  . GLU A 1 407 ? 21.804  -17.606 22.403  1.00 40.70  ? 453  GLU A CB  1 
ATOM   2991  C  CG  . GLU A 1 407 ? 22.886  -16.561 22.606  1.00 43.79  ? 453  GLU A CG  1 
ATOM   2992  C  CD  . GLU A 1 407 ? 22.558  -15.227 21.960  1.00 47.49  ? 453  GLU A CD  1 
ATOM   2993  O  OE1 . GLU A 1 407 ? 21.547  -14.587 22.342  1.00 47.54  ? 453  GLU A OE1 1 
ATOM   2994  O  OE2 . GLU A 1 407 ? 23.323  -14.809 21.069  1.00 50.50  ? 453  GLU A OE2 1 
ATOM   2995  N  N   . VAL A 1 408 ? 19.659  -19.745 22.772  1.00 38.54  ? 454  VAL A N   1 
ATOM   2996  C  CA  . VAL A 1 408 ? 18.317  -20.197 22.503  1.00 36.99  ? 454  VAL A CA  1 
ATOM   2997  C  C   . VAL A 1 408 ? 17.613  -20.601 23.787  1.00 36.39  ? 454  VAL A C   1 
ATOM   2998  O  O   . VAL A 1 408 ? 16.434  -20.328 23.946  1.00 36.02  ? 454  VAL A O   1 
ATOM   2999  C  CB  . VAL A 1 408 ? 18.327  -21.367 21.506  1.00 36.90  ? 454  VAL A CB  1 
ATOM   3000  C  CG1 . VAL A 1 408 ? 16.913  -21.645 20.986  1.00 36.32  ? 454  VAL A CG1 1 
ATOM   3001  C  CG2 . VAL A 1 408 ? 19.247  -21.046 20.341  1.00 36.75  ? 454  VAL A CG2 1 
ATOM   3002  N  N   . THR A 1 409 ? 18.335  -21.248 24.700  1.00 35.62  ? 455  THR A N   1 
ATOM   3003  C  CA  . THR A 1 409 ? 17.754  -21.676 25.958  1.00 34.91  ? 455  THR A CA  1 
ATOM   3004  C  C   . THR A 1 409 ? 17.533  -20.468 26.845  1.00 34.59  ? 455  THR A C   1 
ATOM   3005  O  O   . THR A 1 409 ? 16.520  -20.366 27.520  1.00 34.67  ? 455  THR A O   1 
ATOM   3006  C  CB  . THR A 1 409 ? 18.664  -22.669 26.674  1.00 35.09  ? 455  THR A CB  1 
ATOM   3007  O  OG1 . THR A 1 409 ? 19.100  -23.666 25.748  1.00 35.27  ? 455  THR A OG1 1 
ATOM   3008  C  CG2 . THR A 1 409 ? 17.927  -23.358 27.825  1.00 35.24  ? 455  THR A CG2 1 
ATOM   3009  N  N   . ALA A 1 410 ? 18.492  -19.555 26.835  1.00 34.46  ? 456  ALA A N   1 
ATOM   3010  C  CA  . ALA A 1 410 ? 18.437  -18.349 27.624  1.00 34.22  ? 456  ALA A CA  1 
ATOM   3011  C  C   . ALA A 1 410 ? 17.153  -17.587 27.340  1.00 34.37  ? 456  ALA A C   1 
ATOM   3012  O  O   . ALA A 1 410 ? 16.314  -17.397 28.221  1.00 34.39  ? 456  ALA A O   1 
ATOM   3013  C  CB  . ALA A 1 410 ? 19.616  -17.507 27.297  1.00 34.72  ? 456  ALA A CB  1 
ATOM   3014  N  N   . ILE A 1 411 ? 16.985  -17.162 26.098  1.00 34.25  ? 457  ILE A N   1 
ATOM   3015  C  CA  . ILE A 1 411 ? 15.817  -16.384 25.758  1.00 34.26  ? 457  ILE A CA  1 
ATOM   3016  C  C   . ILE A 1 411 ? 14.512  -17.126 26.103  1.00 34.13  ? 457  ILE A C   1 
ATOM   3017  O  O   . ILE A 1 411 ? 13.542  -16.518 26.583  1.00 34.34  ? 457  ILE A O   1 
ATOM   3018  C  CB  . ILE A 1 411 ? 15.849  -15.897 24.298  1.00 34.18  ? 457  ILE A CB  1 
ATOM   3019  C  CG1 . ILE A 1 411 ? 14.785  -14.798 24.089  1.00 35.24  ? 457  ILE A CG1 1 
ATOM   3020  C  CG2 . ILE A 1 411 ? 15.724  -17.033 23.350  1.00 33.11  ? 457  ILE A CG2 1 
ATOM   3021  C  CD1 . ILE A 1 411 ? 14.639  -14.299 22.646  1.00 35.13  ? 457  ILE A CD1 1 
ATOM   3022  N  N   . GLY A 1 412 ? 14.504  -18.431 25.882  1.00 33.43  ? 458  GLY A N   1 
ATOM   3023  C  CA  . GLY A 1 412 ? 13.362  -19.238 26.232  1.00 33.26  ? 458  GLY A CA  1 
ATOM   3024  C  C   . GLY A 1 412 ? 13.103  -19.124 27.719  1.00 33.46  ? 458  GLY A C   1 
ATOM   3025  O  O   . GLY A 1 412 ? 11.961  -18.936 28.151  1.00 33.22  ? 458  GLY A O   1 
ATOM   3026  N  N   . ALA A 1 413 ? 14.181  -19.222 28.498  1.00 33.26  ? 459  ALA A N   1 
ATOM   3027  C  CA  . ALA A 1 413 ? 14.093  -19.223 29.949  1.00 33.38  ? 459  ALA A CA  1 
ATOM   3028  C  C   . ALA A 1 413 ? 13.583  -17.870 30.434  1.00 33.33  ? 459  ALA A C   1 
ATOM   3029  O  O   . ALA A 1 413 ? 12.672  -17.788 31.241  1.00 32.99  ? 459  ALA A O   1 
ATOM   3030  C  CB  . ALA A 1 413 ? 15.454  -19.554 30.560  1.00 33.16  ? 459  ALA A CB  1 
ATOM   3031  N  N   . VAL A 1 414 ? 14.167  -16.813 29.896  1.00 33.75  ? 460  VAL A N   1 
ATOM   3032  C  CA  . VAL A 1 414 ? 13.721  -15.477 30.209  1.00 34.21  ? 460  VAL A CA  1 
ATOM   3033  C  C   . VAL A 1 414 ? 12.230  -15.341 29.904  1.00 34.57  ? 460  VAL A C   1 
ATOM   3034  O  O   . VAL A 1 414 ? 11.473  -14.814 30.717  1.00 34.79  ? 460  VAL A O   1 
ATOM   3035  C  CB  . VAL A 1 414 ? 14.567  -14.428 29.458  1.00 33.97  ? 460  VAL A CB  1 
ATOM   3036  C  CG1 . VAL A 1 414 ? 13.992  -13.041 29.616  1.00 34.52  ? 460  VAL A CG1 1 
ATOM   3037  C  CG2 . VAL A 1 414 ? 15.962  -14.431 29.995  1.00 33.71  ? 460  VAL A CG2 1 
ATOM   3038  N  N   . GLU A 1 415 ? 11.812  -15.844 28.751  1.00 34.75  ? 461  GLU A N   1 
ATOM   3039  C  CA  . GLU A 1 415 ? 10.425  -15.741 28.359  1.00 35.10  ? 461  GLU A CA  1 
ATOM   3040  C  C   . GLU A 1 415 ? 9.508   -16.492 29.341  1.00 34.84  ? 461  GLU A C   1 
ATOM   3041  O  O   . GLU A 1 415 ? 8.483   -15.964 29.776  1.00 34.85  ? 461  GLU A O   1 
ATOM   3042  C  CB  . GLU A 1 415 ? 10.247  -16.245 26.926  1.00 35.30  ? 461  GLU A CB  1 
ATOM   3043  C  CG  . GLU A 1 415 ? 8.799   -16.348 26.473  1.00 37.69  ? 461  GLU A CG  1 
ATOM   3044  C  CD  . GLU A 1 415 ? 8.175   -15.009 26.191  1.00 41.59  ? 461  GLU A CD  1 
ATOM   3045  O  OE1 . GLU A 1 415 ? 8.715   -14.295 25.314  1.00 42.00  ? 461  GLU A OE1 1 
ATOM   3046  O  OE2 . GLU A 1 415 ? 7.150   -14.688 26.847  1.00 43.34  ? 461  GLU A OE2 1 
ATOM   3047  N  N   . ALA A 1 416 ? 9.886   -17.723 29.680  1.00 34.65  ? 462  ALA A N   1 
ATOM   3048  C  CA  . ALA A 1 416 ? 9.126   -18.539 30.622  1.00 34.09  ? 462  ALA A CA  1 
ATOM   3049  C  C   . ALA A 1 416 ? 9.001   -17.800 31.954  1.00 34.54  ? 462  ALA A C   1 
ATOM   3050  O  O   . ALA A 1 416 ? 7.898   -17.777 32.555  1.00 34.40  ? 462  ALA A O   1 
ATOM   3051  C  CB  . ALA A 1 416 ? 9.782   -19.866 30.815  1.00 33.69  ? 462  ALA A CB  1 
ATOM   3052  N  N   . ALA A 1 417 ? 10.117  -17.179 32.382  1.00 34.35  ? 463  ALA A N   1 
ATOM   3053  C  CA  . ALA A 1 417 ? 10.196  -16.463 33.647  1.00 34.34  ? 463  ALA A CA  1 
ATOM   3054  C  C   . ALA A 1 417 ? 9.168   -15.349 33.661  1.00 34.76  ? 463  ALA A C   1 
ATOM   3055  O  O   . ALA A 1 417 ? 8.363   -15.235 34.592  1.00 35.04  ? 463  ALA A O   1 
ATOM   3056  C  CB  . ALA A 1 417 ? 11.592  -15.909 33.876  1.00 33.92  ? 463  ALA A CB  1 
ATOM   3057  N  N   . PHE A 1 418 ? 9.165   -14.550 32.607  1.00 34.84  ? 464  PHE A N   1 
ATOM   3058  C  CA  . PHE A 1 418 ? 8.190   -13.475 32.510  1.00 35.04  ? 464  PHE A CA  1 
ATOM   3059  C  C   . PHE A 1 418 ? 6.757   -13.970 32.645  1.00 35.65  ? 464  PHE A C   1 
ATOM   3060  O  O   . PHE A 1 418 ? 5.949   -13.323 33.314  1.00 36.17  ? 464  PHE A O   1 
ATOM   3061  C  CB  . PHE A 1 418 ? 8.354   -12.676 31.219  1.00 34.50  ? 464  PHE A CB  1 
ATOM   3062  C  CG  . PHE A 1 418 ? 9.390   -11.600 31.317  1.00 34.89  ? 464  PHE A CG  1 
ATOM   3063  C  CD1 . PHE A 1 418 ? 10.559  -11.650 30.533  1.00 35.75  ? 464  PHE A CD1 1 
ATOM   3064  C  CD2 . PHE A 1 418 ? 9.228   -10.549 32.214  1.00 32.57  ? 464  PHE A CD2 1 
ATOM   3065  C  CE1 . PHE A 1 418 ? 11.531  -10.654 30.631  1.00 36.16  ? 464  PHE A CE1 1 
ATOM   3066  C  CE2 . PHE A 1 418 ? 10.186  -9.560  32.313  1.00 33.17  ? 464  PHE A CE2 1 
ATOM   3067  C  CZ  . PHE A 1 418 ? 11.341  -9.602  31.517  1.00 34.26  ? 464  PHE A CZ  1 
ATOM   3068  N  N   . LYS A 1 419 ? 6.450   -15.110 32.037  1.00 35.73  ? 465  LYS A N   1 
ATOM   3069  C  CA  . LYS A 1 419 ? 5.088   -15.557 31.952  1.00 36.39  ? 465  LYS A CA  1 
ATOM   3070  C  C   . LYS A 1 419 ? 4.496   -15.971 33.307  1.00 37.38  ? 465  LYS A C   1 
ATOM   3071  O  O   . LYS A 1 419 ? 3.271   -15.972 33.481  1.00 37.46  ? 465  LYS A O   1 
ATOM   3072  C  CB  . LYS A 1 419 ? 4.987   -16.692 30.926  1.00 36.25  ? 465  LYS A CB  1 
ATOM   3073  C  CG  . LYS A 1 419 ? 3.593   -17.288 30.727  1.00 35.62  ? 465  LYS A CG  1 
ATOM   3074  C  CD  . LYS A 1 419 ? 2.642   -16.345 29.984  1.00 35.29  ? 465  LYS A CD  1 
ATOM   3075  C  CE  . LYS A 1 419 ? 1.306   -17.035 29.702  1.00 35.55  ? 465  LYS A CE  1 
ATOM   3076  N  NZ  . LYS A 1 419 ? 0.314   -16.114 29.073  1.00 36.40  ? 465  LYS A NZ  1 
ATOM   3077  N  N   . CYS A 1 420 ? 5.347   -16.333 34.266  1.00 38.24  ? 466  CYS A N   1 
ATOM   3078  C  CA  . CYS A 1 420 ? 4.840   -16.814 35.556  1.00 38.81  ? 466  CYS A CA  1 
ATOM   3079  C  C   . CYS A 1 420 ? 5.402   -15.993 36.706  1.00 39.52  ? 466  CYS A C   1 
ATOM   3080  O  O   . CYS A 1 420 ? 5.346   -16.410 37.860  1.00 39.96  ? 466  CYS A O   1 
ATOM   3081  C  CB  . CYS A 1 420 ? 5.170   -18.284 35.745  1.00 38.10  ? 466  CYS A CB  1 
ATOM   3082  S  SG  . CYS A 1 420 ? 6.916   -18.554 35.729  1.00 40.21  ? 466  CYS A SG  1 
ATOM   3083  N  N   . CYS A 1 421 ? 5.943   -14.818 36.395  1.00 40.44  ? 467  CYS A N   1 
ATOM   3084  C  CA  . CYS A 1 421 ? 6.612   -13.990 37.406  1.00 41.96  ? 467  CYS A CA  1 
ATOM   3085  C  C   . CYS A 1 421 ? 7.501   -14.871 38.258  1.00 41.04  ? 467  CYS A C   1 
ATOM   3086  O  O   . CYS A 1 421 ? 7.344   -14.901 39.485  1.00 41.42  ? 467  CYS A O   1 
ATOM   3087  C  CB  . CYS A 1 421 ? 5.587   -13.312 38.328  1.00 42.50  ? 467  CYS A CB  1 
ATOM   3088  S  SG  . CYS A 1 421 ? 4.389   -12.221 37.478  1.00 49.71  ? 467  CYS A SG  1 
ATOM   3089  N  N   . ALA A 1 422 ? 8.384   -15.623 37.612  1.00 40.25  ? 468  ALA A N   1 
ATOM   3090  C  CA  . ALA A 1 422 ? 9.310   -16.469 38.329  1.00 39.51  ? 468  ALA A CA  1 
ATOM   3091  C  C   . ALA A 1 422 ? 10.063  -15.587 39.310  1.00 39.12  ? 468  ALA A C   1 
ATOM   3092  O  O   . ALA A 1 422 ? 10.357  -14.429 39.013  1.00 38.82  ? 468  ALA A O   1 
ATOM   3093  C  CB  . ALA A 1 422 ? 10.271  -17.160 37.365  1.00 39.26  ? 468  ALA A CB  1 
ATOM   3094  N  N   . ALA A 1 423 ? 10.321  -16.113 40.501  1.00 38.75  ? 469  ALA A N   1 
ATOM   3095  C  CA  . ALA A 1 423 ? 11.190  -15.417 41.438  1.00 38.27  ? 469  ALA A CA  1 
ATOM   3096  C  C   . ALA A 1 423 ? 12.636  -15.459 40.939  1.00 37.73  ? 469  ALA A C   1 
ATOM   3097  O  O   . ALA A 1 423 ? 13.395  -14.520 41.167  1.00 37.97  ? 469  ALA A O   1 
ATOM   3098  C  CB  . ALA A 1 423 ? 11.090  -16.032 42.803  1.00 38.33  ? 469  ALA A CB  1 
ATOM   3099  N  N   . ALA A 1 424 ? 13.016  -16.542 40.258  1.00 36.86  ? 470  ALA A N   1 
ATOM   3100  C  CA  . ALA A 1 424 ? 14.391  -16.694 39.817  1.00 36.24  ? 470  ALA A CA  1 
ATOM   3101  C  C   . ALA A 1 424 ? 14.602  -17.648 38.652  1.00 35.86  ? 470  ALA A C   1 
ATOM   3102  O  O   . ALA A 1 424 ? 13.784  -18.521 38.377  1.00 36.17  ? 470  ALA A O   1 
ATOM   3103  C  CB  . ALA A 1 424 ? 15.257  -17.116 40.981  1.00 36.21  ? 470  ALA A CB  1 
ATOM   3104  N  N   . ILE A 1 425 ? 15.719  -17.457 37.960  1.00 35.29  ? 471  ILE A N   1 
ATOM   3105  C  CA  . ILE A 1 425 ? 16.214  -18.421 36.981  1.00 34.65  ? 471  ILE A CA  1 
ATOM   3106  C  C   . ILE A 1 425 ? 17.492  -18.901 37.603  1.00 34.90  ? 471  ILE A C   1 
ATOM   3107  O  O   . ILE A 1 425 ? 18.360  -18.076 37.918  1.00 35.35  ? 471  ILE A O   1 
ATOM   3108  C  CB  . ILE A 1 425 ? 16.569  -17.771 35.638  1.00 34.08  ? 471  ILE A CB  1 
ATOM   3109  C  CG1 . ILE A 1 425 ? 15.358  -17.083 35.038  1.00 33.10  ? 471  ILE A CG1 1 
ATOM   3110  C  CG2 . ILE A 1 425 ? 17.101  -18.785 34.674  1.00 33.26  ? 471  ILE A CG2 1 
ATOM   3111  C  CD1 . ILE A 1 425 ? 15.731  -16.070 34.008  1.00 30.85  ? 471  ILE A CD1 1 
ATOM   3112  N  N   . ILE A 1 426 ? 17.588  -20.216 37.803  1.00 34.52  ? 472  ILE A N   1 
ATOM   3113  C  CA  . ILE A 1 426 ? 18.760  -20.870 38.404  1.00 34.35  ? 472  ILE A CA  1 
ATOM   3114  C  C   . ILE A 1 426 ? 19.549  -21.538 37.288  1.00 34.68  ? 472  ILE A C   1 
ATOM   3115  O  O   . ILE A 1 426 ? 18.998  -22.367 36.573  1.00 34.68  ? 472  ILE A O   1 
ATOM   3116  C  CB  . ILE A 1 426 ? 18.340  -21.965 39.430  1.00 34.02  ? 472  ILE A CB  1 
ATOM   3117  C  CG1 . ILE A 1 426 ? 17.663  -21.349 40.660  1.00 33.48  ? 472  ILE A CG1 1 
ATOM   3118  C  CG2 . ILE A 1 426 ? 19.528  -22.784 39.845  1.00 33.28  ? 472  ILE A CG2 1 
ATOM   3119  C  CD1 . ILE A 1 426 ? 17.049  -22.371 41.596  1.00 32.11  ? 472  ILE A CD1 1 
ATOM   3120  N  N   . VAL A 1 427 ? 20.824  -21.187 37.140  1.00 34.79  ? 473  VAL A N   1 
ATOM   3121  C  CA  . VAL A 1 427 ? 21.659  -21.749 36.080  1.00 35.35  ? 473  VAL A CA  1 
ATOM   3122  C  C   . VAL A 1 427 ? 22.917  -22.355 36.627  1.00 35.77  ? 473  VAL A C   1 
ATOM   3123  O  O   . VAL A 1 427 ? 23.665  -21.694 37.359  1.00 36.45  ? 473  VAL A O   1 
ATOM   3124  C  CB  . VAL A 1 427 ? 22.291  -20.683 35.171  1.00 35.35  ? 473  VAL A CB  1 
ATOM   3125  C  CG1 . VAL A 1 427 ? 22.177  -21.078 33.725  1.00 34.78  ? 473  VAL A CG1 1 
ATOM   3126  C  CG2 . VAL A 1 427 ? 21.732  -19.334 35.440  1.00 35.79  ? 473  VAL A CG2 1 
ATOM   3127  N  N   . LEU A 1 428 ? 23.209  -23.577 36.203  1.00 35.71  ? 474  LEU A N   1 
ATOM   3128  C  CA  . LEU A 1 428 ? 24.547  -24.124 36.373  1.00 35.49  ? 474  LEU A CA  1 
ATOM   3129  C  C   . LEU A 1 428 ? 25.452  -23.491 35.316  1.00 35.73  ? 474  LEU A C   1 
ATOM   3130  O  O   . LEU A 1 428 ? 25.094  -23.409 34.145  1.00 35.70  ? 474  LEU A O   1 
ATOM   3131  C  CB  . LEU A 1 428 ? 24.516  -25.650 36.229  1.00 35.08  ? 474  LEU A CB  1 
ATOM   3132  C  CG  . LEU A 1 428 ? 24.065  -26.475 37.441  1.00 34.81  ? 474  LEU A CG  1 
ATOM   3133  C  CD1 . LEU A 1 428 ? 22.882  -25.858 38.165  1.00 35.44  ? 474  LEU A CD1 1 
ATOM   3134  C  CD2 . LEU A 1 428 ? 23.739  -27.864 37.031  1.00 34.57  ? 474  LEU A CD2 1 
ATOM   3135  N  N   . THR A 1 429 ? 26.623  -23.034 35.723  1.00 36.12  ? 475  THR A N   1 
ATOM   3136  C  CA  . THR A 1 429 ? 27.564  -22.465 34.768  1.00 36.30  ? 475  THR A CA  1 
ATOM   3137  C  C   . THR A 1 429 ? 29.003  -22.653 35.211  1.00 36.53  ? 475  THR A C   1 
ATOM   3138  O  O   . THR A 1 429 ? 29.307  -22.579 36.394  1.00 36.07  ? 475  THR A O   1 
ATOM   3139  C  CB  . THR A 1 429 ? 27.279  -20.982 34.480  1.00 36.33  ? 475  THR A CB  1 
ATOM   3140  O  OG1 . THR A 1 429 ? 28.306  -20.466 33.637  1.00 36.42  ? 475  THR A OG1 1 
ATOM   3141  C  CG2 . THR A 1 429 ? 27.230  -20.158 35.759  1.00 36.03  ? 475  THR A CG2 1 
ATOM   3142  N  N   . THR A 1 430 ? 29.876  -22.880 34.237  1.00 37.22  ? 476  THR A N   1 
ATOM   3143  C  CA  . THR A 1 430 ? 31.277  -23.198 34.487  1.00 38.24  ? 476  THR A CA  1 
ATOM   3144  C  C   . THR A 1 430 ? 32.187  -21.996 34.291  1.00 38.83  ? 476  THR A C   1 
ATOM   3145  O  O   . THR A 1 430 ? 33.150  -21.792 35.051  1.00 39.80  ? 476  THR A O   1 
ATOM   3146  C  CB  . THR A 1 430 ? 31.732  -24.382 33.584  1.00 38.51  ? 476  THR A CB  1 
ATOM   3147  O  OG1 . THR A 1 430 ? 31.067  -25.579 34.008  1.00 38.64  ? 476  THR A OG1 1 
ATOM   3148  C  CG2 . THR A 1 430 ? 33.250  -24.594 33.630  1.00 37.15  ? 476  THR A CG2 1 
ATOM   3149  N  N   . THR A 1 431 ? 31.874  -21.204 33.276  1.00 39.02  ? 477  THR A N   1 
ATOM   3150  C  CA  . THR A 1 431 ? 32.650  -20.016 32.934  1.00 39.20  ? 477  THR A CA  1 
ATOM   3151  C  C   . THR A 1 431 ? 31.848  -18.732 33.072  1.00 39.70  ? 477  THR A C   1 
ATOM   3152  O  O   . THR A 1 431 ? 32.384  -17.655 32.802  1.00 40.20  ? 477  THR A O   1 
ATOM   3153  C  CB  . THR A 1 431 ? 33.115  -20.058 31.474  1.00 39.32  ? 477  THR A CB  1 
ATOM   3154  O  OG1 . THR A 1 431 ? 31.976  -19.895 30.607  1.00 38.64  ? 477  THR A OG1 1 
ATOM   3155  C  CG2 . THR A 1 431 ? 33.855  -21.366 31.160  1.00 38.63  ? 477  THR A CG2 1 
ATOM   3156  N  N   . GLY A 1 432 ? 30.567  -18.850 33.447  1.00 39.61  ? 478  GLY A N   1 
ATOM   3157  C  CA  . GLY A 1 432 ? 29.686  -17.705 33.604  1.00 39.08  ? 478  GLY A CA  1 
ATOM   3158  C  C   . GLY A 1 432 ? 28.901  -17.433 32.342  1.00 39.58  ? 478  GLY A C   1 
ATOM   3159  O  O   . GLY A 1 432 ? 27.841  -16.788 32.396  1.00 39.67  ? 478  GLY A O   1 
ATOM   3160  N  N   . ARG A 1 433 ? 29.386  -17.939 31.200  1.00 39.51  ? 479  ARG A N   1 
ATOM   3161  C  CA  . ARG A 1 433 ? 28.738  -17.624 29.921  1.00 39.23  ? 479  ARG A CA  1 
ATOM   3162  C  C   . ARG A 1 433 ? 27.209  -17.820 29.889  1.00 38.79  ? 479  ARG A C   1 
ATOM   3163  O  O   . ARG A 1 433 ? 26.494  -16.947 29.417  1.00 38.75  ? 479  ARG A O   1 
ATOM   3164  C  CB  . ARG A 1 433 ? 29.421  -18.261 28.701  1.00 39.21  ? 479  ARG A CB  1 
ATOM   3165  C  CG  . ARG A 1 433 ? 28.884  -17.638 27.426  1.00 40.23  ? 479  ARG A CG  1 
ATOM   3166  C  CD  . ARG A 1 433 ? 29.644  -17.892 26.128  1.00 44.71  ? 479  ARG A CD  1 
ATOM   3167  N  NE  . ARG A 1 433 ? 29.059  -17.118 25.011  1.00 49.64  ? 479  ARG A NE  1 
ATOM   3168  C  CZ  . ARG A 1 433 ? 28.696  -15.821 25.056  1.00 51.45  ? 479  ARG A CZ  1 
ATOM   3169  N  NH1 . ARG A 1 433 ? 28.876  -15.081 26.155  1.00 52.65  ? 479  ARG A NH1 1 
ATOM   3170  N  NH2 . ARG A 1 433 ? 28.162  -15.246 23.979  1.00 49.26  ? 479  ARG A NH2 1 
ATOM   3171  N  N   . SER A 1 434 ? 26.693  -18.942 30.383  1.00 38.57  ? 480  SER A N   1 
ATOM   3172  C  CA  . SER A 1 434 ? 25.237  -19.108 30.335  1.00 38.43  ? 480  SER A CA  1 
ATOM   3173  C  C   . SER A 1 434 ? 24.489  -18.221 31.305  1.00 38.24  ? 480  SER A C   1 
ATOM   3174  O  O   . SER A 1 434 ? 23.360  -17.827 31.029  1.00 38.43  ? 480  SER A O   1 
ATOM   3175  C  CB  . SER A 1 434 ? 24.740  -20.566 30.377  1.00 38.54  ? 480  SER A CB  1 
ATOM   3176  O  OG  . SER A 1 434 ? 25.682  -21.488 30.885  1.00 38.73  ? 480  SER A OG  1 
ATOM   3177  N  N   . ALA A 1 435 ? 25.116  -17.866 32.414  1.00 38.16  ? 481  ALA A N   1 
ATOM   3178  C  CA  . ALA A 1 435 ? 24.519  -16.842 33.261  1.00 38.48  ? 481  ALA A CA  1 
ATOM   3179  C  C   . ALA A 1 435 ? 24.433  -15.530 32.473  1.00 39.02  ? 481  ALA A C   1 
ATOM   3180  O  O   . ALA A 1 435 ? 23.404  -14.854 32.474  1.00 39.54  ? 481  ALA A O   1 
ATOM   3181  C  CB  . ALA A 1 435 ? 25.309  -16.654 34.534  1.00 38.00  ? 481  ALA A CB  1 
ATOM   3182  N  N   . GLN A 1 436 ? 25.511  -15.185 31.782  1.00 39.21  ? 482  GLN A N   1 
ATOM   3183  C  CA  . GLN A 1 436 ? 25.553  -13.941 31.042  1.00 39.28  ? 482  GLN A CA  1 
ATOM   3184  C  C   . GLN A 1 436 ? 24.478  -13.912 29.978  1.00 39.21  ? 482  GLN A C   1 
ATOM   3185  O  O   . GLN A 1 436 ? 23.752  -12.925 29.862  1.00 40.10  ? 482  GLN A O   1 
ATOM   3186  C  CB  . GLN A 1 436 ? 26.910  -13.760 30.394  1.00 39.72  ? 482  GLN A CB  1 
ATOM   3187  C  CG  . GLN A 1 436 ? 27.031  -12.549 29.509  1.00 41.42  ? 482  GLN A CG  1 
ATOM   3188  C  CD  . GLN A 1 436 ? 28.485  -12.249 29.187  1.00 44.31  ? 482  GLN A CD  1 
ATOM   3189  O  OE1 . GLN A 1 436 ? 29.364  -13.067 29.450  1.00 46.72  ? 482  GLN A OE1 1 
ATOM   3190  N  NE2 . GLN A 1 436 ? 28.745  -11.073 28.625  1.00 43.75  ? 482  GLN A NE2 1 
ATOM   3191  N  N   . LEU A 1 437 ? 24.343  -14.978 29.200  1.00 38.28  ? 483  LEU A N   1 
ATOM   3192  C  CA  . LEU A 1 437 ? 23.354  -14.934 28.136  1.00 37.43  ? 483  LEU A CA  1 
ATOM   3193  C  C   . LEU A 1 437 ? 21.960  -14.705 28.702  1.00 37.34  ? 483  LEU A C   1 
ATOM   3194  O  O   . LEU A 1 437 ? 21.154  -14.068 28.071  1.00 37.94  ? 483  LEU A O   1 
ATOM   3195  C  CB  . LEU A 1 437 ? 23.409  -16.163 27.220  1.00 37.07  ? 483  LEU A CB  1 
ATOM   3196  C  CG  . LEU A 1 437 ? 24.719  -16.396 26.446  1.00 36.50  ? 483  LEU A CG  1 
ATOM   3197  C  CD1 . LEU A 1 437 ? 24.650  -17.657 25.619  1.00 35.09  ? 483  LEU A CD1 1 
ATOM   3198  C  CD2 . LEU A 1 437 ? 25.088  -15.194 25.566  1.00 35.77  ? 483  LEU A CD2 1 
ATOM   3199  N  N   . LEU A 1 438 ? 21.674  -15.201 29.899  1.00 37.20  ? 484  LEU A N   1 
ATOM   3200  C  CA  . LEU A 1 438 ? 20.391  -14.907 30.532  1.00 36.53  ? 484  LEU A CA  1 
ATOM   3201  C  C   . LEU A 1 438 ? 20.285  -13.425 30.833  1.00 36.74  ? 484  LEU A C   1 
ATOM   3202  O  O   . LEU A 1 438 ? 19.323  -12.775 30.427  1.00 36.52  ? 484  LEU A O   1 
ATOM   3203  C  CB  . LEU A 1 438 ? 20.182  -15.731 31.802  1.00 36.19  ? 484  LEU A CB  1 
ATOM   3204  C  CG  . LEU A 1 438 ? 19.840  -17.210 31.611  1.00 35.95  ? 484  LEU A CG  1 
ATOM   3205  C  CD1 . LEU A 1 438 ? 20.181  -17.993 32.839  1.00 32.21  ? 484  LEU A CD1 1 
ATOM   3206  C  CD2 . LEU A 1 438 ? 18.372  -17.403 31.229  1.00 35.44  ? 484  LEU A CD2 1 
ATOM   3207  N  N   . SER A 1 439 ? 21.275  -12.862 31.517  1.00 37.11  ? 485  SER A N   1 
ATOM   3208  C  CA  . SER A 1 439 ? 21.134  -11.459 31.942  1.00 37.81  ? 485  SER A CA  1 
ATOM   3209  C  C   . SER A 1 439 ? 21.067  -10.536 30.734  1.00 38.17  ? 485  SER A C   1 
ATOM   3210  O  O   . SER A 1 439 ? 20.340  -9.560  30.747  1.00 38.14  ? 485  SER A O   1 
ATOM   3211  C  CB  . SER A 1 439 ? 22.225  -11.028 32.928  1.00 37.79  ? 485  SER A CB  1 
ATOM   3212  O  OG  . SER A 1 439 ? 23.299  -10.358 32.297  1.00 37.99  ? 485  SER A OG  1 
ATOM   3213  N  N   . ARG A 1 440 ? 21.828  -10.875 29.695  1.00 38.72  ? 486  ARG A N   1 
ATOM   3214  C  CA  . ARG A 1 440 ? 21.724  -10.269 28.374  1.00 39.06  ? 486  ARG A CA  1 
ATOM   3215  C  C   . ARG A 1 440 ? 20.282  -9.856  27.979  1.00 39.10  ? 486  ARG A C   1 
ATOM   3216  O  O   . ARG A 1 440 ? 20.081  -8.823  27.334  1.00 39.13  ? 486  ARG A O   1 
ATOM   3217  C  CB  . ARG A 1 440 ? 22.226  -11.292 27.373  1.00 39.38  ? 486  ARG A CB  1 
ATOM   3218  C  CG  . ARG A 1 440 ? 22.812  -10.709 26.157  1.00 40.63  ? 486  ARG A CG  1 
ATOM   3219  C  CD  . ARG A 1 440 ? 22.089  -11.226 24.962  1.00 42.21  ? 486  ARG A CD  1 
ATOM   3220  N  NE  . ARG A 1 440 ? 21.524  -10.066 24.303  1.00 46.49  ? 486  ARG A NE  1 
ATOM   3221  C  CZ  . ARG A 1 440 ? 22.015  -9.515  23.201  1.00 47.84  ? 486  ARG A CZ  1 
ATOM   3222  N  NH1 . ARG A 1 440 ? 23.082  -10.048 22.605  1.00 45.12  ? 486  ARG A NH1 1 
ATOM   3223  N  NH2 . ARG A 1 440 ? 21.412  -8.439  22.687  1.00 50.04  ? 486  ARG A NH2 1 
ATOM   3224  N  N   . TYR A 1 441 ? 19.289  -10.671 28.352  1.00 39.20  ? 487  TYR A N   1 
ATOM   3225  C  CA  . TYR A 1 441 ? 17.882  -10.382 28.014  1.00 39.15  ? 487  TYR A CA  1 
ATOM   3226  C  C   . TYR A 1 441 ? 17.151  -9.700  29.155  1.00 39.34  ? 487  TYR A C   1 
ATOM   3227  O  O   . TYR A 1 441 ? 15.946  -9.480  29.081  1.00 39.33  ? 487  TYR A O   1 
ATOM   3228  C  CB  . TYR A 1 441 ? 17.132  -11.634 27.530  1.00 38.79  ? 487  TYR A CB  1 
ATOM   3229  C  CG  . TYR A 1 441 ? 17.628  -12.084 26.177  1.00 39.35  ? 487  TYR A CG  1 
ATOM   3230  C  CD1 . TYR A 1 441 ? 18.416  -13.221 26.039  1.00 38.57  ? 487  TYR A CD1 1 
ATOM   3231  C  CD2 . TYR A 1 441 ? 17.360  -11.334 25.034  1.00 38.87  ? 487  TYR A CD2 1 
ATOM   3232  C  CE1 . TYR A 1 441 ? 18.903  -13.616 24.800  1.00 38.45  ? 487  TYR A CE1 1 
ATOM   3233  C  CE2 . TYR A 1 441 ? 17.843  -11.718 23.792  1.00 38.77  ? 487  TYR A CE2 1 
ATOM   3234  C  CZ  . TYR A 1 441 ? 18.617  -12.863 23.679  1.00 40.01  ? 487  TYR A CZ  1 
ATOM   3235  O  OH  . TYR A 1 441 ? 19.116  -13.257 22.439  1.00 40.97  ? 487  TYR A OH  1 
ATOM   3236  N  N   . ARG A 1 442 ? 17.895  -9.361  30.205  1.00 39.53  ? 488  ARG A N   1 
ATOM   3237  C  CA  . ARG A 1 442 ? 17.355  -8.631  31.343  1.00 39.70  ? 488  ARG A CA  1 
ATOM   3238  C  C   . ARG A 1 442 ? 16.081  -9.254  31.870  1.00 39.51  ? 488  ARG A C   1 
ATOM   3239  O  O   . ARG A 1 442 ? 15.002  -8.654  31.786  1.00 39.72  ? 488  ARG A O   1 
ATOM   3240  C  CB  . ARG A 1 442 ? 17.075  -7.174  30.970  1.00 40.03  ? 488  ARG A CB  1 
ATOM   3241  C  CG  . ARG A 1 442 ? 18.287  -6.344  30.546  1.00 41.62  ? 488  ARG A CG  1 
ATOM   3242  C  CD  . ARG A 1 442 ? 19.311  -6.100  31.634  1.00 43.33  ? 488  ARG A CD  1 
ATOM   3243  N  NE  . ARG A 1 442 ? 20.505  -5.580  30.989  1.00 45.66  ? 488  ARG A NE  1 
ATOM   3244  C  CZ  . ARG A 1 442 ? 21.680  -5.411  31.572  1.00 47.36  ? 488  ARG A CZ  1 
ATOM   3245  N  NH1 . ARG A 1 442 ? 21.842  -5.707  32.835  1.00 50.75  ? 488  ARG A NH1 1 
ATOM   3246  N  NH2 . ARG A 1 442 ? 22.699  -4.923  30.893  1.00 49.66  ? 488  ARG A NH2 1 
ATOM   3247  N  N   . PRO A 1 443 ? 16.192  -10.450 32.444  1.00 39.44  ? 489  PRO A N   1 
ATOM   3248  C  CA  . PRO A 1 443 ? 15.008  -11.005 33.091  1.00 39.68  ? 489  PRO A CA  1 
ATOM   3249  C  C   . PRO A 1 443 ? 14.696  -10.087 34.245  1.00 39.95  ? 489  PRO A C   1 
ATOM   3250  O  O   . PRO A 1 443 ? 15.524  -9.245  34.605  1.00 40.43  ? 489  PRO A O   1 
ATOM   3251  C  CB  . PRO A 1 443 ? 15.500  -12.334 33.663  1.00 39.42  ? 489  PRO A CB  1 
ATOM   3252  C  CG  . PRO A 1 443 ? 16.812  -12.586 33.011  1.00 40.08  ? 489  PRO A CG  1 
ATOM   3253  C  CD  . PRO A 1 443 ? 17.382  -11.291 32.612  1.00 39.35  ? 489  PRO A CD  1 
ATOM   3254  N  N   . ARG A 1 444 ? 13.528  -10.216 34.831  1.00 40.33  ? 490  ARG A N   1 
ATOM   3255  C  CA  . ARG A 1 444 ? 13.299  -9.515  36.078  1.00 40.67  ? 490  ARG A CA  1 
ATOM   3256  C  C   . ARG A 1 444 ? 13.588  -10.481 37.220  1.00 40.87  ? 490  ARG A C   1 
ATOM   3257  O  O   . ARG A 1 444 ? 14.166  -10.103 38.249  1.00 40.77  ? 490  ARG A O   1 
ATOM   3258  C  CB  . ARG A 1 444 ? 11.877  -9.009  36.154  1.00 40.59  ? 490  ARG A CB  1 
ATOM   3259  C  CG  . ARG A 1 444 ? 11.322  -8.955  37.560  1.00 42.52  ? 490  ARG A CG  1 
ATOM   3260  C  CD  . ARG A 1 444 ? 10.120  -8.062  37.560  1.00 47.70  ? 490  ARG A CD  1 
ATOM   3261  N  NE  . ARG A 1 444 ? 10.508  -6.655  37.476  1.00 52.25  ? 490  ARG A NE  1 
ATOM   3262  C  CZ  . ARG A 1 444 ? 9.635   -5.654  37.352  1.00 54.85  ? 490  ARG A CZ  1 
ATOM   3263  N  NH1 . ARG A 1 444 ? 8.328   -5.919  37.289  1.00 55.41  ? 490  ARG A NH1 1 
ATOM   3264  N  NH2 . ARG A 1 444 ? 10.060  -4.391  37.292  1.00 52.74  ? 490  ARG A NH2 1 
ATOM   3265  N  N   . ALA A 1 445 ? 13.171  -11.732 37.034  1.00 40.71  ? 491  ALA A N   1 
ATOM   3266  C  CA  . ALA A 1 445 ? 13.534  -12.766 37.966  1.00 40.34  ? 491  ALA A CA  1 
ATOM   3267  C  C   . ALA A 1 445 ? 15.045  -12.704 38.068  1.00 40.52  ? 491  ALA A C   1 
ATOM   3268  O  O   . ALA A 1 445 ? 15.745  -12.359 37.082  1.00 41.01  ? 491  ALA A O   1 
ATOM   3269  C  CB  . ALA A 1 445 ? 13.072  -14.116 37.460  1.00 40.20  ? 491  ALA A CB  1 
ATOM   3270  N  N   . ALA A 1 446 ? 15.551  -13.002 39.260  1.00 40.50  ? 492  ALA A N   1 
ATOM   3271  C  CA  . ALA A 1 446 ? 16.996  -13.036 39.481  1.00 40.13  ? 492  ALA A CA  1 
ATOM   3272  C  C   . ALA A 1 446 ? 17.619  -14.283 38.875  1.00 39.79  ? 492  ALA A C   1 
ATOM   3273  O  O   . ALA A 1 446 ? 17.027  -15.362 38.919  1.00 39.78  ? 492  ALA A O   1 
ATOM   3274  C  CB  . ALA A 1 446 ? 17.307  -12.946 40.964  1.00 40.17  ? 492  ALA A CB  1 
ATOM   3275  N  N   . VAL A 1 447 ? 18.815  -14.104 38.307  1.00 39.15  ? 493  VAL A N   1 
ATOM   3276  C  CA  . VAL A 1 447 ? 19.643  -15.194 37.758  1.00 38.59  ? 493  VAL A CA  1 
ATOM   3277  C  C   . VAL A 1 447 ? 20.590  -15.745 38.842  1.00 38.75  ? 493  VAL A C   1 
ATOM   3278  O  O   . VAL A 1 447 ? 21.599  -15.140 39.190  1.00 39.78  ? 493  VAL A O   1 
ATOM   3279  C  CB  . VAL A 1 447 ? 20.447  -14.690 36.541  1.00 38.48  ? 493  VAL A CB  1 
ATOM   3280  C  CG1 . VAL A 1 447 ? 21.460  -15.713 36.063  1.00 36.86  ? 493  VAL A CG1 1 
ATOM   3281  C  CG2 . VAL A 1 447 ? 19.491  -14.283 35.426  1.00 38.62  ? 493  VAL A CG2 1 
ATOM   3282  N  N   . ILE A 1 448 ? 20.245  -16.892 39.396  1.00 37.94  ? 494  ILE A N   1 
ATOM   3283  C  CA  . ILE A 1 448 ? 21.050  -17.466 40.447  1.00 36.98  ? 494  ILE A CA  1 
ATOM   3284  C  C   . ILE A 1 448 ? 22.029  -18.442 39.839  1.00 37.06  ? 494  ILE A C   1 
ATOM   3285  O  O   . ILE A 1 448 ? 21.631  -19.503 39.393  1.00 37.34  ? 494  ILE A O   1 
ATOM   3286  C  CB  . ILE A 1 448 ? 20.153  -18.144 41.501  1.00 36.78  ? 494  ILE A CB  1 
ATOM   3287  C  CG1 . ILE A 1 448 ? 19.284  -17.079 42.184  1.00 35.44  ? 494  ILE A CG1 1 
ATOM   3288  C  CG2 . ILE A 1 448 ? 21.014  -18.878 42.513  1.00 35.80  ? 494  ILE A CG2 1 
ATOM   3289  C  CD1 . ILE A 1 448 ? 18.296  -17.610 43.171  1.00 35.40  ? 494  ILE A CD1 1 
ATOM   3290  N  N   . ALA A 1 449 ? 23.303  -18.075 39.808  1.00 37.22  ? 495  ALA A N   1 
ATOM   3291  C  CA  . ALA A 1 449 ? 24.298  -18.855 39.088  1.00 37.29  ? 495  ALA A CA  1 
ATOM   3292  C  C   . ALA A 1 449 ? 25.099  -19.713 40.035  1.00 37.64  ? 495  ALA A C   1 
ATOM   3293  O  O   . ALA A 1 449 ? 25.702  -19.216 40.988  1.00 38.20  ? 495  ALA A O   1 
ATOM   3294  C  CB  . ALA A 1 449 ? 25.209  -17.959 38.286  1.00 37.20  ? 495  ALA A CB  1 
ATOM   3295  N  N   . VAL A 1 450 ? 25.099  -21.011 39.761  1.00 37.56  ? 496  VAL A N   1 
ATOM   3296  C  CA  . VAL A 1 450 ? 25.792  -21.977 40.597  1.00 37.47  ? 496  VAL A CA  1 
ATOM   3297  C  C   . VAL A 1 450 ? 27.028  -22.489 39.864  1.00 37.80  ? 496  VAL A C   1 
ATOM   3298  O  O   . VAL A 1 450 ? 26.954  -22.982 38.736  1.00 37.92  ? 496  VAL A O   1 
ATOM   3299  C  CB  . VAL A 1 450 ? 24.866  -23.156 40.967  1.00 37.55  ? 496  VAL A CB  1 
ATOM   3300  C  CG1 . VAL A 1 450 ? 25.575  -24.106 41.915  1.00 36.63  ? 496  VAL A CG1 1 
ATOM   3301  C  CG2 . VAL A 1 450 ? 23.554  -22.640 41.582  1.00 36.70  ? 496  VAL A CG2 1 
ATOM   3302  N  N   . THR A 1 451 ? 28.173  -22.371 40.511  1.00 37.84  ? 497  THR A N   1 
ATOM   3303  C  CA  . THR A 1 451 ? 29.419  -22.682 39.851  1.00 38.15  ? 497  THR A CA  1 
ATOM   3304  C  C   . THR A 1 451 ? 30.466  -23.197 40.845  1.00 38.90  ? 497  THR A C   1 
ATOM   3305  O  O   . THR A 1 451 ? 30.425  -22.871 42.053  1.00 39.16  ? 497  THR A O   1 
ATOM   3306  C  CB  . THR A 1 451 ? 29.938  -21.459 39.069  1.00 37.72  ? 497  THR A CB  1 
ATOM   3307  O  OG1 . THR A 1 451 ? 30.956  -21.865 38.163  1.00 37.98  ? 497  THR A OG1 1 
ATOM   3308  C  CG2 . THR A 1 451 ? 30.481  -20.391 39.987  1.00 37.56  ? 497  THR A CG2 1 
ATOM   3309  N  N   . ARG A 1 452 ? 31.388  -24.017 40.335  1.00 39.35  ? 498  ARG A N   1 
ATOM   3310  C  CA  . ARG A 1 452 ? 32.529  -24.476 41.127  1.00 39.71  ? 498  ARG A CA  1 
ATOM   3311  C  C   . ARG A 1 452 ? 33.744  -23.580 40.986  1.00 40.32  ? 498  ARG A C   1 
ATOM   3312  O  O   . ARG A 1 452 ? 34.673  -23.669 41.800  1.00 41.14  ? 498  ARG A O   1 
ATOM   3313  C  CB  . ARG A 1 452 ? 32.931  -25.881 40.731  1.00 39.33  ? 498  ARG A CB  1 
ATOM   3314  C  CG  . ARG A 1 452 ? 32.030  -26.925 41.320  1.00 38.66  ? 498  ARG A CG  1 
ATOM   3315  C  CD  . ARG A 1 452 ? 32.692  -28.285 41.353  1.00 36.22  ? 498  ARG A CD  1 
ATOM   3316  N  NE  . ARG A 1 452 ? 31.825  -29.208 42.068  1.00 36.63  ? 498  ARG A NE  1 
ATOM   3317  C  CZ  . ARG A 1 452 ? 30.881  -29.941 41.491  1.00 37.91  ? 498  ARG A CZ  1 
ATOM   3318  N  NH1 . ARG A 1 452 ? 30.686  -29.864 40.180  1.00 39.29  ? 498  ARG A NH1 1 
ATOM   3319  N  NH2 . ARG A 1 452 ? 30.136  -30.753 42.226  1.00 38.20  ? 498  ARG A NH2 1 
ATOM   3320  N  N   . SER A 1 453 ? 33.743  -22.739 39.948  1.00 40.05  ? 499  SER A N   1 
ATOM   3321  C  CA  . SER A 1 453 ? 34.878  -21.875 39.648  1.00 39.44  ? 499  SER A CA  1 
ATOM   3322  C  C   . SER A 1 453 ? 34.762  -20.624 40.497  1.00 39.06  ? 499  SER A C   1 
ATOM   3323  O  O   . SER A 1 453 ? 33.936  -19.758 40.216  1.00 38.82  ? 499  SER A O   1 
ATOM   3324  C  CB  . SER A 1 453 ? 34.919  -21.542 38.150  1.00 39.58  ? 499  SER A CB  1 
ATOM   3325  O  OG  . SER A 1 453 ? 35.713  -20.399 37.877  1.00 39.39  ? 499  SER A OG  1 
ATOM   3326  N  N   . ALA A 1 454 ? 35.589  -20.544 41.541  1.00 38.90  ? 500  ALA A N   1 
ATOM   3327  C  CA  . ALA A 1 454 ? 35.589  -19.394 42.440  1.00 38.73  ? 500  ALA A CA  1 
ATOM   3328  C  C   . ALA A 1 454 ? 35.740  -18.095 41.649  1.00 38.97  ? 500  ALA A C   1 
ATOM   3329  O  O   . ALA A 1 454 ? 35.089  -17.100 41.976  1.00 39.32  ? 500  ALA A O   1 
ATOM   3330  C  CB  . ALA A 1 454 ? 36.664  -19.518 43.473  1.00 37.97  ? 500  ALA A CB  1 
ATOM   3331  N  N   . GLN A 1 455 ? 36.560  -18.130 40.595  1.00 38.92  ? 501  GLN A N   1 
ATOM   3332  C  CA  . GLN A 1 455 ? 36.828  -16.965 39.763  1.00 38.97  ? 501  GLN A CA  1 
ATOM   3333  C  C   . GLN A 1 455 ? 35.623  -16.574 38.932  1.00 39.35  ? 501  GLN A C   1 
ATOM   3334  O  O   . GLN A 1 455 ? 35.210  -15.401 38.945  1.00 39.93  ? 501  GLN A O   1 
ATOM   3335  C  CB  . GLN A 1 455 ? 38.017  -17.234 38.852  1.00 38.99  ? 501  GLN A CB  1 
ATOM   3336  C  CG  . GLN A 1 455 ? 38.207  -16.197 37.774  1.00 39.40  ? 501  GLN A CG  1 
ATOM   3337  C  CD  . GLN A 1 455 ? 39.650  -15.950 37.486  1.00 41.49  ? 501  GLN A CD  1 
ATOM   3338  O  OE1 . GLN A 1 455 ? 40.211  -16.508 36.541  1.00 41.20  ? 501  GLN A OE1 1 
ATOM   3339  N  NE2 . GLN A 1 455 ? 40.284  -15.125 38.320  1.00 41.27  ? 501  GLN A NE2 1 
ATOM   3340  N  N   . ALA A 1 456 ? 35.067  -17.540 38.199  1.00 39.15  ? 502  ALA A N   1 
ATOM   3341  C  CA  . ALA A 1 456 ? 33.846  -17.280 37.453  1.00 39.07  ? 502  ALA A CA  1 
ATOM   3342  C  C   . ALA A 1 456 ? 32.753  -16.700 38.372  1.00 38.87  ? 502  ALA A C   1 
ATOM   3343  O  O   . ALA A 1 456 ? 32.018  -15.809 37.971  1.00 38.83  ? 502  ALA A O   1 
ATOM   3344  C  CB  . ALA A 1 456 ? 33.367  -18.530 36.759  1.00 39.43  ? 502  ALA A CB  1 
ATOM   3345  N  N   . ALA A 1 457 ? 32.681  -17.189 39.609  1.00 38.77  ? 503  ALA A N   1 
ATOM   3346  C  CA  . ALA A 1 457 ? 31.711  -16.692 40.577  1.00 39.05  ? 503  ALA A CA  1 
ATOM   3347  C  C   . ALA A 1 457 ? 31.893  -15.197 40.845  1.00 39.54  ? 503  ALA A C   1 
ATOM   3348  O  O   . ALA A 1 457 ? 30.911  -14.475 41.031  1.00 39.62  ? 503  ALA A O   1 
ATOM   3349  C  CB  . ALA A 1 457 ? 31.817  -17.464 41.846  1.00 39.17  ? 503  ALA A CB  1 
ATOM   3350  N  N   . ARG A 1 458 ? 33.147  -14.741 40.843  1.00 39.56  ? 504  ARG A N   1 
ATOM   3351  C  CA  . ARG A 1 458 ? 33.452  -13.337 41.021  1.00 39.41  ? 504  ARG A CA  1 
ATOM   3352  C  C   . ARG A 1 458 ? 33.161  -12.522 39.743  1.00 39.73  ? 504  ARG A C   1 
ATOM   3353  O  O   . ARG A 1 458 ? 32.476  -11.487 39.808  1.00 39.65  ? 504  ARG A O   1 
ATOM   3354  C  CB  . ARG A 1 458 ? 34.898  -13.132 41.481  1.00 39.43  ? 504  ARG A CB  1 
ATOM   3355  C  CG  . ARG A 1 458 ? 35.257  -13.776 42.831  1.00 38.64  ? 504  ARG A CG  1 
ATOM   3356  C  CD  . ARG A 1 458 ? 36.663  -13.427 43.288  1.00 36.06  ? 504  ARG A CD  1 
ATOM   3357  N  NE  . ARG A 1 458 ? 37.721  -14.092 42.533  1.00 36.48  ? 504  ARG A NE  1 
ATOM   3358  C  CZ  . ARG A 1 458 ? 38.227  -15.299 42.808  1.00 36.68  ? 504  ARG A CZ  1 
ATOM   3359  N  NH1 . ARG A 1 458 ? 39.210  -15.796 42.067  1.00 35.33  ? 504  ARG A NH1 1 
ATOM   3360  N  NH2 . ARG A 1 458 ? 37.757  -16.022 43.812  1.00 35.83  ? 504  ARG A NH2 1 
ATOM   3361  N  N   . GLN A 1 459 ? 33.649  -12.989 38.594  1.00 39.55  ? 505  GLN A N   1 
ATOM   3362  C  CA  . GLN A 1 459 ? 33.542  -12.205 37.359  1.00 39.39  ? 505  GLN A CA  1 
ATOM   3363  C  C   . GLN A 1 459 ? 32.102  -11.958 36.913  1.00 39.59  ? 505  GLN A C   1 
ATOM   3364  O  O   . GLN A 1 459 ? 31.804  -11.009 36.183  1.00 39.75  ? 505  GLN A O   1 
ATOM   3365  C  CB  . GLN A 1 459 ? 34.335  -12.861 36.232  1.00 39.07  ? 505  GLN A CB  1 
ATOM   3366  C  CG  . GLN A 1 459 ? 35.831  -12.890 36.496  1.00 38.67  ? 505  GLN A CG  1 
ATOM   3367  C  CD  . GLN A 1 459 ? 36.572  -13.700 35.455  1.00 39.71  ? 505  GLN A CD  1 
ATOM   3368  O  OE1 . GLN A 1 459 ? 36.099  -14.746 35.031  1.00 39.59  ? 505  GLN A OE1 1 
ATOM   3369  N  NE2 . GLN A 1 459 ? 37.725  -13.215 35.023  1.00 39.94  ? 505  GLN A NE2 1 
ATOM   3370  N  N   . VAL A 1 460 ? 31.210  -12.819 37.367  1.00 39.58  ? 506  VAL A N   1 
ATOM   3371  C  CA  . VAL A 1 460 ? 29.829  -12.754 36.969  1.00 39.35  ? 506  VAL A CA  1 
ATOM   3372  C  C   . VAL A 1 460 ? 29.154  -11.489 37.501  1.00 39.16  ? 506  VAL A C   1 
ATOM   3373  O  O   . VAL A 1 460 ? 28.196  -10.996 36.905  1.00 39.77  ? 506  VAL A O   1 
ATOM   3374  C  CB  . VAL A 1 460 ? 29.097  -14.059 37.322  1.00 39.28  ? 506  VAL A CB  1 
ATOM   3375  C  CG1 . VAL A 1 460 ? 27.694  -13.814 37.769  1.00 40.53  ? 506  VAL A CG1 1 
ATOM   3376  C  CG2 . VAL A 1 460 ? 29.083  -14.929 36.129  1.00 40.21  ? 506  VAL A CG2 1 
ATOM   3377  N  N   . HIS A 1 461 ? 29.664  -10.923 38.586  1.00 39.08  ? 507  HIS A N   1 
ATOM   3378  C  CA  . HIS A 1 461 ? 29.124  -9.648  39.094  1.00 38.80  ? 507  HIS A CA  1 
ATOM   3379  C  C   . HIS A 1 461 ? 29.040  -8.562  38.032  1.00 38.77  ? 507  HIS A C   1 
ATOM   3380  O  O   . HIS A 1 461 ? 28.338  -7.583  38.201  1.00 39.20  ? 507  HIS A O   1 
ATOM   3381  C  CB  . HIS A 1 461 ? 29.957  -9.138  40.262  1.00 38.63  ? 507  HIS A CB  1 
ATOM   3382  C  CG  . HIS A 1 461 ? 29.710  -9.879  41.534  1.00 38.64  ? 507  HIS A CG  1 
ATOM   3383  N  ND1 . HIS A 1 461 ? 28.456  -9.995  42.093  1.00 38.43  ? 507  HIS A ND1 1 
ATOM   3384  C  CD2 . HIS A 1 461 ? 30.558  -10.530 42.364  1.00 37.38  ? 507  HIS A CD2 1 
ATOM   3385  C  CE1 . HIS A 1 461 ? 28.539  -10.698 43.207  1.00 37.88  ? 507  HIS A CE1 1 
ATOM   3386  N  NE2 . HIS A 1 461 ? 29.802  -11.033 43.396  1.00 38.48  ? 507  HIS A NE2 1 
ATOM   3387  N  N   . LEU A 1 462 ? 29.747  -8.752  36.937  1.00 38.53  ? 508  LEU A N   1 
ATOM   3388  C  CA  . LEU A 1 462 ? 29.857  -7.755  35.920  1.00 38.61  ? 508  LEU A CA  1 
ATOM   3389  C  C   . LEU A 1 462 ? 28.584  -7.768  35.104  1.00 39.02  ? 508  LEU A C   1 
ATOM   3390  O  O   . LEU A 1 462 ? 28.340  -6.857  34.315  1.00 39.82  ? 508  LEU A O   1 
ATOM   3391  C  CB  . LEU A 1 462 ? 31.045  -8.115  35.051  1.00 38.51  ? 508  LEU A CB  1 
ATOM   3392  C  CG  . LEU A 1 462 ? 32.216  -7.225  34.675  1.00 38.68  ? 508  LEU A CG  1 
ATOM   3393  C  CD1 . LEU A 1 462 ? 32.610  -6.241  35.730  1.00 37.88  ? 508  LEU A CD1 1 
ATOM   3394  C  CD2 . LEU A 1 462 ? 33.383  -8.170  34.387  1.00 38.28  ? 508  LEU A CD2 1 
ATOM   3395  N  N   . CYS A 1 463 ? 27.746  -8.775  35.294  1.00 38.80  ? 509  CYS A N   1 
ATOM   3396  C  CA  . CYS A 1 463 ? 26.514  -8.873  34.509  1.00 38.83  ? 509  CYS A CA  1 
ATOM   3397  C  C   . CYS A 1 463 ? 25.295  -8.581  35.323  1.00 38.80  ? 509  CYS A C   1 
ATOM   3398  O  O   . CYS A 1 463 ? 25.005  -9.324  36.240  1.00 39.45  ? 509  CYS A O   1 
ATOM   3399  C  CB  . CYS A 1 463 ? 26.384  -10.270 33.965  1.00 38.54  ? 509  CYS A CB  1 
ATOM   3400  S  SG  . CYS A 1 463 ? 27.694  -10.663 32.883  1.00 40.49  ? 509  CYS A SG  1 
ATOM   3401  N  N   . ARG A 1 464 ? 24.543  -7.542  34.973  1.00 38.92  ? 510  ARG A N   1 
ATOM   3402  C  CA  . ARG A 1 464 ? 23.310  -7.241  35.739  1.00 39.25  ? 510  ARG A CA  1 
ATOM   3403  C  C   . ARG A 1 464 ? 22.455  -8.478  36.019  1.00 39.13  ? 510  ARG A C   1 
ATOM   3404  O  O   . ARG A 1 464 ? 22.185  -9.271  35.129  1.00 39.41  ? 510  ARG A O   1 
ATOM   3405  C  CB  . ARG A 1 464 ? 22.433  -6.126  35.137  1.00 38.79  ? 510  ARG A CB  1 
ATOM   3406  C  CG  . ARG A 1 464 ? 21.108  -5.976  35.936  1.00 40.07  ? 510  ARG A CG  1 
ATOM   3407  C  CD  . ARG A 1 464 ? 20.102  -4.907  35.475  1.00 41.86  ? 510  ARG A CD  1 
ATOM   3408  N  NE  . ARG A 1 464 ? 20.691  -3.565  35.415  1.00 41.39  ? 510  ARG A NE  1 
ATOM   3409  C  CZ  . ARG A 1 464 ? 20.090  -2.518  34.862  1.00 41.75  ? 510  ARG A CZ  1 
ATOM   3410  N  NH1 . ARG A 1 464 ? 20.698  -1.343  34.831  1.00 40.93  ? 510  ARG A NH1 1 
ATOM   3411  N  NH2 . ARG A 1 464 ? 18.875  -2.653  34.332  1.00 42.15  ? 510  ARG A NH2 1 
ATOM   3412  N  N   . GLY A 1 465 ? 22.068  -8.630  37.275  1.00 38.96  ? 511  GLY A N   1 
ATOM   3413  C  CA  . GLY A 1 465 ? 21.047  -9.581  37.648  1.00 39.71  ? 511  GLY A CA  1 
ATOM   3414  C  C   . GLY A 1 465 ? 21.528  -10.967 37.972  1.00 40.21  ? 511  GLY A C   1 
ATOM   3415  O  O   . GLY A 1 465 ? 20.710  -11.854 38.246  1.00 40.80  ? 511  GLY A O   1 
ATOM   3416  N  N   . VAL A 1 466 ? 22.844  -11.164 37.934  1.00 40.26  ? 512  VAL A N   1 
ATOM   3417  C  CA  . VAL A 1 466 ? 23.413  -12.464 38.289  1.00 39.87  ? 512  VAL A CA  1 
ATOM   3418  C  C   . VAL A 1 466 ? 23.892  -12.455 39.730  1.00 40.19  ? 512  VAL A C   1 
ATOM   3419  O  O   . VAL A 1 466 ? 24.583  -11.543 40.153  1.00 41.05  ? 512  VAL A O   1 
ATOM   3420  C  CB  . VAL A 1 466 ? 24.572  -12.884 37.393  1.00 39.61  ? 512  VAL A CB  1 
ATOM   3421  C  CG1 . VAL A 1 466 ? 24.975  -14.287 37.738  1.00 39.60  ? 512  VAL A CG1 1 
ATOM   3422  C  CG2 . VAL A 1 466 ? 24.194  -12.800 35.933  1.00 38.42  ? 512  VAL A CG2 1 
ATOM   3423  N  N   . PHE A 1 467 ? 23.494  -13.473 40.474  1.00 40.09  ? 513  PHE A N   1 
ATOM   3424  C  CA  . PHE A 1 467 ? 23.868  -13.633 41.852  1.00 39.93  ? 513  PHE A CA  1 
ATOM   3425  C  C   . PHE A 1 467 ? 24.607  -14.956 41.899  1.00 39.92  ? 513  PHE A C   1 
ATOM   3426  O  O   . PHE A 1 467 ? 23.978  -16.013 41.716  1.00 40.01  ? 513  PHE A O   1 
ATOM   3427  C  CB  . PHE A 1 467 ? 22.605  -13.642 42.714  1.00 39.94  ? 513  PHE A CB  1 
ATOM   3428  C  CG  . PHE A 1 467 ? 21.817  -12.414 42.565  1.00 39.57  ? 513  PHE A CG  1 
ATOM   3429  C  CD1 . PHE A 1 467 ? 20.844  -12.315 41.581  1.00 41.53  ? 513  PHE A CD1 1 
ATOM   3430  C  CD2 . PHE A 1 467 ? 22.112  -11.312 43.346  1.00 39.80  ? 513  PHE A CD2 1 
ATOM   3431  C  CE1 . PHE A 1 467 ? 20.133  -11.129 41.408  1.00 40.64  ? 513  PHE A CE1 1 
ATOM   3432  C  CE2 . PHE A 1 467 ? 21.430  -10.123 43.190  1.00 37.26  ? 513  PHE A CE2 1 
ATOM   3433  C  CZ  . PHE A 1 467 ? 20.421  -10.028 42.232  1.00 40.18  ? 513  PHE A CZ  1 
ATOM   3434  N  N   . PRO A 1 468 ? 25.954  -14.905 42.068  1.00 39.52  ? 514  PRO A N   1 
ATOM   3435  C  CA  . PRO A 1 468 ? 26.751  -16.118 41.980  1.00 39.44  ? 514  PRO A CA  1 
ATOM   3436  C  C   . PRO A 1 468 ? 26.737  -16.868 43.301  1.00 39.70  ? 514  PRO A C   1 
ATOM   3437  O  O   . PRO A 1 468 ? 26.732  -16.231 44.352  1.00 40.30  ? 514  PRO A O   1 
ATOM   3438  C  CB  . PRO A 1 468 ? 28.143  -15.591 41.693  1.00 39.03  ? 514  PRO A CB  1 
ATOM   3439  C  CG  . PRO A 1 468 ? 28.170  -14.296 42.345  1.00 38.67  ? 514  PRO A CG  1 
ATOM   3440  C  CD  . PRO A 1 468 ? 26.800  -13.734 42.326  1.00 39.23  ? 514  PRO A CD  1 
ATOM   3441  N  N   . LEU A 1 469 ? 26.685  -18.196 43.249  1.00 39.32  ? 515  LEU A N   1 
ATOM   3442  C  CA  . LEU A 1 469 ? 26.801  -18.992 44.443  1.00 39.33  ? 515  LEU A CA  1 
ATOM   3443  C  C   . LEU A 1 469 ? 27.930  -19.953 44.198  1.00 39.65  ? 515  LEU A C   1 
ATOM   3444  O  O   . LEU A 1 469 ? 27.921  -20.668 43.202  1.00 40.20  ? 515  LEU A O   1 
ATOM   3445  C  CB  . LEU A 1 469 ? 25.500  -19.738 44.741  1.00 39.12  ? 515  LEU A CB  1 
ATOM   3446  C  CG  . LEU A 1 469 ? 24.269  -18.844 44.894  1.00 38.31  ? 515  LEU A CG  1 
ATOM   3447  C  CD1 . LEU A 1 469 ? 23.129  -19.654 45.424  1.00 37.63  ? 515  LEU A CD1 1 
ATOM   3448  C  CD2 . LEU A 1 469 ? 24.513  -17.637 45.795  1.00 36.29  ? 515  LEU A CD2 1 
ATOM   3449  N  N   . LEU A 1 470 ? 28.922  -19.938 45.081  1.00 39.61  ? 516  LEU A N   1 
ATOM   3450  C  CA  . LEU A 1 470 ? 30.052  -20.822 44.930  1.00 39.66  ? 516  LEU A CA  1 
ATOM   3451  C  C   . LEU A 1 470 ? 29.720  -22.139 45.591  1.00 40.26  ? 516  LEU A C   1 
ATOM   3452  O  O   . LEU A 1 470 ? 29.284  -22.182 46.750  1.00 40.91  ? 516  LEU A O   1 
ATOM   3453  C  CB  . LEU A 1 470 ? 31.333  -20.223 45.515  1.00 39.36  ? 516  LEU A CB  1 
ATOM   3454  C  CG  . LEU A 1 470 ? 32.599  -21.068 45.290  1.00 38.57  ? 516  LEU A CG  1 
ATOM   3455  C  CD1 . LEU A 1 470 ? 32.779  -21.488 43.821  1.00 37.04  ? 516  LEU A CD1 1 
ATOM   3456  C  CD2 . LEU A 1 470 ? 33.800  -20.321 45.762  1.00 37.57  ? 516  LEU A CD2 1 
ATOM   3457  N  N   . TYR A 1 471 ? 29.925  -23.210 44.839  1.00 40.38  ? 517  TYR A N   1 
ATOM   3458  C  CA  . TYR A 1 471 ? 29.591  -24.541 45.286  1.00 40.31  ? 517  TYR A CA  1 
ATOM   3459  C  C   . TYR A 1 471 ? 30.882  -25.285 45.614  1.00 40.95  ? 517  TYR A C   1 
ATOM   3460  O  O   . TYR A 1 471 ? 31.826  -25.284 44.811  1.00 41.11  ? 517  TYR A O   1 
ATOM   3461  C  CB  . TYR A 1 471 ? 28.808  -25.238 44.189  1.00 39.70  ? 517  TYR A CB  1 
ATOM   3462  C  CG  . TYR A 1 471 ? 28.319  -26.610 44.535  1.00 39.09  ? 517  TYR A CG  1 
ATOM   3463  C  CD1 . TYR A 1 471 ? 27.214  -26.793 45.367  1.00 37.72  ? 517  TYR A CD1 1 
ATOM   3464  C  CD2 . TYR A 1 471 ? 28.950  -27.735 44.008  1.00 38.67  ? 517  TYR A CD2 1 
ATOM   3465  C  CE1 . TYR A 1 471 ? 26.753  -28.078 45.669  1.00 37.64  ? 517  TYR A CE1 1 
ATOM   3466  C  CE2 . TYR A 1 471 ? 28.512  -29.023 44.306  1.00 37.20  ? 517  TYR A CE2 1 
ATOM   3467  C  CZ  . TYR A 1 471 ? 27.411  -29.194 45.131  1.00 37.44  ? 517  TYR A CZ  1 
ATOM   3468  O  OH  . TYR A 1 471 ? 26.987  -30.485 45.415  1.00 37.94  ? 517  TYR A OH  1 
ATOM   3469  N  N   . ARG A 1 472 ? 30.912  -25.927 46.785  1.00 41.66  ? 518  ARG A N   1 
ATOM   3470  C  CA  . ARG A 1 472 ? 32.147  -26.471 47.339  1.00 42.26  ? 518  ARG A CA  1 
ATOM   3471  C  C   . ARG A 1 472 ? 32.234  -28.006 47.401  1.00 42.75  ? 518  ARG A C   1 
ATOM   3472  O  O   . ARG A 1 472 ? 33.343  -28.557 47.419  1.00 43.09  ? 518  ARG A O   1 
ATOM   3473  C  CB  . ARG A 1 472 ? 32.399  -25.881 48.733  1.00 42.51  ? 518  ARG A CB  1 
ATOM   3474  C  CG  . ARG A 1 472 ? 32.207  -24.361 48.837  1.00 42.88  ? 518  ARG A CG  1 
ATOM   3475  C  CD  . ARG A 1 472 ? 32.599  -23.779 50.217  1.00 42.91  ? 518  ARG A CD  1 
ATOM   3476  N  NE  . ARG A 1 472 ? 32.399  -22.322 50.232  1.00 43.76  ? 518  ARG A NE  1 
ATOM   3477  C  CZ  . ARG A 1 472 ? 33.354  -21.403 50.078  1.00 44.07  ? 518  ARG A CZ  1 
ATOM   3478  N  NH1 . ARG A 1 472 ? 34.624  -21.748 49.935  1.00 43.68  ? 518  ARG A NH1 1 
ATOM   3479  N  NH2 . ARG A 1 472 ? 33.038  -20.123 50.078  1.00 44.42  ? 518  ARG A NH2 1 
ATOM   3480  N  N   . GLU A 1 473 ? 31.091  -28.695 47.445  1.00 43.13  ? 519  GLU A N   1 
ATOM   3481  C  CA  . GLU A 1 473 ? 31.076  -30.173 47.567  1.00 43.59  ? 519  GLU A CA  1 
ATOM   3482  C  C   . GLU A 1 473 ? 31.835  -30.862 46.427  1.00 43.93  ? 519  GLU A C   1 
ATOM   3483  O  O   . GLU A 1 473 ? 31.860  -30.361 45.300  1.00 44.42  ? 519  GLU A O   1 
ATOM   3484  C  CB  . GLU A 1 473 ? 29.642  -30.742 47.605  1.00 43.39  ? 519  GLU A CB  1 
ATOM   3485  C  CG  . GLU A 1 473 ? 28.640  -29.966 48.458  1.00 44.41  ? 519  GLU A CG  1 
ATOM   3486  C  CD  . GLU A 1 473 ? 28.873  -30.105 49.953  1.00 45.99  ? 519  GLU A CD  1 
ATOM   3487  O  OE1 . GLU A 1 473 ? 29.235  -31.214 50.417  1.00 46.72  ? 519  GLU A OE1 1 
ATOM   3488  O  OE2 . GLU A 1 473 ? 28.671  -29.098 50.664  1.00 46.16  ? 519  GLU A OE2 1 
ATOM   3489  N  N   . PRO A 1 474 ? 32.441  -32.027 46.711  1.00 44.16  ? 520  PRO A N   1 
ATOM   3490  C  CA  . PRO A 1 474 ? 33.080  -32.812 45.651  1.00 44.26  ? 520  PRO A CA  1 
ATOM   3491  C  C   . PRO A 1 474 ? 32.007  -33.424 44.741  1.00 44.25  ? 520  PRO A C   1 
ATOM   3492  O  O   . PRO A 1 474 ? 30.908  -33.710 45.228  1.00 44.44  ? 520  PRO A O   1 
ATOM   3493  C  CB  . PRO A 1 474 ? 33.808  -33.929 46.420  1.00 44.32  ? 520  PRO A CB  1 
ATOM   3494  C  CG  . PRO A 1 474 ? 33.680  -33.587 47.891  1.00 44.47  ? 520  PRO A CG  1 
ATOM   3495  C  CD  . PRO A 1 474 ? 32.524  -32.680 48.033  1.00 44.16  ? 520  PRO A CD  1 
ATOM   3496  N  N   . PRO A 1 475 ? 32.312  -33.622 43.435  1.00 44.08  ? 521  PRO A N   1 
ATOM   3497  C  CA  . PRO A 1 475 ? 31.367  -34.299 42.515  1.00 43.54  ? 521  PRO A CA  1 
ATOM   3498  C  C   . PRO A 1 475 ? 30.821  -35.651 43.041  1.00 43.04  ? 521  PRO A C   1 
ATOM   3499  O  O   . PRO A 1 475 ? 31.555  -36.418 43.676  1.00 42.84  ? 521  PRO A O   1 
ATOM   3500  C  CB  . PRO A 1 475 ? 32.205  -34.540 41.250  1.00 43.45  ? 521  PRO A CB  1 
ATOM   3501  C  CG  . PRO A 1 475 ? 33.316  -33.549 41.314  1.00 43.98  ? 521  PRO A CG  1 
ATOM   3502  C  CD  . PRO A 1 475 ? 33.562  -33.215 42.758  1.00 44.18  ? 521  PRO A CD  1 
ATOM   3503  N  N   . GLU A 1 476 ? 29.539  -35.917 42.787  1.00 42.52  ? 522  GLU A N   1 
ATOM   3504  C  CA  . GLU A 1 476 ? 28.942  -37.226 43.055  1.00 42.17  ? 522  GLU A CA  1 
ATOM   3505  C  C   . GLU A 1 476 ? 29.402  -38.184 41.962  1.00 42.05  ? 522  GLU A C   1 
ATOM   3506  O  O   . GLU A 1 476 ? 29.877  -37.734 40.913  1.00 42.22  ? 522  GLU A O   1 
ATOM   3507  C  CB  . GLU A 1 476 ? 27.412  -37.136 43.029  1.00 42.09  ? 522  GLU A CB  1 
ATOM   3508  C  CG  . GLU A 1 476 ? 26.820  -35.994 43.851  1.00 42.41  ? 522  GLU A CG  1 
ATOM   3509  C  CD  . GLU A 1 476 ? 26.788  -36.299 45.336  1.00 43.83  ? 522  GLU A CD  1 
ATOM   3510  O  OE1 . GLU A 1 476 ? 26.452  -37.451 45.715  1.00 44.79  ? 522  GLU A OE1 1 
ATOM   3511  O  OE2 . GLU A 1 476 ? 27.090  -35.374 46.123  1.00 42.92  ? 522  GLU A OE2 1 
ATOM   3512  N  N   . ALA A 1 477 ? 29.268  -39.493 42.196  1.00 41.55  ? 523  ALA A N   1 
ATOM   3513  C  CA  . ALA A 1 477 ? 29.625  -40.478 41.179  1.00 41.01  ? 523  ALA A CA  1 
ATOM   3514  C  C   . ALA A 1 477 ? 28.714  -40.340 39.940  1.00 40.86  ? 523  ALA A C   1 
ATOM   3515  O  O   . ALA A 1 477 ? 29.198  -40.186 38.811  1.00 40.81  ? 523  ALA A O   1 
ATOM   3516  C  CB  . ALA A 1 477 ? 29.552  -41.869 41.755  1.00 41.15  ? 523  ALA A CB  1 
ATOM   3517  N  N   . ILE A 1 478 ? 27.400  -40.377 40.167  1.00 40.48  ? 524  ILE A N   1 
ATOM   3518  C  CA  . ILE A 1 478 ? 26.407  -40.217 39.104  1.00 40.17  ? 524  ILE A CA  1 
ATOM   3519  C  C   . ILE A 1 478 ? 26.234  -38.728 38.741  1.00 40.07  ? 524  ILE A C   1 
ATOM   3520  O  O   . ILE A 1 478 ? 25.709  -37.934 39.537  1.00 40.08  ? 524  ILE A O   1 
ATOM   3521  C  CB  . ILE A 1 478 ? 25.037  -40.827 39.514  1.00 40.18  ? 524  ILE A CB  1 
ATOM   3522  C  CG1 . ILE A 1 478 ? 25.176  -42.317 39.830  1.00 40.04  ? 524  ILE A CG1 1 
ATOM   3523  C  CG2 . ILE A 1 478 ? 23.976  -40.580 38.425  1.00 40.19  ? 524  ILE A CG2 1 
ATOM   3524  C  CD1 . ILE A 1 478 ? 23.940  -42.935 40.489  1.00 40.66  ? 524  ILE A CD1 1 
ATOM   3525  N  N   . TRP A 1 479 ? 26.670  -38.357 37.537  1.00 39.67  ? 525  TRP A N   1 
ATOM   3526  C  CA  . TRP A 1 479 ? 26.638  -36.957 37.105  1.00 39.13  ? 525  TRP A CA  1 
ATOM   3527  C  C   . TRP A 1 479 ? 25.285  -36.295 37.347  1.00 39.04  ? 525  TRP A C   1 
ATOM   3528  O  O   . TRP A 1 479 ? 25.229  -35.260 37.990  1.00 38.98  ? 525  TRP A O   1 
ATOM   3529  C  CB  . TRP A 1 479 ? 27.055  -36.828 35.641  1.00 38.99  ? 525  TRP A CB  1 
ATOM   3530  C  CG  . TRP A 1 479 ? 27.095  -35.407 35.170  1.00 38.00  ? 525  TRP A CG  1 
ATOM   3531  C  CD1 . TRP A 1 479 ? 27.949  -34.423 35.592  1.00 37.51  ? 525  TRP A CD1 1 
ATOM   3532  C  CD2 . TRP A 1 479 ? 26.253  -34.807 34.178  1.00 37.62  ? 525  TRP A CD2 1 
ATOM   3533  N  NE1 . TRP A 1 479 ? 27.686  -33.242 34.929  1.00 36.60  ? 525  TRP A NE1 1 
ATOM   3534  C  CE2 . TRP A 1 479 ? 26.654  -33.449 34.053  1.00 37.54  ? 525  TRP A CE2 1 
ATOM   3535  C  CE3 . TRP A 1 479 ? 25.197  -35.282 33.382  1.00 37.39  ? 525  TRP A CE3 1 
ATOM   3536  C  CZ2 . TRP A 1 479 ? 26.038  -32.566 33.166  1.00 36.44  ? 525  TRP A CZ2 1 
ATOM   3537  C  CZ3 . TRP A 1 479 ? 24.585  -34.410 32.499  1.00 36.71  ? 525  TRP A CZ3 1 
ATOM   3538  C  CH2 . TRP A 1 479 ? 25.005  -33.059 32.403  1.00 37.18  ? 525  TRP A CH2 1 
ATOM   3539  N  N   . ALA A 1 480 ? 24.212  -36.912 36.846  1.00 38.90  ? 526  ALA A N   1 
ATOM   3540  C  CA  . ALA A 1 480 ? 22.839  -36.453 37.071  1.00 38.86  ? 526  ALA A CA  1 
ATOM   3541  C  C   . ALA A 1 480 ? 22.566  -36.028 38.525  1.00 39.09  ? 526  ALA A C   1 
ATOM   3542  O  O   . ALA A 1 480 ? 21.979  -34.961 38.764  1.00 39.40  ? 526  ALA A O   1 
ATOM   3543  C  CB  . ALA A 1 480 ? 21.841  -37.522 36.618  1.00 38.64  ? 526  ALA A CB  1 
ATOM   3544  N  N   . ASP A 1 481 ? 23.003  -36.847 39.485  1.00 39.06  ? 527  ASP A N   1 
ATOM   3545  C  CA  . ASP A 1 481 ? 22.877  -36.510 40.905  1.00 39.10  ? 527  ASP A CA  1 
ATOM   3546  C  C   . ASP A 1 481 ? 23.659  -35.242 41.240  1.00 39.07  ? 527  ASP A C   1 
ATOM   3547  O  O   . ASP A 1 481 ? 23.176  -34.387 41.987  1.00 39.17  ? 527  ASP A O   1 
ATOM   3548  C  CB  . ASP A 1 481 ? 23.362  -37.656 41.802  1.00 39.28  ? 527  ASP A CB  1 
ATOM   3549  C  CG  . ASP A 1 481 ? 22.455  -38.885 41.751  1.00 39.96  ? 527  ASP A CG  1 
ATOM   3550  O  OD1 . ASP A 1 481 ? 21.258  -38.744 41.403  1.00 38.86  ? 527  ASP A OD1 1 
ATOM   3551  O  OD2 . ASP A 1 481 ? 22.940  -40.001 42.075  1.00 41.70  ? 527  ASP A OD2 1 
ATOM   3552  N  N   . ASP A 1 482 ? 24.865  -35.119 40.690  1.00 38.98  ? 528  ASP A N   1 
ATOM   3553  C  CA  . ASP A 1 482 ? 25.682  -33.933 40.918  1.00 39.01  ? 528  ASP A CA  1 
ATOM   3554  C  C   . ASP A 1 482 ? 24.936  -32.687 40.443  1.00 38.94  ? 528  ASP A C   1 
ATOM   3555  O  O   . ASP A 1 482 ? 24.856  -31.686 41.155  1.00 38.78  ? 528  ASP A O   1 
ATOM   3556  C  CB  . ASP A 1 482 ? 27.027  -34.057 40.204  1.00 39.11  ? 528  ASP A CB  1 
ATOM   3557  C  CG  . ASP A 1 482 ? 28.096  -33.165 40.814  1.00 40.51  ? 528  ASP A CG  1 
ATOM   3558  O  OD1 . ASP A 1 482 ? 28.508  -33.438 41.973  1.00 42.15  ? 528  ASP A OD1 1 
ATOM   3559  O  OD2 . ASP A 1 482 ? 28.522  -32.198 40.131  1.00 41.29  ? 528  ASP A OD2 1 
ATOM   3560  N  N   . VAL A 1 483 ? 24.371  -32.774 39.241  1.00 39.04  ? 529  VAL A N   1 
ATOM   3561  C  CA  . VAL A 1 483 ? 23.511  -31.726 38.703  1.00 38.77  ? 529  VAL A CA  1 
ATOM   3562  C  C   . VAL A 1 483 ? 22.384  -31.367 39.678  1.00 38.88  ? 529  VAL A C   1 
ATOM   3563  O  O   . VAL A 1 483 ? 22.243  -30.195 40.021  1.00 38.82  ? 529  VAL A O   1 
ATOM   3564  C  CB  . VAL A 1 483 ? 22.963  -32.091 37.304  1.00 38.75  ? 529  VAL A CB  1 
ATOM   3565  C  CG1 . VAL A 1 483 ? 21.849  -31.145 36.902  1.00 38.09  ? 529  VAL A CG1 1 
ATOM   3566  C  CG2 . VAL A 1 483 ? 24.077  -32.050 36.278  1.00 37.97  ? 529  VAL A CG2 1 
ATOM   3567  N  N   . ASP A 1 484 ? 21.614  -32.360 40.136  1.00 38.91  ? 530  ASP A N   1 
ATOM   3568  C  CA  . ASP A 1 484 ? 20.484  -32.105 41.050  1.00 39.37  ? 530  ASP A CA  1 
ATOM   3569  C  C   . ASP A 1 484 ? 20.887  -31.449 42.393  1.00 39.48  ? 530  ASP A C   1 
ATOM   3570  O  O   . ASP A 1 484 ? 20.222  -30.501 42.844  1.00 39.37  ? 530  ASP A O   1 
ATOM   3571  C  CB  . ASP A 1 484 ? 19.628  -33.365 41.270  1.00 39.56  ? 530  ASP A CB  1 
ATOM   3572  C  CG  . ASP A 1 484 ? 18.786  -33.754 40.027  1.00 41.02  ? 530  ASP A CG  1 
ATOM   3573  O  OD1 . ASP A 1 484 ? 18.788  -33.026 39.015  1.00 42.95  ? 530  ASP A OD1 1 
ATOM   3574  O  OD2 . ASP A 1 484 ? 18.105  -34.804 40.051  1.00 41.40  ? 530  ASP A OD2 1 
ATOM   3575  N  N   . ARG A 1 485 ? 21.973  -31.923 43.011  1.00 39.55  ? 531  ARG A N   1 
ATOM   3576  C  CA  . ARG A 1 485 ? 22.465  -31.330 44.271  1.00 39.89  ? 531  ARG A CA  1 
ATOM   3577  C  C   . ARG A 1 485 ? 22.789  -29.853 44.085  1.00 39.79  ? 531  ARG A C   1 
ATOM   3578  O  O   . ARG A 1 485 ? 22.497  -29.042 44.965  1.00 40.28  ? 531  ARG A O   1 
ATOM   3579  C  CB  . ARG A 1 485 ? 23.729  -32.031 44.799  1.00 40.18  ? 531  ARG A CB  1 
ATOM   3580  C  CG  . ARG A 1 485 ? 23.655  -33.534 44.892  1.00 41.42  ? 531  ARG A CG  1 
ATOM   3581  C  CD  . ARG A 1 485 ? 23.768  -34.048 46.315  1.00 42.87  ? 531  ARG A CD  1 
ATOM   3582  N  NE  . ARG A 1 485 ? 23.869  -35.512 46.292  1.00 45.06  ? 531  ARG A NE  1 
ATOM   3583  C  CZ  . ARG A 1 485 ? 23.043  -36.361 46.908  1.00 45.63  ? 531  ARG A CZ  1 
ATOM   3584  N  NH1 . ARG A 1 485 ? 22.044  -35.912 47.659  1.00 47.04  ? 531  ARG A NH1 1 
ATOM   3585  N  NH2 . ARG A 1 485 ? 23.234  -37.672 46.790  1.00 44.65  ? 531  ARG A NH2 1 
ATOM   3586  N  N   . ARG A 1 486 ? 23.407  -29.515 42.953  1.00 39.37  ? 532  ARG A N   1 
ATOM   3587  C  CA  . ARG A 1 486 ? 23.722  -28.122 42.617  1.00 38.86  ? 532  ARG A CA  1 
ATOM   3588  C  C   . ARG A 1 486 ? 22.473  -27.255 42.469  1.00 38.62  ? 532  ARG A C   1 
ATOM   3589  O  O   . ARG A 1 486 ? 22.403  -26.166 43.052  1.00 38.58  ? 532  ARG A O   1 
ATOM   3590  C  CB  . ARG A 1 486 ? 24.591  -28.045 41.359  1.00 38.91  ? 532  ARG A CB  1 
ATOM   3591  C  CG  . ARG A 1 486 ? 26.041  -28.387 41.640  1.00 38.22  ? 532  ARG A CG  1 
ATOM   3592  C  CD  . ARG A 1 486 ? 26.915  -28.166 40.443  1.00 37.33  ? 532  ARG A CD  1 
ATOM   3593  N  NE  . ARG A 1 486 ? 26.896  -29.319 39.562  1.00 38.43  ? 532  ARG A NE  1 
ATOM   3594  C  CZ  . ARG A 1 486 ? 27.570  -29.411 38.416  1.00 38.24  ? 532  ARG A CZ  1 
ATOM   3595  N  NH1 . ARG A 1 486 ? 28.337  -28.407 38.006  1.00 37.05  ? 532  ARG A NH1 1 
ATOM   3596  N  NH2 . ARG A 1 486 ? 27.482  -30.521 37.678  1.00 37.65  ? 532  ARG A NH2 1 
ATOM   3597  N  N   . VAL A 1 487 ? 21.496  -27.741 41.701  1.00 38.25  ? 533  VAL A N   1 
ATOM   3598  C  CA  . VAL A 1 487 ? 20.217  -27.050 41.553  1.00 38.15  ? 533  VAL A CA  1 
ATOM   3599  C  C   . VAL A 1 487 ? 19.581  -26.865 42.924  1.00 38.48  ? 533  VAL A C   1 
ATOM   3600  O  O   . VAL A 1 487 ? 19.198  -25.755 43.317  1.00 37.98  ? 533  VAL A O   1 
ATOM   3601  C  CB  . VAL A 1 487 ? 19.259  -27.803 40.611  1.00 37.99  ? 533  VAL A CB  1 
ATOM   3602  C  CG1 . VAL A 1 487 ? 17.874  -27.156 40.621  1.00 37.73  ? 533  VAL A CG1 1 
ATOM   3603  C  CG2 . VAL A 1 487 ? 19.829  -27.831 39.196  1.00 36.98  ? 533  VAL A CG2 1 
ATOM   3604  N  N   . GLN A 1 488 ? 19.501  -27.963 43.663  1.00 39.14  ? 534  GLN A N   1 
ATOM   3605  C  CA  . GLN A 1 488 ? 19.003  -27.912 45.027  1.00 40.09  ? 534  GLN A CA  1 
ATOM   3606  C  C   . GLN A 1 488 ? 19.779  -26.876 45.868  1.00 40.07  ? 534  GLN A C   1 
ATOM   3607  O  O   . GLN A 1 488 ? 19.178  -26.060 46.584  1.00 40.28  ? 534  GLN A O   1 
ATOM   3608  C  CB  . GLN A 1 488 ? 19.006  -29.314 45.649  1.00 40.31  ? 534  GLN A CB  1 
ATOM   3609  C  CG  . GLN A 1 488 ? 17.615  -29.988 45.812  1.00 42.57  ? 534  GLN A CG  1 
ATOM   3610  C  CD  . GLN A 1 488 ? 16.673  -29.909 44.575  1.00 45.25  ? 534  GLN A CD  1 
ATOM   3611  O  OE1 . GLN A 1 488 ? 16.744  -30.723 43.647  1.00 46.14  ? 534  GLN A OE1 1 
ATOM   3612  N  NE2 . GLN A 1 488 ? 15.756  -28.951 44.603  1.00 46.60  ? 534  GLN A NE2 1 
ATOM   3613  N  N   . PHE A 1 489 ? 21.105  -26.879 45.741  1.00 40.02  ? 535  PHE A N   1 
ATOM   3614  C  CA  . PHE A 1 489 ? 21.945  -25.932 46.463  1.00 39.90  ? 535  PHE A CA  1 
ATOM   3615  C  C   . PHE A 1 489 ? 21.483  -24.505 46.195  1.00 40.05  ? 535  PHE A C   1 
ATOM   3616  O  O   . PHE A 1 489 ? 21.336  -23.716 47.148  1.00 39.86  ? 535  PHE A O   1 
ATOM   3617  C  CB  . PHE A 1 489 ? 23.430  -26.110 46.102  1.00 40.00  ? 535  PHE A CB  1 
ATOM   3618  C  CG  . PHE A 1 489 ? 24.354  -25.110 46.772  1.00 40.03  ? 535  PHE A CG  1 
ATOM   3619  C  CD1 . PHE A 1 489 ? 24.573  -25.156 48.144  1.00 40.61  ? 535  PHE A CD1 1 
ATOM   3620  C  CD2 . PHE A 1 489 ? 25.011  -24.138 46.029  1.00 40.04  ? 535  PHE A CD2 1 
ATOM   3621  C  CE1 . PHE A 1 489 ? 25.417  -24.239 48.764  1.00 40.65  ? 535  PHE A CE1 1 
ATOM   3622  C  CE2 . PHE A 1 489 ? 25.868  -23.212 46.644  1.00 39.67  ? 535  PHE A CE2 1 
ATOM   3623  C  CZ  . PHE A 1 489 ? 26.067  -23.259 48.005  1.00 39.57  ? 535  PHE A CZ  1 
ATOM   3624  N  N   . GLY A 1 490 ? 21.242  -24.195 44.909  1.00 40.05  ? 536  GLY A N   1 
ATOM   3625  C  CA  . GLY A 1 490 ? 20.749  -22.880 44.476  1.00 39.85  ? 536  GLY A CA  1 
ATOM   3626  C  C   . GLY A 1 490 ? 19.459  -22.508 45.182  1.00 40.00  ? 536  GLY A C   1 
ATOM   3627  O  O   . GLY A 1 490 ? 19.344  -21.413 45.736  1.00 39.62  ? 536  GLY A O   1 
ATOM   3628  N  N   . ILE A 1 491 ? 18.508  -23.444 45.187  1.00 40.12  ? 537  ILE A N   1 
ATOM   3629  C  CA  . ILE A 1 491 ? 17.205  -23.245 45.825  1.00 40.51  ? 537  ILE A CA  1 
ATOM   3630  C  C   . ILE A 1 491 ? 17.339  -22.892 47.305  1.00 41.01  ? 537  ILE A C   1 
ATOM   3631  O  O   . ILE A 1 491 ? 16.804  -21.889 47.779  1.00 40.64  ? 537  ILE A O   1 
ATOM   3632  C  CB  . ILE A 1 491 ? 16.316  -24.491 45.655  1.00 40.36  ? 537  ILE A CB  1 
ATOM   3633  C  CG1 . ILE A 1 491 ? 15.745  -24.531 44.233  1.00 40.75  ? 537  ILE A CG1 1 
ATOM   3634  C  CG2 . ILE A 1 491 ? 15.184  -24.522 46.700  1.00 40.35  ? 537  ILE A CG2 1 
ATOM   3635  C  CD1 . ILE A 1 491 ? 15.062  -25.848 43.867  1.00 40.76  ? 537  ILE A CD1 1 
ATOM   3636  N  N   . GLU A 1 492 ? 18.064  -23.732 48.026  1.00 41.81  ? 538  GLU A N   1 
ATOM   3637  C  CA  . GLU A 1 492 ? 18.288  -23.527 49.440  1.00 42.71  ? 538  GLU A CA  1 
ATOM   3638  C  C   . GLU A 1 492 ? 18.924  -22.155 49.666  1.00 42.69  ? 538  GLU A C   1 
ATOM   3639  O  O   . GLU A 1 492 ? 18.346  -21.322 50.370  1.00 43.23  ? 538  GLU A O   1 
ATOM   3640  C  CB  . GLU A 1 492 ? 19.167  -24.645 49.978  1.00 43.05  ? 538  GLU A CB  1 
ATOM   3641  C  CG  . GLU A 1 492 ? 18.768  -25.178 51.328  1.00 45.30  ? 538  GLU A CG  1 
ATOM   3642  C  CD  . GLU A 1 492 ? 19.625  -26.382 51.728  1.00 48.62  ? 538  GLU A CD  1 
ATOM   3643  O  OE1 . GLU A 1 492 ? 19.662  -27.368 50.955  1.00 49.30  ? 538  GLU A OE1 1 
ATOM   3644  O  OE2 . GLU A 1 492 ? 20.262  -26.345 52.808  1.00 49.88  ? 538  GLU A OE2 1 
ATOM   3645  N  N   . SER A 1 493 ? 20.076  -21.897 49.050  1.00 42.56  ? 539  SER A N   1 
ATOM   3646  C  CA  . SER A 1 493 ? 20.700  -20.582 49.181  1.00 42.88  ? 539  SER A CA  1 
ATOM   3647  C  C   . SER A 1 493 ? 19.648  -19.534 48.893  1.00 43.12  ? 539  SER A C   1 
ATOM   3648  O  O   . SER A 1 493 ? 19.542  -18.520 49.596  1.00 43.39  ? 539  SER A O   1 
ATOM   3649  C  CB  . SER A 1 493 ? 21.842  -20.403 48.188  1.00 42.63  ? 539  SER A CB  1 
ATOM   3650  O  OG  . SER A 1 493 ? 22.407  -21.653 47.844  1.00 43.55  ? 539  SER A OG  1 
ATOM   3651  N  N   . GLY A 1 494 ? 18.866  -19.801 47.850  1.00 43.35  ? 540  GLY A N   1 
ATOM   3652  C  CA  . GLY A 1 494 ? 17.773  -18.931 47.442  1.00 43.33  ? 540  GLY A CA  1 
ATOM   3653  C  C   . GLY A 1 494 ? 16.829  -18.671 48.593  1.00 43.33  ? 540  GLY A C   1 
ATOM   3654  O  O   . GLY A 1 494 ? 16.642  -17.513 48.965  1.00 43.71  ? 540  GLY A O   1 
ATOM   3655  N  N   . LYS A 1 495 ? 16.257  -19.735 49.162  1.00 43.17  ? 541  LYS A N   1 
ATOM   3656  C  CA  . LYS A 1 495 ? 15.344  -19.610 50.305  1.00 43.33  ? 541  LYS A CA  1 
ATOM   3657  C  C   . LYS A 1 495 ? 15.982  -18.752 51.399  1.00 43.86  ? 541  LYS A C   1 
ATOM   3658  O  O   . LYS A 1 495 ? 15.397  -17.750 51.855  1.00 43.93  ? 541  LYS A O   1 
ATOM   3659  C  CB  . LYS A 1 495 ? 14.936  -20.991 50.852  1.00 42.86  ? 541  LYS A CB  1 
ATOM   3660  C  CG  . LYS A 1 495 ? 13.769  -21.588 50.110  1.00 42.67  ? 541  LYS A CG  1 
ATOM   3661  C  CD  . LYS A 1 495 ? 13.816  -23.111 50.044  1.00 43.47  ? 541  LYS A CD  1 
ATOM   3662  C  CE  . LYS A 1 495 ? 12.690  -23.772 50.864  1.00 43.80  ? 541  LYS A CE  1 
ATOM   3663  N  NZ  . LYS A 1 495 ? 12.592  -25.243 50.600  1.00 42.42  ? 541  LYS A NZ  1 
ATOM   3664  N  N   . LEU A 1 496 ? 17.208  -19.124 51.772  1.00 44.36  ? 542  LEU A N   1 
ATOM   3665  C  CA  . LEU A 1 496 ? 17.906  -18.501 52.894  1.00 44.89  ? 542  LEU A CA  1 
ATOM   3666  C  C   . LEU A 1 496 ? 18.057  -16.987 52.773  1.00 45.22  ? 542  LEU A C   1 
ATOM   3667  O  O   . LEU A 1 496 ? 17.855  -16.273 53.755  1.00 45.78  ? 542  LEU A O   1 
ATOM   3668  C  CB  . LEU A 1 496 ? 19.278  -19.151 53.135  1.00 44.82  ? 542  LEU A CB  1 
ATOM   3669  C  CG  . LEU A 1 496 ? 19.838  -19.243 54.571  1.00 45.60  ? 542  LEU A CG  1 
ATOM   3670  C  CD1 . LEU A 1 496 ? 21.311  -18.805 54.580  1.00 45.09  ? 542  LEU A CD1 1 
ATOM   3671  C  CD2 . LEU A 1 496 ? 19.040  -18.443 55.643  1.00 47.17  ? 542  LEU A CD2 1 
ATOM   3672  N  N   . ARG A 1 497 ? 18.414  -16.486 51.596  1.00 45.31  ? 543  ARG A N   1 
ATOM   3673  C  CA  . ARG A 1 497 ? 18.606  -15.036 51.455  1.00 45.57  ? 543  ARG A CA  1 
ATOM   3674  C  C   . ARG A 1 497 ? 17.319  -14.288 51.076  1.00 46.05  ? 543  ARG A C   1 
ATOM   3675  O  O   . ARG A 1 497 ? 17.372  -13.108 50.730  1.00 46.19  ? 543  ARG A O   1 
ATOM   3676  C  CB  . ARG A 1 497 ? 19.686  -14.739 50.433  1.00 45.44  ? 543  ARG A CB  1 
ATOM   3677  C  CG  . ARG A 1 497 ? 20.686  -15.847 50.302  1.00 45.38  ? 543  ARG A CG  1 
ATOM   3678  C  CD  . ARG A 1 497 ? 21.691  -15.509 49.240  1.00 46.13  ? 543  ARG A CD  1 
ATOM   3679  N  NE  . ARG A 1 497 ? 22.886  -16.331 49.393  1.00 46.28  ? 543  ARG A NE  1 
ATOM   3680  C  CZ  . ARG A 1 497 ? 24.083  -16.014 48.902  1.00 45.46  ? 543  ARG A CZ  1 
ATOM   3681  N  NH1 . ARG A 1 497 ? 24.262  -14.875 48.214  1.00 42.14  ? 543  ARG A NH1 1 
ATOM   3682  N  NH2 . ARG A 1 497 ? 25.103  -16.853 49.106  1.00 43.46  ? 543  ARG A NH2 1 
ATOM   3683  N  N   . GLY A 1 498 ? 16.173  -14.973 51.139  1.00 46.03  ? 544  GLY A N   1 
ATOM   3684  C  CA  . GLY A 1 498 ? 14.897  -14.381 50.750  1.00 45.97  ? 544  GLY A CA  1 
ATOM   3685  C  C   . GLY A 1 498 ? 14.779  -13.999 49.284  1.00 45.94  ? 544  GLY A C   1 
ATOM   3686  O  O   . GLY A 1 498 ? 14.159  -12.992 48.973  1.00 46.40  ? 544  GLY A O   1 
ATOM   3687  N  N   . PHE A 1 499 ? 15.378  -14.780 48.380  1.00 45.78  ? 545  PHE A N   1 
ATOM   3688  C  CA  . PHE A 1 499 ? 15.110  -14.625 46.934  1.00 45.34  ? 545  PHE A CA  1 
ATOM   3689  C  C   . PHE A 1 499 ? 13.887  -15.430 46.507  1.00 45.27  ? 545  PHE A C   1 
ATOM   3690  O  O   . PHE A 1 499 ? 13.207  -15.068 45.538  1.00 45.76  ? 545  PHE A O   1 
ATOM   3691  C  CB  . PHE A 1 499 ? 16.275  -15.117 46.063  1.00 45.19  ? 545  PHE A CB  1 
ATOM   3692  C  CG  . PHE A 1 499 ? 17.555  -14.399 46.275  1.00 43.85  ? 545  PHE A CG  1 
ATOM   3693  C  CD1 . PHE A 1 499 ? 18.747  -15.000 45.904  1.00 42.99  ? 545  PHE A CD1 1 
ATOM   3694  C  CD2 . PHE A 1 499 ? 17.588  -13.145 46.847  1.00 44.22  ? 545  PHE A CD2 1 
ATOM   3695  C  CE1 . PHE A 1 499 ? 19.980  -14.350 46.079  1.00 43.21  ? 545  PHE A CE1 1 
ATOM   3696  C  CE2 . PHE A 1 499 ? 18.831  -12.475 47.039  1.00 46.40  ? 545  PHE A CE2 1 
ATOM   3697  C  CZ  . PHE A 1 499 ? 20.025  -13.086 46.647  1.00 44.08  ? 545  PHE A CZ  1 
ATOM   3698  N  N   . LEU A 1 500 ? 13.643  -16.548 47.185  1.00 44.87  ? 546  LEU A N   1 
ATOM   3699  C  CA  . LEU A 1 500 ? 12.548  -17.442 46.825  1.00 44.70  ? 546  LEU A CA  1 
ATOM   3700  C  C   . LEU A 1 500 ? 11.817  -17.874 48.066  1.00 45.01  ? 546  LEU A C   1 
ATOM   3701  O  O   . LEU A 1 500 ? 12.425  -18.138 49.107  1.00 45.14  ? 546  LEU A O   1 
ATOM   3702  C  CB  . LEU A 1 500 ? 13.070  -18.697 46.118  1.00 44.47  ? 546  LEU A CB  1 
ATOM   3703  C  CG  . LEU A 1 500 ? 14.468  -18.651 45.501  1.00 43.62  ? 546  LEU A CG  1 
ATOM   3704  C  CD1 . LEU A 1 500 ? 14.896  -20.037 45.127  1.00 42.10  ? 546  LEU A CD1 1 
ATOM   3705  C  CD2 . LEU A 1 500 ? 14.489  -17.764 44.288  1.00 44.42  ? 546  LEU A CD2 1 
ATOM   3706  N  N   . ARG A 1 501 ? 10.505  -17.964 47.934  1.00 45.46  ? 547  ARG A N   1 
ATOM   3707  C  CA  . ARG A 1 501 ? 9.644   -18.380 49.020  1.00 45.69  ? 547  ARG A CA  1 
ATOM   3708  C  C   . ARG A 1 501 ? 8.850   -19.586 48.562  1.00 45.60  ? 547  ARG A C   1 
ATOM   3709  O  O   . ARG A 1 501 ? 8.575   -19.720 47.366  1.00 46.01  ? 547  ARG A O   1 
ATOM   3710  C  CB  . ARG A 1 501 ? 8.699   -17.232 49.373  1.00 45.95  ? 547  ARG A CB  1 
ATOM   3711  C  CG  . ARG A 1 501 ? 9.313   -16.150 50.255  1.00 46.88  ? 547  ARG A CG  1 
ATOM   3712  C  CD  . ARG A 1 501 ? 9.857   -16.762 51.555  1.00 50.63  ? 547  ARG A CD  1 
ATOM   3713  N  NE  . ARG A 1 501 ? 9.309   -16.156 52.778  1.00 52.06  ? 547  ARG A NE  1 
ATOM   3714  C  CZ  . ARG A 1 501 ? 8.394   -16.732 53.576  1.00 52.71  ? 547  ARG A CZ  1 
ATOM   3715  N  NH1 . ARG A 1 501 ? 7.904   -17.944 53.293  1.00 51.54  ? 547  ARG A NH1 1 
ATOM   3716  N  NH2 . ARG A 1 501 ? 7.966   -16.100 54.670  1.00 52.94  ? 547  ARG A NH2 1 
ATOM   3717  N  N   . VAL A 1 502 ? 8.479   -20.454 49.502  1.00 45.20  ? 548  VAL A N   1 
ATOM   3718  C  CA  . VAL A 1 502 ? 7.603   -21.599 49.216  1.00 44.83  ? 548  VAL A CA  1 
ATOM   3719  C  C   . VAL A 1 502 ? 6.475   -21.130 48.292  1.00 44.65  ? 548  VAL A C   1 
ATOM   3720  O  O   . VAL A 1 502 ? 5.984   -20.000 48.435  1.00 44.71  ? 548  VAL A O   1 
ATOM   3721  C  CB  . VAL A 1 502 ? 6.978   -22.196 50.514  1.00 45.02  ? 548  VAL A CB  1 
ATOM   3722  C  CG1 . VAL A 1 502 ? 6.813   -23.703 50.383  1.00 45.26  ? 548  VAL A CG1 1 
ATOM   3723  C  CG2 . VAL A 1 502 ? 7.821   -21.866 51.750  1.00 44.82  ? 548  VAL A CG2 1 
ATOM   3724  N  N   . GLY A 1 503 ? 6.085   -21.966 47.331  1.00 44.26  ? 549  GLY A N   1 
ATOM   3725  C  CA  . GLY A 1 503 ? 5.019   -21.593 46.393  1.00 43.48  ? 549  GLY A CA  1 
ATOM   3726  C  C   . GLY A 1 503 ? 5.462   -20.786 45.178  1.00 42.72  ? 549  GLY A C   1 
ATOM   3727  O  O   . GLY A 1 503 ? 4.706   -20.676 44.205  1.00 42.96  ? 549  GLY A O   1 
ATOM   3728  N  N   . ASP A 1 504 ? 6.674   -20.227 45.212  1.00 41.54  ? 550  ASP A N   1 
ATOM   3729  C  CA  . ASP A 1 504 ? 7.251   -19.613 44.007  1.00 40.70  ? 550  ASP A CA  1 
ATOM   3730  C  C   . ASP A 1 504 ? 7.483   -20.647 42.916  1.00 39.67  ? 550  ASP A C   1 
ATOM   3731  O  O   . ASP A 1 504 ? 7.614   -21.850 43.179  1.00 39.46  ? 550  ASP A O   1 
ATOM   3732  C  CB  . ASP A 1 504 ? 8.571   -18.898 44.302  1.00 41.30  ? 550  ASP A CB  1 
ATOM   3733  C  CG  . ASP A 1 504 ? 8.393   -17.654 45.154  1.00 42.60  ? 550  ASP A CG  1 
ATOM   3734  O  OD1 . ASP A 1 504 ? 7.356   -17.532 45.832  1.00 45.46  ? 550  ASP A OD1 1 
ATOM   3735  O  OD2 . ASP A 1 504 ? 9.301   -16.797 45.172  1.00 43.89  ? 550  ASP A OD2 1 
ATOM   3736  N  N   . LEU A 1 505 ? 7.490   -20.169 41.683  1.00 38.61  ? 551  LEU A N   1 
ATOM   3737  C  CA  . LEU A 1 505 ? 7.931   -20.977 40.564  1.00 37.74  ? 551  LEU A CA  1 
ATOM   3738  C  C   . LEU A 1 505 ? 9.332   -20.530 40.274  1.00 37.13  ? 551  LEU A C   1 
ATOM   3739  O  O   . LEU A 1 505 ? 9.688   -19.350 40.500  1.00 37.00  ? 551  LEU A O   1 
ATOM   3740  C  CB  . LEU A 1 505 ? 7.045   -20.756 39.333  1.00 37.63  ? 551  LEU A CB  1 
ATOM   3741  C  CG  . LEU A 1 505 ? 5.659   -21.432 39.302  1.00 37.13  ? 551  LEU A CG  1 
ATOM   3742  C  CD1 . LEU A 1 505 ? 4.881   -20.961 38.090  1.00 37.10  ? 551  LEU A CD1 1 
ATOM   3743  C  CD2 . LEU A 1 505 ? 5.745   -22.968 39.313  1.00 37.02  ? 551  LEU A CD2 1 
ATOM   3744  N  N   . VAL A 1 506 ? 10.134  -21.459 39.775  1.00 36.46  ? 552  VAL A N   1 
ATOM   3745  C  CA  . VAL A 1 506 ? 11.504  -21.121 39.427  1.00 35.92  ? 552  VAL A CA  1 
ATOM   3746  C  C   . VAL A 1 506 ? 11.834  -21.779 38.106  1.00 35.29  ? 552  VAL A C   1 
ATOM   3747  O  O   . VAL A 1 506 ? 11.316  -22.843 37.781  1.00 34.97  ? 552  VAL A O   1 
ATOM   3748  C  CB  . VAL A 1 506 ? 12.466  -21.528 40.564  1.00 36.02  ? 552  VAL A CB  1 
ATOM   3749  C  CG1 . VAL A 1 506 ? 13.144  -22.871 40.288  1.00 35.57  ? 552  VAL A CG1 1 
ATOM   3750  C  CG2 . VAL A 1 506 ? 13.475  -20.451 40.785  1.00 37.76  ? 552  VAL A CG2 1 
ATOM   3751  N  N   . ILE A 1 507 ? 12.669  -21.120 37.327  1.00 35.18  ? 553  ILE A N   1 
ATOM   3752  C  CA  . ILE A 1 507 ? 13.134  -21.687 36.060  1.00 34.92  ? 553  ILE A CA  1 
ATOM   3753  C  C   . ILE A 1 507 ? 14.548  -22.197 36.254  1.00 35.00  ? 553  ILE A C   1 
ATOM   3754  O  O   . ILE A 1 507 ? 15.409  -21.459 36.745  1.00 35.49  ? 553  ILE A O   1 
ATOM   3755  C  CB  . ILE A 1 507 ? 13.149  -20.627 34.942  1.00 34.58  ? 553  ILE A CB  1 
ATOM   3756  C  CG1 . ILE A 1 507 ? 11.809  -19.882 34.862  1.00 33.73  ? 553  ILE A CG1 1 
ATOM   3757  C  CG2 . ILE A 1 507 ? 13.554  -21.245 33.623  1.00 34.63  ? 553  ILE A CG2 1 
ATOM   3758  C  CD1 . ILE A 1 507 ? 10.611  -20.719 34.507  1.00 32.23  ? 553  ILE A CD1 1 
ATOM   3759  N  N   . VAL A 1 508 ? 14.783  -23.449 35.883  1.00 34.68  ? 554  VAL A N   1 
ATOM   3760  C  CA  . VAL A 1 508 ? 16.102  -24.054 36.038  1.00 34.42  ? 554  VAL A CA  1 
ATOM   3761  C  C   . VAL A 1 508 ? 16.711  -24.320 34.679  1.00 34.31  ? 554  VAL A C   1 
ATOM   3762  O  O   . VAL A 1 508 ? 16.104  -24.974 33.846  1.00 34.36  ? 554  VAL A O   1 
ATOM   3763  C  CB  . VAL A 1 508 ? 16.049  -25.374 36.861  1.00 34.36  ? 554  VAL A CB  1 
ATOM   3764  C  CG1 . VAL A 1 508 ? 17.426  -25.973 37.035  1.00 33.88  ? 554  VAL A CG1 1 
ATOM   3765  C  CG2 . VAL A 1 508 ? 15.428  -25.133 38.215  1.00 33.82  ? 554  VAL A CG2 1 
ATOM   3766  N  N   . VAL A 1 509 ? 17.921  -23.821 34.467  1.00 34.21  ? 555  VAL A N   1 
ATOM   3767  C  CA  . VAL A 1 509 ? 18.603  -24.007 33.203  1.00 34.46  ? 555  VAL A CA  1 
ATOM   3768  C  C   . VAL A 1 509 ? 19.834  -24.856 33.403  1.00 34.92  ? 555  VAL A C   1 
ATOM   3769  O  O   . VAL A 1 509 ? 20.718  -24.462 34.171  1.00 35.34  ? 555  VAL A O   1 
ATOM   3770  C  CB  . VAL A 1 509 ? 19.031  -22.663 32.615  1.00 34.44  ? 555  VAL A CB  1 
ATOM   3771  C  CG1 . VAL A 1 509 ? 19.909  -22.866 31.391  1.00 35.01  ? 555  VAL A CG1 1 
ATOM   3772  C  CG2 . VAL A 1 509 ? 17.821  -21.832 32.266  1.00 33.67  ? 555  VAL A CG2 1 
ATOM   3773  N  N   . THR A 1 510 ? 19.906  -25.994 32.699  1.00 35.33  ? 556  THR A N   1 
ATOM   3774  C  CA  . THR A 1 510 ? 21.055  -26.934 32.776  1.00 35.38  ? 556  THR A CA  1 
ATOM   3775  C  C   . THR A 1 510 ? 21.558  -27.425 31.400  1.00 35.48  ? 556  THR A C   1 
ATOM   3776  O  O   . THR A 1 510 ? 21.272  -26.802 30.384  1.00 35.94  ? 556  THR A O   1 
ATOM   3777  C  CB  . THR A 1 510 ? 20.752  -28.145 33.689  1.00 35.23  ? 556  THR A CB  1 
ATOM   3778  O  OG1 . THR A 1 510 ? 19.695  -28.929 33.125  1.00 36.68  ? 556  THR A OG1 1 
ATOM   3779  C  CG2 . THR A 1 510 ? 20.342  -27.691 35.077  1.00 34.76  ? 556  THR A CG2 1 
ATOM   3780  N  N   . GLY A 1 511 ? 22.310  -28.527 31.368  1.00 35.48  ? 557  GLY A N   1 
ATOM   3781  C  CA  . GLY A 1 511 ? 22.844  -29.048 30.104  1.00 35.38  ? 557  GLY A CA  1 
ATOM   3782  C  C   . GLY A 1 511 ? 22.817  -30.566 29.933  1.00 35.56  ? 557  GLY A C   1 
ATOM   3783  O  O   . GLY A 1 511 ? 22.631  -31.315 30.896  1.00 35.54  ? 557  GLY A O   1 
ATOM   3784  N  N   . TRP A 1 512 ? 23.011  -31.030 28.702  1.00 35.39  ? 558  TRP A N   1 
ATOM   3785  C  CA  . TRP A 1 512 ? 22.913  -32.454 28.436  1.00 35.48  ? 558  TRP A CA  1 
ATOM   3786  C  C   . TRP A 1 512 ? 24.151  -33.269 28.825  1.00 35.73  ? 558  TRP A C   1 
ATOM   3787  O  O   . TRP A 1 512 ? 24.048  -34.487 29.040  1.00 35.43  ? 558  TRP A O   1 
ATOM   3788  C  CB  . TRP A 1 512 ? 22.497  -32.724 26.991  1.00 35.32  ? 558  TRP A CB  1 
ATOM   3789  C  CG  . TRP A 1 512 ? 23.485  -32.329 25.946  1.00 35.27  ? 558  TRP A CG  1 
ATOM   3790  C  CD1 . TRP A 1 512 ? 23.648  -31.088 25.405  1.00 35.96  ? 558  TRP A CD1 1 
ATOM   3791  C  CD2 . TRP A 1 512 ? 24.425  -33.187 25.281  1.00 35.91  ? 558  TRP A CD2 1 
ATOM   3792  N  NE1 . TRP A 1 512 ? 24.632  -31.119 24.446  1.00 36.32  ? 558  TRP A NE1 1 
ATOM   3793  C  CE2 . TRP A 1 512 ? 25.126  -32.394 24.350  1.00 35.95  ? 558  TRP A CE2 1 
ATOM   3794  C  CE3 . TRP A 1 512 ? 24.742  -34.553 25.383  1.00 37.12  ? 558  TRP A CE3 1 
ATOM   3795  C  CZ2 . TRP A 1 512 ? 26.137  -32.914 23.526  1.00 36.72  ? 558  TRP A CZ2 1 
ATOM   3796  C  CZ3 . TRP A 1 512 ? 25.747  -35.078 24.551  1.00 36.62  ? 558  TRP A CZ3 1 
ATOM   3797  C  CH2 . TRP A 1 512 ? 26.431  -34.253 23.639  1.00 36.34  ? 558  TRP A CH2 1 
ATOM   3798  N  N   . ARG A 1 513 ? 25.306  -32.607 28.921  1.00 35.97  ? 559  ARG A N   1 
ATOM   3799  C  CA  . ARG A 1 513 ? 26.545  -33.287 29.308  1.00 36.57  ? 559  ARG A CA  1 
ATOM   3800  C  C   . ARG A 1 513 ? 27.481  -32.323 30.040  1.00 36.72  ? 559  ARG A C   1 
ATOM   3801  O  O   . ARG A 1 513 ? 27.286  -31.115 29.955  1.00 36.80  ? 559  ARG A O   1 
ATOM   3802  C  CB  . ARG A 1 513 ? 27.218  -33.959 28.094  1.00 36.69  ? 559  ARG A CB  1 
ATOM   3803  C  CG  . ARG A 1 513 ? 27.567  -33.023 26.963  1.00 37.61  ? 559  ARG A CG  1 
ATOM   3804  C  CD  . ARG A 1 513 ? 28.958  -32.504 27.129  1.00 39.43  ? 559  ARG A CD  1 
ATOM   3805  N  NE  . ARG A 1 513 ? 29.874  -33.142 26.199  1.00 40.66  ? 559  ARG A NE  1 
ATOM   3806  C  CZ  . ARG A 1 513 ? 31.201  -33.070 26.266  1.00 40.66  ? 559  ARG A CZ  1 
ATOM   3807  N  NH1 . ARG A 1 513 ? 31.808  -32.395 27.242  1.00 38.05  ? 559  ARG A NH1 1 
ATOM   3808  N  NH2 . ARG A 1 513 ? 31.927  -33.688 25.343  1.00 41.58  ? 559  ARG A NH2 1 
ATOM   3809  N  N   . PRO A 1 514 ? 28.484  -32.854 30.778  1.00 36.81  ? 560  PRO A N   1 
ATOM   3810  C  CA  . PRO A 1 514 ? 29.423  -32.030 31.546  1.00 36.72  ? 560  PRO A CA  1 
ATOM   3811  C  C   . PRO A 1 514 ? 30.374  -31.231 30.667  1.00 36.97  ? 560  PRO A C   1 
ATOM   3812  O  O   . PRO A 1 514 ? 30.466  -31.479 29.463  1.00 36.90  ? 560  PRO A O   1 
ATOM   3813  C  CB  . PRO A 1 514 ? 30.233  -33.060 32.341  1.00 36.23  ? 560  PRO A CB  1 
ATOM   3814  C  CG  . PRO A 1 514 ? 29.472  -34.319 32.246  1.00 36.94  ? 560  PRO A CG  1 
ATOM   3815  C  CD  . PRO A 1 514 ? 28.786  -34.284 30.940  1.00 36.57  ? 560  PRO A CD  1 
ATOM   3816  N  N   . GLY A 1 515 ? 31.087  -30.292 31.286  1.00 37.32  ? 561  GLY A N   1 
ATOM   3817  C  CA  . GLY A 1 515 ? 31.984  -29.411 30.559  1.00 37.65  ? 561  GLY A CA  1 
ATOM   3818  C  C   . GLY A 1 515 ? 31.182  -28.215 30.103  1.00 37.99  ? 561  GLY A C   1 
ATOM   3819  O  O   . GLY A 1 515 ? 29.957  -28.273 30.053  1.00 38.95  ? 561  GLY A O   1 
ATOM   3820  N  N   . SER A 1 516 ? 31.853  -27.120 29.768  1.00 37.66  ? 562  SER A N   1 
ATOM   3821  C  CA  . SER A 1 516 ? 31.145  -25.909 29.418  1.00 37.04  ? 562  SER A CA  1 
ATOM   3822  C  C   . SER A 1 516 ? 30.717  -25.945 27.953  1.00 37.08  ? 562  SER A C   1 
ATOM   3823  O  O   . SER A 1 516 ? 31.253  -26.730 27.167  1.00 37.32  ? 562  SER A O   1 
ATOM   3824  C  CB  . SER A 1 516 ? 32.044  -24.711 29.672  1.00 36.81  ? 562  SER A CB  1 
ATOM   3825  O  OG  . SER A 1 516 ? 32.628  -24.299 28.455  1.00 37.30  ? 562  SER A OG  1 
ATOM   3826  N  N   . GLY A 1 517 ? 29.756  -25.096 27.596  1.00 37.17  ? 563  GLY A N   1 
ATOM   3827  C  CA  . GLY A 1 517 ? 29.380  -24.881 26.201  1.00 37.45  ? 563  GLY A CA  1 
ATOM   3828  C  C   . GLY A 1 517 ? 28.203  -25.693 25.684  1.00 37.52  ? 563  GLY A C   1 
ATOM   3829  O  O   . GLY A 1 517 ? 27.866  -25.621 24.499  1.00 37.51  ? 563  GLY A O   1 
ATOM   3830  N  N   . TYR A 1 518 ? 27.571  -26.456 26.572  1.00 37.51  ? 564  TYR A N   1 
ATOM   3831  C  CA  . TYR A 1 518 ? 26.496  -27.358 26.184  1.00 37.32  ? 564  TYR A CA  1 
ATOM   3832  C  C   . TYR A 1 518 ? 25.183  -27.122 26.932  1.00 36.66  ? 564  TYR A C   1 
ATOM   3833  O  O   . TYR A 1 518 ? 24.337  -28.012 26.971  1.00 36.09  ? 564  TYR A O   1 
ATOM   3834  C  CB  . TYR A 1 518 ? 26.930  -28.813 26.375  1.00 38.25  ? 564  TYR A CB  1 
ATOM   3835  C  CG  . TYR A 1 518 ? 28.174  -29.227 25.608  1.00 40.85  ? 564  TYR A CG  1 
ATOM   3836  C  CD1 . TYR A 1 518 ? 29.417  -29.248 26.232  1.00 44.27  ? 564  TYR A CD1 1 
ATOM   3837  C  CD2 . TYR A 1 518 ? 28.103  -29.607 24.269  1.00 42.03  ? 564  TYR A CD2 1 
ATOM   3838  C  CE1 . TYR A 1 518 ? 30.552  -29.624 25.556  1.00 44.58  ? 564  TYR A CE1 1 
ATOM   3839  C  CE2 . TYR A 1 518 ? 29.238  -29.981 23.584  1.00 44.49  ? 564  TYR A CE2 1 
ATOM   3840  C  CZ  . TYR A 1 518 ? 30.463  -29.992 24.238  1.00 45.37  ? 564  TYR A CZ  1 
ATOM   3841  O  OH  . TYR A 1 518 ? 31.604  -30.367 23.572  1.00 46.17  ? 564  TYR A OH  1 
ATOM   3842  N  N   . THR A 1 519 ? 24.995  -25.945 27.527  1.00 36.35  ? 565  THR A N   1 
ATOM   3843  C  CA  . THR A 1 519 ? 23.686  -25.630 28.107  1.00 35.92  ? 565  THR A CA  1 
ATOM   3844  C  C   . THR A 1 519 ? 22.648  -25.823 27.007  1.00 35.95  ? 565  THR A C   1 
ATOM   3845  O  O   . THR A 1 519 ? 22.908  -25.479 25.858  1.00 36.40  ? 565  THR A O   1 
ATOM   3846  C  CB  . THR A 1 519 ? 23.616  -24.196 28.635  1.00 35.88  ? 565  THR A CB  1 
ATOM   3847  O  OG1 . THR A 1 519 ? 24.534  -24.038 29.726  1.00 35.80  ? 565  THR A OG1 1 
ATOM   3848  C  CG2 . THR A 1 519 ? 22.222  -23.874 29.103  1.00 33.58  ? 565  THR A CG2 1 
ATOM   3849  N  N   . ASN A 1 520 ? 21.499  -26.408 27.349  1.00 35.58  ? 566  ASN A N   1 
ATOM   3850  C  CA  . ASN A 1 520 ? 20.423  -26.604 26.383  1.00 34.79  ? 566  ASN A CA  1 
ATOM   3851  C  C   . ASN A 1 520 ? 19.083  -27.062 26.958  1.00 34.60  ? 566  ASN A C   1 
ATOM   3852  O  O   . ASN A 1 520 ? 18.225  -27.545 26.214  1.00 34.94  ? 566  ASN A O   1 
ATOM   3853  C  CB  . ASN A 1 520 ? 20.872  -27.563 25.281  1.00 34.37  ? 566  ASN A CB  1 
ATOM   3854  C  CG  . ASN A 1 520 ? 20.650  -29.016 25.641  1.00 34.69  ? 566  ASN A CG  1 
ATOM   3855  O  OD1 . ASN A 1 520 ? 20.913  -29.453 26.760  1.00 33.73  ? 566  ASN A OD1 1 
ATOM   3856  N  ND2 . ASN A 1 520 ? 20.156  -29.775 24.680  1.00 33.72  ? 566  ASN A ND2 1 
ATOM   3857  N  N   . ILE A 1 521 ? 18.892  -26.930 28.262  1.00 34.34  ? 567  ILE A N   1 
ATOM   3858  C  CA  . ILE A 1 521 ? 17.673  -27.422 28.888  1.00 34.18  ? 567  ILE A CA  1 
ATOM   3859  C  C   . ILE A 1 521 ? 17.070  -26.350 29.761  1.00 34.45  ? 567  ILE A C   1 
ATOM   3860  O  O   . ILE A 1 521 ? 17.768  -25.641 30.484  1.00 34.71  ? 567  ILE A O   1 
ATOM   3861  C  CB  . ILE A 1 521 ? 17.922  -28.675 29.768  1.00 34.30  ? 567  ILE A CB  1 
ATOM   3862  C  CG1 . ILE A 1 521 ? 18.635  -29.782 28.983  1.00 33.85  ? 567  ILE A CG1 1 
ATOM   3863  C  CG2 . ILE A 1 521 ? 16.604  -29.204 30.361  1.00 34.25  ? 567  ILE A CG2 1 
ATOM   3864  C  CD1 . ILE A 1 521 ? 19.110  -30.954 29.840  1.00 33.74  ? 567  ILE A CD1 1 
ATOM   3865  N  N   . MET A 1 522 ? 15.757  -26.248 29.709  1.00 34.44  ? 568  MET A N   1 
ATOM   3866  C  CA  . MET A 1 522 ? 15.040  -25.315 30.539  1.00 34.56  ? 568  MET A CA  1 
ATOM   3867  C  C   . MET A 1 522 ? 13.901  -26.077 31.214  1.00 34.43  ? 568  MET A C   1 
ATOM   3868  O  O   . MET A 1 522 ? 13.168  -26.820 30.560  1.00 34.52  ? 568  MET A O   1 
ATOM   3869  C  CB  . MET A 1 522 ? 14.496  -24.221 29.647  1.00 34.77  ? 568  MET A CB  1 
ATOM   3870  C  CG  . MET A 1 522 ? 13.872  -23.069 30.365  1.00 36.21  ? 568  MET A CG  1 
ATOM   3871  S  SD  . MET A 1 522 ? 12.270  -22.733 29.661  1.00 38.52  ? 568  MET A SD  1 
ATOM   3872  C  CE  . MET A 1 522 ? 11.273  -23.708 30.789  1.00 38.15  ? 568  MET A CE  1 
ATOM   3873  N  N   . ARG A 1 523 ? 13.761  -25.907 32.520  1.00 34.39  ? 569  ARG A N   1 
ATOM   3874  C  CA  . ARG A 1 523 ? 12.716  -26.607 33.257  1.00 34.63  ? 569  ARG A CA  1 
ATOM   3875  C  C   . ARG A 1 523 ? 11.988  -25.667 34.179  1.00 34.27  ? 569  ARG A C   1 
ATOM   3876  O  O   . ARG A 1 523 ? 12.586  -24.763 34.759  1.00 33.85  ? 569  ARG A O   1 
ATOM   3877  C  CB  . ARG A 1 523 ? 13.292  -27.763 34.080  1.00 35.02  ? 569  ARG A CB  1 
ATOM   3878  C  CG  . ARG A 1 523 ? 13.851  -28.924 33.270  1.00 36.94  ? 569  ARG A CG  1 
ATOM   3879  C  CD  . ARG A 1 523 ? 14.309  -30.087 34.158  1.00 39.36  ? 569  ARG A CD  1 
ATOM   3880  N  NE  . ARG A 1 523 ? 15.571  -29.815 34.848  1.00 41.58  ? 569  ARG A NE  1 
ATOM   3881  C  CZ  . ARG A 1 523 ? 15.741  -29.845 36.169  1.00 43.06  ? 569  ARG A CZ  1 
ATOM   3882  N  NH1 . ARG A 1 523 ? 14.724  -30.145 36.974  1.00 43.32  ? 569  ARG A NH1 1 
ATOM   3883  N  NH2 . ARG A 1 523 ? 16.941  -29.586 36.685  1.00 43.09  ? 569  ARG A NH2 1 
ATOM   3884  N  N   . VAL A 1 524 ? 10.690  -25.894 34.314  1.00 34.46  ? 570  VAL A N   1 
ATOM   3885  C  CA  . VAL A 1 524 ? 9.880   -25.134 35.247  1.00 34.81  ? 570  VAL A CA  1 
ATOM   3886  C  C   . VAL A 1 524 ? 9.663   -25.995 36.478  1.00 35.34  ? 570  VAL A C   1 
ATOM   3887  O  O   . VAL A 1 524 ? 9.181   -27.121 36.363  1.00 35.34  ? 570  VAL A O   1 
ATOM   3888  C  CB  . VAL A 1 524 ? 8.519   -24.745 34.639  1.00 34.62  ? 570  VAL A CB  1 
ATOM   3889  C  CG1 . VAL A 1 524 ? 7.642   -24.040 35.671  1.00 34.64  ? 570  VAL A CG1 1 
ATOM   3890  C  CG2 . VAL A 1 524 ? 8.712   -23.853 33.449  1.00 34.18  ? 570  VAL A CG2 1 
ATOM   3891  N  N   . LEU A 1 525 ? 10.041  -25.459 37.638  1.00 36.01  ? 571  LEU A N   1 
ATOM   3892  C  CA  . LEU A 1 525 ? 9.829   -26.117 38.924  1.00 36.95  ? 571  LEU A CA  1 
ATOM   3893  C  C   . LEU A 1 525 ? 9.174   -25.158 39.925  1.00 37.33  ? 571  LEU A C   1 
ATOM   3894  O  O   . LEU A 1 525 ? 9.377   -23.924 39.874  1.00 37.15  ? 571  LEU A O   1 
ATOM   3895  C  CB  . LEU A 1 525 ? 11.147  -26.616 39.525  1.00 37.30  ? 571  LEU A CB  1 
ATOM   3896  C  CG  . LEU A 1 525 ? 12.156  -27.492 38.784  1.00 38.21  ? 571  LEU A CG  1 
ATOM   3897  C  CD1 . LEU A 1 525 ? 13.354  -27.714 39.697  1.00 38.27  ? 571  LEU A CD1 1 
ATOM   3898  C  CD2 . LEU A 1 525 ? 11.560  -28.828 38.358  1.00 37.84  ? 571  LEU A CD2 1 
ATOM   3899  N  N   . SER A 1 526 ? 8.405   -25.743 40.842  1.00 37.90  ? 572  SER A N   1 
ATOM   3900  C  CA  . SER A 1 526 ? 7.796   -24.990 41.935  1.00 38.56  ? 572  SER A CA  1 
ATOM   3901  C  C   . SER A 1 526 ? 8.599   -25.209 43.216  1.00 38.95  ? 572  SER A C   1 
ATOM   3902  O  O   . SER A 1 526 ? 9.099   -26.308 43.466  1.00 39.33  ? 572  SER A O   1 
ATOM   3903  C  CB  . SER A 1 526 ? 6.346   -25.439 42.148  1.00 38.45  ? 572  SER A CB  1 
ATOM   3904  O  OG  . SER A 1 526 ? 6.298   -26.803 42.531  1.00 38.65  ? 572  SER A OG  1 
ATOM   3905  N  N   . ILE A 1 527 ? 8.707   -24.162 44.026  1.00 39.08  ? 573  ILE A N   1 
ATOM   3906  C  CA  . ILE A 1 527 ? 9.386   -24.240 45.315  1.00 39.14  ? 573  ILE A CA  1 
ATOM   3907  C  C   . ILE A 1 527 ? 8.396   -24.546 46.448  1.00 39.41  ? 573  ILE A C   1 
ATOM   3908  O  O   . ILE A 1 527 ? 8.123   -25.707 46.756  1.00 39.73  ? 573  ILE A O   1 
ATOM   3909  C  CB  . ILE A 1 527 ? 10.085  -22.914 45.631  1.00 39.07  ? 573  ILE A CB  1 
ATOM   3910  C  CG1 . ILE A 1 527 ? 11.018  -22.490 44.481  1.00 39.12  ? 573  ILE A CG1 1 
ATOM   3911  C  CG2 . ILE A 1 527 ? 10.798  -22.994 46.974  1.00 38.93  ? 573  ILE A CG2 1 
ATOM   3912  C  CD1 . ILE A 1 527 ? 12.086  -23.503 44.119  1.00 39.75  ? 573  ILE A CD1 1 
ATOM   3913  N  N   . GLN B 1 11  ? 15.633  -15.255 -1.026  1.00 54.12  ? 57   GLN B N   1 
ATOM   3914  C  CA  . GLN B 1 11  ? 15.198  -16.071 0.151   1.00 54.51  ? 57   GLN B CA  1 
ATOM   3915  C  C   . GLN B 1 11  ? 13.833  -16.707 -0.064  1.00 54.01  ? 57   GLN B C   1 
ATOM   3916  O  O   . GLN B 1 11  ? 13.121  -16.387 -1.013  1.00 53.95  ? 57   GLN B O   1 
ATOM   3917  C  CB  . GLN B 1 11  ? 15.198  -15.233 1.441   1.00 54.80  ? 57   GLN B CB  1 
ATOM   3918  C  CG  . GLN B 1 11  ? 16.614  -14.930 2.006   1.00 57.44  ? 57   GLN B CG  1 
ATOM   3919  C  CD  . GLN B 1 11  ? 17.322  -16.176 2.582   1.00 60.79  ? 57   GLN B CD  1 
ATOM   3920  O  OE1 . GLN B 1 11  ? 16.668  -17.145 3.036   1.00 61.50  ? 57   GLN B OE1 1 
ATOM   3921  N  NE2 . GLN B 1 11  ? 18.658  -16.143 2.581   1.00 60.41  ? 57   GLN B NE2 1 
ATOM   3922  N  N   . GLN B 1 12  ? 13.486  -17.613 0.842   1.00 53.56  ? 58   GLN B N   1 
ATOM   3923  C  CA  . GLN B 1 12  ? 12.273  -18.415 0.748   1.00 53.04  ? 58   GLN B CA  1 
ATOM   3924  C  C   . GLN B 1 12  ? 11.372  -18.062 1.921   1.00 52.29  ? 58   GLN B C   1 
ATOM   3925  O  O   . GLN B 1 12  ? 11.743  -17.242 2.766   1.00 52.48  ? 58   GLN B O   1 
ATOM   3926  C  CB  . GLN B 1 12  ? 12.655  -19.898 0.766   1.00 53.33  ? 58   GLN B CB  1 
ATOM   3927  C  CG  . GLN B 1 12  ? 13.728  -20.257 -0.289  1.00 55.84  ? 58   GLN B CG  1 
ATOM   3928  C  CD  . GLN B 1 12  ? 14.937  -21.045 0.283   1.00 59.75  ? 58   GLN B CD  1 
ATOM   3929  O  OE1 . GLN B 1 12  ? 15.496  -20.694 1.327   1.00 60.21  ? 58   GLN B OE1 1 
ATOM   3930  N  NE2 . GLN B 1 12  ? 15.346  -22.099 -0.424  1.00 59.97  ? 58   GLN B NE2 1 
ATOM   3931  N  N   . GLN B 1 13  ? 10.189  -18.667 1.968   1.00 51.44  ? 59   GLN B N   1 
ATOM   3932  C  CA  . GLN B 1 13  ? 9.248   -18.506 3.085   1.00 50.87  ? 59   GLN B CA  1 
ATOM   3933  C  C   . GLN B 1 13  ? 8.801   -17.068 3.333   1.00 50.30  ? 59   GLN B C   1 
ATOM   3934  O  O   . GLN B 1 13  ? 8.264   -16.763 4.401   1.00 50.63  ? 59   GLN B O   1 
ATOM   3935  C  CB  . GLN B 1 13  ? 9.833   -19.055 4.393   1.00 50.97  ? 59   GLN B CB  1 
ATOM   3936  C  CG  . GLN B 1 13  ? 10.199  -20.512 4.401   1.00 52.46  ? 59   GLN B CG  1 
ATOM   3937  C  CD  . GLN B 1 13  ? 10.629  -20.979 5.780   1.00 54.48  ? 59   GLN B CD  1 
ATOM   3938  O  OE1 . GLN B 1 13  ? 9.795   -21.249 6.649   1.00 54.74  ? 59   GLN B OE1 1 
ATOM   3939  N  NE2 . GLN B 1 13  ? 11.937  -21.080 5.987   1.00 54.70  ? 59   GLN B NE2 1 
ATOM   3940  N  N   . GLN B 1 14  ? 9.016   -16.182 2.367   1.00 49.66  ? 60   GLN B N   1 
ATOM   3941  C  CA  . GLN B 1 14  ? 8.713   -14.766 2.576   1.00 49.61  ? 60   GLN B CA  1 
ATOM   3942  C  C   . GLN B 1 14  ? 9.466   -14.255 3.808   1.00 49.79  ? 60   GLN B C   1 
ATOM   3943  O  O   . GLN B 1 14  ? 8.862   -13.649 4.716   1.00 49.72  ? 60   GLN B O   1 
ATOM   3944  C  CB  . GLN B 1 14  ? 7.199   -14.534 2.775   1.00 49.18  ? 60   GLN B CB  1 
ATOM   3945  C  CG  . GLN B 1 14  ? 6.299   -15.082 1.678   1.00 48.89  ? 60   GLN B CG  1 
ATOM   3946  C  CD  . GLN B 1 14  ? 6.438   -14.366 0.340   1.00 48.06  ? 60   GLN B CD  1 
ATOM   3947  O  OE1 . GLN B 1 14  ? 6.941   -13.245 0.255   1.00 47.49  ? 60   GLN B OE1 1 
ATOM   3948  N  NE2 . GLN B 1 14  ? 5.968   -15.014 -0.714  1.00 48.27  ? 60   GLN B NE2 1 
ATOM   3949  N  N   . LEU B 1 15  ? 10.770  -14.528 3.860   1.00 49.70  ? 61   LEU B N   1 
ATOM   3950  C  CA  . LEU B 1 15  ? 11.587  -14.086 4.988   1.00 49.74  ? 61   LEU B CA  1 
ATOM   3951  C  C   . LEU B 1 15  ? 11.858  -12.585 4.972   1.00 48.98  ? 61   LEU B C   1 
ATOM   3952  O  O   . LEU B 1 15  ? 11.706  -11.936 6.015   1.00 48.77  ? 61   LEU B O   1 
ATOM   3953  C  CB  . LEU B 1 15  ? 12.874  -14.927 5.158   1.00 50.35  ? 61   LEU B CB  1 
ATOM   3954  C  CG  . LEU B 1 15  ? 12.968  -15.926 6.350   1.00 52.32  ? 61   LEU B CG  1 
ATOM   3955  C  CD1 . LEU B 1 15  ? 11.590  -16.343 6.943   1.00 53.22  ? 61   LEU B CD1 1 
ATOM   3956  C  CD2 . LEU B 1 15  ? 13.806  -17.178 6.037   1.00 52.81  ? 61   LEU B CD2 1 
ATOM   3957  N  N   . PRO B 1 16  ? 12.242  -12.016 3.801   1.00 48.43  ? 62   PRO B N   1 
ATOM   3958  C  CA  . PRO B 1 16  ? 12.338  -10.557 3.798   1.00 48.09  ? 62   PRO B CA  1 
ATOM   3959  C  C   . PRO B 1 16  ? 11.074  -9.941  4.401   1.00 47.83  ? 62   PRO B C   1 
ATOM   3960  O  O   . PRO B 1 16  ? 11.172  -9.050  5.227   1.00 48.09  ? 62   PRO B O   1 
ATOM   3961  C  CB  . PRO B 1 16  ? 12.496  -10.209 2.311   1.00 47.83  ? 62   PRO B CB  1 
ATOM   3962  C  CG  . PRO B 1 16  ? 13.164  -11.389 1.729   1.00 47.76  ? 62   PRO B CG  1 
ATOM   3963  C  CD  . PRO B 1 16  ? 12.620  -12.584 2.491   1.00 48.38  ? 62   PRO B CD  1 
ATOM   3964  N  N   . ALA B 1 17  ? 9.902   -10.442 4.034   1.00 47.69  ? 63   ALA B N   1 
ATOM   3965  C  CA  . ALA B 1 17  ? 8.654   -9.881  4.546   1.00 47.98  ? 63   ALA B CA  1 
ATOM   3966  C  C   . ALA B 1 17  ? 8.461   -10.131 6.049   1.00 48.25  ? 63   ALA B C   1 
ATOM   3967  O  O   . ALA B 1 17  ? 7.852   -9.325  6.745   1.00 48.26  ? 63   ALA B O   1 
ATOM   3968  C  CB  . ALA B 1 17  ? 7.466   -10.405 3.756   1.00 47.84  ? 63   ALA B CB  1 
ATOM   3969  N  N   . ALA B 1 18  ? 8.979   -11.250 6.546   1.00 48.66  ? 64   ALA B N   1 
ATOM   3970  C  CA  . ALA B 1 18  ? 8.947   -11.539 7.982   1.00 48.80  ? 64   ALA B CA  1 
ATOM   3971  C  C   . ALA B 1 18  ? 9.810   -10.560 8.806   1.00 48.99  ? 64   ALA B C   1 
ATOM   3972  O  O   . ALA B 1 18  ? 9.471   -10.242 9.951   1.00 49.06  ? 64   ALA B O   1 
ATOM   3973  C  CB  . ALA B 1 18  ? 9.351   -12.989 8.246   1.00 48.44  ? 64   ALA B CB  1 
ATOM   3974  N  N   . MET B 1 19  ? 10.904  -10.081 8.213   1.00 49.36  ? 65   MET B N   1 
ATOM   3975  C  CA  . MET B 1 19  ? 11.840  -9.164  8.899   1.00 50.24  ? 65   MET B CA  1 
ATOM   3976  C  C   . MET B 1 19  ? 11.427  -7.680  8.874   1.00 49.98  ? 65   MET B C   1 
ATOM   3977  O  O   . MET B 1 19  ? 12.165  -6.826  9.376   1.00 50.02  ? 65   MET B O   1 
ATOM   3978  C  CB  . MET B 1 19  ? 13.267  -9.298  8.334   1.00 50.78  ? 65   MET B CB  1 
ATOM   3979  C  CG  . MET B 1 19  ? 13.812  -10.733 8.191   1.00 53.10  ? 65   MET B CG  1 
ATOM   3980  S  SD  . MET B 1 19  ? 14.316  -11.519 9.743   1.00 58.18  ? 65   MET B SD  1 
ATOM   3981  C  CE  . MET B 1 19  ? 12.754  -12.202 10.356  1.00 54.91  ? 65   MET B CE  1 
ATOM   3982  N  N   . ALA B 1 20  ? 10.256  -7.388  8.302   1.00 49.71  ? 66   ALA B N   1 
ATOM   3983  C  CA  . ALA B 1 20  ? 9.742   -6.016  8.205   1.00 49.25  ? 66   ALA B CA  1 
ATOM   3984  C  C   . ALA B 1 20  ? 9.405   -5.416  9.568   1.00 48.91  ? 66   ALA B C   1 
ATOM   3985  O  O   . ALA B 1 20  ? 8.967   -6.134  10.473  1.00 48.95  ? 66   ALA B O   1 
ATOM   3986  C  CB  . ALA B 1 20  ? 8.507   -5.983  7.316   1.00 49.37  ? 66   ALA B CB  1 
ATOM   3987  N  N   . ASP B 1 21  ? 9.602   -4.103  9.691   1.00 48.43  ? 67   ASP B N   1 
ATOM   3988  C  CA  . ASP B 1 21  ? 9.365   -3.379  10.938  1.00 48.25  ? 67   ASP B CA  1 
ATOM   3989  C  C   . ASP B 1 21  ? 7.916   -2.902  11.108  1.00 47.30  ? 67   ASP B C   1 
ATOM   3990  O  O   . ASP B 1 21  ? 7.513   -2.547  12.209  1.00 47.06  ? 67   ASP B O   1 
ATOM   3991  C  CB  . ASP B 1 21  ? 10.332  -2.194  11.039  1.00 49.10  ? 67   ASP B CB  1 
ATOM   3992  C  CG  . ASP B 1 21  ? 11.778  -2.636  11.237  1.00 52.15  ? 67   ASP B CG  1 
ATOM   3993  O  OD1 . ASP B 1 21  ? 12.550  -2.647  10.248  1.00 54.52  ? 67   ASP B OD1 1 
ATOM   3994  O  OD2 . ASP B 1 21  ? 12.135  -2.987  12.388  1.00 55.63  ? 67   ASP B OD2 1 
ATOM   3995  N  N   . THR B 1 22  ? 7.143   -2.867  10.023  1.00 46.29  ? 68   THR B N   1 
ATOM   3996  C  CA  . THR B 1 22  ? 5.736   -2.467  10.093  1.00 45.50  ? 68   THR B CA  1 
ATOM   3997  C  C   . THR B 1 22  ? 4.912   -3.416  9.259   1.00 44.75  ? 68   THR B C   1 
ATOM   3998  O  O   . THR B 1 22  ? 5.466   -4.166  8.445   1.00 45.03  ? 68   THR B O   1 
ATOM   3999  C  CB  . THR B 1 22  ? 5.478   -1.028  9.590   1.00 45.59  ? 68   THR B CB  1 
ATOM   4000  O  OG1 . THR B 1 22  ? 5.678   -0.957  8.175   1.00 45.82  ? 68   THR B OG1 1 
ATOM   4001  C  CG2 . THR B 1 22  ? 6.387   -0.030  10.275  1.00 46.43  ? 68   THR B CG2 1 
ATOM   4002  N  N   . PHE B 1 23  ? 3.596   -3.395  9.463   1.00 43.43  ? 69   PHE B N   1 
ATOM   4003  C  CA  . PHE B 1 23  ? 2.714   -4.258  8.683   1.00 42.18  ? 69   PHE B CA  1 
ATOM   4004  C  C   . PHE B 1 23  ? 2.707   -3.831  7.218   1.00 41.71  ? 69   PHE B C   1 
ATOM   4005  O  O   . PHE B 1 23  ? 2.743   -4.666  6.327   1.00 41.36  ? 69   PHE B O   1 
ATOM   4006  C  CB  . PHE B 1 23  ? 1.291   -4.300  9.251   1.00 41.68  ? 69   PHE B CB  1 
ATOM   4007  C  CG  . PHE B 1 23  ? 0.404   -5.247  8.530   1.00 39.79  ? 69   PHE B CG  1 
ATOM   4008  C  CD1 . PHE B 1 23  ? -0.640  -4.786  7.747   1.00 38.84  ? 69   PHE B CD1 1 
ATOM   4009  C  CD2 . PHE B 1 23  ? 0.636   -6.609  8.597   1.00 37.95  ? 69   PHE B CD2 1 
ATOM   4010  C  CE1 . PHE B 1 23  ? -1.455  -5.680  7.044   1.00 36.89  ? 69   PHE B CE1 1 
ATOM   4011  C  CE2 . PHE B 1 23  ? -0.167  -7.493  7.913   1.00 36.50  ? 69   PHE B CE2 1 
ATOM   4012  C  CZ  . PHE B 1 23  ? -1.220  -7.024  7.129   1.00 34.98  ? 69   PHE B CZ  1 
ATOM   4013  N  N   . LEU B 1 24  ? 2.673   -2.525  6.988   1.00 41.26  ? 70   LEU B N   1 
ATOM   4014  C  CA  . LEU B 1 24  ? 2.804   -1.971  5.647   1.00 41.14  ? 70   LEU B CA  1 
ATOM   4015  C  C   . LEU B 1 24  ? 4.069   -2.469  4.949   1.00 41.56  ? 70   LEU B C   1 
ATOM   4016  O  O   . LEU B 1 24  ? 3.981   -3.039  3.867   1.00 41.68  ? 70   LEU B O   1 
ATOM   4017  C  CB  . LEU B 1 24  ? 2.803   -0.439  5.681   1.00 40.42  ? 70   LEU B CB  1 
ATOM   4018  C  CG  . LEU B 1 24  ? 2.586   0.299   4.361   1.00 38.28  ? 70   LEU B CG  1 
ATOM   4019  C  CD1 . LEU B 1 24  ? 1.283   -0.122  3.696   1.00 33.55  ? 70   LEU B CD1 1 
ATOM   4020  C  CD2 . LEU B 1 24  ? 2.599   1.786   4.627   1.00 35.49  ? 70   LEU B CD2 1 
ATOM   4021  N  N   . GLU B 1 25  ? 5.231   -2.256  5.567   1.00 42.11  ? 71   GLU B N   1 
ATOM   4022  C  CA  . GLU B 1 25  ? 6.500   -2.668  4.981   1.00 42.76  ? 71   GLU B CA  1 
ATOM   4023  C  C   . GLU B 1 25  ? 6.443   -4.149  4.672   1.00 42.33  ? 71   GLU B C   1 
ATOM   4024  O  O   . GLU B 1 25  ? 6.954   -4.606  3.630   1.00 42.35  ? 71   GLU B O   1 
ATOM   4025  C  CB  . GLU B 1 25  ? 7.656   -2.390  5.928   1.00 43.29  ? 71   GLU B CB  1 
ATOM   4026  C  CG  . GLU B 1 25  ? 9.040   -2.422  5.242   1.00 47.29  ? 71   GLU B CG  1 
ATOM   4027  C  CD  . GLU B 1 25  ? 10.243  -2.288  6.225   1.00 52.06  ? 71   GLU B CD  1 
ATOM   4028  O  OE1 . GLU B 1 25  ? 10.044  -2.104  7.464   1.00 53.06  ? 71   GLU B OE1 1 
ATOM   4029  O  OE2 . GLU B 1 25  ? 11.399  -2.367  5.741   1.00 51.62  ? 71   GLU B OE2 1 
ATOM   4030  N  N   . HIS B 1 26  ? 5.805   -4.889  5.576   1.00 41.60  ? 72   HIS B N   1 
ATOM   4031  C  CA  . HIS B 1 26  ? 5.624   -6.317  5.411   1.00 41.03  ? 72   HIS B CA  1 
ATOM   4032  C  C   . HIS B 1 26  ? 4.919   -6.534  4.085   1.00 40.44  ? 72   HIS B C   1 
ATOM   4033  O  O   . HIS B 1 26  ? 5.528   -7.073  3.168   1.00 41.20  ? 72   HIS B O   1 
ATOM   4034  C  CB  . HIS B 1 26  ? 4.829   -6.889  6.594   1.00 41.45  ? 72   HIS B CB  1 
ATOM   4035  C  CG  . HIS B 1 26  ? 4.281   -8.264  6.367   1.00 42.10  ? 72   HIS B CG  1 
ATOM   4036  N  ND1 . HIS B 1 26  ? 5.061   -9.399  6.451   1.00 43.83  ? 72   HIS B ND1 1 
ATOM   4037  C  CD2 . HIS B 1 26  ? 3.024   -8.687  6.091   1.00 42.42  ? 72   HIS B CD2 1 
ATOM   4038  C  CE1 . HIS B 1 26  ? 4.307   -10.463 6.229   1.00 44.03  ? 72   HIS B CE1 1 
ATOM   4039  N  NE2 . HIS B 1 26  ? 3.065   -10.060 6.011   1.00 42.09  ? 72   HIS B NE2 1 
ATOM   4040  N  N   . LEU B 1 27  ? 3.672   -6.065  3.967   1.00 39.11  ? 73   LEU B N   1 
ATOM   4041  C  CA  . LEU B 1 27  ? 2.906   -6.175  2.732   1.00 37.53  ? 73   LEU B CA  1 
ATOM   4042  C  C   . LEU B 1 27  ? 3.759   -5.829  1.532   1.00 37.44  ? 73   LEU B C   1 
ATOM   4043  O  O   . LEU B 1 27  ? 3.783   -6.569  0.565   1.00 37.71  ? 73   LEU B O   1 
ATOM   4044  C  CB  . LEU B 1 27  ? 1.689   -5.259  2.765   1.00 36.63  ? 73   LEU B CB  1 
ATOM   4045  C  CG  . LEU B 1 27  ? 0.598   -5.534  3.787   1.00 35.25  ? 73   LEU B CG  1 
ATOM   4046  C  CD1 . LEU B 1 27  ? -0.389  -4.403  3.716   1.00 33.09  ? 73   LEU B CD1 1 
ATOM   4047  C  CD2 . LEU B 1 27  ? -0.087  -6.885  3.568   1.00 31.46  ? 73   LEU B CD2 1 
ATOM   4048  N  N   . CYS B 1 28  ? 4.477   -4.719  1.616   1.00 37.29  ? 74   CYS B N   1 
ATOM   4049  C  CA  . CYS B 1 28  ? 5.304   -4.226  0.527   1.00 37.68  ? 74   CYS B CA  1 
ATOM   4050  C  C   . CYS B 1 28  ? 6.403   -5.172  0.080   1.00 37.59  ? 74   CYS B C   1 
ATOM   4051  O  O   . CYS B 1 28  ? 7.009   -4.956  -0.984  1.00 37.57  ? 74   CYS B O   1 
ATOM   4052  C  CB  . CYS B 1 28  ? 5.954   -2.898  0.924   1.00 37.58  ? 74   CYS B CB  1 
ATOM   4053  S  SG  . CYS B 1 28  ? 4.837   -1.530  0.929   1.00 39.84  ? 74   CYS B SG  1 
ATOM   4054  N  N   . LEU B 1 29  ? 6.681   -6.194  0.894   1.00 37.43  ? 75   LEU B N   1 
ATOM   4055  C  CA  . LEU B 1 29  ? 7.798   -7.097  0.627   1.00 37.39  ? 75   LEU B CA  1 
ATOM   4056  C  C   . LEU B 1 29  ? 7.412   -8.554  0.277   1.00 37.44  ? 75   LEU B C   1 
ATOM   4057  O  O   . LEU B 1 29  ? 8.285   -9.406  -0.008  1.00 37.85  ? 75   LEU B O   1 
ATOM   4058  C  CB  . LEU B 1 29  ? 8.793   -7.060  1.793   1.00 37.35  ? 75   LEU B CB  1 
ATOM   4059  C  CG  . LEU B 1 29  ? 9.637   -5.822  2.094   1.00 37.32  ? 75   LEU B CG  1 
ATOM   4060  C  CD1 . LEU B 1 29  ? 10.400  -6.047  3.359   1.00 35.46  ? 75   LEU B CD1 1 
ATOM   4061  C  CD2 . LEU B 1 29  ? 10.576  -5.458  0.954   1.00 37.58  ? 75   LEU B CD2 1 
ATOM   4062  N  N   . LEU B 1 30  ? 6.114   -8.833  0.302   1.00 36.89  ? 76   LEU B N   1 
ATOM   4063  C  CA  . LEU B 1 30  ? 5.604   -10.088 -0.174  1.00 36.36  ? 76   LEU B CA  1 
ATOM   4064  C  C   . LEU B 1 30  ? 6.160   -10.336 -1.595  1.00 37.34  ? 76   LEU B C   1 
ATOM   4065  O  O   . LEU B 1 30  ? 6.183   -9.444  -2.445  1.00 37.40  ? 76   LEU B O   1 
ATOM   4066  C  CB  . LEU B 1 30  ? 4.086   -10.068 -0.096  1.00 35.70  ? 76   LEU B CB  1 
ATOM   4067  C  CG  . LEU B 1 30  ? 3.483   -10.088 1.327   1.00 34.19  ? 76   LEU B CG  1 
ATOM   4068  C  CD1 . LEU B 1 30  ? 1.955   -10.206 1.352   1.00 29.63  ? 76   LEU B CD1 1 
ATOM   4069  C  CD2 . LEU B 1 30  ? 4.072   -11.211 2.177   1.00 34.38  ? 76   LEU B CD2 1 
ATOM   4070  N  N   . ASP B 1 31  ? 6.672   -11.540 -1.827  1.00 38.17  ? 77   ASP B N   1 
ATOM   4071  C  CA  . ASP B 1 31  ? 7.374   -11.860 -3.068  1.00 38.27  ? 77   ASP B CA  1 
ATOM   4072  C  C   . ASP B 1 31  ? 6.784   -13.123 -3.716  1.00 38.70  ? 77   ASP B C   1 
ATOM   4073  O  O   . ASP B 1 31  ? 6.849   -14.212 -3.154  1.00 39.31  ? 77   ASP B O   1 
ATOM   4074  C  CB  . ASP B 1 31  ? 8.853   -12.060 -2.756  1.00 38.16  ? 77   ASP B CB  1 
ATOM   4075  C  CG  . ASP B 1 31  ? 9.734   -12.126 -3.999  1.00 38.12  ? 77   ASP B CG  1 
ATOM   4076  O  OD1 . ASP B 1 31  ? 9.267   -12.418 -5.117  1.00 36.53  ? 77   ASP B OD1 1 
ATOM   4077  O  OD2 . ASP B 1 31  ? 10.943  -11.898 -3.842  1.00 39.59  ? 77   ASP B OD2 1 
ATOM   4078  N  N   . ILE B 1 32  ? 6.210   -12.981 -4.901  1.00 38.92  ? 78   ILE B N   1 
ATOM   4079  C  CA  . ILE B 1 32  ? 5.620   -14.119 -5.598  1.00 39.19  ? 78   ILE B CA  1 
ATOM   4080  C  C   . ILE B 1 32  ? 6.651   -15.198 -5.976  1.00 40.21  ? 78   ILE B C   1 
ATOM   4081  O  O   . ILE B 1 32  ? 6.294   -16.354 -6.162  1.00 40.60  ? 78   ILE B O   1 
ATOM   4082  C  CB  . ILE B 1 32  ? 4.823   -13.668 -6.868  1.00 39.07  ? 78   ILE B CB  1 
ATOM   4083  C  CG1 . ILE B 1 32  ? 5.746   -12.933 -7.863  1.00 37.53  ? 78   ILE B CG1 1 
ATOM   4084  C  CG2 . ILE B 1 32  ? 3.545   -12.853 -6.471  1.00 38.10  ? 78   ILE B CG2 1 
ATOM   4085  C  CD1 . ILE B 1 32  ? 5.307   -13.024 -9.303  1.00 36.22  ? 78   ILE B CD1 1 
ATOM   4086  N  N   . ASP B 1 33  ? 7.921   -14.817 -6.099  1.00 40.98  ? 79   ASP B N   1 
ATOM   4087  C  CA  . ASP B 1 33  ? 9.003   -15.781 -6.340  1.00 42.06  ? 79   ASP B CA  1 
ATOM   4088  C  C   . ASP B 1 33  ? 9.636   -16.389 -5.068  1.00 42.38  ? 79   ASP B C   1 
ATOM   4089  O  O   . ASP B 1 33  ? 10.665  -17.046 -5.137  1.00 43.01  ? 79   ASP B O   1 
ATOM   4090  C  CB  . ASP B 1 33  ? 10.093  -15.147 -7.223  1.00 41.96  ? 79   ASP B CB  1 
ATOM   4091  C  CG  . ASP B 1 33  ? 9.626   -14.918 -8.639  1.00 43.24  ? 79   ASP B CG  1 
ATOM   4092  O  OD1 . ASP B 1 33  ? 8.669   -15.586 -9.061  1.00 42.43  ? 79   ASP B OD1 1 
ATOM   4093  O  OD2 . ASP B 1 33  ? 10.200  -14.072 -9.336  1.00 45.06  ? 79   ASP B OD2 1 
ATOM   4094  N  N   . SER B 1 34  ? 9.044   -16.160 -3.912  1.00 42.64  ? 80   SER B N   1 
ATOM   4095  C  CA  . SER B 1 34  ? 9.589   -16.736 -2.711  1.00 43.44  ? 80   SER B CA  1 
ATOM   4096  C  C   . SER B 1 34  ? 8.781   -18.000 -2.478  1.00 44.13  ? 80   SER B C   1 
ATOM   4097  O  O   . SER B 1 34  ? 7.622   -17.934 -2.003  1.00 44.51  ? 80   SER B O   1 
ATOM   4098  C  CB  . SER B 1 34  ? 9.460   -15.762 -1.529  1.00 43.38  ? 80   SER B CB  1 
ATOM   4099  O  OG  . SER B 1 34  ? 10.216  -16.173 -0.387  1.00 44.39  ? 80   SER B OG  1 
ATOM   4100  N  N   . GLU B 1 35  ? 9.360   -19.153 -2.836  1.00 44.41  ? 81   GLU B N   1 
ATOM   4101  C  CA  . GLU B 1 35  ? 8.616   -20.409 -2.698  1.00 44.76  ? 81   GLU B CA  1 
ATOM   4102  C  C   . GLU B 1 35  ? 8.364   -20.802 -1.255  1.00 44.20  ? 81   GLU B C   1 
ATOM   4103  O  O   . GLU B 1 35  ? 9.257   -20.720 -0.425  1.00 43.79  ? 81   GLU B O   1 
ATOM   4104  C  CB  . GLU B 1 35  ? 9.244   -21.558 -3.471  1.00 45.00  ? 81   GLU B CB  1 
ATOM   4105  C  CG  . GLU B 1 35  ? 9.236   -21.363 -5.005  1.00 48.80  ? 81   GLU B CG  1 
ATOM   4106  C  CD  . GLU B 1 35  ? 7.921   -20.797 -5.610  1.00 53.00  ? 81   GLU B CD  1 
ATOM   4107  O  OE1 . GLU B 1 35  ? 6.828   -20.877 -4.986  1.00 55.00  ? 81   GLU B OE1 1 
ATOM   4108  O  OE2 . GLU B 1 35  ? 7.992   -20.263 -6.743  1.00 55.16  ? 81   GLU B OE2 1 
ATOM   4109  N  N   . PRO B 1 36  ? 7.123   -21.221 -0.949  1.00 44.27  ? 82   PRO B N   1 
ATOM   4110  C  CA  . PRO B 1 36  ? 6.865   -21.632 0.417   1.00 44.45  ? 82   PRO B CA  1 
ATOM   4111  C  C   . PRO B 1 36  ? 7.744   -22.843 0.627   1.00 45.09  ? 82   PRO B C   1 
ATOM   4112  O  O   . PRO B 1 36  ? 8.200   -23.455 -0.340  1.00 45.46  ? 82   PRO B O   1 
ATOM   4113  C  CB  . PRO B 1 36  ? 5.389   -22.036 0.405   1.00 43.93  ? 82   PRO B CB  1 
ATOM   4114  C  CG  . PRO B 1 36  ? 4.837   -21.452 -0.810  1.00 43.98  ? 82   PRO B CG  1 
ATOM   4115  C  CD  . PRO B 1 36  ? 5.941   -21.398 -1.805  1.00 43.75  ? 82   PRO B CD  1 
ATOM   4116  N  N   . VAL B 1 37  ? 8.006   -23.182 1.873   1.00 45.69  ? 83   VAL B N   1 
ATOM   4117  C  CA  . VAL B 1 37  ? 8.976   -24.231 2.146   1.00 46.15  ? 83   VAL B CA  1 
ATOM   4118  C  C   . VAL B 1 37  ? 8.637   -24.656 3.558   1.00 46.23  ? 83   VAL B C   1 
ATOM   4119  O  O   . VAL B 1 37  ? 9.200   -24.179 4.539   1.00 46.95  ? 83   VAL B O   1 
ATOM   4120  C  CB  . VAL B 1 37  ? 10.483  -23.724 1.880   1.00 46.10  ? 83   VAL B CB  1 
ATOM   4121  C  CG1 . VAL B 1 37  ? 11.412  -23.839 3.118   1.00 45.29  ? 83   VAL B CG1 1 
ATOM   4122  C  CG2 . VAL B 1 37  ? 11.085  -24.395 0.612   1.00 45.85  ? 83   VAL B CG2 1 
ATOM   4123  N  N   . ALA B 1 38  ? 7.639   -25.501 3.653   1.00 45.91  ? 84   ALA B N   1 
ATOM   4124  C  CA  . ALA B 1 38  ? 7.105   -25.894 4.938   1.00 45.84  ? 84   ALA B CA  1 
ATOM   4125  C  C   . ALA B 1 38  ? 5.851   -26.675 4.622   1.00 46.03  ? 84   ALA B C   1 
ATOM   4126  O  O   . ALA B 1 38  ? 5.219   -26.471 3.559   1.00 46.99  ? 84   ALA B O   1 
ATOM   4127  C  CB  . ALA B 1 38  ? 6.786   -24.685 5.812   1.00 44.85  ? 84   ALA B CB  1 
ATOM   4128  N  N   . ALA B 1 39  ? 5.536   -27.611 5.513   1.00 45.31  ? 85   ALA B N   1 
ATOM   4129  C  CA  . ALA B 1 39  ? 4.287   -28.332 5.471   1.00 44.36  ? 85   ALA B CA  1 
ATOM   4130  C  C   . ALA B 1 39  ? 3.221   -27.283 5.677   1.00 43.94  ? 85   ALA B C   1 
ATOM   4131  O  O   . ALA B 1 39  ? 3.463   -26.297 6.376   1.00 43.64  ? 85   ALA B O   1 
ATOM   4132  C  CB  . ALA B 1 39  ? 4.264   -29.296 6.575   1.00 44.43  ? 85   ALA B CB  1 
ATOM   4133  N  N   . ARG B 1 40  ? 2.064   -27.446 5.053   1.00 43.66  ? 86   ARG B N   1 
ATOM   4134  C  CA  . ARG B 1 40  ? 1.048   -26.431 5.251   1.00 44.08  ? 86   ARG B CA  1 
ATOM   4135  C  C   . ARG B 1 40  ? 0.390   -26.703 6.573   1.00 44.15  ? 86   ARG B C   1 
ATOM   4136  O  O   . ARG B 1 40  ? 0.114   -27.850 6.899   1.00 44.07  ? 86   ARG B O   1 
ATOM   4137  C  CB  . ARG B 1 40  ? 0.005   -26.395 4.146   1.00 44.00  ? 86   ARG B CB  1 
ATOM   4138  C  CG  . ARG B 1 40  ? -0.614  -27.718 3.842   1.00 44.28  ? 86   ARG B CG  1 
ATOM   4139  C  CD  . ARG B 1 40  ? -1.936  -27.501 3.218   1.00 44.31  ? 86   ARG B CD  1 
ATOM   4140  N  NE  . ARG B 1 40  ? -2.937  -27.873 4.172   1.00 42.71  ? 86   ARG B NE  1 
ATOM   4141  C  CZ  . ARG B 1 40  ? -3.365  -29.118 4.345   1.00 40.46  ? 86   ARG B CZ  1 
ATOM   4142  N  NH1 . ARG B 1 40  ? -2.903  -30.106 3.580   1.00 34.54  ? 86   ARG B NH1 1 
ATOM   4143  N  NH2 . ARG B 1 40  ? -4.280  -29.347 5.284   1.00 40.37  ? 86   ARG B NH2 1 
ATOM   4144  N  N   . SER B 1 41  ? 0.151   -25.644 7.332   1.00 44.07  ? 87   SER B N   1 
ATOM   4145  C  CA  . SER B 1 41  ? -0.328  -25.815 8.664   1.00 44.56  ? 87   SER B CA  1 
ATOM   4146  C  C   . SER B 1 41  ? -1.857  -25.744 8.807   1.00 44.28  ? 87   SER B C   1 
ATOM   4147  O  O   . SER B 1 41  ? -2.424  -26.290 9.755   1.00 44.59  ? 87   SER B O   1 
ATOM   4148  C  CB  . SER B 1 41  ? 0.420   -24.875 9.618   1.00 45.08  ? 87   SER B CB  1 
ATOM   4149  O  OG  . SER B 1 41  ? 0.712   -23.635 9.015   1.00 47.30  ? 87   SER B OG  1 
ATOM   4150  N  N   . THR B 1 42  ? -2.539  -25.107 7.861   1.00 43.78  ? 88   THR B N   1 
ATOM   4151  C  CA  . THR B 1 42  ? -4.013  -25.045 7.904   1.00 42.50  ? 88   THR B CA  1 
ATOM   4152  C  C   . THR B 1 42  ? -4.649  -26.358 7.447   1.00 42.18  ? 88   THR B C   1 
ATOM   4153  O  O   . THR B 1 42  ? -4.492  -26.804 6.301   1.00 41.22  ? 88   THR B O   1 
ATOM   4154  C  CB  . THR B 1 42  ? -4.561  -23.869 7.072   1.00 42.50  ? 88   THR B CB  1 
ATOM   4155  O  OG1 . THR B 1 42  ? -3.819  -22.677 7.372   1.00 41.74  ? 88   THR B OG1 1 
ATOM   4156  C  CG2 . THR B 1 42  ? -6.040  -23.641 7.384   1.00 42.41  ? 88   THR B CG2 1 
ATOM   4157  N  N   . SER B 1 43  ? -5.363  -27.000 8.359   1.00 42.45  ? 89   SER B N   1 
ATOM   4158  C  CA  . SER B 1 43  ? -5.978  -28.293 8.031   1.00 42.19  ? 89   SER B CA  1 
ATOM   4159  C  C   . SER B 1 43  ? -7.200  -28.087 7.138   1.00 42.01  ? 89   SER B C   1 
ATOM   4160  O  O   . SER B 1 43  ? -7.861  -27.055 7.199   1.00 42.73  ? 89   SER B O   1 
ATOM   4161  C  CB  . SER B 1 43  ? -6.301  -29.079 9.284   1.00 41.66  ? 89   SER B CB  1 
ATOM   4162  O  OG  . SER B 1 43  ? -5.128  -29.156 10.077  1.00 43.03  ? 89   SER B OG  1 
ATOM   4163  N  N   . ILE B 1 44  ? -7.434  -29.050 6.259   1.00 41.03  ? 90   ILE B N   1 
ATOM   4164  C  CA  . ILE B 1 44  ? -8.478  -28.972 5.297   1.00 39.51  ? 90   ILE B CA  1 
ATOM   4165  C  C   . ILE B 1 44  ? -9.545  -29.962 5.684   1.00 40.09  ? 90   ILE B C   1 
ATOM   4166  O  O   . ILE B 1 44  ? -9.256  -31.139 5.892   1.00 40.71  ? 90   ILE B O   1 
ATOM   4167  C  CB  . ILE B 1 44  ? -7.952  -29.379 3.938   1.00 39.34  ? 90   ILE B CB  1 
ATOM   4168  C  CG1 . ILE B 1 44  ? -6.889  -28.356 3.478   1.00 37.46  ? 90   ILE B CG1 1 
ATOM   4169  C  CG2 . ILE B 1 44  ? -9.159  -29.580 2.963   1.00 37.24  ? 90   ILE B CG2 1 
ATOM   4170  C  CD1 . ILE B 1 44  ? -6.131  -28.715 2.262   1.00 32.60  ? 90   ILE B CD1 1 
ATOM   4171  N  N   . ILE B 1 45  ? -10.778 -29.477 5.778   1.00 39.63  ? 91   ILE B N   1 
ATOM   4172  C  CA  . ILE B 1 45  ? -11.925 -30.295 6.082   1.00 39.03  ? 91   ILE B CA  1 
ATOM   4173  C  C   . ILE B 1 45  ? -12.680 -30.518 4.785   1.00 39.26  ? 91   ILE B C   1 
ATOM   4174  O  O   . ILE B 1 45  ? -13.025 -29.559 4.107   1.00 39.94  ? 91   ILE B O   1 
ATOM   4175  C  CB  . ILE B 1 45  ? -12.833 -29.557 7.077   1.00 38.85  ? 91   ILE B CB  1 
ATOM   4176  C  CG1 . ILE B 1 45  ? -12.047 -29.240 8.347   1.00 37.74  ? 91   ILE B CG1 1 
ATOM   4177  C  CG2 . ILE B 1 45  ? -14.082 -30.354 7.386   1.00 38.20  ? 91   ILE B CG2 1 
ATOM   4178  C  CD1 . ILE B 1 45  ? -12.775 -28.314 9.313   1.00 35.94  ? 91   ILE B CD1 1 
ATOM   4179  N  N   . ALA B 1 46  ? -12.952 -31.767 4.432   1.00 39.21  ? 92   ALA B N   1 
ATOM   4180  C  CA  . ALA B 1 46  ? -13.644 -32.048 3.175   1.00 39.26  ? 92   ALA B CA  1 
ATOM   4181  C  C   . ALA B 1 46  ? -14.957 -32.759 3.453   1.00 39.60  ? 92   ALA B C   1 
ATOM   4182  O  O   . ALA B 1 46  ? -15.010 -33.719 4.214   1.00 39.83  ? 92   ALA B O   1 
ATOM   4183  C  CB  . ALA B 1 46  ? -12.761 -32.864 2.221   1.00 38.45  ? 92   ALA B CB  1 
ATOM   4184  N  N   . THR B 1 47  ? -16.030 -32.272 2.853   1.00 39.91  ? 93   THR B N   1 
ATOM   4185  C  CA  . THR B 1 47  ? -17.313 -32.910 3.033   1.00 40.34  ? 93   THR B CA  1 
ATOM   4186  C  C   . THR B 1 47  ? -17.425 -34.093 2.081   1.00 40.64  ? 93   THR B C   1 
ATOM   4187  O  O   . THR B 1 47  ? -17.124 -33.970 0.902   1.00 40.91  ? 93   THR B O   1 
ATOM   4188  C  CB  . THR B 1 47  ? -18.456 -31.950 2.794   1.00 40.52  ? 93   THR B CB  1 
ATOM   4189  O  OG1 . THR B 1 47  ? -18.207 -30.714 3.489   1.00 40.85  ? 93   THR B OG1 1 
ATOM   4190  C  CG2 . THR B 1 47  ? -19.783 -32.580 3.267   1.00 39.54  ? 93   THR B CG2 1 
ATOM   4191  N  N   . ILE B 1 48  ? -17.827 -35.237 2.624   1.00 40.82  ? 94   ILE B N   1 
ATOM   4192  C  CA  . ILE B 1 48  ? -18.029 -36.477 1.871   1.00 40.52  ? 94   ILE B CA  1 
ATOM   4193  C  C   . ILE B 1 48  ? -19.413 -36.499 1.194   1.00 40.79  ? 94   ILE B C   1 
ATOM   4194  O  O   . ILE B 1 48  ? -20.465 -36.204 1.817   1.00 40.82  ? 94   ILE B O   1 
ATOM   4195  C  CB  . ILE B 1 48  ? -17.873 -37.749 2.790   1.00 40.44  ? 94   ILE B CB  1 
ATOM   4196  C  CG1 . ILE B 1 48  ? -16.541 -37.751 3.550   1.00 39.72  ? 94   ILE B CG1 1 
ATOM   4197  C  CG2 . ILE B 1 48  ? -18.012 -39.041 1.999   1.00 39.74  ? 94   ILE B CG2 1 
ATOM   4198  C  CD1 . ILE B 1 48  ? -15.330 -37.808 2.674   1.00 37.84  ? 94   ILE B CD1 1 
ATOM   4199  N  N   . GLY B 1 49  ? -19.406 -36.857 -0.086  1.00 40.65  ? 95   GLY B N   1 
ATOM   4200  C  CA  . GLY B 1 49  ? -20.652 -37.065 -0.834  1.00 40.40  ? 95   GLY B CA  1 
ATOM   4201  C  C   . GLY B 1 49  ? -20.437 -37.977 -2.026  1.00 40.08  ? 95   GLY B C   1 
ATOM   4202  O  O   . GLY B 1 49  ? -19.407 -38.650 -2.104  1.00 40.75  ? 95   GLY B O   1 
ATOM   4203  N  N   . PRO B 1 50  ? -21.380 -37.976 -2.985  1.00 39.43  ? 96   PRO B N   1 
ATOM   4204  C  CA  . PRO B 1 50  ? -21.260 -38.918 -4.086  1.00 39.08  ? 96   PRO B CA  1 
ATOM   4205  C  C   . PRO B 1 50  ? -19.920 -38.779 -4.809  1.00 38.80  ? 96   PRO B C   1 
ATOM   4206  O  O   . PRO B 1 50  ? -19.389 -39.780 -5.271  1.00 39.19  ? 96   PRO B O   1 
ATOM   4207  C  CB  . PRO B 1 50  ? -22.407 -38.540 -5.026  1.00 38.96  ? 96   PRO B CB  1 
ATOM   4208  C  CG  . PRO B 1 50  ? -23.280 -37.662 -4.274  1.00 39.21  ? 96   PRO B CG  1 
ATOM   4209  C  CD  . PRO B 1 50  ? -22.549 -37.096 -3.117  1.00 39.23  ? 96   PRO B CD  1 
ATOM   4210  N  N   . ALA B 1 51  ? -19.371 -37.570 -4.877  1.00 37.76  ? 97   ALA B N   1 
ATOM   4211  C  CA  . ALA B 1 51  ? -18.123 -37.322 -5.590  1.00 37.72  ? 97   ALA B CA  1 
ATOM   4212  C  C   . ALA B 1 51  ? -16.906 -37.856 -4.875  1.00 38.17  ? 97   ALA B C   1 
ATOM   4213  O  O   . ALA B 1 51  ? -15.834 -37.999 -5.501  1.00 38.01  ? 97   ALA B O   1 
ATOM   4214  C  CB  . ALA B 1 51  ? -17.926 -35.827 -5.811  1.00 37.56  ? 97   ALA B CB  1 
ATOM   4215  N  N   . SER B 1 52  ? -17.064 -38.129 -3.572  1.00 38.39  ? 98   SER B N   1 
ATOM   4216  C  CA  . SER B 1 52  ? -15.917 -38.372 -2.686  1.00 39.04  ? 98   SER B CA  1 
ATOM   4217  C  C   . SER B 1 52  ? -16.096 -39.504 -1.677  1.00 39.10  ? 98   SER B C   1 
ATOM   4218  O  O   . SER B 1 52  ? -15.698 -39.384 -0.516  1.00 39.70  ? 98   SER B O   1 
ATOM   4219  C  CB  . SER B 1 52  ? -15.625 -37.094 -1.913  1.00 38.91  ? 98   SER B CB  1 
ATOM   4220  O  OG  . SER B 1 52  ? -16.733 -36.849 -1.082  1.00 39.72  ? 98   SER B OG  1 
ATOM   4221  N  N   . ARG B 1 53  ? -16.672 -40.609 -2.108  1.00 39.22  ? 99   ARG B N   1 
ATOM   4222  C  CA  . ARG B 1 53  ? -17.103 -41.593 -1.146  1.00 38.84  ? 99   ARG B CA  1 
ATOM   4223  C  C   . ARG B 1 53  ? -16.436 -42.901 -1.448  1.00 39.00  ? 99   ARG B C   1 
ATOM   4224  O  O   . ARG B 1 53  ? -16.305 -43.755 -0.586  1.00 39.17  ? 99   ARG B O   1 
ATOM   4225  C  CB  . ARG B 1 53  ? -18.601 -41.729 -1.259  1.00 38.87  ? 99   ARG B CB  1 
ATOM   4226  C  CG  . ARG B 1 53  ? -19.275 -41.854 0.041   1.00 38.79  ? 99   ARG B CG  1 
ATOM   4227  C  CD  . ARG B 1 53  ? -20.762 -41.619 -0.133  1.00 38.57  ? 99   ARG B CD  1 
ATOM   4228  N  NE  . ARG B 1 53  ? -21.510 -42.403 0.840   1.00 40.30  ? 99   ARG B NE  1 
ATOM   4229  C  CZ  . ARG B 1 53  ? -21.955 -43.635 0.618   1.00 39.29  ? 99   ARG B CZ  1 
ATOM   4230  N  NH1 . ARG B 1 53  ? -21.753 -44.216 -0.560  1.00 39.49  ? 99   ARG B NH1 1 
ATOM   4231  N  NH2 . ARG B 1 53  ? -22.614 -44.285 1.569   1.00 37.87  ? 99   ARG B NH2 1 
ATOM   4232  N  N   . SER B 1 54  ? -16.024 -43.055 -2.697  1.00 38.79  ? 100  SER B N   1 
ATOM   4233  C  CA  . SER B 1 54  ? -15.334 -44.241 -3.110  1.00 38.69  ? 100  SER B CA  1 
ATOM   4234  C  C   . SER B 1 54  ? -13.960 -44.240 -2.469  1.00 38.79  ? 100  SER B C   1 
ATOM   4235  O  O   . SER B 1 54  ? -13.246 -43.246 -2.499  1.00 38.80  ? 100  SER B O   1 
ATOM   4236  C  CB  . SER B 1 54  ? -15.217 -44.290 -4.635  1.00 38.53  ? 100  SER B CB  1 
ATOM   4237  O  OG  . SER B 1 54  ? -13.999 -43.714 -5.071  1.00 39.54  ? 100  SER B OG  1 
ATOM   4238  N  N   . VAL B 1 55  ? -13.606 -45.371 -1.887  1.00 39.42  ? 101  VAL B N   1 
ATOM   4239  C  CA  . VAL B 1 55  ? -12.263 -45.608 -1.379  1.00 39.88  ? 101  VAL B CA  1 
ATOM   4240  C  C   . VAL B 1 55  ? -11.155 -45.058 -2.275  1.00 40.63  ? 101  VAL B C   1 
ATOM   4241  O  O   . VAL B 1 55  ? -10.292 -44.359 -1.778  1.00 40.95  ? 101  VAL B O   1 
ATOM   4242  C  CB  . VAL B 1 55  ? -12.041 -47.108 -1.090  1.00 39.75  ? 101  VAL B CB  1 
ATOM   4243  C  CG1 . VAL B 1 55  ? -10.567 -47.418 -0.839  1.00 39.19  ? 101  VAL B CG1 1 
ATOM   4244  C  CG2 . VAL B 1 55  ? -12.891 -47.524 0.098   1.00 38.87  ? 101  VAL B CG2 1 
ATOM   4245  N  N   . GLU B 1 56  ? -11.178 -45.333 -3.576  1.00 41.46  ? 102  GLU B N   1 
ATOM   4246  C  CA  . GLU B 1 56  ? -10.074 -44.888 -4.437  1.00 42.60  ? 102  GLU B CA  1 
ATOM   4247  C  C   . GLU B 1 56  ? -9.975  -43.369 -4.549  1.00 42.96  ? 102  GLU B C   1 
ATOM   4248  O  O   . GLU B 1 56  ? -8.873  -42.799 -4.633  1.00 43.34  ? 102  GLU B O   1 
ATOM   4249  C  CB  . GLU B 1 56  ? -10.125 -45.559 -5.815  1.00 42.92  ? 102  GLU B CB  1 
ATOM   4250  C  CG  . GLU B 1 56  ? -9.594  -47.020 -5.775  1.00 45.38  ? 102  GLU B CG  1 
ATOM   4251  C  CD  . GLU B 1 56  ? -8.246  -47.156 -4.999  1.00 47.74  ? 102  GLU B CD  1 
ATOM   4252  O  OE1 . GLU B 1 56  ? -7.501  -46.132 -4.880  1.00 47.95  ? 102  GLU B OE1 1 
ATOM   4253  O  OE2 . GLU B 1 56  ? -7.925  -48.286 -4.528  1.00 46.43  ? 102  GLU B OE2 1 
ATOM   4254  N  N   . ARG B 1 57  ? -11.139 -42.726 -4.536  1.00 42.57  ? 103  ARG B N   1 
ATOM   4255  C  CA  . ARG B 1 57  ? -11.211 -41.297 -4.548  1.00 42.19  ? 103  ARG B CA  1 
ATOM   4256  C  C   . ARG B 1 57  ? -10.622 -40.815 -3.228  1.00 41.53  ? 103  ARG B C   1 
ATOM   4257  O  O   . ARG B 1 57  ? -9.705  -40.000 -3.225  1.00 41.47  ? 103  ARG B O   1 
ATOM   4258  C  CB  . ARG B 1 57  ? -12.670 -40.849 -4.729  1.00 42.81  ? 103  ARG B CB  1 
ATOM   4259  C  CG  . ARG B 1 57  ? -12.883 -39.378 -5.182  1.00 45.13  ? 103  ARG B CG  1 
ATOM   4260  C  CD  . ARG B 1 57  ? -13.344 -39.258 -6.637  1.00 49.02  ? 103  ARG B CD  1 
ATOM   4261  N  NE  . ARG B 1 57  ? -12.242 -38.908 -7.529  1.00 51.51  ? 103  ARG B NE  1 
ATOM   4262  C  CZ  . ARG B 1 57  ? -11.709 -39.740 -8.424  1.00 53.87  ? 103  ARG B CZ  1 
ATOM   4263  N  NH1 . ARG B 1 57  ? -12.194 -40.975 -8.560  1.00 54.05  ? 103  ARG B NH1 1 
ATOM   4264  N  NH2 . ARG B 1 57  ? -10.705 -39.326 -9.199  1.00 54.86  ? 103  ARG B NH2 1 
ATOM   4265  N  N   . LEU B 1 58  ? -11.126 -41.335 -2.107  1.00 40.67  ? 104  LEU B N   1 
ATOM   4266  C  CA  . LEU B 1 58  ? -10.638 -40.914 -0.795  1.00 39.59  ? 104  LEU B CA  1 
ATOM   4267  C  C   . LEU B 1 58  ? -9.132  -40.985 -0.719  1.00 39.70  ? 104  LEU B C   1 
ATOM   4268  O  O   . LEU B 1 58  ? -8.510  -40.068 -0.195  1.00 39.28  ? 104  LEU B O   1 
ATOM   4269  C  CB  . LEU B 1 58  ? -11.236 -41.738 0.327   1.00 39.06  ? 104  LEU B CB  1 
ATOM   4270  C  CG  . LEU B 1 58  ? -12.541 -41.359 1.039   1.00 38.12  ? 104  LEU B CG  1 
ATOM   4271  C  CD1 . LEU B 1 58  ? -12.954 -39.897 0.927   1.00 35.13  ? 104  LEU B CD1 1 
ATOM   4272  C  CD2 . LEU B 1 58  ? -13.674 -42.236 0.562   1.00 38.12  ? 104  LEU B CD2 1 
ATOM   4273  N  N   . LYS B 1 59  ? -8.547  -42.057 -1.258  1.00 40.01  ? 105  LYS B N   1 
ATOM   4274  C  CA  . LYS B 1 59  ? -7.088  -42.183 -1.305  1.00 40.50  ? 105  LYS B CA  1 
ATOM   4275  C  C   . LYS B 1 59  ? -6.454  -40.962 -1.974  1.00 40.97  ? 105  LYS B C   1 
ATOM   4276  O  O   . LYS B 1 59  ? -5.522  -40.372 -1.429  1.00 40.67  ? 105  LYS B O   1 
ATOM   4277  C  CB  . LYS B 1 59  ? -6.641  -43.476 -1.988  1.00 40.22  ? 105  LYS B CB  1 
ATOM   4278  C  CG  . LYS B 1 59  ? -6.771  -44.699 -1.131  1.00 39.52  ? 105  LYS B CG  1 
ATOM   4279  C  CD  . LYS B 1 59  ? -6.384  -45.933 -1.920  1.00 40.37  ? 105  LYS B CD  1 
ATOM   4280  C  CE  . LYS B 1 59  ? -6.861  -47.234 -1.240  1.00 41.80  ? 105  LYS B CE  1 
ATOM   4281  N  NZ  . LYS B 1 59  ? -6.521  -48.493 -1.978  1.00 39.47  ? 105  LYS B NZ  1 
ATOM   4282  N  N   . GLU B 1 60  ? -6.984  -40.567 -3.128  1.00 41.60  ? 106  GLU B N   1 
ATOM   4283  C  CA  . GLU B 1 60  ? -6.509  -39.364 -3.810  1.00 42.91  ? 106  GLU B CA  1 
ATOM   4284  C  C   . GLU B 1 60  ? -6.614  -38.091 -2.957  1.00 42.76  ? 106  GLU B C   1 
ATOM   4285  O  O   . GLU B 1 60  ? -5.708  -37.244 -2.940  1.00 43.06  ? 106  GLU B O   1 
ATOM   4286  C  CB  . GLU B 1 60  ? -7.251  -39.163 -5.117  1.00 43.08  ? 106  GLU B CB  1 
ATOM   4287  C  CG  . GLU B 1 60  ? -6.654  -39.932 -6.256  1.00 48.22  ? 106  GLU B CG  1 
ATOM   4288  C  CD  . GLU B 1 60  ? -7.397  -39.688 -7.559  1.00 55.42  ? 106  GLU B CD  1 
ATOM   4289  O  OE1 . GLU B 1 60  ? -8.571  -40.155 -7.688  1.00 57.28  ? 106  GLU B OE1 1 
ATOM   4290  O  OE2 . GLU B 1 60  ? -6.790  -39.024 -8.445  1.00 57.60  ? 106  GLU B OE2 1 
ATOM   4291  N  N   . MET B 1 61  ? -7.721  -37.962 -2.243  1.00 42.46  ? 107  MET B N   1 
ATOM   4292  C  CA  . MET B 1 61  ? -7.961  -36.780 -1.462  1.00 41.76  ? 107  MET B CA  1 
ATOM   4293  C  C   . MET B 1 61  ? -7.089  -36.690 -0.236  1.00 41.66  ? 107  MET B C   1 
ATOM   4294  O  O   . MET B 1 61  ? -6.730  -35.594 0.189   1.00 42.11  ? 107  MET B O   1 
ATOM   4295  C  CB  . MET B 1 61  ? -9.408  -36.711 -1.072  1.00 41.84  ? 107  MET B CB  1 
ATOM   4296  C  CG  . MET B 1 61  ? -10.226 -36.128 -2.168  1.00 41.75  ? 107  MET B CG  1 
ATOM   4297  S  SD  . MET B 1 61  ? -11.930 -36.307 -1.767  1.00 44.50  ? 107  MET B SD  1 
ATOM   4298  C  CE  . MET B 1 61  ? -12.109 -35.195 -0.373  1.00 43.96  ? 107  MET B CE  1 
ATOM   4299  N  N   . ILE B 1 62  ? -6.754  -37.837 0.348   1.00 41.28  ? 108  ILE B N   1 
ATOM   4300  C  CA  . ILE B 1 62  ? -5.793  -37.863 1.437   1.00 40.34  ? 108  ILE B CA  1 
ATOM   4301  C  C   . ILE B 1 62  ? -4.465  -37.405 0.862   1.00 40.35  ? 108  ILE B C   1 
ATOM   4302  O  O   . ILE B 1 62  ? -3.921  -36.411 1.337   1.00 40.45  ? 108  ILE B O   1 
ATOM   4303  C  CB  . ILE B 1 62  ? -5.682  -39.236 2.062   1.00 40.41  ? 108  ILE B CB  1 
ATOM   4304  C  CG1 . ILE B 1 62  ? -7.045  -39.659 2.619   1.00 40.12  ? 108  ILE B CG1 1 
ATOM   4305  C  CG2 . ILE B 1 62  ? -4.637  -39.232 3.147   1.00 40.26  ? 108  ILE B CG2 1 
ATOM   4306  C  CD1 . ILE B 1 62  ? -7.053  -40.970 3.372   1.00 38.05  ? 108  ILE B CD1 1 
ATOM   4307  N  N   . LYS B 1 63  ? -3.985  -38.078 -0.189  1.00 40.15  ? 109  LYS B N   1 
ATOM   4308  C  CA  . LYS B 1 63  ? -2.741  -37.711 -0.872  1.00 40.18  ? 109  LYS B CA  1 
ATOM   4309  C  C   . LYS B 1 63  ? -2.658  -36.213 -1.144  1.00 39.85  ? 109  LYS B C   1 
ATOM   4310  O  O   . LYS B 1 63  ? -1.591  -35.607 -1.048  1.00 39.65  ? 109  LYS B O   1 
ATOM   4311  C  CB  . LYS B 1 63  ? -2.585  -38.450 -2.208  1.00 40.47  ? 109  LYS B CB  1 
ATOM   4312  C  CG  . LYS B 1 63  ? -2.479  -39.968 -2.114  1.00 42.46  ? 109  LYS B CG  1 
ATOM   4313  C  CD  . LYS B 1 63  ? -2.098  -40.650 -3.451  1.00 44.89  ? 109  LYS B CD  1 
ATOM   4314  C  CE  . LYS B 1 63  ? -0.612  -41.096 -3.453  1.00 47.06  ? 109  LYS B CE  1 
ATOM   4315  N  NZ  . LYS B 1 63  ? -0.324  -42.200 -4.433  1.00 47.92  ? 109  LYS B NZ  1 
ATOM   4316  N  N   . ALA B 1 64  ? -3.800  -35.623 -1.479  1.00 39.26  ? 110  ALA B N   1 
ATOM   4317  C  CA  . ALA B 1 64  ? -3.834  -34.224 -1.872  1.00 38.93  ? 110  ALA B CA  1 
ATOM   4318  C  C   . ALA B 1 64  ? -3.871  -33.248 -0.701  1.00 39.26  ? 110  ALA B C   1 
ATOM   4319  O  O   . ALA B 1 64  ? -3.629  -32.054 -0.887  1.00 39.80  ? 110  ALA B O   1 
ATOM   4320  C  CB  . ALA B 1 64  ? -4.987  -33.971 -2.788  1.00 38.42  ? 110  ALA B CB  1 
ATOM   4321  N  N   . GLY B 1 65  ? -4.196  -33.725 0.495   1.00 39.04  ? 111  GLY B N   1 
ATOM   4322  C  CA  . GLY B 1 65  ? -4.193  -32.831 1.643   1.00 38.41  ? 111  GLY B CA  1 
ATOM   4323  C  C   . GLY B 1 65  ? -5.326  -32.920 2.643   1.00 38.15  ? 111  GLY B C   1 
ATOM   4324  O  O   . GLY B 1 65  ? -5.237  -32.295 3.693   1.00 37.35  ? 111  GLY B O   1 
ATOM   4325  N  N   . MET B 1 66  ? -6.391  -33.664 2.336   1.00 37.90  ? 112  MET B N   1 
ATOM   4326  C  CA  . MET B 1 66  ? -7.520  -33.746 3.265   1.00 38.48  ? 112  MET B CA  1 
ATOM   4327  C  C   . MET B 1 66  ? -7.029  -34.150 4.657   1.00 38.90  ? 112  MET B C   1 
ATOM   4328  O  O   . MET B 1 66  ? -6.184  -35.051 4.788   1.00 39.49  ? 112  MET B O   1 
ATOM   4329  C  CB  . MET B 1 66  ? -8.574  -34.735 2.776   1.00 38.49  ? 112  MET B CB  1 
ATOM   4330  C  CG  . MET B 1 66  ? -9.792  -34.898 3.723   1.00 39.63  ? 112  MET B CG  1 
ATOM   4331  S  SD  . MET B 1 66  ? -11.027 -36.171 3.213   1.00 42.95  ? 112  MET B SD  1 
ATOM   4332  C  CE  . MET B 1 66  ? -10.041 -37.669 3.352   1.00 37.61  ? 112  MET B CE  1 
ATOM   4333  N  N   . ASN B 1 67  ? -7.524  -33.475 5.692   1.00 38.71  ? 113  ASN B N   1 
ATOM   4334  C  CA  . ASN B 1 67  ? -7.194  -33.869 7.052   1.00 38.41  ? 113  ASN B CA  1 
ATOM   4335  C  C   . ASN B 1 67  ? -8.402  -34.250 7.862   1.00 39.04  ? 113  ASN B C   1 
ATOM   4336  O  O   . ASN B 1 67  ? -8.301  -34.945 8.855   1.00 39.82  ? 113  ASN B O   1 
ATOM   4337  C  CB  . ASN B 1 67  ? -6.456  -32.769 7.785   1.00 38.00  ? 113  ASN B CB  1 
ATOM   4338  C  CG  . ASN B 1 67  ? -5.254  -32.233 7.012   1.00 36.93  ? 113  ASN B CG  1 
ATOM   4339  O  OD1 . ASN B 1 67  ? -5.203  -31.053 6.720   1.00 38.77  ? 113  ASN B OD1 1 
ATOM   4340  N  ND2 . ASN B 1 67  ? -4.280  -33.072 6.722   1.00 33.66  ? 113  ASN B ND2 1 
ATOM   4341  N  N   . ILE B 1 68  ? -9.569  -33.797 7.456   1.00 39.34  ? 114  ILE B N   1 
ATOM   4342  C  CA  . ILE B 1 68  ? -10.761 -34.099 8.213   1.00 39.12  ? 114  ILE B CA  1 
ATOM   4343  C  C   . ILE B 1 68  ? -11.841 -34.472 7.223   1.00 39.55  ? 114  ILE B C   1 
ATOM   4344  O  O   . ILE B 1 68  ? -12.012 -33.788 6.224   1.00 40.60  ? 114  ILE B O   1 
ATOM   4345  C  CB  . ILE B 1 68  ? -11.158 -32.890 9.073   1.00 38.75  ? 114  ILE B CB  1 
ATOM   4346  C  CG1 . ILE B 1 68  ? -10.028 -32.572 10.055  1.00 38.92  ? 114  ILE B CG1 1 
ATOM   4347  C  CG2 . ILE B 1 68  ? -12.441 -33.147 9.807   1.00 38.17  ? 114  ILE B CG2 1 
ATOM   4348  C  CD1 . ILE B 1 68  ? -10.283 -31.408 10.987  1.00 39.94  ? 114  ILE B CD1 1 
ATOM   4349  N  N   . ALA B 1 69  ? -12.530 -35.582 7.451   1.00 39.46  ? 115  ALA B N   1 
ATOM   4350  C  CA  . ALA B 1 69  ? -13.709 -35.884 6.657   1.00 39.25  ? 115  ALA B CA  1 
ATOM   4351  C  C   . ALA B 1 69  ? -14.949 -35.394 7.381   1.00 39.36  ? 115  ALA B C   1 
ATOM   4352  O  O   . ALA B 1 69  ? -15.152 -35.660 8.566   1.00 39.44  ? 115  ALA B O   1 
ATOM   4353  C  CB  . ALA B 1 69  ? -13.808 -37.318 6.389   1.00 39.15  ? 115  ALA B CB  1 
ATOM   4354  N  N   . ARG B 1 70  ? -15.769 -34.653 6.660   1.00 39.22  ? 116  ARG B N   1 
ATOM   4355  C  CA  . ARG B 1 70  ? -16.970 -34.102 7.229   1.00 39.23  ? 116  ARG B CA  1 
ATOM   4356  C  C   . ARG B 1 70  ? -18.212 -34.858 6.756   1.00 39.39  ? 116  ARG B C   1 
ATOM   4357  O  O   . ARG B 1 70  ? -18.487 -34.922 5.554   1.00 39.52  ? 116  ARG B O   1 
ATOM   4358  C  CB  . ARG B 1 70  ? -17.072 -32.633 6.865   1.00 38.84  ? 116  ARG B CB  1 
ATOM   4359  C  CG  . ARG B 1 70  ? -18.341 -32.003 7.358   1.00 39.06  ? 116  ARG B CG  1 
ATOM   4360  C  CD  . ARG B 1 70  ? -18.510 -30.603 6.790   1.00 37.12  ? 116  ARG B CD  1 
ATOM   4361  N  NE  . ARG B 1 70  ? -19.787 -30.055 7.225   1.00 37.00  ? 116  ARG B NE  1 
ATOM   4362  C  CZ  . ARG B 1 70  ? -20.764 -29.695 6.411   1.00 36.11  ? 116  ARG B CZ  1 
ATOM   4363  N  NH1 . ARG B 1 70  ? -20.614 -29.783 5.111   1.00 36.21  ? 116  ARG B NH1 1 
ATOM   4364  N  NH2 . ARG B 1 70  ? -21.891 -29.225 6.908   1.00 34.63  ? 116  ARG B NH2 1 
ATOM   4365  N  N   . LEU B 1 71  ? -18.953 -35.440 7.697   1.00 38.97  ? 117  LEU B N   1 
ATOM   4366  C  CA  . LEU B 1 71  ? -20.202 -36.098 7.342   1.00 38.53  ? 117  LEU B CA  1 
ATOM   4367  C  C   . LEU B 1 71  ? -21.344 -35.173 7.667   1.00 38.96  ? 117  LEU B C   1 
ATOM   4368  O  O   . LEU B 1 71  ? -21.540 -34.756 8.814   1.00 39.26  ? 117  LEU B O   1 
ATOM   4369  C  CB  . LEU B 1 71  ? -20.395 -37.419 8.072   1.00 37.96  ? 117  LEU B CB  1 
ATOM   4370  C  CG  . LEU B 1 71  ? -19.247 -38.370 8.413   1.00 37.27  ? 117  LEU B CG  1 
ATOM   4371  C  CD1 . LEU B 1 71  ? -19.848 -39.559 9.198   1.00 35.58  ? 117  LEU B CD1 1 
ATOM   4372  C  CD2 . LEU B 1 71  ? -18.481 -38.852 7.190   1.00 35.09  ? 117  LEU B CD2 1 
ATOM   4373  N  N   . ASN B 1 72  ? -22.116 -34.861 6.647   1.00 38.90  ? 118  ASN B N   1 
ATOM   4374  C  CA  . ASN B 1 72  ? -23.161 -33.893 6.789   1.00 38.83  ? 118  ASN B CA  1 
ATOM   4375  C  C   . ASN B 1 72  ? -24.453 -34.609 6.990   1.00 38.98  ? 118  ASN B C   1 
ATOM   4376  O  O   . ASN B 1 72  ? -25.070 -35.039 6.022   1.00 38.84  ? 118  ASN B O   1 
ATOM   4377  C  CB  . ASN B 1 72  ? -23.231 -33.048 5.525   1.00 39.07  ? 118  ASN B CB  1 
ATOM   4378  C  CG  . ASN B 1 72  ? -24.325 -32.048 5.563   1.00 39.68  ? 118  ASN B CG  1 
ATOM   4379  O  OD1 . ASN B 1 72  ? -25.085 -31.974 6.540   1.00 43.20  ? 118  ASN B OD1 1 
ATOM   4380  N  ND2 . ASN B 1 72  ? -24.425 -31.255 4.505   1.00 37.68  ? 118  ASN B ND2 1 
ATOM   4381  N  N   . PHE B 1 73  ? -24.861 -34.715 8.253   1.00 39.62  ? 119  PHE B N   1 
ATOM   4382  C  CA  . PHE B 1 73  ? -26.079 -35.421 8.633   1.00 40.02  ? 119  PHE B CA  1 
ATOM   4383  C  C   . PHE B 1 73  ? -27.397 -34.758 8.242   1.00 40.77  ? 119  PHE B C   1 
ATOM   4384  O  O   . PHE B 1 73  ? -28.475 -35.287 8.518   1.00 41.25  ? 119  PHE B O   1 
ATOM   4385  C  CB  . PHE B 1 73  ? -26.052 -35.758 10.103  1.00 39.73  ? 119  PHE B CB  1 
ATOM   4386  C  CG  . PHE B 1 73  ? -25.466 -37.103 10.381  1.00 39.40  ? 119  PHE B CG  1 
ATOM   4387  C  CD1 . PHE B 1 73  ? -24.086 -37.331 10.207  1.00 40.88  ? 119  PHE B CD1 1 
ATOM   4388  C  CD2 . PHE B 1 73  ? -26.275 -38.145 10.775  1.00 36.65  ? 119  PHE B CD2 1 
ATOM   4389  C  CE1 . PHE B 1 73  ? -23.536 -38.573 10.453  1.00 40.91  ? 119  PHE B CE1 1 
ATOM   4390  C  CE2 . PHE B 1 73  ? -25.741 -39.383 11.027  1.00 37.33  ? 119  PHE B CE2 1 
ATOM   4391  C  CZ  . PHE B 1 73  ? -24.366 -39.610 10.869  1.00 39.20  ? 119  PHE B CZ  1 
ATOM   4392  N  N   . SER B 1 74  ? -27.301 -33.614 7.570   1.00 41.15  ? 120  SER B N   1 
ATOM   4393  C  CA  . SER B 1 74  ? -28.441 -32.993 6.940   1.00 41.34  ? 120  SER B CA  1 
ATOM   4394  C  C   . SER B 1 74  ? -28.981 -33.852 5.776   1.00 41.75  ? 120  SER B C   1 
ATOM   4395  O  O   . SER B 1 74  ? -30.097 -33.653 5.307   1.00 41.92  ? 120  SER B O   1 
ATOM   4396  C  CB  . SER B 1 74  ? -28.005 -31.639 6.411   1.00 41.27  ? 120  SER B CB  1 
ATOM   4397  O  OG  . SER B 1 74  ? -28.871 -30.616 6.842   1.00 41.85  ? 120  SER B OG  1 
ATOM   4398  N  N   . HIS B 1 75  ? -28.174 -34.797 5.303   1.00 42.07  ? 121  HIS B N   1 
ATOM   4399  C  CA  . HIS B 1 75  ? -28.530 -35.672 4.182   1.00 42.37  ? 121  HIS B CA  1 
ATOM   4400  C  C   . HIS B 1 75  ? -28.003 -37.086 4.417   1.00 42.53  ? 121  HIS B C   1 
ATOM   4401  O  O   . HIS B 1 75  ? -26.898 -37.264 4.932   1.00 43.18  ? 121  HIS B O   1 
ATOM   4402  C  CB  . HIS B 1 75  ? -27.911 -35.146 2.892   1.00 42.23  ? 121  HIS B CB  1 
ATOM   4403  C  CG  . HIS B 1 75  ? -28.300 -33.738 2.558   1.00 43.47  ? 121  HIS B CG  1 
ATOM   4404  N  ND1 . HIS B 1 75  ? -29.520 -33.408 2.005   1.00 44.02  ? 121  HIS B ND1 1 
ATOM   4405  C  CD2 . HIS B 1 75  ? -27.619 -32.574 2.682   1.00 43.59  ? 121  HIS B CD2 1 
ATOM   4406  C  CE1 . HIS B 1 75  ? -29.577 -32.102 1.812   1.00 44.34  ? 121  HIS B CE1 1 
ATOM   4407  N  NE2 . HIS B 1 75  ? -28.435 -31.571 2.216   1.00 43.77  ? 121  HIS B NE2 1 
ATOM   4408  N  N   . GLY B 1 76  ? -28.785 -38.091 4.037   1.00 42.19  ? 122  GLY B N   1 
ATOM   4409  C  CA  . GLY B 1 76  ? -28.319 -39.466 4.115   1.00 41.91  ? 122  GLY B CA  1 
ATOM   4410  C  C   . GLY B 1 76  ? -28.734 -40.149 5.399   1.00 41.98  ? 122  GLY B C   1 
ATOM   4411  O  O   . GLY B 1 76  ? -28.922 -39.507 6.434   1.00 42.57  ? 122  GLY B O   1 
ATOM   4412  N  N   . SER B 1 77  ? -28.876 -41.465 5.319   1.00 41.32  ? 123  SER B N   1 
ATOM   4413  C  CA  . SER B 1 77  ? -29.325 -42.262 6.435   1.00 40.62  ? 123  SER B CA  1 
ATOM   4414  C  C   . SER B 1 77  ? -28.122 -42.701 7.271   1.00 40.42  ? 123  SER B C   1 
ATOM   4415  O  O   . SER B 1 77  ? -26.975 -42.379 6.952   1.00 40.28  ? 123  SER B O   1 
ATOM   4416  C  CB  . SER B 1 77  ? -30.078 -43.476 5.907   1.00 40.45  ? 123  SER B CB  1 
ATOM   4417  O  OG  . SER B 1 77  ? -29.208 -44.272 5.118   1.00 40.25  ? 123  SER B OG  1 
ATOM   4418  N  N   . HIS B 1 78  ? -28.397 -43.444 8.337   1.00 40.10  ? 124  HIS B N   1 
ATOM   4419  C  CA  . HIS B 1 78  ? -27.364 -43.938 9.227   1.00 39.98  ? 124  HIS B CA  1 
ATOM   4420  C  C   . HIS B 1 78  ? -26.501 -44.948 8.500   1.00 40.52  ? 124  HIS B C   1 
ATOM   4421  O  O   . HIS B 1 78  ? -25.284 -44.958 8.635   1.00 40.56  ? 124  HIS B O   1 
ATOM   4422  C  CB  . HIS B 1 78  ? -28.017 -44.591 10.449  1.00 39.55  ? 124  HIS B CB  1 
ATOM   4423  C  CG  . HIS B 1 78  ? -28.360 -43.624 11.535  1.00 38.18  ? 124  HIS B CG  1 
ATOM   4424  N  ND1 . HIS B 1 78  ? -28.377 -42.259 11.338  1.00 38.28  ? 124  HIS B ND1 1 
ATOM   4425  C  CD2 . HIS B 1 78  ? -28.712 -43.823 12.826  1.00 37.54  ? 124  HIS B CD2 1 
ATOM   4426  C  CE1 . HIS B 1 78  ? -28.715 -41.659 12.464  1.00 37.63  ? 124  HIS B CE1 1 
ATOM   4427  N  NE2 . HIS B 1 78  ? -28.925 -42.587 13.384  1.00 37.62  ? 124  HIS B NE2 1 
ATOM   4428  N  N   . GLU B 1 79  ? -27.155 -45.808 7.733   1.00 41.13  ? 125  GLU B N   1 
ATOM   4429  C  CA  . GLU B 1 79  ? -26.475 -46.802 6.943   1.00 41.87  ? 125  GLU B CA  1 
ATOM   4430  C  C   . GLU B 1 79  ? -25.516 -46.097 6.004   1.00 41.96  ? 125  GLU B C   1 
ATOM   4431  O  O   . GLU B 1 79  ? -24.370 -46.530 5.832   1.00 42.14  ? 125  GLU B O   1 
ATOM   4432  C  CB  . GLU B 1 79  ? -27.498 -47.619 6.167   1.00 41.99  ? 125  GLU B CB  1 
ATOM   4433  C  CG  . GLU B 1 79  ? -28.522 -48.360 7.079   1.00 45.42  ? 125  GLU B CG  1 
ATOM   4434  C  CD  . GLU B 1 79  ? -29.542 -47.429 7.777   1.00 49.41  ? 125  GLU B CD  1 
ATOM   4435  O  OE1 . GLU B 1 79  ? -29.877 -46.354 7.228   1.00 50.63  ? 125  GLU B OE1 1 
ATOM   4436  O  OE2 . GLU B 1 79  ? -30.016 -47.784 8.879   1.00 51.60  ? 125  GLU B OE2 1 
ATOM   4437  N  N   . TYR B 1 80  ? -25.986 -44.987 5.433   1.00 41.73  ? 126  TYR B N   1 
ATOM   4438  C  CA  . TYR B 1 80  ? -25.255 -44.261 4.433   1.00 41.63  ? 126  TYR B CA  1 
ATOM   4439  C  C   . TYR B 1 80  ? -23.979 -43.688 5.033   1.00 41.69  ? 126  TYR B C   1 
ATOM   4440  O  O   . TYR B 1 80  ? -22.915 -43.660 4.378   1.00 42.15  ? 126  TYR B O   1 
ATOM   4441  C  CB  . TYR B 1 80  ? -26.132 -43.152 3.845   1.00 41.91  ? 126  TYR B CB  1 
ATOM   4442  C  CG  . TYR B 1 80  ? -25.405 -42.243 2.887   1.00 42.50  ? 126  TYR B CG  1 
ATOM   4443  C  CD1 . TYR B 1 80  ? -25.380 -42.517 1.513   1.00 42.67  ? 126  TYR B CD1 1 
ATOM   4444  C  CD2 . TYR B 1 80  ? -24.725 -41.111 3.355   1.00 42.91  ? 126  TYR B CD2 1 
ATOM   4445  C  CE1 . TYR B 1 80  ? -24.696 -41.676 0.627   1.00 41.35  ? 126  TYR B CE1 1 
ATOM   4446  C  CE2 . TYR B 1 80  ? -24.032 -40.274 2.485   1.00 42.76  ? 126  TYR B CE2 1 
ATOM   4447  C  CZ  . TYR B 1 80  ? -24.025 -40.567 1.129   1.00 43.00  ? 126  TYR B CZ  1 
ATOM   4448  O  OH  . TYR B 1 80  ? -23.367 -39.745 0.269   1.00 45.48  ? 126  TYR B OH  1 
ATOM   4449  N  N   . HIS B 1 81  ? -24.079 -43.214 6.269   1.00 41.38  ? 127  HIS B N   1 
ATOM   4450  C  CA  . HIS B 1 81  ? -22.923 -42.596 6.923   1.00 41.01  ? 127  HIS B CA  1 
ATOM   4451  C  C   . HIS B 1 81  ? -21.949 -43.632 7.472   1.00 41.02  ? 127  HIS B C   1 
ATOM   4452  O  O   . HIS B 1 81  ? -20.742 -43.376 7.586   1.00 41.55  ? 127  HIS B O   1 
ATOM   4453  C  CB  . HIS B 1 81  ? -23.350 -41.609 8.012   1.00 40.80  ? 127  HIS B CB  1 
ATOM   4454  C  CG  . HIS B 1 81  ? -24.066 -40.415 7.481   1.00 40.27  ? 127  HIS B CG  1 
ATOM   4455  N  ND1 . HIS B 1 81  ? -23.445 -39.449 6.712   1.00 40.47  ? 127  HIS B ND1 1 
ATOM   4456  C  CD2 . HIS B 1 81  ? -25.362 -40.040 7.583   1.00 41.43  ? 127  HIS B CD2 1 
ATOM   4457  C  CE1 . HIS B 1 81  ? -24.330 -38.532 6.363   1.00 40.56  ? 127  HIS B CE1 1 
ATOM   4458  N  NE2 . HIS B 1 81  ? -25.501 -38.868 6.877   1.00 42.46  ? 127  HIS B NE2 1 
ATOM   4459  N  N   . ALA B 1 82  ? -22.476 -44.802 7.800   1.00 40.69  ? 128  ALA B N   1 
ATOM   4460  C  CA  . ALA B 1 82  ? -21.656 -45.922 8.204   1.00 40.63  ? 128  ALA B CA  1 
ATOM   4461  C  C   . ALA B 1 82  ? -20.741 -46.326 7.054   1.00 40.75  ? 128  ALA B C   1 
ATOM   4462  O  O   . ALA B 1 82  ? -19.543 -46.501 7.262   1.00 41.31  ? 128  ALA B O   1 
ATOM   4463  C  CB  . ALA B 1 82  ? -22.523 -47.075 8.631   1.00 40.32  ? 128  ALA B CB  1 
ATOM   4464  N  N   . GLU B 1 83  ? -21.297 -46.433 5.843   1.00 40.58  ? 129  GLU B N   1 
ATOM   4465  C  CA  . GLU B 1 83  ? -20.505 -46.733 4.637   1.00 40.45  ? 129  GLU B CA  1 
ATOM   4466  C  C   . GLU B 1 83  ? -19.382 -45.716 4.463   1.00 40.47  ? 129  GLU B C   1 
ATOM   4467  O  O   . GLU B 1 83  ? -18.270 -46.074 4.092   1.00 40.44  ? 129  GLU B O   1 
ATOM   4468  C  CB  . GLU B 1 83  ? -21.389 -46.798 3.368   1.00 40.31  ? 129  GLU B CB  1 
ATOM   4469  C  CG  . GLU B 1 83  ? -22.386 -48.002 3.331   1.00 40.83  ? 129  GLU B CG  1 
ATOM   4470  C  CD  . GLU B 1 83  ? -23.462 -47.923 2.211   1.00 41.33  ? 129  GLU B CD  1 
ATOM   4471  O  OE1 . GLU B 1 83  ? -23.551 -46.876 1.513   1.00 39.56  ? 129  GLU B OE1 1 
ATOM   4472  O  OE2 . GLU B 1 83  ? -24.226 -48.912 2.032   1.00 41.74  ? 129  GLU B OE2 1 
ATOM   4473  N  N   . SER B 1 84  ? -19.686 -44.452 4.751   1.00 40.63  ? 130  SER B N   1 
ATOM   4474  C  CA  . SER B 1 84  ? -18.744 -43.353 4.584   1.00 40.69  ? 130  SER B CA  1 
ATOM   4475  C  C   . SER B 1 84  ? -17.584 -43.498 5.539   1.00 40.58  ? 130  SER B C   1 
ATOM   4476  O  O   . SER B 1 84  ? -16.415 -43.379 5.165   1.00 40.76  ? 130  SER B O   1 
ATOM   4477  C  CB  . SER B 1 84  ? -19.443 -42.032 4.857   1.00 40.53  ? 130  SER B CB  1 
ATOM   4478  O  OG  . SER B 1 84  ? -20.234 -41.661 3.759   1.00 42.01  ? 130  SER B OG  1 
ATOM   4479  N  N   . ILE B 1 85  ? -17.925 -43.766 6.788   1.00 40.25  ? 131  ILE B N   1 
ATOM   4480  C  CA  . ILE B 1 85  ? -16.929 -43.955 7.821   1.00 39.21  ? 131  ILE B CA  1 
ATOM   4481  C  C   . ILE B 1 85  ? -16.062 -45.113 7.393   1.00 39.34  ? 131  ILE B C   1 
ATOM   4482  O  O   . ILE B 1 85  ? -14.842 -44.973 7.310   1.00 39.39  ? 131  ILE B O   1 
ATOM   4483  C  CB  . ILE B 1 85  ? -17.597 -44.200 9.182   1.00 38.82  ? 131  ILE B CB  1 
ATOM   4484  C  CG1 . ILE B 1 85  ? -18.164 -42.877 9.718   1.00 37.77  ? 131  ILE B CG1 1 
ATOM   4485  C  CG2 . ILE B 1 85  ? -16.603 -44.772 10.165  1.00 37.86  ? 131  ILE B CG2 1 
ATOM   4486  C  CD1 . ILE B 1 85  ? -19.187 -43.008 10.819  1.00 35.72  ? 131  ILE B CD1 1 
ATOM   4487  N  N   . ALA B 1 86  ? -16.706 -46.231 7.060   1.00 39.10  ? 132  ALA B N   1 
ATOM   4488  C  CA  . ALA B 1 86  ? -15.999 -47.429 6.633   1.00 39.05  ? 132  ALA B CA  1 
ATOM   4489  C  C   . ALA B 1 86  ? -15.015 -47.135 5.497   1.00 39.29  ? 132  ALA B C   1 
ATOM   4490  O  O   . ALA B 1 86  ? -13.861 -47.602 5.528   1.00 39.43  ? 132  ALA B O   1 
ATOM   4491  C  CB  . ALA B 1 86  ? -16.971 -48.491 6.221   1.00 38.55  ? 132  ALA B CB  1 
ATOM   4492  N  N   . ASN B 1 87  ? -15.453 -46.343 4.517   1.00 38.89  ? 133  ASN B N   1 
ATOM   4493  C  CA  . ASN B 1 87  ? -14.631 -46.122 3.353   1.00 38.71  ? 133  ASN B CA  1 
ATOM   4494  C  C   . ASN B 1 87  ? -13.447 -45.247 3.707   1.00 38.95  ? 133  ASN B C   1 
ATOM   4495  O  O   . ASN B 1 87  ? -12.329 -45.504 3.264   1.00 39.26  ? 133  ASN B O   1 
ATOM   4496  C  CB  . ASN B 1 87  ? -15.448 -45.552 2.200   1.00 38.47  ? 133  ASN B CB  1 
ATOM   4497  C  CG  . ASN B 1 87  ? -16.381 -46.577 1.569   1.00 37.92  ? 133  ASN B CG  1 
ATOM   4498  O  OD1 . ASN B 1 87  ? -17.112 -46.248 0.648   1.00 36.45  ? 133  ASN B OD1 1 
ATOM   4499  N  ND2 . ASN B 1 87  ? -16.358 -47.816 2.055   1.00 37.08  ? 133  ASN B ND2 1 
ATOM   4500  N  N   . VAL B 1 88  ? -13.696 -44.230 4.527   1.00 38.75  ? 134  VAL B N   1 
ATOM   4501  C  CA  . VAL B 1 88  ? -12.637 -43.336 4.966   1.00 38.36  ? 134  VAL B CA  1 
ATOM   4502  C  C   . VAL B 1 88  ? -11.572 -44.166 5.653   1.00 38.43  ? 134  VAL B C   1 
ATOM   4503  O  O   . VAL B 1 88  ? -10.409 -44.184 5.240   1.00 38.42  ? 134  VAL B O   1 
ATOM   4504  C  CB  . VAL B 1 88  ? -13.156 -42.215 5.917   1.00 38.48  ? 134  VAL B CB  1 
ATOM   4505  C  CG1 . VAL B 1 88  ? -12.004 -41.471 6.541   1.00 37.68  ? 134  VAL B CG1 1 
ATOM   4506  C  CG2 . VAL B 1 88  ? -14.029 -41.210 5.167   1.00 37.85  ? 134  VAL B CG2 1 
ATOM   4507  N  N   . ARG B 1 89  ? -12.003 -44.897 6.679   1.00 38.19  ? 135  ARG B N   1 
ATOM   4508  C  CA  . ARG B 1 89  ? -11.099 -45.729 7.470   1.00 37.30  ? 135  ARG B CA  1 
ATOM   4509  C  C   . ARG B 1 89  ? -10.285 -46.665 6.612   1.00 37.62  ? 135  ARG B C   1 
ATOM   4510  O  O   . ARG B 1 89  ? -9.088  -46.796 6.827   1.00 37.88  ? 135  ARG B O   1 
ATOM   4511  C  CB  . ARG B 1 89  ? -11.843 -46.469 8.577   1.00 36.31  ? 135  ARG B CB  1 
ATOM   4512  C  CG  . ARG B 1 89  ? -12.015 -45.583 9.778   1.00 34.21  ? 135  ARG B CG  1 
ATOM   4513  C  CD  . ARG B 1 89  ? -12.897 -46.172 10.847  1.00 32.67  ? 135  ARG B CD  1 
ATOM   4514  N  NE  . ARG B 1 89  ? -13.266 -45.132 11.820  1.00 34.05  ? 135  ARG B NE  1 
ATOM   4515  C  CZ  . ARG B 1 89  ? -14.331 -45.179 12.620  1.00 32.34  ? 135  ARG B CZ  1 
ATOM   4516  N  NH1 . ARG B 1 89  ? -15.154 -46.223 12.589  1.00 30.41  ? 135  ARG B NH1 1 
ATOM   4517  N  NH2 . ARG B 1 89  ? -14.571 -44.169 13.452  1.00 30.91  ? 135  ARG B NH2 1 
ATOM   4518  N  N   . GLU B 1 90  ? -10.920 -47.277 5.618   1.00 37.88  ? 136  GLU B N   1 
ATOM   4519  C  CA  . GLU B 1 90  ? -10.181 -48.106 4.672   1.00 38.37  ? 136  GLU B CA  1 
ATOM   4520  C  C   . GLU B 1 90  ? -9.127  -47.295 3.894   1.00 38.69  ? 136  GLU B C   1 
ATOM   4521  O  O   . GLU B 1 90  ? -7.954  -47.672 3.853   1.00 38.98  ? 136  GLU B O   1 
ATOM   4522  C  CB  . GLU B 1 90  ? -11.131 -48.817 3.711   1.00 38.32  ? 136  GLU B CB  1 
ATOM   4523  C  CG  . GLU B 1 90  ? -10.462 -49.902 2.884   1.00 38.99  ? 136  GLU B CG  1 
ATOM   4524  C  CD  . GLU B 1 90  ? -11.446 -50.696 2.041   1.00 40.89  ? 136  GLU B CD  1 
ATOM   4525  O  OE1 . GLU B 1 90  ? -12.682 -50.599 2.272   1.00 41.44  ? 136  GLU B OE1 1 
ATOM   4526  O  OE2 . GLU B 1 90  ? -10.975 -51.438 1.149   1.00 41.44  ? 136  GLU B OE2 1 
ATOM   4527  N  N   . ALA B 1 91  ? -9.548  -46.184 3.290   1.00 38.53  ? 137  ALA B N   1 
ATOM   4528  C  CA  . ALA B 1 91  ? -8.654  -45.366 2.520   1.00 38.49  ? 137  ALA B CA  1 
ATOM   4529  C  C   . ALA B 1 91  ? -7.491  -44.976 3.417   1.00 38.87  ? 137  ALA B C   1 
ATOM   4530  O  O   . ALA B 1 91  ? -6.327  -45.005 2.998   1.00 39.08  ? 137  ALA B O   1 
ATOM   4531  C  CB  . ALA B 1 91  ? -9.373  -44.141 2.004   1.00 38.05  ? 137  ALA B CB  1 
ATOM   4532  N  N   . VAL B 1 92  ? -7.796  -44.644 4.666   1.00 39.23  ? 138  VAL B N   1 
ATOM   4533  C  CA  . VAL B 1 92  ? -6.762  -44.125 5.548   1.00 39.66  ? 138  VAL B CA  1 
ATOM   4534  C  C   . VAL B 1 92  ? -5.777  -45.234 5.900   1.00 39.96  ? 138  VAL B C   1 
ATOM   4535  O  O   . VAL B 1 92  ? -4.564  -45.046 5.800   1.00 40.62  ? 138  VAL B O   1 
ATOM   4536  C  CB  . VAL B 1 92  ? -7.341  -43.495 6.821   1.00 39.71  ? 138  VAL B CB  1 
ATOM   4537  C  CG1 . VAL B 1 92  ? -6.249  -42.926 7.652   1.00 39.34  ? 138  VAL B CG1 1 
ATOM   4538  C  CG2 . VAL B 1 92  ? -8.356  -42.397 6.481   1.00 40.18  ? 138  VAL B CG2 1 
ATOM   4539  N  N   . GLU B 1 93  ? -6.299  -46.400 6.271   1.00 39.52  ? 139  GLU B N   1 
ATOM   4540  C  CA  . GLU B 1 93  ? -5.446  -47.501 6.696   1.00 39.26  ? 139  GLU B CA  1 
ATOM   4541  C  C   . GLU B 1 93  ? -4.660  -48.147 5.554   1.00 39.03  ? 139  GLU B C   1 
ATOM   4542  O  O   . GLU B 1 93  ? -3.825  -49.008 5.791   1.00 39.04  ? 139  GLU B O   1 
ATOM   4543  C  CB  . GLU B 1 93  ? -6.238  -48.580 7.471   1.00 39.02  ? 139  GLU B CB  1 
ATOM   4544  C  CG  . GLU B 1 93  ? -7.032  -48.104 8.701   1.00 39.61  ? 139  GLU B CG  1 
ATOM   4545  C  CD  . GLU B 1 93  ? -6.261  -47.152 9.619   1.00 42.11  ? 139  GLU B CD  1 
ATOM   4546  O  OE1 . GLU B 1 93  ? -5.267  -47.588 10.263  1.00 39.96  ? 139  GLU B OE1 1 
ATOM   4547  O  OE2 . GLU B 1 93  ? -6.668  -45.963 9.699   1.00 44.60  ? 139  GLU B OE2 1 
ATOM   4548  N  N   . SER B 1 94  ? -4.918  -47.733 4.323   1.00 38.99  ? 140  SER B N   1 
ATOM   4549  C  CA  . SER B 1 94  ? -4.206  -48.296 3.171   1.00 38.96  ? 140  SER B CA  1 
ATOM   4550  C  C   . SER B 1 94  ? -2.772  -47.792 3.094   1.00 39.20  ? 140  SER B C   1 
ATOM   4551  O  O   . SER B 1 94  ? -1.973  -48.271 2.310   1.00 38.59  ? 140  SER B O   1 
ATOM   4552  C  CB  . SER B 1 94  ? -4.947  -48.004 1.858   1.00 38.69  ? 140  SER B CB  1 
ATOM   4553  O  OG  . SER B 1 94  ? -4.788  -46.657 1.453   1.00 38.85  ? 140  SER B OG  1 
ATOM   4554  N  N   . PHE B 1 95  ? -2.469  -46.796 3.911   1.00 39.96  ? 141  PHE B N   1 
ATOM   4555  C  CA  . PHE B 1 95  ? -1.142  -46.208 3.971   1.00 40.30  ? 141  PHE B CA  1 
ATOM   4556  C  C   . PHE B 1 95  ? -0.396  -46.668 5.222   1.00 41.36  ? 141  PHE B C   1 
ATOM   4557  O  O   . PHE B 1 95  ? 0.657   -46.103 5.557   1.00 41.83  ? 141  PHE B O   1 
ATOM   4558  C  CB  . PHE B 1 95  ? -1.261  -44.686 4.052   1.00 39.75  ? 141  PHE B CB  1 
ATOM   4559  C  CG  . PHE B 1 95  ? -1.921  -44.056 2.882   1.00 37.42  ? 141  PHE B CG  1 
ATOM   4560  C  CD1 . PHE B 1 95  ? -3.289  -43.806 2.897   1.00 35.59  ? 141  PHE B CD1 1 
ATOM   4561  C  CD2 . PHE B 1 95  ? -1.164  -43.673 1.769   1.00 35.30  ? 141  PHE B CD2 1 
ATOM   4562  C  CE1 . PHE B 1 95  ? -3.910  -43.188 1.803   1.00 35.96  ? 141  PHE B CE1 1 
ATOM   4563  C  CE2 . PHE B 1 95  ? -1.765  -43.058 0.660   1.00 34.36  ? 141  PHE B CE2 1 
ATOM   4564  C  CZ  . PHE B 1 95  ? -3.147  -42.804 0.678   1.00 35.05  ? 141  PHE B CZ  1 
ATOM   4565  N  N   . ALA B 1 96  ? -0.942  -47.660 5.935   1.00 42.11  ? 142  ALA B N   1 
ATOM   4566  C  CA  . ALA B 1 96  ? -0.403  -48.019 7.259   1.00 42.63  ? 142  ALA B CA  1 
ATOM   4567  C  C   . ALA B 1 96  ? 0.855   -48.821 7.051   1.00 43.15  ? 142  ALA B C   1 
ATOM   4568  O  O   . ALA B 1 96  ? 1.599   -49.113 8.016   1.00 43.48  ? 142  ALA B O   1 
ATOM   4569  C  CB  . ALA B 1 96  ? -1.430  -48.790 8.110   1.00 42.36  ? 142  ALA B CB  1 
ATOM   4570  N  N   . GLY B 1 97  ? 1.097   -49.135 5.772   1.00 43.63  ? 143  GLY B N   1 
ATOM   4571  C  CA  . GLY B 1 97  ? 2.324   -49.786 5.331   1.00 44.03  ? 143  GLY B CA  1 
ATOM   4572  C  C   . GLY B 1 97  ? 3.599   -49.145 5.860   1.00 44.41  ? 143  GLY B C   1 
ATOM   4573  O  O   . GLY B 1 97  ? 4.684   -49.744 5.853   1.00 44.58  ? 143  GLY B O   1 
ATOM   4574  N  N   . SER B 1 98  ? 3.483   -47.928 6.357   1.00 44.56  ? 144  SER B N   1 
ATOM   4575  C  CA  . SER B 1 98  ? 4.671   -47.177 6.606   1.00 44.76  ? 144  SER B CA  1 
ATOM   4576  C  C   . SER B 1 98  ? 4.405   -46.108 7.670   1.00 44.73  ? 144  SER B C   1 
ATOM   4577  O  O   . SER B 1 98  ? 3.987   -44.976 7.333   1.00 44.26  ? 144  SER B O   1 
ATOM   4578  C  CB  . SER B 1 98  ? 5.041   -46.480 5.271   1.00 45.17  ? 144  SER B CB  1 
ATOM   4579  O  OG  . SER B 1 98  ? 6.624   -47.273 5.109   1.00 45.48  ? 144  SER B OG  1 
ATOM   4580  N  N   . PRO B 1 99  ? 4.658   -46.465 8.951   1.00 44.65  ? 145  PRO B N   1 
ATOM   4581  C  CA  . PRO B 1 99  ? 4.318   -45.624 10.115  1.00 44.64  ? 145  PRO B CA  1 
ATOM   4582  C  C   . PRO B 1 99  ? 4.942   -44.226 10.041  1.00 44.69  ? 145  PRO B C   1 
ATOM   4583  O  O   . PRO B 1 99  ? 4.344   -43.252 10.515  1.00 44.66  ? 145  PRO B O   1 
ATOM   4584  C  CB  . PRO B 1 99  ? 4.891   -46.401 11.316  1.00 44.84  ? 145  PRO B CB  1 
ATOM   4585  C  CG  . PRO B 1 99  ? 5.156   -47.801 10.827  1.00 44.48  ? 145  PRO B CG  1 
ATOM   4586  C  CD  . PRO B 1 99  ? 5.322   -47.734 9.332   1.00 44.60  ? 145  PRO B CD  1 
ATOM   4587  N  N   . LEU B 1 100 ? 6.130   -44.137 9.438   1.00 44.83  ? 146  LEU B N   1 
ATOM   4588  C  CA  . LEU B 1 100 ? 6.855   -42.861 9.274   1.00 44.71  ? 146  LEU B CA  1 
ATOM   4589  C  C   . LEU B 1 100 ? 6.170   -41.891 8.317   1.00 44.76  ? 146  LEU B C   1 
ATOM   4590  O  O   . LEU B 1 100 ? 6.449   -40.694 8.369   1.00 45.44  ? 146  LEU B O   1 
ATOM   4591  C  CB  . LEU B 1 100 ? 8.295   -43.099 8.804   1.00 44.51  ? 146  LEU B CB  1 
ATOM   4592  C  CG  . LEU B 1 100 ? 9.177   -43.958 9.710   1.00 44.60  ? 146  LEU B CG  1 
ATOM   4593  C  CD1 . LEU B 1 100 ? 10.487  -44.307 9.024   1.00 44.06  ? 146  LEU B CD1 1 
ATOM   4594  C  CD2 . LEU B 1 100 ? 9.418   -43.245 11.043  1.00 43.96  ? 146  LEU B CD2 1 
ATOM   4595  N  N   . SER B 1 101 ? 5.275   -42.394 7.465   1.00 44.35  ? 147  SER B N   1 
ATOM   4596  C  CA  . SER B 1 101 ? 4.592   -41.558 6.470   1.00 43.88  ? 147  SER B CA  1 
ATOM   4597  C  C   . SER B 1 101 ? 3.054   -41.456 6.669   1.00 43.58  ? 147  SER B C   1 
ATOM   4598  O  O   . SER B 1 101 ? 2.426   -40.502 6.180   1.00 43.48  ? 147  SER B O   1 
ATOM   4599  C  CB  . SER B 1 101 ? 4.985   -42.036 5.066   1.00 43.86  ? 147  SER B CB  1 
ATOM   4600  O  OG  . SER B 1 101 ? 4.007   -41.749 4.088   1.00 44.19  ? 147  SER B OG  1 
ATOM   4601  N  N   . TYR B 1 102 ? 2.477   -42.426 7.398   1.00 42.89  ? 148  TYR B N   1 
ATOM   4602  C  CA  . TYR B 1 102 ? 1.047   -42.498 7.729   1.00 42.18  ? 148  TYR B CA  1 
ATOM   4603  C  C   . TYR B 1 102 ? 0.377   -41.166 8.105   1.00 42.11  ? 148  TYR B C   1 
ATOM   4604  O  O   . TYR B 1 102 ? 0.816   -40.525 9.035   1.00 42.74  ? 148  TYR B O   1 
ATOM   4605  C  CB  . TYR B 1 102 ? 0.889   -43.444 8.904   1.00 41.71  ? 148  TYR B CB  1 
ATOM   4606  C  CG  . TYR B 1 102 ? -0.533  -43.607 9.401   1.00 41.33  ? 148  TYR B CG  1 
ATOM   4607  C  CD1 . TYR B 1 102 ? -1.468  -44.385 8.682   1.00 40.01  ? 148  TYR B CD1 1 
ATOM   4608  C  CD2 . TYR B 1 102 ? -0.945  -43.009 10.605  1.00 40.84  ? 148  TYR B CD2 1 
ATOM   4609  C  CE1 . TYR B 1 102 ? -2.785  -44.558 9.151   1.00 39.48  ? 148  TYR B CE1 1 
ATOM   4610  C  CE2 . TYR B 1 102 ? -2.262  -43.174 11.080  1.00 39.75  ? 148  TYR B CE2 1 
ATOM   4611  C  CZ  . TYR B 1 102 ? -3.176  -43.950 10.347  1.00 39.41  ? 148  TYR B CZ  1 
ATOM   4612  O  OH  . TYR B 1 102 ? -4.477  -44.120 10.806  1.00 38.84  ? 148  TYR B OH  1 
ATOM   4613  N  N   . ARG B 1 103 ? -0.697  -40.780 7.411   1.00 41.51  ? 149  ARG B N   1 
ATOM   4614  C  CA  . ARG B 1 103 ? -1.440  -39.550 7.708   1.00 41.15  ? 149  ARG B CA  1 
ATOM   4615  C  C   . ARG B 1 103 ? -2.790  -39.812 8.362   1.00 40.39  ? 149  ARG B C   1 
ATOM   4616  O  O   . ARG B 1 103 ? -3.719  -40.273 7.694   1.00 40.77  ? 149  ARG B O   1 
ATOM   4617  C  CB  . ARG B 1 103 ? -1.719  -38.758 6.422   1.00 41.79  ? 149  ARG B CB  1 
ATOM   4618  C  CG  . ARG B 1 103 ? -0.595  -37.847 5.899   1.00 43.49  ? 149  ARG B CG  1 
ATOM   4619  C  CD  . ARG B 1 103 ? -0.811  -37.581 4.400   1.00 47.75  ? 149  ARG B CD  1 
ATOM   4620  N  NE  . ARG B 1 103 ? -0.700  -38.805 3.573   1.00 50.93  ? 149  ARG B NE  1 
ATOM   4621  C  CZ  . ARG B 1 103 ? -0.058  -38.867 2.395   1.00 52.78  ? 149  ARG B CZ  1 
ATOM   4622  N  NH1 . ARG B 1 103 ? 0.543   -37.781 1.883   1.00 52.87  ? 149  ARG B NH1 1 
ATOM   4623  N  NH2 . ARG B 1 103 ? 0.010   -40.016 1.730   1.00 51.51  ? 149  ARG B NH2 1 
ATOM   4624  N  N   . PRO B 1 104 ? -2.928  -39.491 9.652   1.00 39.55  ? 150  PRO B N   1 
ATOM   4625  C  CA  . PRO B 1 104 ? -4.213  -39.697 10.315  1.00 39.44  ? 150  PRO B CA  1 
ATOM   4626  C  C   . PRO B 1 104 ? -5.296  -38.830 9.691   1.00 39.31  ? 150  PRO B C   1 
ATOM   4627  O  O   . PRO B 1 104 ? -5.042  -37.688 9.327   1.00 39.97  ? 150  PRO B O   1 
ATOM   4628  C  CB  . PRO B 1 104 ? -3.956  -39.198 11.741  1.00 39.33  ? 150  PRO B CB  1 
ATOM   4629  C  CG  . PRO B 1 104 ? -2.477  -39.195 11.911  1.00 39.98  ? 150  PRO B CG  1 
ATOM   4630  C  CD  . PRO B 1 104 ? -1.906  -38.937 10.552  1.00 39.39  ? 150  PRO B CD  1 
ATOM   4631  N  N   . VAL B 1 105 ? -6.513  -39.332 9.601   1.00 38.59  ? 151  VAL B N   1 
ATOM   4632  C  CA  . VAL B 1 105 ? -7.610  -38.484 9.117   1.00 37.64  ? 151  VAL B CA  1 
ATOM   4633  C  C   . VAL B 1 105 ? -8.758  -38.402 10.127  1.00 37.29  ? 151  VAL B C   1 
ATOM   4634  O  O   . VAL B 1 105 ? -9.303  -39.414 10.507  1.00 37.36  ? 151  VAL B O   1 
ATOM   4635  C  CB  . VAL B 1 105 ? -8.116  -38.985 7.749   1.00 37.60  ? 151  VAL B CB  1 
ATOM   4636  C  CG1 . VAL B 1 105 ? -9.456  -38.360 7.385   1.00 36.12  ? 151  VAL B CG1 1 
ATOM   4637  C  CG2 . VAL B 1 105 ? -7.067  -38.719 6.663   1.00 36.43  ? 151  VAL B CG2 1 
ATOM   4638  N  N   . ALA B 1 106 ? -9.124  -37.210 10.570  1.00 36.86  ? 152  ALA B N   1 
ATOM   4639  C  CA  . ALA B 1 106 ? -10.193 -37.126 11.539  1.00 36.82  ? 152  ALA B CA  1 
ATOM   4640  C  C   . ALA B 1 106 ? -11.510 -37.398 10.861  1.00 37.01  ? 152  ALA B C   1 
ATOM   4641  O  O   . ALA B 1 106 ? -11.571 -37.418 9.642   1.00 37.73  ? 152  ALA B O   1 
ATOM   4642  C  CB  . ALA B 1 106 ? -10.210 -35.791 12.177  1.00 36.46  ? 152  ALA B CB  1 
ATOM   4643  N  N   . ILE B 1 107 ? -12.559 -37.640 11.638  1.00 37.01  ? 153  ILE B N   1 
ATOM   4644  C  CA  . ILE B 1 107 ? -13.905 -37.754 11.086  1.00 36.76  ? 153  ILE B CA  1 
ATOM   4645  C  C   . ILE B 1 107 ? -14.854 -36.900 11.903  1.00 37.44  ? 153  ILE B C   1 
ATOM   4646  O  O   . ILE B 1 107 ? -14.993 -37.089 13.113  1.00 37.76  ? 153  ILE B O   1 
ATOM   4647  C  CB  . ILE B 1 107 ? -14.402 -39.189 11.090  1.00 36.43  ? 153  ILE B CB  1 
ATOM   4648  C  CG1 . ILE B 1 107 ? -13.546 -40.035 10.155  1.00 34.79  ? 153  ILE B CG1 1 
ATOM   4649  C  CG2 . ILE B 1 107 ? -15.867 -39.252 10.663  1.00 36.13  ? 153  ILE B CG2 1 
ATOM   4650  C  CD1 . ILE B 1 107 ? -14.005 -41.475 10.068  1.00 31.57  ? 153  ILE B CD1 1 
ATOM   4651  N  N   . ALA B 1 108 ? -15.500 -35.954 11.235  1.00 37.47  ? 154  ALA B N   1 
ATOM   4652  C  CA  . ALA B 1 108 ? -16.360 -35.017 11.909  1.00 37.27  ? 154  ALA B CA  1 
ATOM   4653  C  C   . ALA B 1 108 ? -17.791 -35.234 11.515  1.00 37.21  ? 154  ALA B C   1 
ATOM   4654  O  O   . ALA B 1 108 ? -18.120 -35.181 10.328  1.00 38.02  ? 154  ALA B O   1 
ATOM   4655  C  CB  . ALA B 1 108 ? -15.947 -33.618 11.571  1.00 37.24  ? 154  ALA B CB  1 
ATOM   4656  N  N   . LEU B 1 109 ? -18.641 -35.449 12.517  1.00 36.68  ? 155  LEU B N   1 
ATOM   4657  C  CA  . LEU B 1 109 ? -20.089 -35.571 12.323  1.00 36.34  ? 155  LEU B CA  1 
ATOM   4658  C  C   . LEU B 1 109 ? -20.744 -34.210 12.327  1.00 36.42  ? 155  LEU B C   1 
ATOM   4659  O  O   . LEU B 1 109 ? -20.731 -33.529 13.352  1.00 36.97  ? 155  LEU B O   1 
ATOM   4660  C  CB  . LEU B 1 109 ? -20.707 -36.421 13.441  1.00 36.05  ? 155  LEU B CB  1 
ATOM   4661  C  CG  . LEU B 1 109 ? -22.214 -36.686 13.344  1.00 36.12  ? 155  LEU B CG  1 
ATOM   4662  C  CD1 . LEU B 1 109 ? -22.561 -37.984 14.005  1.00 35.99  ? 155  LEU B CD1 1 
ATOM   4663  C  CD2 . LEU B 1 109 ? -23.079 -35.532 13.901  1.00 35.42  ? 155  LEU B CD2 1 
ATOM   4664  N  N   . ASP B 1 110 ? -21.331 -33.800 11.206  1.00 36.51  ? 156  ASP B N   1 
ATOM   4665  C  CA  . ASP B 1 110 ? -21.964 -32.458 11.165  1.00 36.46  ? 156  ASP B CA  1 
ATOM   4666  C  C   . ASP B 1 110 ? -23.467 -32.545 11.320  1.00 36.46  ? 156  ASP B C   1 
ATOM   4667  O  O   . ASP B 1 110 ? -24.163 -33.125 10.492  1.00 36.80  ? 156  ASP B O   1 
ATOM   4668  C  CB  . ASP B 1 110 ? -21.608 -31.682 9.907   1.00 36.23  ? 156  ASP B CB  1 
ATOM   4669  C  CG  . ASP B 1 110 ? -22.320 -30.349 9.825   1.00 36.23  ? 156  ASP B CG  1 
ATOM   4670  O  OD1 . ASP B 1 110 ? -23.515 -30.257 10.136  1.00 36.17  ? 156  ASP B OD1 1 
ATOM   4671  O  OD2 . ASP B 1 110 ? -21.706 -29.360 9.406   1.00 34.59  ? 156  ASP B OD2 1 
ATOM   4672  N  N   . THR B 1 111 ? -23.960 -31.929 12.376  1.00 36.32  ? 157  THR B N   1 
ATOM   4673  C  CA  . THR B 1 111 ? -25.330 -32.121 12.815  1.00 36.62  ? 157  THR B CA  1 
ATOM   4674  C  C   . THR B 1 111 ? -26.345 -31.465 11.886  1.00 37.24  ? 157  THR B C   1 
ATOM   4675  O  O   . THR B 1 111 ? -26.069 -30.424 11.303  1.00 37.67  ? 157  THR B O   1 
ATOM   4676  C  CB  . THR B 1 111 ? -25.467 -31.607 14.252  1.00 36.27  ? 157  THR B CB  1 
ATOM   4677  O  OG1 . THR B 1 111 ? -25.926 -32.662 15.065  1.00 36.03  ? 157  THR B OG1 1 
ATOM   4678  C  CG2 . THR B 1 111 ? -26.381 -30.410 14.379  1.00 35.41  ? 157  THR B CG2 1 
ATOM   4679  N  N   . LYS B 1 112 ? -27.513 -32.083 11.722  1.00 38.12  ? 158  LYS B N   1 
ATOM   4680  C  CA  . LYS B 1 112 ? -28.590 -31.420 10.978  1.00 38.30  ? 158  LYS B CA  1 
ATOM   4681  C  C   . LYS B 1 112 ? -29.082 -30.183 11.732  1.00 38.61  ? 158  LYS B C   1 
ATOM   4682  O  O   . LYS B 1 112 ? -28.963 -29.070 11.223  1.00 39.18  ? 158  LYS B O   1 
ATOM   4683  C  CB  . LYS B 1 112 ? -29.770 -32.342 10.673  1.00 38.43  ? 158  LYS B CB  1 
ATOM   4684  C  CG  . LYS B 1 112 ? -30.869 -31.595 9.927   1.00 38.99  ? 158  LYS B CG  1 
ATOM   4685  C  CD  . LYS B 1 112 ? -32.179 -32.328 9.955   1.00 39.96  ? 158  LYS B CD  1 
ATOM   4686  C  CE  . LYS B 1 112 ? -32.449 -32.981 8.581   1.00 42.19  ? 158  LYS B CE  1 
ATOM   4687  N  NZ  . LYS B 1 112 ? -33.366 -34.181 8.685   1.00 43.05  ? 158  LYS B NZ  1 
ATOM   4688  N  N   . GLY B 1 113 ? -29.641 -30.383 12.934  1.00 38.45  ? 159  GLY B N   1 
ATOM   4689  C  CA  . GLY B 1 113 ? -30.127 -29.264 13.741  1.00 38.47  ? 159  GLY B CA  1 
ATOM   4690  C  C   . GLY B 1 113 ? -31.436 -28.690 13.207  1.00 38.96  ? 159  GLY B C   1 
ATOM   4691  O  O   . GLY B 1 113 ? -32.106 -29.329 12.376  1.00 39.06  ? 159  GLY B O   1 
ATOM   4692  N  N   . PRO B 1 114 ? -31.823 -27.488 13.693  1.00 39.14  ? 160  PRO B N   1 
ATOM   4693  C  CA  . PRO B 1 114 ? -33.145 -26.940 13.377  1.00 39.46  ? 160  PRO B CA  1 
ATOM   4694  C  C   . PRO B 1 114 ? -33.271 -26.361 11.983  1.00 39.65  ? 160  PRO B C   1 
ATOM   4695  O  O   . PRO B 1 114 ? -33.687 -25.222 11.847  1.00 40.81  ? 160  PRO B O   1 
ATOM   4696  C  CB  . PRO B 1 114 ? -33.343 -25.847 14.434  1.00 39.55  ? 160  PRO B CB  1 
ATOM   4697  C  CG  . PRO B 1 114 ? -31.939 -25.473 14.874  1.00 39.09  ? 160  PRO B CG  1 
ATOM   4698  C  CD  . PRO B 1 114 ? -31.050 -26.629 14.613  1.00 39.13  ? 160  PRO B CD  1 
ATOM   4699  N  N   . GLU B 1 115 ? -32.954 -27.146 10.958  1.00 39.32  ? 161  GLU B N   1 
ATOM   4700  C  CA  . GLU B 1 115 ? -33.127 -26.707 9.577   1.00 39.04  ? 161  GLU B CA  1 
ATOM   4701  C  C   . GLU B 1 115 ? -34.586 -26.598 9.206   1.00 39.02  ? 161  GLU B C   1 
ATOM   4702  O  O   . GLU B 1 115 ? -35.466 -27.085 9.921   1.00 39.12  ? 161  GLU B O   1 
ATOM   4703  C  CB  . GLU B 1 115 ? -32.521 -27.715 8.608   1.00 38.92  ? 161  GLU B CB  1 
ATOM   4704  C  CG  . GLU B 1 115 ? -31.033 -27.696 8.508   1.00 38.86  ? 161  GLU B CG  1 
ATOM   4705  C  CD  . GLU B 1 115 ? -30.547 -28.423 7.279   1.00 38.56  ? 161  GLU B CD  1 
ATOM   4706  O  OE1 . GLU B 1 115 ? -31.349 -29.143 6.643   1.00 38.72  ? 161  GLU B OE1 1 
ATOM   4707  O  OE2 . GLU B 1 115 ? -29.351 -28.278 6.944   1.00 37.33  ? 161  GLU B OE2 1 
ATOM   4708  N  N   . ILE B 1 116 ? -34.817 -25.977 8.055   1.00 39.07  ? 162  ILE B N   1 
ATOM   4709  C  CA  . ILE B 1 116 ? -36.105 -26.012 7.388   1.00 38.96  ? 162  ILE B CA  1 
ATOM   4710  C  C   . ILE B 1 116 ? -35.793 -26.220 5.914   1.00 39.30  ? 162  ILE B C   1 
ATOM   4711  O  O   . ILE B 1 116 ? -34.898 -25.561 5.375   1.00 39.04  ? 162  ILE B O   1 
ATOM   4712  C  CB  . ILE B 1 116 ? -36.882 -24.691 7.574   1.00 38.68  ? 162  ILE B CB  1 
ATOM   4713  C  CG1 . ILE B 1 116 ? -36.969 -24.316 9.054   1.00 38.04  ? 162  ILE B CG1 1 
ATOM   4714  C  CG2 . ILE B 1 116 ? -38.246 -24.791 6.929   1.00 38.60  ? 162  ILE B CG2 1 
ATOM   4715  C  CD1 . ILE B 1 116 ? -37.089 -22.840 9.293   1.00 37.76  ? 162  ILE B CD1 1 
ATOM   4716  N  N   . ARG B 1 117 ? -36.517 -27.140 5.276   1.00 39.53  ? 163  ARG B N   1 
ATOM   4717  C  CA  . ARG B 1 117 ? -36.376 -27.381 3.843   1.00 39.85  ? 163  ARG B CA  1 
ATOM   4718  C  C   . ARG B 1 117 ? -37.734 -27.416 3.167   1.00 40.29  ? 163  ARG B C   1 
ATOM   4719  O  O   . ARG B 1 117 ? -38.749 -27.688 3.827   1.00 40.40  ? 163  ARG B O   1 
ATOM   4720  C  CB  . ARG B 1 117 ? -35.630 -28.681 3.599   1.00 39.73  ? 163  ARG B CB  1 
ATOM   4721  C  CG  . ARG B 1 117 ? -34.199 -28.599 4.053   1.00 39.78  ? 163  ARG B CG  1 
ATOM   4722  C  CD  . ARG B 1 117 ? -33.444 -29.887 3.855   1.00 40.18  ? 163  ARG B CD  1 
ATOM   4723  N  NE  . ARG B 1 117 ? -32.023 -29.640 4.065   1.00 40.75  ? 163  ARG B NE  1 
ATOM   4724  C  CZ  . ARG B 1 117 ? -31.195 -29.199 3.122   1.00 41.55  ? 163  ARG B CZ  1 
ATOM   4725  N  NH1 . ARG B 1 117 ? -31.642 -28.987 1.889   1.00 41.71  ? 163  ARG B NH1 1 
ATOM   4726  N  NH2 . ARG B 1 117 ? -29.912 -28.981 3.402   1.00 41.63  ? 163  ARG B NH2 1 
ATOM   4727  N  N   . THR B 1 118 ? -37.747 -27.116 1.863   1.00 40.53  ? 164  THR B N   1 
ATOM   4728  C  CA  . THR B 1 118 ? -38.961 -27.196 1.042   1.00 40.90  ? 164  THR B CA  1 
ATOM   4729  C  C   . THR B 1 118 ? -39.277 -28.648 0.721   1.00 41.13  ? 164  THR B C   1 
ATOM   4730  O  O   . THR B 1 118 ? -38.469 -29.535 1.019   1.00 41.17  ? 164  THR B O   1 
ATOM   4731  C  CB  . THR B 1 118 ? -38.841 -26.444 -0.299  1.00 41.03  ? 164  THR B CB  1 
ATOM   4732  O  OG1 . THR B 1 118 ? -37.842 -27.068 -1.121  1.00 41.44  ? 164  THR B OG1 1 
ATOM   4733  C  CG2 . THR B 1 118 ? -38.490 -24.986 -0.083  1.00 41.52  ? 164  THR B CG2 1 
ATOM   4734  N  N   . GLY B 1 119 ? -40.453 -28.878 0.120   1.00 41.33  ? 165  GLY B N   1 
ATOM   4735  C  CA  . GLY B 1 119 ? -40.908 -30.217 -0.296  1.00 41.06  ? 165  GLY B CA  1 
ATOM   4736  C  C   . GLY B 1 119 ? -40.309 -30.628 -1.634  1.00 41.06  ? 165  GLY B C   1 
ATOM   4737  O  O   . GLY B 1 119 ? -39.529 -29.867 -2.232  1.00 40.93  ? 165  GLY B O   1 
ATOM   4738  N  N   . ILE B 1 120 ? -40.675 -31.824 -2.108  1.00 40.99  ? 166  ILE B N   1 
ATOM   4739  C  CA  . ILE B 1 120 ? -40.100 -32.389 -3.341  1.00 40.95  ? 166  ILE B CA  1 
ATOM   4740  C  C   . ILE B 1 120 ? -40.717 -31.771 -4.603  1.00 41.07  ? 166  ILE B C   1 
ATOM   4741  O  O   . ILE B 1 120 ? -41.926 -32.103 -4.954  1.00 41.24  ? 166  ILE B O   1 
ATOM   4742  C  CB  . ILE B 1 120 ? -40.198 -33.945 -3.400  1.00 40.90  ? 166  ILE B CB  1 
ATOM   4743  C  CG1 . ILE B 1 120 ? -39.445 -34.584 -2.193  1.00 40.87  ? 166  ILE B CG1 1 
ATOM   4744  C  CG2 . ILE B 1 120 ? -39.629 -34.473 -4.737  1.00 40.59  ? 166  ILE B CG2 1 
ATOM   4745  C  CD1 . ILE B 1 120 ? -40.401 -35.090 -0.985  1.00 40.71  ? 166  ILE B CD1 1 
ATOM   4746  N  N   . VAL B 1 129 ? -39.660 -25.752 -11.447 1.00 41.66  ? 175  VAL B N   1 
ATOM   4747  C  CA  . VAL B 1 129 ? -40.631 -24.730 -11.062 1.00 41.86  ? 175  VAL B CA  1 
ATOM   4748  C  C   . VAL B 1 129 ? -39.970 -23.360 -10.865 1.00 41.81  ? 175  VAL B C   1 
ATOM   4749  O  O   . VAL B 1 129 ? -38.930 -23.246 -10.221 1.00 41.94  ? 175  VAL B O   1 
ATOM   4750  C  CB  . VAL B 1 129 ? -41.445 -25.168 -9.811  1.00 42.04  ? 175  VAL B CB  1 
ATOM   4751  C  CG1 . VAL B 1 129 ? -41.888 -23.984 -8.975  1.00 42.16  ? 175  VAL B CG1 1 
ATOM   4752  C  CG2 . VAL B 1 129 ? -42.650 -26.040 -10.219 1.00 42.28  ? 175  VAL B CG2 1 
ATOM   4753  N  N   . GLU B 1 130 ? -40.578 -22.325 -11.437 1.00 41.69  ? 176  GLU B N   1 
ATOM   4754  C  CA  . GLU B 1 130 ? -40.019 -20.979 -11.389 1.00 41.46  ? 176  GLU B CA  1 
ATOM   4755  C  C   . GLU B 1 130 ? -40.969 -20.015 -10.697 1.00 41.17  ? 176  GLU B C   1 
ATOM   4756  O  O   . GLU B 1 130 ? -42.059 -19.730 -11.194 1.00 41.14  ? 176  GLU B O   1 
ATOM   4757  C  CB  . GLU B 1 130 ? -39.715 -20.473 -12.797 1.00 41.49  ? 176  GLU B CB  1 
ATOM   4758  C  CG  . GLU B 1 130 ? -38.927 -19.183 -12.796 1.00 42.41  ? 176  GLU B CG  1 
ATOM   4759  C  CD  . GLU B 1 130 ? -39.537 -18.120 -13.679 1.00 43.48  ? 176  GLU B CD  1 
ATOM   4760  O  OE1 . GLU B 1 130 ? -40.124 -17.162 -13.135 1.00 44.00  ? 176  GLU B OE1 1 
ATOM   4761  O  OE2 . GLU B 1 130 ? -39.434 -18.242 -14.916 1.00 43.98  ? 176  GLU B OE2 1 
ATOM   4762  N  N   . LEU B 1 131 ? -40.539 -19.504 -9.552  1.00 40.93  ? 177  LEU B N   1 
ATOM   4763  C  CA  . LEU B 1 131 ? -41.365 -18.597 -8.762  1.00 40.81  ? 177  LEU B CA  1 
ATOM   4764  C  C   . LEU B 1 131 ? -41.292 -17.182 -9.345  1.00 40.72  ? 177  LEU B C   1 
ATOM   4765  O  O   . LEU B 1 131 ? -40.353 -16.430 -9.067  1.00 40.93  ? 177  LEU B O   1 
ATOM   4766  C  CB  . LEU B 1 131 ? -40.929 -18.620 -7.286  1.00 40.74  ? 177  LEU B CB  1 
ATOM   4767  C  CG  . LEU B 1 131 ? -41.101 -19.856 -6.372  1.00 40.79  ? 177  LEU B CG  1 
ATOM   4768  C  CD1 . LEU B 1 131 ? -41.875 -19.540 -5.091  1.00 41.23  ? 177  LEU B CD1 1 
ATOM   4769  C  CD2 . LEU B 1 131 ? -41.699 -21.073 -7.072  1.00 40.76  ? 177  LEU B CD2 1 
ATOM   4770  N  N   . VAL B 1 132 ? -42.285 -16.830 -10.162 1.00 40.43  ? 178  VAL B N   1 
ATOM   4771  C  CA  . VAL B 1 132 ? -42.308 -15.531 -10.838 1.00 40.18  ? 178  VAL B CA  1 
ATOM   4772  C  C   . VAL B 1 132 ? -42.292 -14.359 -9.852  1.00 40.10  ? 178  VAL B C   1 
ATOM   4773  O  O   . VAL B 1 132 ? -42.959 -14.395 -8.814  1.00 40.04  ? 178  VAL B O   1 
ATOM   4774  C  CB  . VAL B 1 132 ? -43.525 -15.397 -11.796 1.00 40.13  ? 178  VAL B CB  1 
ATOM   4775  C  CG1 . VAL B 1 132 ? -43.424 -14.121 -12.637 1.00 39.93  ? 178  VAL B CG1 1 
ATOM   4776  C  CG2 . VAL B 1 132 ? -43.630 -16.614 -12.706 1.00 40.11  ? 178  VAL B CG2 1 
ATOM   4777  N  N   . LYS B 1 133 ? -41.507 -13.335 -10.191 1.00 40.04  ? 179  LYS B N   1 
ATOM   4778  C  CA  . LYS B 1 133 ? -41.495 -12.062 -9.472  1.00 39.90  ? 179  LYS B CA  1 
ATOM   4779  C  C   . LYS B 1 133 ? -42.849 -11.338 -9.580  1.00 39.81  ? 179  LYS B C   1 
ATOM   4780  O  O   . LYS B 1 133 ? -43.319 -11.015 -10.682 1.00 39.62  ? 179  LYS B O   1 
ATOM   4781  C  CB  . LYS B 1 133 ? -40.363 -11.168 -9.990  1.00 39.80  ? 179  LYS B CB  1 
ATOM   4782  C  CG  . LYS B 1 133 ? -40.263 -9.834  -9.282  1.00 40.06  ? 179  LYS B CG  1 
ATOM   4783  C  CD  . LYS B 1 133 ? -39.008 -9.090  -9.685  1.00 41.40  ? 179  LYS B CD  1 
ATOM   4784  C  CE  . LYS B 1 133 ? -38.741 -7.936  -8.706  1.00 42.08  ? 179  LYS B CE  1 
ATOM   4785  N  NZ  . LYS B 1 133 ? -37.467 -7.234  -9.015  1.00 42.47  ? 179  LYS B NZ  1 
ATOM   4786  N  N   . GLY B 1 134 ? -43.461 -11.091 -8.421  1.00 39.70  ? 180  GLY B N   1 
ATOM   4787  C  CA  . GLY B 1 134 ? -44.754 -10.421 -8.339  1.00 39.55  ? 180  GLY B CA  1 
ATOM   4788  C  C   . GLY B 1 134 ? -45.858 -11.331 -7.830  1.00 39.48  ? 180  GLY B C   1 
ATOM   4789  O  O   . GLY B 1 134 ? -46.681 -10.919 -7.014  1.00 39.39  ? 180  GLY B O   1 
ATOM   4790  N  N   . SER B 1 135 ? -45.852 -12.577 -8.299  1.00 39.51  ? 181  SER B N   1 
ATOM   4791  C  CA  . SER B 1 135 ? -46.959 -13.516 -8.088  1.00 39.62  ? 181  SER B CA  1 
ATOM   4792  C  C   . SER B 1 135 ? -47.203 -13.920 -6.634  1.00 39.74  ? 181  SER B C   1 
ATOM   4793  O  O   . SER B 1 135 ? -46.346 -13.719 -5.770  1.00 39.65  ? 181  SER B O   1 
ATOM   4794  C  CB  . SER B 1 135 ? -46.750 -14.774 -8.938  1.00 39.62  ? 181  SER B CB  1 
ATOM   4795  O  OG  . SER B 1 135 ? -45.703 -15.574 -8.415  1.00 39.53  ? 181  SER B OG  1 
ATOM   4796  N  N   . GLN B 1 136 ? -48.390 -14.482 -6.393  1.00 40.07  ? 182  GLN B N   1 
ATOM   4797  C  CA  . GLN B 1 136 ? -48.753 -15.109 -5.117  1.00 40.41  ? 182  GLN B CA  1 
ATOM   4798  C  C   . GLN B 1 136 ? -48.083 -16.468 -4.934  1.00 40.63  ? 182  GLN B C   1 
ATOM   4799  O  O   . GLN B 1 136 ? -47.931 -17.235 -5.890  1.00 40.72  ? 182  GLN B O   1 
ATOM   4800  C  CB  . GLN B 1 136 ? -50.272 -15.304 -5.011  1.00 40.39  ? 182  GLN B CB  1 
ATOM   4801  C  CG  . GLN B 1 136 ? -50.943 -14.557 -3.866  1.00 40.56  ? 182  GLN B CG  1 
ATOM   4802  C  CD  . GLN B 1 136 ? -51.186 -13.101 -4.190  1.00 40.71  ? 182  GLN B CD  1 
ATOM   4803  O  OE1 . GLN B 1 136 ? -52.039 -12.808 -5.089  1.00 40.36  ? 182  GLN B OE1 1 
ATOM   4804  N  NE2 . GLN B 1 136 ? -50.429 -12.175 -3.458  1.00 40.68  ? 182  GLN B NE2 1 
ATOM   4805  N  N   . VAL B 1 137 ? -47.690 -16.755 -3.696  1.00 40.84  ? 183  VAL B N   1 
ATOM   4806  C  CA  . VAL B 1 137 ? -47.221 -18.079 -3.300  1.00 41.04  ? 183  VAL B CA  1 
ATOM   4807  C  C   . VAL B 1 137 ? -47.649 -18.345 -1.855  1.00 41.28  ? 183  VAL B C   1 
ATOM   4808  O  O   . VAL B 1 137 ? -47.297 -17.588 -0.944  1.00 41.24  ? 183  VAL B O   1 
ATOM   4809  C  CB  . VAL B 1 137 ? -45.678 -18.222 -3.445  1.00 41.15  ? 183  VAL B CB  1 
ATOM   4810  C  CG1 . VAL B 1 137 ? -45.155 -19.416 -2.636  1.00 40.84  ? 183  VAL B CG1 1 
ATOM   4811  C  CG2 . VAL B 1 137 ? -45.277 -18.344 -4.916  1.00 40.89  ? 183  VAL B CG2 1 
ATOM   4812  N  N   . LEU B 1 138 ? -48.430 -19.406 -1.658  1.00 41.56  ? 184  LEU B N   1 
ATOM   4813  C  CA  . LEU B 1 138 ? -48.801 -19.854 -0.318  1.00 41.75  ? 184  LEU B CA  1 
ATOM   4814  C  C   . LEU B 1 138 ? -47.708 -20.738 0.277   1.00 41.88  ? 184  LEU B C   1 
ATOM   4815  O  O   . LEU B 1 138 ? -47.005 -21.459 -0.448  1.00 41.78  ? 184  LEU B O   1 
ATOM   4816  C  CB  . LEU B 1 138 ? -50.136 -20.611 -0.347  1.00 41.68  ? 184  LEU B CB  1 
ATOM   4817  C  CG  . LEU B 1 138 ? -50.535 -21.447 0.882   1.00 41.93  ? 184  LEU B CG  1 
ATOM   4818  C  CD1 . LEU B 1 138 ? -50.849 -20.544 2.091   1.00 42.37  ? 184  LEU B CD1 1 
ATOM   4819  C  CD2 . LEU B 1 138 ? -51.735 -22.346 0.561   1.00 42.26  ? 184  LEU B CD2 1 
ATOM   4820  N  N   . VAL B 1 139 ? -47.566 -20.673 1.600   1.00 42.14  ? 185  VAL B N   1 
ATOM   4821  C  CA  . VAL B 1 139 ? -46.707 -21.612 2.314   1.00 42.45  ? 185  VAL B CA  1 
ATOM   4822  C  C   . VAL B 1 139 ? -47.548 -22.449 3.286   1.00 42.61  ? 185  VAL B C   1 
ATOM   4823  O  O   . VAL B 1 139 ? -48.402 -21.910 3.994   1.00 42.69  ? 185  VAL B O   1 
ATOM   4824  C  CB  . VAL B 1 139 ? -45.552 -20.896 3.066   1.00 42.58  ? 185  VAL B CB  1 
ATOM   4825  C  CG1 . VAL B 1 139 ? -44.531 -21.921 3.599   1.00 42.78  ? 185  VAL B CG1 1 
ATOM   4826  C  CG2 . VAL B 1 139 ? -44.848 -19.877 2.150   1.00 42.36  ? 185  VAL B CG2 1 
ATOM   4827  N  N   . THR B 1 140 ? -47.315 -23.764 3.287   1.00 42.75  ? 186  THR B N   1 
ATOM   4828  C  CA  . THR B 1 140 ? -47.949 -24.693 4.228   1.00 42.93  ? 186  THR B CA  1 
ATOM   4829  C  C   . THR B 1 140 ? -46.905 -25.597 4.878   1.00 42.80  ? 186  THR B C   1 
ATOM   4830  O  O   . THR B 1 140 ? -46.175 -26.319 4.185   1.00 42.58  ? 186  THR B O   1 
ATOM   4831  C  CB  . THR B 1 140 ? -49.012 -25.589 3.544   1.00 43.13  ? 186  THR B CB  1 
ATOM   4832  O  OG1 . THR B 1 140 ? -48.527 -25.962 2.182   1.00 43.39  ? 186  THR B OG1 1 
ATOM   4833  C  CG2 . THR B 1 140 ? -50.425 -24.847 3.345   1.00 43.67  ? 186  THR B CG2 1 
ATOM   4834  N  N   . ALA B 1 151 ? -45.212 -24.026 -7.920  1.00 39.81  ? 197  ALA B N   1 
ATOM   4835  C  CA  . ALA B 1 151 ? -45.209 -22.771 -8.667  1.00 39.81  ? 197  ALA B CA  1 
ATOM   4836  C  C   . ALA B 1 151 ? -45.884 -21.645 -7.884  1.00 39.80  ? 197  ALA B C   1 
ATOM   4837  O  O   . ALA B 1 151 ? -45.354 -20.535 -7.784  1.00 39.81  ? 197  ALA B O   1 
ATOM   4838  C  CB  . ALA B 1 151 ? -45.870 -22.962 -10.029 1.00 39.87  ? 197  ALA B CB  1 
ATOM   4839  N  N   . ASN B 1 152 ? -47.060 -21.944 -7.339  1.00 39.85  ? 198  ASN B N   1 
ATOM   4840  C  CA  . ASN B 1 152 ? -47.798 -21.024 -6.480  1.00 39.85  ? 198  ASN B CA  1 
ATOM   4841  C  C   . ASN B 1 152 ? -47.983 -21.686 -5.125  1.00 39.88  ? 198  ASN B C   1 
ATOM   4842  O  O   . ASN B 1 152 ? -48.782 -21.237 -4.297  1.00 39.95  ? 198  ASN B O   1 
ATOM   4843  C  CB  . ASN B 1 152 ? -49.165 -20.688 -7.093  1.00 39.82  ? 198  ASN B CB  1 
ATOM   4844  C  CG  . ASN B 1 152 ? -49.054 -19.908 -8.398  1.00 39.72  ? 198  ASN B CG  1 
ATOM   4845  O  OD1 . ASN B 1 152 ? -48.533 -18.790 -8.428  1.00 39.88  ? 198  ASN B OD1 1 
ATOM   4846  N  ND2 . ASN B 1 152 ? -49.558 -20.492 -9.481  1.00 38.96  ? 198  ASN B ND2 1 
ATOM   4847  N  N   . THR B 1 153 ? -47.240 -22.771 -4.915  1.00 39.85  ? 199  THR B N   1 
ATOM   4848  C  CA  . THR B 1 153 ? -47.356 -23.571 -3.702  1.00 39.76  ? 199  THR B CA  1 
ATOM   4849  C  C   . THR B 1 153 ? -46.018 -24.221 -3.332  1.00 39.88  ? 199  THR B C   1 
ATOM   4850  O  O   . THR B 1 153 ? -45.642 -25.244 -3.919  1.00 40.02  ? 199  THR B O   1 
ATOM   4851  C  CB  . THR B 1 153 ? -48.425 -24.667 -3.868  1.00 39.62  ? 199  THR B CB  1 
ATOM   4852  O  OG1 . THR B 1 153 ? -49.498 -24.172 -4.688  1.00 39.45  ? 199  THR B OG1 1 
ATOM   4853  C  CG2 . THR B 1 153 ? -48.979 -25.092 -2.510  1.00 39.76  ? 199  THR B CG2 1 
ATOM   4854  N  N   . VAL B 1 154 ? -45.301 -23.606 -2.382  1.00 39.75  ? 200  VAL B N   1 
ATOM   4855  C  CA  . VAL B 1 154 ? -44.145 -24.236 -1.725  1.00 39.59  ? 200  VAL B CA  1 
ATOM   4856  C  C   . VAL B 1 154 ? -44.565 -24.881 -0.390  1.00 39.59  ? 200  VAL B C   1 
ATOM   4857  O  O   . VAL B 1 154 ? -45.389 -24.329 0.361   1.00 39.56  ? 200  VAL B O   1 
ATOM   4858  C  CB  . VAL B 1 154 ? -42.933 -23.256 -1.516  1.00 39.81  ? 200  VAL B CB  1 
ATOM   4859  C  CG1 . VAL B 1 154 ? -42.627 -22.467 -2.796  1.00 39.86  ? 200  VAL B CG1 1 
ATOM   4860  C  CG2 . VAL B 1 154 ? -43.161 -22.297 -0.337  1.00 40.02  ? 200  VAL B CG2 1 
ATOM   4861  N  N   . TRP B 1 155 ? -44.022 -26.063 -0.116  1.00 39.36  ? 201  TRP B N   1 
ATOM   4862  C  CA  . TRP B 1 155 ? -44.299 -26.750 1.136   1.00 39.16  ? 201  TRP B CA  1 
ATOM   4863  C  C   . TRP B 1 155 ? -43.035 -26.680 1.975   1.00 39.19  ? 201  TRP B C   1 
ATOM   4864  O  O   . TRP B 1 155 ? -41.934 -26.745 1.438   1.00 39.46  ? 201  TRP B O   1 
ATOM   4865  C  CB  . TRP B 1 155 ? -44.709 -28.203 0.882   1.00 39.08  ? 201  TRP B CB  1 
ATOM   4866  C  CG  . TRP B 1 155 ? -45.057 -28.954 2.142   1.00 39.01  ? 201  TRP B CG  1 
ATOM   4867  C  CD1 . TRP B 1 155 ? -46.293 -29.074 2.711   1.00 38.46  ? 201  TRP B CD1 1 
ATOM   4868  C  CD2 . TRP B 1 155 ? -44.150 -29.678 2.990   1.00 38.72  ? 201  TRP B CD2 1 
ATOM   4869  N  NE1 . TRP B 1 155 ? -46.212 -29.826 3.858   1.00 38.48  ? 201  TRP B NE1 1 
ATOM   4870  C  CE2 . TRP B 1 155 ? -44.908 -30.207 4.054   1.00 38.52  ? 201  TRP B CE2 1 
ATOM   4871  C  CE3 . TRP B 1 155 ? -42.765 -29.929 2.952   1.00 38.55  ? 201  TRP B CE3 1 
ATOM   4872  C  CZ2 . TRP B 1 155 ? -44.332 -30.979 5.074   1.00 38.51  ? 201  TRP B CZ2 1 
ATOM   4873  C  CZ3 . TRP B 1 155 ? -42.193 -30.695 3.966   1.00 38.14  ? 201  TRP B CZ3 1 
ATOM   4874  C  CH2 . TRP B 1 155 ? -42.978 -31.208 5.012   1.00 38.06  ? 201  TRP B CH2 1 
ATOM   4875  N  N   . VAL B 1 156 ? -43.196 -26.539 3.287   1.00 39.20  ? 202  VAL B N   1 
ATOM   4876  C  CA  . VAL B 1 156 ? -42.065 -26.392 4.204   1.00 39.06  ? 202  VAL B CA  1 
ATOM   4877  C  C   . VAL B 1 156 ? -42.174 -27.384 5.397   1.00 39.19  ? 202  VAL B C   1 
ATOM   4878  O  O   . VAL B 1 156 ? -43.289 -27.745 5.822   1.00 39.28  ? 202  VAL B O   1 
ATOM   4879  C  CB  . VAL B 1 156 ? -41.916 -24.900 4.613   1.00 39.01  ? 202  VAL B CB  1 
ATOM   4880  C  CG1 . VAL B 1 156 ? -42.201 -24.664 6.084   1.00 38.56  ? 202  VAL B CG1 1 
ATOM   4881  C  CG2 . VAL B 1 156 ? -40.535 -24.385 4.223   1.00 39.68  ? 202  VAL B CG2 1 
ATOM   4882  N  N   . ASP B 1 157 ? -41.035 -27.857 5.911   1.00 38.98  ? 203  ASP B N   1 
ATOM   4883  C  CA  . ASP B 1 157 ? -41.060 -28.937 6.924   1.00 38.66  ? 203  ASP B CA  1 
ATOM   4884  C  C   . ASP B 1 157 ? -41.170 -28.470 8.386   1.00 38.20  ? 203  ASP B C   1 
ATOM   4885  O  O   . ASP B 1 157 ? -41.084 -29.298 9.342   1.00 37.82  ? 203  ASP B O   1 
ATOM   4886  C  CB  . ASP B 1 157 ? -39.888 -29.915 6.728   1.00 38.73  ? 203  ASP B CB  1 
ATOM   4887  C  CG  . ASP B 1 157 ? -38.521 -29.252 6.911   1.00 39.60  ? 203  ASP B CG  1 
ATOM   4888  O  OD1 . ASP B 1 157 ? -37.637 -29.487 6.050   1.00 40.69  ? 203  ASP B OD1 1 
ATOM   4889  O  OD2 . ASP B 1 157 ? -38.326 -28.504 7.911   1.00 39.96  ? 203  ASP B OD2 1 
ATOM   4890  N  N   . TYR B 1 158 ? -41.365 -27.146 8.542   1.00 37.95  ? 204  TYR B N   1 
ATOM   4891  C  CA  . TYR B 1 158 ? -41.421 -26.508 9.858   1.00 37.87  ? 204  TYR B CA  1 
ATOM   4892  C  C   . TYR B 1 158 ? -42.844 -25.978 10.132  1.00 37.54  ? 204  TYR B C   1 
ATOM   4893  O  O   . TYR B 1 158 ? -43.184 -24.853 9.763   1.00 37.12  ? 204  TYR B O   1 
ATOM   4894  C  CB  . TYR B 1 158 ? -40.312 -25.430 9.985   1.00 37.98  ? 204  TYR B CB  1 
ATOM   4895  C  CG  . TYR B 1 158 ? -40.297 -24.608 11.273  1.00 38.38  ? 204  TYR B CG  1 
ATOM   4896  C  CD1 . TYR B 1 158 ? -40.529 -25.203 12.521  1.00 39.02  ? 204  TYR B CD1 1 
ATOM   4897  C  CD2 . TYR B 1 158 ? -40.030 -23.236 11.241  1.00 38.51  ? 204  TYR B CD2 1 
ATOM   4898  C  CE1 . TYR B 1 158 ? -40.520 -24.446 13.697  1.00 39.34  ? 204  TYR B CE1 1 
ATOM   4899  C  CE2 . TYR B 1 158 ? -40.016 -22.472 12.414  1.00 38.97  ? 204  TYR B CE2 1 
ATOM   4900  C  CZ  . TYR B 1 158 ? -40.260 -23.084 13.635  1.00 39.35  ? 204  TYR B CZ  1 
ATOM   4901  O  OH  . TYR B 1 158 ? -40.250 -22.339 14.795  1.00 38.88  ? 204  TYR B OH  1 
ATOM   4902  N  N   . PRO B 1 159 ? -43.676 -26.807 10.792  1.00 37.51  ? 205  PRO B N   1 
ATOM   4903  C  CA  . PRO B 1 159 ? -45.112 -26.567 10.996  1.00 37.67  ? 205  PRO B CA  1 
ATOM   4904  C  C   . PRO B 1 159 ? -45.420 -25.221 11.658  1.00 37.74  ? 205  PRO B C   1 
ATOM   4905  O  O   . PRO B 1 159 ? -46.464 -24.595 11.363  1.00 37.51  ? 205  PRO B O   1 
ATOM   4906  C  CB  . PRO B 1 159 ? -45.528 -27.716 11.923  1.00 37.77  ? 205  PRO B CB  1 
ATOM   4907  C  CG  . PRO B 1 159 ? -44.512 -28.787 11.655  1.00 37.74  ? 205  PRO B CG  1 
ATOM   4908  C  CD  . PRO B 1 159 ? -43.235 -28.064 11.427  1.00 37.36  ? 205  PRO B CD  1 
ATOM   4909  N  N   . ASN B 1 160 ? -44.501 -24.791 12.532  1.00 38.12  ? 206  ASN B N   1 
ATOM   4910  C  CA  . ASN B 1 160 ? -44.589 -23.507 13.225  1.00 38.32  ? 206  ASN B CA  1 
ATOM   4911  C  C   . ASN B 1 160 ? -44.319 -22.278 12.365  1.00 38.50  ? 206  ASN B C   1 
ATOM   4912  O  O   . ASN B 1 160 ? -44.460 -21.157 12.853  1.00 38.54  ? 206  ASN B O   1 
ATOM   4913  C  CB  . ASN B 1 160 ? -43.618 -23.472 14.406  1.00 38.41  ? 206  ASN B CB  1 
ATOM   4914  C  CG  . ASN B 1 160 ? -44.237 -23.954 15.686  1.00 38.28  ? 206  ASN B CG  1 
ATOM   4915  O  OD1 . ASN B 1 160 ? -45.422 -23.764 15.926  1.00 38.23  ? 206  ASN B OD1 1 
ATOM   4916  N  ND2 . ASN B 1 160 ? -43.426 -24.570 16.531  1.00 38.86  ? 206  ASN B ND2 1 
ATOM   4917  N  N   . ILE B 1 161 ? -43.905 -22.469 11.110  1.00 38.55  ? 207  ILE B N   1 
ATOM   4918  C  CA  . ILE B 1 161 ? -43.700 -21.329 10.206  1.00 38.44  ? 207  ILE B CA  1 
ATOM   4919  C  C   . ILE B 1 161 ? -44.896 -20.342 10.253  1.00 38.33  ? 207  ILE B C   1 
ATOM   4920  O  O   . ILE B 1 161 ? -44.709 -19.146 10.501  1.00 38.13  ? 207  ILE B O   1 
ATOM   4921  C  CB  . ILE B 1 161 ? -43.306 -21.778 8.759   1.00 38.41  ? 207  ILE B CB  1 
ATOM   4922  C  CG1 . ILE B 1 161 ? -42.651 -20.626 7.989   1.00 38.37  ? 207  ILE B CG1 1 
ATOM   4923  C  CG2 . ILE B 1 161 ? -44.495 -22.399 7.999   1.00 38.40  ? 207  ILE B CG2 1 
ATOM   4924  C  CD1 . ILE B 1 161 ? -41.369 -21.055 7.229   1.00 39.48  ? 207  ILE B CD1 1 
ATOM   4925  N  N   . VAL B 1 162 ? -46.112 -20.863 10.075  1.00 38.37  ? 208  VAL B N   1 
ATOM   4926  C  CA  . VAL B 1 162 ? -47.338 -20.059 10.182  1.00 38.53  ? 208  VAL B CA  1 
ATOM   4927  C  C   . VAL B 1 162 ? -47.408 -19.250 11.493  1.00 38.66  ? 208  VAL B C   1 
ATOM   4928  O  O   . VAL B 1 162 ? -48.037 -18.194 11.541  1.00 38.75  ? 208  VAL B O   1 
ATOM   4929  C  CB  . VAL B 1 162 ? -48.633 -20.922 10.001  1.00 38.43  ? 208  VAL B CB  1 
ATOM   4930  C  CG1 . VAL B 1 162 ? -48.713 -21.506 8.596   1.00 38.10  ? 208  VAL B CG1 1 
ATOM   4931  C  CG2 . VAL B 1 162 ? -48.723 -22.030 11.049  1.00 38.69  ? 208  VAL B CG2 1 
ATOM   4932  N  N   . ARG B 1 163 ? -46.720 -19.739 12.528  1.00 38.80  ? 209  ARG B N   1 
ATOM   4933  C  CA  . ARG B 1 163 ? -46.764 -19.174 13.881  1.00 38.92  ? 209  ARG B CA  1 
ATOM   4934  C  C   . ARG B 1 163 ? -45.682 -18.116 14.195  1.00 38.88  ? 209  ARG B C   1 
ATOM   4935  O  O   . ARG B 1 163 ? -45.843 -17.343 15.140  1.00 38.54  ? 209  ARG B O   1 
ATOM   4936  C  CB  . ARG B 1 163 ? -46.710 -20.328 14.900  1.00 39.11  ? 209  ARG B CB  1 
ATOM   4937  C  CG  . ARG B 1 163 ? -47.349 -20.057 16.289  1.00 40.10  ? 209  ARG B CG  1 
ATOM   4938  C  CD  . ARG B 1 163 ? -47.534 -21.368 17.057  1.00 40.98  ? 209  ARG B CD  1 
ATOM   4939  N  NE  . ARG B 1 163 ? -47.212 -21.242 18.507  1.00 41.66  ? 209  ARG B NE  1 
ATOM   4940  C  CZ  . ARG B 1 163 ? -46.006 -21.442 19.042  1.00 42.53  ? 209  ARG B CZ  1 
ATOM   4941  N  NH1 . ARG B 1 163 ? -44.956 -21.827 18.265  1.00 43.53  ? 209  ARG B NH1 1 
ATOM   4942  N  NH2 . ARG B 1 163 ? -45.841 -21.271 20.363  1.00 42.07  ? 209  ARG B NH2 1 
ATOM   4943  N  N   . VAL B 1 164 ? -44.586 -18.072 13.425  1.00 39.14  ? 210  VAL B N   1 
ATOM   4944  C  CA  . VAL B 1 164 ? -43.478 -17.136 13.744  1.00 39.11  ? 210  VAL B CA  1 
ATOM   4945  C  C   . VAL B 1 164 ? -43.127 -16.088 12.677  1.00 38.88  ? 210  VAL B C   1 
ATOM   4946  O  O   . VAL B 1 164 ? -42.258 -15.231 12.916  1.00 38.81  ? 210  VAL B O   1 
ATOM   4947  C  CB  . VAL B 1 164 ? -42.168 -17.841 14.211  1.00 39.24  ? 210  VAL B CB  1 
ATOM   4948  C  CG1 . VAL B 1 164 ? -41.563 -17.068 15.387  1.00 39.40  ? 210  VAL B CG1 1 
ATOM   4949  C  CG2 . VAL B 1 164 ? -42.412 -19.292 14.607  1.00 39.78  ? 210  VAL B CG2 1 
ATOM   4950  N  N   . VAL B 1 165 ? -43.792 -16.146 11.518  1.00 38.72  ? 211  VAL B N   1 
ATOM   4951  C  CA  . VAL B 1 165 ? -43.614 -15.113 10.490  1.00 38.63  ? 211  VAL B CA  1 
ATOM   4952  C  C   . VAL B 1 165 ? -44.876 -14.218 10.425  1.00 38.70  ? 211  VAL B C   1 
ATOM   4953  O  O   . VAL B 1 165 ? -45.910 -14.647 9.907   1.00 38.72  ? 211  VAL B O   1 
ATOM   4954  C  CB  . VAL B 1 165 ? -43.277 -15.724 9.089   1.00 38.52  ? 211  VAL B CB  1 
ATOM   4955  C  CG1 . VAL B 1 165 ? -42.590 -14.697 8.201   1.00 38.32  ? 211  VAL B CG1 1 
ATOM   4956  C  CG2 . VAL B 1 165 ? -42.408 -16.965 9.228   1.00 37.89  ? 211  VAL B CG2 1 
ATOM   4957  N  N   . PRO B 1 166 ? -44.801 -12.982 10.975  1.00 38.73  ? 212  PRO B N   1 
ATOM   4958  C  CA  . PRO B 1 166 ? -45.951 -12.054 10.967  1.00 38.79  ? 212  PRO B CA  1 
ATOM   4959  C  C   . PRO B 1 166 ? -46.120 -11.286 9.649   1.00 38.74  ? 212  PRO B C   1 
ATOM   4960  O  O   . PRO B 1 166 ? -45.165 -11.183 8.874   1.00 38.93  ? 212  PRO B O   1 
ATOM   4961  C  CB  . PRO B 1 166 ? -45.609 -11.078 12.097  1.00 38.83  ? 212  PRO B CB  1 
ATOM   4962  C  CG  . PRO B 1 166 ? -44.101 -11.035 12.102  1.00 38.87  ? 212  PRO B CG  1 
ATOM   4963  C  CD  . PRO B 1 166 ? -43.623 -12.396 11.651  1.00 38.67  ? 212  PRO B CD  1 
ATOM   4964  N  N   . VAL B 1 167 ? -47.324 -10.757 9.411   1.00 38.62  ? 213  VAL B N   1 
ATOM   4965  C  CA  . VAL B 1 167 ? -47.621 -9.893  8.252   1.00 38.62  ? 213  VAL B CA  1 
ATOM   4966  C  C   . VAL B 1 167 ? -46.423 -8.986  7.940   1.00 38.62  ? 213  VAL B C   1 
ATOM   4967  O  O   . VAL B 1 167 ? -45.996 -8.199  8.785   1.00 38.65  ? 213  VAL B O   1 
ATOM   4968  C  CB  . VAL B 1 167 ? -48.914 -9.016  8.481   1.00 38.69  ? 213  VAL B CB  1 
ATOM   4969  C  CG1 . VAL B 1 167 ? -49.216 -8.115  7.276   1.00 38.53  ? 213  VAL B CG1 1 
ATOM   4970  C  CG2 . VAL B 1 167 ? -50.128 -9.883  8.798   1.00 38.51  ? 213  VAL B CG2 1 
ATOM   4971  N  N   . GLY B 1 168 ? -45.873 -9.123  6.736   1.00 38.69  ? 214  GLY B N   1 
ATOM   4972  C  CA  . GLY B 1 168 ? -44.658 -8.398  6.351   1.00 38.86  ? 214  GLY B CA  1 
ATOM   4973  C  C   . GLY B 1 168 ? -43.358 -9.053  6.803   1.00 38.92  ? 214  GLY B C   1 
ATOM   4974  O  O   . GLY B 1 168 ? -42.352 -8.369  7.015   1.00 38.99  ? 214  GLY B O   1 
ATOM   4975  N  N   . GLY B 1 169 ? -43.379 -10.376 6.955   1.00 38.90  ? 215  GLY B N   1 
ATOM   4976  C  CA  . GLY B 1 169 ? -42.186 -11.137 7.313   1.00 39.06  ? 215  GLY B CA  1 
ATOM   4977  C  C   . GLY B 1 169 ? -41.509 -11.671 6.065   1.00 39.24  ? 215  GLY B C   1 
ATOM   4978  O  O   . GLY B 1 169 ? -42.121 -11.720 4.993   1.00 39.34  ? 215  GLY B O   1 
ATOM   4979  N  N   . ARG B 1 170 ? -40.249 -12.077 6.200   1.00 39.33  ? 216  ARG B N   1 
ATOM   4980  C  CA  . ARG B 1 170 ? -39.466 -12.522 5.045   1.00 39.45  ? 216  ARG B CA  1 
ATOM   4981  C  C   . ARG B 1 170 ? -39.021 -13.979 5.140   1.00 39.20  ? 216  ARG B C   1 
ATOM   4982  O  O   . ARG B 1 170 ? -38.537 -14.430 6.183   1.00 39.27  ? 216  ARG B O   1 
ATOM   4983  C  CB  . ARG B 1 170 ? -38.251 -11.614 4.827   1.00 39.67  ? 216  ARG B CB  1 
ATOM   4984  C  CG  . ARG B 1 170 ? -37.980 -11.285 3.358   1.00 40.27  ? 216  ARG B CG  1 
ATOM   4985  C  CD  . ARG B 1 170 ? -36.828 -10.289 3.210   1.00 41.03  ? 216  ARG B CD  1 
ATOM   4986  N  NE  . ARG B 1 170 ? -36.968 -9.126  4.087   1.00 40.74  ? 216  ARG B NE  1 
ATOM   4987  C  CZ  . ARG B 1 170 ? -37.607 -8.008  3.761   1.00 41.07  ? 216  ARG B CZ  1 
ATOM   4988  N  NH1 . ARG B 1 170 ? -38.181 -7.879  2.570   1.00 41.22  ? 216  ARG B NH1 1 
ATOM   4989  N  NH2 . ARG B 1 170 ? -37.669 -7.012  4.632   1.00 41.18  ? 216  ARG B NH2 1 
ATOM   4990  N  N   . ILE B 1 171 ? -39.198 -14.697 4.032   1.00 38.85  ? 217  ILE B N   1 
ATOM   4991  C  CA  . ILE B 1 171 ? -38.821 -16.103 3.915   1.00 38.21  ? 217  ILE B CA  1 
ATOM   4992  C  C   . ILE B 1 171 ? -37.891 -16.289 2.722   1.00 38.13  ? 217  ILE B C   1 
ATOM   4993  O  O   . ILE B 1 171 ? -38.284 -16.110 1.552   1.00 37.98  ? 217  ILE B O   1 
ATOM   4994  C  CB  . ILE B 1 171 ? -40.046 -17.029 3.729   1.00 38.33  ? 217  ILE B CB  1 
ATOM   4995  C  CG1 . ILE B 1 171 ? -41.070 -16.835 4.857   1.00 37.80  ? 217  ILE B CG1 1 
ATOM   4996  C  CG2 . ILE B 1 171 ? -39.590 -18.491 3.593   1.00 38.04  ? 217  ILE B CG2 1 
ATOM   4997  C  CD1 . ILE B 1 171 ? -42.474 -17.246 4.482   1.00 37.70  ? 217  ILE B CD1 1 
ATOM   4998  N  N   . TYR B 1 172 ? -36.652 -16.646 3.038   1.00 37.74  ? 218  TYR B N   1 
ATOM   4999  C  CA  . TYR B 1 172 ? -35.643 -16.918 2.041   1.00 37.40  ? 218  TYR B CA  1 
ATOM   5000  C  C   . TYR B 1 172 ? -35.669 -18.394 1.691   1.00 37.35  ? 218  TYR B C   1 
ATOM   5001  O  O   . TYR B 1 172 ? -35.955 -19.230 2.546   1.00 37.41  ? 218  TYR B O   1 
ATOM   5002  C  CB  . TYR B 1 172 ? -34.270 -16.528 2.578   1.00 37.35  ? 218  TYR B CB  1 
ATOM   5003  C  CG  . TYR B 1 172 ? -34.070 -15.041 2.676   1.00 37.16  ? 218  TYR B CG  1 
ATOM   5004  C  CD1 . TYR B 1 172 ? -34.445 -14.335 3.826   1.00 37.11  ? 218  TYR B CD1 1 
ATOM   5005  C  CD2 . TYR B 1 172 ? -33.505 -14.327 1.610   1.00 36.98  ? 218  TYR B CD2 1 
ATOM   5006  C  CE1 . TYR B 1 172 ? -34.259 -12.943 3.906   1.00 37.63  ? 218  TYR B CE1 1 
ATOM   5007  C  CE2 . TYR B 1 172 ? -33.314 -12.950 1.680   1.00 36.97  ? 218  TYR B CE2 1 
ATOM   5008  C  CZ  . TYR B 1 172 ? -33.690 -12.266 2.825   1.00 37.24  ? 218  TYR B CZ  1 
ATOM   5009  O  OH  . TYR B 1 172 ? -33.498 -10.911 2.877   1.00 37.63  ? 218  TYR B OH  1 
ATOM   5010  N  N   . ILE B 1 173 ? -35.363 -18.710 0.436   1.00 37.09  ? 219  ILE B N   1 
ATOM   5011  C  CA  . ILE B 1 173 ? -35.343 -20.088 -0.017  1.00 36.76  ? 219  ILE B CA  1 
ATOM   5012  C  C   . ILE B 1 173 ? -34.173 -20.322 -0.954  1.00 36.85  ? 219  ILE B C   1 
ATOM   5013  O  O   . ILE B 1 173 ? -33.997 -19.585 -1.931  1.00 36.38  ? 219  ILE B O   1 
ATOM   5014  C  CB  . ILE B 1 173 ? -36.626 -20.451 -0.775  1.00 37.03  ? 219  ILE B CB  1 
ATOM   5015  C  CG1 . ILE B 1 173 ? -37.863 -20.260 0.107   1.00 36.28  ? 219  ILE B CG1 1 
ATOM   5016  C  CG2 . ILE B 1 173 ? -36.537 -21.884 -1.321  1.00 36.96  ? 219  ILE B CG2 1 
ATOM   5017  C  CD1 . ILE B 1 173 ? -39.107 -19.997 -0.678  1.00 35.58  ? 219  ILE B CD1 1 
ATOM   5018  N  N   . ASP B 1 174 ? -33.401 -21.371 -0.649  1.00 36.97  ? 220  ASP B N   1 
ATOM   5019  C  CA  . ASP B 1 174 ? -32.255 -21.806 -1.447  1.00 36.88  ? 220  ASP B CA  1 
ATOM   5020  C  C   . ASP B 1 174 ? -31.146 -20.758 -1.384  1.00 36.69  ? 220  ASP B C   1 
ATOM   5021  O  O   . ASP B 1 174 ? -31.164 -19.801 -2.129  1.00 36.60  ? 220  ASP B O   1 
ATOM   5022  C  CB  . ASP B 1 174 ? -32.678 -22.115 -2.905  1.00 36.81  ? 220  ASP B CB  1 
ATOM   5023  C  CG  . ASP B 1 174 ? -31.516 -22.604 -3.782  1.00 37.33  ? 220  ASP B CG  1 
ATOM   5024  O  OD1 . ASP B 1 174 ? -30.611 -23.308 -3.275  1.00 37.77  ? 220  ASP B OD1 1 
ATOM   5025  O  OD2 . ASP B 1 174 ? -31.515 -22.292 -4.994  1.00 37.17  ? 220  ASP B OD2 1 
ATOM   5026  N  N   . ASP B 1 175 ? -30.209 -20.929 -0.456  1.00 36.91  ? 221  ASP B N   1 
ATOM   5027  C  CA  . ASP B 1 175 ? -29.010 -20.091 -0.385  1.00 37.02  ? 221  ASP B CA  1 
ATOM   5028  C  C   . ASP B 1 175 ? -29.350 -18.589 -0.515  1.00 37.00  ? 221  ASP B C   1 
ATOM   5029  O  O   . ASP B 1 175 ? -28.570 -17.785 -1.073  1.00 36.45  ? 221  ASP B O   1 
ATOM   5030  C  CB  . ASP B 1 175 ? -28.001 -20.561 -1.448  1.00 37.28  ? 221  ASP B CB  1 
ATOM   5031  C  CG  . ASP B 1 175 ? -26.586 -20.028 -1.216  1.00 37.70  ? 221  ASP B CG  1 
ATOM   5032  O  OD1 . ASP B 1 175 ? -26.227 -19.725 -0.053  1.00 37.58  ? 221  ASP B OD1 1 
ATOM   5033  O  OD2 . ASP B 1 175 ? -25.833 -19.915 -2.216  1.00 38.03  ? 221  ASP B OD2 1 
ATOM   5034  N  N   . GLY B 1 176 ? -30.536 -18.245 0.010   1.00 36.91  ? 222  GLY B N   1 
ATOM   5035  C  CA  . GLY B 1 176 ? -31.113 -16.891 -0.010  1.00 36.37  ? 222  GLY B CA  1 
ATOM   5036  C  C   . GLY B 1 176 ? -31.375 -16.313 -1.387  1.00 36.17  ? 222  GLY B C   1 
ATOM   5037  O  O   . GLY B 1 176 ? -31.368 -15.090 -1.564  1.00 36.28  ? 222  GLY B O   1 
ATOM   5038  N  N   . LEU B 1 177 ? -31.594 -17.188 -2.364  1.00 35.99  ? 223  LEU B N   1 
ATOM   5039  C  CA  . LEU B 1 177 ? -31.735 -16.760 -3.748  1.00 36.05  ? 223  LEU B CA  1 
ATOM   5040  C  C   . LEU B 1 177 ? -33.148 -16.321 -4.046  1.00 36.44  ? 223  LEU B C   1 
ATOM   5041  O  O   . LEU B 1 177 ? -33.356 -15.476 -4.910  1.00 36.87  ? 223  LEU B O   1 
ATOM   5042  C  CB  . LEU B 1 177 ? -31.271 -17.837 -4.729  1.00 35.68  ? 223  LEU B CB  1 
ATOM   5043  C  CG  . LEU B 1 177 ? -29.757 -18.091 -4.751  1.00 35.62  ? 223  LEU B CG  1 
ATOM   5044  C  CD1 . LEU B 1 177 ? -29.410 -19.413 -5.410  1.00 35.86  ? 223  LEU B CD1 1 
ATOM   5045  C  CD2 . LEU B 1 177 ? -29.001 -16.962 -5.437  1.00 34.92  ? 223  LEU B CD2 1 
ATOM   5046  N  N   . ILE B 1 178 ? -34.107 -16.899 -3.325  1.00 36.98  ? 224  ILE B N   1 
ATOM   5047  C  CA  . ILE B 1 178 ? -35.518 -16.516 -3.404  1.00 37.39  ? 224  ILE B CA  1 
ATOM   5048  C  C   . ILE B 1 178 ? -35.929 -15.752 -2.143  1.00 37.52  ? 224  ILE B C   1 
ATOM   5049  O  O   . ILE B 1 178 ? -35.419 -16.022 -1.057  1.00 37.34  ? 224  ILE B O   1 
ATOM   5050  C  CB  . ILE B 1 178 ? -36.457 -17.751 -3.554  1.00 37.69  ? 224  ILE B CB  1 
ATOM   5051  C  CG1 . ILE B 1 178 ? -35.918 -18.760 -4.583  1.00 37.69  ? 224  ILE B CG1 1 
ATOM   5052  C  CG2 . ILE B 1 178 ? -37.906 -17.308 -3.862  1.00 37.59  ? 224  ILE B CG2 1 
ATOM   5053  C  CD1 . ILE B 1 178 ? -36.026 -18.323 -6.002  1.00 38.03  ? 224  ILE B CD1 1 
ATOM   5054  N  N   . SER B 1 179 ? -36.873 -14.822 -2.300  1.00 37.79  ? 225  SER B N   1 
ATOM   5055  C  CA  . SER B 1 179 ? -37.375 -13.990 -1.207  1.00 37.80  ? 225  SER B CA  1 
ATOM   5056  C  C   . SER B 1 179 ? -38.911 -13.870 -1.225  1.00 37.86  ? 225  SER B C   1 
ATOM   5057  O  O   . SER B 1 179 ? -39.499 -13.455 -2.224  1.00 37.67  ? 225  SER B O   1 
ATOM   5058  C  CB  . SER B 1 179 ? -36.737 -12.608 -1.300  1.00 37.70  ? 225  SER B CB  1 
ATOM   5059  O  OG  . SER B 1 179 ? -37.352 -11.692 -0.414  1.00 38.32  ? 225  SER B OG  1 
ATOM   5060  N  N   . LEU B 1 180 ? -39.552 -14.219 -0.112  1.00 37.97  ? 226  LEU B N   1 
ATOM   5061  C  CA  . LEU B 1 180 ? -41.011 -14.176 -0.031  1.00 38.15  ? 226  LEU B CA  1 
ATOM   5062  C  C   . LEU B 1 180 ? -41.514 -13.293 1.104   1.00 38.45  ? 226  LEU B C   1 
ATOM   5063  O  O   . LEU B 1 180 ? -41.124 -13.475 2.256   1.00 38.51  ? 226  LEU B O   1 
ATOM   5064  C  CB  . LEU B 1 180 ? -41.582 -15.587 0.122   1.00 38.12  ? 226  LEU B CB  1 
ATOM   5065  C  CG  . LEU B 1 180 ? -41.196 -16.645 -0.917  1.00 37.99  ? 226  LEU B CG  1 
ATOM   5066  C  CD1 . LEU B 1 180 ? -41.874 -17.976 -0.602  1.00 36.80  ? 226  LEU B CD1 1 
ATOM   5067  C  CD2 . LEU B 1 180 ? -41.536 -16.173 -2.338  1.00 37.62  ? 226  LEU B CD2 1 
ATOM   5068  N  N   . VAL B 1 181 ? -42.399 -12.354 0.769   1.00 38.82  ? 227  VAL B N   1 
ATOM   5069  C  CA  . VAL B 1 181 ? -42.916 -11.374 1.727   1.00 39.07  ? 227  VAL B CA  1 
ATOM   5070  C  C   . VAL B 1 181 ? -44.395 -11.625 2.026   1.00 39.27  ? 227  VAL B C   1 
ATOM   5071  O  O   . VAL B 1 181 ? -45.225 -11.600 1.116   1.00 39.23  ? 227  VAL B O   1 
ATOM   5072  C  CB  . VAL B 1 181 ? -42.707 -9.922  1.220   1.00 39.14  ? 227  VAL B CB  1 
ATOM   5073  C  CG1 . VAL B 1 181 ? -43.227 -8.899  2.238   1.00 39.26  ? 227  VAL B CG1 1 
ATOM   5074  C  CG2 . VAL B 1 181 ? -41.235 -9.664  0.898   1.00 38.97  ? 227  VAL B CG2 1 
ATOM   5075  N  N   . VAL B 1 182 ? -44.711 -11.840 3.306   1.00 39.54  ? 228  VAL B N   1 
ATOM   5076  C  CA  . VAL B 1 182 ? -46.055 -12.256 3.746   1.00 39.75  ? 228  VAL B CA  1 
ATOM   5077  C  C   . VAL B 1 182 ? -47.124 -11.170 3.561   1.00 39.92  ? 228  VAL B C   1 
ATOM   5078  O  O   . VAL B 1 182 ? -47.310 -10.295 4.410   1.00 40.17  ? 228  VAL B O   1 
ATOM   5079  C  CB  . VAL B 1 182 ? -46.046 -12.792 5.211   1.00 39.82  ? 228  VAL B CB  1 
ATOM   5080  C  CG1 . VAL B 1 182 ? -47.428 -13.294 5.624   1.00 39.52  ? 228  VAL B CG1 1 
ATOM   5081  C  CG2 . VAL B 1 182 ? -44.984 -13.904 5.387   1.00 39.97  ? 228  VAL B CG2 1 
ATOM   5082  N  N   . VAL B 1 191 ? -50.144 -16.027 3.473   1.00 41.08  ? 237  VAL B N   1 
ATOM   5083  C  CA  . VAL B 1 191 ? -50.029 -15.566 2.090   1.00 40.92  ? 237  VAL B CA  1 
ATOM   5084  C  C   . VAL B 1 191 ? -48.766 -14.732 1.925   1.00 40.93  ? 237  VAL B C   1 
ATOM   5085  O  O   . VAL B 1 191 ? -48.554 -13.765 2.661   1.00 40.89  ? 237  VAL B O   1 
ATOM   5086  C  CB  . VAL B 1 191 ? -51.242 -14.708 1.663   1.00 40.85  ? 237  VAL B CB  1 
ATOM   5087  C  CG1 . VAL B 1 191 ? -51.194 -14.418 0.161   1.00 40.86  ? 237  VAL B CG1 1 
ATOM   5088  C  CG2 . VAL B 1 191 ? -52.541 -15.403 2.027   1.00 40.94  ? 237  VAL B CG2 1 
ATOM   5089  N  N   . THR B 1 192 ? -47.931 -15.115 0.958   1.00 40.82  ? 238  THR B N   1 
ATOM   5090  C  CA  . THR B 1 192 ? -46.739 -14.339 0.628   1.00 40.74  ? 238  THR B CA  1 
ATOM   5091  C  C   . THR B 1 192 ? -46.819 -13.682 -0.747  1.00 40.61  ? 238  THR B C   1 
ATOM   5092  O  O   . THR B 1 192 ? -47.770 -13.886 -1.508  1.00 40.47  ? 238  THR B O   1 
ATOM   5093  C  CB  . THR B 1 192 ? -45.419 -15.173 0.712   1.00 40.83  ? 238  THR B CB  1 
ATOM   5094  O  OG1 . THR B 1 192 ? -45.232 -15.941 -0.489  1.00 40.66  ? 238  THR B OG1 1 
ATOM   5095  C  CG2 . THR B 1 192 ? -45.410 -16.094 1.941   1.00 41.27  ? 238  THR B CG2 1 
ATOM   5096  N  N   . GLN B 1 193 ? -45.801 -12.880 -1.034  1.00 40.51  ? 239  GLN B N   1 
ATOM   5097  C  CA  . GLN B 1 193 ? -45.554 -12.359 -2.362  1.00 40.35  ? 239  GLN B CA  1 
ATOM   5098  C  C   . GLN B 1 193 ? -44.064 -12.511 -2.613  1.00 40.16  ? 239  GLN B C   1 
ATOM   5099  O  O   . GLN B 1 193 ? -43.247 -12.212 -1.741  1.00 39.81  ? 239  GLN B O   1 
ATOM   5100  C  CB  . GLN B 1 193 ? -45.970 -10.887 -2.455  1.00 40.42  ? 239  GLN B CB  1 
ATOM   5101  C  CG  . GLN B 1 193 ? -45.891 -10.296 -3.863  1.00 40.33  ? 239  GLN B CG  1 
ATOM   5102  C  CD  . GLN B 1 193 ? -45.878 -8.776  -3.869  1.00 40.28  ? 239  GLN B CD  1 
ATOM   5103  O  OE1 . GLN B 1 193 ? -46.412 -8.119  -2.958  1.00 40.58  ? 239  GLN B OE1 1 
ATOM   5104  N  NE2 . GLN B 1 193 ? -45.267 -8.195  -4.900  1.00 39.99  ? 239  GLN B NE2 1 
ATOM   5105  N  N   . VAL B 1 194 ? -43.732 -12.995 -3.805  1.00 40.23  ? 240  VAL B N   1 
ATOM   5106  C  CA  . VAL B 1 194 ? -42.348 -13.176 -4.241  1.00 40.29  ? 240  VAL B CA  1 
ATOM   5107  C  C   . VAL B 1 194 ? -41.686 -11.810 -4.478  1.00 40.36  ? 240  VAL B C   1 
ATOM   5108  O  O   . VAL B 1 194 ? -42.144 -11.029 -5.320  1.00 40.32  ? 240  VAL B O   1 
ATOM   5109  C  CB  . VAL B 1 194 ? -42.270 -14.028 -5.538  1.00 40.23  ? 240  VAL B CB  1 
ATOM   5110  C  CG1 . VAL B 1 194 ? -40.875 -14.576 -5.746  1.00 40.20  ? 240  VAL B CG1 1 
ATOM   5111  C  CG2 . VAL B 1 194 ? -43.266 -15.172 -5.498  1.00 40.27  ? 240  VAL B CG2 1 
ATOM   5112  N  N   . GLU B 1 195 ? -40.623 -11.531 -3.720  1.00 40.40  ? 241  GLU B N   1 
ATOM   5113  C  CA  . GLU B 1 195 ? -39.861 -10.284 -3.841  1.00 40.39  ? 241  GLU B CA  1 
ATOM   5114  C  C   . GLU B 1 195 ? -38.699 -10.485 -4.812  1.00 40.29  ? 241  GLU B C   1 
ATOM   5115  O  O   . GLU B 1 195 ? -38.396 -9.619  -5.638  1.00 40.21  ? 241  GLU B O   1 
ATOM   5116  C  CB  . GLU B 1 195 ? -39.349 -9.840  -2.465  1.00 40.40  ? 241  GLU B CB  1 
ATOM   5117  C  CG  . GLU B 1 195 ? -38.870 -8.387  -2.395  1.00 40.72  ? 241  GLU B CG  1 
ATOM   5118  C  CD  . GLU B 1 195 ? -38.120 -8.062  -1.104  1.00 41.21  ? 241  GLU B CD  1 
ATOM   5119  O  OE1 . GLU B 1 195 ? -38.249 -8.822  -0.111  1.00 40.93  ? 241  GLU B OE1 1 
ATOM   5120  O  OE2 . GLU B 1 195 ? -37.394 -7.038  -1.085  1.00 41.49  ? 241  GLU B OE2 1 
ATOM   5121  N  N   . ASN B 1 196 ? -38.054 -11.640 -4.683  1.00 40.30  ? 242  ASN B N   1 
ATOM   5122  C  CA  . ASN B 1 196 ? -37.041 -12.095 -5.610  1.00 40.39  ? 242  ASN B CA  1 
ATOM   5123  C  C   . ASN B 1 196 ? -37.512 -13.400 -6.225  1.00 40.28  ? 242  ASN B C   1 
ATOM   5124  O  O   . ASN B 1 196 ? -37.759 -14.369 -5.512  1.00 40.31  ? 242  ASN B O   1 
ATOM   5125  C  CB  . ASN B 1 196 ? -35.711 -12.332 -4.884  1.00 40.53  ? 242  ASN B CB  1 
ATOM   5126  C  CG  . ASN B 1 196 ? -34.924 -11.056 -4.662  1.00 40.82  ? 242  ASN B CG  1 
ATOM   5127  O  OD1 . ASN B 1 196 ? -34.303 -10.523 -5.587  1.00 41.28  ? 242  ASN B OD1 1 
ATOM   5128  N  ND2 . ASN B 1 196 ? -34.927 -10.571 -3.422  1.00 40.80  ? 242  ASN B ND2 1 
ATOM   5129  N  N   . GLY B 1 197 ? -37.644 -13.419 -7.547  1.00 40.25  ? 243  GLY B N   1 
ATOM   5130  C  CA  . GLY B 1 197 ? -37.923 -14.653 -8.271  1.00 40.01  ? 243  GLY B CA  1 
ATOM   5131  C  C   . GLY B 1 197 ? -36.699 -15.547 -8.412  1.00 39.88  ? 243  GLY B C   1 
ATOM   5132  O  O   . GLY B 1 197 ? -35.589 -15.174 -8.017  1.00 40.04  ? 243  GLY B O   1 
ATOM   5133  N  N   . GLY B 1 198 ? -36.907 -16.733 -8.980  1.00 39.76  ? 244  GLY B N   1 
ATOM   5134  C  CA  . GLY B 1 198 ? -35.830 -17.697 -9.224  1.00 39.55  ? 244  GLY B CA  1 
ATOM   5135  C  C   . GLY B 1 198 ? -36.352 -19.089 -9.551  1.00 39.45  ? 244  GLY B C   1 
ATOM   5136  O  O   . GLY B 1 198 ? -37.559 -19.359 -9.443  1.00 39.54  ? 244  GLY B O   1 
ATOM   5137  N  N   . VAL B 1 199 ? -35.440 -19.972 -9.957  1.00 39.26  ? 245  VAL B N   1 
ATOM   5138  C  CA  . VAL B 1 199 ? -35.788 -21.344 -10.341 1.00 38.82  ? 245  VAL B CA  1 
ATOM   5139  C  C   . VAL B 1 199 ? -35.687 -22.242 -9.104  1.00 38.59  ? 245  VAL B C   1 
ATOM   5140  O  O   . VAL B 1 199 ? -34.599 -22.440 -8.565  1.00 38.40  ? 245  VAL B O   1 
ATOM   5141  C  CB  . VAL B 1 199 ? -34.876 -21.877 -11.501 1.00 38.93  ? 245  VAL B CB  1 
ATOM   5142  C  CG1 . VAL B 1 199 ? -35.271 -23.303 -11.906 1.00 38.64  ? 245  VAL B CG1 1 
ATOM   5143  C  CG2 . VAL B 1 199 ? -34.901 -20.928 -12.721 1.00 38.45  ? 245  VAL B CG2 1 
ATOM   5144  N  N   . LEU B 1 200 ? -36.828 -22.772 -8.664  1.00 38.27  ? 246  LEU B N   1 
ATOM   5145  C  CA  . LEU B 1 200 ? -36.915 -23.593 -7.449  1.00 37.97  ? 246  LEU B CA  1 
ATOM   5146  C  C   . LEU B 1 200 ? -36.718 -25.094 -7.699  1.00 37.82  ? 246  LEU B C   1 
ATOM   5147  O  O   . LEU B 1 200 ? -37.318 -25.666 -8.609  1.00 37.70  ? 246  LEU B O   1 
ATOM   5148  C  CB  . LEU B 1 200 ? -38.271 -23.360 -6.766  1.00 38.03  ? 246  LEU B CB  1 
ATOM   5149  C  CG  . LEU B 1 200 ? -38.542 -24.023 -5.415  1.00 37.68  ? 246  LEU B CG  1 
ATOM   5150  C  CD1 . LEU B 1 200 ? -37.577 -23.467 -4.366  1.00 36.96  ? 246  LEU B CD1 1 
ATOM   5151  C  CD2 . LEU B 1 200 ? -39.992 -23.816 -4.991  1.00 37.42  ? 246  LEU B CD2 1 
ATOM   5152  N  N   . GLY B 1 201 ? -35.886 -25.725 -6.876  1.00 37.79  ? 247  GLY B N   1 
ATOM   5153  C  CA  . GLY B 1 201 ? -35.694 -27.178 -6.926  1.00 37.87  ? 247  GLY B CA  1 
ATOM   5154  C  C   . GLY B 1 201 ? -36.408 -27.923 -5.800  1.00 38.09  ? 247  GLY B C   1 
ATOM   5155  O  O   . GLY B 1 201 ? -37.429 -27.456 -5.269  1.00 37.86  ? 247  GLY B O   1 
ATOM   5156  N  N   . SER B 1 202 ? -35.863 -29.084 -5.436  1.00 38.02  ? 248  SER B N   1 
ATOM   5157  C  CA  . SER B 1 202 ? -36.458 -29.934 -4.408  1.00 37.89  ? 248  SER B CA  1 
ATOM   5158  C  C   . SER B 1 202 ? -35.734 -29.818 -3.074  1.00 37.89  ? 248  SER B C   1 
ATOM   5159  O  O   . SER B 1 202 ? -34.502 -29.739 -3.033  1.00 37.66  ? 248  SER B O   1 
ATOM   5160  C  CB  . SER B 1 202 ? -36.463 -31.397 -4.863  1.00 37.87  ? 248  SER B CB  1 
ATOM   5161  O  OG  . SER B 1 202 ? -37.602 -31.687 -5.679  1.00 37.97  ? 248  SER B OG  1 
ATOM   5162  N  N   . ARG B 1 203 ? -36.526 -29.815 -1.997  1.00 37.99  ? 249  ARG B N   1 
ATOM   5163  C  CA  . ARG B 1 203 ? -36.047 -29.850 -0.600  1.00 38.12  ? 249  ARG B CA  1 
ATOM   5164  C  C   . ARG B 1 203 ? -34.923 -28.855 -0.325  1.00 38.17  ? 249  ARG B C   1 
ATOM   5165  O  O   . ARG B 1 203 ? -33.762 -29.241 -0.166  1.00 38.37  ? 249  ARG B O   1 
ATOM   5166  C  CB  . ARG B 1 203 ? -35.634 -31.277 -0.169  1.00 38.00  ? 249  ARG B CB  1 
ATOM   5167  C  CG  . ARG B 1 203 ? -36.627 -32.391 -0.563  1.00 38.70  ? 249  ARG B CG  1 
ATOM   5168  C  CD  . ARG B 1 203 ? -36.796 -33.498 0.497   1.00 38.96  ? 249  ARG B CD  1 
ATOM   5169  N  NE  . ARG B 1 203 ? -35.518 -34.037 0.963   1.00 39.25  ? 249  ARG B NE  1 
ATOM   5170  C  CZ  . ARG B 1 203 ? -35.051 -33.911 2.203   1.00 38.97  ? 249  ARG B CZ  1 
ATOM   5171  N  NH1 . ARG B 1 203 ? -33.871 -34.430 2.517   1.00 38.46  ? 249  ARG B NH1 1 
ATOM   5172  N  NH2 . ARG B 1 203 ? -35.757 -33.270 3.129   1.00 38.76  ? 249  ARG B NH2 1 
ATOM   5173  N  N   . LYS B 1 204 ? -35.259 -27.572 -0.275  1.00 37.93  ? 250  LYS B N   1 
ATOM   5174  C  CA  . LYS B 1 204 ? -34.210 -26.568 -0.178  1.00 37.76  ? 250  LYS B CA  1 
ATOM   5175  C  C   . LYS B 1 204 ? -34.310 -25.644 1.044   1.00 37.62  ? 250  LYS B C   1 
ATOM   5176  O  O   . LYS B 1 204 ? -35.404 -25.277 1.485   1.00 37.76  ? 250  LYS B O   1 
ATOM   5177  C  CB  . LYS B 1 204 ? -34.046 -25.817 -1.512  1.00 37.86  ? 250  LYS B CB  1 
ATOM   5178  C  CG  . LYS B 1 204 ? -33.524 -26.726 -2.635  1.00 38.16  ? 250  LYS B CG  1 
ATOM   5179  C  CD  . LYS B 1 204 ? -32.718 -25.983 -3.689  1.00 39.49  ? 250  LYS B CD  1 
ATOM   5180  C  CE  . LYS B 1 204 ? -31.976 -26.948 -4.629  1.00 39.52  ? 250  LYS B CE  1 
ATOM   5181  N  NZ  . LYS B 1 204 ? -31.028 -27.868 -3.932  1.00 39.50  ? 250  LYS B NZ  1 
ATOM   5182  N  N   . GLY B 1 205 ? -33.138 -25.306 1.586   1.00 37.38  ? 251  GLY B N   1 
ATOM   5183  C  CA  . GLY B 1 205 ? -32.977 -24.537 2.820   1.00 36.93  ? 251  GLY B CA  1 
ATOM   5184  C  C   . GLY B 1 205 ? -33.793 -23.266 2.887   1.00 36.93  ? 251  GLY B C   1 
ATOM   5185  O  O   . GLY B 1 205 ? -33.678 -22.388 2.029   1.00 37.43  ? 251  GLY B O   1 
ATOM   5186  N  N   . VAL B 1 206 ? -34.623 -23.176 3.921   1.00 36.77  ? 252  VAL B N   1 
ATOM   5187  C  CA  . VAL B 1 206 ? -35.450 -22.002 4.162   1.00 36.29  ? 252  VAL B CA  1 
ATOM   5188  C  C   . VAL B 1 206 ? -34.912 -21.206 5.353   1.00 36.11  ? 252  VAL B C   1 
ATOM   5189  O  O   . VAL B 1 206 ? -34.600 -21.770 6.423   1.00 35.34  ? 252  VAL B O   1 
ATOM   5190  C  CB  . VAL B 1 206 ? -36.945 -22.406 4.349   1.00 36.28  ? 252  VAL B CB  1 
ATOM   5191  C  CG1 . VAL B 1 206 ? -37.810 -21.221 4.809   1.00 36.12  ? 252  VAL B CG1 1 
ATOM   5192  C  CG2 . VAL B 1 206 ? -37.482 -22.993 3.061   1.00 36.03  ? 252  VAL B CG2 1 
ATOM   5193  N  N   . ASN B 1 207 ? -34.814 -19.892 5.159   1.00 36.16  ? 253  ASN B N   1 
ATOM   5194  C  CA  . ASN B 1 207 ? -34.283 -19.004 6.200   1.00 36.58  ? 253  ASN B CA  1 
ATOM   5195  C  C   . ASN B 1 207 ? -35.260 -17.926 6.680   1.00 36.72  ? 253  ASN B C   1 
ATOM   5196  O  O   . ASN B 1 207 ? -35.919 -17.288 5.872   1.00 36.94  ? 253  ASN B O   1 
ATOM   5197  C  CB  . ASN B 1 207 ? -32.949 -18.393 5.745   1.00 36.35  ? 253  ASN B CB  1 
ATOM   5198  C  CG  . ASN B 1 207 ? -31.904 -19.452 5.444   1.00 35.61  ? 253  ASN B CG  1 
ATOM   5199  O  OD1 . ASN B 1 207 ? -31.110 -19.805 6.307   1.00 35.25  ? 253  ASN B OD1 1 
ATOM   5200  N  ND2 . ASN B 1 207 ? -31.929 -19.992 4.228   1.00 35.22  ? 253  ASN B ND2 1 
ATOM   5201  N  N   . LEU B 1 208 ? -35.346 -17.742 7.998   1.00 37.03  ? 254  LEU B N   1 
ATOM   5202  C  CA  . LEU B 1 208 ? -36.256 -16.767 8.606   1.00 37.38  ? 254  LEU B CA  1 
ATOM   5203  C  C   . LEU B 1 208 ? -35.530 -15.895 9.632   1.00 37.72  ? 254  LEU B C   1 
ATOM   5204  O  O   . LEU B 1 208 ? -35.583 -16.172 10.834  1.00 37.66  ? 254  LEU B O   1 
ATOM   5205  C  CB  . LEU B 1 208 ? -37.455 -17.463 9.281   1.00 37.23  ? 254  LEU B CB  1 
ATOM   5206  C  CG  . LEU B 1 208 ? -38.138 -18.665 8.603   1.00 37.47  ? 254  LEU B CG  1 
ATOM   5207  C  CD1 . LEU B 1 208 ? -38.795 -19.594 9.629   1.00 36.64  ? 254  LEU B CD1 1 
ATOM   5208  C  CD2 . LEU B 1 208 ? -39.134 -18.244 7.517   1.00 36.89  ? 254  LEU B CD2 1 
ATOM   5209  N  N   . PRO B 1 209 ? -34.837 -14.843 9.163   1.00 38.13  ? 255  PRO B N   1 
ATOM   5210  C  CA  . PRO B 1 209 ? -34.263 -13.867 10.086  1.00 38.70  ? 255  PRO B CA  1 
ATOM   5211  C  C   . PRO B 1 209 ? -35.359 -12.954 10.628  1.00 39.36  ? 255  PRO B C   1 
ATOM   5212  O  O   . PRO B 1 209 ? -36.487 -12.967 10.114  1.00 39.35  ? 255  PRO B O   1 
ATOM   5213  C  CB  . PRO B 1 209 ? -33.284 -13.071 9.205   1.00 38.62  ? 255  PRO B CB  1 
ATOM   5214  C  CG  . PRO B 1 209 ? -33.208 -13.814 7.906   1.00 38.29  ? 255  PRO B CG  1 
ATOM   5215  C  CD  . PRO B 1 209 ? -34.525 -14.504 7.768   1.00 38.11  ? 255  PRO B CD  1 
ATOM   5216  N  N   . GLY B 1 210 ? -35.035 -12.176 11.659  1.00 40.00  ? 256  GLY B N   1 
ATOM   5217  C  CA  . GLY B 1 210 ? -36.029 -11.338 12.335  1.00 40.78  ? 256  GLY B CA  1 
ATOM   5218  C  C   . GLY B 1 210 ? -37.032 -12.158 13.134  1.00 41.38  ? 256  GLY B C   1 
ATOM   5219  O  O   . GLY B 1 210 ? -37.613 -11.668 14.102  1.00 41.35  ? 256  GLY B O   1 
ATOM   5220  N  N   . ALA B 1 211 ? -37.237 -13.406 12.716  1.00 41.96  ? 257  ALA B N   1 
ATOM   5221  C  CA  . ALA B 1 211 ? -38.103 -14.344 13.420  1.00 42.42  ? 257  ALA B CA  1 
ATOM   5222  C  C   . ALA B 1 211 ? -37.278 -15.109 14.445  1.00 42.77  ? 257  ALA B C   1 
ATOM   5223  O  O   . ALA B 1 211 ? -36.126 -15.465 14.175  1.00 42.73  ? 257  ALA B O   1 
ATOM   5224  C  CB  . ALA B 1 211 ? -38.752 -15.307 12.432  1.00 42.34  ? 257  ALA B CB  1 
ATOM   5225  N  N   . GLN B 1 212 ? -37.863 -15.338 15.620  1.00 43.18  ? 258  GLN B N   1 
ATOM   5226  C  CA  . GLN B 1 212 ? -37.238 -16.158 16.662  1.00 43.75  ? 258  GLN B CA  1 
ATOM   5227  C  C   . GLN B 1 212 ? -37.624 -17.635 16.474  1.00 44.14  ? 258  GLN B C   1 
ATOM   5228  O  O   . GLN B 1 212 ? -38.750 -18.037 16.772  1.00 44.41  ? 258  GLN B O   1 
ATOM   5229  C  CB  . GLN B 1 212 ? -37.611 -15.643 18.064  1.00 43.65  ? 258  GLN B CB  1 
ATOM   5230  C  CG  . GLN B 1 212 ? -39.121 -15.485 18.307  1.00 43.87  ? 258  GLN B CG  1 
ATOM   5231  C  CD  . GLN B 1 212 ? -39.465 -14.338 19.247  1.00 44.44  ? 258  GLN B CD  1 
ATOM   5232  O  OE1 . GLN B 1 212 ? -40.391 -14.437 20.060  1.00 44.61  ? 258  GLN B OE1 1 
ATOM   5233  N  NE2 . GLN B 1 212 ? -38.728 -13.238 19.133  1.00 44.56  ? 258  GLN B NE2 1 
ATOM   5234  N  N   . VAL B 1 213 ? -36.689 -18.439 15.972  1.00 44.63  ? 259  VAL B N   1 
ATOM   5235  C  CA  . VAL B 1 213 ? -36.987 -19.833 15.605  1.00 44.94  ? 259  VAL B CA  1 
ATOM   5236  C  C   . VAL B 1 213 ? -36.988 -20.769 16.822  1.00 45.20  ? 259  VAL B C   1 
ATOM   5237  O  O   . VAL B 1 213 ? -35.932 -21.303 17.208  1.00 44.97  ? 259  VAL B O   1 
ATOM   5238  C  CB  . VAL B 1 213 ? -36.030 -20.362 14.493  1.00 44.88  ? 259  VAL B CB  1 
ATOM   5239  C  CG1 . VAL B 1 213 ? -36.444 -21.765 14.029  1.00 44.94  ? 259  VAL B CG1 1 
ATOM   5240  C  CG2 . VAL B 1 213 ? -35.996 -19.402 13.310  1.00 44.61  ? 259  VAL B CG2 1 
ATOM   5241  N  N   . ASP B 1 214 ? -38.186 -20.973 17.392  1.00 45.58  ? 260  ASP B N   1 
ATOM   5242  C  CA  . ASP B 1 214 ? -38.373 -21.777 18.618  1.00 46.08  ? 260  ASP B CA  1 
ATOM   5243  C  C   . ASP B 1 214 ? -38.186 -23.293 18.429  1.00 46.29  ? 260  ASP B C   1 
ATOM   5244  O  O   . ASP B 1 214 ? -38.446 -24.084 19.353  1.00 46.24  ? 260  ASP B O   1 
ATOM   5245  C  CB  . ASP B 1 214 ? -39.713 -21.443 19.316  1.00 46.22  ? 260  ASP B CB  1 
ATOM   5246  C  CG  . ASP B 1 214 ? -40.887 -22.326 18.858  1.00 46.53  ? 260  ASP B CG  1 
ATOM   5247  O  OD1 . ASP B 1 214 ? -40.990 -22.635 17.526  1.00 46.42  ? 260  ASP B OD1 1 
ATOM   5248  O  OD2 . ASP B 1 214 ? -41.705 -22.708 19.772  1.00 46.62  ? 260  ASP B OD2 1 
ATOM   5249  N  N   . LEU B 1 215 ? -37.734 -23.685 17.234  1.00 46.38  ? 261  LEU B N   1 
ATOM   5250  C  CA  . LEU B 1 215 ? -37.289 -25.050 16.987  1.00 46.54  ? 261  LEU B CA  1 
ATOM   5251  C  C   . LEU B 1 215 ? -36.073 -25.327 17.880  1.00 46.55  ? 261  LEU B C   1 
ATOM   5252  O  O   . LEU B 1 215 ? -35.211 -24.451 18.051  1.00 46.60  ? 261  LEU B O   1 
ATOM   5253  C  CB  . LEU B 1 215 ? -36.946 -25.261 15.502  1.00 46.79  ? 261  LEU B CB  1 
ATOM   5254  C  CG  . LEU B 1 215 ? -37.249 -26.628 14.857  1.00 47.28  ? 261  LEU B CG  1 
ATOM   5255  C  CD1 . LEU B 1 215 ? -38.689 -27.068 15.145  1.00 48.60  ? 261  LEU B CD1 1 
ATOM   5256  C  CD2 . LEU B 1 215 ? -36.972 -26.628 13.340  1.00 48.14  ? 261  LEU B CD2 1 
ATOM   5257  N  N   . PRO B 1 216 ? -36.011 -26.538 18.472  1.00 46.50  ? 262  PRO B N   1 
ATOM   5258  C  CA  . PRO B 1 216 ? -34.909 -26.857 19.386  1.00 46.50  ? 262  PRO B CA  1 
ATOM   5259  C  C   . PRO B 1 216 ? -33.585 -27.016 18.646  1.00 46.69  ? 262  PRO B C   1 
ATOM   5260  O  O   . PRO B 1 216 ? -33.552 -27.308 17.432  1.00 46.71  ? 262  PRO B O   1 
ATOM   5261  C  CB  . PRO B 1 216 ? -35.336 -28.179 20.051  1.00 46.37  ? 262  PRO B CB  1 
ATOM   5262  C  CG  . PRO B 1 216 ? -36.390 -28.755 19.177  1.00 46.45  ? 262  PRO B CG  1 
ATOM   5263  C  CD  . PRO B 1 216 ? -36.954 -27.663 18.303  1.00 46.41  ? 262  PRO B CD  1 
ATOM   5264  N  N   . GLY B 1 217 ? -32.504 -26.800 19.389  1.00 46.75  ? 263  GLY B N   1 
ATOM   5265  C  CA  . GLY B 1 217 ? -31.160 -26.930 18.841  1.00 46.73  ? 263  GLY B CA  1 
ATOM   5266  C  C   . GLY B 1 217 ? -30.877 -28.401 18.663  1.00 46.63  ? 263  GLY B C   1 
ATOM   5267  O  O   . GLY B 1 217 ? -30.048 -28.776 17.826  1.00 47.47  ? 263  GLY B O   1 
ATOM   5268  N  N   . LEU B 1 218 ? -31.581 -29.222 19.447  1.00 45.72  ? 264  LEU B N   1 
ATOM   5269  C  CA  . LEU B 1 218 ? -31.400 -30.657 19.422  1.00 44.72  ? 264  LEU B CA  1 
ATOM   5270  C  C   . LEU B 1 218 ? -32.742 -31.361 19.379  1.00 44.33  ? 264  LEU B C   1 
ATOM   5271  O  O   . LEU B 1 218 ? -33.488 -31.377 20.365  1.00 44.09  ? 264  LEU B O   1 
ATOM   5272  C  CB  . LEU B 1 218 ? -30.588 -31.110 20.636  1.00 44.52  ? 264  LEU B CB  1 
ATOM   5273  C  CG  . LEU B 1 218 ? -29.363 -31.975 20.327  1.00 43.73  ? 264  LEU B CG  1 
ATOM   5274  C  CD1 . LEU B 1 218 ? -28.332 -31.183 19.511  1.00 42.46  ? 264  LEU B CD1 1 
ATOM   5275  C  CD2 . LEU B 1 218 ? -28.739 -32.483 21.613  1.00 43.76  ? 264  LEU B CD2 1 
ATOM   5276  N  N   . SER B 1 219 ? -33.039 -31.926 18.211  1.00 43.81  ? 265  SER B N   1 
ATOM   5277  C  CA  . SER B 1 219 ? -34.287 -32.653 17.969  1.00 43.54  ? 265  SER B CA  1 
ATOM   5278  C  C   . SER B 1 219 ? -34.113 -34.122 18.303  1.00 43.50  ? 265  SER B C   1 
ATOM   5279  O  O   . SER B 1 219 ? -33.008 -34.572 18.609  1.00 43.32  ? 265  SER B O   1 
ATOM   5280  C  CB  . SER B 1 219 ? -34.676 -32.542 16.501  1.00 43.20  ? 265  SER B CB  1 
ATOM   5281  O  OG  . SER B 1 219 ? -33.708 -33.199 15.698  1.00 43.96  ? 265  SER B OG  1 
ATOM   5282  N  N   . GLU B 1 220 ? -35.198 -34.882 18.220  1.00 43.58  ? 266  GLU B N   1 
ATOM   5283  C  CA  . GLU B 1 220 ? -35.079 -36.309 18.444  1.00 43.87  ? 266  GLU B CA  1 
ATOM   5284  C  C   . GLU B 1 220 ? -34.027 -36.883 17.472  1.00 43.59  ? 266  GLU B C   1 
ATOM   5285  O  O   . GLU B 1 220 ? -33.122 -37.602 17.898  1.00 43.58  ? 266  GLU B O   1 
ATOM   5286  C  CB  . GLU B 1 220 ? -36.439 -37.014 18.389  1.00 43.71  ? 266  GLU B CB  1 
ATOM   5287  C  CG  . GLU B 1 220 ? -36.678 -37.889 19.627  1.00 46.07  ? 266  GLU B CG  1 
ATOM   5288  C  CD  . GLU B 1 220 ? -38.158 -38.253 19.881  1.00 48.82  ? 266  GLU B CD  1 
ATOM   5289  O  OE1 . GLU B 1 220 ? -38.877 -38.573 18.913  1.00 49.59  ? 266  GLU B OE1 1 
ATOM   5290  O  OE2 . GLU B 1 220 ? -38.600 -38.248 21.059  1.00 48.51  ? 266  GLU B OE2 1 
ATOM   5291  N  N   . GLN B 1 221 ? -34.089 -36.512 16.195  1.00 43.32  ? 267  GLN B N   1 
ATOM   5292  C  CA  . GLN B 1 221 ? -33.086 -37.018 15.256  1.00 43.50  ? 267  GLN B CA  1 
ATOM   5293  C  C   . GLN B 1 221 ? -31.640 -36.672 15.640  1.00 43.29  ? 267  GLN B C   1 
ATOM   5294  O  O   . GLN B 1 221 ? -30.804 -37.567 15.723  1.00 43.21  ? 267  GLN B O   1 
ATOM   5295  C  CB  . GLN B 1 221 ? -33.369 -36.597 13.814  1.00 43.81  ? 267  GLN B CB  1 
ATOM   5296  C  CG  . GLN B 1 221 ? -32.509 -37.330 12.779  1.00 44.95  ? 267  GLN B CG  1 
ATOM   5297  C  CD  . GLN B 1 221 ? -32.745 -38.834 12.771  1.00 47.45  ? 267  GLN B CD  1 
ATOM   5298  O  OE1 . GLN B 1 221 ? -33.842 -39.323 13.094  1.00 49.33  ? 267  GLN B OE1 1 
ATOM   5299  N  NE2 . GLN B 1 221 ? -31.713 -39.579 12.399  1.00 47.14  ? 267  GLN B NE2 1 
ATOM   5300  N  N   . ASP B 1 222 ? -31.339 -35.396 15.872  1.00 42.88  ? 268  ASP B N   1 
ATOM   5301  C  CA  . ASP B 1 222 ? -29.976 -35.023 16.270  1.00 42.91  ? 268  ASP B CA  1 
ATOM   5302  C  C   . ASP B 1 222 ? -29.449 -35.977 17.371  1.00 42.72  ? 268  ASP B C   1 
ATOM   5303  O  O   . ASP B 1 222 ? -28.402 -36.616 17.208  1.00 43.26  ? 268  ASP B O   1 
ATOM   5304  C  CB  . ASP B 1 222 ? -29.881 -33.552 16.707  1.00 42.91  ? 268  ASP B CB  1 
ATOM   5305  C  CG  . ASP B 1 222 ? -30.435 -32.580 15.664  1.00 44.40  ? 268  ASP B CG  1 
ATOM   5306  O  OD1 . ASP B 1 222 ? -29.775 -32.360 14.607  1.00 45.36  ? 268  ASP B OD1 1 
ATOM   5307  O  OD2 . ASP B 1 222 ? -31.523 -32.014 15.925  1.00 45.04  ? 268  ASP B OD2 1 
ATOM   5308  N  N   . VAL B 1 223 ? -30.183 -36.090 18.474  1.00 42.08  ? 269  VAL B N   1 
ATOM   5309  C  CA  . VAL B 1 223 ? -29.810 -36.987 19.563  1.00 41.47  ? 269  VAL B CA  1 
ATOM   5310  C  C   . VAL B 1 223 ? -29.468 -38.376 19.020  1.00 41.54  ? 269  VAL B C   1 
ATOM   5311  O  O   . VAL B 1 223 ? -28.409 -38.919 19.342  1.00 41.63  ? 269  VAL B O   1 
ATOM   5312  C  CB  . VAL B 1 223 ? -30.928 -37.075 20.657  1.00 41.59  ? 269  VAL B CB  1 
ATOM   5313  C  CG1 . VAL B 1 223 ? -30.796 -38.337 21.511  1.00 41.00  ? 269  VAL B CG1 1 
ATOM   5314  C  CG2 . VAL B 1 223 ? -30.912 -35.834 21.549  1.00 40.49  ? 269  VAL B CG2 1 
ATOM   5315  N  N   . ARG B 1 224 ? -30.348 -38.940 18.190  1.00 41.26  ? 270  ARG B N   1 
ATOM   5316  C  CA  . ARG B 1 224 ? -30.053 -40.218 17.527  1.00 41.33  ? 270  ARG B CA  1 
ATOM   5317  C  C   . ARG B 1 224 ? -28.729 -40.127 16.754  1.00 40.87  ? 270  ARG B C   1 
ATOM   5318  O  O   . ARG B 1 224 ? -27.833 -40.957 16.919  1.00 40.98  ? 270  ARG B O   1 
ATOM   5319  C  CB  . ARG B 1 224 ? -31.192 -40.642 16.585  1.00 41.27  ? 270  ARG B CB  1 
ATOM   5320  C  CG  . ARG B 1 224 ? -32.258 -41.538 17.216  1.00 42.57  ? 270  ARG B CG  1 
ATOM   5321  C  CD  . ARG B 1 224 ? -33.298 -41.939 16.163  1.00 45.88  ? 270  ARG B CD  1 
ATOM   5322  N  NE  . ARG B 1 224 ? -34.239 -40.851 15.881  1.00 48.70  ? 270  ARG B NE  1 
ATOM   5323  C  CZ  . ARG B 1 224 ? -35.527 -40.864 16.214  1.00 51.19  ? 270  ARG B CZ  1 
ATOM   5324  N  NH1 . ARG B 1 224 ? -36.058 -41.924 16.825  1.00 53.12  ? 270  ARG B NH1 1 
ATOM   5325  N  NH2 . ARG B 1 224 ? -36.287 -39.819 15.920  1.00 51.64  ? 270  ARG B NH2 1 
ATOM   5326  N  N   . ASP B 1 225 ? -28.611 -39.093 15.935  1.00 40.51  ? 271  ASP B N   1 
ATOM   5327  C  CA  . ASP B 1 225 ? -27.433 -38.917 15.111  1.00 40.31  ? 271  ASP B CA  1 
ATOM   5328  C  C   . ASP B 1 225 ? -26.188 -38.853 15.979  1.00 40.29  ? 271  ASP B C   1 
ATOM   5329  O  O   . ASP B 1 225 ? -25.168 -39.461 15.657  1.00 40.11  ? 271  ASP B O   1 
ATOM   5330  C  CB  . ASP B 1 225 ? -27.566 -37.664 14.239  1.00 40.09  ? 271  ASP B CB  1 
ATOM   5331  C  CG  . ASP B 1 225 ? -28.556 -37.844 13.107  1.00 39.45  ? 271  ASP B CG  1 
ATOM   5332  O  OD1 . ASP B 1 225 ? -29.192 -38.905 13.014  1.00 37.68  ? 271  ASP B OD1 1 
ATOM   5333  O  OD2 . ASP B 1 225 ? -28.690 -36.922 12.285  1.00 41.50  ? 271  ASP B OD2 1 
ATOM   5334  N  N   . LEU B 1 226 ? -26.281 -38.143 17.097  1.00 40.11  ? 272  LEU B N   1 
ATOM   5335  C  CA  . LEU B 1 226 ? -25.134 -38.024 17.971  1.00 40.07  ? 272  LEU B CA  1 
ATOM   5336  C  C   . LEU B 1 226 ? -24.765 -39.391 18.550  1.00 40.37  ? 272  LEU B C   1 
ATOM   5337  O  O   . LEU B 1 226 ? -23.622 -39.818 18.427  1.00 40.23  ? 272  LEU B O   1 
ATOM   5338  C  CB  . LEU B 1 226 ? -25.364 -36.950 19.036  1.00 39.60  ? 272  LEU B CB  1 
ATOM   5339  C  CG  . LEU B 1 226 ? -25.313 -35.516 18.486  1.00 39.16  ? 272  LEU B CG  1 
ATOM   5340  C  CD1 . LEU B 1 226 ? -25.944 -34.518 19.447  1.00 39.80  ? 272  LEU B CD1 1 
ATOM   5341  C  CD2 . LEU B 1 226 ? -23.884 -35.081 18.135  1.00 38.17  ? 272  LEU B CD2 1 
ATOM   5342  N  N   . ARG B 1 227 ? -25.744 -40.098 19.115  1.00 40.85  ? 273  ARG B N   1 
ATOM   5343  C  CA  . ARG B 1 227 ? -25.505 -41.444 19.649  1.00 41.54  ? 273  ARG B CA  1 
ATOM   5344  C  C   . ARG B 1 227 ? -24.812 -42.310 18.603  1.00 41.41  ? 273  ARG B C   1 
ATOM   5345  O  O   . ARG B 1 227 ? -23.913 -43.099 18.945  1.00 41.33  ? 273  ARG B O   1 
ATOM   5346  C  CB  . ARG B 1 227 ? -26.799 -42.113 20.123  1.00 41.70  ? 273  ARG B CB  1 
ATOM   5347  C  CG  . ARG B 1 227 ? -27.703 -41.237 20.988  1.00 43.75  ? 273  ARG B CG  1 
ATOM   5348  C  CD  . ARG B 1 227 ? -26.970 -40.574 22.149  1.00 46.33  ? 273  ARG B CD  1 
ATOM   5349  N  NE  . ARG B 1 227 ? -27.039 -41.355 23.385  1.00 48.80  ? 273  ARG B NE  1 
ATOM   5350  C  CZ  . ARG B 1 227 ? -26.037 -42.077 23.900  1.00 49.74  ? 273  ARG B CZ  1 
ATOM   5351  N  NH1 . ARG B 1 227 ? -24.845 -42.133 23.292  1.00 49.38  ? 273  ARG B NH1 1 
ATOM   5352  N  NH2 . ARG B 1 227 ? -26.239 -42.752 25.037  1.00 48.76  ? 273  ARG B NH2 1 
ATOM   5353  N  N   . PHE B 1 228 ? -25.225 -42.140 17.340  1.00 41.18  ? 274  PHE B N   1 
ATOM   5354  C  CA  . PHE B 1 228 ? -24.614 -42.838 16.214  1.00 41.26  ? 274  PHE B CA  1 
ATOM   5355  C  C   . PHE B 1 228 ? -23.134 -42.514 16.175  1.00 41.41  ? 274  PHE B C   1 
ATOM   5356  O  O   . PHE B 1 228 ? -22.293 -43.418 16.113  1.00 41.65  ? 274  PHE B O   1 
ATOM   5357  C  CB  . PHE B 1 228 ? -25.301 -42.474 14.899  1.00 40.95  ? 274  PHE B CB  1 
ATOM   5358  C  CG  . PHE B 1 228 ? -24.674 -43.102 13.677  1.00 41.17  ? 274  PHE B CG  1 
ATOM   5359  C  CD1 . PHE B 1 228 ? -25.221 -44.255 13.117  1.00 40.21  ? 274  PHE B CD1 1 
ATOM   5360  C  CD2 . PHE B 1 228 ? -23.556 -42.516 13.056  1.00 42.31  ? 274  PHE B CD2 1 
ATOM   5361  C  CE1 . PHE B 1 228 ? -24.662 -44.838 11.968  1.00 39.89  ? 274  PHE B CE1 1 
ATOM   5362  C  CE2 . PHE B 1 228 ? -22.985 -43.082 11.904  1.00 41.57  ? 274  PHE B CE2 1 
ATOM   5363  C  CZ  . PHE B 1 228 ? -23.550 -44.253 11.358  1.00 41.02  ? 274  PHE B CZ  1 
ATOM   5364  N  N   . GLY B 1 229 ? -22.821 -41.222 16.250  1.00 41.79  ? 275  GLY B N   1 
ATOM   5365  C  CA  . GLY B 1 229 ? -21.433 -40.743 16.200  1.00 41.61  ? 275  GLY B CA  1 
ATOM   5366  C  C   . GLY B 1 229 ? -20.576 -41.381 17.277  1.00 41.68  ? 275  GLY B C   1 
ATOM   5367  O  O   . GLY B 1 229 ? -19.414 -41.713 17.040  1.00 42.04  ? 275  GLY B O   1 
ATOM   5368  N  N   . VAL B 1 230 ? -21.153 -41.556 18.461  1.00 41.43  ? 276  VAL B N   1 
ATOM   5369  C  CA  . VAL B 1 230 ? -20.436 -42.204 19.545  1.00 41.28  ? 276  VAL B CA  1 
ATOM   5370  C  C   . VAL B 1 230 ? -20.098 -43.626 19.132  1.00 41.37  ? 276  VAL B C   1 
ATOM   5371  O  O   . VAL B 1 230 ? -18.929 -43.996 19.089  1.00 41.55  ? 276  VAL B O   1 
ATOM   5372  C  CB  . VAL B 1 230 ? -21.220 -42.218 20.877  1.00 41.15  ? 276  VAL B CB  1 
ATOM   5373  C  CG1 . VAL B 1 230 ? -20.396 -42.891 21.942  1.00 40.05  ? 276  VAL B CG1 1 
ATOM   5374  C  CG2 . VAL B 1 230 ? -21.548 -40.802 21.299  1.00 40.94  ? 276  VAL B CG2 1 
ATOM   5375  N  N   . GLU B 1 231 ? -21.123 -44.397 18.787  1.00 41.43  ? 277  GLU B N   1 
ATOM   5376  C  CA  . GLU B 1 231 ? -20.956 -45.811 18.457  1.00 41.53  ? 277  GLU B CA  1 
ATOM   5377  C  C   . GLU B 1 231 ? -19.917 -46.041 17.365  1.00 41.11  ? 277  GLU B C   1 
ATOM   5378  O  O   . GLU B 1 231 ? -19.228 -47.047 17.383  1.00 41.11  ? 277  GLU B O   1 
ATOM   5379  C  CB  . GLU B 1 231 ? -22.291 -46.451 18.053  1.00 41.73  ? 277  GLU B CB  1 
ATOM   5380  C  CG  . GLU B 1 231 ? -23.367 -46.442 19.144  1.00 44.07  ? 277  GLU B CG  1 
ATOM   5381  C  CD  . GLU B 1 231 ? -24.680 -47.166 18.745  1.00 47.31  ? 277  GLU B CD  1 
ATOM   5382  O  OE1 . GLU B 1 231 ? -24.951 -47.358 17.526  1.00 47.29  ? 277  GLU B OE1 1 
ATOM   5383  O  OE2 . GLU B 1 231 ? -25.448 -47.536 19.672  1.00 47.94  ? 277  GLU B OE2 1 
ATOM   5384  N  N   . HIS B 1 232 ? -19.796 -45.116 16.417  1.00 40.50  ? 278  HIS B N   1 
ATOM   5385  C  CA  . HIS B 1 232 ? -18.873 -45.327 15.311  1.00 39.95  ? 278  HIS B CA  1 
ATOM   5386  C  C   . HIS B 1 232 ? -17.586 -44.532 15.488  1.00 39.75  ? 278  HIS B C   1 
ATOM   5387  O  O   . HIS B 1 232 ? -16.777 -44.402 14.558  1.00 39.57  ? 278  HIS B O   1 
ATOM   5388  C  CB  . HIS B 1 232 ? -19.537 -44.985 13.997  1.00 39.98  ? 278  HIS B CB  1 
ATOM   5389  C  CG  . HIS B 1 232 ? -20.678 -45.879 13.656  1.00 40.33  ? 278  HIS B CG  1 
ATOM   5390  N  ND1 . HIS B 1 232 ? -20.550 -46.942 12.795  1.00 40.38  ? 278  HIS B ND1 1 
ATOM   5391  C  CD2 . HIS B 1 232 ? -21.974 -45.860 14.046  1.00 41.12  ? 278  HIS B CD2 1 
ATOM   5392  C  CE1 . HIS B 1 232 ? -21.721 -47.542 12.668  1.00 41.52  ? 278  HIS B CE1 1 
ATOM   5393  N  NE2 . HIS B 1 232 ? -22.603 -46.907 13.419  1.00 42.00  ? 278  HIS B NE2 1 
ATOM   5394  N  N   . GLY B 1 233 ? -17.415 -43.995 16.697  1.00 39.31  ? 279  GLY B N   1 
ATOM   5395  C  CA  . GLY B 1 233 ? -16.174 -43.354 17.110  1.00 38.67  ? 279  GLY B CA  1 
ATOM   5396  C  C   . GLY B 1 233 ? -15.794 -42.163 16.274  1.00 38.68  ? 279  GLY B C   1 
ATOM   5397  O  O   . GLY B 1 233 ? -14.606 -41.967 15.960  1.00 39.03  ? 279  GLY B O   1 
ATOM   5398  N  N   . VAL B 1 234 ? -16.781 -41.354 15.902  1.00 38.24  ? 280  VAL B N   1 
ATOM   5399  C  CA  . VAL B 1 234 ? -16.444 -40.080 15.272  1.00 38.16  ? 280  VAL B CA  1 
ATOM   5400  C  C   . VAL B 1 234 ? -15.554 -39.302 16.241  1.00 38.48  ? 280  VAL B C   1 
ATOM   5401  O  O   . VAL B 1 234 ? -15.566 -39.569 17.438  1.00 39.12  ? 280  VAL B O   1 
ATOM   5402  C  CB  . VAL B 1 234 ? -17.671 -39.238 14.905  1.00 37.82  ? 280  VAL B CB  1 
ATOM   5403  C  CG1 . VAL B 1 234 ? -18.479 -39.922 13.842  1.00 36.45  ? 280  VAL B CG1 1 
ATOM   5404  C  CG2 . VAL B 1 234 ? -18.491 -38.925 16.142  1.00 37.99  ? 280  VAL B CG2 1 
ATOM   5405  N  N   . ASP B 1 235 ? -14.809 -38.337 15.726  1.00 38.68  ? 281  ASP B N   1 
ATOM   5406  C  CA  . ASP B 1 235 ? -13.807 -37.612 16.501  1.00 39.06  ? 281  ASP B CA  1 
ATOM   5407  C  C   . ASP B 1 235 ? -14.260 -36.217 16.917  1.00 38.90  ? 281  ASP B C   1 
ATOM   5408  O  O   . ASP B 1 235 ? -13.753 -35.639 17.887  1.00 39.20  ? 281  ASP B O   1 
ATOM   5409  C  CB  . ASP B 1 235 ? -12.533 -37.498 15.651  1.00 39.32  ? 281  ASP B CB  1 
ATOM   5410  C  CG  . ASP B 1 235 ? -11.908 -38.847 15.383  1.00 42.07  ? 281  ASP B CG  1 
ATOM   5411  O  OD1 . ASP B 1 235 ? -12.551 -39.729 14.769  1.00 47.77  ? 281  ASP B OD1 1 
ATOM   5412  O  OD2 . ASP B 1 235 ? -10.782 -39.053 15.830  1.00 44.90  ? 281  ASP B OD2 1 
ATOM   5413  N  N   . ILE B 1 236 ? -15.206 -35.667 16.166  1.00 38.56  ? 282  ILE B N   1 
ATOM   5414  C  CA  . ILE B 1 236 ? -15.547 -34.264 16.277  1.00 37.93  ? 282  ILE B CA  1 
ATOM   5415  C  C   . ILE B 1 236 ? -16.995 -34.076 15.889  1.00 37.83  ? 282  ILE B C   1 
ATOM   5416  O  O   . ILE B 1 236 ? -17.472 -34.682 14.937  1.00 37.72  ? 282  ILE B O   1 
ATOM   5417  C  CB  . ILE B 1 236 ? -14.669 -33.403 15.337  1.00 37.63  ? 282  ILE B CB  1 
ATOM   5418  C  CG1 . ILE B 1 236 ? -13.177 -33.605 15.643  1.00 36.67  ? 282  ILE B CG1 1 
ATOM   5419  C  CG2 . ILE B 1 236 ? -15.050 -31.960 15.466  1.00 37.80  ? 282  ILE B CG2 1 
ATOM   5420  C  CD1 . ILE B 1 236 ? -12.246 -33.229 14.501  1.00 33.91  ? 282  ILE B CD1 1 
ATOM   5421  N  N   . VAL B 1 237 ? -17.686 -33.228 16.633  1.00 37.68  ? 283  VAL B N   1 
ATOM   5422  C  CA  . VAL B 1 237 ? -19.030 -32.818 16.278  1.00 37.63  ? 283  VAL B CA  1 
ATOM   5423  C  C   . VAL B 1 237 ? -19.067 -31.352 15.822  1.00 38.15  ? 283  VAL B C   1 
ATOM   5424  O  O   . VAL B 1 237 ? -18.769 -30.429 16.600  1.00 38.90  ? 283  VAL B O   1 
ATOM   5425  C  CB  . VAL B 1 237 ? -19.976 -32.992 17.470  1.00 37.56  ? 283  VAL B CB  1 
ATOM   5426  C  CG1 . VAL B 1 237 ? -21.332 -32.352 17.173  1.00 36.78  ? 283  VAL B CG1 1 
ATOM   5427  C  CG2 . VAL B 1 237 ? -20.129 -34.467 17.813  1.00 36.49  ? 283  VAL B CG2 1 
ATOM   5428  N  N   . PHE B 1 238 ? -19.416 -31.115 14.566  1.00 38.14  ? 284  PHE B N   1 
ATOM   5429  C  CA  . PHE B 1 238 ? -19.738 -29.756 14.138  1.00 37.90  ? 284  PHE B CA  1 
ATOM   5430  C  C   . PHE B 1 238 ? -21.216 -29.553 14.512  1.00 38.54  ? 284  PHE B C   1 
ATOM   5431  O  O   . PHE B 1 238 ? -22.124 -30.094 13.869  1.00 39.07  ? 284  PHE B O   1 
ATOM   5432  C  CB  . PHE B 1 238 ? -19.527 -29.584 12.627  1.00 37.34  ? 284  PHE B CB  1 
ATOM   5433  C  CG  . PHE B 1 238 ? -18.092 -29.705 12.171  1.00 37.15  ? 284  PHE B CG  1 
ATOM   5434  C  CD1 . PHE B 1 238 ? -17.022 -29.427 13.022  1.00 37.10  ? 284  PHE B CD1 1 
ATOM   5435  C  CD2 . PHE B 1 238 ? -17.802 -30.067 10.854  1.00 37.50  ? 284  PHE B CD2 1 
ATOM   5436  C  CE1 . PHE B 1 238 ? -15.692 -29.530 12.575  1.00 36.69  ? 284  PHE B CE1 1 
ATOM   5437  C  CE2 . PHE B 1 238 ? -16.456 -30.157 10.395  1.00 35.98  ? 284  PHE B CE2 1 
ATOM   5438  C  CZ  . PHE B 1 238 ? -15.421 -29.892 11.266  1.00 36.38  ? 284  PHE B CZ  1 
ATOM   5439  N  N   . ALA B 1 239 ? -21.473 -28.816 15.581  1.00 38.76  ? 285  ALA B N   1 
ATOM   5440  C  CA  . ALA B 1 239 ? -22.844 -28.673 16.058  1.00 38.95  ? 285  ALA B CA  1 
ATOM   5441  C  C   . ALA B 1 239 ? -23.544 -27.489 15.386  1.00 39.48  ? 285  ALA B C   1 
ATOM   5442  O  O   . ALA B 1 239 ? -23.148 -26.331 15.554  1.00 39.86  ? 285  ALA B O   1 
ATOM   5443  C  CB  . ALA B 1 239 ? -22.875 -28.555 17.584  1.00 38.68  ? 285  ALA B CB  1 
ATOM   5444  N  N   . SER B 1 240 ? -24.582 -27.793 14.615  1.00 39.92  ? 286  SER B N   1 
ATOM   5445  C  CA  . SER B 1 240 ? -25.302 -26.780 13.872  1.00 40.16  ? 286  SER B CA  1 
ATOM   5446  C  C   . SER B 1 240 ? -26.183 -25.895 14.751  1.00 40.52  ? 286  SER B C   1 
ATOM   5447  O  O   . SER B 1 240 ? -26.601 -26.275 15.834  1.00 40.57  ? 286  SER B O   1 
ATOM   5448  C  CB  . SER B 1 240 ? -26.153 -27.418 12.782  1.00 40.33  ? 286  SER B CB  1 
ATOM   5449  O  OG  . SER B 1 240 ? -25.351 -28.043 11.791  1.00 40.11  ? 286  SER B OG  1 
ATOM   5450  N  N   . PHE B 1 241 ? -26.420 -24.690 14.245  1.00 41.14  ? 287  PHE B N   1 
ATOM   5451  C  CA  . PHE B 1 241 ? -27.253 -23.647 14.846  1.00 40.83  ? 287  PHE B CA  1 
ATOM   5452  C  C   . PHE B 1 241 ? -27.091 -23.349 16.340  1.00 40.74  ? 287  PHE B C   1 
ATOM   5453  O  O   . PHE B 1 241 ? -28.077 -23.116 17.042  1.00 40.70  ? 287  PHE B O   1 
ATOM   5454  C  CB  . PHE B 1 241 ? -28.705 -23.831 14.399  1.00 40.88  ? 287  PHE B CB  1 
ATOM   5455  C  CG  . PHE B 1 241 ? -28.862 -23.767 12.896  1.00 40.68  ? 287  PHE B CG  1 
ATOM   5456  C  CD1 . PHE B 1 241 ? -28.783 -24.922 12.114  1.00 39.86  ? 287  PHE B CD1 1 
ATOM   5457  C  CD2 . PHE B 1 241 ? -29.038 -22.540 12.267  1.00 41.45  ? 287  PHE B CD2 1 
ATOM   5458  C  CE1 . PHE B 1 241 ? -28.906 -24.860 10.730  1.00 40.23  ? 287  PHE B CE1 1 
ATOM   5459  C  CE2 . PHE B 1 241 ? -29.157 -22.457 10.884  1.00 42.11  ? 287  PHE B CE2 1 
ATOM   5460  C  CZ  . PHE B 1 241 ? -29.085 -23.627 10.109  1.00 40.96  ? 287  PHE B CZ  1 
ATOM   5461  N  N   . VAL B 1 242 ? -25.836 -23.301 16.792  1.00 40.47  ? 288  VAL B N   1 
ATOM   5462  C  CA  . VAL B 1 242 ? -25.536 -23.051 18.194  1.00 40.72  ? 288  VAL B CA  1 
ATOM   5463  C  C   . VAL B 1 242 ? -25.810 -21.596 18.545  1.00 40.99  ? 288  VAL B C   1 
ATOM   5464  O  O   . VAL B 1 242 ? -25.136 -20.714 18.045  1.00 41.36  ? 288  VAL B O   1 
ATOM   5465  C  CB  . VAL B 1 242 ? -24.075 -23.446 18.558  1.00 40.35  ? 288  VAL B CB  1 
ATOM   5466  C  CG1 . VAL B 1 242 ? -23.741 -23.023 19.970  1.00 40.04  ? 288  VAL B CG1 1 
ATOM   5467  C  CG2 . VAL B 1 242 ? -23.896 -24.941 18.445  1.00 40.62  ? 288  VAL B CG2 1 
ATOM   5468  N  N   . ARG B 1 243 ? -26.782 -21.358 19.419  1.00 41.42  ? 289  ARG B N   1 
ATOM   5469  C  CA  . ARG B 1 243 ? -27.205 -19.993 19.767  1.00 42.16  ? 289  ARG B CA  1 
ATOM   5470  C  C   . ARG B 1 243 ? -26.836 -19.522 21.182  1.00 42.06  ? 289  ARG B C   1 
ATOM   5471  O  O   . ARG B 1 243 ? -26.855 -18.320 21.456  1.00 42.27  ? 289  ARG B O   1 
ATOM   5472  C  CB  . ARG B 1 243 ? -28.724 -19.789 19.584  1.00 42.58  ? 289  ARG B CB  1 
ATOM   5473  C  CG  . ARG B 1 243 ? -29.510 -20.938 18.974  1.00 45.31  ? 289  ARG B CG  1 
ATOM   5474  C  CD  . ARG B 1 243 ? -31.011 -20.716 19.109  1.00 50.60  ? 289  ARG B CD  1 
ATOM   5475  N  NE  . ARG B 1 243 ? -31.713 -21.157 17.900  1.00 56.23  ? 289  ARG B NE  1 
ATOM   5476  C  CZ  . ARG B 1 243 ? -32.112 -20.357 16.906  1.00 57.45  ? 289  ARG B CZ  1 
ATOM   5477  N  NH1 . ARG B 1 243 ? -31.905 -19.036 16.953  1.00 57.02  ? 289  ARG B NH1 1 
ATOM   5478  N  NH2 . ARG B 1 243 ? -32.730 -20.884 15.852  1.00 57.60  ? 289  ARG B NH2 1 
ATOM   5479  N  N   . LYS B 1 244 ? -26.537 -20.457 22.080  1.00 41.92  ? 290  LYS B N   1 
ATOM   5480  C  CA  . LYS B 1 244 ? -26.265 -20.147 23.486  1.00 41.50  ? 290  LYS B CA  1 
ATOM   5481  C  C   . LYS B 1 244 ? -25.555 -21.323 24.138  1.00 41.50  ? 290  LYS B C   1 
ATOM   5482  O  O   . LYS B 1 244 ? -25.684 -22.457 23.685  1.00 41.70  ? 290  LYS B O   1 
ATOM   5483  C  CB  . LYS B 1 244 ? -27.570 -19.876 24.213  1.00 41.29  ? 290  LYS B CB  1 
ATOM   5484  C  CG  . LYS B 1 244 ? -28.683 -20.792 23.768  1.00 42.50  ? 290  LYS B CG  1 
ATOM   5485  C  CD  . LYS B 1 244 ? -30.017 -20.501 24.437  1.00 44.06  ? 290  LYS B CD  1 
ATOM   5486  C  CE  . LYS B 1 244 ? -31.100 -21.387 23.825  1.00 44.54  ? 290  LYS B CE  1 
ATOM   5487  N  NZ  . LYS B 1 244 ? -32.228 -21.642 24.747  1.00 46.19  ? 290  LYS B NZ  1 
ATOM   5488  N  N   . ALA B 1 245 ? -24.814 -21.057 25.209  1.00 41.57  ? 291  ALA B N   1 
ATOM   5489  C  CA  . ALA B 1 245 ? -24.099 -22.107 25.963  1.00 41.48  ? 291  ALA B CA  1 
ATOM   5490  C  C   . ALA B 1 245 ? -24.883 -23.412 26.195  1.00 41.52  ? 291  ALA B C   1 
ATOM   5491  O  O   . ALA B 1 245 ? -24.341 -24.501 26.004  1.00 41.59  ? 291  ALA B O   1 
ATOM   5492  C  CB  . ALA B 1 245 ? -23.589 -21.554 27.286  1.00 41.35  ? 291  ALA B CB  1 
ATOM   5493  N  N   . SER B 1 246 ? -26.150 -23.303 26.595  1.00 41.77  ? 292  SER B N   1 
ATOM   5494  C  CA  . SER B 1 246 ? -26.969 -24.487 26.873  1.00 42.11  ? 292  SER B CA  1 
ATOM   5495  C  C   . SER B 1 246 ? -27.102 -25.404 25.664  1.00 41.98  ? 292  SER B C   1 
ATOM   5496  O  O   . SER B 1 246 ? -27.396 -26.593 25.821  1.00 42.22  ? 292  SER B O   1 
ATOM   5497  C  CB  . SER B 1 246 ? -28.365 -24.086 27.324  1.00 42.11  ? 292  SER B CB  1 
ATOM   5498  O  OG  . SER B 1 246 ? -29.195 -23.887 26.187  1.00 43.83  ? 292  SER B OG  1 
ATOM   5499  N  N   . ASP B 1 247 ? -26.916 -24.845 24.471  1.00 41.73  ? 293  ASP B N   1 
ATOM   5500  C  CA  . ASP B 1 247 ? -26.996 -25.626 23.242  1.00 41.59  ? 293  ASP B CA  1 
ATOM   5501  C  C   . ASP B 1 247 ? -25.901 -26.667 23.184  1.00 41.38  ? 293  ASP B C   1 
ATOM   5502  O  O   . ASP B 1 247 ? -26.157 -27.803 22.794  1.00 41.58  ? 293  ASP B O   1 
ATOM   5503  C  CB  . ASP B 1 247 ? -26.916 -24.727 22.007  1.00 42.05  ? 293  ASP B CB  1 
ATOM   5504  C  CG  . ASP B 1 247 ? -28.240 -24.042 21.684  1.00 42.52  ? 293  ASP B CG  1 
ATOM   5505  O  OD1 . ASP B 1 247 ? -29.288 -24.453 22.218  1.00 42.49  ? 293  ASP B OD1 1 
ATOM   5506  O  OD2 . ASP B 1 247 ? -28.228 -23.089 20.884  1.00 43.96  ? 293  ASP B OD2 1 
ATOM   5507  N  N   . VAL B 1 248 ? -24.689 -26.285 23.573  1.00 40.86  ? 294  VAL B N   1 
ATOM   5508  C  CA  . VAL B 1 248 ? -23.574 -27.226 23.592  1.00 40.58  ? 294  VAL B CA  1 
ATOM   5509  C  C   . VAL B 1 248 ? -23.668 -28.177 24.800  1.00 40.30  ? 294  VAL B C   1 
ATOM   5510  O  O   . VAL B 1 248 ? -23.300 -29.351 24.715  1.00 40.23  ? 294  VAL B O   1 
ATOM   5511  C  CB  . VAL B 1 248 ? -22.171 -26.521 23.434  1.00 40.70  ? 294  VAL B CB  1 
ATOM   5512  C  CG1 . VAL B 1 248 ? -22.241 -25.023 23.721  1.00 40.68  ? 294  VAL B CG1 1 
ATOM   5513  C  CG2 . VAL B 1 248 ? -21.083 -27.210 24.270  1.00 40.65  ? 294  VAL B CG2 1 
ATOM   5514  N  N   . ALA B 1 249 ? -24.196 -27.678 25.911  1.00 39.97  ? 295  ALA B N   1 
ATOM   5515  C  CA  . ALA B 1 249 ? -24.496 -28.550 27.049  1.00 39.27  ? 295  ALA B CA  1 
ATOM   5516  C  C   . ALA B 1 249 ? -25.400 -29.682 26.587  1.00 38.97  ? 295  ALA B C   1 
ATOM   5517  O  O   . ALA B 1 249 ? -25.151 -30.851 26.897  1.00 38.80  ? 295  ALA B O   1 
ATOM   5518  C  CB  . ALA B 1 249 ? -25.133 -27.775 28.179  1.00 38.83  ? 295  ALA B CB  1 
ATOM   5519  N  N   . ALA B 1 250 ? -26.432 -29.333 25.825  1.00 38.87  ? 296  ALA B N   1 
ATOM   5520  C  CA  . ALA B 1 250 ? -27.339 -30.336 25.276  1.00 39.12  ? 296  ALA B CA  1 
ATOM   5521  C  C   . ALA B 1 250 ? -26.584 -31.345 24.387  1.00 39.53  ? 296  ALA B C   1 
ATOM   5522  O  O   . ALA B 1 250 ? -26.758 -32.565 24.583  1.00 39.82  ? 296  ALA B O   1 
ATOM   5523  C  CB  . ALA B 1 250 ? -28.510 -29.688 24.536  1.00 38.52  ? 296  ALA B CB  1 
ATOM   5524  N  N   . VAL B 1 251 ? -25.745 -30.849 23.457  1.00 39.52  ? 297  VAL B N   1 
ATOM   5525  C  CA  . VAL B 1 251 ? -24.887 -31.719 22.623  1.00 39.81  ? 297  VAL B CA  1 
ATOM   5526  C  C   . VAL B 1 251 ? -24.061 -32.636 23.513  1.00 40.45  ? 297  VAL B C   1 
ATOM   5527  O  O   . VAL B 1 251 ? -23.981 -33.835 23.262  1.00 40.70  ? 297  VAL B O   1 
ATOM   5528  C  CB  . VAL B 1 251 ? -23.904 -30.933 21.679  1.00 40.00  ? 297  VAL B CB  1 
ATOM   5529  C  CG1 . VAL B 1 251 ? -22.887 -31.869 21.059  1.00 39.04  ? 297  VAL B CG1 1 
ATOM   5530  C  CG2 . VAL B 1 251 ? -24.648 -30.183 20.566  1.00 39.71  ? 297  VAL B CG2 1 
ATOM   5531  N  N   . ARG B 1 252 ? -23.469 -32.071 24.565  1.00 41.01  ? 298  ARG B N   1 
ATOM   5532  C  CA  . ARG B 1 252 ? -22.648 -32.847 25.491  1.00 41.54  ? 298  ARG B CA  1 
ATOM   5533  C  C   . ARG B 1 252 ? -23.446 -33.967 26.126  1.00 41.53  ? 298  ARG B C   1 
ATOM   5534  O  O   . ARG B 1 252 ? -22.972 -35.098 26.145  1.00 41.90  ? 298  ARG B O   1 
ATOM   5535  C  CB  . ARG B 1 252 ? -22.011 -31.959 26.562  1.00 41.83  ? 298  ARG B CB  1 
ATOM   5536  C  CG  . ARG B 1 252 ? -20.555 -32.295 26.865  1.00 42.86  ? 298  ARG B CG  1 
ATOM   5537  C  CD  . ARG B 1 252 ? -19.823 -31.050 27.294  1.00 43.18  ? 298  ARG B CD  1 
ATOM   5538  N  NE  . ARG B 1 252 ? -18.712 -30.775 26.401  1.00 44.48  ? 298  ARG B NE  1 
ATOM   5539  C  CZ  . ARG B 1 252 ? -18.167 -29.571 26.231  1.00 46.42  ? 298  ARG B CZ  1 
ATOM   5540  N  NH1 . ARG B 1 252 ? -18.645 -28.532 26.912  1.00 45.90  ? 298  ARG B NH1 1 
ATOM   5541  N  NH2 . ARG B 1 252 ? -17.145 -29.401 25.372  1.00 45.72  ? 298  ARG B NH2 1 
ATOM   5542  N  N   . ALA B 1 253 ? -24.647 -33.654 26.631  1.00 41.81  ? 299  ALA B N   1 
ATOM   5543  C  CA  . ALA B 1 253 ? -25.555 -34.651 27.265  1.00 41.69  ? 299  ALA B CA  1 
ATOM   5544  C  C   . ALA B 1 253 ? -25.871 -35.807 26.313  1.00 41.83  ? 299  ALA B C   1 
ATOM   5545  O  O   . ALA B 1 253 ? -25.770 -36.982 26.684  1.00 41.65  ? 299  ALA B O   1 
ATOM   5546  C  CB  . ALA B 1 253 ? -26.846 -33.993 27.728  1.00 41.23  ? 299  ALA B CB  1 
ATOM   5547  N  N   . ALA B 1 254 ? -26.216 -35.454 25.074  1.00 41.99  ? 300  ALA B N   1 
ATOM   5548  C  CA  . ALA B 1 254 ? -26.601 -36.425 24.060  1.00 42.09  ? 300  ALA B CA  1 
ATOM   5549  C  C   . ALA B 1 254 ? -25.426 -37.307 23.679  1.00 42.22  ? 300  ALA B C   1 
ATOM   5550  O  O   . ALA B 1 254 ? -25.591 -38.515 23.525  1.00 42.38  ? 300  ALA B O   1 
ATOM   5551  C  CB  . ALA B 1 254 ? -27.157 -35.729 22.849  1.00 42.24  ? 300  ALA B CB  1 
ATOM   5552  N  N   . LEU B 1 255 ? -24.245 -36.704 23.555  1.00 42.12  ? 301  LEU B N   1 
ATOM   5553  C  CA  . LEU B 1 255 ? -23.012 -37.431 23.257  1.00 42.38  ? 301  LEU B CA  1 
ATOM   5554  C  C   . LEU B 1 255 ? -22.774 -38.538 24.291  1.00 42.97  ? 301  LEU B C   1 
ATOM   5555  O  O   . LEU B 1 255 ? -22.123 -39.548 24.021  1.00 43.16  ? 301  LEU B O   1 
ATOM   5556  C  CB  . LEU B 1 255 ? -21.838 -36.453 23.265  1.00 42.28  ? 301  LEU B CB  1 
ATOM   5557  C  CG  . LEU B 1 255 ? -20.893 -36.436 22.071  1.00 42.48  ? 301  LEU B CG  1 
ATOM   5558  C  CD1 . LEU B 1 255 ? -21.658 -36.208 20.778  1.00 41.76  ? 301  LEU B CD1 1 
ATOM   5559  C  CD2 . LEU B 1 255 ? -19.838 -35.357 22.285  1.00 43.66  ? 301  LEU B CD2 1 
ATOM   5560  N  N   . GLY B 1 256 ? -23.326 -38.343 25.483  1.00 43.70  ? 302  GLY B N   1 
ATOM   5561  C  CA  . GLY B 1 256 ? -23.264 -39.336 26.542  1.00 44.46  ? 302  GLY B CA  1 
ATOM   5562  C  C   . GLY B 1 256 ? -21.857 -39.546 27.061  1.00 45.20  ? 302  GLY B C   1 
ATOM   5563  O  O   . GLY B 1 256 ? -20.892 -38.951 26.548  1.00 45.64  ? 302  GLY B O   1 
ATOM   5564  N  N   . PRO B 1 257 ? -21.720 -40.427 28.056  1.00 45.61  ? 303  PRO B N   1 
ATOM   5565  C  CA  . PRO B 1 257 ? -20.460 -40.639 28.753  1.00 45.97  ? 303  PRO B CA  1 
ATOM   5566  C  C   . PRO B 1 257 ? -19.452 -41.376 27.881  1.00 46.40  ? 303  PRO B C   1 
ATOM   5567  O  O   . PRO B 1 257 ? -18.246 -41.129 28.006  1.00 47.00  ? 303  PRO B O   1 
ATOM   5568  C  CB  . PRO B 1 257 ? -20.854 -41.512 29.954  1.00 45.88  ? 303  PRO B CB  1 
ATOM   5569  C  CG  . PRO B 1 257 ? -22.360 -41.552 29.964  1.00 45.86  ? 303  PRO B CG  1 
ATOM   5570  C  CD  . PRO B 1 257 ? -22.776 -41.323 28.552  1.00 45.73  ? 303  PRO B CD  1 
ATOM   5571  N  N   . GLU B 1 258 ? -19.928 -42.250 26.993  1.00 46.60  ? 304  GLU B N   1 
ATOM   5572  C  CA  . GLU B 1 258 ? -19.028 -42.954 26.074  1.00 46.83  ? 304  GLU B CA  1 
ATOM   5573  C  C   . GLU B 1 258 ? -18.278 -41.969 25.158  1.00 46.53  ? 304  GLU B C   1 
ATOM   5574  O  O   . GLU B 1 258 ? -17.483 -42.403 24.325  1.00 46.60  ? 304  GLU B O   1 
ATOM   5575  C  CB  . GLU B 1 258 ? -19.777 -43.997 25.218  1.00 47.01  ? 304  GLU B CB  1 
ATOM   5576  C  CG  . GLU B 1 258 ? -21.029 -44.637 25.825  1.00 48.60  ? 304  GLU B CG  1 
ATOM   5577  C  CD  . GLU B 1 258 ? -20.814 -46.078 26.338  1.00 51.39  ? 304  GLU B CD  1 
ATOM   5578  O  OE1 . GLU B 1 258 ? -19.970 -46.817 25.781  1.00 52.08  ? 304  GLU B OE1 1 
ATOM   5579  O  OE2 . GLU B 1 258 ? -21.514 -46.488 27.299  1.00 52.85  ? 304  GLU B OE2 1 
ATOM   5580  N  N   . GLY B 1 259 ? -18.514 -40.661 25.325  1.00 46.35  ? 305  GLY B N   1 
ATOM   5581  C  CA  . GLY B 1 259 ? -17.968 -39.655 24.402  1.00 46.50  ? 305  GLY B CA  1 
ATOM   5582  C  C   . GLY B 1 259 ? -17.513 -38.305 24.926  1.00 46.69  ? 305  GLY B C   1 
ATOM   5583  O  O   . GLY B 1 259 ? -17.772 -37.276 24.306  1.00 47.02  ? 305  GLY B O   1 
ATOM   5584  N  N   . HIS B 1 260 ? -16.815 -38.292 26.053  1.00 46.98  ? 306  HIS B N   1 
ATOM   5585  C  CA  . HIS B 1 260 ? -16.179 -37.062 26.530  1.00 47.07  ? 306  HIS B CA  1 
ATOM   5586  C  C   . HIS B 1 260 ? -15.015 -36.678 25.677  1.00 46.39  ? 306  HIS B C   1 
ATOM   5587  O  O   . HIS B 1 260 ? -14.674 -35.498 25.601  1.00 46.95  ? 306  HIS B O   1 
ATOM   5588  C  CB  . HIS B 1 260 ? -15.595 -37.248 27.918  1.00 47.71  ? 306  HIS B CB  1 
ATOM   5589  C  CG  . HIS B 1 260 ? -16.549 -36.938 29.016  1.00 50.13  ? 306  HIS B CG  1 
ATOM   5590  N  ND1 . HIS B 1 260 ? -17.102 -37.920 29.816  1.00 52.28  ? 306  HIS B ND1 1 
ATOM   5591  C  CD2 . HIS B 1 260 ? -17.059 -35.761 29.453  1.00 51.72  ? 306  HIS B CD2 1 
ATOM   5592  C  CE1 . HIS B 1 260 ? -17.902 -37.361 30.707  1.00 52.56  ? 306  HIS B CE1 1 
ATOM   5593  N  NE2 . HIS B 1 260 ? -17.896 -36.052 30.507  1.00 53.04  ? 306  HIS B NE2 1 
ATOM   5594  N  N   . GLY B 1 261 ? -14.361 -37.679 25.095  1.00 45.61  ? 307  GLY B N   1 
ATOM   5595  C  CA  . GLY B 1 261 ? -13.155 -37.450 24.292  1.00 44.92  ? 307  GLY B CA  1 
ATOM   5596  C  C   . GLY B 1 261 ? -13.403 -36.553 23.093  1.00 44.22  ? 307  GLY B C   1 
ATOM   5597  O  O   . GLY B 1 261 ? -12.526 -35.793 22.706  1.00 44.18  ? 307  GLY B O   1 
ATOM   5598  N  N   . ILE B 1 262 ? -14.623 -36.655 22.557  1.00 43.68  ? 308  ILE B N   1 
ATOM   5599  C  CA  . ILE B 1 262 ? -15.071 -36.027 21.321  1.00 43.37  ? 308  ILE B CA  1 
ATOM   5600  C  C   . ILE B 1 262 ? -15.016 -34.511 21.439  1.00 43.25  ? 308  ILE B C   1 
ATOM   5601  O  O   . ILE B 1 262 ? -15.601 -33.952 22.364  1.00 43.78  ? 308  ILE B O   1 
ATOM   5602  C  CB  . ILE B 1 262 ? -16.532 -36.497 20.962  1.00 43.38  ? 308  ILE B CB  1 
ATOM   5603  C  CG1 . ILE B 1 262 ? -16.571 -38.011 20.744  1.00 43.43  ? 308  ILE B CG1 1 
ATOM   5604  C  CG2 . ILE B 1 262 ? -17.057 -35.789 19.736  1.00 42.73  ? 308  ILE B CG2 1 
ATOM   5605  C  CD1 . ILE B 1 262 ? -17.660 -38.472 19.832  1.00 43.66  ? 308  ILE B CD1 1 
ATOM   5606  N  N   . LYS B 1 263 ? -14.310 -33.861 20.512  1.00 42.58  ? 309  LYS B N   1 
ATOM   5607  C  CA  . LYS B 1 263 ? -14.248 -32.402 20.472  1.00 42.07  ? 309  LYS B CA  1 
ATOM   5608  C  C   . LYS B 1 263 ? -15.520 -31.852 19.867  1.00 41.65  ? 309  LYS B C   1 
ATOM   5609  O  O   . LYS B 1 263 ? -16.052 -32.406 18.898  1.00 41.97  ? 309  LYS B O   1 
ATOM   5610  C  CB  . LYS B 1 263 ? -13.046 -31.909 19.673  1.00 42.22  ? 309  LYS B CB  1 
ATOM   5611  C  CG  . LYS B 1 263 ? -11.703 -32.424 20.170  1.00 42.94  ? 309  LYS B CG  1 
ATOM   5612  C  CD  . LYS B 1 263 ? -11.524 -32.148 21.629  1.00 43.34  ? 309  LYS B CD  1 
ATOM   5613  C  CE  . LYS B 1 263 ? -10.100 -32.358 22.058  1.00 45.31  ? 309  LYS B CE  1 
ATOM   5614  N  NZ  . LYS B 1 263 ? -9.801  -31.437 23.180  1.00 45.96  ? 309  LYS B NZ  1 
ATOM   5615  N  N   . ILE B 1 264 ? -16.009 -30.765 20.451  1.00 40.88  ? 310  ILE B N   1 
ATOM   5616  C  CA  . ILE B 1 264 ? -17.272 -30.168 20.047  1.00 39.87  ? 310  ILE B CA  1 
ATOM   5617  C  C   . ILE B 1 264 ? -16.972 -28.830 19.427  1.00 39.59  ? 310  ILE B C   1 
ATOM   5618  O  O   . ILE B 1 264 ? -16.386 -27.969 20.083  1.00 40.02  ? 310  ILE B O   1 
ATOM   5619  C  CB  . ILE B 1 264 ? -18.202 -29.994 21.264  1.00 39.66  ? 310  ILE B CB  1 
ATOM   5620  C  CG1 . ILE B 1 264 ? -18.577 -31.367 21.805  1.00 39.63  ? 310  ILE B CG1 1 
ATOM   5621  C  CG2 . ILE B 1 264 ? -19.425 -29.159 20.920  1.00 39.11  ? 310  ILE B CG2 1 
ATOM   5622  C  CD1 . ILE B 1 264 ? -19.962 -31.439 22.359  1.00 41.02  ? 310  ILE B CD1 1 
ATOM   5623  N  N   . ILE B 1 265 ? -17.352 -28.658 18.164  1.00 39.01  ? 311  ILE B N   1 
ATOM   5624  C  CA  . ILE B 1 265 ? -17.121 -27.410 17.457  1.00 38.73  ? 311  ILE B CA  1 
ATOM   5625  C  C   . ILE B 1 265 ? -18.472 -26.738 17.231  1.00 39.07  ? 311  ILE B C   1 
ATOM   5626  O  O   . ILE B 1 265 ? -19.281 -27.232 16.437  1.00 39.73  ? 311  ILE B O   1 
ATOM   5627  C  CB  . ILE B 1 265 ? -16.444 -27.671 16.076  1.00 38.64  ? 311  ILE B CB  1 
ATOM   5628  C  CG1 . ILE B 1 265 ? -15.106 -28.431 16.206  1.00 37.92  ? 311  ILE B CG1 1 
ATOM   5629  C  CG2 . ILE B 1 265 ? -16.288 -26.373 15.263  1.00 38.21  ? 311  ILE B CG2 1 
ATOM   5630  C  CD1 . ILE B 1 265 ? -14.033 -27.770 17.069  1.00 37.16  ? 311  ILE B CD1 1 
ATOM   5631  N  N   . SER B 1 266 ? -18.742 -25.628 17.909  1.00 38.93  ? 312  SER B N   1 
ATOM   5632  C  CA  . SER B 1 266 ? -20.017 -24.936 17.679  1.00 39.16  ? 312  SER B CA  1 
ATOM   5633  C  C   . SER B 1 266 ? -19.999 -24.141 16.370  1.00 39.47  ? 312  SER B C   1 
ATOM   5634  O  O   . SER B 1 266 ? -19.075 -23.321 16.127  1.00 39.26  ? 312  SER B O   1 
ATOM   5635  C  CB  . SER B 1 266 ? -20.367 -24.011 18.830  1.00 38.54  ? 312  SER B CB  1 
ATOM   5636  O  OG  . SER B 1 266 ? -20.008 -24.616 20.039  1.00 39.49  ? 312  SER B OG  1 
ATOM   5637  N  N   . LYS B 1 267 ? -21.020 -24.392 15.538  1.00 39.16  ? 313  LYS B N   1 
ATOM   5638  C  CA  . LYS B 1 267 ? -21.175 -23.650 14.300  1.00 38.95  ? 313  LYS B CA  1 
ATOM   5639  C  C   . LYS B 1 267 ? -22.011 -22.445 14.610  1.00 38.93  ? 313  LYS B C   1 
ATOM   5640  O  O   . LYS B 1 267 ? -23.073 -22.557 15.221  1.00 39.15  ? 313  LYS B O   1 
ATOM   5641  C  CB  . LYS B 1 267 ? -21.836 -24.465 13.181  1.00 38.98  ? 313  LYS B CB  1 
ATOM   5642  C  CG  . LYS B 1 267 ? -21.390 -25.919 13.063  1.00 37.74  ? 313  LYS B CG  1 
ATOM   5643  C  CD  . LYS B 1 267 ? -21.531 -26.487 11.657  1.00 37.75  ? 313  LYS B CD  1 
ATOM   5644  C  CE  . LYS B 1 267 ? -22.875 -26.240 11.002  1.00 36.67  ? 313  LYS B CE  1 
ATOM   5645  N  NZ  . LYS B 1 267 ? -23.297 -27.459 10.243  1.00 34.31  ? 313  LYS B NZ  1 
ATOM   5646  N  N   . ILE B 1 268 ? -21.505 -21.289 14.181  1.00 38.88  ? 314  ILE B N   1 
ATOM   5647  C  CA  . ILE B 1 268 ? -22.163 -19.998 14.380  1.00 38.50  ? 314  ILE B CA  1 
ATOM   5648  C  C   . ILE B 1 268 ? -22.857 -19.616 13.060  1.00 38.54  ? 314  ILE B C   1 
ATOM   5649  O  O   . ILE B 1 268 ? -22.221 -19.304 12.064  1.00 38.81  ? 314  ILE B O   1 
ATOM   5650  C  CB  . ILE B 1 268 ? -21.142 -18.935 14.889  1.00 38.32  ? 314  ILE B CB  1 
ATOM   5651  C  CG1 . ILE B 1 268 ? -20.505 -19.381 16.225  1.00 38.45  ? 314  ILE B CG1 1 
ATOM   5652  C  CG2 . ILE B 1 268 ? -21.740 -17.551 14.963  1.00 37.58  ? 314  ILE B CG2 1 
ATOM   5653  C  CD1 . ILE B 1 268 ? -21.442 -19.442 17.420  1.00 39.59  ? 314  ILE B CD1 1 
ATOM   5654  N  N   . GLU B 1 269 ? -24.178 -19.687 13.068  1.00 38.59  ? 315  GLU B N   1 
ATOM   5655  C  CA  . GLU B 1 269 ? -24.955 -19.589 11.853  1.00 38.41  ? 315  GLU B CA  1 
ATOM   5656  C  C   . GLU B 1 269 ? -26.000 -18.470 11.874  1.00 38.33  ? 315  GLU B C   1 
ATOM   5657  O  O   . GLU B 1 269 ? -26.748 -18.295 10.908  1.00 38.55  ? 315  GLU B O   1 
ATOM   5658  C  CB  . GLU B 1 269 ? -25.630 -20.938 11.570  1.00 38.79  ? 315  GLU B CB  1 
ATOM   5659  C  CG  . GLU B 1 269 ? -24.649 -22.016 11.126  1.00 39.72  ? 315  GLU B CG  1 
ATOM   5660  C  CD  . GLU B 1 269 ? -25.302 -23.291 10.617  1.00 42.49  ? 315  GLU B CD  1 
ATOM   5661  O  OE1 . GLU B 1 269 ? -25.776 -24.071 11.489  1.00 42.85  ? 315  GLU B OE1 1 
ATOM   5662  O  OE2 . GLU B 1 269 ? -25.290 -23.527 9.368   1.00 41.22  ? 315  GLU B OE2 1 
ATOM   5663  N  N   . ASN B 1 270 ? -26.065 -17.699 12.952  1.00 37.89  ? 316  ASN B N   1 
ATOM   5664  C  CA  . ASN B 1 270 ? -27.059 -16.628 12.995  1.00 37.66  ? 316  ASN B CA  1 
ATOM   5665  C  C   . ASN B 1 270 ? -26.737 -15.498 13.947  1.00 37.59  ? 316  ASN B C   1 
ATOM   5666  O  O   . ASN B 1 270 ? -25.722 -15.526 14.657  1.00 37.78  ? 316  ASN B O   1 
ATOM   5667  C  CB  . ASN B 1 270 ? -28.456 -17.178 13.289  1.00 37.79  ? 316  ASN B CB  1 
ATOM   5668  C  CG  . ASN B 1 270 ? -28.512 -17.948 14.593  1.00 38.49  ? 316  ASN B CG  1 
ATOM   5669  O  OD1 . ASN B 1 270 ? -27.827 -17.608 15.577  1.00 38.92  ? 316  ASN B OD1 1 
ATOM   5670  N  ND2 . ASN B 1 270 ? -29.327 -18.997 14.613  1.00 39.29  ? 316  ASN B ND2 1 
ATOM   5671  N  N   . HIS B 1 271 ? -27.616 -14.504 13.948  1.00 37.62  ? 317  HIS B N   1 
ATOM   5672  C  CA  . HIS B 1 271 ? -27.350 -13.294 14.669  1.00 38.02  ? 317  HIS B CA  1 
ATOM   5673  C  C   . HIS B 1 271 ? -27.192 -13.578 16.160  1.00 38.20  ? 317  HIS B C   1 
ATOM   5674  O  O   . HIS B 1 271 ? -26.200 -13.177 16.765  1.00 38.44  ? 317  HIS B O   1 
ATOM   5675  C  CB  . HIS B 1 271 ? -28.431 -12.263 14.402  1.00 38.00  ? 317  HIS B CB  1 
ATOM   5676  C  CG  . HIS B 1 271 ? -28.118 -10.916 14.968  1.00 39.54  ? 317  HIS B CG  1 
ATOM   5677  N  ND1 . HIS B 1 271 ? -28.539 -10.514 16.223  1.00 41.74  ? 317  HIS B ND1 1 
ATOM   5678  C  CD2 . HIS B 1 271 ? -27.414 -9.881  14.454  1.00 40.64  ? 317  HIS B CD2 1 
ATOM   5679  C  CE1 . HIS B 1 271 ? -28.116 -9.282  16.449  1.00 42.55  ? 317  HIS B CE1 1 
ATOM   5680  N  NE2 . HIS B 1 271 ? -27.426 -8.877  15.393  1.00 41.38  ? 317  HIS B NE2 1 
ATOM   5681  N  N   . GLU B 1 272 ? -28.140 -14.295 16.749  1.00 38.30  ? 318  GLU B N   1 
ATOM   5682  C  CA  . GLU B 1 272 ? -28.064 -14.533 18.172  1.00 38.61  ? 318  GLU B CA  1 
ATOM   5683  C  C   . GLU B 1 272 ? -26.738 -15.206 18.504  1.00 38.08  ? 318  GLU B C   1 
ATOM   5684  O  O   . GLU B 1 272 ? -26.049 -14.807 19.438  1.00 37.67  ? 318  GLU B O   1 
ATOM   5685  C  CB  . GLU B 1 272 ? -29.245 -15.369 18.658  1.00 39.13  ? 318  GLU B CB  1 
ATOM   5686  C  CG  . GLU B 1 272 ? -29.083 -15.795 20.108  1.00 40.78  ? 318  GLU B CG  1 
ATOM   5687  C  CD  . GLU B 1 272 ? -30.393 -16.061 20.796  1.00 43.47  ? 318  GLU B CD  1 
ATOM   5688  O  OE1 . GLU B 1 272 ? -31.330 -16.567 20.141  1.00 44.19  ? 318  GLU B OE1 1 
ATOM   5689  O  OE2 . GLU B 1 272 ? -30.470 -15.766 22.003  1.00 45.09  ? 318  GLU B OE2 1 
ATOM   5690  N  N   . GLY B 1 273 ? -26.390 -16.215 17.716  1.00 37.91  ? 319  GLY B N   1 
ATOM   5691  C  CA  . GLY B 1 273 ? -25.107 -16.906 17.848  1.00 38.39  ? 319  GLY B CA  1 
ATOM   5692  C  C   . GLY B 1 273 ? -23.934 -15.949 17.796  1.00 38.83  ? 319  GLY B C   1 
ATOM   5693  O  O   . GLY B 1 273 ? -22.996 -16.057 18.574  1.00 39.21  ? 319  GLY B O   1 
ATOM   5694  N  N   . VAL B 1 274 ? -23.985 -14.994 16.883  1.00 39.01  ? 320  VAL B N   1 
ATOM   5695  C  CA  . VAL B 1 274 ? -22.931 -14.021 16.819  1.00 39.45  ? 320  VAL B CA  1 
ATOM   5696  C  C   . VAL B 1 274 ? -22.912 -13.190 18.095  1.00 40.06  ? 320  VAL B C   1 
ATOM   5697  O  O   . VAL B 1 274 ? -21.861 -12.965 18.687  1.00 40.18  ? 320  VAL B O   1 
ATOM   5698  C  CB  . VAL B 1 274 ? -23.038 -13.154 15.552  1.00 39.70  ? 320  VAL B CB  1 
ATOM   5699  C  CG1 . VAL B 1 274 ? -22.051 -11.973 15.596  1.00 38.37  ? 320  VAL B CG1 1 
ATOM   5700  C  CG2 . VAL B 1 274 ? -22.730 -14.006 14.343  1.00 38.96  ? 320  VAL B CG2 1 
ATOM   5701  N  N   . LYS B 1 275 ? -24.086 -12.765 18.540  1.00 40.79  ? 321  LYS B N   1 
ATOM   5702  C  CA  . LYS B 1 275 ? -24.174 -11.958 19.741  1.00 41.40  ? 321  LYS B CA  1 
ATOM   5703  C  C   . LYS B 1 275 ? -23.750 -12.642 21.037  1.00 41.18  ? 321  LYS B C   1 
ATOM   5704  O  O   . LYS B 1 275 ? -23.222 -11.980 21.929  1.00 41.58  ? 321  LYS B O   1 
ATOM   5705  C  CB  . LYS B 1 275 ? -25.556 -11.323 19.867  1.00 41.94  ? 321  LYS B CB  1 
ATOM   5706  C  CG  . LYS B 1 275 ? -25.706 -10.056 18.993  1.00 44.05  ? 321  LYS B CG  1 
ATOM   5707  C  CD  . LYS B 1 275 ? -25.011 -8.826  19.616  1.00 46.41  ? 321  LYS B CD  1 
ATOM   5708  C  CE  . LYS B 1 275 ? -24.034 -8.193  18.625  1.00 47.21  ? 321  LYS B CE  1 
ATOM   5709  N  NZ  . LYS B 1 275 ? -23.237 -7.125  19.283  1.00 48.72  ? 321  LYS B NZ  1 
ATOM   5710  N  N   . ARG B 1 276 ? -23.953 -13.951 21.147  1.00 40.82  ? 322  ARG B N   1 
ATOM   5711  C  CA  . ARG B 1 276 ? -23.640 -14.636 22.405  1.00 40.68  ? 322  ARG B CA  1 
ATOM   5712  C  C   . ARG B 1 276 ? -22.394 -15.474 22.283  1.00 40.71  ? 322  ARG B C   1 
ATOM   5713  O  O   . ARG B 1 276 ? -22.148 -16.394 23.079  1.00 40.66  ? 322  ARG B O   1 
ATOM   5714  C  CB  . ARG B 1 276 ? -24.835 -15.427 22.871  1.00 40.84  ? 322  ARG B CB  1 
ATOM   5715  C  CG  . ARG B 1 276 ? -26.040 -14.493 22.963  1.00 42.02  ? 322  ARG B CG  1 
ATOM   5716  C  CD  . ARG B 1 276 ? -27.238 -15.179 23.395  1.00 42.75  ? 322  ARG B CD  1 
ATOM   5717  N  NE  . ARG B 1 276 ? -27.039 -15.602 24.756  1.00 45.86  ? 322  ARG B NE  1 
ATOM   5718  C  CZ  . ARG B 1 276 ? -27.784 -16.526 25.323  1.00 48.01  ? 322  ARG B CZ  1 
ATOM   5719  N  NH1 . ARG B 1 276 ? -28.781 -17.093 24.609  1.00 48.07  ? 322  ARG B NH1 1 
ATOM   5720  N  NH2 . ARG B 1 276 ? -27.553 -16.866 26.598  1.00 48.23  ? 322  ARG B NH2 1 
ATOM   5721  N  N   . PHE B 1 277 ? -21.586 -15.085 21.302  1.00 40.32  ? 323  PHE B N   1 
ATOM   5722  C  CA  . PHE B 1 277 ? -20.377 -15.781 20.950  1.00 40.14  ? 323  PHE B CA  1 
ATOM   5723  C  C   . PHE B 1 277 ? -19.445 -16.025 22.123  1.00 40.50  ? 323  PHE B C   1 
ATOM   5724  O  O   . PHE B 1 277 ? -18.924 -17.128 22.275  1.00 40.94  ? 323  PHE B O   1 
ATOM   5725  C  CB  . PHE B 1 277 ? -19.621 -15.017 19.867  1.00 39.85  ? 323  PHE B CB  1 
ATOM   5726  C  CG  . PHE B 1 277 ? -18.320 -15.639 19.513  1.00 38.67  ? 323  PHE B CG  1 
ATOM   5727  C  CD1 . PHE B 1 277 ? -18.263 -16.609 18.558  1.00 36.91  ? 323  PHE B CD1 1 
ATOM   5728  C  CD2 . PHE B 1 277 ? -17.153 -15.277 20.167  1.00 38.69  ? 323  PHE B CD2 1 
ATOM   5729  C  CE1 . PHE B 1 277 ? -17.061 -17.193 18.233  1.00 38.61  ? 323  PHE B CE1 1 
ATOM   5730  C  CE2 . PHE B 1 277 ? -15.940 -15.865 19.851  1.00 38.51  ? 323  PHE B CE2 1 
ATOM   5731  C  CZ  . PHE B 1 277 ? -15.890 -16.812 18.878  1.00 38.42  ? 323  PHE B CZ  1 
ATOM   5732  N  N   . ASP B 1 278 ? -19.192 -15.003 22.927  1.00 40.57  ? 324  ASP B N   1 
ATOM   5733  C  CA  . ASP B 1 278 ? -18.281 -15.189 24.047  1.00 41.02  ? 324  ASP B CA  1 
ATOM   5734  C  C   . ASP B 1 278 ? -18.714 -16.383 24.912  1.00 40.72  ? 324  ASP B C   1 
ATOM   5735  O  O   . ASP B 1 278 ? -17.889 -17.232 25.280  1.00 40.48  ? 324  ASP B O   1 
ATOM   5736  C  CB  . ASP B 1 278 ? -18.174 -13.912 24.899  1.00 41.43  ? 324  ASP B CB  1 
ATOM   5737  C  CG  . ASP B 1 278 ? -17.332 -12.826 24.234  1.00 43.59  ? 324  ASP B CG  1 
ATOM   5738  O  OD1 . ASP B 1 278 ? -16.476 -13.146 23.352  1.00 44.66  ? 324  ASP B OD1 1 
ATOM   5739  O  OD2 . ASP B 1 278 ? -17.536 -11.646 24.600  1.00 45.89  ? 324  ASP B OD2 1 
ATOM   5740  N  N   . GLU B 1 279 ? -20.011 -16.459 25.212  1.00 40.35  ? 325  GLU B N   1 
ATOM   5741  C  CA  . GLU B 1 279 ? -20.483 -17.488 26.116  1.00 40.10  ? 325  GLU B CA  1 
ATOM   5742  C  C   . GLU B 1 279 ? -20.315 -18.821 25.427  1.00 39.77  ? 325  GLU B C   1 
ATOM   5743  O  O   . GLU B 1 279 ? -19.893 -19.797 26.041  1.00 40.21  ? 325  GLU B O   1 
ATOM   5744  C  CB  . GLU B 1 279 ? -21.928 -17.241 26.562  1.00 39.96  ? 325  GLU B CB  1 
ATOM   5745  C  CG  . GLU B 1 279 ? -23.025 -17.858 25.693  1.00 40.60  ? 325  GLU B CG  1 
ATOM   5746  C  CD  . GLU B 1 279 ? -24.421 -17.517 26.173  1.00 41.42  ? 325  GLU B CD  1 
ATOM   5747  O  OE1 . GLU B 1 279 ? -24.743 -16.307 26.343  1.00 41.90  ? 325  GLU B OE1 1 
ATOM   5748  O  OE2 . GLU B 1 279 ? -25.196 -18.471 26.391  1.00 41.87  ? 325  GLU B OE2 1 
ATOM   5749  N  N   . ILE B 1 280 ? -20.611 -18.841 24.136  1.00 39.42  ? 326  ILE B N   1 
ATOM   5750  C  CA  . ILE B 1 280 ? -20.503 -20.062 23.361  1.00 38.97  ? 326  ILE B CA  1 
ATOM   5751  C  C   . ILE B 1 280 ? -19.066 -20.570 23.310  1.00 39.30  ? 326  ILE B C   1 
ATOM   5752  O  O   . ILE B 1 280 ? -18.827 -21.766 23.501  1.00 39.45  ? 326  ILE B O   1 
ATOM   5753  C  CB  . ILE B 1 280 ? -21.115 -19.904 21.971  1.00 38.76  ? 326  ILE B CB  1 
ATOM   5754  C  CG1 . ILE B 1 280 ? -22.622 -19.636 22.130  1.00 38.94  ? 326  ILE B CG1 1 
ATOM   5755  C  CG2 . ILE B 1 280 ? -20.863 -21.141 21.150  1.00 36.87  ? 326  ILE B CG2 1 
ATOM   5756  C  CD1 . ILE B 1 280 ? -23.252 -18.828 21.028  1.00 38.35  ? 326  ILE B CD1 1 
ATOM   5757  N  N   . LEU B 1 281 ? -18.110 -19.667 23.103  1.00 39.46  ? 327  LEU B N   1 
ATOM   5758  C  CA  . LEU B 1 281 ? -16.718 -20.075 22.961  1.00 39.93  ? 327  LEU B CA  1 
ATOM   5759  C  C   . LEU B 1 281 ? -16.178 -20.703 24.250  1.00 40.60  ? 327  LEU B C   1 
ATOM   5760  O  O   . LEU B 1 281 ? -15.527 -21.742 24.234  1.00 40.79  ? 327  LEU B O   1 
ATOM   5761  C  CB  . LEU B 1 281 ? -15.862 -18.882 22.584  1.00 39.62  ? 327  LEU B CB  1 
ATOM   5762  C  CG  . LEU B 1 281 ? -14.609 -19.083 21.745  1.00 38.90  ? 327  LEU B CG  1 
ATOM   5763  C  CD1 . LEU B 1 281 ? -13.629 -18.058 22.210  1.00 39.40  ? 327  LEU B CD1 1 
ATOM   5764  C  CD2 . LEU B 1 281 ? -13.984 -20.453 21.833  1.00 38.53  ? 327  LEU B CD2 1 
ATOM   5765  N  N   . GLU B 1 282 ? -16.456 -20.055 25.370  1.00 41.45  ? 328  GLU B N   1 
ATOM   5766  C  CA  . GLU B 1 282 ? -15.984 -20.510 26.670  1.00 41.94  ? 328  GLU B CA  1 
ATOM   5767  C  C   . GLU B 1 282 ? -16.314 -21.979 26.939  1.00 41.53  ? 328  GLU B C   1 
ATOM   5768  O  O   . GLU B 1 282 ? -15.608 -22.668 27.677  1.00 41.56  ? 328  GLU B O   1 
ATOM   5769  C  CB  . GLU B 1 282 ? -16.613 -19.650 27.759  1.00 42.01  ? 328  GLU B CB  1 
ATOM   5770  C  CG  . GLU B 1 282 ? -15.696 -19.416 28.932  1.00 44.51  ? 328  GLU B CG  1 
ATOM   5771  C  CD  . GLU B 1 282 ? -16.378 -18.645 30.029  1.00 48.85  ? 328  GLU B CD  1 
ATOM   5772  O  OE1 . GLU B 1 282 ? -17.632 -18.505 29.995  1.00 48.50  ? 328  GLU B OE1 1 
ATOM   5773  O  OE2 . GLU B 1 282 ? -15.655 -18.174 30.928  1.00 50.85  ? 328  GLU B OE2 1 
ATOM   5774  N  N   . VAL B 1 283 ? -17.379 -22.447 26.308  1.00 41.23  ? 329  VAL B N   1 
ATOM   5775  C  CA  . VAL B 1 283 ? -17.968 -23.729 26.630  1.00 41.06  ? 329  VAL B CA  1 
ATOM   5776  C  C   . VAL B 1 283 ? -17.710 -24.766 25.518  1.00 41.16  ? 329  VAL B C   1 
ATOM   5777  O  O   . VAL B 1 283 ? -17.915 -25.966 25.699  1.00 41.35  ? 329  VAL B O   1 
ATOM   5778  C  CB  . VAL B 1 283 ? -19.481 -23.515 26.963  1.00 41.09  ? 329  VAL B CB  1 
ATOM   5779  C  CG1 . VAL B 1 283 ? -20.385 -24.427 26.177  1.00 40.53  ? 329  VAL B CG1 1 
ATOM   5780  C  CG2 . VAL B 1 283 ? -19.723 -23.606 28.461  1.00 40.17  ? 329  VAL B CG2 1 
ATOM   5781  N  N   . SER B 1 284 ? -17.232 -24.291 24.381  1.00 40.92  ? 330  SER B N   1 
ATOM   5782  C  CA  . SER B 1 284 ? -16.934 -25.148 23.241  1.00 40.91  ? 330  SER B CA  1 
ATOM   5783  C  C   . SER B 1 284 ? -15.435 -25.421 23.106  1.00 40.84  ? 330  SER B C   1 
ATOM   5784  O  O   . SER B 1 284 ? -14.603 -24.709 23.663  1.00 40.69  ? 330  SER B O   1 
ATOM   5785  C  CB  . SER B 1 284 ? -17.439 -24.487 21.957  1.00 40.89  ? 330  SER B CB  1 
ATOM   5786  O  OG  . SER B 1 284 ? -18.741 -23.963 22.151  1.00 40.74  ? 330  SER B OG  1 
ATOM   5787  N  N   . ASP B 1 285 ? -15.097 -26.457 22.357  1.00 40.91  ? 331  ASP B N   1 
ATOM   5788  C  CA  . ASP B 1 285 ? -13.703 -26.743 22.080  1.00 41.50  ? 331  ASP B CA  1 
ATOM   5789  C  C   . ASP B 1 285 ? -13.174 -25.869 20.960  1.00 41.50  ? 331  ASP B C   1 
ATOM   5790  O  O   . ASP B 1 285 ? -11.967 -25.658 20.853  1.00 41.85  ? 331  ASP B O   1 
ATOM   5791  C  CB  . ASP B 1 285 ? -13.534 -28.210 21.710  1.00 41.77  ? 331  ASP B CB  1 
ATOM   5792  C  CG  . ASP B 1 285 ? -13.829 -29.128 22.863  1.00 42.69  ? 331  ASP B CG  1 
ATOM   5793  O  OD1 . ASP B 1 285 ? -13.202 -28.944 23.928  1.00 43.57  ? 331  ASP B OD1 1 
ATOM   5794  O  OD2 . ASP B 1 285 ? -14.688 -30.027 22.703  1.00 45.12  ? 331  ASP B OD2 1 
ATOM   5795  N  N   . GLY B 1 286 ? -14.089 -25.386 20.125  1.00 41.25  ? 332  GLY B N   1 
ATOM   5796  C  CA  . GLY B 1 286 ? -13.749 -24.502 19.025  1.00 40.90  ? 332  GLY B CA  1 
ATOM   5797  C  C   . GLY B 1 286 ? -14.979 -23.968 18.321  1.00 40.54  ? 332  GLY B C   1 
ATOM   5798  O  O   . GLY B 1 286 ? -16.096 -24.171 18.769  1.00 40.93  ? 332  GLY B O   1 
ATOM   5799  N  N   . ILE B 1 287 ? -14.762 -23.310 17.192  1.00 40.19  ? 333  ILE B N   1 
ATOM   5800  C  CA  . ILE B 1 287 ? -15.809 -22.596 16.493  1.00 39.60  ? 333  ILE B CA  1 
ATOM   5801  C  C   . ILE B 1 287 ? -15.739 -22.879 14.980  1.00 39.45  ? 333  ILE B C   1 
ATOM   5802  O  O   . ILE B 1 287 ? -14.655 -23.127 14.445  1.00 39.24  ? 333  ILE B O   1 
ATOM   5803  C  CB  . ILE B 1 287 ? -15.689 -21.067 16.789  1.00 39.37  ? 333  ILE B CB  1 
ATOM   5804  C  CG1 . ILE B 1 287 ? -16.120 -20.736 18.232  1.00 39.18  ? 333  ILE B CG1 1 
ATOM   5805  C  CG2 . ILE B 1 287 ? -16.444 -20.212 15.759  1.00 39.18  ? 333  ILE B CG2 1 
ATOM   5806  C  CD1 . ILE B 1 287 ? -17.618 -20.873 18.538  1.00 38.31  ? 333  ILE B CD1 1 
ATOM   5807  N  N   . MET B 1 288 ? -16.908 -22.883 14.332  1.00 39.27  ? 334  MET B N   1 
ATOM   5808  C  CA  . MET B 1 288 ? -17.049 -22.845 12.883  1.00 38.97  ? 334  MET B CA  1 
ATOM   5809  C  C   . MET B 1 288 ? -17.788 -21.588 12.433  1.00 38.78  ? 334  MET B C   1 
ATOM   5810  O  O   . MET B 1 288 ? -18.964 -21.351 12.815  1.00 38.53  ? 334  MET B O   1 
ATOM   5811  C  CB  . MET B 1 288 ? -17.834 -24.040 12.349  1.00 38.90  ? 334  MET B CB  1 
ATOM   5812  C  CG  . MET B 1 288 ? -17.712 -24.143 10.824  1.00 39.74  ? 334  MET B CG  1 
ATOM   5813  S  SD  . MET B 1 288 ? -19.005 -25.016 9.921   1.00 38.25  ? 334  MET B SD  1 
ATOM   5814  C  CE  . MET B 1 288 ? -18.542 -26.695 10.272  1.00 38.29  ? 334  MET B CE  1 
ATOM   5815  N  N   . VAL B 1 289 ? -17.118 -20.799 11.590  1.00 38.16  ? 335  VAL B N   1 
ATOM   5816  C  CA  . VAL B 1 289 ? -17.756 -19.616 11.016  1.00 37.41  ? 335  VAL B CA  1 
ATOM   5817  C  C   . VAL B 1 289 ? -18.608 -20.126 9.885   1.00 38.18  ? 335  VAL B C   1 
ATOM   5818  O  O   . VAL B 1 289 ? -18.126 -20.322 8.763   1.00 37.81  ? 335  VAL B O   1 
ATOM   5819  C  CB  . VAL B 1 289 ? -16.775 -18.559 10.515  1.00 36.94  ? 335  VAL B CB  1 
ATOM   5820  C  CG1 . VAL B 1 289 ? -17.545 -17.336 10.059  1.00 35.23  ? 335  VAL B CG1 1 
ATOM   5821  C  CG2 . VAL B 1 289 ? -15.806 -18.164 11.608  1.00 35.24  ? 335  VAL B CG2 1 
ATOM   5822  N  N   . ALA B 1 290 ? -19.884 -20.367 10.204  1.00 38.82  ? 336  ALA B N   1 
ATOM   5823  C  CA  . ALA B 1 290 ? -20.779 -21.024 9.272   1.00 38.85  ? 336  ALA B CA  1 
ATOM   5824  C  C   . ALA B 1 290 ? -21.339 -19.999 8.303   1.00 39.09  ? 336  ALA B C   1 
ATOM   5825  O  O   . ALA B 1 290 ? -22.495 -19.586 8.427   1.00 39.76  ? 336  ALA B O   1 
ATOM   5826  C  CB  . ALA B 1 290 ? -21.870 -21.729 10.017  1.00 38.63  ? 336  ALA B CB  1 
ATOM   5827  N  N   . ARG B 1 291 ? -20.519 -19.590 7.332   1.00 38.79  ? 337  ARG B N   1 
ATOM   5828  C  CA  . ARG B 1 291 ? -20.878 -18.486 6.447   1.00 38.51  ? 337  ARG B CA  1 
ATOM   5829  C  C   . ARG B 1 291 ? -22.182 -18.651 5.677   1.00 38.77  ? 337  ARG B C   1 
ATOM   5830  O  O   . ARG B 1 291 ? -22.905 -17.682 5.502   1.00 38.86  ? 337  ARG B O   1 
ATOM   5831  C  CB  . ARG B 1 291 ? -19.778 -18.226 5.453   1.00 38.58  ? 337  ARG B CB  1 
ATOM   5832  C  CG  . ARG B 1 291 ? -18.593 -17.507 6.000   1.00 37.30  ? 337  ARG B CG  1 
ATOM   5833  C  CD  . ARG B 1 291 ? -17.415 -18.148 5.333   1.00 36.02  ? 337  ARG B CD  1 
ATOM   5834  N  NE  . ARG B 1 291 ? -16.529 -17.178 4.736   1.00 33.23  ? 337  ARG B NE  1 
ATOM   5835  C  CZ  . ARG B 1 291 ? -15.916 -17.376 3.580   1.00 31.55  ? 337  ARG B CZ  1 
ATOM   5836  N  NH1 . ARG B 1 291 ? -16.097 -18.496 2.912   1.00 31.18  ? 337  ARG B NH1 1 
ATOM   5837  N  NH2 . ARG B 1 291 ? -15.131 -16.449 3.087   1.00 33.64  ? 337  ARG B NH2 1 
ATOM   5838  N  N   . GLY B 1 292 ? -22.456 -19.857 5.183   1.00 39.07  ? 338  GLY B N   1 
ATOM   5839  C  CA  . GLY B 1 292 ? -23.684 -20.148 4.430   1.00 38.93  ? 338  GLY B CA  1 
ATOM   5840  C  C   . GLY B 1 292 ? -24.938 -19.573 5.079   1.00 39.16  ? 338  GLY B C   1 
ATOM   5841  O  O   . GLY B 1 292 ? -25.508 -18.596 4.572   1.00 39.06  ? 338  GLY B O   1 
ATOM   5842  N  N   . ASP B 1 293 ? -25.357 -20.161 6.198   1.00 38.70  ? 339  ASP B N   1 
ATOM   5843  C  CA  . ASP B 1 293 ? -26.514 -19.663 6.923   1.00 39.14  ? 339  ASP B CA  1 
ATOM   5844  C  C   . ASP B 1 293 ? -26.275 -18.238 7.401   1.00 39.45  ? 339  ASP B C   1 
ATOM   5845  O  O   . ASP B 1 293 ? -27.111 -17.346 7.184   1.00 39.49  ? 339  ASP B O   1 
ATOM   5846  C  CB  . ASP B 1 293 ? -26.846 -20.557 8.108   1.00 39.18  ? 339  ASP B CB  1 
ATOM   5847  C  CG  . ASP B 1 293 ? -27.494 -21.877 7.689   1.00 40.32  ? 339  ASP B CG  1 
ATOM   5848  O  OD1 . ASP B 1 293 ? -28.691 -21.828 7.320   1.00 36.04  ? 339  ASP B OD1 1 
ATOM   5849  O  OD2 . ASP B 1 293 ? -26.805 -22.956 7.739   1.00 40.90  ? 339  ASP B OD2 1 
ATOM   5850  N  N   . LEU B 1 294 ? -25.127 -18.011 8.034   1.00 39.41  ? 340  LEU B N   1 
ATOM   5851  C  CA  . LEU B 1 294 ? -24.819 -16.683 8.545   1.00 39.22  ? 340  LEU B CA  1 
ATOM   5852  C  C   . LEU B 1 294 ? -25.090 -15.630 7.474   1.00 39.16  ? 340  LEU B C   1 
ATOM   5853  O  O   . LEU B 1 294 ? -25.648 -14.561 7.749   1.00 39.29  ? 340  LEU B O   1 
ATOM   5854  C  CB  . LEU B 1 294 ? -23.373 -16.610 9.014   1.00 39.00  ? 340  LEU B CB  1 
ATOM   5855  C  CG  . LEU B 1 294 ? -23.038 -15.463 9.964   1.00 39.23  ? 340  LEU B CG  1 
ATOM   5856  C  CD1 . LEU B 1 294 ? -24.017 -15.396 11.158  1.00 37.14  ? 340  LEU B CD1 1 
ATOM   5857  C  CD2 . LEU B 1 294 ? -21.565 -15.627 10.401  1.00 37.72  ? 340  LEU B CD2 1 
ATOM   5858  N  N   . GLY B 1 295 ? -24.716 -15.960 6.241   1.00 39.48  ? 341  GLY B N   1 
ATOM   5859  C  CA  . GLY B 1 295 ? -24.809 -15.031 5.100   1.00 39.26  ? 341  GLY B CA  1 
ATOM   5860  C  C   . GLY B 1 295 ? -26.253 -14.825 4.676   1.00 39.16  ? 341  GLY B C   1 
ATOM   5861  O  O   . GLY B 1 295 ? -26.529 -14.087 3.741   1.00 39.70  ? 341  GLY B O   1 
ATOM   5862  N  N   . ILE B 1 296 ? -27.181 -15.490 5.344   1.00 38.87  ? 342  ILE B N   1 
ATOM   5863  C  CA  . ILE B 1 296 ? -28.573 -15.343 4.975   1.00 38.60  ? 342  ILE B CA  1 
ATOM   5864  C  C   . ILE B 1 296 ? -29.316 -14.728 6.145   1.00 38.32  ? 342  ILE B C   1 
ATOM   5865  O  O   . ILE B 1 296 ? -30.279 -13.996 5.966   1.00 37.71  ? 342  ILE B O   1 
ATOM   5866  C  CB  . ILE B 1 296 ? -29.216 -16.682 4.594   1.00 38.40  ? 342  ILE B CB  1 
ATOM   5867  C  CG1 . ILE B 1 296 ? -28.391 -17.399 3.536   1.00 39.05  ? 342  ILE B CG1 1 
ATOM   5868  C  CG2 . ILE B 1 296 ? -30.570 -16.432 4.008   1.00 38.83  ? 342  ILE B CG2 1 
ATOM   5869  C  CD1 . ILE B 1 296 ? -28.962 -18.759 3.120   1.00 38.54  ? 342  ILE B CD1 1 
ATOM   5870  N  N   . GLU B 1 297 ? -28.827 -15.019 7.342   1.00 38.58  ? 343  GLU B N   1 
ATOM   5871  C  CA  . GLU B 1 297 ? -29.457 -14.595 8.591   1.00 38.82  ? 343  GLU B CA  1 
ATOM   5872  C  C   . GLU B 1 297 ? -29.125 -13.160 8.895   1.00 38.85  ? 343  GLU B C   1 
ATOM   5873  O  O   . GLU B 1 297 ? -29.946 -12.433 9.446   1.00 39.35  ? 343  GLU B O   1 
ATOM   5874  C  CB  . GLU B 1 297 ? -28.963 -15.486 9.718   1.00 38.72  ? 343  GLU B CB  1 
ATOM   5875  C  CG  . GLU B 1 297 ? -29.400 -16.941 9.556   1.00 39.15  ? 343  GLU B CG  1 
ATOM   5876  C  CD  . GLU B 1 297 ? -30.887 -17.136 9.884   1.00 40.00  ? 343  GLU B CD  1 
ATOM   5877  O  OE1 . GLU B 1 297 ? -31.590 -17.847 9.135   1.00 40.02  ? 343  GLU B OE1 1 
ATOM   5878  O  OE2 . GLU B 1 297 ? -31.352 -16.584 10.904  1.00 40.36  ? 343  GLU B OE2 1 
ATOM   5879  N  N   . ILE B 1 298 ? -27.900 -12.769 8.558   1.00 38.95  ? 344  ILE B N   1 
ATOM   5880  C  CA  . ILE B 1 298 ? -27.468 -11.378 8.649   1.00 38.87  ? 344  ILE B CA  1 
ATOM   5881  C  C   . ILE B 1 298 ? -27.137 -10.919 7.230   1.00 38.84  ? 344  ILE B C   1 
ATOM   5882  O  O   . ILE B 1 298 ? -26.883 -11.765 6.359   1.00 39.32  ? 344  ILE B O   1 
ATOM   5883  C  CB  . ILE B 1 298 ? -26.230 -11.211 9.565   1.00 38.92  ? 344  ILE B CB  1 
ATOM   5884  C  CG1 . ILE B 1 298 ? -24.973 -11.763 8.879   1.00 38.41  ? 344  ILE B CG1 1 
ATOM   5885  C  CG2 . ILE B 1 298 ? -26.468 -11.857 10.926  1.00 38.20  ? 344  ILE B CG2 1 
ATOM   5886  C  CD1 . ILE B 1 298 ? -23.648 -11.341 9.529   1.00 37.83  ? 344  ILE B CD1 1 
ATOM   5887  N  N   . PRO B 1 299 ? -27.129 -9.593  6.983   1.00 38.30  ? 345  PRO B N   1 
ATOM   5888  C  CA  . PRO B 1 299 ? -26.792 -9.093  5.643   1.00 37.99  ? 345  PRO B CA  1 
ATOM   5889  C  C   . PRO B 1 299 ? -25.472 -9.643  5.127   1.00 37.70  ? 345  PRO B C   1 
ATOM   5890  O  O   . PRO B 1 299 ? -24.488 -9.696  5.874   1.00 37.94  ? 345  PRO B O   1 
ATOM   5891  C  CB  . PRO B 1 299 ? -26.666 -7.581  5.853   1.00 38.23  ? 345  PRO B CB  1 
ATOM   5892  C  CG  . PRO B 1 299 ? -27.552 -7.280  7.056   1.00 38.20  ? 345  PRO B CG  1 
ATOM   5893  C  CD  . PRO B 1 299 ? -27.427 -8.499  7.932   1.00 38.07  ? 345  PRO B CD  1 
ATOM   5894  N  N   . ALA B 1 300 ? -25.452 -10.047 3.859   1.00 37.21  ? 346  ALA B N   1 
ATOM   5895  C  CA  . ALA B 1 300 ? -24.229 -10.528 3.214   1.00 36.59  ? 346  ALA B CA  1 
ATOM   5896  C  C   . ALA B 1 300 ? -23.035 -9.568  3.392   1.00 36.61  ? 346  ALA B C   1 
ATOM   5897  O  O   . ALA B 1 300 ? -21.932 -10.024 3.613   1.00 37.34  ? 346  ALA B O   1 
ATOM   5898  C  CB  . ALA B 1 300 ? -24.481 -10.832 1.751   1.00 35.91  ? 346  ALA B CB  1 
ATOM   5899  N  N   . GLU B 1 301 ? -23.252 -8.257  3.340   1.00 36.15  ? 347  GLU B N   1 
ATOM   5900  C  CA  . GLU B 1 301 ? -22.186 -7.288  3.625   1.00 36.29  ? 347  GLU B CA  1 
ATOM   5901  C  C   . GLU B 1 301 ? -21.487 -7.479  4.956   1.00 36.01  ? 347  GLU B C   1 
ATOM   5902  O  O   . GLU B 1 301 ? -20.443 -6.874  5.191   1.00 35.95  ? 347  GLU B O   1 
ATOM   5903  C  CB  . GLU B 1 301 ? -22.714 -5.849  3.691   1.00 36.50  ? 347  GLU B CB  1 
ATOM   5904  C  CG  . GLU B 1 301 ? -23.699 -5.460  2.665   1.00 38.87  ? 347  GLU B CG  1 
ATOM   5905  C  CD  . GLU B 1 301 ? -25.098 -5.923  3.013   1.00 40.72  ? 347  GLU B CD  1 
ATOM   5906  O  OE1 . GLU B 1 301 ? -25.833 -5.133  3.639   1.00 39.71  ? 347  GLU B OE1 1 
ATOM   5907  O  OE2 . GLU B 1 301 ? -25.447 -7.087  2.678   1.00 40.88  ? 347  GLU B OE2 1 
ATOM   5908  N  N   . LYS B 1 302 ? -22.075 -8.238  5.863   1.00 35.93  ? 348  LYS B N   1 
ATOM   5909  C  CA  . LYS B 1 302 ? -21.601 -8.151  7.241   1.00 36.43  ? 348  LYS B CA  1 
ATOM   5910  C  C   . LYS B 1 302 ? -20.833 -9.384  7.685   1.00 36.84  ? 348  LYS B C   1 
ATOM   5911  O  O   . LYS B 1 302 ? -20.070 -9.333  8.644   1.00 37.37  ? 348  LYS B O   1 
ATOM   5912  C  CB  . LYS B 1 302 ? -22.738 -7.791  8.217   1.00 36.44  ? 348  LYS B CB  1 
ATOM   5913  C  CG  . LYS B 1 302 ? -23.181 -6.344  8.098   1.00 36.70  ? 348  LYS B CG  1 
ATOM   5914  C  CD  . LYS B 1 302 ? -24.130 -5.930  9.204   1.00 38.15  ? 348  LYS B CD  1 
ATOM   5915  C  CE  . LYS B 1 302 ? -24.342 -4.417  9.188   1.00 39.59  ? 348  LYS B CE  1 
ATOM   5916  N  NZ  . LYS B 1 302 ? -23.158 -3.674  9.725   1.00 41.66  ? 348  LYS B NZ  1 
ATOM   5917  N  N   . VAL B 1 303 ? -21.015 -10.487 6.971   1.00 37.01  ? 349  VAL B N   1 
ATOM   5918  C  CA  . VAL B 1 303 ? -20.334 -11.711 7.328   1.00 36.86  ? 349  VAL B CA  1 
ATOM   5919  C  C   . VAL B 1 303 ? -18.831 -11.495 7.577   1.00 37.40  ? 349  VAL B C   1 
ATOM   5920  O  O   . VAL B 1 303 ? -18.326 -11.927 8.611   1.00 38.29  ? 349  VAL B O   1 
ATOM   5921  C  CB  . VAL B 1 303 ? -20.556 -12.795 6.290   1.00 36.72  ? 349  VAL B CB  1 
ATOM   5922  C  CG1 . VAL B 1 303 ? -19.827 -14.051 6.696   1.00 35.62  ? 349  VAL B CG1 1 
ATOM   5923  C  CG2 . VAL B 1 303 ? -22.047 -13.062 6.119   1.00 36.00  ? 349  VAL B CG2 1 
ATOM   5924  N  N   . PHE B 1 304 ? -18.122 -10.805 6.680   1.00 37.03  ? 350  PHE B N   1 
ATOM   5925  C  CA  . PHE B 1 304 ? -16.678 -10.688 6.842   1.00 36.22  ? 350  PHE B CA  1 
ATOM   5926  C  C   . PHE B 1 304 ? -16.339 -10.119 8.219   1.00 36.37  ? 350  PHE B C   1 
ATOM   5927  O  O   . PHE B 1 304 ? -15.328 -10.487 8.813   1.00 36.65  ? 350  PHE B O   1 
ATOM   5928  C  CB  . PHE B 1 304 ? -16.026 -9.868  5.720   1.00 35.75  ? 350  PHE B CB  1 
ATOM   5929  C  CG  . PHE B 1 304 ? -16.114 -8.406  5.923   1.00 34.12  ? 350  PHE B CG  1 
ATOM   5930  C  CD1 . PHE B 1 304 ? -17.268 -7.708  5.554   1.00 34.10  ? 350  PHE B CD1 1 
ATOM   5931  C  CD2 . PHE B 1 304 ? -15.061 -7.719  6.505   1.00 34.11  ? 350  PHE B CD2 1 
ATOM   5932  C  CE1 . PHE B 1 304 ? -17.371 -6.356  5.764   1.00 33.19  ? 350  PHE B CE1 1 
ATOM   5933  C  CE2 . PHE B 1 304 ? -15.153 -6.356  6.716   1.00 32.48  ? 350  PHE B CE2 1 
ATOM   5934  C  CZ  . PHE B 1 304 ? -16.314 -5.673  6.343   1.00 33.89  ? 350  PHE B CZ  1 
ATOM   5935  N  N   . LEU B 1 305 ? -17.193 -9.243  8.740   1.00 36.18  ? 351  LEU B N   1 
ATOM   5936  C  CA  . LEU B 1 305 ? -17.021 -8.742  10.098  1.00 36.20  ? 351  LEU B CA  1 
ATOM   5937  C  C   . LEU B 1 305 ? -17.196 -9.853  11.141  1.00 37.03  ? 351  LEU B C   1 
ATOM   5938  O  O   . LEU B 1 305 ? -16.381 -9.975  12.060  1.00 37.57  ? 351  LEU B O   1 
ATOM   5939  C  CB  . LEU B 1 305 ? -17.986 -7.600  10.388  1.00 35.99  ? 351  LEU B CB  1 
ATOM   5940  C  CG  . LEU B 1 305 ? -17.947 -6.369  9.469   1.00 35.10  ? 351  LEU B CG  1 
ATOM   5941  C  CD1 . LEU B 1 305 ? -19.252 -5.613  9.575   1.00 33.01  ? 351  LEU B CD1 1 
ATOM   5942  C  CD2 . LEU B 1 305 ? -16.755 -5.455  9.796   1.00 33.78  ? 351  LEU B CD2 1 
ATOM   5943  N  N   . ALA B 1 306 ? -18.235 -10.674 11.017  1.00 37.24  ? 352  ALA B N   1 
ATOM   5944  C  CA  . ALA B 1 306 ? -18.413 -11.732 11.991  1.00 37.58  ? 352  ALA B CA  1 
ATOM   5945  C  C   . ALA B 1 306 ? -17.229 -12.660 11.894  1.00 37.83  ? 352  ALA B C   1 
ATOM   5946  O  O   . ALA B 1 306 ? -16.632 -12.995 12.919  1.00 38.36  ? 352  ALA B O   1 
ATOM   5947  C  CB  . ALA B 1 306 ? -19.705 -12.474 11.778  1.00 37.65  ? 352  ALA B CB  1 
ATOM   5948  N  N   . GLN B 1 307 ? -16.855 -13.024 10.664  1.00 37.70  ? 353  GLN B N   1 
ATOM   5949  C  CA  . GLN B 1 307 ? -15.744 -13.929 10.450  1.00 37.23  ? 353  GLN B CA  1 
ATOM   5950  C  C   . GLN B 1 307 ? -14.495 -13.415 11.143  1.00 37.54  ? 353  GLN B C   1 
ATOM   5951  O  O   . GLN B 1 307 ? -13.897 -14.133 11.942  1.00 37.78  ? 353  GLN B O   1 
ATOM   5952  C  CB  . GLN B 1 307 ? -15.467 -14.183 8.963   1.00 36.93  ? 353  GLN B CB  1 
ATOM   5953  C  CG  . GLN B 1 307 ? -14.024 -14.706 8.669   1.00 35.97  ? 353  GLN B CG  1 
ATOM   5954  C  CD  . GLN B 1 307 ? -13.833 -15.148 7.244   1.00 36.50  ? 353  GLN B CD  1 
ATOM   5955  O  OE1 . GLN B 1 307 ? -14.799 -15.448 6.524   1.00 38.83  ? 353  GLN B OE1 1 
ATOM   5956  N  NE2 . GLN B 1 307 ? -12.568 -15.222 6.818   1.00 36.45  ? 353  GLN B NE2 1 
ATOM   5957  N  N   . LYS B 1 308 ? -14.094 -12.182 10.848  1.00 37.72  ? 354  LYS B N   1 
ATOM   5958  C  CA  . LYS B 1 308 ? -12.800 -11.701 11.353  1.00 37.82  ? 354  LYS B CA  1 
ATOM   5959  C  C   . LYS B 1 308 ? -12.830 -11.525 12.866  1.00 38.30  ? 354  LYS B C   1 
ATOM   5960  O  O   . LYS B 1 308 ? -11.807 -11.726 13.527  1.00 38.59  ? 354  LYS B O   1 
ATOM   5961  C  CB  . LYS B 1 308 ? -12.381 -10.415 10.660  1.00 37.52  ? 354  LYS B CB  1 
ATOM   5962  C  CG  . LYS B 1 308 ? -11.944 -10.638 9.240   1.00 35.56  ? 354  LYS B CG  1 
ATOM   5963  C  CD  . LYS B 1 308 ? -12.081 -9.396  8.454   1.00 34.36  ? 354  LYS B CD  1 
ATOM   5964  C  CE  . LYS B 1 308 ? -11.573 -9.576  7.045   1.00 36.42  ? 354  LYS B CE  1 
ATOM   5965  N  NZ  . LYS B 1 308 ? -10.078 -9.694  6.926   1.00 35.50  ? 354  LYS B NZ  1 
ATOM   5966  N  N   . MET B 1 309 ? -14.004 -11.190 13.406  1.00 38.18  ? 355  MET B N   1 
ATOM   5967  C  CA  . MET B 1 309 ? -14.175 -11.048 14.840  1.00 37.94  ? 355  MET B CA  1 
ATOM   5968  C  C   . MET B 1 309 ? -14.033 -12.390 15.548  1.00 38.07  ? 355  MET B C   1 
ATOM   5969  O  O   . MET B 1 309 ? -13.303 -12.513 16.539  1.00 38.27  ? 355  MET B O   1 
ATOM   5970  C  CB  . MET B 1 309 ? -15.521 -10.398 15.154  1.00 38.16  ? 355  MET B CB  1 
ATOM   5971  C  CG  . MET B 1 309 ? -15.800 -10.200 16.631  1.00 38.17  ? 355  MET B CG  1 
ATOM   5972  S  SD  . MET B 1 309 ? -16.479 -11.703 17.326  1.00 38.03  ? 355  MET B SD  1 
ATOM   5973  C  CE  . MET B 1 309 ? -18.235 -11.536 16.890  1.00 35.39  ? 355  MET B CE  1 
ATOM   5974  N  N   . MET B 1 310 ? -14.716 -13.406 15.038  1.00 37.94  ? 356  MET B N   1 
ATOM   5975  C  CA  . MET B 1 310 ? -14.669 -14.717 15.666  1.00 37.62  ? 356  MET B CA  1 
ATOM   5976  C  C   . MET B 1 310 ? -13.281 -15.335 15.599  1.00 37.44  ? 356  MET B C   1 
ATOM   5977  O  O   . MET B 1 310 ? -12.748 -15.761 16.633  1.00 37.62  ? 356  MET B O   1 
ATOM   5978  C  CB  . MET B 1 310 ? -15.746 -15.625 15.098  1.00 37.63  ? 356  MET B CB  1 
ATOM   5979  C  CG  . MET B 1 310 ? -17.134 -15.136 15.480  1.00 38.72  ? 356  MET B CG  1 
ATOM   5980  S  SD  . MET B 1 310 ? -18.351 -16.373 15.068  1.00 43.44  ? 356  MET B SD  1 
ATOM   5981  C  CE  . MET B 1 310 ? -18.747 -15.962 13.369  1.00 39.08  ? 356  MET B CE  1 
ATOM   5982  N  N   . ILE B 1 311 ? -12.688 -15.363 14.405  1.00 36.68  ? 357  ILE B N   1 
ATOM   5983  C  CA  . ILE B 1 311 ? -11.322 -15.833 14.245  1.00 36.05  ? 357  ILE B CA  1 
ATOM   5984  C  C   . ILE B 1 311 ? -10.349 -15.086 15.167  1.00 36.68  ? 357  ILE B C   1 
ATOM   5985  O  O   . ILE B 1 311 ? -9.406  -15.666 15.697  1.00 36.52  ? 357  ILE B O   1 
ATOM   5986  C  CB  . ILE B 1 311 ? -10.825 -15.713 12.789  1.00 35.87  ? 357  ILE B CB  1 
ATOM   5987  C  CG1 . ILE B 1 311 ? -11.669 -16.599 11.862  1.00 35.42  ? 357  ILE B CG1 1 
ATOM   5988  C  CG2 . ILE B 1 311 ? -9.324  -16.070 12.688  1.00 33.76  ? 357  ILE B CG2 1 
ATOM   5989  C  CD1 . ILE B 1 311 ? -11.011 -16.916 10.528  1.00 33.15  ? 357  ILE B CD1 1 
ATOM   5990  N  N   . GLY B 1 312 ? -10.575 -13.797 15.360  1.00 37.23  ? 358  GLY B N   1 
ATOM   5991  C  CA  . GLY B 1 312 ? -9.712  -13.032 16.227  1.00 38.03  ? 358  GLY B CA  1 
ATOM   5992  C  C   . GLY B 1 312 ? -9.879  -13.529 17.649  1.00 38.94  ? 358  GLY B C   1 
ATOM   5993  O  O   . GLY B 1 312 ? -8.900  -13.915 18.308  1.00 38.52  ? 358  GLY B O   1 
ATOM   5994  N  N   . ARG B 1 313 ? -11.129 -13.522 18.118  1.00 39.44  ? 359  ARG B N   1 
ATOM   5995  C  CA  . ARG B 1 313 ? -11.445 -14.007 19.461  1.00 39.70  ? 359  ARG B CA  1 
ATOM   5996  C  C   . ARG B 1 313 ? -10.917 -15.433 19.710  1.00 40.46  ? 359  ARG B C   1 
ATOM   5997  O  O   . ARG B 1 313 ? -10.284 -15.675 20.752  1.00 40.67  ? 359  ARG B O   1 
ATOM   5998  C  CB  . ARG B 1 313 ? -12.939 -13.838 19.776  1.00 38.96  ? 359  ARG B CB  1 
ATOM   5999  C  CG  . ARG B 1 313 ? -13.183 -12.583 20.560  1.00 39.17  ? 359  ARG B CG  1 
ATOM   6000  C  CD  . ARG B 1 313 ? -14.229 -11.667 19.985  1.00 38.51  ? 359  ARG B CD  1 
ATOM   6001  N  NE  . ARG B 1 313 ? -15.546 -11.839 20.592  1.00 38.81  ? 359  ARG B NE  1 
ATOM   6002  C  CZ  . ARG B 1 313 ? -16.463 -10.883 20.676  1.00 38.69  ? 359  ARG B CZ  1 
ATOM   6003  N  NH1 . ARG B 1 313 ? -16.214 -9.664  20.228  1.00 36.27  ? 359  ARG B NH1 1 
ATOM   6004  N  NH2 . ARG B 1 313 ? -17.633 -11.149 21.225  1.00 38.46  ? 359  ARG B NH2 1 
ATOM   6005  N  N   . CYS B 1 314 ? -11.133 -16.357 18.769  1.00 41.06  ? 360  CYS B N   1 
ATOM   6006  C  CA  . CYS B 1 314 ? -10.620 -17.711 18.938  1.00 42.03  ? 360  CYS B CA  1 
ATOM   6007  C  C   . CYS B 1 314 ? -9.124  -17.667 19.089  1.00 41.98  ? 360  CYS B C   1 
ATOM   6008  O  O   . CYS B 1 314 ? -8.590  -18.221 20.054  1.00 42.71  ? 360  CYS B O   1 
ATOM   6009  C  CB  . CYS B 1 314 ? -11.022 -18.623 17.785  1.00 42.18  ? 360  CYS B CB  1 
ATOM   6010  S  SG  . CYS B 1 314 ? -12.785 -19.049 17.854  1.00 45.30  ? 360  CYS B SG  1 
ATOM   6011  N  N   . ASN B 1 315 ? -8.442  -16.980 18.178  1.00 41.90  ? 361  ASN B N   1 
ATOM   6012  C  CA  . ASN B 1 315 ? -6.983  -16.856 18.284  1.00 42.14  ? 361  ASN B CA  1 
ATOM   6013  C  C   . ASN B 1 315 ? -6.587  -16.455 19.699  1.00 42.61  ? 361  ASN B C   1 
ATOM   6014  O  O   . ASN B 1 315 ? -5.669  -17.029 20.274  1.00 42.64  ? 361  ASN B O   1 
ATOM   6015  C  CB  . ASN B 1 315 ? -6.416  -15.863 17.271  1.00 41.92  ? 361  ASN B CB  1 
ATOM   6016  C  CG  . ASN B 1 315 ? -6.284  -16.437 15.892  1.00 41.37  ? 361  ASN B CG  1 
ATOM   6017  O  OD1 . ASN B 1 315 ? -5.599  -15.876 15.047  1.00 44.61  ? 361  ASN B OD1 1 
ATOM   6018  N  ND2 . ASN B 1 315 ? -6.943  -17.547 15.648  1.00 39.07  ? 361  ASN B ND2 1 
ATOM   6019  N  N   . LEU B 1 316 ? -7.323  -15.498 20.263  1.00 43.42  ? 362  LEU B N   1 
ATOM   6020  C  CA  . LEU B 1 316 ? -7.132  -15.038 21.651  1.00 44.02  ? 362  LEU B CA  1 
ATOM   6021  C  C   . LEU B 1 316 ? -7.402  -16.120 22.694  1.00 44.15  ? 362  LEU B C   1 
ATOM   6022  O  O   . LEU B 1 316 ? -6.647  -16.262 23.653  1.00 44.81  ? 362  LEU B O   1 
ATOM   6023  C  CB  . LEU B 1 316 ? -8.062  -13.867 21.968  1.00 44.06  ? 362  LEU B CB  1 
ATOM   6024  C  CG  . LEU B 1 316 ? -7.538  -12.849 22.976  1.00 44.95  ? 362  LEU B CG  1 
ATOM   6025  C  CD1 . LEU B 1 316 ? -6.966  -11.671 22.210  1.00 46.03  ? 362  LEU B CD1 1 
ATOM   6026  C  CD2 . LEU B 1 316 ? -8.641  -12.387 23.931  1.00 45.54  ? 362  LEU B CD2 1 
ATOM   6027  N  N   . ALA B 1 317 ? -8.498  -16.855 22.530  1.00 43.83  ? 363  ALA B N   1 
ATOM   6028  C  CA  . ALA B 1 317 ? -8.858  -17.891 23.502  1.00 43.52  ? 363  ALA B CA  1 
ATOM   6029  C  C   . ALA B 1 317 ? -7.966  -19.130 23.384  1.00 43.49  ? 363  ALA B C   1 
ATOM   6030  O  O   . ALA B 1 317 ? -7.865  -19.914 24.326  1.00 43.50  ? 363  ALA B O   1 
ATOM   6031  C  CB  . ALA B 1 317 ? -10.320 -18.261 23.382  1.00 43.05  ? 363  ALA B CB  1 
ATOM   6032  N  N   . GLY B 1 318 ? -7.304  -19.279 22.237  1.00 43.19  ? 364  GLY B N   1 
ATOM   6033  C  CA  . GLY B 1 318 ? -6.452  -20.432 21.992  1.00 42.99  ? 364  GLY B CA  1 
ATOM   6034  C  C   . GLY B 1 318 ? -7.237  -21.651 21.541  1.00 43.00  ? 364  GLY B C   1 
ATOM   6035  O  O   . GLY B 1 318 ? -6.782  -22.783 21.705  1.00 43.36  ? 364  GLY B O   1 
ATOM   6036  N  N   . LYS B 1 319 ? -8.412  -21.418 20.962  1.00 42.38  ? 365  LYS B N   1 
ATOM   6037  C  CA  . LYS B 1 319 ? -9.265  -22.490 20.504  1.00 41.61  ? 365  LYS B CA  1 
ATOM   6038  C  C   . LYS B 1 319 ? -9.287  -22.600 18.967  1.00 41.70  ? 365  LYS B C   1 
ATOM   6039  O  O   . LYS B 1 319 ? -9.097  -21.608 18.276  1.00 41.96  ? 365  LYS B O   1 
ATOM   6040  C  CB  . LYS B 1 319 ? -10.650 -22.279 21.081  1.00 41.41  ? 365  LYS B CB  1 
ATOM   6041  C  CG  . LYS B 1 319 ? -10.650 -22.337 22.594  1.00 40.66  ? 365  LYS B CG  1 
ATOM   6042  C  CD  . LYS B 1 319 ? -11.990 -22.797 23.136  1.00 40.03  ? 365  LYS B CD  1 
ATOM   6043  C  CE  . LYS B 1 319 ? -11.936 -22.924 24.647  1.00 40.27  ? 365  LYS B CE  1 
ATOM   6044  N  NZ  . LYS B 1 319 ? -13.305 -23.031 25.264  1.00 41.83  ? 365  LYS B NZ  1 
ATOM   6045  N  N   . PRO B 1 320 ? -9.500  -23.812 18.421  1.00 41.61  ? 366  PRO B N   1 
ATOM   6046  C  CA  . PRO B 1 320 ? -9.523  -23.954 16.977  1.00 41.56  ? 366  PRO B CA  1 
ATOM   6047  C  C   . PRO B 1 320 ? -10.671 -23.158 16.396  1.00 42.08  ? 366  PRO B C   1 
ATOM   6048  O  O   . PRO B 1 320 ? -11.754 -23.140 16.998  1.00 42.24  ? 366  PRO B O   1 
ATOM   6049  C  CB  . PRO B 1 320 ? -9.863  -25.439 16.790  1.00 41.75  ? 366  PRO B CB  1 
ATOM   6050  C  CG  . PRO B 1 320 ? -9.465  -26.104 18.040  1.00 41.04  ? 366  PRO B CG  1 
ATOM   6051  C  CD  . PRO B 1 320 ? -9.744  -25.098 19.099  1.00 41.05  ? 366  PRO B CD  1 
ATOM   6052  N  N   . VAL B 1 321 ? -10.460 -22.529 15.237  1.00 42.04  ? 367  VAL B N   1 
ATOM   6053  C  CA  . VAL B 1 321 ? -11.578 -21.922 14.508  1.00 41.45  ? 367  VAL B CA  1 
ATOM   6054  C  C   . VAL B 1 321 ? -11.580 -22.324 13.041  1.00 41.50  ? 367  VAL B C   1 
ATOM   6055  O  O   . VAL B 1 321 ? -10.527 -22.333 12.376  1.00 41.84  ? 367  VAL B O   1 
ATOM   6056  C  CB  . VAL B 1 321 ? -11.554 -20.412 14.602  1.00 41.69  ? 367  VAL B CB  1 
ATOM   6057  C  CG1 . VAL B 1 321 ? -10.267 -19.844 13.940  1.00 41.22  ? 367  VAL B CG1 1 
ATOM   6058  C  CG2 . VAL B 1 321 ? -12.831 -19.840 13.988  1.00 39.75  ? 367  VAL B CG2 1 
ATOM   6059  N  N   . VAL B 1 322 ? -12.773 -22.635 12.549  1.00 40.79  ? 368  VAL B N   1 
ATOM   6060  C  CA  . VAL B 1 322 ? -12.967 -23.118 11.201  1.00 40.52  ? 368  VAL B CA  1 
ATOM   6061  C  C   . VAL B 1 322 ? -13.645 -22.074 10.323  1.00 40.84  ? 368  VAL B C   1 
ATOM   6062  O  O   . VAL B 1 322 ? -14.684 -21.530 10.710  1.00 41.18  ? 368  VAL B O   1 
ATOM   6063  C  CB  . VAL B 1 322 ? -13.902 -24.322 11.221  1.00 40.47  ? 368  VAL B CB  1 
ATOM   6064  C  CG1 . VAL B 1 322 ? -14.195 -24.794 9.809   1.00 40.42  ? 368  VAL B CG1 1 
ATOM   6065  C  CG2 . VAL B 1 322 ? -13.282 -25.450 12.008  1.00 41.05  ? 368  VAL B CG2 1 
ATOM   6066  N  N   . CYS B 1 323 ? -13.087 -21.829 9.130   1.00 40.67  ? 369  CYS B N   1 
ATOM   6067  C  CA  . CYS B 1 323 ? -13.745 -21.020 8.114   1.00 40.52  ? 369  CYS B CA  1 
ATOM   6068  C  C   . CYS B 1 323 ? -14.428 -21.895 7.066   1.00 40.39  ? 369  CYS B C   1 
ATOM   6069  O  O   . CYS B 1 323 ? -13.812 -22.810 6.502   1.00 40.87  ? 369  CYS B O   1 
ATOM   6070  C  CB  . CYS B 1 323 ? -12.744 -20.099 7.438   1.00 40.43  ? 369  CYS B CB  1 
ATOM   6071  S  SG  . CYS B 1 323 ? -13.484 -19.035 6.165   1.00 41.47  ? 369  CYS B SG  1 
ATOM   6072  N  N   . ALA B 1 324 ? -15.690 -21.598 6.778   1.00 39.54  ? 370  ALA B N   1 
ATOM   6073  C  CA  . ALA B 1 324 ? -16.500 -22.517 5.984   1.00 38.44  ? 370  ALA B CA  1 
ATOM   6074  C  C   . ALA B 1 324 ? -17.420 -21.895 4.913   1.00 38.18  ? 370  ALA B C   1 
ATOM   6075  O  O   . ALA B 1 324 ? -17.876 -20.729 5.021   1.00 38.17  ? 370  ALA B O   1 
ATOM   6076  C  CB  . ALA B 1 324 ? -17.309 -23.426 6.905   1.00 38.18  ? 370  ALA B CB  1 
ATOM   6077  N  N   . THR B 1 325 ? -17.668 -22.710 3.883   1.00 37.11  ? 371  THR B N   1 
ATOM   6078  C  CA  . THR B 1 325 ? -18.715 -22.493 2.911   1.00 36.35  ? 371  THR B CA  1 
ATOM   6079  C  C   . THR B 1 325 ? -18.330 -21.599 1.735   1.00 36.71  ? 371  THR B C   1 
ATOM   6080  O  O   . THR B 1 325 ? -17.979 -20.425 1.892   1.00 36.79  ? 371  THR B O   1 
ATOM   6081  C  CB  . THR B 1 325 ? -20.006 -22.048 3.586   1.00 36.22  ? 371  THR B CB  1 
ATOM   6082  O  OG1 . THR B 1 325 ? -20.272 -22.930 4.685   1.00 35.93  ? 371  THR B OG1 1 
ATOM   6083  C  CG2 . THR B 1 325 ? -21.144 -22.125 2.606   1.00 34.60  ? 371  THR B CG2 1 
ATOM   6084  N  N   . GLN B 1 326 ? -18.397 -22.181 0.546   1.00 36.96  ? 372  GLN B N   1 
ATOM   6085  C  CA  . GLN B 1 326 ? -18.236 -21.445 -0.714  1.00 37.24  ? 372  GLN B CA  1 
ATOM   6086  C  C   . GLN B 1 326 ? -16.825 -20.928 -0.922  1.00 37.35  ? 372  GLN B C   1 
ATOM   6087  O  O   . GLN B 1 326 ? -16.601 -20.036 -1.726  1.00 37.41  ? 372  GLN B O   1 
ATOM   6088  C  CB  . GLN B 1 326 ? -19.304 -20.342 -0.886  1.00 36.77  ? 372  GLN B CB  1 
ATOM   6089  C  CG  . GLN B 1 326 ? -20.714 -20.901 -1.079  1.00 37.40  ? 372  GLN B CG  1 
ATOM   6090  C  CD  . GLN B 1 326 ? -21.792 -19.846 -1.258  1.00 41.17  ? 372  GLN B CD  1 
ATOM   6091  O  OE1 . GLN B 1 326 ? -21.532 -18.640 -1.326  1.00 42.11  ? 372  GLN B OE1 1 
ATOM   6092  N  NE2 . GLN B 1 326 ? -23.021 -20.305 -1.321  1.00 42.72  ? 372  GLN B NE2 1 
ATOM   6093  N  N   . MET B 1 327 ? -15.847 -21.497 -0.231  1.00 38.13  ? 373  MET B N   1 
ATOM   6094  C  CA  . MET B 1 327 ? -14.503 -20.935 -0.374  1.00 38.73  ? 373  MET B CA  1 
ATOM   6095  C  C   . MET B 1 327 ? -13.970 -21.160 -1.789  1.00 38.77  ? 373  MET B C   1 
ATOM   6096  O  O   . MET B 1 327 ? -13.072 -20.469 -2.209  1.00 39.24  ? 373  MET B O   1 
ATOM   6097  C  CB  . MET B 1 327 ? -13.521 -21.446 0.684   1.00 38.79  ? 373  MET B CB  1 
ATOM   6098  C  CG  . MET B 1 327 ? -13.971 -21.269 2.139   1.00 39.66  ? 373  MET B CG  1 
ATOM   6099  S  SD  . MET B 1 327 ? -12.612 -21.616 3.331   1.00 41.96  ? 373  MET B SD  1 
ATOM   6100  C  CE  . MET B 1 327 ? -11.736 -20.035 3.262   1.00 36.40  ? 373  MET B CE  1 
ATOM   6101  N  N   . LEU B 1 328 ? -14.575 -22.081 -2.532  1.00 38.97  ? 374  LEU B N   1 
ATOM   6102  C  CA  . LEU B 1 328 ? -14.145 -22.428 -3.875  1.00 39.25  ? 374  LEU B CA  1 
ATOM   6103  C  C   . LEU B 1 328 ? -15.311 -22.960 -4.744  1.00 40.13  ? 374  LEU B C   1 
ATOM   6104  O  O   . LEU B 1 328 ? -15.094 -23.872 -5.541  1.00 40.00  ? 374  LEU B O   1 
ATOM   6105  C  CB  . LEU B 1 328 ? -13.068 -23.504 -3.760  1.00 38.64  ? 374  LEU B CB  1 
ATOM   6106  C  CG  . LEU B 1 328 ? -11.546 -23.279 -3.856  1.00 38.62  ? 374  LEU B CG  1 
ATOM   6107  C  CD1 . LEU B 1 328 ? -10.978 -21.946 -3.388  1.00 35.24  ? 374  LEU B CD1 1 
ATOM   6108  C  CD2 . LEU B 1 328 ? -10.784 -24.448 -3.218  1.00 36.43  ? 374  LEU B CD2 1 
ATOM   6109  N  N   . GLU B 1 329 ? -16.530 -22.389 -4.587  1.00 40.89  ? 375  GLU B N   1 
ATOM   6110  C  CA  . GLU B 1 329 ? -17.780 -22.861 -5.264  1.00 40.85  ? 375  GLU B CA  1 
ATOM   6111  C  C   . GLU B 1 329 ? -17.662 -23.104 -6.730  1.00 40.37  ? 375  GLU B C   1 
ATOM   6112  O  O   . GLU B 1 329 ? -18.179 -24.119 -7.211  1.00 41.02  ? 375  GLU B O   1 
ATOM   6113  C  CB  . GLU B 1 329 ? -18.932 -21.887 -5.133  1.00 41.17  ? 375  GLU B CB  1 
ATOM   6114  C  CG  . GLU B 1 329 ? -19.663 -21.983 -3.852  1.00 44.56  ? 375  GLU B CG  1 
ATOM   6115  C  CD  . GLU B 1 329 ? -20.761 -23.024 -3.846  1.00 47.56  ? 375  GLU B CD  1 
ATOM   6116  O  OE1 . GLU B 1 329 ? -21.642 -22.972 -4.740  1.00 49.51  ? 375  GLU B OE1 1 
ATOM   6117  O  OE2 . GLU B 1 329 ? -20.760 -23.871 -2.918  1.00 46.20  ? 375  GLU B OE2 1 
ATOM   6118  N  N   . SER B 1 330 ? -17.038 -22.177 -7.464  1.00 39.43  ? 376  SER B N   1 
ATOM   6119  C  CA  . SER B 1 330 ? -16.940 -22.342 -8.917  1.00 38.70  ? 376  SER B CA  1 
ATOM   6120  C  C   . SER B 1 330 ? -16.325 -23.695 -9.256  1.00 38.16  ? 376  SER B C   1 
ATOM   6121  O  O   . SER B 1 330 ? -16.676 -24.304 -10.273 1.00 38.43  ? 376  SER B O   1 
ATOM   6122  C  CB  . SER B 1 330 ? -16.202 -21.187 -9.603  1.00 38.59  ? 376  SER B CB  1 
ATOM   6123  O  OG  . SER B 1 330 ? -14.797 -21.226 -9.398  1.00 39.99  ? 376  SER B OG  1 
ATOM   6124  N  N   . MET B 1 331 ? -15.472 -24.204 -8.375  1.00 37.68  ? 377  MET B N   1 
ATOM   6125  C  CA  . MET B 1 331 ? -14.852 -25.506 -8.607  1.00 37.51  ? 377  MET B CA  1 
ATOM   6126  C  C   . MET B 1 331 ? -15.820 -26.650 -8.626  1.00 37.70  ? 377  MET B C   1 
ATOM   6127  O  O   . MET B 1 331 ? -15.540 -27.642 -9.276  1.00 38.24  ? 377  MET B O   1 
ATOM   6128  C  CB  . MET B 1 331 ? -13.644 -25.760 -7.700  1.00 37.08  ? 377  MET B CB  1 
ATOM   6129  C  CG  . MET B 1 331 ? -12.502 -24.780 -8.023  1.00 36.82  ? 377  MET B CG  1 
ATOM   6130  S  SD  . MET B 1 331 ? -10.889 -25.314 -7.492  1.00 36.95  ? 377  MET B SD  1 
ATOM   6131  C  CE  . MET B 1 331 ? -10.573 -26.604 -8.675  1.00 33.41  ? 377  MET B CE  1 
ATOM   6132  N  N   . ILE B 1 332 ? -16.975 -26.518 -7.961  1.00 37.85  ? 378  ILE B N   1 
ATOM   6133  C  CA  . ILE B 1 332 ? -18.022 -27.527 -8.111  1.00 37.89  ? 378  ILE B CA  1 
ATOM   6134  C  C   . ILE B 1 332 ? -18.208 -27.843 -9.608  1.00 38.78  ? 378  ILE B C   1 
ATOM   6135  O  O   . ILE B 1 332 ? -18.669 -28.926 -9.981  1.00 39.14  ? 378  ILE B O   1 
ATOM   6136  C  CB  . ILE B 1 332 ? -19.379 -27.059 -7.574  1.00 37.51  ? 378  ILE B CB  1 
ATOM   6137  C  CG1 . ILE B 1 332 ? -19.448 -27.176 -6.060  1.00 37.17  ? 378  ILE B CG1 1 
ATOM   6138  C  CG2 . ILE B 1 332 ? -20.530 -27.905 -8.157  1.00 36.49  ? 378  ILE B CG2 1 
ATOM   6139  C  CD1 . ILE B 1 332 ? -20.519 -26.318 -5.474  1.00 34.39  ? 378  ILE B CD1 1 
ATOM   6140  N  N   . THR B 1 333 ? -17.837 -26.894 -10.460 1.00 39.09  ? 379  THR B N   1 
ATOM   6141  C  CA  . THR B 1 333 ? -18.242 -26.968 -11.839 1.00 39.67  ? 379  THR B CA  1 
ATOM   6142  C  C   . THR B 1 333 ? -17.111 -26.734 -12.822 1.00 39.40  ? 379  THR B C   1 
ATOM   6143  O  O   . THR B 1 333 ? -17.214 -27.090 -13.981 1.00 38.57  ? 379  THR B O   1 
ATOM   6144  C  CB  . THR B 1 333 ? -19.467 -26.038 -12.063 1.00 40.23  ? 379  THR B CB  1 
ATOM   6145  O  OG1 . THR B 1 333 ? -20.656 -26.835 -12.012 1.00 39.76  ? 379  THR B OG1 1 
ATOM   6146  C  CG2 . THR B 1 333 ? -19.407 -25.313 -13.396 1.00 41.64  ? 379  THR B CG2 1 
ATOM   6147  N  N   . LYS B 1 334 ? -16.026 -26.145 -12.325 1.00 39.94  ? 380  LYS B N   1 
ATOM   6148  C  CA  . LYS B 1 334 ? -14.907 -25.668 -13.161 1.00 39.86  ? 380  LYS B CA  1 
ATOM   6149  C  C   . LYS B 1 334 ? -13.583 -26.071 -12.574 1.00 39.28  ? 380  LYS B C   1 
ATOM   6150  O  O   . LYS B 1 334 ? -13.459 -26.152 -11.357 1.00 39.55  ? 380  LYS B O   1 
ATOM   6151  C  CB  . LYS B 1 334 ? -14.958 -24.156 -13.229 1.00 40.01  ? 380  LYS B CB  1 
ATOM   6152  C  CG  . LYS B 1 334 ? -16.262 -23.648 -13.812 1.00 42.16  ? 380  LYS B CG  1 
ATOM   6153  C  CD  . LYS B 1 334 ? -16.334 -22.158 -13.789 1.00 46.38  ? 380  LYS B CD  1 
ATOM   6154  C  CE  . LYS B 1 334 ? -15.597 -21.585 -14.957 1.00 50.52  ? 380  LYS B CE  1 
ATOM   6155  N  NZ  . LYS B 1 334 ? -15.669 -20.088 -14.924 1.00 52.20  ? 380  LYS B NZ  1 
ATOM   6156  N  N   . PRO B 1 335 ? -12.581 -26.312 -13.431 1.00 38.65  ? 381  PRO B N   1 
ATOM   6157  C  CA  . PRO B 1 335 ? -11.324 -26.881 -12.957 1.00 38.34  ? 381  PRO B CA  1 
ATOM   6158  C  C   . PRO B 1 335 ? -10.445 -25.870 -12.281 1.00 38.33  ? 381  PRO B C   1 
ATOM   6159  O  O   . PRO B 1 335 ? -9.425  -26.254 -11.701 1.00 38.91  ? 381  PRO B O   1 
ATOM   6160  C  CB  . PRO B 1 335 ? -10.630 -27.373 -14.226 1.00 38.22  ? 381  PRO B CB  1 
ATOM   6161  C  CG  . PRO B 1 335 ? -11.502 -27.013 -15.352 1.00 38.50  ? 381  PRO B CG  1 
ATOM   6162  C  CD  . PRO B 1 335 ? -12.554 -26.066 -14.873 1.00 38.50  ? 381  PRO B CD  1 
ATOM   6163  N  N   . ARG B 1 336 ? -10.834 -24.594 -12.348 1.00 37.80  ? 382  ARG B N   1 
ATOM   6164  C  CA  . ARG B 1 336 ? -10.038 -23.502 -11.795 1.00 37.29  ? 382  ARG B CA  1 
ATOM   6165  C  C   . ARG B 1 336 ? -10.918 -22.591 -10.988 1.00 36.55  ? 382  ARG B C   1 
ATOM   6166  O  O   . ARG B 1 336 ? -12.071 -22.379 -11.351 1.00 37.32  ? 382  ARG B O   1 
ATOM   6167  C  CB  . ARG B 1 336 ? -9.340  -22.680 -12.903 1.00 37.53  ? 382  ARG B CB  1 
ATOM   6168  C  CG  . ARG B 1 336 ? -8.445  -23.468 -13.810 1.00 38.45  ? 382  ARG B CG  1 
ATOM   6169  C  CD  . ARG B 1 336 ? -7.394  -24.118 -13.018 1.00 41.94  ? 382  ARG B CD  1 
ATOM   6170  N  NE  . ARG B 1 336 ? -6.122  -23.463 -13.280 1.00 47.15  ? 382  ARG B NE  1 
ATOM   6171  C  CZ  . ARG B 1 336 ? -5.157  -23.218 -12.385 1.00 47.90  ? 382  ARG B CZ  1 
ATOM   6172  N  NH1 . ARG B 1 336 ? -5.303  -23.545 -11.104 1.00 43.95  ? 382  ARG B NH1 1 
ATOM   6173  N  NH2 . ARG B 1 336 ? -4.038  -22.609 -12.791 1.00 48.77  ? 382  ARG B NH2 1 
ATOM   6174  N  N   . PRO B 1 337 ? -10.376 -22.033 -9.890  1.00 35.61  ? 383  PRO B N   1 
ATOM   6175  C  CA  . PRO B 1 337 ? -11.187 -21.157 -9.037  1.00 34.99  ? 383  PRO B CA  1 
ATOM   6176  C  C   . PRO B 1 337 ? -11.241 -19.753 -9.595  1.00 34.51  ? 383  PRO B C   1 
ATOM   6177  O  O   . PRO B 1 337 ? -10.415 -19.388 -10.472 1.00 34.29  ? 383  PRO B O   1 
ATOM   6178  C  CB  . PRO B 1 337 ? -10.441 -21.164 -7.692  1.00 35.34  ? 383  PRO B CB  1 
ATOM   6179  C  CG  . PRO B 1 337 ? -9.011  -21.652 -8.013  1.00 34.96  ? 383  PRO B CG  1 
ATOM   6180  C  CD  . PRO B 1 337 ? -8.992  -22.205 -9.394  1.00 35.20  ? 383  PRO B CD  1 
ATOM   6181  N  N   . THR B 1 338 ? -12.187 -18.967 -9.098  1.00 33.82  ? 384  THR B N   1 
ATOM   6182  C  CA  . THR B 1 338 ? -12.283 -17.589 -9.500  1.00 33.86  ? 384  THR B CA  1 
ATOM   6183  C  C   . THR B 1 338 ? -11.268 -16.831 -8.684  1.00 34.63  ? 384  THR B C   1 
ATOM   6184  O  O   . THR B 1 338 ? -10.689 -17.364 -7.732  1.00 34.79  ? 384  THR B O   1 
ATOM   6185  C  CB  . THR B 1 338 ? -13.669 -17.021 -9.260  1.00 34.11  ? 384  THR B CB  1 
ATOM   6186  O  OG1 . THR B 1 338 ? -13.842 -16.798 -7.854  1.00 34.58  ? 384  THR B OG1 1 
ATOM   6187  C  CG2 . THR B 1 338 ? -14.751 -17.982 -9.794  1.00 32.05  ? 384  THR B CG2 1 
ATOM   6188  N  N   . ARG B 1 339 ? -11.019 -15.583 -9.043  1.00 35.21  ? 385  ARG B N   1 
ATOM   6189  C  CA  . ARG B 1 339 ? -10.001 -14.841 -8.338  1.00 35.25  ? 385  ARG B CA  1 
ATOM   6190  C  C   . ARG B 1 339 ? -10.438 -14.507 -6.917  1.00 35.85  ? 385  ARG B C   1 
ATOM   6191  O  O   . ARG B 1 339 ? -9.597  -14.240 -6.052  1.00 36.47  ? 385  ARG B O   1 
ATOM   6192  C  CB  . ARG B 1 339 ? -9.665  -13.594 -9.104  1.00 34.95  ? 385  ARG B CB  1 
ATOM   6193  C  CG  . ARG B 1 339 ? -9.295  -13.846 -10.561 1.00 35.22  ? 385  ARG B CG  1 
ATOM   6194  C  CD  . ARG B 1 339 ? -7.920  -14.503 -10.748 1.00 34.93  ? 385  ARG B CD  1 
ATOM   6195  N  NE  . ARG B 1 339 ? -7.615  -14.780 -12.152 1.00 34.57  ? 385  ARG B NE  1 
ATOM   6196  C  CZ  . ARG B 1 339 ? -8.348  -15.560 -12.939 1.00 31.85  ? 385  ARG B CZ  1 
ATOM   6197  N  NH1 . ARG B 1 339 ? -9.453  -16.104 -12.478 1.00 29.28  ? 385  ARG B NH1 1 
ATOM   6198  N  NH2 . ARG B 1 339 ? -8.000  -15.760 -14.201 1.00 30.75  ? 385  ARG B NH2 1 
ATOM   6199  N  N   . ALA B 1 340 ? -11.742 -14.522 -6.665  1.00 36.03  ? 386  ALA B N   1 
ATOM   6200  C  CA  . ALA B 1 340 ? -12.219 -14.143 -5.349  1.00 37.03  ? 386  ALA B CA  1 
ATOM   6201  C  C   . ALA B 1 340 ? -12.046 -15.332 -4.408  1.00 38.01  ? 386  ALA B C   1 
ATOM   6202  O  O   . ALA B 1 340 ? -11.865 -15.186 -3.200  1.00 39.28  ? 386  ALA B O   1 
ATOM   6203  C  CB  . ALA B 1 340 ? -13.650 -13.731 -5.410  1.00 36.77  ? 386  ALA B CB  1 
ATOM   6204  N  N   . GLU B 1 341 ? -12.089 -16.522 -4.971  1.00 38.24  ? 387  GLU B N   1 
ATOM   6205  C  CA  . GLU B 1 341 ? -12.077 -17.704 -4.168  1.00 38.43  ? 387  GLU B CA  1 
ATOM   6206  C  C   . GLU B 1 341 ? -10.676 -17.885 -3.629  1.00 38.37  ? 387  GLU B C   1 
ATOM   6207  O  O   . GLU B 1 341 ? -10.490 -18.047 -2.431  1.00 38.51  ? 387  GLU B O   1 
ATOM   6208  C  CB  . GLU B 1 341 ? -12.615 -18.856 -5.007  1.00 38.43  ? 387  GLU B CB  1 
ATOM   6209  C  CG  . GLU B 1 341 ? -14.049 -18.520 -5.489  1.00 39.05  ? 387  GLU B CG  1 
ATOM   6210  C  CD  . GLU B 1 341 ? -14.660 -19.529 -6.458  1.00 41.53  ? 387  GLU B CD  1 
ATOM   6211  O  OE1 . GLU B 1 341 ? -13.967 -19.924 -7.424  1.00 42.56  ? 387  GLU B OE1 1 
ATOM   6212  O  OE2 . GLU B 1 341 ? -15.848 -19.906 -6.262  1.00 42.23  ? 387  GLU B OE2 1 
ATOM   6213  N  N   . THR B 1 342 ? -9.697  -17.776 -4.524  1.00 38.60  ? 388  THR B N   1 
ATOM   6214  C  CA  . THR B 1 342 ? -8.284  -17.800 -4.170  1.00 38.30  ? 388  THR B CA  1 
ATOM   6215  C  C   . THR B 1 342 ? -7.982  -16.838 -3.007  1.00 38.45  ? 388  THR B C   1 
ATOM   6216  O  O   . THR B 1 342 ? -7.457  -17.248 -1.965  1.00 38.27  ? 388  THR B O   1 
ATOM   6217  C  CB  . THR B 1 342 ? -7.460  -17.471 -5.395  1.00 38.32  ? 388  THR B CB  1 
ATOM   6218  O  OG1 . THR B 1 342 ? -7.068  -18.704 -6.011  1.00 39.14  ? 388  THR B OG1 1 
ATOM   6219  C  CG2 . THR B 1 342 ? -6.224  -16.613 -5.053  1.00 38.33  ? 388  THR B CG2 1 
ATOM   6220  N  N   . SER B 1 343 ? -8.351  -15.573 -3.168  1.00 38.31  ? 389  SER B N   1 
ATOM   6221  C  CA  . SER B 1 343 ? -8.101  -14.622 -2.125  1.00 38.49  ? 389  SER B CA  1 
ATOM   6222  C  C   . SER B 1 343 ? -8.928  -14.954 -0.856  1.00 38.82  ? 389  SER B C   1 
ATOM   6223  O  O   . SER B 1 343 ? -8.427  -14.779 0.262   1.00 39.48  ? 389  SER B O   1 
ATOM   6224  C  CB  . SER B 1 343 ? -8.334  -13.208 -2.629  1.00 38.47  ? 389  SER B CB  1 
ATOM   6225  O  OG  . SER B 1 343 ? -9.508  -12.659 -2.079  1.00 39.94  ? 389  SER B OG  1 
ATOM   6226  N  N   . ASP B 1 344 ? -10.153 -15.453 -1.004  1.00 37.74  ? 390  ASP B N   1 
ATOM   6227  C  CA  . ASP B 1 344 ? -10.884 -15.899 0.168   1.00 37.42  ? 390  ASP B CA  1 
ATOM   6228  C  C   . ASP B 1 344 ? -10.092 -16.871 1.029   1.00 37.98  ? 390  ASP B C   1 
ATOM   6229  O  O   . ASP B 1 344 ? -9.999  -16.676 2.249   1.00 38.78  ? 390  ASP B O   1 
ATOM   6230  C  CB  . ASP B 1 344 ? -12.213 -16.561 -0.179  1.00 37.24  ? 390  ASP B CB  1 
ATOM   6231  C  CG  . ASP B 1 344 ? -13.109 -16.662 1.016   1.00 34.69  ? 390  ASP B CG  1 
ATOM   6232  O  OD1 . ASP B 1 344 ? -13.149 -15.657 1.745   1.00 34.57  ? 390  ASP B OD1 1 
ATOM   6233  O  OD2 . ASP B 1 344 ? -13.754 -17.715 1.254   1.00 29.77  ? 390  ASP B OD2 1 
ATOM   6234  N  N   . VAL B 1 345 ? -9.540  -17.916 0.417   1.00 37.53  ? 391  VAL B N   1 
ATOM   6235  C  CA  . VAL B 1 345 ? -8.739  -18.872 1.165   1.00 37.31  ? 391  VAL B CA  1 
ATOM   6236  C  C   . VAL B 1 345 ? -7.547  -18.183 1.841   1.00 37.13  ? 391  VAL B C   1 
ATOM   6237  O  O   . VAL B 1 345 ? -7.416  -18.214 3.059   1.00 36.69  ? 391  VAL B O   1 
ATOM   6238  C  CB  . VAL B 1 345 ? -8.251  -20.005 0.287   1.00 37.68  ? 391  VAL B CB  1 
ATOM   6239  C  CG1 . VAL B 1 345 ? -7.387  -20.965 1.087   1.00 37.58  ? 391  VAL B CG1 1 
ATOM   6240  C  CG2 . VAL B 1 345 ? -9.424  -20.730 -0.324  1.00 36.87  ? 391  VAL B CG2 1 
ATOM   6241  N  N   . ALA B 1 346 ? -6.697  -17.532 1.060   1.00 37.05  ? 392  ALA B N   1 
ATOM   6242  C  CA  . ALA B 1 346 ? -5.551  -16.818 1.638   1.00 36.90  ? 392  ALA B CA  1 
ATOM   6243  C  C   . ALA B 1 346 ? -5.968  -15.905 2.790   1.00 36.87  ? 392  ALA B C   1 
ATOM   6244  O  O   . ALA B 1 346 ? -5.372  -15.945 3.860   1.00 37.10  ? 392  ALA B O   1 
ATOM   6245  C  CB  . ALA B 1 346 ? -4.770  -16.060 0.579   1.00 36.12  ? 392  ALA B CB  1 
ATOM   6246  N  N   . ASN B 1 347 ? -7.008  -15.102 2.598   1.00 37.15  ? 393  ASN B N   1 
ATOM   6247  C  CA  . ASN B 1 347 ? -7.489  -14.241 3.716   1.00 37.20  ? 393  ASN B CA  1 
ATOM   6248  C  C   . ASN B 1 347 ? -8.022  -14.983 4.952   1.00 36.89  ? 393  ASN B C   1 
ATOM   6249  O  O   . ASN B 1 347 ? -7.883  -14.494 6.059   1.00 36.82  ? 393  ASN B O   1 
ATOM   6250  C  CB  . ASN B 1 347 ? -8.443  -13.139 3.249   1.00 36.60  ? 393  ASN B CB  1 
ATOM   6251  C  CG  . ASN B 1 347 ? -7.732  -12.076 2.389   1.00 37.69  ? 393  ASN B CG  1 
ATOM   6252  O  OD1 . ASN B 1 347 ? -6.755  -11.458 2.818   1.00 38.68  ? 393  ASN B OD1 1 
ATOM   6253  N  ND2 . ASN B 1 347 ? -8.237  -11.853 1.182   1.00 38.29  ? 393  ASN B ND2 1 
ATOM   6254  N  N   . ALA B 1 348 ? -8.555  -16.184 4.772   1.00 36.52  ? 394  ALA B N   1 
ATOM   6255  C  CA  . ALA B 1 348 ? -8.991  -16.944 5.936   1.00 37.13  ? 394  ALA B CA  1 
ATOM   6256  C  C   . ALA B 1 348 ? -7.767  -17.274 6.760   1.00 37.69  ? 394  ALA B C   1 
ATOM   6257  O  O   . ALA B 1 348 ? -7.781  -17.141 7.983   1.00 38.48  ? 394  ALA B O   1 
ATOM   6258  C  CB  . ALA B 1 348 ? -9.767  -18.246 5.550   1.00 36.17  ? 394  ALA B CB  1 
ATOM   6259  N  N   . VAL B 1 349 ? -6.706  -17.710 6.084   1.00 37.87  ? 395  VAL B N   1 
ATOM   6260  C  CA  . VAL B 1 349 ? -5.475  -18.076 6.753   1.00 37.67  ? 395  VAL B CA  1 
ATOM   6261  C  C   . VAL B 1 349 ? -4.893  -16.835 7.413   1.00 37.96  ? 395  VAL B C   1 
ATOM   6262  O  O   . VAL B 1 349 ? -4.584  -16.852 8.592   1.00 38.18  ? 395  VAL B O   1 
ATOM   6263  C  CB  . VAL B 1 349 ? -4.472  -18.671 5.757   1.00 37.89  ? 395  VAL B CB  1 
ATOM   6264  C  CG1 . VAL B 1 349 ? -3.045  -18.672 6.332   1.00 37.90  ? 395  VAL B CG1 1 
ATOM   6265  C  CG2 . VAL B 1 349 ? -4.902  -20.079 5.354   1.00 37.26  ? 395  VAL B CG2 1 
ATOM   6266  N  N   . LEU B 1 350 ? -4.754  -15.755 6.646   1.00 37.87  ? 396  LEU B N   1 
ATOM   6267  C  CA  . LEU B 1 350 ? -4.256  -14.507 7.165   1.00 37.40  ? 396  LEU B CA  1 
ATOM   6268  C  C   . LEU B 1 350 ? -5.162  -13.971 8.273   1.00 37.49  ? 396  LEU B C   1 
ATOM   6269  O  O   . LEU B 1 350 ? -4.702  -13.259 9.176   1.00 37.07  ? 396  LEU B O   1 
ATOM   6270  C  CB  . LEU B 1 350 ? -4.123  -13.504 6.029   1.00 37.23  ? 396  LEU B CB  1 
ATOM   6271  C  CG  . LEU B 1 350 ? -2.800  -13.195 5.313   1.00 37.65  ? 396  LEU B CG  1 
ATOM   6272  C  CD1 . LEU B 1 350 ? -1.630  -14.080 5.666   1.00 40.14  ? 396  LEU B CD1 1 
ATOM   6273  C  CD2 . LEU B 1 350 ? -2.998  -13.203 3.813   1.00 36.62  ? 396  LEU B CD2 1 
ATOM   6274  N  N   . ASP B 1 351 ? -6.450  -14.304 8.231   1.00 37.98  ? 397  ASP B N   1 
ATOM   6275  C  CA  . ASP B 1 351 ? -7.315  -13.874 9.325   1.00 38.65  ? 397  ASP B CA  1 
ATOM   6276  C  C   . ASP B 1 351 ? -6.852  -14.592 10.590  1.00 39.30  ? 397  ASP B C   1 
ATOM   6277  O  O   . ASP B 1 351 ? -6.787  -13.999 11.680  1.00 39.57  ? 397  ASP B O   1 
ATOM   6278  C  CB  . ASP B 1 351 ? -8.795  -14.163 9.048   1.00 38.44  ? 397  ASP B CB  1 
ATOM   6279  C  CG  . ASP B 1 351 ? -9.436  -13.156 8.113   1.00 38.42  ? 397  ASP B CG  1 
ATOM   6280  O  OD1 . ASP B 1 351 ? -9.019  -11.986 8.086   1.00 37.45  ? 397  ASP B OD1 1 
ATOM   6281  O  OD2 . ASP B 1 351 ? -10.382 -13.554 7.400   1.00 39.81  ? 397  ASP B OD2 1 
ATOM   6282  N  N   . GLY B 1 352 ? -6.531  -15.872 10.430  1.00 39.70  ? 398  GLY B N   1 
ATOM   6283  C  CA  . GLY B 1 352 ? -5.949  -16.692 11.504  1.00 40.30  ? 398  GLY B CA  1 
ATOM   6284  C  C   . GLY B 1 352 ? -6.701  -17.990 11.725  1.00 40.71  ? 398  GLY B C   1 
ATOM   6285  O  O   . GLY B 1 352 ? -6.727  -18.509 12.816  1.00 41.67  ? 398  GLY B O   1 
ATOM   6286  N  N   . ALA B 1 353 ? -7.316  -18.522 10.684  1.00 41.15  ? 399  ALA B N   1 
ATOM   6287  C  CA  . ALA B 1 353 ? -8.211  -19.652 10.830  1.00 41.07  ? 399  ALA B CA  1 
ATOM   6288  C  C   . ALA B 1 353 ? -7.391  -20.874 11.036  1.00 41.24  ? 399  ALA B C   1 
ATOM   6289  O  O   . ALA B 1 353 ? -6.324  -21.021 10.415  1.00 41.43  ? 399  ALA B O   1 
ATOM   6290  C  CB  . ALA B 1 353 ? -9.045  -19.808 9.583   1.00 40.81  ? 399  ALA B CB  1 
ATOM   6291  N  N   . ASP B 1 354 ? -7.882  -21.771 11.888  1.00 41.47  ? 400  ASP B N   1 
ATOM   6292  C  CA  . ASP B 1 354 ? -7.212  -23.065 12.054  1.00 41.53  ? 400  ASP B CA  1 
ATOM   6293  C  C   . ASP B 1 354 ? -7.487  -24.063 10.927  1.00 41.84  ? 400  ASP B C   1 
ATOM   6294  O  O   . ASP B 1 354 ? -6.597  -24.809 10.553  1.00 42.76  ? 400  ASP B O   1 
ATOM   6295  C  CB  . ASP B 1 354 ? -7.540  -23.661 13.396  1.00 41.39  ? 400  ASP B CB  1 
ATOM   6296  C  CG  . ASP B 1 354 ? -6.902  -22.901 14.514  1.00 41.97  ? 400  ASP B CG  1 
ATOM   6297  O  OD1 . ASP B 1 354 ? -5.664  -23.048 14.702  1.00 40.86  ? 400  ASP B OD1 1 
ATOM   6298  O  OD2 . ASP B 1 354 ? -7.641  -22.162 15.200  1.00 42.90  ? 400  ASP B OD2 1 
ATOM   6299  N  N   . CYS B 1 355 ? -8.704  -24.079 10.386  1.00 41.46  ? 401  CYS B N   1 
ATOM   6300  C  CA  . CYS B 1 355 ? -9.037  -24.988 9.304   1.00 41.19  ? 401  CYS B CA  1 
ATOM   6301  C  C   . CYS B 1 355 ? -9.875  -24.287 8.275   1.00 40.80  ? 401  CYS B C   1 
ATOM   6302  O  O   . CYS B 1 355 ? -10.593 -23.344 8.597   1.00 41.90  ? 401  CYS B O   1 
ATOM   6303  C  CB  . CYS B 1 355 ? -9.853  -26.178 9.800   1.00 41.25  ? 401  CYS B CB  1 
ATOM   6304  S  SG  . CYS B 1 355 ? -9.244  -26.997 11.224  1.00 43.89  ? 401  CYS B SG  1 
ATOM   6305  N  N   . ILE B 1 356 ? -9.811  -24.771 7.042   1.00 39.83  ? 402  ILE B N   1 
ATOM   6306  C  CA  . ILE B 1 356 ? -10.643 -24.279 5.962   1.00 38.70  ? 402  ILE B CA  1 
ATOM   6307  C  C   . ILE B 1 356 ? -11.460 -25.453 5.452   1.00 39.10  ? 402  ILE B C   1 
ATOM   6308  O  O   . ILE B 1 356 ? -11.010 -26.591 5.500   1.00 39.17  ? 402  ILE B O   1 
ATOM   6309  C  CB  . ILE B 1 356 ? -9.805  -23.617 4.878   1.00 38.30  ? 402  ILE B CB  1 
ATOM   6310  C  CG1 . ILE B 1 356 ? -8.604  -24.506 4.510   1.00 36.69  ? 402  ILE B CG1 1 
ATOM   6311  C  CG2 . ILE B 1 356 ? -9.319  -22.290 5.397   1.00 36.56  ? 402  ILE B CG2 1 
ATOM   6312  C  CD1 . ILE B 1 356 ? -7.640  -23.957 3.427   1.00 32.86  ? 402  ILE B CD1 1 
ATOM   6313  N  N   . MET B 1 357 ? -12.692 -25.185 5.016   1.00 39.48  ? 403  MET B N   1 
ATOM   6314  C  CA  . MET B 1 357 ? -13.618 -26.256 4.646   1.00 38.72  ? 403  MET B CA  1 
ATOM   6315  C  C   . MET B 1 357 ? -13.928 -26.256 3.140   1.00 39.04  ? 403  MET B C   1 
ATOM   6316  O  O   . MET B 1 357 ? -13.590 -25.309 2.421   1.00 39.51  ? 403  MET B O   1 
ATOM   6317  C  CB  . MET B 1 357 ? -14.893 -26.154 5.474   1.00 38.14  ? 403  MET B CB  1 
ATOM   6318  C  CG  . MET B 1 357 ? -15.629 -27.482 5.620   1.00 37.27  ? 403  MET B CG  1 
ATOM   6319  S  SD  . MET B 1 357 ? -16.886 -27.486 6.914   1.00 38.79  ? 403  MET B SD  1 
ATOM   6320  C  CE  . MET B 1 357 ? -18.358 -26.846 6.132   1.00 38.27  ? 403  MET B CE  1 
ATOM   6321  N  N   . LEU B 1 358 ? -14.546 -27.340 2.673   1.00 38.67  ? 404  LEU B N   1 
ATOM   6322  C  CA  . LEU B 1 358 ? -15.071 -27.465 1.328   1.00 37.79  ? 404  LEU B CA  1 
ATOM   6323  C  C   . LEU B 1 358 ? -16.342 -28.241 1.465   1.00 38.15  ? 404  LEU B C   1 
ATOM   6324  O  O   . LEU B 1 358 ? -16.419 -29.175 2.271   1.00 38.59  ? 404  LEU B O   1 
ATOM   6325  C  CB  . LEU B 1 358 ? -14.119 -28.288 0.473   1.00 37.57  ? 404  LEU B CB  1 
ATOM   6326  C  CG  . LEU B 1 358 ? -12.776 -27.703 0.061   1.00 37.54  ? 404  LEU B CG  1 
ATOM   6327  C  CD1 . LEU B 1 358 ? -11.857 -28.780 -0.480  1.00 34.36  ? 404  LEU B CD1 1 
ATOM   6328  C  CD2 . LEU B 1 358 ? -13.014 -26.658 -0.980  1.00 36.26  ? 404  LEU B CD2 1 
ATOM   6329  N  N   . SER B 1 359 ? -17.351 -27.883 0.684   1.00 38.37  ? 405  SER B N   1 
ATOM   6330  C  CA  . SER B 1 359 ? -18.656 -28.557 0.782   1.00 38.03  ? 405  SER B CA  1 
ATOM   6331  C  C   . SER B 1 359 ? -19.087 -29.096 -0.565  1.00 38.60  ? 405  SER B C   1 
ATOM   6332  O  O   . SER B 1 359 ? -18.659 -30.190 -0.940  1.00 39.50  ? 405  SER B O   1 
ATOM   6333  C  CB  . SER B 1 359 ? -19.679 -27.621 1.384   1.00 37.44  ? 405  SER B CB  1 
ATOM   6334  O  OG  . SER B 1 359 ? -19.189 -27.196 2.637   1.00 34.81  ? 405  SER B OG  1 
ATOM   6335  N  N   . GLY B 1 360 ? -19.909 -28.362 -1.302  1.00 38.32  ? 406  GLY B N   1 
ATOM   6336  C  CA  . GLY B 1 360 ? -20.200 -28.789 -2.663  1.00 38.60  ? 406  GLY B CA  1 
ATOM   6337  C  C   . GLY B 1 360 ? -18.920 -29.194 -3.420  1.00 38.83  ? 406  GLY B C   1 
ATOM   6338  O  O   . GLY B 1 360 ? -18.901 -30.194 -4.169  1.00 38.20  ? 406  GLY B O   1 
ATOM   6339  N  N   . GLU B 1 361 ? -17.837 -28.450 -3.200  1.00 38.38  ? 407  GLU B N   1 
ATOM   6340  C  CA  . GLU B 1 361 ? -16.610 -28.671 -3.976  1.00 38.47  ? 407  GLU B CA  1 
ATOM   6341  C  C   . GLU B 1 361 ? -16.124 -30.098 -3.931  1.00 38.70  ? 407  GLU B C   1 
ATOM   6342  O  O   . GLU B 1 361 ? -15.577 -30.580 -4.940  1.00 39.38  ? 407  GLU B O   1 
ATOM   6343  C  CB  . GLU B 1 361 ? -15.476 -27.729 -3.570  1.00 38.38  ? 407  GLU B CB  1 
ATOM   6344  C  CG  . GLU B 1 361 ? -15.826 -26.264 -3.599  1.00 38.14  ? 407  GLU B CG  1 
ATOM   6345  C  CD  . GLU B 1 361 ? -16.408 -25.765 -2.308  1.00 39.65  ? 407  GLU B CD  1 
ATOM   6346  O  OE1 . GLU B 1 361 ? -17.233 -26.479 -1.659  1.00 36.09  ? 407  GLU B OE1 1 
ATOM   6347  O  OE2 . GLU B 1 361 ? -16.042 -24.625 -1.968  1.00 40.34  ? 407  GLU B OE2 1 
ATOM   6348  N  N   . THR B 1 362 ? -16.309 -30.764 -2.783  1.00 38.56  ? 408  THR B N   1 
ATOM   6349  C  CA  . THR B 1 362 ? -15.868 -32.142 -2.638  1.00 38.54  ? 408  THR B CA  1 
ATOM   6350  C  C   . THR B 1 362 ? -17.012 -33.103 -2.487  1.00 38.57  ? 408  THR B C   1 
ATOM   6351  O  O   . THR B 1 362 ? -16.832 -34.279 -2.690  1.00 39.15  ? 408  THR B O   1 
ATOM   6352  C  CB  . THR B 1 362 ? -14.929 -32.355 -1.449  1.00 38.72  ? 408  THR B CB  1 
ATOM   6353  O  OG1 . THR B 1 362 ? -15.560 -31.889 -0.254  1.00 39.32  ? 408  THR B OG1 1 
ATOM   6354  C  CG2 . THR B 1 362 ? -13.570 -31.676 -1.674  1.00 37.14  ? 408  THR B CG2 1 
ATOM   6355  N  N   . ALA B 1 363 ? -18.191 -32.630 -2.123  1.00 38.53  ? 409  ALA B N   1 
ATOM   6356  C  CA  . ALA B 1 363 ? -19.313 -33.558 -1.933  1.00 38.63  ? 409  ALA B CA  1 
ATOM   6357  C  C   . ALA B 1 363 ? -19.993 -33.966 -3.240  1.00 38.78  ? 409  ALA B C   1 
ATOM   6358  O  O   . ALA B 1 363 ? -20.359 -35.109 -3.379  1.00 39.41  ? 409  ALA B O   1 
ATOM   6359  C  CB  . ALA B 1 363 ? -20.339 -33.017 -0.905  1.00 38.08  ? 409  ALA B CB  1 
ATOM   6360  N  N   . LYS B 1 364 ? -20.157 -33.049 -4.191  1.00 39.05  ? 410  LYS B N   1 
ATOM   6361  C  CA  . LYS B 1 364 ? -20.853 -33.369 -5.445  1.00 39.55  ? 410  LYS B CA  1 
ATOM   6362  C  C   . LYS B 1 364 ? -20.217 -32.903 -6.727  1.00 38.47  ? 410  LYS B C   1 
ATOM   6363  O  O   . LYS B 1 364 ? -20.682 -33.281 -7.803  1.00 38.89  ? 410  LYS B O   1 
ATOM   6364  C  CB  . LYS B 1 364 ? -22.223 -32.725 -5.514  1.00 40.03  ? 410  LYS B CB  1 
ATOM   6365  C  CG  . LYS B 1 364 ? -22.783 -32.297 -4.264  1.00 44.78  ? 410  LYS B CG  1 
ATOM   6366  C  CD  . LYS B 1 364 ? -23.166 -30.870 -4.546  1.00 51.62  ? 410  LYS B CD  1 
ATOM   6367  C  CE  . LYS B 1 364 ? -23.664 -30.185 -3.320  1.00 53.44  ? 410  LYS B CE  1 
ATOM   6368  N  NZ  . LYS B 1 364 ? -24.677 -31.037 -2.634  1.00 53.81  ? 410  LYS B NZ  1 
ATOM   6369  N  N   . GLY B 1 365 ? -19.240 -32.018 -6.630  1.00 37.10  ? 411  GLY B N   1 
ATOM   6370  C  CA  . GLY B 1 365 ? -18.728 -31.373 -7.793  1.00 36.06  ? 411  GLY B CA  1 
ATOM   6371  C  C   . GLY B 1 365 ? -17.901 -32.290 -8.643  1.00 35.69  ? 411  GLY B C   1 
ATOM   6372  O  O   . GLY B 1 365 ? -17.663 -33.447 -8.284  1.00 35.40  ? 411  GLY B O   1 
ATOM   6373  N  N   . ASN B 1 366 ? -17.456 -31.769 -9.778  1.00 35.69  ? 412  ASN B N   1 
ATOM   6374  C  CA  . ASN B 1 366 ? -16.694 -32.563 -10.702 1.00 36.06  ? 412  ASN B CA  1 
ATOM   6375  C  C   . ASN B 1 366 ? -15.198 -32.522 -10.460 1.00 36.06  ? 412  ASN B C   1 
ATOM   6376  O  O   . ASN B 1 366 ? -14.444 -33.121 -11.213 1.00 36.23  ? 412  ASN B O   1 
ATOM   6377  C  CB  . ASN B 1 366 ? -17.046 -32.169 -12.130 1.00 36.38  ? 412  ASN B CB  1 
ATOM   6378  C  CG  . ASN B 1 366 ? -18.496 -32.531 -12.499 1.00 37.33  ? 412  ASN B CG  1 
ATOM   6379  O  OD1 . ASN B 1 366 ? -19.008 -33.613 -12.141 1.00 41.01  ? 412  ASN B OD1 1 
ATOM   6380  N  ND2 . ASN B 1 366 ? -19.157 -31.636 -13.222 1.00 34.17  ? 412  ASN B ND2 1 
ATOM   6381  N  N   . PHE B 1 367 ? -14.761 -31.821 -9.411  1.00 36.28  ? 413  PHE B N   1 
ATOM   6382  C  CA  . PHE B 1 367 ? -13.310 -31.649 -9.157  1.00 36.09  ? 413  PHE B CA  1 
ATOM   6383  C  C   . PHE B 1 367 ? -12.907 -31.700 -7.682  1.00 35.82  ? 413  PHE B C   1 
ATOM   6384  O  O   . PHE B 1 367 ? -12.200 -30.822 -7.206  1.00 35.53  ? 413  PHE B O   1 
ATOM   6385  C  CB  . PHE B 1 367 ? -12.777 -30.366 -9.810  1.00 35.74  ? 413  PHE B CB  1 
ATOM   6386  C  CG  . PHE B 1 367 ? -13.014 -30.307 -11.280 1.00 36.64  ? 413  PHE B CG  1 
ATOM   6387  C  CD1 . PHE B 1 367 ? -14.122 -29.621 -11.786 1.00 37.26  ? 413  PHE B CD1 1 
ATOM   6388  C  CD2 . PHE B 1 367 ? -12.157 -30.966 -12.181 1.00 36.39  ? 413  PHE B CD2 1 
ATOM   6389  C  CE1 . PHE B 1 367 ? -14.385 -29.585 -13.175 1.00 37.15  ? 413  PHE B CE1 1 
ATOM   6390  C  CE2 . PHE B 1 367 ? -12.406 -30.927 -13.569 1.00 35.67  ? 413  PHE B CE2 1 
ATOM   6391  C  CZ  . PHE B 1 367 ? -13.524 -30.239 -14.061 1.00 35.20  ? 413  PHE B CZ  1 
ATOM   6392  N  N   . PRO B 1 368 ? -13.329 -32.758 -6.960  1.00 35.70  ? 414  PRO B N   1 
ATOM   6393  C  CA  . PRO B 1 368 ? -13.069 -32.781 -5.519  1.00 35.28  ? 414  PRO B CA  1 
ATOM   6394  C  C   . PRO B 1 368 ? -11.555 -32.796 -5.197  1.00 35.35  ? 414  PRO B C   1 
ATOM   6395  O  O   . PRO B 1 368 ? -11.080 -32.030 -4.353  1.00 35.43  ? 414  PRO B O   1 
ATOM   6396  C  CB  . PRO B 1 368 ? -13.756 -34.059 -5.068  1.00 35.17  ? 414  PRO B CB  1 
ATOM   6397  C  CG  . PRO B 1 368 ? -13.852 -34.901 -6.300  1.00 34.80  ? 414  PRO B CG  1 
ATOM   6398  C  CD  . PRO B 1 368 ? -14.018 -33.978 -7.426  1.00 34.85  ? 414  PRO B CD  1 
ATOM   6399  N  N   . VAL B 1 369 ? -10.789 -33.632 -5.872  1.00 35.06  ? 415  VAL B N   1 
ATOM   6400  C  CA  . VAL B 1 369 ? -9.375  -33.645 -5.607  1.00 34.88  ? 415  VAL B CA  1 
ATOM   6401  C  C   . VAL B 1 369 ? -8.695  -32.342 -6.035  1.00 35.57  ? 415  VAL B C   1 
ATOM   6402  O  O   . VAL B 1 369 ? -7.873  -31.800 -5.293  1.00 36.18  ? 415  VAL B O   1 
ATOM   6403  C  CB  . VAL B 1 369 ? -8.707  -34.849 -6.268  1.00 35.07  ? 415  VAL B CB  1 
ATOM   6404  C  CG1 . VAL B 1 369 ? -7.175  -34.748 -6.195  1.00 32.34  ? 415  VAL B CG1 1 
ATOM   6405  C  CG2 . VAL B 1 369 ? -9.213  -36.127 -5.624  1.00 34.45  ? 415  VAL B CG2 1 
ATOM   6406  N  N   . GLU B 1 370 ? -9.022  -31.826 -7.216  1.00 35.53  ? 416  GLU B N   1 
ATOM   6407  C  CA  . GLU B 1 370 ? -8.508  -30.524 -7.609  1.00 36.14  ? 416  GLU B CA  1 
ATOM   6408  C  C   . GLU B 1 370 ? -8.849  -29.461 -6.571  1.00 36.18  ? 416  GLU B C   1 
ATOM   6409  O  O   . GLU B 1 370 ? -8.000  -28.654 -6.212  1.00 36.42  ? 416  GLU B O   1 
ATOM   6410  C  CB  . GLU B 1 370 ? -9.003  -30.111 -8.987  1.00 36.05  ? 416  GLU B CB  1 
ATOM   6411  C  CG  . GLU B 1 370 ? -8.485  -30.997 -10.107 1.00 38.68  ? 416  GLU B CG  1 
ATOM   6412  C  CD  . GLU B 1 370 ? -9.356  -32.218 -10.333 1.00 43.55  ? 416  GLU B CD  1 
ATOM   6413  O  OE1 . GLU B 1 370 ? -10.288 -32.481 -9.524  1.00 44.70  ? 416  GLU B OE1 1 
ATOM   6414  O  OE2 . GLU B 1 370 ? -9.097  -32.917 -11.337 1.00 44.75  ? 416  GLU B OE2 1 
ATOM   6415  N  N   . ALA B 1 371 ? -10.073 -29.483 -6.056  1.00 36.26  ? 417  ALA B N   1 
ATOM   6416  C  CA  . ALA B 1 371 ? -10.473 -28.563 -4.989  1.00 36.40  ? 417  ALA B CA  1 
ATOM   6417  C  C   . ALA B 1 371 ? -9.606  -28.668 -3.739  1.00 36.93  ? 417  ALA B C   1 
ATOM   6418  O  O   . ALA B 1 371 ? -9.228  -27.648 -3.162  1.00 37.49  ? 417  ALA B O   1 
ATOM   6419  C  CB  . ALA B 1 371 ? -11.939 -28.723 -4.638  1.00 36.12  ? 417  ALA B CB  1 
ATOM   6420  N  N   . VAL B 1 372 ? -9.277  -29.888 -3.321  1.00 37.23  ? 418  VAL B N   1 
ATOM   6421  C  CA  . VAL B 1 372 ? -8.414  -30.070 -2.161  1.00 37.14  ? 418  VAL B CA  1 
ATOM   6422  C  C   . VAL B 1 372 ? -6.992  -29.616 -2.478  1.00 37.20  ? 418  VAL B C   1 
ATOM   6423  O  O   . VAL B 1 372 ? -6.380  -28.906 -1.688  1.00 37.22  ? 418  VAL B O   1 
ATOM   6424  C  CB  . VAL B 1 372 ? -8.441  -31.500 -1.665  1.00 37.21  ? 418  VAL B CB  1 
ATOM   6425  C  CG1 . VAL B 1 372 ? -7.355  -31.711 -0.631  1.00 37.32  ? 418  VAL B CG1 1 
ATOM   6426  C  CG2 . VAL B 1 372 ? -9.792  -31.784 -1.071  1.00 37.32  ? 418  VAL B CG2 1 
ATOM   6427  N  N   . LYS B 1 373 ? -6.487  -29.978 -3.654  1.00 37.00  ? 419  LYS B N   1 
ATOM   6428  C  CA  . LYS B 1 373 ? -5.173  -29.514 -4.063  1.00 37.23  ? 419  LYS B CA  1 
ATOM   6429  C  C   . LYS B 1 373 ? -5.031  -27.989 -4.019  1.00 37.18  ? 419  LYS B C   1 
ATOM   6430  O  O   . LYS B 1 373 ? -3.994  -27.480 -3.601  1.00 37.09  ? 419  LYS B O   1 
ATOM   6431  C  CB  . LYS B 1 373 ? -4.829  -30.029 -5.444  1.00 37.63  ? 419  LYS B CB  1 
ATOM   6432  C  CG  . LYS B 1 373 ? -4.481  -31.520 -5.518  1.00 38.20  ? 419  LYS B CG  1 
ATOM   6433  C  CD  . LYS B 1 373 ? -3.872  -31.799 -6.862  1.00 39.86  ? 419  LYS B CD  1 
ATOM   6434  C  CE  . LYS B 1 373 ? -3.931  -33.256 -7.268  1.00 42.86  ? 419  LYS B CE  1 
ATOM   6435  N  NZ  . LYS B 1 373 ? -2.947  -33.518 -8.382  1.00 44.25  ? 419  LYS B NZ  1 
ATOM   6436  N  N   . MET B 1 374 ? -6.073  -27.273 -4.426  1.00 37.31  ? 420  MET B N   1 
ATOM   6437  C  CA  . MET B 1 374 ? -6.055  -25.811 -4.369  1.00 37.74  ? 420  MET B CA  1 
ATOM   6438  C  C   . MET B 1 374 ? -5.986  -25.238 -2.940  1.00 37.69  ? 420  MET B C   1 
ATOM   6439  O  O   . MET B 1 374 ? -5.116  -24.443 -2.655  1.00 37.64  ? 420  MET B O   1 
ATOM   6440  C  CB  . MET B 1 374 ? -7.218  -25.192 -5.158  1.00 38.17  ? 420  MET B CB  1 
ATOM   6441  C  CG  . MET B 1 374 ? -7.083  -23.686 -5.388  1.00 37.54  ? 420  MET B CG  1 
ATOM   6442  S  SD  . MET B 1 374 ? -5.887  -23.371 -6.725  1.00 40.21  ? 420  MET B SD  1 
ATOM   6443  C  CE  . MET B 1 374 ? -4.850  -22.267 -5.815  1.00 38.03  ? 420  MET B CE  1 
ATOM   6444  N  N   . GLN B 1 375 ? -6.888  -25.629 -2.046  1.00 37.67  ? 421  GLN B N   1 
ATOM   6445  C  CA  . GLN B 1 375 ? -6.775  -25.182 -0.659  1.00 37.83  ? 421  GLN B CA  1 
ATOM   6446  C  C   . GLN B 1 375 ? -5.384  -25.475 -0.123  1.00 38.24  ? 421  GLN B C   1 
ATOM   6447  O  O   . GLN B 1 375 ? -4.805  -24.645 0.562   1.00 38.44  ? 421  GLN B O   1 
ATOM   6448  C  CB  . GLN B 1 375 ? -7.831  -25.816 0.246   1.00 37.63  ? 421  GLN B CB  1 
ATOM   6449  C  CG  . GLN B 1 375 ? -9.230  -25.420 -0.087  1.00 37.10  ? 421  GLN B CG  1 
ATOM   6450  C  CD  . GLN B 1 375 ? -10.134 -25.355 1.120   1.00 38.04  ? 421  GLN B CD  1 
ATOM   6451  O  OE1 . GLN B 1 375 ? -10.933 -24.448 1.230   1.00 39.48  ? 421  GLN B OE1 1 
ATOM   6452  N  NE2 . GLN B 1 375 ? -10.031 -26.314 2.022   1.00 37.90  ? 421  GLN B NE2 1 
ATOM   6453  N  N   . HIS B 1 376 ? -4.839  -26.648 -0.434  1.00 38.93  ? 422  HIS B N   1 
ATOM   6454  C  CA  . HIS B 1 376 ? -3.443  -26.936 -0.058  1.00 39.25  ? 422  HIS B CA  1 
ATOM   6455  C  C   . HIS B 1 376 ? -2.445  -25.865 -0.602  1.00 39.59  ? 422  HIS B C   1 
ATOM   6456  O  O   . HIS B 1 376 ? -1.682  -25.272 0.168   1.00 39.89  ? 422  HIS B O   1 
ATOM   6457  C  CB  . HIS B 1 376 ? -3.018  -28.376 -0.434  1.00 38.77  ? 422  HIS B CB  1 
ATOM   6458  C  CG  . HIS B 1 376 ? -1.540  -28.636 -0.280  1.00 37.58  ? 422  HIS B CG  1 
ATOM   6459  N  ND1 . HIS B 1 376 ? -0.955  -28.945 0.930   1.00 36.15  ? 422  HIS B ND1 1 
ATOM   6460  C  CD2 . HIS B 1 376 ? -0.532  -28.633 -1.187  1.00 37.04  ? 422  HIS B CD2 1 
ATOM   6461  C  CE1 . HIS B 1 376 ? 0.344   -29.110 0.765   1.00 36.81  ? 422  HIS B CE1 1 
ATOM   6462  N  NE2 . HIS B 1 376 ? 0.628   -28.932 -0.512  1.00 35.90  ? 422  HIS B NE2 1 
ATOM   6463  N  N   . ALA B 1 377 ? -2.496  -25.590 -1.905  1.00 40.06  ? 423  ALA B N   1 
ATOM   6464  C  CA  . ALA B 1 377 ? -1.548  -24.663 -2.539  1.00 40.49  ? 423  ALA B CA  1 
ATOM   6465  C  C   . ALA B 1 377 ? -1.635  -23.253 -1.971  1.00 40.96  ? 423  ALA B C   1 
ATOM   6466  O  O   . ALA B 1 377 ? -0.602  -22.653 -1.635  1.00 41.48  ? 423  ALA B O   1 
ATOM   6467  C  CB  . ALA B 1 377 ? -1.730  -24.650 -4.031  1.00 40.20  ? 423  ALA B CB  1 
ATOM   6468  N  N   . ILE B 1 378 ? -2.853  -22.732 -1.847  1.00 41.06  ? 424  ILE B N   1 
ATOM   6469  C  CA  . ILE B 1 378 ? -3.053  -21.395 -1.309  1.00 40.93  ? 424  ILE B CA  1 
ATOM   6470  C  C   . ILE B 1 378 ? -2.608  -21.308 0.150   1.00 41.30  ? 424  ILE B C   1 
ATOM   6471  O  O   . ILE B 1 378 ? -1.888  -20.362 0.521   1.00 41.52  ? 424  ILE B O   1 
ATOM   6472  C  CB  . ILE B 1 378 ? -4.510  -20.941 -1.374  1.00 40.89  ? 424  ILE B CB  1 
ATOM   6473  C  CG1 . ILE B 1 378 ? -5.066  -21.024 -2.783  1.00 39.16  ? 424  ILE B CG1 1 
ATOM   6474  C  CG2 . ILE B 1 378 ? -4.633  -19.504 -0.903  1.00 41.73  ? 424  ILE B CG2 1 
ATOM   6475  C  CD1 . ILE B 1 378 ? -6.571  -21.119 -2.785  1.00 35.79  ? 424  ILE B CD1 1 
ATOM   6476  N  N   . ALA B 1 379 ? -3.030  -22.274 0.980   1.00 40.92  ? 425  ALA B N   1 
ATOM   6477  C  CA  . ALA B 1 379 ? -2.738  -22.188 2.407   1.00 40.28  ? 425  ALA B CA  1 
ATOM   6478  C  C   . ALA B 1 379 ? -1.243  -22.119 2.631   1.00 40.21  ? 425  ALA B C   1 
ATOM   6479  O  O   . ALA B 1 379 ? -0.797  -21.393 3.497   1.00 40.05  ? 425  ALA B O   1 
ATOM   6480  C  CB  . ALA B 1 379 ? -3.333  -23.294 3.151   1.00 40.46  ? 425  ALA B CB  1 
ATOM   6481  N  N   . ARG B 1 380 ? -0.456  -22.807 1.812   1.00 40.32  ? 426  ARG B N   1 
ATOM   6482  C  CA  . ARG B 1 380 ? 0.999   -22.757 1.988   1.00 40.62  ? 426  ARG B CA  1 
ATOM   6483  C  C   . ARG B 1 380 ? 1.578   -21.389 1.737   1.00 40.62  ? 426  ARG B C   1 
ATOM   6484  O  O   . ARG B 1 380 ? 2.431   -20.939 2.498   1.00 41.50  ? 426  ARG B O   1 
ATOM   6485  C  CB  . ARG B 1 380 ? 1.723   -23.788 1.127   1.00 40.61  ? 426  ARG B CB  1 
ATOM   6486  C  CG  . ARG B 1 380 ? 1.498   -25.207 1.609   1.00 42.19  ? 426  ARG B CG  1 
ATOM   6487  C  CD  . ARG B 1 380 ? 2.674   -26.079 1.380   1.00 43.50  ? 426  ARG B CD  1 
ATOM   6488  N  NE  . ARG B 1 380 ? 3.167   -25.878 0.032   1.00 44.35  ? 426  ARG B NE  1 
ATOM   6489  C  CZ  . ARG B 1 380 ? 4.441   -26.001 -0.308  1.00 46.36  ? 426  ARG B CZ  1 
ATOM   6490  N  NH1 . ARG B 1 380 ? 5.329   -26.340 0.633   1.00 45.55  ? 426  ARG B NH1 1 
ATOM   6491  N  NH2 . ARG B 1 380 ? 4.815   -25.777 -1.571  1.00 45.99  ? 426  ARG B NH2 1 
ATOM   6492  N  N   . GLU B 1 381 ? 1.137   -20.740 0.659   1.00 40.25  ? 427  GLU B N   1 
ATOM   6493  C  CA  . GLU B 1 381 ? 1.523   -19.361 0.381   1.00 39.41  ? 427  GLU B CA  1 
ATOM   6494  C  C   . GLU B 1 381 ? 1.090   -18.438 1.510   1.00 39.46  ? 427  GLU B C   1 
ATOM   6495  O  O   . GLU B 1 381 ? 1.891   -17.658 2.025   1.00 39.51  ? 427  GLU B O   1 
ATOM   6496  C  CB  . GLU B 1 381 ? 0.885   -18.892 -0.912  1.00 39.14  ? 427  GLU B CB  1 
ATOM   6497  C  CG  . GLU B 1 381 ? 1.277   -19.704 -2.116  1.00 37.77  ? 427  GLU B CG  1 
ATOM   6498  C  CD  . GLU B 1 381 ? 2.732   -19.542 -2.473  1.00 35.26  ? 427  GLU B CD  1 
ATOM   6499  O  OE1 . GLU B 1 381 ? 3.374   -18.585 -2.021  1.00 37.59  ? 427  GLU B OE1 1 
ATOM   6500  O  OE2 . GLU B 1 381 ? 3.236   -20.392 -3.196  1.00 33.95  ? 427  GLU B OE2 1 
ATOM   6501  N  N   . ALA B 1 382 ? -0.176  -18.543 1.910   1.00 39.27  ? 428  ALA B N   1 
ATOM   6502  C  CA  . ALA B 1 382 ? -0.716  -17.626 2.898   1.00 39.10  ? 428  ALA B CA  1 
ATOM   6503  C  C   . ALA B 1 382 ? -0.024  -17.787 4.237   1.00 39.02  ? 428  ALA B C   1 
ATOM   6504  O  O   . ALA B 1 382 ? 0.362   -16.808 4.878   1.00 38.95  ? 428  ALA B O   1 
ATOM   6505  C  CB  . ALA B 1 382 ? -2.210  -17.806 3.036   1.00 38.88  ? 428  ALA B CB  1 
ATOM   6506  N  N   . GLU B 1 383 ? 0.155   -19.035 4.646   1.00 39.28  ? 429  GLU B N   1 
ATOM   6507  C  CA  . GLU B 1 383 ? 0.887   -19.324 5.871   1.00 39.74  ? 429  GLU B CA  1 
ATOM   6508  C  C   . GLU B 1 383 ? 2.265   -18.653 5.948   1.00 40.42  ? 429  GLU B C   1 
ATOM   6509  O  O   . GLU B 1 383 ? 2.527   -17.994 6.950   1.00 41.00  ? 429  GLU B O   1 
ATOM   6510  C  CB  . GLU B 1 383 ? 0.977   -20.816 6.101   1.00 39.13  ? 429  GLU B CB  1 
ATOM   6511  C  CG  . GLU B 1 383 ? -0.304  -21.360 6.614   1.00 39.28  ? 429  GLU B CG  1 
ATOM   6512  C  CD  . GLU B 1 383 ? -0.579  -22.760 6.156   1.00 39.83  ? 429  GLU B CD  1 
ATOM   6513  O  OE1 . GLU B 1 383 ? 0.399   -23.492 5.888   1.00 40.55  ? 429  GLU B OE1 1 
ATOM   6514  O  OE2 . GLU B 1 383 ? -1.764  -23.132 6.054   1.00 39.64  ? 429  GLU B OE2 1 
ATOM   6515  N  N   . ALA B 1 384 ? 3.088   -18.769 4.891   1.00 40.61  ? 430  ALA B N   1 
ATOM   6516  C  CA  . ALA B 1 384 ? 4.380   -18.064 4.767   1.00 41.05  ? 430  ALA B CA  1 
ATOM   6517  C  C   . ALA B 1 384 ? 4.285   -16.547 4.814   1.00 41.52  ? 430  ALA B C   1 
ATOM   6518  O  O   . ALA B 1 384 ? 5.252   -15.851 5.121   1.00 42.35  ? 430  ALA B O   1 
ATOM   6519  C  CB  . ALA B 1 384 ? 5.096   -18.472 3.493   1.00 40.85  ? 430  ALA B CB  1 
ATOM   6520  N  N   . ALA B 1 385 ? 3.133   -16.021 4.501   1.00 41.54  ? 431  ALA B N   1 
ATOM   6521  C  CA  . ALA B 1 385 ? 3.012   -14.598 4.497   1.00 42.18  ? 431  ALA B CA  1 
ATOM   6522  C  C   . ALA B 1 385 ? 2.516   -14.036 5.833   1.00 42.88  ? 431  ALA B C   1 
ATOM   6523  O  O   . ALA B 1 385 ? 2.390   -12.828 5.978   1.00 43.62  ? 431  ALA B O   1 
ATOM   6524  C  CB  . ALA B 1 385 ? 2.103   -14.188 3.397   1.00 41.97  ? 431  ALA B CB  1 
ATOM   6525  N  N   . VAL B 1 386 ? 2.218   -14.886 6.809   1.00 43.13  ? 432  VAL B N   1 
ATOM   6526  C  CA  . VAL B 1 386 ? 1.783   -14.374 8.096   1.00 43.11  ? 432  VAL B CA  1 
ATOM   6527  C  C   . VAL B 1 386 ? 2.909   -13.536 8.677   1.00 43.57  ? 432  VAL B C   1 
ATOM   6528  O  O   . VAL B 1 386 ? 4.066   -13.958 8.675   1.00 44.24  ? 432  VAL B O   1 
ATOM   6529  C  CB  . VAL B 1 386 ? 1.454   -15.511 9.076   1.00 43.07  ? 432  VAL B CB  1 
ATOM   6530  C  CG1 . VAL B 1 386 ? 1.363   -14.974 10.502  1.00 42.03  ? 432  VAL B CG1 1 
ATOM   6531  C  CG2 . VAL B 1 386 ? 0.157   -16.207 8.670   1.00 42.40  ? 432  VAL B CG2 1 
ATOM   6532  N  N   . TYR B 1 387 ? 2.563   -12.354 9.173   1.00 43.76  ? 433  TYR B N   1 
ATOM   6533  C  CA  . TYR B 1 387 ? 3.529   -11.469 9.829   1.00 43.40  ? 433  TYR B CA  1 
ATOM   6534  C  C   . TYR B 1 387 ? 3.690   -11.883 11.289  1.00 43.40  ? 433  TYR B C   1 
ATOM   6535  O  O   . TYR B 1 387 ? 3.198   -11.205 12.181  1.00 43.77  ? 433  TYR B O   1 
ATOM   6536  C  CB  . TYR B 1 387 ? 3.062   -10.000 9.689   1.00 43.24  ? 433  TYR B CB  1 
ATOM   6537  C  CG  . TYR B 1 387 ? 4.056   -8.920  10.119  1.00 42.61  ? 433  TYR B CG  1 
ATOM   6538  C  CD1 . TYR B 1 387 ? 5.420   -9.021  9.824   1.00 43.05  ? 433  TYR B CD1 1 
ATOM   6539  C  CD2 . TYR B 1 387 ? 3.614   -7.778  10.800  1.00 43.11  ? 433  TYR B CD2 1 
ATOM   6540  C  CE1 . TYR B 1 387 ? 6.314   -8.032  10.228  1.00 42.93  ? 433  TYR B CE1 1 
ATOM   6541  C  CE2 . TYR B 1 387 ? 4.494   -6.791  11.197  1.00 43.07  ? 433  TYR B CE2 1 
ATOM   6542  C  CZ  . TYR B 1 387 ? 5.843   -6.925  10.908  1.00 43.62  ? 433  TYR B CZ  1 
ATOM   6543  O  OH  . TYR B 1 387 ? 6.719   -5.933  11.290  1.00 45.21  ? 433  TYR B OH  1 
ATOM   6544  N  N   . HIS B 1 388 ? 4.370   -12.999 11.543  1.00 43.64  ? 434  HIS B N   1 
ATOM   6545  C  CA  . HIS B 1 388 ? 4.463   -13.520 12.922  1.00 44.03  ? 434  HIS B CA  1 
ATOM   6546  C  C   . HIS B 1 388 ? 4.900   -12.471 13.919  1.00 44.37  ? 434  HIS B C   1 
ATOM   6547  O  O   . HIS B 1 388 ? 4.306   -12.351 14.995  1.00 44.47  ? 434  HIS B O   1 
ATOM   6548  C  CB  . HIS B 1 388 ? 5.390   -14.709 13.004  1.00 43.77  ? 434  HIS B CB  1 
ATOM   6549  C  CG  . HIS B 1 388 ? 5.037   -15.785 12.047  1.00 44.89  ? 434  HIS B CG  1 
ATOM   6550  N  ND1 . HIS B 1 388 ? 3.993   -16.657 12.269  1.00 45.36  ? 434  HIS B ND1 1 
ATOM   6551  C  CD2 . HIS B 1 388 ? 5.556   -16.105 10.836  1.00 46.68  ? 434  HIS B CD2 1 
ATOM   6552  C  CE1 . HIS B 1 388 ? 3.895   -17.486 11.243  1.00 46.42  ? 434  HIS B CE1 1 
ATOM   6553  N  NE2 . HIS B 1 388 ? 4.824   -17.166 10.354  1.00 46.84  ? 434  HIS B NE2 1 
ATOM   6554  N  N   . ARG B 1 389 ? 5.919   -11.693 13.538  1.00 44.74  ? 435  ARG B N   1 
ATOM   6555  C  CA  . ARG B 1 389 ? 6.439   -10.640 14.412  1.00 44.92  ? 435  ARG B CA  1 
ATOM   6556  C  C   . ARG B 1 389 ? 5.277   -9.949  15.127  1.00 44.50  ? 435  ARG B C   1 
ATOM   6557  O  O   . ARG B 1 389 ? 5.179   -10.048 16.347  1.00 44.66  ? 435  ARG B O   1 
ATOM   6558  C  CB  . ARG B 1 389 ? 7.341   -9.638  13.660  1.00 44.82  ? 435  ARG B CB  1 
ATOM   6559  C  CG  . ARG B 1 389 ? 7.802   -8.474  14.526  1.00 45.71  ? 435  ARG B CG  1 
ATOM   6560  C  CD  . ARG B 1 389 ? 8.633   -7.461  13.747  1.00 49.37  ? 435  ARG B CD  1 
ATOM   6561  N  NE  . ARG B 1 389 ? 10.032  -7.889  13.610  1.00 52.10  ? 435  ARG B NE  1 
ATOM   6562  C  CZ  . ARG B 1 389 ? 11.080  -7.065  13.521  1.00 53.00  ? 435  ARG B CZ  1 
ATOM   6563  N  NH1 . ARG B 1 389 ? 10.922  -5.738  13.558  1.00 52.50  ? 435  ARG B NH1 1 
ATOM   6564  N  NH2 . ARG B 1 389 ? 12.306  -7.571  13.408  1.00 53.16  ? 435  ARG B NH2 1 
ATOM   6565  N  N   . GLN B 1 390 ? 4.388   -9.300  14.373  1.00 44.11  ? 436  GLN B N   1 
ATOM   6566  C  CA  . GLN B 1 390 ? 3.212   -8.654  14.977  1.00 44.42  ? 436  GLN B CA  1 
ATOM   6567  C  C   . GLN B 1 390 ? 2.360   -9.702  15.709  1.00 44.24  ? 436  GLN B C   1 
ATOM   6568  O  O   . GLN B 1 390 ? 1.991   -9.523  16.877  1.00 44.09  ? 436  GLN B O   1 
ATOM   6569  C  CB  . GLN B 1 390 ? 2.378   -7.871  13.943  1.00 44.28  ? 436  GLN B CB  1 
ATOM   6570  C  CG  . GLN B 1 390 ? 1.359   -6.910  14.554  1.00 45.95  ? 436  GLN B CG  1 
ATOM   6571  C  CD  . GLN B 1 390 ? 0.602   -6.075  13.506  1.00 48.85  ? 436  GLN B CD  1 
ATOM   6572  O  OE1 . GLN B 1 390 ? 1.075   -5.040  13.039  1.00 49.98  ? 436  GLN B OE1 1 
ATOM   6573  N  NE2 . GLN B 1 390 ? -0.597  -6.518  13.159  1.00 51.75  ? 436  GLN B NE2 1 
ATOM   6574  N  N   . LEU B 1 391 ? 2.096   -10.810 15.026  1.00 44.04  ? 437  LEU B N   1 
ATOM   6575  C  CA  . LEU B 1 391 ? 1.164   -11.790 15.521  1.00 43.89  ? 437  LEU B CA  1 
ATOM   6576  C  C   . LEU B 1 391 ? 1.597   -12.282 16.892  1.00 44.05  ? 437  LEU B C   1 
ATOM   6577  O  O   . LEU B 1 391 ? 0.828   -12.195 17.854  1.00 44.14  ? 437  LEU B O   1 
ATOM   6578  C  CB  . LEU B 1 391 ? 1.032   -12.938 14.521  1.00 43.58  ? 437  LEU B CB  1 
ATOM   6579  C  CG  . LEU B 1 391 ? 0.032   -14.030 14.893  1.00 43.33  ? 437  LEU B CG  1 
ATOM   6580  C  CD1 . LEU B 1 391 ? -1.383  -13.500 15.185  1.00 41.89  ? 437  LEU B CD1 1 
ATOM   6581  C  CD2 . LEU B 1 391 ? 0.021   -15.070 13.798  1.00 40.00  ? 437  LEU B CD2 1 
ATOM   6582  N  N   . PHE B 1 392 ? 2.824   -12.783 16.981  1.00 44.08  ? 438  PHE B N   1 
ATOM   6583  C  CA  . PHE B 1 392 ? 3.368   -13.251 18.248  1.00 44.39  ? 438  PHE B CA  1 
ATOM   6584  C  C   . PHE B 1 392 ? 3.318   -12.155 19.310  1.00 44.55  ? 438  PHE B C   1 
ATOM   6585  O  O   . PHE B 1 392 ? 2.783   -12.377 20.409  1.00 44.72  ? 438  PHE B O   1 
ATOM   6586  C  CB  . PHE B 1 392 ? 4.796   -13.766 18.056  1.00 44.45  ? 438  PHE B CB  1 
ATOM   6587  C  CG  . PHE B 1 392 ? 5.340   -14.517 19.234  1.00 44.89  ? 438  PHE B CG  1 
ATOM   6588  C  CD1 . PHE B 1 392 ? 4.491   -15.148 20.131  1.00 46.07  ? 438  PHE B CD1 1 
ATOM   6589  C  CD2 . PHE B 1 392 ? 6.707   -14.611 19.443  1.00 43.97  ? 438  PHE B CD2 1 
ATOM   6590  C  CE1 . PHE B 1 392 ? 4.999   -15.841 21.231  1.00 43.82  ? 438  PHE B CE1 1 
ATOM   6591  C  CE2 . PHE B 1 392 ? 7.211   -15.306 20.531  1.00 42.65  ? 438  PHE B CE2 1 
ATOM   6592  C  CZ  . PHE B 1 392 ? 6.355   -15.921 21.421  1.00 41.63  ? 438  PHE B CZ  1 
ATOM   6593  N  N   . GLU B 1 393 ? 3.843   -10.973 18.979  1.00 44.31  ? 439  GLU B N   1 
ATOM   6594  C  CA  . GLU B 1 393 ? 3.839   -9.871  19.928  1.00 44.71  ? 439  GLU B CA  1 
ATOM   6595  C  C   . GLU B 1 393 ? 2.464   -9.706  20.517  1.00 44.42  ? 439  GLU B C   1 
ATOM   6596  O  O   . GLU B 1 393 ? 2.309   -9.736  21.729  1.00 44.37  ? 439  GLU B O   1 
ATOM   6597  C  CB  . GLU B 1 393 ? 4.294   -8.566  19.288  1.00 44.99  ? 439  GLU B CB  1 
ATOM   6598  C  CG  . GLU B 1 393 ? 5.814   -8.414  19.206  1.00 47.77  ? 439  GLU B CG  1 
ATOM   6599  C  CD  . GLU B 1 393 ? 6.253   -6.941  19.094  1.00 51.46  ? 439  GLU B CD  1 
ATOM   6600  O  OE1 . GLU B 1 393 ? 5.409   -6.035  19.372  1.00 51.96  ? 439  GLU B OE1 1 
ATOM   6601  O  OE2 . GLU B 1 393 ? 7.443   -6.695  18.735  1.00 52.70  ? 439  GLU B OE2 1 
ATOM   6602  N  N   . GLU B 1 394 ? 1.467   -9.596  19.645  1.00 44.49  ? 440  GLU B N   1 
ATOM   6603  C  CA  . GLU B 1 394 ? 0.115   -9.276  20.061  1.00 44.49  ? 440  GLU B CA  1 
ATOM   6604  C  C   . GLU B 1 394 ? -0.465  -10.354 20.964  1.00 44.65  ? 440  GLU B C   1 
ATOM   6605  O  O   . GLU B 1 394 ? -1.102  -10.038 21.983  1.00 44.51  ? 440  GLU B O   1 
ATOM   6606  C  CB  . GLU B 1 394 ? -0.774  -8.990  18.853  1.00 44.36  ? 440  GLU B CB  1 
ATOM   6607  C  CG  . GLU B 1 394 ? -0.229  -7.864  17.996  1.00 44.82  ? 440  GLU B CG  1 
ATOM   6608  C  CD  . GLU B 1 394 ? -1.275  -7.169  17.172  1.00 46.36  ? 440  GLU B CD  1 
ATOM   6609  O  OE1 . GLU B 1 394 ? -2.198  -7.851  16.670  1.00 48.54  ? 440  GLU B OE1 1 
ATOM   6610  O  OE2 . GLU B 1 394 ? -1.163  -5.930  17.018  1.00 46.44  ? 440  GLU B OE2 1 
ATOM   6611  N  N   . LEU B 1 395 ? -0.208  -11.616 20.622  1.00 44.93  ? 441  LEU B N   1 
ATOM   6612  C  CA  . LEU B 1 395 ? -0.714  -12.736 21.425  1.00 45.23  ? 441  LEU B CA  1 
ATOM   6613  C  C   . LEU B 1 395 ? -0.105  -12.739 22.819  1.00 45.94  ? 441  LEU B C   1 
ATOM   6614  O  O   . LEU B 1 395 ? -0.844  -12.674 23.793  1.00 46.69  ? 441  LEU B O   1 
ATOM   6615  C  CB  . LEU B 1 395 ? -0.523  -14.077 20.730  1.00 44.69  ? 441  LEU B CB  1 
ATOM   6616  C  CG  . LEU B 1 395 ? -1.296  -14.274 19.415  1.00 43.82  ? 441  LEU B CG  1 
ATOM   6617  C  CD1 . LEU B 1 395 ? -0.722  -15.438 18.619  1.00 41.86  ? 441  LEU B CD1 1 
ATOM   6618  C  CD2 . LEU B 1 395 ? -2.800  -14.443 19.631  1.00 41.12  ? 441  LEU B CD2 1 
ATOM   6619  N  N   . ARG B 1 396 ? 1.222   -12.767 22.939  1.00 46.44  ? 442  ARG B N   1 
ATOM   6620  C  CA  . ARG B 1 396 ? 1.842   -12.580 24.265  1.00 47.30  ? 442  ARG B CA  1 
ATOM   6621  C  C   . ARG B 1 396 ? 1.176   -11.435 25.019  1.00 47.53  ? 442  ARG B C   1 
ATOM   6622  O  O   . ARG B 1 396 ? 0.573   -11.631 26.078  1.00 47.91  ? 442  ARG B O   1 
ATOM   6623  C  CB  . ARG B 1 396 ? 3.323   -12.239 24.147  1.00 47.45  ? 442  ARG B CB  1 
ATOM   6624  C  CG  . ARG B 1 396 ? 4.059   -13.031 23.107  1.00 48.78  ? 442  ARG B CG  1 
ATOM   6625  C  CD  . ARG B 1 396 ? 5.541   -13.094 23.436  1.00 51.45  ? 442  ARG B CD  1 
ATOM   6626  N  NE  . ARG B 1 396 ? 6.264   -11.886 23.052  1.00 51.41  ? 442  ARG B NE  1 
ATOM   6627  C  CZ  . ARG B 1 396 ? 6.770   -11.018 23.920  1.00 52.71  ? 442  ARG B CZ  1 
ATOM   6628  N  NH1 . ARG B 1 396 ? 6.622   -11.227 25.229  1.00 52.35  ? 442  ARG B NH1 1 
ATOM   6629  N  NH2 . ARG B 1 396 ? 7.420   -9.941  23.472  1.00 52.53  ? 442  ARG B NH2 1 
ATOM   6630  N  N   . ARG B 1 397 ? 1.288   -10.243 24.434  1.00 47.55  ? 443  ARG B N   1 
ATOM   6631  C  CA  . ARG B 1 397 ? 0.775   -8.995  24.994  1.00 47.48  ? 443  ARG B CA  1 
ATOM   6632  C  C   . ARG B 1 397 ? -0.655  -9.148  25.511  1.00 47.19  ? 443  ARG B C   1 
ATOM   6633  O  O   . ARG B 1 397 ? -0.965  -8.666  26.595  1.00 47.02  ? 443  ARG B O   1 
ATOM   6634  C  CB  . ARG B 1 397 ? 0.831   -7.891  23.923  1.00 47.61  ? 443  ARG B CB  1 
ATOM   6635  C  CG  . ARG B 1 397 ? 1.509   -6.610  24.349  1.00 48.70  ? 443  ARG B CG  1 
ATOM   6636  C  CD  . ARG B 1 397 ? 1.374   -5.512  23.282  1.00 51.12  ? 443  ARG B CD  1 
ATOM   6637  N  NE  . ARG B 1 397 ? 1.610   -4.182  23.857  1.00 54.05  ? 443  ARG B NE  1 
ATOM   6638  C  CZ  . ARG B 1 397 ? 2.564   -3.340  23.465  1.00 55.07  ? 443  ARG B CZ  1 
ATOM   6639  N  NH1 . ARG B 1 397 ? 3.376   -3.659  22.463  1.00 55.97  ? 443  ARG B NH1 1 
ATOM   6640  N  NH2 . ARG B 1 397 ? 2.696   -2.166  24.068  1.00 53.84  ? 443  ARG B NH2 1 
ATOM   6641  N  N   . ALA B 1 398 ? -1.515  -9.817  24.734  1.00 46.78  ? 444  ALA B N   1 
ATOM   6642  C  CA  . ALA B 1 398 ? -2.937  -9.921  25.081  1.00 46.47  ? 444  ALA B CA  1 
ATOM   6643  C  C   . ALA B 1 398 ? -3.211  -11.019 26.101  1.00 46.23  ? 444  ALA B C   1 
ATOM   6644  O  O   . ALA B 1 398 ? -3.998  -10.811 27.023  1.00 46.51  ? 444  ALA B O   1 
ATOM   6645  C  CB  . ALA B 1 398 ? -3.809  -10.104 23.832  1.00 46.55  ? 444  ALA B CB  1 
ATOM   6646  N  N   . ALA B 1 399 ? -2.563  -12.173 25.936  1.00 45.47  ? 445  ALA B N   1 
ATOM   6647  C  CA  . ALA B 1 399 ? -2.773  -13.330 26.804  1.00 45.06  ? 445  ALA B CA  1 
ATOM   6648  C  C   . ALA B 1 399 ? -2.348  -13.035 28.242  1.00 45.12  ? 445  ALA B C   1 
ATOM   6649  O  O   . ALA B 1 399 ? -1.234  -12.543 28.485  1.00 45.16  ? 445  ALA B O   1 
ATOM   6650  C  CB  . ALA B 1 399 ? -2.030  -14.528 26.275  1.00 44.84  ? 445  ALA B CB  1 
ATOM   6651  N  N   . PRO B 1 400 ? -3.241  -13.321 29.213  1.00 45.00  ? 446  PRO B N   1 
ATOM   6652  C  CA  . PRO B 1 400 ? -2.951  -12.984 30.609  1.00 44.47  ? 446  PRO B CA  1 
ATOM   6653  C  C   . PRO B 1 400 ? -1.794  -13.834 31.137  1.00 44.04  ? 446  PRO B C   1 
ATOM   6654  O  O   . PRO B 1 400 ? -1.473  -14.865 30.543  1.00 43.63  ? 446  PRO B O   1 
ATOM   6655  C  CB  . PRO B 1 400 ? -4.261  -13.324 31.333  1.00 44.31  ? 446  PRO B CB  1 
ATOM   6656  C  CG  . PRO B 1 400 ? -4.898  -14.362 30.488  1.00 44.71  ? 446  PRO B CG  1 
ATOM   6657  C  CD  . PRO B 1 400 ? -4.553  -13.983 29.072  1.00 45.01  ? 446  PRO B CD  1 
ATOM   6658  N  N   . LEU B 1 401 ? -1.167  -13.395 32.230  1.00 43.88  ? 447  LEU B N   1 
ATOM   6659  C  CA  . LEU B 1 401 ? -0.124  -14.189 32.878  1.00 43.76  ? 447  LEU B CA  1 
ATOM   6660  C  C   . LEU B 1 401 ? -0.673  -15.585 33.051  1.00 43.67  ? 447  LEU B C   1 
ATOM   6661  O  O   . LEU B 1 401 ? -1.864  -15.813 32.843  1.00 44.10  ? 447  LEU B O   1 
ATOM   6662  C  CB  . LEU B 1 401 ? 0.252   -13.622 34.245  1.00 43.82  ? 447  LEU B CB  1 
ATOM   6663  C  CG  . LEU B 1 401 ? 0.517   -12.122 34.374  1.00 44.61  ? 447  LEU B CG  1 
ATOM   6664  C  CD1 . LEU B 1 401 ? 0.894   -11.822 35.811  1.00 45.70  ? 447  LEU B CD1 1 
ATOM   6665  C  CD2 . LEU B 1 401 ? 1.596   -11.622 33.404  1.00 44.60  ? 447  LEU B CD2 1 
ATOM   6666  N  N   . SER B 1 402 ? 0.184   -16.528 33.415  1.00 43.37  ? 448  SER B N   1 
ATOM   6667  C  CA  . SER B 1 402 ? -0.263  -17.894 33.604  1.00 43.00  ? 448  SER B CA  1 
ATOM   6668  C  C   . SER B 1 402 ? 0.653   -18.579 34.541  1.00 42.82  ? 448  SER B C   1 
ATOM   6669  O  O   . SER B 1 402 ? 1.844   -18.276 34.600  1.00 43.25  ? 448  SER B O   1 
ATOM   6670  C  CB  . SER B 1 402 ? -0.263  -18.683 32.306  1.00 43.14  ? 448  SER B CB  1 
ATOM   6671  O  OG  . SER B 1 402 ? -0.635  -20.029 32.559  1.00 44.24  ? 448  SER B OG  1 
ATOM   6672  N  N   . ARG B 1 403 ? 0.083   -19.543 35.243  1.00 42.47  ? 449  ARG B N   1 
ATOM   6673  C  CA  . ARG B 1 403 ? 0.760   -20.261 36.288  1.00 41.96  ? 449  ARG B CA  1 
ATOM   6674  C  C   . ARG B 1 403 ? 0.834   -21.743 35.932  1.00 41.57  ? 449  ARG B C   1 
ATOM   6675  O  O   . ARG B 1 403 ? 1.497   -22.517 36.620  1.00 41.59  ? 449  ARG B O   1 
ATOM   6676  C  CB  . ARG B 1 403 ? -0.032  -20.091 37.574  1.00 42.23  ? 449  ARG B CB  1 
ATOM   6677  C  CG  . ARG B 1 403 ? 0.809   -20.071 38.826  1.00 43.49  ? 449  ARG B CG  1 
ATOM   6678  C  CD  . ARG B 1 403 ? 0.949   -18.650 39.350  1.00 45.32  ? 449  ARG B CD  1 
ATOM   6679  N  NE  . ARG B 1 403 ? 1.881   -18.593 40.471  1.00 46.70  ? 449  ARG B NE  1 
ATOM   6680  C  CZ  . ARG B 1 403 ? 2.922   -17.763 40.546  1.00 47.51  ? 449  ARG B CZ  1 
ATOM   6681  N  NH1 . ARG B 1 403 ? 3.162   -16.889 39.569  1.00 47.62  ? 449  ARG B NH1 1 
ATOM   6682  N  NH2 . ARG B 1 403 ? 3.718   -17.796 41.610  1.00 47.12  ? 449  ARG B NH2 1 
ATOM   6683  N  N   . ASP B 1 404 ? 0.134   -22.139 34.871  1.00 40.96  ? 450  ASP B N   1 
ATOM   6684  C  CA  . ASP B 1 404 ? 0.138   -23.528 34.434  1.00 40.82  ? 450  ASP B CA  1 
ATOM   6685  C  C   . ASP B 1 404 ? 1.453   -23.833 33.728  1.00 40.35  ? 450  ASP B C   1 
ATOM   6686  O  O   . ASP B 1 404 ? 1.703   -23.325 32.634  1.00 40.98  ? 450  ASP B O   1 
ATOM   6687  C  CB  . ASP B 1 404 ? -1.054  -23.805 33.500  1.00 41.00  ? 450  ASP B CB  1 
ATOM   6688  C  CG  . ASP B 1 404 ? -0.944  -25.151 32.748  1.00 41.89  ? 450  ASP B CG  1 
ATOM   6689  O  OD1 . ASP B 1 404 ? -0.256  -26.093 33.222  1.00 42.73  ? 450  ASP B OD1 1 
ATOM   6690  O  OD2 . ASP B 1 404 ? -1.576  -25.257 31.667  1.00 44.05  ? 450  ASP B OD2 1 
ATOM   6691  N  N   . PRO B 1 405 ? 2.278   -24.692 34.328  1.00 39.64  ? 451  PRO B N   1 
ATOM   6692  C  CA  . PRO B 1 405 ? 3.591   -25.022 33.784  1.00 39.51  ? 451  PRO B CA  1 
ATOM   6693  C  C   . PRO B 1 405 ? 3.568   -25.389 32.306  1.00 39.59  ? 451  PRO B C   1 
ATOM   6694  O  O   . PRO B 1 405 ? 4.488   -25.036 31.585  1.00 39.88  ? 451  PRO B O   1 
ATOM   6695  C  CB  . PRO B 1 405 ? 4.012   -26.219 34.623  1.00 39.53  ? 451  PRO B CB  1 
ATOM   6696  C  CG  . PRO B 1 405 ? 3.343   -25.974 35.944  1.00 39.19  ? 451  PRO B CG  1 
ATOM   6697  C  CD  . PRO B 1 405 ? 2.001   -25.431 35.570  1.00 39.53  ? 451  PRO B CD  1 
ATOM   6698  N  N   . THR B 1 406 ? 2.517   -26.058 31.847  1.00 39.72  ? 452  THR B N   1 
ATOM   6699  C  CA  . THR B 1 406 ? 2.403   -26.397 30.435  1.00 39.83  ? 452  THR B CA  1 
ATOM   6700  C  C   . THR B 1 406 ? 2.408   -25.146 29.544  1.00 40.13  ? 452  THR B C   1 
ATOM   6701  O  O   . THR B 1 406 ? 3.171   -25.087 28.572  1.00 40.20  ? 452  THR B O   1 
ATOM   6702  C  CB  . THR B 1 406 ? 1.155   -27.236 30.161  1.00 39.81  ? 452  THR B CB  1 
ATOM   6703  O  OG1 . THR B 1 406 ? 1.055   -28.269 31.142  1.00 40.74  ? 452  THR B OG1 1 
ATOM   6704  C  CG2 . THR B 1 406 ? 1.229   -27.857 28.791  1.00 39.14  ? 452  THR B CG2 1 
ATOM   6705  N  N   . GLU B 1 407 ? 1.573   -24.154 29.871  1.00 40.14  ? 453  GLU B N   1 
ATOM   6706  C  CA  . GLU B 1 407 ? 1.541   -22.906 29.098  1.00 40.44  ? 453  GLU B CA  1 
ATOM   6707  C  C   . GLU B 1 407 ? 2.905   -22.263 29.113  1.00 39.75  ? 453  GLU B C   1 
ATOM   6708  O  O   . GLU B 1 407 ? 3.440   -21.878 28.065  1.00 40.38  ? 453  GLU B O   1 
ATOM   6709  C  CB  . GLU B 1 407 ? 0.508   -21.909 29.637  1.00 40.76  ? 453  GLU B CB  1 
ATOM   6710  C  CG  . GLU B 1 407 ? -0.863  -22.035 28.998  1.00 43.71  ? 453  GLU B CG  1 
ATOM   6711  C  CD  . GLU B 1 407 ? -1.456  -20.695 28.623  1.00 47.62  ? 453  GLU B CD  1 
ATOM   6712  O  OE1 . GLU B 1 407 ? -0.888  -20.004 27.731  1.00 47.59  ? 453  GLU B OE1 1 
ATOM   6713  O  OE2 . GLU B 1 407 ? -2.506  -20.342 29.219  1.00 50.70  ? 453  GLU B OE2 1 
ATOM   6714  N  N   . VAL B 1 408 ? 3.457   -22.172 30.317  1.00 38.42  ? 454  VAL B N   1 
ATOM   6715  C  CA  . VAL B 1 408 ? 4.758   -21.563 30.558  1.00 37.08  ? 454  VAL B CA  1 
ATOM   6716  C  C   . VAL B 1 408 ? 5.855   -22.187 29.702  1.00 36.36  ? 454  VAL B C   1 
ATOM   6717  O  O   . VAL B 1 408 ? 6.699   -21.477 29.182  1.00 35.96  ? 454  VAL B O   1 
ATOM   6718  C  CB  . VAL B 1 408 ? 5.142   -21.633 32.048  1.00 36.92  ? 454  VAL B CB  1 
ATOM   6719  C  CG1 . VAL B 1 408 ? 6.342   -20.741 32.334  1.00 36.51  ? 454  VAL B CG1 1 
ATOM   6720  C  CG2 . VAL B 1 408 ? 3.965   -21.202 32.911  1.00 36.77  ? 454  VAL B CG2 1 
ATOM   6721  N  N   . THR B 1 409 ? 5.824   -23.506 29.534  1.00 35.59  ? 455  THR B N   1 
ATOM   6722  C  CA  . THR B 1 409 ? 6.810   -24.188 28.702  1.00 34.95  ? 455  THR B CA  1 
ATOM   6723  C  C   . THR B 1 409 ? 6.548   -23.906 27.227  1.00 34.59  ? 455  THR B C   1 
ATOM   6724  O  O   . THR B 1 409 ? 7.472   -23.702 26.450  1.00 34.60  ? 455  THR B O   1 
ATOM   6725  C  CB  . THR B 1 409 ? 6.805   -25.688 28.955  1.00 34.83  ? 455  THR B CB  1 
ATOM   6726  O  OG1 . THR B 1 409 ? 6.840   -25.909 30.354  1.00 35.17  ? 455  THR B OG1 1 
ATOM   6727  C  CG2 . THR B 1 409 ? 8.026   -26.316 28.394  1.00 35.01  ? 455  THR B CG2 1 
ATOM   6728  N  N   . ALA B 1 410 ? 5.277   -23.894 26.859  1.00 34.43  ? 456  ALA B N   1 
ATOM   6729  C  CA  . ALA B 1 410 ? 4.865   -23.655 25.505  1.00 34.33  ? 456  ALA B CA  1 
ATOM   6730  C  C   . ALA B 1 410 ? 5.432   -22.325 24.986  1.00 34.41  ? 456  ALA B C   1 
ATOM   6731  O  O   . ALA B 1 410 ? 6.182   -22.282 24.005  1.00 34.47  ? 456  ALA B O   1 
ATOM   6732  C  CB  . ALA B 1 410 ? 3.363   -23.653 25.449  1.00 34.67  ? 456  ALA B CB  1 
ATOM   6733  N  N   . ILE B 1 411 ? 5.093   -21.238 25.657  1.00 34.19  ? 457  ILE B N   1 
ATOM   6734  C  CA  . ILE B 1 411 ? 5.519   -19.932 25.179  1.00 34.31  ? 457  ILE B CA  1 
ATOM   6735  C  C   . ILE B 1 411 ? 7.036   -19.863 25.124  1.00 34.12  ? 457  ILE B C   1 
ATOM   6736  O  O   . ILE B 1 411 ? 7.603   -19.276 24.195  1.00 34.32  ? 457  ILE B O   1 
ATOM   6737  C  CB  . ILE B 1 411 ? 4.905   -18.778 26.004  1.00 34.18  ? 457  ILE B CB  1 
ATOM   6738  C  CG1 . ILE B 1 411 ? 5.082   -17.452 25.271  1.00 35.29  ? 457  ILE B CG1 1 
ATOM   6739  C  CG2 . ILE B 1 411 ? 5.468   -18.747 27.405  1.00 33.27  ? 457  ILE B CG2 1 
ATOM   6740  C  CD1 . ILE B 1 411 ? 4.611   -16.234 26.072  1.00 35.20  ? 457  ILE B CD1 1 
ATOM   6741  N  N   . GLY B 1 412 ? 7.678   -20.495 26.102  1.00 33.45  ? 458  GLY B N   1 
ATOM   6742  C  CA  . GLY B 1 412 ? 9.121   -20.573 26.133  1.00 33.32  ? 458  GLY B CA  1 
ATOM   6743  C  C   . GLY B 1 412 ? 9.636   -21.283 24.909  1.00 33.31  ? 458  GLY B C   1 
ATOM   6744  O  O   . GLY B 1 412 ? 10.540  -20.813 24.239  1.00 33.30  ? 458  GLY B O   1 
ATOM   6745  N  N   . ALA B 1 413 ? 9.026   -22.412 24.602  1.00 33.03  ? 459  ALA B N   1 
ATOM   6746  C  CA  . ALA B 1 413 ? 9.424   -23.191 23.455  1.00 33.28  ? 459  ALA B CA  1 
ATOM   6747  C  C   . ALA B 1 413 ? 9.248   -22.397 22.169  1.00 33.35  ? 459  ALA B C   1 
ATOM   6748  O  O   . ALA B 1 413 ? 10.117  -22.383 21.321  1.00 33.26  ? 459  ALA B O   1 
ATOM   6749  C  CB  . ALA B 1 413 ? 8.633   -24.463 23.396  1.00 33.02  ? 459  ALA B CB  1 
ATOM   6750  N  N   . VAL B 1 414 ? 8.117   -21.729 22.033  1.00 33.78  ? 460  VAL B N   1 
ATOM   6751  C  CA  . VAL B 1 414 ? 7.839   -20.962 20.841  1.00 34.12  ? 460  VAL B CA  1 
ATOM   6752  C  C   . VAL B 1 414 ? 8.890   -19.873 20.720  1.00 34.55  ? 460  VAL B C   1 
ATOM   6753  O  O   . VAL B 1 414 ? 9.398   -19.620 19.628  1.00 34.79  ? 460  VAL B O   1 
ATOM   6754  C  CB  . VAL B 1 414 ? 6.398   -20.372 20.884  1.00 34.04  ? 460  VAL B CB  1 
ATOM   6755  C  CG1 . VAL B 1 414 ? 6.177   -19.358 19.793  1.00 34.27  ? 460  VAL B CG1 1 
ATOM   6756  C  CG2 . VAL B 1 414 ? 5.379   -21.483 20.756  1.00 33.65  ? 460  VAL B CG2 1 
ATOM   6757  N  N   . GLU B 1 415 ? 9.239   -19.248 21.844  1.00 34.82  ? 461  GLU B N   1 
ATOM   6758  C  CA  . GLU B 1 415 ? 10.195  -18.158 21.824  1.00 35.01  ? 461  GLU B CA  1 
ATOM   6759  C  C   . GLU B 1 415 ? 11.560  -18.661 21.382  1.00 34.79  ? 461  GLU B C   1 
ATOM   6760  O  O   . GLU B 1 415 ? 12.223  -18.021 20.565  1.00 34.79  ? 461  GLU B O   1 
ATOM   6761  C  CB  . GLU B 1 415 ? 10.266  -17.485 23.185  1.00 35.30  ? 461  GLU B CB  1 
ATOM   6762  C  CG  . GLU B 1 415 ? 11.386  -16.452 23.333  1.00 37.63  ? 461  GLU B CG  1 
ATOM   6763  C  CD  . GLU B 1 415 ? 11.101  -15.164 22.595  1.00 41.51  ? 461  GLU B CD  1 
ATOM   6764  O  OE1 . GLU B 1 415 ? 10.135  -14.470 22.967  1.00 41.82  ? 461  GLU B OE1 1 
ATOM   6765  O  OE2 . GLU B 1 415 ? 11.846  -14.846 21.641  1.00 43.37  ? 461  GLU B OE2 1 
ATOM   6766  N  N   . ALA B 1 416 ? 11.954  -19.817 21.915  1.00 34.47  ? 462  ALA B N   1 
ATOM   6767  C  CA  . ALA B 1 416 ? 13.219  -20.446 21.574  1.00 34.11  ? 462  ALA B CA  1 
ATOM   6768  C  C   . ALA B 1 416 ? 13.244  -20.777 20.091  1.00 34.27  ? 462  ALA B C   1 
ATOM   6769  O  O   . ALA B 1 416 ? 14.224  -20.500 19.390  1.00 34.30  ? 462  ALA B O   1 
ATOM   6770  C  CB  . ALA B 1 416 ? 13.403  -21.679 22.379  1.00 34.07  ? 462  ALA B CB  1 
ATOM   6771  N  N   . ALA B 1 417 ? 12.138  -21.329 19.620  1.00 34.11  ? 463  ALA B N   1 
ATOM   6772  C  CA  . ALA B 1 417 ? 11.977  -21.692 18.233  1.00 34.31  ? 463  ALA B CA  1 
ATOM   6773  C  C   . ALA B 1 417 ? 12.225  -20.500 17.312  1.00 34.86  ? 463  ALA B C   1 
ATOM   6774  O  O   . ALA B 1 417 ? 13.020  -20.579 16.353  1.00 35.17  ? 463  ALA B O   1 
ATOM   6775  C  CB  . ALA B 1 417 ? 10.610  -22.260 18.011  1.00 33.81  ? 463  ALA B CB  1 
ATOM   6776  N  N   . PHE B 1 418 ? 11.576  -19.381 17.617  1.00 34.99  ? 464  PHE B N   1 
ATOM   6777  C  CA  . PHE B 1 418 ? 11.790  -18.182 16.825  1.00 35.04  ? 464  PHE B CA  1 
ATOM   6778  C  C   . PHE B 1 418 ? 13.241  -17.758 16.789  1.00 35.44  ? 464  PHE B C   1 
ATOM   6779  O  O   . PHE B 1 418 ? 13.722  -17.362 15.744  1.00 35.98  ? 464  PHE B O   1 
ATOM   6780  C  CB  . PHE B 1 418 ? 10.927  -17.038 17.313  1.00 34.65  ? 464  PHE B CB  1 
ATOM   6781  C  CG  . PHE B 1 418 ? 9.551   -17.045 16.738  1.00 34.91  ? 464  PHE B CG  1 
ATOM   6782  C  CD1 . PHE B 1 418 ? 8.446   -17.227 17.559  1.00 35.74  ? 464  PHE B CD1 1 
ATOM   6783  C  CD2 . PHE B 1 418 ? 9.351   -16.879 15.374  1.00 32.59  ? 464  PHE B CD2 1 
ATOM   6784  C  CE1 . PHE B 1 418 ? 7.165   -17.224 17.037  1.00 36.07  ? 464  PHE B CE1 1 
ATOM   6785  C  CE2 . PHE B 1 418 ? 8.084   -16.872 14.859  1.00 33.01  ? 464  PHE B CE2 1 
ATOM   6786  C  CZ  . PHE B 1 418 ? 6.981   -17.054 15.700  1.00 34.14  ? 464  PHE B CZ  1 
ATOM   6787  N  N   . LYS B 1 419 ? 13.938  -17.850 17.914  1.00 35.67  ? 465  LYS B N   1 
ATOM   6788  C  CA  . LYS B 1 419 ? 15.283  -17.320 17.982  1.00 36.50  ? 465  LYS B CA  1 
ATOM   6789  C  C   . LYS B 1 419 ? 16.301  -18.057 17.098  1.00 37.39  ? 465  LYS B C   1 
ATOM   6790  O  O   . LYS B 1 419 ? 17.309  -17.479 16.708  1.00 37.52  ? 465  LYS B O   1 
ATOM   6791  C  CB  . LYS B 1 419 ? 15.757  -17.262 19.431  1.00 36.34  ? 465  LYS B CB  1 
ATOM   6792  C  CG  . LYS B 1 419 ? 17.167  -16.711 19.636  1.00 35.50  ? 465  LYS B CG  1 
ATOM   6793  C  CD  . LYS B 1 419 ? 17.253  -15.213 19.389  1.00 35.16  ? 465  LYS B CD  1 
ATOM   6794  C  CE  . LYS B 1 419 ? 18.636  -14.702 19.803  1.00 35.70  ? 465  LYS B CE  1 
ATOM   6795  N  NZ  . LYS B 1 419 ? 18.853  -13.263 19.539  1.00 36.23  ? 465  LYS B NZ  1 
ATOM   6796  N  N   . CYS B 1 420 ? 16.034  -19.324 16.774  1.00 38.33  ? 466  CYS B N   1 
ATOM   6797  C  CA  . CYS B 1 420 ? 16.984  -20.133 15.999  1.00 38.85  ? 466  CYS B CA  1 
ATOM   6798  C  C   . CYS B 1 420 ? 16.365  -20.643 14.711  1.00 39.44  ? 466  CYS B C   1 
ATOM   6799  O  O   . CYS B 1 420 ? 16.925  -21.525 14.065  1.00 39.76  ? 466  CYS B O   1 
ATOM   6800  C  CB  . CYS B 1 420 ? 17.488  -21.311 16.832  1.00 38.26  ? 466  CYS B CB  1 
ATOM   6801  S  SG  . CYS B 1 420 ? 16.138  -22.428 17.333  1.00 40.05  ? 466  CYS B SG  1 
ATOM   6802  N  N   . CYS B 1 421 ? 15.222  -20.086 14.332  1.00 40.11  ? 467  CYS B N   1 
ATOM   6803  C  CA  . CYS B 1 421 ? 14.522  -20.563 13.161  1.00 41.76  ? 467  CYS B CA  1 
ATOM   6804  C  C   . CYS B 1 421 ? 14.460  -22.072 13.227  1.00 40.94  ? 467  CYS B C   1 
ATOM   6805  O  O   . CYS B 1 421 ? 14.872  -22.753 12.292  1.00 41.22  ? 467  CYS B O   1 
ATOM   6806  C  CB  . CYS B 1 421 ? 15.268  -20.183 11.878  1.00 42.35  ? 467  CYS B CB  1 
ATOM   6807  S  SG  . CYS B 1 421 ? 15.191  -18.462 11.425  1.00 49.05  ? 467  CYS B SG  1 
ATOM   6808  N  N   . ALA B 1 422 ? 13.990  -22.595 14.353  1.00 40.42  ? 468  ALA B N   1 
ATOM   6809  C  CA  . ALA B 1 422 ? 13.862  -24.031 14.527  1.00 39.53  ? 468  ALA B CA  1 
ATOM   6810  C  C   . ALA B 1 422 ? 12.985  -24.563 13.388  1.00 39.29  ? 468  ALA B C   1 
ATOM   6811  O  O   . ALA B 1 422 ? 12.018  -23.897 12.957  1.00 38.98  ? 468  ALA B O   1 
ATOM   6812  C  CB  . ALA B 1 422 ? 13.264  -24.348 15.888  1.00 39.09  ? 468  ALA B CB  1 
ATOM   6813  N  N   . ALA B 1 423 ? 13.344  -25.734 12.865  1.00 38.78  ? 469  ALA B N   1 
ATOM   6814  C  CA  . ALA B 1 423 ? 12.514  -26.353 11.835  1.00 38.30  ? 469  ALA B CA  1 
ATOM   6815  C  C   . ALA B 1 423 ? 11.235  -26.828 12.473  1.00 37.74  ? 469  ALA B C   1 
ATOM   6816  O  O   . ALA B 1 423 ? 10.196  -26.805 11.833  1.00 37.93  ? 469  ALA B O   1 
ATOM   6817  C  CB  . ALA B 1 423 ? 13.229  -27.518 11.179  1.00 38.40  ? 469  ALA B CB  1 
ATOM   6818  N  N   . ALA B 1 424 ? 11.318  -27.252 13.738  1.00 37.07  ? 470  ALA B N   1 
ATOM   6819  C  CA  . ALA B 1 424 ? 10.169  -27.819 14.445  1.00 36.30  ? 470  ALA B CA  1 
ATOM   6820  C  C   . ALA B 1 424 ? 10.273  -27.778 15.965  1.00 35.85  ? 470  ALA B C   1 
ATOM   6821  O  O   . ALA B 1 424 ? 11.369  -27.698 16.544  1.00 36.06  ? 470  ALA B O   1 
ATOM   6822  C  CB  . ALA B 1 424 ? 9.956   -29.247 14.002  1.00 36.23  ? 470  ALA B CB  1 
ATOM   6823  N  N   . ILE B 1 425 ? 9.105   -27.840 16.590  1.00 35.19  ? 471  ILE B N   1 
ATOM   6824  C  CA  . ILE B 1 425 ? 8.963   -28.098 18.018  1.00 34.65  ? 471  ILE B CA  1 
ATOM   6825  C  C   . ILE B 1 425 ? 8.332   -29.497 18.122  1.00 34.93  ? 471  ILE B C   1 
ATOM   6826  O  O   . ILE B 1 425 ? 7.241   -29.709 17.591  1.00 35.38  ? 471  ILE B O   1 
ATOM   6827  C  CB  . ILE B 1 425 ? 8.001   -27.087 18.674  1.00 34.30  ? 471  ILE B CB  1 
ATOM   6828  C  CG1 . ILE B 1 425 ? 8.453   -25.666 18.409  1.00 33.03  ? 471  ILE B CG1 1 
ATOM   6829  C  CG2 . ILE B 1 425 ? 7.837   -27.347 20.183  1.00 33.43  ? 471  ILE B CG2 1 
ATOM   6830  C  CD1 . ILE B 1 425 ? 7.359   -24.694 18.616  1.00 30.60  ? 471  ILE B CD1 1 
ATOM   6831  N  N   . ILE B 1 426 ? 9.005   -30.431 18.790  1.00 34.40  ? 472  ILE B N   1 
ATOM   6832  C  CA  . ILE B 1 426 ? 8.514   -31.795 18.920  1.00 34.26  ? 472  ILE B CA  1 
ATOM   6833  C  C   . ILE B 1 426 ? 7.967   -31.962 20.319  1.00 34.70  ? 472  ILE B C   1 
ATOM   6834  O  O   . ILE B 1 426 ? 8.709   -31.756 21.284  1.00 34.71  ? 472  ILE B O   1 
ATOM   6835  C  CB  . ILE B 1 426 ? 9.644   -32.816 18.724  1.00 34.03  ? 472  ILE B CB  1 
ATOM   6836  C  CG1 . ILE B 1 426 ? 10.126  -32.850 17.277  1.00 33.23  ? 472  ILE B CG1 1 
ATOM   6837  C  CG2 . ILE B 1 426 ? 9.176   -34.191 19.131  1.00 33.47  ? 472  ILE B CG2 1 
ATOM   6838  C  CD1 . ILE B 1 426 ? 11.391  -33.641 17.094  1.00 32.09  ? 472  ILE B CD1 1 
ATOM   6839  N  N   . VAL B 1 427 ? 6.686   -32.329 20.437  1.00 34.90  ? 473  VAL B N   1 
ATOM   6840  C  CA  . VAL B 1 427 ? 6.055   -32.475 21.764  1.00 35.43  ? 473  VAL B CA  1 
ATOM   6841  C  C   . VAL B 1 427 ? 5.502   -33.854 22.007  1.00 35.70  ? 473  VAL B C   1 
ATOM   6842  O  O   . VAL B 1 427 ? 4.755   -34.365 21.182  1.00 36.64  ? 473  VAL B O   1 
ATOM   6843  C  CB  . VAL B 1 427 ? 4.772   -31.657 21.925  1.00 35.36  ? 473  VAL B CB  1 
ATOM   6844  C  CG1 . VAL B 1 427 ? 4.782   -30.907 23.256  1.00 34.83  ? 473  VAL B CG1 1 
ATOM   6845  C  CG2 . VAL B 1 427 ? 4.554   -30.781 20.780  1.00 35.64  ? 473  VAL B CG2 1 
ATOM   6846  N  N   . LEU B 1 428 ? 5.790   -34.421 23.167  1.00 35.58  ? 474  LEU B N   1 
ATOM   6847  C  CA  . LEU B 1 428 ? 5.052   -35.592 23.634  1.00 35.58  ? 474  LEU B CA  1 
ATOM   6848  C  C   . LEU B 1 428 ? 3.725   -35.099 24.214  1.00 35.78  ? 474  LEU B C   1 
ATOM   6849  O  O   . LEU B 1 428 ? 3.703   -34.143 24.982  1.00 35.66  ? 474  LEU B O   1 
ATOM   6850  C  CB  . LEU B 1 428 ? 5.861   -36.364 24.683  1.00 34.89  ? 474  LEU B CB  1 
ATOM   6851  C  CG  . LEU B 1 428 ? 6.950   -37.319 24.177  1.00 34.72  ? 474  LEU B CG  1 
ATOM   6852  C  CD1 . LEU B 1 428 ? 7.756   -36.766 23.014  1.00 35.47  ? 474  LEU B CD1 1 
ATOM   6853  C  CD2 . LEU B 1 428 ? 7.877   -37.695 25.293  1.00 34.49  ? 474  LEU B CD2 1 
ATOM   6854  N  N   . THR B 1 429 ? 2.619   -35.729 23.836  1.00 36.01  ? 475  THR B N   1 
ATOM   6855  C  CA  . THR B 1 429 ? 1.330   -35.305 24.363  1.00 36.26  ? 475  THR B CA  1 
ATOM   6856  C  C   . THR B 1 429 ? 0.363   -36.463 24.411  1.00 36.58  ? 475  THR B C   1 
ATOM   6857  O  O   . THR B 1 429 ? 0.350   -37.300 23.515  1.00 36.28  ? 475  THR B O   1 
ATOM   6858  C  CB  . THR B 1 429 ? 0.730   -34.114 23.565  1.00 36.43  ? 475  THR B CB  1 
ATOM   6859  O  OG1 . THR B 1 429 ? -0.574  -33.813 24.053  1.00 36.61  ? 475  THR B OG1 1 
ATOM   6860  C  CG2 . THR B 1 429 ? 0.626   -34.407 22.067  1.00 36.08  ? 475  THR B CG2 1 
ATOM   6861  N  N   . THR B 1 430 ? -0.441  -36.502 25.466  1.00 37.25  ? 476  THR B N   1 
ATOM   6862  C  CA  . THR B 1 430 ? -1.368  -37.600 25.701  1.00 38.18  ? 476  THR B CA  1 
ATOM   6863  C  C   . THR B 1 430 ? -2.790  -37.289 25.243  1.00 38.88  ? 476  THR B C   1 
ATOM   6864  O  O   . THR B 1 430 ? -3.492  -38.171 24.718  1.00 39.79  ? 476  THR B O   1 
ATOM   6865  C  CB  . THR B 1 430 ? -1.339  -37.976 27.178  1.00 38.38  ? 476  THR B CB  1 
ATOM   6866  O  OG1 . THR B 1 430 ? -0.054  -38.532 27.466  1.00 38.75  ? 476  THR B OG1 1 
ATOM   6867  C  CG2 . THR B 1 430 ? -2.436  -38.973 27.546  1.00 37.27  ? 476  THR B CG2 1 
ATOM   6868  N  N   . THR B 1 431 ? -3.205  -36.041 25.436  1.00 38.87  ? 477  THR B N   1 
ATOM   6869  C  CA  . THR B 1 431 ? -4.553  -35.619 25.095  1.00 39.14  ? 477  THR B CA  1 
ATOM   6870  C  C   . THR B 1 431 ? -4.531  -34.527 24.048  1.00 39.79  ? 477  THR B C   1 
ATOM   6871  O  O   . THR B 1 431 ? -5.595  -34.045 23.629  1.00 40.23  ? 477  THR B O   1 
ATOM   6872  C  CB  . THR B 1 431 ? -5.281  -35.030 26.306  1.00 39.28  ? 477  THR B CB  1 
ATOM   6873  O  OG1 . THR B 1 431 ? -4.678  -33.766 26.660  1.00 38.56  ? 477  THR B OG1 1 
ATOM   6874  C  CG2 . THR B 1 431 ? -5.257  -36.010 27.489  1.00 38.66  ? 477  THR B CG2 1 
ATOM   6875  N  N   . GLY B 1 432 ? -3.325  -34.108 23.656  1.00 39.66  ? 478  GLY B N   1 
ATOM   6876  C  CA  . GLY B 1 432 ? -3.152  -33.063 22.661  1.00 39.13  ? 478  GLY B CA  1 
ATOM   6877  C  C   . GLY B 1 432 ? -2.965  -31.712 23.307  1.00 39.58  ? 478  GLY B C   1 
ATOM   6878  O  O   . GLY B 1 432 ? -2.471  -30.784 22.668  1.00 39.85  ? 478  GLY B O   1 
ATOM   6879  N  N   . ARG B 1 433 ? -3.349  -31.578 24.574  1.00 39.49  ? 479  ARG B N   1 
ATOM   6880  C  CA  . ARG B 1 433 ? -3.333  -30.255 25.196  1.00 39.19  ? 479  ARG B CA  1 
ATOM   6881  C  C   . ARG B 1 433 ? -1.983  -29.530 25.099  1.00 38.76  ? 479  ARG B C   1 
ATOM   6882  O  O   . ARG B 1 433 ? -1.951  -28.357 24.798  1.00 38.85  ? 479  ARG B O   1 
ATOM   6883  C  CB  . ARG B 1 433 ? -3.866  -30.251 26.632  1.00 39.30  ? 479  ARG B CB  1 
ATOM   6884  C  CG  . ARG B 1 433 ? -4.006  -28.830 27.136  1.00 40.29  ? 479  ARG B CG  1 
ATOM   6885  C  CD  . ARG B 1 433 ? -4.793  -28.612 28.430  1.00 44.56  ? 479  ARG B CD  1 
ATOM   6886  N  NE  . ARG B 1 433 ? -5.021  -27.172 28.688  1.00 49.48  ? 479  ARG B NE  1 
ATOM   6887  C  CZ  . ARG B 1 433 ? -5.434  -26.250 27.787  1.00 51.52  ? 479  ARG B CZ  1 
ATOM   6888  N  NH1 . ARG B 1 433 ? -5.730  -26.573 26.515  1.00 52.83  ? 479  ARG B NH1 1 
ATOM   6889  N  NH2 . ARG B 1 433 ? -5.572  -24.976 28.165  1.00 49.27  ? 479  ARG B NH2 1 
ATOM   6890  N  N   . SER B 1 434 ? -0.866  -30.196 25.320  1.00 38.49  ? 480  SER B N   1 
ATOM   6891  C  CA  . SER B 1 434 ? 0.379   -29.454 25.178  1.00 38.39  ? 480  SER B CA  1 
ATOM   6892  C  C   . SER B 1 434 ? 0.770   -29.149 23.749  1.00 38.27  ? 480  SER B C   1 
ATOM   6893  O  O   . SER B 1 434 ? 1.475   -28.166 23.511  1.00 38.59  ? 480  SER B O   1 
ATOM   6894  C  CB  . SER B 1 434 ? 1.581   -30.001 25.986  1.00 38.51  ? 480  SER B CB  1 
ATOM   6895  O  OG  . SER B 1 434 ? 1.481   -31.354 26.348  1.00 38.83  ? 480  SER B OG  1 
ATOM   6896  N  N   . ALA B 1 435 ? 0.331   -29.957 22.796  1.00 38.04  ? 481  ALA B N   1 
ATOM   6897  C  CA  . ALA B 1 435 ? 0.491   -29.553 21.412  1.00 38.29  ? 481  ALA B CA  1 
ATOM   6898  C  C   . ALA B 1 435 ? -0.347  -28.289 21.151  1.00 39.06  ? 481  ALA B C   1 
ATOM   6899  O  O   . ALA B 1 435 ? 0.119   -27.321 20.517  1.00 39.45  ? 481  ALA B O   1 
ATOM   6900  C  CB  . ALA B 1 435 ? 0.088   -30.651 20.495  1.00 37.92  ? 481  ALA B CB  1 
ATOM   6901  N  N   . GLN B 1 436 ? -1.579  -28.291 21.665  1.00 39.28  ? 482  GLN B N   1 
ATOM   6902  C  CA  . GLN B 1 436 ? -2.462  -27.166 21.482  1.00 39.36  ? 482  GLN B CA  1 
ATOM   6903  C  C   . GLN B 1 436 ? -1.862  -25.894 22.019  1.00 39.14  ? 482  GLN B C   1 
ATOM   6904  O  O   . GLN B 1 436 ? -1.880  -24.869 21.323  1.00 39.82  ? 482  GLN B O   1 
ATOM   6905  C  CB  . GLN B 1 436 ? -3.787  -27.415 22.167  1.00 39.73  ? 482  GLN B CB  1 
ATOM   6906  C  CG  . GLN B 1 436 ? -4.729  -26.231 22.078  1.00 41.53  ? 482  GLN B CG  1 
ATOM   6907  C  CD  . GLN B 1 436 ? -6.144  -26.627 22.349  1.00 44.23  ? 482  GLN B CD  1 
ATOM   6908  O  OE1 . GLN B 1 436 ? -6.417  -27.775 22.722  1.00 46.71  ? 482  GLN B OE1 1 
ATOM   6909  N  NE2 . GLN B 1 436 ? -7.067  -25.684 22.170  1.00 43.78  ? 482  GLN B NE2 1 
ATOM   6910  N  N   . LEU B 1 437 ? -1.350  -25.952 23.251  1.00 38.37  ? 483  LEU B N   1 
ATOM   6911  C  CA  . LEU B 1 437 ? -0.791  -24.758 23.881  1.00 37.45  ? 483  LEU B CA  1 
ATOM   6912  C  C   . LEU B 1 437 ? 0.339   -24.177 23.066  1.00 37.25  ? 483  LEU B C   1 
ATOM   6913  O  O   . LEU B 1 437 ? 0.421   -22.973 22.965  1.00 38.06  ? 483  LEU B O   1 
ATOM   6914  C  CB  . LEU B 1 437 ? -0.398  -24.974 25.337  1.00 36.90  ? 483  LEU B CB  1 
ATOM   6915  C  CG  . LEU B 1 437 ? -1.538  -25.284 26.322  1.00 36.43  ? 483  LEU B CG  1 
ATOM   6916  C  CD1 . LEU B 1 437 ? -0.997  -25.427 27.744  1.00 35.24  ? 483  LEU B CD1 1 
ATOM   6917  C  CD2 . LEU B 1 437 ? -2.659  -24.261 26.298  1.00 35.82  ? 483  LEU B CD2 1 
ATOM   6918  N  N   . LEU B 1 438 ? 1.167   -25.009 22.442  1.00 36.93  ? 484  LEU B N   1 
ATOM   6919  C  CA  . LEU B 1 438 ? 2.165   -24.512 21.500  1.00 36.40  ? 484  LEU B CA  1 
ATOM   6920  C  C   . LEU B 1 438 ? 1.547   -23.785 20.303  1.00 36.71  ? 484  LEU B C   1 
ATOM   6921  O  O   . LEU B 1 438 ? 1.882   -22.633 20.026  1.00 36.52  ? 484  LEU B O   1 
ATOM   6922  C  CB  . LEU B 1 438 ? 3.071   -25.632 21.016  1.00 36.15  ? 484  LEU B CB  1 
ATOM   6923  C  CG  . LEU B 1 438 ? 4.076   -26.171 22.039  1.00 35.98  ? 484  LEU B CG  1 
ATOM   6924  C  CD1 . LEU B 1 438 ? 4.498   -27.556 21.673  1.00 32.37  ? 484  LEU B CD1 1 
ATOM   6925  C  CD2 . LEU B 1 438 ? 5.299   -25.256 22.163  1.00 35.59  ? 484  LEU B CD2 1 
ATOM   6926  N  N   . SER B 1 439 ? 0.631   -24.433 19.596  1.00 37.12  ? 485  SER B N   1 
ATOM   6927  C  CA  . SER B 1 439 ? 0.056   -23.798 18.414  1.00 37.83  ? 485  SER B CA  1 
ATOM   6928  C  C   . SER B 1 439 ? -0.704  -22.505 18.738  1.00 38.21  ? 485  SER B C   1 
ATOM   6929  O  O   . SER B 1 439 ? -0.719  -21.572 17.935  1.00 38.44  ? 485  SER B O   1 
ATOM   6930  C  CB  . SER B 1 439 ? -0.824  -24.767 17.635  1.00 37.83  ? 485  SER B CB  1 
ATOM   6931  O  OG  . SER B 1 439 ? -2.197  -24.510 17.848  1.00 38.21  ? 485  SER B OG  1 
ATOM   6932  N  N   . ARG B 1 440 ? -1.333  -22.470 19.907  1.00 38.60  ? 486  ARG B N   1 
ATOM   6933  C  CA  . ARG B 1 440 ? -1.911  -21.265 20.483  1.00 39.02  ? 486  ARG B CA  1 
ATOM   6934  C  C   . ARG B 1 440 ? -1.058  -20.012 20.268  1.00 38.97  ? 486  ARG B C   1 
ATOM   6935  O  O   . ARG B 1 440 ? -1.592  -18.933 20.066  1.00 39.04  ? 486  ARG B O   1 
ATOM   6936  C  CB  . ARG B 1 440 ? -2.041  -21.495 21.973  1.00 39.41  ? 486  ARG B CB  1 
ATOM   6937  C  CG  . ARG B 1 440 ? -3.122  -20.748 22.596  1.00 40.40  ? 486  ARG B CG  1 
ATOM   6938  C  CD  . ARG B 1 440 ? -2.530  -19.932 23.670  1.00 42.34  ? 486  ARG B CD  1 
ATOM   6939  N  NE  . ARG B 1 440 ? -2.835  -18.557 23.343  1.00 46.39  ? 486  ARG B NE  1 
ATOM   6940  C  CZ  . ARG B 1 440 ? -3.712  -17.806 23.995  1.00 47.84  ? 486  ARG B CZ  1 
ATOM   6941  N  NH1 . ARG B 1 440 ? -4.367  -18.284 25.060  1.00 45.18  ? 486  ARG B NH1 1 
ATOM   6942  N  NH2 . ARG B 1 440 ? -3.911  -16.558 23.573  1.00 50.13  ? 486  ARG B NH2 1 
ATOM   6943  N  N   . TYR B 1 441 ? 0.266   -20.164 20.338  1.00 39.19  ? 487  TYR B N   1 
ATOM   6944  C  CA  . TYR B 1 441 ? 1.201   -19.048 20.100  1.00 39.26  ? 487  TYR B CA  1 
ATOM   6945  C  C   . TYR B 1 441 ? 1.690   -18.951 18.657  1.00 39.40  ? 487  TYR B C   1 
ATOM   6946  O  O   . TYR B 1 441 ? 2.540   -18.122 18.349  1.00 39.58  ? 487  TYR B O   1 
ATOM   6947  C  CB  . TYR B 1 441 ? 2.367   -19.039 21.106  1.00 38.82  ? 487  TYR B CB  1 
ATOM   6948  C  CG  . TYR B 1 441 ? 1.888   -18.746 22.512  1.00 39.35  ? 487  TYR B CG  1 
ATOM   6949  C  CD1 . TYR B 1 441 ? 1.884   -19.728 23.495  1.00 38.49  ? 487  TYR B CD1 1 
ATOM   6950  C  CD2 . TYR B 1 441 ? 1.378   -17.492 22.845  1.00 38.93  ? 487  TYR B CD2 1 
ATOM   6951  C  CE1 . TYR B 1 441 ? 1.411   -19.455 24.783  1.00 38.55  ? 487  TYR B CE1 1 
ATOM   6952  C  CE2 . TYR B 1 441 ? 0.901   -17.215 24.133  1.00 38.70  ? 487  TYR B CE2 1 
ATOM   6953  C  CZ  . TYR B 1 441 ? 0.927   -18.197 25.091  1.00 39.77  ? 487  TYR B CZ  1 
ATOM   6954  O  OH  . TYR B 1 441 ? 0.449   -17.931 26.355  1.00 40.75  ? 487  TYR B OH  1 
ATOM   6955  N  N   . ARG B 1 442 ? 1.125   -19.772 17.774  1.00 39.55  ? 488  ARG B N   1 
ATOM   6956  C  CA  . ARG B 1 442 ? 1.460   -19.754 16.346  1.00 39.73  ? 488  ARG B CA  1 
ATOM   6957  C  C   . ARG B 1 442 ? 2.956   -19.707 16.130  1.00 39.50  ? 488  ARG B C   1 
ATOM   6958  O  O   . ARG B 1 442 ? 3.485   -18.705 15.663  1.00 39.78  ? 488  ARG B O   1 
ATOM   6959  C  CB  . ARG B 1 442 ? 0.844   -18.542 15.632  1.00 40.02  ? 488  ARG B CB  1 
ATOM   6960  C  CG  . ARG B 1 442 ? -0.641  -18.407 15.715  1.00 41.54  ? 488  ARG B CG  1 
ATOM   6961  C  CD  . ARG B 1 442 ? -1.364  -19.467 14.915  1.00 43.47  ? 488  ARG B CD  1 
ATOM   6962  N  NE  . ARG B 1 442 ? -2.775  -19.468 15.305  1.00 45.63  ? 488  ARG B NE  1 
ATOM   6963  C  CZ  . ARG B 1 442 ? -3.674  -20.372 14.932  1.00 47.45  ? 488  ARG B CZ  1 
ATOM   6964  N  NH1 . ARG B 1 442 ? -3.332  -21.370 14.155  1.00 50.72  ? 488  ARG B NH1 1 
ATOM   6965  N  NH2 . ARG B 1 442 ? -4.933  -20.284 15.324  1.00 49.76  ? 488  ARG B NH2 1 
ATOM   6966  N  N   . PRO B 1 443 ? 3.651   -20.785 16.468  1.00 39.44  ? 489  PRO B N   1 
ATOM   6967  C  CA  . PRO B 1 443 ? 5.043   -20.845 16.095  1.00 39.51  ? 489  PRO B CA  1 
ATOM   6968  C  C   . PRO B 1 443 ? 5.089   -20.836 14.594  1.00 39.82  ? 489  PRO B C   1 
ATOM   6969  O  O   . PRO B 1 443 ? 4.070   -21.013 13.955  1.00 40.11  ? 489  PRO B O   1 
ATOM   6970  C  CB  . PRO B 1 443 ? 5.476   -22.221 16.568  1.00 39.37  ? 489  PRO B CB  1 
ATOM   6971  C  CG  . PRO B 1 443 ? 4.391   -22.736 17.426  1.00 40.04  ? 489  PRO B CG  1 
ATOM   6972  C  CD  . PRO B 1 443 ? 3.169   -22.000 17.148  1.00 39.42  ? 489  PRO B CD  1 
ATOM   6973  N  N   . ARG B 1 444 ? 6.253   -20.619 14.016  1.00 40.33  ? 490  ARG B N   1 
ATOM   6974  C  CA  . ARG B 1 444 ? 6.397   -20.876 12.600  1.00 40.59  ? 490  ARG B CA  1 
ATOM   6975  C  C   . ARG B 1 444 ? 6.972   -22.276 12.410  1.00 40.83  ? 490  ARG B C   1 
ATOM   6976  O  O   . ARG B 1 444 ? 6.603   -22.997 11.482  1.00 41.04  ? 490  ARG B O   1 
ATOM   6977  C  CB  . ARG B 1 444 ? 7.290   -19.835 11.963  1.00 40.58  ? 490  ARG B CB  1 
ATOM   6978  C  CG  . ARG B 1 444 ? 8.087   -20.336 10.780  1.00 42.60  ? 490  ARG B CG  1 
ATOM   6979  C  CD  . ARG B 1 444 ? 8.608   -19.169 9.993   1.00 47.51  ? 490  ARG B CD  1 
ATOM   6980  N  NE  . ARG B 1 444 ? 7.516   -18.547 9.254   1.00 52.35  ? 490  ARG B NE  1 
ATOM   6981  C  CZ  . ARG B 1 444 ? 7.638   -17.429 8.539   1.00 54.99  ? 490  ARG B CZ  1 
ATOM   6982  N  NH1 . ARG B 1 444 ? 8.830   -16.819 8.478   1.00 55.54  ? 490  ARG B NH1 1 
ATOM   6983  N  NH2 . ARG B 1 444 ? 6.580   -16.932 7.877   1.00 52.79  ? 490  ARG B NH2 1 
ATOM   6984  N  N   . ALA B 1 445 ? 7.893   -22.659 13.287  1.00 40.67  ? 491  ALA B N   1 
ATOM   6985  C  CA  . ALA B 1 445 ? 8.378   -24.011 13.277  1.00 40.24  ? 491  ALA B CA  1 
ATOM   6986  C  C   . ALA B 1 445 ? 7.135   -24.863 13.462  1.00 40.38  ? 491  ALA B C   1 
ATOM   6987  O  O   . ALA B 1 445 ? 6.172   -24.445 14.125  1.00 40.68  ? 491  ALA B O   1 
ATOM   6988  C  CB  . ALA B 1 445 ? 9.375   -24.224 14.396  1.00 40.04  ? 491  ALA B CB  1 
ATOM   6989  N  N   . ALA B 1 446 ? 7.140   -26.033 12.834  1.00 40.40  ? 492  ALA B N   1 
ATOM   6990  C  CA  . ALA B 1 446 ? 6.002   -26.940 12.879  1.00 40.01  ? 492  ALA B CA  1 
ATOM   6991  C  C   . ALA B 1 446 ? 5.983   -27.650 14.221  1.00 39.80  ? 492  ALA B C   1 
ATOM   6992  O  O   . ALA B 1 446 ? 7.049   -27.941 14.778  1.00 40.14  ? 492  ALA B O   1 
ATOM   6993  C  CB  . ALA B 1 446 ? 6.096   -27.924 11.755  1.00 40.06  ? 492  ALA B CB  1 
ATOM   6994  N  N   . VAL B 1 447 ? 4.781   -27.908 14.732  1.00 38.86  ? 493  VAL B N   1 
ATOM   6995  C  CA  . VAL B 1 447 ? 4.586   -28.608 15.987  1.00 38.48  ? 493  VAL B CA  1 
ATOM   6996  C  C   . VAL B 1 447 ? 4.336   -30.106 15.700  1.00 38.80  ? 493  VAL B C   1 
ATOM   6997  O  O   . VAL B 1 447 ? 3.248   -30.495 15.292  1.00 39.91  ? 493  VAL B O   1 
ATOM   6998  C  CB  . VAL B 1 447 ? 3.387   -28.009 16.765  1.00 38.48  ? 493  VAL B CB  1 
ATOM   6999  C  CG1 . VAL B 1 447 ? 3.063   -28.839 18.021  1.00 37.00  ? 493  VAL B CG1 1 
ATOM   7000  C  CG2 . VAL B 1 447 ? 3.659   -26.576 17.135  1.00 38.44  ? 493  VAL B CG2 1 
ATOM   7001  N  N   . ILE B 1 448 ? 5.347   -30.942 15.905  1.00 38.08  ? 494  ILE B N   1 
ATOM   7002  C  CA  . ILE B 1 448 ? 5.252   -32.375 15.653  1.00 36.93  ? 494  ILE B CA  1 
ATOM   7003  C  C   . ILE B 1 448 ? 4.828   -33.074 16.955  1.00 37.17  ? 494  ILE B C   1 
ATOM   7004  O  O   . ILE B 1 448 ? 5.616   -33.221 17.920  1.00 37.33  ? 494  ILE B O   1 
ATOM   7005  C  CB  . ILE B 1 448 ? 6.601   -32.907 15.097  1.00 36.71  ? 494  ILE B CB  1 
ATOM   7006  C  CG1 . ILE B 1 448 ? 6.887   -32.274 13.730  1.00 35.50  ? 494  ILE B CG1 1 
ATOM   7007  C  CG2 . ILE B 1 448 ? 6.602   -34.400 15.012  1.00 35.58  ? 494  ILE B CG2 1 
ATOM   7008  C  CD1 . ILE B 1 448 ? 8.266   -32.622 13.156  1.00 35.47  ? 494  ILE B CD1 1 
ATOM   7009  N  N   . ALA B 1 449 ? 3.567   -33.477 16.998  1.00 37.13  ? 495  ALA B N   1 
ATOM   7010  C  CA  . ALA B 1 449 ? 3.017   -34.053 18.220  1.00 37.31  ? 495  ALA B CA  1 
ATOM   7011  C  C   . ALA B 1 449 ? 3.071   -35.562 18.196  1.00 37.67  ? 495  ALA B C   1 
ATOM   7012  O  O   . ALA B 1 449 ? 2.500   -36.189 17.278  1.00 38.50  ? 495  ALA B O   1 
ATOM   7013  C  CB  . ALA B 1 449 ? 1.600   -33.590 18.425  1.00 37.12  ? 495  ALA B CB  1 
ATOM   7014  N  N   . VAL B 1 450 ? 3.744   -36.142 19.190  1.00 37.40  ? 496  VAL B N   1 
ATOM   7015  C  CA  . VAL B 1 450 ? 3.898   -37.596 19.279  1.00 37.45  ? 496  VAL B CA  1 
ATOM   7016  C  C   . VAL B 1 450 ? 2.956   -38.131 20.357  1.00 37.76  ? 496  VAL B C   1 
ATOM   7017  O  O   . VAL B 1 450 ? 2.987   -37.681 21.515  1.00 37.97  ? 496  VAL B O   1 
ATOM   7018  C  CB  . VAL B 1 450 ? 5.387   -38.020 19.562  1.00 37.52  ? 496  VAL B CB  1 
ATOM   7019  C  CG1 . VAL B 1 450 ? 5.523   -39.529 19.626  1.00 36.47  ? 496  VAL B CG1 1 
ATOM   7020  C  CG2 . VAL B 1 450 ? 6.317   -37.465 18.495  1.00 36.63  ? 496  VAL B CG2 1 
ATOM   7021  N  N   . THR B 1 451 ? 2.104   -39.073 19.979  1.00 37.65  ? 497  THR B N   1 
ATOM   7022  C  CA  . THR B 1 451 ? 1.110   -39.569 20.912  1.00 38.18  ? 497  THR B CA  1 
ATOM   7023  C  C   . THR B 1 451 ? 0.792   -41.041 20.703  1.00 38.85  ? 497  THR B C   1 
ATOM   7024  O  O   . THR B 1 451 ? 0.937   -41.568 19.591  1.00 39.20  ? 497  THR B O   1 
ATOM   7025  C  CB  . THR B 1 451 ? -0.184  -38.719 20.855  1.00 37.86  ? 497  THR B CB  1 
ATOM   7026  O  OG1 . THR B 1 451 ? -0.987  -38.978 22.009  1.00 38.02  ? 497  THR B OG1 1 
ATOM   7027  C  CG2 . THR B 1 451 ? -1.006  -39.031 19.624  1.00 37.73  ? 497  THR B CG2 1 
ATOM   7028  N  N   . ARG B 1 452 ? 0.375   -41.702 21.779  1.00 39.27  ? 498  ARG B N   1 
ATOM   7029  C  CA  . ARG B 1 452 ? -0.120  -43.068 21.676  1.00 39.68  ? 498  ARG B CA  1 
ATOM   7030  C  C   . ARG B 1 452 ? -1.618  -43.121 21.410  1.00 40.23  ? 498  ARG B C   1 
ATOM   7031  O  O   . ARG B 1 452 ? -2.121  -44.150 20.963  1.00 41.14  ? 498  ARG B O   1 
ATOM   7032  C  CB  . ARG B 1 452 ? 0.194   -43.860 22.932  1.00 39.29  ? 498  ARG B CB  1 
ATOM   7033  C  CG  . ARG B 1 452 ? 1.621   -44.309 22.988  1.00 38.58  ? 498  ARG B CG  1 
ATOM   7034  C  CD  . ARG B 1 452 ? 1.819   -45.449 23.946  1.00 36.33  ? 498  ARG B CD  1 
ATOM   7035  N  NE  . ARG B 1 452 ? 3.167   -45.989 23.836  1.00 36.69  ? 498  ARG B NE  1 
ATOM   7036  C  CZ  . ARG B 1 452 ? 4.205   -45.538 24.538  1.00 38.07  ? 498  ARG B CZ  1 
ATOM   7037  N  NH1 . ARG B 1 452 ? 4.044   -44.538 25.393  1.00 39.53  ? 498  ARG B NH1 1 
ATOM   7038  N  NH2 . ARG B 1 452 ? 5.411   -46.083 24.401  1.00 38.37  ? 498  ARG B NH2 1 
ATOM   7039  N  N   . SER B 1 453 ? -2.321  -42.028 21.694  1.00 39.86  ? 499  SER B N   1 
ATOM   7040  C  CA  . SER B 1 453 ? -3.773  -42.001 21.588  1.00 39.31  ? 499  SER B CA  1 
ATOM   7041  C  C   . SER B 1 453 ? -4.144  -41.730 20.140  1.00 39.20  ? 499  SER B C   1 
ATOM   7042  O  O   . SER B 1 453 ? -3.999  -40.597 19.651  1.00 39.11  ? 499  SER B O   1 
ATOM   7043  C  CB  . SER B 1 453 ? -4.354  -40.945 22.533  1.00 39.46  ? 499  SER B CB  1 
ATOM   7044  O  OG  . SER B 1 453 ? -5.654  -40.550 22.171  1.00 39.08  ? 499  SER B OG  1 
ATOM   7045  N  N   . ALA B 1 454 ? -4.605  -42.768 19.441  1.00 38.95  ? 500  ALA B N   1 
ATOM   7046  C  CA  . ALA B 1 454 ? -5.013  -42.622 18.043  1.00 38.65  ? 500  ALA B CA  1 
ATOM   7047  C  C   . ALA B 1 454 ? -5.998  -41.467 17.894  1.00 38.92  ? 500  ALA B C   1 
ATOM   7048  O  O   . ALA B 1 454 ? -5.899  -40.697 16.955  1.00 39.49  ? 500  ALA B O   1 
ATOM   7049  C  CB  . ALA B 1 454 ? -5.614  -43.900 17.518  1.00 37.93  ? 500  ALA B CB  1 
ATOM   7050  N  N   . GLN B 1 455 ? -6.931  -41.334 18.834  1.00 38.98  ? 501  GLN B N   1 
ATOM   7051  C  CA  . GLN B 1 455 ? -7.949  -40.286 18.787  1.00 38.98  ? 501  GLN B CA  1 
ATOM   7052  C  C   . GLN B 1 455 ? -7.360  -38.906 18.952  1.00 39.34  ? 501  GLN B C   1 
ATOM   7053  O  O   . GLN B 1 455 ? -7.606  -38.020 18.122  1.00 40.00  ? 501  GLN B O   1 
ATOM   7054  C  CB  . GLN B 1 455 ? -8.994  -40.528 19.871  1.00 39.16  ? 501  GLN B CB  1 
ATOM   7055  C  CG  . GLN B 1 455 ? -9.995  -39.418 20.046  1.00 39.39  ? 501  GLN B CG  1 
ATOM   7056  C  CD  . GLN B 1 455 ? -11.347 -39.952 20.415  1.00 41.40  ? 501  GLN B CD  1 
ATOM   7057  O  OE1 . GLN B 1 455 ? -11.713 -39.995 21.594  1.00 40.92  ? 501  GLN B OE1 1 
ATOM   7058  N  NE2 . GLN B 1 455 ? -12.103 -40.379 19.410  1.00 40.97  ? 501  GLN B NE2 1 
ATOM   7059  N  N   . ALA B 1 456 ? -6.595  -38.697 20.020  1.00 39.20  ? 502  ALA B N   1 
ATOM   7060  C  CA  . ALA B 1 456 ? -5.926  -37.417 20.192  1.00 39.04  ? 502  ALA B CA  1 
ATOM   7061  C  C   . ALA B 1 456 ? -5.151  -37.059 18.921  1.00 38.95  ? 502  ALA B C   1 
ATOM   7062  O  O   . ALA B 1 456 ? -5.193  -35.917 18.486  1.00 39.19  ? 502  ALA B O   1 
ATOM   7063  C  CB  . ALA B 1 456 ? -5.020  -37.429 21.400  1.00 39.42  ? 502  ALA B CB  1 
ATOM   7064  N  N   . ALA B 1 457 ? -4.490  -38.039 18.306  1.00 38.80  ? 503  ALA B N   1 
ATOM   7065  C  CA  . ALA B 1 457 ? -3.752  -37.811 17.070  1.00 38.95  ? 503  ALA B CA  1 
ATOM   7066  C  C   . ALA B 1 457 ? -4.641  -37.215 15.977  1.00 39.46  ? 503  ALA B C   1 
ATOM   7067  O  O   . ALA B 1 457 ? -4.215  -36.354 15.199  1.00 39.62  ? 503  ALA B O   1 
ATOM   7068  C  CB  . ALA B 1 457 ? -3.136  -39.094 16.597  1.00 39.26  ? 503  ALA B CB  1 
ATOM   7069  N  N   . ARG B 1 458 ? -5.887  -37.671 15.921  1.00 39.68  ? 504  ARG B N   1 
ATOM   7070  C  CA  . ARG B 1 458 ? -6.847  -37.158 14.954  1.00 39.43  ? 504  ARG B CA  1 
ATOM   7071  C  C   . ARG B 1 458 ? -7.371  -35.773 15.336  1.00 39.75  ? 504  ARG B C   1 
ATOM   7072  O  O   . ARG B 1 458 ? -7.471  -34.893 14.489  1.00 39.82  ? 504  ARG B O   1 
ATOM   7073  C  CB  . ARG B 1 458 ? -8.021  -38.118 14.797  1.00 39.26  ? 504  ARG B CB  1 
ATOM   7074  C  CG  . ARG B 1 458 ? -7.671  -39.451 14.171  1.00 38.69  ? 504  ARG B CG  1 
ATOM   7075  C  CD  . ARG B 1 458 ? -8.915  -40.324 13.833  1.00 36.34  ? 504  ARG B CD  1 
ATOM   7076  N  NE  . ARG B 1 458 ? -9.591  -40.875 15.014  1.00 36.65  ? 504  ARG B NE  1 
ATOM   7077  C  CZ  . ARG B 1 458 ? -9.198  -41.957 15.682  1.00 36.79  ? 504  ARG B CZ  1 
ATOM   7078  N  NH1 . ARG B 1 458 ? -9.893  -42.381 16.750  1.00 35.54  ? 504  ARG B NH1 1 
ATOM   7079  N  NH2 . ARG B 1 458 ? -8.120  -42.626 15.276  1.00 35.88  ? 504  ARG B NH2 1 
ATOM   7080  N  N   . GLN B 1 459 ? -7.724  -35.577 16.603  1.00 39.78  ? 505  GLN B N   1 
ATOM   7081  C  CA  . GLN B 1 459 ? -8.373  -34.324 16.995  1.00 39.43  ? 505  GLN B CA  1 
ATOM   7082  C  C   . GLN B 1 459 ? -7.399  -33.152 16.917  1.00 39.64  ? 505  GLN B C   1 
ATOM   7083  O  O   . GLN B 1 459 ? -7.809  -32.000 16.787  1.00 40.05  ? 505  GLN B O   1 
ATOM   7084  C  CB  . GLN B 1 459 ? -8.964  -34.445 18.400  1.00 39.14  ? 505  GLN B CB  1 
ATOM   7085  C  CG  . GLN B 1 459 ? -10.075 -35.471 18.530  1.00 38.53  ? 505  GLN B CG  1 
ATOM   7086  C  CD  . GLN B 1 459 ? -10.453 -35.694 19.977  1.00 39.60  ? 505  GLN B CD  1 
ATOM   7087  O  OE1 . GLN B 1 459 ? -9.593  -35.705 20.855  1.00 39.28  ? 505  GLN B OE1 1 
ATOM   7088  N  NE2 . GLN B 1 459 ? -11.739 -35.860 20.236  1.00 39.99  ? 505  GLN B NE2 1 
ATOM   7089  N  N   . VAL B 1 460 ? -6.107  -33.444 16.999  1.00 39.51  ? 506  VAL B N   1 
ATOM   7090  C  CA  . VAL B 1 460 ? -5.089  -32.408 16.985  1.00 39.35  ? 506  VAL B CA  1 
ATOM   7091  C  C   . VAL B 1 460 ? -5.037  -31.632 15.657  1.00 38.99  ? 506  VAL B C   1 
ATOM   7092  O  O   . VAL B 1 460 ? -4.562  -30.493 15.618  1.00 39.40  ? 506  VAL B O   1 
ATOM   7093  C  CB  . VAL B 1 460 ? -3.713  -32.982 17.418  1.00 39.34  ? 506  VAL B CB  1 
ATOM   7094  C  CG1 . VAL B 1 460 ? -2.602  -32.333 16.703  1.00 40.50  ? 506  VAL B CG1 1 
ATOM   7095  C  CG2 . VAL B 1 460 ? -3.516  -32.759 18.872  1.00 40.31  ? 506  VAL B CG2 1 
ATOM   7096  N  N   . HIS B 1 461 ? -5.564  -32.219 14.586  1.00 38.75  ? 507  HIS B N   1 
ATOM   7097  C  CA  . HIS B 1 461 ? -5.739  -31.500 13.302  1.00 38.65  ? 507  HIS B CA  1 
ATOM   7098  C  C   . HIS B 1 461 ? -6.543  -30.196 13.360  1.00 38.74  ? 507  HIS B C   1 
ATOM   7099  O  O   . HIS B 1 461 ? -6.517  -29.411 12.421  1.00 38.81  ? 507  HIS B O   1 
ATOM   7100  C  CB  . HIS B 1 461 ? -6.415  -32.395 12.273  1.00 38.57  ? 507  HIS B CB  1 
ATOM   7101  C  CG  . HIS B 1 461 ? -5.518  -33.446 11.694  1.00 38.66  ? 507  HIS B CG  1 
ATOM   7102  N  ND1 . HIS B 1 461 ? -4.307  -33.159 11.103  1.00 38.54  ? 507  HIS B ND1 1 
ATOM   7103  C  CD2 . HIS B 1 461 ? -5.671  -34.785 11.602  1.00 37.23  ? 507  HIS B CD2 1 
ATOM   7104  C  CE1 . HIS B 1 461 ? -3.746  -34.278 10.690  1.00 37.87  ? 507  HIS B CE1 1 
ATOM   7105  N  NE2 . HIS B 1 461 ? -4.562  -35.277 10.967  1.00 38.33  ? 507  HIS B NE2 1 
ATOM   7106  N  N   . LEU B 1 462 ? -7.282  -30.004 14.448  1.00 38.56  ? 508  LEU B N   1 
ATOM   7107  C  CA  . LEU B 1 462 ? -8.099  -28.856 14.653  1.00 38.53  ? 508  LEU B CA  1 
ATOM   7108  C  C   . LEU B 1 462 ? -7.224  -27.633 14.990  1.00 39.11  ? 508  LEU B C   1 
ATOM   7109  O  O   . LEU B 1 462 ? -7.701  -26.498 14.928  1.00 39.58  ? 508  LEU B O   1 
ATOM   7110  C  CB  . LEU B 1 462 ? -9.035  -29.182 15.798  1.00 38.49  ? 508  LEU B CB  1 
ATOM   7111  C  CG  . LEU B 1 462 ? -10.563 -29.120 15.732  1.00 38.69  ? 508  LEU B CG  1 
ATOM   7112  C  CD1 . LEU B 1 462 ? -11.136 -29.414 14.371  1.00 37.65  ? 508  LEU B CD1 1 
ATOM   7113  C  CD2 . LEU B 1 462 ? -11.119 -30.102 16.772  1.00 38.14  ? 508  LEU B CD2 1 
ATOM   7114  N  N   . CYS B 1 463 ? -5.940  -27.849 15.308  1.00 38.90  ? 509  CYS B N   1 
ATOM   7115  C  CA  . CYS B 1 463 ? -5.063  -26.775 15.802  1.00 38.99  ? 509  CYS B CA  1 
ATOM   7116  C  C   . CYS B 1 463 ? -3.993  -26.399 14.810  1.00 39.05  ? 509  CYS B C   1 
ATOM   7117  O  O   . CYS B 1 463 ? -3.138  -27.215 14.499  1.00 39.70  ? 509  CYS B O   1 
ATOM   7118  C  CB  . CYS B 1 463 ? -4.376  -27.227 17.073  1.00 38.67  ? 509  CYS B CB  1 
ATOM   7119  S  SG  . CYS B 1 463 ? -5.532  -27.446 18.388  1.00 41.05  ? 509  CYS B SG  1 
ATOM   7120  N  N   . ARG B 1 464 ? -3.994  -25.164 14.329  1.00 38.96  ? 510  ARG B N   1 
ATOM   7121  C  CA  . ARG B 1 464 ? -3.010  -24.832 13.303  1.00 39.24  ? 510  ARG B CA  1 
ATOM   7122  C  C   . ARG B 1 464 ? -1.591  -25.267 13.677  1.00 39.29  ? 510  ARG B C   1 
ATOM   7123  O  O   . ARG B 1 464 ? -1.136  -25.037 14.795  1.00 39.70  ? 510  ARG B O   1 
ATOM   7124  C  CB  . ARG B 1 464 ? -2.994  -23.351 12.922  1.00 38.92  ? 510  ARG B CB  1 
ATOM   7125  C  CG  . ARG B 1 464 ? -1.812  -23.052 11.923  1.00 40.14  ? 510  ARG B CG  1 
ATOM   7126  C  CD  . ARG B 1 464 ? -1.707  -21.602 11.374  1.00 41.94  ? 510  ARG B CD  1 
ATOM   7127  N  NE  . ARG B 1 464 ? -2.941  -21.102 10.760  1.00 41.17  ? 510  ARG B NE  1 
ATOM   7128  C  CZ  . ARG B 1 464 ? -3.111  -19.834 10.392  1.00 41.88  ? 510  ARG B CZ  1 
ATOM   7129  N  NH1 . ARG B 1 464 ? -4.269  -19.412 9.852   1.00 41.18  ? 510  ARG B NH1 1 
ATOM   7130  N  NH2 . ARG B 1 464 ? -2.114  -18.975 10.557  1.00 41.98  ? 510  ARG B NH2 1 
ATOM   7131  N  N   . GLY B 1 465 ? -0.897  -25.884 12.729  1.00 39.16  ? 511  GLY B N   1 
ATOM   7132  C  CA  . GLY B 1 465 ? 0.529   -26.104 12.860  1.00 39.67  ? 511  GLY B CA  1 
ATOM   7133  C  C   . GLY B 1 465 ? 0.915   -27.373 13.574  1.00 40.26  ? 511  GLY B C   1 
ATOM   7134  O  O   . GLY B 1 465 ? 2.104   -27.627 13.795  1.00 40.98  ? 511  GLY B O   1 
ATOM   7135  N  N   . VAL B 1 466 ? -0.076  -28.175 13.947  1.00 40.37  ? 512  VAL B N   1 
ATOM   7136  C  CA  . VAL B 1 466 ? 0.212   -29.449 14.600  1.00 40.00  ? 512  VAL B CA  1 
ATOM   7137  C  C   . VAL B 1 466 ? 0.152   -30.577 13.588  1.00 40.23  ? 512  VAL B C   1 
ATOM   7138  O  O   . VAL B 1 466 ? -0.829  -30.708 12.850  1.00 40.77  ? 512  VAL B O   1 
ATOM   7139  C  CB  . VAL B 1 466 ? -0.746  -29.775 15.758  1.00 39.57  ? 512  VAL B CB  1 
ATOM   7140  C  CG1 . VAL B 1 466 ? -0.272  -31.017 16.457  1.00 39.56  ? 512  VAL B CG1 1 
ATOM   7141  C  CG2 . VAL B 1 466 ? -0.815  -28.638 16.739  1.00 38.54  ? 512  VAL B CG2 1 
ATOM   7142  N  N   . PHE B 1 467 ? 1.216   -31.374 13.585  1.00 40.16  ? 513  PHE B N   1 
ATOM   7143  C  CA  . PHE B 1 467 ? 1.372   -32.547 12.742  1.00 39.95  ? 513  PHE B CA  1 
ATOM   7144  C  C   . PHE B 1 467 ? 1.478   -33.745 13.660  1.00 39.79  ? 513  PHE B C   1 
ATOM   7145  O  O   . PHE B 1 467 ? 2.510   -33.938 14.299  1.00 39.94  ? 513  PHE B O   1 
ATOM   7146  C  CB  . PHE B 1 467 ? 2.610   -32.375 11.863  1.00 39.84  ? 513  PHE B CB  1 
ATOM   7147  C  CG  . PHE B 1 467 ? 2.557   -31.131 11.053  1.00 39.80  ? 513  PHE B CG  1 
ATOM   7148  C  CD1 . PHE B 1 467 ? 3.012   -29.922 11.571  1.00 41.69  ? 513  PHE B CD1 1 
ATOM   7149  C  CD2 . PHE B 1 467 ? 1.940   -31.130 9.810   1.00 40.02  ? 513  PHE B CD2 1 
ATOM   7150  C  CE1 . PHE B 1 467 ? 2.903   -28.734 10.819  1.00 40.47  ? 513  PHE B CE1 1 
ATOM   7151  C  CE2 . PHE B 1 467 ? 1.823   -29.951 9.063   1.00 37.17  ? 513  PHE B CE2 1 
ATOM   7152  C  CZ  . PHE B 1 467 ? 2.322   -28.768 9.563   1.00 39.85  ? 513  PHE B CZ  1 
ATOM   7153  N  N   . PRO B 1 468 ? 0.384   -34.527 13.774  1.00 39.49  ? 514  PRO B N   1 
ATOM   7154  C  CA  . PRO B 1 468 ? 0.378   -35.614 14.735  1.00 39.45  ? 514  PRO B CA  1 
ATOM   7155  C  C   . PRO B 1 468 ? 1.128   -36.811 14.195  1.00 39.72  ? 514  PRO B C   1 
ATOM   7156  O  O   . PRO B 1 468 ? 1.083   -37.083 12.986  1.00 40.19  ? 514  PRO B O   1 
ATOM   7157  C  CB  . PRO B 1 468 ? -1.093  -35.964 14.844  1.00 39.14  ? 514  PRO B CB  1 
ATOM   7158  C  CG  . PRO B 1 468 ? -1.637  -35.658 13.526  1.00 38.80  ? 514  PRO B CG  1 
ATOM   7159  C  CD  . PRO B 1 468 ? -0.877  -34.472 13.013  1.00 39.23  ? 514  PRO B CD  1 
ATOM   7160  N  N   . LEU B 1 469 ? 1.831   -37.511 15.073  1.00 39.40  ? 515  LEU B N   1 
ATOM   7161  C  CA  . LEU B 1 469 ? 2.397   -38.790 14.696  1.00 39.43  ? 515  LEU B CA  1 
ATOM   7162  C  C   . LEU B 1 469 ? 1.917   -39.806 15.696  1.00 39.69  ? 515  LEU B C   1 
ATOM   7163  O  O   . LEU B 1 469 ? 2.068   -39.602 16.906  1.00 40.10  ? 515  LEU B O   1 
ATOM   7164  C  CB  . LEU B 1 469 ? 3.929   -38.734 14.649  1.00 39.19  ? 515  LEU B CB  1 
ATOM   7165  C  CG  . LEU B 1 469 ? 4.502   -37.617 13.774  1.00 38.35  ? 515  LEU B CG  1 
ATOM   7166  C  CD1 . LEU B 1 469 ? 5.993   -37.802 13.681  1.00 37.67  ? 515  LEU B CD1 1 
ATOM   7167  C  CD2 . LEU B 1 469 ? 3.877   -37.526 12.370  1.00 36.42  ? 515  LEU B CD2 1 
ATOM   7168  N  N   . LEU B 1 470 ? 1.309   -40.876 15.191  1.00 39.64  ? 516  LEU B N   1 
ATOM   7169  C  CA  . LEU B 1 470 ? 0.827   -41.939 16.050  1.00 39.66  ? 516  LEU B CA  1 
ATOM   7170  C  C   . LEU B 1 470 ? 1.961   -42.905 16.311  1.00 40.21  ? 516  LEU B C   1 
ATOM   7171  O  O   . LEU B 1 470 ? 2.622   -43.367 15.377  1.00 40.89  ? 516  LEU B O   1 
ATOM   7172  C  CB  . LEU B 1 470 ? -0.360  -42.664 15.427  1.00 39.25  ? 516  LEU B CB  1 
ATOM   7173  C  CG  . LEU B 1 470 ? -1.008  -43.683 16.364  1.00 38.58  ? 516  LEU B CG  1 
ATOM   7174  C  CD1 . LEU B 1 470 ? -1.270  -43.111 17.778  1.00 37.07  ? 516  LEU B CD1 1 
ATOM   7175  C  CD2 . LEU B 1 470 ? -2.279  -44.217 15.734  1.00 37.65  ? 516  LEU B CD2 1 
ATOM   7176  N  N   . TYR B 1 471 ? 2.176   -43.201 17.586  1.00 40.39  ? 517  TYR B N   1 
ATOM   7177  C  CA  . TYR B 1 471 ? 3.288   -44.028 18.027  1.00 40.35  ? 517  TYR B CA  1 
ATOM   7178  C  C   . TYR B 1 471 ? 2.748   -45.371 18.504  1.00 40.95  ? 517  TYR B C   1 
ATOM   7179  O  O   . TYR B 1 471 ? 1.815   -45.410 19.314  1.00 41.19  ? 517  TYR B O   1 
ATOM   7180  C  CB  . TYR B 1 471 ? 4.016   -43.305 19.147  1.00 39.59  ? 517  TYR B CB  1 
ATOM   7181  C  CG  . TYR B 1 471 ? 5.217   -44.029 19.658  1.00 39.12  ? 517  TYR B CG  1 
ATOM   7182  C  CD1 . TYR B 1 471 ? 6.425   -44.001 18.957  1.00 37.71  ? 517  TYR B CD1 1 
ATOM   7183  C  CD2 . TYR B 1 471 ? 5.160   -44.750 20.861  1.00 38.69  ? 517  TYR B CD2 1 
ATOM   7184  C  CE1 . TYR B 1 471 ? 7.548   -44.678 19.441  1.00 37.64  ? 517  TYR B CE1 1 
ATOM   7185  C  CE2 . TYR B 1 471 ? 6.276   -45.429 21.348  1.00 37.12  ? 517  TYR B CE2 1 
ATOM   7186  C  CZ  . TYR B 1 471 ? 7.462   -45.384 20.635  1.00 37.25  ? 517  TYR B CZ  1 
ATOM   7187  O  OH  . TYR B 1 471 ? 8.563   -46.043 21.118  1.00 37.93  ? 517  TYR B OH  1 
ATOM   7188  N  N   . ARG B 1 472 ? 3.331   -46.460 18.004  1.00 41.67  ? 518  ARG B N   1 
ATOM   7189  C  CA  . ARG B 1 472 ? 2.728   -47.796 18.137  1.00 42.31  ? 518  ARG B CA  1 
ATOM   7190  C  C   . ARG B 1 472 ? 3.488   -48.771 19.058  1.00 42.76  ? 518  ARG B C   1 
ATOM   7191  O  O   . ARG B 1 472 ? 2.888   -49.698 19.594  1.00 43.10  ? 518  ARG B O   1 
ATOM   7192  C  CB  . ARG B 1 472 ? 2.519   -48.432 16.754  1.00 42.40  ? 518  ARG B CB  1 
ATOM   7193  C  CG  . ARG B 1 472 ? 1.849   -47.514 15.728  1.00 42.90  ? 518  ARG B CG  1 
ATOM   7194  C  CD  . ARG B 1 472 ? 1.576   -48.213 14.384  1.00 42.98  ? 518  ARG B CD  1 
ATOM   7195  N  NE  . ARG B 1 472 ? 0.987   -47.270 13.428  1.00 43.79  ? 518  ARG B NE  1 
ATOM   7196  C  CZ  . ARG B 1 472 ? -0.317  -47.193 13.133  1.00 44.28  ? 518  ARG B CZ  1 
ATOM   7197  N  NH1 . ARG B 1 472 ? -1.181  -48.027 13.708  1.00 43.75  ? 518  ARG B NH1 1 
ATOM   7198  N  NH2 . ARG B 1 472 ? -0.765  -46.286 12.249  1.00 44.59  ? 518  ARG B NH2 1 
ATOM   7199  N  N   . GLU B 1 473 ? 4.790   -48.566 19.247  1.00 43.13  ? 519  GLU B N   1 
ATOM   7200  C  CA  . GLU B 1 473 ? 5.598   -49.463 20.087  1.00 43.62  ? 519  GLU B CA  1 
ATOM   7201  C  C   . GLU B 1 473 ? 5.061   -49.573 21.519  1.00 43.96  ? 519  GLU B C   1 
ATOM   7202  O  O   . GLU B 1 473 ? 4.473   -48.620 22.045  1.00 44.30  ? 519  GLU B O   1 
ATOM   7203  C  CB  . GLU B 1 473 ? 7.074   -49.023 20.151  1.00 43.43  ? 519  GLU B CB  1 
ATOM   7204  C  CG  . GLU B 1 473 ? 7.681   -48.532 18.838  1.00 44.40  ? 519  GLU B CG  1 
ATOM   7205  C  CD  . GLU B 1 473 ? 7.896   -49.638 17.822  1.00 46.07  ? 519  GLU B CD  1 
ATOM   7206  O  OE1 . GLU B 1 473 ? 8.290   -50.769 18.222  1.00 46.67  ? 519  GLU B OE1 1 
ATOM   7207  O  OE2 . GLU B 1 473 ? 7.673   -49.355 16.620  1.00 46.21  ? 519  GLU B OE2 1 
ATOM   7208  N  N   . PRO B 1 474 ? 5.274   -50.737 22.157  1.00 44.12  ? 520  PRO B N   1 
ATOM   7209  C  CA  . PRO B 1 474 ? 4.935   -50.928 23.569  1.00 44.25  ? 520  PRO B CA  1 
ATOM   7210  C  C   . PRO B 1 474 ? 5.936   -50.186 24.464  1.00 44.29  ? 520  PRO B C   1 
ATOM   7211  O  O   . PRO B 1 474 ? 7.118   -50.109 24.100  1.00 44.41  ? 520  PRO B O   1 
ATOM   7212  C  CB  . PRO B 1 474 ? 5.103   -52.439 23.783  1.00 44.40  ? 520  PRO B CB  1 
ATOM   7213  C  CG  . PRO B 1 474 ? 5.347   -53.032 22.417  1.00 44.64  ? 520  PRO B CG  1 
ATOM   7214  C  CD  . PRO B 1 474 ? 5.874   -51.939 21.557  1.00 44.12  ? 520  PRO B CD  1 
ATOM   7215  N  N   . PRO B 1 475 ? 5.478   -49.659 25.633  1.00 44.13  ? 521  PRO B N   1 
ATOM   7216  C  CA  . PRO B 1 475 ? 6.359   -48.923 26.555  1.00 43.53  ? 521  PRO B CA  1 
ATOM   7217  C  C   . PRO B 1 475 ? 7.609   -49.707 26.883  1.00 42.91  ? 521  PRO B C   1 
ATOM   7218  O  O   . PRO B 1 475 ? 7.533   -50.917 26.999  1.00 42.90  ? 521  PRO B O   1 
ATOM   7219  C  CB  . PRO B 1 475 ? 5.514   -48.781 27.827  1.00 43.43  ? 521  PRO B CB  1 
ATOM   7220  C  CG  . PRO B 1 475 ? 4.112   -48.839 27.369  1.00 43.98  ? 521  PRO B CG  1 
ATOM   7221  C  CD  . PRO B 1 475 ? 4.090   -49.730 26.141  1.00 44.28  ? 521  PRO B CD  1 
ATOM   7222  N  N   . GLU B 1 476 ? 8.742   -49.019 27.008  1.00 42.46  ? 522  GLU B N   1 
ATOM   7223  C  CA  . GLU B 1 476 ? 9.978   -49.617 27.515  1.00 42.12  ? 522  GLU B CA  1 
ATOM   7224  C  C   . GLU B 1 476 ? 9.845   -49.750 29.021  1.00 41.99  ? 522  GLU B C   1 
ATOM   7225  O  O   . GLU B 1 476 ? 8.969   -49.119 29.618  1.00 42.18  ? 522  GLU B O   1 
ATOM   7226  C  CB  . GLU B 1 476 ? 11.175  -48.718 27.208  1.00 42.02  ? 522  GLU B CB  1 
ATOM   7227  C  CG  . GLU B 1 476 ? 11.267  -48.256 25.771  1.00 42.44  ? 522  GLU B CG  1 
ATOM   7228  C  CD  . GLU B 1 476 ? 11.793  -49.330 24.842  1.00 43.80  ? 522  GLU B CD  1 
ATOM   7229  O  OE1 . GLU B 1 476 ? 12.773  -50.020 25.213  1.00 44.80  ? 522  GLU B OE1 1 
ATOM   7230  O  OE2 . GLU B 1 476 ? 11.230  -49.470 23.733  1.00 42.88  ? 522  GLU B OE2 1 
ATOM   7231  N  N   . ALA B 1 477 ? 10.716  -50.552 29.637  1.00 41.51  ? 523  ALA B N   1 
ATOM   7232  C  CA  . ALA B 1 477 ? 10.725  -50.709 31.094  1.00 41.02  ? 523  ALA B CA  1 
ATOM   7233  C  C   . ALA B 1 477 ? 11.114  -49.407 31.809  1.00 40.86  ? 523  ALA B C   1 
ATOM   7234  O  O   . ALA B 1 477 ? 10.392  -48.935 32.692  1.00 40.86  ? 523  ALA B O   1 
ATOM   7235  C  CB  . ALA B 1 477 ? 11.643  -51.850 31.506  1.00 41.08  ? 523  ALA B CB  1 
ATOM   7236  N  N   . ILE B 1 478 ? 12.251  -48.832 31.421  1.00 40.45  ? 524  ILE B N   1 
ATOM   7237  C  CA  . ILE B 1 478 ? 12.698  -47.542 31.950  1.00 40.19  ? 524  ILE B CA  1 
ATOM   7238  C  C   . ILE B 1 478 ? 11.943  -46.390 31.254  1.00 40.07  ? 524  ILE B C   1 
ATOM   7239  O  O   . ILE B 1 478 ? 12.091  -46.175 30.041  1.00 40.10  ? 524  ILE B O   1 
ATOM   7240  C  CB  . ILE B 1 478 ? 14.239  -47.372 31.778  1.00 40.24  ? 524  ILE B CB  1 
ATOM   7241  C  CG1 . ILE B 1 478 ? 14.987  -48.504 32.496  1.00 40.00  ? 524  ILE B CG1 1 
ATOM   7242  C  CG2 . ILE B 1 478 ? 14.712  -45.975 32.238  1.00 40.13  ? 524  ILE B CG2 1 
ATOM   7243  C  CD1 . ILE B 1 478 ? 16.473  -48.622 32.121  1.00 40.63  ? 524  ILE B CD1 1 
ATOM   7244  N  N   . TRP B 1 479 ? 11.138  -45.655 32.023  1.00 39.69  ? 525  TRP B N   1 
ATOM   7245  C  CA  . TRP B 1 479 ? 10.318  -44.567 31.468  1.00 39.15  ? 525  TRP B CA  1 
ATOM   7246  C  C   . TRP B 1 479 ? 11.126  -43.584 30.627  1.00 39.01  ? 525  TRP B C   1 
ATOM   7247  O  O   . TRP B 1 479 ? 10.748  -43.299 29.491  1.00 38.99  ? 525  TRP B O   1 
ATOM   7248  C  CB  . TRP B 1 479 ? 9.548   -43.836 32.567  1.00 38.95  ? 525  TRP B CB  1 
ATOM   7249  C  CG  . TRP B 1 479 ? 8.640   -42.756 32.038  1.00 38.02  ? 525  TRP B CG  1 
ATOM   7250  C  CD1 . TRP B 1 479 ? 7.522   -42.917 31.254  1.00 37.53  ? 525  TRP B CD1 1 
ATOM   7251  C  CD2 . TRP B 1 479 ? 8.771   -41.349 32.256  1.00 37.60  ? 525  TRP B CD2 1 
ATOM   7252  N  NE1 . TRP B 1 479 ? 6.955   -41.694 30.974  1.00 36.54  ? 525  TRP B NE1 1 
ATOM   7253  C  CE2 . TRP B 1 479 ? 7.702   -40.717 31.578  1.00 37.46  ? 525  TRP B CE2 1 
ATOM   7254  C  CE3 . TRP B 1 479 ? 9.687   -40.557 32.962  1.00 37.44  ? 525  TRP B CE3 1 
ATOM   7255  C  CZ2 . TRP B 1 479 ? 7.527   -39.339 31.593  1.00 36.39  ? 525  TRP B CZ2 1 
ATOM   7256  C  CZ3 . TRP B 1 479 ? 9.512   -39.183 32.970  1.00 36.72  ? 525  TRP B CZ3 1 
ATOM   7257  C  CH2 . TRP B 1 479 ? 8.444   -38.590 32.289  1.00 37.00  ? 525  TRP B CH2 1 
ATOM   7258  N  N   . ALA B 1 480 ? 12.240  -43.102 31.182  1.00 38.81  ? 526  ALA B N   1 
ATOM   7259  C  CA  . ALA B 1 480 ? 13.153  -42.193 30.478  1.00 38.91  ? 526  ALA B CA  1 
ATOM   7260  C  C   . ALA B 1 480 ? 13.503  -42.652 29.053  1.00 39.15  ? 526  ALA B C   1 
ATOM   7261  O  O   . ALA B 1 480 ? 13.475  -41.846 28.107  1.00 39.48  ? 526  ALA B O   1 
ATOM   7262  C  CB  . ALA B 1 480 ? 14.415  -41.959 31.300  1.00 38.65  ? 526  ALA B CB  1 
ATOM   7263  N  N   . ASP B 1 481 ? 13.810  -43.944 28.902  1.00 39.14  ? 527  ASP B N   1 
ATOM   7264  C  CA  . ASP B 1 481 ? 14.042  -44.534 27.578  1.00 39.15  ? 527  ASP B CA  1 
ATOM   7265  C  C   . ASP B 1 481 ? 12.812  -44.402 26.692  1.00 39.06  ? 527  ASP B C   1 
ATOM   7266  O  O   . ASP B 1 481 ? 12.937  -44.033 25.520  1.00 39.13  ? 527  ASP B O   1 
ATOM   7267  C  CB  . ASP B 1 481 ? 14.457  -46.005 27.681  1.00 39.38  ? 527  ASP B CB  1 
ATOM   7268  C  CG  . ASP B 1 481 ? 15.817  -46.196 28.356  1.00 39.95  ? 527  ASP B CG  1 
ATOM   7269  O  OD1 . ASP B 1 481 ? 16.631  -45.243 28.339  1.00 38.73  ? 527  ASP B OD1 1 
ATOM   7270  O  OD2 . ASP B 1 481 ? 16.065  -47.309 28.895  1.00 41.63  ? 527  ASP B OD2 1 
ATOM   7271  N  N   . ASP B 1 482 ? 11.630  -44.685 27.251  1.00 38.99  ? 528  ASP B N   1 
ATOM   7272  C  CA  . ASP B 1 482 ? 10.380  -44.602 26.482  1.00 39.05  ? 528  ASP B CA  1 
ATOM   7273  C  C   . ASP B 1 482 ? 10.221  -43.207 25.909  1.00 39.01  ? 528  ASP B C   1 
ATOM   7274  O  O   . ASP B 1 482 ? 9.887   -43.030 24.727  1.00 38.85  ? 528  ASP B O   1 
ATOM   7275  C  CB  . ASP B 1 482 ? 9.152   -44.960 27.330  1.00 39.03  ? 528  ASP B CB  1 
ATOM   7276  C  CG  . ASP B 1 482 ? 7.964   -45.405 26.473  1.00 40.45  ? 528  ASP B CG  1 
ATOM   7277  O  OD1 . ASP B 1 482 ? 8.062   -46.482 25.844  1.00 42.20  ? 528  ASP B OD1 1 
ATOM   7278  O  OD2 . ASP B 1 482 ? 6.937   -44.688 26.413  1.00 41.27  ? 528  ASP B OD2 1 
ATOM   7279  N  N   . VAL B 1 483 ? 10.479  -42.219 26.766  1.00 39.08  ? 529  VAL B N   1 
ATOM   7280  C  CA  . VAL B 1 483 ? 10.481  -40.815 26.366  1.00 38.82  ? 529  VAL B CA  1 
ATOM   7281  C  C   . VAL B 1 483 ? 11.427  -40.600 25.177  1.00 38.95  ? 529  VAL B C   1 
ATOM   7282  O  O   . VAL B 1 483 ? 10.987  -40.127 24.125  1.00 38.81  ? 529  VAL B O   1 
ATOM   7283  C  CB  . VAL B 1 483 ? 10.801  -39.875 27.562  1.00 38.80  ? 529  VAL B CB  1 
ATOM   7284  C  CG1 . VAL B 1 483 ? 11.101  -38.456 27.087  1.00 38.11  ? 529  VAL B CG1 1 
ATOM   7285  C  CG2 . VAL B 1 483 ? 9.634   -39.871 28.552  1.00 38.11  ? 529  VAL B CG2 1 
ATOM   7286  N  N   . ASP B 1 484 ? 12.695  -40.993 25.325  1.00 38.96  ? 530  ASP B N   1 
ATOM   7287  C  CA  . ASP B 1 484 ? 13.685  -40.793 24.259  1.00 39.40  ? 530  ASP B CA  1 
ATOM   7288  C  C   . ASP B 1 484 ? 13.291  -41.435 22.914  1.00 39.48  ? 530  ASP B C   1 
ATOM   7289  O  O   . ASP B 1 484 ? 13.377  -40.775 21.869  1.00 39.35  ? 530  ASP B O   1 
ATOM   7290  C  CB  . ASP B 1 484 ? 15.101  -41.187 24.714  1.00 39.56  ? 530  ASP B CB  1 
ATOM   7291  C  CG  . ASP B 1 484 ? 15.672  -40.222 25.760  1.00 40.99  ? 530  ASP B CG  1 
ATOM   7292  O  OD1 . ASP B 1 484 ? 15.054  -39.165 26.027  1.00 42.84  ? 530  ASP B OD1 1 
ATOM   7293  O  OD2 . ASP B 1 484 ? 16.747  -40.513 26.322  1.00 41.43  ? 530  ASP B OD2 1 
ATOM   7294  N  N   . ARG B 1 485 ? 12.826  -42.688 22.945  1.00 39.56  ? 531  ARG B N   1 
ATOM   7295  C  CA  . ARG B 1 485 ? 12.411  -43.388 21.722  1.00 39.88  ? 531  ARG B CA  1 
ATOM   7296  C  C   . ARG B 1 485 ? 11.337  -42.594 20.994  1.00 39.82  ? 531  ARG B C   1 
ATOM   7297  O  O   . ARG B 1 485 ? 11.356  -42.492 19.760  1.00 40.20  ? 531  ARG B O   1 
ATOM   7298  C  CB  . ARG B 1 485 ? 11.864  -44.790 22.014  1.00 40.20  ? 531  ARG B CB  1 
ATOM   7299  C  CG  . ARG B 1 485 ? 12.772  -45.687 22.840  1.00 41.51  ? 531  ARG B CG  1 
ATOM   7300  C  CD  . ARG B 1 485 ? 13.280  -46.923 22.099  1.00 42.80  ? 531  ARG B CD  1 
ATOM   7301  N  NE  . ARG B 1 485 ? 13.960  -47.810 23.050  1.00 44.99  ? 531  ARG B NE  1 
ATOM   7302  C  CZ  . ARG B 1 485 ? 15.227  -48.223 22.965  1.00 45.64  ? 531  ARG B CZ  1 
ATOM   7303  N  NH1 . ARG B 1 485 ? 15.990  -47.867 21.934  1.00 47.08  ? 531  ARG B NH1 1 
ATOM   7304  N  NH2 . ARG B 1 485 ? 15.727  -49.017 23.907  1.00 44.64  ? 531  ARG B NH2 1 
ATOM   7305  N  N   . ARG B 1 486 ? 10.403  -42.035 21.761  1.00 39.43  ? 532  ARG B N   1 
ATOM   7306  C  CA  . ARG B 1 486 ? 9.323   -41.222 21.193  1.00 38.91  ? 532  ARG B CA  1 
ATOM   7307  C  C   . ARG B 1 486 ? 9.834   -39.941 20.526  1.00 38.62  ? 532  ARG B C   1 
ATOM   7308  O  O   . ARG B 1 486 ? 9.493   -39.653 19.385  1.00 38.55  ? 532  ARG B O   1 
ATOM   7309  C  CB  . ARG B 1 486 ? 8.286   -40.901 22.265  1.00 39.00  ? 532  ARG B CB  1 
ATOM   7310  C  CG  . ARG B 1 486 ? 7.360   -42.055 22.553  1.00 38.19  ? 532  ARG B CG  1 
ATOM   7311  C  CD  . ARG B 1 486 ? 6.269   -41.646 23.503  1.00 37.42  ? 532  ARG B CD  1 
ATOM   7312  N  NE  . ARG B 1 486 ? 6.674   -41.805 24.897  1.00 38.53  ? 532  ARG B NE  1 
ATOM   7313  C  CZ  . ARG B 1 486 ? 5.902   -41.515 25.944  1.00 38.17  ? 532  ARG B CZ  1 
ATOM   7314  N  NH1 . ARG B 1 486 ? 4.681   -41.033 25.773  1.00 37.12  ? 532  ARG B NH1 1 
ATOM   7315  N  NH2 . ARG B 1 486 ? 6.354   -41.698 27.170  1.00 37.51  ? 532  ARG B NH2 1 
ATOM   7316  N  N   . VAL B 1 487 ? 10.659  -39.184 21.241  1.00 38.37  ? 533  VAL B N   1 
ATOM   7317  C  CA  . VAL B 1 487 ? 11.330  -38.010 20.676  1.00 38.16  ? 533  VAL B CA  1 
ATOM   7318  C  C   . VAL B 1 487 ? 12.104  -38.404 19.416  1.00 38.52  ? 533  VAL B C   1 
ATOM   7319  O  O   . VAL B 1 487 ? 11.931  -37.796 18.362  1.00 38.01  ? 533  VAL B O   1 
ATOM   7320  C  CB  . VAL B 1 487 ? 12.291  -37.352 21.706  1.00 38.09  ? 533  VAL B CB  1 
ATOM   7321  C  CG1 . VAL B 1 487 ? 13.151  -36.269 21.055  1.00 37.84  ? 533  VAL B CG1 1 
ATOM   7322  C  CG2 . VAL B 1 487 ? 11.514  -36.799 22.893  1.00 36.92  ? 533  VAL B CG2 1 
ATOM   7323  N  N   . GLN B 1 488 ? 12.955  -39.423 19.530  1.00 39.18  ? 534  GLN B N   1 
ATOM   7324  C  CA  . GLN B 1 488 ? 13.643  -39.966 18.358  1.00 40.06  ? 534  GLN B CA  1 
ATOM   7325  C  C   . GLN B 1 488 ? 12.659  -40.312 17.216  1.00 40.10  ? 534  GLN B C   1 
ATOM   7326  O  O   . GLN B 1 488 ? 12.870  -39.919 16.058  1.00 40.26  ? 534  GLN B O   1 
ATOM   7327  C  CB  . GLN B 1 488 ? 14.501  -41.163 18.755  1.00 40.37  ? 534  GLN B CB  1 
ATOM   7328  C  CG  . GLN B 1 488 ? 16.043  -40.933 18.773  1.00 42.68  ? 534  GLN B CG  1 
ATOM   7329  C  CD  . GLN B 1 488 ? 16.519  -39.642 19.469  1.00 45.31  ? 534  GLN B CD  1 
ATOM   7330  O  OE1 . GLN B 1 488 ? 16.738  -39.610 20.686  1.00 46.25  ? 534  GLN B OE1 1 
ATOM   7331  N  NE2 . GLN B 1 488 ? 16.728  -38.593 18.677  1.00 46.67  ? 534  GLN B NE2 1 
ATOM   7332  N  N   . PHE B 1 489 ? 11.567  -41.000 17.552  1.00 40.12  ? 535  PHE B N   1 
ATOM   7333  C  CA  . PHE B 1 489 ? 10.525  -41.325 16.567  1.00 39.98  ? 535  PHE B CA  1 
ATOM   7334  C  C   . PHE B 1 489 ? 10.096  -40.090 15.803  1.00 39.91  ? 535  PHE B C   1 
ATOM   7335  O  O   . PHE B 1 489 ? 10.041  -40.124 14.578  1.00 39.75  ? 535  PHE B O   1 
ATOM   7336  C  CB  . PHE B 1 489 ? 9.304   -41.997 17.221  1.00 40.07  ? 535  PHE B CB  1 
ATOM   7337  C  CG  . PHE B 1 489 ? 8.196   -42.323 16.256  1.00 40.01  ? 535  PHE B CG  1 
ATOM   7338  C  CD1 . PHE B 1 489 ? 8.388   -43.272 15.248  1.00 40.68  ? 535  PHE B CD1 1 
ATOM   7339  C  CD2 . PHE B 1 489 ? 6.961   -41.697 16.353  1.00 39.99  ? 535  PHE B CD2 1 
ATOM   7340  C  CE1 . PHE B 1 489 ? 7.360   -43.584 14.341  1.00 40.64  ? 535  PHE B CE1 1 
ATOM   7341  C  CE2 . PHE B 1 489 ? 5.930   -42.008 15.457  1.00 39.63  ? 535  PHE B CE2 1 
ATOM   7342  C  CZ  . PHE B 1 489 ? 6.132   -42.953 14.452  1.00 39.37  ? 535  PHE B CZ  1 
ATOM   7343  N  N   . GLY B 1 490 ? 9.808   -39.010 16.534  1.00 40.00  ? 536  GLY B N   1 
ATOM   7344  C  CA  . GLY B 1 490 ? 9.389   -37.728 15.944  1.00 39.85  ? 536  GLY B CA  1 
ATOM   7345  C  C   . GLY B 1 490 ? 10.415  -37.211 14.954  1.00 40.01  ? 536  GLY B C   1 
ATOM   7346  O  O   . GLY B 1 490 ? 10.073  -36.831 13.834  1.00 39.61  ? 536  GLY B O   1 
ATOM   7347  N  N   . ILE B 1 491 ? 11.683  -37.232 15.369  1.00 40.29  ? 537  ILE B N   1 
ATOM   7348  C  CA  . ILE B 1 491 ? 12.814  -36.812 14.521  1.00 40.67  ? 537  ILE B CA  1 
ATOM   7349  C  C   . ILE B 1 491 ? 12.870  -37.588 13.205  1.00 41.12  ? 537  ILE B C   1 
ATOM   7350  O  O   . ILE B 1 491 ? 12.840  -36.994 12.119  1.00 40.89  ? 537  ILE B O   1 
ATOM   7351  C  CB  . ILE B 1 491 ? 14.169  -36.936 15.261  1.00 40.40  ? 537  ILE B CB  1 
ATOM   7352  C  CG1 . ILE B 1 491 ? 14.318  -35.800 16.271  1.00 40.77  ? 537  ILE B CG1 1 
ATOM   7353  C  CG2 . ILE B 1 491 ? 15.324  -36.910 14.278  1.00 40.27  ? 537  ILE B CG2 1 
ATOM   7354  C  CD1 . ILE B 1 491 ? 15.471  -35.973 17.226  1.00 40.78  ? 537  ILE B CD1 1 
ATOM   7355  N  N   . GLU B 1 492 ? 12.935  -38.909 13.314  1.00 41.66  ? 538  GLU B N   1 
ATOM   7356  C  CA  . GLU B 1 492 ? 12.951  -39.757 12.147  1.00 42.62  ? 538  GLU B CA  1 
ATOM   7357  C  C   . GLU B 1 492 ? 11.759  -39.449 11.235  1.00 42.70  ? 538  GLU B C   1 
ATOM   7358  O  O   . GLU B 1 492 ? 11.958  -39.089 10.080  1.00 43.30  ? 538  GLU B O   1 
ATOM   7359  C  CB  . GLU B 1 492 ? 12.940  -41.209 12.582  1.00 43.06  ? 538  GLU B CB  1 
ATOM   7360  C  CG  . GLU B 1 492 ? 13.893  -42.097 11.827  1.00 45.37  ? 538  GLU B CG  1 
ATOM   7361  C  CD  . GLU B 1 492 ? 13.941  -43.489 12.422  1.00 48.62  ? 538  GLU B CD  1 
ATOM   7362  O  OE1 . GLU B 1 492 ? 14.234  -43.596 13.636  1.00 49.25  ? 538  GLU B OE1 1 
ATOM   7363  O  OE2 . GLU B 1 492 ? 13.680  -44.471 11.679  1.00 49.93  ? 538  GLU B OE2 1 
ATOM   7364  N  N   . SER B 1 493 ? 10.530  -39.549 11.745  1.00 42.70  ? 539  SER B N   1 
ATOM   7365  C  CA  . SER B 1 493 ? 9.344   -39.213 10.937  1.00 42.97  ? 539  SER B CA  1 
ATOM   7366  C  C   . SER B 1 493 ? 9.565   -37.853 10.294  1.00 43.15  ? 539  SER B C   1 
ATOM   7367  O  O   . SER B 1 493 ? 9.290   -37.652 9.104   1.00 43.34  ? 539  SER B O   1 
ATOM   7368  C  CB  . SER B 1 493 ? 8.079   -39.166 11.796  1.00 42.61  ? 539  SER B CB  1 
ATOM   7369  O  OG  . SER B 1 493 ? 8.194   -40.035 12.910  1.00 43.35  ? 539  SER B OG  1 
ATOM   7370  N  N   . GLY B 1 494 ? 10.094  -36.937 11.109  1.00 43.36  ? 540  GLY B N   1 
ATOM   7371  C  CA  . GLY B 1 494 ? 10.462  -35.604 10.674  1.00 43.28  ? 540  GLY B CA  1 
ATOM   7372  C  C   . GLY B 1 494 ? 11.341  -35.675 9.450   1.00 43.28  ? 540  GLY B C   1 
ATOM   7373  O  O   . GLY B 1 494 ? 10.933  -35.235 8.365   1.00 43.53  ? 540  GLY B O   1 
ATOM   7374  N  N   . LYS B 1 495 ? 12.531  -36.258 9.613   1.00 43.18  ? 541  LYS B N   1 
ATOM   7375  C  CA  . LYS B 1 495 ? 13.478  -36.405 8.505   1.00 43.26  ? 541  LYS B CA  1 
ATOM   7376  C  C   . LYS B 1 495 ? 12.765  -36.911 7.255   1.00 43.92  ? 541  LYS B C   1 
ATOM   7377  O  O   . LYS B 1 495 ? 12.811  -36.254 6.204   1.00 44.11  ? 541  LYS B O   1 
ATOM   7378  C  CB  . LYS B 1 495 ? 14.645  -37.308 8.891   1.00 42.85  ? 541  LYS B CB  1 
ATOM   7379  C  CG  . LYS B 1 495 ? 15.783  -36.549 9.563   1.00 42.72  ? 541  LYS B CG  1 
ATOM   7380  C  CD  . LYS B 1 495 ? 16.529  -37.386 10.595  1.00 43.36  ? 541  LYS B CD  1 
ATOM   7381  C  CE  . LYS B 1 495 ? 17.951  -37.702 10.154  1.00 43.83  ? 541  LYS B CE  1 
ATOM   7382  N  NZ  . LYS B 1 495 ? 18.798  -38.258 11.268  1.00 42.44  ? 541  LYS B NZ  1 
ATOM   7383  N  N   . LEU B 1 496 ? 12.046  -38.032 7.405   1.00 44.52  ? 542  LEU B N   1 
ATOM   7384  C  CA  . LEU B 1 496 ? 11.416  -38.739 6.290   1.00 44.91  ? 542  LEU B CA  1 
ATOM   7385  C  C   . LEU B 1 496 ? 10.468  -37.867 5.467   1.00 45.32  ? 542  LEU B C   1 
ATOM   7386  O  O   . LEU B 1 496 ? 10.467  -37.954 4.236   1.00 45.74  ? 542  LEU B O   1 
ATOM   7387  C  CB  . LEU B 1 496 ? 10.667  -39.980 6.778   1.00 44.90  ? 542  LEU B CB  1 
ATOM   7388  C  CG  . LEU B 1 496 ? 10.540  -41.185 5.825   1.00 45.80  ? 542  LEU B CG  1 
ATOM   7389  C  CD1 . LEU B 1 496 ? 9.091   -41.688 5.808   1.00 45.03  ? 542  LEU B CD1 1 
ATOM   7390  C  CD2 . LEU B 1 496 ? 11.002  -40.909 4.371   1.00 47.29  ? 542  LEU B CD2 1 
ATOM   7391  N  N   . ARG B 1 497 ? 9.667   -37.036 6.124   1.00 45.35  ? 543  ARG B N   1 
ATOM   7392  C  CA  . ARG B 1 497 ? 8.679   -36.261 5.384   1.00 45.60  ? 543  ARG B CA  1 
ATOM   7393  C  C   . ARG B 1 497 ? 9.250   -34.914 4.939   1.00 46.06  ? 543  ARG B C   1 
ATOM   7394  O  O   . ARG B 1 497 ? 8.508   -34.047 4.426   1.00 46.18  ? 543  ARG B O   1 
ATOM   7395  C  CB  . ARG B 1 497 ? 7.420   -36.054 6.215   1.00 45.42  ? 543  ARG B CB  1 
ATOM   7396  C  CG  . ARG B 1 497 ? 7.139   -37.195 7.150   1.00 45.32  ? 543  ARG B CG  1 
ATOM   7397  C  CD  . ARG B 1 497 ? 5.892   -36.924 7.908   1.00 46.10  ? 543  ARG B CD  1 
ATOM   7398  N  NE  . ARG B 1 497 ? 5.385   -38.124 8.551   1.00 46.22  ? 543  ARG B NE  1 
ATOM   7399  C  CZ  . ARG B 1 497 ? 4.118   -38.263 8.950   1.00 45.47  ? 543  ARG B CZ  1 
ATOM   7400  N  NH1 . ARG B 1 497 ? 3.259   -37.258 8.752   1.00 42.34  ? 543  ARG B NH1 1 
ATOM   7401  N  NH2 . ARG B 1 497 ? 3.711   -39.395 9.541   1.00 43.23  ? 543  ARG B NH2 1 
ATOM   7402  N  N   . GLY B 1 498 ? 10.560  -34.735 5.129   1.00 45.95  ? 544  GLY B N   1 
ATOM   7403  C  CA  . GLY B 1 498 ? 11.192  -33.437 4.842   1.00 46.16  ? 544  GLY B CA  1 
ATOM   7404  C  C   . GLY B 1 498 ? 10.700  -32.237 5.677   1.00 46.07  ? 544  GLY B C   1 
ATOM   7405  O  O   . GLY B 1 498 ? 10.558  -31.121 5.160   1.00 46.37  ? 544  GLY B O   1 
ATOM   7406  N  N   . PHE B 1 499 ? 10.429  -32.459 6.965   1.00 45.81  ? 545  PHE B N   1 
ATOM   7407  C  CA  . PHE B 1 499 ? 10.215  -31.344 7.907   1.00 45.34  ? 545  PHE B CA  1 
ATOM   7408  C  C   . PHE B 1 499 ? 11.522  -30.855 8.511   1.00 45.23  ? 545  PHE B C   1 
ATOM   7409  O  O   . PHE B 1 499 ? 11.606  -29.704 8.912   1.00 45.54  ? 545  PHE B O   1 
ATOM   7410  C  CB  . PHE B 1 499 ? 9.332   -31.752 9.086   1.00 45.22  ? 545  PHE B CB  1 
ATOM   7411  C  CG  . PHE B 1 499 ? 7.938   -32.134 8.719   1.00 43.97  ? 545  PHE B CG  1 
ATOM   7412  C  CD1 . PHE B 1 499 ? 7.218   -32.965 9.566   1.00 43.13  ? 545  PHE B CD1 1 
ATOM   7413  C  CD2 . PHE B 1 499 ? 7.342   -31.678 7.547   1.00 44.12  ? 545  PHE B CD2 1 
ATOM   7414  C  CE1 . PHE B 1 499 ? 5.910   -33.333 9.259   1.00 43.45  ? 545  PHE B CE1 1 
ATOM   7415  C  CE2 . PHE B 1 499 ? 6.034   -32.045 7.227   1.00 46.24  ? 545  PHE B CE2 1 
ATOM   7416  C  CZ  . PHE B 1 499 ? 5.313   -32.867 8.086   1.00 44.22  ? 545  PHE B CZ  1 
ATOM   7417  N  N   . LEU B 1 500 ? 12.514  -31.746 8.617   1.00 44.91  ? 546  LEU B N   1 
ATOM   7418  C  CA  . LEU B 1 500 ? 13.786  -31.446 9.278   1.00 44.62  ? 546  LEU B CA  1 
ATOM   7419  C  C   . LEU B 1 500 ? 14.907  -32.079 8.507   1.00 45.09  ? 546  LEU B C   1 
ATOM   7420  O  O   . LEU B 1 500 ? 14.809  -33.235 8.077   1.00 45.22  ? 546  LEU B O   1 
ATOM   7421  C  CB  . LEU B 1 500 ? 13.840  -32.019 10.698  1.00 44.39  ? 546  LEU B CB  1 
ATOM   7422  C  CG  . LEU B 1 500 ? 12.557  -32.441 11.408  1.00 43.63  ? 546  LEU B CG  1 
ATOM   7423  C  CD1 . LEU B 1 500 ? 12.900  -33.257 12.632  1.00 42.01  ? 546  LEU B CD1 1 
ATOM   7424  C  CD2 . LEU B 1 500 ? 11.710  -31.229 11.767  1.00 44.44  ? 546  LEU B CD2 1 
ATOM   7425  N  N   . ARG B 1 501 ? 15.989  -31.322 8.361   1.00 45.56  ? 547  ARG B N   1 
ATOM   7426  C  CA  . ARG B 1 501 ? 17.173  -31.784 7.653   1.00 45.60  ? 547  ARG B CA  1 
ATOM   7427  C  C   . ARG B 1 501 ? 18.318  -31.776 8.636   1.00 45.59  ? 547  ARG B C   1 
ATOM   7428  O  O   . ARG B 1 501 ? 18.288  -31.014 9.600   1.00 46.04  ? 547  ARG B O   1 
ATOM   7429  C  CB  . ARG B 1 501 ? 17.477  -30.846 6.482   1.00 45.92  ? 547  ARG B CB  1 
ATOM   7430  C  CG  . ARG B 1 501 ? 16.566  -31.022 5.248   1.00 46.98  ? 547  ARG B CG  1 
ATOM   7431  C  CD  . ARG B 1 501 ? 16.668  -32.466 4.712   1.00 50.82  ? 547  ARG B CD  1 
ATOM   7432  N  NE  . ARG B 1 501 ? 17.148  -32.560 3.321   1.00 52.14  ? 547  ARG B NE  1 
ATOM   7433  C  CZ  . ARG B 1 501 ? 18.400  -32.895 2.957   1.00 52.66  ? 547  ARG B CZ  1 
ATOM   7434  N  NH1 . ARG B 1 501 ? 19.334  -33.173 3.869   1.00 51.30  ? 547  ARG B NH1 1 
ATOM   7435  N  NH2 . ARG B 1 501 ? 18.721  -32.957 1.664   1.00 52.99  ? 547  ARG B NH2 1 
ATOM   7436  N  N   . VAL B 1 502 ? 19.314  -32.632 8.409   1.00 45.24  ? 548  VAL B N   1 
ATOM   7437  C  CA  . VAL B 1 502 ? 20.561  -32.641 9.183   1.00 44.80  ? 548  VAL B CA  1 
ATOM   7438  C  C   . VAL B 1 502 ? 21.045  -31.198 9.370   1.00 44.66  ? 548  VAL B C   1 
ATOM   7439  O  O   . VAL B 1 502 ? 20.885  -30.351 8.461   1.00 44.68  ? 548  VAL B O   1 
ATOM   7440  C  CB  . VAL B 1 502 ? 21.671  -33.426 8.439   1.00 45.07  ? 548  VAL B CB  1 
ATOM   7441  C  CG1 . VAL B 1 502 ? 22.635  -34.105 9.430   1.00 45.25  ? 548  VAL B CG1 1 
ATOM   7442  C  CG2 . VAL B 1 502 ? 21.064  -34.462 7.464   1.00 44.97  ? 548  VAL B CG2 1 
ATOM   7443  N  N   . GLY B 1 503 ? 21.617  -30.909 10.541  1.00 44.20  ? 549  GLY B N   1 
ATOM   7444  C  CA  . GLY B 1 503 ? 22.033  -29.539 10.871  1.00 43.45  ? 549  GLY B CA  1 
ATOM   7445  C  C   . GLY B 1 503 ? 20.940  -28.577 11.376  1.00 42.81  ? 549  GLY B C   1 
ATOM   7446  O  O   . GLY B 1 503 ? 21.276  -27.536 11.959  1.00 42.98  ? 549  GLY B O   1 
ATOM   7447  N  N   . ASP B 1 504 ? 19.654  -28.889 11.155  1.00 41.52  ? 550  ASP B N   1 
ATOM   7448  C  CA  . ASP B 1 504 ? 18.572  -28.111 11.781  1.00 40.79  ? 550  ASP B CA  1 
ATOM   7449  C  C   . ASP B 1 504 ? 18.677  -28.172 13.298  1.00 39.77  ? 550  ASP B C   1 
ATOM   7450  O  O   . ASP B 1 504 ? 19.292  -29.096 13.862  1.00 39.48  ? 550  ASP B O   1 
ATOM   7451  C  CB  . ASP B 1 504 ? 17.178  -28.608 11.378  1.00 41.32  ? 550  ASP B CB  1 
ATOM   7452  C  CG  . ASP B 1 504 ? 16.887  -28.401 9.915   1.00 42.65  ? 550  ASP B CG  1 
ATOM   7453  O  OD1 . ASP B 1 504 ? 17.850  -28.190 9.149   1.00 45.60  ? 550  ASP B OD1 1 
ATOM   7454  O  OD2 . ASP B 1 504 ? 15.706  -28.470 9.523   1.00 44.04  ? 550  ASP B OD2 1 
ATOM   7455  N  N   . LEU B 1 505 ? 18.108  -27.161 13.947  1.00 38.61  ? 551  LEU B N   1 
ATOM   7456  C  CA  . LEU B 1 505 ? 17.888  -27.206 15.375  1.00 37.68  ? 551  LEU B CA  1 
ATOM   7457  C  C   . LEU B 1 505 ? 16.429  -27.584 15.569  1.00 37.07  ? 551  LEU B C   1 
ATOM   7458  O  O   . LEU B 1 505 ? 15.570  -27.285 14.724  1.00 37.04  ? 551  LEU B O   1 
ATOM   7459  C  CB  . LEU B 1 505 ? 18.186  -25.857 16.018  1.00 37.38  ? 551  LEU B CB  1 
ATOM   7460  C  CG  . LEU B 1 505 ? 19.652  -25.487 16.198  1.00 37.05  ? 551  LEU B CG  1 
ATOM   7461  C  CD1 . LEU B 1 505 ? 19.773  -24.076 16.728  1.00 37.17  ? 551  LEU B CD1 1 
ATOM   7462  C  CD2 . LEU B 1 505 ? 20.364  -26.435 17.133  1.00 37.14  ? 551  LEU B CD2 1 
ATOM   7463  N  N   . VAL B 1 506 ? 16.140  -28.247 16.672  1.00 36.30  ? 552  VAL B N   1 
ATOM   7464  C  CA  . VAL B 1 506 ? 14.774  -28.595 16.953  1.00 35.93  ? 552  VAL B CA  1 
ATOM   7465  C  C   . VAL B 1 506 ? 14.539  -28.359 18.425  1.00 35.32  ? 552  VAL B C   1 
ATOM   7466  O  O   . VAL B 1 506 ? 15.475  -28.468 19.232  1.00 34.93  ? 552  VAL B O   1 
ATOM   7467  C  CB  . VAL B 1 506 ? 14.477  -30.063 16.520  1.00 36.08  ? 552  VAL B CB  1 
ATOM   7468  C  CG1 . VAL B 1 506 ? 14.542  -31.026 17.695  1.00 35.47  ? 552  VAL B CG1 1 
ATOM   7469  C  CG2 . VAL B 1 506 ? 13.150  -30.146 15.841  1.00 37.61  ? 552  VAL B CG2 1 
ATOM   7470  N  N   . ILE B 1 507 ? 13.299  -28.007 18.760  1.00 35.02  ? 553  ILE B N   1 
ATOM   7471  C  CA  . ILE B 1 507 ? 12.926  -27.772 20.150  1.00 34.83  ? 553  ILE B CA  1 
ATOM   7472  C  C   . ILE B 1 507 ? 12.105  -28.948 20.609  1.00 34.94  ? 553  ILE B C   1 
ATOM   7473  O  O   . ILE B 1 507 ? 11.132  -29.302 19.970  1.00 35.53  ? 553  ILE B O   1 
ATOM   7474  C  CB  . ILE B 1 507 ? 12.108  -26.471 20.329  1.00 34.60  ? 553  ILE B CB  1 
ATOM   7475  C  CG1 . ILE B 1 507 ? 12.809  -25.278 19.672  1.00 33.66  ? 553  ILE B CG1 1 
ATOM   7476  C  CG2 . ILE B 1 507 ? 11.823  -26.195 21.813  1.00 34.68  ? 553  ILE B CG2 1 
ATOM   7477  C  CD1 . ILE B 1 507 ? 14.145  -24.889 20.286  1.00 32.21  ? 553  ILE B CD1 1 
ATOM   7478  N  N   . VAL B 1 508 ? 12.497  -29.554 21.717  1.00 34.80  ? 554  VAL B N   1 
ATOM   7479  C  CA  . VAL B 1 508 ? 11.786  -30.713 22.232  1.00 34.46  ? 554  VAL B CA  1 
ATOM   7480  C  C   . VAL B 1 508 ? 11.076  -30.397 23.543  1.00 34.38  ? 554  VAL B C   1 
ATOM   7481  O  O   . VAL B 1 508 ? 11.693  -29.947 24.511  1.00 34.34  ? 554  VAL B O   1 
ATOM   7482  C  CB  . VAL B 1 508 ? 12.736  -31.908 22.442  1.00 34.44  ? 554  VAL B CB  1 
ATOM   7483  C  CG1 . VAL B 1 508 ? 11.949  -33.124 22.912  1.00 33.98  ? 554  VAL B CG1 1 
ATOM   7484  C  CG2 . VAL B 1 508 ? 13.508  -32.217 21.169  1.00 33.72  ? 554  VAL B CG2 1 
ATOM   7485  N  N   . VAL B 1 509 ? 9.775   -30.642 23.579  1.00 34.26  ? 555  VAL B N   1 
ATOM   7486  C  CA  . VAL B 1 509 ? 9.008   -30.377 24.792  1.00 34.56  ? 555  VAL B CA  1 
ATOM   7487  C  C   . VAL B 1 509 ? 8.513   -31.665 25.433  1.00 34.92  ? 555  VAL B C   1 
ATOM   7488  O  O   . VAL B 1 509 ? 7.789   -32.421 24.787  1.00 35.17  ? 555  VAL B O   1 
ATOM   7489  C  CB  . VAL B 1 509 ? 7.804   -29.462 24.494  1.00 34.46  ? 555  VAL B CB  1 
ATOM   7490  C  CG1 . VAL B 1 509 ? 6.916   -29.331 25.715  1.00 34.80  ? 555  VAL B CG1 1 
ATOM   7491  C  CG2 . VAL B 1 509 ? 8.267   -28.101 24.040  1.00 33.47  ? 555  VAL B CG2 1 
ATOM   7492  N  N   . THR B 1 510 ? 8.889   -31.912 26.693  1.00 35.29  ? 556  THR B N   1 
ATOM   7493  C  CA  . THR B 1 510 ? 8.455   -33.126 27.425  1.00 35.36  ? 556  THR B CA  1 
ATOM   7494  C  C   . THR B 1 510 ? 7.985   -32.838 28.867  1.00 35.52  ? 556  THR B C   1 
ATOM   7495  O  O   . THR B 1 510 ? 7.627   -31.711 29.191  1.00 35.96  ? 556  THR B O   1 
ATOM   7496  C  CB  . THR B 1 510 ? 9.572   -34.184 27.479  1.00 35.25  ? 556  THR B CB  1 
ATOM   7497  O  OG1 . THR B 1 510 ? 10.720  -33.612 28.114  1.00 36.63  ? 556  THR B OG1 1 
ATOM   7498  C  CG2 . THR B 1 510 ? 9.961   -34.644 26.093  1.00 34.91  ? 556  THR B CG2 1 
ATOM   7499  N  N   . GLY B 1 511 ? 7.990   -33.856 29.730  1.00 35.62  ? 557  GLY B N   1 
ATOM   7500  C  CA  . GLY B 1 511 ? 7.538   -33.696 31.115  1.00 35.35  ? 557  GLY B CA  1 
ATOM   7501  C  C   . GLY B 1 511 ? 8.333   -34.473 32.154  1.00 35.56  ? 557  GLY B C   1 
ATOM   7502  O  O   . GLY B 1 511 ? 9.121   -35.370 31.823  1.00 35.47  ? 557  GLY B O   1 
ATOM   7503  N  N   . TRP B 1 512 ? 8.123   -34.130 33.426  1.00 35.53  ? 558  TRP B N   1 
ATOM   7504  C  CA  . TRP B 1 512 ? 8.915   -34.708 34.512  1.00 35.44  ? 558  TRP B CA  1 
ATOM   7505  C  C   . TRP B 1 512 ? 8.426   -36.075 34.971  1.00 35.69  ? 558  TRP B C   1 
ATOM   7506  O  O   . TRP B 1 512 ? 9.193   -36.835 35.565  1.00 35.46  ? 558  TRP B O   1 
ATOM   7507  C  CB  . TRP B 1 512 ? 9.069   -33.732 35.695  1.00 35.32  ? 558  TRP B CB  1 
ATOM   7508  C  CG  . TRP B 1 512 ? 7.803   -33.392 36.466  1.00 35.33  ? 558  TRP B CG  1 
ATOM   7509  C  CD1 . TRP B 1 512 ? 6.885   -32.430 36.147  1.00 36.02  ? 558  TRP B CD1 1 
ATOM   7510  C  CD2 . TRP B 1 512 ? 7.345   -33.989 37.696  1.00 35.92  ? 558  TRP B CD2 1 
ATOM   7511  N  NE1 . TRP B 1 512 ? 5.881   -32.401 37.087  1.00 36.24  ? 558  TRP B NE1 1 
ATOM   7512  C  CE2 . TRP B 1 512 ? 6.139   -33.345 38.048  1.00 35.97  ? 558  TRP B CE2 1 
ATOM   7513  C  CE3 . TRP B 1 512 ? 7.827   -35.018 38.523  1.00 37.05  ? 558  TRP B CE3 1 
ATOM   7514  C  CZ2 . TRP B 1 512 ? 5.406   -33.693 39.196  1.00 36.70  ? 558  TRP B CZ2 1 
ATOM   7515  C  CZ3 . TRP B 1 512 ? 7.100   -35.357 39.669  1.00 36.55  ? 558  TRP B CZ3 1 
ATOM   7516  C  CH2 . TRP B 1 512 ? 5.903   -34.694 39.991  1.00 36.24  ? 558  TRP B CH2 1 
ATOM   7517  N  N   . ARG B 1 513 ? 7.161   -36.392 34.695  1.00 36.02  ? 559  ARG B N   1 
ATOM   7518  C  CA  . ARG B 1 513 ? 6.608   -37.709 35.043  1.00 36.57  ? 559  ARG B CA  1 
ATOM   7519  C  C   . ARG B 1 513 ? 5.488   -38.101 34.072  1.00 36.59  ? 559  ARG B C   1 
ATOM   7520  O  O   . ARG B 1 513 ? 4.970   -37.248 33.367  1.00 36.56  ? 559  ARG B O   1 
ATOM   7521  C  CB  . ARG B 1 513 ? 6.151   -37.747 36.518  1.00 36.70  ? 559  ARG B CB  1 
ATOM   7522  C  CG  . ARG B 1 513 ? 5.091   -36.720 36.881  1.00 37.71  ? 559  ARG B CG  1 
ATOM   7523  C  CD  . ARG B 1 513 ? 3.702   -37.279 36.666  1.00 39.51  ? 559  ARG B CD  1 
ATOM   7524  N  NE  . ARG B 1 513 ? 3.071   -37.600 37.935  1.00 40.65  ? 559  ARG B NE  1 
ATOM   7525  C  CZ  . ARG B 1 513 ? 1.940   -38.286 38.070  1.00 40.71  ? 559  ARG B CZ  1 
ATOM   7526  N  NH1 . ARG B 1 513 ? 1.290   -38.763 37.008  1.00 38.23  ? 559  ARG B NH1 1 
ATOM   7527  N  NH2 . ARG B 1 513 ? 1.465   -38.506 39.285  1.00 41.62  ? 559  ARG B NH2 1 
ATOM   7528  N  N   . PRO B 1 514 ? 5.118   -39.396 34.035  1.00 36.77  ? 560  PRO B N   1 
ATOM   7529  C  CA  . PRO B 1 514 ? 4.091   -39.893 33.111  1.00 36.68  ? 560  PRO B CA  1 
ATOM   7530  C  C   . PRO B 1 514 ? 2.685   -39.453 33.481  1.00 36.94  ? 560  PRO B C   1 
ATOM   7531  O  O   . PRO B 1 514 ? 2.456   -38.931 34.572  1.00 36.89  ? 560  PRO B O   1 
ATOM   7532  C  CB  . PRO B 1 514 ? 4.195   -41.409 33.238  1.00 36.21  ? 560  PRO B CB  1 
ATOM   7533  C  CG  . PRO B 1 514 ? 5.466   -41.659 33.987  1.00 36.96  ? 560  PRO B CG  1 
ATOM   7534  C  CD  . PRO B 1 514 ? 5.659   -40.483 34.862  1.00 36.59  ? 560  PRO B CD  1 
ATOM   7535  N  N   . GLY B 1 515 ? 1.749   -39.672 32.564  1.00 37.36  ? 561  GLY B N   1 
ATOM   7536  C  CA  . GLY B 1 515 ? 0.383   -39.195 32.730  1.00 37.67  ? 561  GLY B CA  1 
ATOM   7537  C  C   . GLY B 1 515 ? 0.292   -37.807 32.144  1.00 37.96  ? 561  GLY B C   1 
ATOM   7538  O  O   . GLY B 1 515 ? 1.312   -37.158 31.936  1.00 39.00  ? 561  GLY B O   1 
ATOM   7539  N  N   . SER B 1 516 ? -0.915  -37.340 31.855  1.00 37.53  ? 562  SER B N   1 
ATOM   7540  C  CA  . SER B 1 516 ? -1.045  -36.050 31.220  1.00 36.96  ? 562  SER B CA  1 
ATOM   7541  C  C   . SER B 1 516 ? -1.049  -34.939 32.263  1.00 37.05  ? 562  SER B C   1 
ATOM   7542  O  O   . SER B 1 516 ? -1.217  -35.194 33.450  1.00 37.12  ? 562  SER B O   1 
ATOM   7543  C  CB  . SER B 1 516 ? -2.318  -35.996 30.399  1.00 36.80  ? 562  SER B CB  1 
ATOM   7544  O  OG  . SER B 1 516 ? -3.300  -35.293 31.119  1.00 37.33  ? 562  SER B OG  1 
ATOM   7545  N  N   . GLY B 1 517 ? -0.849  -33.705 31.805  1.00 37.43  ? 563  GLY B N   1 
ATOM   7546  C  CA  . GLY B 1 517 ? -0.924  -32.520 32.661  1.00 37.60  ? 563  GLY B CA  1 
ATOM   7547  C  C   . GLY B 1 517 ? 0.369   -32.046 33.311  1.00 37.61  ? 563  GLY B C   1 
ATOM   7548  O  O   . GLY B 1 517 ? 0.351   -31.079 34.074  1.00 37.72  ? 563  GLY B O   1 
ATOM   7549  N  N   . TYR B 1 518 ? 1.493   -32.701 33.017  1.00 37.50  ? 564  TYR B N   1 
ATOM   7550  C  CA  . TYR B 1 518 ? 2.746   -32.363 33.691  1.00 37.35  ? 564  TYR B CA  1 
ATOM   7551  C  C   . TYR B 1 518 ? 3.877   -31.919 32.761  1.00 36.60  ? 564  TYR B C   1 
ATOM   7552  O  O   . TYR B 1 518 ? 5.039   -31.945 33.159  1.00 35.89  ? 564  TYR B O   1 
ATOM   7553  C  CB  . TYR B 1 518 ? 3.216   -33.526 34.561  1.00 38.23  ? 564  TYR B CB  1 
ATOM   7554  C  CG  . TYR B 1 518 ? 2.232   -33.992 35.614  1.00 40.84  ? 564  TYR B CG  1 
ATOM   7555  C  CD1 . TYR B 1 518 ? 1.412   -35.099 35.387  1.00 44.31  ? 564  TYR B CD1 1 
ATOM   7556  C  CD2 . TYR B 1 518 ? 2.140   -33.345 36.845  1.00 42.05  ? 564  TYR B CD2 1 
ATOM   7557  C  CE1 . TYR B 1 518 ? 0.520   -35.537 36.348  1.00 44.64  ? 564  TYR B CE1 1 
ATOM   7558  C  CE2 . TYR B 1 518 ? 1.249   -33.776 37.812  1.00 44.31  ? 564  TYR B CE2 1 
ATOM   7559  C  CZ  . TYR B 1 518 ? 0.442   -34.872 37.556  1.00 45.34  ? 564  TYR B CZ  1 
ATOM   7560  O  OH  . TYR B 1 518 ? -0.446  -35.313 38.511  1.00 46.30  ? 564  TYR B OH  1 
ATOM   7561  N  N   . THR B 1 519 ? 3.552   -31.510 31.535  1.00 36.23  ? 565  THR B N   1 
ATOM   7562  C  CA  . THR B 1 519 ? 4.577   -30.981 30.635  1.00 35.88  ? 565  THR B CA  1 
ATOM   7563  C  C   . THR B 1 519 ? 5.280   -29.825 31.335  1.00 36.02  ? 565  THR B C   1 
ATOM   7564  O  O   . THR B 1 519 ? 4.620   -28.982 31.954  1.00 36.68  ? 565  THR B O   1 
ATOM   7565  C  CB  . THR B 1 519 ? 3.971   -30.469 29.326  1.00 35.95  ? 565  THR B CB  1 
ATOM   7566  O  OG1 . THR B 1 519 ? 3.416   -31.568 28.586  1.00 35.76  ? 565  THR B OG1 1 
ATOM   7567  C  CG2 . THR B 1 519 ? 5.028   -29.762 28.488  1.00 33.71  ? 565  THR B CG2 1 
ATOM   7568  N  N   . ASN B 1 520 ? 6.608   -29.785 31.265  1.00 35.48  ? 566  ASN B N   1 
ATOM   7569  C  CA  . ASN B 1 520 ? 7.360   -28.725 31.949  1.00 34.82  ? 566  ASN B CA  1 
ATOM   7570  C  C   . ASN B 1 520 ? 8.839   -28.586 31.570  1.00 34.60  ? 566  ASN B C   1 
ATOM   7571  O  O   . ASN B 1 520 ? 9.601   -27.909 32.268  1.00 34.67  ? 566  ASN B O   1 
ATOM   7572  C  CB  . ASN B 1 520 ? 7.219   -28.859 33.472  1.00 34.44  ? 566  ASN B CB  1 
ATOM   7573  C  CG  . ASN B 1 520 ? 8.258   -29.781 34.085  1.00 34.78  ? 566  ASN B CG  1 
ATOM   7574  O  OD1 . ASN B 1 520 ? 8.536   -30.870 33.571  1.00 33.86  ? 566  ASN B OD1 1 
ATOM   7575  N  ND2 . ASN B 1 520 ? 8.839   -29.345 35.200  1.00 33.76  ? 566  ASN B ND2 1 
ATOM   7576  N  N   . ILE B 1 521 ? 9.240   -29.218 30.468  1.00 34.43  ? 567  ILE B N   1 
ATOM   7577  C  CA  . ILE B 1 521 ? 10.639  -29.222 30.049  1.00 34.20  ? 567  ILE B CA  1 
ATOM   7578  C  C   . ILE B 1 521 ? 10.758  -28.791 28.607  1.00 34.46  ? 567  ILE B C   1 
ATOM   7579  O  O   . ILE B 1 521 ? 9.952   -29.170 27.756  1.00 34.63  ? 567  ILE B O   1 
ATOM   7580  C  CB  . ILE B 1 521 ? 11.295  -30.616 30.210  1.00 34.25  ? 567  ILE B CB  1 
ATOM   7581  C  CG1 . ILE B 1 521 ? 11.154  -31.123 31.651  1.00 33.80  ? 567  ILE B CG1 1 
ATOM   7582  C  CG2 . ILE B 1 521 ? 12.763  -30.587 29.790  1.00 34.16  ? 567  ILE B CG2 1 
ATOM   7583  C  CD1 . ILE B 1 521 ? 11.507  -32.568 31.833  1.00 33.68  ? 567  ILE B CD1 1 
ATOM   7584  N  N   . MET B 1 522 ? 11.789  -28.014 28.330  1.00 34.48  ? 568  MET B N   1 
ATOM   7585  C  CA  . MET B 1 522 ? 12.057  -27.564 26.985  1.00 34.59  ? 568  MET B CA  1 
ATOM   7586  C  C   . MET B 1 522 ? 13.536  -27.761 26.756  1.00 34.41  ? 568  MET B C   1 
ATOM   7587  O  O   . MET B 1 522 ? 14.347  -27.411 27.606  1.00 34.52  ? 568  MET B O   1 
ATOM   7588  C  CB  . MET B 1 522 ? 11.704  -26.087 26.876  1.00 34.81  ? 568  MET B CB  1 
ATOM   7589  C  CG  . MET B 1 522 ? 11.756  -25.531 25.494  1.00 36.16  ? 568  MET B CG  1 
ATOM   7590  S  SD  . MET B 1 522 ? 12.818  -24.087 25.425  1.00 38.82  ? 568  MET B SD  1 
ATOM   7591  C  CE  . MET B 1 522 ? 14.382  -24.836 25.028  1.00 38.09  ? 568  MET B CE  1 
ATOM   7592  N  N   . ARG B 1 523 ? 13.884  -28.336 25.614  1.00 34.49  ? 569  ARG B N   1 
ATOM   7593  C  CA  . ARG B 1 523 ? 15.270  -28.648 25.295  1.00 34.56  ? 569  ARG B CA  1 
ATOM   7594  C  C   . ARG B 1 523 ? 15.570  -28.271 23.871  1.00 34.24  ? 569  ARG B C   1 
ATOM   7595  O  O   . ARG B 1 523 ? 14.745  -28.433 22.983  1.00 33.77  ? 569  ARG B O   1 
ATOM   7596  C  CB  . ARG B 1 523 ? 15.556  -30.138 25.476  1.00 34.94  ? 569  ARG B CB  1 
ATOM   7597  C  CG  . ARG B 1 523 ? 15.468  -30.627 26.911  1.00 37.01  ? 569  ARG B CG  1 
ATOM   7598  C  CD  . ARG B 1 523 ? 15.951  -32.065 27.079  1.00 39.34  ? 569  ARG B CD  1 
ATOM   7599  N  NE  . ARG B 1 523 ? 14.949  -33.011 26.604  1.00 41.50  ? 569  ARG B NE  1 
ATOM   7600  C  CZ  . ARG B 1 523 ? 15.162  -33.934 25.676  1.00 42.92  ? 569  ARG B CZ  1 
ATOM   7601  N  NH1 . ARG B 1 523 ? 16.358  -34.063 25.115  1.00 43.33  ? 569  ARG B NH1 1 
ATOM   7602  N  NH2 . ARG B 1 523 ? 14.175  -34.738 25.316  1.00 42.97  ? 569  ARG B NH2 1 
ATOM   7603  N  N   . VAL B 1 524 ? 16.775  -27.775 23.660  1.00 34.43  ? 570  VAL B N   1 
ATOM   7604  C  CA  . VAL B 1 524 ? 17.240  -27.444 22.329  1.00 34.73  ? 570  VAL B CA  1 
ATOM   7605  C  C   . VAL B 1 524 ? 18.163  -28.549 21.861  1.00 35.34  ? 570  VAL B C   1 
ATOM   7606  O  O   . VAL B 1 524 ? 19.180  -28.822 22.513  1.00 35.39  ? 570  VAL B O   1 
ATOM   7607  C  CB  . VAL B 1 524 ? 18.016  -26.123 22.343  1.00 34.46  ? 570  VAL B CB  1 
ATOM   7608  C  CG1 . VAL B 1 524 ? 18.646  -25.832 20.985  1.00 34.44  ? 570  VAL B CG1 1 
ATOM   7609  C  CG2 . VAL B 1 524 ? 17.112  -25.020 22.748  1.00 34.17  ? 570  VAL B CG2 1 
ATOM   7610  N  N   . LEU B 1 525 ? 17.804  -29.184 20.744  1.00 36.00  ? 571  LEU B N   1 
ATOM   7611  C  CA  . LEU B 1 525 ? 18.624  -30.239 20.148  1.00 36.91  ? 571  LEU B CA  1 
ATOM   7612  C  C   . LEU B 1 525 ? 18.936  -29.948 18.698  1.00 37.28  ? 571  LEU B C   1 
ATOM   7613  O  O   . LEU B 1 525 ? 18.132  -29.322 17.990  1.00 37.13  ? 571  LEU B O   1 
ATOM   7614  C  CB  . LEU B 1 525 ? 17.927  -31.595 20.214  1.00 37.14  ? 571  LEU B CB  1 
ATOM   7615  C  CG  . LEU B 1 525 ? 17.426  -32.213 21.525  1.00 38.25  ? 571  LEU B CG  1 
ATOM   7616  C  CD1 . LEU B 1 525 ? 16.827  -33.584 21.225  1.00 38.17  ? 571  LEU B CD1 1 
ATOM   7617  C  CD2 . LEU B 1 525 ? 18.517  -32.354 22.599  1.00 37.90  ? 571  LEU B CD2 1 
ATOM   7618  N  N   . SER B 1 526 ? 20.098  -30.426 18.254  1.00 37.92  ? 572  SER B N   1 
ATOM   7619  C  CA  . SER B 1 526 ? 20.488  -30.304 16.852  1.00 38.55  ? 572  SER B CA  1 
ATOM   7620  C  C   . SER B 1 526 ? 20.265  -31.640 16.164  1.00 38.92  ? 572  SER B C   1 
ATOM   7621  O  O   . SER B 1 526 ? 20.494  -32.696 16.774  1.00 39.15  ? 572  SER B O   1 
ATOM   7622  C  CB  . SER B 1 526 ? 21.954  -29.907 16.741  1.00 38.38  ? 572  SER B CB  1 
ATOM   7623  O  OG  . SER B 1 526 ? 22.763  -30.902 17.327  1.00 38.43  ? 572  SER B OG  1 
ATOM   7624  N  N   . ILE B 1 527 ? 19.819  -31.588 14.906  1.00 39.02  ? 573  ILE B N   1 
ATOM   7625  C  CA  . ILE B 1 527 ? 19.582  -32.797 14.092  1.00 39.16  ? 573  ILE B CA  1 
ATOM   7626  C  C   . ILE B 1 527 ? 20.814  -33.199 13.255  1.00 39.53  ? 573  ILE B C   1 
ATOM   7627  O  O   . ILE B 1 527 ? 21.703  -33.938 13.714  1.00 39.66  ? 573  ILE B O   1 
ATOM   7628  C  CB  . ILE B 1 527 ? 18.385  -32.600 13.144  1.00 39.05  ? 573  ILE B CB  1 
ATOM   7629  C  CG1 . ILE B 1 527 ? 17.132  -32.203 13.929  1.00 39.01  ? 573  ILE B CG1 1 
ATOM   7630  C  CG2 . ILE B 1 527 ? 18.151  -33.843 12.307  1.00 38.91  ? 573  ILE B CG2 1 
ATOM   7631  C  CD1 . ILE B 1 527 ? 16.758  -33.158 15.037  1.00 39.54  ? 573  ILE B CD1 1 
ATOM   7632  N  N   . GLN C 1 11  ? 25.211  14.775  10.367  1.00 54.08  ? 57   GLN C N   1 
ATOM   7633  C  CA  . GLN C 1 11  ? 23.992  15.588  10.649  1.00 54.53  ? 57   GLN C CA  1 
ATOM   7634  C  C   . GLN C 1 11  ? 24.027  16.202  12.048  1.00 54.17  ? 57   GLN C C   1 
ATOM   7635  O  O   . GLN C 1 11  ? 24.852  15.830  12.887  1.00 54.26  ? 57   GLN C O   1 
ATOM   7636  C  CB  . GLN C 1 11  ? 22.704  14.754  10.504  1.00 54.74  ? 57   GLN C CB  1 
ATOM   7637  C  CG  . GLN C 1 11  ? 22.288  14.452  9.076   1.00 57.39  ? 57   GLN C CG  1 
ATOM   7638  C  CD  . GLN C 1 11  ? 21.880  15.692  8.281   1.00 60.74  ? 57   GLN C CD  1 
ATOM   7639  O  OE1 . GLN C 1 11  ? 21.350  16.669  8.838   1.00 61.25  ? 57   GLN C OE1 1 
ATOM   7640  N  NE2 . GLN C 1 11  ? 22.119  15.647  6.953   1.00 60.53  ? 57   GLN C NE2 1 
ATOM   7641  N  N   . GLN C 1 12  ? 23.096  17.123  12.282  1.00 53.48  ? 58   GLN C N   1 
ATOM   7642  C  CA  . GLN C 1 12  ? 23.046  17.914  13.484  1.00 53.04  ? 58   GLN C CA  1 
ATOM   7643  C  C   . GLN C 1 12  ? 21.758  17.564  14.216  1.00 52.35  ? 58   GLN C C   1 
ATOM   7644  O  O   . GLN C 1 12  ? 20.966  16.752  13.734  1.00 52.44  ? 58   GLN C O   1 
ATOM   7645  C  CB  . GLN C 1 12  ? 23.080  19.386  13.100  1.00 53.37  ? 58   GLN C CB  1 
ATOM   7646  C  CG  . GLN C 1 12  ? 24.236  19.740  12.166  1.00 55.69  ? 58   GLN C CG  1 
ATOM   7647  C  CD  . GLN C 1 12  ? 23.791  20.575  10.958  1.00 59.69  ? 58   GLN C CD  1 
ATOM   7648  O  OE1 . GLN C 1 12  ? 22.755  20.310  10.339  1.00 60.20  ? 58   GLN C OE1 1 
ATOM   7649  N  NE2 . GLN C 1 12  ? 24.586  21.576  10.615  1.00 60.04  ? 58   GLN C NE2 1 
ATOM   7650  N  N   . GLN C 1 13  ? 21.558  18.169  15.383  1.00 51.52  ? 59   GLN C N   1 
ATOM   7651  C  CA  . GLN C 1 13  ? 20.347  17.993  16.190  1.00 50.88  ? 59   GLN C CA  1 
ATOM   7652  C  C   . GLN C 1 13  ? 20.040  16.552  16.562  1.00 50.34  ? 59   GLN C C   1 
ATOM   7653  O  O   . GLN C 1 13  ? 18.878  16.236  16.871  1.00 50.69  ? 59   GLN C O   1 
ATOM   7654  C  CB  . GLN C 1 13  ? 19.127  18.549  15.475  1.00 51.00  ? 59   GLN C CB  1 
ATOM   7655  C  CG  . GLN C 1 13  ? 19.186  19.983  15.083  1.00 52.35  ? 59   GLN C CG  1 
ATOM   7656  C  CD  . GLN C 1 13  ? 17.862  20.439  14.489  1.00 54.56  ? 59   GLN C CD  1 
ATOM   7657  O  OE1 . GLN C 1 13  ? 16.865  20.633  15.215  1.00 54.80  ? 59   GLN C OE1 1 
ATOM   7658  N  NE2 . GLN C 1 13  ? 17.835  20.600  13.166  1.00 54.50  ? 59   GLN C NE2 1 
ATOM   7659  N  N   . GLN C 1 14  ? 21.051  15.682  16.548  1.00 49.63  ? 60   GLN C N   1 
ATOM   7660  C  CA  . GLN C 1 14  ? 20.821  14.247  16.799  1.00 49.65  ? 60   GLN C CA  1 
ATOM   7661  C  C   . GLN C 1 14  ? 19.681  13.728  15.893  1.00 49.83  ? 60   GLN C C   1 
ATOM   7662  O  O   . GLN C 1 14  ? 18.683  13.160  16.383  1.00 49.55  ? 60   GLN C O   1 
ATOM   7663  C  CB  . GLN C 1 14  ? 20.447  13.971  18.275  1.00 49.45  ? 60   GLN C CB  1 
ATOM   7664  C  CG  . GLN C 1 14  ? 21.394  14.524  19.341  1.00 49.09  ? 60   GLN C CG  1 
ATOM   7665  C  CD  . GLN C 1 14  ? 22.758  13.854  19.324  1.00 48.13  ? 60   GLN C CD  1 
ATOM   7666  O  OE1 . GLN C 1 14  ? 22.928  12.754  18.781  1.00 47.50  ? 60   GLN C OE1 1 
ATOM   7667  N  NE2 . GLN C 1 14  ? 23.730  14.506  19.942  1.00 48.21  ? 60   GLN C NE2 1 
ATOM   7668  N  N   . LEU C 1 15  ? 19.813  13.963  14.583  1.00 49.81  ? 61   LEU C N   1 
ATOM   7669  C  CA  . LEU C 1 15  ? 18.790  13.531  13.624  1.00 49.81  ? 61   LEU C CA  1 
ATOM   7670  C  C   . LEU C 1 15  ? 18.875  12.031  13.340  1.00 49.06  ? 61   LEU C C   1 
ATOM   7671  O  O   . LEU C 1 15  ? 17.837  11.359  13.361  1.00 48.97  ? 61   LEU C O   1 
ATOM   7672  C  CB  . LEU C 1 15  ? 18.792  14.374  12.339  1.00 50.24  ? 61   LEU C CB  1 
ATOM   7673  C  CG  . LEU C 1 15  ? 17.607  15.331  12.071  1.00 52.33  ? 61   LEU C CG  1 
ATOM   7674  C  CD1 . LEU C 1 15  ? 16.833  15.730  13.321  1.00 53.14  ? 61   LEU C CD1 1 
ATOM   7675  C  CD2 . LEU C 1 15  ? 18.020  16.597  11.261  1.00 52.90  ? 61   LEU C CD2 1 
ATOM   7676  N  N   . PRO C 1 16  ? 20.097  11.492  13.104  1.00 48.42  ? 62   PRO C N   1 
ATOM   7677  C  CA  . PRO C 1 16  ? 20.140  10.034  12.997  1.00 48.10  ? 62   PRO C CA  1 
ATOM   7678  C  C   . PRO C 1 16  ? 19.397  9.406   14.160  1.00 47.91  ? 62   PRO C C   1 
ATOM   7679  O  O   . PRO C 1 16  ? 18.635  8.466   13.935  1.00 48.13  ? 62   PRO C O   1 
ATOM   7680  C  CB  . PRO C 1 16  ? 21.636  9.707   13.075  1.00 47.94  ? 62   PRO C CB  1 
ATOM   7681  C  CG  . PRO C 1 16  ? 22.302  10.923  12.507  1.00 47.89  ? 62   PRO C CG  1 
ATOM   7682  C  CD  . PRO C 1 16  ? 21.434  12.095  12.918  1.00 48.35  ? 62   PRO C CD  1 
ATOM   7683  N  N   . ALA C 1 17  ? 19.579  9.943   15.370  1.00 47.63  ? 63   ALA C N   1 
ATOM   7684  C  CA  . ALA C 1 17  ? 18.935  9.378   16.548  1.00 48.00  ? 63   ALA C CA  1 
ATOM   7685  C  C   . ALA C 1 17  ? 17.412  9.548   16.497  1.00 48.31  ? 63   ALA C C   1 
ATOM   7686  O  O   . ALA C 1 17  ? 16.671  8.673   16.955  1.00 48.40  ? 63   ALA C O   1 
ATOM   7687  C  CB  . ALA C 1 17  ? 19.510  9.971   17.816  1.00 47.85  ? 63   ALA C CB  1 
ATOM   7688  N  N   . ALA C 1 18  ? 16.956  10.662  15.920  1.00 48.60  ? 64   ALA C N   1 
ATOM   7689  C  CA  . ALA C 1 18  ? 15.522  10.954  15.800  1.00 48.78  ? 64   ALA C CA  1 
ATOM   7690  C  C   . ALA C 1 18  ? 14.814  9.968   14.864  1.00 49.16  ? 64   ALA C C   1 
ATOM   7691  O  O   . ALA C 1 18  ? 13.622  9.661   15.045  1.00 49.27  ? 64   ALA C O   1 
ATOM   7692  C  CB  . ALA C 1 18  ? 15.299  12.392  15.336  1.00 48.46  ? 64   ALA C CB  1 
ATOM   7693  N  N   . MET C 1 19  ? 15.551  9.471   13.873  1.00 49.45  ? 65   MET C N   1 
ATOM   7694  C  CA  . MET C 1 19  ? 15.006  8.548   12.883  1.00 50.19  ? 65   MET C CA  1 
ATOM   7695  C  C   . MET C 1 19  ? 15.002  7.078   13.324  1.00 49.94  ? 65   MET C C   1 
ATOM   7696  O  O   . MET C 1 19  ? 14.637  6.205   12.546  1.00 50.19  ? 65   MET C O   1 
ATOM   7697  C  CB  . MET C 1 19  ? 15.781  8.669   11.554  1.00 50.83  ? 65   MET C CB  1 
ATOM   7698  C  CG  . MET C 1 19  ? 15.949  10.102  11.010  1.00 53.15  ? 65   MET C CG  1 
ATOM   7699  S  SD  . MET C 1 19  ? 14.433  10.853  10.334  1.00 58.59  ? 65   MET C SD  1 
ATOM   7700  C  CE  . MET C 1 19  ? 13.652  11.582  11.796  1.00 54.77  ? 65   MET C CE  1 
ATOM   7701  N  N   . ALA C 1 20  ? 15.417  6.793   14.555  1.00 49.79  ? 66   ALA C N   1 
ATOM   7702  C  CA  . ALA C 1 20  ? 15.477  5.400   15.042  1.00 49.24  ? 66   ALA C CA  1 
ATOM   7703  C  C   . ALA C 1 20  ? 14.088  4.782   15.185  1.00 48.87  ? 66   ALA C C   1 
ATOM   7704  O  O   . ALA C 1 20  ? 13.109  5.483   15.490  1.00 48.85  ? 66   ALA C O   1 
ATOM   7705  C  CB  . ALA C 1 20  ? 16.240  5.313   16.362  1.00 49.14  ? 66   ALA C CB  1 
ATOM   7706  N  N   . ASP C 1 21  ? 14.019  3.472   14.962  1.00 48.39  ? 67   ASP C N   1 
ATOM   7707  C  CA  . ASP C 1 21  ? 12.769  2.722   15.043  1.00 48.21  ? 67   ASP C CA  1 
ATOM   7708  C  C   . ASP C 1 21  ? 12.431  2.216   16.458  1.00 47.34  ? 67   ASP C C   1 
ATOM   7709  O  O   . ASP C 1 21  ? 11.298  1.804   16.708  1.00 47.15  ? 67   ASP C O   1 
ATOM   7710  C  CB  . ASP C 1 21  ? 12.801  1.550   14.064  1.00 49.10  ? 67   ASP C CB  1 
ATOM   7711  C  CG  . ASP C 1 21  ? 12.766  2.003   12.588  1.00 52.21  ? 67   ASP C CG  1 
ATOM   7712  O  OD1 . ASP C 1 21  ? 13.827  1.961   11.908  1.00 54.67  ? 67   ASP C OD1 1 
ATOM   7713  O  OD2 . ASP C 1 21  ? 11.675  2.389   12.095  1.00 55.44  ? 67   ASP C OD2 1 
ATOM   7714  N  N   . THR C 1 22  ? 13.402  2.228   17.372  1.00 46.33  ? 68   THR C N   1 
ATOM   7715  C  CA  . THR C 1 22  ? 13.151  1.848   18.766  1.00 45.54  ? 68   THR C CA  1 
ATOM   7716  C  C   . THR C 1 22  ? 13.849  2.824   19.701  1.00 44.77  ? 68   THR C C   1 
ATOM   7717  O  O   . THR C 1 22  ? 14.717  3.579   19.268  1.00 45.06  ? 68   THR C O   1 
ATOM   7718  C  CB  . THR C 1 22  ? 13.630  0.406   19.088  1.00 45.60  ? 68   THR C CB  1 
ATOM   7719  O  OG1 . THR C 1 22  ? 15.060  0.359   19.115  1.00 45.83  ? 68   THR C OG1 1 
ATOM   7720  C  CG2 . THR C 1 22  ? 13.110  -0.588  18.072  1.00 46.38  ? 68   THR C CG2 1 
ATOM   7721  N  N   . PHE C 1 23  ? 13.481  2.810   20.981  1.00 43.49  ? 69   PHE C N   1 
ATOM   7722  C  CA  . PHE C 1 23  ? 14.153  3.663   21.941  1.00 42.05  ? 69   PHE C CA  1 
ATOM   7723  C  C   . PHE C 1 23  ? 15.604  3.228   22.105  1.00 41.72  ? 69   PHE C C   1 
ATOM   7724  O  O   . PHE C 1 23  ? 16.501  4.061   22.212  1.00 41.29  ? 69   PHE C O   1 
ATOM   7725  C  CB  . PHE C 1 23  ? 13.442  3.665   23.285  1.00 41.64  ? 69   PHE C CB  1 
ATOM   7726  C  CG  . PHE C 1 23  ? 14.044  4.626   24.272  1.00 39.93  ? 69   PHE C CG  1 
ATOM   7727  C  CD1 . PHE C 1 23  ? 14.677  4.176   25.425  1.00 38.82  ? 69   PHE C CD1 1 
ATOM   7728  C  CD2 . PHE C 1 23  ? 14.026  5.981   24.025  1.00 38.07  ? 69   PHE C CD2 1 
ATOM   7729  C  CE1 . PHE C 1 23  ? 15.254  5.084   26.325  1.00 36.87  ? 69   PHE C CE1 1 
ATOM   7730  C  CE2 . PHE C 1 23  ? 14.603  6.868   24.925  1.00 36.67  ? 69   PHE C CE2 1 
ATOM   7731  C  CZ  . PHE C 1 23  ? 15.214  6.409   26.074  1.00 34.88  ? 69   PHE C CZ  1 
ATOM   7732  N  N   . LEU C 1 24  ? 15.825  1.918   22.117  1.00 41.25  ? 70   LEU C N   1 
ATOM   7733  C  CA  . LEU C 1 24  ? 17.163  1.385   22.246  1.00 41.15  ? 70   LEU C CA  1 
ATOM   7734  C  C   . LEU C 1 24  ? 18.062  1.843   21.092  1.00 41.61  ? 70   LEU C C   1 
ATOM   7735  O  O   . LEU C 1 24  ? 19.179  2.314   21.315  1.00 41.61  ? 70   LEU C O   1 
ATOM   7736  C  CB  . LEU C 1 24  ? 17.130  -0.136  22.330  1.00 40.45  ? 70   LEU C CB  1 
ATOM   7737  C  CG  . LEU C 1 24  ? 18.441  -0.828  22.707  1.00 38.35  ? 70   LEU C CG  1 
ATOM   7738  C  CD1 . LEU C 1 24  ? 18.895  -0.444  24.095  1.00 33.33  ? 70   LEU C CD1 1 
ATOM   7739  C  CD2 . LEU C 1 24  ? 18.254  -2.323  22.600  1.00 35.52  ? 70   LEU C CD2 1 
ATOM   7740  N  N   . GLU C 1 25  ? 17.564  1.712   19.866  1.00 42.20  ? 71   GLU C N   1 
ATOM   7741  C  CA  . GLU C 1 25  ? 18.321  2.110   18.679  1.00 42.82  ? 71   GLU C CA  1 
ATOM   7742  C  C   . GLU C 1 25  ? 18.588  3.609   18.762  1.00 42.26  ? 71   GLU C C   1 
ATOM   7743  O  O   . GLU C 1 25  ? 19.634  4.110   18.319  1.00 42.24  ? 71   GLU C O   1 
ATOM   7744  C  CB  . GLU C 1 25  ? 17.545  1.767   17.404  1.00 43.26  ? 71   GLU C CB  1 
ATOM   7745  C  CG  . GLU C 1 25  ? 18.408  1.719   16.126  1.00 47.26  ? 71   GLU C CG  1 
ATOM   7746  C  CD  . GLU C 1 25  ? 17.588  1.629   14.802  1.00 52.05  ? 71   GLU C CD  1 
ATOM   7747  O  OE1 . GLU C 1 25  ? 16.354  1.359   14.830  1.00 53.09  ? 71   GLU C OE1 1 
ATOM   7748  O  OE2 . GLU C 1 25  ? 18.199  1.827   13.718  1.00 51.61  ? 71   GLU C OE2 1 
ATOM   7749  N  N   . HIS C 1 26  ? 17.630  4.315   19.352  1.00 41.58  ? 72   HIS C N   1 
ATOM   7750  C  CA  . HIS C 1 26  ? 17.732  5.748   19.510  1.00 41.06  ? 72   HIS C CA  1 
ATOM   7751  C  C   . HIS C 1 26  ? 18.927  6.020   20.385  1.00 40.43  ? 72   HIS C C   1 
ATOM   7752  O  O   . HIS C 1 26  ? 19.889  6.612   19.912  1.00 41.20  ? 72   HIS C O   1 
ATOM   7753  C  CB  . HIS C 1 26  ? 16.453  6.322   20.098  1.00 41.25  ? 72   HIS C CB  1 
ATOM   7754  C  CG  . HIS C 1 26  ? 16.616  7.690   20.668  1.00 42.12  ? 72   HIS C CG  1 
ATOM   7755  N  ND1 . HIS C 1 26  ? 16.694  8.816   19.876  1.00 43.79  ? 72   HIS C ND1 1 
ATOM   7756  C  CD2 . HIS C 1 26  ? 16.685  8.120   21.952  1.00 42.50  ? 72   HIS C CD2 1 
ATOM   7757  C  CE1 . HIS C 1 26  ? 16.800  9.884   20.650  1.00 43.98  ? 72   HIS C CE1 1 
ATOM   7758  N  NE2 . HIS C 1 26  ? 16.794  9.490   21.913  1.00 42.11  ? 72   HIS C NE2 1 
ATOM   7759  N  N   . LEU C 1 27  ? 18.892  5.553   21.633  1.00 39.08  ? 73   LEU C N   1 
ATOM   7760  C  CA  . LEU C 1 27  ? 20.046  5.643   22.512  1.00 37.52  ? 73   LEU C CA  1 
ATOM   7761  C  C   . LEU C 1 27  ? 21.348  5.262   21.758  1.00 37.42  ? 73   LEU C C   1 
ATOM   7762  O  O   . LEU C 1 27  ? 22.329  5.977   21.785  1.00 37.70  ? 73   LEU C O   1 
ATOM   7763  C  CB  . LEU C 1 27  ? 19.846  4.760   23.740  1.00 36.63  ? 73   LEU C CB  1 
ATOM   7764  C  CG  . LEU C 1 27  ? 18.669  5.011   24.687  1.00 35.33  ? 73   LEU C CG  1 
ATOM   7765  C  CD1 . LEU C 1 27  ? 18.555  3.911   25.716  1.00 33.09  ? 73   LEU C CD1 1 
ATOM   7766  C  CD2 . LEU C 1 27  ? 18.794  6.347   25.364  1.00 31.43  ? 73   LEU C CD2 1 
ATOM   7767  N  N   . CYS C 1 28  ? 21.345  4.153   21.051  1.00 37.23  ? 74   CYS C N   1 
ATOM   7768  C  CA  . CYS C 1 28  ? 22.558  3.696   20.382  1.00 37.78  ? 74   CYS C CA  1 
ATOM   7769  C  C   . CYS C 1 28  ? 23.132  4.659   19.351  1.00 37.66  ? 74   CYS C C   1 
ATOM   7770  O  O   . CYS C 1 28  ? 24.227  4.422   18.832  1.00 37.71  ? 74   CYS C O   1 
ATOM   7771  C  CB  . CYS C 1 28  ? 22.323  2.359   19.694  1.00 37.49  ? 74   CYS C CB  1 
ATOM   7772  S  SG  . CYS C 1 28  ? 22.071  1.049   20.816  1.00 40.14  ? 74   CYS C SG  1 
ATOM   7773  N  N   . LEU C 1 29  ? 22.400  5.721   19.037  1.00 37.48  ? 75   LEU C N   1 
ATOM   7774  C  CA  . LEU C 1 29  ? 22.788  6.609   17.935  1.00 37.38  ? 75   LEU C CA  1 
ATOM   7775  C  C   . LEU C 1 29  ? 23.023  8.069   18.365  1.00 37.46  ? 75   LEU C C   1 
ATOM   7776  O  O   . LEU C 1 29  ? 23.357  8.927   17.529  1.00 37.88  ? 75   LEU C O   1 
ATOM   7777  C  CB  . LEU C 1 29  ? 21.740  6.569   16.819  1.00 37.13  ? 75   LEU C CB  1 
ATOM   7778  C  CG  . LEU C 1 29  ? 21.535  5.345   15.919  1.00 37.64  ? 75   LEU C CG  1 
ATOM   7779  C  CD1 . LEU C 1 29  ? 20.325  5.522   14.980  1.00 35.37  ? 75   LEU C CD1 1 
ATOM   7780  C  CD2 . LEU C 1 29  ? 22.803  4.948   15.093  1.00 37.71  ? 75   LEU C CD2 1 
ATOM   7781  N  N   . LEU C 1 30  ? 22.819  8.361   19.648  1.00 36.87  ? 76   LEU C N   1 
ATOM   7782  C  CA  . LEU C 1 30  ? 23.134  9.666   20.189  1.00 36.40  ? 76   LEU C CA  1 
ATOM   7783  C  C   . LEU C 1 30  ? 24.605  9.915   19.870  1.00 37.46  ? 76   LEU C C   1 
ATOM   7784  O  O   . LEU C 1 30  ? 25.440  9.014   20.030  1.00 37.71  ? 76   LEU C O   1 
ATOM   7785  C  CB  . LEU C 1 30  ? 22.855  9.681   21.689  1.00 35.86  ? 76   LEU C CB  1 
ATOM   7786  C  CG  . LEU C 1 30  ? 21.354  9.582   22.025  1.00 34.22  ? 76   LEU C CG  1 
ATOM   7787  C  CD1 . LEU C 1 30  ? 21.046  9.646   23.500  1.00 30.00  ? 76   LEU C CD1 1 
ATOM   7788  C  CD2 . LEU C 1 30  ? 20.600  10.711  21.344  1.00 34.30  ? 76   LEU C CD2 1 
ATOM   7789  N  N   . ASP C 1 31  ? 24.907  11.118  19.379  1.00 38.18  ? 77   ASP C N   1 
ATOM   7790  C  CA  . ASP C 1 31  ? 26.228  11.463  18.841  1.00 38.32  ? 77   ASP C CA  1 
ATOM   7791  C  C   . ASP C 1 31  ? 26.792  12.728  19.521  1.00 38.77  ? 77   ASP C C   1 
ATOM   7792  O  O   . ASP C 1 31  ? 26.246  13.834  19.378  1.00 39.01  ? 77   ASP C O   1 
ATOM   7793  C  CB  . ASP C 1 31  ? 26.102  11.676  17.330  1.00 38.23  ? 77   ASP C CB  1 
ATOM   7794  C  CG  . ASP C 1 31  ? 27.458  11.774  16.592  1.00 38.18  ? 77   ASP C CG  1 
ATOM   7795  O  OD1 . ASP C 1 31  ? 28.515  12.082  17.174  1.00 36.63  ? 77   ASP C OD1 1 
ATOM   7796  O  OD2 . ASP C 1 31  ? 27.440  11.560  15.371  1.00 39.46  ? 77   ASP C OD2 1 
ATOM   7797  N  N   . ILE C 1 32  ? 27.911  12.573  20.234  1.00 39.18  ? 78   ILE C N   1 
ATOM   7798  C  CA  . ILE C 1 32  ? 28.536  13.721  20.910  1.00 39.32  ? 78   ILE C CA  1 
ATOM   7799  C  C   . ILE C 1 32  ? 29.014  14.802  19.938  1.00 40.32  ? 78   ILE C C   1 
ATOM   7800  O  O   . ILE C 1 32  ? 29.187  15.942  20.355  1.00 40.84  ? 78   ILE C O   1 
ATOM   7801  C  CB  . ILE C 1 32  ? 29.691  13.327  21.856  1.00 38.92  ? 78   ILE C CB  1 
ATOM   7802  C  CG1 . ILE C 1 32  ? 30.797  12.594  21.079  1.00 37.70  ? 78   ILE C CG1 1 
ATOM   7803  C  CG2 . ILE C 1 32  ? 29.151  12.567  23.082  1.00 38.15  ? 78   ILE C CG2 1 
ATOM   7804  C  CD1 . ILE C 1 32  ? 32.186  12.697  21.690  1.00 36.33  ? 78   ILE C CD1 1 
ATOM   7805  N  N   . ASP C 1 33  ? 29.225  14.456  18.661  1.00 40.98  ? 79   ASP C N   1 
ATOM   7806  C  CA  . ASP C 1 33  ? 29.657  15.425  17.641  1.00 41.93  ? 79   ASP C CA  1 
ATOM   7807  C  C   . ASP C 1 33  ? 28.498  16.045  16.843  1.00 42.41  ? 79   ASP C C   1 
ATOM   7808  O  O   . ASP C 1 33  ? 28.704  16.789  15.893  1.00 42.90  ? 79   ASP C O   1 
ATOM   7809  C  CB  . ASP C 1 33  ? 30.678  14.797  16.689  1.00 41.90  ? 79   ASP C CB  1 
ATOM   7810  C  CG  . ASP C 1 33  ? 32.028  14.608  17.332  1.00 43.38  ? 79   ASP C CG  1 
ATOM   7811  O  OD1 . ASP C 1 33  ? 32.305  15.298  18.345  1.00 42.36  ? 79   ASP C OD1 1 
ATOM   7812  O  OD2 . ASP C 1 33  ? 32.817  13.777  16.815  1.00 45.40  ? 79   ASP C OD2 1 
ATOM   7813  N  N   . SER C 1 34  ? 27.268  15.746  17.219  1.00 42.87  ? 80   SER C N   1 
ATOM   7814  C  CA  . SER C 1 34  ? 26.163  16.311  16.498  1.00 43.33  ? 80   SER C CA  1 
ATOM   7815  C  C   . SER C 1 34  ? 25.776  17.533  17.275  1.00 44.01  ? 80   SER C C   1 
ATOM   7816  O  O   . SER C 1 34  ? 25.140  17.413  18.325  1.00 44.75  ? 80   SER C O   1 
ATOM   7817  C  CB  . SER C 1 34  ? 25.013  15.318  16.438  1.00 43.36  ? 80   SER C CB  1 
ATOM   7818  O  OG  . SER C 1 34  ? 24.067  15.718  15.469  1.00 44.14  ? 80   SER C OG  1 
ATOM   7819  N  N   . GLU C 1 35  ? 26.182  18.709  16.802  1.00 44.30  ? 81   GLU C N   1 
ATOM   7820  C  CA  . GLU C 1 35  ? 25.949  19.943  17.567  1.00 44.69  ? 81   GLU C CA  1 
ATOM   7821  C  C   . GLU C 1 35  ? 24.481  20.272  17.608  1.00 44.18  ? 81   GLU C C   1 
ATOM   7822  O  O   . GLU C 1 35  ? 23.790  20.110  16.610  1.00 43.71  ? 81   GLU C O   1 
ATOM   7823  C  CB  . GLU C 1 35  ? 26.754  21.144  17.052  1.00 45.04  ? 81   GLU C CB  1 
ATOM   7824  C  CG  . GLU C 1 35  ? 28.297  21.005  17.235  1.00 48.80  ? 81   GLU C CG  1 
ATOM   7825  C  CD  . GLU C 1 35  ? 28.712  20.405  18.580  1.00 52.91  ? 81   GLU C CD  1 
ATOM   7826  O  OE1 . GLU C 1 35  ? 27.917  20.450  19.540  1.00 54.96  ? 81   GLU C OE1 1 
ATOM   7827  O  OE2 . GLU C 1 35  ? 29.843  19.888  18.677  1.00 55.22  ? 81   GLU C OE2 1 
ATOM   7828  N  N   . PRO C 1 36  ? 23.995  20.726  18.780  1.00 44.23  ? 82   PRO C N   1 
ATOM   7829  C  CA  . PRO C 1 36  ? 22.598  21.130  18.880  1.00 44.31  ? 82   PRO C CA  1 
ATOM   7830  C  C   . PRO C 1 36  ? 22.492  22.339  18.009  1.00 44.94  ? 82   PRO C C   1 
ATOM   7831  O  O   . PRO C 1 36  ? 23.494  22.982  17.723  1.00 45.55  ? 82   PRO C O   1 
ATOM   7832  C  CB  . PRO C 1 36  ? 22.433  21.546  20.341  1.00 43.79  ? 82   PRO C CB  1 
ATOM   7833  C  CG  . PRO C 1 36  ? 23.576  20.976  21.044  1.00 44.24  ? 82   PRO C CG  1 
ATOM   7834  C  CD  . PRO C 1 36  ? 24.716  20.928  20.048  1.00 43.83  ? 82   PRO C CD  1 
ATOM   7835  N  N   . VAL C 1 37  ? 21.298  22.654  17.566  1.00 45.59  ? 83   VAL C N   1 
ATOM   7836  C  CA  . VAL C 1 37  ? 21.147  23.697  16.561  1.00 46.06  ? 83   VAL C CA  1 
ATOM   7837  C  C   . VAL C 1 37  ? 19.707  24.137  16.689  1.00 46.15  ? 83   VAL C C   1 
ATOM   7838  O  O   . VAL C 1 37  ? 18.817  23.792  15.911  1.00 46.46  ? 83   VAL C O   1 
ATOM   7839  C  CB  . VAL C 1 37  ? 21.662  23.225  15.103  1.00 46.18  ? 83   VAL C CB  1 
ATOM   7840  C  CG1 . VAL C 1 37  ? 20.588  23.303  13.974  1.00 45.37  ? 83   VAL C CG1 1 
ATOM   7841  C  CG2 . VAL C 1 37  ? 22.977  23.959  14.710  1.00 45.81  ? 83   VAL C CG2 1 
ATOM   7842  N  N   . ALA C 1 38  ? 19.482  24.856  17.761  1.00 46.01  ? 84   ALA C N   1 
ATOM   7843  C  CA  . ALA C 1 38  ? 18.152  25.294  18.069  1.00 45.99  ? 84   ALA C CA  1 
ATOM   7844  C  C   . ALA C 1 38  ? 18.320  26.113  19.338  1.00 46.26  ? 84   ALA C C   1 
ATOM   7845  O  O   . ALA C 1 38  ? 19.297  25.886  20.101  1.00 47.21  ? 84   ALA C O   1 
ATOM   7846  C  CB  . ALA C 1 38  ? 17.245  24.104  18.288  1.00 44.91  ? 84   ALA C CB  1 
ATOM   7847  N  N   . ALA C 1 39  ? 17.426  27.089  19.526  1.00 45.28  ? 85   ALA C N   1 
ATOM   7848  C  CA  . ALA C 1 39  ? 17.283  27.768  20.791  1.00 44.38  ? 85   ALA C CA  1 
ATOM   7849  C  C   . ALA C 1 39  ? 16.967  26.700  21.796  1.00 43.85  ? 85   ALA C C   1 
ATOM   7850  O  O   . ALA C 1 39  ? 16.310  25.737  21.459  1.00 43.67  ? 85   ALA C O   1 
ATOM   7851  C  CB  . ALA C 1 39  ? 16.137  28.688  20.712  1.00 44.69  ? 85   ALA C CB  1 
ATOM   7852  N  N   . ARG C 1 40  ? 17.435  26.847  23.023  1.00 43.71  ? 86   ARG C N   1 
ATOM   7853  C  CA  . ARG C 1 40  ? 17.077  25.861  24.036  1.00 44.20  ? 86   ARG C CA  1 
ATOM   7854  C  C   . ARG C 1 40  ? 15.643  26.091  24.541  1.00 44.06  ? 86   ARG C C   1 
ATOM   7855  O  O   . ARG C 1 40  ? 15.230  27.217  24.830  1.00 44.00  ? 86   ARG C O   1 
ATOM   7856  C  CB  . ARG C 1 40  ? 18.075  25.840  25.191  1.00 43.90  ? 86   ARG C CB  1 
ATOM   7857  C  CG  . ARG C 1 40  ? 18.244  27.167  25.838  1.00 44.14  ? 86   ARG C CG  1 
ATOM   7858  C  CD  . ARG C 1 40  ? 18.673  26.964  27.250  1.00 44.40  ? 86   ARG C CD  1 
ATOM   7859  N  NE  . ARG C 1 40  ? 17.604  27.311  28.148  1.00 42.72  ? 86   ARG C NE  1 
ATOM   7860  C  CZ  . ARG C 1 40  ? 17.363  28.552  28.551  1.00 40.51  ? 86   ARG C CZ  1 
ATOM   7861  N  NH1 . ARG C 1 40  ? 18.147  29.546  28.143  1.00 34.77  ? 86   ARG C NH1 1 
ATOM   7862  N  NH2 . ARG C 1 40  ? 16.329  28.779  29.359  1.00 40.27  ? 86   ARG C NH2 1 
ATOM   7863  N  N   . SER C 1 41  ? 14.893  25.014  24.628  1.00 43.97  ? 87   SER C N   1 
ATOM   7864  C  CA  . SER C 1 41  ? 13.491  25.134  24.940  1.00 44.86  ? 87   SER C CA  1 
ATOM   7865  C  C   . SER C 1 41  ? 13.129  25.078  26.447  1.00 44.37  ? 87   SER C C   1 
ATOM   7866  O  O   . SER C 1 41  ? 12.102  25.613  26.858  1.00 44.48  ? 87   SER C O   1 
ATOM   7867  C  CB  . SER C 1 41  ? 12.682  24.139  24.101  1.00 45.23  ? 87   SER C CB  1 
ATOM   7868  O  OG  . SER C 1 41  ? 13.380  22.923  23.917  1.00 47.00  ? 87   SER C OG  1 
ATOM   7869  N  N   . THR C 1 42  ? 13.981  24.454  27.259  1.00 43.72  ? 88   THR C N   1 
ATOM   7870  C  CA  . THR C 1 42  ? 13.800  24.425  28.725  1.00 42.52  ? 88   THR C CA  1 
ATOM   7871  C  C   . THR C 1 42  ? 14.118  25.766  29.431  1.00 42.28  ? 88   THR C C   1 
ATOM   7872  O  O   . THR C 1 42  ? 15.265  26.234  29.472  1.00 41.22  ? 88   THR C O   1 
ATOM   7873  C  CB  . THR C 1 42  ? 14.619  23.288  29.358  1.00 42.30  ? 88   THR C CB  1 
ATOM   7874  O  OG1 . THR C 1 42  ? 14.443  22.083  28.593  1.00 41.63  ? 88   THR C OG1 1 
ATOM   7875  C  CG2 . THR C 1 42  ? 14.176  23.046  30.777  1.00 42.50  ? 88   THR C CG2 1 
ATOM   7876  N  N   . SER C 1 43  ? 13.092  26.410  29.981  1.00 42.44  ? 89   SER C N   1 
ATOM   7877  C  CA  . SER C 1 43  ? 13.339  27.697  30.622  1.00 41.99  ? 89   SER C CA  1 
ATOM   7878  C  C   . SER C 1 43  ? 14.011  27.474  31.954  1.00 41.96  ? 89   SER C C   1 
ATOM   7879  O  O   . SER C 1 43  ? 13.806  26.438  32.607  1.00 42.87  ? 89   SER C O   1 
ATOM   7880  C  CB  . SER C 1 43  ? 12.074  28.480  30.769  1.00 41.61  ? 89   SER C CB  1 
ATOM   7881  O  OG  . SER C 1 43  ? 11.454  28.568  29.501  1.00 42.97  ? 89   SER C OG  1 
ATOM   7882  N  N   . ILE C 1 44  ? 14.843  28.429  32.336  1.00 41.04  ? 90   ILE C N   1 
ATOM   7883  C  CA  . ILE C 1 44  ? 15.685  28.332  33.502  1.00 39.47  ? 90   ILE C CA  1 
ATOM   7884  C  C   . ILE C 1 44  ? 15.133  29.327  34.455  1.00 39.93  ? 90   ILE C C   1 
ATOM   7885  O  O   . ILE C 1 44  ? 14.905  30.473  34.104  1.00 40.95  ? 90   ILE C O   1 
ATOM   7886  C  CB  . ILE C 1 44  ? 17.144  28.721  33.166  1.00 39.25  ? 90   ILE C CB  1 
ATOM   7887  C  CG1 . ILE C 1 44  ? 17.773  27.640  32.250  1.00 37.47  ? 90   ILE C CG1 1 
ATOM   7888  C  CG2 . ILE C 1 44  ? 17.926  29.014  34.436  1.00 37.21  ? 90   ILE C CG2 1 
ATOM   7889  C  CD1 . ILE C 1 44  ? 18.981  28.051  31.424  1.00 32.76  ? 90   ILE C CD1 1 
ATOM   7890  N  N   . ILE C 1 45  ? 14.903  28.883  35.668  1.00 39.59  ? 91   ILE C N   1 
ATOM   7891  C  CA  . ILE C 1 45  ? 14.492  29.741  36.739  1.00 38.99  ? 91   ILE C CA  1 
ATOM   7892  C  C   . ILE C 1 45  ? 15.719  29.973  37.605  1.00 39.13  ? 91   ILE C C   1 
ATOM   7893  O  O   . ILE C 1 45  ? 16.405  29.028  37.970  1.00 40.07  ? 91   ILE C O   1 
ATOM   7894  C  CB  . ILE C 1 45  ? 13.411  29.013  37.533  1.00 38.86  ? 91   ILE C CB  1 
ATOM   7895  C  CG1 . ILE C 1 45  ? 12.224  28.707  36.618  1.00 37.48  ? 91   ILE C CG1 1 
ATOM   7896  C  CG2 . ILE C 1 45  ? 13.028  29.793  38.786  1.00 38.25  ? 91   ILE C CG2 1 
ATOM   7897  C  CD1 . ILE C 1 45  ? 11.202  27.805  37.272  1.00 35.86  ? 91   ILE C CD1 1 
ATOM   7898  N  N   . ALA C 1 46  ? 16.015  31.214  37.952  1.00 39.12  ? 92   ALA C N   1 
ATOM   7899  C  CA  . ALA C 1 46  ? 17.146  31.495  38.847  1.00 39.04  ? 92   ALA C CA  1 
ATOM   7900  C  C   . ALA C 1 46  ? 16.669  32.225  40.108  1.00 39.64  ? 92   ALA C C   1 
ATOM   7901  O  O   . ALA C 1 46  ? 15.866  33.172  40.044  1.00 40.02  ? 92   ALA C O   1 
ATOM   7902  C  CB  . ALA C 1 46  ? 18.194  32.292  38.133  1.00 38.48  ? 92   ALA C CB  1 
ATOM   7903  N  N   . THR C 1 47  ? 17.139  31.765  41.257  1.00 39.92  ? 93   THR C N   1 
ATOM   7904  C  CA  . THR C 1 47  ? 16.767  32.365  42.506  1.00 40.28  ? 93   THR C CA  1 
ATOM   7905  C  C   . THR C 1 47  ? 17.678  33.554  42.749  1.00 40.72  ? 93   THR C C   1 
ATOM   7906  O  O   . THR C 1 47  ? 18.884  33.471  42.552  1.00 40.80  ? 93   THR C O   1 
ATOM   7907  C  CB  . THR C 1 47  ? 16.898  31.397  43.678  1.00 40.53  ? 93   THR C CB  1 
ATOM   7908  O  OG1 . THR C 1 47  ? 16.314  30.121  43.344  1.00 41.00  ? 93   THR C OG1 1 
ATOM   7909  C  CG2 . THR C 1 47  ? 16.218  31.986  44.915  1.00 39.43  ? 93   THR C CG2 1 
ATOM   7910  N  N   . ILE C 1 48  ? 17.068  34.660  43.178  1.00 41.04  ? 94   ILE C N   1 
ATOM   7911  C  CA  . ILE C 1 48  ? 17.757  35.916  43.416  1.00 40.65  ? 94   ILE C CA  1 
ATOM   7912  C  C   . ILE C 1 48  ? 18.254  35.942  44.845  1.00 40.77  ? 94   ILE C C   1 
ATOM   7913  O  O   . ILE C 1 48  ? 17.492  35.665  45.783  1.00 40.78  ? 94   ILE C O   1 
ATOM   7914  C  CB  . ILE C 1 48  ? 16.833  37.144  43.152  1.00 40.40  ? 94   ILE C CB  1 
ATOM   7915  C  CG1 . ILE C 1 48  ? 16.290  37.118  41.719  1.00 39.82  ? 94   ILE C CG1 1 
ATOM   7916  C  CG2 . ILE C 1 48  ? 17.568  38.449  43.399  1.00 39.78  ? 94   ILE C CG2 1 
ATOM   7917  C  CD1 . ILE C 1 48  ? 17.334  37.229  40.634  1.00 37.85  ? 94   ILE C CD1 1 
ATOM   7918  N  N   . GLY C 1 49  ? 19.534  36.281  44.994  1.00 40.49  ? 95   GLY C N   1 
ATOM   7919  C  CA  . GLY C 1 49  ? 20.128  36.501  46.305  1.00 40.20  ? 95   GLY C CA  1 
ATOM   7920  C  C   . GLY C 1 49  ? 21.276  37.486  46.245  1.00 40.05  ? 95   GLY C C   1 
ATOM   7921  O  O   . GLY C 1 49  ? 21.464  38.163  45.234  1.00 40.74  ? 95   GLY C O   1 
ATOM   7922  N  N   . PRO C 1 50  ? 22.064  37.567  47.320  1.00 39.43  ? 96   PRO C N   1 
ATOM   7923  C  CA  . PRO C 1 50  ? 23.173  38.506  47.317  1.00 39.11  ? 96   PRO C CA  1 
ATOM   7924  C  C   . PRO C 1 50  ? 24.052  38.349  46.051  1.00 38.93  ? 96   PRO C C   1 
ATOM   7925  O  O   . PRO C 1 50  ? 24.564  39.351  45.536  1.00 39.20  ? 96   PRO C O   1 
ATOM   7926  C  CB  . PRO C 1 50  ? 23.984  38.123  48.568  1.00 39.11  ? 96   PRO C CB  1 
ATOM   7927  C  CG  . PRO C 1 50  ? 23.108  37.243  49.386  1.00 39.25  ? 96   PRO C CG  1 
ATOM   7928  C  CD  . PRO C 1 50  ? 21.980  36.760  48.551  1.00 39.25  ? 96   PRO C CD  1 
ATOM   7929  N  N   . ALA C 1 51  ? 24.196  37.124  45.537  1.00 37.87  ? 97   ALA C N   1 
ATOM   7930  C  CA  . ALA C 1 51  ? 25.106  36.881  44.424  1.00 37.81  ? 97   ALA C CA  1 
ATOM   7931  C  C   . ALA C 1 51  ? 24.566  37.389  43.102  1.00 38.17  ? 97   ALA C C   1 
ATOM   7932  O  O   . ALA C 1 51  ? 25.333  37.549  42.137  1.00 38.24  ? 97   ALA C O   1 
ATOM   7933  C  CB  . ALA C 1 51  ? 25.439  35.405  44.311  1.00 37.43  ? 97   ALA C CB  1 
ATOM   7934  N  N   . SER C 1 52  ? 23.262  37.660  43.063  1.00 38.24  ? 98   SER C N   1 
ATOM   7935  C  CA  . SER C 1 52  ? 22.571  37.900  41.818  1.00 38.76  ? 98   SER C CA  1 
ATOM   7936  C  C   . SER C 1 52  ? 21.539  39.027  41.885  1.00 39.09  ? 98   SER C C   1 
ATOM   7937  O  O   . SER C 1 52  ? 20.449  38.922  41.314  1.00 39.97  ? 98   SER C O   1 
ATOM   7938  C  CB  . SER C 1 52  ? 21.835  36.618  41.462  1.00 38.90  ? 98   SER C CB  1 
ATOM   7939  O  OG  . SER C 1 52  ? 20.837  36.348  42.443  1.00 39.67  ? 98   SER C OG  1 
ATOM   7940  N  N   . ARG C 1 53  ? 21.863  40.112  42.557  1.00 39.20  ? 99   ARG C N   1 
ATOM   7941  C  CA  . ARG C 1 53  ? 20.858  41.110  42.867  1.00 38.93  ? 99   ARG C CA  1 
ATOM   7942  C  C   . ARG C 1 53  ? 21.218  42.442  42.234  1.00 39.03  ? 99   ARG C C   1 
ATOM   7943  O  O   . ARG C 1 53  ? 20.364  43.295  41.973  1.00 39.15  ? 99   ARG C O   1 
ATOM   7944  C  CB  . ARG C 1 53  ? 20.775  41.250  44.386  1.00 38.94  ? 99   ARG C CB  1 
ATOM   7945  C  CG  . ARG C 1 53  ? 19.392  41.392  44.872  1.00 38.78  ? 99   ARG C CG  1 
ATOM   7946  C  CD  . ARG C 1 53  ? 19.298  41.076  46.321  1.00 38.47  ? 99   ARG C CD  1 
ATOM   7947  N  NE  . ARG C 1 53  ? 18.230  41.885  46.896  1.00 40.35  ? 99   ARG C NE  1 
ATOM   7948  C  CZ  . ARG C 1 53  ? 18.420  43.099  47.410  1.00 39.30  ? 99   ARG C CZ  1 
ATOM   7949  N  NH1 . ARG C 1 53  ? 19.637  43.634  47.459  1.00 39.47  ? 99   ARG C NH1 1 
ATOM   7950  N  NH2 . ARG C 1 53  ? 17.400  43.764  47.900  1.00 37.84  ? 99   ARG C NH2 1 
ATOM   7951  N  N   . SER C 1 54  ? 22.508  42.617  42.006  1.00 38.72  ? 100  SER C N   1 
ATOM   7952  C  CA  . SER C 1 54  ? 22.987  43.799  41.365  1.00 38.71  ? 100  SER C CA  1 
ATOM   7953  C  C   . SER C 1 54  ? 22.518  43.798  39.923  1.00 38.93  ? 100  SER C C   1 
ATOM   7954  O  O   . SER C 1 54  ? 22.658  42.796  39.206  1.00 39.02  ? 100  SER C O   1 
ATOM   7955  C  CB  . SER C 1 54  ? 24.507  43.842  41.416  1.00 38.49  ? 100  SER C CB  1 
ATOM   7956  O  OG  . SER C 1 54  ? 25.056  43.324  40.226  1.00 39.27  ? 100  SER C OG  1 
ATOM   7957  N  N   . VAL C 1 55  ? 21.963  44.930  39.508  1.00 39.41  ? 101  VAL C N   1 
ATOM   7958  C  CA  . VAL C 1 55  ? 21.657  45.177  38.110  1.00 39.90  ? 101  VAL C CA  1 
ATOM   7959  C  C   . VAL C 1 55  ? 22.679  44.592  37.112  1.00 40.75  ? 101  VAL C C   1 
ATOM   7960  O  O   . VAL C 1 55  ? 22.277  43.887  36.173  1.00 41.00  ? 101  VAL C O   1 
ATOM   7961  C  CB  . VAL C 1 55  ? 21.434  46.657  37.863  1.00 39.58  ? 101  VAL C CB  1 
ATOM   7962  C  CG1 . VAL C 1 55  ? 21.394  46.956  36.365  1.00 39.26  ? 101  VAL C CG1 1 
ATOM   7963  C  CG2 . VAL C 1 55  ? 20.140  47.078  38.535  1.00 38.85  ? 101  VAL C CG2 1 
ATOM   7964  N  N   . GLU C 1 56  ? 23.976  44.852  37.313  1.00 41.53  ? 102  GLU C N   1 
ATOM   7965  C  CA  . GLU C 1 56  ? 24.973  44.423  36.311  1.00 42.70  ? 102  GLU C CA  1 
ATOM   7966  C  C   . GLU C 1 56  ? 25.130  42.914  36.209  1.00 43.03  ? 102  GLU C C   1 
ATOM   7967  O  O   . GLU C 1 56  ? 25.319  42.361  35.107  1.00 43.44  ? 102  GLU C O   1 
ATOM   7968  C  CB  . GLU C 1 56  ? 26.324  45.114  36.497  1.00 42.97  ? 102  GLU C CB  1 
ATOM   7969  C  CG  . GLU C 1 56  ? 26.317  46.584  35.953  1.00 45.47  ? 102  GLU C CG  1 
ATOM   7970  C  CD  . GLU C 1 56  ? 25.777  46.717  34.503  1.00 47.63  ? 102  GLU C CD  1 
ATOM   7971  O  OE1 . GLU C 1 56  ? 25.891  45.748  33.716  1.00 47.95  ? 102  GLU C OE1 1 
ATOM   7972  O  OE2 . GLU C 1 56  ? 25.244  47.791  34.149  1.00 46.37  ? 102  GLU C OE2 1 
ATOM   7973  N  N   . ARG C 1 57  ? 25.040  42.261  37.361  1.00 42.63  ? 103  ARG C N   1 
ATOM   7974  C  CA  . ARG C 1 57  ? 25.022  40.824  37.426  1.00 42.28  ? 103  ARG C CA  1 
ATOM   7975  C  C   . ARG C 1 57  ? 23.758  40.344  36.680  1.00 41.69  ? 103  ARG C C   1 
ATOM   7976  O  O   . ARG C 1 57  ? 23.872  39.579  35.713  1.00 41.54  ? 103  ARG C O   1 
ATOM   7977  C  CB  . ARG C 1 57  ? 25.038  40.378  38.896  1.00 42.81  ? 103  ARG C CB  1 
ATOM   7978  C  CG  . ARG C 1 57  ? 25.429  38.926  39.153  1.00 45.12  ? 103  ARG C CG  1 
ATOM   7979  C  CD  . ARG C 1 57  ? 26.811  38.783  39.839  1.00 49.07  ? 103  ARG C CD  1 
ATOM   7980  N  NE  . ARG C 1 57  ? 27.898  38.464  38.909  1.00 51.30  ? 103  ARG C NE  1 
ATOM   7981  C  CZ  . ARG C 1 57  ? 28.825  39.331  38.489  1.00 53.76  ? 103  ARG C CZ  1 
ATOM   7982  N  NH1 . ARG C 1 57  ? 28.824  40.598  38.916  1.00 54.09  ? 103  ARG C NH1 1 
ATOM   7983  N  NH2 . ARG C 1 57  ? 29.772  38.935  37.641  1.00 54.76  ? 103  ARG C NH2 1 
ATOM   7984  N  N   . LEU C 1 58  ? 22.567  40.816  37.088  1.00 40.73  ? 104  LEU C N   1 
ATOM   7985  C  CA  . LEU C 1 58  ? 21.330  40.425  36.390  1.00 39.73  ? 104  LEU C CA  1 
ATOM   7986  C  C   . LEU C 1 58  ? 21.494  40.480  34.870  1.00 39.76  ? 104  LEU C C   1 
ATOM   7987  O  O   . LEU C 1 58  ? 21.154  39.530  34.174  1.00 39.28  ? 104  LEU C O   1 
ATOM   7988  C  CB  . LEU C 1 58  ? 20.121  41.256  36.824  1.00 39.04  ? 104  LEU C CB  1 
ATOM   7989  C  CG  . LEU C 1 58  ? 19.245  40.882  38.026  1.00 37.98  ? 104  LEU C CG  1 
ATOM   7990  C  CD1 . LEU C 1 58  ? 19.361  39.429  38.475  1.00 35.36  ? 104  LEU C CD1 1 
ATOM   7991  C  CD2 . LEU C 1 58  ? 19.546  41.759  39.177  1.00 38.00  ? 104  LEU C CD2 1 
ATOM   7992  N  N   . LYS C 1 59  ? 22.033  41.586  34.357  1.00 40.07  ? 105  LYS C N   1 
ATOM   7993  C  CA  . LYS C 1 59  ? 22.257  41.699  32.909  1.00 40.57  ? 105  LYS C CA  1 
ATOM   7994  C  C   . LYS C 1 59  ? 23.025  40.487  32.382  1.00 41.04  ? 105  LYS C C   1 
ATOM   7995  O  O   . LYS C 1 59  ? 22.615  39.888  31.400  1.00 40.79  ? 105  LYS C O   1 
ATOM   7996  C  CB  . LYS C 1 59  ? 22.976  43.000  32.527  1.00 40.32  ? 105  LYS C CB  1 
ATOM   7997  C  CG  . LYS C 1 59  ? 22.075  44.228  32.544  1.00 39.74  ? 105  LYS C CG  1 
ATOM   7998  C  CD  . LYS C 1 59  ? 22.863  45.489  32.239  1.00 40.29  ? 105  LYS C CD  1 
ATOM   7999  C  CE  . LYS C 1 59  ? 22.103  46.745  32.679  1.00 41.77  ? 105  LYS C CE  1 
ATOM   8000  N  NZ  . LYS C 1 59  ? 22.854  48.032  32.452  1.00 39.46  ? 105  LYS C NZ  1 
ATOM   8001  N  N   . GLU C 1 60  ? 24.113  40.114  33.049  1.00 41.68  ? 106  GLU C N   1 
ATOM   8002  C  CA  . GLU C 1 60  ? 24.876  38.956  32.637  1.00 42.90  ? 106  GLU C CA  1 
ATOM   8003  C  C   . GLU C 1 60  ? 24.032  37.685  32.623  1.00 42.89  ? 106  GLU C C   1 
ATOM   8004  O  O   . GLU C 1 60  ? 24.124  36.879  31.674  1.00 43.29  ? 106  GLU C O   1 
ATOM   8005  C  CB  . GLU C 1 60  ? 26.080  38.763  33.533  1.00 43.19  ? 106  GLU C CB  1 
ATOM   8006  C  CG  . GLU C 1 60  ? 27.277  39.598  33.142  1.00 48.11  ? 106  GLU C CG  1 
ATOM   8007  C  CD  . GLU C 1 60  ? 28.478  39.334  34.065  1.00 55.41  ? 106  GLU C CD  1 
ATOM   8008  O  OE1 . GLU C 1 60  ? 28.508  39.873  35.204  1.00 57.33  ? 106  GLU C OE1 1 
ATOM   8009  O  OE2 . GLU C 1 60  ? 29.403  38.580  33.653  1.00 57.68  ? 106  GLU C OE2 1 
ATOM   8010  N  N   . MET C 1 61  ? 23.199  37.519  33.654  1.00 42.57  ? 107  MET C N   1 
ATOM   8011  C  CA  . MET C 1 61  ? 22.396  36.320  33.809  1.00 41.76  ? 107  MET C CA  1 
ATOM   8012  C  C   . MET C 1 61  ? 21.309  36.217  32.773  1.00 41.60  ? 107  MET C C   1 
ATOM   8013  O  O   . MET C 1 61  ? 20.988  35.130  32.301  1.00 42.22  ? 107  MET C O   1 
ATOM   8014  C  CB  . MET C 1 61  ? 21.806  36.274  35.195  1.00 41.89  ? 107  MET C CB  1 
ATOM   8015  C  CG  . MET C 1 61  ? 22.801  35.763  36.188  1.00 41.75  ? 107  MET C CG  1 
ATOM   8016  S  SD  . MET C 1 61  ? 22.150  35.925  37.812  1.00 43.71  ? 107  MET C SD  1 
ATOM   8017  C  CE  . MET C 1 61  ? 20.754  34.801  37.791  1.00 43.87  ? 107  MET C CE  1 
ATOM   8018  N  N   . ILE C 1 62  ? 20.740  37.347  32.401  1.00 41.16  ? 108  ILE C N   1 
ATOM   8019  C  CA  . ILE C 1 62  ? 19.809  37.360  31.296  1.00 40.42  ? 108  ILE C CA  1 
ATOM   8020  C  C   . ILE C 1 62  ? 20.545  36.887  30.051  1.00 40.30  ? 108  ILE C C   1 
ATOM   8021  O  O   . ILE C 1 62  ? 20.137  35.907  29.429  1.00 40.08  ? 108  ILE C O   1 
ATOM   8022  C  CB  . ILE C 1 62  ? 19.194  38.744  31.111  1.00 40.49  ? 108  ILE C CB  1 
ATOM   8023  C  CG1 . ILE C 1 62  ? 18.495  39.166  32.410  1.00 40.06  ? 108  ILE C CG1 1 
ATOM   8024  C  CG2 . ILE C 1 62  ? 18.230  38.752  29.943  1.00 40.25  ? 108  ILE C CG2 1 
ATOM   8025  C  CD1 . ILE C 1 62  ? 17.728  40.424  32.274  1.00 38.23  ? 108  ILE C CD1 1 
ATOM   8026  N  N   . LYS C 1 63  ? 21.656  37.555  29.728  1.00 40.33  ? 109  LYS C N   1 
ATOM   8027  C  CA  . LYS C 1 63  ? 22.455  37.231  28.540  1.00 40.19  ? 109  LYS C CA  1 
ATOM   8028  C  C   . LYS C 1 63  ? 22.720  35.746  28.519  1.00 39.86  ? 109  LYS C C   1 
ATOM   8029  O  O   . LYS C 1 63  ? 22.643  35.111  27.468  1.00 39.74  ? 109  LYS C O   1 
ATOM   8030  C  CB  . LYS C 1 63  ? 23.788  37.975  28.524  1.00 40.50  ? 109  LYS C CB  1 
ATOM   8031  C  CG  . LYS C 1 63  ? 23.690  39.487  28.406  1.00 42.39  ? 109  LYS C CG  1 
ATOM   8032  C  CD  . LYS C 1 63  ? 25.070  40.185  28.249  1.00 44.65  ? 109  LYS C CD  1 
ATOM   8033  C  CE  . LYS C 1 63  ? 25.289  40.551  26.781  1.00 47.02  ? 109  LYS C CE  1 
ATOM   8034  N  NZ  . LYS C 1 63  ? 26.275  41.669  26.566  1.00 48.00  ? 109  LYS C NZ  1 
ATOM   8035  N  N   . ALA C 1 64  ? 22.999  35.190  29.695  1.00 39.21  ? 110  ALA C N   1 
ATOM   8036  C  CA  . ALA C 1 64  ? 23.365  33.791  29.802  1.00 38.79  ? 110  ALA C CA  1 
ATOM   8037  C  C   . ALA C 1 64  ? 22.194  32.797  29.701  1.00 39.22  ? 110  ALA C C   1 
ATOM   8038  O  O   . ALA C 1 64  ? 22.412  31.602  29.496  1.00 39.75  ? 110  ALA C O   1 
ATOM   8039  C  CB  . ALA C 1 64  ? 24.133  33.571  31.049  1.00 38.40  ? 110  ALA C CB  1 
ATOM   8040  N  N   . GLY C 1 65  ? 20.959  33.258  29.857  1.00 38.90  ? 111  GLY C N   1 
ATOM   8041  C  CA  . GLY C 1 65  ? 19.856  32.343  29.682  1.00 38.37  ? 111  GLY C CA  1 
ATOM   8042  C  C   . GLY C 1 65  ? 18.733  32.394  30.693  1.00 38.24  ? 111  GLY C C   1 
ATOM   8043  O  O   . GLY C 1 65  ? 17.698  31.735  30.496  1.00 37.46  ? 111  GLY C O   1 
ATOM   8044  N  N   . MET C 1 66  ? 18.899  33.172  31.761  1.00 37.95  ? 112  MET C N   1 
ATOM   8045  C  CA  . MET C 1 66  ? 17.826  33.246  32.741  1.00 38.56  ? 112  MET C CA  1 
ATOM   8046  C  C   . MET C 1 66  ? 16.513  33.603  32.058  1.00 38.79  ? 112  MET C C   1 
ATOM   8047  O  O   . MET C 1 66  ? 16.518  34.433  31.133  1.00 39.32  ? 112  MET C O   1 
ATOM   8048  C  CB  . MET C 1 66  ? 18.149  34.234  33.847  1.00 38.50  ? 112  MET C CB  1 
ATOM   8049  C  CG  . MET C 1 66  ? 17.052  34.316  34.940  1.00 39.62  ? 112  MET C CG  1 
ATOM   8050  S  SD  . MET C 1 66  ? 17.405  35.574  36.185  1.00 43.07  ? 112  MET C SD  1 
ATOM   8051  C  CE  . MET C 1 66  ? 17.342  37.082  35.210  1.00 37.63  ? 112  MET C CE  1 
ATOM   8052  N  N   . ASN C 1 67  ? 15.422  32.948  32.461  1.00 38.51  ? 113  ASN C N   1 
ATOM   8053  C  CA  . ASN C 1 67  ? 14.092  33.309  31.948  1.00 38.58  ? 113  ASN C CA  1 
ATOM   8054  C  C   . ASN C 1 67  ? 13.127  33.638  33.060  1.00 39.26  ? 113  ASN C C   1 
ATOM   8055  O  O   . ASN C 1 67  ? 12.145  34.354  32.854  1.00 39.96  ? 113  ASN C O   1 
ATOM   8056  C  CB  . ASN C 1 67  ? 13.447  32.225  31.083  1.00 38.09  ? 113  ASN C CB  1 
ATOM   8057  C  CG  . ASN C 1 67  ? 14.394  31.645  30.017  1.00 37.00  ? 113  ASN C CG  1 
ATOM   8058  O  OD1 . ASN C 1 67  ? 14.777  30.485  30.077  1.00 38.45  ? 113  ASN C OD1 1 
ATOM   8059  N  ND2 . ASN C 1 67  ? 14.723  32.438  29.026  1.00 33.88  ? 113  ASN C ND2 1 
ATOM   8060  N  N   . ILE C 1 68  ? 13.375  33.128  34.256  1.00 39.44  ? 114  ILE C N   1 
ATOM   8061  C  CA  . ILE C 1 68  ? 12.461  33.446  35.353  1.00 39.32  ? 114  ILE C CA  1 
ATOM   8062  C  C   . ILE C 1 68  ? 13.267  33.845  36.551  1.00 39.70  ? 114  ILE C C   1 
ATOM   8063  O  O   . ILE C 1 68  ? 14.231  33.164  36.882  1.00 40.72  ? 114  ILE C O   1 
ATOM   8064  C  CB  . ILE C 1 68  ? 11.538  32.250  35.659  1.00 38.97  ? 114  ILE C CB  1 
ATOM   8065  C  CG1 . ILE C 1 68  ? 10.683  31.954  34.427  1.00 38.99  ? 114  ILE C CG1 1 
ATOM   8066  C  CG2 . ILE C 1 68  ? 10.641  32.532  36.849  1.00 38.16  ? 114  ILE C CG2 1 
ATOM   8067  C  CD1 . ILE C 1 68  ? 9.706   30.845  34.589  1.00 39.87  ? 114  ILE C CD1 1 
ATOM   8068  N  N   . ALA C 1 69  ? 12.923  34.964  37.180  1.00 39.58  ? 115  ALA C N   1 
ATOM   8069  C  CA  . ALA C 1 69  ? 13.588  35.299  38.432  1.00 39.45  ? 115  ALA C CA  1 
ATOM   8070  C  C   . ALA C 1 69  ? 12.719  34.809  39.606  1.00 39.33  ? 115  ALA C C   1 
ATOM   8071  O  O   . ALA C 1 69  ? 11.520  35.054  39.664  1.00 39.27  ? 115  ALA C O   1 
ATOM   8072  C  CB  . ALA C 1 69  ? 13.877  36.763  38.511  1.00 39.00  ? 115  ALA C CB  1 
ATOM   8073  N  N   . ARG C 1 70  ? 13.334  34.075  40.518  1.00 39.19  ? 116  ARG C N   1 
ATOM   8074  C  CA  . ARG C 1 70  ? 12.599  33.513  41.638  1.00 39.23  ? 116  ARG C CA  1 
ATOM   8075  C  C   . ARG C 1 70  ? 12.908  34.254  42.929  1.00 39.29  ? 116  ARG C C   1 
ATOM   8076  O  O   . ARG C 1 70  ? 14.059  34.320  43.342  1.00 39.48  ? 116  ARG C O   1 
ATOM   8077  C  CB  . ARG C 1 70  ? 12.956  32.043  41.798  1.00 39.05  ? 116  ARG C CB  1 
ATOM   8078  C  CG  . ARG C 1 70  ? 12.328  31.409  43.018  1.00 38.93  ? 116  ARG C CG  1 
ATOM   8079  C  CD  . ARG C 1 70  ? 12.893  30.037  43.244  1.00 36.90  ? 116  ARG C CD  1 
ATOM   8080  N  NE  . ARG C 1 70  ? 12.316  29.463  44.435  1.00 37.17  ? 116  ARG C NE  1 
ATOM   8081  C  CZ  . ARG C 1 70  ? 12.983  29.134  45.522  1.00 36.07  ? 116  ARG C CZ  1 
ATOM   8082  N  NH1 . ARG C 1 70  ? 14.293  29.289  45.580  1.00 36.13  ? 116  ARG C NH1 1 
ATOM   8083  N  NH2 . ARG C 1 70  ? 12.320  28.625  46.542  1.00 34.33  ? 116  ARG C NH2 1 
ATOM   8084  N  N   . LEU C 1 71  ? 11.884  34.826  43.553  1.00 38.87  ? 117  LEU C N   1 
ATOM   8085  C  CA  . LEU C 1 71  ? 12.080  35.516  44.813  1.00 38.58  ? 117  LEU C CA  1 
ATOM   8086  C  C   . LEU C 1 71  ? 11.666  34.595  45.918  1.00 39.00  ? 117  LEU C C   1 
ATOM   8087  O  O   . LEU C 1 71  ? 10.494  34.174  45.979  1.00 39.38  ? 117  LEU C O   1 
ATOM   8088  C  CB  . LEU C 1 71  ? 11.244  36.781  44.917  1.00 37.88  ? 117  LEU C CB  1 
ATOM   8089  C  CG  . LEU C 1 71  ? 11.112  37.702  43.728  1.00 37.21  ? 117  LEU C CG  1 
ATOM   8090  C  CD1 . LEU C 1 71  ? 10.194  38.821  44.103  1.00 35.61  ? 117  LEU C CD1 1 
ATOM   8091  C  CD2 . LEU C 1 71  ? 12.459  38.234  43.245  1.00 35.18  ? 117  LEU C CD2 1 
ATOM   8092  N  N   . ASN C 1 72  ? 12.613  34.292  46.801  1.00 38.78  ? 118  ASN C N   1 
ATOM   8093  C  CA  . ASN C 1 72  ? 12.346  33.335  47.854  1.00 38.78  ? 118  ASN C CA  1 
ATOM   8094  C  C   . ASN C 1 72  ? 11.900  34.041  49.127  1.00 39.13  ? 118  ASN C C   1 
ATOM   8095  O  O   . ASN C 1 72  ? 12.727  34.530  49.911  1.00 38.88  ? 118  ASN C O   1 
ATOM   8096  C  CB  . ASN C 1 72  ? 13.575  32.488  48.093  1.00 38.81  ? 118  ASN C CB  1 
ATOM   8097  C  CG  . ASN C 1 72  ? 13.362  31.466  49.147  1.00 39.52  ? 118  ASN C CG  1 
ATOM   8098  O  OD1 . ASN C 1 72  ? 12.264  31.311  49.654  1.00 43.24  ? 118  ASN C OD1 1 
ATOM   8099  N  ND2 . ASN C 1 72  ? 14.404  30.755  49.493  1.00 37.74  ? 118  ASN C ND2 1 
ATOM   8100  N  N   . PHE C 1 73  ? 10.586  34.110  49.331  1.00 39.78  ? 119  PHE C N   1 
ATOM   8101  C  CA  . PHE C 1 73  ? 10.046  34.808  50.499  1.00 40.07  ? 119  PHE C CA  1 
ATOM   8102  C  C   . PHE C 1 73  ? 10.288  34.134  51.832  1.00 40.55  ? 119  PHE C C   1 
ATOM   8103  O  O   . PHE C 1 73  ? 9.858   34.621  52.851  1.00 41.26  ? 119  PHE C O   1 
ATOM   8104  C  CB  . PHE C 1 73  ? 8.563   35.140  50.308  1.00 39.87  ? 119  PHE C CB  1 
ATOM   8105  C  CG  . PHE C 1 73  ? 8.343   36.466  49.664  1.00 39.35  ? 119  PHE C CG  1 
ATOM   8106  C  CD1 . PHE C 1 73  ? 8.665   36.673  48.311  1.00 41.15  ? 119  PHE C CD1 1 
ATOM   8107  C  CD2 . PHE C 1 73  ? 7.863   37.514  50.395  1.00 36.74  ? 119  PHE C CD2 1 
ATOM   8108  C  CE1 . PHE C 1 73  ? 8.478   37.931  47.720  1.00 41.01  ? 119  PHE C CE1 1 
ATOM   8109  C  CE2 . PHE C 1 73  ? 7.669   38.750  49.823  1.00 37.29  ? 119  PHE C CE2 1 
ATOM   8110  C  CZ  . PHE C 1 73  ? 7.980   38.964  48.492  1.00 39.20  ? 119  PHE C CZ  1 
ATOM   8111  N  N   . SER C 1 74  ? 10.973  33.004  51.817  1.00 40.91  ? 120  SER C N   1 
ATOM   8112  C  CA  . SER C 1 74  ? 11.447  32.388  53.031  1.00 41.32  ? 120  SER C CA  1 
ATOM   8113  C  C   . SER C 1 74  ? 12.522  33.262  53.727  1.00 41.88  ? 120  SER C C   1 
ATOM   8114  O  O   . SER C 1 74  ? 12.830  33.066  54.911  1.00 42.04  ? 120  SER C O   1 
ATOM   8115  C  CB  . SER C 1 74  ? 12.028  31.031  52.696  1.00 41.17  ? 120  SER C CB  1 
ATOM   8116  O  OG  . SER C 1 74  ? 11.393  29.997  53.429  1.00 41.86  ? 120  SER C OG  1 
ATOM   8117  N  N   . HIS C 1 75  ? 13.085  34.216  52.982  1.00 42.06  ? 121  HIS C N   1 
ATOM   8118  C  CA  . HIS C 1 75  ? 14.122  35.109  53.468  1.00 42.28  ? 121  HIS C CA  1 
ATOM   8119  C  C   . HIS C 1 75  ? 13.902  36.515  52.914  1.00 42.53  ? 121  HIS C C   1 
ATOM   8120  O  O   . HIS C 1 75  ? 13.476  36.681  51.769  1.00 43.21  ? 121  HIS C O   1 
ATOM   8121  C  CB  . HIS C 1 75  ? 15.504  34.620  53.043  1.00 41.94  ? 121  HIS C CB  1 
ATOM   8122  C  CG  . HIS C 1 75  ? 15.798  33.218  53.462  1.00 43.48  ? 121  HIS C CG  1 
ATOM   8123  N  ND1 . HIS C 1 75  ? 16.160  32.886  54.751  1.00 44.10  ? 121  HIS C ND1 1 
ATOM   8124  C  CD2 . HIS C 1 75  ? 15.776  32.055  52.764  1.00 43.52  ? 121  HIS C CD2 1 
ATOM   8125  C  CE1 . HIS C 1 75  ? 16.356  31.579  54.826  1.00 44.37  ? 121  HIS C CE1 1 
ATOM   8126  N  NE2 . HIS C 1 75  ? 16.128  31.052  53.636  1.00 43.74  ? 121  HIS C NE2 1 
ATOM   8127  N  N   . GLY C 1 76  ? 14.209  37.527  53.720  1.00 42.18  ? 122  GLY C N   1 
ATOM   8128  C  CA  . GLY C 1 76  ? 14.118  38.902  53.271  1.00 41.99  ? 122  GLY C CA  1 
ATOM   8129  C  C   . GLY C 1 76  ? 12.774  39.569  53.549  1.00 42.05  ? 122  GLY C C   1 
ATOM   8130  O  O   . GLY C 1 76  ? 11.727  38.918  53.652  1.00 42.58  ? 122  GLY C O   1 
ATOM   8131  N  N   . SER C 1 77  ? 12.817  40.887  53.657  1.00 41.30  ? 123  SER C N   1 
ATOM   8132  C  CA  . SER C 1 77  ? 11.655  41.674  53.966  1.00 40.55  ? 123  SER C CA  1 
ATOM   8133  C  C   . SER C 1 77  ? 11.003  42.134  52.690  1.00 40.34  ? 123  SER C C   1 
ATOM   8134  O  O   . SER C 1 77  ? 11.506  41.894  51.601  1.00 40.31  ? 123  SER C O   1 
ATOM   8135  C  CB  . SER C 1 77  ? 12.066  42.898  54.762  1.00 40.38  ? 123  SER C CB  1 
ATOM   8136  O  OG  . SER C 1 77  ? 12.787  43.765  53.921  1.00 40.25  ? 123  SER C OG  1 
ATOM   8137  N  N   . HIS C 1 78  ? 9.872   42.810  52.829  1.00 40.14  ? 124  HIS C N   1 
ATOM   8138  C  CA  . HIS C 1 78  ? 9.148   43.305  51.680  1.00 39.97  ? 124  HIS C CA  1 
ATOM   8139  C  C   . HIS C 1 78  ? 9.991   44.306  50.914  1.00 40.66  ? 124  HIS C C   1 
ATOM   8140  O  O   . HIS C 1 78  ? 10.080  44.265  49.676  1.00 40.66  ? 124  HIS C O   1 
ATOM   8141  C  CB  . HIS C 1 78  ? 7.861   43.942  52.139  1.00 39.40  ? 124  HIS C CB  1 
ATOM   8142  C  CG  . HIS C 1 78  ? 6.757   42.967  52.306  1.00 38.05  ? 124  HIS C CG  1 
ATOM   8143  N  ND1 . HIS C 1 78  ? 6.984   41.622  52.473  1.00 38.28  ? 124  HIS C ND1 1 
ATOM   8144  C  CD2 . HIS C 1 78  ? 5.419   43.135  52.360  1.00 37.50  ? 124  HIS C CD2 1 
ATOM   8145  C  CE1 . HIS C 1 78  ? 5.828   40.996  52.592  1.00 37.64  ? 124  HIS C CE1 1 
ATOM   8146  N  NE2 . HIS C 1 78  ? 4.861   41.893  52.527  1.00 37.55  ? 124  HIS C NE2 1 
ATOM   8147  N  N   . GLU C 1 79  ? 10.616  45.204  51.669  1.00 41.30  ? 125  GLU C N   1 
ATOM   8148  C  CA  . GLU C 1 79  ? 11.504  46.205  51.104  1.00 42.04  ? 125  GLU C CA  1 
ATOM   8149  C  C   . GLU C 1 79  ? 12.591  45.496  50.309  1.00 41.98  ? 125  GLU C C   1 
ATOM   8150  O  O   . GLU C 1 79  ? 12.927  45.911  49.195  1.00 42.26  ? 125  GLU C O   1 
ATOM   8151  C  CB  . GLU C 1 79  ? 12.103  47.069  52.208  1.00 42.14  ? 125  GLU C CB  1 
ATOM   8152  C  CG  . GLU C 1 79  ? 11.064  47.787  53.083  1.00 45.26  ? 125  GLU C CG  1 
ATOM   8153  C  CD  . GLU C 1 79  ? 10.268  46.849  54.024  1.00 49.45  ? 125  GLU C CD  1 
ATOM   8154  O  OE1 . GLU C 1 79  ? 10.788  45.773  54.400  1.00 50.71  ? 125  GLU C OE1 1 
ATOM   8155  O  OE2 . GLU C 1 79  ? 9.117   47.192  54.395  1.00 51.66  ? 125  GLU C OE2 1 
ATOM   8156  N  N   . TYR C 1 80  ? 13.098  44.394  50.862  1.00 41.80  ? 126  TYR C N   1 
ATOM   8157  C  CA  . TYR C 1 80  ? 14.195  43.680  50.239  1.00 41.67  ? 126  TYR C CA  1 
ATOM   8158  C  C   . TYR C 1 80  ? 13.783  43.142  48.887  1.00 41.64  ? 126  TYR C C   1 
ATOM   8159  O  O   . TYR C 1 80  ? 14.564  43.224  47.940  1.00 42.18  ? 126  TYR C O   1 
ATOM   8160  C  CB  . TYR C 1 80  ? 14.707  42.573  51.152  1.00 41.91  ? 126  TYR C CB  1 
ATOM   8161  C  CG  . TYR C 1 80  ? 15.760  41.678  50.521  1.00 42.60  ? 126  TYR C CG  1 
ATOM   8162  C  CD1 . TYR C 1 80  ? 17.126  41.955  50.668  1.00 42.76  ? 126  TYR C CD1 1 
ATOM   8163  C  CD2 . TYR C 1 80  ? 15.391  40.554  49.787  1.00 42.76  ? 126  TYR C CD2 1 
ATOM   8164  C  CE1 . TYR C 1 80  ? 18.083  41.129  50.091  1.00 41.19  ? 126  TYR C CE1 1 
ATOM   8165  C  CE2 . TYR C 1 80  ? 16.319  39.745  49.214  1.00 42.62  ? 126  TYR C CE2 1 
ATOM   8166  C  CZ  . TYR C 1 80  ? 17.659  40.029  49.363  1.00 43.12  ? 126  TYR C CZ  1 
ATOM   8167  O  OH  . TYR C 1 80  ? 18.572  39.181  48.773  1.00 45.73  ? 126  TYR C OH  1 
ATOM   8168  N  N   . HIS C 1 81  ? 12.562  42.606  48.793  1.00 41.45  ? 127  HIS C N   1 
ATOM   8169  C  CA  . HIS C 1 81  ? 12.087  41.988  47.549  1.00 40.92  ? 127  HIS C CA  1 
ATOM   8170  C  C   . HIS C 1 81  ? 11.659  43.027  46.533  1.00 40.85  ? 127  HIS C C   1 
ATOM   8171  O  O   . HIS C 1 81  ? 11.676  42.771  45.331  1.00 41.37  ? 127  HIS C O   1 
ATOM   8172  C  CB  . HIS C 1 81  ? 10.957  40.991  47.812  1.00 40.87  ? 127  HIS C CB  1 
ATOM   8173  C  CG  . HIS C 1 81  ? 11.387  39.812  48.609  1.00 40.20  ? 127  HIS C CG  1 
ATOM   8174  N  ND1 . HIS C 1 81  ? 12.275  38.877  48.124  1.00 40.43  ? 127  HIS C ND1 1 
ATOM   8175  C  CD2 . HIS C 1 81  ? 11.087  39.432  49.869  1.00 41.40  ? 127  HIS C CD2 1 
ATOM   8176  C  CE1 . HIS C 1 81  ? 12.501  37.965  49.053  1.00 40.56  ? 127  HIS C CE1 1 
ATOM   8177  N  NE2 . HIS C 1 81  ? 11.794  38.281  50.123  1.00 42.49  ? 127  HIS C NE2 1 
ATOM   8178  N  N   . ALA C 1 82  ? 11.271  44.196  47.020  1.00 40.56  ? 128  ALA C N   1 
ATOM   8179  C  CA  . ALA C 1 82  ? 10.933  45.302  46.140  1.00 40.67  ? 128  ALA C CA  1 
ATOM   8180  C  C   . ALA C 1 82  ? 12.175  45.743  45.378  1.00 40.67  ? 128  ALA C C   1 
ATOM   8181  O  O   . ALA C 1 82  ? 12.112  45.978  44.173  1.00 41.04  ? 128  ALA C O   1 
ATOM   8182  C  CB  . ALA C 1 82  ? 10.338  46.452  46.918  1.00 40.28  ? 128  ALA C CB  1 
ATOM   8183  N  N   . GLU C 1 83  ? 13.304  45.822  46.082  1.00 40.49  ? 129  GLU C N   1 
ATOM   8184  C  CA  . GLU C 1 83  ? 14.585  46.176  45.461  1.00 40.44  ? 129  GLU C CA  1 
ATOM   8185  C  C   . GLU C 1 83  ? 14.985  45.150  44.400  1.00 40.51  ? 129  GLU C C   1 
ATOM   8186  O  O   . GLU C 1 83  ? 15.584  45.518  43.388  1.00 40.42  ? 129  GLU C O   1 
ATOM   8187  C  CB  . GLU C 1 83  ? 15.706  46.311  46.505  1.00 40.42  ? 129  GLU C CB  1 
ATOM   8188  C  CG  . GLU C 1 83  ? 15.616  47.523  47.458  1.00 40.76  ? 129  GLU C CG  1 
ATOM   8189  C  CD  . GLU C 1 83  ? 16.527  47.416  48.725  1.00 41.29  ? 129  GLU C CD  1 
ATOM   8190  O  OE1 . GLU C 1 83  ? 17.190  46.380  48.976  1.00 39.46  ? 129  GLU C OE1 1 
ATOM   8191  O  OE2 . GLU C 1 83  ? 16.561  48.395  49.494  1.00 41.79  ? 129  GLU C OE2 1 
ATOM   8192  N  N   . SER C 1 84  ? 14.645  43.877  44.645  1.00 40.54  ? 130  SER C N   1 
ATOM   8193  C  CA  . SER C 1 84  ? 14.939  42.788  43.731  1.00 40.58  ? 130  SER C CA  1 
ATOM   8194  C  C   . SER C 1 84  ? 14.123  42.962  42.473  1.00 40.57  ? 130  SER C C   1 
ATOM   8195  O  O   . SER C 1 84  ? 14.652  42.917  41.351  1.00 40.84  ? 130  SER C O   1 
ATOM   8196  C  CB  . SER C 1 84  ? 14.617  41.437  44.368  1.00 40.49  ? 130  SER C CB  1 
ATOM   8197  O  OG  . SER C 1 84  ? 15.579  41.070  45.328  1.00 41.89  ? 130  SER C OG  1 
ATOM   8198  N  N   . ILE C 1 85  ? 12.822  43.165  42.661  1.00 40.24  ? 131  ILE C N   1 
ATOM   8199  C  CA  . ILE C 1 85  ? 11.931  43.345  41.532  1.00 39.27  ? 131  ILE C CA  1 
ATOM   8200  C  C   . ILE C 1 85  ? 12.488  44.511  40.715  1.00 39.36  ? 131  ILE C C   1 
ATOM   8201  O  O   . ILE C 1 85  ? 12.796  44.337  39.530  1.00 39.35  ? 131  ILE C O   1 
ATOM   8202  C  CB  . ILE C 1 85  ? 10.486  43.547  41.986  1.00 38.76  ? 131  ILE C CB  1 
ATOM   8203  C  CG1 . ILE C 1 85  ? 9.937   42.227  42.508  1.00 37.66  ? 131  ILE C CG1 1 
ATOM   8204  C  CG2 . ILE C 1 85  ? 9.630   44.038  40.831  1.00 37.82  ? 131  ILE C CG2 1 
ATOM   8205  C  CD1 . ILE C 1 85  ? 8.708   42.333  43.396  1.00 35.69  ? 131  ILE C CD1 1 
ATOM   8206  N  N   . ALA C 1 86  ? 12.683  45.655  41.377  1.00 39.13  ? 132  ALA C N   1 
ATOM   8207  C  CA  . ALA C 1 86  ? 13.206  46.878  40.739  1.00 39.10  ? 132  ALA C CA  1 
ATOM   8208  C  C   . ALA C 1 86  ? 14.469  46.634  39.950  1.00 39.15  ? 132  ALA C C   1 
ATOM   8209  O  O   . ALA C 1 86  ? 14.632  47.209  38.878  1.00 39.31  ? 132  ALA C O   1 
ATOM   8210  C  CB  . ALA C 1 86  ? 13.456  47.963  41.751  1.00 38.42  ? 132  ALA C CB  1 
ATOM   8211  N  N   . ASN C 1 87  ? 15.356  45.787  40.468  1.00 38.82  ? 133  ASN C N   1 
ATOM   8212  C  CA  . ASN C 1 87  ? 16.623  45.533  39.784  1.00 38.81  ? 133  ASN C CA  1 
ATOM   8213  C  C   . ASN C 1 87  ? 16.491  44.581  38.585  1.00 39.05  ? 133  ASN C C   1 
ATOM   8214  O  O   . ASN C 1 87  ? 17.114  44.771  37.539  1.00 39.44  ? 133  ASN C O   1 
ATOM   8215  C  CB  . ASN C 1 87  ? 17.683  45.034  40.762  1.00 38.64  ? 133  ASN C CB  1 
ATOM   8216  C  CG  . ASN C 1 87  ? 18.225  46.139  41.664  1.00 37.90  ? 133  ASN C CG  1 
ATOM   8217  O  OD1 . ASN C 1 87  ? 19.145  45.914  42.429  1.00 36.52  ? 133  ASN C OD1 1 
ATOM   8218  N  ND2 . ASN C 1 87  ? 17.663  47.326  41.570  1.00 36.95  ? 133  ASN C ND2 1 
ATOM   8219  N  N   . VAL C 1 88  ? 15.693  43.538  38.747  1.00 38.82  ? 134  VAL C N   1 
ATOM   8220  C  CA  . VAL C 1 88  ? 15.340  42.705  37.629  1.00 38.38  ? 134  VAL C CA  1 
ATOM   8221  C  C   . VAL C 1 88  ? 14.814  43.625  36.512  1.00 38.61  ? 134  VAL C C   1 
ATOM   8222  O  O   . VAL C 1 88  ? 15.446  43.748  35.437  1.00 38.55  ? 134  VAL C O   1 
ATOM   8223  C  CB  . VAL C 1 88  ? 14.276  41.632  38.044  1.00 38.53  ? 134  VAL C CB  1 
ATOM   8224  C  CG1 . VAL C 1 88  ? 13.789  40.834  36.857  1.00 37.35  ? 134  VAL C CG1 1 
ATOM   8225  C  CG2 . VAL C 1 88  ? 14.858  40.692  39.084  1.00 38.00  ? 134  VAL C CG2 1 
ATOM   8226  N  N   . ARG C 1 89  ? 13.682  44.290  36.789  1.00 38.03  ? 135  ARG C N   1 
ATOM   8227  C  CA  . ARG C 1 89  ? 13.014  45.115  35.793  1.00 37.19  ? 135  ARG C CA  1 
ATOM   8228  C  C   . ARG C 1 89  ? 13.961  46.064  35.096  1.00 37.58  ? 135  ARG C C   1 
ATOM   8229  O  O   . ARG C 1 89  ? 13.861  46.237  33.886  1.00 38.04  ? 135  ARG C O   1 
ATOM   8230  C  CB  . ARG C 1 89  ? 11.799  45.827  36.371  1.00 36.17  ? 135  ARG C CB  1 
ATOM   8231  C  CG  . ARG C 1 89  ? 10.618  44.902  36.429  1.00 34.10  ? 135  ARG C CG  1 
ATOM   8232  C  CD  . ARG C 1 89  ? 9.499   45.462  37.220  1.00 32.63  ? 135  ARG C CD  1 
ATOM   8233  N  NE  . ARG C 1 89  ? 8.450   44.462  37.404  1.00 34.27  ? 135  ARG C NE  1 
ATOM   8234  C  CZ  . ARG C 1 89  ? 7.478   44.556  38.312  1.00 32.44  ? 135  ARG C CZ  1 
ATOM   8235  N  NH1 . ARG C 1 89  ? 7.462   45.578  39.130  1.00 30.38  ? 135  ARG C NH1 1 
ATOM   8236  N  NH2 . ARG C 1 89  ? 6.548   43.620  38.428  1.00 30.89  ? 135  ARG C NH2 1 
ATOM   8237  N  N   . GLU C 1 90  ? 14.890  46.653  35.840  1.00 37.77  ? 136  GLU C N   1 
ATOM   8238  C  CA  . GLU C 1 90  ? 15.896  47.518  35.244  1.00 38.29  ? 136  GLU C CA  1 
ATOM   8239  C  C   . GLU C 1 90  ? 16.820  46.741  34.299  1.00 38.66  ? 136  GLU C C   1 
ATOM   8240  O  O   . GLU C 1 90  ? 16.988  47.110  33.139  1.00 39.00  ? 136  GLU C O   1 
ATOM   8241  C  CB  . GLU C 1 90  ? 16.730  48.204  36.316  1.00 38.27  ? 136  GLU C CB  1 
ATOM   8242  C  CG  . GLU C 1 90  ? 17.639  49.300  35.751  1.00 39.05  ? 136  GLU C CG  1 
ATOM   8243  C  CD  . GLU C 1 90  ? 18.358  50.093  36.828  1.00 40.84  ? 136  GLU C CD  1 
ATOM   8244  O  OE1 . GLU C 1 90  ? 17.917  50.071  38.006  1.00 41.52  ? 136  GLU C OE1 1 
ATOM   8245  O  OE2 . GLU C 1 90  ? 19.363  50.749  36.494  1.00 41.32  ? 136  GLU C OE2 1 
ATOM   8246  N  N   . ALA C 1 91  ? 17.414  45.666  34.804  1.00 38.51  ? 137  ALA C N   1 
ATOM   8247  C  CA  . ALA C 1 91  ? 18.254  44.826  33.998  1.00 38.56  ? 137  ALA C CA  1 
ATOM   8248  C  C   . ALA C 1 91  ? 17.496  44.413  32.743  1.00 38.86  ? 137  ALA C C   1 
ATOM   8249  O  O   . ALA C 1 91  ? 18.012  44.492  31.634  1.00 39.15  ? 137  ALA C O   1 
ATOM   8250  C  CB  . ALA C 1 91  ? 18.679  43.611  34.789  1.00 38.04  ? 137  ALA C CB  1 
ATOM   8251  N  N   . VAL C 1 92  ? 16.252  44.005  32.912  1.00 39.34  ? 138  VAL C N   1 
ATOM   8252  C  CA  . VAL C 1 92  ? 15.494  43.518  31.771  1.00 39.81  ? 138  VAL C CA  1 
ATOM   8253  C  C   . VAL C 1 92  ? 15.272  44.608  30.725  1.00 39.95  ? 138  VAL C C   1 
ATOM   8254  O  O   . VAL C 1 92  ? 15.504  44.366  29.538  1.00 40.71  ? 138  VAL C O   1 
ATOM   8255  C  CB  . VAL C 1 92  ? 14.151  42.866  32.187  1.00 39.79  ? 138  VAL C CB  1 
ATOM   8256  C  CG1 . VAL C 1 92  ? 13.488  42.270  30.992  1.00 39.40  ? 138  VAL C CG1 1 
ATOM   8257  C  CG2 . VAL C 1 92  ? 14.390  41.789  33.213  1.00 40.01  ? 138  VAL C CG2 1 
ATOM   8258  N  N   . GLU C 1 93  ? 14.836  45.786  31.162  1.00 39.42  ? 139  GLU C N   1 
ATOM   8259  C  CA  . GLU C 1 93  ? 14.452  46.831  30.229  1.00 39.22  ? 139  GLU C CA  1 
ATOM   8260  C  C   . GLU C 1 93  ? 15.653  47.472  29.566  1.00 39.24  ? 139  GLU C C   1 
ATOM   8261  O  O   . GLU C 1 93  ? 15.486  48.313  28.680  1.00 39.43  ? 139  GLU C O   1 
ATOM   8262  C  CB  . GLU C 1 93  ? 13.597  47.900  30.917  1.00 38.99  ? 139  GLU C CB  1 
ATOM   8263  C  CG  . GLU C 1 93  ? 12.305  47.371  31.555  1.00 39.72  ? 139  GLU C CG  1 
ATOM   8264  C  CD  . GLU C 1 93  ? 11.531  46.394  30.647  1.00 42.08  ? 139  GLU C CD  1 
ATOM   8265  O  OE1 . GLU C 1 93  ? 11.006  46.808  29.584  1.00 39.92  ? 139  GLU C OE1 1 
ATOM   8266  O  OE2 . GLU C 1 93  ? 11.454  45.204  31.013  1.00 44.47  ? 139  GLU C OE2 1 
ATOM   8267  N  N   . SER C 1 94  ? 16.861  47.096  29.997  1.00 39.20  ? 140  SER C N   1 
ATOM   8268  C  CA  . SER C 1 94  ? 18.081  47.728  29.483  1.00 39.08  ? 140  SER C CA  1 
ATOM   8269  C  C   . SER C 1 94  ? 18.302  47.264  28.049  1.00 39.33  ? 140  SER C C   1 
ATOM   8270  O  O   . SER C 1 94  ? 19.042  47.883  27.270  1.00 38.66  ? 140  SER C O   1 
ATOM   8271  C  CB  . SER C 1 94  ? 19.294  47.437  30.378  1.00 38.82  ? 140  SER C CB  1 
ATOM   8272  O  OG  . SER C 1 94  ? 19.749  46.105  30.254  1.00 38.78  ? 140  SER C OG  1 
ATOM   8273  N  N   . PHE C 1 95  ? 17.608  46.179  27.708  1.00 39.93  ? 141  PHE C N   1 
ATOM   8274  C  CA  . PHE C 1 95  ? 17.656  45.593  26.363  1.00 40.28  ? 141  PHE C CA  1 
ATOM   8275  C  C   . PHE C 1 95  ? 16.475  45.960  25.494  1.00 41.06  ? 141  PHE C C   1 
ATOM   8276  O  O   . PHE C 1 95  ? 16.323  45.398  24.436  1.00 41.25  ? 141  PHE C O   1 
ATOM   8277  C  CB  . PHE C 1 95  ? 17.674  44.088  26.446  1.00 39.64  ? 141  PHE C CB  1 
ATOM   8278  C  CG  . PHE C 1 95  ? 18.793  43.541  27.249  1.00 37.54  ? 141  PHE C CG  1 
ATOM   8279  C  CD1 . PHE C 1 95  ? 18.619  43.283  28.597  1.00 35.80  ? 141  PHE C CD1 1 
ATOM   8280  C  CD2 . PHE C 1 95  ? 20.025  43.253  26.655  1.00 35.31  ? 141  PHE C CD2 1 
ATOM   8281  C  CE1 . PHE C 1 95  ? 19.668  42.763  29.360  1.00 35.96  ? 141  PHE C CE1 1 
ATOM   8282  C  CE2 . PHE C 1 95  ? 21.072  42.724  27.403  1.00 34.39  ? 141  PHE C CE2 1 
ATOM   8283  C  CZ  . PHE C 1 95  ? 20.892  42.477  28.763  1.00 34.99  ? 141  PHE C CZ  1 
ATOM   8284  N  N   . ALA C 1 96  ? 15.638  46.891  25.938  1.00 41.96  ? 142  ALA C N   1 
ATOM   8285  C  CA  . ALA C 1 96  ? 14.468  47.285  25.152  1.00 42.46  ? 142  ALA C CA  1 
ATOM   8286  C  C   . ALA C 1 96  ? 14.855  48.138  23.943  1.00 43.14  ? 142  ALA C C   1 
ATOM   8287  O  O   . ALA C 1 96  ? 14.022  48.380  23.075  1.00 43.59  ? 142  ALA C O   1 
ATOM   8288  C  CB  . ALA C 1 96  ? 13.480  48.003  26.014  1.00 42.18  ? 142  ALA C CB  1 
ATOM   8289  N  N   . GLY C 1 97  ? 16.119  48.571  23.881  1.00 43.71  ? 143  GLY C N   1 
ATOM   8290  C  CA  . GLY C 1 97  ? 16.635  49.320  22.734  1.00 44.03  ? 143  GLY C CA  1 
ATOM   8291  C  C   . GLY C 1 97  ? 16.433  48.637  21.399  1.00 44.22  ? 143  GLY C C   1 
ATOM   8292  O  O   . GLY C 1 97  ? 16.569  49.266  20.359  1.00 44.29  ? 143  GLY C O   1 
ATOM   8293  N  N   . SER C 1 98  ? 16.103  47.347  21.432  1.00 44.56  ? 144  SER C N   1 
ATOM   8294  C  CA  . SER C 1 98  ? 15.913  46.567  20.214  1.00 44.76  ? 144  SER C CA  1 
ATOM   8295  C  C   . SER C 1 98  ? 14.829  45.518  20.377  1.00 44.67  ? 144  SER C C   1 
ATOM   8296  O  O   . SER C 1 98  ? 15.123  44.394  20.821  1.00 44.32  ? 144  SER C O   1 
ATOM   8297  C  CB  . SER C 1 98  ? 17.214  45.860  19.831  1.00 45.05  ? 144  SER C CB  1 
ATOM   8298  O  OG  . SER C 1 98  ? 18.111  46.756  19.187  1.00 45.53  ? 144  SER C OG  1 
ATOM   8299  N  N   . PRO C 1 99  ? 13.587  45.859  19.976  1.00 44.57  ? 145  PRO C N   1 
ATOM   8300  C  CA  . PRO C 1 99  ? 12.420  44.991  20.158  1.00 44.58  ? 145  PRO C CA  1 
ATOM   8301  C  C   . PRO C 1 99  ? 12.608  43.602  19.536  1.00 44.53  ? 145  PRO C C   1 
ATOM   8302  O  O   . PRO C 1 99  ? 12.041  42.638  20.033  1.00 44.53  ? 145  PRO C O   1 
ATOM   8303  C  CB  . PRO C 1 99  ? 11.296  45.741  19.431  1.00 44.76  ? 145  PRO C CB  1 
ATOM   8304  C  CG  . PRO C 1 99  ? 11.776  47.119  19.230  1.00 44.35  ? 145  PRO C CG  1 
ATOM   8305  C  CD  . PRO C 1 99  ? 13.257  47.116  19.281  1.00 44.46  ? 145  PRO C CD  1 
ATOM   8306  N  N   . LEU C 1 100 ? 13.397  43.518  18.464  1.00 44.54  ? 146  LEU C N   1 
ATOM   8307  C  CA  . LEU C 1 100 ? 13.625  42.271  17.728  1.00 44.64  ? 146  LEU C CA  1 
ATOM   8308  C  C   . LEU C 1 100 ? 14.500  41.314  18.510  1.00 44.88  ? 146  LEU C C   1 
ATOM   8309  O  O   . LEU C 1 100 ? 14.532  40.098  18.231  1.00 45.47  ? 146  LEU C O   1 
ATOM   8310  C  CB  . LEU C 1 100 ? 14.273  42.523  16.358  1.00 44.56  ? 146  LEU C CB  1 
ATOM   8311  C  CG  . LEU C 1 100 ? 13.485  43.330  15.308  1.00 44.61  ? 146  LEU C CG  1 
ATOM   8312  C  CD1 . LEU C 1 100 ? 14.358  43.675  14.113  1.00 43.90  ? 146  LEU C CD1 1 
ATOM   8313  C  CD2 . LEU C 1 100 ? 12.224  42.602  14.856  1.00 43.92  ? 146  LEU C CD2 1 
ATOM   8314  N  N   . SER C 1 101 ? 15.196  41.848  19.506  1.00 44.51  ? 147  SER C N   1 
ATOM   8315  C  CA  . SER C 1 101 ? 16.105  41.022  20.305  1.00 44.04  ? 147  SER C CA  1 
ATOM   8316  C  C   . SER C 1 101 ? 15.738  40.900  21.826  1.00 43.50  ? 147  SER C C   1 
ATOM   8317  O  O   . SER C 1 101 ? 16.216  40.007  22.519  1.00 43.45  ? 147  SER C O   1 
ATOM   8318  C  CB  . SER C 1 101 ? 17.556  41.475  19.988  1.00 43.64  ? 147  SER C CB  1 
ATOM   8319  O  OG  . SER C 1 101 ? 18.372  41.506  21.169  1.00 44.38  ? 147  SER C OG  1 
ATOM   8320  N  N   . TYR C 1 102 ? 14.882  41.806  22.305  1.00 42.93  ? 148  TYR C N   1 
ATOM   8321  C  CA  . TYR C 1 102 ? 14.404  41.880  23.698  1.00 42.25  ? 148  TYR C CA  1 
ATOM   8322  C  C   . TYR C 1 102 ? 13.949  40.532  24.260  1.00 42.25  ? 148  TYR C C   1 
ATOM   8323  O  O   . TYR C 1 102 ? 13.114  39.869  23.635  1.00 42.71  ? 148  TYR C O   1 
ATOM   8324  C  CB  . TYR C 1 102 ? 13.226  42.846  23.759  1.00 41.61  ? 148  TYR C CB  1 
ATOM   8325  C  CG  . TYR C 1 102 ? 12.563  42.942  25.101  1.00 41.01  ? 148  TYR C CG  1 
ATOM   8326  C  CD1 . TYR C 1 102 ? 13.154  43.663  26.127  1.00 39.96  ? 148  TYR C CD1 1 
ATOM   8327  C  CD2 . TYR C 1 102 ? 11.333  42.332  25.344  1.00 40.77  ? 148  TYR C CD2 1 
ATOM   8328  C  CE1 . TYR C 1 102 ? 12.540  43.777  27.375  1.00 39.59  ? 148  TYR C CE1 1 
ATOM   8329  C  CE2 . TYR C 1 102 ? 10.712  42.438  26.583  1.00 39.80  ? 148  TYR C CE2 1 
ATOM   8330  C  CZ  . TYR C 1 102 ? 11.325  43.164  27.593  1.00 39.32  ? 148  TYR C CZ  1 
ATOM   8331  O  OH  . TYR C 1 102 ? 10.750  43.293  28.821  1.00 38.84  ? 148  TYR C OH  1 
ATOM   8332  N  N   . ARG C 1 103 ? 14.467  40.166  25.441  1.00 41.56  ? 149  ARG C N   1 
ATOM   8333  C  CA  . ARG C 1 103 ? 14.080  38.938  26.155  1.00 41.12  ? 149  ARG C CA  1 
ATOM   8334  C  C   . ARG C 1 103 ? 13.236  39.211  27.403  1.00 40.27  ? 149  ARG C C   1 
ATOM   8335  O  O   . ARG C 1 103 ? 13.758  39.679  28.415  1.00 40.50  ? 149  ARG C O   1 
ATOM   8336  C  CB  . ARG C 1 103 ? 15.333  38.163  26.604  1.00 41.66  ? 149  ARG C CB  1 
ATOM   8337  C  CG  . ARG C 1 103 ? 16.026  37.331  25.513  1.00 43.52  ? 149  ARG C CG  1 
ATOM   8338  C  CD  . ARG C 1 103 ? 17.468  37.034  25.877  1.00 47.78  ? 149  ARG C CD  1 
ATOM   8339  N  NE  . ARG C 1 103 ? 18.291  38.261  25.920  1.00 50.87  ? 149  ARG C NE  1 
ATOM   8340  C  CZ  . ARG C 1 103 ? 19.544  38.334  25.448  1.00 52.69  ? 149  ARG C CZ  1 
ATOM   8341  N  NH1 . ARG C 1 103 ? 20.097  37.248  24.894  1.00 52.87  ? 149  ARG C NH1 1 
ATOM   8342  N  NH2 . ARG C 1 103 ? 20.238  39.479  25.499  1.00 51.36  ? 149  ARG C NH2 1 
ATOM   8343  N  N   . PRO C 1 104 ? 11.945  38.887  27.361  1.00 39.40  ? 150  PRO C N   1 
ATOM   8344  C  CA  . PRO C 1 104 ? 11.118  39.030  28.562  1.00 39.40  ? 150  PRO C CA  1 
ATOM   8345  C  C   . PRO C 1 104 ? 11.624  38.145  29.702  1.00 39.44  ? 150  PRO C C   1 
ATOM   8346  O  O   . PRO C 1 104 ? 12.079  37.028  29.466  1.00 39.72  ? 150  PRO C O   1 
ATOM   8347  C  CB  . PRO C 1 104 ? 9.749   38.514  28.128  1.00 39.20  ? 150  PRO C CB  1 
ATOM   8348  C  CG  . PRO C 1 104 ? 9.782   38.503  26.643  1.00 40.00  ? 150  PRO C CG  1 
ATOM   8349  C  CD  . PRO C 1 104 ? 11.201  38.369  26.212  1.00 39.21  ? 150  PRO C CD  1 
ATOM   8350  N  N   . VAL C 1 105 ? 11.521  38.622  30.939  1.00 38.79  ? 151  VAL C N   1 
ATOM   8351  C  CA  . VAL C 1 105 ? 11.915  37.796  32.078  1.00 37.69  ? 151  VAL C CA  1 
ATOM   8352  C  C   . VAL C 1 105 ? 10.766  37.748  33.070  1.00 37.49  ? 151  VAL C C   1 
ATOM   8353  O  O   . VAL C 1 105 ? 10.291  38.779  33.520  1.00 37.55  ? 151  VAL C O   1 
ATOM   8354  C  CB  . VAL C 1 105 ? 13.185  38.376  32.777  1.00 37.82  ? 151  VAL C CB  1 
ATOM   8355  C  CG1 . VAL C 1 105 ? 13.376  37.773  34.174  1.00 36.07  ? 151  VAL C CG1 1 
ATOM   8356  C  CG2 . VAL C 1 105 ? 14.441  38.185  31.897  1.00 36.50  ? 151  VAL C CG2 1 
ATOM   8357  N  N   . ALA C 1 106 ? 10.325  36.554  33.428  1.00 37.23  ? 152  ALA C N   1 
ATOM   8358  C  CA  . ALA C 1 106 ? 9.227   36.447  34.372  1.00 36.98  ? 152  ALA C CA  1 
ATOM   8359  C  C   . ALA C 1 106 ? 9.737   36.754  35.753  1.00 37.09  ? 152  ALA C C   1 
ATOM   8360  O  O   . ALA C 1 106 ? 10.941  36.845  35.970  1.00 37.47  ? 152  ALA C O   1 
ATOM   8361  C  CB  . ALA C 1 106 ? 8.627   35.079  34.328  1.00 36.51  ? 152  ALA C CB  1 
ATOM   8362  N  N   . ILE C 1 107 ? 8.814   36.950  36.684  1.00 37.20  ? 153  ILE C N   1 
ATOM   8363  C  CA  . ILE C 1 107 ? 9.179   37.093  38.080  1.00 36.80  ? 153  ILE C CA  1 
ATOM   8364  C  C   . ILE C 1 107 ? 8.247   36.211  38.870  1.00 37.39  ? 153  ILE C C   1 
ATOM   8365  O  O   . ILE C 1 107 ? 7.012   36.372  38.793  1.00 37.89  ? 153  ILE C O   1 
ATOM   8366  C  CB  . ILE C 1 107 ? 9.087   38.546  38.568  1.00 36.39  ? 153  ILE C CB  1 
ATOM   8367  C  CG1 . ILE C 1 107 ? 10.149  39.389  37.890  1.00 34.67  ? 153  ILE C CG1 1 
ATOM   8368  C  CG2 . ILE C 1 107 ? 9.320   38.636  40.070  1.00 36.19  ? 153  ILE C CG2 1 
ATOM   8369  C  CD1 . ILE C 1 107 ? 10.188  40.812  38.371  1.00 31.54  ? 153  ILE C CD1 1 
ATOM   8370  N  N   . ALA C 1 108 ? 8.843   35.294  39.625  1.00 37.24  ? 154  ALA C N   1 
ATOM   8371  C  CA  . ALA C 1 108 ? 8.078   34.342  40.415  1.00 37.41  ? 154  ALA C CA  1 
ATOM   8372  C  C   . ALA C 1 108 ? 8.290   34.551  41.904  1.00 37.35  ? 154  ALA C C   1 
ATOM   8373  O  O   . ALA C 1 108 ? 9.423   34.526  42.385  1.00 38.32  ? 154  ALA C O   1 
ATOM   8374  C  CB  . ALA C 1 108 ? 8.432   32.916  40.022  1.00 37.40  ? 154  ALA C CB  1 
ATOM   8375  N  N   . LEU C 1 109 ? 7.199   34.784  42.616  1.00 36.72  ? 155  LEU C N   1 
ATOM   8376  C  CA  . LEU C 1 109 ? 7.229   34.918  44.053  1.00 36.42  ? 155  LEU C CA  1 
ATOM   8377  C  C   . LEU C 1 109 ? 7.146   33.526  44.631  1.00 36.48  ? 155  LEU C C   1 
ATOM   8378  O  O   . LEU C 1 109 ? 6.148   32.838  44.424  1.00 37.15  ? 155  LEU C O   1 
ATOM   8379  C  CB  . LEU C 1 109 ? 6.020   35.730  44.525  1.00 36.09  ? 155  LEU C CB  1 
ATOM   8380  C  CG  . LEU C 1 109 ? 5.899   35.952  46.032  1.00 36.18  ? 155  LEU C CG  1 
ATOM   8381  C  CD1 . LEU C 1 109 ? 5.094   37.220  46.319  1.00 36.15  ? 155  LEU C CD1 1 
ATOM   8382  C  CD2 . LEU C 1 109 ? 5.282   34.737  46.754  1.00 35.47  ? 155  LEU C CD2 1 
ATOM   8383  N  N   . ASP C 1 110 ? 8.171   33.115  45.370  1.00 36.45  ? 156  ASP C N   1 
ATOM   8384  C  CA  . ASP C 1 110 ? 8.131   31.808  46.036  1.00 36.47  ? 156  ASP C CA  1 
ATOM   8385  C  C   . ASP C 1 110 ? 7.739   31.918  47.494  1.00 36.24  ? 156  ASP C C   1 
ATOM   8386  O  O   . ASP C 1 110 ? 8.429   32.570  48.276  1.00 36.61  ? 156  ASP C O   1 
ATOM   8387  C  CB  . ASP C 1 110 ? 9.465   31.057  45.886  1.00 36.36  ? 156  ASP C CB  1 
ATOM   8388  C  CG  . ASP C 1 110 ? 9.432   29.663  46.541  1.00 36.50  ? 156  ASP C CG  1 
ATOM   8389  O  OD1 . ASP C 1 110 ? 8.884   29.524  47.688  1.00 36.03  ? 156  ASP C OD1 1 
ATOM   8390  O  OD2 . ASP C 1 110 ? 9.968   28.710  45.911  1.00 34.25  ? 156  ASP C OD2 1 
ATOM   8391  N  N   . THR C 1 111 ? 6.655   31.247  47.855  1.00 36.13  ? 157  THR C N   1 
ATOM   8392  C  CA  . THR C 1 111 ? 6.022   31.410  49.172  1.00 36.56  ? 157  THR C CA  1 
ATOM   8393  C  C   . THR C 1 111 ? 6.804   30.792  50.329  1.00 37.21  ? 157  THR C C   1 
ATOM   8394  O  O   . THR C 1 111 ? 7.471   29.775  50.161  1.00 37.89  ? 157  THR C O   1 
ATOM   8395  C  CB  . THR C 1 111 ? 4.594   30.888  49.135  1.00 36.15  ? 157  THR C CB  1 
ATOM   8396  O  OG1 . THR C 1 111 ? 3.735   31.917  49.578  1.00 36.20  ? 157  THR C OG1 1 
ATOM   8397  C  CG2 . THR C 1 111 ? 4.394   29.711  49.994  1.00 35.33  ? 157  THR C CG2 1 
ATOM   8398  N  N   . LYS C 1 112 ? 6.772   31.412  51.501  1.00 38.07  ? 158  LYS C N   1 
ATOM   8399  C  CA  . LYS C 1 112 ? 7.413   30.778  52.652  1.00 38.31  ? 158  LYS C CA  1 
ATOM   8400  C  C   . LYS C 1 112 ? 6.632   29.530  53.054  1.00 38.59  ? 158  LYS C C   1 
ATOM   8401  O  O   . LYS C 1 112 ? 7.193   28.440  52.988  1.00 39.53  ? 158  LYS C O   1 
ATOM   8402  C  CB  . LYS C 1 112 ? 7.613   31.723  53.835  1.00 38.39  ? 158  LYS C CB  1 
ATOM   8403  C  CG  . LYS C 1 112 ? 8.286   31.023  55.027  1.00 39.10  ? 158  LYS C CG  1 
ATOM   8404  C  CD  . LYS C 1 112 ? 7.945   31.703  56.368  1.00 39.87  ? 158  LYS C CD  1 
ATOM   8405  C  CE  . LYS C 1 112 ? 9.210   32.266  56.941  1.00 42.28  ? 158  LYS C CE  1 
ATOM   8406  N  NZ  . LYS C 1 112 ? 8.961   33.574  57.677  1.00 43.20  ? 158  LYS C NZ  1 
ATOM   8407  N  N   . GLY C 1 113 ? 5.361   29.672  53.438  1.00 38.07  ? 159  GLY C N   1 
ATOM   8408  C  CA  . GLY C 1 113 ? 4.545   28.508  53.787  1.00 38.22  ? 159  GLY C CA  1 
ATOM   8409  C  C   . GLY C 1 113 ? 4.884   27.966  55.170  1.00 38.85  ? 159  GLY C C   1 
ATOM   8410  O  O   . GLY C 1 113 ? 5.648   28.584  55.906  1.00 39.25  ? 159  GLY C O   1 
ATOM   8411  N  N   . PRO C 1 114 ? 4.351   26.788  55.527  1.00 38.98  ? 160  PRO C N   1 
ATOM   8412  C  CA  . PRO C 1 114 ? 4.520   26.237  56.869  1.00 39.31  ? 160  PRO C CA  1 
ATOM   8413  C  C   . PRO C 1 114 ? 5.906   25.676  57.192  1.00 39.63  ? 160  PRO C C   1 
ATOM   8414  O  O   . PRO C 1 114 ? 5.999   24.524  57.610  1.00 40.70  ? 160  PRO C O   1 
ATOM   8415  C  CB  . PRO C 1 114 ? 3.478   25.114  56.924  1.00 39.33  ? 160  PRO C CB  1 
ATOM   8416  C  CG  . PRO C 1 114 ? 3.173   24.786  55.532  1.00 38.96  ? 160  PRO C CG  1 
ATOM   8417  C  CD  . PRO C 1 114 ? 3.552   25.916  54.653  1.00 39.06  ? 160  PRO C CD  1 
ATOM   8418  N  N   . GLU C 1 115 ? 6.961   26.475  57.023  1.00 39.29  ? 161  GLU C N   1 
ATOM   8419  C  CA  . GLU C 1 115 ? 8.309   26.028  57.331  1.00 38.98  ? 161  GLU C CA  1 
ATOM   8420  C  C   . GLU C 1 115 ? 8.470   25.904  58.818  1.00 39.06  ? 161  GLU C C   1 
ATOM   8421  O  O   . GLU C 1 115 ? 7.624   26.375  59.582  1.00 39.25  ? 161  GLU C O   1 
ATOM   8422  C  CB  . GLU C 1 115 ? 9.337   27.057  56.881  1.00 38.88  ? 161  GLU C CB  1 
ATOM   8423  C  CG  . GLU C 1 115 ? 9.606   27.105  55.415  1.00 38.99  ? 161  GLU C CG  1 
ATOM   8424  C  CD  . GLU C 1 115 ? 10.901  27.834  55.077  1.00 38.61  ? 161  GLU C CD  1 
ATOM   8425  O  OE1 . GLU C 1 115 ? 11.431  28.588  55.926  1.00 38.74  ? 161  GLU C OE1 1 
ATOM   8426  O  OE2 . GLU C 1 115 ? 11.378  27.660  53.934  1.00 37.27  ? 161  GLU C OE2 1 
ATOM   8427  N  N   . ILE C 1 116 ? 9.583   25.299  59.224  1.00 39.06  ? 162  ILE C N   1 
ATOM   8428  C  CA  . ILE C 1 116 ? 10.007  25.317  60.611  1.00 38.91  ? 162  ILE C CA  1 
ATOM   8429  C  C   . ILE C 1 116 ? 11.500  25.540  60.573  1.00 39.14  ? 162  ILE C C   1 
ATOM   8430  O  O   . ILE C 1 116 ? 12.199  24.890  59.802  1.00 39.43  ? 162  ILE C O   1 
ATOM   8431  C  CB  . ILE C 1 116 ? 9.690   23.997  61.321  1.00 38.83  ? 162  ILE C CB  1 
ATOM   8432  C  CG1 . ILE C 1 116 ? 8.221   23.616  61.110  1.00 38.16  ? 162  ILE C CG1 1 
ATOM   8433  C  CG2 . ILE C 1 116 ? 10.000  24.111  62.796  1.00 38.46  ? 162  ILE C CG2 1 
ATOM   8434  C  CD1 . ILE C 1 116 ? 7.932   22.170  61.352  1.00 37.48  ? 162  ILE C CD1 1 
ATOM   8435  N  N   . ARG C 1 117 ? 11.987  26.486  61.366  1.00 39.38  ? 163  ARG C N   1 
ATOM   8436  C  CA  . ARG C 1 117 ? 13.430  26.726  61.465  1.00 39.79  ? 163  ARG C CA  1 
ATOM   8437  C  C   . ARG C 1 117 ? 13.902  26.796  62.915  1.00 39.86  ? 163  ARG C C   1 
ATOM   8438  O  O   . ARG C 1 117 ? 13.169  27.221  63.826  1.00 40.11  ? 163  ARG C O   1 
ATOM   8439  C  CB  . ARG C 1 117 ? 13.858  27.993  60.697  1.00 39.47  ? 163  ARG C CB  1 
ATOM   8440  C  CG  . ARG C 1 117 ? 13.674  27.874  59.202  1.00 39.68  ? 163  ARG C CG  1 
ATOM   8441  C  CD  . ARG C 1 117 ? 13.992  29.155  58.425  1.00 40.05  ? 163  ARG C CD  1 
ATOM   8442  N  NE  . ARG C 1 117 ? 13.845  28.949  56.976  1.00 40.10  ? 163  ARG C NE  1 
ATOM   8443  C  CZ  . ARG C 1 117 ? 14.812  28.544  56.151  1.00 39.72  ? 163  ARG C CZ  1 
ATOM   8444  N  NH1 . ARG C 1 117 ? 16.032  28.306  56.597  1.00 39.60  ? 163  ARG C NH1 1 
ATOM   8445  N  NH2 . ARG C 1 117 ? 14.567  28.401  54.863  1.00 39.19  ? 163  ARG C NH2 1 
ATOM   8446  N  N   . THR C 1 118 ? 15.133  26.368  63.120  1.00 39.78  ? 164  THR C N   1 
ATOM   8447  C  CA  . THR C 1 118 ? 15.789  26.567  64.388  1.00 40.18  ? 164  THR C CA  1 
ATOM   8448  C  C   . THR C 1 118 ? 15.959  28.076  64.651  1.00 40.81  ? 164  THR C C   1 
ATOM   8449  O  O   . THR C 1 118 ? 15.749  28.905  63.737  1.00 40.56  ? 164  THR C O   1 
ATOM   8450  C  CB  . THR C 1 118 ? 17.161  25.883  64.405  1.00 40.02  ? 164  THR C CB  1 
ATOM   8451  O  OG1 . THR C 1 118 ? 18.058  26.581  63.542  1.00 40.27  ? 164  THR C OG1 1 
ATOM   8452  C  CG2 . THR C 1 118 ? 17.047  24.455  63.963  1.00 39.80  ? 164  THR C CG2 1 
ATOM   8453  N  N   . GLY C 1 119 ? 16.332  28.423  65.892  1.00 40.83  ? 165  GLY C N   1 
ATOM   8454  C  CA  . GLY C 1 119 ? 16.601  29.809  66.273  1.00 40.93  ? 165  GLY C CA  1 
ATOM   8455  C  C   . GLY C 1 119 ? 17.952  30.354  65.822  1.00 41.36  ? 165  GLY C C   1 
ATOM   8456  O  O   . GLY C 1 119 ? 18.677  29.707  65.061  1.00 41.35  ? 165  GLY C O   1 
ATOM   8457  N  N   . ILE C 1 120 ? 18.280  31.564  66.291  1.00 41.80  ? 166  ILE C N   1 
ATOM   8458  C  CA  . ILE C 1 120 ? 19.574  32.185  66.048  1.00 41.52  ? 166  ILE C CA  1 
ATOM   8459  C  C   . ILE C 1 120 ? 20.543  31.664  67.077  1.00 42.28  ? 166  ILE C C   1 
ATOM   8460  O  O   . ILE C 1 120 ? 20.174  31.409  68.220  1.00 42.35  ? 166  ILE C O   1 
ATOM   8461  C  CB  . ILE C 1 120 ? 19.515  33.714  66.146  1.00 41.27  ? 166  ILE C CB  1 
ATOM   8462  C  CG1 . ILE C 1 120 ? 18.554  34.282  65.096  1.00 40.82  ? 166  ILE C CG1 1 
ATOM   8463  C  CG2 . ILE C 1 120 ? 20.921  34.330  65.975  1.00 40.60  ? 166  ILE C CG2 1 
ATOM   8464  C  CD1 . ILE C 1 120 ? 17.174  34.605  65.615  1.00 40.51  ? 166  ILE C CD1 1 
ATOM   8465  N  N   . LEU C 1 121 ? 21.800  31.524  66.681  1.00 43.45  ? 167  LEU C N   1 
ATOM   8466  C  CA  . LEU C 1 121 ? 22.776  30.923  67.571  1.00 43.93  ? 167  LEU C CA  1 
ATOM   8467  C  C   . LEU C 1 121 ? 23.350  31.886  68.610  1.00 44.72  ? 167  LEU C C   1 
ATOM   8468  O  O   . LEU C 1 121 ? 23.517  33.086  68.343  1.00 44.60  ? 167  LEU C O   1 
ATOM   8469  C  CB  . LEU C 1 121 ? 23.860  30.212  66.772  1.00 43.34  ? 167  LEU C CB  1 
ATOM   8470  C  CG  . LEU C 1 121 ? 23.908  28.734  67.157  1.00 42.39  ? 167  LEU C CG  1 
ATOM   8471  C  CD1 . LEU C 1 121 ? 22.507  28.176  67.433  1.00 41.53  ? 167  LEU C CD1 1 
ATOM   8472  C  CD2 . LEU C 1 121 ? 24.597  27.947  66.105  1.00 41.09  ? 167  LEU C CD2 1 
ATOM   8473  N  N   . GLN C 1 122 ? 23.622  31.341  69.799  1.00 45.80  ? 168  GLN C N   1 
ATOM   8474  C  CA  . GLN C 1 122 ? 24.168  32.097  70.929  1.00 46.95  ? 168  GLN C CA  1 
ATOM   8475  C  C   . GLN C 1 122 ? 25.344  32.947  70.478  1.00 47.23  ? 168  GLN C C   1 
ATOM   8476  O  O   . GLN C 1 122 ? 26.373  32.433  70.042  1.00 47.05  ? 168  GLN C O   1 
ATOM   8477  C  CB  . GLN C 1 122 ? 24.571  31.144  72.060  1.00 47.17  ? 168  GLN C CB  1 
ATOM   8478  C  CG  . GLN C 1 122 ? 24.947  31.818  73.388  1.00 48.89  ? 168  GLN C CG  1 
ATOM   8479  C  CD  . GLN C 1 122 ? 24.706  30.899  74.593  1.00 50.94  ? 168  GLN C CD  1 
ATOM   8480  O  OE1 . GLN C 1 122 ? 23.604  30.871  75.157  1.00 51.12  ? 168  GLN C OE1 1 
ATOM   8481  N  NE2 . GLN C 1 122 ? 25.740  30.138  74.985  1.00 51.29  ? 168  GLN C NE2 1 
ATOM   8482  N  N   . GLY C 1 123 ? 25.174  34.261  70.552  1.00 48.16  ? 169  GLY C N   1 
ATOM   8483  C  CA  . GLY C 1 123 ? 26.164  35.167  69.975  1.00 48.95  ? 169  GLY C CA  1 
ATOM   8484  C  C   . GLY C 1 123 ? 26.737  34.533  68.710  1.00 49.11  ? 169  GLY C C   1 
ATOM   8485  O  O   . GLY C 1 123 ? 27.934  34.229  68.622  1.00 49.06  ? 169  GLY C O   1 
ATOM   8486  N  N   . GLY C 1 124 ? 25.873  34.298  67.735  1.00 49.09  ? 170  GLY C N   1 
ATOM   8487  C  CA  . GLY C 1 124 ? 26.367  33.801  66.491  1.00 50.00  ? 170  GLY C CA  1 
ATOM   8488  C  C   . GLY C 1 124 ? 25.346  33.579  65.413  1.00 50.49  ? 170  GLY C C   1 
ATOM   8489  O  O   . GLY C 1 124 ? 24.784  32.490  65.326  1.00 51.14  ? 170  GLY C O   1 
ATOM   8490  N  N   . PRO C 1 125 ? 25.110  34.603  64.572  1.00 50.67  ? 171  PRO C N   1 
ATOM   8491  C  CA  . PRO C 1 125 ? 24.320  34.366  63.366  1.00 50.90  ? 171  PRO C CA  1 
ATOM   8492  C  C   . PRO C 1 125 ? 25.191  33.684  62.288  1.00 51.19  ? 171  PRO C C   1 
ATOM   8493  O  O   . PRO C 1 125 ? 24.682  32.841  61.529  1.00 51.36  ? 171  PRO C O   1 
ATOM   8494  C  CB  . PRO C 1 125 ? 23.883  35.767  62.931  1.00 50.61  ? 171  PRO C CB  1 
ATOM   8495  C  CG  . PRO C 1 125 ? 24.613  36.735  63.817  1.00 50.80  ? 171  PRO C CG  1 
ATOM   8496  C  CD  . PRO C 1 125 ? 25.574  35.997  64.678  1.00 50.76  ? 171  PRO C CD  1 
ATOM   8497  N  N   . GLU C 1 126 ? 26.485  34.042  62.245  1.00 51.00  ? 172  GLU C N   1 
ATOM   8498  C  CA  . GLU C 1 126 ? 27.479  33.387  61.378  1.00 50.36  ? 172  GLU C CA  1 
ATOM   8499  C  C   . GLU C 1 126 ? 28.441  32.470  62.161  1.00 49.35  ? 172  GLU C C   1 
ATOM   8500  O  O   . GLU C 1 126 ? 29.559  32.201  61.724  1.00 49.06  ? 172  GLU C O   1 
ATOM   8501  C  CB  . GLU C 1 126 ? 28.261  34.425  60.563  1.00 50.92  ? 172  GLU C CB  1 
ATOM   8502  C  CG  . GLU C 1 126 ? 27.399  35.509  59.878  1.00 52.71  ? 172  GLU C CG  1 
ATOM   8503  C  CD  . GLU C 1 126 ? 27.360  36.827  60.670  1.00 54.66  ? 172  GLU C CD  1 
ATOM   8504  O  OE1 . GLU C 1 126 ? 27.055  36.786  61.891  1.00 55.29  ? 172  GLU C OE1 1 
ATOM   8505  O  OE2 . GLU C 1 126 ? 27.642  37.896  60.067  1.00 53.57  ? 172  GLU C OE2 1 
ATOM   8506  N  N   . SER C 1 127 ? 27.976  31.979  63.307  1.00 48.43  ? 173  SER C N   1 
ATOM   8507  C  CA  . SER C 1 127 ? 28.741  31.075  64.164  1.00 47.38  ? 173  SER C CA  1 
ATOM   8508  C  C   . SER C 1 127 ? 28.118  29.686  64.178  1.00 46.39  ? 173  SER C C   1 
ATOM   8509  O  O   . SER C 1 127 ? 26.974  29.519  63.786  1.00 45.70  ? 173  SER C O   1 
ATOM   8510  C  CB  . SER C 1 127 ? 28.777  31.614  65.594  1.00 47.48  ? 173  SER C CB  1 
ATOM   8511  O  OG  . SER C 1 127 ? 27.507  31.429  66.211  1.00 48.11  ? 173  SER C OG  1 
ATOM   8512  N  N   . GLU C 1 128 ? 28.881  28.710  64.670  1.00 45.86  ? 174  GLU C N   1 
ATOM   8513  C  CA  . GLU C 1 128 ? 28.510  27.295  64.628  1.00 45.14  ? 174  GLU C CA  1 
ATOM   8514  C  C   . GLU C 1 128 ? 28.603  26.648  66.002  1.00 44.74  ? 174  GLU C C   1 
ATOM   8515  O  O   . GLU C 1 128 ? 29.580  26.858  66.741  1.00 45.06  ? 174  GLU C O   1 
ATOM   8516  C  CB  . GLU C 1 128 ? 29.442  26.520  63.699  1.00 45.09  ? 174  GLU C CB  1 
ATOM   8517  C  CG  . GLU C 1 128 ? 29.441  26.913  62.222  1.00 46.07  ? 174  GLU C CG  1 
ATOM   8518  C  CD  . GLU C 1 128 ? 30.617  26.269  61.456  1.00 48.18  ? 174  GLU C CD  1 
ATOM   8519  O  OE1 . GLU C 1 128 ? 31.704  26.056  62.058  1.00 47.97  ? 174  GLU C OE1 1 
ATOM   8520  O  OE2 . GLU C 1 128 ? 30.451  25.962  60.251  1.00 48.76  ? 174  GLU C OE2 1 
ATOM   8521  N  N   . VAL C 1 129 ? 27.586  25.849  66.321  1.00 43.76  ? 175  VAL C N   1 
ATOM   8522  C  CA  . VAL C 1 129 ? 27.552  24.965  67.495  1.00 43.09  ? 175  VAL C CA  1 
ATOM   8523  C  C   . VAL C 1 129 ? 27.727  23.531  66.945  1.00 42.83  ? 175  VAL C C   1 
ATOM   8524  O  O   . VAL C 1 129 ? 27.612  23.330  65.741  1.00 42.99  ? 175  VAL C O   1 
ATOM   8525  C  CB  . VAL C 1 129 ? 26.220  25.205  68.333  1.00 42.95  ? 175  VAL C CB  1 
ATOM   8526  C  CG1 . VAL C 1 129 ? 25.576  23.948  68.795  1.00 42.43  ? 175  VAL C CG1 1 
ATOM   8527  C  CG2 . VAL C 1 129 ? 26.476  26.126  69.524  1.00 42.94  ? 175  VAL C CG2 1 
ATOM   8528  N  N   . GLU C 1 130 ? 28.032  22.547  67.791  1.00 42.71  ? 176  GLU C N   1 
ATOM   8529  C  CA  . GLU C 1 130 ? 28.213  21.158  67.315  1.00 42.32  ? 176  GLU C CA  1 
ATOM   8530  C  C   . GLU C 1 130 ? 27.352  20.139  68.082  1.00 41.86  ? 176  GLU C C   1 
ATOM   8531  O  O   . GLU C 1 130 ? 27.604  19.847  69.259  1.00 41.95  ? 176  GLU C O   1 
ATOM   8532  C  CB  . GLU C 1 130 ? 29.700  20.755  67.355  1.00 42.23  ? 176  GLU C CB  1 
ATOM   8533  C  CG  . GLU C 1 130 ? 30.063  19.690  66.345  1.00 43.10  ? 176  GLU C CG  1 
ATOM   8534  C  CD  . GLU C 1 130 ? 30.665  18.450  66.985  1.00 44.79  ? 176  GLU C CD  1 
ATOM   8535  O  OE1 . GLU C 1 130 ? 29.902  17.477  67.211  1.00 45.75  ? 176  GLU C OE1 1 
ATOM   8536  O  OE2 . GLU C 1 130 ? 31.885  18.447  67.264  1.00 44.12  ? 176  GLU C OE2 1 
ATOM   8537  N  N   . LEU C 1 131 ? 26.337  19.600  67.415  1.00 41.37  ? 177  LEU C N   1 
ATOM   8538  C  CA  . LEU C 1 131 ? 25.488  18.588  68.035  1.00 40.84  ? 177  LEU C CA  1 
ATOM   8539  C  C   . LEU C 1 131 ? 26.153  17.222  67.968  1.00 40.78  ? 177  LEU C C   1 
ATOM   8540  O  O   . LEU C 1 131 ? 26.138  16.571  66.925  1.00 40.93  ? 177  LEU C O   1 
ATOM   8541  C  CB  . LEU C 1 131 ? 24.119  18.535  67.367  1.00 40.47  ? 177  LEU C CB  1 
ATOM   8542  C  CG  . LEU C 1 131 ? 23.300  19.828  67.386  1.00 40.72  ? 177  LEU C CG  1 
ATOM   8543  C  CD1 . LEU C 1 131 ? 21.823  19.492  67.620  1.00 41.13  ? 177  LEU C CD1 1 
ATOM   8544  C  CD2 . LEU C 1 131 ? 23.813  20.784  68.466  1.00 40.09  ? 177  LEU C CD2 1 
ATOM   8545  N  N   . VAL C 1 132 ? 26.735  16.794  69.087  1.00 40.55  ? 178  VAL C N   1 
ATOM   8546  C  CA  . VAL C 1 132 ? 27.490  15.540  69.145  1.00 40.16  ? 178  VAL C CA  1 
ATOM   8547  C  C   . VAL C 1 132 ? 26.559  14.329  69.107  1.00 40.11  ? 178  VAL C C   1 
ATOM   8548  O  O   . VAL C 1 132 ? 25.508  14.330  69.748  1.00 40.28  ? 178  VAL C O   1 
ATOM   8549  C  CB  . VAL C 1 132 ? 28.408  15.480  70.399  1.00 40.08  ? 178  VAL C CB  1 
ATOM   8550  C  CG1 . VAL C 1 132 ? 29.173  14.152  70.469  1.00 39.88  ? 178  VAL C CG1 1 
ATOM   8551  C  CG2 . VAL C 1 132 ? 29.383  16.667  70.406  1.00 40.06  ? 178  VAL C CG2 1 
ATOM   8552  N  N   . LYS C 1 133 ? 26.951  13.306  68.342  1.00 40.06  ? 179  LYS C N   1 
ATOM   8553  C  CA  . LYS C 1 133 ? 26.231  12.037  68.310  1.00 39.73  ? 179  LYS C CA  1 
ATOM   8554  C  C   . LYS C 1 133 ? 26.143  11.404  69.699  1.00 39.44  ? 179  LYS C C   1 
ATOM   8555  O  O   . LYS C 1 133 ? 27.160  11.184  70.366  1.00 39.07  ? 179  LYS C O   1 
ATOM   8556  C  CB  . LYS C 1 133 ? 26.875  11.052  67.327  1.00 39.62  ? 179  LYS C CB  1 
ATOM   8557  C  CG  . LYS C 1 133 ? 26.018  9.806   67.118  1.00 39.84  ? 179  LYS C CG  1 
ATOM   8558  C  CD  . LYS C 1 133 ? 26.620  8.858   66.109  1.00 41.60  ? 179  LYS C CD  1 
ATOM   8559  C  CE  . LYS C 1 133 ? 25.617  7.750   65.731  1.00 42.16  ? 179  LYS C CE  1 
ATOM   8560  N  NZ  . LYS C 1 133 ? 26.087  7.058   64.480  1.00 43.25  ? 179  LYS C NZ  1 
ATOM   8561  N  N   . GLY C 1 134 ? 24.910  11.138  70.122  1.00 39.27  ? 180  GLY C N   1 
ATOM   8562  C  CA  . GLY C 1 134 ? 24.649  10.400  71.351  1.00 39.25  ? 180  GLY C CA  1 
ATOM   8563  C  C   . GLY C 1 134 ? 24.247  11.251  72.539  1.00 39.13  ? 180  GLY C C   1 
ATOM   8564  O  O   . GLY C 1 134 ? 23.938  10.717  73.606  1.00 38.88  ? 180  GLY C O   1 
ATOM   8565  N  N   . SER C 1 135 ? 24.237  12.571  72.355  1.00 39.02  ? 181  SER C N   1 
ATOM   8566  C  CA  . SER C 1 135 ? 24.016  13.487  73.467  1.00 39.06  ? 181  SER C CA  1 
ATOM   8567  C  C   . SER C 1 135 ? 22.553  13.897  73.647  1.00 39.02  ? 181  SER C C   1 
ATOM   8568  O  O   . SER C 1 135 ? 21.719  13.642  72.790  1.00 38.74  ? 181  SER C O   1 
ATOM   8569  C  CB  . SER C 1 135 ? 24.927  14.712  73.342  1.00 39.02  ? 181  SER C CB  1 
ATOM   8570  O  OG  . SER C 1 135 ? 24.570  15.508  72.226  1.00 39.68  ? 181  SER C OG  1 
ATOM   8571  N  N   . GLN C 1 136 ? 22.259  14.504  74.794  1.00 39.56  ? 182  GLN C N   1 
ATOM   8572  C  CA  . GLN C 1 136 ? 20.945  15.089  75.084  1.00 40.08  ? 182  GLN C CA  1 
ATOM   8573  C  C   . GLN C 1 136 ? 20.801  16.504  74.472  1.00 40.32  ? 182  GLN C C   1 
ATOM   8574  O  O   . GLN C 1 136 ? 21.595  17.407  74.752  1.00 40.48  ? 182  GLN C O   1 
ATOM   8575  C  CB  . GLN C 1 136 ? 20.688  15.108  76.608  1.00 40.04  ? 182  GLN C CB  1 
ATOM   8576  C  CG  . GLN C 1 136 ? 19.789  13.981  77.168  1.00 40.48  ? 182  GLN C CG  1 
ATOM   8577  C  CD  . GLN C 1 136 ? 20.413  12.566  77.098  1.00 41.51  ? 182  GLN C CD  1 
ATOM   8578  O  OE1 . GLN C 1 136 ? 20.809  11.994  78.125  1.00 41.14  ? 182  GLN C OE1 1 
ATOM   8579  N  NE2 . GLN C 1 136 ? 20.478  11.993  75.887  1.00 41.32  ? 182  GLN C NE2 1 
ATOM   8580  N  N   . VAL C 1 137 ? 19.793  16.676  73.622  1.00 40.35  ? 183  VAL C N   1 
ATOM   8581  C  CA  . VAL C 1 137 ? 19.462  17.973  73.061  1.00 40.33  ? 183  VAL C CA  1 
ATOM   8582  C  C   . VAL C 1 137 ? 18.006  18.282  73.354  1.00 40.69  ? 183  VAL C C   1 
ATOM   8583  O  O   . VAL C 1 137 ? 17.127  17.480  73.063  1.00 40.49  ? 183  VAL C O   1 
ATOM   8584  C  CB  . VAL C 1 137 ? 19.702  17.998  71.556  1.00 40.34  ? 183  VAL C CB  1 
ATOM   8585  C  CG1 . VAL C 1 137 ? 18.911  19.108  70.912  1.00 39.50  ? 183  VAL C CG1 1 
ATOM   8586  C  CG2 . VAL C 1 137 ? 21.193  18.139  71.267  1.00 40.32  ? 183  VAL C CG2 1 
ATOM   8587  N  N   . LEU C 1 138 ? 17.760  19.439  73.956  1.00 41.22  ? 184  LEU C N   1 
ATOM   8588  C  CA  . LEU C 1 138 ? 16.410  19.851  74.305  1.00 41.62  ? 184  LEU C CA  1 
ATOM   8589  C  C   . LEU C 1 138 ? 15.895  20.728  73.205  1.00 42.13  ? 184  LEU C C   1 
ATOM   8590  O  O   . LEU C 1 138 ? 16.517  21.749  72.899  1.00 42.71  ? 184  LEU C O   1 
ATOM   8591  C  CB  . LEU C 1 138 ? 16.421  20.662  75.596  1.00 41.58  ? 184  LEU C CB  1 
ATOM   8592  C  CG  . LEU C 1 138 ? 15.110  21.265  76.123  1.00 41.97  ? 184  LEU C CG  1 
ATOM   8593  C  CD1 . LEU C 1 138 ? 14.030  20.220  76.354  1.00 42.45  ? 184  LEU C CD1 1 
ATOM   8594  C  CD2 . LEU C 1 138 ? 15.361  22.042  77.423  1.00 42.22  ? 184  LEU C CD2 1 
ATOM   8595  N  N   . VAL C 1 139 ? 14.771  20.353  72.601  1.00 42.26  ? 185  VAL C N   1 
ATOM   8596  C  CA  . VAL C 1 139 ? 14.100  21.274  71.683  1.00 42.47  ? 185  VAL C CA  1 
ATOM   8597  C  C   . VAL C 1 139 ? 13.044  22.071  72.455  1.00 42.60  ? 185  VAL C C   1 
ATOM   8598  O  O   . VAL C 1 139 ? 12.152  21.488  73.072  1.00 42.75  ? 185  VAL C O   1 
ATOM   8599  C  CB  . VAL C 1 139 ? 13.483  20.574  70.452  1.00 42.61  ? 185  VAL C CB  1 
ATOM   8600  C  CG1 . VAL C 1 139 ? 12.875  21.616  69.530  1.00 42.84  ? 185  VAL C CG1 1 
ATOM   8601  C  CG2 . VAL C 1 139 ? 14.532  19.746  69.700  1.00 41.69  ? 185  VAL C CG2 1 
ATOM   8602  N  N   . THR C 1 140 ? 13.176  23.396  72.443  1.00 42.78  ? 186  THR C N   1 
ATOM   8603  C  CA  . THR C 1 140 ? 12.273  24.285  73.173  1.00 43.04  ? 186  THR C CA  1 
ATOM   8604  C  C   . THR C 1 140 ? 11.505  25.192  72.248  1.00 42.88  ? 186  THR C C   1 
ATOM   8605  O  O   . THR C 1 140 ? 11.998  25.606  71.207  1.00 42.87  ? 186  THR C O   1 
ATOM   8606  C  CB  . THR C 1 140 ? 13.023  25.255  74.110  1.00 43.33  ? 186  THR C CB  1 
ATOM   8607  O  OG1 . THR C 1 140 ? 14.127  25.851  73.392  1.00 43.63  ? 186  THR C OG1 1 
ATOM   8608  C  CG2 . THR C 1 140 ? 13.517  24.530  75.343  1.00 43.82  ? 186  THR C CG2 1 
ATOM   8609  N  N   . VAL C 1 141 ? 10.307  25.551  72.676  1.00 42.94  ? 187  VAL C N   1 
ATOM   8610  C  CA  . VAL C 1 141 ? 9.555   26.581  72.001  1.00 42.48  ? 187  VAL C CA  1 
ATOM   8611  C  C   . VAL C 1 141 ? 9.513   27.835  72.880  1.00 42.40  ? 187  VAL C C   1 
ATOM   8612  O  O   . VAL C 1 141 ? 8.975   28.870  72.475  1.00 42.14  ? 187  VAL C O   1 
ATOM   8613  C  CB  . VAL C 1 141 ? 8.153   26.073  71.580  1.00 42.72  ? 187  VAL C CB  1 
ATOM   8614  C  CG1 . VAL C 1 141 ? 8.285   24.990  70.486  1.00 41.59  ? 187  VAL C CG1 1 
ATOM   8615  C  CG2 . VAL C 1 141 ? 7.360   25.582  72.790  1.00 41.43  ? 187  VAL C CG2 1 
ATOM   8616  N  N   . ASP C 1 142 ? 10.144  27.748  74.054  1.00 42.49  ? 188  ASP C N   1 
ATOM   8617  C  CA  . ASP C 1 142 ? 10.165  28.863  75.017  1.00 42.91  ? 188  ASP C CA  1 
ATOM   8618  C  C   . ASP C 1 142 ? 10.736  30.144  74.404  1.00 42.60  ? 188  ASP C C   1 
ATOM   8619  O  O   . ASP C 1 142 ? 11.895  30.160  74.001  1.00 42.78  ? 188  ASP C O   1 
ATOM   8620  C  CB  . ASP C 1 142 ? 10.956  28.482  76.263  1.00 43.12  ? 188  ASP C CB  1 
ATOM   8621  C  CG  . ASP C 1 142 ? 10.861  29.523  77.360  1.00 43.62  ? 188  ASP C CG  1 
ATOM   8622  O  OD1 . ASP C 1 142 ? 11.022  30.728  77.067  1.00 45.46  ? 188  ASP C OD1 1 
ATOM   8623  O  OD2 . ASP C 1 142 ? 10.640  29.135  78.527  1.00 43.49  ? 188  ASP C OD2 1 
ATOM   8624  N  N   . PRO C 1 143 ? 9.931   31.232  74.371  1.00 42.36  ? 189  PRO C N   1 
ATOM   8625  C  CA  . PRO C 1 143 ? 10.262  32.414  73.551  1.00 41.98  ? 189  PRO C CA  1 
ATOM   8626  C  C   . PRO C 1 143 ? 11.635  32.968  73.898  1.00 41.68  ? 189  PRO C C   1 
ATOM   8627  O  O   . PRO C 1 143 ? 12.320  33.533  73.038  1.00 40.83  ? 189  PRO C O   1 
ATOM   8628  C  CB  . PRO C 1 143 ? 9.177   33.423  73.918  1.00 41.92  ? 189  PRO C CB  1 
ATOM   8629  C  CG  . PRO C 1 143 ? 8.063   32.614  74.495  1.00 42.22  ? 189  PRO C CG  1 
ATOM   8630  C  CD  . PRO C 1 143 ? 8.683   31.415  75.136  1.00 42.28  ? 189  PRO C CD  1 
ATOM   8631  N  N   . ALA C 1 144 ? 12.031  32.752  75.150  1.00 41.62  ? 190  ALA C N   1 
ATOM   8632  C  CA  . ALA C 1 144 ? 13.286  33.261  75.681  1.00 41.92  ? 190  ALA C CA  1 
ATOM   8633  C  C   . ALA C 1 144 ? 14.516  32.528  75.148  1.00 41.89  ? 190  ALA C C   1 
ATOM   8634  O  O   . ALA C 1 144 ? 15.653  32.976  75.355  1.00 42.21  ? 190  ALA C O   1 
ATOM   8635  C  CB  . ALA C 1 144 ? 13.269  33.240  77.212  1.00 41.81  ? 190  ALA C CB  1 
ATOM   8636  N  N   . PHE C 1 145 ? 14.311  31.408  74.469  1.00 41.66  ? 191  PHE C N   1 
ATOM   8637  C  CA  . PHE C 1 145 ? 15.460  30.653  73.988  1.00 41.73  ? 191  PHE C CA  1 
ATOM   8638  C  C   . PHE C 1 145 ? 15.786  30.859  72.510  1.00 41.49  ? 191  PHE C C   1 
ATOM   8639  O  O   . PHE C 1 145 ? 16.781  30.352  72.035  1.00 41.48  ? 191  PHE C O   1 
ATOM   8640  C  CB  . PHE C 1 145 ? 15.368  29.185  74.399  1.00 41.75  ? 191  PHE C CB  1 
ATOM   8641  C  CG  . PHE C 1 145 ? 15.505  28.970  75.897  1.00 43.32  ? 191  PHE C CG  1 
ATOM   8642  C  CD1 . PHE C 1 145 ? 14.373  28.825  76.705  1.00 43.80  ? 191  PHE C CD1 1 
ATOM   8643  C  CD2 . PHE C 1 145 ? 16.771  28.937  76.504  1.00 43.87  ? 191  PHE C CD2 1 
ATOM   8644  C  CE1 . PHE C 1 145 ? 14.492  28.634  78.085  1.00 44.18  ? 191  PHE C CE1 1 
ATOM   8645  C  CE2 . PHE C 1 145 ? 16.904  28.743  77.888  1.00 43.80  ? 191  PHE C CE2 1 
ATOM   8646  C  CZ  . PHE C 1 145 ? 15.764  28.594  78.681  1.00 44.41  ? 191  PHE C CZ  1 
ATOM   8647  N  N   . ARG C 1 146 ? 14.980  31.660  71.816  1.00 41.59  ? 192  ARG C N   1 
ATOM   8648  C  CA  . ARG C 1 146 ? 15.160  31.954  70.401  1.00 41.77  ? 192  ARG C CA  1 
ATOM   8649  C  C   . ARG C 1 146 ? 16.629  32.200  70.013  1.00 42.14  ? 192  ARG C C   1 
ATOM   8650  O  O   . ARG C 1 146 ? 17.103  31.847  68.910  1.00 41.67  ? 192  ARG C O   1 
ATOM   8651  C  CB  . ARG C 1 146 ? 14.325  33.172  70.050  1.00 41.58  ? 192  ARG C CB  1 
ATOM   8652  C  CG  . ARG C 1 146 ? 14.166  33.405  68.559  1.00 44.34  ? 192  ARG C CG  1 
ATOM   8653  C  CD  . ARG C 1 146 ? 13.308  34.634  68.208  1.00 47.90  ? 192  ARG C CD  1 
ATOM   8654  N  NE  . ARG C 1 146 ? 13.078  34.721  66.762  1.00 51.56  ? 192  ARG C NE  1 
ATOM   8655  C  CZ  . ARG C 1 146 ? 12.343  35.658  66.153  1.00 54.86  ? 192  ARG C CZ  1 
ATOM   8656  N  NH1 . ARG C 1 146 ? 11.737  36.632  66.840  1.00 56.55  ? 192  ARG C NH1 1 
ATOM   8657  N  NH2 . ARG C 1 146 ? 12.200  35.618  64.835  1.00 55.83  ? 192  ARG C NH2 1 
ATOM   8658  N  N   . THR C 1 147 ? 17.349  32.777  70.962  1.00 42.31  ? 193  THR C N   1 
ATOM   8659  C  CA  . THR C 1 147 ? 18.585  33.463  70.679  1.00 42.33  ? 193  THR C CA  1 
ATOM   8660  C  C   . THR C 1 147 ? 19.680  32.827  71.520  1.00 42.50  ? 193  THR C C   1 
ATOM   8661  O  O   . THR C 1 147 ? 20.881  33.024  71.290  1.00 42.32  ? 193  THR C O   1 
ATOM   8662  C  CB  . THR C 1 147 ? 18.379  34.971  70.994  1.00 42.11  ? 193  THR C CB  1 
ATOM   8663  O  OG1 . THR C 1 147 ? 18.864  35.764  69.908  1.00 42.66  ? 193  THR C OG1 1 
ATOM   8664  C  CG2 . THR C 1 147 ? 19.025  35.389  72.313  1.00 42.22  ? 193  THR C CG2 1 
ATOM   8665  N  N   . ARG C 1 148 ? 19.231  32.033  72.484  1.00 42.83  ? 194  ARG C N   1 
ATOM   8666  C  CA  . ARG C 1 148 ? 20.090  31.443  73.492  1.00 43.26  ? 194  ARG C CA  1 
ATOM   8667  C  C   . ARG C 1 148 ? 20.608  30.037  73.123  1.00 43.12  ? 194  ARG C C   1 
ATOM   8668  O  O   . ARG C 1 148 ? 21.286  29.400  73.927  1.00 43.31  ? 194  ARG C O   1 
ATOM   8669  C  CB  . ARG C 1 148 ? 19.327  31.392  74.818  1.00 43.40  ? 194  ARG C CB  1 
ATOM   8670  C  CG  . ARG C 1 148 ? 19.527  32.572  75.769  1.00 44.71  ? 194  ARG C CG  1 
ATOM   8671  C  CD  . ARG C 1 148 ? 18.868  32.235  77.123  1.00 46.87  ? 194  ARG C CD  1 
ATOM   8672  N  NE  . ARG C 1 148 ? 19.272  33.110  78.229  1.00 48.80  ? 194  ARG C NE  1 
ATOM   8673  C  CZ  . ARG C 1 148 ? 18.547  33.331  79.338  1.00 50.19  ? 194  ARG C CZ  1 
ATOM   8674  N  NH1 . ARG C 1 148 ? 17.359  32.743  79.502  1.00 49.47  ? 194  ARG C NH1 1 
ATOM   8675  N  NH2 . ARG C 1 148 ? 19.005  34.152  80.296  1.00 49.52  ? 194  ARG C NH2 1 
ATOM   8676  N  N   . GLY C 1 149 ? 20.314  29.568  71.913  1.00 42.76  ? 195  GLY C N   1 
ATOM   8677  C  CA  . GLY C 1 149 ? 20.559  28.172  71.547  1.00 42.86  ? 195  GLY C CA  1 
ATOM   8678  C  C   . GLY C 1 149 ? 22.004  27.677  71.455  1.00 42.95  ? 195  GLY C C   1 
ATOM   8679  O  O   . GLY C 1 149 ? 22.873  28.353  70.879  1.00 43.13  ? 195  GLY C O   1 
ATOM   8680  N  N   . ASN C 1 150 ? 22.248  26.481  72.003  1.00 42.46  ? 196  ASN C N   1 
ATOM   8681  C  CA  . ASN C 1 150 ? 23.594  25.884  72.076  1.00 41.76  ? 196  ASN C CA  1 
ATOM   8682  C  C   . ASN C 1 150 ? 23.632  24.423  71.626  1.00 41.38  ? 196  ASN C C   1 
ATOM   8683  O  O   . ASN C 1 150 ? 22.724  23.949  70.947  1.00 41.45  ? 196  ASN C O   1 
ATOM   8684  C  CB  . ASN C 1 150 ? 24.168  26.012  73.499  1.00 41.68  ? 196  ASN C CB  1 
ATOM   8685  C  CG  . ASN C 1 150 ? 23.292  25.338  74.558  1.00 41.50  ? 196  ASN C CG  1 
ATOM   8686  O  OD1 . ASN C 1 150 ? 22.735  24.261  74.341  1.00 42.15  ? 196  ASN C OD1 1 
ATOM   8687  N  ND2 . ASN C 1 150 ? 23.171  25.977  75.708  1.00 41.04  ? 196  ASN C ND2 1 
ATOM   8688  N  N   . ALA C 1 151 ? 24.688  23.719  72.029  1.00 40.97  ? 197  ALA C N   1 
ATOM   8689  C  CA  . ALA C 1 151 ? 24.937  22.325  71.639  1.00 40.63  ? 197  ALA C CA  1 
ATOM   8690  C  C   . ALA C 1 151 ? 23.960  21.333  72.256  1.00 40.39  ? 197  ALA C C   1 
ATOM   8691  O  O   . ALA C 1 151 ? 23.716  20.270  71.689  1.00 40.81  ? 197  ALA C O   1 
ATOM   8692  C  CB  . ALA C 1 151 ? 26.379  21.926  71.974  1.00 40.52  ? 197  ALA C CB  1 
ATOM   8693  N  N   . ASN C 1 152 ? 23.416  21.682  73.416  1.00 39.99  ? 198  ASN C N   1 
ATOM   8694  C  CA  . ASN C 1 152 ? 22.454  20.847  74.102  1.00 39.42  ? 198  ASN C CA  1 
ATOM   8695  C  C   . ASN C 1 152 ? 21.079  21.463  74.027  1.00 39.26  ? 198  ASN C C   1 
ATOM   8696  O  O   . ASN C 1 152 ? 20.128  20.883  74.534  1.00 39.41  ? 198  ASN C O   1 
ATOM   8697  C  CB  . ASN C 1 152 ? 22.837  20.657  75.573  1.00 39.65  ? 198  ASN C CB  1 
ATOM   8698  C  CG  . ASN C 1 152 ? 24.238  20.088  75.758  1.00 39.47  ? 198  ASN C CG  1 
ATOM   8699  O  OD1 . ASN C 1 152 ? 24.558  19.020  75.239  1.00 39.77  ? 198  ASN C OD1 1 
ATOM   8700  N  ND2 . ASN C 1 152 ? 25.070  20.792  76.520  1.00 38.10  ? 198  ASN C ND2 1 
ATOM   8701  N  N   . THR C 1 153 ? 20.957  22.634  73.405  1.00 39.14  ? 199  THR C N   1 
ATOM   8702  C  CA  . THR C 1 153 ? 19.641  23.282  73.309  1.00 39.19  ? 199  THR C CA  1 
ATOM   8703  C  C   . THR C 1 153 ? 19.358  23.948  71.984  1.00 39.07  ? 199  THR C C   1 
ATOM   8704  O  O   . THR C 1 153 ? 20.030  24.914  71.632  1.00 39.24  ? 199  THR C O   1 
ATOM   8705  C  CB  . THR C 1 153 ? 19.411  24.347  74.415  1.00 39.18  ? 199  THR C CB  1 
ATOM   8706  O  OG1 . THR C 1 153 ? 19.793  23.832  75.704  1.00 39.57  ? 199  THR C OG1 1 
ATOM   8707  C  CG2 . THR C 1 153 ? 17.943  24.755  74.446  1.00 38.74  ? 199  THR C CG2 1 
ATOM   8708  N  N   . VAL C 1 154 ? 18.347  23.453  71.267  1.00 38.93  ? 200  VAL C N   1 
ATOM   8709  C  CA  . VAL C 1 154 ? 17.878  24.136  70.060  1.00 39.07  ? 200  VAL C CA  1 
ATOM   8710  C  C   . VAL C 1 154 ? 16.432  24.610  70.184  1.00 39.21  ? 200  VAL C C   1 
ATOM   8711  O  O   . VAL C 1 154 ? 15.536  23.846  70.557  1.00 39.33  ? 200  VAL C O   1 
ATOM   8712  C  CB  . VAL C 1 154 ? 18.151  23.354  68.720  1.00 39.03  ? 200  VAL C CB  1 
ATOM   8713  C  CG1 . VAL C 1 154 ? 19.279  22.341  68.875  1.00 38.98  ? 200  VAL C CG1 1 
ATOM   8714  C  CG2 . VAL C 1 154 ? 16.929  22.672  68.189  1.00 39.99  ? 200  VAL C CG2 1 
ATOM   8715  N  N   . TRP C 1 155 ? 16.241  25.898  69.907  1.00 39.49  ? 201  TRP C N   1 
ATOM   8716  C  CA  . TRP C 1 155 ? 14.929  26.542  69.831  1.00 39.06  ? 201  TRP C CA  1 
ATOM   8717  C  C   . TRP C 1 155 ? 14.391  26.404  68.414  1.00 39.20  ? 201  TRP C C   1 
ATOM   8718  O  O   . TRP C 1 155 ? 15.160  26.457  67.426  1.00 39.52  ? 201  TRP C O   1 
ATOM   8719  C  CB  . TRP C 1 155 ? 15.042  28.026  70.197  1.00 38.58  ? 201  TRP C CB  1 
ATOM   8720  C  CG  . TRP C 1 155 ? 13.714  28.774  70.265  1.00 38.95  ? 201  TRP C CG  1 
ATOM   8721  C  CD1 . TRP C 1 155 ? 12.902  28.939  71.375  1.00 38.11  ? 201  TRP C CD1 1 
ATOM   8722  C  CD2 . TRP C 1 155 ? 13.067  29.483  69.195  1.00 38.22  ? 201  TRP C CD2 1 
ATOM   8723  N  NE1 . TRP C 1 155 ? 11.801  29.705  71.052  1.00 37.61  ? 201  TRP C NE1 1 
ATOM   8724  C  CE2 . TRP C 1 155 ? 11.872  30.045  69.724  1.00 37.87  ? 201  TRP C CE2 1 
ATOM   8725  C  CE3 . TRP C 1 155 ? 13.384  29.712  67.849  1.00 36.37  ? 201  TRP C CE3 1 
ATOM   8726  C  CZ2 . TRP C 1 155 ? 10.996  30.794  68.944  1.00 36.84  ? 201  TRP C CZ2 1 
ATOM   8727  C  CZ3 . TRP C 1 155 ? 12.515  30.441  67.087  1.00 36.03  ? 201  TRP C CZ3 1 
ATOM   8728  C  CH2 . TRP C 1 155 ? 11.334  30.981  67.632  1.00 35.78  ? 201  TRP C CH2 1 
ATOM   8729  N  N   . VAL C 1 156 ? 13.071  26.247  68.319  1.00 39.12  ? 202  VAL C N   1 
ATOM   8730  C  CA  . VAL C 1 156 ? 12.385  26.098  67.045  1.00 38.99  ? 202  VAL C CA  1 
ATOM   8731  C  C   . VAL C 1 156 ? 11.154  27.019  66.999  1.00 38.93  ? 202  VAL C C   1 
ATOM   8732  O  O   . VAL C 1 156 ? 10.544  27.290  68.033  1.00 38.99  ? 202  VAL C O   1 
ATOM   8733  C  CB  . VAL C 1 156 ? 12.048  24.620  66.839  1.00 39.35  ? 202  VAL C CB  1 
ATOM   8734  C  CG1 . VAL C 1 156 ? 10.518  24.323  67.038  1.00 39.46  ? 202  VAL C CG1 1 
ATOM   8735  C  CG2 . VAL C 1 156 ? 12.605  24.138  65.500  1.00 38.84  ? 202  VAL C CG2 1 
ATOM   8736  N  N   . ASP C 1 157 ? 10.816  27.533  65.814  1.00 39.02  ? 203  ASP C N   1 
ATOM   8737  C  CA  . ASP C 1 157 ? 9.697   28.506  65.656  1.00 38.45  ? 203  ASP C CA  1 
ATOM   8738  C  C   . ASP C 1 157 ? 8.321   27.877  65.479  1.00 37.90  ? 203  ASP C C   1 
ATOM   8739  O  O   . ASP C 1 157 ? 7.423   28.508  64.940  1.00 37.39  ? 203  ASP C O   1 
ATOM   8740  C  CB  . ASP C 1 157 ? 9.945   29.466  64.487  1.00 38.16  ? 203  ASP C CB  1 
ATOM   8741  C  CG  . ASP C 1 157 ? 10.211  28.745  63.194  1.00 39.86  ? 203  ASP C CG  1 
ATOM   8742  O  OD1 . ASP C 1 157 ? 10.937  29.309  62.334  1.00 41.51  ? 203  ASP C OD1 1 
ATOM   8743  O  OD2 . ASP C 1 157 ? 9.710   27.603  63.032  1.00 41.32  ? 203  ASP C OD2 1 
ATOM   8744  N  N   . TYR C 1 158 ? 8.155   26.637  65.917  1.00 37.60  ? 204  TYR C N   1 
ATOM   8745  C  CA  . TYR C 1 158 ? 6.865   25.995  65.768  1.00 37.72  ? 204  TYR C CA  1 
ATOM   8746  C  C   . TYR C 1 158 ? 6.286   25.574  67.137  1.00 38.06  ? 204  TYR C C   1 
ATOM   8747  O  O   . TYR C 1 158 ? 6.481   24.426  67.585  1.00 38.20  ? 204  TYR C O   1 
ATOM   8748  C  CB  . TYR C 1 158 ? 6.958   24.859  64.742  1.00 37.52  ? 204  TYR C CB  1 
ATOM   8749  C  CG  . TYR C 1 158 ? 5.749   23.979  64.620  1.00 37.49  ? 204  TYR C CG  1 
ATOM   8750  C  CD1 . TYR C 1 158 ? 4.463   24.516  64.600  1.00 37.88  ? 204  TYR C CD1 1 
ATOM   8751  C  CD2 . TYR C 1 158 ? 5.890   22.600  64.499  1.00 37.95  ? 204  TYR C CD2 1 
ATOM   8752  C  CE1 . TYR C 1 158 ? 3.340   23.695  64.496  1.00 38.61  ? 204  TYR C CE1 1 
ATOM   8753  C  CE2 . TYR C 1 158 ? 4.779   21.769  64.370  1.00 38.61  ? 204  TYR C CE2 1 
ATOM   8754  C  CZ  . TYR C 1 158 ? 3.504   22.321  64.377  1.00 38.61  ? 204  TYR C CZ  1 
ATOM   8755  O  OH  . TYR C 1 158 ? 2.398   21.510  64.254  1.00 38.06  ? 204  TYR C OH  1 
ATOM   8756  N  N   . PRO C 1 159 ? 5.586   26.520  67.814  1.00 37.80  ? 205  PRO C N   1 
ATOM   8757  C  CA  . PRO C 1 159 ? 4.962   26.257  69.103  1.00 37.81  ? 205  PRO C CA  1 
ATOM   8758  C  C   . PRO C 1 159 ? 4.445   24.822  69.253  1.00 37.81  ? 205  PRO C C   1 
ATOM   8759  O  O   . PRO C 1 159 ? 4.861   24.140  70.175  1.00 38.22  ? 205  PRO C O   1 
ATOM   8760  C  CB  . PRO C 1 159 ? 3.817   27.281  69.158  1.00 37.84  ? 205  PRO C CB  1 
ATOM   8761  C  CG  . PRO C 1 159 ? 4.293   28.430  68.328  1.00 37.63  ? 205  PRO C CG  1 
ATOM   8762  C  CD  . PRO C 1 159 ? 5.375   27.918  67.387  1.00 37.67  ? 205  PRO C CD  1 
ATOM   8763  N  N   . ASN C 1 160 ? 3.586   24.348  68.354  1.00 37.73  ? 206  ASN C N   1 
ATOM   8764  C  CA  . ASN C 1 160 ? 3.055   22.988  68.473  1.00 37.77  ? 206  ASN C CA  1 
ATOM   8765  C  C   . ASN C 1 160 ? 4.038   21.795  68.338  1.00 37.91  ? 206  ASN C C   1 
ATOM   8766  O  O   . ASN C 1 160 ? 3.610   20.649  68.490  1.00 37.21  ? 206  ASN C O   1 
ATOM   8767  C  CB  . ASN C 1 160 ? 1.880   22.800  67.520  1.00 37.85  ? 206  ASN C CB  1 
ATOM   8768  C  CG  . ASN C 1 160 ? 0.573   23.355  68.079  1.00 39.00  ? 206  ASN C CG  1 
ATOM   8769  O  OD1 . ASN C 1 160 ? 0.336   23.368  69.301  1.00 38.67  ? 206  ASN C OD1 1 
ATOM   8770  N  ND2 . ASN C 1 160 ? -0.294  23.802  67.178  1.00 39.23  ? 206  ASN C ND2 1 
ATOM   8771  N  N   . ILE C 1 161 ? 5.334   22.037  68.067  1.00 38.17  ? 207  ILE C N   1 
ATOM   8772  C  CA  . ILE C 1 161 ? 6.261   20.911  67.868  1.00 38.27  ? 207  ILE C CA  1 
ATOM   8773  C  C   . ILE C 1 161 ? 6.118   19.955  69.043  1.00 38.52  ? 207  ILE C C   1 
ATOM   8774  O  O   . ILE C 1 161 ? 5.947   18.756  68.847  1.00 38.37  ? 207  ILE C O   1 
ATOM   8775  C  CB  . ILE C 1 161 ? 7.754   21.307  67.677  1.00 38.15  ? 207  ILE C CB  1 
ATOM   8776  C  CG1 . ILE C 1 161 ? 8.517   20.185  66.976  1.00 38.05  ? 207  ILE C CG1 1 
ATOM   8777  C  CG2 . ILE C 1 161 ? 8.449   21.545  69.006  1.00 38.48  ? 207  ILE C CG2 1 
ATOM   8778  C  CD1 . ILE C 1 161 ? 9.870   20.587  66.439  1.00 38.33  ? 207  ILE C CD1 1 
ATOM   8779  N  N   . VAL C 1 162 ? 6.147   20.514  70.255  1.00 38.67  ? 208  VAL C N   1 
ATOM   8780  C  CA  . VAL C 1 162 ? 6.107   19.735  71.490  1.00 38.85  ? 208  VAL C CA  1 
ATOM   8781  C  C   . VAL C 1 162 ? 4.875   18.838  71.543  1.00 39.27  ? 208  VAL C C   1 
ATOM   8782  O  O   . VAL C 1 162 ? 4.878   17.808  72.208  1.00 39.72  ? 208  VAL C O   1 
ATOM   8783  C  CB  . VAL C 1 162 ? 6.173   20.647  72.759  1.00 38.98  ? 208  VAL C CB  1 
ATOM   8784  C  CG1 . VAL C 1 162 ? 7.379   21.569  72.676  1.00 38.03  ? 208  VAL C CG1 1 
ATOM   8785  C  CG2 . VAL C 1 162 ? 4.854   21.452  72.978  1.00 38.41  ? 208  VAL C CG2 1 
ATOM   8786  N  N   . ARG C 1 163 ? 3.840   19.225  70.808  1.00 39.48  ? 209  ARG C N   1 
ATOM   8787  C  CA  . ARG C 1 163 ? 2.545   18.564  70.860  1.00 39.65  ? 209  ARG C CA  1 
ATOM   8788  C  C   . ARG C 1 163 ? 2.352   17.560  69.701  1.00 39.63  ? 209  ARG C C   1 
ATOM   8789  O  O   . ARG C 1 163 ? 1.406   16.766  69.728  1.00 39.57  ? 209  ARG C O   1 
ATOM   8790  C  CB  . ARG C 1 163 ? 1.466   19.653  70.882  1.00 39.67  ? 209  ARG C CB  1 
ATOM   8791  C  CG  . ARG C 1 163 ? 0.081   19.244  70.463  1.00 40.97  ? 209  ARG C CG  1 
ATOM   8792  C  CD  . ARG C 1 163 ? -0.545  20.311  69.553  1.00 42.72  ? 209  ARG C CD  1 
ATOM   8793  N  NE  . ARG C 1 163 ? -2.014  20.353  69.665  1.00 44.09  ? 209  ARG C NE  1 
ATOM   8794  C  CZ  . ARG C 1 163 ? -2.845  20.760  68.703  1.00 43.93  ? 209  ARG C CZ  1 
ATOM   8795  N  NH1 . ARG C 1 163 ? -2.387  21.154  67.517  1.00 44.19  ? 209  ARG C NH1 1 
ATOM   8796  N  NH2 . ARG C 1 163 ? -4.149  20.761  68.928  1.00 44.31  ? 209  ARG C NH2 1 
ATOM   8797  N  N   . VAL C 1 164 ? 3.255   17.583  68.707  1.00 39.68  ? 210  VAL C N   1 
ATOM   8798  C  CA  . VAL C 1 164 ? 3.138   16.735  67.486  1.00 39.68  ? 210  VAL C CA  1 
ATOM   8799  C  C   . VAL C 1 164 ? 4.224   15.663  67.246  1.00 39.08  ? 210  VAL C C   1 
ATOM   8800  O  O   . VAL C 1 164 ? 4.014   14.749  66.448  1.00 39.30  ? 210  VAL C O   1 
ATOM   8801  C  CB  . VAL C 1 164 ? 2.993   17.555  66.163  1.00 39.97  ? 210  VAL C CB  1 
ATOM   8802  C  CG1 . VAL C 1 164 ? 2.290   16.692  65.104  1.00 41.34  ? 210  VAL C CG1 1 
ATOM   8803  C  CG2 . VAL C 1 164 ? 2.187   18.831  66.374  1.00 40.74  ? 210  VAL C CG2 1 
ATOM   8804  N  N   . VAL C 1 165 ? 5.376   15.768  67.897  1.00 38.65  ? 211  VAL C N   1 
ATOM   8805  C  CA  . VAL C 1 165 ? 6.366   14.682  67.820  1.00 38.32  ? 211  VAL C CA  1 
ATOM   8806  C  C   . VAL C 1 165 ? 6.295   13.736  69.030  1.00 38.44  ? 211  VAL C C   1 
ATOM   8807  O  O   . VAL C 1 165 ? 6.618   14.116  70.165  1.00 38.55  ? 211  VAL C O   1 
ATOM   8808  C  CB  . VAL C 1 165 ? 7.819   15.169  67.578  1.00 38.01  ? 211  VAL C CB  1 
ATOM   8809  C  CG1 . VAL C 1 165 ? 8.691   14.001  67.166  1.00 37.07  ? 211  VAL C CG1 1 
ATOM   8810  C  CG2 . VAL C 1 165 ? 7.846   16.230  66.506  1.00 37.30  ? 211  VAL C CG2 1 
ATOM   8811  N  N   . PRO C 1 166 ? 5.874   12.489  68.785  1.00 38.34  ? 212  PRO C N   1 
ATOM   8812  C  CA  . PRO C 1 166 ? 5.765   11.561  69.892  1.00 38.38  ? 212  PRO C CA  1 
ATOM   8813  C  C   . PRO C 1 166 ? 7.131   11.004  70.263  1.00 38.34  ? 212  PRO C C   1 
ATOM   8814  O  O   . PRO C 1 166 ? 8.118   11.250  69.548  1.00 38.58  ? 212  PRO C O   1 
ATOM   8815  C  CB  . PRO C 1 166 ? 4.853   10.463  69.336  1.00 38.45  ? 212  PRO C CB  1 
ATOM   8816  C  CG  . PRO C 1 166 ? 5.125   10.457  67.879  1.00 38.56  ? 212  PRO C CG  1 
ATOM   8817  C  CD  . PRO C 1 166 ? 5.499   11.872  67.500  1.00 38.37  ? 212  PRO C CD  1 
ATOM   8818  N  N   . VAL C 1 167 ? 7.180   10.283  71.382  1.00 38.16  ? 213  VAL C N   1 
ATOM   8819  C  CA  . VAL C 1 167 ? 8.373   9.568   71.797  1.00 38.08  ? 213  VAL C CA  1 
ATOM   8820  C  C   . VAL C 1 167 ? 8.764   8.582   70.701  1.00 38.06  ? 213  VAL C C   1 
ATOM   8821  O  O   . VAL C 1 167 ? 7.936   7.822   70.204  1.00 37.80  ? 213  VAL C O   1 
ATOM   8822  C  CB  . VAL C 1 167 ? 8.164   8.845   73.142  1.00 38.21  ? 213  VAL C CB  1 
ATOM   8823  C  CG1 . VAL C 1 167 ? 9.340   7.926   73.452  1.00 38.21  ? 213  VAL C CG1 1 
ATOM   8824  C  CG2 . VAL C 1 167 ? 7.957   9.864   74.268  1.00 38.41  ? 213  VAL C CG2 1 
ATOM   8825  N  N   . GLY C 1 168 ? 10.031  8.626   70.314  1.00 38.16  ? 214  GLY C N   1 
ATOM   8826  C  CA  . GLY C 1 168 ? 10.537  7.778   69.258  1.00 38.41  ? 214  GLY C CA  1 
ATOM   8827  C  C   . GLY C 1 168 ? 10.404  8.468   67.923  1.00 38.74  ? 214  GLY C C   1 
ATOM   8828  O  O   . GLY C 1 168 ? 10.673  7.857   66.890  1.00 39.07  ? 214  GLY C O   1 
ATOM   8829  N  N   . GLY C 1 169 ? 9.986   9.736   67.948  1.00 38.66  ? 215  GLY C N   1 
ATOM   8830  C  CA  . GLY C 1 169 ? 9.789   10.528  66.736  1.00 38.80  ? 215  GLY C CA  1 
ATOM   8831  C  C   . GLY C 1 169 ? 11.059  11.272  66.335  1.00 39.24  ? 215  GLY C C   1 
ATOM   8832  O  O   . GLY C 1 169 ? 11.839  11.725  67.197  1.00 38.90  ? 215  GLY C O   1 
ATOM   8833  N  N   . ARG C 1 170 ? 11.258  11.408  65.022  1.00 39.28  ? 216  ARG C N   1 
ATOM   8834  C  CA  . ARG C 1 170 ? 12.511  11.918  64.479  1.00 39.45  ? 216  ARG C CA  1 
ATOM   8835  C  C   . ARG C 1 170 ? 12.389  13.381  64.061  1.00 39.44  ? 216  ARG C C   1 
ATOM   8836  O  O   . ARG C 1 170 ? 11.340  13.795  63.536  1.00 39.97  ? 216  ARG C O   1 
ATOM   8837  C  CB  . ARG C 1 170 ? 12.971  11.047  63.304  1.00 39.80  ? 216  ARG C CB  1 
ATOM   8838  C  CG  . ARG C 1 170 ? 14.481  11.123  63.018  1.00 40.48  ? 216  ARG C CG  1 
ATOM   8839  C  CD  . ARG C 1 170 ? 14.960  10.104  61.969  1.00 40.47  ? 216  ARG C CD  1 
ATOM   8840  N  NE  . ARG C 1 170 ? 14.321  8.785   62.053  1.00 40.71  ? 216  ARG C NE  1 
ATOM   8841  C  CZ  . ARG C 1 170 ? 14.650  7.820   62.914  1.00 41.31  ? 216  ARG C CZ  1 
ATOM   8842  N  NH1 . ARG C 1 170 ? 15.610  8.006   63.812  1.00 41.61  ? 216  ARG C NH1 1 
ATOM   8843  N  NH2 . ARG C 1 170 ? 14.003  6.656   62.885  1.00 42.29  ? 216  ARG C NH2 1 
ATOM   8844  N  N   . ILE C 1 171 ? 13.453  14.153  64.304  1.00 38.73  ? 217  ILE C N   1 
ATOM   8845  C  CA  . ILE C 1 171 ? 13.495  15.583  63.990  1.00 38.16  ? 217  ILE C CA  1 
ATOM   8846  C  C   . ILE C 1 171 ? 14.765  15.858  63.205  1.00 37.74  ? 217  ILE C C   1 
ATOM   8847  O  O   . ILE C 1 171 ? 15.882  15.675  63.688  1.00 37.58  ? 217  ILE C O   1 
ATOM   8848  C  CB  . ILE C 1 171 ? 13.415  16.457  65.278  1.00 38.65  ? 217  ILE C CB  1 
ATOM   8849  C  CG1 . ILE C 1 171 ? 12.047  16.277  65.956  1.00 38.27  ? 217  ILE C CG1 1 
ATOM   8850  C  CG2 . ILE C 1 171 ? 13.725  17.964  64.994  1.00 38.43  ? 217  ILE C CG2 1 
ATOM   8851  C  CD1 . ILE C 1 171 ? 12.028  16.669  67.422  1.00 38.13  ? 217  ILE C CD1 1 
ATOM   8852  N  N   . TYR C 1 172 ? 14.580  16.250  61.959  1.00 37.47  ? 218  TYR C N   1 
ATOM   8853  C  CA  . TYR C 1 172 ? 15.701  16.465  61.069  1.00 37.06  ? 218  TYR C CA  1 
ATOM   8854  C  C   . TYR C 1 172 ? 16.019  17.941  61.058  1.00 37.00  ? 218  TYR C C   1 
ATOM   8855  O  O   . TYR C 1 172 ? 15.103  18.772  61.014  1.00 37.15  ? 218  TYR C O   1 
ATOM   8856  C  CB  . TYR C 1 172 ? 15.358  16.006  59.651  1.00 36.80  ? 218  TYR C CB  1 
ATOM   8857  C  CG  . TYR C 1 172 ? 15.433  14.512  59.420  1.00 36.72  ? 218  TYR C CG  1 
ATOM   8858  C  CD1 . TYR C 1 172 ? 14.301  13.710  59.554  1.00 36.71  ? 218  TYR C CD1 1 
ATOM   8859  C  CD2 . TYR C 1 172 ? 16.635  13.904  59.044  1.00 35.41  ? 218  TYR C CD2 1 
ATOM   8860  C  CE1 . TYR C 1 172 ? 14.373  12.336  59.326  1.00 37.64  ? 218  TYR C CE1 1 
ATOM   8861  C  CE2 . TYR C 1 172 ? 16.715  12.550  58.825  1.00 35.68  ? 218  TYR C CE2 1 
ATOM   8862  C  CZ  . TYR C 1 172 ? 15.584  11.765  58.958  1.00 36.72  ? 218  TYR C CZ  1 
ATOM   8863  O  OH  . TYR C 1 172 ? 15.660  10.407  58.736  1.00 36.63  ? 218  TYR C OH  1 
ATOM   8864  N  N   . ILE C 1 173 ? 17.306  18.272  61.100  1.00 36.67  ? 219  ILE C N   1 
ATOM   8865  C  CA  . ILE C 1 173 ? 17.717  19.659  61.045  1.00 36.44  ? 219  ILE C CA  1 
ATOM   8866  C  C   . ILE C 1 173 ? 18.738  19.907  59.947  1.00 36.24  ? 219  ILE C C   1 
ATOM   8867  O  O   . ILE C 1 173 ? 19.702  19.168  59.827  1.00 35.75  ? 219  ILE C O   1 
ATOM   8868  C  CB  . ILE C 1 173 ? 18.303  20.146  62.389  1.00 36.63  ? 219  ILE C CB  1 
ATOM   8869  C  CG1 . ILE C 1 173 ? 17.262  20.065  63.499  1.00 36.30  ? 219  ILE C CG1 1 
ATOM   8870  C  CG2 . ILE C 1 173 ? 18.838  21.585  62.252  1.00 35.78  ? 219  ILE C CG2 1 
ATOM   8871  C  CD1 . ILE C 1 173 ? 17.887  19.978  64.863  1.00 35.64  ? 219  ILE C CD1 1 
ATOM   8872  N  N   . ASP C 1 174 ? 18.511  20.972  59.177  1.00 36.12  ? 220  ASP C N   1 
ATOM   8873  C  CA  . ASP C 1 174 ? 19.444  21.458  58.181  1.00 36.19  ? 220  ASP C CA  1 
ATOM   8874  C  C   . ASP C 1 174 ? 19.579  20.493  57.010  1.00 36.27  ? 220  ASP C C   1 
ATOM   8875  O  O   . ASP C 1 174 ? 20.512  19.678  56.963  1.00 35.86  ? 220  ASP C O   1 
ATOM   8876  C  CB  . ASP C 1 174 ? 20.795  21.764  58.846  1.00 36.88  ? 220  ASP C CB  1 
ATOM   8877  C  CG  . ASP C 1 174 ? 21.896  22.128  57.856  1.00 37.18  ? 220  ASP C CG  1 
ATOM   8878  O  OD1 . ASP C 1 174 ? 21.640  22.382  56.654  1.00 37.92  ? 220  ASP C OD1 1 
ATOM   8879  O  OD2 . ASP C 1 174 ? 23.048  22.150  58.311  1.00 38.01  ? 220  ASP C OD2 1 
ATOM   8880  N  N   . ASP C 1 175 ? 18.628  20.583  56.071  1.00 36.51  ? 221  ASP C N   1 
ATOM   8881  C  CA  . ASP C 1 175 ? 18.674  19.796  54.838  1.00 36.71  ? 221  ASP C CA  1 
ATOM   8882  C  C   . ASP C 1 175 ? 18.833  18.328  55.242  1.00 36.77  ? 221  ASP C C   1 
ATOM   8883  O  O   . ASP C 1 175 ? 19.585  17.566  54.624  1.00 37.04  ? 221  ASP C O   1 
ATOM   8884  C  CB  . ASP C 1 175 ? 19.831  20.302  53.944  1.00 36.81  ? 221  ASP C CB  1 
ATOM   8885  C  CG  . ASP C 1 175 ? 19.825  19.713  52.517  1.00 37.76  ? 221  ASP C CG  1 
ATOM   8886  O  OD1 . ASP C 1 175 ? 18.746  19.485  51.922  1.00 37.02  ? 221  ASP C OD1 1 
ATOM   8887  O  OD2 . ASP C 1 175 ? 20.946  19.508  51.980  1.00 39.12  ? 221  ASP C OD2 1 
ATOM   8888  N  N   . GLY C 1 176 ? 18.126  17.949  56.309  1.00 36.64  ? 222  GLY C N   1 
ATOM   8889  C  CA  . GLY C 1 176 ? 18.153  16.586  56.844  1.00 36.20  ? 222  GLY C CA  1 
ATOM   8890  C  C   . GLY C 1 176 ? 19.500  15.994  57.229  1.00 35.98  ? 222  GLY C C   1 
ATOM   8891  O  O   . GLY C 1 176 ? 19.635  14.771  57.355  1.00 36.12  ? 222  GLY C O   1 
ATOM   8892  N  N   . LEU C 1 177 ? 20.502  16.835  57.418  1.00 35.65  ? 223  LEU C N   1 
ATOM   8893  C  CA  . LEU C 1 177 ? 21.811  16.319  57.756  1.00 35.98  ? 223  LEU C CA  1 
ATOM   8894  C  C   . LEU C 1 177 ? 21.959  16.059  59.258  1.00 36.83  ? 223  LEU C C   1 
ATOM   8895  O  O   . LEU C 1 177 ? 22.837  15.307  59.666  1.00 37.18  ? 223  LEU C O   1 
ATOM   8896  C  CB  . LEU C 1 177 ? 22.896  17.226  57.201  1.00 35.79  ? 223  LEU C CB  1 
ATOM   8897  C  CG  . LEU C 1 177 ? 22.837  17.437  55.674  1.00 35.11  ? 223  LEU C CG  1 
ATOM   8898  C  CD1 . LEU C 1 177 ? 23.547  18.697  55.256  1.00 34.66  ? 223  LEU C CD1 1 
ATOM   8899  C  CD2 . LEU C 1 177 ? 23.391  16.260  54.926  1.00 33.63  ? 223  LEU C CD2 1 
ATOM   8900  N  N   . ILE C 1 178 ? 21.072  16.656  60.062  1.00 37.55  ? 224  ILE C N   1 
ATOM   8901  C  CA  . ILE C 1 178 ? 21.042  16.497  61.514  1.00 37.92  ? 224  ILE C CA  1 
ATOM   8902  C  C   . ILE C 1 178 ? 19.786  15.730  61.890  1.00 38.23  ? 224  ILE C C   1 
ATOM   8903  O  O   . ILE C 1 178 ? 18.733  15.883  61.263  1.00 38.34  ? 224  ILE C O   1 
ATOM   8904  C  CB  . ILE C 1 178 ? 20.980  17.851  62.260  1.00 38.04  ? 224  ILE C CB  1 
ATOM   8905  C  CG1 . ILE C 1 178 ? 22.213  18.722  62.000  1.00 38.83  ? 224  ILE C CG1 1 
ATOM   8906  C  CG2 . ILE C 1 178 ? 20.830  17.635  63.752  1.00 38.81  ? 224  ILE C CG2 1 
ATOM   8907  C  CD1 . ILE C 1 178 ? 23.511  18.189  62.556  1.00 39.15  ? 224  ILE C CD1 1 
ATOM   8908  N  N   . SER C 1 179 ? 19.883  14.946  62.958  1.00 38.40  ? 225  SER C N   1 
ATOM   8909  C  CA  . SER C 1 179 ? 18.900  13.913  63.220  1.00 38.12  ? 225  SER C CA  1 
ATOM   8910  C  C   . SER C 1 179 ? 18.727  13.717  64.709  1.00 37.92  ? 225  SER C C   1 
ATOM   8911  O  O   . SER C 1 179 ? 19.622  13.207  65.390  1.00 37.73  ? 225  SER C O   1 
ATOM   8912  C  CB  . SER C 1 179 ? 19.364  12.612  62.553  1.00 37.72  ? 225  SER C CB  1 
ATOM   8913  O  OG  . SER C 1 179 ? 18.452  11.555  62.748  1.00 38.08  ? 225  SER C OG  1 
ATOM   8914  N  N   . LEU C 1 180 ? 17.563  14.127  65.195  1.00 37.69  ? 226  LEU C N   1 
ATOM   8915  C  CA  . LEU C 1 180 ? 17.210  13.976  66.591  1.00 38.10  ? 226  LEU C CA  1 
ATOM   8916  C  C   . LEU C 1 180 ? 16.039  13.006  66.785  1.00 38.68  ? 226  LEU C C   1 
ATOM   8917  O  O   . LEU C 1 180 ? 15.134  12.965  65.947  1.00 38.91  ? 226  LEU C O   1 
ATOM   8918  C  CB  . LEU C 1 180 ? 16.841  15.330  67.155  1.00 37.75  ? 226  LEU C CB  1 
ATOM   8919  C  CG  . LEU C 1 180 ? 17.929  16.374  66.977  1.00 37.21  ? 226  LEU C CG  1 
ATOM   8920  C  CD1 . LEU C 1 180 ? 17.370  17.736  67.323  1.00 36.43  ? 226  LEU C CD1 1 
ATOM   8921  C  CD2 . LEU C 1 180 ? 19.137  16.042  67.817  1.00 35.98  ? 226  LEU C CD2 1 
ATOM   8922  N  N   . VAL C 1 181 ? 16.072  12.232  67.881  1.00 38.91  ? 227  VAL C N   1 
ATOM   8923  C  CA  . VAL C 1 181 ? 15.000  11.283  68.222  1.00 39.08  ? 227  VAL C CA  1 
ATOM   8924  C  C   . VAL C 1 181 ? 14.451  11.519  69.641  1.00 39.54  ? 227  VAL C C   1 
ATOM   8925  O  O   . VAL C 1 181 ? 15.175  11.404  70.638  1.00 39.49  ? 227  VAL C O   1 
ATOM   8926  C  CB  . VAL C 1 181 ? 15.430  9.798   68.065  1.00 38.79  ? 227  VAL C CB  1 
ATOM   8927  C  CG1 . VAL C 1 181 ? 14.202  8.887   68.051  1.00 38.82  ? 227  VAL C CG1 1 
ATOM   8928  C  CG2 . VAL C 1 181 ? 16.216  9.584   66.802  1.00 38.64  ? 227  VAL C CG2 1 
ATOM   8929  N  N   . VAL C 1 182 ? 13.163  11.836  69.711  1.00 39.89  ? 228  VAL C N   1 
ATOM   8930  C  CA  . VAL C 1 182 ? 12.510  12.196  70.967  1.00 40.57  ? 228  VAL C CA  1 
ATOM   8931  C  C   . VAL C 1 182 ? 12.475  11.025  71.933  1.00 41.39  ? 228  VAL C C   1 
ATOM   8932  O  O   . VAL C 1 182 ? 11.897  9.985   71.614  1.00 41.62  ? 228  VAL C O   1 
ATOM   8933  C  CB  . VAL C 1 182 ? 11.052  12.673  70.729  1.00 40.35  ? 228  VAL C CB  1 
ATOM   8934  C  CG1 . VAL C 1 182 ? 10.385  13.045  72.042  1.00 39.64  ? 228  VAL C CG1 1 
ATOM   8935  C  CG2 . VAL C 1 182 ? 11.027  13.850  69.782  1.00 39.95  ? 228  VAL C CG2 1 
ATOM   8936  N  N   . GLN C 1 183 ? 13.073  11.180  73.114  1.00 42.47  ? 229  GLN C N   1 
ATOM   8937  C  CA  . GLN C 1 183 ? 12.937  10.119  74.125  1.00 43.51  ? 229  GLN C CA  1 
ATOM   8938  C  C   . GLN C 1 183 ? 11.982  10.439  75.266  1.00 43.70  ? 229  GLN C C   1 
ATOM   8939  O  O   . GLN C 1 183 ? 11.169  9.597   75.660  1.00 43.64  ? 229  GLN C O   1 
ATOM   8940  C  CB  . GLN C 1 183 ? 14.271  9.544   74.637  1.00 43.65  ? 229  GLN C CB  1 
ATOM   8941  C  CG  . GLN C 1 183 ? 15.535  10.381  74.482  1.00 45.26  ? 229  GLN C CG  1 
ATOM   8942  C  CD  . GLN C 1 183 ? 16.785  9.584   74.894  1.00 48.17  ? 229  GLN C CD  1 
ATOM   8943  O  OE1 . GLN C 1 183 ? 17.672  10.103  75.579  1.00 49.17  ? 229  GLN C OE1 1 
ATOM   8944  N  NE2 . GLN C 1 183 ? 16.841  8.308   74.492  1.00 48.29  ? 229  GLN C NE2 1 
ATOM   8945  N  N   . LYS C 1 184 ? 12.073  11.656  75.790  1.00 44.28  ? 230  LYS C N   1 
ATOM   8946  C  CA  . LYS C 1 184 ? 11.086  12.115  76.765  1.00 44.63  ? 230  LYS C CA  1 
ATOM   8947  C  C   . LYS C 1 184 ? 10.415  13.393  76.318  1.00 44.74  ? 230  LYS C C   1 
ATOM   8948  O  O   . LYS C 1 184 ? 11.060  14.317  75.816  1.00 44.42  ? 230  LYS C O   1 
ATOM   8949  C  CB  . LYS C 1 184 ? 11.682  12.302  78.170  1.00 44.65  ? 230  LYS C CB  1 
ATOM   8950  C  CG  . LYS C 1 184 ? 12.121  11.021  78.878  1.00 44.99  ? 230  LYS C CG  1 
ATOM   8951  C  CD  . LYS C 1 184 ? 10.984  10.000  79.009  1.00 45.30  ? 230  LYS C CD  1 
ATOM   8952  C  CE  . LYS C 1 184 ? 11.540  8.657   79.462  1.00 44.28  ? 230  LYS C CE  1 
ATOM   8953  N  NZ  . LYS C 1 184 ? 10.608  7.574   79.025  1.00 44.24  ? 230  LYS C NZ  1 
ATOM   8954  N  N   . ILE C 1 185 ? 9.101   13.404  76.485  1.00 45.15  ? 231  ILE C N   1 
ATOM   8955  C  CA  . ILE C 1 185 ? 8.306   14.606  76.392  1.00 45.57  ? 231  ILE C CA  1 
ATOM   8956  C  C   . ILE C 1 185 ? 8.289   15.189  77.802  1.00 45.82  ? 231  ILE C C   1 
ATOM   8957  O  O   . ILE C 1 185 ? 8.467   14.455  78.781  1.00 45.95  ? 231  ILE C O   1 
ATOM   8958  C  CB  . ILE C 1 185 ? 6.873   14.262  75.901  1.00 45.72  ? 231  ILE C CB  1 
ATOM   8959  C  CG1 . ILE C 1 185 ? 6.295   15.389  75.031  1.00 45.39  ? 231  ILE C CG1 1 
ATOM   8960  C  CG2 . ILE C 1 185 ? 5.934   13.761  77.084  1.00 46.18  ? 231  ILE C CG2 1 
ATOM   8961  C  CD1 . ILE C 1 185 ? 5.804   16.623  75.787  1.00 45.34  ? 231  ILE C CD1 1 
ATOM   8962  N  N   . GLY C 1 186 ? 8.091   16.497  77.913  1.00 45.98  ? 232  GLY C N   1 
ATOM   8963  C  CA  . GLY C 1 186 ? 8.058   17.147  79.223  1.00 46.43  ? 232  GLY C CA  1 
ATOM   8964  C  C   . GLY C 1 186 ? 7.290   18.454  79.197  1.00 46.45  ? 232  GLY C C   1 
ATOM   8965  O  O   . GLY C 1 186 ? 6.764   18.828  78.151  1.00 46.80  ? 232  GLY C O   1 
ATOM   8966  N  N   . PRO C 1 187 ? 7.230   19.167  80.344  1.00 46.23  ? 233  PRO C N   1 
ATOM   8967  C  CA  . PRO C 1 187 ? 6.489   20.424  80.365  1.00 46.02  ? 233  PRO C CA  1 
ATOM   8968  C  C   . PRO C 1 187 ? 7.243   21.561  79.670  1.00 45.96  ? 233  PRO C C   1 
ATOM   8969  O  O   . PRO C 1 187 ? 6.607   22.434  79.084  1.00 45.92  ? 233  PRO C O   1 
ATOM   8970  C  CB  . PRO C 1 187 ? 6.310   20.723  81.860  1.00 45.85  ? 233  PRO C CB  1 
ATOM   8971  C  CG  . PRO C 1 187 ? 6.902   19.562  82.583  1.00 46.21  ? 233  PRO C CG  1 
ATOM   8972  C  CD  . PRO C 1 187 ? 7.834   18.875  81.651  1.00 45.96  ? 233  PRO C CD  1 
ATOM   8973  N  N   . GLU C 1 188 ? 8.574   21.549  79.706  1.00 45.81  ? 234  GLU C N   1 
ATOM   8974  C  CA  . GLU C 1 188 ? 9.338   22.641  79.089  1.00 45.92  ? 234  GLU C CA  1 
ATOM   8975  C  C   . GLU C 1 188 ? 10.146  22.251  77.829  1.00 45.64  ? 234  GLU C C   1 
ATOM   8976  O  O   . GLU C 1 188 ? 11.194  22.853  77.531  1.00 45.47  ? 234  GLU C O   1 
ATOM   8977  C  CB  . GLU C 1 188 ? 10.194  23.402  80.127  1.00 46.17  ? 234  GLU C CB  1 
ATOM   8978  C  CG  . GLU C 1 188 ? 10.717  22.578  81.317  1.00 47.65  ? 234  GLU C CG  1 
ATOM   8979  C  CD  . GLU C 1 188 ? 11.817  21.586  80.935  1.00 49.75  ? 234  GLU C CD  1 
ATOM   8980  O  OE1 . GLU C 1 188 ? 12.481  21.790  79.890  1.00 51.40  ? 234  GLU C OE1 1 
ATOM   8981  O  OE2 . GLU C 1 188 ? 12.027  20.607  81.691  1.00 49.45  ? 234  GLU C OE2 1 
ATOM   8982  N  N   . GLY C 1 189 ? 9.643   21.263  77.086  1.00 45.06  ? 235  GLY C N   1 
ATOM   8983  C  CA  . GLY C 1 189 ? 10.276  20.877  75.826  1.00 44.28  ? 235  GLY C CA  1 
ATOM   8984  C  C   . GLY C 1 189 ? 10.480  19.391  75.592  1.00 43.76  ? 235  GLY C C   1 
ATOM   8985  O  O   . GLY C 1 189 ? 10.132  18.554  76.433  1.00 43.90  ? 235  GLY C O   1 
ATOM   8986  N  N   . LEU C 1 190 ? 11.055  19.077  74.436  1.00 43.05  ? 236  LEU C N   1 
ATOM   8987  C  CA  . LEU C 1 190 ? 11.274  17.697  74.007  1.00 42.45  ? 236  LEU C CA  1 
ATOM   8988  C  C   . LEU C 1 190 ? 12.680  17.184  74.361  1.00 42.13  ? 236  LEU C C   1 
ATOM   8989  O  O   . LEU C 1 190 ? 13.674  17.687  73.859  1.00 42.60  ? 236  LEU C O   1 
ATOM   8990  C  CB  . LEU C 1 190 ? 11.014  17.590  72.492  1.00 42.19  ? 236  LEU C CB  1 
ATOM   8991  C  CG  . LEU C 1 190 ? 9.609   17.933  71.976  1.00 41.00  ? 236  LEU C CG  1 
ATOM   8992  C  CD1 . LEU C 1 190 ? 9.592   18.131  70.483  1.00 41.69  ? 236  LEU C CD1 1 
ATOM   8993  C  CD2 . LEU C 1 190 ? 8.629   16.847  72.334  1.00 41.20  ? 236  LEU C CD2 1 
ATOM   8994  N  N   . VAL C 1 191 ? 12.777  16.196  75.235  1.00 41.69  ? 237  VAL C N   1 
ATOM   8995  C  CA  . VAL C 1 191 ? 14.091  15.642  75.540  1.00 41.43  ? 237  VAL C CA  1 
ATOM   8996  C  C   . VAL C 1 191 ? 14.457  14.710  74.407  1.00 41.11  ? 237  VAL C C   1 
ATOM   8997  O  O   . VAL C 1 191 ? 13.799  13.683  74.195  1.00 41.08  ? 237  VAL C O   1 
ATOM   8998  C  CB  . VAL C 1 191 ? 14.133  14.877  76.885  1.00 41.47  ? 237  VAL C CB  1 
ATOM   8999  C  CG1 . VAL C 1 191 ? 15.559  14.383  77.184  1.00 41.72  ? 237  VAL C CG1 1 
ATOM   9000  C  CG2 . VAL C 1 191 ? 13.638  15.761  78.019  1.00 41.54  ? 237  VAL C CG2 1 
ATOM   9001  N  N   . THR C 1 192 ? 15.503  15.076  73.679  1.00 40.84  ? 238  THR C N   1 
ATOM   9002  C  CA  . THR C 1 192 ? 15.904  14.320  72.497  1.00 40.80  ? 238  THR C CA  1 
ATOM   9003  C  C   . THR C 1 192 ? 17.297  13.763  72.653  1.00 40.62  ? 238  THR C C   1 
ATOM   9004  O  O   . THR C 1 192 ? 18.091  14.277  73.440  1.00 40.61  ? 238  THR C O   1 
ATOM   9005  C  CB  . THR C 1 192 ? 15.832  15.172  71.190  1.00 41.11  ? 238  THR C CB  1 
ATOM   9006  O  OG1 . THR C 1 192 ? 16.920  16.109  71.136  1.00 40.54  ? 238  THR C OG1 1 
ATOM   9007  C  CG2 . THR C 1 192 ? 14.490  15.923  71.089  1.00 41.33  ? 238  THR C CG2 1 
ATOM   9008  N  N   . GLN C 1 193 ? 17.579  12.701  71.906  1.00 40.55  ? 239  GLN C N   1 
ATOM   9009  C  CA  . GLN C 1 193 ? 18.926  12.155  71.807  1.00 40.43  ? 239  GLN C CA  1 
ATOM   9010  C  C   . GLN C 1 193 ? 19.388  12.375  70.381  1.00 40.30  ? 239  GLN C C   1 
ATOM   9011  O  O   . GLN C 1 193 ? 18.632  12.080  69.443  1.00 40.24  ? 239  GLN C O   1 
ATOM   9012  C  CB  . GLN C 1 193 ? 18.933  10.664  72.140  1.00 40.49  ? 239  GLN C CB  1 
ATOM   9013  C  CG  . GLN C 1 193 ? 20.340  10.059  72.303  1.00 41.08  ? 239  GLN C CG  1 
ATOM   9014  C  CD  . GLN C 1 193 ? 20.336  8.549   72.551  1.00 40.85  ? 239  GLN C CD  1 
ATOM   9015  O  OE1 . GLN C 1 193 ? 19.342  7.860   72.293  1.00 41.22  ? 239  GLN C OE1 1 
ATOM   9016  N  NE2 . GLN C 1 193 ? 21.458  8.033   73.041  1.00 40.20  ? 239  GLN C NE2 1 
ATOM   9017  N  N   . VAL C 1 194 ? 20.602  12.909  70.225  1.00 40.02  ? 240  VAL C N   1 
ATOM   9018  C  CA  . VAL C 1 194 ? 21.191  13.147  68.901  1.00 40.04  ? 240  VAL C CA  1 
ATOM   9019  C  C   . VAL C 1 194 ? 21.553  11.829  68.214  1.00 40.17  ? 240  VAL C C   1 
ATOM   9020  O  O   . VAL C 1 194 ? 22.469  11.121  68.647  1.00 39.95  ? 240  VAL C O   1 
ATOM   9021  C  CB  . VAL C 1 194 ? 22.471  14.033  68.944  1.00 40.13  ? 240  VAL C CB  1 
ATOM   9022  C  CG1 . VAL C 1 194 ? 22.886  14.426  67.533  1.00 39.87  ? 240  VAL C CG1 1 
ATOM   9023  C  CG2 . VAL C 1 194 ? 22.278  15.275  69.793  1.00 39.74  ? 240  VAL C CG2 1 
ATOM   9024  N  N   . GLU C 1 195 ? 20.839  11.528  67.129  1.00 40.32  ? 241  GLU C N   1 
ATOM   9025  C  CA  . GLU C 1 195 ? 21.008  10.281  66.381  1.00 40.42  ? 241  GLU C CA  1 
ATOM   9026  C  C   . GLU C 1 195 ? 22.050  10.429  65.274  1.00 40.51  ? 241  GLU C C   1 
ATOM   9027  O  O   . GLU C 1 195 ? 22.946  9.600   65.157  1.00 40.78  ? 241  GLU C O   1 
ATOM   9028  C  CB  . GLU C 1 195 ? 19.669  9.836   65.800  1.00 40.39  ? 241  GLU C CB  1 
ATOM   9029  C  CG  . GLU C 1 195 ? 19.726  8.541   65.018  1.00 40.67  ? 241  GLU C CG  1 
ATOM   9030  C  CD  . GLU C 1 195 ? 18.560  8.386   64.061  1.00 40.89  ? 241  GLU C CD  1 
ATOM   9031  O  OE1 . GLU C 1 195 ? 17.864  9.392   63.765  1.00 38.57  ? 241  GLU C OE1 1 
ATOM   9032  O  OE2 . GLU C 1 195 ? 18.345  7.240   63.598  1.00 42.26  ? 241  GLU C OE2 1 
ATOM   9033  N  N   . ASN C 1 196 ? 21.902  11.466  64.452  1.00 40.53  ? 242  ASN C N   1 
ATOM   9034  C  CA  . ASN C 1 196 ? 22.960  11.914  63.572  1.00 40.40  ? 242  ASN C CA  1 
ATOM   9035  C  C   . ASN C 1 196 ? 23.348  13.292  64.035  1.00 40.56  ? 242  ASN C C   1 
ATOM   9036  O  O   . ASN C 1 196 ? 22.492  14.177  64.150  1.00 41.03  ? 242  ASN C O   1 
ATOM   9037  C  CB  . ASN C 1 196 ? 22.473  12.018  62.136  1.00 40.63  ? 242  ASN C CB  1 
ATOM   9038  C  CG  . ASN C 1 196 ? 22.577  10.722  61.386  1.00 40.80  ? 242  ASN C CG  1 
ATOM   9039  O  OD1 . ASN C 1 196 ? 23.635  10.394  60.826  1.00 41.77  ? 242  ASN C OD1 1 
ATOM   9040  N  ND2 . ASN C 1 196 ? 21.470  9.984   61.343  1.00 41.04  ? 242  ASN C ND2 1 
ATOM   9041  N  N   . GLY C 1 197 ? 24.634  13.469  64.313  1.00 40.40  ? 243  GLY C N   1 
ATOM   9042  C  CA  . GLY C 1 197 ? 25.183  14.760  64.660  1.00 39.67  ? 243  GLY C CA  1 
ATOM   9043  C  C   . GLY C 1 197 ? 25.724  15.464  63.435  1.00 39.71  ? 243  GLY C C   1 
ATOM   9044  O  O   . GLY C 1 197 ? 25.530  15.015  62.304  1.00 39.95  ? 243  GLY C O   1 
ATOM   9045  N  N   . GLY C 1 198 ? 26.415  16.575  63.681  1.00 39.65  ? 244  GLY C N   1 
ATOM   9046  C  CA  . GLY C 1 198 ? 26.947  17.460  62.650  1.00 38.87  ? 244  GLY C CA  1 
ATOM   9047  C  C   . GLY C 1 198 ? 26.974  18.886  63.174  1.00 38.70  ? 244  GLY C C   1 
ATOM   9048  O  O   . GLY C 1 198 ? 26.504  19.162  64.290  1.00 38.48  ? 244  GLY C O   1 
ATOM   9049  N  N   . VAL C 1 199 ? 27.525  19.785  62.360  1.00 38.44  ? 245  VAL C N   1 
ATOM   9050  C  CA  . VAL C 1 199 ? 27.697  21.195  62.710  1.00 38.12  ? 245  VAL C CA  1 
ATOM   9051  C  C   . VAL C 1 199 ? 26.476  22.049  62.352  1.00 37.82  ? 245  VAL C C   1 
ATOM   9052  O  O   . VAL C 1 199 ? 26.056  22.084  61.206  1.00 37.51  ? 245  VAL C O   1 
ATOM   9053  C  CB  . VAL C 1 199 ? 28.957  21.775  62.028  1.00 38.26  ? 245  VAL C CB  1 
ATOM   9054  C  CG1 . VAL C 1 199 ? 29.027  23.280  62.221  1.00 37.74  ? 245  VAL C CG1 1 
ATOM   9055  C  CG2 . VAL C 1 199 ? 30.205  21.095  62.571  1.00 37.71  ? 245  VAL C CG2 1 
ATOM   9056  N  N   . LEU C 1 200 ? 25.949  22.764  63.343  1.00 37.73  ? 246  LEU C N   1 
ATOM   9057  C  CA  . LEU C 1 200 ? 24.684  23.488  63.226  1.00 37.65  ? 246  LEU C CA  1 
ATOM   9058  C  C   . LEU C 1 200 ? 24.846  24.994  63.296  1.00 37.62  ? 246  LEU C C   1 
ATOM   9059  O  O   . LEU C 1 200 ? 25.603  25.506  64.101  1.00 37.71  ? 246  LEU C O   1 
ATOM   9060  C  CB  . LEU C 1 200 ? 23.722  23.018  64.323  1.00 37.66  ? 246  LEU C CB  1 
ATOM   9061  C  CG  . LEU C 1 200 ? 22.442  23.813  64.573  1.00 37.30  ? 246  LEU C CG  1 
ATOM   9062  C  CD1 . LEU C 1 200 ? 21.498  23.637  63.438  1.00 35.84  ? 246  LEU C CD1 1 
ATOM   9063  C  CD2 . LEU C 1 200 ? 21.793  23.411  65.904  1.00 37.90  ? 246  LEU C CD2 1 
ATOM   9064  N  N   . GLY C 1 201 ? 24.114  25.698  62.450  1.00 37.87  ? 247  GLY C N   1 
ATOM   9065  C  CA  . GLY C 1 201 ? 24.105  27.154  62.456  1.00 37.99  ? 247  GLY C CA  1 
ATOM   9066  C  C   . GLY C 1 201 ? 22.730  27.703  62.820  1.00 38.43  ? 247  GLY C C   1 
ATOM   9067  O  O   . GLY C 1 201 ? 21.892  27.026  63.444  1.00 38.22  ? 247  GLY C O   1 
ATOM   9068  N  N   . SER C 1 202 ? 22.484  28.941  62.427  1.00 38.26  ? 248  SER C N   1 
ATOM   9069  C  CA  . SER C 1 202 ? 21.315  29.615  62.928  1.00 38.15  ? 248  SER C CA  1 
ATOM   9070  C  C   . SER C 1 202 ? 20.206  29.551  61.908  1.00 38.53  ? 248  SER C C   1 
ATOM   9071  O  O   . SER C 1 202 ? 20.454  29.632  60.695  1.00 39.59  ? 248  SER C O   1 
ATOM   9072  C  CB  . SER C 1 202 ? 21.668  31.059  63.261  1.00 38.25  ? 248  SER C CB  1 
ATOM   9073  O  OG  . SER C 1 202 ? 22.981  31.152  63.801  1.00 37.84  ? 248  SER C OG  1 
ATOM   9074  N  N   . ARG C 1 203 ? 18.980  29.410  62.395  1.00 38.30  ? 249  ARG C N   1 
ATOM   9075  C  CA  . ARG C 1 203 ? 17.780  29.472  61.552  1.00 38.00  ? 249  ARG C CA  1 
ATOM   9076  C  C   . ARG C 1 203 ? 17.765  28.395  60.495  1.00 37.55  ? 249  ARG C C   1 
ATOM   9077  O  O   . ARG C 1 203 ? 17.588  28.685  59.314  1.00 37.50  ? 249  ARG C O   1 
ATOM   9078  C  CB  . ARG C 1 203 ? 17.597  30.851  60.883  1.00 37.59  ? 249  ARG C CB  1 
ATOM   9079  C  CG  . ARG C 1 203 ? 17.457  32.017  61.835  1.00 38.71  ? 249  ARG C CG  1 
ATOM   9080  C  CD  . ARG C 1 203 ? 16.742  33.215  61.208  1.00 38.84  ? 249  ARG C CD  1 
ATOM   9081  N  NE  . ARG C 1 203 ? 15.317  32.936  61.201  1.00 39.28  ? 249  ARG C NE  1 
ATOM   9082  C  CZ  . ARG C 1 203 ? 14.504  33.052  60.163  1.00 37.94  ? 249  ARG C CZ  1 
ATOM   9083  N  NH1 . ARG C 1 203 ? 14.947  33.487  58.985  1.00 36.48  ? 249  ARG C NH1 1 
ATOM   9084  N  NH2 . ARG C 1 203 ? 13.229  32.731  60.331  1.00 37.56  ? 249  ARG C NH2 1 
ATOM   9085  N  N   . LYS C 1 204 ? 17.950  27.150  60.893  1.00 37.32  ? 250  LYS C N   1 
ATOM   9086  C  CA  . LYS C 1 204 ? 17.986  26.127  59.859  1.00 37.57  ? 250  LYS C CA  1 
ATOM   9087  C  C   . LYS C 1 204 ? 16.719  25.317  59.723  1.00 37.09  ? 250  LYS C C   1 
ATOM   9088  O  O   . LYS C 1 204 ? 15.980  25.147  60.675  1.00 37.38  ? 250  LYS C O   1 
ATOM   9089  C  CB  . LYS C 1 204 ? 19.320  25.366  59.850  1.00 37.83  ? 250  LYS C CB  1 
ATOM   9090  C  CG  . LYS C 1 204 ? 20.258  26.157  58.957  1.00 38.51  ? 250  LYS C CG  1 
ATOM   9091  C  CD  . LYS C 1 204 ? 21.719  25.920  59.159  1.00 40.94  ? 250  LYS C CD  1 
ATOM   9092  C  CE  . LYS C 1 204 ? 22.540  27.035  58.433  1.00 41.18  ? 250  LYS C CE  1 
ATOM   9093  N  NZ  . LYS C 1 204 ? 22.284  27.153  56.934  1.00 41.89  ? 250  LYS C NZ  1 
ATOM   9094  N  N   . GLY C 1 205 ? 16.426  24.876  58.513  1.00 37.01  ? 251  GLY C N   1 
ATOM   9095  C  CA  . GLY C 1 205 ? 15.137  24.223  58.252  1.00 36.62  ? 251  GLY C CA  1 
ATOM   9096  C  C   . GLY C 1 205 ? 14.984  22.952  59.048  1.00 36.21  ? 251  GLY C C   1 
ATOM   9097  O  O   . GLY C 1 205 ? 15.933  22.197  59.193  1.00 36.41  ? 251  GLY C O   1 
ATOM   9098  N  N   . VAL C 1 206 ? 13.788  22.724  59.575  1.00 36.26  ? 252  VAL C N   1 
ATOM   9099  C  CA  . VAL C 1 206 ? 13.469  21.506  60.327  1.00 36.14  ? 252  VAL C CA  1 
ATOM   9100  C  C   . VAL C 1 206 ? 12.436  20.705  59.527  1.00 36.43  ? 252  VAL C C   1 
ATOM   9101  O  O   . VAL C 1 206 ? 11.530  21.282  58.925  1.00 37.06  ? 252  VAL C O   1 
ATOM   9102  C  CB  . VAL C 1 206 ? 12.921  21.860  61.722  1.00 36.00  ? 252  VAL C CB  1 
ATOM   9103  C  CG1 . VAL C 1 206 ? 12.600  20.615  62.551  1.00 36.27  ? 252  VAL C CG1 1 
ATOM   9104  C  CG2 . VAL C 1 206 ? 13.922  22.733  62.470  1.00 36.55  ? 252  VAL C CG2 1 
ATOM   9105  N  N   . ASN C 1 207 ? 12.564  19.387  59.486  1.00 36.22  ? 253  ASN C N   1 
ATOM   9106  C  CA  . ASN C 1 207 ? 11.503  18.591  58.894  1.00 36.10  ? 253  ASN C CA  1 
ATOM   9107  C  C   . ASN C 1 207 ? 11.015  17.565  59.878  1.00 36.49  ? 253  ASN C C   1 
ATOM   9108  O  O   . ASN C 1 207 ? 11.803  16.999  60.647  1.00 35.88  ? 253  ASN C O   1 
ATOM   9109  C  CB  . ASN C 1 207 ? 11.959  17.899  57.618  1.00 36.26  ? 253  ASN C CB  1 
ATOM   9110  C  CG  . ASN C 1 207 ? 12.212  18.868  56.486  1.00 36.73  ? 253  ASN C CG  1 
ATOM   9111  O  OD1 . ASN C 1 207 ? 11.372  18.992  55.582  1.00 36.59  ? 253  ASN C OD1 1 
ATOM   9112  N  ND2 . ASN C 1 207 ? 13.369  19.562  56.518  1.00 33.98  ? 253  ASN C ND2 1 
ATOM   9113  N  N   . LEU C 1 208 ? 9.706   17.328  59.830  1.00 37.00  ? 254  LEU C N   1 
ATOM   9114  C  CA  . LEU C 1 208 ? 9.040   16.388  60.723  1.00 37.55  ? 254  LEU C CA  1 
ATOM   9115  C  C   . LEU C 1 208 ? 8.305   15.263  59.978  1.00 38.19  ? 254  LEU C C   1 
ATOM   9116  O  O   . LEU C 1 208 ? 7.065   15.245  59.960  1.00 38.37  ? 254  LEU C O   1 
ATOM   9117  C  CB  . LEU C 1 208 ? 8.046   17.136  61.624  1.00 37.20  ? 254  LEU C CB  1 
ATOM   9118  C  CG  . LEU C 1 208 ? 8.543   18.387  62.346  1.00 37.33  ? 254  LEU C CG  1 
ATOM   9119  C  CD1 . LEU C 1 208 ? 7.465   18.922  63.321  1.00 36.41  ? 254  LEU C CD1 1 
ATOM   9120  C  CD2 . LEU C 1 208 ? 9.865   18.113  63.073  1.00 37.48  ? 254  LEU C CD2 1 
ATOM   9121  N  N   . PRO C 1 209 ? 9.049   14.292  59.402  1.00 38.73  ? 255  PRO C N   1 
ATOM   9122  C  CA  . PRO C 1 209 ? 8.302   13.225  58.723  1.00 38.99  ? 255  PRO C CA  1 
ATOM   9123  C  C   . PRO C 1 209 ? 7.494   12.429  59.745  1.00 39.49  ? 255  PRO C C   1 
ATOM   9124  O  O   . PRO C 1 209 ? 7.811   12.416  60.933  1.00 39.49  ? 255  PRO C O   1 
ATOM   9125  C  CB  . PRO C 1 209 ? 9.399   12.342  58.105  1.00 38.70  ? 255  PRO C CB  1 
ATOM   9126  C  CG  . PRO C 1 209 ? 10.673  13.152  58.181  1.00 38.87  ? 255  PRO C CG  1 
ATOM   9127  C  CD  . PRO C 1 209 ? 10.507  14.057  59.370  1.00 38.78  ? 255  PRO C CD  1 
ATOM   9128  N  N   . GLY C 1 210 ? 6.430   11.793  59.297  1.00 40.31  ? 256  GLY C N   1 
ATOM   9129  C  CA  . GLY C 1 210 ? 5.688   10.924  60.191  1.00 41.33  ? 256  GLY C CA  1 
ATOM   9130  C  C   . GLY C 1 210 ? 4.801   11.688  61.149  1.00 41.77  ? 256  GLY C C   1 
ATOM   9131  O  O   . GLY C 1 210 ? 3.810   11.129  61.656  1.00 42.44  ? 256  GLY C O   1 
ATOM   9132  N  N   . ALA C 1 211 ? 5.145   12.951  61.399  1.00 41.85  ? 257  ALA C N   1 
ATOM   9133  C  CA  . ALA C 1 211 ? 4.259   13.851  62.142  1.00 42.36  ? 257  ALA C CA  1 
ATOM   9134  C  C   . ALA C 1 211 ? 3.375   14.628  61.185  1.00 42.47  ? 257  ALA C C   1 
ATOM   9135  O  O   . ALA C 1 211 ? 3.867   15.271  60.272  1.00 42.46  ? 257  ALA C O   1 
ATOM   9136  C  CB  . ALA C 1 211 ? 5.054   14.800  63.025  1.00 42.48  ? 257  ALA C CB  1 
ATOM   9137  N  N   . GLN C 1 212 ? 2.062   14.530  61.367  1.00 43.37  ? 258  GLN C N   1 
ATOM   9138  C  CA  . GLN C 1 212 ? 1.134   15.383  60.611  1.00 43.97  ? 258  GLN C CA  1 
ATOM   9139  C  C   . GLN C 1 212 ? 1.336   16.838  61.101  1.00 44.20  ? 258  GLN C C   1 
ATOM   9140  O  O   . GLN C 1 212 ? 1.115   17.148  62.270  1.00 44.14  ? 258  GLN C O   1 
ATOM   9141  C  CB  . GLN C 1 212 ? -0.346  14.875  60.654  1.00 43.65  ? 258  GLN C CB  1 
ATOM   9142  C  CG  . GLN C 1 212 ? -0.794  14.063  61.919  1.00 44.44  ? 258  GLN C CG  1 
ATOM   9143  C  CD  . GLN C 1 212 ? -2.304  13.589  61.918  1.00 45.68  ? 258  GLN C CD  1 
ATOM   9144  O  OE1 . GLN C 1 212 ? -3.164  14.150  62.635  1.00 45.49  ? 258  GLN C OE1 1 
ATOM   9145  N  NE2 . GLN C 1 212 ? -2.597  12.544  61.126  1.00 44.81  ? 258  GLN C NE2 1 
ATOM   9146  N  N   . VAL C 1 213 ? 1.835   17.710  60.228  1.00 44.46  ? 259  VAL C N   1 
ATOM   9147  C  CA  . VAL C 1 213 ? 2.103   19.093  60.639  1.00 44.65  ? 259  VAL C CA  1 
ATOM   9148  C  C   . VAL C 1 213 ? 0.841   19.938  60.440  1.00 44.80  ? 259  VAL C C   1 
ATOM   9149  O  O   . VAL C 1 213 ? 0.448   20.208  59.308  1.00 44.75  ? 259  VAL C O   1 
ATOM   9150  C  CB  . VAL C 1 213 ? 3.347   19.709  59.922  1.00 44.46  ? 259  VAL C CB  1 
ATOM   9151  C  CG1 . VAL C 1 213 ? 3.675   21.074  60.493  1.00 44.64  ? 259  VAL C CG1 1 
ATOM   9152  C  CG2 . VAL C 1 213 ? 4.554   18.824  60.093  1.00 44.35  ? 259  VAL C CG2 1 
ATOM   9153  N  N   . ASP C 1 214 ? 0.221   20.347  61.547  1.00 45.20  ? 260  ASP C N   1 
ATOM   9154  C  CA  . ASP C 1 214 ? -1.094  21.013  61.520  1.00 46.12  ? 260  ASP C CA  1 
ATOM   9155  C  C   . ASP C 1 214 ? -1.005  22.509  61.200  1.00 46.30  ? 260  ASP C C   1 
ATOM   9156  O  O   . ASP C 1 214 ? -2.016  23.235  61.188  1.00 46.42  ? 260  ASP C O   1 
ATOM   9157  C  CB  . ASP C 1 214 ? -1.852  20.788  62.837  1.00 46.02  ? 260  ASP C CB  1 
ATOM   9158  C  CG  . ASP C 1 214 ? -1.273  21.586  63.990  1.00 47.01  ? 260  ASP C CG  1 
ATOM   9159  O  OD1 . ASP C 1 214 ? -0.170  22.189  63.840  1.00 46.84  ? 260  ASP C OD1 1 
ATOM   9160  O  OD2 . ASP C 1 214 ? -1.938  21.604  65.049  1.00 47.70  ? 260  ASP C OD2 1 
ATOM   9161  N  N   . LEU C 1 215 ? 0.218   22.955  60.952  1.00 46.40  ? 261  LEU C N   1 
ATOM   9162  C  CA  . LEU C 1 215 ? 0.480   24.308  60.495  1.00 46.61  ? 261  LEU C CA  1 
ATOM   9163  C  C   . LEU C 1 215 ? -0.312  24.582  59.200  1.00 46.54  ? 261  LEU C C   1 
ATOM   9164  O  O   . LEU C 1 215 ? -0.435  23.688  58.354  1.00 46.69  ? 261  LEU C O   1 
ATOM   9165  C  CB  . LEU C 1 215 ? 1.999   24.503  60.285  1.00 46.67  ? 261  LEU C CB  1 
ATOM   9166  C  CG  . LEU C 1 215 ? 2.588   25.852  60.719  1.00 47.29  ? 261  LEU C CG  1 
ATOM   9167  C  CD1 . LEU C 1 215 ? 2.116   26.321  62.136  1.00 48.55  ? 261  LEU C CD1 1 
ATOM   9168  C  CD2 . LEU C 1 215 ? 4.086   25.816  60.627  1.00 48.08  ? 261  LEU C CD2 1 
ATOM   9169  N  N   . PRO C 1 216 ? -0.873  25.800  59.048  1.00 46.27  ? 262  PRO C N   1 
ATOM   9170  C  CA  . PRO C 1 216 ? -1.629  26.108  57.833  1.00 46.35  ? 262  PRO C CA  1 
ATOM   9171  C  C   . PRO C 1 216 ? -0.715  26.272  56.615  1.00 46.98  ? 262  PRO C C   1 
ATOM   9172  O  O   . PRO C 1 216 ? 0.488   26.620  56.747  1.00 47.06  ? 262  PRO C O   1 
ATOM   9173  C  CB  . PRO C 1 216 ? -2.323  27.432  58.147  1.00 46.41  ? 262  PRO C CB  1 
ATOM   9174  C  CG  . PRO C 1 216 ? -1.621  28.007  59.335  1.00 46.39  ? 262  PRO C CG  1 
ATOM   9175  C  CD  . PRO C 1 216 ? -0.822  26.927  59.995  1.00 46.33  ? 262  PRO C CD  1 
ATOM   9176  N  N   . GLY C 1 217 ? -1.272  25.995  55.433  1.00 46.96  ? 263  GLY C N   1 
ATOM   9177  C  CA  . GLY C 1 217 ? -0.542  26.162  54.195  1.00 46.49  ? 263  GLY C CA  1 
ATOM   9178  C  C   . GLY C 1 217 ? -0.372  27.647  53.940  1.00 46.60  ? 263  GLY C C   1 
ATOM   9179  O  O   . GLY C 1 217 ? 0.559   28.052  53.240  1.00 47.49  ? 263  GLY C O   1 
ATOM   9180  N  N   . LEU C 1 218 ? -1.257  28.461  54.521  1.00 45.75  ? 264  LEU C N   1 
ATOM   9181  C  CA  . LEU C 1 218 ? -1.220  29.909  54.328  1.00 44.69  ? 264  LEU C CA  1 
ATOM   9182  C  C   . LEU C 1 218 ? -1.387  30.648  55.653  1.00 44.24  ? 264  LEU C C   1 
ATOM   9183  O  O   . LEU C 1 218 ? -2.477  30.688  56.240  1.00 44.14  ? 264  LEU C O   1 
ATOM   9184  C  CB  . LEU C 1 218 ? -2.298  30.341  53.330  1.00 44.61  ? 264  LEU C CB  1 
ATOM   9185  C  CG  . LEU C 1 218 ? -1.860  31.221  52.155  1.00 43.69  ? 264  LEU C CG  1 
ATOM   9186  C  CD1 . LEU C 1 218 ? -0.916  30.465  51.283  1.00 42.46  ? 264  LEU C CD1 1 
ATOM   9187  C  CD2 . LEU C 1 218 ? -3.033  31.666  51.336  1.00 43.63  ? 264  LEU C CD2 1 
ATOM   9188  N  N   . SER C 1 219 ? -0.283  31.221  56.111  1.00 43.56  ? 265  SER C N   1 
ATOM   9189  C  CA  . SER C 1 219 ? -0.221  31.913  57.382  1.00 43.42  ? 265  SER C CA  1 
ATOM   9190  C  C   . SER C 1 219 ? -0.549  33.376  57.166  1.00 43.47  ? 265  SER C C   1 
ATOM   9191  O  O   . SER C 1 219 ? -0.654  33.835  56.028  1.00 43.34  ? 265  SER C O   1 
ATOM   9192  C  CB  . SER C 1 219 ? 1.184   31.797  57.965  1.00 43.04  ? 265  SER C CB  1 
ATOM   9193  O  OG  . SER C 1 219 ? 2.099   32.513  57.163  1.00 43.64  ? 265  SER C OG  1 
ATOM   9194  N  N   . GLU C 1 220 ? -0.690  34.122  58.252  1.00 43.51  ? 266  GLU C N   1 
ATOM   9195  C  CA  . GLU C 1 220 ? -0.908  35.549  58.109  1.00 43.84  ? 266  GLU C CA  1 
ATOM   9196  C  C   . GLU C 1 220 ? 0.171   36.172  57.193  1.00 43.48  ? 266  GLU C C   1 
ATOM   9197  O  O   . GLU C 1 220 ? -0.165  36.898  56.270  1.00 43.38  ? 266  GLU C O   1 
ATOM   9198  C  CB  . GLU C 1 220 ? -1.023  36.241  59.474  1.00 43.74  ? 266  GLU C CB  1 
ATOM   9199  C  CG  . GLU C 1 220 ? -2.250  37.131  59.568  1.00 46.10  ? 266  GLU C CG  1 
ATOM   9200  C  CD  . GLU C 1 220 ? -2.707  37.448  61.017  1.00 48.95  ? 266  GLU C CD  1 
ATOM   9201  O  OE1 . GLU C 1 220 ? -1.867  37.841  61.865  1.00 49.61  ? 266  GLU C OE1 1 
ATOM   9202  O  OE2 . GLU C 1 220 ? -3.926  37.328  61.298  1.00 48.61  ? 266  GLU C OE2 1 
ATOM   9203  N  N   . GLN C 1 221 ? 1.444   35.853  57.418  1.00 43.35  ? 267  GLN C N   1 
ATOM   9204  C  CA  . GLN C 1 221 ? 2.522   36.357  56.550  1.00 43.52  ? 267  GLN C CA  1 
ATOM   9205  C  C   . GLN C 1 221 ? 2.387   35.977  55.047  1.00 43.28  ? 267  GLN C C   1 
ATOM   9206  O  O   . GLN C 1 221 ? 2.448   36.848  54.179  1.00 42.90  ? 267  GLN C O   1 
ATOM   9207  C  CB  . GLN C 1 221 ? 3.904   35.947  57.085  1.00 43.83  ? 267  GLN C CB  1 
ATOM   9208  C  CG  . GLN C 1 221 ? 5.046   36.700  56.403  1.00 45.29  ? 267  GLN C CG  1 
ATOM   9209  C  CD  . GLN C 1 221 ? 4.973   38.207  56.647  1.00 47.49  ? 267  GLN C CD  1 
ATOM   9210  O  OE1 . GLN C 1 221 ? 4.588   38.646  57.728  1.00 49.16  ? 267  GLN C OE1 1 
ATOM   9211  N  NE2 . GLN C 1 221 ? 5.349   39.000  55.643  1.00 47.35  ? 267  GLN C NE2 1 
ATOM   9212  N  N   . ASP C 1 222 ? 2.215   34.688  54.747  1.00 42.81  ? 268  ASP C N   1 
ATOM   9213  C  CA  . ASP C 1 222 ? 1.990   34.288  53.366  1.00 42.90  ? 268  ASP C CA  1 
ATOM   9214  C  C   . ASP C 1 222 ? 0.968   35.219  52.700  1.00 42.69  ? 268  ASP C C   1 
ATOM   9215  O  O   . ASP C 1 222 ? 1.278   35.854  51.693  1.00 43.35  ? 268  ASP C O   1 
ATOM   9216  C  CB  . ASP C 1 222 ? 1.564   32.815  53.264  1.00 42.95  ? 268  ASP C CB  1 
ATOM   9217  C  CG  . ASP C 1 222 ? 2.572   31.855  53.916  1.00 44.32  ? 268  ASP C CG  1 
ATOM   9218  O  OD1 . ASP C 1 222 ? 3.731   31.744  53.434  1.00 45.43  ? 268  ASP C OD1 1 
ATOM   9219  O  OD2 . ASP C 1 222 ? 2.207   31.191  54.906  1.00 45.10  ? 268  ASP C OD2 1 
ATOM   9220  N  N   . VAL C 1 223 ? -0.227  35.323  53.274  1.00 42.08  ? 269  VAL C N   1 
ATOM   9221  C  CA  . VAL C 1 223 ? -1.268  36.204  52.750  1.00 41.42  ? 269  VAL C CA  1 
ATOM   9222  C  C   . VAL C 1 223 ? -0.720  37.606  52.480  1.00 41.40  ? 269  VAL C C   1 
ATOM   9223  O  O   . VAL C 1 223 ? -0.908  38.131  51.386  1.00 41.54  ? 269  VAL C O   1 
ATOM   9224  C  CB  . VAL C 1 223 ? -2.535  36.244  53.678  1.00 41.59  ? 269  VAL C CB  1 
ATOM   9225  C  CG1 . VAL C 1 223 ? -3.399  37.485  53.403  1.00 40.99  ? 269  VAL C CG1 1 
ATOM   9226  C  CG2 . VAL C 1 223 ? -3.361  34.964  53.529  1.00 40.18  ? 269  VAL C CG2 1 
ATOM   9227  N  N   . ARG C 1 224 ? -0.036  38.199  53.458  1.00 41.15  ? 270  ARG C N   1 
ATOM   9228  C  CA  . ARG C 1 224 ? 0.626   39.493  53.255  1.00 41.18  ? 270  ARG C CA  1 
ATOM   9229  C  C   . ARG C 1 224 ? 1.590   39.396  52.084  1.00 40.91  ? 270  ARG C C   1 
ATOM   9230  O  O   . ARG C 1 224 ? 1.591   40.258  51.212  1.00 41.28  ? 270  ARG C O   1 
ATOM   9231  C  CB  . ARG C 1 224 ? 1.400   39.943  54.494  1.00 41.19  ? 270  ARG C CB  1 
ATOM   9232  C  CG  . ARG C 1 224 ? 0.632   40.786  55.491  1.00 42.50  ? 270  ARG C CG  1 
ATOM   9233  C  CD  . ARG C 1 224 ? 1.542   41.210  56.649  1.00 45.78  ? 270  ARG C CD  1 
ATOM   9234  N  NE  . ARG C 1 224 ? 1.749   40.125  57.605  1.00 48.54  ? 270  ARG C NE  1 
ATOM   9235  C  CZ  . ARG C 1 224 ? 1.248   40.103  58.827  1.00 51.16  ? 270  ARG C CZ  1 
ATOM   9236  N  NH1 . ARG C 1 224 ? 0.524   41.132  59.269  1.00 53.38  ? 270  ARG C NH1 1 
ATOM   9237  N  NH2 . ARG C 1 224 ? 1.483   39.062  59.611  1.00 51.65  ? 270  ARG C NH2 1 
ATOM   9238  N  N   . ASP C 1 225 ? 2.398   38.342  52.054  1.00 40.53  ? 271  ASP C N   1 
ATOM   9239  C  CA  . ASP C 1 225 ? 3.370   38.187  50.987  1.00 40.22  ? 271  ASP C CA  1 
ATOM   9240  C  C   . ASP C 1 225 ? 2.666   38.145  49.647  1.00 40.29  ? 271  ASP C C   1 
ATOM   9241  O  O   . ASP C 1 225 ? 3.105   38.787  48.689  1.00 40.19  ? 271  ASP C O   1 
ATOM   9242  C  CB  . ASP C 1 225 ? 4.225   36.949  51.198  1.00 39.88  ? 271  ASP C CB  1 
ATOM   9243  C  CG  . ASP C 1 225 ? 5.222   37.123  52.299  1.00 39.41  ? 271  ASP C CG  1 
ATOM   9244  O  OD1 . ASP C 1 225 ? 5.281   38.207  52.894  1.00 37.81  ? 271  ASP C OD1 1 
ATOM   9245  O  OD2 . ASP C 1 225 ? 5.970   36.170  52.571  1.00 41.70  ? 271  ASP C OD2 1 
ATOM   9246  N  N   . LEU C 1 226 ? 1.557   37.417  49.586  1.00 40.04  ? 272  LEU C N   1 
ATOM   9247  C  CA  . LEU C 1 226 ? 0.850   37.281  48.328  1.00 40.04  ? 272  LEU C CA  1 
ATOM   9248  C  C   . LEU C 1 226 ? 0.301   38.640  47.887  1.00 40.51  ? 272  LEU C C   1 
ATOM   9249  O  O   . LEU C 1 226 ? 0.512   39.069  46.741  1.00 40.35  ? 272  LEU C O   1 
ATOM   9250  C  CB  . LEU C 1 226 ? -0.226  36.188  48.397  1.00 39.55  ? 272  LEU C CB  1 
ATOM   9251  C  CG  . LEU C 1 226 ? 0.319   34.744  48.435  1.00 39.11  ? 272  LEU C CG  1 
ATOM   9252  C  CD1 . LEU C 1 226 ? -0.722  33.752  48.911  1.00 39.74  ? 272  LEU C CD1 1 
ATOM   9253  C  CD2 . LEU C 1 226 ? 0.889   34.290  47.107  1.00 38.14  ? 272  LEU C CD2 1 
ATOM   9254  N  N   . ARG C 1 227 ? -0.371  39.345  48.795  1.00 40.90  ? 273  ARG C N   1 
ATOM   9255  C  CA  . ARG C 1 227 ? -0.884  40.673  48.447  1.00 41.54  ? 273  ARG C CA  1 
ATOM   9256  C  C   . ARG C 1 227 ? 0.263   41.521  47.876  1.00 41.38  ? 273  ARG C C   1 
ATOM   9257  O  O   . ARG C 1 227 ? 0.092   42.228  46.874  1.00 41.29  ? 273  ARG C O   1 
ATOM   9258  C  CB  . ARG C 1 227 ? -1.551  41.362  49.641  1.00 41.68  ? 273  ARG C CB  1 
ATOM   9259  C  CG  . ARG C 1 227 ? -2.484  40.449  50.464  1.00 43.93  ? 273  ARG C CG  1 
ATOM   9260  C  CD  . ARG C 1 227 ? -3.566  39.758  49.621  1.00 46.44  ? 273  ARG C CD  1 
ATOM   9261  N  NE  . ARG C 1 227 ? -4.800  40.546  49.537  1.00 48.78  ? 273  ARG C NE  1 
ATOM   9262  C  CZ  . ARG C 1 227 ? -5.175  41.279  48.481  1.00 49.82  ? 273  ARG C CZ  1 
ATOM   9263  N  NH1 . ARG C 1 227 ? -4.414  41.342  47.371  1.00 49.53  ? 273  ARG C NH1 1 
ATOM   9264  N  NH2 . ARG C 1 227 ? -6.329  41.956  48.534  1.00 48.78  ? 273  ARG C NH2 1 
ATOM   9265  N  N   . PHE C 1 228 ? 1.444   41.400  48.483  1.00 41.17  ? 274  PHE C N   1 
ATOM   9266  C  CA  . PHE C 1 228 ? 2.616   42.132  48.024  1.00 41.29  ? 274  PHE C CA  1 
ATOM   9267  C  C   . PHE C 1 228 ? 2.878   41.812  46.565  1.00 41.50  ? 274  PHE C C   1 
ATOM   9268  O  O   . PHE C 1 228 ? 3.088   42.710  45.760  1.00 41.72  ? 274  PHE C O   1 
ATOM   9269  C  CB  . PHE C 1 228 ? 3.826   41.768  48.865  1.00 41.09  ? 274  PHE C CB  1 
ATOM   9270  C  CG  . PHE C 1 228 ? 5.103   42.411  48.409  1.00 41.35  ? 274  PHE C CG  1 
ATOM   9271  C  CD1 . PHE C 1 228 ? 5.571   43.574  49.029  1.00 40.23  ? 274  PHE C CD1 1 
ATOM   9272  C  CD2 . PHE C 1 228 ? 5.869   41.835  47.381  1.00 42.36  ? 274  PHE C CD2 1 
ATOM   9273  C  CE1 . PHE C 1 228 ? 6.780   44.171  48.627  1.00 39.97  ? 274  PHE C CE1 1 
ATOM   9274  C  CE2 . PHE C 1 228 ? 7.081   42.428  46.970  1.00 41.74  ? 274  PHE C CE2 1 
ATOM   9275  C  CZ  . PHE C 1 228 ? 7.534   43.604  47.602  1.00 40.88  ? 274  PHE C CZ  1 
ATOM   9276  N  N   . GLY C 1 229 ? 2.854   40.521  46.231  1.00 41.86  ? 275  GLY C N   1 
ATOM   9277  C  CA  . GLY C 1 229 ? 3.071   40.048  44.864  1.00 41.50  ? 275  GLY C CA  1 
ATOM   9278  C  C   . GLY C 1 229 ? 2.076   40.641  43.896  1.00 41.67  ? 275  GLY C C   1 
ATOM   9279  O  O   . GLY C 1 229 ? 2.424   40.996  42.775  1.00 42.05  ? 275  GLY C O   1 
ATOM   9280  N  N   . VAL C 1 230 ? 0.825   40.773  44.324  1.00 41.63  ? 276  VAL C N   1 
ATOM   9281  C  CA  . VAL C 1 230 ? -0.166  41.392  43.450  1.00 41.29  ? 276  VAL C CA  1 
ATOM   9282  C  C   . VAL C 1 230 ? 0.268   42.815  43.166  1.00 41.36  ? 276  VAL C C   1 
ATOM   9283  O  O   . VAL C 1 230 ? 0.489   43.152  42.006  1.00 41.55  ? 276  VAL C O   1 
ATOM   9284  C  CB  . VAL C 1 230 ? -1.582  41.359  44.020  1.00 41.14  ? 276  VAL C CB  1 
ATOM   9285  C  CG1 . VAL C 1 230 ? -2.536  41.967  43.048  1.00 40.17  ? 276  VAL C CG1 1 
ATOM   9286  C  CG2 . VAL C 1 230 ? -1.983  39.955  44.259  1.00 40.94  ? 276  VAL C CG2 1 
ATOM   9287  N  N   . GLU C 1 231 ? 0.437   43.617  44.221  1.00 41.40  ? 277  GLU C N   1 
ATOM   9288  C  CA  . GLU C 1 231 ? 0.822   45.045  44.096  1.00 41.53  ? 277  GLU C CA  1 
ATOM   9289  C  C   . GLU C 1 231 ? 2.066   45.304  43.227  1.00 41.09  ? 277  GLU C C   1 
ATOM   9290  O  O   . GLU C 1 231 ? 2.141   46.328  42.566  1.00 41.12  ? 277  GLU C O   1 
ATOM   9291  C  CB  . GLU C 1 231 ? 1.022   45.690  45.469  1.00 41.72  ? 277  GLU C CB  1 
ATOM   9292  C  CG  . GLU C 1 231 ? -0.215  45.644  46.379  1.00 44.07  ? 277  GLU C CG  1 
ATOM   9293  C  CD  . GLU C 1 231 ? 0.009   46.304  47.749  1.00 47.33  ? 277  GLU C CD  1 
ATOM   9294  O  OE1 . GLU C 1 231 ? 1.186   46.535  48.152  1.00 47.33  ? 277  GLU C OE1 1 
ATOM   9295  O  OE2 . GLU C 1 231 ? -1.017  46.597  48.422  1.00 48.26  ? 277  GLU C OE2 1 
ATOM   9296  N  N   . HIS C 1 232 ? 3.030   44.388  43.206  1.00 40.40  ? 278  HIS C N   1 
ATOM   9297  C  CA  . HIS C 1 232 ? 4.248   44.640  42.447  1.00 39.85  ? 278  HIS C CA  1 
ATOM   9298  C  C   . HIS C 1 232 ? 4.256   43.895  41.137  1.00 39.66  ? 278  HIS C C   1 
ATOM   9299  O  O   . HIS C 1 232 ? 5.263   43.869  40.425  1.00 39.43  ? 278  HIS C O   1 
ATOM   9300  C  CB  . HIS C 1 232 ? 5.476   44.314  43.276  1.00 39.88  ? 278  HIS C CB  1 
ATOM   9301  C  CG  . HIS C 1 232 ? 5.647   45.223  44.447  1.00 40.43  ? 278  HIS C CG  1 
ATOM   9302  N  ND1 . HIS C 1 232 ? 6.430   46.356  44.401  1.00 40.56  ? 278  HIS C ND1 1 
ATOM   9303  C  CD2 . HIS C 1 232 ? 5.103   45.190  45.684  1.00 41.08  ? 278  HIS C CD2 1 
ATOM   9304  C  CE1 . HIS C 1 232 ? 6.371   46.977  45.564  1.00 41.35  ? 278  HIS C CE1 1 
ATOM   9305  N  NE2 . HIS C 1 232 ? 5.569   46.293  46.359  1.00 42.05  ? 278  HIS C NE2 1 
ATOM   9306  N  N   . GLY C 1 233 ? 3.117   43.283  40.829  1.00 39.15  ? 279  GLY C N   1 
ATOM   9307  C  CA  . GLY C 1 233 ? 2.903   42.679  39.527  1.00 38.60  ? 279  GLY C CA  1 
ATOM   9308  C  C   . GLY C 1 233 ? 3.757   41.458  39.243  1.00 38.64  ? 279  GLY C C   1 
ATOM   9309  O  O   . GLY C 1 233 ? 4.160   41.239  38.098  1.00 38.80  ? 279  GLY C O   1 
ATOM   9310  N  N   . VAL C 1 234 ? 4.044   40.651  40.266  1.00 38.30  ? 280  VAL C N   1 
ATOM   9311  C  CA  . VAL C 1 234 ? 4.688   39.368  40.014  1.00 38.16  ? 280  VAL C CA  1 
ATOM   9312  C  C   . VAL C 1 234 ? 3.819   38.562  39.039  1.00 38.57  ? 280  VAL C C   1 
ATOM   9313  O  O   . VAL C 1 234 ? 2.601   38.798  38.940  1.00 39.12  ? 280  VAL C O   1 
ATOM   9314  C  CB  . VAL C 1 234 ? 4.876   38.563  41.290  1.00 38.04  ? 280  VAL C CB  1 
ATOM   9315  C  CG1 . VAL C 1 234 ? 5.699   39.344  42.290  1.00 36.60  ? 280  VAL C CG1 1 
ATOM   9316  C  CG2 . VAL C 1 234 ? 3.509   38.120  41.858  1.00 38.09  ? 280  VAL C CG2 1 
ATOM   9317  N  N   . ASP C 1 235 ? 4.440   37.620  38.337  1.00 38.60  ? 281  ASP C N   1 
ATOM   9318  C  CA  . ASP C 1 235 ? 3.779   36.901  37.250  1.00 38.89  ? 281  ASP C CA  1 
ATOM   9319  C  C   . ASP C 1 235 ? 3.295   35.502  37.648  1.00 38.65  ? 281  ASP C C   1 
ATOM   9320  O  O   . ASP C 1 235 ? 2.404   34.941  37.030  1.00 38.56  ? 281  ASP C O   1 
ATOM   9321  C  CB  . ASP C 1 235 ? 4.769   36.791  36.086  1.00 39.15  ? 281  ASP C CB  1 
ATOM   9322  C  CG  . ASP C 1 235 ? 5.193   38.142  35.558  1.00 42.02  ? 281  ASP C CG  1 
ATOM   9323  O  OD1 . ASP C 1 235 ? 5.911   38.886  36.253  1.00 47.78  ? 281  ASP C OD1 1 
ATOM   9324  O  OD2 . ASP C 1 235 ? 4.803   38.493  34.443  1.00 44.94  ? 281  ASP C OD2 1 
ATOM   9325  N  N   . ILE C 1 236 ? 3.921   34.941  38.677  1.00 38.54  ? 282  ILE C N   1 
ATOM   9326  C  CA  . ILE C 1 236 ? 3.818   33.524  39.002  1.00 37.98  ? 282  ILE C CA  1 
ATOM   9327  C  C   . ILE C 1 236 ? 4.022   33.359  40.496  1.00 37.93  ? 282  ILE C C   1 
ATOM   9328  O  O   . ILE C 1 236 ? 4.922   33.972  41.066  1.00 37.78  ? 282  ILE C O   1 
ATOM   9329  C  CB  . ILE C 1 236 ? 4.937   32.693  38.281  1.00 37.67  ? 282  ILE C CB  1 
ATOM   9330  C  CG1 . ILE C 1 236 ? 4.850   32.831  36.771  1.00 36.61  ? 282  ILE C CG1 1 
ATOM   9331  C  CG2 . ILE C 1 236 ? 4.826   31.231  38.614  1.00 37.93  ? 282  ILE C CG2 1 
ATOM   9332  C  CD1 . ILE C 1 236 ? 6.152   32.505  36.051  1.00 33.64  ? 282  ILE C CD1 1 
ATOM   9333  N  N   . VAL C 1 237 ? 3.218   32.502  41.110  1.00 37.68  ? 283  VAL C N   1 
ATOM   9334  C  CA  . VAL C 1 237 ? 3.402   32.139  42.511  1.00 37.62  ? 283  VAL C CA  1 
ATOM   9335  C  C   . VAL C 1 237 ? 3.859   30.697  42.602  1.00 37.93  ? 283  VAL C C   1 
ATOM   9336  O  O   . VAL C 1 237 ? 3.147   29.787  42.178  1.00 38.57  ? 283  VAL C O   1 
ATOM   9337  C  CB  . VAL C 1 237 ? 2.053   32.265  43.291  1.00 37.59  ? 283  VAL C CB  1 
ATOM   9338  C  CG1 . VAL C 1 237 ? 2.165   31.652  44.682  1.00 36.72  ? 283  VAL C CG1 1 
ATOM   9339  C  CG2 . VAL C 1 237 ? 1.600   33.704  43.351  1.00 36.41  ? 283  VAL C CG2 1 
ATOM   9340  N  N   . PHE C 1 238 ? 5.049   30.472  43.131  1.00 38.16  ? 284  PHE C N   1 
ATOM   9341  C  CA  . PHE C 1 238 ? 5.444   29.106  43.469  1.00 38.11  ? 284  PHE C CA  1 
ATOM   9342  C  C   . PHE C 1 238 ? 4.881   28.893  44.872  1.00 38.61  ? 284  PHE C C   1 
ATOM   9343  O  O   . PHE C 1 238 ? 5.399   29.472  45.815  1.00 39.26  ? 284  PHE C O   1 
ATOM   9344  C  CB  . PHE C 1 238 ? 6.962   28.958  43.452  1.00 37.51  ? 284  PHE C CB  1 
ATOM   9345  C  CG  . PHE C 1 238 ? 7.594   29.061  42.070  1.00 37.04  ? 284  PHE C CG  1 
ATOM   9346  C  CD1 . PHE C 1 238 ? 6.877   28.823  40.921  1.00 36.94  ? 284  PHE C CD1 1 
ATOM   9347  C  CD2 . PHE C 1 238 ? 8.949   29.355  41.946  1.00 37.41  ? 284  PHE C CD2 1 
ATOM   9348  C  CE1 . PHE C 1 238 ? 7.498   28.888  39.666  1.00 36.97  ? 284  PHE C CE1 1 
ATOM   9349  C  CE2 . PHE C 1 238 ? 9.581   29.429  40.700  1.00 35.98  ? 284  PHE C CE2 1 
ATOM   9350  C  CZ  . PHE C 1 238 ? 8.855   29.197  39.563  1.00 36.58  ? 284  PHE C CZ  1 
ATOM   9351  N  N   . ALA C 1 239 ? 3.790   28.134  45.010  1.00 38.64  ? 285  ALA C N   1 
ATOM   9352  C  CA  . ALA C 1 239 ? 3.146   27.951  46.316  1.00 38.78  ? 285  ALA C CA  1 
ATOM   9353  C  C   . ALA C 1 239 ? 3.756   26.786  47.104  1.00 39.55  ? 285  ALA C C   1 
ATOM   9354  O  O   . ALA C 1 239 ? 3.695   25.638  46.683  1.00 40.14  ? 285  ALA C O   1 
ATOM   9355  C  CB  . ALA C 1 239 ? 1.675   27.758  46.146  1.00 38.43  ? 285  ALA C CB  1 
ATOM   9356  N  N   . SER C 1 240 ? 4.374   27.088  48.242  1.00 40.12  ? 286  SER C N   1 
ATOM   9357  C  CA  . SER C 1 240 ? 5.041   26.075  49.057  1.00 40.15  ? 286  SER C CA  1 
ATOM   9358  C  C   . SER C 1 240 ? 4.072   25.181  49.821  1.00 40.38  ? 286  SER C C   1 
ATOM   9359  O  O   . SER C 1 240 ? 2.955   25.559  50.106  1.00 40.49  ? 286  SER C O   1 
ATOM   9360  C  CB  . SER C 1 240 ? 5.966   26.731  50.056  1.00 40.06  ? 286  SER C CB  1 
ATOM   9361  O  OG  . SER C 1 240 ? 6.969   27.449  49.390  1.00 40.22  ? 286  SER C OG  1 
ATOM   9362  N  N   . PHE C 1 241 ? 4.557   23.988  50.120  1.00 40.83  ? 287  PHE C N   1 
ATOM   9363  C  CA  . PHE C 1 241 ? 3.906   22.936  50.846  1.00 40.58  ? 287  PHE C CA  1 
ATOM   9364  C  C   . PHE C 1 241 ? 2.454   22.600  50.499  1.00 40.67  ? 287  PHE C C   1 
ATOM   9365  O  O   . PHE C 1 241 ? 1.609   22.370  51.391  1.00 40.71  ? 287  PHE C O   1 
ATOM   9366  C  CB  . PHE C 1 241 ? 4.165   23.149  52.328  1.00 40.81  ? 287  PHE C CB  1 
ATOM   9367  C  CG  . PHE C 1 241 ? 5.615   23.073  52.681  1.00 40.44  ? 287  PHE C CG  1 
ATOM   9368  C  CD1 . PHE C 1 241 ? 6.374   24.223  52.782  1.00 39.90  ? 287  PHE C CD1 1 
ATOM   9369  C  CD2 . PHE C 1 241 ? 6.228   21.846  52.883  1.00 41.34  ? 287  PHE C CD2 1 
ATOM   9370  C  CE1 . PHE C 1 241 ? 7.731   24.158  53.081  1.00 40.34  ? 287  PHE C CE1 1 
ATOM   9371  C  CE2 . PHE C 1 241 ? 7.581   21.763  53.194  1.00 41.94  ? 287  PHE C CE2 1 
ATOM   9372  C  CZ  . PHE C 1 241 ? 8.338   22.920  53.283  1.00 40.75  ? 287  PHE C CZ  1 
ATOM   9373  N  N   . VAL C 1 242 ? 2.180   22.510  49.201  1.00 40.44  ? 288  VAL C N   1 
ATOM   9374  C  CA  . VAL C 1 242 ? 0.800   22.292  48.752  1.00 40.75  ? 288  VAL C CA  1 
ATOM   9375  C  C   . VAL C 1 242 ? 0.408   20.842  48.974  1.00 41.00  ? 288  VAL C C   1 
ATOM   9376  O  O   . VAL C 1 242 ? 0.987   19.958  48.363  1.00 41.25  ? 288  VAL C O   1 
ATOM   9377  C  CB  . VAL C 1 242 ? 0.589   22.704  47.276  1.00 40.29  ? 288  VAL C CB  1 
ATOM   9378  C  CG1 . VAL C 1 242 ? -0.797  22.311  46.831  1.00 40.14  ? 288  VAL C CG1 1 
ATOM   9379  C  CG2 . VAL C 1 242 ? 0.780   24.194  47.111  1.00 40.44  ? 288  VAL C CG2 1 
ATOM   9380  N  N   . ARG C 1 243 ? -0.569  20.604  49.846  1.00 41.37  ? 289  ARG C N   1 
ATOM   9381  C  CA  . ARG C 1 243 ? -0.952  19.232  50.198  1.00 42.04  ? 289  ARG C CA  1 
ATOM   9382  C  C   . ARG C 1 243 ? -2.278  18.741  49.629  1.00 42.09  ? 289  ARG C C   1 
ATOM   9383  O  O   . ARG C 1 243 ? -2.557  17.534  49.666  1.00 42.42  ? 289  ARG C O   1 
ATOM   9384  C  CB  . ARG C 1 243 ? -1.012  19.013  51.716  1.00 42.58  ? 289  ARG C CB  1 
ATOM   9385  C  CG  . ARG C 1 243 ? -0.582  20.152  52.614  1.00 45.49  ? 289  ARG C CG  1 
ATOM   9386  C  CD  . ARG C 1 243 ? -0.875  19.860  54.100  1.00 50.43  ? 289  ARG C CD  1 
ATOM   9387  N  NE  . ARG C 1 243 ? 0.225   20.345  54.945  1.00 56.28  ? 289  ARG C NE  1 
ATOM   9388  C  CZ  . ARG C 1 243 ? 1.198   19.584  55.463  1.00 57.55  ? 289  ARG C CZ  1 
ATOM   9389  N  NH1 . ARG C 1 243 ? 1.205   18.260  55.267  1.00 57.01  ? 289  ARG C NH1 1 
ATOM   9390  N  NH2 . ARG C 1 243 ? 2.172   20.149  56.191  1.00 57.70  ? 289  ARG C NH2 1 
ATOM   9391  N  N   . LYS C 1 244 ? -3.119  19.655  49.148  1.00 41.96  ? 290  LYS C N   1 
ATOM   9392  C  CA  . LYS C 1 244 ? -4.481  19.311  48.726  1.00 41.53  ? 290  LYS C CA  1 
ATOM   9393  C  C   . LYS C 1 244 ? -5.077  20.488  47.973  1.00 41.55  ? 290  LYS C C   1 
ATOM   9394  O  O   . LYS C 1 244 ? -4.648  21.617  48.159  1.00 41.67  ? 290  LYS C O   1 
ATOM   9395  C  CB  . LYS C 1 244 ? -5.332  18.985  49.948  1.00 41.28  ? 290  LYS C CB  1 
ATOM   9396  C  CG  . LYS C 1 244 ? -5.075  19.937  51.114  1.00 42.57  ? 290  LYS C CG  1 
ATOM   9397  C  CD  . LYS C 1 244 ? -6.012  19.740  52.301  1.00 44.19  ? 290  LYS C CD  1 
ATOM   9398  C  CE  . LYS C 1 244 ? -5.574  20.652  53.460  1.00 44.85  ? 290  LYS C CE  1 
ATOM   9399  N  NZ  . LYS C 1 244 ? -6.618  20.856  54.547  1.00 46.06  ? 290  LYS C NZ  1 
ATOM   9400  N  N   . ALA C 1 245 ? -6.094  20.225  47.156  1.00 41.66  ? 291  ALA C N   1 
ATOM   9401  C  CA  . ALA C 1 245 ? -6.741  21.254  46.319  1.00 41.45  ? 291  ALA C CA  1 
ATOM   9402  C  C   . ALA C 1 245 ? -7.094  22.556  47.031  1.00 41.54  ? 291  ALA C C   1 
ATOM   9403  O  O   . ALA C 1 245 ? -6.815  23.638  46.506  1.00 41.67  ? 291  ALA C O   1 
ATOM   9404  C  CB  . ALA C 1 245 ? -7.954  20.689  45.600  1.00 41.17  ? 291  ALA C CB  1 
ATOM   9405  N  N   . SER C 1 246 ? -7.695  22.466  48.219  1.00 41.74  ? 292  SER C N   1 
ATOM   9406  C  CA  . SER C 1 246 ? -8.055  23.661  48.978  1.00 41.97  ? 292  SER C CA  1 
ATOM   9407  C  C   . SER C 1 246 ? -6.850  24.602  49.219  1.00 42.03  ? 292  SER C C   1 
ATOM   9408  O  O   . SER C 1 246 ? -7.028  25.812  49.411  1.00 42.04  ? 292  SER C O   1 
ATOM   9409  C  CB  . SER C 1 246 ? -8.655  23.267  50.313  1.00 41.94  ? 292  SER C CB  1 
ATOM   9410  O  OG  . SER C 1 246 ? -7.623  23.033  51.258  1.00 43.85  ? 292  SER C OG  1 
ATOM   9411  N  N   . ASP C 1 247 ? -5.633  24.044  49.219  1.00 41.87  ? 293  ASP C N   1 
ATOM   9412  C  CA  . ASP C 1 247 ? -4.436  24.824  49.483  1.00 41.58  ? 293  ASP C CA  1 
ATOM   9413  C  C   . ASP C 1 247 ? -4.270  25.843  48.367  1.00 41.45  ? 293  ASP C C   1 
ATOM   9414  O  O   . ASP C 1 247 ? -3.926  27.001  48.619  1.00 41.81  ? 293  ASP C O   1 
ATOM   9415  C  CB  . ASP C 1 247 ? -3.193  23.940  49.575  1.00 41.97  ? 293  ASP C CB  1 
ATOM   9416  C  CG  . ASP C 1 247 ? -3.022  23.266  50.926  1.00 42.53  ? 293  ASP C CG  1 
ATOM   9417  O  OD1 . ASP C 1 247 ? -3.721  23.611  51.901  1.00 42.49  ? 293  ASP C OD1 1 
ATOM   9418  O  OD2 . ASP C 1 247 ? -2.149  22.369  50.999  1.00 44.19  ? 293  ASP C OD2 1 
ATOM   9419  N  N   . VAL C 1 248 ? -4.527  25.435  47.133  1.00 40.84  ? 294  VAL C N   1 
ATOM   9420  C  CA  . VAL C 1 248 ? -4.427  26.378  46.030  1.00 40.56  ? 294  VAL C CA  1 
ATOM   9421  C  C   . VAL C 1 248 ? -5.628  27.315  45.933  1.00 40.33  ? 294  VAL C C   1 
ATOM   9422  O  O   . VAL C 1 248 ? -5.500  28.477  45.540  1.00 40.26  ? 294  VAL C O   1 
ATOM   9423  C  CB  . VAL C 1 248 ? -4.075  25.706  44.682  1.00 40.73  ? 294  VAL C CB  1 
ATOM   9424  C  CG1 . VAL C 1 248 ? -4.302  24.217  44.720  1.00 40.92  ? 294  VAL C CG1 1 
ATOM   9425  C  CG2 . VAL C 1 248 ? -4.787  26.375  43.539  1.00 40.47  ? 294  VAL C CG2 1 
ATOM   9426  N  N   . ALA C 1 249 ? -6.799  26.821  46.323  1.00 40.12  ? 295  ALA C N   1 
ATOM   9427  C  CA  . ALA C 1 249 ? -7.950  27.690  46.481  1.00 39.07  ? 295  ALA C CA  1 
ATOM   9428  C  C   . ALA C 1 249 ? -7.583  28.827  47.432  1.00 38.89  ? 295  ALA C C   1 
ATOM   9429  O  O   . ALA C 1 249 ? -7.805  29.999  47.115  1.00 38.54  ? 295  ALA C O   1 
ATOM   9430  C  CB  . ALA C 1 249 ? -9.115  26.914  46.982  1.00 38.79  ? 295  ALA C CB  1 
ATOM   9431  N  N   . ALA C 1 250 ? -6.982  28.482  48.575  1.00 38.83  ? 296  ALA C N   1 
ATOM   9432  C  CA  . ALA C 1 250 ? -6.546  29.494  49.550  1.00 39.01  ? 296  ALA C CA  1 
ATOM   9433  C  C   . ALA C 1 250 ? -5.599  30.506  48.917  1.00 39.28  ? 296  ALA C C   1 
ATOM   9434  O  O   . ALA C 1 250 ? -5.833  31.709  49.041  1.00 39.46  ? 296  ALA C O   1 
ATOM   9435  C  CB  . ALA C 1 250 ? -5.939  28.857  50.804  1.00 38.35  ? 296  ALA C CB  1 
ATOM   9436  N  N   . VAL C 1 251 ? -4.562  30.020  48.217  1.00 39.42  ? 297  VAL C N   1 
ATOM   9437  C  CA  . VAL C 1 251 ? -3.648  30.901  47.477  1.00 39.74  ? 297  VAL C CA  1 
ATOM   9438  C  C   . VAL C 1 251 ? -4.450  31.830  46.551  1.00 40.55  ? 297  VAL C C   1 
ATOM   9439  O  O   . VAL C 1 251 ? -4.230  33.061  46.532  1.00 40.65  ? 297  VAL C O   1 
ATOM   9440  C  CB  . VAL C 1 251 ? -2.597  30.124  46.642  1.00 39.96  ? 297  VAL C CB  1 
ATOM   9441  C  CG1 . VAL C 1 251 ? -1.870  31.059  45.683  1.00 39.02  ? 297  VAL C CG1 1 
ATOM   9442  C  CG2 . VAL C 1 251 ? -1.586  29.381  47.538  1.00 39.77  ? 297  VAL C CG2 1 
ATOM   9443  N  N   . ARG C 1 252 ? -5.392  31.242  45.802  1.00 41.19  ? 298  ARG C N   1 
ATOM   9444  C  CA  . ARG C 1 252 ? -6.240  32.000  44.875  1.00 41.54  ? 298  ARG C CA  1 
ATOM   9445  C  C   . ARG C 1 252 ? -6.994  33.101  45.595  1.00 41.64  ? 298  ARG C C   1 
ATOM   9446  O  O   . ARG C 1 252 ? -6.964  34.233  45.151  1.00 42.15  ? 298  ARG C O   1 
ATOM   9447  C  CB  . ARG C 1 252 ? -7.214  31.093  44.144  1.00 41.69  ? 298  ARG C CB  1 
ATOM   9448  C  CG  . ARG C 1 252 ? -7.351  31.396  42.669  1.00 42.89  ? 298  ARG C CG  1 
ATOM   9449  C  CD  . ARG C 1 252 ? -7.635  30.112  41.866  1.00 43.15  ? 298  ARG C CD  1 
ATOM   9450  N  NE  . ARG C 1 252 ? -6.643  29.895  40.807  1.00 44.58  ? 298  ARG C NE  1 
ATOM   9451  C  CZ  . ARG C 1 252 ? -6.347  28.698  40.292  1.00 46.44  ? 298  ARG C CZ  1 
ATOM   9452  N  NH1 . ARG C 1 252 ? -6.985  27.611  40.731  1.00 45.96  ? 298  ARG C NH1 1 
ATOM   9453  N  NH2 . ARG C 1 252 ? -5.413  28.579  39.341  1.00 45.65  ? 298  ARG C NH2 1 
ATOM   9454  N  N   . ALA C 1 253 ? -7.647  32.785  46.714  1.00 41.84  ? 299  ALA C N   1 
ATOM   9455  C  CA  . ALA C 1 253 ? -8.398  33.800  47.478  1.00 41.60  ? 299  ALA C CA  1 
ATOM   9456  C  C   . ALA C 1 253 ? -7.478  34.948  47.909  1.00 41.74  ? 299  ALA C C   1 
ATOM   9457  O  O   . ALA C 1 253 ? -7.788  36.113  47.699  1.00 41.50  ? 299  ALA C O   1 
ATOM   9458  C  CB  . ALA C 1 253 ? -9.058  33.171  48.675  1.00 41.21  ? 299  ALA C CB  1 
ATOM   9459  N  N   . ALA C 1 254 ? -6.329  34.594  48.485  1.00 41.99  ? 300  ALA C N   1 
ATOM   9460  C  CA  . ALA C 1 254 ? -5.348  35.564  48.962  1.00 42.18  ? 300  ALA C CA  1 
ATOM   9461  C  C   . ALA C 1 254 ? -4.865  36.461  47.837  1.00 42.27  ? 300  ALA C C   1 
ATOM   9462  O  O   . ALA C 1 254 ? -4.800  37.690  47.995  1.00 42.45  ? 300  ALA C O   1 
ATOM   9463  C  CB  . ALA C 1 254 ? -4.178  34.857  49.586  1.00 42.31  ? 300  ALA C CB  1 
ATOM   9464  N  N   . LEU C 1 255 ? -4.548  35.844  46.698  1.00 42.24  ? 301  LEU C N   1 
ATOM   9465  C  CA  . LEU C 1 255 ? -4.113  36.568  45.504  1.00 42.49  ? 301  LEU C CA  1 
ATOM   9466  C  C   . LEU C 1 255 ? -5.123  37.667  45.160  1.00 43.02  ? 301  LEU C C   1 
ATOM   9467  O  O   . LEU C 1 255 ? -4.795  38.694  44.565  1.00 43.31  ? 301  LEU C O   1 
ATOM   9468  C  CB  . LEU C 1 255 ? -3.980  35.592  44.346  1.00 42.16  ? 301  LEU C CB  1 
ATOM   9469  C  CG  . LEU C 1 255 ? -2.665  35.675  43.602  1.00 42.42  ? 301  LEU C CG  1 
ATOM   9470  C  CD1 . LEU C 1 255 ? -1.523  35.480  44.577  1.00 41.78  ? 301  LEU C CD1 1 
ATOM   9471  C  CD2 . LEU C 1 255 ? -2.644  34.585  42.542  1.00 43.74  ? 301  LEU C CD2 1 
ATOM   9472  N  N   . GLY C 1 256 ? -6.369  37.443  45.550  1.00 43.71  ? 302  GLY C N   1 
ATOM   9473  C  CA  . GLY C 1 256 ? -7.414  38.419  45.340  1.00 44.56  ? 302  GLY C CA  1 
ATOM   9474  C  C   . GLY C 1 256 ? -7.749  38.617  43.881  1.00 45.20  ? 302  GLY C C   1 
ATOM   9475  O  O   . GLY C 1 256 ? -7.128  38.017  43.004  1.00 45.47  ? 302  GLY C O   1 
ATOM   9476  N  N   . PRO C 1 257 ? -8.725  39.493  43.613  1.00 45.73  ? 303  PRO C N   1 
ATOM   9477  C  CA  . PRO C 1 257 ? -9.247  39.686  42.269  1.00 45.91  ? 303  PRO C CA  1 
ATOM   9478  C  C   . PRO C 1 257 ? -8.270  40.464  41.388  1.00 46.29  ? 303  PRO C C   1 
ATOM   9479  O  O   . PRO C 1 257 ? -8.269  40.264  40.176  1.00 46.73  ? 303  PRO C O   1 
ATOM   9480  C  CB  . PRO C 1 257 ? -10.535 40.491  42.496  1.00 45.82  ? 303  PRO C CB  1 
ATOM   9481  C  CG  . PRO C 1 257 ? -10.711 40.603  44.002  1.00 45.94  ? 303  PRO C CG  1 
ATOM   9482  C  CD  . PRO C 1 257 ? -9.364  40.394  44.595  1.00 45.78  ? 303  PRO C CD  1 
ATOM   9483  N  N   . GLU C 1 258 ? -7.441  41.327  41.981  1.00 46.53  ? 304  GLU C N   1 
ATOM   9484  C  CA  . GLU C 1 258 ? -6.417  42.055  41.215  1.00 46.76  ? 304  GLU C CA  1 
ATOM   9485  C  C   . GLU C 1 258 ? -5.398  41.087  40.598  1.00 46.67  ? 304  GLU C C   1 
ATOM   9486  O  O   . GLU C 1 258 ? -4.498  41.516  39.874  1.00 46.87  ? 304  GLU C O   1 
ATOM   9487  C  CB  . GLU C 1 258 ? -5.677  43.093  42.086  1.00 47.05  ? 304  GLU C CB  1 
ATOM   9488  C  CG  . GLU C 1 258 ? -6.494  43.759  43.270  1.00 48.79  ? 304  GLU C CG  1 
ATOM   9489  C  CD  . GLU C 1 258 ? -6.988  45.199  42.977  1.00 51.44  ? 304  GLU C CD  1 
ATOM   9490  O  OE1 . GLU C 1 258 ? -6.357  45.929  42.172  1.00 52.25  ? 304  GLU C OE1 1 
ATOM   9491  O  OE2 . GLU C 1 258 ? -8.011  45.617  43.572  1.00 53.05  ? 304  GLU C OE2 1 
ATOM   9492  N  N   . GLY C 1 259 ? -5.544  39.783  40.860  1.00 46.44  ? 305  GLY C N   1 
ATOM   9493  C  CA  . GLY C 1 259 ? -4.569  38.814  40.393  1.00 46.48  ? 305  GLY C CA  1 
ATOM   9494  C  C   . GLY C 1 259 ? -4.989  37.453  39.857  1.00 46.77  ? 305  GLY C C   1 
ATOM   9495  O  O   . GLY C 1 259 ? -4.315  36.441  40.132  1.00 46.96  ? 305  GLY C O   1 
ATOM   9496  N  N   . HIS C 1 260 ? -6.062  37.407  39.069  1.00 46.98  ? 306  HIS C N   1 
ATOM   9497  C  CA  . HIS C 1 260 ? -6.420  36.172  38.348  1.00 47.05  ? 306  HIS C CA  1 
ATOM   9498  C  C   . HIS C 1 260 ? -5.384  35.792  37.329  1.00 46.29  ? 306  HIS C C   1 
ATOM   9499  O  O   . HIS C 1 260 ? -5.253  34.629  36.996  1.00 46.76  ? 306  HIS C O   1 
ATOM   9500  C  CB  . HIS C 1 260 ? -7.716  36.338  37.571  1.00 47.68  ? 306  HIS C CB  1 
ATOM   9501  C  CG  . HIS C 1 260 ? -8.935  36.029  38.368  1.00 50.15  ? 306  HIS C CG  1 
ATOM   9502  N  ND1 . HIS C 1 260 ? -9.816  37.008  38.791  1.00 52.31  ? 306  HIS C ND1 1 
ATOM   9503  C  CD2 . HIS C 1 260 ? -9.430  34.850  38.822  1.00 51.81  ? 306  HIS C CD2 1 
ATOM   9504  C  CE1 . HIS C 1 260 ? -10.805 36.446  39.468  1.00 52.66  ? 306  HIS C CE1 1 
ATOM   9505  N  NE2 . HIS C 1 260 ? -10.594 35.139  39.504  1.00 53.31  ? 306  HIS C NE2 1 
ATOM   9506  N  N   . GLY C 1 261 ? -4.683  36.786  36.798  1.00 45.58  ? 307  GLY C N   1 
ATOM   9507  C  CA  . GLY C 1 261 ? -3.813  36.583  35.651  1.00 44.72  ? 307  GLY C CA  1 
ATOM   9508  C  C   . GLY C 1 261 ? -2.603  35.784  36.056  1.00 44.28  ? 307  GLY C C   1 
ATOM   9509  O  O   . GLY C 1 261 ? -2.007  35.091  35.237  1.00 44.51  ? 307  GLY C O   1 
ATOM   9510  N  N   . ILE C 1 262 ? -2.261  35.881  37.337  1.00 43.73  ? 308  ILE C N   1 
ATOM   9511  C  CA  . ILE C 1 262 ? -1.088  35.245  37.912  1.00 43.29  ? 308  ILE C CA  1 
ATOM   9512  C  C   . ILE C 1 262 ? -1.220  33.735  37.862  1.00 43.22  ? 308  ILE C C   1 
ATOM   9513  O  O   . ILE C 1 262 ? -2.194  33.177  38.384  1.00 43.60  ? 308  ILE C O   1 
ATOM   9514  C  CB  . ILE C 1 262 ? -0.889  35.714  39.382  1.00 43.36  ? 308  ILE C CB  1 
ATOM   9515  C  CG1 . ILE C 1 262 ? -0.737  37.244  39.436  1.00 43.33  ? 308  ILE C CG1 1 
ATOM   9516  C  CG2 . ILE C 1 262 ? 0.252   34.983  40.051  1.00 42.45  ? 308  ILE C CG2 1 
ATOM   9517  C  CD1 . ILE C 1 262 ? -0.101  37.766  40.669  1.00 43.68  ? 308  ILE C CD1 1 
ATOM   9518  N  N   . LYS C 1 263 ? -0.240  33.091  37.220  1.00 42.64  ? 309  LYS C N   1 
ATOM   9519  C  CA  . LYS C 1 263 ? -0.116  31.631  37.212  1.00 42.05  ? 309  LYS C CA  1 
ATOM   9520  C  C   . LYS C 1 263 ? 0.328   31.101  38.564  1.00 41.49  ? 309  LYS C C   1 
ATOM   9521  O  O   . LYS C 1 263 ? 1.267   31.621  39.179  1.00 41.74  ? 309  LYS C O   1 
ATOM   9522  C  CB  . LYS C 1 263 ? 0.871   31.162  36.133  1.00 42.20  ? 309  LYS C CB  1 
ATOM   9523  C  CG  . LYS C 1 263 ? 0.538   31.631  34.729  1.00 42.94  ? 309  LYS C CG  1 
ATOM   9524  C  CD  . LYS C 1 263 ? -0.894  31.317  34.376  1.00 43.52  ? 309  LYS C CD  1 
ATOM   9525  C  CE  . LYS C 1 263 ? -1.158  31.515  32.902  1.00 45.45  ? 309  LYS C CE  1 
ATOM   9526  N  NZ  . LYS C 1 263 ? -2.186  30.543  32.473  1.00 45.92  ? 309  LYS C NZ  1 
ATOM   9527  N  N   . ILE C 1 264 ? -0.346  30.051  39.004  1.00 40.80  ? 310  ILE C N   1 
ATOM   9528  C  CA  . ILE C 1 264 ? -0.081  29.406  40.287  1.00 40.03  ? 310  ILE C CA  1 
ATOM   9529  C  C   . ILE C 1 264 ? 0.610   28.059  40.083  1.00 39.58  ? 310  ILE C C   1 
ATOM   9530  O  O   . ILE C 1 264 ? 0.088   27.184  39.427  1.00 40.07  ? 310  ILE C O   1 
ATOM   9531  C  CB  . ILE C 1 264 ? -1.403  29.204  41.026  1.00 39.65  ? 310  ILE C CB  1 
ATOM   9532  C  CG1 . ILE C 1 264 ? -1.993  30.567  41.321  1.00 39.66  ? 310  ILE C CG1 1 
ATOM   9533  C  CG2 . ILE C 1 264 ? -1.228  28.350  42.264  1.00 39.25  ? 310  ILE C CG2 1 
ATOM   9534  C  CD1 . ILE C 1 264 ? -2.896  30.593  42.517  1.00 41.20  ? 310  ILE C CD1 1 
ATOM   9535  N  N   . ILE C 1 265 ? 1.783   27.894  40.654  1.00 39.08  ? 311  ILE C N   1 
ATOM   9536  C  CA  . ILE C 1 265 ? 2.545   26.653  40.481  1.00 38.89  ? 311  ILE C CA  1 
ATOM   9537  C  C   . ILE C 1 265 ? 2.625   25.948  41.843  1.00 39.08  ? 311  ILE C C   1 
ATOM   9538  O  O   . ILE C 1 265 ? 3.269   26.444  42.772  1.00 39.70  ? 311  ILE C O   1 
ATOM   9539  C  CB  . ILE C 1 265 ? 3.993   26.952  39.987  1.00 38.49  ? 311  ILE C CB  1 
ATOM   9540  C  CG1 . ILE C 1 265 ? 4.005   27.712  38.663  1.00 37.68  ? 311  ILE C CG1 1 
ATOM   9541  C  CG2 . ILE C 1 265 ? 4.799   25.683  39.923  1.00 38.45  ? 311  ILE C CG2 1 
ATOM   9542  C  CD1 . ILE C 1 265 ? 3.288   27.028  37.524  1.00 37.22  ? 311  ILE C CD1 1 
ATOM   9543  N  N   . SER C 1 266 ? 1.964   24.820  42.009  1.00 38.99  ? 312  SER C N   1 
ATOM   9544  C  CA  . SER C 1 266 ? 2.018   24.178  43.319  1.00 39.12  ? 312  SER C CA  1 
ATOM   9545  C  C   . SER C 1 266 ? 3.311   23.410  43.479  1.00 39.34  ? 312  SER C C   1 
ATOM   9546  O  O   . SER C 1 266 ? 3.675   22.591  42.616  1.00 39.47  ? 312  SER C O   1 
ATOM   9547  C  CB  . SER C 1 266 ? 0.843   23.260  43.527  1.00 38.50  ? 312  SER C CB  1 
ATOM   9548  O  OG  . SER C 1 266 ? -0.309  23.944  43.121  1.00 39.88  ? 312  SER C OG  1 
ATOM   9549  N  N   . LYS C 1 267 ? 4.020   23.688  44.568  1.00 39.00  ? 313  LYS C N   1 
ATOM   9550  C  CA  . LYS C 1 267 ? 5.233   22.945  44.844  1.00 38.97  ? 313  LYS C CA  1 
ATOM   9551  C  C   . LYS C 1 267 ? 4.827   21.725  45.647  1.00 39.01  ? 313  LYS C C   1 
ATOM   9552  O  O   . LYS C 1 267 ? 4.048   21.849  46.596  1.00 39.34  ? 313  LYS C O   1 
ATOM   9553  C  CB  . LYS C 1 267 ? 6.273   23.770  45.600  1.00 38.84  ? 313  LYS C CB  1 
ATOM   9554  C  CG  . LYS C 1 267 ? 6.385   25.212  45.197  1.00 37.59  ? 313  LYS C CG  1 
ATOM   9555  C  CD  . LYS C 1 267 ? 7.723   25.824  45.564  1.00 38.08  ? 313  LYS C CD  1 
ATOM   9556  C  CE  . LYS C 1 267 ? 8.214   25.624  47.017  1.00 36.78  ? 313  LYS C CE  1 
ATOM   9557  N  NZ  . LYS C 1 267 ? 8.879   26.847  47.511  1.00 33.90  ? 313  LYS C NZ  1 
ATOM   9558  N  N   . ILE C 1 268 ? 5.343   20.563  45.245  1.00 38.60  ? 314  ILE C N   1 
ATOM   9559  C  CA  . ILE C 1 268 ? 5.019   19.304  45.866  1.00 38.35  ? 314  ILE C CA  1 
ATOM   9560  C  C   . ILE C 1 268 ? 6.234   18.918  46.686  1.00 38.60  ? 314  ILE C C   1 
ATOM   9561  O  O   . ILE C 1 268 ? 7.286   18.584  46.154  1.00 38.83  ? 314  ILE C O   1 
ATOM   9562  C  CB  . ILE C 1 268 ? 4.659   18.241  44.815  1.00 38.38  ? 314  ILE C CB  1 
ATOM   9563  C  CG1 . ILE C 1 268 ? 3.438   18.681  43.974  1.00 38.48  ? 314  ILE C CG1 1 
ATOM   9564  C  CG2 . ILE C 1 268 ? 4.407   16.886  45.460  1.00 37.84  ? 314  ILE C CG2 1 
ATOM   9565  C  CD1 . ILE C 1 268 ? 2.125   18.743  44.748  1.00 39.66  ? 314  ILE C CD1 1 
ATOM   9566  N  N   . GLU C 1 269 ? 6.077   19.000  48.000  1.00 38.71  ? 315  GLU C N   1 
ATOM   9567  C  CA  . GLU C 1 269 ? 7.196   18.926  48.924  1.00 38.53  ? 315  GLU C CA  1 
ATOM   9568  C  C   . GLU C 1 269 ? 7.098   17.767  49.939  1.00 38.45  ? 315  GLU C C   1 
ATOM   9569  O  O   . GLU C 1 269 ? 8.005   17.592  50.763  1.00 38.78  ? 315  GLU C O   1 
ATOM   9570  C  CB  . GLU C 1 269 ? 7.347   20.293  49.662  1.00 38.89  ? 315  GLU C CB  1 
ATOM   9571  C  CG  . GLU C 1 269 ? 7.766   21.429  48.734  1.00 39.68  ? 315  GLU C CG  1 
ATOM   9572  C  CD  . GLU C 1 269 ? 8.286   22.671  49.433  1.00 42.57  ? 315  GLU C CD  1 
ATOM   9573  O  OE1 . GLU C 1 269 ? 7.407   23.503  49.746  1.00 42.53  ? 315  GLU C OE1 1 
ATOM   9574  O  OE2 . GLU C 1 269 ? 9.555   22.841  49.612  1.00 41.78  ? 315  GLU C OE2 1 
ATOM   9575  N  N   . ASN C 1 270 ? 6.012   16.997  49.915  1.00 37.91  ? 316  ASN C N   1 
ATOM   9576  C  CA  . ASN C 1 270 ? 5.854   15.941  50.899  1.00 37.58  ? 316  ASN C CA  1 
ATOM   9577  C  C   . ASN C 1 270 ? 5.006   14.772  50.442  1.00 37.47  ? 316  ASN C C   1 
ATOM   9578  O  O   . ASN C 1 270 ? 4.474   14.783  49.347  1.00 37.73  ? 316  ASN C O   1 
ATOM   9579  C  CB  . ASN C 1 270 ? 5.359   16.507  52.244  1.00 37.85  ? 316  ASN C CB  1 
ATOM   9580  C  CG  . ASN C 1 270 ? 4.017   17.186  52.140  1.00 38.33  ? 316  ASN C CG  1 
ATOM   9581  O  OD1 . ASN C 1 270 ? 3.152   16.777  51.371  1.00 38.89  ? 316  ASN C OD1 1 
ATOM   9582  N  ND2 . ASN C 1 270 ? 3.830   18.233  52.931  1.00 39.37  ? 316  ASN C ND2 1 
ATOM   9583  N  N   . HIS C 1 271 ? 4.902   13.753  51.291  1.00 37.61  ? 317  HIS C N   1 
ATOM   9584  C  CA  . HIS C 1 271 ? 4.180   12.541  50.959  1.00 37.93  ? 317  HIS C CA  1 
ATOM   9585  C  C   . HIS C 1 271 ? 2.712   12.805  50.639  1.00 38.10  ? 317  HIS C C   1 
ATOM   9586  O  O   . HIS C 1 271 ? 2.219   12.332  49.614  1.00 38.19  ? 317  HIS C O   1 
ATOM   9587  C  CB  . HIS C 1 271 ? 4.302   11.527  52.085  1.00 38.02  ? 317  HIS C CB  1 
ATOM   9588  C  CG  . HIS C 1 271 ? 3.799   10.160  51.728  1.00 39.48  ? 317  HIS C CG  1 
ATOM   9589  N  ND1 . HIS C 1 271 ? 2.500   9.748   51.962  1.00 41.68  ? 317  HIS C ND1 1 
ATOM   9590  C  CD2 . HIS C 1 271 ? 4.429   9.106   51.164  1.00 40.55  ? 317  HIS C CD2 1 
ATOM   9591  C  CE1 . HIS C 1 271 ? 2.357   8.500   51.560  1.00 42.37  ? 317  HIS C CE1 1 
ATOM   9592  N  NE2 . HIS C 1 271 ? 3.513   8.087   51.073  1.00 41.21  ? 317  HIS C NE2 1 
ATOM   9593  N  N   . GLU C 1 272 ? 2.022   13.560  51.488  1.00 38.09  ? 318  GLU C N   1 
ATOM   9594  C  CA  . GLU C 1 272 ? 0.610   13.792  51.231  1.00 38.60  ? 318  GLU C CA  1 
ATOM   9595  C  C   . GLU C 1 272 ? 0.406   14.474  49.888  1.00 38.10  ? 318  GLU C C   1 
ATOM   9596  O  O   . GLU C 1 272 ? -0.505  14.128  49.122  1.00 37.52  ? 318  GLU C O   1 
ATOM   9597  C  CB  . GLU C 1 272 ? -0.056  14.601  52.336  1.00 39.05  ? 318  GLU C CB  1 
ATOM   9598  C  CG  . GLU C 1 272 ? -1.488  14.907  51.976  1.00 40.66  ? 318  GLU C CG  1 
ATOM   9599  C  CD  . GLU C 1 272 ? -2.347  15.160  53.164  1.00 43.60  ? 318  GLU C CD  1 
ATOM   9600  O  OE1 . GLU C 1 272 ? -1.827  15.733  54.149  1.00 44.72  ? 318  GLU C OE1 1 
ATOM   9601  O  OE2 . GLU C 1 272 ? -3.540  14.790  53.119  1.00 45.19  ? 318  GLU C OE2 1 
ATOM   9602  N  N   . GLY C 1 273 ? 1.269   15.441  49.618  1.00 37.73  ? 319  GLY C N   1 
ATOM   9603  C  CA  . GLY C 1 273 ? 1.251   16.135  48.354  1.00 38.41  ? 319  GLY C CA  1 
ATOM   9604  C  C   . GLY C 1 273 ? 1.458   15.184  47.192  1.00 39.06  ? 319  GLY C C   1 
ATOM   9605  O  O   . GLY C 1 273 ? 0.791   15.298  46.153  1.00 39.52  ? 319  GLY C O   1 
ATOM   9606  N  N   . VAL C 1 274 ? 2.359   14.223  47.367  1.00 39.19  ? 320  VAL C N   1 
ATOM   9607  C  CA  . VAL C 1 274 ? 2.594   13.255  46.323  1.00 39.58  ? 320  VAL C CA  1 
ATOM   9608  C  C   . VAL C 1 274 ? 1.334   12.411  46.155  1.00 40.06  ? 320  VAL C C   1 
ATOM   9609  O  O   . VAL C 1 274 ? 0.883   12.152  45.034  1.00 40.30  ? 320  VAL C O   1 
ATOM   9610  C  CB  . VAL C 1 274 ? 3.869   12.407  46.584  1.00 39.73  ? 320  VAL C CB  1 
ATOM   9611  C  CG1 . VAL C 1 274 ? 3.965   11.252  45.614  1.00 38.18  ? 320  VAL C CG1 1 
ATOM   9612  C  CG2 . VAL C 1 274 ? 5.098   13.276  46.460  1.00 38.77  ? 320  VAL C CG2 1 
ATOM   9613  N  N   . LYS C 1 275 ? 0.739   12.014  47.262  1.00 40.56  ? 321  LYS C N   1 
ATOM   9614  C  CA  . LYS C 1 275 ? -0.452  11.169  47.189  1.00 41.39  ? 321  LYS C CA  1 
ATOM   9615  C  C   . LYS C 1 275 ? -1.701  11.838  46.608  1.00 41.23  ? 321  LYS C C   1 
ATOM   9616  O  O   . LYS C 1 275 ? -2.516  11.182  45.961  1.00 41.39  ? 321  LYS C O   1 
ATOM   9617  C  CB  . LYS C 1 275 ? -0.750  10.531  48.544  1.00 41.93  ? 321  LYS C CB  1 
ATOM   9618  C  CG  . LYS C 1 275 ? 0.142   9.291   48.821  1.00 44.05  ? 321  LYS C CG  1 
ATOM   9619  C  CD  . LYS C 1 275 ? -0.366  8.048   48.065  1.00 46.44  ? 321  LYS C CD  1 
ATOM   9620  C  CE  . LYS C 1 275 ? 0.746   7.409   47.218  1.00 47.43  ? 321  LYS C CE  1 
ATOM   9621  N  NZ  . LYS C 1 275 ? 0.199   6.343   46.311  1.00 48.79  ? 321  LYS C NZ  1 
ATOM   9622  N  N   . ARG C 1 276 ? -1.841  13.144  46.801  1.00 41.01  ? 322  ARG C N   1 
ATOM   9623  C  CA  . ARG C 1 276 ? -3.033  13.825  46.311  1.00 40.73  ? 322  ARG C CA  1 
ATOM   9624  C  C   . ARG C 1 276 ? -2.729  14.652  45.084  1.00 40.57  ? 322  ARG C C   1 
ATOM   9625  O  O   . ARG C 1 276 ? -3.492  15.541  44.699  1.00 40.38  ? 322  ARG C O   1 
ATOM   9626  C  CB  . ARG C 1 276 ? -3.673  14.620  47.433  1.00 40.83  ? 322  ARG C CB  1 
ATOM   9627  C  CG  . ARG C 1 276 ? -3.909  13.717  48.628  1.00 41.95  ? 322  ARG C CG  1 
ATOM   9628  C  CD  . ARG C 1 276 ? -4.472  14.480  49.747  1.00 42.77  ? 322  ARG C CD  1 
ATOM   9629  N  NE  . ARG C 1 276 ? -5.847  14.848  49.437  1.00 46.19  ? 322  ARG C NE  1 
ATOM   9630  C  CZ  . ARG C 1 276 ? -6.625  15.573  50.242  1.00 48.14  ? 322  ARG C CZ  1 
ATOM   9631  N  NH1 . ARG C 1 276 ? -6.150  16.027  51.412  1.00 48.15  ? 322  ARG C NH1 1 
ATOM   9632  N  NH2 . ARG C 1 276 ? -7.871  15.865  49.871  1.00 48.20  ? 322  ARG C NH2 1 
ATOM   9633  N  N   . PHE C 1 277 ? -1.619  14.288  44.450  1.00 40.23  ? 323  PHE C N   1 
ATOM   9634  C  CA  . PHE C 1 277 ? -1.135  14.964  43.280  1.00 40.14  ? 323  PHE C CA  1 
ATOM   9635  C  C   . PHE C 1 277 ? -2.189  15.203  42.206  1.00 40.50  ? 323  PHE C C   1 
ATOM   9636  O  O   . PHE C 1 277 ? -2.272  16.301  41.673  1.00 40.89  ? 323  PHE C O   1 
ATOM   9637  C  CB  . PHE C 1 277 ? 0.040   14.214  42.681  1.00 39.88  ? 323  PHE C CB  1 
ATOM   9638  C  CG  . PHE C 1 277 ? 0.553   14.835  41.444  1.00 38.80  ? 323  PHE C CG  1 
ATOM   9639  C  CD1 . PHE C 1 277 ? 1.536   15.806  41.513  1.00 36.87  ? 323  PHE C CD1 1 
ATOM   9640  C  CD2 . PHE C 1 277 ? 0.028   14.479  40.205  1.00 38.71  ? 323  PHE C CD2 1 
ATOM   9641  C  CE1 . PHE C 1 277 ? 2.003   16.410  40.373  1.00 38.30  ? 323  PHE C CE1 1 
ATOM   9642  C  CE2 . PHE C 1 277 ? 0.510   15.070  39.045  1.00 39.01  ? 323  PHE C CE2 1 
ATOM   9643  C  CZ  . PHE C 1 277 ? 1.504   16.044  39.130  1.00 38.44  ? 323  PHE C CZ  1 
ATOM   9644  N  N   . ASP C 1 278 ? -2.960  14.177  41.863  1.00 40.68  ? 324  ASP C N   1 
ATOM   9645  C  CA  . ASP C 1 278 ? -3.978  14.335  40.826  1.00 41.00  ? 324  ASP C CA  1 
ATOM   9646  C  C   . ASP C 1 278 ? -4.918  15.494  41.136  1.00 40.57  ? 324  ASP C C   1 
ATOM   9647  O  O   . ASP C 1 278 ? -5.198  16.301  40.263  1.00 40.48  ? 324  ASP C O   1 
ATOM   9648  C  CB  . ASP C 1 278 ? -4.769  13.046  40.604  1.00 41.36  ? 324  ASP C CB  1 
ATOM   9649  C  CG  . ASP C 1 278 ? -3.971  11.984  39.872  1.00 43.47  ? 324  ASP C CG  1 
ATOM   9650  O  OD1 . ASP C 1 278 ? -3.039  12.308  39.110  1.00 44.64  ? 324  ASP C OD1 1 
ATOM   9651  O  OD2 . ASP C 1 278 ? -4.304  10.802  40.047  1.00 46.04  ? 324  ASP C OD2 1 
ATOM   9652  N  N   . GLU C 1 279 ? -5.395  15.582  42.374  1.00 40.27  ? 325  GLU C N   1 
ATOM   9653  C  CA  . GLU C 1 279 ? -6.369  16.601  42.710  1.00 39.90  ? 325  GLU C CA  1 
ATOM   9654  C  C   . GLU C 1 279 ? -5.682  17.969  42.644  1.00 39.73  ? 325  GLU C C   1 
ATOM   9655  O  O   . GLU C 1 279 ? -6.228  18.926  42.124  1.00 40.13  ? 325  GLU C O   1 
ATOM   9656  C  CB  . GLU C 1 279 ? -7.025  16.313  44.065  1.00 39.85  ? 325  GLU C CB  1 
ATOM   9657  C  CG  . GLU C 1 279 ? -6.364  16.950  45.264  1.00 40.64  ? 325  GLU C CG  1 
ATOM   9658  C  CD  . GLU C 1 279 ? -7.054  16.611  46.581  1.00 41.61  ? 325  GLU C CD  1 
ATOM   9659  O  OE1 . GLU C 1 279 ? -7.188  15.401  46.875  1.00 42.11  ? 325  GLU C OE1 1 
ATOM   9660  O  OE2 . GLU C 1 279 ? -7.433  17.549  47.335  1.00 41.88  ? 325  GLU C OE2 1 
ATOM   9661  N  N   . ILE C 1 280 ? -4.448  18.032  43.121  1.00 39.62  ? 326  ILE C N   1 
ATOM   9662  C  CA  . ILE C 1 280 ? -3.631  19.259  43.067  1.00 39.12  ? 326  ILE C CA  1 
ATOM   9663  C  C   . ILE C 1 280 ? -3.345  19.752  41.642  1.00 39.27  ? 326  ILE C C   1 
ATOM   9664  O  O   . ILE C 1 280 ? -3.353  20.953  41.395  1.00 39.53  ? 326  ILE C O   1 
ATOM   9665  C  CB  . ILE C 1 280 ? -2.291  19.108  43.868  1.00 38.89  ? 326  ILE C CB  1 
ATOM   9666  C  CG1 . ILE C 1 280 ? -2.605  18.851  45.356  1.00 38.97  ? 326  ILE C CG1 1 
ATOM   9667  C  CG2 . ILE C 1 280 ? -1.409  20.337  43.696  1.00 36.85  ? 326  ILE C CG2 1 
ATOM   9668  C  CD1 . ILE C 1 280 ? -1.571  18.057  46.104  1.00 38.11  ? 326  ILE C CD1 1 
ATOM   9669  N  N   . LEU C 1 281 ? -3.131  18.844  40.703  1.00 39.31  ? 327  LEU C N   1 
ATOM   9670  C  CA  . LEU C 1 281 ? -2.787  19.259  39.354  1.00 39.90  ? 327  LEU C CA  1 
ATOM   9671  C  C   . LEU C 1 281 ? -3.980  19.887  38.665  1.00 40.45  ? 327  LEU C C   1 
ATOM   9672  O  O   . LEU C 1 281 ? -3.886  20.941  38.047  1.00 40.67  ? 327  LEU C O   1 
ATOM   9673  C  CB  . LEU C 1 281 ? -2.272  18.071  38.527  1.00 39.74  ? 327  LEU C CB  1 
ATOM   9674  C  CG  . LEU C 1 281 ? -1.226  18.255  37.428  1.00 38.79  ? 327  LEU C CG  1 
ATOM   9675  C  CD1 . LEU C 1 281 ? -1.538  17.274  36.359  1.00 39.24  ? 327  LEU C CD1 1 
ATOM   9676  C  CD2 . LEU C 1 281 ? -1.202  19.639  36.826  1.00 38.55  ? 327  LEU C CD2 1 
ATOM   9677  N  N   . GLU C 1 282 ? -5.114  19.223  38.774  1.00 41.38  ? 328  GLU C N   1 
ATOM   9678  C  CA  . GLU C 1 282 ? -6.343  19.657  38.122  1.00 41.84  ? 328  GLU C CA  1 
ATOM   9679  C  C   . GLU C 1 282 ? -6.668  21.121  38.431  1.00 41.51  ? 328  GLU C C   1 
ATOM   9680  O  O   . GLU C 1 282 ? -7.258  21.836  37.617  1.00 41.29  ? 328  GLU C O   1 
ATOM   9681  C  CB  . GLU C 1 282 ? -7.474  18.781  38.604  1.00 41.92  ? 328  GLU C CB  1 
ATOM   9682  C  CG  . GLU C 1 282 ? -8.470  18.485  37.551  1.00 44.50  ? 328  GLU C CG  1 
ATOM   9683  C  CD  . GLU C 1 282 ? -9.665  17.733  38.105  1.00 48.92  ? 328  GLU C CD  1 
ATOM   9684  O  OE1 . GLU C 1 282 ? -9.853  17.702  39.346  1.00 48.46  ? 328  GLU C OE1 1 
ATOM   9685  O  OE2 . GLU C 1 282 ? -10.420 17.173  37.279  1.00 51.08  ? 328  GLU C OE2 1 
ATOM   9686  N  N   . VAL C 1 283 ? -6.225  21.556  39.600  1.00 41.16  ? 329  VAL C N   1 
ATOM   9687  C  CA  . VAL C 1 283 ? -6.595  22.837  40.135  1.00 41.03  ? 329  VAL C CA  1 
ATOM   9688  C  C   . VAL C 1 283 ? -5.478  23.907  40.042  1.00 41.06  ? 329  VAL C C   1 
ATOM   9689  O  O   . VAL C 1 283 ? -5.714  25.097  40.269  1.00 41.15  ? 329  VAL C O   1 
ATOM   9690  C  CB  . VAL C 1 283 ? -7.111  22.610  41.577  1.00 41.10  ? 329  VAL C CB  1 
ATOM   9691  C  CG1 . VAL C 1 283 ? -6.477  23.542  42.543  1.00 40.68  ? 329  VAL C CG1 1 
ATOM   9692  C  CG2 . VAL C 1 283 ? -8.608  22.686  41.625  1.00 40.16  ? 329  VAL C CG2 1 
ATOM   9693  N  N   . SER C 1 284 ? -4.276  23.470  39.688  1.00 40.86  ? 330  SER C N   1 
ATOM   9694  C  CA  . SER C 1 284 ? -3.106  24.347  39.551  1.00 40.84  ? 330  SER C CA  1 
ATOM   9695  C  C   . SER C 1 284 ? -2.747  24.588  38.099  1.00 40.80  ? 330  SER C C   1 
ATOM   9696  O  O   . SER C 1 284 ? -3.123  23.824  37.231  1.00 40.87  ? 330  SER C O   1 
ATOM   9697  C  CB  . SER C 1 284 ? -1.896  23.707  40.228  1.00 40.83  ? 330  SER C CB  1 
ATOM   9698  O  OG  . SER C 1 284 ? -2.270  23.171  41.480  1.00 40.70  ? 330  SER C OG  1 
ATOM   9699  N  N   . ASP C 1 285 ? -1.998  25.642  37.834  1.00 40.87  ? 331  ASP C N   1 
ATOM   9700  C  CA  . ASP C 1 285 ? -1.567  25.922  36.471  1.00 41.49  ? 331  ASP C CA  1 
ATOM   9701  C  C   . ASP C 1 285 ? -0.371  25.061  36.098  1.00 41.63  ? 331  ASP C C   1 
ATOM   9702  O  O   . ASP C 1 285 ? -0.083  24.856  34.911  1.00 42.04  ? 331  ASP C O   1 
ATOM   9703  C  CB  . ASP C 1 285 ? -1.209  27.408  36.306  1.00 41.74  ? 331  ASP C CB  1 
ATOM   9704  C  CG  . ASP C 1 285 ? -2.396  28.307  36.461  1.00 42.58  ? 331  ASP C CG  1 
ATOM   9705  O  OD1 . ASP C 1 285 ? -3.398  28.076  35.744  1.00 43.50  ? 331  ASP C OD1 1 
ATOM   9706  O  OD2 . ASP C 1 285 ? -2.331  29.229  37.311  1.00 45.10  ? 331  ASP C OD2 1 
ATOM   9707  N  N   . GLY C 1 286 ? 0.331   24.575  37.120  1.00 41.44  ? 332  GLY C N   1 
ATOM   9708  C  CA  . GLY C 1 286 ? 1.509   23.733  36.918  1.00 40.96  ? 332  GLY C CA  1 
ATOM   9709  C  C   . GLY C 1 286 ? 2.048   23.194  38.222  1.00 40.65  ? 332  GLY C C   1 
ATOM   9710  O  O   . GLY C 1 286 ? 1.438   23.380  39.289  1.00 41.18  ? 332  GLY C O   1 
ATOM   9711  N  N   . ILE C 1 287 ? 3.199   22.539  38.150  1.00 40.14  ? 333  ILE C N   1 
ATOM   9712  C  CA  . ILE C 1 287 ? 3.749   21.839  39.313  1.00 39.62  ? 333  ILE C CA  1 
ATOM   9713  C  C   . ILE C 1 287 ? 5.242   22.100  39.451  1.00 39.53  ? 333  ILE C C   1 
ATOM   9714  O  O   . ILE C 1 287 ? 5.930   22.291  38.440  1.00 39.26  ? 333  ILE C O   1 
ATOM   9715  C  CB  . ILE C 1 287 ? 3.483   20.304  39.191  1.00 39.39  ? 333  ILE C CB  1 
ATOM   9716  C  CG1 . ILE C 1 287 ? 1.981   19.994  39.372  1.00 39.22  ? 333  ILE C CG1 1 
ATOM   9717  C  CG2 . ILE C 1 287 ? 4.423   19.473  40.076  1.00 38.66  ? 333  ILE C CG2 1 
ATOM   9718  C  CD1 . ILE C 1 287 ? 1.390   20.207  40.775  1.00 38.29  ? 333  ILE C CD1 1 
ATOM   9719  N  N   . MET C 1 288 ? 5.712   22.136  40.709  1.00 39.34  ? 334  MET C N   1 
ATOM   9720  C  CA  . MET C 1 288 ? 7.144   22.155  41.052  1.00 38.98  ? 334  MET C CA  1 
ATOM   9721  C  C   . MET C 1 288 ? 7.509   20.895  41.837  1.00 38.72  ? 334  MET C C   1 
ATOM   9722  O  O   . MET C 1 288 ? 6.977   20.644  42.919  1.00 38.48  ? 334  MET C O   1 
ATOM   9723  C  CB  . MET C 1 288 ? 7.550   23.381  41.879  1.00 38.78  ? 334  MET C CB  1 
ATOM   9724  C  CG  . MET C 1 288 ? 9.080   23.478  42.004  1.00 39.58  ? 334  MET C CG  1 
ATOM   9725  S  SD  . MET C 1 288 ? 9.870   24.411  43.355  1.00 38.49  ? 334  MET C SD  1 
ATOM   9726  C  CE  . MET C 1 288 ? 9.704   26.082  42.776  1.00 38.32  ? 334  MET C CE  1 
ATOM   9727  N  N   . VAL C 1 289 ? 8.415   20.094  41.287  1.00 38.19  ? 335  VAL C N   1 
ATOM   9728  C  CA  . VAL C 1 289 ? 8.900   18.923  41.998  1.00 37.33  ? 335  VAL C CA  1 
ATOM   9729  C  C   . VAL C 1 289 ? 9.914   19.471  42.982  1.00 38.15  ? 335  VAL C C   1 
ATOM   9730  O  O   . VAL C 1 289 ? 11.104  19.687  42.660  1.00 37.96  ? 335  VAL C O   1 
ATOM   9731  C  CB  . VAL C 1 289 ? 9.534   17.881  41.054  1.00 36.97  ? 335  VAL C CB  1 
ATOM   9732  C  CG1 . VAL C 1 289 ? 9.991   16.664  41.828  1.00 35.10  ? 335  VAL C CG1 1 
ATOM   9733  C  CG2 . VAL C 1 289 ? 8.547   17.482  40.000  1.00 35.30  ? 335  VAL C CG2 1 
ATOM   9734  N  N   . ALA C 1 290 ? 9.430   19.723  44.192  1.00 38.72  ? 336  ALA C N   1 
ATOM   9735  C  CA  . ALA C 1 290 ? 10.248  20.400  45.189  1.00 38.89  ? 336  ALA C CA  1 
ATOM   9736  C  C   . ALA C 1 290 ? 11.197  19.403  45.878  1.00 39.10  ? 336  ALA C C   1 
ATOM   9737  O  O   . ALA C 1 290 ? 10.922  18.926  47.007  1.00 39.48  ? 336  ALA C O   1 
ATOM   9738  C  CB  . ALA C 1 290 ? 9.361   21.078  46.174  1.00 38.39  ? 336  ALA C CB  1 
ATOM   9739  N  N   . ARG C 1 291 ? 12.295  19.065  45.194  1.00 38.71  ? 337  ARG C N   1 
ATOM   9740  C  CA  . ARG C 1 291 ? 13.104  17.920  45.629  1.00 38.62  ? 337  ARG C CA  1 
ATOM   9741  C  C   . ARG C 1 291 ? 13.724  18.057  47.019  1.00 38.89  ? 337  ARG C C   1 
ATOM   9742  O  O   . ARG C 1 291 ? 13.822  17.057  47.742  1.00 38.95  ? 337  ARG C O   1 
ATOM   9743  C  CB  . ARG C 1 291 ? 14.213  17.635  44.658  1.00 38.80  ? 337  ARG C CB  1 
ATOM   9744  C  CG  . ARG C 1 291 ? 13.817  16.989  43.363  1.00 37.32  ? 337  ARG C CG  1 
ATOM   9745  C  CD  . ARG C 1 291 ? 14.775  17.601  42.399  1.00 35.93  ? 337  ARG C CD  1 
ATOM   9746  N  NE  . ARG C 1 291 ? 15.419  16.644  41.542  1.00 33.43  ? 337  ARG C NE  1 
ATOM   9747  C  CZ  . ARG C 1 291 ? 16.608  16.827  40.988  1.00 31.51  ? 337  ARG C CZ  1 
ATOM   9748  N  NH1 . ARG C 1 291 ? 17.312  17.895  41.245  1.00 31.02  ? 337  ARG C NH1 1 
ATOM   9749  N  NH2 . ARG C 1 291 ? 17.101  15.900  40.211  1.00 33.47  ? 337  ARG C NH2 1 
ATOM   9750  N  N   . GLY C 1 292 ? 14.153  19.277  47.376  1.00 39.17  ? 338  GLY C N   1 
ATOM   9751  C  CA  . GLY C 1 292 ? 14.740  19.596  48.705  1.00 38.83  ? 338  GLY C CA  1 
ATOM   9752  C  C   . GLY C 1 292 ? 13.945  19.000  49.867  1.00 39.26  ? 338  GLY C C   1 
ATOM   9753  O  O   . GLY C 1 292 ? 14.400  18.036  50.497  1.00 39.27  ? 338  GLY C O   1 
ATOM   9754  N  N   . ASP C 1 293 ? 12.766  19.560  50.150  1.00 38.76  ? 339  ASP C N   1 
ATOM   9755  C  CA  . ASP C 1 293 ? 11.856  19.032  51.181  1.00 39.23  ? 339  ASP C CA  1 
ATOM   9756  C  C   . ASP C 1 293 ? 11.413  17.589  50.864  1.00 39.46  ? 339  ASP C C   1 
ATOM   9757  O  O   . ASP C 1 293 ? 11.389  16.713  51.733  1.00 39.14  ? 339  ASP C O   1 
ATOM   9758  C  CB  . ASP C 1 293 ? 10.602  19.916  51.313  1.00 39.17  ? 339  ASP C CB  1 
ATOM   9759  C  CG  . ASP C 1 293 ? 10.890  21.256  51.977  1.00 40.28  ? 339  ASP C CG  1 
ATOM   9760  O  OD1 . ASP C 1 293 ? 11.058  21.202  53.226  1.00 35.99  ? 339  ASP C OD1 1 
ATOM   9761  O  OD2 . ASP C 1 293 ? 10.915  22.332  51.261  1.00 40.30  ? 339  ASP C OD2 1 
ATOM   9762  N  N   . LEU C 1 294 ? 11.063  17.343  49.604  1.00 39.62  ? 340  LEU C N   1 
ATOM   9763  C  CA  . LEU C 1 294 ? 10.560  16.024  49.237  1.00 39.31  ? 340  LEU C CA  1 
ATOM   9764  C  C   . LEU C 1 294 ? 11.615  15.005  49.634  1.00 39.06  ? 340  LEU C C   1 
ATOM   9765  O  O   . LEU C 1 294 ? 11.308  13.929  50.154  1.00 39.01  ? 340  LEU C O   1 
ATOM   9766  C  CB  . LEU C 1 294 ? 10.256  15.960  47.744  1.00 38.96  ? 340  LEU C CB  1 
ATOM   9767  C  CG  . LEU C 1 294 ? 9.348   14.821  47.303  1.00 38.92  ? 340  LEU C CG  1 
ATOM   9768  C  CD1 . LEU C 1 294 ? 8.102   14.788  48.145  1.00 37.06  ? 340  LEU C CD1 1 
ATOM   9769  C  CD2 . LEU C 1 294 ? 9.058   14.911  45.810  1.00 37.39  ? 340  LEU C CD2 1 
ATOM   9770  N  N   . GLY C 1 295 ? 12.869  15.391  49.432  1.00 39.05  ? 341  GLY C N   1 
ATOM   9771  C  CA  . GLY C 1 295 ? 13.997  14.507  49.681  1.00 39.04  ? 341  GLY C CA  1 
ATOM   9772  C  C   . GLY C 1 295 ? 14.259  14.241  51.143  1.00 38.97  ? 341  GLY C C   1 
ATOM   9773  O  O   . GLY C 1 295 ? 15.170  13.504  51.470  1.00 39.45  ? 341  GLY C O   1 
ATOM   9774  N  N   . ILE C 1 296 ? 13.476  14.861  52.017  1.00 38.88  ? 342  ILE C N   1 
ATOM   9775  C  CA  . ILE C 1 296 ? 13.648  14.712  53.455  1.00 38.53  ? 342  ILE C CA  1 
ATOM   9776  C  C   . ILE C 1 296 ? 12.393  14.093  54.044  1.00 38.44  ? 342  ILE C C   1 
ATOM   9777  O  O   . ILE C 1 296 ? 12.468  13.317  54.995  1.00 37.85  ? 342  ILE C O   1 
ATOM   9778  C  CB  . ILE C 1 296 ? 13.941  16.054  54.144  1.00 38.31  ? 342  ILE C CB  1 
ATOM   9779  C  CG1 . ILE C 1 296 ? 15.131  16.760  53.468  1.00 39.08  ? 342  ILE C CG1 1 
ATOM   9780  C  CG2 . ILE C 1 296 ? 14.267  15.832  55.590  1.00 38.46  ? 342  ILE C CG2 1 
ATOM   9781  C  CD1 . ILE C 1 296 ? 15.411  18.202  53.976  1.00 38.62  ? 342  ILE C CD1 1 
ATOM   9782  N  N   . GLU C 1 297 ? 11.247  14.443  53.462  1.00 38.63  ? 343  GLU C N   1 
ATOM   9783  C  CA  . GLU C 1 297 ? 9.944   13.960  53.881  1.00 38.69  ? 343  GLU C CA  1 
ATOM   9784  C  C   . GLU C 1 297 ? 9.721   12.512  53.467  1.00 38.69  ? 343  GLU C C   1 
ATOM   9785  O  O   . GLU C 1 297 ? 9.096   11.747  54.178  1.00 39.36  ? 343  GLU C O   1 
ATOM   9786  C  CB  . GLU C 1 297 ? 8.866   14.833  53.254  1.00 38.77  ? 343  GLU C CB  1 
ATOM   9787  C  CG  . GLU C 1 297 ? 8.922   16.302  53.665  1.00 39.10  ? 343  GLU C CG  1 
ATOM   9788  C  CD  . GLU C 1 297 ? 8.430   16.547  55.072  1.00 40.04  ? 343  GLU C CD  1 
ATOM   9789  O  OE1 . GLU C 1 297 ? 9.059   17.368  55.777  1.00 40.07  ? 343  GLU C OE1 1 
ATOM   9790  O  OE2 . GLU C 1 297 ? 7.415   15.916  55.471  1.00 40.54  ? 343  GLU C OE2 1 
ATOM   9791  N  N   . ILE C 1 298 ? 10.200  12.149  52.295  1.00 38.78  ? 344  ILE C N   1 
ATOM   9792  C  CA  . ILE C 1 298 ? 10.190  10.756  51.884  1.00 38.89  ? 344  ILE C CA  1 
ATOM   9793  C  C   . ILE C 1 298 ? 11.643  10.311  51.772  1.00 38.84  ? 344  ILE C C   1 
ATOM   9794  O  O   . ILE C 1 298 ? 12.546  11.175  51.724  1.00 39.21  ? 344  ILE C O   1 
ATOM   9795  C  CB  . ILE C 1 298 ? 9.436   10.535  50.539  1.00 39.19  ? 344  ILE C CB  1 
ATOM   9796  C  CG1 . ILE C 1 298 ? 10.246  11.070  49.343  1.00 38.38  ? 344  ILE C CG1 1 
ATOM   9797  C  CG2 . ILE C 1 298 ? 7.981   11.087  50.622  1.00 38.25  ? 344  ILE C CG2 1 
ATOM   9798  C  CD1 . ILE C 1 298 ? 9.699   10.655  48.015  1.00 37.60  ? 344  ILE C CD1 1 
ATOM   9799  N  N   . PRO C 1 299 ? 11.885  8.984   51.762  1.00 38.21  ? 345  PRO C N   1 
ATOM   9800  C  CA  . PRO C 1 299 ? 13.277  8.497   51.624  1.00 37.93  ? 345  PRO C CA  1 
ATOM   9801  C  C   . PRO C 1 299 ? 13.972  9.022   50.365  1.00 37.53  ? 345  PRO C C   1 
ATOM   9802  O  O   . PRO C 1 299 ? 13.366  9.084   49.298  1.00 37.57  ? 345  PRO C O   1 
ATOM   9803  C  CB  . PRO C 1 299 ? 13.122  6.971   51.549  1.00 37.99  ? 345  PRO C CB  1 
ATOM   9804  C  CG  . PRO C 1 299 ? 11.784  6.687   52.150  1.00 37.96  ? 345  PRO C CG  1 
ATOM   9805  C  CD  . PRO C 1 299 ? 10.915  7.885   51.900  1.00 37.79  ? 345  PRO C CD  1 
ATOM   9806  N  N   . ALA C 1 300 ? 15.242  9.390   50.500  1.00 37.20  ? 346  ALA C N   1 
ATOM   9807  C  CA  . ALA C 1 300 ? 16.019  9.937   49.379  1.00 36.60  ? 346  ALA C CA  1 
ATOM   9808  C  C   . ALA C 1 300 ? 16.025  9.022   48.137  1.00 36.60  ? 346  ALA C C   1 
ATOM   9809  O  O   . ALA C 1 300 ? 15.978  9.510   47.015  1.00 37.10  ? 346  ALA C O   1 
ATOM   9810  C  CB  . ALA C 1 300 ? 17.395  10.287  49.801  1.00 35.63  ? 346  ALA C CB  1 
ATOM   9811  N  N   . GLU C 1 301 ? 16.024  7.707   48.344  1.00 36.33  ? 347  GLU C N   1 
ATOM   9812  C  CA  . GLU C 1 301 ? 15.907  6.723   47.264  1.00 36.30  ? 347  GLU C CA  1 
ATOM   9813  C  C   . GLU C 1 301 ? 14.657  6.858   46.417  1.00 36.07  ? 347  GLU C C   1 
ATOM   9814  O  O   . GLU C 1 301 ? 14.581  6.261   45.356  1.00 35.87  ? 347  GLU C O   1 
ATOM   9815  C  CB  . GLU C 1 301 ? 15.785  5.297   47.816  1.00 36.75  ? 347  GLU C CB  1 
ATOM   9816  C  CG  . GLU C 1 301 ? 16.706  4.889   48.888  1.00 38.90  ? 347  GLU C CG  1 
ATOM   9817  C  CD  . GLU C 1 301 ? 16.243  5.325   50.218  1.00 40.58  ? 347  GLU C CD  1 
ATOM   9818  O  OE1 . GLU C 1 301 ? 15.560  4.515   50.865  1.00 39.79  ? 347  GLU C OE1 1 
ATOM   9819  O  OE2 . GLU C 1 301 ? 16.571  6.478   50.599  1.00 41.01  ? 347  GLU C OE2 1 
ATOM   9820  N  N   . LYS C 1 302 ? 13.639  7.552   46.909  1.00 36.27  ? 348  LYS C N   1 
ATOM   9821  C  CA  . LYS C 1 302 ? 12.331  7.502   46.250  1.00 36.33  ? 348  LYS C CA  1 
ATOM   9822  C  C   . LYS C 1 302 ? 11.956  8.735   45.451  1.00 36.70  ? 348  LYS C C   1 
ATOM   9823  O  O   . LYS C 1 302 ? 11.040  8.678   44.647  1.00 37.28  ? 348  LYS C O   1 
ATOM   9824  C  CB  . LYS C 1 302 ? 11.253  7.151   47.257  1.00 36.30  ? 348  LYS C CB  1 
ATOM   9825  C  CG  . LYS C 1 302 ? 11.389  5.739   47.733  1.00 36.55  ? 348  LYS C CG  1 
ATOM   9826  C  CD  . LYS C 1 302 ? 10.153  5.255   48.404  1.00 38.05  ? 348  LYS C CD  1 
ATOM   9827  C  CE  . LYS C 1 302 ? 10.230  3.749   48.602  1.00 39.61  ? 348  LYS C CE  1 
ATOM   9828  N  NZ  . LYS C 1 302 ? 9.821   2.972   47.382  1.00 41.54  ? 348  LYS C NZ  1 
ATOM   9829  N  N   . VAL C 1 303 ? 12.672  9.840   45.658  1.00 37.12  ? 349  VAL C N   1 
ATOM   9830  C  CA  . VAL C 1 303 ? 12.392  11.089  44.959  1.00 36.97  ? 349  VAL C CA  1 
ATOM   9831  C  C   . VAL C 1 303 ? 12.340  10.872  43.452  1.00 37.44  ? 349  VAL C C   1 
ATOM   9832  O  O   . VAL C 1 303 ? 11.337  11.222  42.812  1.00 38.32  ? 349  VAL C O   1 
ATOM   9833  C  CB  . VAL C 1 303 ? 13.413  12.177  45.300  1.00 36.80  ? 349  VAL C CB  1 
ATOM   9834  C  CG1 . VAL C 1 303 ? 13.102  13.435  44.547  1.00 35.51  ? 349  VAL C CG1 1 
ATOM   9835  C  CG2 . VAL C 1 303 ? 13.399  12.444  46.801  1.00 36.09  ? 349  VAL C CG2 1 
ATOM   9836  N  N   . PHE C 1 304 ? 13.372  10.252  42.882  1.00 37.07  ? 350  PHE C N   1 
ATOM   9837  C  CA  . PHE C 1 304 ? 13.380  10.053  41.417  1.00 36.39  ? 350  PHE C CA  1 
ATOM   9838  C  C   . PHE C 1 304 ? 12.029  9.487   40.912  1.00 36.43  ? 350  PHE C C   1 
ATOM   9839  O  O   . PHE C 1 304 ? 11.529  9.890   39.853  1.00 36.77  ? 350  PHE C O   1 
ATOM   9840  C  CB  . PHE C 1 304 ? 14.595  9.233   40.923  1.00 35.59  ? 350  PHE C CB  1 
ATOM   9841  C  CG  . PHE C 1 304 ? 14.391  7.767   40.988  1.00 33.92  ? 350  PHE C CG  1 
ATOM   9842  C  CD1 . PHE C 1 304 ? 14.651  7.067   42.154  1.00 34.22  ? 350  PHE C CD1 1 
ATOM   9843  C  CD2 . PHE C 1 304 ? 13.893  7.085   39.907  1.00 34.18  ? 350  PHE C CD2 1 
ATOM   9844  C  CE1 . PHE C 1 304 ? 14.427  5.718   42.245  1.00 33.12  ? 350  PHE C CE1 1 
ATOM   9845  C  CE2 . PHE C 1 304 ? 13.666  5.724   39.981  1.00 32.41  ? 350  PHE C CE2 1 
ATOM   9846  C  CZ  . PHE C 1 304 ? 13.933  5.046   41.157  1.00 33.89  ? 350  PHE C CZ  1 
ATOM   9847  N  N   . LEU C 1 305 ? 11.442  8.567   41.671  1.00 36.13  ? 351  LEU C N   1 
ATOM   9848  C  CA  . LEU C 1 305 ? 10.128  8.065   41.345  1.00 36.26  ? 351  LEU C CA  1 
ATOM   9849  C  C   . LEU C 1 305 ? 9.054   9.151   41.396  1.00 37.05  ? 351  LEU C C   1 
ATOM   9850  O  O   . LEU C 1 305 ? 8.211   9.200   40.510  1.00 37.48  ? 351  LEU C O   1 
ATOM   9851  C  CB  . LEU C 1 305 ? 9.740   6.936   42.282  1.00 36.03  ? 351  LEU C CB  1 
ATOM   9852  C  CG  . LEU C 1 305 ? 10.644  5.713   42.311  1.00 34.93  ? 351  LEU C CG  1 
ATOM   9853  C  CD1 . LEU C 1 305 ? 10.454  5.009   43.626  1.00 32.87  ? 351  LEU C CD1 1 
ATOM   9854  C  CD2 . LEU C 1 305 ? 10.344  4.789   41.116  1.00 33.35  ? 351  LEU C CD2 1 
ATOM   9855  N  N   . ALA C 1 306 ? 9.059   10.015  42.417  1.00 37.30  ? 352  ALA C N   1 
ATOM   9856  C  CA  . ALA C 1 306 ? 8.040   11.064  42.449  1.00 37.60  ? 352  ALA C CA  1 
ATOM   9857  C  C   . ALA C 1 306 ? 8.291   12.027  41.301  1.00 37.63  ? 352  ALA C C   1 
ATOM   9858  O  O   . ALA C 1 306 ? 7.377   12.382  40.589  1.00 38.16  ? 352  ALA C O   1 
ATOM   9859  C  CB  . ALA C 1 306 ? 7.993   11.766  43.777  1.00 37.48  ? 352  ALA C CB  1 
ATOM   9860  N  N   . GLN C 1 307 ? 9.547   12.390  41.081  1.00 37.65  ? 353  GLN C N   1 
ATOM   9861  C  CA  . GLN C 1 307 ? 9.885   13.296  39.992  1.00 37.27  ? 353  GLN C CA  1 
ATOM   9862  C  C   . GLN C 1 307 ? 9.399   12.754  38.669  1.00 37.56  ? 353  GLN C C   1 
ATOM   9863  O  O   . GLN C 1 307 ? 8.698   13.449  37.934  1.00 37.86  ? 353  GLN C O   1 
ATOM   9864  C  CB  . GLN C 1 307 ? 11.381  13.579  39.928  1.00 36.67  ? 353  GLN C CB  1 
ATOM   9865  C  CG  . GLN C 1 307 ? 11.844  14.087  38.573  1.00 36.24  ? 353  GLN C CG  1 
ATOM   9866  C  CD  . GLN C 1 307 ? 13.297  14.567  38.555  1.00 36.61  ? 353  GLN C CD  1 
ATOM   9867  O  OE1 . GLN C 1 307 ? 13.846  14.932  39.593  1.00 38.80  ? 353  GLN C OE1 1 
ATOM   9868  N  NE2 . GLN C 1 307 ? 13.911  14.585  37.372  1.00 35.79  ? 353  GLN C NE2 1 
ATOM   9869  N  N   . LYS C 1 308 ? 9.744   11.513  38.348  1.00 37.69  ? 354  LYS C N   1 
ATOM   9870  C  CA  . LYS C 1 308 ? 9.402   11.015  37.020  1.00 37.79  ? 354  LYS C CA  1 
ATOM   9871  C  C   . LYS C 1 308 ? 7.891   10.869  36.839  1.00 38.15  ? 354  LYS C C   1 
ATOM   9872  O  O   . LYS C 1 308 ? 7.371   11.143  35.758  1.00 38.33  ? 354  LYS C O   1 
ATOM   9873  C  CB  . LYS C 1 308 ? 10.175  9.750   36.677  1.00 37.36  ? 354  LYS C CB  1 
ATOM   9874  C  CG  . LYS C 1 308 ? 11.587  10.028  36.319  1.00 35.33  ? 354  LYS C CG  1 
ATOM   9875  C  CD  . LYS C 1 308 ? 12.394  8.785   36.588  1.00 34.68  ? 354  LYS C CD  1 
ATOM   9876  C  CE  . LYS C 1 308 ? 13.876  8.959   36.320  1.00 36.27  ? 354  LYS C CE  1 
ATOM   9877  N  NZ  . LYS C 1 308 ? 14.199  9.097   34.867  1.00 35.28  ? 354  LYS C NZ  1 
ATOM   9878  N  N   . MET C 1 309 ? 7.206   10.483  37.915  1.00 38.25  ? 355  MET C N   1 
ATOM   9879  C  CA  . MET C 1 309 ? 5.745   10.346  37.938  1.00 37.99  ? 355  MET C CA  1 
ATOM   9880  C  C   . MET C 1 309 ? 5.020   11.670  37.716  1.00 38.04  ? 355  MET C C   1 
ATOM   9881  O  O   . MET C 1 309 ? 4.059   11.745  36.934  1.00 38.19  ? 355  MET C O   1 
ATOM   9882  C  CB  . MET C 1 309 ? 5.282   9.727   39.253  1.00 38.07  ? 355  MET C CB  1 
ATOM   9883  C  CG  . MET C 1 309 ? 3.774   9.521   39.346  1.00 38.26  ? 355  MET C CG  1 
ATOM   9884  S  SD  . MET C 1 309 ? 2.912   10.980  39.913  1.00 37.58  ? 355  MET C SD  1 
ATOM   9885  C  CE  . MET C 1 309 ? 3.304   10.932  41.651  1.00 35.19  ? 355  MET C CE  1 
ATOM   9886  N  N   . MET C 1 310 ? 5.463   12.711  38.404  1.00 37.66  ? 356  MET C N   1 
ATOM   9887  C  CA  . MET C 1 310 ? 4.803   13.993  38.279  1.00 37.46  ? 356  MET C CA  1 
ATOM   9888  C  C   . MET C 1 310 ? 5.063   14.611  36.903  1.00 37.60  ? 356  MET C C   1 
ATOM   9889  O  O   . MET C 1 310 ? 4.119   15.049  36.217  1.00 37.75  ? 356  MET C O   1 
ATOM   9890  C  CB  . MET C 1 310 ? 5.202   14.898  39.418  1.00 37.50  ? 356  MET C CB  1 
ATOM   9891  C  CG  . MET C 1 310 ? 4.729   14.385  40.776  1.00 38.63  ? 356  MET C CG  1 
ATOM   9892  S  SD  . MET C 1 310 ? 4.982   15.626  42.050  1.00 43.58  ? 356  MET C SD  1 
ATOM   9893  C  CE  . MET C 1 310 ? 6.576   15.223  42.718  1.00 38.74  ? 356  MET C CE  1 
ATOM   9894  N  N   . ILE C 1 311 ? 6.328   14.601  36.461  1.00 37.09  ? 357  ILE C N   1 
ATOM   9895  C  CA  . ILE C 1 311 ? 6.669   15.115  35.144  1.00 36.07  ? 357  ILE C CA  1 
ATOM   9896  C  C   . ILE C 1 311 ? 5.834   14.410  34.090  1.00 36.64  ? 357  ILE C C   1 
ATOM   9897  O  O   . ILE C 1 311 ? 5.333   15.045  33.162  1.00 36.33  ? 357  ILE C O   1 
ATOM   9898  C  CB  . ILE C 1 311 ? 8.163   15.001  34.855  1.00 35.69  ? 357  ILE C CB  1 
ATOM   9899  C  CG1 . ILE C 1 311 ? 8.939   15.942  35.788  1.00 35.30  ? 357  ILE C CG1 1 
ATOM   9900  C  CG2 . ILE C 1 311 ? 8.460   15.300  33.388  1.00 33.86  ? 357  ILE C CG2 1 
ATOM   9901  C  CD1 . ILE C 1 311 ? 10.431  16.118  35.482  1.00 33.07  ? 357  ILE C CD1 1 
ATOM   9902  N  N   . GLY C 1 312 ? 5.670   13.096  34.262  1.00 37.20  ? 358  GLY C N   1 
ATOM   9903  C  CA  . GLY C 1 312 ? 4.938   12.294  33.315  1.00 37.74  ? 358  GLY C CA  1 
ATOM   9904  C  C   . GLY C 1 312 ? 3.523   12.800  33.266  1.00 38.76  ? 358  GLY C C   1 
ATOM   9905  O  O   . GLY C 1 312 ? 2.991   13.077  32.173  1.00 38.16  ? 358  GLY C O   1 
ATOM   9906  N  N   . ARG C 1 313 ? 2.934   12.947  34.467  1.00 39.23  ? 359  ARG C N   1 
ATOM   9907  C  CA  . ARG C 1 313 ? 1.533   13.303  34.606  1.00 39.55  ? 359  ARG C CA  1 
ATOM   9908  C  C   . ARG C 1 313 ? 1.256   14.693  34.069  1.00 40.25  ? 359  ARG C C   1 
ATOM   9909  O  O   . ARG C 1 313 ? 0.287   14.905  33.344  1.00 40.31  ? 359  ARG C O   1 
ATOM   9910  C  CB  . ARG C 1 313 ? 1.038   13.088  36.042  1.00 39.19  ? 359  ARG C CB  1 
ATOM   9911  C  CG  . ARG C 1 313 ? 0.183   11.801  36.156  1.00 39.39  ? 359  ARG C CG  1 
ATOM   9912  C  CD  . ARG C 1 313 ? 0.582   10.826  37.226  1.00 38.37  ? 359  ARG C CD  1 
ATOM   9913  N  NE  . ARG C 1 313 ? -0.189  10.999  38.444  1.00 38.76  ? 359  ARG C NE  1 
ATOM   9914  C  CZ  . ARG C 1 313 ? -0.351  10.056  39.374  1.00 38.83  ? 359  ARG C CZ  1 
ATOM   9915  N  NH1 . ARG C 1 313 ? 0.175   8.844   39.216  1.00 36.28  ? 359  ARG C NH1 1 
ATOM   9916  N  NH2 . ARG C 1 313 ? -1.055  10.326  40.464  1.00 38.57  ? 359  ARG C NH2 1 
ATOM   9917  N  N   . CYS C 1 314 ? 2.139   15.628  34.377  1.00 41.09  ? 360  CYS C N   1 
ATOM   9918  C  CA  . CYS C 1 314 ? 2.009   16.971  33.825  1.00 42.04  ? 360  CYS C CA  1 
ATOM   9919  C  C   . CYS C 1 314 ? 2.079   16.896  32.323  1.00 41.91  ? 360  CYS C C   1 
ATOM   9920  O  O   . CYS C 1 314 ? 1.167   17.352  31.664  1.00 42.66  ? 360  CYS C O   1 
ATOM   9921  C  CB  . CYS C 1 314 ? 3.069   17.928  34.376  1.00 42.27  ? 360  CYS C CB  1 
ATOM   9922  S  SG  . CYS C 1 314 ? 2.853   18.326  36.123  1.00 44.65  ? 360  CYS C SG  1 
ATOM   9923  N  N   . ASN C 1 315 ? 3.126   16.291  31.778  1.00 41.82  ? 361  ASN C N   1 
ATOM   9924  C  CA  . ASN C 1 315 ? 3.202   16.129  30.337  1.00 42.05  ? 361  ASN C CA  1 
ATOM   9925  C  C   . ASN C 1 315 ? 1.826   15.700  29.809  1.00 42.70  ? 361  ASN C C   1 
ATOM   9926  O  O   . ASN C 1 315 ? 1.305   16.305  28.880  1.00 42.82  ? 361  ASN C O   1 
ATOM   9927  C  CB  . ASN C 1 315 ? 4.305   15.146  29.929  1.00 41.91  ? 361  ASN C CB  1 
ATOM   9928  C  CG  . ASN C 1 315 ? 5.753   15.745  30.019  1.00 41.68  ? 361  ASN C CG  1 
ATOM   9929  O  OD1 . ASN C 1 315 ? 6.716   15.122  29.560  1.00 44.85  ? 361  ASN C OD1 1 
ATOM   9930  N  ND2 . ASN C 1 315 ? 5.897   16.926  30.590  1.00 39.17  ? 361  ASN C ND2 1 
ATOM   9931  N  N   . LEU C 1 316 ? 1.214   14.696  30.441  1.00 43.47  ? 362  LEU C N   1 
ATOM   9932  C  CA  . LEU C 1 316 ? -0.122  14.231  30.057  1.00 43.90  ? 362  LEU C CA  1 
ATOM   9933  C  C   . LEU C 1 316 ? -1.165  15.338  30.144  1.00 44.19  ? 362  LEU C C   1 
ATOM   9934  O  O   . LEU C 1 316 ? -1.958  15.515  29.227  1.00 45.10  ? 362  LEU C O   1 
ATOM   9935  C  CB  . LEU C 1 316 ? -0.577  13.077  30.939  1.00 43.88  ? 362  LEU C CB  1 
ATOM   9936  C  CG  . LEU C 1 316 ? -1.483  12.028  30.274  1.00 44.93  ? 362  LEU C CG  1 
ATOM   9937  C  CD1 . LEU C 1 316 ? -0.647  10.856  29.795  1.00 46.08  ? 362  LEU C CD1 1 
ATOM   9938  C  CD2 . LEU C 1 316 ? -2.559  11.506  31.218  1.00 45.46  ? 362  LEU C CD2 1 
ATOM   9939  N  N   . ALA C 1 317 ? -1.179  16.086  31.239  1.00 43.78  ? 363  ALA C N   1 
ATOM   9940  C  CA  . ALA C 1 317 ? -2.236  17.063  31.445  1.00 43.37  ? 363  ALA C CA  1 
ATOM   9941  C  C   . ALA C 1 317 ? -2.001  18.295  30.586  1.00 43.46  ? 363  ALA C C   1 
ATOM   9942  O  O   . ALA C 1 317 ? -2.898  19.122  30.387  1.00 43.62  ? 363  ALA C O   1 
ATOM   9943  C  CB  . ALA C 1 317 ? -2.337  17.436  32.906  1.00 43.10  ? 363  ALA C CB  1 
ATOM   9944  N  N   . GLY C 1 318 ? -0.781  18.410  30.077  1.00 43.29  ? 364  GLY C N   1 
ATOM   9945  C  CA  . GLY C 1 318 ? -0.355  19.591  29.341  1.00 43.02  ? 364  GLY C CA  1 
ATOM   9946  C  C   . GLY C 1 318 ? -0.103  20.805  30.208  1.00 42.85  ? 364  GLY C C   1 
ATOM   9947  O  O   . GLY C 1 318 ? -0.315  21.929  29.771  1.00 43.60  ? 364  GLY C O   1 
ATOM   9948  N  N   . LYS C 1 319 ? 0.359   20.586  31.432  1.00 42.13  ? 365  LYS C N   1 
ATOM   9949  C  CA  . LYS C 1 319 ? 0.649   21.688  32.336  1.00 41.61  ? 365  LYS C CA  1 
ATOM   9950  C  C   . LYS C 1 319 ? 2.140   21.811  32.612  1.00 41.52  ? 365  LYS C C   1 
ATOM   9951  O  O   . LYS C 1 319 ? 2.830   20.804  32.632  1.00 41.66  ? 365  LYS C O   1 
ATOM   9952  C  CB  . LYS C 1 319 ? -0.137  21.530  33.634  1.00 41.49  ? 365  LYS C CB  1 
ATOM   9953  C  CG  . LYS C 1 319 ? -1.632  21.594  33.416  1.00 40.58  ? 365  LYS C CG  1 
ATOM   9954  C  CD  . LYS C 1 319 ? -2.324  22.015  34.651  1.00 39.97  ? 365  LYS C CD  1 
ATOM   9955  C  CE  . LYS C 1 319 ? -3.816  22.118  34.427  1.00 40.30  ? 365  LYS C CE  1 
ATOM   9956  N  NZ  . LYS C 1 319 ? -4.602  22.123  35.688  1.00 41.65  ? 365  LYS C NZ  1 
ATOM   9957  N  N   . PRO C 1 320 ? 2.643   23.042  32.826  1.00 41.33  ? 366  PRO C N   1 
ATOM   9958  C  CA  . PRO C 1 320 ? 4.072   23.215  33.031  1.00 41.45  ? 366  PRO C CA  1 
ATOM   9959  C  C   . PRO C 1 320 ? 4.522   22.419  34.228  1.00 42.04  ? 366  PRO C C   1 
ATOM   9960  O  O   . PRO C 1 320 ? 3.800   22.349  35.233  1.00 42.11  ? 366  PRO C O   1 
ATOM   9961  C  CB  . PRO C 1 320 ? 4.197   24.688  33.388  1.00 41.57  ? 366  PRO C CB  1 
ATOM   9962  C  CG  . PRO C 1 320 ? 3.015   25.312  32.847  1.00 40.98  ? 366  PRO C CG  1 
ATOM   9963  C  CD  . PRO C 1 320 ? 1.925   24.317  32.926  1.00 40.74  ? 366  PRO C CD  1 
ATOM   9964  N  N   . VAL C 1 321 ? 5.705   21.810  34.145  1.00 42.22  ? 367  VAL C N   1 
ATOM   9965  C  CA  . VAL C 1 321 ? 6.291   21.191  35.348  1.00 41.65  ? 367  VAL C CA  1 
ATOM   9966  C  C   . VAL C 1 321 ? 7.731   21.634  35.547  1.00 41.39  ? 367  VAL C C   1 
ATOM   9967  O  O   . VAL C 1 321 ? 8.505   21.638  34.610  1.00 41.92  ? 367  VAL C O   1 
ATOM   9968  C  CB  . VAL C 1 321 ? 6.215   19.678  35.311  1.00 41.62  ? 367  VAL C CB  1 
ATOM   9969  C  CG1 . VAL C 1 321 ? 7.085   19.154  34.177  1.00 41.12  ? 367  VAL C CG1 1 
ATOM   9970  C  CG2 . VAL C 1 321 ? 6.616   19.095  36.683  1.00 39.71  ? 367  VAL C CG2 1 
ATOM   9971  N  N   . VAL C 1 322 ? 8.061   21.984  36.778  1.00 40.71  ? 368  VAL C N   1 
ATOM   9972  C  CA  . VAL C 1 322 ? 9.363   22.470  37.147  1.00 40.50  ? 368  VAL C CA  1 
ATOM   9973  C  C   . VAL C 1 322 ? 10.138  21.413  37.934  1.00 40.90  ? 368  VAL C C   1 
ATOM   9974  O  O   . VAL C 1 322 ? 9.600   20.840  38.889  1.00 41.33  ? 368  VAL C O   1 
ATOM   9975  C  CB  . VAL C 1 322 ? 9.195   23.643  38.085  1.00 40.44  ? 368  VAL C CB  1 
ATOM   9976  C  CG1 . VAL C 1 322 ? 10.536  24.133  38.546  1.00 40.44  ? 368  VAL C CG1 1 
ATOM   9977  C  CG2 . VAL C 1 322 ? 8.449   24.764  37.392  1.00 41.21  ? 368  VAL C CG2 1 
ATOM   9978  N  N   . CYS C 1 323 ? 11.394  21.171  37.552  1.00 40.72  ? 369  CYS C N   1 
ATOM   9979  C  CA  . CYS C 1 323 ? 12.318  20.377  38.356  1.00 40.67  ? 369  CYS C CA  1 
ATOM   9980  C  C   . CYS C 1 323 ? 13.253  21.273  39.165  1.00 40.49  ? 369  CYS C C   1 
ATOM   9981  O  O   . CYS C 1 323 ? 13.861  22.187  38.608  1.00 40.95  ? 369  CYS C O   1 
ATOM   9982  C  CB  . CYS C 1 323 ? 13.182  19.494  37.477  1.00 40.56  ? 369  CYS C CB  1 
ATOM   9983  S  SG  . CYS C 1 323 ? 14.257  18.413  38.492  1.00 42.14  ? 369  CYS C SG  1 
ATOM   9984  N  N   . ALA C 1 324 ? 13.405  20.984  40.458  1.00 39.65  ? 370  ALA C N   1 
ATOM   9985  C  CA  . ALA C 1 324 ? 14.077  21.918  41.372  1.00 38.51  ? 370  ALA C CA  1 
ATOM   9986  C  C   . ALA C 1 324 ? 15.072  21.330  42.374  1.00 37.92  ? 370  ALA C C   1 
ATOM   9987  O  O   . ALA C 1 324 ? 14.959  20.187  42.793  1.00 37.93  ? 370  ALA C O   1 
ATOM   9988  C  CB  . ALA C 1 324 ? 13.034  22.779  42.118  1.00 37.89  ? 370  ALA C CB  1 
ATOM   9989  N  N   . THR C 1 325 ? 16.053  22.153  42.737  1.00 37.09  ? 371  THR C N   1 
ATOM   9990  C  CA  . THR C 1 325 ? 16.854  21.978  43.938  1.00 36.47  ? 371  THR C CA  1 
ATOM   9991  C  C   . THR C 1 325 ? 18.043  21.077  43.774  1.00 36.70  ? 371  THR C C   1 
ATOM   9992  O  O   . THR C 1 325 ? 17.915  19.907  43.452  1.00 36.94  ? 371  THR C O   1 
ATOM   9993  C  CB  . THR C 1 325 ? 15.998  21.503  45.140  1.00 36.48  ? 371  THR C CB  1 
ATOM   9994  O  OG1 . THR C 1 325 ? 14.865  22.366  45.273  1.00 35.92  ? 371  THR C OG1 1 
ATOM   9995  C  CG2 . THR C 1 325 ? 16.816  21.554  46.428  1.00 34.62  ? 371  THR C CG2 1 
ATOM   9996  N  N   . GLN C 1 326 ? 19.210  21.647  44.019  1.00 37.23  ? 372  GLN C N   1 
ATOM   9997  C  CA  . GLN C 1 326 ? 20.501  20.935  43.956  1.00 37.31  ? 372  GLN C CA  1 
ATOM   9998  C  C   . GLN C 1 326 ? 20.849  20.404  42.557  1.00 37.46  ? 372  GLN C C   1 
ATOM   9999  O  O   . GLN C 1 326 ? 21.659  19.484  42.411  1.00 37.46  ? 372  GLN C O   1 
ATOM   10000 C  CB  . GLN C 1 326 ? 20.579  19.821  45.005  1.00 36.61  ? 372  GLN C CB  1 
ATOM   10001 C  CG  . GLN C 1 326 ? 20.749  20.345  46.398  1.00 37.45  ? 372  GLN C CG  1 
ATOM   10002 C  CD  . GLN C 1 326 ? 20.634  19.265  47.483  1.00 41.49  ? 372  GLN C CD  1 
ATOM   10003 O  OE1 . GLN C 1 326 ? 20.787  18.058  47.207  1.00 42.24  ? 372  GLN C OE1 1 
ATOM   10004 N  NE2 . GLN C 1 326 ? 20.334  19.701  48.730  1.00 43.08  ? 372  GLN C NE2 1 
ATOM   10005 N  N   . MET C 1 327 ? 20.267  20.973  41.514  1.00 38.07  ? 373  MET C N   1 
ATOM   10006 C  CA  . MET C 1 327 ? 20.622  20.434  40.209  1.00 38.79  ? 373  MET C CA  1 
ATOM   10007 C  C   . MET C 1 327 ? 22.098  20.672  39.901  1.00 38.78  ? 373  MET C C   1 
ATOM   10008 O  O   . MET C 1 327 ? 22.676  19.938  39.129  1.00 39.25  ? 373  MET C O   1 
ATOM   10009 C  CB  . MET C 1 327 ? 19.716  20.934  39.092  1.00 38.83  ? 373  MET C CB  1 
ATOM   10010 C  CG  . MET C 1 327 ? 18.263  20.720  39.385  1.00 39.53  ? 373  MET C CG  1 
ATOM   10011 S  SD  . MET C 1 327 ? 17.257  21.060  37.950  1.00 40.90  ? 373  MET C SD  1 
ATOM   10012 C  CE  . MET C 1 327 ? 17.462  19.546  37.027  1.00 36.64  ? 373  MET C CE  1 
ATOM   10013 N  N   . LEU C 1 328 ? 22.709  21.651  40.558  1.00 38.94  ? 374  LEU C N   1 
ATOM   10014 C  CA  . LEU C 1 328 ? 24.109  21.985  40.305  1.00 39.47  ? 374  LEU C CA  1 
ATOM   10015 C  C   . LEU C 1 328 ? 24.836  22.489  41.596  1.00 40.21  ? 374  LEU C C   1 
ATOM   10016 O  O   . LEU C 1 328 ? 25.640  23.439  41.511  1.00 40.49  ? 374  LEU C O   1 
ATOM   10017 C  CB  . LEU C 1 328 ? 24.183  23.057  39.181  1.00 38.80  ? 374  LEU C CB  1 
ATOM   10018 C  CG  . LEU C 1 328 ? 24.454  22.837  37.683  1.00 38.42  ? 374  LEU C CG  1 
ATOM   10019 C  CD1 . LEU C 1 328 ? 24.005  21.532  37.125  1.00 35.27  ? 374  LEU C CD1 1 
ATOM   10020 C  CD2 . LEU C 1 328 ? 23.936  23.969  36.816  1.00 36.19  ? 374  LEU C CD2 1 
ATOM   10021 N  N   . GLU C 1 329 ? 24.578  21.861  42.755  1.00 40.46  ? 375  GLU C N   1 
ATOM   10022 C  CA  . GLU C 1 329 ? 25.086  22.355  44.059  1.00 40.92  ? 375  GLU C CA  1 
ATOM   10023 C  C   . GLU C 1 329 ? 26.551  22.653  44.135  1.00 40.30  ? 375  GLU C C   1 
ATOM   10024 O  O   . GLU C 1 329 ? 26.947  23.675  44.718  1.00 40.56  ? 375  GLU C O   1 
ATOM   10025 C  CB  . GLU C 1 329 ? 24.826  21.377  45.194  1.00 41.37  ? 375  GLU C CB  1 
ATOM   10026 C  CG  . GLU C 1 329 ? 23.479  21.474  45.769  1.00 44.61  ? 375  GLU C CG  1 
ATOM   10027 C  CD  . GLU C 1 329 ? 23.346  22.548  46.765  1.00 47.40  ? 375  GLU C CD  1 
ATOM   10028 O  OE1 . GLU C 1 329 ? 24.048  22.475  47.786  1.00 49.21  ? 375  GLU C OE1 1 
ATOM   10029 O  OE2 . GLU C 1 329 ? 22.498  23.434  46.528  1.00 46.56  ? 375  GLU C OE2 1 
ATOM   10030 N  N   . SER C 1 330 ? 27.364  21.743  43.601  1.00 39.39  ? 376  SER C N   1 
ATOM   10031 C  CA  . SER C 1 330 ? 28.798  21.932  43.701  1.00 38.68  ? 376  SER C CA  1 
ATOM   10032 C  C   . SER C 1 330 ? 29.212  23.305  43.146  1.00 38.16  ? 376  SER C C   1 
ATOM   10033 O  O   . SER C 1 330 ? 30.192  23.912  43.614  1.00 38.12  ? 376  SER C O   1 
ATOM   10034 C  CB  . SER C 1 330 ? 29.568  20.769  43.084  1.00 38.51  ? 376  SER C CB  1 
ATOM   10035 O  OG  . SER C 1 330 ? 29.568  20.778  41.671  1.00 40.05  ? 376  SER C OG  1 
ATOM   10036 N  N   . MET C 1 331 ? 28.422  23.818  42.202  1.00 37.76  ? 377  MET C N   1 
ATOM   10037 C  CA  . MET C 1 331 ? 28.703  25.119  41.596  1.00 37.68  ? 377  MET C CA  1 
ATOM   10038 C  C   . MET C 1 331 ? 28.548  26.296  42.531  1.00 37.74  ? 377  MET C C   1 
ATOM   10039 O  O   . MET C 1 331 ? 29.096  27.353  42.257  1.00 38.32  ? 377  MET C O   1 
ATOM   10040 C  CB  . MET C 1 331 ? 27.949  25.330  40.278  1.00 37.11  ? 377  MET C CB  1 
ATOM   10041 C  CG  . MET C 1 331 ? 28.456  24.406  39.200  1.00 37.10  ? 377  MET C CG  1 
ATOM   10042 S  SD  . MET C 1 331 ? 27.949  24.942  37.572  1.00 38.46  ? 377  MET C SD  1 
ATOM   10043 C  CE  . MET C 1 331 ? 29.249  26.182  37.245  1.00 33.64  ? 377  MET C CE  1 
ATOM   10044 N  N   . ILE C 1 332 ? 27.817  26.129  43.627  1.00 37.78  ? 378  ILE C N   1 
ATOM   10045 C  CA  . ILE C 1 332 ? 27.823  27.144  44.679  1.00 37.92  ? 378  ILE C CA  1 
ATOM   10046 C  C   . ILE C 1 332 ? 29.276  27.480  45.046  1.00 38.68  ? 378  ILE C C   1 
ATOM   10047 O  O   . ILE C 1 332 ? 29.594  28.582  45.495  1.00 39.31  ? 378  ILE C O   1 
ATOM   10048 C  CB  . ILE C 1 332 ? 27.126  26.648  45.949  1.00 37.45  ? 378  ILE C CB  1 
ATOM   10049 C  CG1 . ILE C 1 332 ? 25.612  26.691  45.781  1.00 37.23  ? 378  ILE C CG1 1 
ATOM   10050 C  CG2 . ILE C 1 332 ? 27.549  27.463  47.175  1.00 36.42  ? 378  ILE C CG2 1 
ATOM   10051 C  CD1 . ILE C 1 332 ? 24.879  25.716  46.708  1.00 34.41  ? 378  ILE C CD1 1 
ATOM   10052 N  N   . THR C 1 333 ? 30.170  26.530  44.837  1.00 39.07  ? 379  THR C N   1 
ATOM   10053 C  CA  . THR C 1 333 ? 31.494  26.636  45.408  1.00 39.51  ? 379  THR C CA  1 
ATOM   10054 C  C   . THR C 1 333 ? 32.602  26.386  44.395  1.00 39.47  ? 379  THR C C   1 
ATOM   10055 O  O   . THR C 1 333 ? 33.759  26.745  44.627  1.00 38.69  ? 379  THR C O   1 
ATOM   10056 C  CB  . THR C 1 333 ? 31.584  25.695  46.613  1.00 40.11  ? 379  THR C CB  1 
ATOM   10057 O  OG1 . THR C 1 333 ? 31.361  26.453  47.809  1.00 39.92  ? 379  THR C OG1 1 
ATOM   10058 C  CG2 . THR C 1 333 ? 32.926  24.997  46.702  1.00 41.59  ? 379  THR C CG2 1 
ATOM   10059 N  N   . LYS C 1 334 ? 32.230  25.805  43.255  1.00 39.71  ? 380  LYS C N   1 
ATOM   10060 C  CA  . LYS C 1 334 ? 33.204  25.392  42.267  1.00 39.89  ? 380  LYS C CA  1 
ATOM   10061 C  C   . LYS C 1 334 ? 32.775  25.825  40.895  1.00 39.41  ? 380  LYS C C   1 
ATOM   10062 O  O   . LYS C 1 334 ? 31.582  25.850  40.624  1.00 39.89  ? 380  LYS C O   1 
ATOM   10063 C  CB  . LYS C 1 334 ? 33.347  23.874  42.303  1.00 40.13  ? 380  LYS C CB  1 
ATOM   10064 C  CG  . LYS C 1 334 ? 33.750  23.364  43.671  1.00 42.30  ? 380  LYS C CG  1 
ATOM   10065 C  CD  . LYS C 1 334 ? 33.761  21.849  43.718  1.00 46.61  ? 380  LYS C CD  1 
ATOM   10066 C  CE  . LYS C 1 334 ? 35.168  21.329  43.309  1.00 50.52  ? 380  LYS C CE  1 
ATOM   10067 N  NZ  . LYS C 1 334 ? 35.250  19.813  43.276  1.00 52.04  ? 380  LYS C NZ  1 
ATOM   10068 N  N   . PRO C 1 335 ? 33.741  26.119  40.008  1.00 38.58  ? 381  PRO C N   1 
ATOM   10069 C  CA  . PRO C 1 335 ? 33.406  26.612  38.677  1.00 38.38  ? 381  PRO C CA  1 
ATOM   10070 C  C   . PRO C 1 335 ? 32.887  25.517  37.718  1.00 38.19  ? 381  PRO C C   1 
ATOM   10071 O  O   . PRO C 1 335 ? 32.398  25.818  36.637  1.00 38.64  ? 381  PRO C O   1 
ATOM   10072 C  CB  . PRO C 1 335 ? 34.739  27.206  38.171  1.00 38.41  ? 381  PRO C CB  1 
ATOM   10073 C  CG  . PRO C 1 335 ? 35.776  26.912  39.228  1.00 38.42  ? 381  PRO C CG  1 
ATOM   10074 C  CD  . PRO C 1 335 ? 35.191  25.964  40.201  1.00 38.38  ? 381  PRO C CD  1 
ATOM   10075 N  N   . ARG C 1 336 ? 33.014  24.254  38.100  1.00 37.80  ? 382  ARG C N   1 
ATOM   10076 C  CA  . ARG C 1 336 ? 32.547  23.159  37.252  1.00 37.37  ? 382  ARG C CA  1 
ATOM   10077 C  C   . ARG C 1 336 ? 31.590  22.243  38.000  1.00 36.73  ? 382  ARG C C   1 
ATOM   10078 O  O   . ARG C 1 336 ? 31.746  22.030  39.197  1.00 37.75  ? 382  ARG C O   1 
ATOM   10079 C  CB  . ARG C 1 336 ? 33.728  22.356  36.734  1.00 37.68  ? 382  ARG C CB  1 
ATOM   10080 C  CG  . ARG C 1 336 ? 34.770  23.197  35.971  1.00 39.01  ? 382  ARG C CG  1 
ATOM   10081 C  CD  . ARG C 1 336 ? 34.148  23.860  34.757  1.00 42.17  ? 382  ARG C CD  1 
ATOM   10082 N  NE  . ARG C 1 336 ? 34.538  23.164  33.546  1.00 46.73  ? 382  ARG C NE  1 
ATOM   10083 C  CZ  . ARG C 1 336 ? 33.757  22.943  32.486  1.00 47.78  ? 382  ARG C CZ  1 
ATOM   10084 N  NH1 . ARG C 1 336 ? 32.495  23.355  32.437  1.00 43.99  ? 382  ARG C NH1 1 
ATOM   10085 N  NH2 . ARG C 1 336 ? 34.260  22.283  31.450  1.00 49.01  ? 382  ARG C NH2 1 
ATOM   10086 N  N   . PRO C 1 337 ? 30.592  21.687  37.308  1.00 35.63  ? 383  PRO C N   1 
ATOM   10087 C  CA  . PRO C 1 337 ? 29.665  20.803  38.014  1.00 35.04  ? 383  PRO C CA  1 
ATOM   10088 C  C   . PRO C 1 337 ? 30.209  19.371  38.133  1.00 34.45  ? 383  PRO C C   1 
ATOM   10089 O  O   . PRO C 1 337 ? 31.138  18.980  37.415  1.00 33.96  ? 383  PRO C O   1 
ATOM   10090 C  CB  . PRO C 1 337 ? 28.432  20.838  37.129  1.00 35.34  ? 383  PRO C CB  1 
ATOM   10091 C  CG  . PRO C 1 337 ? 28.990  21.155  35.723  1.00 35.07  ? 383  PRO C CG  1 
ATOM   10092 C  CD  . PRO C 1 337 ? 30.293  21.806  35.870  1.00 35.22  ? 383  PRO C CD  1 
ATOM   10093 N  N   . THR C 1 338 ? 29.624  18.591  39.023  1.00 33.92  ? 384  THR C N   1 
ATOM   10094 C  CA  . THR C 1 338 ? 30.061  17.215  39.197  1.00 34.09  ? 384  THR C CA  1 
ATOM   10095 C  C   . THR C 1 338 ? 29.406  16.450  38.074  1.00 34.77  ? 384  THR C C   1 
ATOM   10096 O  O   . THR C 1 338 ? 28.466  16.965  37.466  1.00 34.89  ? 384  THR C O   1 
ATOM   10097 C  CB  . THR C 1 338 ? 29.585  16.638  40.550  1.00 34.31  ? 384  THR C CB  1 
ATOM   10098 O  OG1 . THR C 1 338 ? 28.146  16.512  40.550  1.00 34.02  ? 384  THR C OG1 1 
ATOM   10099 C  CG2 . THR C 1 338 ? 30.062  17.529  41.716  1.00 32.11  ? 384  THR C CG2 1 
ATOM   10100 N  N   . ARG C 1 339 ? 29.875  15.242  37.775  1.00 34.97  ? 385  ARG C N   1 
ATOM   10101 C  CA  . ARG C 1 339 ? 29.251  14.477  36.698  1.00 35.25  ? 385  ARG C CA  1 
ATOM   10102 C  C   . ARG C 1 339 ? 27.771  14.114  36.978  1.00 35.96  ? 385  ARG C C   1 
ATOM   10103 O  O   . ARG C 1 339 ? 27.025  13.889  36.035  1.00 36.54  ? 385  ARG C O   1 
ATOM   10104 C  CB  . ARG C 1 339 ? 30.035  13.214  36.400  1.00 34.83  ? 385  ARG C CB  1 
ATOM   10105 C  CG  . ARG C 1 339 ? 31.511  13.429  36.270  1.00 35.16  ? 385  ARG C CG  1 
ATOM   10106 C  CD  . ARG C 1 339 ? 31.880  14.155  34.998  1.00 34.83  ? 385  ARG C CD  1 
ATOM   10107 N  NE  . ARG C 1 339 ? 33.301  14.405  34.926  1.00 34.48  ? 385  ARG C NE  1 
ATOM   10108 C  CZ  . ARG C 1 339 ? 33.983  15.234  35.714  1.00 32.07  ? 385  ARG C CZ  1 
ATOM   10109 N  NH1 . ARG C 1 339 ? 33.371  15.915  36.664  1.00 29.13  ? 385  ARG C NH1 1 
ATOM   10110 N  NH2 . ARG C 1 339 ? 35.310  15.374  35.538  1.00 31.02  ? 385  ARG C NH2 1 
ATOM   10111 N  N   . ALA C 1 340 ? 27.351  14.035  38.245  1.00 36.17  ? 386  ALA C N   1 
ATOM   10112 C  CA  . ALA C 1 340 ? 25.954  13.701  38.539  1.00 37.17  ? 386  ALA C CA  1 
ATOM   10113 C  C   . ALA C 1 340 ? 25.040  14.884  38.230  1.00 38.11  ? 386  ALA C C   1 
ATOM   10114 O  O   . ALA C 1 340 ? 23.843  14.710  37.901  1.00 39.20  ? 386  ALA C O   1 
ATOM   10115 C  CB  . ALA C 1 340 ? 25.772  13.291  39.977  1.00 36.97  ? 386  ALA C CB  1 
ATOM   10116 N  N   . GLU C 1 341 ? 25.595  16.086  38.325  1.00 38.22  ? 387  GLU C N   1 
ATOM   10117 C  CA  . GLU C 1 341 ? 24.779  17.277  38.239  1.00 38.50  ? 387  GLU C CA  1 
ATOM   10118 C  C   . GLU C 1 341 ? 24.394  17.458  36.771  1.00 38.65  ? 387  GLU C C   1 
ATOM   10119 O  O   . GLU C 1 341 ? 23.193  17.661  36.414  1.00 38.82  ? 387  GLU C O   1 
ATOM   10120 C  CB  . GLU C 1 341 ? 25.518  18.456  38.889  1.00 38.40  ? 387  GLU C CB  1 
ATOM   10121 C  CG  . GLU C 1 341 ? 25.678  18.214  40.398  1.00 39.20  ? 387  GLU C CG  1 
ATOM   10122 C  CD  . GLU C 1 341 ? 26.672  19.105  41.096  1.00 41.45  ? 387  GLU C CD  1 
ATOM   10123 O  OE1 . GLU C 1 341 ? 27.656  19.504  40.445  1.00 42.75  ? 387  GLU C OE1 1 
ATOM   10124 O  OE2 . GLU C 1 341 ? 26.470  19.377  42.302  1.00 42.08  ? 387  GLU C OE2 1 
ATOM   10125 N  N   . THR C 1 342 ? 25.407  17.274  35.929  1.00 38.52  ? 388  THR C N   1 
ATOM   10126 C  CA  . THR C 1 342 ? 25.258  17.341  34.494  1.00 38.26  ? 388  THR C CA  1 
ATOM   10127 C  C   . THR C 1 342 ? 24.185  16.382  34.042  1.00 38.36  ? 388  THR C C   1 
ATOM   10128 O  O   . THR C 1 342 ? 23.217  16.787  33.378  1.00 38.22  ? 388  THR C O   1 
ATOM   10129 C  CB  . THR C 1 342 ? 26.579  17.066  33.842  1.00 38.29  ? 388  THR C CB  1 
ATOM   10130 O  OG1 . THR C 1 342 ? 27.177  18.330  33.573  1.00 38.97  ? 388  THR C OG1 1 
ATOM   10131 C  CG2 . THR C 1 342 ? 26.445  16.235  32.537  1.00 38.35  ? 388  THR C CG2 1 
ATOM   10132 N  N   . SER C 1 343 ? 24.331  15.121  34.435  1.00 38.20  ? 389  SER C N   1 
ATOM   10133 C  CA  . SER C 1 343 ? 23.340  14.136  34.087  1.00 38.49  ? 389  SER C CA  1 
ATOM   10134 C  C   . SER C 1 343 ? 21.973  14.454  34.755  1.00 38.86  ? 389  SER C C   1 
ATOM   10135 O  O   . SER C 1 343 ? 20.916  14.186  34.167  1.00 39.49  ? 389  SER C O   1 
ATOM   10136 C  CB  . SER C 1 343 ? 23.832  12.738  34.409  1.00 38.43  ? 389  SER C CB  1 
ATOM   10137 O  OG  . SER C 1 343 ? 23.101  12.171  35.449  1.00 39.65  ? 389  SER C OG  1 
ATOM   10138 N  N   . ASP C 1 344 ? 21.977  15.061  35.937  1.00 37.73  ? 390  ASP C N   1 
ATOM   10139 C  CA  . ASP C 1 344 ? 20.711  15.422  36.513  1.00 37.56  ? 390  ASP C CA  1 
ATOM   10140 C  C   . ASP C 1 344 ? 19.895  16.361  35.611  1.00 38.07  ? 390  ASP C C   1 
ATOM   10141 O  O   . ASP C 1 344 ? 18.690  16.149  35.364  1.00 38.57  ? 390  ASP C O   1 
ATOM   10142 C  CB  . ASP C 1 344 ? 20.901  16.094  37.859  1.00 37.41  ? 390  ASP C CB  1 
ATOM   10143 C  CG  . ASP C 1 344 ? 19.632  16.198  38.583  1.00 34.70  ? 390  ASP C CG  1 
ATOM   10144 O  OD1 . ASP C 1 344 ? 18.933  15.167  38.564  1.00 34.87  ? 390  ASP C OD1 1 
ATOM   10145 O  OD2 . ASP C 1 344 ? 19.313  17.293  39.094  1.00 29.84  ? 390  ASP C OD2 1 
ATOM   10146 N  N   . VAL C 1 345 ? 20.550  17.414  35.142  1.00 37.68  ? 391  VAL C N   1 
ATOM   10147 C  CA  . VAL C 1 345 ? 19.882  18.367  34.267  1.00 37.37  ? 391  VAL C CA  1 
ATOM   10148 C  C   . VAL C 1 345 ? 19.370  17.613  33.023  1.00 37.33  ? 391  VAL C C   1 
ATOM   10149 O  O   . VAL C 1 345 ? 18.165  17.598  32.761  1.00 36.64  ? 391  VAL C O   1 
ATOM   10150 C  CB  . VAL C 1 345 ? 20.847  19.508  33.830  1.00 37.78  ? 391  VAL C CB  1 
ATOM   10151 C  CG1 . VAL C 1 345 ? 20.171  20.410  32.831  1.00 37.56  ? 391  VAL C CG1 1 
ATOM   10152 C  CG2 . VAL C 1 345 ? 21.359  20.304  35.030  1.00 36.88  ? 391  VAL C CG2 1 
ATOM   10153 N  N   . ALA C 1 346 ? 20.283  16.965  32.274  1.00 37.09  ? 392  ALA C N   1 
ATOM   10154 C  CA  . ALA C 1 346 ? 19.882  16.261  31.060  1.00 36.83  ? 392  ALA C CA  1 
ATOM   10155 C  C   . ALA C 1 346 ? 18.675  15.396  31.326  1.00 36.97  ? 392  ALA C C   1 
ATOM   10156 O  O   . ALA C 1 346 ? 17.685  15.527  30.637  1.00 37.24  ? 392  ALA C O   1 
ATOM   10157 C  CB  . ALA C 1 346 ? 21.006  15.469  30.465  1.00 36.29  ? 392  ALA C CB  1 
ATOM   10158 N  N   . ASN C 1 347 ? 18.732  14.543  32.352  1.00 37.21  ? 393  ASN C N   1 
ATOM   10159 C  CA  . ASN C 1 347 ? 17.598  13.666  32.665  1.00 36.97  ? 393  ASN C CA  1 
ATOM   10160 C  C   . ASN C 1 347 ? 16.310  14.402  33.090  1.00 37.23  ? 393  ASN C C   1 
ATOM   10161 O  O   . ASN C 1 347 ? 15.234  13.872  32.864  1.00 37.58  ? 393  ASN C O   1 
ATOM   10162 C  CB  . ASN C 1 347 ? 17.958  12.579  33.678  1.00 36.54  ? 393  ASN C CB  1 
ATOM   10163 C  CG  . ASN C 1 347 ? 18.916  11.512  33.114  1.00 37.76  ? 393  ASN C CG  1 
ATOM   10164 O  OD1 . ASN C 1 347 ? 18.615  10.828  32.129  1.00 38.94  ? 393  ASN C OD1 1 
ATOM   10165 N  ND2 . ASN C 1 347 ? 20.057  11.339  33.770  1.00 38.48  ? 393  ASN C ND2 1 
ATOM   10166 N  N   . ALA C 1 348 ? 16.387  15.596  33.680  1.00 36.79  ? 394  ALA C N   1 
ATOM   10167 C  CA  . ALA C 1 348 ? 15.161  16.340  33.958  1.00 36.94  ? 394  ALA C CA  1 
ATOM   10168 C  C   . ALA C 1 348 ? 14.501  16.678  32.622  1.00 37.80  ? 394  ALA C C   1 
ATOM   10169 O  O   . ALA C 1 348 ? 13.260  16.658  32.488  1.00 38.81  ? 394  ALA C O   1 
ATOM   10170 C  CB  . ALA C 1 348 ? 15.437  17.636  34.780  1.00 35.93  ? 394  ALA C CB  1 
ATOM   10171 N  N   . VAL C 1 349 ? 15.330  16.999  31.631  1.00 38.00  ? 395  VAL C N   1 
ATOM   10172 C  CA  . VAL C 1 349 ? 14.844  17.438  30.355  1.00 37.73  ? 395  VAL C CA  1 
ATOM   10173 C  C   . VAL C 1 349 ? 14.265  16.229  29.673  1.00 38.00  ? 395  VAL C C   1 
ATOM   10174 O  O   . VAL C 1 349 ? 13.169  16.301  29.117  1.00 38.18  ? 395  VAL C O   1 
ATOM   10175 C  CB  . VAL C 1 349 ? 15.973  18.060  29.508  1.00 37.69  ? 395  VAL C CB  1 
ATOM   10176 C  CG1 . VAL C 1 349 ? 15.593  18.075  28.012  1.00 37.86  ? 395  VAL C CG1 1 
ATOM   10177 C  CG2 . VAL C 1 349 ? 16.288  19.481  30.022  1.00 37.18  ? 395  VAL C CG2 1 
ATOM   10178 N  N   . LEU C 1 350 ? 15.011  15.120  29.715  1.00 37.93  ? 396  LEU C N   1 
ATOM   10179 C  CA  . LEU C 1 350 ? 14.608  13.900  29.051  1.00 37.31  ? 396  LEU C CA  1 
ATOM   10180 C  C   . LEU C 1 350 ? 13.384  13.365  29.753  1.00 37.31  ? 396  LEU C C   1 
ATOM   10181 O  O   . LEU C 1 350 ? 12.540  12.766  29.127  1.00 36.76  ? 396  LEU C O   1 
ATOM   10182 C  CB  . LEU C 1 350 ? 15.734  12.898  29.083  1.00 37.18  ? 396  LEU C CB  1 
ATOM   10183 C  CG  . LEU C 1 350 ? 16.656  12.628  27.885  1.00 37.72  ? 396  LEU C CG  1 
ATOM   10184 C  CD1 . LEU C 1 350 ? 16.450  13.510  26.695  1.00 40.18  ? 396  LEU C CD1 1 
ATOM   10185 C  CD2 . LEU C 1 350 ? 18.112  12.705  28.310  1.00 36.63  ? 396  LEU C CD2 1 
ATOM   10186 N  N   . ASP C 1 351 ? 13.269  13.613  31.055  1.00 38.01  ? 397  ASP C N   1 
ATOM   10187 C  CA  . ASP C 1 351 ? 12.077  13.228  31.791  1.00 38.56  ? 397  ASP C CA  1 
ATOM   10188 C  C   . ASP C 1 351 ? 10.898  13.969  31.184  1.00 39.28  ? 397  ASP C C   1 
ATOM   10189 O  O   . ASP C 1 351 ? 9.831   13.388  30.999  1.00 39.72  ? 397  ASP C O   1 
ATOM   10190 C  CB  . ASP C 1 351 ? 12.190  13.503  33.298  1.00 38.35  ? 397  ASP C CB  1 
ATOM   10191 C  CG  . ASP C 1 351 ? 13.098  12.497  34.030  1.00 38.59  ? 397  ASP C CG  1 
ATOM   10192 O  OD1 . ASP C 1 351 ? 13.246  11.364  33.559  1.00 37.99  ? 397  ASP C OD1 1 
ATOM   10193 O  OD2 . ASP C 1 351 ? 13.679  12.819  35.097  1.00 40.08  ? 397  ASP C OD2 1 
ATOM   10194 N  N   . GLY C 1 352 ? 11.094  15.241  30.872  1.00 39.45  ? 398  GLY C N   1 
ATOM   10195 C  CA  . GLY C 1 352 ? 10.079  16.019  30.176  1.00 40.16  ? 398  GLY C CA  1 
ATOM   10196 C  C   . GLY C 1 352 ? 9.698   17.279  30.929  1.00 40.77  ? 398  GLY C C   1 
ATOM   10197 O  O   . GLY C 1 352 ? 8.569   17.706  30.898  1.00 41.70  ? 398  GLY C O   1 
ATOM   10198 N  N   . ALA C 1 353 ? 10.652  17.873  31.621  1.00 41.34  ? 399  ALA C N   1 
ATOM   10199 C  CA  . ALA C 1 353 ? 10.383  19.002  32.495  1.00 41.16  ? 399  ALA C CA  1 
ATOM   10200 C  C   . ALA C 1 353 ? 10.288  20.256  31.686  1.00 41.26  ? 399  ALA C C   1 
ATOM   10201 O  O   . ALA C 1 353 ? 11.101  20.478  30.772  1.00 41.87  ? 399  ALA C O   1 
ATOM   10202 C  CB  . ALA C 1 353 ? 11.514  19.133  33.514  1.00 40.82  ? 399  ALA C CB  1 
ATOM   10203 N  N   . ASP C 1 354 ? 9.342   21.113  32.027  1.00 41.32  ? 400  ASP C N   1 
ATOM   10204 C  CA  . ASP C 1 354 ? 9.269   22.399  31.340  1.00 41.58  ? 400  ASP C CA  1 
ATOM   10205 C  C   . ASP C 1 354 ? 10.390  23.369  31.752  1.00 42.08  ? 400  ASP C C   1 
ATOM   10206 O  O   . ASP C 1 354 ? 11.052  23.994  30.882  1.00 42.74  ? 400  ASP C O   1 
ATOM   10207 C  CB  . ASP C 1 354 ? 7.906   23.009  31.495  1.00 41.32  ? 400  ASP C CB  1 
ATOM   10208 C  CG  . ASP C 1 354 ? 6.871   22.241  30.739  1.00 41.96  ? 400  ASP C CG  1 
ATOM   10209 O  OD1 . ASP C 1 354 ? 6.923   22.276  29.487  1.00 40.89  ? 400  ASP C OD1 1 
ATOM   10210 O  OD2 . ASP C 1 354 ? 6.013   21.596  31.388  1.00 42.98  ? 400  ASP C OD2 1 
ATOM   10211 N  N   . CYS C 1 355 ? 10.622  23.480  33.062  1.00 41.66  ? 401  CYS C N   1 
ATOM   10212 C  CA  . CYS C 1 355 ? 11.674  24.359  33.568  1.00 41.39  ? 401  CYS C CA  1 
ATOM   10213 C  C   . CYS C 1 355 ? 12.642  23.635  34.481  1.00 40.89  ? 401  CYS C C   1 
ATOM   10214 O  O   . CYS C 1 355 ? 12.282  22.654  35.142  1.00 41.64  ? 401  CYS C O   1 
ATOM   10215 C  CB  . CYS C 1 355 ? 11.054  25.517  34.333  1.00 41.30  ? 401  CYS C CB  1 
ATOM   10216 S  SG  . CYS C 1 355 ? 9.705   26.365  33.480  1.00 44.66  ? 401  CYS C SG  1 
ATOM   10217 N  N   . ILE C 1 356 ? 13.870  24.134  34.532  1.00 39.81  ? 402  ILE C N   1 
ATOM   10218 C  CA  . ILE C 1 356 ? 14.834  23.670  35.534  1.00 38.77  ? 402  ILE C CA  1 
ATOM   10219 C  C   . ILE C 1 356 ? 15.216  24.850  36.427  1.00 39.13  ? 402  ILE C C   1 
ATOM   10220 O  O   . ILE C 1 356 ? 15.204  25.986  35.981  1.00 39.42  ? 402  ILE C O   1 
ATOM   10221 C  CB  . ILE C 1 356 ? 16.045  23.000  34.865  1.00 38.56  ? 402  ILE C CB  1 
ATOM   10222 C  CG1 . ILE C 1 356 ? 16.667  23.916  33.785  1.00 36.64  ? 402  ILE C CG1 1 
ATOM   10223 C  CG2 . ILE C 1 356 ? 15.594  21.659  34.275  1.00 36.67  ? 402  ILE C CG2 1 
ATOM   10224 C  CD1 . ILE C 1 356 ? 17.823  23.325  32.993  1.00 32.71  ? 402  ILE C CD1 1 
ATOM   10225 N  N   . MET C 1 357 ? 15.494  24.604  37.698  1.00 39.32  ? 403  MET C N   1 
ATOM   10226 C  CA  . MET C 1 357 ? 15.723  25.703  38.651  1.00 38.69  ? 403  MET C CA  1 
ATOM   10227 C  C   . MET C 1 357 ? 17.165  25.727  39.163  1.00 39.00  ? 403  MET C C   1 
ATOM   10228 O  O   . MET C 1 357 ? 17.933  24.746  38.979  1.00 39.29  ? 403  MET C O   1 
ATOM   10229 C  CB  . MET C 1 357 ? 14.754  25.582  39.816  1.00 38.14  ? 403  MET C CB  1 
ATOM   10230 C  CG  . MET C 1 357 ? 14.504  26.855  40.536  1.00 37.14  ? 403  MET C CG  1 
ATOM   10231 S  SD  . MET C 1 357 ? 13.049  26.671  41.534  1.00 38.70  ? 403  MET C SD  1 
ATOM   10232 C  CE  . MET C 1 357 ? 13.703  26.414  43.156  1.00 38.38  ? 403  MET C CE  1 
ATOM   10233 N  N   . LEU C 1 358 ? 17.536  26.852  39.780  1.00 38.39  ? 404  LEU C N   1 
ATOM   10234 C  CA  . LEU C 1 358 ? 18.789  26.983  40.520  1.00 37.86  ? 404  LEU C CA  1 
ATOM   10235 C  C   . LEU C 1 358 ? 18.462  27.690  41.835  1.00 38.37  ? 404  LEU C C   1 
ATOM   10236 O  O   . LEU C 1 358 ? 17.592  28.580  41.887  1.00 38.62  ? 404  LEU C O   1 
ATOM   10237 C  CB  . LEU C 1 358 ? 19.806  27.816  39.743  1.00 37.23  ? 404  LEU C CB  1 
ATOM   10238 C  CG  . LEU C 1 358 ? 20.313  27.254  38.420  1.00 37.62  ? 404  LEU C CG  1 
ATOM   10239 C  CD1 . LEU C 1 358 ? 20.972  28.318  37.503  1.00 34.39  ? 404  LEU C CD1 1 
ATOM   10240 C  CD2 . LEU C 1 358 ? 21.263  26.096  38.698  1.00 36.60  ? 404  LEU C CD2 1 
ATOM   10241 N  N   . SER C 1 359 ? 19.146  27.333  42.912  1.00 38.19  ? 405  SER C N   1 
ATOM   10242 C  CA  . SER C 1 359 ? 18.896  28.067  44.133  1.00 37.97  ? 405  SER C CA  1 
ATOM   10243 C  C   . SER C 1 359 ? 20.188  28.590  44.711  1.00 38.48  ? 405  SER C C   1 
ATOM   10244 O  O   . SER C 1 359 ? 20.634  29.674  44.338  1.00 39.39  ? 405  SER C O   1 
ATOM   10245 C  CB  . SER C 1 359 ? 18.108  27.219  45.108  1.00 37.51  ? 405  SER C CB  1 
ATOM   10246 O  OG  . SER C 1 359 ? 16.938  26.756  44.465  1.00 35.10  ? 405  SER C OG  1 
ATOM   10247 N  N   . GLY C 1 360 ? 20.799  27.837  45.600  1.00 38.21  ? 406  GLY C N   1 
ATOM   10248 C  CA  . GLY C 1 360 ? 22.094  28.226  46.102  1.00 38.64  ? 406  GLY C CA  1 
ATOM   10249 C  C   . GLY C 1 360 ? 22.997  28.702  44.981  1.00 38.99  ? 406  GLY C C   1 
ATOM   10250 O  O   . GLY C 1 360 ? 23.718  29.713  45.147  1.00 38.49  ? 406  GLY C O   1 
ATOM   10251 N  N   . GLU C 1 361 ? 22.927  28.006  43.837  1.00 38.44  ? 407  GLU C N   1 
ATOM   10252 C  CA  . GLU C 1 361 ? 23.870  28.245  42.747  1.00 38.42  ? 407  GLU C CA  1 
ATOM   10253 C  C   . GLU C 1 361 ? 23.824  29.656  42.247  1.00 38.49  ? 407  GLU C C   1 
ATOM   10254 O  O   . GLU C 1 361 ? 24.856  30.183  41.851  1.00 39.35  ? 407  GLU C O   1 
ATOM   10255 C  CB  . GLU C 1 361 ? 23.699  27.263  41.584  1.00 38.44  ? 407  GLU C CB  1 
ATOM   10256 C  CG  . GLU C 1 361 ? 23.659  25.801  42.008  1.00 38.07  ? 407  GLU C CG  1 
ATOM   10257 C  CD  . GLU C 1 361 ? 22.249  25.311  42.369  1.00 39.86  ? 407  GLU C CD  1 
ATOM   10258 O  OE1 . GLU C 1 361 ? 21.462  26.030  43.102  1.00 35.96  ? 407  GLU C OE1 1 
ATOM   10259 O  OE2 . GLU C 1 361 ? 21.954  24.173  41.897  1.00 40.67  ? 407  GLU C OE2 1 
ATOM   10260 N  N   . THR C 1 362 ? 22.652  30.283  42.269  1.00 38.54  ? 408  THR C N   1 
ATOM   10261 C  CA  . THR C 1 362 ? 22.554  31.696  41.833  1.00 38.68  ? 408  THR C CA  1 
ATOM   10262 C  C   . THR C 1 362 ? 22.272  32.658  42.958  1.00 38.51  ? 408  THR C C   1 
ATOM   10263 O  O   . THR C 1 362 ? 22.521  33.823  42.821  1.00 38.88  ? 408  THR C O   1 
ATOM   10264 C  CB  . THR C 1 362 ? 21.509  31.944  40.731  1.00 38.61  ? 408  THR C CB  1 
ATOM   10265 O  OG1 . THR C 1 362 ? 20.223  31.525  41.208  1.00 39.53  ? 408  THR C OG1 1 
ATOM   10266 C  CG2 . THR C 1 362 ? 21.895  31.203  39.447  1.00 37.14  ? 408  THR C CG2 1 
ATOM   10267 N  N   . ALA C 1 363 ? 21.740  32.185  44.066  1.00 38.50  ? 409  ALA C N   1 
ATOM   10268 C  CA  . ALA C 1 363 ? 21.426  33.100  45.168  1.00 38.62  ? 409  ALA C CA  1 
ATOM   10269 C  C   . ALA C 1 363 ? 22.653  33.541  46.008  1.00 38.81  ? 409  ALA C C   1 
ATOM   10270 O  O   . ALA C 1 363 ? 22.775  34.704  46.351  1.00 39.15  ? 409  ALA C O   1 
ATOM   10271 C  CB  . ALA C 1 363 ? 20.287  32.531  46.067  1.00 37.96  ? 409  ALA C CB  1 
ATOM   10272 N  N   . LYS C 1 364 ? 23.559  32.623  46.333  1.00 39.14  ? 410  LYS C N   1 
ATOM   10273 C  CA  . LYS C 1 364 ? 24.702  32.973  47.170  1.00 39.55  ? 410  LYS C CA  1 
ATOM   10274 C  C   . LYS C 1 364 ? 26.058  32.531  46.655  1.00 38.54  ? 410  LYS C C   1 
ATOM   10275 O  O   . LYS C 1 364 ? 27.080  32.996  47.143  1.00 39.00  ? 410  LYS C O   1 
ATOM   10276 C  CB  . LYS C 1 364 ? 24.606  32.363  48.550  1.00 39.97  ? 410  LYS C CB  1 
ATOM   10277 C  CG  . LYS C 1 364 ? 23.300  31.874  48.945  1.00 44.83  ? 410  LYS C CG  1 
ATOM   10278 C  CD  . LYS C 1 364 ? 23.597  30.474  49.480  1.00 51.68  ? 410  LYS C CD  1 
ATOM   10279 C  CE  . LYS C 1 364 ? 22.385  29.662  49.665  1.00 53.24  ? 410  LYS C CE  1 
ATOM   10280 N  NZ  . LYS C 1 364 ? 21.393  30.472  50.402  1.00 54.20  ? 410  LYS C NZ  1 
ATOM   10281 N  N   . GLY C 1 365 ? 26.081  31.611  45.712  1.00 37.42  ? 411  GLY C N   1 
ATOM   10282 C  CA  . GLY C 1 365 ? 27.325  31.000  45.299  1.00 36.30  ? 411  GLY C CA  1 
ATOM   10283 C  C   . GLY C 1 365 ? 28.253  31.927  44.565  1.00 35.74  ? 411  GLY C C   1 
ATOM   10284 O  O   . GLY C 1 365 ? 27.905  33.044  44.232  1.00 35.28  ? 411  GLY C O   1 
ATOM   10285 N  N   . ASN C 1 366 ? 29.452  31.438  44.299  1.00 35.99  ? 412  ASN C N   1 
ATOM   10286 C  CA  . ASN C 1 366 ? 30.463  32.246  43.669  1.00 36.05  ? 412  ASN C CA  1 
ATOM   10287 C  C   . ASN C 1 366 ? 30.426  32.197  42.163  1.00 36.08  ? 412  ASN C C   1 
ATOM   10288 O  O   . ASN C 1 366 ? 31.173  32.932  41.523  1.00 36.04  ? 412  ASN C O   1 
ATOM   10289 C  CB  . ASN C 1 366 ? 31.834  31.895  44.223  1.00 36.43  ? 412  ASN C CB  1 
ATOM   10290 C  CG  . ASN C 1 366 ? 31.940  32.208  45.714  1.00 37.32  ? 412  ASN C CG  1 
ATOM   10291 O  OD1 . ASN C 1 366 ? 31.411  33.209  46.185  1.00 40.96  ? 412  ASN C OD1 1 
ATOM   10292 N  ND2 . ASN C 1 366 ? 32.588  31.331  46.462  1.00 34.63  ? 412  ASN C ND2 1 
ATOM   10293 N  N   . PHE C 1 367 ? 29.525  31.388  41.590  1.00 36.17  ? 413  PHE C N   1 
ATOM   10294 C  CA  . PHE C 1 367 ? 29.418  31.301  40.129  1.00 35.94  ? 413  PHE C CA  1 
ATOM   10295 C  C   . PHE C 1 367 ? 28.002  31.316  39.558  1.00 35.80  ? 413  PHE C C   1 
ATOM   10296 O  O   . PHE C 1 367 ? 27.645  30.435  38.770  1.00 35.84  ? 413  PHE C O   1 
ATOM   10297 C  CB  . PHE C 1 367 ? 30.167  30.080  39.635  1.00 35.96  ? 413  PHE C CB  1 
ATOM   10298 C  CG  . PHE C 1 367 ? 31.559  30.013  40.124  1.00 36.63  ? 413  PHE C CG  1 
ATOM   10299 C  CD1 . PHE C 1 367 ? 31.883  29.293  41.277  1.00 37.21  ? 413  PHE C CD1 1 
ATOM   10300 C  CD2 . PHE C 1 367 ? 32.558  30.713  39.456  1.00 36.33  ? 413  PHE C CD2 1 
ATOM   10301 C  CE1 . PHE C 1 367 ? 33.210  29.272  41.742  1.00 37.27  ? 413  PHE C CE1 1 
ATOM   10302 C  CE2 . PHE C 1 367 ? 33.884  30.691  39.909  1.00 35.59  ? 413  PHE C CE2 1 
ATOM   10303 C  CZ  . PHE C 1 367 ? 34.210  29.985  41.044  1.00 35.13  ? 413  PHE C CZ  1 
ATOM   10304 N  N   . PRO C 1 368 ? 27.206  32.348  39.885  1.00 35.59  ? 414  PRO C N   1 
ATOM   10305 C  CA  . PRO C 1 368 ? 25.787  32.318  39.466  1.00 35.36  ? 414  PRO C CA  1 
ATOM   10306 C  C   . PRO C 1 368 ? 25.642  32.315  37.935  1.00 35.26  ? 414  PRO C C   1 
ATOM   10307 O  O   . PRO C 1 368 ? 24.835  31.588  37.388  1.00 35.09  ? 414  PRO C O   1 
ATOM   10308 C  CB  . PRO C 1 368 ? 25.215  33.611  40.069  1.00 35.36  ? 414  PRO C CB  1 
ATOM   10309 C  CG  . PRO C 1 368 ? 26.421  34.503  40.306  1.00 34.88  ? 414  PRO C CG  1 
ATOM   10310 C  CD  . PRO C 1 368 ? 27.574  33.601  40.575  1.00 34.84  ? 414  PRO C CD  1 
ATOM   10311 N  N   . VAL C 1 369 ? 26.448  33.126  37.260  1.00 35.41  ? 415  VAL C N   1 
ATOM   10312 C  CA  . VAL C 1 369 ? 26.375  33.204  35.818  1.00 35.15  ? 415  VAL C CA  1 
ATOM   10313 C  C   . VAL C 1 369 ? 26.851  31.907  35.208  1.00 35.59  ? 415  VAL C C   1 
ATOM   10314 O  O   . VAL C 1 369 ? 26.132  31.314  34.386  1.00 36.17  ? 415  VAL C O   1 
ATOM   10315 C  CB  . VAL C 1 369 ? 27.127  34.415  35.291  1.00 35.05  ? 415  VAL C CB  1 
ATOM   10316 C  CG1 . VAL C 1 369 ? 27.295  34.345  33.778  1.00 32.39  ? 415  VAL C CG1 1 
ATOM   10317 C  CG2 . VAL C 1 369 ? 26.358  35.656  35.715  1.00 34.38  ? 415  VAL C CG2 1 
ATOM   10318 N  N   . GLU C 1 370 ? 28.026  31.443  35.616  1.00 35.56  ? 416  GLU C N   1 
ATOM   10319 C  CA  . GLU C 1 370 ? 28.493  30.143  35.128  1.00 36.41  ? 416  GLU C CA  1 
ATOM   10320 C  C   . GLU C 1 370 ? 27.404  29.048  35.324  1.00 36.19  ? 416  GLU C C   1 
ATOM   10321 O  O   . GLU C 1 370 ? 27.153  28.257  34.418  1.00 35.90  ? 416  GLU C O   1 
ATOM   10322 C  CB  . GLU C 1 370 ? 29.837  29.757  35.743  1.00 35.95  ? 416  GLU C CB  1 
ATOM   10323 C  CG  . GLU C 1 370 ? 30.930  30.678  35.342  1.00 38.50  ? 416  GLU C CG  1 
ATOM   10324 C  CD  . GLU C 1 370 ? 31.084  31.889  36.262  1.00 43.62  ? 416  GLU C CD  1 
ATOM   10325 O  OE1 . GLU C 1 370 ? 30.197  32.103  37.137  1.00 44.89  ? 416  GLU C OE1 1 
ATOM   10326 O  OE2 . GLU C 1 370 ? 32.107  32.617  36.103  1.00 44.31  ? 416  GLU C OE2 1 
ATOM   10327 N  N   . ALA C 1 371 ? 26.751  29.049  36.490  1.00 36.30  ? 417  ALA C N   1 
ATOM   10328 C  CA  . ALA C 1 371 ? 25.653  28.113  36.787  1.00 36.62  ? 417  ALA C CA  1 
ATOM   10329 C  C   . ALA C 1 371 ? 24.502  28.208  35.774  1.00 37.10  ? 417  ALA C C   1 
ATOM   10330 O  O   . ALA C 1 371 ? 23.985  27.175  35.311  1.00 37.57  ? 417  ALA C O   1 
ATOM   10331 C  CB  . ALA C 1 371 ? 25.126  28.321  38.187  1.00 36.20  ? 417  ALA C CB  1 
ATOM   10332 N  N   . VAL C 1 372 ? 24.122  29.429  35.408  1.00 37.15  ? 418  VAL C N   1 
ATOM   10333 C  CA  . VAL C 1 372 ? 23.093  29.601  34.408  1.00 37.19  ? 418  VAL C CA  1 
ATOM   10334 C  C   . VAL C 1 372 ? 23.592  29.125  33.057  1.00 37.33  ? 418  VAL C C   1 
ATOM   10335 O  O   . VAL C 1 372 ? 22.879  28.367  32.405  1.00 37.54  ? 418  VAL C O   1 
ATOM   10336 C  CB  . VAL C 1 372 ? 22.555  31.045  34.347  1.00 37.49  ? 418  VAL C CB  1 
ATOM   10337 C  CG1 . VAL C 1 372 ? 21.624  31.225  33.128  1.00 37.35  ? 418  VAL C CG1 1 
ATOM   10338 C  CG2 . VAL C 1 372 ? 21.825  31.387  35.652  1.00 37.37  ? 418  VAL C CG2 1 
ATOM   10339 N  N   . LYS C 1 373 ? 24.796  29.539  32.645  1.00 36.94  ? 419  LYS C N   1 
ATOM   10340 C  CA  . LYS C 1 373 ? 25.354  29.061  31.388  1.00 37.08  ? 419  LYS C CA  1 
ATOM   10341 C  C   . LYS C 1 373 ? 25.329  27.532  31.294  1.00 37.25  ? 419  LYS C C   1 
ATOM   10342 O  O   . LYS C 1 373 ? 25.015  26.978  30.238  1.00 37.19  ? 419  LYS C O   1 
ATOM   10343 C  CB  . LYS C 1 373 ? 26.769  29.579  31.154  1.00 37.62  ? 419  LYS C CB  1 
ATOM   10344 C  CG  . LYS C 1 373 ? 26.896  31.066  30.842  1.00 38.14  ? 419  LYS C CG  1 
ATOM   10345 C  CD  . LYS C 1 373 ? 28.350  31.353  30.497  1.00 40.01  ? 419  LYS C CD  1 
ATOM   10346 C  CE  . LYS C 1 373 ? 28.715  32.852  30.538  1.00 43.01  ? 419  LYS C CE  1 
ATOM   10347 N  NZ  . LYS C 1 373 ? 29.913  33.148  29.669  1.00 44.19  ? 419  LYS C NZ  1 
ATOM   10348 N  N   . MET C 1 374 ? 25.630  26.836  32.390  1.00 37.61  ? 420  MET C N   1 
ATOM   10349 C  CA  . MET C 1 374 ? 25.624  25.360  32.356  1.00 37.82  ? 420  MET C CA  1 
ATOM   10350 C  C   . MET C 1 374 ? 24.222  24.794  32.118  1.00 37.68  ? 420  MET C C   1 
ATOM   10351 O  O   . MET C 1 374 ? 24.049  23.970  31.253  1.00 37.75  ? 420  MET C O   1 
ATOM   10352 C  CB  . MET C 1 374 ? 26.264  24.721  33.608  1.00 38.24  ? 420  MET C CB  1 
ATOM   10353 C  CG  . MET C 1 374 ? 26.414  23.184  33.517  1.00 37.38  ? 420  MET C CG  1 
ATOM   10354 S  SD  . MET C 1 374 ? 27.891  22.867  32.543  1.00 40.65  ? 420  MET C SD  1 
ATOM   10355 C  CE  . MET C 1 374 ? 27.243  21.832  31.281  1.00 38.09  ? 420  MET C CE  1 
ATOM   10356 N  N   . GLN C 1 375 ? 23.214  25.216  32.873  1.00 37.53  ? 421  GLN C N   1 
ATOM   10357 C  CA  . GLN C 1 375 ? 21.873  24.703  32.568  1.00 37.78  ? 421  GLN C CA  1 
ATOM   10358 C  C   . GLN C 1 375 ? 21.523  24.982  31.120  1.00 38.44  ? 421  GLN C C   1 
ATOM   10359 O  O   . GLN C 1 375 ? 20.953  24.122  30.448  1.00 38.90  ? 421  GLN C O   1 
ATOM   10360 C  CB  . GLN C 1 375 ? 20.794  25.269  33.471  1.00 37.56  ? 421  GLN C CB  1 
ATOM   10361 C  CG  . GLN C 1 375 ? 20.992  24.930  34.899  1.00 37.18  ? 421  GLN C CG  1 
ATOM   10362 C  CD  . GLN C 1 375 ? 19.728  24.796  35.679  1.00 37.94  ? 421  GLN C CD  1 
ATOM   10363 O  OE1 . GLN C 1 375 ? 19.661  23.965  36.566  1.00 39.29  ? 421  GLN C OE1 1 
ATOM   10364 N  NE2 . GLN C 1 375 ? 18.724  25.612  35.386  1.00 37.94  ? 421  GLN C NE2 1 
ATOM   10365 N  N   . HIS C 1 376 ? 21.894  26.161  30.618  1.00 39.04  ? 422  HIS C N   1 
ATOM   10366 C  CA  . HIS C 1 376 ? 21.720  26.451  29.179  1.00 39.24  ? 422  HIS C CA  1 
ATOM   10367 C  C   . HIS C 1 376 ? 22.366  25.388  28.299  1.00 39.53  ? 422  HIS C C   1 
ATOM   10368 O  O   . HIS C 1 376 ? 21.678  24.799  27.485  1.00 40.21  ? 422  HIS C O   1 
ATOM   10369 C  CB  . HIS C 1 376 ? 22.198  27.851  28.806  1.00 38.70  ? 422  HIS C CB  1 
ATOM   10370 C  CG  . HIS C 1 376 ? 22.219  28.117  27.336  1.00 37.67  ? 422  HIS C CG  1 
ATOM   10371 N  ND1 . HIS C 1 376 ? 21.082  28.451  26.621  1.00 36.35  ? 422  HIS C ND1 1 
ATOM   10372 C  CD2 . HIS C 1 376 ? 23.251  28.153  26.449  1.00 36.98  ? 422  HIS C CD2 1 
ATOM   10373 C  CE1 . HIS C 1 376 ? 21.407  28.635  25.350  1.00 36.87  ? 422  HIS C CE1 1 
ATOM   10374 N  NE2 . HIS C 1 376 ? 22.717  28.462  25.219  1.00 35.92  ? 422  HIS C NE2 1 
ATOM   10375 N  N   . ALA C 1 377 ? 23.649  25.104  28.500  1.00 40.00  ? 423  ALA C N   1 
ATOM   10376 C  CA  . ALA C 1 377 ? 24.409  24.215  27.601  1.00 40.39  ? 423  ALA C CA  1 
ATOM   10377 C  C   . ALA C 1 377 ? 23.860  22.787  27.629  1.00 40.89  ? 423  ALA C C   1 
ATOM   10378 O  O   . ALA C 1 377 ? 23.623  22.179  26.568  1.00 41.15  ? 423  ALA C O   1 
ATOM   10379 C  CB  . ALA C 1 377 ? 25.909  24.242  27.941  1.00 40.10  ? 423  ALA C CB  1 
ATOM   10380 N  N   . ILE C 1 378 ? 23.613  22.269  28.834  1.00 41.20  ? 424  ILE C N   1 
ATOM   10381 C  CA  . ILE C 1 378 ? 23.061  20.928  28.977  1.00 41.07  ? 424  ILE C CA  1 
ATOM   10382 C  C   . ILE C 1 378 ? 21.672  20.831  28.366  1.00 41.41  ? 424  ILE C C   1 
ATOM   10383 O  O   . ILE C 1 378 ? 21.416  19.895  27.602  1.00 41.85  ? 424  ILE C O   1 
ATOM   10384 C  CB  . ILE C 1 378 ? 22.959  20.466  30.403  1.00 40.85  ? 424  ILE C CB  1 
ATOM   10385 C  CG1 . ILE C 1 378 ? 24.264  20.651  31.129  1.00 39.07  ? 424  ILE C CG1 1 
ATOM   10386 C  CG2 . ILE C 1 378 ? 22.568  18.976  30.443  1.00 41.60  ? 424  ILE C CG2 1 
ATOM   10387 C  CD1 . ILE C 1 378 ? 24.071  20.740  32.588  1.00 35.75  ? 424  ILE C CD1 1 
ATOM   10388 N  N   . ALA C 1 379 ? 20.777  21.777  28.671  1.00 40.85  ? 425  ALA C N   1 
ATOM   10389 C  CA  . ALA C 1 379 ? 19.402  21.654  28.157  1.00 40.42  ? 425  ALA C CA  1 
ATOM   10390 C  C   . ALA C 1 379 ? 19.342  21.584  26.640  1.00 40.17  ? 425  ALA C C   1 
ATOM   10391 O  O   . ALA C 1 379 ? 18.525  20.870  26.099  1.00 39.98  ? 425  ALA C O   1 
ATOM   10392 C  CB  . ALA C 1 379 ? 18.480  22.734  28.700  1.00 40.51  ? 425  ALA C CB  1 
ATOM   10393 N  N   . ARG C 1 380 ? 20.228  22.293  25.954  1.00 40.42  ? 426  ARG C N   1 
ATOM   10394 C  CA  . ARG C 1 380 ? 20.273  22.233  24.496  1.00 40.57  ? 426  ARG C CA  1 
ATOM   10395 C  C   . ARG C 1 380 ? 20.615  20.856  24.005  1.00 40.55  ? 426  ARG C C   1 
ATOM   10396 O  O   . ARG C 1 380 ? 19.970  20.374  23.112  1.00 41.57  ? 426  ARG C O   1 
ATOM   10397 C  CB  . ARG C 1 380 ? 21.257  23.234  23.919  1.00 40.58  ? 426  ARG C CB  1 
ATOM   10398 C  CG  . ARG C 1 380 ? 20.797  24.648  24.082  1.00 42.47  ? 426  ARG C CG  1 
ATOM   10399 C  CD  . ARG C 1 380 ? 21.130  25.498  22.888  1.00 43.64  ? 426  ARG C CD  1 
ATOM   10400 N  NE  . ARG C 1 380 ? 22.540  25.370  22.580  1.00 44.28  ? 426  ARG C NE  1 
ATOM   10401 C  CZ  . ARG C 1 380 ? 23.049  25.535  21.365  1.00 46.32  ? 426  ARG C CZ  1 
ATOM   10402 N  NH1 . ARG C 1 380 ? 22.266  25.838  20.324  1.00 45.44  ? 426  ARG C NH1 1 
ATOM   10403 N  NH2 . ARG C 1 380 ? 24.350  25.380  21.194  1.00 46.09  ? 426  ARG C NH2 1 
ATOM   10404 N  N   . GLU C 1 381 ? 21.646  20.236  24.565  1.00 40.21  ? 427  GLU C N   1 
ATOM   10405 C  CA  . GLU C 1 381 ? 22.009  18.887  24.193  1.00 39.44  ? 427  GLU C CA  1 
ATOM   10406 C  C   . GLU C 1 381 ? 20.842  17.948  24.439  1.00 39.37  ? 427  GLU C C   1 
ATOM   10407 O  O   . GLU C 1 381 ? 20.436  17.228  23.533  1.00 39.45  ? 427  GLU C O   1 
ATOM   10408 C  CB  . GLU C 1 381 ? 23.229  18.418  24.979  1.00 39.05  ? 427  GLU C CB  1 
ATOM   10409 C  CG  . GLU C 1 381 ? 24.428  19.259  24.757  1.00 37.62  ? 427  GLU C CG  1 
ATOM   10410 C  CD  . GLU C 1 381 ? 25.049  19.089  23.389  1.00 35.39  ? 427  GLU C CD  1 
ATOM   10411 O  OE1 . GLU C 1 381 ? 24.768  18.101  22.696  1.00 37.88  ? 427  GLU C OE1 1 
ATOM   10412 O  OE2 . GLU C 1 381 ? 25.829  19.958  22.988  1.00 34.08  ? 427  GLU C OE2 1 
ATOM   10413 N  N   . ALA C 1 382 ? 20.303  17.977  25.653  1.00 39.12  ? 428  ALA C N   1 
ATOM   10414 C  CA  . ALA C 1 382 ? 19.273  17.043  26.055  1.00 38.81  ? 428  ALA C CA  1 
ATOM   10415 C  C   . ALA C 1 382 ? 18.012  17.222  25.229  1.00 39.00  ? 428  ALA C C   1 
ATOM   10416 O  O   . ALA C 1 382 ? 17.438  16.248  24.759  1.00 39.26  ? 428  ALA C O   1 
ATOM   10417 C  CB  . ALA C 1 382 ? 18.987  17.181  27.505  1.00 38.78  ? 428  ALA C CB  1 
ATOM   10418 N  N   . GLU C 1 383 ? 17.586  18.459  25.017  1.00 39.20  ? 429  GLU C N   1 
ATOM   10419 C  CA  . GLU C 1 383 ? 16.459  18.718  24.120  1.00 39.67  ? 429  GLU C CA  1 
ATOM   10420 C  C   . GLU C 1 383 ? 16.575  18.025  22.764  1.00 40.40  ? 429  GLU C C   1 
ATOM   10421 O  O   . GLU C 1 383 ? 15.608  17.430  22.319  1.00 40.88  ? 429  GLU C O   1 
ATOM   10422 C  CB  . GLU C 1 383 ? 16.251  20.211  23.941  1.00 39.12  ? 429  GLU C CB  1 
ATOM   10423 C  CG  . GLU C 1 383 ? 15.509  20.779  25.104  1.00 39.43  ? 429  GLU C CG  1 
ATOM   10424 C  CD  . GLU C 1 383 ? 16.027  22.097  25.493  1.00 40.01  ? 429  GLU C CD  1 
ATOM   10425 O  OE1 . GLU C 1 383 ? 16.565  22.818  24.616  1.00 40.39  ? 429  GLU C OE1 1 
ATOM   10426 O  OE2 . GLU C 1 383 ? 15.898  22.403  26.689  1.00 40.30  ? 429  GLU C OE2 1 
ATOM   10427 N  N   . ALA C 1 384 ? 17.757  18.082  22.139  1.00 40.71  ? 430  ALA C N   1 
ATOM   10428 C  CA  . ALA C 1 384 ? 18.036  17.349  20.910  1.00 41.26  ? 430  ALA C CA  1 
ATOM   10429 C  C   . ALA C 1 384 ? 17.952  15.796  21.043  1.00 41.70  ? 430  ALA C C   1 
ATOM   10430 O  O   . ALA C 1 384 ? 17.821  15.116  20.005  1.00 42.08  ? 430  ALA C O   1 
ATOM   10431 C  CB  . ALA C 1 384 ? 19.410  17.780  20.298  1.00 40.93  ? 430  ALA C CB  1 
ATOM   10432 N  N   . ALA C 1 385 ? 18.041  15.245  22.279  1.00 41.62  ? 431  ALA C N   1 
ATOM   10433 C  CA  . ALA C 1 385 ? 18.114  13.781  22.508  1.00 42.19  ? 431  ALA C CA  1 
ATOM   10434 C  C   . ALA C 1 385 ? 16.762  13.182  22.863  1.00 42.77  ? 431  ALA C C   1 
ATOM   10435 O  O   . ALA C 1 385 ? 16.635  11.964  22.992  1.00 43.31  ? 431  ALA C O   1 
ATOM   10436 C  CB  . ALA C 1 385 ? 19.174  13.412  23.579  1.00 41.63  ? 431  ALA C CB  1 
ATOM   10437 N  N   . VAL C 1 386 ? 15.753  14.037  23.022  1.00 43.13  ? 432  VAL C N   1 
ATOM   10438 C  CA  . VAL C 1 386 ? 14.388  13.562  23.194  1.00 43.10  ? 432  VAL C CA  1 
ATOM   10439 C  C   . VAL C 1 386 ? 13.977  12.722  21.980  1.00 43.52  ? 432  VAL C C   1 
ATOM   10440 O  O   . VAL C 1 386 ? 14.119  13.155  20.843  1.00 44.03  ? 432  VAL C O   1 
ATOM   10441 C  CB  . VAL C 1 386 ? 13.407  14.715  23.340  1.00 42.80  ? 432  VAL C CB  1 
ATOM   10442 C  CG1 . VAL C 1 386 ? 11.986  14.191  23.269  1.00 41.83  ? 432  VAL C CG1 1 
ATOM   10443 C  CG2 . VAL C 1 386 ? 13.630  15.414  24.650  1.00 42.31  ? 432  VAL C CG2 1 
ATOM   10444 N  N   . TYR C 1 387 ? 13.468  11.521  22.238  1.00 43.80  ? 433  TYR C N   1 
ATOM   10445 C  CA  . TYR C 1 387 ? 12.910  10.631  21.205  1.00 43.40  ? 433  TYR C CA  1 
ATOM   10446 C  C   . TYR C 1 387 ? 11.462  11.058  20.877  1.00 43.38  ? 433  TYR C C   1 
ATOM   10447 O  O   . TYR C 1 387 ? 10.492  10.415  21.281  1.00 43.56  ? 433  TYR C O   1 
ATOM   10448 C  CB  . TYR C 1 387 ? 12.964  9.175   21.717  1.00 43.23  ? 433  TYR C CB  1 
ATOM   10449 C  CG  . TYR C 1 387 ? 12.650  8.106   20.712  1.00 42.47  ? 433  TYR C CG  1 
ATOM   10450 C  CD1 . TYR C 1 387 ? 13.164  8.177   19.410  1.00 43.22  ? 433  TYR C CD1 1 
ATOM   10451 C  CD2 . TYR C 1 387 ? 11.886  6.990   21.070  1.00 42.98  ? 433  TYR C CD2 1 
ATOM   10452 C  CE1 . TYR C 1 387 ? 12.899  7.174   18.459  1.00 42.98  ? 433  TYR C CE1 1 
ATOM   10453 C  CE2 . TYR C 1 387 ? 11.616  5.975   20.148  1.00 43.19  ? 433  TYR C CE2 1 
ATOM   10454 C  CZ  . TYR C 1 387 ? 12.131  6.081   18.833  1.00 43.84  ? 433  TYR C CZ  1 
ATOM   10455 O  OH  . TYR C 1 387 ? 11.896  5.093   17.892  1.00 45.27  ? 433  TYR C OH  1 
ATOM   10456 N  N   . HIS C 1 388 ? 11.328  12.159  20.149  1.00 43.63  ? 434  HIS C N   1 
ATOM   10457 C  CA  . HIS C 1 388 ? 10.006  12.735  19.836  1.00 44.11  ? 434  HIS C CA  1 
ATOM   10458 C  C   . HIS C 1 388 ? 9.073   11.705  19.251  1.00 44.49  ? 434  HIS C C   1 
ATOM   10459 O  O   . HIS C 1 388 ? 7.896   11.641  19.635  1.00 44.53  ? 434  HIS C O   1 
ATOM   10460 C  CB  . HIS C 1 388 ? 10.121  13.902  18.865  1.00 43.66  ? 434  HIS C CB  1 
ATOM   10461 C  CG  . HIS C 1 388 ? 11.031  14.972  19.352  1.00 44.93  ? 434  HIS C CG  1 
ATOM   10462 N  ND1 . HIS C 1 388 ? 10.663  15.868  20.340  1.00 45.63  ? 434  HIS C ND1 1 
ATOM   10463 C  CD2 . HIS C 1 388 ? 12.315  15.259  19.036  1.00 46.42  ? 434  HIS C CD2 1 
ATOM   10464 C  CE1 . HIS C 1 388 ? 11.677  16.681  20.591  1.00 46.28  ? 434  HIS C CE1 1 
ATOM   10465 N  NE2 . HIS C 1 388 ? 12.694  16.324  19.821  1.00 46.77  ? 434  HIS C NE2 1 
ATOM   10466 N  N   . ARG C 1 389 ? 9.602   10.898  18.323  1.00 44.72  ? 435  ARG C N   1 
ATOM   10467 C  CA  . ARG C 1 389 ? 8.793   9.853   17.696  1.00 44.83  ? 435  ARG C CA  1 
ATOM   10468 C  C   . ARG C 1 389 ? 7.901   9.188   18.758  1.00 44.61  ? 435  ARG C C   1 
ATOM   10469 O  O   . ARG C 1 389 ? 6.673   9.284   18.650  1.00 44.82  ? 435  ARG C O   1 
ATOM   10470 C  CB  . ARG C 1 389 ? 9.652   8.835   16.937  1.00 44.79  ? 435  ARG C CB  1 
ATOM   10471 C  CG  . ARG C 1 389 ? 8.844   7.699   16.347  1.00 45.74  ? 435  ARG C CG  1 
ATOM   10472 C  CD  . ARG C 1 389 ? 9.734   6.668   15.661  1.00 49.38  ? 435  ARG C CD  1 
ATOM   10473 N  NE  . ARG C 1 389 ? 10.084  7.083   14.302  1.00 52.08  ? 435  ARG C NE  1 
ATOM   10474 C  CZ  . ARG C 1 389 ? 10.269  6.240   13.275  1.00 53.14  ? 435  ARG C CZ  1 
ATOM   10475 N  NH1 . ARG C 1 389 ? 10.147  4.919   13.436  1.00 52.54  ? 435  ARG C NH1 1 
ATOM   10476 N  NH2 . ARG C 1 389 ? 10.568  6.721   12.066  1.00 53.18  ? 435  ARG C NH2 1 
ATOM   10477 N  N   . GLN C 1 390 ? 8.504   8.577   19.789  1.00 44.14  ? 436  GLN C N   1 
ATOM   10478 C  CA  . GLN C 1 390 ? 7.725   7.931   20.846  1.00 44.38  ? 436  GLN C CA  1 
ATOM   10479 C  C   . GLN C 1 390 ? 6.888   8.996   21.565  1.00 44.20  ? 436  GLN C C   1 
ATOM   10480 O  O   . GLN C 1 390 ? 5.673   8.861   21.739  1.00 44.08  ? 436  GLN C O   1 
ATOM   10481 C  CB  . GLN C 1 390 ? 8.618   7.160   21.841  1.00 44.42  ? 436  GLN C CB  1 
ATOM   10482 C  CG  . GLN C 1 390 ? 7.867   6.179   22.742  1.00 45.92  ? 436  GLN C CG  1 
ATOM   10483 C  CD  . GLN C 1 390 ? 8.789   5.371   23.637  1.00 48.72  ? 436  GLN C CD  1 
ATOM   10484 O  OE1 . GLN C 1 390 ? 9.367   4.369   23.227  1.00 50.13  ? 436  GLN C OE1 1 
ATOM   10485 N  NE2 . GLN C 1 390 ? 8.914   5.796   24.877  1.00 51.76  ? 436  GLN C NE2 1 
ATOM   10486 N  N   . LEU C 1 391 ? 7.551   10.078  21.945  1.00 44.15  ? 437  LEU C N   1 
ATOM   10487 C  CA  . LEU C 1 391 ? 6.929   11.090  22.771  1.00 43.91  ? 437  LEU C CA  1 
ATOM   10488 C  C   . LEU C 1 391 ? 5.638   11.561  22.132  1.00 44.03  ? 437  LEU C C   1 
ATOM   10489 O  O   . LEU C 1 391 ? 4.580   11.479  22.743  1.00 44.12  ? 437  LEU C O   1 
ATOM   10490 C  CB  . LEU C 1 391 ? 7.886   12.261  22.999  1.00 43.56  ? 437  LEU C CB  1 
ATOM   10491 C  CG  . LEU C 1 391 ? 7.383   13.347  23.964  1.00 43.33  ? 437  LEU C CG  1 
ATOM   10492 C  CD1 . LEU C 1 391 ? 6.884   12.767  25.306  1.00 41.88  ? 437  LEU C CD1 1 
ATOM   10493 C  CD2 . LEU C 1 391 ? 8.444   14.400  24.190  1.00 39.75  ? 437  LEU C CD2 1 
ATOM   10494 N  N   . PHE C 1 392 ? 5.737   12.027  20.893  1.00 44.21  ? 438  PHE C N   1 
ATOM   10495 C  CA  . PHE C 1 392 ? 4.587   12.510  20.156  1.00 44.46  ? 438  PHE C CA  1 
ATOM   10496 C  C   . PHE C 1 392 ? 3.527   11.430  20.054  1.00 44.58  ? 438  PHE C C   1 
ATOM   10497 O  O   . PHE C 1 392 ? 2.374   11.678  20.385  1.00 44.79  ? 438  PHE C O   1 
ATOM   10498 C  CB  . PHE C 1 392 ? 4.991   12.995  18.764  1.00 44.45  ? 438  PHE C CB  1 
ATOM   10499 C  CG  . PHE C 1 392 ? 3.911   13.756  18.048  1.00 44.88  ? 438  PHE C CG  1 
ATOM   10500 C  CD1 . PHE C 1 392 ? 2.883   14.373  18.747  1.00 46.15  ? 438  PHE C CD1 1 
ATOM   10501 C  CD2 . PHE C 1 392 ? 3.934   13.890  16.680  1.00 43.98  ? 438  PHE C CD2 1 
ATOM   10502 C  CE1 . PHE C 1 392 ? 1.880   15.094  18.077  1.00 43.85  ? 438  PHE C CE1 1 
ATOM   10503 C  CE2 . PHE C 1 392 ? 2.945   14.617  16.027  1.00 42.84  ? 438  PHE C CE2 1 
ATOM   10504 C  CZ  . PHE C 1 392 ? 1.922   15.218  16.727  1.00 41.48  ? 438  PHE C CZ  1 
ATOM   10505 N  N   . GLU C 1 393 ? 3.915   10.230  19.631  1.00 44.33  ? 439  GLU C N   1 
ATOM   10506 C  CA  . GLU C 1 393 ? 2.941   9.168   19.477  1.00 44.68  ? 439  GLU C CA  1 
ATOM   10507 C  C   . GLU C 1 393 ? 2.160   9.007   20.753  1.00 44.39  ? 439  GLU C C   1 
ATOM   10508 O  O   . GLU C 1 393 ? 0.943   9.007   20.736  1.00 44.46  ? 439  GLU C O   1 
ATOM   10509 C  CB  . GLU C 1 393 ? 3.603   7.847   19.106  1.00 44.98  ? 439  GLU C CB  1 
ATOM   10510 C  CG  . GLU C 1 393 ? 3.940   7.703   17.629  1.00 47.72  ? 439  GLU C CG  1 
ATOM   10511 C  CD  . GLU C 1 393 ? 4.064   6.240   17.200  1.00 51.52  ? 439  GLU C CD  1 
ATOM   10512 O  OE1 . GLU C 1 393 ? 3.580   5.359   17.972  1.00 52.08  ? 439  GLU C OE1 1 
ATOM   10513 O  OE2 . GLU C 1 393 ? 4.642   5.966   16.098  1.00 52.81  ? 439  GLU C OE2 1 
ATOM   10514 N  N   . GLU C 1 394 ? 2.874   8.921   21.866  1.00 44.51  ? 440  GLU C N   1 
ATOM   10515 C  CA  . GLU C 1 394 ? 2.256   8.617   23.153  1.00 44.59  ? 440  GLU C CA  1 
ATOM   10516 C  C   . GLU C 1 394 ? 1.293   9.704   23.580  1.00 44.70  ? 440  GLU C C   1 
ATOM   10517 O  O   . GLU C 1 394 ? 0.186   9.402   24.049  1.00 44.48  ? 440  GLU C O   1 
ATOM   10518 C  CB  . GLU C 1 394 ? 3.319   8.343   24.214  1.00 44.31  ? 440  GLU C CB  1 
ATOM   10519 C  CG  . GLU C 1 394 ? 4.238   7.200   23.805  1.00 44.79  ? 440  GLU C CG  1 
ATOM   10520 C  CD  . GLU C 1 394 ? 4.829   6.461   24.968  1.00 46.26  ? 440  GLU C CD  1 
ATOM   10521 O  OE1 . GLU C 1 394 ? 5.169   7.098   25.988  1.00 48.43  ? 440  GLU C OE1 1 
ATOM   10522 O  OE2 . GLU C 1 394 ? 4.964   5.232   24.865  1.00 46.28  ? 440  GLU C OE2 1 
ATOM   10523 N  N   . LEU C 1 395 ? 1.691   10.957  23.361  1.00 44.80  ? 441  LEU C N   1 
ATOM   10524 C  CA  . LEU C 1 395 ? 0.834   12.093  23.720  1.00 45.33  ? 441  LEU C CA  1 
ATOM   10525 C  C   . LEU C 1 395 ? -0.476  12.091  22.922  1.00 45.94  ? 441  LEU C C   1 
ATOM   10526 O  O   . LEU C 1 395 ? -1.553  12.010  23.514  1.00 46.60  ? 441  LEU C O   1 
ATOM   10527 C  CB  . LEU C 1 395 ? 1.572   13.437  23.655  1.00 44.70  ? 441  LEU C CB  1 
ATOM   10528 C  CG  . LEU C 1 395 ? 2.773   13.608  24.620  1.00 43.83  ? 441  LEU C CG  1 
ATOM   10529 C  CD1 . LEU C 1 395 ? 3.730   14.710  24.176  1.00 41.78  ? 441  LEU C CD1 1 
ATOM   10530 C  CD2 . LEU C 1 395 ? 2.333   13.843  26.058  1.00 41.22  ? 441  LEU C CD2 1 
ATOM   10531 N  N   . ARG C 1 396 ? -0.395  12.126  21.599  1.00 46.39  ? 442  ARG C N   1 
ATOM   10532 C  CA  . ARG C 1 396 ? -1.589  11.969  20.773  1.00 47.27  ? 442  ARG C CA  1 
ATOM   10533 C  C   . ARG C 1 396 ? -2.427  10.839  21.349  1.00 47.62  ? 442  ARG C C   1 
ATOM   10534 O  O   . ARG C 1 396 ? -3.577  11.040  21.761  1.00 48.17  ? 442  ARG C O   1 
ATOM   10535 C  CB  . ARG C 1 396 ? -1.238  11.601  19.326  1.00 47.34  ? 442  ARG C CB  1 
ATOM   10536 C  CG  . ARG C 1 396 ? -0.087  12.363  18.758  1.00 48.61  ? 442  ARG C CG  1 
ATOM   10537 C  CD  . ARG C 1 396 ? -0.153  12.414  17.253  1.00 51.53  ? 442  ARG C CD  1 
ATOM   10538 N  NE  . ARG C 1 396 ? 0.319   11.192  16.614  1.00 51.31  ? 442  ARG C NE  1 
ATOM   10539 C  CZ  . ARG C 1 396 ? -0.477  10.338  15.987  1.00 52.81  ? 442  ARG C CZ  1 
ATOM   10540 N  NH1 . ARG C 1 396 ? -1.794  10.581  15.918  1.00 52.56  ? 442  ARG C NH1 1 
ATOM   10541 N  NH2 . ARG C 1 396 ? 0.042   9.242   15.425  1.00 52.53  ? 442  ARG C NH2 1 
ATOM   10542 N  N   . ARG C 1 397 ? -1.820  9.658   21.400  1.00 47.50  ? 443  ARG C N   1 
ATOM   10543 C  CA  . ARG C 1 397 ? -2.493  8.431   21.795  1.00 47.54  ? 443  ARG C CA  1 
ATOM   10544 C  C   . ARG C 1 397 ? -3.226  8.592   23.117  1.00 47.17  ? 443  ARG C C   1 
ATOM   10545 O  O   . ARG C 1 397 ? -4.337  8.093   23.287  1.00 47.05  ? 443  ARG C O   1 
ATOM   10546 C  CB  . ARG C 1 397 ? -1.467  7.291   21.905  1.00 47.76  ? 443  ARG C CB  1 
ATOM   10547 C  CG  . ARG C 1 397 ? -1.834  6.009   21.141  1.00 48.77  ? 443  ARG C CG  1 
ATOM   10548 C  CD  . ARG C 1 397 ? -0.806  4.894   21.445  1.00 51.27  ? 443  ARG C CD  1 
ATOM   10549 N  NE  . ARG C 1 397 ? -1.327  3.559   21.136  1.00 54.09  ? 443  ARG C NE  1 
ATOM   10550 C  CZ  . ARG C 1 397 ? -0.804  2.722   20.235  1.00 55.15  ? 443  ARG C CZ  1 
ATOM   10551 N  NH1 . ARG C 1 397 ? 0.299   3.057   19.560  1.00 55.93  ? 443  ARG C NH1 1 
ATOM   10552 N  NH2 . ARG C 1 397 ? -1.377  1.534   20.022  1.00 53.85  ? 443  ARG C NH2 1 
ATOM   10553 N  N   . ALA C 1 398 ? -2.596  9.293   24.051  1.00 46.70  ? 444  ALA C N   1 
ATOM   10554 C  CA  . ALA C 1 398 ? -3.136  9.385   25.395  1.00 46.49  ? 444  ALA C CA  1 
ATOM   10555 C  C   . ALA C 1 398 ? -4.160  10.509  25.527  1.00 46.36  ? 444  ALA C C   1 
ATOM   10556 O  O   . ALA C 1 398 ? -5.209  10.314  26.155  1.00 46.61  ? 444  ALA C O   1 
ATOM   10557 C  CB  . ALA C 1 398 ? -2.019  9.553   26.401  1.00 46.61  ? 444  ALA C CB  1 
ATOM   10558 N  N   . ALA C 1 399 ? -3.849  11.671  24.940  1.00 45.57  ? 445  ALA C N   1 
ATOM   10559 C  CA  . ALA C 1 399 ? -4.734  12.835  24.965  1.00 45.13  ? 445  ALA C CA  1 
ATOM   10560 C  C   . ALA C 1 399 ? -6.098  12.532  24.333  1.00 45.08  ? 445  ALA C C   1 
ATOM   10561 O  O   . ALA C 1 399 ? -6.155  12.002  23.214  1.00 45.05  ? 445  ALA C O   1 
ATOM   10562 C  CB  . ALA C 1 399 ? -4.082  13.992  24.265  1.00 44.74  ? 445  ALA C CB  1 
ATOM   10563 N  N   . PRO C 1 400 ? -7.197  12.872  25.048  1.00 44.83  ? 446  PRO C N   1 
ATOM   10564 C  CA  . PRO C 1 400 ? -8.553  12.585  24.542  1.00 44.50  ? 446  PRO C CA  1 
ATOM   10565 C  C   . PRO C 1 400 ? -8.887  13.411  23.303  1.00 44.05  ? 446  PRO C C   1 
ATOM   10566 O  O   . PRO C 1 400 ? -8.253  14.434  23.054  1.00 43.69  ? 446  PRO C O   1 
ATOM   10567 C  CB  . PRO C 1 400 ? -9.470  12.998  25.704  1.00 44.43  ? 446  PRO C CB  1 
ATOM   10568 C  CG  . PRO C 1 400 ? -8.675  14.029  26.469  1.00 44.76  ? 446  PRO C CG  1 
ATOM   10569 C  CD  . PRO C 1 400 ? -7.227  13.569  26.349  1.00 44.84  ? 446  PRO C CD  1 
ATOM   10570 N  N   . LEU C 1 401 ? -9.871  12.966  22.530  1.00 43.80  ? 447  LEU C N   1 
ATOM   10571 C  CA  . LEU C 1 401 ? -10.350 13.748  21.410  1.00 43.70  ? 447  LEU C CA  1 
ATOM   10572 C  C   . LEU C 1 401 ? -10.557 15.153  21.910  1.00 43.71  ? 447  LEU C C   1 
ATOM   10573 O  O   . LEU C 1 401 ? -10.533 15.388  23.119  1.00 44.14  ? 447  LEU C O   1 
ATOM   10574 C  CB  . LEU C 1 401 ? -11.678 13.195  20.893  1.00 43.98  ? 447  LEU C CB  1 
ATOM   10575 C  CG  . LEU C 1 401 ? -11.819 11.684  20.611  1.00 44.71  ? 447  LEU C CG  1 
ATOM   10576 C  CD1 . LEU C 1 401 ? -13.192 11.440  20.039  1.00 45.76  ? 447  LEU C CD1 1 
ATOM   10577 C  CD2 . LEU C 1 401 ? -10.716 11.110  19.673  1.00 44.67  ? 447  LEU C CD2 1 
ATOM   10578 N  N   . SER C 1 402 ? -10.750 16.099  20.998  1.00 43.45  ? 448  SER C N   1 
ATOM   10579 C  CA  . SER C 1 402 ? -10.977 17.482  21.407  1.00 43.19  ? 448  SER C CA  1 
ATOM   10580 C  C   . SER C 1 402 ? -11.777 18.211  20.385  1.00 42.88  ? 448  SER C C   1 
ATOM   10581 O  O   . SER C 1 402 ? -11.658 17.944  19.201  1.00 43.40  ? 448  SER C O   1 
ATOM   10582 C  CB  . SER C 1 402 ? -9.671  18.241  21.629  1.00 43.15  ? 448  SER C CB  1 
ATOM   10583 O  OG  . SER C 1 402 ? -9.943  19.592  21.986  1.00 44.20  ? 448  SER C OG  1 
ATOM   10584 N  N   . ARG C 1 403 ? -12.565 19.164  20.863  1.00 42.53  ? 449  ARG C N   1 
ATOM   10585 C  CA  . ARG C 1 403 ? -13.487 19.902  20.027  1.00 42.02  ? 449  ARG C CA  1 
ATOM   10586 C  C   . ARG C 1 403 ? -13.081 21.376  19.988  1.00 41.52  ? 449  ARG C C   1 
ATOM   10587 O  O   . ARG C 1 403 ? -13.636 22.165  19.213  1.00 41.60  ? 449  ARG C O   1 
ATOM   10588 C  CB  . ARG C 1 403 ? -14.887 19.763  20.606  1.00 42.23  ? 449  ARG C CB  1 
ATOM   10589 C  CG  . ARG C 1 403 ? -15.970 19.727  19.583  1.00 43.43  ? 449  ARG C CG  1 
ATOM   10590 C  CD  . ARG C 1 403 ? -16.423 18.306  19.326  1.00 45.29  ? 449  ARG C CD  1 
ATOM   10591 N  NE  . ARG C 1 403 ? -17.412 18.283  18.246  1.00 46.80  ? 449  ARG C NE  1 
ATOM   10592 C  CZ  . ARG C 1 403 ? -17.371 17.457  17.201  1.00 47.63  ? 449  ARG C CZ  1 
ATOM   10593 N  NH1 . ARG C 1 403 ? -16.401 16.551  17.101  1.00 47.69  ? 449  ARG C NH1 1 
ATOM   10594 N  NH2 . ARG C 1 403 ? -18.318 17.521  16.266  1.00 47.36  ? 449  ARG C NH2 1 
ATOM   10595 N  N   . ASP C 1 404 ? -12.116 21.742  20.826  1.00 40.82  ? 450  ASP C N   1 
ATOM   10596 C  CA  . ASP C 1 404 ? -11.624 23.116  20.870  1.00 40.77  ? 450  ASP C CA  1 
ATOM   10597 C  C   . ASP C 1 404 ? -10.721 23.418  19.673  1.00 40.38  ? 450  ASP C C   1 
ATOM   10598 O  O   . ASP C 1 404 ? -9.583  22.909  19.591  1.00 40.81  ? 450  ASP C O   1 
ATOM   10599 C  CB  . ASP C 1 404 ? -10.878 23.402  22.185  1.00 40.92  ? 450  ASP C CB  1 
ATOM   10600 C  CG  . ASP C 1 404 ? -10.105 24.738  22.168  1.00 41.79  ? 450  ASP C CG  1 
ATOM   10601 O  OD1 . ASP C 1 404 ? -10.412 25.650  21.371  1.00 43.08  ? 450  ASP C OD1 1 
ATOM   10602 O  OD2 . ASP C 1 404 ? -9.183  24.890  22.977  1.00 43.80  ? 450  ASP C OD2 1 
ATOM   10603 N  N   . PRO C 1 405 ? -11.203 24.271  18.763  1.00 39.53  ? 451  PRO C N   1 
ATOM   10604 C  CA  . PRO C 1 405 ? -10.485 24.546  17.542  1.00 39.52  ? 451  PRO C CA  1 
ATOM   10605 C  C   . PRO C 1 405 ? -9.017  24.871  17.779  1.00 39.58  ? 451  PRO C C   1 
ATOM   10606 O  O   . PRO C 1 405 ? -8.186  24.512  16.963  1.00 39.83  ? 451  PRO C O   1 
ATOM   10607 C  CB  . PRO C 1 405 ? -11.231 25.741  16.968  1.00 39.48  ? 451  PRO C CB  1 
ATOM   10608 C  CG  . PRO C 1 405 ? -12.611 25.531  17.433  1.00 39.35  ? 451  PRO C CG  1 
ATOM   10609 C  CD  . PRO C 1 405 ? -12.450 25.038  18.840  1.00 39.53  ? 451  PRO C CD  1 
ATOM   10610 N  N   . THR C 1 406 ? -8.699  25.514  18.898  1.00 39.73  ? 452  THR C N   1 
ATOM   10611 C  CA  . THR C 1 406 ? -7.317  25.874  19.219  1.00 39.78  ? 452  THR C CA  1 
ATOM   10612 C  C   . THR C 1 406 ? -6.423  24.639  19.386  1.00 40.14  ? 452  THR C C   1 
ATOM   10613 O  O   . THR C 1 406 ? -5.342  24.573  18.804  1.00 40.19  ? 452  THR C O   1 
ATOM   10614 C  CB  . THR C 1 406 ? -7.247  26.716  20.495  1.00 39.79  ? 452  THR C CB  1 
ATOM   10615 O  OG1 . THR C 1 406 ? -8.287  27.692  20.486  1.00 41.15  ? 452  THR C OG1 1 
ATOM   10616 C  CG2 . THR C 1 406 ? -5.927  27.421  20.598  1.00 39.22  ? 452  THR C CG2 1 
ATOM   10617 N  N   . GLU C 1 407 ? -6.869  23.664  20.186  1.00 40.31  ? 453  GLU C N   1 
ATOM   10618 C  CA  . GLU C 1 407 ? -6.156  22.390  20.306  1.00 40.44  ? 453  GLU C CA  1 
ATOM   10619 C  C   . GLU C 1 407 ? -6.020  21.780  18.931  1.00 39.83  ? 453  GLU C C   1 
ATOM   10620 O  O   . GLU C 1 407 ? -4.920  21.418  18.521  1.00 40.49  ? 453  GLU C O   1 
ATOM   10621 C  CB  . GLU C 1 407 ? -6.896  21.402  21.212  1.00 40.76  ? 453  GLU C CB  1 
ATOM   10622 C  CG  . GLU C 1 407 ? -6.586  21.550  22.677  1.00 43.85  ? 453  GLU C CG  1 
ATOM   10623 C  CD  . GLU C 1 407 ? -6.281  20.222  23.343  1.00 47.65  ? 453  GLU C CD  1 
ATOM   10624 O  OE1 . GLU C 1 407 ? -5.310  19.547  22.930  1.00 47.77  ? 453  GLU C OE1 1 
ATOM   10625 O  OE2 . GLU C 1 407 ? -7.000  19.877  24.306  1.00 50.67  ? 453  GLU C OE2 1 
ATOM   10626 N  N   . VAL C 1 408 ? -7.142  21.701  18.220  1.00 38.36  ? 454  VAL C N   1 
ATOM   10627 C  CA  . VAL C 1 408 ? -7.191  21.074  16.918  1.00 37.11  ? 454  VAL C CA  1 
ATOM   10628 C  C   . VAL C 1 408 ? -6.136  21.641  15.978  1.00 36.42  ? 454  VAL C C   1 
ATOM   10629 O  O   . VAL C 1 408 ? -5.494  20.910  15.254  1.00 36.25  ? 454  VAL C O   1 
ATOM   10630 C  CB  . VAL C 1 408 ? -8.587  21.215  16.297  1.00 36.99  ? 454  VAL C CB  1 
ATOM   10631 C  CG1 . VAL C 1 408 ? -8.693  20.350  15.077  1.00 36.56  ? 454  VAL C CG1 1 
ATOM   10632 C  CG2 . VAL C 1 408 ? -9.648  20.796  17.311  1.00 36.84  ? 454  VAL C CG2 1 
ATOM   10633 N  N   . THR C 1 409 ? -5.945  22.948  16.012  1.00 35.72  ? 455  THR C N   1 
ATOM   10634 C  CA  . THR C 1 409 ? -4.985  23.604  15.136  1.00 35.02  ? 455  THR C CA  1 
ATOM   10635 C  C   . THR C 1 409 ? -3.586  23.347  15.635  1.00 34.62  ? 455  THR C C   1 
ATOM   10636 O  O   . THR C 1 409 ? -2.674  23.163  14.853  1.00 34.64  ? 455  THR C O   1 
ATOM   10637 C  CB  . THR C 1 409 ? -5.230  25.114  15.077  1.00 35.12  ? 455  THR C CB  1 
ATOM   10638 O  OG1 . THR C 1 409 ? -6.624  25.349  14.874  1.00 35.35  ? 455  THR C OG1 1 
ATOM   10639 C  CG2 . THR C 1 409 ? -4.463  25.757  13.923  1.00 35.19  ? 455  THR C CG2 1 
ATOM   10640 N  N   . ALA C 1 410 ? -3.427  23.342  16.950  1.00 34.45  ? 456  ALA C N   1 
ATOM   10641 C  CA  . ALA C 1 410 ? -2.151  23.086  17.577  1.00 34.37  ? 456  ALA C CA  1 
ATOM   10642 C  C   . ALA C 1 410 ? -1.567  21.764  17.104  1.00 34.40  ? 456  ALA C C   1 
ATOM   10643 O  O   . ALA C 1 410 ? -0.523  21.738  16.494  1.00 34.67  ? 456  ALA C O   1 
ATOM   10644 C  CB  . ALA C 1 410 ? -2.329  23.056  19.067  1.00 34.83  ? 456  ALA C CB  1 
ATOM   10645 N  N   . ILE C 1 411 ? -2.263  20.669  17.366  1.00 34.36  ? 457  ILE C N   1 
ATOM   10646 C  CA  . ILE C 1 411 ? -1.787  19.344  16.959  1.00 34.39  ? 457  ILE C CA  1 
ATOM   10647 C  C   . ILE C 1 411 ? -1.546  19.275  15.438  1.00 34.32  ? 457  ILE C C   1 
ATOM   10648 O  O   . ILE C 1 411 ? -0.532  18.703  14.990  1.00 34.46  ? 457  ILE C O   1 
ATOM   10649 C  CB  . ILE C 1 411 ? -2.723  18.216  17.447  1.00 34.14  ? 457  ILE C CB  1 
ATOM   10650 C  CG1 . ILE C 1 411 ? -1.994  16.867  17.366  1.00 35.45  ? 457  ILE C CG1 1 
ATOM   10651 C  CG2 . ILE C 1 411 ? -4.048  18.248  16.710  1.00 33.01  ? 457  ILE C CG2 1 
ATOM   10652 C  CD1 . ILE C 1 411 ? -2.861  15.610  17.753  1.00 35.19  ? 457  ILE C CD1 1 
ATOM   10653 N  N   . GLY C 1 412 ? -2.446  19.886  14.659  1.00 33.50  ? 458  GLY C N   1 
ATOM   10654 C  CA  . GLY C 1 412 ? -2.237  19.964  13.229  1.00 33.38  ? 458  GLY C CA  1 
ATOM   10655 C  C   . GLY C 1 412 ? -0.873  20.599  12.969  1.00 33.54  ? 458  GLY C C   1 
ATOM   10656 O  O   . GLY C 1 412 ? -0.051  20.080  12.203  1.00 33.47  ? 458  GLY C O   1 
ATOM   10657 N  N   . ALA C 1 413 ? -0.624  21.705  13.650  1.00 33.06  ? 459  ALA C N   1 
ATOM   10658 C  CA  . ALA C 1 413 ? 0.559   22.501  13.399  1.00 33.47  ? 459  ALA C CA  1 
ATOM   10659 C  C   . ALA C 1 413 ? 1.815   21.719  13.766  1.00 33.42  ? 459  ALA C C   1 
ATOM   10660 O  O   . ALA C 1 413 ? 2.813   21.683  13.033  1.00 33.28  ? 459  ALA C O   1 
ATOM   10661 C  CB  . ALA C 1 413 ? 0.486   23.826  14.169  1.00 32.96  ? 459  ALA C CB  1 
ATOM   10662 N  N   . VAL C 1 414 ? 1.743   21.054  14.896  1.00 33.85  ? 460  VAL C N   1 
ATOM   10663 C  CA  . VAL C 1 414 ? 2.836   20.216  15.332  1.00 34.32  ? 460  VAL C CA  1 
ATOM   10664 C  C   . VAL C 1 414 ? 3.120   19.109  14.303  1.00 34.54  ? 460  VAL C C   1 
ATOM   10665 O  O   . VAL C 1 414 ? 4.266   18.857  13.944  1.00 34.43  ? 460  VAL C O   1 
ATOM   10666 C  CB  . VAL C 1 414 ? 2.546   19.661  16.720  1.00 34.06  ? 460  VAL C CB  1 
ATOM   10667 C  CG1 . VAL C 1 414 ? 3.604   18.654  17.122  1.00 34.41  ? 460  VAL C CG1 1 
ATOM   10668 C  CG2 . VAL C 1 414 ? 2.508   20.809  17.709  1.00 33.76  ? 460  VAL C CG2 1 
ATOM   10669 N  N   . GLU C 1 415 ? 2.058   18.488  13.806  1.00 34.73  ? 461  GLU C N   1 
ATOM   10670 C  CA  . GLU C 1 415 ? 2.214   17.432  12.845  1.00 34.86  ? 461  GLU C CA  1 
ATOM   10671 C  C   . GLU C 1 415 ? 2.902   17.977  11.589  1.00 34.78  ? 461  GLU C C   1 
ATOM   10672 O  O   . GLU C 1 415 ? 3.826   17.350  11.061  1.00 34.63  ? 461  GLU C O   1 
ATOM   10673 C  CB  . GLU C 1 415 ? 0.863   16.818  12.543  1.00 35.02  ? 461  GLU C CB  1 
ATOM   10674 C  CG  . GLU C 1 415 ? 0.852   15.776  11.452  1.00 37.55  ? 461  GLU C CG  1 
ATOM   10675 C  CD  . GLU C 1 415 ? 1.505   14.458  11.872  1.00 41.67  ? 461  GLU C CD  1 
ATOM   10676 O  OE1 . GLU C 1 415 ? 0.942   13.785  12.756  1.00 41.88  ? 461  GLU C OE1 1 
ATOM   10677 O  OE2 . GLU C 1 415 ? 2.574   14.082  11.304  1.00 43.50  ? 461  GLU C OE2 1 
ATOM   10678 N  N   . ALA C 1 416 ? 2.461   19.149  11.127  1.00 34.39  ? 462  ALA C N   1 
ATOM   10679 C  CA  . ALA C 1 416 ? 2.944   19.