data_2VIG
# 
_entry.id   2VIG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VIG         
PDBE  EBI-34614    
WWPDB D_1290034614 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VIG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pike, A.C.W.'     1  
'Pantic, N.'       2  
'Parizotto, E.'    3  
'Gileadi, O.'      4  
'Ugochukwu, E.'    5  
'von Delft, F.'    6  
'Weigelt, J.'      7  
'Arrowsmith, C.H.' 8  
'Edwards, A.'      9  
'Oppermann, U.'    10 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Short-Chain Acyl Coa Dehydrogenase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pike, A.C.W.'     1  
primary 'Pantic, N.'       2  
primary 'Parizotto, E.'    3  
primary 'Gileadi, O.'      4  
primary 'Ugochukwu, E.'    5  
primary 'von Delft, F.'    6  
primary 'Weigelt, J.'      7  
primary 'Arrowsmith, C.H.' 8  
primary 'Edwards, A.'      9  
primary 'Oppermann, U.'    10 
# 
_cell.entry_id           2VIG 
_cell.length_a           85.714 
_cell.length_b           157.620 
_cell.length_c           260.843 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VIG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SHORT-CHAIN SPECIFIC ACYL-COA DEHYDROGENASE,' 42163.449 8    1.3.99.2 ? 'RESIDUES 30-412' ? 
2 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                  785.550   8    ?        ? ?                 ? 
3 non-polymer syn 1,2-ETHANEDIOL                                 62.068    12   ?        ? ?                 ? 
4 non-polymer syn 'COENZYME A PERSULFIDE'                        799.599   5    ?        ? ?                 ? 
5 water       nat water                                          18.015    1128 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SCAD, BUTYRYL-COA DEHYDROGENASE, ACYL COA DEHYDROGENASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRG
CASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITN
AWEASAAVVFASTDRALQNKSISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTL
DMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMA
KLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRSAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRG
CASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITN
AWEASAAVVFASTDRALQNKSISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTL
DMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMA
KLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRSAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLN n 
1 3   SER n 
1 4   VAL n 
1 5   GLU n 
1 6   LEU n 
1 7   PRO n 
1 8   GLU n 
1 9   THR n 
1 10  HIS n 
1 11  GLN n 
1 12  MET n 
1 13  LEU n 
1 14  LEU n 
1 15  GLN n 
1 16  THR n 
1 17  CYS n 
1 18  ARG n 
1 19  ASP n 
1 20  PHE n 
1 21  ALA n 
1 22  GLU n 
1 23  LYS n 
1 24  GLU n 
1 25  LEU n 
1 26  PHE n 
1 27  PRO n 
1 28  ILE n 
1 29  ALA n 
1 30  ALA n 
1 31  GLN n 
1 32  VAL n 
1 33  ASP n 
1 34  LYS n 
1 35  GLU n 
1 36  HIS n 
1 37  LEU n 
1 38  PHE n 
1 39  PRO n 
1 40  ALA n 
1 41  ALA n 
1 42  GLN n 
1 43  VAL n 
1 44  LYS n 
1 45  LYS n 
1 46  MET n 
1 47  GLY n 
1 48  GLY n 
1 49  LEU n 
1 50  GLY n 
1 51  LEU n 
1 52  LEU n 
1 53  ALA n 
1 54  MET n 
1 55  ASP n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  LEU n 
1 61  GLY n 
1 62  GLY n 
1 63  ALA n 
1 64  GLY n 
1 65  LEU n 
1 66  ASP n 
1 67  TYR n 
1 68  LEU n 
1 69  ALA n 
1 70  TYR n 
1 71  ALA n 
1 72  ILE n 
1 73  ALA n 
1 74  MET n 
1 75  GLU n 
1 76  GLU n 
1 77  ILE n 
1 78  SER n 
1 79  ARG n 
1 80  GLY n 
1 81  CYS n 
1 82  ALA n 
1 83  SER n 
1 84  THR n 
1 85  GLY n 
1 86  VAL n 
1 87  ILE n 
1 88  MET n 
1 89  SER n 
1 90  VAL n 
1 91  ASN n 
1 92  ASN n 
1 93  SER n 
1 94  LEU n 
1 95  TYR n 
1 96  LEU n 
1 97  GLY n 
1 98  PRO n 
1 99  ILE n 
1 100 LEU n 
1 101 LYS n 
1 102 PHE n 
1 103 GLY n 
1 104 SER n 
1 105 LYS n 
1 106 GLU n 
1 107 GLN n 
1 108 LYS n 
1 109 GLN n 
1 110 ALA n 
1 111 TRP n 
1 112 VAL n 
1 113 THR n 
1 114 PRO n 
1 115 PHE n 
1 116 THR n 
1 117 SER n 
1 118 GLY n 
1 119 ASP n 
1 120 LYS n 
1 121 ILE n 
1 122 GLY n 
1 123 CYS n 
1 124 PHE n 
1 125 ALA n 
1 126 LEU n 
1 127 SER n 
1 128 GLU n 
1 129 PRO n 
1 130 GLY n 
1 131 ASN n 
1 132 GLY n 
1 133 SER n 
1 134 ASP n 
1 135 ALA n 
1 136 GLY n 
1 137 ALA n 
1 138 ALA n 
1 139 SER n 
1 140 THR n 
1 141 THR n 
1 142 ALA n 
1 143 ARG n 
1 144 ALA n 
1 145 GLU n 
1 146 GLY n 
1 147 ASP n 
1 148 SER n 
1 149 TRP n 
1 150 VAL n 
1 151 LEU n 
1 152 ASN n 
1 153 GLY n 
1 154 THR n 
1 155 LYS n 
1 156 ALA n 
1 157 TRP n 
1 158 ILE n 
1 159 THR n 
1 160 ASN n 
1 161 ALA n 
1 162 TRP n 
1 163 GLU n 
1 164 ALA n 
1 165 SER n 
1 166 ALA n 
1 167 ALA n 
1 168 VAL n 
1 169 VAL n 
1 170 PHE n 
1 171 ALA n 
1 172 SER n 
1 173 THR n 
1 174 ASP n 
1 175 ARG n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 ASN n 
1 180 LYS n 
1 181 SER n 
1 182 ILE n 
1 183 SER n 
1 184 ALA n 
1 185 PHE n 
1 186 LEU n 
1 187 VAL n 
1 188 PRO n 
1 189 MET n 
1 190 PRO n 
1 191 THR n 
1 192 PRO n 
1 193 GLY n 
1 194 LEU n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 LYS n 
1 199 LYS n 
1 200 GLU n 
1 201 ASP n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ARG n 
1 207 GLY n 
1 208 SER n 
1 209 SER n 
1 210 THR n 
1 211 ALA n 
1 212 ASN n 
1 213 LEU n 
1 214 ILE n 
1 215 PHE n 
1 216 GLU n 
1 217 ASP n 
1 218 CYS n 
1 219 ARG n 
1 220 ILE n 
1 221 PRO n 
1 222 LYS n 
1 223 ASP n 
1 224 SER n 
1 225 ILE n 
1 226 LEU n 
1 227 GLY n 
1 228 GLU n 
1 229 PRO n 
1 230 GLY n 
1 231 MET n 
1 232 GLY n 
1 233 PHE n 
1 234 LYS n 
1 235 ILE n 
1 236 ALA n 
1 237 MET n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 ASP n 
1 242 MET n 
1 243 GLY n 
1 244 ARG n 
1 245 ILE n 
1 246 GLY n 
1 247 ILE n 
1 248 ALA n 
1 249 SER n 
1 250 GLN n 
1 251 ALA n 
1 252 LEU n 
1 253 GLY n 
1 254 ILE n 
1 255 ALA n 
1 256 GLN n 
1 257 THR n 
1 258 ALA n 
1 259 LEU n 
1 260 ASP n 
1 261 CYS n 
1 262 ALA n 
1 263 VAL n 
1 264 ASN n 
1 265 TYR n 
1 266 ALA n 
1 267 GLU n 
1 268 ASN n 
1 269 ARG n 
1 270 MET n 
1 271 ALA n 
1 272 PHE n 
1 273 GLY n 
1 274 ALA n 
1 275 PRO n 
1 276 LEU n 
1 277 THR n 
1 278 LYS n 
1 279 LEU n 
1 280 GLN n 
1 281 VAL n 
1 282 ILE n 
1 283 GLN n 
1 284 PHE n 
1 285 LYS n 
1 286 LEU n 
1 287 ALA n 
1 288 ASP n 
1 289 MET n 
1 290 ALA n 
1 291 LEU n 
1 292 ALA n 
1 293 LEU n 
1 294 GLU n 
1 295 SER n 
1 296 ALA n 
1 297 ARG n 
1 298 LEU n 
1 299 LEU n 
1 300 THR n 
1 301 TRP n 
1 302 ARG n 
1 303 ALA n 
1 304 ALA n 
1 305 MET n 
1 306 LEU n 
1 307 LYS n 
1 308 ASP n 
1 309 ASN n 
1 310 LYS n 
1 311 LYS n 
1 312 PRO n 
1 313 PHE n 
1 314 ILE n 
1 315 LYS n 
1 316 GLU n 
1 317 ALA n 
1 318 ALA n 
1 319 MET n 
1 320 ALA n 
1 321 LYS n 
1 322 LEU n 
1 323 ALA n 
1 324 ALA n 
1 325 SER n 
1 326 GLU n 
1 327 ALA n 
1 328 ALA n 
1 329 THR n 
1 330 ALA n 
1 331 ILE n 
1 332 SER n 
1 333 HIS n 
1 334 GLN n 
1 335 ALA n 
1 336 ILE n 
1 337 GLN n 
1 338 ILE n 
1 339 LEU n 
1 340 GLY n 
1 341 GLY n 
1 342 MET n 
1 343 GLY n 
1 344 TYR n 
1 345 VAL n 
1 346 THR n 
1 347 GLU n 
1 348 MET n 
1 349 PRO n 
1 350 ALA n 
1 351 GLU n 
1 352 ARG n 
1 353 HIS n 
1 354 TYR n 
1 355 ARG n 
1 356 ASP n 
1 357 ALA n 
1 358 ARG n 
1 359 ILE n 
1 360 THR n 
1 361 GLU n 
1 362 ILE n 
1 363 TYR n 
1 364 GLU n 
1 365 GLY n 
1 366 THR n 
1 367 SER n 
1 368 GLU n 
1 369 ILE n 
1 370 GLN n 
1 371 ARG n 
1 372 LEU n 
1 373 VAL n 
1 374 ILE n 
1 375 ALA n 
1 376 GLY n 
1 377 HIS n 
1 378 LEU n 
1 379 LEU n 
1 380 ARG n 
1 381 SER n 
1 382 TYR n 
1 383 ARG n 
1 384 SER n 
1 385 ALA n 
1 386 GLU n 
1 387 ASN n 
1 388 LEU n 
1 389 TYR n 
1 390 PHE n 
1 391 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-CTHF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2VIG        1 ? ? 2VIG   ? 
2 UNP ACADS_HUMAN 1 ? ? P16219 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2VIG A 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
2  2 2VIG A 2   ? 384 ? P16219 30  ? 412 ? 30  412 
3  1 2VIG A 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
4  1 2VIG B 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
5  2 2VIG B 2   ? 384 ? P16219 30  ? 412 ? 30  412 
6  1 2VIG B 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
7  1 2VIG C 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
8  2 2VIG C 2   ? 384 ? P16219 30  ? 412 ? 30  412 
9  1 2VIG C 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
10 1 2VIG D 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
11 2 2VIG D 2   ? 384 ? P16219 30  ? 412 ? 30  412 
12 1 2VIG D 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
13 1 2VIG E 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
14 2 2VIG E 2   ? 384 ? P16219 30  ? 412 ? 30  412 
15 1 2VIG E 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
16 1 2VIG F 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
17 2 2VIG F 2   ? 384 ? P16219 30  ? 412 ? 30  412 
18 1 2VIG F 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
19 1 2VIG G 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
20 2 2VIG G 2   ? 384 ? P16219 30  ? 412 ? 30  412 
21 1 2VIG G 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
22 1 2VIG H 1   ? 1   ? 2VIG   29  ? 29  ? 29  29  
23 2 2VIG H 2   ? 384 ? P16219 30  ? 412 ? 30  412 
24 1 2VIG H 385 ? 391 ? 2VIG   413 ? 419 ? 413 419 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2VIG SER A 181 ? UNP P16219 GLY 209 conflict 209 1 
4  2VIG SER B 181 ? UNP P16219 GLY 209 conflict 209 2 
7  2VIG SER C 181 ? UNP P16219 GLY 209 conflict 209 3 
10 2VIG SER D 181 ? UNP P16219 GLY 209 conflict 209 4 
13 2VIG SER E 181 ? UNP P16219 GLY 209 conflict 209 5 
16 2VIG SER F 181 ? UNP P16219 GLY 209 conflict 209 6 
19 2VIG SER G 181 ? UNP P16219 GLY 209 conflict 209 7 
22 2VIG SER H 181 ? UNP P16219 GLY 209 conflict 209 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE                      ?                 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                 'C4 H7 N O4'           133.103 
COS non-polymer         . 'COENZYME A PERSULFIDE'       ?                 'C21 H36 N7 O16 P3 S2' 799.599 
CYS 'L-peptide linking' y CYSTEINE                      ?                 'C3 H7 N O2 S'         121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                'ETHYLENE GLYCOL' 'C2 H6 O2'             62.068  
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ?                 'C27 H33 N9 O15 P2'    785.550 
GLN 'L-peptide linking' y GLUTAMINE                     ?                 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                       ?                 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER                         ?                 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                        ?                 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE                    ?                 'C5 H11 N O2 S'        149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                       ?                 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE                        ?                 'C3 H7 N O3'           105.093 
THR 'L-peptide linking' y THREONINE                     ?                 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE                        ?                 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          2VIG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.43 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2M AMMONIUM CHLORIDE, 20% PEG6000, 10% ETHYLENE GLYCOL, 0.1M TRIS-HCL PH8.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-08-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98074 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.98074 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VIG 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             17.90 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   275882 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.23 
_reflns.B_iso_Wilson_estimate        22.56 
_reflns.pdbx_redundancy              4.98 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.99 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.51 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.00 
_reflns_shell.pdbx_redundancy        4.99 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VIG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     274018 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.89 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.231 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.600 
_refine.ls_number_reflns_R_free                  1730 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               23.87 
_refine.aniso_B[1][1]                            3.44000 
_refine.aniso_B[2][2]                            -2.53000 
_refine.aniso_B[3][3]                            -0.91000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. DENSITY ADJACENT TO FAD IN THE ACTIVE SITE HAS BEEN MODELLED AS COENZYME-A PERSULPHIDE. BOUND COS IS MOST APPARENT IN CHAIN G BUT NOT FULLY OCCUPIED IN OTHER CHAINS. NO ATTEMPT WAS MADE TO MODEL OCCUPANCY SO TEMPERATURE FACTORS ARE HIGH.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1JQI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.139 
_refine.pdbx_overall_ESU_R_Free                  0.130 
_refine.overall_SU_ML                            0.119 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.187 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22282 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         600 
_refine_hist.number_atoms_solvent             1128 
_refine_hist.number_atoms_total               24010 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        17.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 23326 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.003  0.020  ? 15457 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.360  1.999  ? 31633 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.028  3.002  ? 37556 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.503  5.000  ? 2993  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.422 24.194 ? 837   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.423 15.000 ? 3816  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.893 15.000 ? 118   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.083  0.200  ? 3620  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 25737 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 4433  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.199  0.200  ? 4952  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.185  0.200  ? 15924 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.172  0.200  ? 11292 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.090  0.200  ? 11520 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.152  0.200  ? 1206  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.078  0.200  ? 6     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.230  0.200  ? 49    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.154  0.200  ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.940  3.000  ? 15362 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.597  5.000  ? 23579 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.151  8.000  ? 9311  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.062  11.000 ? 8054  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 4377 0.22 0.50  'medium positional' 1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 4377 0.19 0.00  'medium positional' 1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 4377 0.19 0.00  'medium positional' 1 3  'X-RAY DIFFRACTION' ? ? ? 
4 D 4377 0.19 0.00  'medium positional' 1 4  'X-RAY DIFFRACTION' ? ? ? 
5 E 4377 0.18 0.00  'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
6 F 4377 0.23 0.00  'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? 
7 G 4377 0.20 0.00  'medium positional' 1 7  'X-RAY DIFFRACTION' ? ? ? 
8 H 4377 0.19 0.00  'medium positional' 1 8  'X-RAY DIFFRACTION' ? ? ? 
1 A 55   0.65 5.00  'loose positional'  1 9  'X-RAY DIFFRACTION' ? ? ? 
2 B 55   0.27 0.09  'loose positional'  1 10 'X-RAY DIFFRACTION' ? ? ? 
3 C 55   0.29 0.00  'loose positional'  1 11 'X-RAY DIFFRACTION' ? ? ? 
4 D 55   0.57 0.00  'loose positional'  1 12 'X-RAY DIFFRACTION' ? ? ? 
5 E 55   0.49 0.00  'loose positional'  1 13 'X-RAY DIFFRACTION' ? ? ? 
6 F 55   0.32 0.00  'loose positional'  1 14 'X-RAY DIFFRACTION' ? ? ? 
7 G 55   0.26 0.00  'loose positional'  1 15 'X-RAY DIFFRACTION' ? ? ? 
8 H 55   0.60 0.00  'loose positional'  1 16 'X-RAY DIFFRACTION' ? ? ? 
1 A 4377 1.39 2.00  'medium thermal'    1 17 'X-RAY DIFFRACTION' ? ? ? 
2 B 4377 1.19 0.00  'medium thermal'    1 18 'X-RAY DIFFRACTION' ? ? ? 
3 C 4377 1.04 0.00  'medium thermal'    1 19 'X-RAY DIFFRACTION' ? ? ? 
4 D 4377 1.02 0.00  'medium thermal'    1 20 'X-RAY DIFFRACTION' ? ? ? 
5 E 4377 1.16 0.00  'medium thermal'    1 21 'X-RAY DIFFRACTION' ? ? ? 
6 F 4377 1.31 0.00  'medium thermal'    1 22 'X-RAY DIFFRACTION' ? ? ? 
7 G 4377 1.13 0.00  'medium thermal'    1 23 'X-RAY DIFFRACTION' ? ? ? 
8 H 4377 1.18 0.00  'medium thermal'    1 24 'X-RAY DIFFRACTION' ? ? ? 
1 A 55   2.08 10.00 'loose thermal'     1 25 'X-RAY DIFFRACTION' ? ? ? 
2 B 55   0.99 0.18  'loose thermal'     1 26 'X-RAY DIFFRACTION' ? ? ? 
3 C 55   0.94 0.00  'loose thermal'     1 27 'X-RAY DIFFRACTION' ? ? ? 
4 D 55   0.83 0.00  'loose thermal'     1 28 'X-RAY DIFFRACTION' ? ? ? 
5 E 55   0.93 0.00  'loose thermal'     1 29 'X-RAY DIFFRACTION' ? ? ? 
6 F 55   1.47 0.00  'loose thermal'     1 30 'X-RAY DIFFRACTION' ? ? ? 
7 G 55   0.94 0.00  'loose thermal'     1 31 'X-RAY DIFFRACTION' ? ? ? 
8 H 55   1.10 0.00  'loose thermal'     1 32 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.95 
_refine_ls_shell.number_reflns_R_work             19885 
_refine_ls_shell.R_factor_R_work                  0.3440 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3530 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             101 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.971950 0.234990  0.009190  0.234940  0.968490  0.082610  0.010510  0.082450  -0.996540 -15.05459 -0.89465  64.60194  
2 given ? 0.954940  -0.246230 0.165740  -0.245270 -0.969090 -0.026590 0.167160  -0.015260 -0.985810 -7.55474  -15.63447 64.82802  
3 given ? -0.984150 -0.001220 -0.177320 0.011550  -0.998300 -0.057190 -0.176950 -0.058330 0.982490  -10.98226 -12.68379 -1.45823  
4 given ? -0.910670 -0.023670 -0.412460 -0.056620 -0.981790 0.181350  -0.409240 0.188510  0.892740  -27.63089 -23.21614 66.88654  
5 given ? 0.878680  -0.275210 0.390090  -0.179270 -0.947530 -0.264670 0.442460  0.162620  -0.881920 -40.12488 -9.65566  130.82877 
6 given ? -0.937530 0.245270  0.246750  0.206600  0.963120  -0.172380 -0.279930 -0.110640 -0.953620 -46.97618 4.59595   125.26363 
7 given ? 0.970450  0.046170  -0.236830 0.015410  0.967660  0.251780  0.240800  -0.248000 0.938360  -17.01266 -10.53792 67.91837  
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
5 E 1 
6 F 1 
7 G 1 
8 H 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 34  A 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 34  B 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 34  C 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 34  D 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
5 E 34  E 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
6 F 34  F 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
7 G 34  G 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
8 H 34  H 172 1 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 173 A 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
2 B 173 B 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
3 C 173 C 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
4 D 173 D 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
5 E 173 E 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
6 F 173 F 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
7 G 173 G 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
8 H 173 H 177 2 6 ? ? ? ? ? ? ? ? 1 ? 
1 A 178 A 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 178 B 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 178 C 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 178 D 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
5 E 178 E 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
6 F 178 F 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
7 G 178 G 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
8 H 178 H 201 3 4 ? ? ? ? ? ? ? ? 1 ? 
1 A 211 A 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 211 B 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 211 C 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 211 D 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
5 E 211 E 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
6 F 211 F 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
7 G 211 G 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
8 H 211 H 411 4 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2VIG 
_struct.title                     'Crystal structure of human short-chain acyl CoA dehydrogenase' 
_struct.pdbx_descriptor           'SHORT-CHAIN SPECIFIC ACYL-COA DEHYDROGENASE, (E.C.1.3.99.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VIG 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;FATTY ACID METABOLISM, FAD, POLYMORPHISM, FLAVOPROTEIN, MITOCHONDRION, DISEASE MUTATION, LIPID METABOLISM, OXIDOREDUCTASE, BETA OXIDATION, TRANSIT PEPTIDE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 4 ? 
M  N N 3 ? 
N  N N 2 ? 
O  N N 4 ? 
P  N N 2 ? 
Q  N N 4 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 2 ? 
Y  N N 4 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 4 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
OA N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PRO A 7   ? LEU A 25  ? PRO A 35  LEU A 53  1 ? 19 
HELX_P HELX_P2   2   ILE A 28  ? HIS A 36  ? ILE A 56  HIS A 64  1 ? 9  
HELX_P HELX_P3   3   PRO A 39  ? GLY A 50  ? PRO A 67  GLY A 78  1 ? 12 
HELX_P HELX_P4   4   PRO A 57  ? GLY A 61  ? PRO A 85  GLY A 89  5 ? 5  
HELX_P HELX_P5   5   ASP A 66  ? CYS A 81  ? ASP A 94  CYS A 109 1 ? 16 
HELX_P HELX_P6   6   CYS A 81  ? LEU A 94  ? CYS A 109 LEU A 122 1 ? 14 
HELX_P HELX_P7   7   TYR A 95  ? GLY A 103 ? TYR A 123 GLY A 131 1 ? 9  
HELX_P HELX_P8   8   SER A 104 ? VAL A 112 ? SER A 132 VAL A 140 1 ? 9  
HELX_P HELX_P9   9   THR A 113 ? THR A 116 ? THR A 141 THR A 144 5 ? 4  
HELX_P HELX_P10  10  ASP A 134 ? ALA A 138 ? ASP A 162 ALA A 166 5 ? 5  
HELX_P HELX_P11  11  MET A 231 ? ARG A 269 ? MET A 259 ARG A 297 1 ? 39 
HELX_P HELX_P12  12  LEU A 279 ? ASN A 309 ? LEU A 307 ASN A 337 1 ? 31 
HELX_P HELX_P13  13  PHE A 313 ? GLY A 340 ? PHE A 341 GLY A 368 1 ? 28 
HELX_P HELX_P14  14  GLY A 341 ? TYR A 344 ? GLY A 369 TYR A 372 5 ? 4  
HELX_P HELX_P15  15  PRO A 349 ? GLU A 361 ? PRO A 377 GLU A 389 1 ? 13 
HELX_P HELX_P16  16  THR A 366 ? SER A 384 ? THR A 394 SER A 412 1 ? 19 
HELX_P HELX_P17  17  PRO B 7   ? LEU B 25  ? PRO B 35  LEU B 53  1 ? 19 
HELX_P HELX_P18  18  ILE B 28  ? GLU B 35  ? ILE B 56  GLU B 63  1 ? 8  
HELX_P HELX_P19  19  PRO B 39  ? GLY B 50  ? PRO B 67  GLY B 78  1 ? 12 
HELX_P HELX_P20  20  PRO B 57  ? GLY B 61  ? PRO B 85  GLY B 89  5 ? 5  
HELX_P HELX_P21  21  ASP B 66  ? CYS B 81  ? ASP B 94  CYS B 109 1 ? 16 
HELX_P HELX_P22  22  CYS B 81  ? LEU B 94  ? CYS B 109 LEU B 122 1 ? 14 
HELX_P HELX_P23  23  TYR B 95  ? GLY B 103 ? TYR B 123 GLY B 131 1 ? 9  
HELX_P HELX_P24  24  SER B 104 ? VAL B 112 ? SER B 132 VAL B 140 1 ? 9  
HELX_P HELX_P25  25  THR B 113 ? THR B 116 ? THR B 141 THR B 144 5 ? 4  
HELX_P HELX_P26  26  ASP B 134 ? ALA B 138 ? ASP B 162 ALA B 166 5 ? 5  
HELX_P HELX_P27  27  MET B 231 ? ARG B 269 ? MET B 259 ARG B 297 1 ? 39 
HELX_P HELX_P28  28  LEU B 279 ? ASN B 309 ? LEU B 307 ASN B 337 1 ? 31 
HELX_P HELX_P29  29  PHE B 313 ? GLY B 340 ? PHE B 341 GLY B 368 1 ? 28 
HELX_P HELX_P30  30  GLY B 341 ? TYR B 344 ? GLY B 369 TYR B 372 5 ? 4  
HELX_P HELX_P31  31  PRO B 349 ? THR B 360 ? PRO B 377 THR B 388 1 ? 12 
HELX_P HELX_P32  32  THR B 366 ? ARG B 383 ? THR B 394 ARG B 411 1 ? 18 
HELX_P HELX_P33  33  PRO C 7   ? LEU C 25  ? PRO C 35  LEU C 53  1 ? 19 
HELX_P HELX_P34  34  ILE C 28  ? HIS C 36  ? ILE C 56  HIS C 64  1 ? 9  
HELX_P HELX_P35  35  PRO C 39  ? GLY C 50  ? PRO C 67  GLY C 78  1 ? 12 
HELX_P HELX_P36  36  PRO C 57  ? GLY C 61  ? PRO C 85  GLY C 89  5 ? 5  
HELX_P HELX_P37  37  ASP C 66  ? CYS C 81  ? ASP C 94  CYS C 109 1 ? 16 
HELX_P HELX_P38  38  CYS C 81  ? LEU C 94  ? CYS C 109 LEU C 122 1 ? 14 
HELX_P HELX_P39  39  TYR C 95  ? GLY C 103 ? TYR C 123 GLY C 131 1 ? 9  
HELX_P HELX_P40  40  SER C 104 ? VAL C 112 ? SER C 132 VAL C 140 1 ? 9  
HELX_P HELX_P41  41  THR C 113 ? THR C 116 ? THR C 141 THR C 144 5 ? 4  
HELX_P HELX_P42  42  ASP C 134 ? ALA C 138 ? ASP C 162 ALA C 166 5 ? 5  
HELX_P HELX_P43  43  MET C 231 ? ARG C 269 ? MET C 259 ARG C 297 1 ? 39 
HELX_P HELX_P44  44  LEU C 279 ? ASN C 309 ? LEU C 307 ASN C 337 1 ? 31 
HELX_P HELX_P45  45  PHE C 313 ? GLY C 340 ? PHE C 341 GLY C 368 1 ? 28 
HELX_P HELX_P46  46  GLY C 341 ? TYR C 344 ? GLY C 369 TYR C 372 5 ? 4  
HELX_P HELX_P47  47  PRO C 349 ? ARG C 358 ? PRO C 377 ARG C 386 1 ? 10 
HELX_P HELX_P48  48  ILE C 359 ? ILE C 362 ? ILE C 387 ILE C 390 5 ? 4  
HELX_P HELX_P49  49  THR C 366 ? LEU C 388 ? THR C 394 LEU C 416 1 ? 23 
HELX_P HELX_P50  50  PRO D 7   ? LEU D 25  ? PRO D 35  LEU D 53  1 ? 19 
HELX_P HELX_P51  51  ILE D 28  ? HIS D 36  ? ILE D 56  HIS D 64  1 ? 9  
HELX_P HELX_P52  52  PRO D 39  ? LEU D 49  ? PRO D 67  LEU D 77  1 ? 11 
HELX_P HELX_P53  53  PRO D 57  ? GLY D 61  ? PRO D 85  GLY D 89  5 ? 5  
HELX_P HELX_P54  54  ASP D 66  ? CYS D 81  ? ASP D 94  CYS D 109 1 ? 16 
HELX_P HELX_P55  55  CYS D 81  ? LEU D 94  ? CYS D 109 LEU D 122 1 ? 14 
HELX_P HELX_P56  56  TYR D 95  ? GLY D 103 ? TYR D 123 GLY D 131 1 ? 9  
HELX_P HELX_P57  57  SER D 104 ? VAL D 112 ? SER D 132 VAL D 140 1 ? 9  
HELX_P HELX_P58  58  THR D 113 ? THR D 116 ? THR D 141 THR D 144 5 ? 4  
HELX_P HELX_P59  59  ASP D 134 ? ALA D 138 ? ASP D 162 ALA D 166 5 ? 5  
HELX_P HELX_P60  60  MET D 231 ? ARG D 269 ? MET D 259 ARG D 297 1 ? 39 
HELX_P HELX_P61  61  LEU D 279 ? ASN D 309 ? LEU D 307 ASN D 337 1 ? 31 
HELX_P HELX_P62  62  PHE D 313 ? GLY D 340 ? PHE D 341 GLY D 368 1 ? 28 
HELX_P HELX_P63  63  GLY D 341 ? TYR D 344 ? GLY D 369 TYR D 372 5 ? 4  
HELX_P HELX_P64  64  PRO D 349 ? THR D 360 ? PRO D 377 THR D 388 1 ? 12 
HELX_P HELX_P65  65  THR D 366 ? ALA D 385 ? THR D 394 ALA D 413 1 ? 20 
HELX_P HELX_P66  66  PRO E 7   ? LEU E 25  ? PRO E 35  LEU E 53  1 ? 19 
HELX_P HELX_P67  67  ILE E 28  ? HIS E 36  ? ILE E 56  HIS E 64  1 ? 9  
HELX_P HELX_P68  68  PRO E 39  ? GLY E 50  ? PRO E 67  GLY E 78  1 ? 12 
HELX_P HELX_P69  69  PRO E 57  ? GLY E 61  ? PRO E 85  GLY E 89  5 ? 5  
HELX_P HELX_P70  70  ASP E 66  ? CYS E 81  ? ASP E 94  CYS E 109 1 ? 16 
HELX_P HELX_P71  71  CYS E 81  ? LEU E 94  ? CYS E 109 LEU E 122 1 ? 14 
HELX_P HELX_P72  72  TYR E 95  ? GLY E 103 ? TYR E 123 GLY E 131 1 ? 9  
HELX_P HELX_P73  73  SER E 104 ? VAL E 112 ? SER E 132 VAL E 140 1 ? 9  
HELX_P HELX_P74  74  THR E 113 ? THR E 116 ? THR E 141 THR E 144 5 ? 4  
HELX_P HELX_P75  75  ASP E 134 ? ALA E 138 ? ASP E 162 ALA E 166 5 ? 5  
HELX_P HELX_P76  76  MET E 231 ? ARG E 269 ? MET E 259 ARG E 297 1 ? 39 
HELX_P HELX_P77  77  LEU E 279 ? ASN E 309 ? LEU E 307 ASN E 337 1 ? 31 
HELX_P HELX_P78  78  PHE E 313 ? GLY E 340 ? PHE E 341 GLY E 368 1 ? 28 
HELX_P HELX_P79  79  GLY E 341 ? TYR E 344 ? GLY E 369 TYR E 372 5 ? 4  
HELX_P HELX_P80  80  PRO E 349 ? THR E 360 ? PRO E 377 THR E 388 1 ? 12 
HELX_P HELX_P81  81  THR E 366 ? ALA E 385 ? THR E 394 ALA E 413 1 ? 20 
HELX_P HELX_P82  82  PRO F 7   ? LEU F 25  ? PRO F 35  LEU F 53  1 ? 19 
HELX_P HELX_P83  83  ILE F 28  ? HIS F 36  ? ILE F 56  HIS F 64  1 ? 9  
HELX_P HELX_P84  84  PRO F 39  ? GLY F 50  ? PRO F 67  GLY F 78  1 ? 12 
HELX_P HELX_P85  85  PRO F 57  ? GLY F 61  ? PRO F 85  GLY F 89  5 ? 5  
HELX_P HELX_P86  86  ASP F 66  ? CYS F 81  ? ASP F 94  CYS F 109 1 ? 16 
HELX_P HELX_P87  87  CYS F 81  ? LEU F 94  ? CYS F 109 LEU F 122 1 ? 14 
HELX_P HELX_P88  88  TYR F 95  ? GLY F 103 ? TYR F 123 GLY F 131 1 ? 9  
HELX_P HELX_P89  89  SER F 104 ? VAL F 112 ? SER F 132 VAL F 140 1 ? 9  
HELX_P HELX_P90  90  THR F 113 ? THR F 116 ? THR F 141 THR F 144 5 ? 4  
HELX_P HELX_P91  91  ASP F 134 ? ALA F 138 ? ASP F 162 ALA F 166 5 ? 5  
HELX_P HELX_P92  92  MET F 231 ? ARG F 269 ? MET F 259 ARG F 297 1 ? 39 
HELX_P HELX_P93  93  LEU F 279 ? ASN F 309 ? LEU F 307 ASN F 337 1 ? 31 
HELX_P HELX_P94  94  PHE F 313 ? GLY F 340 ? PHE F 341 GLY F 368 1 ? 28 
HELX_P HELX_P95  95  GLY F 341 ? TYR F 344 ? GLY F 369 TYR F 372 5 ? 4  
HELX_P HELX_P96  96  PRO F 349 ? THR F 360 ? PRO F 377 THR F 388 1 ? 12 
HELX_P HELX_P97  97  THR F 366 ? ALA F 385 ? THR F 394 ALA F 413 1 ? 20 
HELX_P HELX_P98  98  PRO G 7   ? LEU G 25  ? PRO G 35  LEU G 53  1 ? 19 
HELX_P HELX_P99  99  ILE G 28  ? GLU G 35  ? ILE G 56  GLU G 63  1 ? 8  
HELX_P HELX_P100 100 PRO G 39  ? LEU G 49  ? PRO G 67  LEU G 77  1 ? 11 
HELX_P HELX_P101 101 PRO G 57  ? GLY G 61  ? PRO G 85  GLY G 89  5 ? 5  
HELX_P HELX_P102 102 ASP G 66  ? CYS G 81  ? ASP G 94  CYS G 109 1 ? 16 
HELX_P HELX_P103 103 CYS G 81  ? LEU G 94  ? CYS G 109 LEU G 122 1 ? 14 
HELX_P HELX_P104 104 TYR G 95  ? GLY G 103 ? TYR G 123 GLY G 131 1 ? 9  
HELX_P HELX_P105 105 SER G 104 ? VAL G 112 ? SER G 132 VAL G 140 1 ? 9  
HELX_P HELX_P106 106 THR G 113 ? THR G 116 ? THR G 141 THR G 144 5 ? 4  
HELX_P HELX_P107 107 ASP G 134 ? ALA G 138 ? ASP G 162 ALA G 166 5 ? 5  
HELX_P HELX_P108 108 GLN G 178 ? LYS G 180 ? GLN G 206 LYS G 208 5 ? 3  
HELX_P HELX_P109 109 MET G 231 ? ARG G 269 ? MET G 259 ARG G 297 1 ? 39 
HELX_P HELX_P110 110 LEU G 279 ? ASN G 309 ? LEU G 307 ASN G 337 1 ? 31 
HELX_P HELX_P111 111 PHE G 313 ? GLY G 340 ? PHE G 341 GLY G 368 1 ? 28 
HELX_P HELX_P112 112 GLY G 341 ? TYR G 344 ? GLY G 369 TYR G 372 5 ? 4  
HELX_P HELX_P113 113 PRO G 349 ? GLU G 361 ? PRO G 377 GLU G 389 1 ? 13 
HELX_P HELX_P114 114 THR G 366 ? ARG G 383 ? THR G 394 ARG G 411 1 ? 18 
HELX_P HELX_P115 115 PRO H 7   ? LEU H 25  ? PRO H 35  LEU H 53  1 ? 19 
HELX_P HELX_P116 116 ILE H 28  ? HIS H 36  ? ILE H 56  HIS H 64  1 ? 9  
HELX_P HELX_P117 117 PRO H 39  ? LEU H 49  ? PRO H 67  LEU H 77  1 ? 11 
HELX_P HELX_P118 118 PRO H 57  ? GLY H 61  ? PRO H 85  GLY H 89  5 ? 5  
HELX_P HELX_P119 119 ASP H 66  ? CYS H 81  ? ASP H 94  CYS H 109 1 ? 16 
HELX_P HELX_P120 120 CYS H 81  ? LEU H 94  ? CYS H 109 LEU H 122 1 ? 14 
HELX_P HELX_P121 121 TYR H 95  ? GLY H 103 ? TYR H 123 GLY H 131 1 ? 9  
HELX_P HELX_P122 122 SER H 104 ? VAL H 112 ? SER H 132 VAL H 140 1 ? 9  
HELX_P HELX_P123 123 THR H 113 ? THR H 116 ? THR H 141 THR H 144 5 ? 4  
HELX_P HELX_P124 124 ASP H 134 ? ALA H 138 ? ASP H 162 ALA H 166 5 ? 5  
HELX_P HELX_P125 125 MET H 231 ? ARG H 269 ? MET H 259 ARG H 297 1 ? 39 
HELX_P HELX_P126 126 LEU H 279 ? ASN H 309 ? LEU H 307 ASN H 337 1 ? 31 
HELX_P HELX_P127 127 PHE H 313 ? GLY H 340 ? PHE H 341 GLY H 368 1 ? 28 
HELX_P HELX_P128 128 GLY H 341 ? TYR H 344 ? GLY H 369 TYR H 372 5 ? 4  
HELX_P HELX_P129 129 PRO H 349 ? GLU H 361 ? PRO H 377 GLU H 389 1 ? 13 
HELX_P HELX_P130 130 THR H 366 ? ALA H 385 ? THR H 394 ALA H 413 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 189 A . ? MET 217 A PRO 190 A ? PRO 218 A 1 7.34  
2 MET 189 B . ? MET 217 B PRO 190 B ? PRO 218 B 1 -0.74 
3 MET 189 C . ? MET 217 C PRO 190 C ? PRO 218 C 1 -4.61 
4 MET 189 D . ? MET 217 D PRO 190 D ? PRO 218 D 1 0.01  
5 MET 189 E . ? MET 217 E PRO 190 E ? PRO 218 E 1 -2.20 
6 MET 189 F . ? MET 217 F PRO 190 F ? PRO 218 F 1 3.25  
7 MET 189 G . ? MET 217 G PRO 190 G ? PRO 218 G 1 4.93  
8 MET 189 H . ? MET 217 H PRO 190 H ? PRO 218 H 1 -2.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 2 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 2 ? 
CA ? 4 ? 
CB ? 4 ? 
CC ? 2 ? 
DA ? 4 ? 
DB ? 4 ? 
DC ? 2 ? 
EA ? 4 ? 
EB ? 4 ? 
EC ? 2 ? 
FA ? 4 ? 
FB ? 4 ? 
FC ? 2 ? 
GA ? 4 ? 
GB ? 4 ? 
GC ? 2 ? 
HA ? 4 ? 
HB ? 4 ? 
HC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DC 1 2 ? anti-parallel 
EA 1 2 ? parallel      
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? anti-parallel 
EB 3 4 ? anti-parallel 
EC 1 2 ? anti-parallel 
FA 1 2 ? parallel      
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FB 1 2 ? anti-parallel 
FB 2 3 ? anti-parallel 
FB 3 4 ? anti-parallel 
FC 1 2 ? anti-parallel 
GA 1 2 ? parallel      
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
GB 3 4 ? anti-parallel 
GC 1 2 ? anti-parallel 
HA 1 2 ? parallel      
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HB 1 2 ? anti-parallel 
HB 2 3 ? anti-parallel 
HB 3 4 ? anti-parallel 
HC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 122 ? ALA A 125 ? GLY A 150 ALA A 153 
AA 2 ALA A 166 ? SER A 172 ? ALA A 194 SER A 200 
AA 3 ILE A 182 ? PRO A 188 ? ILE A 210 PRO A 216 
AA 4 ILE A 225 ? LEU A 226 ? ILE A 253 LEU A 254 
AB 1 THR A 141 ? GLU A 145 ? THR A 169 GLU A 173 
AB 2 SER A 148 ? THR A 159 ? SER A 176 THR A 187 
AB 3 THR A 210 ? PRO A 221 ? THR A 238 PRO A 249 
AB 4 LEU A 194 ? LEU A 196 ? LEU A 222 LEU A 224 
AC 1 MET A 270 ? ALA A 271 ? MET A 298 ALA A 299 
AC 2 ALA A 274 ? PRO A 275 ? ALA A 302 PRO A 303 
BA 1 GLY B 122 ? ALA B 125 ? GLY B 150 ALA B 153 
BA 2 ALA B 166 ? SER B 172 ? ALA B 194 SER B 200 
BA 3 ILE B 182 ? PRO B 188 ? ILE B 210 PRO B 216 
BA 4 ILE B 225 ? LEU B 226 ? ILE B 253 LEU B 254 
BB 1 THR B 141 ? GLU B 145 ? THR B 169 GLU B 173 
BB 2 SER B 148 ? THR B 159 ? SER B 176 THR B 187 
BB 3 THR B 210 ? PRO B 221 ? THR B 238 PRO B 249 
BB 4 LEU B 194 ? LEU B 196 ? LEU B 222 LEU B 224 
BC 1 MET B 270 ? ALA B 271 ? MET B 298 ALA B 299 
BC 2 ALA B 274 ? PRO B 275 ? ALA B 302 PRO B 303 
CA 1 CYS C 123 ? ALA C 125 ? CYS C 151 ALA C 153 
CA 2 ALA C 166 ? SER C 172 ? ALA C 194 SER C 200 
CA 3 ILE C 182 ? PRO C 188 ? ILE C 210 PRO C 216 
CA 4 ILE C 225 ? LEU C 226 ? ILE C 253 LEU C 254 
CB 1 THR C 141 ? GLU C 145 ? THR C 169 GLU C 173 
CB 2 SER C 148 ? THR C 159 ? SER C 176 THR C 187 
CB 3 THR C 210 ? PRO C 221 ? THR C 238 PRO C 249 
CB 4 LEU C 194 ? LEU C 196 ? LEU C 222 LEU C 224 
CC 1 MET C 270 ? ALA C 271 ? MET C 298 ALA C 299 
CC 2 ALA C 274 ? PRO C 275 ? ALA C 302 PRO C 303 
DA 1 GLY D 122 ? ALA D 125 ? GLY D 150 ALA D 153 
DA 2 ALA D 166 ? SER D 172 ? ALA D 194 SER D 200 
DA 3 ILE D 182 ? PRO D 188 ? ILE D 210 PRO D 216 
DA 4 ILE D 225 ? LEU D 226 ? ILE D 253 LEU D 254 
DB 1 THR D 141 ? GLU D 145 ? THR D 169 GLU D 173 
DB 2 SER D 148 ? THR D 159 ? SER D 176 THR D 187 
DB 3 THR D 210 ? PRO D 221 ? THR D 238 PRO D 249 
DB 4 LEU D 194 ? LEU D 196 ? LEU D 222 LEU D 224 
DC 1 MET D 270 ? ALA D 271 ? MET D 298 ALA D 299 
DC 2 ALA D 274 ? PRO D 275 ? ALA D 302 PRO D 303 
EA 1 GLY E 122 ? ALA E 125 ? GLY E 150 ALA E 153 
EA 2 ALA E 166 ? SER E 172 ? ALA E 194 SER E 200 
EA 3 ILE E 182 ? PRO E 188 ? ILE E 210 PRO E 216 
EA 4 ILE E 225 ? LEU E 226 ? ILE E 253 LEU E 254 
EB 1 THR E 141 ? GLU E 145 ? THR E 169 GLU E 173 
EB 2 SER E 148 ? THR E 159 ? SER E 176 THR E 187 
EB 3 THR E 210 ? PRO E 221 ? THR E 238 PRO E 249 
EB 4 LEU E 194 ? LEU E 196 ? LEU E 222 LEU E 224 
EC 1 MET E 270 ? ALA E 271 ? MET E 298 ALA E 299 
EC 2 ALA E 274 ? PRO E 275 ? ALA E 302 PRO E 303 
FA 1 GLY F 122 ? ALA F 125 ? GLY F 150 ALA F 153 
FA 2 ALA F 166 ? SER F 172 ? ALA F 194 SER F 200 
FA 3 ILE F 182 ? PRO F 188 ? ILE F 210 PRO F 216 
FA 4 ILE F 225 ? LEU F 226 ? ILE F 253 LEU F 254 
FB 1 THR F 141 ? GLU F 145 ? THR F 169 GLU F 173 
FB 2 SER F 148 ? THR F 159 ? SER F 176 THR F 187 
FB 3 THR F 210 ? PRO F 221 ? THR F 238 PRO F 249 
FB 4 LEU F 194 ? LEU F 196 ? LEU F 222 LEU F 224 
FC 1 MET F 270 ? ALA F 271 ? MET F 298 ALA F 299 
FC 2 ALA F 274 ? PRO F 275 ? ALA F 302 PRO F 303 
GA 1 GLY G 122 ? ALA G 125 ? GLY G 150 ALA G 153 
GA 2 ALA G 166 ? SER G 172 ? ALA G 194 SER G 200 
GA 3 ILE G 182 ? PRO G 188 ? ILE G 210 PRO G 216 
GA 4 ILE G 225 ? LEU G 226 ? ILE G 253 LEU G 254 
GB 1 THR G 141 ? GLU G 145 ? THR G 169 GLU G 173 
GB 2 SER G 148 ? THR G 159 ? SER G 176 THR G 187 
GB 3 THR G 210 ? PRO G 221 ? THR G 238 PRO G 249 
GB 4 LEU G 194 ? LEU G 196 ? LEU G 222 LEU G 224 
GC 1 MET G 270 ? ALA G 271 ? MET G 298 ALA G 299 
GC 2 ALA G 274 ? PRO G 275 ? ALA G 302 PRO G 303 
HA 1 GLY H 122 ? ALA H 125 ? GLY H 150 ALA H 153 
HA 2 ALA H 166 ? SER H 172 ? ALA H 194 SER H 200 
HA 3 ILE H 182 ? PRO H 188 ? ILE H 210 PRO H 216 
HA 4 ILE H 225 ? LEU H 226 ? ILE H 253 LEU H 254 
HB 1 THR H 141 ? GLU H 145 ? THR H 169 GLU H 173 
HB 2 SER H 148 ? THR H 159 ? SER H 176 THR H 187 
HB 3 THR H 210 ? PRO H 221 ? THR H 238 PRO H 249 
HB 4 LEU H 194 ? LEU H 196 ? LEU H 222 LEU H 224 
HC 1 MET H 270 ? ALA H 271 ? MET H 298 ALA H 299 
HC 2 ALA H 274 ? PRO H 275 ? ALA H 302 PRO H 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 123 ? N CYS A 151 O ALA A 166 ? O ALA A 194 
AA 2 3 N ALA A 171 ? N ALA A 199 O SER A 183 ? O SER A 211 
AA 3 4 N ALA A 184 ? N ALA A 212 O LEU A 226 ? O LEU A 254 
AB 1 2 N GLU A 145 ? N GLU A 173 O SER A 148 ? O SER A 176 
AB 2 3 N ILE A 158 ? N ILE A 186 O ALA A 211 ? O ALA A 239 
AB 3 4 N ILE A 214 ? N ILE A 242 O THR A 195 ? O THR A 223 
AC 1 2 N ALA A 271 ? N ALA A 299 O ALA A 274 ? O ALA A 302 
BA 1 2 N CYS B 123 ? N CYS B 151 O ALA B 166 ? O ALA B 194 
BA 2 3 N ALA B 171 ? N ALA B 199 O SER B 183 ? O SER B 211 
BA 3 4 N ALA B 184 ? N ALA B 212 O LEU B 226 ? O LEU B 254 
BB 1 2 N GLU B 145 ? N GLU B 173 O SER B 148 ? O SER B 176 
BB 2 3 N ILE B 158 ? N ILE B 186 O ALA B 211 ? O ALA B 239 
BB 3 4 N ILE B 214 ? N ILE B 242 O THR B 195 ? O THR B 223 
BC 1 2 N ALA B 271 ? N ALA B 299 O ALA B 274 ? O ALA B 302 
CA 1 2 N CYS C 123 ? N CYS C 151 O ALA C 166 ? O ALA C 194 
CA 2 3 N ALA C 171 ? N ALA C 199 O SER C 183 ? O SER C 211 
CA 3 4 N ALA C 184 ? N ALA C 212 O LEU C 226 ? O LEU C 254 
CB 1 2 N GLU C 145 ? N GLU C 173 O SER C 148 ? O SER C 176 
CB 2 3 N ILE C 158 ? N ILE C 186 O ALA C 211 ? O ALA C 239 
CB 3 4 N ILE C 214 ? N ILE C 242 O THR C 195 ? O THR C 223 
CC 1 2 N ALA C 271 ? N ALA C 299 O ALA C 274 ? O ALA C 302 
DA 1 2 N CYS D 123 ? N CYS D 151 O ALA D 166 ? O ALA D 194 
DA 2 3 N ALA D 171 ? N ALA D 199 O SER D 183 ? O SER D 211 
DA 3 4 N ALA D 184 ? N ALA D 212 O LEU D 226 ? O LEU D 254 
DB 1 2 N GLU D 145 ? N GLU D 173 O SER D 148 ? O SER D 176 
DB 2 3 N ILE D 158 ? N ILE D 186 O ALA D 211 ? O ALA D 239 
DB 3 4 N ILE D 214 ? N ILE D 242 O THR D 195 ? O THR D 223 
DC 1 2 N ALA D 271 ? N ALA D 299 O ALA D 274 ? O ALA D 302 
EA 1 2 N CYS E 123 ? N CYS E 151 O ALA E 166 ? O ALA E 194 
EA 2 3 N ALA E 171 ? N ALA E 199 O SER E 183 ? O SER E 211 
EA 3 4 N ALA E 184 ? N ALA E 212 O LEU E 226 ? O LEU E 254 
EB 1 2 N GLU E 145 ? N GLU E 173 O SER E 148 ? O SER E 176 
EB 2 3 N ILE E 158 ? N ILE E 186 O ALA E 211 ? O ALA E 239 
EB 3 4 N ILE E 214 ? N ILE E 242 O THR E 195 ? O THR E 223 
EC 1 2 N ALA E 271 ? N ALA E 299 O ALA E 274 ? O ALA E 302 
FA 1 2 N CYS F 123 ? N CYS F 151 O ALA F 166 ? O ALA F 194 
FA 2 3 N ALA F 171 ? N ALA F 199 O SER F 183 ? O SER F 211 
FA 3 4 N ALA F 184 ? N ALA F 212 O LEU F 226 ? O LEU F 254 
FB 1 2 N GLU F 145 ? N GLU F 173 O SER F 148 ? O SER F 176 
FB 2 3 N ILE F 158 ? N ILE F 186 O ALA F 211 ? O ALA F 239 
FB 3 4 N ILE F 214 ? N ILE F 242 O THR F 195 ? O THR F 223 
FC 1 2 N ALA F 271 ? N ALA F 299 O ALA F 274 ? O ALA F 302 
GA 1 2 N CYS G 123 ? N CYS G 151 O ALA G 166 ? O ALA G 194 
GA 2 3 N ALA G 171 ? N ALA G 199 O SER G 183 ? O SER G 211 
GA 3 4 N ALA G 184 ? N ALA G 212 O LEU G 226 ? O LEU G 254 
GB 1 2 N GLU G 145 ? N GLU G 173 O SER G 148 ? O SER G 176 
GB 2 3 N ILE G 158 ? N ILE G 186 O ALA G 211 ? O ALA G 239 
GB 3 4 N ILE G 214 ? N ILE G 242 O THR G 195 ? O THR G 223 
GC 1 2 N ALA G 271 ? N ALA G 299 O ALA G 274 ? O ALA G 302 
HA 1 2 N CYS H 123 ? N CYS H 151 O ALA H 166 ? O ALA H 194 
HA 2 3 N ALA H 171 ? N ALA H 199 O SER H 183 ? O SER H 211 
HA 3 4 N ALA H 184 ? N ALA H 212 O LEU H 226 ? O LEU H 254 
HB 1 2 N GLU H 145 ? N GLU H 173 O SER H 148 ? O SER H 176 
HB 2 3 N ILE H 158 ? N ILE H 186 O ALA H 211 ? O ALA H 239 
HB 3 4 N ILE H 214 ? N ILE H 242 O THR H 195 ? O THR H 223 
HC 1 2 N ALA H 271 ? N ALA H 299 O ALA H 274 ? O ALA H 302 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE FAD A 600' 
AC2 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE FAD B 600' 
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE COS B 605' 
AC4 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE FAD C 600' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE COS C 605' 
AC6 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE FAD D 600' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE COS D 605' 
AC8 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE FAD E 600' 
AC9 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE FAD F 600' 
BC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE COS F 605' 
BC2 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE FAD G 600' 
BC3 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE COS G 605' 
BC4 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE FAD H 600' 
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO F1414' 
BC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO D1414' 
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO E1414' 
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO H1414' 
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO B1412' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D1415' 
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A1413' 
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO E1415' 
CC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO H1415' 
CC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO E1416' 
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO F1415' 
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO F1416' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 29 PHE A  124 ? PHE A 152 . ? 1_555 ? 
2   AC1 29 LEU A  126 ? LEU A 154 . ? 1_555 ? 
3   AC1 29 SER A  127 ? SER A 155 . ? 1_555 ? 
4   AC1 29 GLY A  132 ? GLY A 160 . ? 1_555 ? 
5   AC1 29 SER A  133 ? SER A 161 . ? 1_555 ? 
6   AC1 29 TRP A  157 ? TRP A 185 . ? 1_555 ? 
7   AC1 29 THR A  159 ? THR A 187 . ? 1_555 ? 
8   AC1 29 LYS A  202 ? LYS A 230 . ? 1_555 ? 
9   AC1 29 ILE A  359 ? ILE A 387 . ? 1_555 ? 
10  AC1 29 TYR A  363 ? TYR A 391 . ? 1_555 ? 
11  AC1 29 GLU A  364 ? GLU A 392 . ? 1_555 ? 
12  AC1 29 THR A  366 ? THR A 394 . ? 1_555 ? 
13  AC1 29 GLU A  368 ? GLU A 396 . ? 1_555 ? 
14  AC1 29 LEU A  372 ? LEU A 400 . ? 1_555 ? 
15  AC1 29 HOH HA .   ? HOH A 711 . ? 1_555 ? 
16  AC1 29 HOH HA .   ? HOH A 630 . ? 1_555 ? 
17  AC1 29 HOH HA .   ? HOH A 683 . ? 1_555 ? 
18  AC1 29 HOH HA .   ? HOH A 633 . ? 1_555 ? 
19  AC1 29 HOH HA .   ? HOH A 639 . ? 1_555 ? 
20  AC1 29 HOH HA .   ? HOH A 669 . ? 1_555 ? 
21  AC1 29 ARG B  269 ? ARG B 297 . ? 1_555 ? 
22  AC1 29 PHE B  272 ? PHE B 300 . ? 1_555 ? 
23  AC1 29 LEU B  276 ? LEU B 304 . ? 1_555 ? 
24  AC1 29 LEU B  279 ? LEU B 307 . ? 1_555 ? 
25  AC1 29 GLN B  337 ? GLN B 365 . ? 1_555 ? 
26  AC1 29 ILE B  338 ? ILE B 366 . ? 1_555 ? 
27  AC1 29 GLY B  341 ? GLY B 369 . ? 1_555 ? 
28  AC1 29 HOH IA .   ? HOH B 608 . ? 1_555 ? 
29  AC1 29 GLN C  280 ? GLN C 308 . ? 1_555 ? 
30  AC2 29 ARG A  269 ? ARG A 297 . ? 1_555 ? 
31  AC2 29 PHE A  272 ? PHE A 300 . ? 1_555 ? 
32  AC2 29 LEU A  276 ? LEU A 304 . ? 1_555 ? 
33  AC2 29 LEU A  279 ? LEU A 307 . ? 1_555 ? 
34  AC2 29 GLN A  337 ? GLN A 365 . ? 1_555 ? 
35  AC2 29 ILE A  338 ? ILE A 366 . ? 1_555 ? 
36  AC2 29 GLY A  341 ? GLY A 369 . ? 1_555 ? 
37  AC2 29 HOH HA .   ? HOH A 603 . ? 1_555 ? 
38  AC2 29 PHE B  124 ? PHE B 152 . ? 1_555 ? 
39  AC2 29 LEU B  126 ? LEU B 154 . ? 1_555 ? 
40  AC2 29 SER B  127 ? SER B 155 . ? 1_555 ? 
41  AC2 29 GLY B  132 ? GLY B 160 . ? 1_555 ? 
42  AC2 29 SER B  133 ? SER B 161 . ? 1_555 ? 
43  AC2 29 TRP B  157 ? TRP B 185 . ? 1_555 ? 
44  AC2 29 THR B  159 ? THR B 187 . ? 1_555 ? 
45  AC2 29 LYS B  202 ? LYS B 230 . ? 1_555 ? 
46  AC2 29 ILE B  359 ? ILE B 387 . ? 1_555 ? 
47  AC2 29 ILE B  362 ? ILE B 390 . ? 1_555 ? 
48  AC2 29 TYR B  363 ? TYR B 391 . ? 1_555 ? 
49  AC2 29 GLU B  364 ? GLU B 392 . ? 1_555 ? 
50  AC2 29 THR B  366 ? THR B 394 . ? 1_555 ? 
51  AC2 29 GLU B  368 ? GLU B 396 . ? 1_555 ? 
52  AC2 29 COS L  .   ? COS B 502 . ? 1_555 ? 
53  AC2 29 HOH IA .   ? HOH B 676 . ? 1_555 ? 
54  AC2 29 HOH IA .   ? HOH B 634 . ? 1_555 ? 
55  AC2 29 HOH IA .   ? HOH B 681 . ? 1_555 ? 
56  AC2 29 HOH IA .   ? HOH B 675 . ? 1_555 ? 
57  AC2 29 HOH IA .   ? HOH B 669 . ? 1_555 ? 
58  AC2 29 GLN D  280 ? GLN D 308 . ? 1_555 ? 
59  AC3 17 PHE A  272 ? PHE A 300 . ? 1_555 ? 
60  AC3 17 GLY B  132 ? GLY B 160 . ? 1_555 ? 
61  AC3 17 SER B  133 ? SER B 161 . ? 1_555 ? 
62  AC3 17 PHE B  233 ? PHE B 261 . ? 1_555 ? 
63  AC3 17 MET B  237 ? MET B 265 . ? 1_555 ? 
64  AC3 17 GLN B  238 ? GLN B 266 . ? 1_555 ? 
65  AC3 17 LEU B  240 ? LEU B 268 . ? 1_555 ? 
66  AC3 17 ASP B  241 ? ASP B 269 . ? 1_555 ? 
67  AC3 17 ARG B  244 ? ARG B 272 . ? 1_555 ? 
68  AC3 17 ILE B  314 ? ILE B 342 . ? 1_555 ? 
69  AC3 17 GLU B  364 ? GLU B 392 . ? 1_555 ? 
70  AC3 17 GLY B  365 ? GLY B 393 . ? 1_555 ? 
71  AC3 17 ILE B  369 ? ILE B 397 . ? 1_555 ? 
72  AC3 17 FAD K  .   ? FAD B 501 . ? 1_555 ? 
73  AC3 17 HOH IA .   ? HOH B 656 . ? 1_555 ? 
74  AC3 17 HOH IA .   ? HOH B 646 . ? 1_555 ? 
75  AC3 17 HOH IA .   ? HOH B 631 . ? 1_555 ? 
76  AC4 31 GLN A  280 ? GLN A 308 . ? 1_555 ? 
77  AC4 31 PHE C  124 ? PHE C 152 . ? 1_555 ? 
78  AC4 31 LEU C  126 ? LEU C 154 . ? 1_555 ? 
79  AC4 31 SER C  127 ? SER C 155 . ? 1_555 ? 
80  AC4 31 GLY C  132 ? GLY C 160 . ? 1_555 ? 
81  AC4 31 SER C  133 ? SER C 161 . ? 1_555 ? 
82  AC4 31 TRP C  157 ? TRP C 185 . ? 1_555 ? 
83  AC4 31 THR C  159 ? THR C 187 . ? 1_555 ? 
84  AC4 31 LYS C  202 ? LYS C 230 . ? 1_555 ? 
85  AC4 31 ILE C  359 ? ILE C 387 . ? 1_555 ? 
86  AC4 31 ILE C  362 ? ILE C 390 . ? 1_555 ? 
87  AC4 31 TYR C  363 ? TYR C 391 . ? 1_555 ? 
88  AC4 31 GLU C  364 ? GLU C 392 . ? 1_555 ? 
89  AC4 31 THR C  366 ? THR C 394 . ? 1_555 ? 
90  AC4 31 GLU C  368 ? GLU C 396 . ? 1_555 ? 
91  AC4 31 LEU C  372 ? LEU C 400 . ? 1_555 ? 
92  AC4 31 COS O  .   ? COS C 502 . ? 1_555 ? 
93  AC4 31 HOH JA .   ? HOH C 653 . ? 1_555 ? 
94  AC4 31 HOH JA .   ? HOH C 649 . ? 1_555 ? 
95  AC4 31 HOH JA .   ? HOH C 625 . ? 1_555 ? 
96  AC4 31 HOH JA .   ? HOH C 633 . ? 1_555 ? 
97  AC4 31 HOH JA .   ? HOH C 651 . ? 1_555 ? 
98  AC4 31 HOH JA .   ? HOH C 671 . ? 1_555 ? 
99  AC4 31 ARG D  269 ? ARG D 297 . ? 1_555 ? 
100 AC4 31 PHE D  272 ? PHE D 300 . ? 1_555 ? 
101 AC4 31 LEU D  276 ? LEU D 304 . ? 1_555 ? 
102 AC4 31 LEU D  279 ? LEU D 307 . ? 1_555 ? 
103 AC4 31 GLN D  337 ? GLN D 365 . ? 1_555 ? 
104 AC4 31 ILE D  338 ? ILE D 366 . ? 1_555 ? 
105 AC4 31 GLY D  341 ? GLY D 369 . ? 1_555 ? 
106 AC4 31 HOH KA .   ? HOH D 650 . ? 1_555 ? 
107 AC5 9  SER C  127 ? SER C 155 . ? 1_555 ? 
108 AC5 9  GLY C  132 ? GLY C 160 . ? 1_555 ? 
109 AC5 9  SER C  133 ? SER C 161 . ? 1_555 ? 
110 AC5 9  LEU C  240 ? LEU C 268 . ? 1_555 ? 
111 AC5 9  ARG C  244 ? ARG C 272 . ? 1_555 ? 
112 AC5 9  GLU C  364 ? GLU C 392 . ? 1_555 ? 
113 AC5 9  GLY C  365 ? GLY C 393 . ? 1_555 ? 
114 AC5 9  ILE C  369 ? ILE C 397 . ? 1_555 ? 
115 AC5 9  FAD N  .   ? FAD C 501 . ? 1_555 ? 
116 AC6 31 GLN B  280 ? GLN B 308 . ? 1_555 ? 
117 AC6 31 ARG C  269 ? ARG C 297 . ? 1_555 ? 
118 AC6 31 PHE C  272 ? PHE C 300 . ? 1_555 ? 
119 AC6 31 LEU C  276 ? LEU C 304 . ? 1_555 ? 
120 AC6 31 LEU C  279 ? LEU C 307 . ? 1_555 ? 
121 AC6 31 VAL C  281 ? VAL C 309 . ? 1_555 ? 
122 AC6 31 GLN C  337 ? GLN C 365 . ? 1_555 ? 
123 AC6 31 ILE C  338 ? ILE C 366 . ? 1_555 ? 
124 AC6 31 GLY C  341 ? GLY C 369 . ? 1_555 ? 
125 AC6 31 HOH JA .   ? HOH C 604 . ? 1_555 ? 
126 AC6 31 PHE D  124 ? PHE D 152 . ? 1_555 ? 
127 AC6 31 LEU D  126 ? LEU D 154 . ? 1_555 ? 
128 AC6 31 SER D  127 ? SER D 155 . ? 1_555 ? 
129 AC6 31 GLY D  132 ? GLY D 160 . ? 1_555 ? 
130 AC6 31 SER D  133 ? SER D 161 . ? 1_555 ? 
131 AC6 31 TRP D  157 ? TRP D 185 . ? 1_555 ? 
132 AC6 31 ILE D  158 ? ILE D 186 . ? 1_555 ? 
133 AC6 31 THR D  159 ? THR D 187 . ? 1_555 ? 
134 AC6 31 LYS D  202 ? LYS D 230 . ? 1_555 ? 
135 AC6 31 ILE D  359 ? ILE D 387 . ? 1_555 ? 
136 AC6 31 TYR D  363 ? TYR D 391 . ? 1_555 ? 
137 AC6 31 GLU D  364 ? GLU D 392 . ? 1_555 ? 
138 AC6 31 THR D  366 ? THR D 394 . ? 1_555 ? 
139 AC6 31 GLU D  368 ? GLU D 396 . ? 1_555 ? 
140 AC6 31 LEU D  372 ? LEU D 400 . ? 1_555 ? 
141 AC6 31 COS Q  .   ? COS D 502 . ? 1_555 ? 
142 AC6 31 HOH KA .   ? HOH D 652 . ? 1_555 ? 
143 AC6 31 HOH KA .   ? HOH D 645 . ? 1_555 ? 
144 AC6 31 HOH KA .   ? HOH D 671 . ? 1_555 ? 
145 AC6 31 HOH KA .   ? HOH D 657 . ? 1_555 ? 
146 AC6 31 HOH KA .   ? HOH D 619 . ? 1_555 ? 
147 AC7 8  SER D  127 ? SER D 155 . ? 1_555 ? 
148 AC7 8  GLY D  132 ? GLY D 160 . ? 1_555 ? 
149 AC7 8  SER D  133 ? SER D 161 . ? 1_555 ? 
150 AC7 8  LEU D  240 ? LEU D 268 . ? 1_555 ? 
151 AC7 8  ARG D  244 ? ARG D 272 . ? 1_555 ? 
152 AC7 8  GLU D  364 ? GLU D 392 . ? 1_555 ? 
153 AC7 8  GLY D  365 ? GLY D 393 . ? 1_555 ? 
154 AC7 8  FAD P  .   ? FAD D 501 . ? 1_555 ? 
155 AC8 30 PHE E  124 ? PHE E 152 . ? 1_555 ? 
156 AC8 30 LEU E  126 ? LEU E 154 . ? 1_555 ? 
157 AC8 30 SER E  127 ? SER E 155 . ? 1_555 ? 
158 AC8 30 GLY E  132 ? GLY E 160 . ? 1_555 ? 
159 AC8 30 SER E  133 ? SER E 161 . ? 1_555 ? 
160 AC8 30 TRP E  157 ? TRP E 185 . ? 1_555 ? 
161 AC8 30 THR E  159 ? THR E 187 . ? 1_555 ? 
162 AC8 30 LYS E  202 ? LYS E 230 . ? 1_555 ? 
163 AC8 30 ILE E  362 ? ILE E 390 . ? 1_555 ? 
164 AC8 30 TYR E  363 ? TYR E 391 . ? 1_555 ? 
165 AC8 30 GLU E  364 ? GLU E 392 . ? 1_555 ? 
166 AC8 30 THR E  366 ? THR E 394 . ? 1_555 ? 
167 AC8 30 GLU E  368 ? GLU E 396 . ? 1_555 ? 
168 AC8 30 LEU E  372 ? LEU E 400 . ? 1_555 ? 
169 AC8 30 HOH LA .   ? HOH E 685 . ? 1_555 ? 
170 AC8 30 HOH LA .   ? HOH E 688 . ? 1_555 ? 
171 AC8 30 HOH LA .   ? HOH E 616 . ? 1_555 ? 
172 AC8 30 HOH LA .   ? HOH E 646 . ? 1_555 ? 
173 AC8 30 HOH LA .   ? HOH E 707 . ? 1_555 ? 
174 AC8 30 HOH LA .   ? HOH E 655 . ? 1_555 ? 
175 AC8 30 ARG F  269 ? ARG F 297 . ? 1_555 ? 
176 AC8 30 PHE F  272 ? PHE F 300 . ? 1_555 ? 
177 AC8 30 LEU F  276 ? LEU F 304 . ? 1_555 ? 
178 AC8 30 LEU F  279 ? LEU F 307 . ? 1_555 ? 
179 AC8 30 VAL F  281 ? VAL F 309 . ? 1_555 ? 
180 AC8 30 GLN F  337 ? GLN F 365 . ? 1_555 ? 
181 AC8 30 ILE F  338 ? ILE F 366 . ? 1_555 ? 
182 AC8 30 GLY F  341 ? GLY F 369 . ? 1_555 ? 
183 AC8 30 HOH MA .   ? HOH F 604 . ? 1_555 ? 
184 AC8 30 GLN G  280 ? GLN G 308 . ? 1_555 ? 
185 AC9 28 ARG E  269 ? ARG E 297 . ? 1_555 ? 
186 AC9 28 PHE E  272 ? PHE E 300 . ? 1_555 ? 
187 AC9 28 LEU E  276 ? LEU E 304 . ? 1_555 ? 
188 AC9 28 LEU E  279 ? LEU E 307 . ? 1_555 ? 
189 AC9 28 VAL E  281 ? VAL E 309 . ? 1_555 ? 
190 AC9 28 GLN E  337 ? GLN E 365 . ? 1_555 ? 
191 AC9 28 ILE E  338 ? ILE E 366 . ? 1_555 ? 
192 AC9 28 GLY E  341 ? GLY E 369 . ? 1_555 ? 
193 AC9 28 HOH LA .   ? HOH E 613 . ? 1_555 ? 
194 AC9 28 PHE F  124 ? PHE F 152 . ? 1_555 ? 
195 AC9 28 LEU F  126 ? LEU F 154 . ? 1_555 ? 
196 AC9 28 SER F  127 ? SER F 155 . ? 1_555 ? 
197 AC9 28 GLY F  132 ? GLY F 160 . ? 1_555 ? 
198 AC9 28 SER F  133 ? SER F 161 . ? 1_555 ? 
199 AC9 28 TRP F  157 ? TRP F 185 . ? 1_555 ? 
200 AC9 28 THR F  159 ? THR F 187 . ? 1_555 ? 
201 AC9 28 LYS F  202 ? LYS F 230 . ? 1_555 ? 
202 AC9 28 TYR F  363 ? TYR F 391 . ? 1_555 ? 
203 AC9 28 GLU F  364 ? GLU F 392 . ? 1_555 ? 
204 AC9 28 THR F  366 ? THR F 394 . ? 1_555 ? 
205 AC9 28 GLU F  368 ? GLU F 396 . ? 1_555 ? 
206 AC9 28 COS Y  .   ? COS F 502 . ? 1_555 ? 
207 AC9 28 HOH MA .   ? HOH F 654 . ? 1_555 ? 
208 AC9 28 HOH MA .   ? HOH F 656 . ? 1_555 ? 
209 AC9 28 HOH MA .   ? HOH F 647 . ? 1_555 ? 
210 AC9 28 HOH MA .   ? HOH F 652 . ? 1_555 ? 
211 AC9 28 HOH MA .   ? HOH F 630 . ? 1_555 ? 
212 AC9 28 GLN H  280 ? GLN H 308 . ? 1_555 ? 
213 BC1 9  SER F  127 ? SER F 155 . ? 1_555 ? 
214 BC1 9  GLY F  132 ? GLY F 160 . ? 1_555 ? 
215 BC1 9  SER F  133 ? SER F 161 . ? 1_555 ? 
216 BC1 9  LEU F  240 ? LEU F 268 . ? 1_555 ? 
217 BC1 9  ARG F  244 ? ARG F 272 . ? 1_555 ? 
218 BC1 9  GLU F  364 ? GLU F 392 . ? 1_555 ? 
219 BC1 9  GLY F  365 ? GLY F 393 . ? 1_555 ? 
220 BC1 9  FAD X  .   ? FAD F 501 . ? 1_555 ? 
221 BC1 9  HOH MA .   ? HOH F 610 . ? 1_555 ? 
222 BC2 31 GLN E  280 ? GLN E 308 . ? 1_555 ? 
223 BC2 31 PHE G  124 ? PHE G 152 . ? 1_555 ? 
224 BC2 31 LEU G  126 ? LEU G 154 . ? 1_555 ? 
225 BC2 31 SER G  127 ? SER G 155 . ? 1_555 ? 
226 BC2 31 GLY G  132 ? GLY G 160 . ? 1_555 ? 
227 BC2 31 SER G  133 ? SER G 161 . ? 1_555 ? 
228 BC2 31 TRP G  157 ? TRP G 185 . ? 1_555 ? 
229 BC2 31 ILE G  158 ? ILE G 186 . ? 1_555 ? 
230 BC2 31 THR G  159 ? THR G 187 . ? 1_555 ? 
231 BC2 31 LYS G  202 ? LYS G 230 . ? 1_555 ? 
232 BC2 31 ILE G  359 ? ILE G 387 . ? 1_555 ? 
233 BC2 31 ILE G  362 ? ILE G 390 . ? 1_555 ? 
234 BC2 31 TYR G  363 ? TYR G 391 . ? 1_555 ? 
235 BC2 31 GLU G  364 ? GLU G 392 . ? 1_555 ? 
236 BC2 31 THR G  366 ? THR G 394 . ? 1_555 ? 
237 BC2 31 GLU G  368 ? GLU G 396 . ? 1_555 ? 
238 BC2 31 LEU G  372 ? LEU G 400 . ? 1_555 ? 
239 BC2 31 COS DA .   ? COS G 502 . ? 1_555 ? 
240 BC2 31 HOH NA .   ? HOH G 637 . ? 1_555 ? 
241 BC2 31 HOH NA .   ? HOH G 662 . ? 1_555 ? 
242 BC2 31 HOH NA .   ? HOH G 689 . ? 1_555 ? 
243 BC2 31 HOH NA .   ? HOH G 674 . ? 1_555 ? 
244 BC2 31 HOH NA .   ? HOH G 630 . ? 1_555 ? 
245 BC2 31 ARG H  269 ? ARG H 297 . ? 1_555 ? 
246 BC2 31 PHE H  272 ? PHE H 300 . ? 1_555 ? 
247 BC2 31 LEU H  276 ? LEU H 304 . ? 1_555 ? 
248 BC2 31 LEU H  279 ? LEU H 307 . ? 1_555 ? 
249 BC2 31 GLN H  337 ? GLN H 365 . ? 1_555 ? 
250 BC2 31 ILE H  338 ? ILE H 366 . ? 1_555 ? 
251 BC2 31 GLY H  341 ? GLY H 369 . ? 1_555 ? 
252 BC2 31 HOH OA .   ? HOH H 644 . ? 1_555 ? 
253 BC3 20 GLY G  132 ? GLY G 160 . ? 1_555 ? 
254 BC3 20 SER G  133 ? SER G 161 . ? 1_555 ? 
255 BC3 20 ALA G  135 ? ALA G 163 . ? 1_555 ? 
256 BC3 20 ASN G  179 ? ASN G 207 . ? 1_555 ? 
257 BC3 20 PHE G  233 ? PHE G 261 . ? 1_555 ? 
258 BC3 20 MET G  237 ? MET G 265 . ? 1_555 ? 
259 BC3 20 GLN G  238 ? GLN G 266 . ? 1_555 ? 
260 BC3 20 LEU G  240 ? LEU G 268 . ? 1_555 ? 
261 BC3 20 ASP G  241 ? ASP G 269 . ? 1_555 ? 
262 BC3 20 ARG G  244 ? ARG G 272 . ? 1_555 ? 
263 BC3 20 ILE G  314 ? ILE G 342 . ? 1_555 ? 
264 BC3 20 GLU G  364 ? GLU G 392 . ? 1_555 ? 
265 BC3 20 GLY G  365 ? GLY G 393 . ? 1_555 ? 
266 BC3 20 VAL G  373 ? VAL G 401 . ? 1_555 ? 
267 BC3 20 FAD CA .   ? FAD G 501 . ? 1_555 ? 
268 BC3 20 HOH NA .   ? HOH G 672 . ? 1_555 ? 
269 BC3 20 HOH NA .   ? HOH G 642 . ? 1_555 ? 
270 BC3 20 HOH NA .   ? HOH G 601 . ? 1_555 ? 
271 BC3 20 HOH NA .   ? HOH G 660 . ? 1_555 ? 
272 BC3 20 PHE H  272 ? PHE H 300 . ? 1_555 ? 
273 BC4 29 GLN F  280 ? GLN F 308 . ? 1_555 ? 
274 BC4 29 ARG G  269 ? ARG G 297 . ? 1_555 ? 
275 BC4 29 PHE G  272 ? PHE G 300 . ? 1_555 ? 
276 BC4 29 LEU G  279 ? LEU G 307 . ? 1_555 ? 
277 BC4 29 GLN G  337 ? GLN G 365 . ? 1_555 ? 
278 BC4 29 ILE G  338 ? ILE G 366 . ? 1_555 ? 
279 BC4 29 GLY G  341 ? GLY G 369 . ? 1_555 ? 
280 BC4 29 HOH NA .   ? HOH G 611 . ? 1_555 ? 
281 BC4 29 PHE H  124 ? PHE H 152 . ? 1_555 ? 
282 BC4 29 LEU H  126 ? LEU H 154 . ? 1_555 ? 
283 BC4 29 SER H  127 ? SER H 155 . ? 1_555 ? 
284 BC4 29 GLY H  132 ? GLY H 160 . ? 1_555 ? 
285 BC4 29 SER H  133 ? SER H 161 . ? 1_555 ? 
286 BC4 29 TRP H  157 ? TRP H 185 . ? 1_555 ? 
287 BC4 29 ILE H  158 ? ILE H 186 . ? 1_555 ? 
288 BC4 29 THR H  159 ? THR H 187 . ? 1_555 ? 
289 BC4 29 LYS H  202 ? LYS H 230 . ? 1_555 ? 
290 BC4 29 ILE H  359 ? ILE H 387 . ? 1_555 ? 
291 BC4 29 ILE H  362 ? ILE H 390 . ? 1_555 ? 
292 BC4 29 TYR H  363 ? TYR H 391 . ? 1_555 ? 
293 BC4 29 GLU H  364 ? GLU H 392 . ? 1_555 ? 
294 BC4 29 THR H  366 ? THR H 394 . ? 1_555 ? 
295 BC4 29 GLU H  368 ? GLU H 396 . ? 1_555 ? 
296 BC4 29 LEU H  372 ? LEU H 400 . ? 1_555 ? 
297 BC4 29 HOH OA .   ? HOH H 669 . ? 1_555 ? 
298 BC4 29 HOH OA .   ? HOH H 695 . ? 1_555 ? 
299 BC4 29 HOH OA .   ? HOH H 647 . ? 1_555 ? 
300 BC4 29 HOH OA .   ? HOH H 614 . ? 1_555 ? 
301 BC4 29 HOH OA .   ? HOH H 610 . ? 1_555 ? 
302 BC5 5  GLN F  31  ? GLN F 59  . ? 1_555 ? 
303 BC5 5  PRO F  39  ? PRO F 67  . ? 1_555 ? 
304 BC5 5  GLN F  42  ? GLN F 70  . ? 1_555 ? 
305 BC5 5  HOH MA .   ? HOH F 699 . ? 1_555 ? 
306 BC5 5  HOH MA .   ? HOH F 704 . ? 1_555 ? 
307 BC6 2  PRO D  39  ? PRO D 67  . ? 1_555 ? 
308 BC6 2  GLN D  42  ? GLN D 70  . ? 1_555 ? 
309 BC7 4  LEU E  37  ? LEU E 65  . ? 1_555 ? 
310 BC7 4  PRO E  39  ? PRO E 67  . ? 1_555 ? 
311 BC7 4  GLN E  42  ? GLN E 70  . ? 1_555 ? 
312 BC7 4  HOH LA .   ? HOH E 680 . ? 1_555 ? 
313 BC8 5  GLN H  31  ? GLN H 59  . ? 1_555 ? 
314 BC8 5  LEU H  37  ? LEU H 65  . ? 1_555 ? 
315 BC8 5  PRO H  39  ? PRO H 67  . ? 1_555 ? 
316 BC8 5  GLN H  42  ? GLN H 70  . ? 1_555 ? 
317 BC8 5  HOH OA .   ? HOH H 635 . ? 1_555 ? 
318 BC9 3  GLN B  31  ? GLN B 59  . ? 1_555 ? 
319 BC9 3  PRO B  39  ? PRO B 67  . ? 1_555 ? 
320 BC9 3  GLN B  42  ? GLN B 70  . ? 1_555 ? 
321 CC1 5  ARG B  302 ? ARG B 330 . ? 1_555 ? 
322 CC1 5  GLU D  294 ? GLU D 322 . ? 1_555 ? 
323 CC1 5  ARG D  297 ? ARG D 325 . ? 1_555 ? 
324 CC1 5  LEU D  298 ? LEU D 326 . ? 1_555 ? 
325 CC1 5  HOH KA .   ? HOH D 702 . ? 1_555 ? 
326 CC2 4  GLU A  294 ? GLU A 322 . ? 1_555 ? 
327 CC2 4  ARG A  297 ? ARG A 325 . ? 1_555 ? 
328 CC2 4  LEU A  298 ? LEU A 326 . ? 1_555 ? 
329 CC2 4  ARG C  302 ? ARG C 330 . ? 1_555 ? 
330 CC3 6  GLU E  294 ? GLU E 322 . ? 1_555 ? 
331 CC3 6  ARG E  297 ? ARG E 325 . ? 1_555 ? 
332 CC3 6  LEU E  298 ? LEU E 326 . ? 1_555 ? 
333 CC3 6  ARG G  302 ? ARG G 330 . ? 1_555 ? 
334 CC3 6  HOH LA .   ? HOH E 633 . ? 1_555 ? 
335 CC3 6  HOH LA .   ? HOH E 700 . ? 1_555 ? 
336 CC4 5  ARG F  302 ? ARG F 330 . ? 1_555 ? 
337 CC4 5  GLU H  294 ? GLU H 322 . ? 1_555 ? 
338 CC4 5  ARG H  297 ? ARG H 325 . ? 1_555 ? 
339 CC4 5  LEU H  298 ? LEU H 326 . ? 1_555 ? 
340 CC4 5  HOH OA .   ? HOH H 700 . ? 1_555 ? 
341 CC5 7  GLU E  128 ? GLU E 156 . ? 1_555 ? 
342 CC5 7  PRO E  129 ? PRO E 157 . ? 1_555 ? 
343 CC5 7  SER E  139 ? SER E 167 . ? 1_555 ? 
344 CC5 7  GLY E  153 ? GLY E 181 . ? 1_555 ? 
345 CC5 7  THR E  154 ? THR E 182 . ? 1_555 ? 
346 CC5 7  HOH LA .   ? HOH E 706 . ? 1_555 ? 
347 CC5 7  HOH LA .   ? HOH E 689 . ? 1_555 ? 
348 CC6 5  GLU D  106 ? GLU D 134 . ? 1_555 ? 
349 CC6 5  GLU F  106 ? GLU F 134 . ? 1_555 ? 
350 CC6 5  GLN F  107 ? GLN F 135 . ? 1_555 ? 
351 CC6 5  TRP F  111 ? TRP F 139 . ? 1_555 ? 
352 CC6 5  HOH MA .   ? HOH F 702 . ? 1_555 ? 
353 CC7 6  GLU F  128 ? GLU F 156 . ? 1_555 ? 
354 CC7 6  SER F  139 ? SER F 167 . ? 1_555 ? 
355 CC7 6  THR F  140 ? THR F 168 . ? 1_555 ? 
356 CC7 6  GLY F  153 ? GLY F 181 . ? 1_555 ? 
357 CC7 6  THR F  154 ? THR F 182 . ? 1_555 ? 
358 CC7 6  HOH MA .   ? HOH F 693 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VIG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VIG 
_atom_sites.fract_transf_matrix[1][1]   0.011667 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006344 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003834 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LEU A  1 6   ? -38.686 2.364   23.847  1.00 50.31  ? 34  LEU A N     1 
ATOM   2     C CA    . LEU A  1 6   ? -38.896 3.557   24.713  1.00 49.07  ? 34  LEU A CA    1 
ATOM   3     C C     . LEU A  1 6   ? -40.238 4.189   24.401  1.00 49.92  ? 34  LEU A C     1 
ATOM   4     O O     . LEU A  1 6   ? -40.572 4.387   23.227  1.00 50.70  ? 34  LEU A O     1 
ATOM   5     C CB    . LEU A  1 6   ? -37.799 4.614   24.492  1.00 46.90  ? 34  LEU A CB    1 
ATOM   6     C CG    . LEU A  1 6   ? -36.677 4.762   25.523  1.00 47.06  ? 34  LEU A CG    1 
ATOM   7     C CD1   . LEU A  1 6   ? -35.824 5.989   25.182  1.00 44.21  ? 34  LEU A CD1   1 
ATOM   8     C CD2   . LEU A  1 6   ? -37.230 4.865   26.934  1.00 48.22  ? 34  LEU A CD2   1 
ATOM   9     N N     . PRO A  1 7   ? -40.998 4.550   25.448  1.00 51.30  ? 35  PRO A N     1 
ATOM   10    C CA    . PRO A  1 7   ? -42.214 5.359   25.254  1.00 50.12  ? 35  PRO A CA    1 
ATOM   11    C C     . PRO A  1 7   ? -41.968 6.565   24.330  1.00 52.48  ? 35  PRO A C     1 
ATOM   12    O O     . PRO A  1 7   ? -40.828 7.063   24.235  1.00 55.80  ? 35  PRO A O     1 
ATOM   13    C CB    . PRO A  1 7   ? -42.553 5.842   26.672  1.00 47.90  ? 35  PRO A CB    1 
ATOM   14    C CG    . PRO A  1 7   ? -41.963 4.804   27.576  1.00 52.30  ? 35  PRO A CG    1 
ATOM   15    C CD    . PRO A  1 7   ? -40.753 4.234   26.867  1.00 51.49  ? 35  PRO A CD    1 
ATOM   16    N N     . GLU A  1 8   ? -43.025 7.021   23.654  1.00 54.66  ? 36  GLU A N     1 
ATOM   17    C CA    . GLU A  1 8   ? -42.939 8.191   22.770  1.00 52.14  ? 36  GLU A CA    1 
ATOM   18    C C     . GLU A  1 8   ? -42.503 9.411   23.576  1.00 49.17  ? 36  GLU A C     1 
ATOM   19    O O     . GLU A  1 8   ? -41.663 10.197  23.124  1.00 53.89  ? 36  GLU A O     1 
ATOM   20    C CB    . GLU A  1 8   ? -44.282 8.460   22.067  1.00 52.80  ? 36  GLU A CB    1 
ATOM   21    N N     . THR A  1 9   ? -43.065 9.541   24.779  1.00 48.52  ? 37  THR A N     1 
ATOM   22    C CA    . THR A  1 9   ? -42.753 10.649  25.700  1.00 46.74  ? 37  THR A CA    1 
ATOM   23    C C     . THR A  1 9   ? -41.256 10.735  26.009  1.00 46.33  ? 37  THR A C     1 
ATOM   24    O O     . THR A  1 9   ? -40.645 11.818  25.943  1.00 47.07  ? 37  THR A O     1 
ATOM   25    C CB    . THR A  1 9   ? -43.486 10.458  27.034  1.00 49.55  ? 37  THR A CB    1 
ATOM   26    O OG1   . THR A  1 9   ? -43.249 9.120   27.503  1.00 56.79  ? 37  THR A OG1   1 
ATOM   27    C CG2   . THR A  1 9   ? -45.004 10.690  26.866  1.00 44.33  ? 37  THR A CG2   1 
ATOM   28    N N     . HIS A  1 10  ? -40.674 9.582   26.337  1.00 42.90  ? 38  HIS A N     1 
ATOM   29    C CA    . HIS A  1 10  ? -39.245 9.506   26.638  1.00 42.13  ? 38  HIS A CA    1 
ATOM   30    C C     . HIS A  1 10  ? -38.416 9.753   25.383  1.00 40.99  ? 38  HIS A C     1 
ATOM   31    O O     . HIS A  1 10  ? -37.299 10.301  25.468  1.00 41.38  ? 38  HIS A O     1 
ATOM   32    C CB    . HIS A  1 10  ? -38.906 8.167   27.303  1.00 41.34  ? 38  HIS A CB    1 
ATOM   33    C CG    . HIS A  1 10  ? -39.435 8.044   28.697  1.00 43.13  ? 38  HIS A CG    1 
ATOM   34    N ND1   . HIS A  1 10  ? -40.725 7.648   28.972  1.00 55.41  ? 38  HIS A ND1   1 
ATOM   35    C CD2   . HIS A  1 10  ? -38.854 8.287   29.896  1.00 52.74  ? 38  HIS A CD2   1 
ATOM   36    C CE1   . HIS A  1 10  ? -40.915 7.645   30.281  1.00 48.83  ? 38  HIS A CE1   1 
ATOM   37    N NE2   . HIS A  1 10  ? -39.795 8.027   30.865  1.00 44.94  ? 38  HIS A NE2   1 
ATOM   38    N N     . GLN A  1 11  ? -38.966 9.382   24.220  1.00 42.98  ? 39  GLN A N     1 
ATOM   39    C CA    . GLN A  1 11  ? -38.319 9.688   22.925  1.00 43.99  ? 39  GLN A CA    1 
ATOM   40    C C     . GLN A  1 11  ? -38.283 11.202  22.634  1.00 41.44  ? 39  GLN A C     1 
ATOM   41    O O     . GLN A  1 11  ? -37.270 11.719  22.139  1.00 44.18  ? 39  GLN A O     1 
ATOM   42    C CB    . GLN A  1 11  ? -38.976 8.921   21.755  1.00 42.32  ? 39  GLN A CB    1 
ATOM   43    N N     . MET A  1 12  ? -39.376 11.905  22.941  1.00 42.18  ? 40  MET A N     1 
ATOM   44    C CA    . MET A  1 12  ? -39.432 13.370  22.803  1.00 42.43  ? 40  MET A CA    1 
ATOM   45    C C     . MET A  1 12  ? -38.391 14.018  23.710  1.00 42.35  ? 40  MET A C     1 
ATOM   46    O O     . MET A  1 12  ? -37.538 14.799  23.255  1.00 41.10  ? 40  MET A O     1 
ATOM   47    C CB    . MET A  1 12  ? -40.823 13.904  23.172  1.00 43.69  ? 40  MET A CB    1 
ATOM   48    N N     . LEU A  1 13  ? -38.463 13.660  24.993  1.00 41.04  ? 41  LEU A N     1 
ATOM   49    C CA    . LEU A  1 13  ? -37.506 14.117  26.003  1.00 34.78  ? 41  LEU A CA    1 
ATOM   50    C C     . LEU A  1 13  ? -36.065 13.899  25.545  1.00 33.63  ? 41  LEU A C     1 
ATOM   51    O O     . LEU A  1 13  ? -35.224 14.799  25.670  1.00 33.83  ? 41  LEU A O     1 
ATOM   52    C CB    . LEU A  1 13  ? -37.755 13.376  27.320  1.00 35.43  ? 41  LEU A CB    1 
ATOM   53    C CG    . LEU A  1 13  ? -36.797 13.671  28.477  1.00 40.88  ? 41  LEU A CG    1 
ATOM   54    C CD1   . LEU A  1 13  ? -37.045 15.068  29.035  1.00 36.26  ? 41  LEU A CD1   1 
ATOM   55    C CD2   . LEU A  1 13  ? -36.941 12.614  29.556  1.00 42.81  ? 41  LEU A CD2   1 
ATOM   56    N N     . LEU A  1 14  ? -35.767 12.717  25.011  1.00 32.77  ? 42  LEU A N     1 
ATOM   57    C CA    . LEU A  1 14  ? -34.406 12.447  24.565  1.00 34.57  ? 42  LEU A CA    1 
ATOM   58    C C     . LEU A  1 14  ? -33.969 13.501  23.528  1.00 36.06  ? 42  LEU A C     1 
ATOM   59    O O     . LEU A  1 14  ? -32.859 14.073  23.609  1.00 32.57  ? 42  LEU A O     1 
ATOM   60    C CB    . LEU A  1 14  ? -34.269 11.009  24.042  1.00 34.03  ? 42  LEU A CB    1 
ATOM   61    C CG    . LEU A  1 14  ? -32.853 10.531  23.679  1.00 35.32  ? 42  LEU A CG    1 
ATOM   62    C CD1   . LEU A  1 14  ? -32.737 9.034   23.839  1.00 41.02  ? 42  LEU A CD1   1 
ATOM   63    C CD2   . LEU A  1 14  ? -32.482 10.953  22.267  1.00 38.02  ? 42  LEU A CD2   1 
ATOM   64    N N     . GLN A  1 15  ? -34.862 13.793  22.588  1.00 36.18  ? 43  GLN A N     1 
ATOM   65    C CA    . GLN A  1 15  ? -34.565 14.730  21.495  1.00 36.82  ? 43  GLN A CA    1 
ATOM   66    C C     . GLN A  1 15  ? -34.446 16.176  21.979  1.00 32.09  ? 43  GLN A C     1 
ATOM   67    O O     . GLN A  1 15  ? -33.585 16.927  21.524  1.00 31.82  ? 43  GLN A O     1 
ATOM   68    C CB    . GLN A  1 15  ? -35.638 14.619  20.395  1.00 37.78  ? 43  GLN A CB    1 
ATOM   69    C CG    . GLN A  1 15  ? -35.239 15.267  19.082  1.00 46.04  ? 43  GLN A CG    1 
ATOM   70    C CD    . GLN A  1 15  ? -33.885 14.783  18.587  1.00 50.08  ? 43  GLN A CD    1 
ATOM   71    O OE1   . GLN A  1 15  ? -33.733 13.622  18.201  1.00 55.79  ? 43  GLN A OE1   1 
ATOM   72    N NE2   . GLN A  1 15  ? -32.886 15.670  18.613  1.00 50.76  ? 43  GLN A NE2   1 
ATOM   73    N N     . THR A  1 16  ? -35.321 16.553  22.904  1.00 32.02  ? 44  THR A N     1 
ATOM   74    C CA    . THR A  1 16  ? -35.240 17.852  23.540  1.00 34.37  ? 44  THR A CA    1 
ATOM   75    C C     . THR A  1 16  ? -33.868 18.067  24.179  1.00 32.36  ? 44  THR A C     1 
ATOM   76    O O     . THR A  1 16  ? -33.232 19.100  23.943  1.00 27.07  ? 44  THR A O     1 
ATOM   77    C CB    . THR A  1 16  ? -36.318 18.021  24.620  1.00 35.93  ? 44  THR A CB    1 
ATOM   78    O OG1   . THR A  1 16  ? -37.625 17.870  24.039  1.00 41.01  ? 44  THR A OG1   1 
ATOM   79    C CG2   . THR A  1 16  ? -36.200 19.394  25.280  1.00 36.58  ? 44  THR A CG2   1 
ATOM   80    N N     . CYS A  1 17  ? -33.419 17.089  24.977  1.00 32.39  ? 45  CYS A N     1 
ATOM   81    C CA    . CYS A  1 17  ? -32.161 17.220  25.711  1.00 28.21  ? 45  CYS A CA    1 
ATOM   82    C C     . CYS A  1 17  ? -30.957 17.169  24.801  1.00 30.44  ? 45  CYS A C     1 
ATOM   83    O O     . CYS A  1 17  ? -29.980 17.896  25.010  1.00 29.98  ? 45  CYS A O     1 
ATOM   84    C CB    . CYS A  1 17  ? -32.042 16.157  26.812  1.00 33.41  ? 45  CYS A CB    1 
ATOM   85    S SG    . CYS A  1 17  ? -33.402 16.200  27.981  1.00 33.05  ? 45  CYS A SG    1 
ATOM   86    N N     . ARG A  1 18  ? -31.022 16.317  23.787  1.00 30.89  ? 46  ARG A N     1 
ATOM   87    C CA    . ARG A  1 18  ? -29.963 16.265  22.802  1.00 33.00  ? 46  ARG A CA    1 
ATOM   88    C C     . ARG A  1 18  ? -29.831 17.606  22.090  1.00 31.59  ? 46  ARG A C     1 
ATOM   89    O O     . ARG A  1 18  ? -28.718 18.127  21.922  1.00 28.46  ? 46  ARG A O     1 
ATOM   90    C CB    . ARG A  1 18  ? -30.217 15.152  21.786  1.00 31.15  ? 46  ARG A CB    1 
ATOM   91    C CG    . ARG A  1 18  ? -29.048 14.931  20.844  1.00 40.36  ? 46  ARG A CG    1 
ATOM   92    C CD    . ARG A  1 18  ? -29.294 13.763  19.914  1.00 50.03  ? 46  ARG A CD    1 
ATOM   93    N NE    . ARG A  1 18  ? -29.529 12.508  20.632  1.00 63.36  ? 46  ARG A NE    1 
ATOM   94    C CZ    . ARG A  1 18  ? -28.582 11.655  21.035  1.00 61.01  ? 46  ARG A CZ    1 
ATOM   95    N NH1   . ARG A  1 18  ? -27.285 11.891  20.821  1.00 51.75  ? 46  ARG A NH1   1 
ATOM   96    N NH2   . ARG A  1 18  ? -28.942 10.545  21.668  1.00 59.66  ? 46  ARG A NH2   1 
ATOM   97    N N     . ASP A  1 19  ? -30.967 18.169  21.686  1.00 31.00  ? 47  ASP A N     1 
ATOM   98    C CA    . ASP A  1 19  ? -30.972 19.452  20.979  1.00 32.23  ? 47  ASP A CA    1 
ATOM   99    C C     . ASP A  1 19  ? -30.421 20.570  21.838  1.00 30.29  ? 47  ASP A C     1 
ATOM   100   O O     . ASP A  1 19  ? -29.556 21.338  21.391  1.00 30.04  ? 47  ASP A O     1 
ATOM   101   C CB    . ASP A  1 19  ? -32.388 19.786  20.496  1.00 33.32  ? 47  ASP A CB    1 
ATOM   102   C CG    . ASP A  1 19  ? -32.826 18.913  19.329  1.00 41.90  ? 47  ASP A CG    1 
ATOM   103   O OD1   . ASP A  1 19  ? -31.943 18.340  18.637  1.00 38.51  ? 47  ASP A OD1   1 
ATOM   104   O OD2   . ASP A  1 19  ? -34.059 18.801  19.112  1.00 49.97  ? 47  ASP A OD2   1 
ATOM   105   N N     . PHE A  1 20  ? -30.891 20.637  23.080  1.00 29.52  ? 48  PHE A N     1 
ATOM   106   C CA    . PHE A  1 20  ? -30.323 21.555  24.067  1.00 26.85  ? 48  PHE A CA    1 
ATOM   107   C C     . PHE A  1 20  ? -28.818 21.368  24.230  1.00 28.57  ? 48  PHE A C     1 
ATOM   108   O O     . PHE A  1 20  ? -28.065 22.335  24.203  1.00 29.66  ? 48  PHE A O     1 
ATOM   109   C CB    . PHE A  1 20  ? -31.004 21.383  25.415  1.00 28.26  ? 48  PHE A CB    1 
ATOM   110   C CG    . PHE A  1 20  ? -30.535 22.373  26.445  1.00 33.81  ? 48  PHE A CG    1 
ATOM   111   C CD1   . PHE A  1 20  ? -31.100 23.638  26.508  1.00 31.70  ? 48  PHE A CD1   1 
ATOM   112   C CD2   . PHE A  1 20  ? -29.496 22.057  27.312  1.00 30.23  ? 48  PHE A CD2   1 
ATOM   113   C CE1   . PHE A  1 20  ? -30.683 24.549  27.441  1.00 40.42  ? 48  PHE A CE1   1 
ATOM   114   C CE2   . PHE A  1 20  ? -29.055 22.969  28.237  1.00 40.57  ? 48  PHE A CE2   1 
ATOM   115   C CZ    . PHE A  1 20  ? -29.658 24.234  28.302  1.00 35.71  ? 48  PHE A CZ    1 
ATOM   116   N N     . ALA A  1 21  ? -28.370 20.120  24.370  1.00 29.55  ? 49  ALA A N     1 
ATOM   117   C CA    . ALA A  1 21  ? -26.956 19.850  24.574  1.00 30.01  ? 49  ALA A CA    1 
ATOM   118   C C     . ALA A  1 21  ? -26.141 20.323  23.386  1.00 32.64  ? 49  ALA A C     1 
ATOM   119   O O     . ALA A  1 21  ? -25.095 20.992  23.541  1.00 26.65  ? 49  ALA A O     1 
ATOM   120   C CB    . ALA A  1 21  ? -26.718 18.355  24.819  1.00 32.49  ? 49  ALA A CB    1 
ATOM   121   N N     . GLU A  1 22  ? -26.628 19.978  22.197  1.00 30.92  ? 50  GLU A N     1 
ATOM   122   C CA    . GLU A  1 22  ? -25.983 20.394  20.966  1.00 36.82  ? 50  GLU A CA    1 
ATOM   123   C C     . GLU A  1 22  ? -25.992 21.917  20.843  1.00 33.58  ? 50  GLU A C     1 
ATOM   124   O O     . GLU A  1 22  ? -24.958 22.520  20.565  1.00 31.17  ? 50  GLU A O     1 
ATOM   125   C CB    . GLU A  1 22  ? -26.595 19.660  19.748  1.00 36.42  ? 50  GLU A CB    1 
ATOM   126   C CG    . GLU A  1 22  ? -25.901 18.296  19.510  1.00 50.49  ? 50  GLU A CG    1 
ATOM   127   C CD    . GLU A  1 22  ? -26.800 17.176  18.980  1.00 56.36  ? 50  GLU A CD    1 
ATOM   128   O OE1   . GLU A  1 22  ? -27.910 17.451  18.468  1.00 60.86  ? 50  GLU A OE1   1 
ATOM   129   O OE2   . GLU A  1 22  ? -26.370 15.998  19.075  1.00 50.36  ? 50  GLU A OE2   1 
ATOM   130   N N     . LYS A  1 23  ? -27.133 22.543  21.110  1.00 34.87  ? 51  LYS A N     1 
ATOM   131   C CA    . LYS A  1 23  ? -27.226 24.007  21.034  1.00 33.26  ? 51  LYS A CA    1 
ATOM   132   C C     . LYS A  1 23  ? -26.481 24.772  22.153  1.00 33.38  ? 51  LYS A C     1 
ATOM   133   O O     . LYS A  1 23  ? -25.844 25.801  21.882  1.00 33.67  ? 51  LYS A O     1 
ATOM   134   C CB    . LYS A  1 23  ? -28.693 24.428  21.005  1.00 33.34  ? 51  LYS A CB    1 
ATOM   135   C CG    . LYS A  1 23  ? -28.887 25.934  20.868  1.00 39.60  ? 51  LYS A CG    1 
ATOM   136   C CD    . LYS A  1 23  ? -30.342 26.326  20.840  1.00 42.47  ? 51  LYS A CD    1 
ATOM   137   C CE    . LYS A  1 23  ? -30.512 27.783  20.424  1.00 47.40  ? 51  LYS A CE    1 
ATOM   138   N NZ    . LYS A  1 23  ? -31.954 28.141  20.279  1.00 56.24  ? 51  LYS A NZ    1 
ATOM   139   N N     . GLU A  1 24  ? -26.511 24.271  23.390  1.00 30.33  ? 52  GLU A N     1 
ATOM   140   C CA    . GLU A  1 24  ? -26.054 25.073  24.545  1.00 29.98  ? 52  GLU A CA    1 
ATOM   141   C C     . GLU A  1 24  ? -24.798 24.605  25.285  1.00 30.49  ? 52  GLU A C     1 
ATOM   142   O O     . GLU A  1 24  ? -24.159 25.406  25.959  1.00 28.32  ? 52  GLU A O     1 
ATOM   143   C CB    . GLU A  1 24  ? -27.167 25.164  25.581  1.00 31.94  ? 52  GLU A CB    1 
ATOM   144   C CG    . GLU A  1 24  ? -28.505 25.671  25.027  1.00 35.38  ? 52  GLU A CG    1 
ATOM   145   C CD    . GLU A  1 24  ? -28.528 27.171  24.731  1.00 49.31  ? 52  GLU A CD    1 
ATOM   146   O OE1   . GLU A  1 24  ? -27.523 27.874  25.024  1.00 48.71  ? 52  GLU A OE1   1 
ATOM   147   O OE2   . GLU A  1 24  ? -29.575 27.648  24.220  1.00 49.07  ? 52  GLU A OE2   1 
ATOM   148   N N     . LEU A  1 25  ? -24.473 23.318  25.205  1.00 27.97  ? 53  LEU A N     1 
ATOM   149   C CA    . LEU A  1 25  ? -23.433 22.745  26.060  1.00 25.72  ? 53  LEU A CA    1 
ATOM   150   C C     . LEU A  1 25  ? -22.164 22.453  25.277  1.00 26.39  ? 53  LEU A C     1 
ATOM   151   O O     . LEU A  1 25  ? -21.077 22.902  25.656  1.00 27.40  ? 53  LEU A O     1 
ATOM   152   C CB    . LEU A  1 25  ? -23.981 21.490  26.765  1.00 23.18  ? 53  LEU A CB    1 
ATOM   153   C CG    . LEU A  1 25  ? -25.182 21.700  27.690  1.00 27.95  ? 53  LEU A CG    1 
ATOM   154   C CD1   . LEU A  1 25  ? -25.545 20.415  28.469  1.00 26.78  ? 53  LEU A CD1   1 
ATOM   155   C CD2   . LEU A  1 25  ? -24.892 22.847  28.684  1.00 24.49  ? 53  LEU A CD2   1 
ATOM   156   N N     . PHE A  1 26  ? -22.295 21.727  24.173  1.00 29.55  ? 54  PHE A N     1 
ATOM   157   C CA    . PHE A  1 26  ? -21.150 21.455  23.306  1.00 30.22  ? 54  PHE A CA    1 
ATOM   158   C C     . PHE A  1 26  ? -20.277 22.696  23.032  1.00 29.76  ? 54  PHE A C     1 
ATOM   159   O O     . PHE A  1 26  ? -19.043 22.625  23.110  1.00 26.46  ? 54  PHE A O     1 
ATOM   160   C CB    . PHE A  1 26  ? -21.599 20.781  21.991  1.00 30.63  ? 54  PHE A CB    1 
ATOM   161   C CG    . PHE A  1 26  ? -21.777 19.272  22.112  1.00 36.07  ? 54  PHE A CG    1 
ATOM   162   C CD1   . PHE A  1 26  ? -23.012 18.725  22.429  1.00 37.31  ? 54  PHE A CD1   1 
ATOM   163   C CD2   . PHE A  1 26  ? -20.692 18.408  21.948  1.00 48.64  ? 54  PHE A CD2   1 
ATOM   164   C CE1   . PHE A  1 26  ? -23.182 17.355  22.565  1.00 35.80  ? 54  PHE A CE1   1 
ATOM   165   C CE2   . PHE A  1 26  ? -20.852 17.030  22.076  1.00 44.53  ? 54  PHE A CE2   1 
ATOM   166   C CZ    . PHE A  1 26  ? -22.109 16.506  22.378  1.00 31.24  ? 54  PHE A CZ    1 
ATOM   167   N N     . PRO A  1 27  ? -20.900 23.839  22.695  1.00 29.97  ? 55  PRO A N     1 
ATOM   168   C CA    . PRO A  1 27  ? -20.065 25.015  22.397  1.00 30.13  ? 55  PRO A CA    1 
ATOM   169   C C     . PRO A  1 27  ? -19.360 25.682  23.598  1.00 31.01  ? 55  PRO A C     1 
ATOM   170   O O     . PRO A  1 27  ? -18.487 26.497  23.378  1.00 32.22  ? 55  PRO A O     1 
ATOM   171   C CB    . PRO A  1 27  ? -21.053 25.997  21.748  1.00 31.02  ? 55  PRO A CB    1 
ATOM   172   C CG    . PRO A  1 27  ? -22.291 25.176  21.425  1.00 32.38  ? 55  PRO A CG    1 
ATOM   173   C CD    . PRO A  1 27  ? -22.333 24.112  22.468  1.00 27.04  ? 55  PRO A CD    1 
ATOM   174   N N     . ILE A  1 28  ? -19.731 25.349  24.835  1.00 27.94  ? 56  ILE A N     1 
ATOM   175   C CA    . ILE A  1 28  ? -19.092 25.929  26.016  1.00 28.02  ? 56  ILE A CA    1 
ATOM   176   C C     . ILE A  1 28  ? -18.152 24.962  26.778  1.00 29.42  ? 56  ILE A C     1 
ATOM   177   O O     . ILE A  1 28  ? -17.401 25.398  27.651  1.00 25.26  ? 56  ILE A O     1 
ATOM   178   C CB    . ILE A  1 28  ? -20.152 26.534  27.004  1.00 31.84  ? 56  ILE A CB    1 
ATOM   179   C CG1   . ILE A  1 28  ? -21.134 25.462  27.521  1.00 33.17  ? 56  ILE A CG1   1 
ATOM   180   C CG2   . ILE A  1 28  ? -20.909 27.637  26.318  1.00 30.52  ? 56  ILE A CG2   1 
ATOM   181   C CD1   . ILE A  1 28  ? -21.941 25.850  28.733  1.00 31.84  ? 56  ILE A CD1   1 
ATOM   182   N N     . ALA A  1 29  ? -18.146 23.674  26.409  1.00 29.03  ? 57  ALA A N     1 
ATOM   183   C CA    . ALA A  1 29  ? -17.504 22.640  27.234  1.00 27.84  ? 57  ALA A CA    1 
ATOM   184   C C     . ALA A  1 29  ? -16.008 22.809  27.392  1.00 24.99  ? 57  ALA A C     1 
ATOM   185   O O     . ALA A  1 29  ? -15.496 22.624  28.499  1.00 26.66  ? 57  ALA A O     1 
ATOM   186   C CB    . ALA A  1 29  ? -17.808 21.257  26.697  1.00 25.96  ? 57  ALA A CB    1 
ATOM   187   N N     . ALA A  1 30  ? -15.306 23.115  26.294  1.00 26.03  ? 58  ALA A N     1 
ATOM   188   C CA    . ALA A  1 30  ? -13.869 23.407  26.354  1.00 26.77  ? 58  ALA A CA    1 
ATOM   189   C C     . ALA A  1 30  ? -13.596 24.592  27.296  1.00 28.74  ? 58  ALA A C     1 
ATOM   190   O O     . ALA A  1 30  ? -12.695 24.530  28.115  1.00 26.15  ? 58  ALA A O     1 
ATOM   191   C CB    . ALA A  1 30  ? -13.291 23.667  24.964  1.00 25.80  ? 58  ALA A CB    1 
ATOM   192   N N     . GLN A  1 31  ? -14.399 25.651  27.196  1.00 26.79  ? 59  GLN A N     1 
ATOM   193   C CA    . GLN A  1 31  ? -14.187 26.841  28.032  1.00 30.52  ? 59  GLN A CA    1 
ATOM   194   C C     . GLN A  1 31  ? -14.489 26.605  29.513  1.00 24.75  ? 59  GLN A C     1 
ATOM   195   O O     . GLN A  1 31  ? -13.760 27.080  30.392  1.00 29.31  ? 59  GLN A O     1 
ATOM   196   C CB    . GLN A  1 31  ? -15.042 28.009  27.531  1.00 27.78  ? 59  GLN A CB    1 
ATOM   197   C CG    . GLN A  1 31  ? -14.634 29.353  28.132  1.00 31.41  ? 59  GLN A CG    1 
ATOM   198   C CD    . GLN A  1 31  ? -15.582 30.475  27.785  1.00 38.23  ? 59  GLN A CD    1 
ATOM   199   O OE1   . GLN A  1 31  ? -16.475 30.320  26.954  1.00 42.86  ? 59  GLN A OE1   1 
ATOM   200   N NE2   . GLN A  1 31  ? -15.414 31.610  28.453  1.00 38.66  ? 59  GLN A NE2   1 
ATOM   201   N N     . VAL A  1 32  ? -15.592 25.918  29.780  1.00 23.46  ? 60  VAL A N     1 
ATOM   202   C CA    . VAL A  1 32  ? -15.985 25.558  31.136  1.00 26.00  ? 60  VAL A CA    1 
ATOM   203   C C     . VAL A  1 32  ? -14.872 24.769  31.824  1.00 29.17  ? 60  VAL A C     1 
ATOM   204   O O     . VAL A  1 32  ? -14.551 25.024  32.985  1.00 24.57  ? 60  VAL A O     1 
ATOM   205   C CB    . VAL A  1 32  ? -17.283 24.709  31.143  1.00 29.98  ? 60  VAL A CB    1 
ATOM   206   C CG1   . VAL A  1 32  ? -17.366 23.843  32.408  1.00 24.63  ? 60  VAL A CG1   1 
ATOM   207   C CG2   . VAL A  1 32  ? -18.503 25.621  30.970  1.00 22.81  ? 60  VAL A CG2   1 
ATOM   208   N N     . ASP A  1 33  ? -14.291 23.832  31.072  1.00 26.12  ? 61  ASP A N     1 
ATOM   209   C CA    . ASP A  1 33  ? -13.193 23.004  31.552  1.00 25.14  ? 61  ASP A CA    1 
ATOM   210   C C     . ASP A  1 33  ? -11.909 23.817  31.715  1.00 24.67  ? 61  ASP A C     1 
ATOM   211   O O     . ASP A  1 33  ? -11.229 23.735  32.739  1.00 28.72  ? 61  ASP A O     1 
ATOM   212   C CB    . ASP A  1 33  ? -12.959 21.848  30.573  1.00 20.56  ? 61  ASP A CB    1 
ATOM   213   C CG    . ASP A  1 33  ? -11.678 21.071  30.872  1.00 26.09  ? 61  ASP A CG    1 
ATOM   214   O OD1   . ASP A  1 33  ? -11.647 20.363  31.890  1.00 24.71  ? 61  ASP A OD1   1 
ATOM   215   O OD2   . ASP A  1 33  ? -10.707 21.192  30.097  1.00 25.75  ? 61  ASP A OD2   1 
ATOM   216   N N     . LYS A  1 34  ? -11.573 24.598  30.695  1.00 25.42  ? 62  LYS A N     1 
ATOM   217   C CA    . LYS A  1 34  ? -10.313 25.321  30.691  1.00 25.51  ? 62  LYS A CA    1 
ATOM   218   C C     . LYS A  1 34  ? -10.226 26.341  31.827  1.00 29.99  ? 62  LYS A C     1 
ATOM   219   O O     . LYS A  1 34  ? -9.168  26.506  32.449  1.00 31.13  ? 62  LYS A O     1 
ATOM   220   C CB    . LYS A  1 34  ? -10.097 26.017  29.350  1.00 28.87  ? 62  LYS A CB    1 
ATOM   221   C CG    . LYS A  1 34  ? -8.840  26.892  29.339  1.00 28.06  ? 62  LYS A CG    1 
ATOM   222   C CD    . LYS A  1 34  ? -8.423  27.369  27.975  1.00 34.19  ? 62  LYS A CD    1 
ATOM   223   C CE    . LYS A  1 34  ? -7.030  28.019  28.083  1.00 43.31  ? 62  LYS A CE    1 
ATOM   224   N NZ    . LYS A  1 34  ? -6.567  28.627  26.821  1.00 49.97  ? 62  LYS A NZ    1 
ATOM   225   N N     . GLU A  1 35  ? -11.330 27.028  32.073  1.00 32.12  ? 63  GLU A N     1 
ATOM   226   C CA    . GLU A  1 35  ? -11.337 28.192  32.952  1.00 34.73  ? 63  GLU A CA    1 
ATOM   227   C C     . GLU A  1 35  ? -11.970 27.901  34.305  1.00 33.01  ? 63  GLU A C     1 
ATOM   228   O O     . GLU A  1 35  ? -12.039 28.797  35.143  1.00 33.57  ? 63  GLU A O     1 
ATOM   229   C CB    . GLU A  1 35  ? -12.049 29.368  32.259  1.00 32.97  ? 63  GLU A CB    1 
ATOM   230   C CG    . GLU A  1 35  ? -11.283 29.912  31.042  1.00 35.33  ? 63  GLU A CG    1 
ATOM   231   C CD    . GLU A  1 35  ? -12.064 30.986  30.248  1.00 44.26  ? 63  GLU A CD    1 
ATOM   232   O OE1   . GLU A  1 35  ? -13.170 31.412  30.683  1.00 42.70  ? 63  GLU A OE1   1 
ATOM   233   O OE2   . GLU A  1 35  ? -11.555 31.405  29.185  1.00 53.32  ? 63  GLU A OE2   1 
ATOM   234   N N     . HIS A  1 36  ? -12.402 26.657  34.529  1.00 31.65  ? 64  HIS A N     1 
ATOM   235   C CA    . HIS A  1 36  ? -13.058 26.247  35.784  1.00 29.32  ? 64  HIS A CA    1 
ATOM   236   C C     . HIS A  1 36  ? -14.296 27.110  35.997  1.00 28.09  ? 64  HIS A C     1 
ATOM   237   O O     . HIS A  1 36  ? -14.570 27.568  37.094  1.00 28.61  ? 64  HIS A O     1 
ATOM   238   C CB    . HIS A  1 36  ? -12.131 26.370  37.025  1.00 29.12  ? 64  HIS A CB    1 
ATOM   239   C CG    . HIS A  1 36  ? -10.885 25.528  36.967  1.00 33.72  ? 64  HIS A CG    1 
ATOM   240   N ND1   . HIS A  1 36  ? -9.945  25.639  35.965  1.00 44.53  ? 64  HIS A ND1   1 
ATOM   241   C CD2   . HIS A  1 36  ? -10.408 24.593  37.819  1.00 40.44  ? 64  HIS A CD2   1 
ATOM   242   C CE1   . HIS A  1 36  ? -8.951  24.796  36.193  1.00 37.96  ? 64  HIS A CE1   1 
ATOM   243   N NE2   . HIS A  1 36  ? -9.202  24.159  37.320  1.00 37.31  ? 64  HIS A NE2   1 
ATOM   244   N N     . LEU A  1 37  ? -15.050 27.315  34.935  1.00 31.45  ? 65  LEU A N     1 
ATOM   245   C CA    . LEU A  1 37  ? -16.096 28.311  34.918  1.00 27.38  ? 65  LEU A CA    1 
ATOM   246   C C     . LEU A  1 37  ? -17.455 27.672  35.159  1.00 24.09  ? 65  LEU A C     1 
ATOM   247   O O     . LEU A  1 37  ? -17.868 26.793  34.400  1.00 26.87  ? 65  LEU A O     1 
ATOM   248   C CB    . LEU A  1 37  ? -16.052 28.994  33.552  1.00 30.78  ? 65  LEU A CB    1 
ATOM   249   C CG    . LEU A  1 37  ? -16.978 30.166  33.257  1.00 35.02  ? 65  LEU A CG    1 
ATOM   250   C CD1   . LEU A  1 37  ? -16.627 31.371  34.139  1.00 35.87  ? 65  LEU A CD1   1 
ATOM   251   C CD2   . LEU A  1 37  ? -16.876 30.496  31.755  1.00 37.30  ? 65  LEU A CD2   1 
ATOM   252   N N     . PHE A  1 38  ? -18.156 28.106  36.205  1.00 25.18  ? 66  PHE A N     1 
ATOM   253   C CA    . PHE A  1 38  ? -19.474 27.561  36.511  1.00 24.42  ? 66  PHE A CA    1 
ATOM   254   C C     . PHE A  1 38  ? -20.443 28.018  35.423  1.00 29.74  ? 66  PHE A C     1 
ATOM   255   O O     . PHE A  1 38  ? -20.510 29.213  35.135  1.00 25.75  ? 66  PHE A O     1 
ATOM   256   C CB    . PHE A  1 38  ? -19.948 28.012  37.902  1.00 27.01  ? 66  PHE A CB    1 
ATOM   257   C CG    . PHE A  1 38  ? -21.334 27.562  38.245  1.00 25.54  ? 66  PHE A CG    1 
ATOM   258   C CD1   . PHE A  1 38  ? -21.560 26.276  38.719  1.00 23.95  ? 66  PHE A CD1   1 
ATOM   259   C CD2   . PHE A  1 38  ? -22.417 28.403  38.078  1.00 29.63  ? 66  PHE A CD2   1 
ATOM   260   C CE1   . PHE A  1 38  ? -22.839 25.853  39.064  1.00 27.10  ? 66  PHE A CE1   1 
ATOM   261   C CE2   . PHE A  1 38  ? -23.718 27.978  38.387  1.00 31.03  ? 66  PHE A CE2   1 
ATOM   262   C CZ    . PHE A  1 38  ? -23.927 26.704  38.888  1.00 30.61  ? 66  PHE A CZ    1 
ATOM   263   N N     . PRO A  1 39  ? -21.179 27.079  34.787  1.00 31.43  ? 67  PRO A N     1 
ATOM   264   C CA    . PRO A  1 39  ? -22.014 27.483  33.631  1.00 28.79  ? 67  PRO A CA    1 
ATOM   265   C C     . PRO A  1 39  ? -23.411 27.948  34.018  1.00 28.75  ? 67  PRO A C     1 
ATOM   266   O O     . PRO A  1 39  ? -24.383 27.265  33.726  1.00 26.23  ? 67  PRO A O     1 
ATOM   267   C CB    . PRO A  1 39  ? -22.058 26.201  32.782  1.00 25.84  ? 67  PRO A CB    1 
ATOM   268   C CG    . PRO A  1 39  ? -21.927 25.079  33.790  1.00 27.68  ? 67  PRO A CG    1 
ATOM   269   C CD    . PRO A  1 39  ? -21.263 25.625  35.034  1.00 29.03  ? 67  PRO A CD    1 
ATOM   270   N N     . ALA A  1 40  ? -23.484 29.118  34.657  1.00 29.33  ? 68  ALA A N     1 
ATOM   271   C CA    . ALA A  1 40  ? -24.697 29.602  35.310  1.00 27.06  ? 68  ALA A CA    1 
ATOM   272   C C     . ALA A  1 40  ? -25.878 29.848  34.358  1.00 25.55  ? 68  ALA A C     1 
ATOM   273   O O     . ALA A  1 40  ? -27.024 29.461  34.657  1.00 24.90  ? 68  ALA A O     1 
ATOM   274   C CB    . ALA A  1 40  ? -24.370 30.891  36.126  1.00 23.89  ? 68  ALA A CB    1 
ATOM   275   N N     . ALA A  1 41  ? -25.616 30.482  33.217  1.00 28.36  ? 69  ALA A N     1 
ATOM   276   C CA    . ALA A  1 41  ? -26.682 30.769  32.241  1.00 30.84  ? 69  ALA A CA    1 
ATOM   277   C C     . ALA A  1 41  ? -27.345 29.475  31.743  1.00 29.01  ? 69  ALA A C     1 
ATOM   278   O O     . ALA A  1 41  ? -28.582 29.379  31.637  1.00 24.26  ? 69  ALA A O     1 
ATOM   279   C CB    . ALA A  1 41  ? -26.114 31.581  31.063  1.00 30.81  ? 69  ALA A CB    1 
ATOM   280   N N     . GLN A  1 42  ? -26.517 28.468  31.482  1.00 25.04  ? 70  GLN A N     1 
ATOM   281   C CA    . GLN A  1 42  ? -27.009 27.182  30.970  1.00 28.83  ? 70  GLN A CA    1 
ATOM   282   C C     . GLN A  1 42  ? -27.842 26.425  32.015  1.00 24.62  ? 70  GLN A C     1 
ATOM   283   O O     . GLN A  1 42  ? -28.910 25.902  31.696  1.00 27.71  ? 70  GLN A O     1 
ATOM   284   C CB    . GLN A  1 42  ? -25.849 26.327  30.451  1.00 28.46  ? 70  GLN A CB    1 
ATOM   285   C CG    . GLN A  1 42  ? -25.160 26.910  29.224  1.00 32.60  ? 70  GLN A CG    1 
ATOM   286   C CD    . GLN A  1 42  ? -24.258 28.096  29.537  1.00 32.84  ? 70  GLN A CD    1 
ATOM   287   O OE1   . GLN A  1 42  ? -23.829 28.288  30.679  1.00 27.47  ? 70  GLN A OE1   1 
ATOM   288   N NE2   . GLN A  1 42  ? -23.971 28.905  28.517  1.00 29.91  ? 70  GLN A NE2   1 
ATOM   289   N N     . VAL A  1 43  ? -27.371 26.411  33.266  1.00 29.72  ? 71  VAL A N     1 
ATOM   290   C CA    . VAL A  1 43  ? -28.109 25.804  34.372  1.00 26.34  ? 71  VAL A CA    1 
ATOM   291   C C     . VAL A  1 43  ? -29.476 26.453  34.576  1.00 27.89  ? 71  VAL A C     1 
ATOM   292   O O     . VAL A  1 43  ? -30.460 25.755  34.834  1.00 26.26  ? 71  VAL A O     1 
ATOM   293   C CB    . VAL A  1 43  ? -27.319 25.866  35.725  1.00 31.18  ? 71  VAL A CB    1 
ATOM   294   C CG1   . VAL A  1 43  ? -28.198 25.425  36.891  1.00 26.77  ? 71  VAL A CG1   1 
ATOM   295   C CG2   . VAL A  1 43  ? -26.023 25.033  35.666  1.00 26.18  ? 71  VAL A CG2   1 
ATOM   296   N N     . LYS A  1 44  ? -29.528 27.780  34.485  1.00 28.82  ? 72  LYS A N     1 
ATOM   297   C CA    . LYS A  1 44  ? -30.816 28.516  34.565  1.00 30.07  ? 72  LYS A CA    1 
ATOM   298   C C     . LYS A  1 44  ? -31.766 28.067  33.437  1.00 26.09  ? 72  LYS A C     1 
ATOM   299   O O     . LYS A  1 44  ? -32.930 27.743  33.688  1.00 28.87  ? 72  LYS A O     1 
ATOM   300   C CB    . LYS A  1 44  ? -30.550 30.028  34.540  1.00 31.99  ? 72  LYS A CB    1 
ATOM   301   C CG    . LYS A  1 44  ? -31.743 30.934  34.342  1.00 38.46  ? 72  LYS A CG    1 
ATOM   302   C CD    . LYS A  1 44  ? -32.669 30.977  35.522  1.00 43.27  ? 72  LYS A CD    1 
ATOM   303   C CE    . LYS A  1 44  ? -33.589 32.189  35.445  1.00 32.67  ? 72  LYS A CE    1 
ATOM   304   N NZ    . LYS A  1 44  ? -34.824 31.975  36.255  1.00 34.41  ? 72  LYS A NZ    1 
ATOM   305   N N     . LYS A  1 45  ? -31.276 28.023  32.199  1.00 28.87  ? 73  LYS A N     1 
ATOM   306   C CA    . LYS A  1 45  ? -32.110 27.527  31.067  1.00 29.05  ? 73  LYS A CA    1 
ATOM   307   C C     . LYS A  1 45  ? -32.621 26.102  31.316  1.00 31.51  ? 73  LYS A C     1 
ATOM   308   O O     . LYS A  1 45  ? -33.829 25.837  31.176  1.00 29.22  ? 73  LYS A O     1 
ATOM   309   C CB    . LYS A  1 45  ? -31.367 27.562  29.741  1.00 31.82  ? 73  LYS A CB    1 
ATOM   310   C CG    . LYS A  1 45  ? -31.207 28.921  29.117  1.00 36.87  ? 73  LYS A CG    1 
ATOM   311   C CD    . LYS A  1 45  ? -30.620 28.781  27.713  1.00 43.39  ? 73  LYS A CD    1 
ATOM   312   C CE    . LYS A  1 45  ? -30.304 30.139  27.086  1.00 50.33  ? 73  LYS A CE    1 
ATOM   313   N NZ    . LYS A  1 45  ? -29.460 30.996  27.983  1.00 51.54  ? 73  LYS A NZ    1 
ATOM   314   N N     . MET A  1 46  ? -31.716 25.197  31.713  1.00 30.24  ? 74  MET A N     1 
ATOM   315   C CA    . MET A  1 46  ? -32.107 23.822  32.126  1.00 30.55  ? 74  MET A CA    1 
ATOM   316   C C     . MET A  1 46  ? -33.206 23.854  33.207  1.00 28.05  ? 74  MET A C     1 
ATOM   317   O O     . MET A  1 46  ? -34.142 23.055  33.214  1.00 23.19  ? 74  MET A O     1 
ATOM   318   C CB    . MET A  1 46  ? -30.888 23.050  32.660  1.00 31.05  ? 74  MET A CB    1 
ATOM   319   C CG    . MET A  1 46  ? -29.892 22.655  31.598  1.00 31.20  ? 74  MET A CG    1 
ATOM   320   S SD    . MET A  1 46  ? -28.233 22.206  32.175  1.00 35.81  ? 74  MET A SD    1 
ATOM   321   C CE    . MET A  1 46  ? -28.565 20.710  33.127  1.00 34.38  ? 74  MET A CE    1 
ATOM   322   N N     . GLY A  1 47  ? -33.059 24.772  34.142  1.00 27.59  ? 75  GLY A N     1 
ATOM   323   C CA    . GLY A  1 47  ? -34.041 24.959  35.171  1.00 29.53  ? 75  GLY A CA    1 
ATOM   324   C C     . GLY A  1 47  ? -35.407 25.243  34.588  1.00 29.77  ? 75  GLY A C     1 
ATOM   325   O O     . GLY A  1 47  ? -36.380 24.667  35.034  1.00 27.04  ? 75  GLY A O     1 
ATOM   326   N N     . GLY A  1 48  ? -35.464 26.133  33.595  1.00 32.39  ? 76  GLY A N     1 
ATOM   327   C CA    . GLY A  1 48  ? -36.725 26.472  32.916  1.00 35.35  ? 76  GLY A CA    1 
ATOM   328   C C     . GLY A  1 48  ? -37.367 25.295  32.206  1.00 34.38  ? 76  GLY A C     1 
ATOM   329   O O     . GLY A  1 48  ? -38.600 25.213  32.098  1.00 36.54  ? 76  GLY A O     1 
ATOM   330   N N     . LEU A  1 49  ? -36.532 24.381  31.722  1.00 29.68  ? 77  LEU A N     1 
ATOM   331   C CA    . LEU A  1 49  ? -37.002 23.153  31.063  1.00 29.85  ? 77  LEU A CA    1 
ATOM   332   C C     . LEU A  1 49  ? -37.403 21.997  31.986  1.00 32.10  ? 77  LEU A C     1 
ATOM   333   O O     . LEU A  1 49  ? -37.873 20.991  31.499  1.00 36.42  ? 77  LEU A O     1 
ATOM   334   C CB    . LEU A  1 49  ? -35.938 22.655  30.092  1.00 29.62  ? 77  LEU A CB    1 
ATOM   335   C CG    . LEU A  1 49  ? -35.617 23.653  28.992  1.00 36.20  ? 77  LEU A CG    1 
ATOM   336   C CD1   . LEU A  1 49  ? -34.371 23.237  28.247  1.00 36.56  ? 77  LEU A CD1   1 
ATOM   337   C CD2   . LEU A  1 49  ? -36.825 23.782  28.052  1.00 37.41  ? 77  LEU A CD2   1 
ATOM   338   N N     . GLY A  1 50  ? -37.212 22.127  33.299  1.00 29.81  ? 78  GLY A N     1 
ATOM   339   C CA    . GLY A  1 50  ? -37.564 21.060  34.241  1.00 27.73  ? 78  GLY A CA    1 
ATOM   340   C C     . GLY A  1 50  ? -36.417 20.101  34.586  1.00 27.48  ? 78  GLY A C     1 
ATOM   341   O O     . GLY A  1 50  ? -36.565 19.224  35.432  1.00 30.77  ? 78  GLY A O     1 
ATOM   342   N N     . LEU A  1 51  ? -35.265 20.286  33.958  1.00 27.90  ? 79  LEU A N     1 
ATOM   343   C CA    . LEU A  1 51  ? -34.161 19.339  34.071  1.00 28.19  ? 79  LEU A CA    1 
ATOM   344   C C     . LEU A  1 51  ? -33.530 19.261  35.468  1.00 26.95  ? 79  LEU A C     1 
ATOM   345   O O     . LEU A  1 51  ? -32.907 18.249  35.823  1.00 24.84  ? 79  LEU A O     1 
ATOM   346   C CB    . LEU A  1 51  ? -33.098 19.663  33.034  1.00 26.20  ? 79  LEU A CB    1 
ATOM   347   C CG    . LEU A  1 51  ? -33.553 19.542  31.580  1.00 28.55  ? 79  LEU A CG    1 
ATOM   348   C CD1   . LEU A  1 51  ? -32.381 19.938  30.650  1.00 27.67  ? 79  LEU A CD1   1 
ATOM   349   C CD2   . LEU A  1 51  ? -34.085 18.154  31.269  1.00 33.12  ? 79  LEU A CD2   1 
ATOM   350   N N     . LEU A  1 52  ? -33.699 20.317  36.252  1.00 24.84  ? 80  LEU A N     1 
ATOM   351   C CA    . LEU A  1 52  ? -33.162 20.356  37.609  1.00 29.36  ? 80  LEU A CA    1 
ATOM   352   C C     . LEU A  1 52  ? -34.095 19.741  38.665  1.00 27.41  ? 80  LEU A C     1 
ATOM   353   O O     . LEU A  1 52  ? -33.652 19.547  39.797  1.00 25.47  ? 80  LEU A O     1 
ATOM   354   C CB    . LEU A  1 52  ? -32.758 21.794  37.982  1.00 29.99  ? 80  LEU A CB    1 
ATOM   355   C CG    . LEU A  1 52  ? -31.744 22.450  37.020  1.00 29.61  ? 80  LEU A CG    1 
ATOM   356   C CD1   . LEU A  1 52  ? -31.532 23.907  37.401  1.00 26.66  ? 80  LEU A CD1   1 
ATOM   357   C CD2   . LEU A  1 52  ? -30.417 21.728  37.002  1.00 29.75  ? 80  LEU A CD2   1 
ATOM   358   N N     . ALA A  1 53  ? -35.332 19.398  38.274  1.00 25.26  ? 81  ALA A N     1 
ATOM   359   C CA    . ALA A  1 53  ? -36.379 18.850  39.188  1.00 27.32  ? 81  ALA A CA    1 
ATOM   360   C C     . ALA A  1 53  ? -37.263 17.811  38.503  1.00 27.53  ? 81  ALA A C     1 
ATOM   361   O O     . ALA A  1 53  ? -38.506 17.892  38.535  1.00 29.08  ? 81  ALA A O     1 
ATOM   362   C CB    . ALA A  1 53  ? -37.260 19.965  39.768  1.00 25.01  ? 81  ALA A CB    1 
ATOM   363   N N     . MET A  1 54  ? -36.626 16.803  37.918  1.00 30.94  ? 82  MET A N     1 
ATOM   364   C CA    . MET A  1 54  ? -37.331 15.903  36.992  1.00 32.36  ? 82  MET A CA    1 
ATOM   365   C C     . MET A  1 54  ? -38.362 14.984  37.634  1.00 29.62  ? 82  MET A C     1 
ATOM   366   O O     . MET A  1 54  ? -39.416 14.752  37.050  1.00 30.09  ? 82  MET A O     1 
ATOM   367   C CB    . MET A  1 54  ? -36.340 15.053  36.236  1.00 29.22  ? 82  MET A CB    1 
ATOM   368   C CG    . MET A  1 54  ? -35.269 15.857  35.556  1.00 36.22  ? 82  MET A CG    1 
ATOM   369   S SD    . MET A  1 54  ? -34.955 15.260  33.899  1.00 42.15  ? 82  MET A SD    1 
ATOM   370   C CE    . MET A  1 54  ? -36.594 15.533  33.235  1.00 35.50  ? 82  MET A CE    1 
ATOM   371   N N     . ASP A  1 55  ? -38.036 14.456  38.815  1.00 29.15  ? 83  ASP A N     1 
ATOM   372   C CA    . ASP A  1 55  ? -38.874 13.502  39.538  1.00 32.87  ? 83  ASP A CA    1 
ATOM   373   C C     . ASP A  1 55  ? -39.767 14.224  40.558  1.00 34.33  ? 83  ASP A C     1 
ATOM   374   O O     . ASP A  1 55  ? -40.484 13.591  41.340  1.00 37.46  ? 83  ASP A O     1 
ATOM   375   C CB    . ASP A  1 55  ? -37.964 12.476  40.243  1.00 36.45  ? 83  ASP A CB    1 
ATOM   376   C CG    . ASP A  1 55  ? -38.716 11.243  40.753  1.00 50.24  ? 83  ASP A CG    1 
ATOM   377   O OD1   . ASP A  1 55  ? -39.520 10.652  39.997  1.00 47.91  ? 83  ASP A OD1   1 
ATOM   378   O OD2   . ASP A  1 55  ? -38.482 10.847  41.917  1.00 53.29  ? 83  ASP A OD2   1 
ATOM   379   N N     . VAL A  1 56  ? -39.713 15.552  40.574  1.00 34.70  ? 84  VAL A N     1 
ATOM   380   C CA    . VAL A  1 56  ? -40.515 16.323  41.515  1.00 32.02  ? 84  VAL A CA    1 
ATOM   381   C C     . VAL A  1 56  ? -41.918 16.490  40.919  1.00 31.22  ? 84  VAL A C     1 
ATOM   382   O O     . VAL A  1 56  ? -42.055 16.760  39.720  1.00 31.53  ? 84  VAL A O     1 
ATOM   383   C CB    . VAL A  1 56  ? -39.846 17.680  41.857  1.00 30.05  ? 84  VAL A CB    1 
ATOM   384   C CG1   . VAL A  1 56  ? -40.736 18.511  42.786  1.00 24.01  ? 84  VAL A CG1   1 
ATOM   385   C CG2   . VAL A  1 56  ? -38.519 17.435  42.514  1.00 31.16  ? 84  VAL A CG2   1 
ATOM   386   N N     . PRO A  1 57  ? -42.965 16.291  41.739  1.00 30.31  ? 85  PRO A N     1 
ATOM   387   C CA    . PRO A  1 57  ? -44.307 16.491  41.218  1.00 30.97  ? 85  PRO A CA    1 
ATOM   388   C C     . PRO A  1 57  ? -44.529 17.916  40.715  1.00 31.67  ? 85  PRO A C     1 
ATOM   389   O O     . PRO A  1 57  ? -43.956 18.874  41.255  1.00 27.94  ? 85  PRO A O     1 
ATOM   390   C CB    . PRO A  1 57  ? -45.202 16.246  42.438  1.00 31.50  ? 85  PRO A CB    1 
ATOM   391   C CG    . PRO A  1 57  ? -44.401 15.533  43.398  1.00 35.04  ? 85  PRO A CG    1 
ATOM   392   C CD    . PRO A  1 57  ? -42.984 15.875  43.154  1.00 28.82  ? 85  PRO A CD    1 
ATOM   393   N N     . GLU A  1 58  ? -45.374 18.054  39.702  1.00 29.52  ? 86  GLU A N     1 
ATOM   394   C CA    . GLU A  1 58  ? -45.675 19.373  39.136  1.00 35.37  ? 86  GLU A CA    1 
ATOM   395   C C     . GLU A  1 58  ? -46.228 20.346  40.177  1.00 33.48  ? 86  GLU A C     1 
ATOM   396   O O     . GLU A  1 58  ? -45.950 21.536  40.128  1.00 32.09  ? 86  GLU A O     1 
ATOM   397   C CB    . GLU A  1 58  ? -46.676 19.237  37.990  1.00 37.33  ? 86  GLU A CB    1 
ATOM   398   C CG    . GLU A  1 58  ? -46.075 18.688  36.716  1.00 42.87  ? 86  GLU A CG    1 
ATOM   399   C CD    . GLU A  1 58  ? -47.022 18.838  35.533  1.00 55.34  ? 86  GLU A CD    1 
ATOM   400   O OE1   . GLU A  1 58  ? -48.229 18.516  35.685  1.00 56.24  ? 86  GLU A OE1   1 
ATOM   401   O OE2   . GLU A  1 58  ? -46.560 19.286  34.461  1.00 62.10  ? 86  GLU A OE2   1 
ATOM   402   N N     . GLU A  1 59  ? -47.011 19.810  41.108  1.00 36.79  ? 87  GLU A N     1 
ATOM   403   C CA    . GLU A  1 59  ? -47.621 20.559  42.198  1.00 38.44  ? 87  GLU A CA    1 
ATOM   404   C C     . GLU A  1 59  ? -46.597 21.195  43.160  1.00 36.58  ? 87  GLU A C     1 
ATOM   405   O O     . GLU A  1 59  ? -46.918 22.124  43.893  1.00 34.35  ? 87  GLU A O     1 
ATOM   406   C CB    . GLU A  1 59  ? -48.538 19.603  42.965  1.00 36.38  ? 87  GLU A CB    1 
ATOM   407   C CG    . GLU A  1 59  ? -49.268 20.183  44.160  1.00 48.34  ? 87  GLU A CG    1 
ATOM   408   C CD    . GLU A  1 59  ? -50.009 19.105  44.929  1.00 54.97  ? 87  GLU A CD    1 
ATOM   409   O OE1   . GLU A  1 59  ? -49.367 18.093  45.295  1.00 79.39  ? 87  GLU A OE1   1 
ATOM   410   O OE2   . GLU A  1 59  ? -51.229 19.264  45.163  1.00 80.74  ? 87  GLU A OE2   1 
ATOM   411   N N     . LEU A  1 60  ? -45.370 20.689  43.173  1.00 36.18  ? 88  LEU A N     1 
ATOM   412   C CA    . LEU A  1 60  ? -44.292 21.340  43.915  1.00 30.90  ? 88  LEU A CA    1 
ATOM   413   C C     . LEU A  1 60  ? -43.367 22.139  42.990  1.00 31.51  ? 88  LEU A C     1 
ATOM   414   O O     . LEU A  1 60  ? -42.311 22.615  43.420  1.00 34.00  ? 88  LEU A O     1 
ATOM   415   C CB    . LEU A  1 60  ? -43.510 20.299  44.739  1.00 31.62  ? 88  LEU A CB    1 
ATOM   416   C CG    . LEU A  1 60  ? -44.194 19.720  45.989  1.00 34.77  ? 88  LEU A CG    1 
ATOM   417   C CD1   . LEU A  1 60  ? -43.443 18.473  46.461  1.00 33.89  ? 88  LEU A CD1   1 
ATOM   418   C CD2   . LEU A  1 60  ? -44.318 20.784  47.128  1.00 29.62  ? 88  LEU A CD2   1 
ATOM   419   N N     . GLY A  1 61  ? -43.773 22.308  41.731  1.00 32.30  ? 89  GLY A N     1 
ATOM   420   C CA    . GLY A  1 61  ? -42.983 23.022  40.742  1.00 30.53  ? 89  GLY A CA    1 
ATOM   421   C C     . GLY A  1 61  ? -42.058 22.189  39.882  1.00 30.77  ? 89  GLY A C     1 
ATOM   422   O O     . GLY A  1 61  ? -41.262 22.735  39.106  1.00 27.84  ? 89  GLY A O     1 
ATOM   423   N N     . GLY A  1 62  ? -42.145 20.870  40.013  1.00 32.61  ? 90  GLY A N     1 
ATOM   424   C CA    . GLY A  1 62  ? -41.272 19.958  39.277  1.00 30.79  ? 90  GLY A CA    1 
ATOM   425   C C     . GLY A  1 62  ? -41.776 19.585  37.891  1.00 32.23  ? 90  GLY A C     1 
ATOM   426   O O     . GLY A  1 62  ? -42.850 20.007  37.486  1.00 28.39  ? 90  GLY A O     1 
ATOM   427   N N     . ALA A  1 63  ? -40.977 18.794  37.170  1.00 31.96  ? 91  ALA A N     1 
ATOM   428   C CA    . ALA A  1 63  ? -41.324 18.320  35.822  1.00 30.91  ? 91  ALA A CA    1 
ATOM   429   C C     . ALA A  1 63  ? -42.396 17.219  35.837  1.00 29.06  ? 91  ALA A C     1 
ATOM   430   O O     . ALA A  1 63  ? -43.052 16.968  34.820  1.00 33.55  ? 91  ALA A O     1 
ATOM   431   C CB    . ALA A  1 63  ? -40.076 17.851  35.096  1.00 27.58  ? 91  ALA A CB    1 
ATOM   432   N N     . GLY A  1 64  ? -42.594 16.577  36.987  1.00 29.76  ? 92  GLY A N     1 
ATOM   433   C CA    . GLY A  1 64  ? -43.595 15.520  37.138  1.00 28.79  ? 92  GLY A CA    1 
ATOM   434   C C     . GLY A  1 64  ? -43.315 14.220  36.386  1.00 32.18  ? 92  GLY A C     1 
ATOM   435   O O     . GLY A  1 64  ? -44.241 13.487  36.057  1.00 28.45  ? 92  GLY A O     1 
ATOM   436   N N     . LEU A  1 65  ? -42.040 13.940  36.128  1.00 28.02  ? 93  LEU A N     1 
ATOM   437   C CA    . LEU A  1 65  ? -41.604 12.761  35.386  1.00 30.54  ? 93  LEU A CA    1 
ATOM   438   C C     . LEU A  1 65  ? -41.055 11.692  36.347  1.00 32.81  ? 93  LEU A C     1 
ATOM   439   O O     . LEU A  1 65  ? -41.417 11.664  37.524  1.00 36.08  ? 93  LEU A O     1 
ATOM   440   C CB    . LEU A  1 65  ? -40.535 13.172  34.372  1.00 28.20  ? 93  LEU A CB    1 
ATOM   441   C CG    . LEU A  1 65  ? -40.853 14.367  33.468  1.00 34.20  ? 93  LEU A CG    1 
ATOM   442   C CD1   . LEU A  1 65  ? -39.693 14.634  32.528  1.00 30.62  ? 93  LEU A CD1   1 
ATOM   443   C CD2   . LEU A  1 65  ? -42.142 14.121  32.678  1.00 31.26  ? 93  LEU A CD2   1 
ATOM   444   N N     . ASP A  1 66  ? -40.186 10.815  35.849  1.00 35.72  ? 94  ASP A N     1 
ATOM   445   C CA    . ASP A  1 66  ? -39.669 9.684   36.634  1.00 30.57  ? 94  ASP A CA    1 
ATOM   446   C C     . ASP A  1 66  ? -38.166 9.513   36.445  1.00 27.73  ? 94  ASP A C     1 
ATOM   447   O O     . ASP A  1 66  ? -37.565 10.216  35.649  1.00 24.20  ? 94  ASP A O     1 
ATOM   448   C CB    . ASP A  1 66  ? -40.419 8.399   36.260  1.00 32.44  ? 94  ASP A CB    1 
ATOM   449   C CG    . ASP A  1 66  ? -40.267 8.009   34.787  1.00 29.78  ? 94  ASP A CG    1 
ATOM   450   O OD1   . ASP A  1 66  ? -39.289 8.408   34.115  1.00 33.63  ? 94  ASP A OD1   1 
ATOM   451   O OD2   . ASP A  1 66  ? -41.146 7.271   34.295  1.00 38.77  ? 94  ASP A OD2   1 
ATOM   452   N N     . TYR A  1 67  ? -37.588 8.533   37.146  1.00 28.00  ? 95  TYR A N     1 
ATOM   453   C CA    . TYR A  1 67  ? -36.136 8.292   37.109  1.00 24.99  ? 95  TYR A CA    1 
ATOM   454   C C     . TYR A  1 67  ? -35.595 7.738   35.806  1.00 22.80  ? 95  TYR A C     1 
ATOM   455   O O     . TYR A  1 67  ? -34.412 7.961   35.474  1.00 22.86  ? 95  TYR A O     1 
ATOM   456   C CB    . TYR A  1 67  ? -35.698 7.442   38.312  1.00 25.40  ? 95  TYR A CB    1 
ATOM   457   C CG    . TYR A  1 67  ? -34.992 8.299   39.332  1.00 32.13  ? 95  TYR A CG    1 
ATOM   458   C CD1   . TYR A  1 67  ? -33.676 8.036   39.693  1.00 26.67  ? 95  TYR A CD1   1 
ATOM   459   C CD2   . TYR A  1 67  ? -35.618 9.421   39.883  1.00 27.29  ? 95  TYR A CD2   1 
ATOM   460   C CE1   . TYR A  1 67  ? -33.001 8.837   40.603  1.00 30.14  ? 95  TYR A CE1   1 
ATOM   461   C CE2   . TYR A  1 67  ? -34.957 10.249  40.796  1.00 30.80  ? 95  TYR A CE2   1 
ATOM   462   C CZ    . TYR A  1 67  ? -33.631 9.945   41.156  1.00 31.42  ? 95  TYR A CZ    1 
ATOM   463   O OH    . TYR A  1 67  ? -32.944 10.742  42.060  1.00 34.88  ? 95  TYR A OH    1 
ATOM   464   N N     . LEU A  1 68  ? -36.427 7.029   35.045  1.00 24.16  ? 96  LEU A N     1 
ATOM   465   C CA    . LEU A  1 68  ? -36.029 6.661   33.680  1.00 26.07  ? 96  LEU A CA    1 
ATOM   466   C C     . LEU A  1 68  ? -35.825 7.905   32.787  1.00 23.12  ? 96  LEU A C     1 
ATOM   467   O O     . LEU A  1 68  ? -34.822 8.013   32.056  1.00 21.89  ? 96  LEU A O     1 
ATOM   468   C CB    . LEU A  1 68  ? -37.000 5.659   33.047  1.00 22.43  ? 96  LEU A CB    1 
ATOM   469   C CG    . LEU A  1 68  ? -36.682 5.204   31.620  1.00 24.94  ? 96  LEU A CG    1 
ATOM   470   C CD1   . LEU A  1 68  ? -35.282 4.599   31.546  1.00 21.88  ? 96  LEU A CD1   1 
ATOM   471   C CD2   . LEU A  1 68  ? -37.740 4.194   31.092  1.00 24.81  ? 96  LEU A CD2   1 
ATOM   472   N N     . ALA A  1 69  ? -36.738 8.859   32.892  1.00 23.89  ? 97  ALA A N     1 
ATOM   473   C CA    . ALA A  1 69  ? -36.599 10.140  32.200  1.00 24.97  ? 97  ALA A CA    1 
ATOM   474   C C     . ALA A  1 69  ? -35.350 10.876  32.647  1.00 25.93  ? 97  ALA A C     1 
ATOM   475   O O     . ALA A  1 69  ? -34.600 11.395  31.817  1.00 24.72  ? 97  ALA A O     1 
ATOM   476   C CB    . ALA A  1 69  ? -37.854 11.019  32.432  1.00 26.51  ? 97  ALA A CB    1 
ATOM   477   N N     . TYR A  1 70  ? -35.109 10.868  33.962  1.00 26.18  ? 98  TYR A N     1 
ATOM   478   C CA    . TYR A  1 70  ? -33.943 11.527  34.553  1.00 24.02  ? 98  TYR A CA    1 
ATOM   479   C C     . TYR A  1 70  ? -32.666 10.916  34.024  1.00 21.63  ? 98  TYR A C     1 
ATOM   480   O O     . TYR A  1 70  ? -31.724 11.635  33.638  1.00 21.32  ? 98  TYR A O     1 
ATOM   481   C CB    . TYR A  1 70  ? -34.046 11.457  36.095  1.00 24.89  ? 98  TYR A CB    1 
ATOM   482   C CG    . TYR A  1 70  ? -32.826 11.850  36.898  1.00 25.96  ? 98  TYR A CG    1 
ATOM   483   C CD1   . TYR A  1 70  ? -32.210 13.092  36.738  1.00 22.99  ? 98  TYR A CD1   1 
ATOM   484   C CD2   . TYR A  1 70  ? -32.315 10.981  37.863  1.00 28.66  ? 98  TYR A CD2   1 
ATOM   485   C CE1   . TYR A  1 70  ? -31.103 13.451  37.509  1.00 21.43  ? 98  TYR A CE1   1 
ATOM   486   C CE2   . TYR A  1 70  ? -31.225 11.330  38.638  1.00 28.21  ? 98  TYR A CE2   1 
ATOM   487   C CZ    . TYR A  1 70  ? -30.608 12.557  38.457  1.00 26.68  ? 98  TYR A CZ    1 
ATOM   488   O OH    . TYR A  1 70  ? -29.519 12.891  39.259  1.00 26.86  ? 98  TYR A OH    1 
ATOM   489   N N     . ALA A  1 71  ? -32.632 9.592   33.970  1.00 24.40  ? 99  ALA A N     1 
ATOM   490   C CA    . ALA A  1 71  ? -31.447 8.887   33.447  1.00 27.36  ? 99  ALA A CA    1 
ATOM   491   C C     . ALA A  1 71  ? -31.128 9.224   31.974  1.00 26.55  ? 99  ALA A C     1 
ATOM   492   O O     . ALA A  1 71  ? -29.964 9.453   31.602  1.00 20.14  ? 99  ALA A O     1 
ATOM   493   C CB    . ALA A  1 71  ? -31.599 7.378   33.636  1.00 23.70  ? 99  ALA A CB    1 
ATOM   494   N N     . ILE A  1 72  ? -32.168 9.240   31.150  1.00 22.24  ? 100 ILE A N     1 
ATOM   495   C CA    . ILE A  1 72  ? -32.072 9.632   29.739  1.00 25.99  ? 100 ILE A CA    1 
ATOM   496   C C     . ILE A  1 72  ? -31.595 11.076  29.604  1.00 25.98  ? 100 ILE A C     1 
ATOM   497   O O     . ILE A  1 72  ? -30.623 11.361  28.892  1.00 24.36  ? 100 ILE A O     1 
ATOM   498   C CB    . ILE A  1 72  ? -33.434 9.450   29.016  1.00 25.01  ? 100 ILE A CB    1 
ATOM   499   C CG1   . ILE A  1 72  ? -33.768 7.960   28.863  1.00 28.24  ? 100 ILE A CG1   1 
ATOM   500   C CG2   . ILE A  1 72  ? -33.423 10.134  27.640  1.00 27.05  ? 100 ILE A CG2   1 
ATOM   501   C CD1   . ILE A  1 72  ? -35.259 7.657   28.806  1.00 31.25  ? 100 ILE A CD1   1 
ATOM   502   N N     . ALA A  1 73  ? -32.269 11.976  30.316  1.00 25.73  ? 101 ALA A N     1 
ATOM   503   C CA    . ALA A  1 73  ? -31.903 13.401  30.351  1.00 29.65  ? 101 ALA A CA    1 
ATOM   504   C C     . ALA A  1 73  ? -30.474 13.624  30.835  1.00 22.69  ? 101 ALA A C     1 
ATOM   505   O O     . ALA A  1 73  ? -29.714 14.361  30.195  1.00 27.51  ? 101 ALA A O     1 
ATOM   506   C CB    . ALA A  1 73  ? -32.868 14.171  31.248  1.00 25.60  ? 101 ALA A CB    1 
ATOM   507   N N     . MET A  1 74  ? -30.103 12.959  31.941  1.00 24.08  ? 102 MET A N     1 
ATOM   508   C CA    . MET A  1 74  ? -28.712 13.018  32.463  1.00 20.84  ? 102 MET A CA    1 
ATOM   509   C C     . MET A  1 74  ? -27.664 12.604  31.454  1.00 22.88  ? 102 MET A C     1 
ATOM   510   O O     . MET A  1 74  ? -26.550 13.187  31.376  1.00 19.46  ? 102 MET A O     1 
ATOM   511   C CB    . MET A  1 74  ? -28.546 12.114  33.718  1.00 21.94  ? 102 MET A CB    1 
ATOM   512   C CG    . MET A  1 74  ? -28.806 12.755  35.065  1.00 35.89  ? 102 MET A CG    1 
ATOM   513   S SD    . MET A  1 74  ? -27.766 14.182  35.438  1.00 30.63  ? 102 MET A SD    1 
ATOM   514   C CE    . MET A  1 74  ? -26.138 13.606  35.047  1.00 17.53  ? 102 MET A CE    1 
ATOM   515   N N     . GLU A  1 75  ? -27.978 11.571  30.685  1.00 21.82  ? 103 GLU A N     1 
ATOM   516   C CA    . GLU A  1 75  ? -27.001 11.085  29.727  1.00 25.74  ? 103 GLU A CA    1 
ATOM   517   C C     . GLU A  1 75  ? -26.783 12.102  28.576  1.00 24.04  ? 103 GLU A C     1 
ATOM   518   O O     . GLU A  1 75  ? -25.634 12.409  28.150  1.00 18.37  ? 103 GLU A O     1 
ATOM   519   C CB    . GLU A  1 75  ? -27.429 9.722   29.206  1.00 25.46  ? 103 GLU A CB    1 
ATOM   520   C CG    . GLU A  1 75  ? -26.454 9.168   28.189  1.00 24.99  ? 103 GLU A CG    1 
ATOM   521   C CD    . GLU A  1 75  ? -26.936 7.900   27.510  1.00 34.60  ? 103 GLU A CD    1 
ATOM   522   O OE1   . GLU A  1 75  ? -27.755 7.151   28.102  1.00 33.74  ? 103 GLU A OE1   1 
ATOM   523   O OE2   . GLU A  1 75  ? -26.476 7.663   26.376  1.00 34.53  ? 103 GLU A OE2   1 
ATOM   524   N N     . GLU A  1 76  ? -27.884 12.629  28.069  1.00 21.13  ? 104 GLU A N     1 
ATOM   525   C CA    . GLU A  1 76  ? -27.821 13.661  27.029  1.00 24.67  ? 104 GLU A CA    1 
ATOM   526   C C     . GLU A  1 76  ? -27.157 14.957  27.492  1.00 17.31  ? 104 GLU A C     1 
ATOM   527   O O     . GLU A  1 76  ? -26.375 15.551  26.732  1.00 23.70  ? 104 GLU A O     1 
ATOM   528   C CB    . GLU A  1 76  ? -29.230 13.985  26.507  1.00 22.82  ? 104 GLU A CB    1 
ATOM   529   C CG    . GLU A  1 76  ? -29.871 12.843  25.741  1.00 27.76  ? 104 GLU A CG    1 
ATOM   530   C CD    . GLU A  1 76  ? -29.012 12.338  24.584  1.00 39.88  ? 104 GLU A CD    1 
ATOM   531   O OE1   . GLU A  1 76  ? -28.316 13.127  23.902  1.00 33.46  ? 104 GLU A OE1   1 
ATOM   532   O OE2   . GLU A  1 76  ? -29.022 11.122  24.373  1.00 42.35  ? 104 GLU A OE2   1 
ATOM   533   N N     . ILE A  1 77  ? -27.464 15.399  28.719  1.00 21.44  ? 105 ILE A N     1 
ATOM   534   C CA    . ILE A  1 77  ? -26.802 16.592  29.255  1.00 22.44  ? 105 ILE A CA    1 
ATOM   535   C C     . ILE A  1 77  ? -25.291 16.363  29.378  1.00 21.19  ? 105 ILE A C     1 
ATOM   536   O O     . ILE A  1 77  ? -24.476 17.191  28.919  1.00 18.75  ? 105 ILE A O     1 
ATOM   537   C CB    . ILE A  1 77  ? -27.418 17.061  30.602  1.00 23.58  ? 105 ILE A CB    1 
ATOM   538   C CG1   . ILE A  1 77  ? -28.804 17.678  30.366  1.00 19.90  ? 105 ILE A CG1   1 
ATOM   539   C CG2   . ILE A  1 77  ? -26.502 18.103  31.310  1.00 23.00  ? 105 ILE A CG2   1 
ATOM   540   C CD1   . ILE A  1 77  ? -28.887 18.702  29.274  1.00 27.62  ? 105 ILE A CD1   1 
ATOM   541   N N     . SER A  1 78  ? -24.922 15.233  29.977  1.00 24.03  ? 106 SER A N     1 
ATOM   542   C CA    . SER A  1 78  ? -23.496 14.941  30.273  1.00 20.21  ? 106 SER A CA    1 
ATOM   543   C C     . SER A  1 78  ? -22.632 14.675  29.045  1.00 20.00  ? 106 SER A C     1 
ATOM   544   O O     . SER A  1 78  ? -21.370 14.881  29.040  1.00 19.47  ? 106 SER A O     1 
ATOM   545   C CB    . SER A  1 78  ? -23.416 13.753  31.247  1.00 28.33  ? 106 SER A CB    1 
ATOM   546   O OG    . SER A  1 78  ? -24.190 13.992  32.413  1.00 28.95  ? 106 SER A OG    1 
ATOM   547   N N     . ARG A  1 79  ? -23.278 14.174  27.995  1.00 18.35  ? 107 ARG A N     1 
ATOM   548   C CA    . ARG A  1 79  ? -22.672 14.053  26.671  1.00 27.29  ? 107 ARG A CA    1 
ATOM   549   C C     . ARG A  1 79  ? -22.153 15.410  26.163  1.00 27.18  ? 107 ARG A C     1 
ATOM   550   O O     . ARG A  1 79  ? -21.048 15.498  25.608  1.00 24.43  ? 107 ARG A O     1 
ATOM   551   C CB    . ARG A  1 79  ? -23.702 13.425  25.721  1.00 29.76  ? 107 ARG A CB    1 
ATOM   552   C CG    . ARG A  1 79  ? -23.249 13.117  24.346  1.00 29.47  ? 107 ARG A CG    1 
ATOM   553   C CD    . ARG A  1 79  ? -24.359 12.350  23.595  1.00 34.91  ? 107 ARG A CD    1 
ATOM   554   N NE    . ARG A  1 79  ? -24.071 12.231  22.167  1.00 39.14  ? 107 ARG A NE    1 
ATOM   555   C CZ    . ARG A  1 79  ? -24.316 13.171  21.246  1.00 47.17  ? 107 ARG A CZ    1 
ATOM   556   N NH1   . ARG A  1 79  ? -24.885 14.330  21.558  1.00 33.17  ? 107 ARG A NH1   1 
ATOM   557   N NH2   . ARG A  1 79  ? -23.994 12.948  19.983  1.00 51.38  ? 107 ARG A NH2   1 
ATOM   558   N N     . GLY A  1 80  ? -22.927 16.466  26.407  1.00 29.77  ? 108 GLY A N     1 
ATOM   559   C CA    . GLY A  1 80  ? -22.525 17.833  26.058  1.00 28.39  ? 108 GLY A CA    1 
ATOM   560   C C     . GLY A  1 80  ? -21.529 18.474  27.025  1.00 28.71  ? 108 GLY A C     1 
ATOM   561   O O     . GLY A  1 80  ? -20.485 19.005  26.596  1.00 29.37  ? 108 GLY A O     1 
ATOM   562   N N     . CYS A  1 81  ? -21.830 18.406  28.323  1.00 26.41  ? 109 CYS A N     1 
ATOM   563   C CA    . CYS A  1 81  ? -20.907 18.917  29.360  1.00 27.17  ? 109 CYS A CA    1 
ATOM   564   C C     . CYS A  1 81  ? -21.009 18.120  30.676  1.00 23.03  ? 109 CYS A C     1 
ATOM   565   O O     . CYS A  1 81  ? -22.051 18.102  31.330  1.00 20.73  ? 109 CYS A O     1 
ATOM   566   C CB    . CYS A  1 81  ? -21.159 20.411  29.591  1.00 27.90  ? 109 CYS A CB    1 
ATOM   567   S SG    . CYS A  1 81  ? -20.140 21.196  30.879  1.00 30.76  ? 109 CYS A SG    1 
ATOM   568   N N     . ALA A  1 82  ? -19.914 17.447  31.023  1.00 23.29  ? 110 ALA A N     1 
ATOM   569   C CA    . ALA A  1 82  ? -19.842 16.585  32.208  1.00 26.00  ? 110 ALA A CA    1 
ATOM   570   C C     . ALA A  1 82  ? -20.095 17.369  33.499  1.00 25.47  ? 110 ALA A C     1 
ATOM   571   O O     . ALA A  1 82  ? -20.722 16.854  34.424  1.00 22.27  ? 110 ALA A O     1 
ATOM   572   C CB    . ALA A  1 82  ? -18.468 15.884  32.259  1.00 22.64  ? 110 ALA A CB    1 
ATOM   573   N N     . SER A  1 83  ? -19.594 18.609  33.559  1.00 24.61  ? 111 SER A N     1 
ATOM   574   C CA    . SER A  1 83  ? -19.814 19.472  34.722  1.00 23.74  ? 111 SER A CA    1 
ATOM   575   C C     . SER A  1 83  ? -21.272 19.844  34.919  1.00 25.37  ? 111 SER A C     1 
ATOM   576   O O     . SER A  1 83  ? -21.772 19.751  36.045  1.00 22.85  ? 111 SER A O     1 
ATOM   577   C CB    . SER A  1 83  ? -18.950 20.737  34.670  1.00 22.16  ? 111 SER A CB    1 
ATOM   578   O OG    . SER A  1 83  ? -17.577 20.391  34.691  1.00 24.41  ? 111 SER A OG    1 
ATOM   579   N N     . THR A  1 84  ? -21.940 20.275  33.843  1.00 26.03  ? 112 THR A N     1 
ATOM   580   C CA    . THR A  1 84  ? -23.392 20.539  33.871  1.00 26.55  ? 112 THR A CA    1 
ATOM   581   C C     . THR A  1 84  ? -24.176 19.308  34.321  1.00 25.88  ? 112 THR A C     1 
ATOM   582   O O     . THR A  1 84  ? -25.205 19.404  35.014  1.00 24.50  ? 112 THR A O     1 
ATOM   583   C CB    . THR A  1 84  ? -23.901 21.001  32.475  1.00 26.15  ? 112 THR A CB    1 
ATOM   584   O OG1   . THR A  1 84  ? -23.302 22.256  32.143  1.00 30.98  ? 112 THR A OG1   1 
ATOM   585   C CG2   . THR A  1 84  ? -25.400 21.182  32.459  1.00 32.54  ? 112 THR A CG2   1 
ATOM   586   N N     . GLY A  1 85  ? -23.704 18.133  33.918  1.00 26.49  ? 113 GLY A N     1 
ATOM   587   C CA    . GLY A  1 85  ? -24.335 16.890  34.365  1.00 27.74  ? 113 GLY A CA    1 
ATOM   588   C C     . GLY A  1 85  ? -24.253 16.678  35.870  1.00 21.35  ? 113 GLY A C     1 
ATOM   589   O O     . GLY A  1 85  ? -25.264 16.363  36.507  1.00 20.83  ? 113 GLY A O     1 
ATOM   590   N N     . VAL A  1 86  ? -23.075 16.864  36.465  1.00 21.04  ? 114 VAL A N     1 
ATOM   591   C CA    . VAL A  1 86  ? -22.980 16.635  37.925  1.00 22.26  ? 114 VAL A CA    1 
ATOM   592   C C     . VAL A  1 86  ? -23.782 17.719  38.696  1.00 22.91  ? 114 VAL A C     1 
ATOM   593   O O     . VAL A  1 86  ? -24.431 17.425  39.685  1.00 21.46  ? 114 VAL A O     1 
ATOM   594   C CB    . VAL A  1 86  ? -21.519 16.431  38.423  1.00 27.32  ? 114 VAL A CB    1 
ATOM   595   C CG1   . VAL A  1 86  ? -20.678 17.697  38.286  1.00 27.46  ? 114 VAL A CG1   1 
ATOM   596   C CG2   . VAL A  1 86  ? -21.510 15.895  39.870  1.00 25.92  ? 114 VAL A CG2   1 
ATOM   597   N N     . ILE A  1 87  ? -23.807 18.943  38.172  1.00 24.11  ? 115 ILE A N     1 
ATOM   598   C CA    . ILE A  1 87  ? -24.522 20.040  38.828  1.00 21.27  ? 115 ILE A CA    1 
ATOM   599   C C     . ILE A  1 87  ? -26.004 19.663  38.911  1.00 22.07  ? 115 ILE A C     1 
ATOM   600   O O     . ILE A  1 87  ? -26.620 19.752  39.976  1.00 19.98  ? 115 ILE A O     1 
ATOM   601   C CB    . ILE A  1 87  ? -24.260 21.427  38.130  1.00 22.41  ? 115 ILE A CB    1 
ATOM   602   C CG1   . ILE A  1 87  ? -22.772 21.808  38.204  1.00 22.02  ? 115 ILE A CG1   1 
ATOM   603   C CG2   . ILE A  1 87  ? -25.060 22.552  38.776  1.00 24.50  ? 115 ILE A CG2   1 
ATOM   604   C CD1   . ILE A  1 87  ? -22.312 22.863  37.183  1.00 23.31  ? 115 ILE A CD1   1 
ATOM   605   N N     . MET A  1 88  ? -26.528 19.171  37.787  1.00 23.36  ? 116 MET A N     1 
ATOM   606   C CA    . MET A  1 88  ? -27.916 18.738  37.644  1.00 25.32  ? 116 MET A CA    1 
ATOM   607   C C     . MET A  1 88  ? -28.234 17.514  38.516  1.00 24.10  ? 116 MET A C     1 
ATOM   608   O O     . MET A  1 88  ? -29.307 17.413  39.142  1.00 19.59  ? 116 MET A O     1 
ATOM   609   C CB    . MET A  1 88  ? -28.188 18.449  36.158  1.00 24.01  ? 116 MET A CB    1 
ATOM   610   C CG    . MET A  1 88  ? -29.473 17.676  35.849  1.00 21.77  ? 116 MET A CG    1 
ATOM   611   S SD    . MET A  1 88  ? -29.683 17.268  34.059  1.00 30.24  ? 116 MET A SD    1 
ATOM   612   C CE    . MET A  1 88  ? -31.177 16.300  34.129  1.00 25.48  ? 116 MET A CE    1 
ATOM   613   N N     . SER A  1 89  ? -27.311 16.567  38.535  1.00 21.76  ? 117 SER A N     1 
ATOM   614   C CA    . SER A  1 89  ? -27.484 15.359  39.336  1.00 25.79  ? 117 SER A CA    1 
ATOM   615   C C     . SER A  1 89  ? -27.543 15.662  40.853  1.00 24.21  ? 117 SER A C     1 
ATOM   616   O O     . SER A  1 89  ? -28.391 15.138  41.554  1.00 26.13  ? 117 SER A O     1 
ATOM   617   C CB    . SER A  1 89  ? -26.370 14.327  39.038  1.00 24.10  ? 117 SER A CB    1 
ATOM   618   O OG    . SER A  1 89  ? -26.810 13.032  39.409  1.00 32.42  ? 117 SER A OG    1 
ATOM   619   N N     . VAL A  1 90  ? -26.636 16.509  41.342  1.00 23.54  ? 118 VAL A N     1 
ATOM   620   C CA    . VAL A  1 90  ? -26.654 16.882  42.752  1.00 27.01  ? 118 VAL A CA    1 
ATOM   621   C C     . VAL A  1 90  ? -27.995 17.498  43.120  1.00 26.46  ? 118 VAL A C     1 
ATOM   622   O O     . VAL A  1 90  ? -28.634 17.068  44.086  1.00 24.98  ? 118 VAL A O     1 
ATOM   623   C CB    . VAL A  1 90  ? -25.477 17.825  43.128  1.00 26.47  ? 118 VAL A CB    1 
ATOM   624   C CG1   . VAL A  1 90  ? -25.656 18.370  44.551  1.00 24.57  ? 118 VAL A CG1   1 
ATOM   625   C CG2   . VAL A  1 90  ? -24.179 17.075  42.993  1.00 23.10  ? 118 VAL A CG2   1 
ATOM   626   N N     . ASN A  1 91  ? -28.470 18.454  42.317  1.00 26.91  ? 119 ASN A N     1 
ATOM   627   C CA    . ASN A  1 91  ? -29.744 19.062  42.636  1.00 24.24  ? 119 ASN A CA    1 
ATOM   628   C C     . ASN A  1 91  ? -30.926 18.080  42.630  1.00 22.62  ? 119 ASN A C     1 
ATOM   629   O O     . ASN A  1 91  ? -31.725 18.059  43.576  1.00 22.52  ? 119 ASN A O     1 
ATOM   630   C CB    . ASN A  1 91  ? -30.070 20.275  41.754  1.00 31.57  ? 119 ASN A CB    1 
ATOM   631   C CG    . ASN A  1 91  ? -31.084 21.188  42.427  1.00 27.27  ? 119 ASN A CG    1 
ATOM   632   O OD1   . ASN A  1 91  ? -30.769 21.810  43.442  1.00 26.73  ? 119 ASN A OD1   1 
ATOM   633   N ND2   . ASN A  1 91  ? -32.306 21.221  41.919  1.00 23.67  ? 119 ASN A ND2   1 
ATOM   634   N N     . ASN A  1 92  ? -31.040 17.280  41.564  1.00 21.85  ? 120 ASN A N     1 
ATOM   635   C CA    . ASN A  1 92  ? -32.093 16.265  41.469  1.00 19.83  ? 120 ASN A CA    1 
ATOM   636   C C     . ASN A  1 92  ? -32.041 15.201  42.595  1.00 24.62  ? 120 ASN A C     1 
ATOM   637   O O     . ASN A  1 92  ? -32.988 15.014  43.362  1.00 20.70  ? 120 ASN A O     1 
ATOM   638   C CB    . ASN A  1 92  ? -32.006 15.551  40.104  1.00 21.55  ? 120 ASN A CB    1 
ATOM   639   C CG    . ASN A  1 92  ? -32.719 16.318  38.994  1.00 26.71  ? 120 ASN A CG    1 
ATOM   640   O OD1   . ASN A  1 92  ? -33.934 16.273  38.901  1.00 17.45  ? 120 ASN A OD1   1 
ATOM   641   N ND2   . ASN A  1 92  ? -31.968 16.994  38.149  1.00 17.22  ? 120 ASN A ND2   1 
ATOM   642   N N     . SER A  1 93  ? -30.923 14.489  42.659  1.00 23.34  ? 121 SER A N     1 
ATOM   643   C CA    . SER A  1 93  ? -30.843 13.272  43.469  1.00 24.12  ? 121 SER A CA    1 
ATOM   644   C C     . SER A  1 93  ? -30.496 13.540  44.920  1.00 24.65  ? 121 SER A C     1 
ATOM   645   O O     . SER A  1 93  ? -31.122 12.979  45.813  1.00 24.94  ? 121 SER A O     1 
ATOM   646   C CB    . SER A  1 93  ? -29.794 12.314  42.898  1.00 24.48  ? 121 SER A CB    1 
ATOM   647   O OG    . SER A  1 93  ? -30.217 11.725  41.677  1.00 29.83  ? 121 SER A OG    1 
ATOM   648   N N     . LEU A  1 94  ? -29.450 14.337  45.137  1.00 20.97  ? 122 LEU A N     1 
ATOM   649   C CA    . LEU A  1 94  ? -28.890 14.525  46.473  1.00 25.14  ? 122 LEU A CA    1 
ATOM   650   C C     . LEU A  1 94  ? -29.515 15.642  47.304  1.00 26.54  ? 122 LEU A C     1 
ATOM   651   O O     . LEU A  1 94  ? -29.561 15.524  48.521  1.00 27.73  ? 122 LEU A O     1 
ATOM   652   C CB    . LEU A  1 94  ? -27.388 14.744  46.377  1.00 22.34  ? 122 LEU A CB    1 
ATOM   653   C CG    . LEU A  1 94  ? -26.616 13.704  45.568  1.00 27.77  ? 122 LEU A CG    1 
ATOM   654   C CD1   . LEU A  1 94  ? -25.098 13.951  45.793  1.00 20.43  ? 122 LEU A CD1   1 
ATOM   655   C CD2   . LEU A  1 94  ? -26.989 12.276  45.934  1.00 25.25  ? 122 LEU A CD2   1 
ATOM   656   N N     . TYR A  1 95  ? -29.974 16.723  46.660  1.00 24.43  ? 123 TYR A N     1 
ATOM   657   C CA    . TYR A  1 95  ? -30.615 17.819  47.376  1.00 25.36  ? 123 TYR A CA    1 
ATOM   658   C C     . TYR A  1 95  ? -32.118 17.574  47.436  1.00 25.04  ? 123 TYR A C     1 
ATOM   659   O O     . TYR A  1 95  ? -32.673 17.371  48.521  1.00 21.22  ? 123 TYR A O     1 
ATOM   660   C CB    . TYR A  1 95  ? -30.297 19.203  46.770  1.00 25.17  ? 123 TYR A CB    1 
ATOM   661   C CG    . TYR A  1 95  ? -31.012 20.288  47.520  1.00 21.35  ? 123 TYR A CG    1 
ATOM   662   C CD1   . TYR A  1 95  ? -30.611 20.649  48.816  1.00 24.40  ? 123 TYR A CD1   1 
ATOM   663   C CD2   . TYR A  1 95  ? -32.176 20.874  46.997  1.00 27.76  ? 123 TYR A CD2   1 
ATOM   664   C CE1   . TYR A  1 95  ? -31.294 21.604  49.547  1.00 25.82  ? 123 TYR A CE1   1 
ATOM   665   C CE2   . TYR A  1 95  ? -32.885 21.822  47.722  1.00 28.90  ? 123 TYR A CE2   1 
ATOM   666   C CZ    . TYR A  1 95  ? -32.438 22.187  49.000  1.00 24.24  ? 123 TYR A CZ    1 
ATOM   667   O OH    . TYR A  1 95  ? -33.135 23.124  49.712  1.00 25.64  ? 123 TYR A OH    1 
ATOM   668   N N     . LEU A  1 96  ? -32.769 17.585  46.270  1.00 26.39  ? 124 LEU A N     1 
ATOM   669   C CA    . LEU A  1 96  ? -34.228 17.442  46.213  1.00 29.21  ? 124 LEU A CA    1 
ATOM   670   C C     . LEU A  1 96  ? -34.690 16.050  46.635  1.00 26.80  ? 124 LEU A C     1 
ATOM   671   O O     . LEU A  1 96  ? -35.702 15.928  47.308  1.00 25.44  ? 124 LEU A O     1 
ATOM   672   C CB    . LEU A  1 96  ? -34.789 17.797  44.821  1.00 28.38  ? 124 LEU A CB    1 
ATOM   673   C CG    . LEU A  1 96  ? -34.710 19.264  44.348  1.00 31.65  ? 124 LEU A CG    1 
ATOM   674   C CD1   . LEU A  1 96  ? -35.345 19.405  42.947  1.00 21.37  ? 124 LEU A CD1   1 
ATOM   675   C CD2   . LEU A  1 96  ? -35.338 20.270  45.333  1.00 22.06  ? 124 LEU A CD2   1 
ATOM   676   N N     . GLY A  1 97  ? -33.935 15.018  46.233  1.00 28.50  ? 125 GLY A N     1 
ATOM   677   C CA    . GLY A  1 97  ? -34.291 13.617  46.540  1.00 30.68  ? 125 GLY A CA    1 
ATOM   678   C C     . GLY A  1 97  ? -34.703 13.336  47.984  1.00 27.33  ? 125 GLY A C     1 
ATOM   679   O O     . GLY A  1 97  ? -35.851 12.930  48.247  1.00 21.31  ? 125 GLY A O     1 
ATOM   680   N N     . PRO A  1 98  ? -33.786 13.580  48.941  1.00 22.51  ? 126 PRO A N     1 
ATOM   681   C CA    . PRO A  1 98  ? -34.086 13.335  50.355  1.00 24.90  ? 126 PRO A CA    1 
ATOM   682   C C     . PRO A  1 98  ? -35.227 14.169  50.895  1.00 25.88  ? 126 PRO A C     1 
ATOM   683   O O     . PRO A  1 98  ? -36.006 13.678  51.720  1.00 22.72  ? 126 PRO A O     1 
ATOM   684   C CB    . PRO A  1 98  ? -32.770 13.704  51.071  1.00 26.47  ? 126 PRO A CB    1 
ATOM   685   C CG    . PRO A  1 98  ? -32.066 14.574  50.155  1.00 28.01  ? 126 PRO A CG    1 
ATOM   686   C CD    . PRO A  1 98  ? -32.419 14.094  48.763  1.00 27.47  ? 126 PRO A CD    1 
ATOM   687   N N     . ILE A  1 99  ? -35.348 15.408  50.421  1.00 25.82  ? 127 ILE A N     1 
ATOM   688   C CA    . ILE A  1 99  ? -36.427 16.290  50.920  1.00 24.42  ? 127 ILE A CA    1 
ATOM   689   C C     . ILE A  1 99  ? -37.763 15.715  50.470  1.00 25.78  ? 127 ILE A C     1 
ATOM   690   O O     . ILE A  1 99  ? -38.695 15.601  51.269  1.00 24.51  ? 127 ILE A O     1 
ATOM   691   C CB    . ILE A  1 99  ? -36.252 17.764  50.502  1.00 25.18  ? 127 ILE A CB    1 
ATOM   692   C CG1   . ILE A  1 99  ? -34.889 18.302  50.955  1.00 24.35  ? 127 ILE A CG1   1 
ATOM   693   C CG2   . ILE A  1 99  ? -37.384 18.646  51.103  1.00 20.46  ? 127 ILE A CG2   1 
ATOM   694   C CD1   . ILE A  1 99  ? -34.521 19.686  50.388  1.00 25.24  ? 127 ILE A CD1   1 
ATOM   695   N N     . LEU A  1 100 ? -37.846 15.309  49.206  1.00 27.53  ? 128 LEU A N     1 
ATOM   696   C CA    . LEU A  1 100 ? -39.070 14.653  48.720  1.00 30.37  ? 128 LEU A CA    1 
ATOM   697   C C     . LEU A  1 100 ? -39.344 13.338  49.451  1.00 27.10  ? 128 LEU A C     1 
ATOM   698   O O     . LEU A  1 100 ? -40.455 13.096  49.862  1.00 25.95  ? 128 LEU A O     1 
ATOM   699   C CB    . LEU A  1 100 ? -39.037 14.405  47.211  1.00 30.01  ? 128 LEU A CB    1 
ATOM   700   C CG    . LEU A  1 100 ? -39.329 15.587  46.298  1.00 36.65  ? 128 LEU A CG    1 
ATOM   701   C CD1   . LEU A  1 100 ? -39.347 15.118  44.838  1.00 43.23  ? 128 LEU A CD1   1 
ATOM   702   C CD2   . LEU A  1 100 ? -40.642 16.256  46.682  1.00 36.18  ? 128 LEU A CD2   1 
ATOM   703   N N     . LYS A  1 101 ? -38.321 12.506  49.635  1.00 25.76  ? 129 LYS A N     1 
ATOM   704   C CA    . LYS A  1 101 ? -38.524 11.209  50.299  1.00 28.02  ? 129 LYS A CA    1 
ATOM   705   C C     . LYS A  1 101 ? -38.858 11.316  51.796  1.00 27.62  ? 129 LYS A C     1 
ATOM   706   O O     . LYS A  1 101 ? -39.799 10.671  52.261  1.00 31.94  ? 129 LYS A O     1 
ATOM   707   C CB    . LYS A  1 101 ? -37.327 10.273  50.077  1.00 29.34  ? 129 LYS A CB    1 
ATOM   708   C CG    . LYS A  1 101 ? -37.613 8.838   50.537  1.00 35.11  ? 129 LYS A CG    1 
ATOM   709   C CD    . LYS A  1 101 ? -36.579 7.839   50.041  1.00 41.77  ? 129 LYS A CD    1 
ATOM   710   C CE    . LYS A  1 101 ? -37.129 6.407   50.160  1.00 44.13  ? 129 LYS A CE    1 
ATOM   711   N NZ    . LYS A  1 101 ? -36.092 5.366   49.961  1.00 51.30  ? 129 LYS A NZ    1 
ATOM   712   N N     . PHE A  1 102 ? -38.148 12.170  52.534  1.00 27.32  ? 130 PHE A N     1 
ATOM   713   C CA    . PHE A  1 102 ? -38.253 12.191  54.000  1.00 29.91  ? 130 PHE A CA    1 
ATOM   714   C C     . PHE A  1 102 ? -38.877 13.441  54.628  1.00 30.87  ? 130 PHE A C     1 
ATOM   715   O O     . PHE A  1 102 ? -39.140 13.472  55.840  1.00 30.19  ? 130 PHE A O     1 
ATOM   716   C CB    . PHE A  1 102 ? -36.863 11.998  54.589  1.00 28.08  ? 130 PHE A CB    1 
ATOM   717   C CG    . PHE A  1 102 ? -36.201 10.750  54.140  1.00 29.70  ? 130 PHE A CG    1 
ATOM   718   C CD1   . PHE A  1 102 ? -36.562 9.529   54.692  1.00 31.26  ? 130 PHE A CD1   1 
ATOM   719   C CD2   . PHE A  1 102 ? -35.230 10.777  53.155  1.00 34.61  ? 130 PHE A CD2   1 
ATOM   720   C CE1   . PHE A  1 102 ? -35.962 8.360   54.274  1.00 36.02  ? 130 PHE A CE1   1 
ATOM   721   C CE2   . PHE A  1 102 ? -34.610 9.607   52.743  1.00 33.36  ? 130 PHE A CE2   1 
ATOM   722   C CZ    . PHE A  1 102 ? -34.984 8.400   53.304  1.00 30.36  ? 130 PHE A CZ    1 
ATOM   723   N N     . GLY A  1 103 ? -39.103 14.469  53.813  1.00 28.83  ? 131 GLY A N     1 
ATOM   724   C CA    . GLY A  1 103 ? -39.544 15.745  54.320  1.00 29.22  ? 131 GLY A CA    1 
ATOM   725   C C     . GLY A  1 103 ? -41.025 15.806  54.574  1.00 30.05  ? 131 GLY A C     1 
ATOM   726   O O     . GLY A  1 103 ? -41.786 15.024  54.010  1.00 29.07  ? 131 GLY A O     1 
ATOM   727   N N     . SER A  1 104 ? -41.424 16.746  55.427  1.00 29.18  ? 132 SER A N     1 
ATOM   728   C CA    . SER A  1 104 ? -42.825 17.061  55.649  1.00 31.96  ? 132 SER A CA    1 
ATOM   729   C C     . SER A  1 104 ? -43.337 17.894  54.464  1.00 29.30  ? 132 SER A C     1 
ATOM   730   O O     . SER A  1 104 ? -42.539 18.372  53.639  1.00 24.97  ? 132 SER A O     1 
ATOM   731   C CB    . SER A  1 104 ? -42.973 17.862  56.940  1.00 29.23  ? 132 SER A CB    1 
ATOM   732   O OG    . SER A  1 104 ? -42.234 19.071  56.852  1.00 29.94  ? 132 SER A OG    1 
ATOM   733   N N     . LYS A  1 105 ? -44.657 18.083  54.397  1.00 30.95  ? 133 LYS A N     1 
ATOM   734   C CA    . LYS A  1 105 ? -45.271 18.996  53.419  1.00 36.18  ? 133 LYS A CA    1 
ATOM   735   C C     . LYS A  1 105 ? -44.610 20.384  53.454  1.00 35.76  ? 133 LYS A C     1 
ATOM   736   O O     . LYS A  1 105 ? -44.212 20.931  52.425  1.00 33.13  ? 133 LYS A O     1 
ATOM   737   C CB    . LYS A  1 105 ? -46.783 19.116  53.686  1.00 38.80  ? 133 LYS A CB    1 
ATOM   738   C CG    . LYS A  1 105 ? -47.556 19.983  52.688  1.00 50.53  ? 133 LYS A CG    1 
ATOM   739   C CD    . LYS A  1 105 ? -49.013 20.178  53.126  1.00 44.63  ? 133 LYS A CD    1 
ATOM   740   C CE    . LYS A  1 105 ? -49.874 18.912  52.913  1.00 65.13  ? 133 LYS A CE    1 
ATOM   741   N NZ    . LYS A  1 105 ? -49.855 17.905  54.043  1.00 49.87  ? 133 LYS A NZ    1 
ATOM   742   N N     . GLU A  1 106 ? -44.452 20.910  54.662  1.00 35.26  ? 134 GLU A N     1 
ATOM   743   C CA    . GLU A  1 106 ? -43.913 22.245  54.885  1.00 32.98  ? 134 GLU A CA    1 
ATOM   744   C C     . GLU A  1 106 ? -42.467 22.332  54.439  1.00 30.62  ? 134 GLU A C     1 
ATOM   745   O O     . GLU A  1 106 ? -42.044 23.332  53.887  1.00 27.89  ? 134 GLU A O     1 
ATOM   746   C CB    . GLU A  1 106 ? -44.019 22.616  56.363  1.00 33.20  ? 134 GLU A CB    1 
ATOM   747   C CG    . GLU A  1 106 ? -45.458 22.662  56.884  1.00 28.58  ? 134 GLU A CG    1 
ATOM   748   C CD    . GLU A  1 106 ? -46.076 21.274  57.113  1.00 56.42  ? 134 GLU A CD    1 
ATOM   749   O OE1   . GLU A  1 106 ? -45.352 20.331  57.514  1.00 57.32  ? 134 GLU A OE1   1 
ATOM   750   O OE2   . GLU A  1 106 ? -47.294 21.128  56.887  1.00 56.31  ? 134 GLU A OE2   1 
ATOM   751   N N     . GLN A  1 107 ? -41.711 21.271  54.680  1.00 27.91  ? 135 GLN A N     1 
ATOM   752   C CA    . GLN A  1 107 ? -40.329 21.219  54.234  1.00 27.43  ? 135 GLN A CA    1 
ATOM   753   C C     . GLN A  1 107 ? -40.234 21.180  52.717  1.00 24.77  ? 135 GLN A C     1 
ATOM   754   O O     . GLN A  1 107 ? -39.398 21.852  52.133  1.00 25.17  ? 135 GLN A O     1 
ATOM   755   C CB    . GLN A  1 107 ? -39.617 20.031  54.877  1.00 25.69  ? 135 GLN A CB    1 
ATOM   756   C CG    . GLN A  1 107 ? -39.333 20.275  56.335  1.00 30.25  ? 135 GLN A CG    1 
ATOM   757   C CD    . GLN A  1 107 ? -38.728 19.084  57.028  1.00 27.17  ? 135 GLN A CD    1 
ATOM   758   O OE1   . GLN A  1 107 ? -39.134 17.946  56.815  1.00 26.39  ? 135 GLN A OE1   1 
ATOM   759   N NE2   . GLN A  1 107 ? -37.733 19.349  57.861  1.00 28.24  ? 135 GLN A NE2   1 
ATOM   760   N N     . LYS A  1 108 ? -41.116 20.412  52.076  1.00 23.90  ? 136 LYS A N     1 
ATOM   761   C CA    . LYS A  1 108 ? -41.147 20.380  50.621  1.00 28.87  ? 136 LYS A CA    1 
ATOM   762   C C     . LYS A  1 108 ? -41.462 21.777  50.047  1.00 29.62  ? 136 LYS A C     1 
ATOM   763   O O     . LYS A  1 108 ? -40.740 22.272  49.192  1.00 22.68  ? 136 LYS A O     1 
ATOM   764   C CB    . LYS A  1 108 ? -42.135 19.328  50.112  1.00 29.96  ? 136 LYS A CB    1 
ATOM   765   C CG    . LYS A  1 108 ? -41.723 17.881  50.390  1.00 34.94  ? 136 LYS A CG    1 
ATOM   766   C CD    . LYS A  1 108 ? -42.935 16.951  50.187  1.00 35.40  ? 136 LYS A CD    1 
ATOM   767   C CE    . LYS A  1 108 ? -42.759 15.599  50.839  1.00 40.90  ? 136 LYS A CE    1 
ATOM   768   N NZ    . LYS A  1 108 ? -43.812 14.618  50.407  1.00 42.71  ? 136 LYS A NZ    1 
ATOM   769   N N     . GLN A  1 109 ? -42.494 22.431  50.565  1.00 29.38  ? 137 GLN A N     1 
ATOM   770   C CA    . GLN A  1 109 ? -42.832 23.783  50.097  1.00 30.62  ? 137 GLN A CA    1 
ATOM   771   C C     . GLN A  1 109 ? -41.690 24.793  50.319  1.00 27.26  ? 137 GLN A C     1 
ATOM   772   O O     . GLN A  1 109 ? -41.370 25.576  49.415  1.00 27.87  ? 137 GLN A O     1 
ATOM   773   C CB    . GLN A  1 109 ? -44.124 24.245  50.757  1.00 33.01  ? 137 GLN A CB    1 
ATOM   774   C CG    . GLN A  1 109 ? -45.318 23.394  50.370  1.00 36.19  ? 137 GLN A CG    1 
ATOM   775   C CD    . GLN A  1 109 ? -46.604 23.799  51.067  1.00 42.28  ? 137 GLN A CD    1 
ATOM   776   O OE1   . GLN A  1 109 ? -46.639 24.753  51.827  1.00 52.21  ? 137 GLN A OE1   1 
ATOM   777   N NE2   . GLN A  1 109 ? -47.667 23.068  50.803  1.00 46.60  ? 137 GLN A NE2   1 
ATOM   778   N N     . ALA A  1 110 ? -41.059 24.748  51.496  1.00 25.71  ? 138 ALA A N     1 
ATOM   779   C CA    . ALA A  1 110 ? -40.017 25.704  51.858  1.00 28.86  ? 138 ALA A CA    1 
ATOM   780   C C     . ALA A  1 110 ? -38.725 25.452  51.100  1.00 24.32  ? 138 ALA A C     1 
ATOM   781   O O     . ALA A  1 110 ? -38.073 26.384  50.672  1.00 22.13  ? 138 ALA A O     1 
ATOM   782   C CB    . ALA A  1 110 ? -39.739 25.657  53.374  1.00 27.92  ? 138 ALA A CB    1 
ATOM   783   N N     . TRP A  1 111 ? -38.377 24.180  50.933  1.00 26.11  ? 139 TRP A N     1 
ATOM   784   C CA    . TRP A  1 111 ? -37.055 23.797  50.452  1.00 26.10  ? 139 TRP A CA    1 
ATOM   785   C C     . TRP A  1 111 ? -37.062 23.134  49.074  1.00 24.64  ? 139 TRP A C     1 
ATOM   786   O O     . TRP A  1 111 ? -36.048 23.120  48.424  1.00 23.51  ? 139 TRP A O     1 
ATOM   787   C CB    . TRP A  1 111 ? -36.386 22.856  51.458  1.00 22.96  ? 139 TRP A CB    1 
ATOM   788   C CG    . TRP A  1 111 ? -36.193 23.448  52.821  1.00 25.92  ? 139 TRP A CG    1 
ATOM   789   C CD1   . TRP A  1 111 ? -37.088 23.457  53.836  1.00 22.92  ? 139 TRP A CD1   1 
ATOM   790   C CD2   . TRP A  1 111 ? -35.018 24.109  53.314  1.00 23.55  ? 139 TRP A CD2   1 
ATOM   791   N NE1   . TRP A  1 111 ? -36.567 24.100  54.930  1.00 27.48  ? 139 TRP A NE1   1 
ATOM   792   C CE2   . TRP A  1 111 ? -35.290 24.499  54.644  1.00 24.37  ? 139 TRP A CE2   1 
ATOM   793   C CE3   . TRP A  1 111 ? -33.770 24.410  52.764  1.00 27.50  ? 139 TRP A CE3   1 
ATOM   794   C CZ2   . TRP A  1 111 ? -34.363 25.199  55.431  1.00 22.07  ? 139 TRP A CZ2   1 
ATOM   795   C CZ3   . TRP A  1 111 ? -32.833 25.077  53.556  1.00 22.86  ? 139 TRP A CZ3   1 
ATOM   796   C CH2   . TRP A  1 111 ? -33.150 25.476  54.873  1.00 22.99  ? 139 TRP A CH2   1 
ATOM   797   N N     . VAL A  1 112 ? -38.168 22.537  48.645  1.00 23.68  ? 140 VAL A N     1 
ATOM   798   C CA    . VAL A  1 112 ? -38.209 21.973  47.281  1.00 27.03  ? 140 VAL A CA    1 
ATOM   799   C C     . VAL A  1 112 ? -38.600 23.042  46.279  1.00 23.34  ? 140 VAL A C     1 
ATOM   800   O O     . VAL A  1 112 ? -37.840 23.389  45.375  1.00 21.67  ? 140 VAL A O     1 
ATOM   801   C CB    . VAL A  1 112 ? -39.132 20.707  47.171  1.00 24.28  ? 140 VAL A CB    1 
ATOM   802   C CG1   . VAL A  1 112 ? -39.300 20.268  45.713  1.00 24.37  ? 140 VAL A CG1   1 
ATOM   803   C CG2   . VAL A  1 112 ? -38.553 19.564  48.008  1.00 27.04  ? 140 VAL A CG2   1 
ATOM   804   N N     . THR A  1 113 ? -39.792 23.600  46.452  1.00 27.97  ? 141 THR A N     1 
ATOM   805   C CA    . THR A  1 113 ? -40.355 24.485  45.433  1.00 28.88  ? 141 THR A CA    1 
ATOM   806   C C     . THR A  1 113 ? -39.462 25.608  44.885  1.00 27.54  ? 141 THR A C     1 
ATOM   807   O O     . THR A  1 113 ? -39.448 25.806  43.681  1.00 31.14  ? 141 THR A O     1 
ATOM   808   C CB    . THR A  1 113 ? -41.713 25.007  45.887  1.00 28.29  ? 141 THR A CB    1 
ATOM   809   O OG1   . THR A  1 113 ? -42.528 23.874  46.217  1.00 23.94  ? 141 THR A OG1   1 
ATOM   810   C CG2   . THR A  1 113 ? -42.376 25.823  44.779  1.00 32.33  ? 141 THR A CG2   1 
ATOM   811   N N     . PRO A  1 114 ? -38.727 26.349  45.746  1.00 26.40  ? 142 PRO A N     1 
ATOM   812   C CA    . PRO A  1 114 ? -37.829 27.403  45.228  1.00 23.41  ? 142 PRO A CA    1 
ATOM   813   C C     . PRO A  1 114 ? -36.557 26.932  44.555  1.00 25.84  ? 142 PRO A C     1 
ATOM   814   O O     . PRO A  1 114 ? -35.774 27.777  44.068  1.00 19.76  ? 142 PRO A O     1 
ATOM   815   C CB    . PRO A  1 114 ? -37.476 28.218  46.484  1.00 25.62  ? 142 PRO A CB    1 
ATOM   816   C CG    . PRO A  1 114 ? -38.465 27.787  47.530  1.00 27.94  ? 142 PRO A CG    1 
ATOM   817   C CD    . PRO A  1 114 ? -38.739 26.352  47.217  1.00 28.05  ? 142 PRO A CD    1 
ATOM   818   N N     . PHE A  1 115 ? -36.357 25.611  44.530  1.00 26.56  ? 143 PHE A N     1 
ATOM   819   C CA    . PHE A  1 115 ? -35.141 24.998  44.003  1.00 29.36  ? 143 PHE A CA    1 
ATOM   820   C C     . PHE A  1 115 ? -35.452 24.116  42.790  1.00 28.38  ? 143 PHE A C     1 
ATOM   821   O O     . PHE A  1 115 ? -34.718 23.185  42.470  1.00 25.87  ? 143 PHE A O     1 
ATOM   822   C CB    . PHE A  1 115 ? -34.475 24.173  45.128  1.00 27.39  ? 143 PHE A CB    1 
ATOM   823   C CG    . PHE A  1 115 ? -33.865 25.013  46.204  1.00 21.22  ? 143 PHE A CG    1 
ATOM   824   C CD1   . PHE A  1 115 ? -32.479 25.135  46.305  1.00 26.76  ? 143 PHE A CD1   1 
ATOM   825   C CD2   . PHE A  1 115 ? -34.672 25.694  47.130  1.00 24.11  ? 143 PHE A CD2   1 
ATOM   826   C CE1   . PHE A  1 115 ? -31.909 25.908  47.290  1.00 25.76  ? 143 PHE A CE1   1 
ATOM   827   C CE2   . PHE A  1 115 ? -34.094 26.474  48.118  1.00 23.57  ? 143 PHE A CE2   1 
ATOM   828   C CZ    . PHE A  1 115 ? -32.713 26.572  48.194  1.00 26.67  ? 143 PHE A CZ    1 
ATOM   829   N N     . THR A  1 116 ? -36.546 24.432  42.108  1.00 27.48  ? 144 THR A N     1 
ATOM   830   C CA    . THR A  1 116 ? -37.006 23.645  40.972  1.00 28.89  ? 144 THR A CA    1 
ATOM   831   C C     . THR A  1 116 ? -36.867 24.335  39.602  1.00 30.28  ? 144 THR A C     1 
ATOM   832   O O     . THR A  1 116 ? -37.191 23.728  38.592  1.00 34.81  ? 144 THR A O     1 
ATOM   833   C CB    . THR A  1 116 ? -38.487 23.231  41.133  1.00 24.44  ? 144 THR A CB    1 
ATOM   834   O OG1   . THR A  1 116 ? -39.299 24.397  41.253  1.00 32.82  ? 144 THR A OG1   1 
ATOM   835   C CG2   . THR A  1 116 ? -38.693 22.351  42.323  1.00 27.39  ? 144 THR A CG2   1 
ATOM   836   N N     . SER A  1 117 ? -36.357 25.565  39.551  1.00 33.56  ? 145 SER A N     1 
ATOM   837   C CA    . SER A  1 117 ? -36.429 26.369  38.335  1.00 31.37  ? 145 SER A CA    1 
ATOM   838   C C     . SER A  1 117 ? -35.102 26.922  37.850  1.00 30.46  ? 145 SER A C     1 
ATOM   839   O O     . SER A  1 117 ? -35.059 27.608  36.842  1.00 34.33  ? 145 SER A O     1 
ATOM   840   C CB    . SER A  1 117 ? -37.423 27.516  38.527  1.00 34.68  ? 145 SER A CB    1 
ATOM   841   O OG    . SER A  1 117 ? -36.998 28.397  39.557  1.00 42.64  ? 145 SER A OG    1 
ATOM   842   N N     . GLY A  1 118 ? -34.008 26.612  38.524  1.00 30.65  ? 146 GLY A N     1 
ATOM   843   C CA    . GLY A  1 118 ? -32.707 27.056  38.049  1.00 29.83  ? 146 GLY A CA    1 
ATOM   844   C C     . GLY A  1 118 ? -32.234 28.356  38.677  1.00 31.27  ? 146 GLY A C     1 
ATOM   845   O O     . GLY A  1 118 ? -31.101 28.756  38.453  1.00 35.58  ? 146 GLY A O     1 
ATOM   846   N N     . ASP A  1 119 ? -33.074 29.005  39.478  1.00 31.93  ? 147 ASP A N     1 
ATOM   847   C CA    . ASP A  1 119 ? -32.625 30.166  40.260  1.00 34.77  ? 147 ASP A CA    1 
ATOM   848   C C     . ASP A  1 119 ? -31.840 29.788  41.509  1.00 35.11  ? 147 ASP A C     1 
ATOM   849   O O     . ASP A  1 119 ? -30.831 30.427  41.837  1.00 31.87  ? 147 ASP A O     1 
ATOM   850   C CB    . ASP A  1 119 ? -33.814 31.024  40.655  1.00 37.04  ? 147 ASP A CB    1 
ATOM   851   C CG    . ASP A  1 119 ? -34.455 31.682  39.460  1.00 49.74  ? 147 ASP A CG    1 
ATOM   852   O OD1   . ASP A  1 119 ? -33.712 32.283  38.637  1.00 39.33  ? 147 ASP A OD1   1 
ATOM   853   O OD2   . ASP A  1 119 ? -35.692 31.581  39.346  1.00 35.60  ? 147 ASP A OD2   1 
ATOM   854   N N     . LYS A  1 120 ? -32.329 28.774  42.219  1.00 32.83  ? 148 LYS A N     1 
ATOM   855   C CA    . LYS A  1 120 ? -31.639 28.239  43.399  1.00 29.75  ? 148 LYS A CA    1 
ATOM   856   C C     . LYS A  1 120 ? -31.397 26.758  43.212  1.00 25.83  ? 148 LYS A C     1 
ATOM   857   O O     . LYS A  1 120 ? -32.266 26.024  42.762  1.00 21.33  ? 148 LYS A O     1 
ATOM   858   C CB    . LYS A  1 120 ? -32.425 28.497  44.676  1.00 29.15  ? 148 LYS A CB    1 
ATOM   859   C CG    . LYS A  1 120 ? -32.472 29.953  45.064  1.00 27.82  ? 148 LYS A CG    1 
ATOM   860   C CD    . LYS A  1 120 ? -33.325 30.180  46.341  1.00 34.99  ? 148 LYS A CD    1 
ATOM   861   C CE    . LYS A  1 120 ? -32.966 31.478  47.056  1.00 34.66  ? 148 LYS A CE    1 
ATOM   862   N NZ    . LYS A  1 120 ? -33.329 31.419  48.519  1.00 22.88  ? 148 LYS A NZ    1 
ATOM   863   N N     . ILE A  1 121 ? -30.160 26.344  43.478  1.00 22.91  ? 149 ILE A N     1 
ATOM   864   C CA    . ILE A  1 121 ? -29.821 24.944  43.529  1.00 24.40  ? 149 ILE A CA    1 
ATOM   865   C C     . ILE A  1 121 ? -29.270 24.601  44.941  1.00 26.06  ? 149 ILE A C     1 
ATOM   866   O O     . ILE A  1 121 ? -28.792 25.485  45.694  1.00 20.56  ? 149 ILE A O     1 
ATOM   867   C CB    . ILE A  1 121 ? -28.781 24.550  42.403  1.00 21.43  ? 149 ILE A CB    1 
ATOM   868   C CG1   . ILE A  1 121 ? -27.453 25.261  42.608  1.00 23.68  ? 149 ILE A CG1   1 
ATOM   869   C CG2   . ILE A  1 121 ? -29.329 24.849  40.949  1.00 22.76  ? 149 ILE A CG2   1 
ATOM   870   C CD1   . ILE A  1 121 ? -26.408 24.789  41.658  1.00 19.31  ? 149 ILE A CD1   1 
ATOM   871   N N     . GLY A  1 122 ? -29.330 23.314  45.272  1.00 25.28  ? 150 GLY A N     1 
ATOM   872   C CA    . GLY A  1 122 ? -28.781 22.809  46.527  1.00 26.78  ? 150 GLY A CA    1 
ATOM   873   C C     . GLY A  1 122 ? -27.493 22.008  46.422  1.00 24.71  ? 150 GLY A C     1 
ATOM   874   O O     . GLY A  1 122 ? -26.884 21.872  45.360  1.00 22.35  ? 150 GLY A O     1 
ATOM   875   N N     . CYS A  1 123 ? -27.098 21.488  47.573  1.00 23.35  ? 151 CYS A N     1 
ATOM   876   C CA    . CYS A  1 123 ? -25.961 20.622  47.729  1.00 20.54  ? 151 CYS A CA    1 
ATOM   877   C C     . CYS A  1 123 ? -26.180 19.623  48.883  1.00 22.18  ? 151 CYS A C     1 
ATOM   878   O O     . CYS A  1 123 ? -27.187 19.656  49.562  1.00 20.08  ? 151 CYS A O     1 
ATOM   879   C CB    . CYS A  1 123 ? -24.650 21.433  47.884  1.00 20.96  ? 151 CYS A CB    1 
ATOM   880   S SG    . CYS A  1 123 ? -24.453 22.372  49.463  1.00 23.54  ? 151 CYS A SG    1 
ATOM   881   N N     . PHE A  1 124 ? -25.223 18.708  49.058  1.00 22.15  ? 152 PHE A N     1 
ATOM   882   C CA    . PHE A  1 124 ? -25.369 17.507  49.893  1.00 19.62  ? 152 PHE A CA    1 
ATOM   883   C C     . PHE A  1 124 ? -24.054 17.353  50.639  1.00 19.98  ? 152 PHE A C     1 
ATOM   884   O O     . PHE A  1 124 ? -23.021 17.241  50.010  1.00 16.93  ? 152 PHE A O     1 
ATOM   885   C CB    . PHE A  1 124 ? -25.634 16.321  48.961  1.00 23.78  ? 152 PHE A CB    1 
ATOM   886   C CG    . PHE A  1 124 ? -25.687 14.965  49.620  1.00 23.94  ? 152 PHE A CG    1 
ATOM   887   C CD1   . PHE A  1 124 ? -26.864 14.494  50.193  1.00 24.62  ? 152 PHE A CD1   1 
ATOM   888   C CD2   . PHE A  1 124 ? -24.574 14.110  49.569  1.00 22.73  ? 152 PHE A CD2   1 
ATOM   889   C CE1   . PHE A  1 124 ? -26.947 13.199  50.729  1.00 24.80  ? 152 PHE A CE1   1 
ATOM   890   C CE2   . PHE A  1 124 ? -24.640 12.809  50.130  1.00 24.61  ? 152 PHE A CE2   1 
ATOM   891   C CZ    . PHE A  1 124 ? -25.832 12.371  50.723  1.00 24.38  ? 152 PHE A CZ    1 
ATOM   892   N N     . ALA A  1 125 ? -24.077 17.436  51.955  1.00 23.63  ? 153 ALA A N     1 
ATOM   893   C CA    . ALA A  1 125 ? -22.816 17.467  52.708  1.00 23.30  ? 153 ALA A CA    1 
ATOM   894   C C     . ALA A  1 125 ? -22.726 16.301  53.690  1.00 18.93  ? 153 ALA A C     1 
ATOM   895   O O     . ALA A  1 125 ? -23.302 16.322  54.772  1.00 20.45  ? 153 ALA A O     1 
ATOM   896   C CB    . ALA A  1 125 ? -22.583 18.852  53.393  1.00 18.58  ? 153 ALA A CB    1 
ATOM   897   N N     . LEU A  1 126 ? -21.990 15.276  53.257  1.00 22.98  ? 154 LEU A N     1 
ATOM   898   C CA    . LEU A  1 126 ? -21.808 14.032  54.007  1.00 19.56  ? 154 LEU A CA    1 
ATOM   899   C C     . LEU A  1 126 ? -20.316 13.808  54.343  1.00 20.99  ? 154 LEU A C     1 
ATOM   900   O O     . LEU A  1 126 ? -19.957 13.575  55.505  1.00 26.78  ? 154 LEU A O     1 
ATOM   901   C CB    . LEU A  1 126 ? -22.386 12.857  53.195  1.00 24.26  ? 154 LEU A CB    1 
ATOM   902   C CG    . LEU A  1 126 ? -22.386 11.414  53.751  1.00 24.90  ? 154 LEU A CG    1 
ATOM   903   C CD1   . LEU A  1 126 ? -22.897 11.350  55.201  1.00 18.47  ? 154 LEU A CD1   1 
ATOM   904   C CD2   . LEU A  1 126 ? -23.153 10.392  52.841  1.00 23.04  ? 154 LEU A CD2   1 
ATOM   905   N N     . SER A  1 127 ? -19.461 13.883  53.336  1.00 22.47  ? 155 SER A N     1 
ATOM   906   C CA    . SER A  1 127 ? -18.036 13.626  53.525  1.00 23.59  ? 155 SER A CA    1 
ATOM   907   C C     . SER A  1 127 ? -17.360 14.722  54.366  1.00 25.49  ? 155 SER A C     1 
ATOM   908   O O     . SER A  1 127 ? -17.858 15.867  54.483  1.00 23.34  ? 155 SER A O     1 
ATOM   909   C CB    . SER A  1 127 ? -17.335 13.496  52.181  1.00 23.81  ? 155 SER A CB    1 
ATOM   910   O OG    . SER A  1 127 ? -18.066 12.640  51.344  1.00 22.24  ? 155 SER A OG    1 
ATOM   911   N N     . GLU A  1 128 ? -16.216 14.346  54.939  1.00 26.29  ? 156 GLU A N     1 
ATOM   912   C CA    . GLU A  1 128 ? -15.420 15.225  55.784  1.00 26.90  ? 156 GLU A CA    1 
ATOM   913   C C     . GLU A  1 128 ? -13.970 15.021  55.401  1.00 24.19  ? 156 GLU A C     1 
ATOM   914   O O     . GLU A  1 128 ? -13.633 14.077  54.699  1.00 25.28  ? 156 GLU A O     1 
ATOM   915   C CB    . GLU A  1 128 ? -15.705 14.951  57.260  1.00 24.05  ? 156 GLU A CB    1 
ATOM   916   C CG    . GLU A  1 128 ? -17.201 15.135  57.591  1.00 28.63  ? 156 GLU A CG    1 
ATOM   917   C CD    . GLU A  1 128 ? -17.561 14.982  59.060  1.00 36.74  ? 156 GLU A CD    1 
ATOM   918   O OE1   . GLU A  1 128 ? -16.699 14.553  59.860  1.00 41.60  ? 156 GLU A OE1   1 
ATOM   919   O OE2   . GLU A  1 128 ? -18.738 15.274  59.409  1.00 31.72  ? 156 GLU A OE2   1 
ATOM   920   N N     . PRO A  1 129 ? -13.100 15.948  55.797  1.00 27.59  ? 157 PRO A N     1 
ATOM   921   C CA    . PRO A  1 129 ? -11.706 15.721  55.400  1.00 27.06  ? 157 PRO A CA    1 
ATOM   922   C C     . PRO A  1 129 ? -11.175 14.345  55.847  1.00 28.91  ? 157 PRO A C     1 
ATOM   923   O O     . PRO A  1 129 ? -10.359 13.732  55.139  1.00 27.30  ? 157 PRO A O     1 
ATOM   924   C CB    . PRO A  1 129 ? -10.965 16.869  56.083  1.00 28.67  ? 157 PRO A CB    1 
ATOM   925   C CG    . PRO A  1 129 ? -12.038 17.958  56.196  1.00 29.81  ? 157 PRO A CG    1 
ATOM   926   C CD    . PRO A  1 129 ? -13.274 17.209  56.531  1.00 23.42  ? 157 PRO A CD    1 
ATOM   927   N N     . GLY A  1 130 ? -11.665 13.871  56.990  1.00 28.65  ? 158 GLY A N     1 
ATOM   928   C CA    . GLY A  1 130 ? -11.170 12.658  57.626  1.00 29.86  ? 158 GLY A CA    1 
ATOM   929   C C     . GLY A  1 130 ? -11.792 11.390  57.118  1.00 31.70  ? 158 GLY A C     1 
ATOM   930   O O     . GLY A  1 130 ? -11.223 10.322  57.329  1.00 29.39  ? 158 GLY A O     1 
ATOM   931   N N     . ASN A  1 131 ? -12.936 11.510  56.437  1.00 28.10  ? 159 ASN A N     1 
ATOM   932   C CA    . ASN A  1 131 ? -13.726 10.358  56.010  1.00 28.19  ? 159 ASN A CA    1 
ATOM   933   C C     . ASN A  1 131 ? -14.733 10.633  54.885  1.00 28.92  ? 159 ASN A C     1 
ATOM   934   O O     . ASN A  1 131 ? -15.518 11.603  54.932  1.00 26.02  ? 159 ASN A O     1 
ATOM   935   C CB    . ASN A  1 131 ? -14.494 9.762   57.194  1.00 31.79  ? 159 ASN A CB    1 
ATOM   936   C CG    . ASN A  1 131 ? -15.312 10.795  57.947  1.00 35.83  ? 159 ASN A CG    1 
ATOM   937   O OD1   . ASN A  1 131 ? -14.798 11.483  58.818  1.00 48.83  ? 159 ASN A OD1   1 
ATOM   938   N ND2   . ASN A  1 131 ? -16.601 10.886  57.631  1.00 47.72  ? 159 ASN A ND2   1 
ATOM   939   N N     . GLY A  1 132 ? -14.710 9.748   53.892  1.00 28.08  ? 160 GLY A N     1 
ATOM   940   C CA    . GLY A  1 132 ? -15.658 9.747   52.788  1.00 27.43  ? 160 GLY A CA    1 
ATOM   941   C C     . GLY A  1 132 ? -16.307 8.383   52.664  1.00 29.00  ? 160 GLY A C     1 
ATOM   942   O O     . GLY A  1 132 ? -17.491 8.223   52.945  1.00 32.61  ? 160 GLY A O     1 
ATOM   943   N N     . SER A  1 133 ? -15.524 7.385   52.268  1.00 30.23  ? 161 SER A N     1 
ATOM   944   C CA    . SER A  1 133 ? -16.025 5.992   52.208  1.00 30.90  ? 161 SER A CA    1 
ATOM   945   C C     . SER A  1 133 ? -16.600 5.560   53.538  1.00 28.90  ? 161 SER A C     1 
ATOM   946   O O     . SER A  1 133 ? -17.653 4.919   53.595  1.00 27.23  ? 161 SER A O     1 
ATOM   947   C CB    . SER A  1 133 ? -14.902 5.044   51.817  1.00 22.87  ? 161 SER A CB    1 
ATOM   948   O OG    . SER A  1 133 ? -14.488 5.289   50.494  1.00 31.93  ? 161 SER A OG    1 
ATOM   949   N N     . ASP A  1 134 ? -15.912 5.946   54.613  1.00 33.68  ? 162 ASP A N     1 
ATOM   950   C CA    . ASP A  1 134 ? -16.358 5.678   55.978  1.00 34.30  ? 162 ASP A CA    1 
ATOM   951   C C     . ASP A  1 134 ? -17.295 6.815   56.406  1.00 36.39  ? 162 ASP A C     1 
ATOM   952   O O     . ASP A  1 134 ? -16.964 7.643   57.264  1.00 32.29  ? 162 ASP A O     1 
ATOM   953   C CB    . ASP A  1 134 ? -15.133 5.540   56.900  1.00 33.26  ? 162 ASP A CB    1 
ATOM   954   C CG    . ASP A  1 134 ? -15.486 5.054   58.314  1.00 41.71  ? 162 ASP A CG    1 
ATOM   955   O OD1   . ASP A  1 134 ? -16.670 4.745   58.589  1.00 27.62  ? 162 ASP A OD1   1 
ATOM   956   O OD2   . ASP A  1 134 ? -14.557 4.989   59.156  1.00 31.58  ? 162 ASP A OD2   1 
ATOM   957   N N     . ALA A  1 135 ? -18.477 6.819   55.788  1.00 37.32  ? 163 ALA A N     1 
ATOM   958   C CA    . ALA A  1 135 ? -19.476 7.877   55.945  1.00 39.91  ? 163 ALA A CA    1 
ATOM   959   C C     . ALA A  1 135 ? -19.978 8.021   57.379  1.00 39.39  ? 163 ALA A C     1 
ATOM   960   O O     . ALA A  1 135 ? -20.265 9.133   57.825  1.00 40.17  ? 163 ALA A O     1 
ATOM   961   C CB    . ALA A  1 135 ? -20.656 7.620   55.014  1.00 38.80  ? 163 ALA A CB    1 
ATOM   962   N N     . GLY A  1 136 ? -20.078 6.899   58.088  1.00 35.77  ? 164 GLY A N     1 
ATOM   963   C CA    . GLY A  1 136 ? -20.554 6.875   59.461  1.00 36.12  ? 164 GLY A CA    1 
ATOM   964   C C     . GLY A  1 136 ? -19.630 7.523   60.479  1.00 34.73  ? 164 GLY A C     1 
ATOM   965   O O     . GLY A  1 136 ? -20.061 7.824   61.577  1.00 32.44  ? 164 GLY A O     1 
ATOM   966   N N     . ALA A  1 137 ? -18.373 7.773   60.110  1.00 32.72  ? 165 ALA A N     1 
ATOM   967   C CA    . ALA A  1 137 ? -17.409 8.405   61.020  1.00 36.15  ? 165 ALA A CA    1 
ATOM   968   C C     . ALA A  1 137 ? -17.492 9.948   61.043  1.00 36.99  ? 165 ALA A C     1 
ATOM   969   O O     . ALA A  1 137 ? -16.468 10.620  61.258  1.00 39.09  ? 165 ALA A O     1 
ATOM   970   C CB    . ALA A  1 137 ? -15.969 7.954   60.663  1.00 30.27  ? 165 ALA A CB    1 
ATOM   971   N N     . ALA A  1 138 ? -18.686 10.506  60.816  1.00 38.78  ? 166 ALA A N     1 
ATOM   972   C CA    . ALA A  1 138 ? -18.884 11.968  60.814  1.00 37.58  ? 166 ALA A CA    1 
ATOM   973   C C     . ALA A  1 138 ? -18.557 12.602  62.181  1.00 32.76  ? 166 ALA A C     1 
ATOM   974   O O     . ALA A  1 138 ? -19.170 12.278  63.176  1.00 33.80  ? 166 ALA A O     1 
ATOM   975   C CB    . ALA A  1 138 ? -20.326 12.321  60.387  1.00 34.36  ? 166 ALA A CB    1 
ATOM   976   N N     . SER A  1 139 ? -17.588 13.513  62.209  1.00 30.85  ? 167 SER A N     1 
ATOM   977   C CA    . SER A  1 139 ? -17.214 14.185  63.448  1.00 33.80  ? 167 SER A CA    1 
ATOM   978   C C     . SER A  1 139 ? -17.834 15.588  63.585  1.00 34.29  ? 167 SER A C     1 
ATOM   979   O O     . SER A  1 139 ? -17.802 16.184  64.673  1.00 27.63  ? 167 SER A O     1 
ATOM   980   C CB    . SER A  1 139 ? -15.693 14.260  63.563  1.00 30.96  ? 167 SER A CB    1 
ATOM   981   O OG    . SER A  1 139 ? -15.137 14.833  62.404  1.00 41.14  ? 167 SER A OG    1 
ATOM   982   N N     . THR A  1 140 ? -18.375 16.120  62.488  1.00 30.04  ? 168 THR A N     1 
ATOM   983   C CA    . THR A  1 140 ? -19.219 17.310  62.541  1.00 28.32  ? 168 THR A CA    1 
ATOM   984   C C     . THR A  1 140 ? -20.362 17.014  63.481  1.00 25.59  ? 168 THR A C     1 
ATOM   985   O O     . THR A  1 140 ? -20.966 15.949  63.420  1.00 28.59  ? 168 THR A O     1 
ATOM   986   C CB    . THR A  1 140 ? -19.746 17.740  61.132  1.00 27.06  ? 168 THR A CB    1 
ATOM   987   O OG1   . THR A  1 140 ? -18.638 18.182  60.343  1.00 32.21  ? 168 THR A OG1   1 
ATOM   988   C CG2   . THR A  1 140 ? -20.756 18.891  61.247  1.00 22.37  ? 168 THR A CG2   1 
ATOM   989   N N     . THR A  1 141 ? -20.639 17.941  64.387  1.00 25.30  ? 169 THR A N     1 
ATOM   990   C CA    . THR A  1 141 ? -21.629 17.692  65.437  1.00 25.32  ? 169 THR A CA    1 
ATOM   991   C C     . THR A  1 141 ? -22.789 18.653  65.337  1.00 25.22  ? 169 THR A C     1 
ATOM   992   O O     . THR A  1 141 ? -22.624 19.749  64.831  1.00 26.89  ? 169 THR A O     1 
ATOM   993   C CB    . THR A  1 141 ? -20.991 17.847  66.826  1.00 29.47  ? 169 THR A CB    1 
ATOM   994   O OG1   . THR A  1 141 ? -20.535 19.198  66.982  1.00 30.87  ? 169 THR A OG1   1 
ATOM   995   C CG2   . THR A  1 141 ? -19.806 16.904  66.957  1.00 24.85  ? 169 THR A CG2   1 
ATOM   996   N N     . ALA A  1 142 ? -23.951 18.203  65.808  1.00 24.92  ? 170 ALA A N     1 
ATOM   997   C CA    . ALA A  1 142 ? -25.161 19.007  65.935  1.00 30.09  ? 170 ALA A CA    1 
ATOM   998   C C     . ALA A  1 142 ? -25.666 18.784  67.348  1.00 30.33  ? 170 ALA A C     1 
ATOM   999   O O     . ALA A  1 142 ? -25.945 17.643  67.729  1.00 33.39  ? 170 ALA A O     1 
ATOM   1000  C CB    . ALA A  1 142 ? -26.228 18.589  64.921  1.00 21.10  ? 170 ALA A CB    1 
ATOM   1001  N N     . ARG A  1 143 ? -25.794 19.862  68.112  1.00 28.13  ? 171 ARG A N     1 
ATOM   1002  C CA    . ARG A  1 143 ? -26.182 19.786  69.520  1.00 31.68  ? 171 ARG A CA    1 
ATOM   1003  C C     . ARG A  1 143 ? -27.492 20.516  69.710  1.00 27.86  ? 171 ARG A C     1 
ATOM   1004  O O     . ARG A  1 143 ? -27.651 21.638  69.238  1.00 28.35  ? 171 ARG A O     1 
ATOM   1005  C CB    . ARG A  1 143 ? -25.088 20.415  70.406  1.00 32.13  ? 171 ARG A CB    1 
ATOM   1006  C CG    . ARG A  1 143 ? -25.548 20.772  71.829  1.00 46.73  ? 171 ARG A CG    1 
ATOM   1007  C CD    . ARG A  1 143 ? -24.424 21.386  72.684  1.00 42.41  ? 171 ARG A CD    1 
ATOM   1008  N NE    . ARG A  1 143 ? -24.325 22.847  72.559  1.00 51.15  ? 171 ARG A NE    1 
ATOM   1009  C CZ    . ARG A  1 143 ? -23.438 23.511  71.809  1.00 54.62  ? 171 ARG A CZ    1 
ATOM   1010  N NH1   . ARG A  1 143 ? -22.531 22.878  71.058  1.00 62.67  ? 171 ARG A NH1   1 
ATOM   1011  N NH2   . ARG A  1 143 ? -23.461 24.838  71.802  1.00 48.07  ? 171 ARG A NH2   1 
ATOM   1012  N N     . ALA A  1 144 ? -28.430 19.887  70.404  1.00 26.57  ? 172 ALA A N     1 
ATOM   1013  C CA    . ALA A  1 144 ? -29.691 20.541  70.709  1.00 30.04  ? 172 ALA A CA    1 
ATOM   1014  C C     . ALA A  1 144 ? -29.434 21.565  71.813  1.00 34.29  ? 172 ALA A C     1 
ATOM   1015  O O     . ALA A  1 144 ? -29.009 21.204  72.915  1.00 35.72  ? 172 ALA A O     1 
ATOM   1016  C CB    . ALA A  1 144 ? -30.749 19.529  71.135  1.00 27.39  ? 172 ALA A CB    1 
ATOM   1017  N N     . GLU A  1 145 ? -29.651 22.839  71.496  1.00 36.31  ? 173 GLU A N     1 
ATOM   1018  C CA    . GLU A  1 145 ? -29.511 23.920  72.454  1.00 36.48  ? 173 GLU A CA    1 
ATOM   1019  C C     . GLU A  1 145 ? -30.802 24.724  72.424  1.00 40.14  ? 173 GLU A C     1 
ATOM   1020  O O     . GLU A  1 145 ? -31.076 25.453  71.460  1.00 36.83  ? 173 GLU A O     1 
ATOM   1021  C CB    . GLU A  1 145 ? -28.307 24.793  72.110  1.00 35.76  ? 173 GLU A CB    1 
ATOM   1022  N N     . GLY A  1 146 ? -31.609 24.559  73.468  1.00 38.36  ? 174 GLY A N     1 
ATOM   1023  C CA    . GLY A  1 146 ? -32.911 25.193  73.540  1.00 41.10  ? 174 GLY A CA    1 
ATOM   1024  C C     . GLY A  1 146 ? -33.756 24.766  72.366  1.00 39.89  ? 174 GLY A C     1 
ATOM   1025  O O     . GLY A  1 146 ? -33.849 23.574  72.060  1.00 44.18  ? 174 GLY A O     1 
ATOM   1026  N N     . ASP A  1 147 ? -34.353 25.743  71.687  1.00 41.05  ? 175 ASP A N     1 
ATOM   1027  C CA    . ASP A  1 147 ? -35.197 25.473  70.526  1.00 39.63  ? 175 ASP A CA    1 
ATOM   1028  C C     . ASP A  1 147 ? -34.410 25.289  69.219  1.00 35.47  ? 175 ASP A C     1 
ATOM   1029  O O     . ASP A  1 147 ? -34.989 25.324  68.168  1.00 37.27  ? 175 ASP A O     1 
ATOM   1030  C CB    . ASP A  1 147 ? -36.264 26.578  70.368  1.00 41.17  ? 175 ASP A CB    1 
ATOM   1031  C CG    . ASP A  1 147 ? -35.671 28.007  70.195  1.00 53.04  ? 175 ASP A CG    1 
ATOM   1032  O OD1   . ASP A  1 147 ? -34.465 28.195  69.878  1.00 37.94  ? 175 ASP A OD1   1 
ATOM   1033  O OD2   . ASP A  1 147 ? -36.451 28.967  70.377  1.00 58.65  ? 175 ASP A OD2   1 
ATOM   1034  N N     . SER A  1 148 ? -33.094 25.110  69.283  1.00 35.40  ? 176 SER A N     1 
ATOM   1035  C CA    . SER A  1 148 ? -32.269 25.121  68.081  1.00 34.99  ? 176 SER A CA    1 
ATOM   1036  C C     . SER A  1 148 ? -31.256 23.966  68.003  1.00 32.38  ? 176 SER A C     1 
ATOM   1037  O O     . SER A  1 148 ? -31.135 23.167  68.924  1.00 31.69  ? 176 SER A O     1 
ATOM   1038  C CB    . SER A  1 148 ? -31.560 26.463  67.999  1.00 35.63  ? 176 SER A CB    1 
ATOM   1039  O OG    . SER A  1 148 ? -32.523 27.496  67.999  1.00 35.00  ? 176 SER A OG    1 
ATOM   1040  N N     . TRP A  1 149 ? -30.554 23.886  66.879  1.00 27.75  ? 177 TRP A N     1 
ATOM   1041  C CA    . TRP A  1 149 ? -29.453 22.948  66.707  1.00 26.13  ? 177 TRP A CA    1 
ATOM   1042  C C     . TRP A  1 149 ? -28.226 23.764  66.438  1.00 23.59  ? 177 TRP A C     1 
ATOM   1043  O O     . TRP A  1 149 ? -28.283 24.738  65.707  1.00 24.73  ? 177 TRP A O     1 
ATOM   1044  C CB    . TRP A  1 149 ? -29.687 22.015  65.529  1.00 26.37  ? 177 TRP A CB    1 
ATOM   1045  C CG    . TRP A  1 149 ? -30.916 21.170  65.651  1.00 32.16  ? 177 TRP A CG    1 
ATOM   1046  C CD1   . TRP A  1 149 ? -32.137 21.420  65.125  1.00 25.98  ? 177 TRP A CD1   1 
ATOM   1047  C CD2   . TRP A  1 149 ? -31.009 19.923  66.333  1.00 29.57  ? 177 TRP A CD2   1 
ATOM   1048  N NE1   . TRP A  1 149 ? -33.013 20.400  65.459  1.00 32.00  ? 177 TRP A NE1   1 
ATOM   1049  C CE2   . TRP A  1 149 ? -32.338 19.475  66.208  1.00 25.95  ? 177 TRP A CE2   1 
ATOM   1050  C CE3   . TRP A  1 149 ? -30.096 19.151  67.062  1.00 25.67  ? 177 TRP A CE3   1 
ATOM   1051  C CZ2   . TRP A  1 149 ? -32.765 18.266  66.750  1.00 29.81  ? 177 TRP A CZ2   1 
ATOM   1052  C CZ3   . TRP A  1 149 ? -30.519 17.971  67.611  1.00 32.67  ? 177 TRP A CZ3   1 
ATOM   1053  C CH2   . TRP A  1 149 ? -31.847 17.534  67.450  1.00 29.43  ? 177 TRP A CH2   1 
ATOM   1054  N N     . VAL A  1 150 ? -27.108 23.379  67.041  1.00 26.43  ? 178 VAL A N     1 
ATOM   1055  C CA    . VAL A  1 150 ? -25.873 24.104  66.833  1.00 27.79  ? 178 VAL A CA    1 
ATOM   1056  C C     . VAL A  1 150 ? -24.849 23.173  66.172  1.00 28.39  ? 178 VAL A C     1 
ATOM   1057  O O     . VAL A  1 150 ? -24.504 22.125  66.731  1.00 25.96  ? 178 VAL A O     1 
ATOM   1058  C CB    . VAL A  1 150 ? -25.341 24.705  68.176  1.00 27.78  ? 178 VAL A CB    1 
ATOM   1059  C CG1   . VAL A  1 150 ? -24.199 25.640  67.903  1.00 27.88  ? 178 VAL A CG1   1 
ATOM   1060  C CG2   . VAL A  1 150 ? -26.479 25.428  68.948  1.00 30.91  ? 178 VAL A CG2   1 
ATOM   1061  N N     . LEU A  1 151 ? -24.341 23.587  65.012  1.00 25.95  ? 179 LEU A N     1 
ATOM   1062  C CA    . LEU A  1 151 ? -23.472 22.759  64.195  1.00 24.73  ? 179 LEU A CA    1 
ATOM   1063  C C     . LEU A  1 151 ? -22.037 23.230  64.280  1.00 25.82  ? 179 LEU A C     1 
ATOM   1064  O O     . LEU A  1 151 ? -21.744 24.435  64.190  1.00 25.74  ? 179 LEU A O     1 
ATOM   1065  C CB    . LEU A  1 151 ? -23.939 22.729  62.725  1.00 25.88  ? 179 LEU A CB    1 
ATOM   1066  C CG    . LEU A  1 151 ? -25.126 21.807  62.359  1.00 32.30  ? 179 LEU A CG    1 
ATOM   1067  C CD1   . LEU A  1 151 ? -26.288 21.970  63.292  1.00 29.98  ? 179 LEU A CD1   1 
ATOM   1068  C CD2   . LEU A  1 151 ? -25.597 22.045  60.929  1.00 34.49  ? 179 LEU A CD2   1 
ATOM   1069  N N     . ASN A  1 152 ? -21.139 22.265  64.439  1.00 28.15  ? 180 ASN A N     1 
ATOM   1070  C CA    . ASN A  1 152 ? -19.720 22.539  64.468  1.00 24.07  ? 180 ASN A CA    1 
ATOM   1071  C C     . ASN A  1 152 ? -18.951 21.465  63.731  1.00 25.59  ? 180 ASN A C     1 
ATOM   1072  O O     . ASN A  1 152 ? -19.050 20.296  64.055  1.00 28.51  ? 180 ASN A O     1 
ATOM   1073  C CB    . ASN A  1 152 ? -19.236 22.590  65.919  1.00 29.13  ? 180 ASN A CB    1 
ATOM   1074  C CG    . ASN A  1 152 ? -19.534 23.903  66.578  1.00 34.33  ? 180 ASN A CG    1 
ATOM   1075  O OD1   . ASN A  1 152 ? -18.851 24.886  66.318  1.00 31.17  ? 180 ASN A OD1   1 
ATOM   1076  N ND2   . ASN A  1 152 ? -20.565 23.938  67.426  1.00 20.41  ? 180 ASN A ND2   1 
ATOM   1077  N N     . GLY A  1 153 ? -18.143 21.868  62.771  1.00 27.03  ? 181 GLY A N     1 
ATOM   1078  C CA    . GLY A  1 153 ? -17.357 20.912  62.010  1.00 27.05  ? 181 GLY A CA    1 
ATOM   1079  C C     . GLY A  1 153 ? -17.161 21.338  60.579  1.00 25.69  ? 181 GLY A C     1 
ATOM   1080  O O     . GLY A  1 153 ? -17.771 22.308  60.114  1.00 26.09  ? 181 GLY A O     1 
ATOM   1081  N N     . THR A  1 154 ? -16.281 20.607  59.892  1.00 26.19  ? 182 THR A N     1 
ATOM   1082  C CA    . THR A  1 154 ? -15.978 20.832  58.488  1.00 29.28  ? 182 THR A CA    1 
ATOM   1083  C C     . THR A  1 154 ? -16.545 19.658  57.639  1.00 25.78  ? 182 THR A C     1 
ATOM   1084  O O     . THR A  1 154 ? -16.330 18.484  57.953  1.00 24.79  ? 182 THR A O     1 
ATOM   1085  C CB    . THR A  1 154 ? -14.452 21.035  58.286  1.00 32.05  ? 182 THR A CB    1 
ATOM   1086  O OG1   . THR A  1 154 ? -14.000 22.147  59.088  1.00 36.80  ? 182 THR A OG1   1 
ATOM   1087  C CG2   . THR A  1 154 ? -14.111 21.295  56.819  1.00 27.47  ? 182 THR A CG2   1 
ATOM   1088  N N     . LYS A  1 155 ? -17.352 19.975  56.625  1.00 26.93  ? 183 LYS A N     1 
ATOM   1089  C CA    . LYS A  1 155 ? -17.646 18.993  55.576  1.00 25.57  ? 183 LYS A CA    1 
ATOM   1090  C C     . LYS A  1 155 ? -16.634 19.230  54.458  1.00 25.54  ? 183 LYS A C     1 
ATOM   1091  O O     . LYS A  1 155 ? -16.141 20.340  54.295  1.00 28.03  ? 183 LYS A O     1 
ATOM   1092  C CB    . LYS A  1 155 ? -19.099 19.062  55.095  1.00 26.71  ? 183 LYS A CB    1 
ATOM   1093  C CG    . LYS A  1 155 ? -20.181 19.095  56.190  1.00 26.40  ? 183 LYS A CG    1 
ATOM   1094  C CD    . LYS A  1 155 ? -20.105 17.966  57.247  1.00 32.26  ? 183 LYS A CD    1 
ATOM   1095  C CE    . LYS A  1 155 ? -20.494 16.608  56.717  1.00 26.53  ? 183 LYS A CE    1 
ATOM   1096  N NZ    . LYS A  1 155 ? -20.840 15.618  57.768  1.00 24.21  ? 183 LYS A NZ    1 
ATOM   1097  N N     . ALA A  1 156 ? -16.284 18.177  53.730  1.00 24.18  ? 184 ALA A N     1 
ATOM   1098  C CA    . ALA A  1 156 ? -15.388 18.272  52.589  1.00 24.93  ? 184 ALA A CA    1 
ATOM   1099  C C     . ALA A  1 156 ? -15.980 17.736  51.292  1.00 24.63  ? 184 ALA A C     1 
ATOM   1100  O O     . ALA A  1 156 ? -16.877 16.869  51.282  1.00 21.87  ? 184 ALA A O     1 
ATOM   1101  C CB    . ALA A  1 156 ? -14.044 17.564  52.897  1.00 26.30  ? 184 ALA A CB    1 
ATOM   1102  N N     . TRP A  1 157 ? -15.440 18.275  50.199  1.00 25.40  ? 185 TRP A N     1 
ATOM   1103  C CA    . TRP A  1 157 ? -15.736 17.850  48.824  1.00 27.14  ? 185 TRP A CA    1 
ATOM   1104  C C     . TRP A  1 157 ? -17.129 18.190  48.341  1.00 24.65  ? 185 TRP A C     1 
ATOM   1105  O O     . TRP A  1 157 ? -17.650 17.475  47.504  1.00 29.07  ? 185 TRP A O     1 
ATOM   1106  C CB    . TRP A  1 157 ? -15.584 16.344  48.658  1.00 28.12  ? 185 TRP A CB    1 
ATOM   1107  C CG    . TRP A  1 157 ? -14.355 15.794  49.146  1.00 24.73  ? 185 TRP A CG    1 
ATOM   1108  C CD1   . TRP A  1 157 ? -14.205 14.973  50.218  1.00 28.62  ? 185 TRP A CD1   1 
ATOM   1109  C CD2   . TRP A  1 157 ? -13.044 15.995  48.601  1.00 19.94  ? 185 TRP A CD2   1 
ATOM   1110  N NE1   . TRP A  1 157 ? -12.898 14.641  50.370  1.00 19.04  ? 185 TRP A NE1   1 
ATOM   1111  C CE2   . TRP A  1 157 ? -12.155 15.254  49.397  1.00 23.84  ? 185 TRP A CE2   1 
ATOM   1112  C CE3   . TRP A  1 157 ? -12.546 16.704  47.508  1.00 22.94  ? 185 TRP A CE3   1 
ATOM   1113  C CZ2   . TRP A  1 157 ? -10.790 15.199  49.135  1.00 23.12  ? 185 TRP A CZ2   1 
ATOM   1114  C CZ3   . TRP A  1 157 ? -11.187 16.671  47.252  1.00 28.03  ? 185 TRP A CZ3   1 
ATOM   1115  C CH2   . TRP A  1 157 ? -10.321 15.919  48.063  1.00 26.38  ? 185 TRP A CH2   1 
ATOM   1116  N N     . ILE A  1 158 ? -17.728 19.274  48.810  1.00 20.51  ? 186 ILE A N     1 
ATOM   1117  C CA    . ILE A  1 158 ? -19.159 19.495  48.517  1.00 22.83  ? 186 ILE A CA    1 
ATOM   1118  C C     . ILE A  1 158 ? -19.308 20.139  47.132  1.00 18.22  ? 186 ILE A C     1 
ATOM   1119  O O     . ILE A  1 158 ? -18.849 21.254  46.897  1.00 22.78  ? 186 ILE A O     1 
ATOM   1120  C CB    . ILE A  1 158 ? -19.852 20.340  49.599  1.00 24.93  ? 186 ILE A CB    1 
ATOM   1121  C CG1   . ILE A  1 158 ? -19.533 19.795  51.015  1.00 26.98  ? 186 ILE A CG1   1 
ATOM   1122  C CG2   . ILE A  1 158 ? -21.374 20.454  49.310  1.00 22.02  ? 186 ILE A CG2   1 
ATOM   1123  C CD1   . ILE A  1 158 ? -19.688 18.294  51.203  1.00 26.44  ? 186 ILE A CD1   1 
ATOM   1124  N N     . THR A  1 159 ? -19.853 19.372  46.198  1.00 19.63  ? 187 THR A N     1 
ATOM   1125  C CA    . THR A  1 159 ? -20.193 19.842  44.853  1.00 21.84  ? 187 THR A CA    1 
ATOM   1126  C C     . THR A  1 159 ? -21.300 20.903  44.932  1.00 23.63  ? 187 THR A C     1 
ATOM   1127  O O     . THR A  1 159 ? -22.300 20.707  45.628  1.00 21.90  ? 187 THR A O     1 
ATOM   1128  C CB    . THR A  1 159 ? -20.701 18.651  43.973  1.00 22.90  ? 187 THR A CB    1 
ATOM   1129  O OG1   . THR A  1 159 ? -19.673 17.667  43.893  1.00 24.11  ? 187 THR A OG1   1 
ATOM   1130  C CG2   . THR A  1 159 ? -21.104 19.105  42.536  1.00 19.25  ? 187 THR A CG2   1 
ATOM   1131  N N     . ASN A  1 160 ? -21.114 22.008  44.198  1.00 20.01  ? 188 ASN A N     1 
ATOM   1132  C CA    . ASN A  1 160 ? -22.044 23.161  44.210  1.00 20.68  ? 188 ASN A CA    1 
ATOM   1133  C C     . ASN A  1 160 ? -21.890 24.068  45.443  1.00 25.72  ? 188 ASN A C     1 
ATOM   1134  O O     . ASN A  1 160 ? -22.665 25.001  45.606  1.00 27.04  ? 188 ASN A O     1 
ATOM   1135  C CB    . ASN A  1 160 ? -23.529 22.754  44.085  1.00 24.03  ? 188 ASN A CB    1 
ATOM   1136  C CG    . ASN A  1 160 ? -23.875 22.043  42.774  1.00 22.56  ? 188 ASN A CG    1 
ATOM   1137  O OD1   . ASN A  1 160 ? -23.118 22.059  41.804  1.00 26.84  ? 188 ASN A OD1   1 
ATOM   1138  N ND2   . ASN A  1 160 ? -25.066 21.433  42.751  1.00 20.03  ? 188 ASN A ND2   1 
ATOM   1139  N N     . ALA A  1 161 ? -20.895 23.806  46.296  1.00 22.54  ? 189 ALA A N     1 
ATOM   1140  C CA    . ALA A  1 161 ? -20.689 24.562  47.539  1.00 28.57  ? 189 ALA A CA    1 
ATOM   1141  C C     . ALA A  1 161 ? -20.678 26.082  47.319  1.00 27.64  ? 189 ALA A C     1 
ATOM   1142  O O     . ALA A  1 161 ? -21.318 26.820  48.070  1.00 20.48  ? 189 ALA A O     1 
ATOM   1143  C CB    . ALA A  1 161 ? -19.374 24.133  48.219  1.00 24.94  ? 189 ALA A CB    1 
ATOM   1144  N N     . TRP A  1 162 ? -19.969 26.523  46.279  1.00 24.97  ? 190 TRP A N     1 
ATOM   1145  C CA    . TRP A  1 162 ? -19.854 27.938  45.983  1.00 23.40  ? 190 TRP A CA    1 
ATOM   1146  C C     . TRP A  1 162 ? -21.029 28.537  45.223  1.00 24.53  ? 190 TRP A C     1 
ATOM   1147  O O     . TRP A  1 162 ? -21.091 29.749  45.080  1.00 29.56  ? 190 TRP A O     1 
ATOM   1148  C CB    . TRP A  1 162 ? -18.561 28.214  45.246  1.00 26.49  ? 190 TRP A CB    1 
ATOM   1149  C CG    . TRP A  1 162 ? -17.396 28.314  46.166  1.00 28.12  ? 190 TRP A CG    1 
ATOM   1150  C CD1   . TRP A  1 162 ? -16.709 27.293  46.741  1.00 30.79  ? 190 TRP A CD1   1 
ATOM   1151  C CD2   . TRP A  1 162 ? -16.768 29.526  46.603  1.00 38.01  ? 190 TRP A CD2   1 
ATOM   1152  N NE1   . TRP A  1 162 ? -15.658 27.793  47.499  1.00 23.79  ? 190 TRP A NE1   1 
ATOM   1153  C CE2   . TRP A  1 162 ? -15.689 29.162  47.444  1.00 25.96  ? 190 TRP A CE2   1 
ATOM   1154  C CE3   . TRP A  1 162 ? -17.008 30.886  46.360  1.00 38.40  ? 190 TRP A CE3   1 
ATOM   1155  C CZ2   . TRP A  1 162 ? -14.861 30.111  48.056  1.00 36.70  ? 190 TRP A CZ2   1 
ATOM   1156  C CZ3   . TRP A  1 162 ? -16.169 31.832  46.961  1.00 37.50  ? 190 TRP A CZ3   1 
ATOM   1157  C CH2   . TRP A  1 162 ? -15.115 31.436  47.799  1.00 37.44  ? 190 TRP A CH2   1 
ATOM   1158  N N     . GLU A  1 163 ? -21.961 27.718  44.754  1.00 26.36  ? 191 GLU A N     1 
ATOM   1159  C CA    . GLU A  1 163 ? -23.181 28.229  44.106  1.00 23.32  ? 191 GLU A CA    1 
ATOM   1160  C C     . GLU A  1 163 ? -24.496 27.916  44.809  1.00 23.99  ? 191 GLU A C     1 
ATOM   1161  O O     . GLU A  1 163 ? -25.522 28.521  44.459  1.00 24.18  ? 191 GLU A O     1 
ATOM   1162  C CB    . GLU A  1 163 ? -23.272 27.723  42.660  1.00 23.88  ? 191 GLU A CB    1 
ATOM   1163  C CG    . GLU A  1 163 ? -22.113 28.180  41.783  1.00 24.42  ? 191 GLU A CG    1 
ATOM   1164  C CD    . GLU A  1 163 ? -20.889 27.295  41.934  1.00 35.80  ? 191 GLU A CD    1 
ATOM   1165  O OE1   . GLU A  1 163 ? -21.020 26.157  42.446  1.00 30.90  ? 191 GLU A OE1   1 
ATOM   1166  O OE2   . GLU A  1 163 ? -19.799 27.734  41.543  1.00 29.79  ? 191 GLU A OE2   1 
ATOM   1167  N N     . ALA A  1 164 ? -24.490 26.974  45.757  1.00 19.89  ? 192 ALA A N     1 
ATOM   1168  C CA    . ALA A  1 164 ? -25.720 26.521  46.451  1.00 24.79  ? 192 ALA A CA    1 
ATOM   1169  C C     . ALA A  1 164 ? -26.388 27.576  47.364  1.00 21.54  ? 192 ALA A C     1 
ATOM   1170  O O     . ALA A  1 164 ? -25.721 28.435  47.963  1.00 24.69  ? 192 ALA A O     1 
ATOM   1171  C CB    . ALA A  1 164 ? -25.430 25.223  47.250  1.00 18.58  ? 192 ALA A CB    1 
ATOM   1172  N N     . SER A  1 165 ? -27.713 27.516  47.426  1.00 23.99  ? 193 SER A N     1 
ATOM   1173  C CA    . SER A  1 165 ? -28.530 28.334  48.304  1.00 24.84  ? 193 SER A CA    1 
ATOM   1174  C C     . SER A  1 165 ? -29.134 27.583  49.475  1.00 21.64  ? 193 SER A C     1 
ATOM   1175  O O     . SER A  1 165 ? -29.836 28.177  50.285  1.00 20.96  ? 193 SER A O     1 
ATOM   1176  C CB    . SER A  1 165 ? -29.679 28.953  47.516  1.00 24.06  ? 193 SER A CB    1 
ATOM   1177  O OG    . SER A  1 165 ? -29.190 29.865  46.595  1.00 24.35  ? 193 SER A OG    1 
ATOM   1178  N N     . ALA A  1 166 ? -28.859 26.282  49.559  1.00 23.44  ? 194 ALA A N     1 
ATOM   1179  C CA    . ALA A  1 166 ? -29.226 25.448  50.696  1.00 21.37  ? 194 ALA A CA    1 
ATOM   1180  C C     . ALA A  1 166 ? -28.469 24.128  50.603  1.00 21.96  ? 194 ALA A C     1 
ATOM   1181  O O     . ALA A  1 166 ? -28.028 23.732  49.524  1.00 24.09  ? 194 ALA A O     1 
ATOM   1182  C CB    . ALA A  1 166 ? -30.699 25.168  50.724  1.00 20.48  ? 194 ALA A CB    1 
ATOM   1183  N N     . ALA A  1 167 ? -28.329 23.473  51.752  1.00 21.65  ? 195 ALA A N     1 
ATOM   1184  C CA    . ALA A  1 167 ? -27.598 22.213  51.878  1.00 24.06  ? 195 ALA A CA    1 
ATOM   1185  C C     . ALA A  1 167 ? -28.411 21.232  52.724  1.00 25.79  ? 195 ALA A C     1 
ATOM   1186  O O     . ALA A  1 167 ? -29.139 21.633  53.645  1.00 25.53  ? 195 ALA A O     1 
ATOM   1187  C CB    . ALA A  1 167 ? -26.185 22.444  52.491  1.00 19.96  ? 195 ALA A CB    1 
ATOM   1188  N N     . VAL A  1 168 ? -28.325 19.954  52.349  1.00 27.89  ? 196 VAL A N     1 
ATOM   1189  C CA    . VAL A  1 168 ? -28.694 18.842  53.220  1.00 24.68  ? 196 VAL A CA    1 
ATOM   1190  C C     . VAL A  1 168 ? -27.377 18.422  53.922  1.00 24.18  ? 196 VAL A C     1 
ATOM   1191  O O     . VAL A  1 168 ? -26.409 18.033  53.275  1.00 27.90  ? 196 VAL A O     1 
ATOM   1192  C CB    . VAL A  1 168 ? -29.358 17.680  52.426  1.00 23.17  ? 196 VAL A CB    1 
ATOM   1193  C CG1   . VAL A  1 168 ? -29.822 16.586  53.363  1.00 20.47  ? 196 VAL A CG1   1 
ATOM   1194  C CG2   . VAL A  1 168 ? -30.545 18.211  51.596  1.00 25.88  ? 196 VAL A CG2   1 
ATOM   1195  N N     . VAL A  1 169 ? -27.354 18.559  55.248  1.00 26.49  ? 197 VAL A N     1 
ATOM   1196  C CA    . VAL A  1 169 ? -26.128 18.423  56.015  1.00 24.76  ? 197 VAL A CA    1 
ATOM   1197  C C     . VAL A  1 169 ? -26.269 17.291  57.034  1.00 21.96  ? 197 VAL A C     1 
ATOM   1198  O O     . VAL A  1 169 ? -27.254 17.215  57.751  1.00 20.71  ? 197 VAL A O     1 
ATOM   1199  C CB    . VAL A  1 169 ? -25.776 19.759  56.719  1.00 28.48  ? 197 VAL A CB    1 
ATOM   1200  C CG1   . VAL A  1 169 ? -24.475 19.634  57.508  1.00 23.17  ? 197 VAL A CG1   1 
ATOM   1201  C CG2   . VAL A  1 169 ? -25.686 20.887  55.670  1.00 23.47  ? 197 VAL A CG2   1 
ATOM   1202  N N     . PHE A  1 170 ? -25.255 16.430  57.099  1.00 22.00  ? 198 PHE A N     1 
ATOM   1203  C CA    . PHE A  1 170 ? -25.257 15.290  58.029  1.00 22.94  ? 198 PHE A CA    1 
ATOM   1204  C C     . PHE A  1 170 ? -24.289 15.531  59.181  1.00 25.11  ? 198 PHE A C     1 
ATOM   1205  O O     . PHE A  1 170 ? -23.108 15.768  58.963  1.00 25.98  ? 198 PHE A O     1 
ATOM   1206  C CB    . PHE A  1 170 ? -24.929 13.984  57.281  1.00 22.39  ? 198 PHE A CB    1 
ATOM   1207  C CG    . PHE A  1 170 ? -25.936 13.656  56.243  1.00 23.57  ? 198 PHE A CG    1 
ATOM   1208  C CD1   . PHE A  1 170 ? -27.070 12.925  56.567  1.00 22.92  ? 198 PHE A CD1   1 
ATOM   1209  C CD2   . PHE A  1 170 ? -25.816 14.180  54.967  1.00 21.72  ? 198 PHE A CD2   1 
ATOM   1210  C CE1   . PHE A  1 170 ? -28.028 12.690  55.634  1.00 22.42  ? 198 PHE A CE1   1 
ATOM   1211  C CE2   . PHE A  1 170 ? -26.774 13.935  54.014  1.00 25.31  ? 198 PHE A CE2   1 
ATOM   1212  C CZ    . PHE A  1 170 ? -27.889 13.200  54.343  1.00 22.91  ? 198 PHE A CZ    1 
ATOM   1213  N N     . ALA A  1 171 ? -24.817 15.474  60.397  1.00 24.84  ? 199 ALA A N     1 
ATOM   1214  C CA    . ALA A  1 171 ? -24.033 15.757  61.599  1.00 29.62  ? 199 ALA A CA    1 
ATOM   1215  C C     . ALA A  1 171 ? -24.302 14.717  62.694  1.00 25.57  ? 199 ALA A C     1 
ATOM   1216  O O     . ALA A  1 171 ? -25.405 14.182  62.822  1.00 22.11  ? 199 ALA A O     1 
ATOM   1217  C CB    . ALA A  1 171 ? -24.318 17.200  62.122  1.00 20.60  ? 199 ALA A CB    1 
ATOM   1218  N N     . SER A  1 172 ? -23.281 14.467  63.501  1.00 26.68  ? 200 SER A N     1 
ATOM   1219  C CA    . SER A  1 172 ? -23.412 13.561  64.646  1.00 30.80  ? 200 SER A CA    1 
ATOM   1220  C C     . SER A  1 172 ? -24.221 14.231  65.751  1.00 29.20  ? 200 SER A C     1 
ATOM   1221  O O     . SER A  1 172 ? -23.868 15.316  66.200  1.00 25.61  ? 200 SER A O     1 
ATOM   1222  C CB    . SER A  1 172 ? -22.025 13.126  65.162  1.00 28.80  ? 200 SER A CB    1 
ATOM   1223  O OG    . SER A  1 172 ? -22.162 12.351  66.351  1.00 40.01  ? 200 SER A OG    1 
ATOM   1224  N N     . THR A  1 173 ? -25.331 13.600  66.136  1.00 29.27  ? 201 THR A N     1 
ATOM   1225  C CA    . THR A  1 173 ? -26.209 14.078  67.182  1.00 33.25  ? 201 THR A CA    1 
ATOM   1226  C C     . THR A  1 173 ? -26.239 13.175  68.444  1.00 36.82  ? 201 THR A C     1 
ATOM   1227  O O     . THR A  1 173 ? -26.857 13.546  69.432  1.00 33.23  ? 201 THR A O     1 
ATOM   1228  C CB    . THR A  1 173 ? -27.644 14.195  66.640  1.00 34.52  ? 201 THR A CB    1 
ATOM   1229  O OG1   . THR A  1 173 ? -27.973 13.001  65.912  1.00 33.76  ? 201 THR A OG1   1 
ATOM   1230  C CG2   . THR A  1 173 ? -27.761 15.436  65.704  1.00 25.69  ? 201 THR A CG2   1 
ATOM   1231  N N     . ASP A  1 174 ? -25.574 12.014  68.406  1.00 34.93  ? 202 ASP A N     1 
ATOM   1232  C CA    . ASP A  1 174 ? -25.622 11.029  69.524  1.00 34.55  ? 202 ASP A CA    1 
ATOM   1233  C C     . ASP A  1 174 ? -24.574 9.931   69.354  1.00 31.90  ? 202 ASP A C     1 
ATOM   1234  O O     . ASP A  1 174 ? -24.848 8.892   68.758  1.00 41.41  ? 202 ASP A O     1 
ATOM   1235  C CB    . ASP A  1 174 ? -27.007 10.371  69.595  1.00 34.04  ? 202 ASP A CB    1 
ATOM   1236  C CG    . ASP A  1 174 ? -27.241 9.617   70.897  1.00 45.06  ? 202 ASP A CG    1 
ATOM   1237  O OD1   . ASP A  1 174 ? -26.286 9.315   71.662  1.00 27.43  ? 202 ASP A OD1   1 
ATOM   1238  O OD2   . ASP A  1 174 ? -28.421 9.347   71.169  1.00 31.08  ? 202 ASP A OD2   1 
ATOM   1239  N N     . ARG A  1 175 ? -23.392 10.139  69.897  1.00 36.76  ? 203 ARG A N     1 
ATOM   1240  C CA    . ARG A  1 175 ? -22.322 9.121   69.817  1.00 41.81  ? 203 ARG A CA    1 
ATOM   1241  C C     . ARG A  1 175 ? -22.576 7.899   70.760  1.00 46.67  ? 203 ARG A C     1 
ATOM   1242  O O     . ARG A  1 175 ? -21.958 6.828   70.561  1.00 47.39  ? 203 ARG A O     1 
ATOM   1243  C CB    . ARG A  1 175 ? -20.945 9.773   70.087  1.00 42.83  ? 203 ARG A CB    1 
ATOM   1244  C CG    . ARG A  1 175 ? -19.781 9.172   69.315  1.00 47.04  ? 203 ARG A CG    1 
ATOM   1245  N N     . ALA A  1 176 ? -23.468 8.050   71.761  1.00 39.05  ? 204 ALA A N     1 
ATOM   1246  C CA    . ALA A  1 176 ? -23.888 6.914   72.610  1.00 36.36  ? 204 ALA A CA    1 
ATOM   1247  C C     . ALA A  1 176 ? -24.622 5.831   71.826  1.00 28.71  ? 204 ALA A C     1 
ATOM   1248  O O     . ALA A  1 176 ? -24.341 4.671   72.009  1.00 25.45  ? 204 ALA A O     1 
ATOM   1249  C CB    . ALA A  1 176 ? -24.755 7.366   73.811  1.00 34.43  ? 204 ALA A CB    1 
ATOM   1250  N N     . LEU A  1 177 ? -25.589 6.209   70.992  1.00 25.63  ? 205 LEU A N     1 
ATOM   1251  C CA    . LEU A  1 177 ? -26.357 5.238   70.222  1.00 21.14  ? 205 LEU A CA    1 
ATOM   1252  C C     . LEU A  1 177 ? -25.715 5.089   68.865  1.00 22.89  ? 205 LEU A C     1 
ATOM   1253  O O     . LEU A  1 177 ? -25.978 5.861   67.943  1.00 24.76  ? 205 LEU A O     1 
ATOM   1254  C CB    . LEU A  1 177 ? -27.833 5.625   70.161  1.00 23.59  ? 205 LEU A CB    1 
ATOM   1255  C CG    . LEU A  1 177 ? -28.507 5.866   71.517  1.00 29.15  ? 205 LEU A CG    1 
ATOM   1256  C CD1   . LEU A  1 177 ? -29.959 6.312   71.263  1.00 27.54  ? 205 LEU A CD1   1 
ATOM   1257  C CD2   . LEU A  1 177 ? -28.433 4.631   72.456  1.00 20.80  ? 205 LEU A CD2   1 
ATOM   1258  N N     . GLN A  1 178 ? -24.861 4.066   68.748  1.00 23.55  ? 206 GLN A N     1 
ATOM   1259  C CA    . GLN A  1 178 ? -23.877 3.968   67.685  1.00 29.36  ? 206 GLN A CA    1 
ATOM   1260  C C     . GLN A  1 178 ? -24.460 3.739   66.275  1.00 32.13  ? 206 GLN A C     1 
ATOM   1261  O O     . GLN A  1 178 ? -23.802 4.038   65.281  1.00 33.29  ? 206 GLN A O     1 
ATOM   1262  C CB    . GLN A  1 178 ? -22.841 2.888   68.006  1.00 32.35  ? 206 GLN A CB    1 
ATOM   1263  C CG    . GLN A  1 178 ? -22.086 3.085   69.356  1.00 34.28  ? 206 GLN A CG    1 
ATOM   1264  C CD    . GLN A  1 178 ? -22.551 2.118   70.429  1.00 28.86  ? 206 GLN A CD    1 
ATOM   1265  O OE1   . GLN A  1 178 ? -23.734 1.889   70.568  1.00 21.48  ? 206 GLN A OE1   1 
ATOM   1266  N NE2   . GLN A  1 178 ? -21.617 1.540   71.185  1.00 26.36  ? 206 GLN A NE2   1 
ATOM   1267  N N     . ASN A  1 179 ? -25.688 3.238   66.198  1.00 24.20  ? 207 ASN A N     1 
ATOM   1268  C CA    . ASN A  1 179 ? -26.381 3.086   64.911  1.00 30.46  ? 207 ASN A CA    1 
ATOM   1269  C C     . ASN A  1 179 ? -27.516 4.096   64.674  1.00 28.14  ? 207 ASN A C     1 
ATOM   1270  O O     . ASN A  1 179 ? -28.120 4.076   63.601  1.00 30.14  ? 207 ASN A O     1 
ATOM   1271  C CB    . ASN A  1 179 ? -26.898 1.649   64.744  1.00 34.42  ? 207 ASN A CB    1 
ATOM   1272  C CG    . ASN A  1 179 ? -25.776 0.646   64.479  1.00 33.32  ? 207 ASN A CG    1 
ATOM   1273  O OD1   . ASN A  1 179 ? -24.762 0.975   63.862  1.00 58.89  ? 207 ASN A OD1   1 
ATOM   1274  N ND2   . ASN A  1 179 ? -25.953 -0.574  64.951  1.00 41.69  ? 207 ASN A ND2   1 
ATOM   1275  N N     . LYS A  1 180 ? -27.805 4.944   65.672  1.00 25.07  ? 208 LYS A N     1 
ATOM   1276  C CA    . LYS A  1 180 ? -28.738 6.077   65.558  1.00 25.91  ? 208 LYS A CA    1 
ATOM   1277  C C     . LYS A  1 180 ? -27.960 7.370   65.844  1.00 25.84  ? 208 LYS A C     1 
ATOM   1278  O O     . LYS A  1 180 ? -28.411 8.250   66.559  1.00 26.61  ? 208 LYS A O     1 
ATOM   1279  C CB    . LYS A  1 180 ? -29.900 5.939   66.553  1.00 31.83  ? 208 LYS A CB    1 
ATOM   1280  C CG    . LYS A  1 180 ? -31.087 5.087   66.104  1.00 33.23  ? 208 LYS A CG    1 
ATOM   1281  C CD    . LYS A  1 180 ? -32.323 5.399   66.961  1.00 29.24  ? 208 LYS A CD    1 
ATOM   1282  N N     . SER A  1 181 ? -26.782 7.488   65.257  1.00 24.52  ? 209 SER A N     1 
ATOM   1283  C CA    . SER A  1 181 ? -25.836 8.510   65.687  1.00 29.30  ? 209 SER A CA    1 
ATOM   1284  C C     . SER A  1 181 ? -25.871 9.805   64.880  1.00 30.73  ? 209 SER A C     1 
ATOM   1285  O O     . SER A  1 181 ? -25.298 10.803  65.310  1.00 27.93  ? 209 SER A O     1 
ATOM   1286  C CB    . SER A  1 181 ? -24.417 7.946   65.617  1.00 24.61  ? 209 SER A CB    1 
ATOM   1287  O OG    . SER A  1 181 ? -23.474 8.947   65.951  1.00 54.14  ? 209 SER A OG    1 
ATOM   1288  N N     . ILE A  1 182 ? -26.494 9.777   63.703  1.00 28.90  ? 210 ILE A N     1 
ATOM   1289  C CA    . ILE A  1 182 ? -26.391 10.891  62.764  1.00 25.76  ? 210 ILE A CA    1 
ATOM   1290  C C     . ILE A  1 182 ? -27.771 11.416  62.463  1.00 24.48  ? 210 ILE A C     1 
ATOM   1291  O O     . ILE A  1 182 ? -28.753 10.681  62.497  1.00 20.90  ? 210 ILE A O     1 
ATOM   1292  C CB    . ILE A  1 182 ? -25.623 10.491  61.473  1.00 31.17  ? 210 ILE A CB    1 
ATOM   1293  C CG1   . ILE A  1 182 ? -24.198 10.076  61.841  1.00 27.32  ? 210 ILE A CG1   1 
ATOM   1294  C CG2   . ILE A  1 182 ? -25.607 11.651  60.429  1.00 25.99  ? 210 ILE A CG2   1 
ATOM   1295  C CD1   . ILE A  1 182 ? -23.467 9.333   60.741  1.00 46.99  ? 210 ILE A CD1   1 
ATOM   1296  N N     . SER A  1 183 ? -27.847 12.719  62.230  1.00 27.58  ? 211 SER A N     1 
ATOM   1297  C CA    . SER A  1 183 ? -29.099 13.337  61.791  1.00 27.66  ? 211 SER A CA    1 
ATOM   1298  C C     . SER A  1 183 ? -28.856 14.172  60.536  1.00 24.16  ? 211 SER A C     1 
ATOM   1299  O O     . SER A  1 183 ? -27.737 14.637  60.277  1.00 19.89  ? 211 SER A O     1 
ATOM   1300  C CB    . SER A  1 183 ? -29.719 14.214  62.898  1.00 26.24  ? 211 SER A CB    1 
ATOM   1301  O OG    . SER A  1 183 ? -30.086 13.458  64.040  1.00 21.98  ? 211 SER A OG    1 
ATOM   1302  N N     . ALA A  1 184 ? -29.923 14.359  59.769  1.00 24.92  ? 212 ALA A N     1 
ATOM   1303  C CA    . ALA A  1 184 ? -29.883 15.207  58.571  1.00 26.73  ? 212 ALA A CA    1 
ATOM   1304  C C     . ALA A  1 184 ? -30.538 16.579  58.850  1.00 22.43  ? 212 ALA A C     1 
ATOM   1305  O O     . ALA A  1 184 ? -31.577 16.672  59.502  1.00 24.35  ? 212 ALA A O     1 
ATOM   1306  C CB    . ALA A  1 184 ? -30.553 14.500  57.375  1.00 22.63  ? 212 ALA A CB    1 
ATOM   1307  N N     . PHE A  1 185 ? -29.926 17.628  58.314  1.00 25.09  ? 213 PHE A N     1 
ATOM   1308  C CA    . PHE A  1 185 ? -30.384 18.997  58.506  1.00 23.73  ? 213 PHE A CA    1 
ATOM   1309  C C     . PHE A  1 185 ? -30.454 19.811  57.201  1.00 24.81  ? 213 PHE A C     1 
ATOM   1310  O O     . PHE A  1 185 ? -29.555 19.741  56.342  1.00 24.45  ? 213 PHE A O     1 
ATOM   1311  C CB    . PHE A  1 185 ? -29.464 19.729  59.507  1.00 23.83  ? 213 PHE A CB    1 
ATOM   1312  C CG    . PHE A  1 185 ? -29.423 19.086  60.849  1.00 24.69  ? 213 PHE A CG    1 
ATOM   1313  C CD1   . PHE A  1 185 ? -30.353 19.403  61.813  1.00 26.41  ? 213 PHE A CD1   1 
ATOM   1314  C CD2   . PHE A  1 185 ? -28.433 18.139  61.151  1.00 26.66  ? 213 PHE A CD2   1 
ATOM   1315  C CE1   . PHE A  1 185 ? -30.321 18.792  63.055  1.00 25.48  ? 213 PHE A CE1   1 
ATOM   1316  C CE2   . PHE A  1 185 ? -28.408 17.520  62.394  1.00 31.41  ? 213 PHE A CE2   1 
ATOM   1317  C CZ    . PHE A  1 185 ? -29.355 17.845  63.341  1.00 27.75  ? 213 PHE A CZ    1 
ATOM   1318  N N     . LEU A  1 186 ? -31.493 20.636  57.118  1.00 23.53  ? 214 LEU A N     1 
ATOM   1319  C CA    . LEU A  1 186 ? -31.642 21.637  56.043  1.00 23.46  ? 214 LEU A CA    1 
ATOM   1320  C C     . LEU A  1 186 ? -31.082 22.967  56.504  1.00 25.02  ? 214 LEU A C     1 
ATOM   1321  O O     . LEU A  1 186 ? -31.530 23.506  57.492  1.00 25.69  ? 214 LEU A O     1 
ATOM   1322  C CB    . LEU A  1 186 ? -33.114 21.784  55.658  1.00 21.21  ? 214 LEU A CB    1 
ATOM   1323  C CG    . LEU A  1 186 ? -33.738 20.472  55.220  1.00 25.19  ? 214 LEU A CG    1 
ATOM   1324  C CD1   . LEU A  1 186 ? -35.212 20.587  54.936  1.00 25.05  ? 214 LEU A CD1   1 
ATOM   1325  C CD2   . LEU A  1 186 ? -32.990 19.943  54.006  1.00 26.77  ? 214 LEU A CD2   1 
ATOM   1326  N N     . VAL A  1 187 ? -30.103 23.479  55.771  1.00 25.27  ? 215 VAL A N     1 
ATOM   1327  C CA    . VAL A  1 187 ? -29.358 24.657  56.159  1.00 23.77  ? 215 VAL A CA    1 
ATOM   1328  C C     . VAL A  1 187 ? -29.318 25.668  54.987  1.00 27.65  ? 215 VAL A C     1 
ATOM   1329  O O     . VAL A  1 187 ? -28.912 25.318  53.882  1.00 23.72  ? 215 VAL A O     1 
ATOM   1330  C CB    . VAL A  1 187 ? -27.912 24.290  56.523  1.00 25.52  ? 215 VAL A CB    1 
ATOM   1331  C CG1   . VAL A  1 187 ? -27.150 25.540  56.986  1.00 24.60  ? 215 VAL A CG1   1 
ATOM   1332  C CG2   . VAL A  1 187 ? -27.888 23.173  57.574  1.00 23.73  ? 215 VAL A CG2   1 
ATOM   1333  N N     . PRO A  1 188 ? -29.726 26.924  55.231  1.00 27.20  ? 216 PRO A N     1 
ATOM   1334  C CA    . PRO A  1 188 ? -29.659 27.905  54.143  1.00 24.46  ? 216 PRO A CA    1 
ATOM   1335  C C     . PRO A  1 188 ? -28.224 28.391  53.922  1.00 26.66  ? 216 PRO A C     1 
ATOM   1336  O O     . PRO A  1 188 ? -27.412 28.371  54.855  1.00 27.43  ? 216 PRO A O     1 
ATOM   1337  C CB    . PRO A  1 188 ? -30.575 29.035  54.634  1.00 29.40  ? 216 PRO A CB    1 
ATOM   1338  C CG    . PRO A  1 188 ? -30.570 28.933  56.122  1.00 28.60  ? 216 PRO A CG    1 
ATOM   1339  C CD    . PRO A  1 188 ? -30.263 27.501  56.481  1.00 25.02  ? 216 PRO A CD    1 
ATOM   1340  N N     . MET A  1 189 ? -27.929 28.811  52.700  1.00 22.89  ? 217 MET A N     1 
ATOM   1341  C CA    . MET A  1 189 ? -26.632 29.331  52.323  1.00 26.75  ? 217 MET A CA    1 
ATOM   1342  C C     . MET A  1 189 ? -26.872 30.673  51.629  1.00 27.18  ? 217 MET A C     1 
ATOM   1343  O O     . MET A  1 189 ? -27.455 30.723  50.536  1.00 30.66  ? 217 MET A O     1 
ATOM   1344  C CB    . MET A  1 189 ? -25.915 28.363  51.384  1.00 22.97  ? 217 MET A CB    1 
ATOM   1345  C CG    . MET A  1 189 ? -25.759 26.939  51.977  1.00 30.83  ? 217 MET A CG    1 
ATOM   1346  S SD    . MET A  1 189 ? -24.881 25.695  51.000  1.00 25.39  ? 217 MET A SD    1 
ATOM   1347  C CE    . MET A  1 189 ? -23.296 26.431  50.652  1.00 25.29  ? 217 MET A CE    1 
ATOM   1348  N N     . PRO A  1 190 ? -26.413 31.766  52.245  1.00 28.77  ? 218 PRO A N     1 
ATOM   1349  C CA    . PRO A  1 190 ? -25.573 31.878  53.440  1.00 27.97  ? 218 PRO A CA    1 
ATOM   1350  C C     . PRO A  1 190 ? -26.325 31.682  54.742  1.00 24.64  ? 218 PRO A C     1 
ATOM   1351  O O     . PRO A  1 190 ? -27.581 31.676  54.777  1.00 24.08  ? 218 PRO A O     1 
ATOM   1352  C CB    . PRO A  1 190 ? -25.057 33.329  53.351  1.00 27.77  ? 218 PRO A CB    1 
ATOM   1353  C CG    . PRO A  1 190 ? -26.234 34.056  52.761  1.00 29.44  ? 218 PRO A CG    1 
ATOM   1354  C CD    . PRO A  1 190 ? -26.767 33.098  51.714  1.00 29.93  ? 218 PRO A CD    1 
ATOM   1355  N N     . THR A  1 191 ? -25.560 31.464  55.804  1.00 26.58  ? 219 THR A N     1 
ATOM   1356  C CA    . THR A  1 191 ? -26.109 31.518  57.162  1.00 29.88  ? 219 THR A CA    1 
ATOM   1357  C C     . THR A  1 191 ? -24.974 31.845  58.153  1.00 26.30  ? 219 THR A C     1 
ATOM   1358  O O     . THR A  1 191 ? -23.820 31.424  57.964  1.00 28.12  ? 219 THR A O     1 
ATOM   1359  C CB    . THR A  1 191 ? -26.924 30.228  57.534  1.00 32.38  ? 219 THR A CB    1 
ATOM   1360  O OG1   . THR A  1 191 ? -27.877 30.506  58.573  1.00 29.17  ? 219 THR A OG1   1 
ATOM   1361  C CG2   . THR A  1 191 ? -26.006 29.083  57.966  1.00 25.67  ? 219 THR A CG2   1 
ATOM   1362  N N     . PRO A  1 192 ? -25.270 32.652  59.182  1.00 29.10  ? 220 PRO A N     1 
ATOM   1363  C CA    . PRO A  1 192 ? -24.241 32.958  60.173  1.00 30.73  ? 220 PRO A CA    1 
ATOM   1364  C C     . PRO A  1 192 ? -23.709 31.687  60.815  1.00 26.60  ? 220 PRO A C     1 
ATOM   1365  O O     . PRO A  1 192 ? -24.483 30.839  61.233  1.00 23.17  ? 220 PRO A O     1 
ATOM   1366  C CB    . PRO A  1 192 ? -24.985 33.808  61.209  1.00 30.53  ? 220 PRO A CB    1 
ATOM   1367  C CG    . PRO A  1 192 ? -26.132 34.372  60.483  1.00 26.85  ? 220 PRO A CG    1 
ATOM   1368  C CD    . PRO A  1 192 ? -26.547 33.300  59.518  1.00 29.87  ? 220 PRO A CD    1 
ATOM   1369  N N     . GLY A  1 193 ? -22.387 31.563  60.875  1.00 28.23  ? 221 GLY A N     1 
ATOM   1370  C CA    . GLY A  1 193 ? -21.763 30.334  61.366  1.00 29.90  ? 221 GLY A CA    1 
ATOM   1371  C C     . GLY A  1 193 ? -21.263 29.395  60.274  1.00 29.49  ? 221 GLY A C     1 
ATOM   1372  O O     . GLY A  1 193 ? -20.517 28.448  60.567  1.00 26.67  ? 221 GLY A O     1 
ATOM   1373  N N     . LEU A  1 194 ? -21.649 29.661  59.026  1.00 25.87  ? 222 LEU A N     1 
ATOM   1374  C CA    . LEU A  1 194 ? -21.144 28.899  57.873  1.00 28.26  ? 222 LEU A CA    1 
ATOM   1375  C C     . LEU A  1 194 ? -20.163 29.705  57.013  1.00 27.19  ? 222 LEU A C     1 
ATOM   1376  O O     . LEU A  1 194 ? -20.455 30.827  56.590  1.00 29.11  ? 222 LEU A O     1 
ATOM   1377  C CB    . LEU A  1 194 ? -22.328 28.423  57.040  1.00 28.14  ? 222 LEU A CB    1 
ATOM   1378  C CG    . LEU A  1 194 ? -22.124 27.681  55.712  1.00 31.59  ? 222 LEU A CG    1 
ATOM   1379  C CD1   . LEU A  1 194 ? -21.229 26.437  55.877  1.00 25.60  ? 222 LEU A CD1   1 
ATOM   1380  C CD2   . LEU A  1 194 ? -23.512 27.291  55.183  1.00 30.90  ? 222 LEU A CD2   1 
ATOM   1381  N N     . THR A  1 195 ? -18.993 29.137  56.761  1.00 26.34  ? 223 THR A N     1 
ATOM   1382  C CA    . THR A  1 195 ? -18.081 29.675  55.774  1.00 25.79  ? 223 THR A CA    1 
ATOM   1383  C C     . THR A  1 195 ? -17.591 28.596  54.796  1.00 23.85  ? 223 THR A C     1 
ATOM   1384  O O     . THR A  1 195 ? -17.581 27.443  55.111  1.00 24.48  ? 223 THR A O     1 
ATOM   1385  C CB    . THR A  1 195 ? -16.865 30.392  56.420  1.00 30.37  ? 223 THR A CB    1 
ATOM   1386  O OG1   . THR A  1 195 ? -15.982 29.423  56.999  1.00 31.25  ? 223 THR A OG1   1 
ATOM   1387  C CG2   . THR A  1 195 ? -17.360 31.416  57.470  1.00 33.03  ? 223 THR A CG2   1 
ATOM   1388  N N     . LEU A  1 196 ? -17.148 29.020  53.616  1.00 24.39  ? 224 LEU A N     1 
ATOM   1389  C CA    . LEU A  1 196 ? -16.716 28.109  52.574  1.00 28.62  ? 224 LEU A CA    1 
ATOM   1390  C C     . LEU A  1 196 ? -15.209 28.034  52.537  1.00 26.25  ? 224 LEU A C     1 
ATOM   1391  O O     . LEU A  1 196 ? -14.516 29.037  52.746  1.00 29.55  ? 224 LEU A O     1 
ATOM   1392  C CB    . LEU A  1 196 ? -17.228 28.565  51.206  1.00 26.92  ? 224 LEU A CB    1 
ATOM   1393  C CG    . LEU A  1 196 ? -18.742 28.540  51.003  1.00 30.77  ? 224 LEU A CG    1 
ATOM   1394  C CD1   . LEU A  1 196 ? -19.101 29.002  49.582  1.00 29.02  ? 224 LEU A CD1   1 
ATOM   1395  C CD2   . LEU A  1 196 ? -19.271 27.147  51.275  1.00 28.83  ? 224 LEU A CD2   1 
ATOM   1396  N N     . GLY A  1 197 ? -14.689 26.849  52.250  1.00 27.75  ? 225 GLY A N     1 
ATOM   1397  C CA    . GLY A  1 197 ? -13.268 26.698  51.978  1.00 26.42  ? 225 GLY A CA    1 
ATOM   1398  C C     . GLY A  1 197 ? -12.970 27.090  50.541  1.00 25.73  ? 225 GLY A C     1 
ATOM   1399  O O     . GLY A  1 197 ? -13.872 27.342  49.760  1.00 27.61  ? 225 GLY A O     1 
ATOM   1400  N N     . LYS A  1 198 ? -11.689 27.178  50.208  1.00 27.04  ? 226 LYS A N     1 
ATOM   1401  C CA    . LYS A  1 198 ? -11.266 27.407  48.839  1.00 28.78  ? 226 LYS A CA    1 
ATOM   1402  C C     . LYS A  1 198 ? -11.778 26.293  47.888  1.00 25.93  ? 226 LYS A C     1 
ATOM   1403  O O     . LYS A  1 198 ? -11.834 25.118  48.265  1.00 26.87  ? 226 LYS A O     1 
ATOM   1404  C CB    . LYS A  1 198 ? -9.739  27.508  48.802  1.00 27.58  ? 226 LYS A CB    1 
ATOM   1405  C CG    . LYS A  1 198 ? -9.125  27.676  47.412  1.00 35.78  ? 226 LYS A CG    1 
ATOM   1406  N N     . LYS A  1 199 ? -12.175 26.689  46.682  1.00 25.33  ? 227 LYS A N     1 
ATOM   1407  C CA    . LYS A  1 199 ? -12.512 25.747  45.608  1.00 26.89  ? 227 LYS A CA    1 
ATOM   1408  C C     . LYS A  1 199 ? -11.380 24.776  45.347  1.00 26.68  ? 227 LYS A C     1 
ATOM   1409  O O     . LYS A  1 199 ? -10.213 25.188  45.258  1.00 28.53  ? 227 LYS A O     1 
ATOM   1410  C CB    . LYS A  1 199 ? -12.806 26.490  44.303  1.00 26.99  ? 227 LYS A CB    1 
ATOM   1411  C CG    . LYS A  1 199 ? -14.132 27.214  44.262  1.00 25.39  ? 227 LYS A CG    1 
ATOM   1412  C CD    . LYS A  1 199 ? -14.279 27.921  42.943  1.00 30.14  ? 227 LYS A CD    1 
ATOM   1413  C CE    . LYS A  1 199 ? -15.603 28.611  42.825  1.00 37.27  ? 227 LYS A CE    1 
ATOM   1414  N NZ    . LYS A  1 199 ? -15.632 29.408  41.573  1.00 32.11  ? 227 LYS A NZ    1 
ATOM   1415  N N     . GLU A  1 200 ? -11.699 23.489  45.204  1.00 27.17  ? 228 GLU A N     1 
ATOM   1416  C CA    . GLU A  1 200 ? -10.653 22.510  44.837  1.00 27.66  ? 228 GLU A CA    1 
ATOM   1417  C C     . GLU A  1 200 ? -10.252 22.703  43.372  1.00 27.53  ? 228 GLU A C     1 
ATOM   1418  O O     . GLU A  1 200 ? -11.076 23.107  42.532  1.00 28.15  ? 228 GLU A O     1 
ATOM   1419  C CB    . GLU A  1 200 ? -11.119 21.054  45.043  1.00 26.96  ? 228 GLU A CB    1 
ATOM   1420  C CG    . GLU A  1 200 ? -11.670 20.708  46.434  1.00 23.90  ? 228 GLU A CG    1 
ATOM   1421  C CD    . GLU A  1 200 ? -10.610 20.575  47.520  1.00 39.07  ? 228 GLU A CD    1 
ATOM   1422  O OE1   . GLU A  1 200 ? -9.394  20.636  47.204  1.00 31.78  ? 228 GLU A OE1   1 
ATOM   1423  O OE2   . GLU A  1 200 ? -11.003 20.410  48.702  1.00 41.87  ? 228 GLU A OE2   1 
ATOM   1424  N N     . ASP A  1 201 ? -8.979  22.432  43.097  1.00 24.92  ? 229 ASP A N     1 
ATOM   1425  C CA    . ASP A  1 201 ? -8.381  22.430  41.770  1.00 26.46  ? 229 ASP A CA    1 
ATOM   1426  C C     . ASP A  1 201 ? -8.349  20.968  41.277  1.00 23.95  ? 229 ASP A C     1 
ATOM   1427  O O     . ASP A  1 201 ? -7.528  20.175  41.723  1.00 28.55  ? 229 ASP A O     1 
ATOM   1428  C CB    . ASP A  1 201 ? -6.959  23.020  41.866  1.00 25.22  ? 229 ASP A CB    1 
ATOM   1429  C CG    . ASP A  1 201 ? -6.293  23.191  40.507  1.00 27.47  ? 229 ASP A CG    1 
ATOM   1430  O OD1   . ASP A  1 201 ? -6.985  23.086  39.474  1.00 33.98  ? 229 ASP A OD1   1 
ATOM   1431  O OD2   . ASP A  1 201 ? -5.065  23.432  40.467  1.00 40.18  ? 229 ASP A OD2   1 
ATOM   1432  N N     . LYS A  1 202 ? -9.281  20.623  40.391  1.00 27.69  ? 230 LYS A N     1 
ATOM   1433  C CA    . LYS A  1 202 ? -9.581  19.242  40.050  1.00 22.95  ? 230 LYS A CA    1 
ATOM   1434  C C     . LYS A  1 202 ? -9.036  18.831  38.674  1.00 26.28  ? 230 LYS A C     1 
ATOM   1435  O O     . LYS A  1 202 ? -8.825  19.677  37.794  1.00 24.85  ? 230 LYS A O     1 
ATOM   1436  C CB    . LYS A  1 202 ? -11.100 19.037  40.066  1.00 22.07  ? 230 LYS A CB    1 
ATOM   1437  C CG    . LYS A  1 202 ? -11.768 19.277  41.396  1.00 25.39  ? 230 LYS A CG    1 
ATOM   1438  C CD    . LYS A  1 202 ? -13.239 18.809  41.404  1.00 25.09  ? 230 LYS A CD    1 
ATOM   1439  C CE    . LYS A  1 202 ? -14.102 19.627  40.478  1.00 22.02  ? 230 LYS A CE    1 
ATOM   1440  N NZ    . LYS A  1 202 ? -14.334 21.039  40.900  1.00 27.70  ? 230 LYS A NZ    1 
ATOM   1441  N N     . LEU A  1 203 ? -8.807  17.521  38.518  1.00 24.50  ? 231 LEU A N     1 
ATOM   1442  C CA    . LEU A  1 203 ? -8.407  16.896  37.270  1.00 22.67  ? 231 LEU A CA    1 
ATOM   1443  C C     . LEU A  1 203 ? -9.441  17.137  36.157  1.00 22.87  ? 231 LEU A C     1 
ATOM   1444  O O     . LEU A  1 203 ? -9.096  17.428  35.030  1.00 21.20  ? 231 LEU A O     1 
ATOM   1445  C CB    . LEU A  1 203 ? -8.218  15.379  37.488  1.00 25.44  ? 231 LEU A CB    1 
ATOM   1446  C CG    . LEU A  1 203 ? -7.887  14.521  36.249  1.00 22.73  ? 231 LEU A CG    1 
ATOM   1447  C CD1   . LEU A  1 203 ? -6.594  15.030  35.625  1.00 19.99  ? 231 LEU A CD1   1 
ATOM   1448  C CD2   . LEU A  1 203 ? -7.750  13.030  36.604  1.00 20.64  ? 231 LEU A CD2   1 
ATOM   1449  N N     . GLY A  1 204 ? -10.704 17.044  36.522  1.00 22.51  ? 232 GLY A N     1 
ATOM   1450  C CA    . GLY A  1 204 ? -11.805 17.163  35.590  1.00 22.27  ? 232 GLY A CA    1 
ATOM   1451  C C     . GLY A  1 204 ? -13.029 17.670  36.316  1.00 20.70  ? 232 GLY A C     1 
ATOM   1452  O O     . GLY A  1 204 ? -12.932 18.156  37.452  1.00 20.86  ? 232 GLY A O     1 
ATOM   1453  N N     . ILE A  1 205 ? -14.184 17.528  35.665  1.00 21.90  ? 233 ILE A N     1 
ATOM   1454  C CA    . ILE A  1 205 ? -15.448 18.222  36.022  1.00 21.17  ? 233 ILE A CA    1 
ATOM   1455  C C     . ILE A  1 205 ? -15.259 19.642  36.640  1.00 24.42  ? 233 ILE A C     1 
ATOM   1456  O O     . ILE A  1 205 ? -15.891 20.017  37.643  1.00 23.86  ? 233 ILE A O     1 
ATOM   1457  C CB    . ILE A  1 205 ? -16.447 17.318  36.859  1.00 25.60  ? 233 ILE A CB    1 
ATOM   1458  C CG1   . ILE A  1 205 ? -15.823 16.866  38.188  1.00 28.68  ? 233 ILE A CG1   1 
ATOM   1459  C CG2   . ILE A  1 205 ? -16.952 16.103  36.010  1.00 18.18  ? 233 ILE A CG2   1 
ATOM   1460  C CD1   . ILE A  1 205 ? -16.827 16.517  39.221  1.00 16.52  ? 233 ILE A CD1   1 
ATOM   1461  N N     . ARG A  1 206 ? -14.452 20.459  35.973  1.00 22.83  ? 234 ARG A N     1 
ATOM   1462  C CA    . ARG A  1 206 ? -13.953 21.713  36.562  1.00 24.79  ? 234 ARG A CA    1 
ATOM   1463  C C     . ARG A  1 206 ? -14.945 22.862  36.628  1.00 28.30  ? 234 ARG A C     1 
ATOM   1464  O O     . ARG A  1 206 ? -14.696 23.833  37.329  1.00 29.45  ? 234 ARG A O     1 
ATOM   1465  C CB    . ARG A  1 206 ? -12.705 22.163  35.838  1.00 25.74  ? 234 ARG A CB    1 
ATOM   1466  C CG    . ARG A  1 206 ? -11.611 21.139  35.917  1.00 23.96  ? 234 ARG A CG    1 
ATOM   1467  C CD    . ARG A  1 206 ? -10.540 21.497  34.923  1.00 26.67  ? 234 ARG A CD    1 
ATOM   1468  N NE    . ARG A  1 206 ? -9.356  20.692  35.070  1.00 41.84  ? 234 ARG A NE    1 
ATOM   1469  C CZ    . ARG A  1 206 ? -8.306  20.769  34.264  1.00 52.23  ? 234 ARG A CZ    1 
ATOM   1470  N NH1   . ARG A  1 206 ? -8.305  21.632  33.262  1.00 48.90  ? 234 ARG A NH1   1 
ATOM   1471  N NH2   . ARG A  1 206 ? -7.264  19.965  34.452  1.00 52.16  ? 234 ARG A NH2   1 
ATOM   1472  N N     . GLY A  1 207 ? -16.056 22.745  35.903  1.00 24.75  ? 235 GLY A N     1 
ATOM   1473  C CA    . GLY A  1 207 ? -17.118 23.740  35.949  1.00 27.84  ? 235 GLY A CA    1 
ATOM   1474  C C     . GLY A  1 207 ? -17.935 23.649  37.211  1.00 28.91  ? 235 GLY A C     1 
ATOM   1475  O O     . GLY A  1 207 ? -18.608 24.614  37.590  1.00 29.31  ? 235 GLY A O     1 
ATOM   1476  N N     . SER A  1 208 ? -17.923 22.492  37.861  1.00 24.95  ? 236 SER A N     1 
ATOM   1477  C CA    . SER A  1 208 ? -18.613 22.362  39.138  1.00 27.65  ? 236 SER A CA    1 
ATOM   1478  C C     . SER A  1 208 ? -17.679 22.866  40.234  1.00 28.27  ? 236 SER A C     1 
ATOM   1479  O O     . SER A  1 208 ? -16.462 22.704  40.144  1.00 27.85  ? 236 SER A O     1 
ATOM   1480  C CB    . SER A  1 208 ? -19.081 20.906  39.403  1.00 31.78  ? 236 SER A CB    1 
ATOM   1481  O OG    . SER A  1 208 ? -17.993 19.992  39.602  1.00 20.89  ? 236 SER A OG    1 
ATOM   1482  N N     . SER A  1 209 ? -18.242 23.501  41.253  1.00 23.22  ? 237 SER A N     1 
ATOM   1483  C CA    . SER A  1 209 ? -17.445 23.894  42.412  1.00 24.90  ? 237 SER A CA    1 
ATOM   1484  C C     . SER A  1 209 ? -17.424 22.743  43.420  1.00 24.36  ? 237 SER A C     1 
ATOM   1485  O O     . SER A  1 209 ? -18.401 22.018  43.604  1.00 23.72  ? 237 SER A O     1 
ATOM   1486  C CB    . SER A  1 209 ? -17.934 25.191  43.067  1.00 25.07  ? 237 SER A CB    1 
ATOM   1487  O OG    . SER A  1 209 ? -19.170 25.016  43.740  1.00 26.08  ? 237 SER A OG    1 
ATOM   1488  N N     . THR A  1 210 ? -16.268 22.571  44.033  1.00 24.94  ? 238 THR A N     1 
ATOM   1489  C CA    . THR A  1 210 ? -16.098 21.619  45.118  1.00 27.20  ? 238 THR A CA    1 
ATOM   1490  C C     . THR A  1 210 ? -15.344 22.348  46.213  1.00 23.99  ? 238 THR A C     1 
ATOM   1491  O O     . THR A  1 210 ? -14.306 22.932  45.939  1.00 24.23  ? 238 THR A O     1 
ATOM   1492  C CB    . THR A  1 210 ? -15.237 20.418  44.690  1.00 27.48  ? 238 THR A CB    1 
ATOM   1493  O OG1   . THR A  1 210 ? -15.481 20.120  43.318  1.00 31.05  ? 238 THR A OG1   1 
ATOM   1494  C CG2   . THR A  1 210 ? -15.512 19.219  45.575  1.00 22.18  ? 238 THR A CG2   1 
ATOM   1495  N N     . ALA A  1 211 ? -15.858 22.311  47.437  1.00 24.25  ? 239 ALA A N     1 
ATOM   1496  C CA    . ALA A  1 211 ? -15.166 22.977  48.548  1.00 26.65  ? 239 ALA A CA    1 
ATOM   1497  C C     . ALA A  1 211 ? -15.685 22.543  49.911  1.00 25.13  ? 239 ALA A C     1 
ATOM   1498  O O     . ALA A  1 211 ? -16.723 21.883  50.005  1.00 25.50  ? 239 ALA A O     1 
ATOM   1499  C CB    . ALA A  1 211 ? -15.221 24.497  48.394  1.00 21.33  ? 239 ALA A CB    1 
ATOM   1500  N N     . ASN A  1 212 ? -14.923 22.879  50.959  1.00 29.19  ? 240 ASN A N     1 
ATOM   1501  C CA    . ASN A  1 212 ? -15.364 22.620  52.342  1.00 27.64  ? 240 ASN A CA    1 
ATOM   1502  C C     . ASN A  1 212 ? -16.461 23.574  52.776  1.00 25.28  ? 240 ASN A C     1 
ATOM   1503  O O     . ASN A  1 212 ? -16.416 24.753  52.422  1.00 23.34  ? 240 ASN A O     1 
ATOM   1504  C CB    . ASN A  1 212 ? -14.212 22.757  53.335  1.00 28.75  ? 240 ASN A CB    1 
ATOM   1505  C CG    . ASN A  1 212 ? -13.110 21.738  53.105  1.00 25.90  ? 240 ASN A CG    1 
ATOM   1506  O OD1   . ASN A  1 212 ? -13.274 20.783  52.345  1.00 27.84  ? 240 ASN A OD1   1 
ATOM   1507  N ND2   . ASN A  1 212 ? -12.005 21.913  53.797  1.00 30.34  ? 240 ASN A ND2   1 
ATOM   1508  N N     . LEU A  1 213 ? -17.436 23.039  53.515  1.00 21.52  ? 241 LEU A N     1 
ATOM   1509  C CA    . LEU A  1 213 ? -18.383 23.817  54.324  1.00 27.54  ? 241 LEU A CA    1 
ATOM   1510  C C     . LEU A  1 213 ? -17.919 23.775  55.795  1.00 27.58  ? 241 LEU A C     1 
ATOM   1511  O O     . LEU A  1 213 ? -17.899 22.689  56.424  1.00 25.12  ? 241 LEU A O     1 
ATOM   1512  C CB    . LEU A  1 213 ? -19.806 23.243  54.228  1.00 25.08  ? 241 LEU A CB    1 
ATOM   1513  C CG    . LEU A  1 213 ? -20.785 23.715  53.136  1.00 33.60  ? 241 LEU A CG    1 
ATOM   1514  C CD1   . LEU A  1 213 ? -20.251 23.538  51.724  1.00 28.84  ? 241 LEU A CD1   1 
ATOM   1515  C CD2   . LEU A  1 213 ? -22.089 22.967  53.260  1.00 29.87  ? 241 LEU A CD2   1 
ATOM   1516  N N     . ILE A  1 214 ? -17.541 24.943  56.322  1.00 23.63  ? 242 ILE A N     1 
ATOM   1517  C CA    . ILE A  1 214 ? -17.066 25.085  57.701  1.00 25.07  ? 242 ILE A CA    1 
ATOM   1518  C C     . ILE A  1 214 ? -18.117 25.724  58.596  1.00 23.07  ? 242 ILE A C     1 
ATOM   1519  O O     . ILE A  1 214 ? -18.508 26.880  58.389  1.00 24.47  ? 242 ILE A O     1 
ATOM   1520  C CB    . ILE A  1 214 ? -15.791 25.906  57.735  1.00 22.96  ? 242 ILE A CB    1 
ATOM   1521  C CG1   . ILE A  1 214 ? -14.783 25.336  56.714  1.00 26.94  ? 242 ILE A CG1   1 
ATOM   1522  C CG2   . ILE A  1 214 ? -15.224 25.941  59.188  1.00 28.68  ? 242 ILE A CG2   1 
ATOM   1523  C CD1   . ILE A  1 214 ? -13.962 26.365  55.990  1.00 27.31  ? 242 ILE A CD1   1 
ATOM   1524  N N     . PHE A  1 215 ? -18.591 24.935  59.561  1.00 23.03  ? 243 PHE A N     1 
ATOM   1525  C CA    . PHE A  1 215 ? -19.559 25.347  60.552  1.00 28.24  ? 243 PHE A CA    1 
ATOM   1526  C C     . PHE A  1 215 ? -18.828 25.655  61.859  1.00 26.56  ? 243 PHE A C     1 
ATOM   1527  O O     . PHE A  1 215 ? -18.092 24.819  62.388  1.00 26.38  ? 243 PHE A O     1 
ATOM   1528  C CB    . PHE A  1 215 ? -20.600 24.243  60.807  1.00 24.77  ? 243 PHE A CB    1 
ATOM   1529  C CG    . PHE A  1 215 ? -21.438 23.911  59.609  1.00 32.92  ? 243 PHE A CG    1 
ATOM   1530  C CD1   . PHE A  1 215 ? -22.644 24.590  59.365  1.00 30.07  ? 243 PHE A CD1   1 
ATOM   1531  C CD2   . PHE A  1 215 ? -21.039 22.918  58.724  1.00 28.93  ? 243 PHE A CD2   1 
ATOM   1532  C CE1   . PHE A  1 215 ? -23.432 24.283  58.271  1.00 33.57  ? 243 PHE A CE1   1 
ATOM   1533  C CE2   . PHE A  1 215 ? -21.816 22.599  57.619  1.00 27.97  ? 243 PHE A CE2   1 
ATOM   1534  C CZ    . PHE A  1 215 ? -23.012 23.286  57.372  1.00 30.59  ? 243 PHE A CZ    1 
ATOM   1535  N N     . GLU A  1 216 ? -19.042 26.859  62.365  1.00 28.48  ? 244 GLU A N     1 
ATOM   1536  C CA    . GLU A  1 216 ? -18.594 27.239  63.703  1.00 30.28  ? 244 GLU A CA    1 
ATOM   1537  C C     . GLU A  1 216 ? -19.742 27.949  64.416  1.00 30.56  ? 244 GLU A C     1 
ATOM   1538  O O     . GLU A  1 216 ? -20.203 28.990  63.968  1.00 31.88  ? 244 GLU A O     1 
ATOM   1539  C CB    . GLU A  1 216 ? -17.368 28.135  63.611  1.00 33.01  ? 244 GLU A CB    1 
ATOM   1540  C CG    . GLU A  1 216 ? -16.663 28.286  64.953  1.00 45.14  ? 244 GLU A CG    1 
ATOM   1541  C CD    . GLU A  1 216 ? -15.953 29.600  65.084  1.00 49.52  ? 244 GLU A CD    1 
ATOM   1542  O OE1   . GLU A  1 216 ? -15.252 29.976  64.116  1.00 61.13  ? 244 GLU A OE1   1 
ATOM   1543  O OE2   . GLU A  1 216 ? -16.103 30.250  66.149  1.00 56.50  ? 244 GLU A OE2   1 
ATOM   1544  N N     . ASP A  1 217 ? -20.224 27.328  65.492  1.00 30.84  ? 245 ASP A N     1 
ATOM   1545  C CA    . ASP A  1 217 ? -21.338 27.803  66.299  1.00 33.09  ? 245 ASP A CA    1 
ATOM   1546  C C     . ASP A  1 217 ? -22.536 28.171  65.429  1.00 32.22  ? 245 ASP A C     1 
ATOM   1547  O O     . ASP A  1 217 ? -23.145 29.201  65.616  1.00 28.70  ? 245 ASP A O     1 
ATOM   1548  C CB    . ASP A  1 217 ? -20.897 29.011  67.165  1.00 38.34  ? 245 ASP A CB    1 
ATOM   1549  C CG    . ASP A  1 217 ? -19.893 28.640  68.263  1.00 61.27  ? 245 ASP A CG    1 
ATOM   1550  O OD1   . ASP A  1 217 ? -19.342 27.515  68.256  1.00 69.84  ? 245 ASP A OD1   1 
ATOM   1551  O OD2   . ASP A  1 217 ? -19.652 29.498  69.145  1.00 87.15  ? 245 ASP A OD2   1 
ATOM   1552  N N     . CYS A  1 218 ? -22.871 27.319  64.466  1.00 31.25  ? 246 CYS A N     1 
ATOM   1553  C CA    . CYS A  1 218 ? -23.903 27.634  63.493  1.00 25.85  ? 246 CYS A CA    1 
ATOM   1554  C C     . CYS A  1 218 ? -25.290 27.183  63.968  1.00 28.65  ? 246 CYS A C     1 
ATOM   1555  O O     . CYS A  1 218 ? -25.604 25.989  63.992  1.00 26.16  ? 246 CYS A O     1 
ATOM   1556  C CB    . CYS A  1 218 ? -23.543 27.001  62.150  1.00 27.88  ? 246 CYS A CB    1 
ATOM   1557  S SG    . CYS A  1 218 ? -24.713 27.355  60.853  1.00 28.85  ? 246 CYS A SG    1 
ATOM   1558  N N     . ARG A  1 219 ? -26.120 28.159  64.334  1.00 26.51  ? 247 ARG A N     1 
ATOM   1559  C CA    . ARG A  1 219 ? -27.427 27.910  64.935  1.00 28.44  ? 247 ARG A CA    1 
ATOM   1560  C C     . ARG A  1 219 ? -28.501 27.914  63.852  1.00 28.70  ? 247 ARG A C     1 
ATOM   1561  O O     . ARG A  1 219 ? -28.581 28.851  63.052  1.00 30.06  ? 247 ARG A O     1 
ATOM   1562  C CB    . ARG A  1 219 ? -27.704 28.994  65.982  1.00 30.69  ? 247 ARG A CB    1 
ATOM   1563  C CG    . ARG A  1 219 ? -28.931 28.794  66.840  1.00 33.48  ? 247 ARG A CG    1 
ATOM   1564  C CD    . ARG A  1 219 ? -29.039 29.942  67.854  1.00 39.08  ? 247 ARG A CD    1 
ATOM   1565  N NE    . ARG A  1 219 ? -30.414 30.406  68.047  1.00 55.05  ? 247 ARG A NE    1 
ATOM   1566  C CZ    . ARG A  1 219 ? -31.201 30.106  69.084  1.00 68.08  ? 247 ARG A CZ    1 
ATOM   1567  N NH1   . ARG A  1 219 ? -30.785 29.304  70.070  1.00 80.45  ? 247 ARG A NH1   1 
ATOM   1568  N NH2   . ARG A  1 219 ? -32.437 30.602  69.127  1.00 56.39  ? 247 ARG A NH2   1 
ATOM   1569  N N     . ILE A  1 220 ? -29.320 26.862  63.826  1.00 26.37  ? 248 ILE A N     1 
ATOM   1570  C CA    . ILE A  1 220 ? -30.380 26.729  62.836  1.00 26.56  ? 248 ILE A CA    1 
ATOM   1571  C C     . ILE A  1 220 ? -31.600 26.325  63.623  1.00 23.44  ? 248 ILE A C     1 
ATOM   1572  O O     . ILE A  1 220 ? -31.467 25.735  64.686  1.00 25.93  ? 248 ILE A O     1 
ATOM   1573  C CB    . ILE A  1 220 ? -30.003 25.704  61.711  1.00 25.30  ? 248 ILE A CB    1 
ATOM   1574  C CG1   . ILE A  1 220 ? -29.786 24.290  62.307  1.00 29.62  ? 248 ILE A CG1   1 
ATOM   1575  C CG2   . ILE A  1 220 ? -28.723 26.205  60.945  1.00 25.09  ? 248 ILE A CG2   1 
ATOM   1576  C CD1   . ILE A  1 220 ? -29.332 23.206  61.282  1.00 27.88  ? 248 ILE A CD1   1 
ATOM   1577  N N     . PRO A  1 221 ? -32.785 26.721  63.155  1.00 26.48  ? 249 PRO A N     1 
ATOM   1578  C CA    . PRO A  1 221 ? -34.015 26.471  63.911  1.00 27.43  ? 249 PRO A CA    1 
ATOM   1579  C C     . PRO A  1 221 ? -34.413 25.004  64.054  1.00 29.07  ? 249 PRO A C     1 
ATOM   1580  O O     . PRO A  1 221 ? -33.947 24.153  63.292  1.00 26.86  ? 249 PRO A O     1 
ATOM   1581  C CB    . PRO A  1 221 ? -35.081 27.292  63.151  1.00 28.83  ? 249 PRO A CB    1 
ATOM   1582  C CG    . PRO A  1 221 ? -34.547 27.547  61.839  1.00 29.01  ? 249 PRO A CG    1 
ATOM   1583  C CD    . PRO A  1 221 ? -33.028 27.489  61.917  1.00 24.77  ? 249 PRO A CD    1 
ATOM   1584  N N     . LYS A  1 222 ? -35.258 24.701  65.039  1.00 31.11  ? 250 LYS A N     1 
ATOM   1585  C CA    . LYS A  1 222 ? -35.539 23.305  65.384  1.00 31.63  ? 250 LYS A CA    1 
ATOM   1586  C C     . LYS A  1 222 ? -36.143 22.479  64.247  1.00 29.43  ? 250 LYS A C     1 
ATOM   1587  O O     . LYS A  1 222 ? -35.806 21.297  64.105  1.00 28.58  ? 250 LYS A O     1 
ATOM   1588  C CB    . LYS A  1 222 ? -36.410 23.167  66.638  1.00 35.12  ? 250 LYS A CB    1 
ATOM   1589  C CG    . LYS A  1 222 ? -37.849 23.618  66.504  1.00 36.12  ? 250 LYS A CG    1 
ATOM   1590  C CD    . LYS A  1 222 ? -38.658 23.148  67.693  1.00 41.18  ? 250 LYS A CD    1 
ATOM   1591  C CE    . LYS A  1 222 ? -40.086 23.667  67.616  1.00 54.77  ? 250 LYS A CE    1 
ATOM   1592  N NZ    . LYS A  1 222 ? -40.856 23.447  68.876  1.00 68.93  ? 250 LYS A NZ    1 
ATOM   1593  N N     . ASP A  1 223 ? -36.980 23.096  63.410  1.00 27.67  ? 251 ASP A N     1 
ATOM   1594  C CA    . ASP A  1 223 ? -37.579 22.372  62.277  1.00 28.60  ? 251 ASP A CA    1 
ATOM   1595  C C     . ASP A  1 223 ? -36.673 22.218  61.053  1.00 29.01  ? 251 ASP A C     1 
ATOM   1596  O O     . ASP A  1 223 ? -37.157 21.893  59.984  1.00 32.05  ? 251 ASP A O     1 
ATOM   1597  C CB    . ASP A  1 223 ? -38.932 22.995  61.890  1.00 32.77  ? 251 ASP A CB    1 
ATOM   1598  C CG    . ASP A  1 223 ? -39.993 22.777  62.945  1.00 44.80  ? 251 ASP A CG    1 
ATOM   1599  O OD1   . ASP A  1 223 ? -39.781 21.920  63.828  1.00 54.61  ? 251 ASP A OD1   1 
ATOM   1600  O OD2   . ASP A  1 223 ? -41.049 23.450  62.898  1.00 54.53  ? 251 ASP A OD2   1 
ATOM   1601  N N     . SER A  1 224 ? -35.370 22.458  61.218  1.00 23.13  ? 252 SER A N     1 
ATOM   1602  C CA    . SER A  1 224 ? -34.373 22.247  60.181  1.00 28.17  ? 252 SER A CA    1 
ATOM   1603  C C     . SER A  1 224 ? -34.036 20.756  59.996  1.00 26.63  ? 252 SER A C     1 
ATOM   1604  O O     . SER A  1 224 ? -33.506 20.374  58.953  1.00 23.67  ? 252 SER A O     1 
ATOM   1605  C CB    . SER A  1 224 ? -33.082 22.985  60.533  1.00 27.33  ? 252 SER A CB    1 
ATOM   1606  O OG    . SER A  1 224 ? -33.281 24.363  60.790  1.00 29.08  ? 252 SER A OG    1 
ATOM   1607  N N     . ILE A  1 225 ? -34.338 19.937  61.014  1.00 26.92  ? 253 ILE A N     1 
ATOM   1608  C CA    . ILE A  1 225 ? -34.044 18.493  60.993  1.00 26.31  ? 253 ILE A CA    1 
ATOM   1609  C C     . ILE A  1 225 ? -34.966 17.779  60.006  1.00 27.07  ? 253 ILE A C     1 
ATOM   1610  O O     . ILE A  1 225 ? -36.193 17.948  60.036  1.00 25.79  ? 253 ILE A O     1 
ATOM   1611  C CB    . ILE A  1 225 ? -34.084 17.855  62.422  1.00 26.59  ? 253 ILE A CB    1 
ATOM   1612  C CG1   . ILE A  1 225 ? -33.463 16.440  62.424  1.00 26.17  ? 253 ILE A CG1   1 
ATOM   1613  C CG2   . ILE A  1 225 ? -35.492 17.813  62.997  1.00 22.13  ? 253 ILE A CG2   1 
ATOM   1614  C CD1   . ILE A  1 225 ? -33.461 15.783  63.780  1.00 28.34  ? 253 ILE A CD1   1 
ATOM   1615  N N     . LEU A  1 226 ? -34.347 17.023  59.094  1.00 26.80  ? 254 LEU A N     1 
ATOM   1616  C CA    . LEU A  1 226 ? -35.066 16.260  58.065  1.00 27.61  ? 254 LEU A CA    1 
ATOM   1617  C C     . LEU A  1 226 ? -35.270 14.828  58.569  1.00 26.03  ? 254 LEU A C     1 
ATOM   1618  O O     . LEU A  1 226 ? -34.323 14.086  58.732  1.00 25.06  ? 254 LEU A O     1 
ATOM   1619  C CB    . LEU A  1 226 ? -34.255 16.277  56.756  1.00 30.76  ? 254 LEU A CB    1 
ATOM   1620  C CG    . LEU A  1 226 ? -34.813 15.517  55.555  1.00 28.00  ? 254 LEU A CG    1 
ATOM   1621  C CD1   . LEU A  1 226 ? -36.172 16.086  55.191  1.00 28.11  ? 254 LEU A CD1   1 
ATOM   1622  C CD2   . LEU A  1 226 ? -33.840 15.611  54.376  1.00 27.61  ? 254 LEU A CD2   1 
ATOM   1623  N N     . GLY A  1 227 ? -36.506 14.429  58.836  1.00 28.31  ? 255 GLY A N     1 
ATOM   1624  C CA    . GLY A  1 227 ? -36.737 13.144  59.471  1.00 31.04  ? 255 GLY A CA    1 
ATOM   1625  C C     . GLY A  1 227 ? -36.421 13.197  60.966  1.00 33.27  ? 255 GLY A C     1 
ATOM   1626  O O     . GLY A  1 227 ? -36.266 14.276  61.552  1.00 28.96  ? 255 GLY A O     1 
ATOM   1627  N N     . GLU A  1 228 ? -36.322 12.025  61.582  1.00 36.17  ? 256 GLU A N     1 
ATOM   1628  C CA    . GLU A  1 228 ? -36.137 11.918  63.028  1.00 33.96  ? 256 GLU A CA    1 
ATOM   1629  C C     . GLU A  1 228 ? -34.661 11.955  63.432  1.00 34.67  ? 256 GLU A C     1 
ATOM   1630  O O     . GLU A  1 228 ? -33.780 11.609  62.646  1.00 28.13  ? 256 GLU A O     1 
ATOM   1631  C CB    . GLU A  1 228 ? -36.769 10.622  63.538  1.00 39.54  ? 256 GLU A CB    1 
ATOM   1632  C CG    . GLU A  1 228 ? -38.275 10.525  63.321  1.00 47.18  ? 256 GLU A CG    1 
ATOM   1633  C CD    . GLU A  1 228 ? -39.070 11.390  64.275  1.00 65.18  ? 256 GLU A CD    1 
ATOM   1634  O OE1   . GLU A  1 228 ? -38.484 11.914  65.249  1.00 71.70  ? 256 GLU A OE1   1 
ATOM   1635  O OE2   . GLU A  1 228 ? -40.290 11.541  64.051  1.00 75.25  ? 256 GLU A OE2   1 
ATOM   1636  N N     . PRO A  1 229 ? -34.381 12.355  64.675  1.00 34.12  ? 257 PRO A N     1 
ATOM   1637  C CA    . PRO A  1 229 ? -32.990 12.276  65.123  1.00 34.60  ? 257 PRO A CA    1 
ATOM   1638  C C     . PRO A  1 229 ? -32.457 10.832  65.054  1.00 29.19  ? 257 PRO A C     1 
ATOM   1639  O O     . PRO A  1 229 ? -33.181 9.893   65.372  1.00 28.51  ? 257 PRO A O     1 
ATOM   1640  C CB    . PRO A  1 229 ? -33.058 12.797  66.564  1.00 36.87  ? 257 PRO A CB    1 
ATOM   1641  C CG    . PRO A  1 229 ? -34.321 13.590  66.615  1.00 33.34  ? 257 PRO A CG    1 
ATOM   1642  C CD    . PRO A  1 229 ? -35.265 12.900  65.714  1.00 35.10  ? 257 PRO A CD    1 
ATOM   1643  N N     . GLY A  1 230 ? -31.233 10.663  64.574  1.00 30.01  ? 258 GLY A N     1 
ATOM   1644  C CA    . GLY A  1 230 ? -30.639 9.336   64.439  1.00 31.99  ? 258 GLY A CA    1 
ATOM   1645  C C     . GLY A  1 230 ? -30.843 8.656   63.082  1.00 32.18  ? 258 GLY A C     1 
ATOM   1646  O O     . GLY A  1 230 ? -30.121 7.712   62.767  1.00 31.70  ? 258 GLY A O     1 
ATOM   1647  N N     . MET A  1 231 ? -31.804 9.151   62.287  1.00 27.14  ? 259 MET A N     1 
ATOM   1648  C CA    . MET A  1 231 ? -32.073 8.683   60.898  1.00 31.07  ? 259 MET A CA    1 
ATOM   1649  C C     . MET A  1 231 ? -31.052 9.107   59.827  1.00 27.51  ? 259 MET A C     1 
ATOM   1650  O O     . MET A  1 231 ? -31.134 8.673   58.682  1.00 30.94  ? 259 MET A O     1 
ATOM   1651  C CB    . MET A  1 231 ? -33.421 9.226   60.416  1.00 32.00  ? 259 MET A CB    1 
ATOM   1652  C CG    . MET A  1 231 ? -34.654 8.532   60.954  1.00 39.28  ? 259 MET A CG    1 
ATOM   1653  S SD    . MET A  1 231 ? -36.157 9.088   60.084  1.00 48.98  ? 259 MET A SD    1 
ATOM   1654  C CE    . MET A  1 231 ? -35.739 8.797   58.355  1.00 42.72  ? 259 MET A CE    1 
ATOM   1655  N N     . GLY A  1 232 ? -30.115 9.973   60.174  1.00 24.88  ? 260 GLY A N     1 
ATOM   1656  C CA    . GLY A  1 232 ? -29.187 10.533  59.195  1.00 26.90  ? 260 GLY A CA    1 
ATOM   1657  C C     . GLY A  1 232 ? -28.391 9.571   58.337  1.00 27.62  ? 260 GLY A C     1 
ATOM   1658  O O     . GLY A  1 232 ? -28.124 9.851   57.162  1.00 22.10  ? 260 GLY A O     1 
ATOM   1659  N N     . PHE A  1 233 ? -27.948 8.464   58.912  1.00 28.43  ? 261 PHE A N     1 
ATOM   1660  C CA    . PHE A  1 233 ? -27.141 7.514   58.139  1.00 28.14  ? 261 PHE A CA    1 
ATOM   1661  C C     . PHE A  1 233 ? -28.029 6.809   57.094  1.00 27.12  ? 261 PHE A C     1 
ATOM   1662  O O     . PHE A  1 233 ? -27.638 6.656   55.933  1.00 26.36  ? 261 PHE A O     1 
ATOM   1663  C CB    . PHE A  1 233 ? -26.396 6.518   59.041  1.00 29.57  ? 261 PHE A CB    1 
ATOM   1664  C CG    . PHE A  1 233 ? -25.463 5.600   58.280  1.00 26.58  ? 261 PHE A CG    1 
ATOM   1665  C CD1   . PHE A  1 233 ? -24.148 5.972   58.040  1.00 40.85  ? 261 PHE A CD1   1 
ATOM   1666  C CD2   . PHE A  1 233 ? -25.921 4.385   57.785  1.00 31.70  ? 261 PHE A CD2   1 
ATOM   1667  C CE1   . PHE A  1 233 ? -23.289 5.142   57.336  1.00 41.68  ? 261 PHE A CE1   1 
ATOM   1668  C CE2   . PHE A  1 233 ? -25.076 3.541   57.080  1.00 37.30  ? 261 PHE A CE2   1 
ATOM   1669  C CZ    . PHE A  1 233 ? -23.750 3.919   56.857  1.00 39.25  ? 261 PHE A CZ    1 
ATOM   1670  N N     . LYS A  1 234 ? -29.226 6.421   57.505  1.00 24.90  ? 262 LYS A N     1 
ATOM   1671  C CA    . LYS A  1 234 ? -30.190 5.833   56.599  1.00 29.64  ? 262 LYS A CA    1 
ATOM   1672  C C     . LYS A  1 234 ? -30.610 6.799   55.469  1.00 28.49  ? 262 LYS A C     1 
ATOM   1673  O O     . LYS A  1 234 ? -30.765 6.392   54.313  1.00 24.63  ? 262 LYS A O     1 
ATOM   1674  C CB    . LYS A  1 234 ? -31.430 5.384   57.371  1.00 30.28  ? 262 LYS A CB    1 
ATOM   1675  C CG    . LYS A  1 234 ? -32.509 4.773   56.478  1.00 44.52  ? 262 LYS A CG    1 
ATOM   1676  C CD    . LYS A  1 234 ? -33.747 4.312   57.256  1.00 47.11  ? 262 LYS A CD    1 
ATOM   1677  C CE    . LYS A  1 234 ? -34.580 5.481   57.760  1.00 55.33  ? 262 LYS A CE    1 
ATOM   1678  N NZ    . LYS A  1 234 ? -35.930 5.010   58.220  1.00 59.05  ? 262 LYS A NZ    1 
ATOM   1679  N N     . ILE A  1 235 ? -30.842 8.065   55.812  1.00 28.48  ? 263 ILE A N     1 
ATOM   1680  C CA    . ILE A  1 235 ? -31.297 9.042   54.822  1.00 24.47  ? 263 ILE A CA    1 
ATOM   1681  C C     . ILE A  1 235 ? -30.161 9.206   53.817  1.00 23.78  ? 263 ILE A C     1 
ATOM   1682  O O     . ILE A  1 235 ? -30.375 9.194   52.616  1.00 27.57  ? 263 ILE A O     1 
ATOM   1683  C CB    . ILE A  1 235 ? -31.705 10.375  55.493  1.00 24.26  ? 263 ILE A CB    1 
ATOM   1684  C CG1   . ILE A  1 235 ? -32.987 10.180  56.297  1.00 27.71  ? 263 ILE A CG1   1 
ATOM   1685  C CG2   . ILE A  1 235 ? -31.841 11.518  54.465  1.00 18.39  ? 263 ILE A CG2   1 
ATOM   1686  C CD1   . ILE A  1 235 ? -33.248 11.302  57.288  1.00 26.41  ? 263 ILE A CD1   1 
ATOM   1687  N N     . ALA A  1 236 ? -28.940 9.265   54.321  1.00 23.50  ? 264 ALA A N     1 
ATOM   1688  C CA    . ALA A  1 236 ? -27.768 9.462   53.491  1.00 23.98  ? 264 ALA A CA    1 
ATOM   1689  C C     . ALA A  1 236 ? -27.541 8.306   52.503  1.00 28.34  ? 264 ALA A C     1 
ATOM   1690  O O     . ALA A  1 236 ? -27.258 8.551   51.325  1.00 21.87  ? 264 ALA A O     1 
ATOM   1691  C CB    . ALA A  1 236 ? -26.559 9.634   54.371  1.00 23.68  ? 264 ALA A CB    1 
ATOM   1692  N N     . MET A  1 237 ? -27.638 7.068   53.004  1.00 27.67  ? 265 MET A N     1 
ATOM   1693  C CA    . MET A  1 237 ? -27.457 5.867   52.184  1.00 31.87  ? 265 MET A CA    1 
ATOM   1694  C C     . MET A  1 237 ? -28.540 5.692   51.098  1.00 25.12  ? 265 MET A C     1 
ATOM   1695  O O     . MET A  1 237 ? -28.216 5.376   49.952  1.00 21.36  ? 265 MET A O     1 
ATOM   1696  C CB    . MET A  1 237 ? -27.397 4.607   53.053  1.00 29.49  ? 265 MET A CB    1 
ATOM   1697  C CG    . MET A  1 237 ? -26.183 4.521   53.962  1.00 34.13  ? 265 MET A CG    1 
ATOM   1698  S SD    . MET A  1 237 ? -24.595 4.752   53.136  1.00 38.75  ? 265 MET A SD    1 
ATOM   1699  C CE    . MET A  1 237 ? -24.052 6.355   53.751  1.00 36.00  ? 265 MET A CE    1 
ATOM   1700  N N     . GLN A  1 238 ? -29.797 5.891   51.470  1.00 24.15  ? 266 GLN A N     1 
ATOM   1701  C CA    . GLN A  1 238 ? -30.895 5.815   50.532  1.00 26.13  ? 266 GLN A CA    1 
ATOM   1702  C C     . GLN A  1 238 ? -30.857 6.958   49.525  1.00 25.53  ? 266 GLN A C     1 
ATOM   1703  O O     . GLN A  1 238 ? -31.280 6.784   48.373  1.00 24.49  ? 266 GLN A O     1 
ATOM   1704  C CB    . GLN A  1 238 ? -32.248 5.789   51.244  1.00 25.77  ? 266 GLN A CB    1 
ATOM   1705  C CG    . GLN A  1 238 ? -32.527 4.506   51.997  1.00 31.84  ? 266 GLN A CG    1 
ATOM   1706  C CD    . GLN A  1 238 ? -33.808 4.559   52.786  1.00 33.85  ? 266 GLN A CD    1 
ATOM   1707  O OE1   . GLN A  1 238 ? -34.793 5.165   52.369  1.00 42.41  ? 266 GLN A OE1   1 
ATOM   1708  N NE2   . GLN A  1 238 ? -33.817 3.896   53.931  1.00 51.70  ? 266 GLN A NE2   1 
ATOM   1709  N N     . THR A  1 239 ? -30.322 8.105   49.937  1.00 25.88  ? 267 THR A N     1 
ATOM   1710  C CA    . THR A  1 239 ? -30.107 9.192   49.002  1.00 28.33  ? 267 THR A CA    1 
ATOM   1711  C C     . THR A  1 239 ? -29.020 8.825   47.989  1.00 23.62  ? 267 THR A C     1 
ATOM   1712  O O     . THR A  1 239 ? -29.200 9.040   46.787  1.00 18.67  ? 267 THR A O     1 
ATOM   1713  C CB    . THR A  1 239 ? -29.805 10.542  49.707  1.00 27.56  ? 267 THR A CB    1 
ATOM   1714  O OG1   . THR A  1 239 ? -30.887 10.854  50.594  1.00 25.47  ? 267 THR A OG1   1 
ATOM   1715  C CG2   . THR A  1 239 ? -29.657 11.672  48.702  1.00 25.36  ? 267 THR A CG2   1 
ATOM   1716  N N     . LEU A  1 240 ? -27.909 8.258   48.460  1.00 25.98  ? 268 LEU A N     1 
ATOM   1717  C CA    . LEU A  1 240 ? -26.846 7.848   47.557  1.00 26.83  ? 268 LEU A CA    1 
ATOM   1718  C C     . LEU A  1 240 ? -27.274 6.744   46.564  1.00 24.34  ? 268 LEU A C     1 
ATOM   1719  O O     . LEU A  1 240 ? -26.720 6.656   45.481  1.00 24.44  ? 268 LEU A O     1 
ATOM   1720  C CB    . LEU A  1 240 ? -25.615 7.410   48.343  1.00 25.95  ? 268 LEU A CB    1 
ATOM   1721  C CG    . LEU A  1 240 ? -24.851 8.560   49.015  1.00 30.56  ? 268 LEU A CG    1 
ATOM   1722  C CD1   . LEU A  1 240 ? -23.997 8.018   50.141  1.00 29.14  ? 268 LEU A CD1   1 
ATOM   1723  C CD2   . LEU A  1 240 ? -24.020 9.368   48.010  1.00 32.68  ? 268 LEU A CD2   1 
ATOM   1724  N N     . ASP A  1 241 ? -28.234 5.905   46.945  1.00 27.35  ? 269 ASP A N     1 
ATOM   1725  C CA    . ASP A  1 241 ? -28.760 4.860   46.049  1.00 28.12  ? 269 ASP A CA    1 
ATOM   1726  C C     . ASP A  1 241 ? -29.337 5.492   44.782  1.00 28.26  ? 269 ASP A C     1 
ATOM   1727  O O     . ASP A  1 241 ? -29.085 5.028   43.674  1.00 24.57  ? 269 ASP A O     1 
ATOM   1728  C CB    . ASP A  1 241 ? -29.853 4.024   46.730  1.00 24.49  ? 269 ASP A CB    1 
ATOM   1729  C CG    . ASP A  1 241 ? -29.331 3.159   47.897  1.00 38.05  ? 269 ASP A CG    1 
ATOM   1730  O OD1   . ASP A  1 241 ? -28.193 2.650   47.849  1.00 36.43  ? 269 ASP A OD1   1 
ATOM   1731  O OD2   . ASP A  1 241 ? -30.090 2.967   48.878  1.00 39.76  ? 269 ASP A OD2   1 
ATOM   1732  N N     . MET A  1 242 ? -30.132 6.539   44.969  1.00 25.54  ? 270 MET A N     1 
ATOM   1733  C CA    . MET A  1 242 ? -30.664 7.343   43.866  1.00 30.48  ? 270 MET A CA    1 
ATOM   1734  C C     . MET A  1 242 ? -29.579 8.121   43.119  1.00 26.57  ? 270 MET A C     1 
ATOM   1735  O O     . MET A  1 242 ? -29.560 8.176   41.899  1.00 27.26  ? 270 MET A O     1 
ATOM   1736  C CB    . MET A  1 242 ? -31.692 8.334   44.403  1.00 31.88  ? 270 MET A CB    1 
ATOM   1737  C CG    . MET A  1 242 ? -32.783 7.706   45.219  1.00 38.63  ? 270 MET A CG    1 
ATOM   1738  S SD    . MET A  1 242 ? -34.053 8.893   45.665  1.00 41.15  ? 270 MET A SD    1 
ATOM   1739  C CE    . MET A  1 242 ? -33.332 9.766   47.045  1.00 32.21  ? 270 MET A CE    1 
ATOM   1740  N N     . GLY A  1 243 ? -28.695 8.752   43.875  1.00 25.43  ? 271 GLY A N     1 
ATOM   1741  C CA    . GLY A  1 243 ? -27.601 9.514   43.313  1.00 24.41  ? 271 GLY A CA    1 
ATOM   1742  C C     . GLY A  1 243 ? -26.778 8.675   42.364  1.00 25.09  ? 271 GLY A C     1 
ATOM   1743  O O     . GLY A  1 243 ? -26.331 9.163   41.338  1.00 23.46  ? 271 GLY A O     1 
ATOM   1744  N N     . ARG A  1 244 ? -26.568 7.412   42.737  1.00 24.18  ? 272 ARG A N     1 
ATOM   1745  C CA    . ARG A  1 244 ? -25.830 6.479   41.926  1.00 22.82  ? 272 ARG A CA    1 
ATOM   1746  C C     . ARG A  1 244 ? -26.455 6.245   40.540  1.00 20.83  ? 272 ARG A C     1 
ATOM   1747  O O     . ARG A  1 244 ? -25.741 6.005   39.574  1.00 22.55  ? 272 ARG A O     1 
ATOM   1748  C CB    . ARG A  1 244 ? -25.657 5.155   42.683  1.00 22.87  ? 272 ARG A CB    1 
ATOM   1749  C CG    . ARG A  1 244 ? -24.521 5.223   43.672  1.00 29.32  ? 272 ARG A CG    1 
ATOM   1750  C CD    . ARG A  1 244 ? -24.648 4.214   44.804  1.00 27.60  ? 272 ARG A CD    1 
ATOM   1751  N NE    . ARG A  1 244 ? -23.668 4.524   45.848  1.00 31.56  ? 272 ARG A NE    1 
ATOM   1752  C CZ    . ARG A  1 244 ? -23.502 3.811   46.957  1.00 35.18  ? 272 ARG A CZ    1 
ATOM   1753  N NH1   . ARG A  1 244 ? -24.262 2.757   47.191  1.00 27.60  ? 272 ARG A NH1   1 
ATOM   1754  N NH2   . ARG A  1 244 ? -22.561 4.167   47.833  1.00 33.72  ? 272 ARG A NH2   1 
ATOM   1755  N N     . ILE A  1 245 ? -27.774 6.332   40.439  1.00 21.41  ? 273 ILE A N     1 
ATOM   1756  C CA    . ILE A  1 245 ? -28.409 6.216   39.135  1.00 24.64  ? 273 ILE A CA    1 
ATOM   1757  C C     . ILE A  1 245 ? -28.083 7.455   38.277  1.00 27.87  ? 273 ILE A C     1 
ATOM   1758  O O     . ILE A  1 245 ? -27.827 7.328   37.076  1.00 23.27  ? 273 ILE A O     1 
ATOM   1759  C CB    . ILE A  1 245 ? -29.938 6.007   39.234  1.00 22.79  ? 273 ILE A CB    1 
ATOM   1760  C CG1   . ILE A  1 245 ? -30.260 4.685   39.944  1.00 25.79  ? 273 ILE A CG1   1 
ATOM   1761  C CG2   . ILE A  1 245 ? -30.544 6.032   37.826  1.00 27.31  ? 273 ILE A CG2   1 
ATOM   1762  C CD1   . ILE A  1 245 ? -31.625 4.624   40.576  1.00 23.82  ? 273 ILE A CD1   1 
ATOM   1763  N N     . GLY A  1 246 ? -28.080 8.633   38.916  1.00 27.72  ? 274 GLY A N     1 
ATOM   1764  C CA    . GLY A  1 246 ? -27.651 9.875   38.282  1.00 25.31  ? 274 GLY A CA    1 
ATOM   1765  C C     . GLY A  1 246 ? -26.211 9.814   37.820  1.00 23.66  ? 274 GLY A C     1 
ATOM   1766  O O     . GLY A  1 246 ? -25.896 10.190  36.688  1.00 25.25  ? 274 GLY A O     1 
ATOM   1767  N N     . ILE A  1 247 ? -25.326 9.342   38.689  1.00 22.72  ? 275 ILE A N     1 
ATOM   1768  C CA    . ILE A  1 247 ? -23.899 9.285   38.339  1.00 21.30  ? 275 ILE A CA    1 
ATOM   1769  C C     . ILE A  1 247 ? -23.628 8.256   37.240  1.00 18.21  ? 275 ILE A C     1 
ATOM   1770  O O     . ILE A  1 247 ? -22.836 8.529   36.332  1.00 23.13  ? 275 ILE A O     1 
ATOM   1771  C CB    . ILE A  1 247 ? -22.996 9.075   39.582  1.00 21.26  ? 275 ILE A CB    1 
ATOM   1772  C CG1   . ILE A  1 247 ? -23.154 10.263  40.548  1.00 27.25  ? 275 ILE A CG1   1 
ATOM   1773  C CG2   . ILE A  1 247 ? -21.525 8.912   39.174  1.00 17.89  ? 275 ILE A CG2   1 
ATOM   1774  C CD1   . ILE A  1 247 ? -23.028 11.668  39.883  1.00 24.65  ? 275 ILE A CD1   1 
ATOM   1775  N N     . ALA A  1 248 ? -24.293 7.103   37.306  1.00 22.73  ? 276 ALA A N     1 
ATOM   1776  C CA    . ALA A  1 248 ? -24.248 6.126   36.210  1.00 23.25  ? 276 ALA A CA    1 
ATOM   1777  C C     . ALA A  1 248 ? -24.671 6.768   34.875  1.00 21.49  ? 276 ALA A C     1 
ATOM   1778  O O     . ALA A  1 248 ? -24.016 6.562   33.864  1.00 21.10  ? 276 ALA A O     1 
ATOM   1779  C CB    . ALA A  1 248 ? -25.091 4.872   36.528  1.00 15.32  ? 276 ALA A CB    1 
ATOM   1780  N N     . SER A  1 249 ? -25.722 7.594   34.891  1.00 22.61  ? 277 SER A N     1 
ATOM   1781  C CA    . SER A  1 249 ? -26.170 8.274   33.674  1.00 20.26  ? 277 SER A CA    1 
ATOM   1782  C C     . SER A  1 249 ? -25.161 9.316   33.193  1.00 22.11  ? 277 SER A C     1 
ATOM   1783  O O     . SER A  1 249 ? -24.930 9.473   31.973  1.00 20.12  ? 277 SER A O     1 
ATOM   1784  C CB    . SER A  1 249 ? -27.535 8.890   33.880  1.00 25.18  ? 277 SER A CB    1 
ATOM   1785  O OG    . SER A  1 249 ? -28.459 7.895   34.273  1.00 23.73  ? 277 SER A OG    1 
ATOM   1786  N N     . GLN A  1 250 ? -24.564 10.031  34.146  1.00 17.66  ? 278 GLN A N     1 
ATOM   1787  C CA    . GLN A  1 250 ? -23.508 10.957  33.814  1.00 21.47  ? 278 GLN A CA    1 
ATOM   1788  C C     . GLN A  1 250 ? -22.395 10.230  33.078  1.00 21.43  ? 278 GLN A C     1 
ATOM   1789  O O     . GLN A  1 250 ? -21.941 10.690  32.028  1.00 22.99  ? 278 GLN A O     1 
ATOM   1790  C CB    . GLN A  1 250 ? -22.948 11.672  35.048  1.00 23.87  ? 278 GLN A CB    1 
ATOM   1791  C CG    . GLN A  1 250 ? -21.791 12.626  34.694  1.00 22.62  ? 278 GLN A CG    1 
ATOM   1792  C CD    . GLN A  1 250 ? -20.859 12.972  35.868  1.00 31.15  ? 278 GLN A CD    1 
ATOM   1793  O OE1   . GLN A  1 250 ? -20.765 12.242  36.863  1.00 26.17  ? 278 GLN A OE1   1 
ATOM   1794  N NE2   . GLN A  1 250 ? -20.140 14.082  35.725  1.00 24.82  ? 278 GLN A NE2   1 
ATOM   1795  N N     . ALA A  1 251 ? -21.933 9.117   33.657  1.00 21.91  ? 279 ALA A N     1 
ATOM   1796  C CA    . ALA A  1 251 ? -20.862 8.316   33.079  1.00 17.72  ? 279 ALA A CA    1 
ATOM   1797  C C     . ALA A  1 251 ? -21.214 7.753   31.673  1.00 16.84  ? 279 ALA A C     1 
ATOM   1798  O O     . ALA A  1 251 ? -20.367 7.716   30.793  1.00 18.33  ? 279 ALA A O     1 
ATOM   1799  C CB    . ALA A  1 251 ? -20.440 7.187   34.045  1.00 15.08  ? 279 ALA A CB    1 
ATOM   1800  N N     . LEU A  1 252 ? -22.463 7.358   31.452  1.00 19.76  ? 280 LEU A N     1 
ATOM   1801  C CA    . LEU A  1 252 ? -22.898 6.960   30.097  1.00 23.26  ? 280 LEU A CA    1 
ATOM   1802  C C     . LEU A  1 252 ? -22.726 8.080   29.068  1.00 20.09  ? 280 LEU A C     1 
ATOM   1803  O O     . LEU A  1 252 ? -22.342 7.825   27.920  1.00 17.19  ? 280 LEU A O     1 
ATOM   1804  C CB    . LEU A  1 252 ? -24.360 6.508   30.085  1.00 24.52  ? 280 LEU A CB    1 
ATOM   1805  C CG    . LEU A  1 252 ? -24.740 5.316   30.970  1.00 30.26  ? 280 LEU A CG    1 
ATOM   1806  C CD1   . LEU A  1 252 ? -26.237 5.254   31.132  1.00 22.60  ? 280 LEU A CD1   1 
ATOM   1807  C CD2   . LEU A  1 252 ? -24.194 4.026   30.395  1.00 23.09  ? 280 LEU A CD2   1 
ATOM   1808  N N     . GLY A  1 253 ? -23.062 9.304   29.485  1.00 21.20  ? 281 GLY A N     1 
ATOM   1809  C CA    . GLY A  1 253 ? -22.932 10.474  28.656  1.00 21.47  ? 281 GLY A CA    1 
ATOM   1810  C C     . GLY A  1 253 ? -21.497 10.743  28.268  1.00 20.59  ? 281 GLY A C     1 
ATOM   1811  O O     . GLY A  1 253 ? -21.219 11.046  27.091  1.00 23.48  ? 281 GLY A O     1 
ATOM   1812  N N     . ILE A  1 254 ? -20.591 10.622  29.245  1.00 20.54  ? 282 ILE A N     1 
ATOM   1813  C CA    . ILE A  1 254 ? -19.143 10.780  29.005  1.00 22.88  ? 282 ILE A CA    1 
ATOM   1814  C C     . ILE A  1 254 ? -18.603 9.688   28.060  1.00 23.84  ? 282 ILE A C     1 
ATOM   1815  O O     . ILE A  1 254 ? -17.881 9.984   27.095  1.00 18.97  ? 282 ILE A O     1 
ATOM   1816  C CB    . ILE A  1 254 ? -18.322 10.795  30.339  1.00 22.51  ? 282 ILE A CB    1 
ATOM   1817  C CG1   . ILE A  1 254 ? -18.701 12.022  31.184  1.00 25.12  ? 282 ILE A CG1   1 
ATOM   1818  C CG2   . ILE A  1 254 ? -16.832 10.834  30.058  1.00 20.23  ? 282 ILE A CG2   1 
ATOM   1819  C CD1   . ILE A  1 254 ? -18.407 11.916  32.696  1.00 21.05  ? 282 ILE A CD1   1 
ATOM   1820  N N     . ALA A  1 255 ? -18.954 8.435   28.350  1.00 24.76  ? 283 ALA A N     1 
ATOM   1821  C CA    . ALA A  1 255 ? -18.639 7.303   27.468  1.00 26.25  ? 283 ALA A CA    1 
ATOM   1822  C C     . ALA A  1 255 ? -19.220 7.473   26.054  1.00 18.88  ? 283 ALA A C     1 
ATOM   1823  O O     . ALA A  1 255 ? -18.564 7.197   25.091  1.00 17.19  ? 283 ALA A O     1 
ATOM   1824  C CB    . ALA A  1 255 ? -19.161 6.021   28.088  1.00 22.32  ? 283 ALA A CB    1 
ATOM   1825  N N     . GLN A  1 256 ? -20.483 7.878   25.940  1.00 19.72  ? 284 GLN A N     1 
ATOM   1826  C CA    . GLN A  1 256 ? -21.081 8.057   24.620  1.00 21.16  ? 284 GLN A CA    1 
ATOM   1827  C C     . GLN A  1 256 ? -20.375 9.118   23.766  1.00 23.37  ? 284 GLN A C     1 
ATOM   1828  O O     . GLN A  1 256 ? -20.078 8.870   22.601  1.00 20.48  ? 284 GLN A O     1 
ATOM   1829  C CB    . GLN A  1 256 ? -22.579 8.341   24.702  1.00 22.90  ? 284 GLN A CB    1 
ATOM   1830  C CG    . GLN A  1 256 ? -23.233 8.408   23.323  1.00 28.43  ? 284 GLN A CG    1 
ATOM   1831  C CD    . GLN A  1 256 ? -23.432 7.038   22.667  1.00 31.66  ? 284 GLN A CD    1 
ATOM   1832  O OE1   . GLN A  1 256 ? -24.290 6.273   23.084  1.00 30.58  ? 284 GLN A OE1   1 
ATOM   1833  N NE2   . GLN A  1 256 ? -22.675 6.757   21.618  1.00 19.46  ? 284 GLN A NE2   1 
ATOM   1834  N N     . THR A  1 257 ? -20.053 10.276  24.346  1.00 24.99  ? 285 THR A N     1 
ATOM   1835  C CA    . THR A  1 257 ? -19.387 11.328  23.564  1.00 24.29  ? 285 THR A CA    1 
ATOM   1836  C C     . THR A  1 257 ? -17.961 10.927  23.203  1.00 19.44  ? 285 THR A C     1 
ATOM   1837  O O     . THR A  1 257 ? -17.472 11.219  22.099  1.00 22.25  ? 285 THR A O     1 
ATOM   1838  C CB    . THR A  1 257 ? -19.428 12.717  24.258  1.00 27.29  ? 285 THR A CB    1 
ATOM   1839  O OG1   . THR A  1 257 ? -19.055 13.722  23.301  1.00 27.29  ? 285 THR A OG1   1 
ATOM   1840  C CG2   . THR A  1 257 ? -18.479 12.765  25.477  1.00 22.31  ? 285 THR A CG2   1 
ATOM   1841  N N     . ALA A  1 258 ? -17.308 10.209  24.108  1.00 22.39  ? 286 ALA A N     1 
ATOM   1842  C CA    . ALA A  1 258 ? -15.965 9.661   23.825  1.00 20.08  ? 286 ALA A CA    1 
ATOM   1843  C C     . ALA A  1 258 ? -15.979 8.663   22.644  1.00 19.58  ? 286 ALA A C     1 
ATOM   1844  O O     . ALA A  1 258 ? -15.079 8.662   21.818  1.00 19.21  ? 286 ALA A O     1 
ATOM   1845  C CB    . ALA A  1 258 ? -15.395 8.997   25.072  1.00 18.33  ? 286 ALA A CB    1 
ATOM   1846  N N     . LEU A  1 259 ? -16.999 7.803   22.607  1.00 25.59  ? 287 LEU A N     1 
ATOM   1847  C CA    . LEU A  1 259 ? -17.200 6.840   21.535  1.00 24.40  ? 287 LEU A CA    1 
ATOM   1848  C C     . LEU A  1 259 ? -17.562 7.546   20.209  1.00 24.93  ? 287 LEU A C     1 
ATOM   1849  O O     . LEU A  1 259 ? -16.958 7.249   19.185  1.00 19.53  ? 287 LEU A O     1 
ATOM   1850  C CB    . LEU A  1 259 ? -18.292 5.819   21.917  1.00 21.43  ? 287 LEU A CB    1 
ATOM   1851  C CG    . LEU A  1 259 ? -18.707 4.776   20.852  1.00 23.71  ? 287 LEU A CG    1 
ATOM   1852  C CD1   . LEU A  1 259 ? -17.496 3.980   20.351  1.00 18.49  ? 287 LEU A CD1   1 
ATOM   1853  C CD2   . LEU A  1 259 ? -19.793 3.855   21.404  1.00 23.01  ? 287 LEU A CD2   1 
ATOM   1854  N N     . ASP A  1 260 ? -18.558 8.449   20.234  1.00 23.67  ? 288 ASP A N     1 
ATOM   1855  C CA    . ASP A  1 260 ? -18.847 9.309   19.052  1.00 25.89  ? 288 ASP A CA    1 
ATOM   1856  C C     . ASP A  1 260 ? -17.553 9.935   18.478  1.00 25.40  ? 288 ASP A C     1 
ATOM   1857  O O     . ASP A  1 260 ? -17.273 9.903   17.272  1.00 24.98  ? 288 ASP A O     1 
ATOM   1858  C CB    . ASP A  1 260 ? -19.814 10.439  19.408  1.00 26.33  ? 288 ASP A CB    1 
ATOM   1859  C CG    . ASP A  1 260 ? -21.130 9.941   19.961  1.00 28.28  ? 288 ASP A CG    1 
ATOM   1860  O OD1   . ASP A  1 260 ? -21.508 8.777   19.695  1.00 30.10  ? 288 ASP A OD1   1 
ATOM   1861  O OD2   . ASP A  1 260 ? -21.782 10.716  20.688  1.00 32.99  ? 288 ASP A OD2   1 
ATOM   1862  N N     . CYS A  1 261 ? -16.757 10.494  19.370  1.00 28.88  ? 289 CYS A N     1 
ATOM   1863  C CA    . CYS A  1 261 ? -15.495 11.106  18.996  1.00 22.28  ? 289 CYS A CA    1 
ATOM   1864  C C     . CYS A  1 261 ? -14.541 10.124  18.298  1.00 26.31  ? 289 CYS A C     1 
ATOM   1865  O O     . CYS A  1 261 ? -13.943 10.457  17.268  1.00 24.60  ? 289 CYS A O     1 
ATOM   1866  C CB    . CYS A  1 261 ? -14.832 11.692  20.247  1.00 26.11  ? 289 CYS A CB    1 
ATOM   1867  S SG    . CYS A  1 261 ? -13.180 12.371  19.944  1.00 34.56  ? 289 CYS A SG    1 
ATOM   1868  N N     . ALA A  1 262 ? -14.360 8.936   18.883  1.00 27.01  ? 290 ALA A N     1 
ATOM   1869  C CA    . ALA A  1 262 ? -13.415 7.948   18.340  1.00 24.47  ? 290 ALA A CA    1 
ATOM   1870  C C     . ALA A  1 262 ? -13.895 7.400   16.983  1.00 21.65  ? 290 ALA A C     1 
ATOM   1871  O O     . ALA A  1 262 ? -13.117 7.202   16.088  1.00 20.27  ? 290 ALA A O     1 
ATOM   1872  C CB    . ALA A  1 262 ? -13.161 6.782   19.355  1.00 19.62  ? 290 ALA A CB    1 
ATOM   1873  N N     . VAL A  1 263 ? -15.192 7.161   16.842  1.00 20.79  ? 291 VAL A N     1 
ATOM   1874  C CA    . VAL A  1 263 ? -15.721 6.645   15.583  1.00 25.97  ? 291 VAL A CA    1 
ATOM   1875  C C     . VAL A  1 263 ? -15.559 7.673   14.434  1.00 25.00  ? 291 VAL A C     1 
ATOM   1876  O O     . VAL A  1 263 ? -15.005 7.356   13.382  1.00 25.16  ? 291 VAL A O     1 
ATOM   1877  C CB    . VAL A  1 263 ? -17.217 6.230   15.724  1.00 16.16  ? 291 VAL A CB    1 
ATOM   1878  C CG1   . VAL A  1 263 ? -17.824 5.853   14.330  1.00 29.23  ? 291 VAL A CG1   1 
ATOM   1879  C CG2   . VAL A  1 263 ? -17.365 5.035   16.690  1.00 19.85  ? 291 VAL A CG2   1 
ATOM   1880  N N     . ASN A  1 264 ? -16.003 8.907   14.654  1.00 24.16  ? 292 ASN A N     1 
ATOM   1881  C CA    . ASN A  1 264 ? -15.814 9.952   13.660  1.00 25.73  ? 292 ASN A CA    1 
ATOM   1882  C C     . ASN A  1 264 ? -14.346 10.092  13.206  1.00 26.40  ? 292 ASN A C     1 
ATOM   1883  O O     . ASN A  1 264 ? -14.052 10.216  11.999  1.00 24.06  ? 292 ASN A O     1 
ATOM   1884  C CB    . ASN A  1 264 ? -16.313 11.298  14.185  1.00 28.37  ? 292 ASN A CB    1 
ATOM   1885  C CG    . ASN A  1 264 ? -16.343 12.360  13.092  1.00 42.54  ? 292 ASN A CG    1 
ATOM   1886  O OD1   . ASN A  1 264 ? -17.185 12.316  12.190  1.00 39.78  ? 292 ASN A OD1   1 
ATOM   1887  N ND2   . ASN A  1 264 ? -15.414 13.299  13.157  1.00 28.12  ? 292 ASN A ND2   1 
ATOM   1888  N N     . TYR A  1 265 ? -13.438 10.051  14.173  1.00 22.94  ? 293 TYR A N     1 
ATOM   1889  C CA    . TYR A  1 265 ? -12.009 10.184  13.899  1.00 21.99  ? 293 TYR A CA    1 
ATOM   1890  C C     . TYR A  1 265 ? -11.468 8.983   13.126  1.00 23.02  ? 293 TYR A C     1 
ATOM   1891  O O     . TYR A  1 265 ? -10.660 9.122   12.163  1.00 22.16  ? 293 TYR A O     1 
ATOM   1892  C CB    . TYR A  1 265 ? -11.182 10.375  15.201  1.00 20.40  ? 293 TYR A CB    1 
ATOM   1893  C CG    . TYR A  1 265 ? -9.740  10.815  14.911  1.00 20.78  ? 293 TYR A CG    1 
ATOM   1894  C CD1   . TYR A  1 265 ? -9.435  12.161  14.744  1.00 29.10  ? 293 TYR A CD1   1 
ATOM   1895  C CD2   . TYR A  1 265 ? -8.699  9.896   14.792  1.00 22.49  ? 293 TYR A CD2   1 
ATOM   1896  C CE1   . TYR A  1 265 ? -8.139  12.587  14.477  1.00 24.18  ? 293 TYR A CE1   1 
ATOM   1897  C CE2   . TYR A  1 265 ? -7.389  10.318  14.509  1.00 28.25  ? 293 TYR A CE2   1 
ATOM   1898  C CZ    . TYR A  1 265 ? -7.128  11.680  14.347  1.00 31.86  ? 293 TYR A CZ    1 
ATOM   1899  O OH    . TYR A  1 265 ? -5.858  12.158  14.066  1.00 24.75  ? 293 TYR A OH    1 
ATOM   1900  N N     . ALA A  1 266 ? -11.888 7.799   13.567  1.00 22.16  ? 294 ALA A N     1 
ATOM   1901  C CA    . ALA A  1 266 ? -11.418 6.572   12.978  1.00 23.86  ? 294 ALA A CA    1 
ATOM   1902  C C     . ALA A  1 266 ? -11.915 6.391   11.538  1.00 22.28  ? 294 ALA A C     1 
ATOM   1903  O O     . ALA A  1 266 ? -11.189 5.867   10.714  1.00 21.59  ? 294 ALA A O     1 
ATOM   1904  C CB    . ALA A  1 266 ? -11.789 5.364   13.861  1.00 21.90  ? 294 ALA A CB    1 
ATOM   1905  N N     . GLU A  1 267 ? -13.148 6.812   11.236  1.00 22.34  ? 295 GLU A N     1 
ATOM   1906  C CA    . GLU A  1 267 ? -13.659 6.727   9.874   1.00 26.29  ? 295 GLU A CA    1 
ATOM   1907  C C     . GLU A  1 267 ? -12.968 7.685   8.897   1.00 29.59  ? 295 GLU A C     1 
ATOM   1908  O O     . GLU A  1 267 ? -13.042 7.458   7.689   1.00 23.30  ? 295 GLU A O     1 
ATOM   1909  C CB    . GLU A  1 267 ? -15.176 6.998   9.837   1.00 25.88  ? 295 GLU A CB    1 
ATOM   1910  C CG    . GLU A  1 267 ? -16.000 5.916   10.494  1.00 34.93  ? 295 GLU A CG    1 
ATOM   1911  C CD    . GLU A  1 267 ? -16.292 4.725   9.564   1.00 49.14  ? 295 GLU A CD    1 
ATOM   1912  O OE1   . GLU A  1 267 ? -15.343 4.117   9.005   1.00 43.18  ? 295 GLU A OE1   1 
ATOM   1913  O OE2   . GLU A  1 267 ? -17.480 4.384   9.425   1.00 53.05  ? 295 GLU A OE2   1 
ATOM   1914  N N     . ASN A  1 268 ? -12.308 8.735   9.417   1.00 27.53  ? 296 ASN A N     1 
ATOM   1915  C CA    . ASN A  1 268 ? -11.825 9.851   8.606   1.00 28.17  ? 296 ASN A CA    1 
ATOM   1916  C C     . ASN A  1 268 ? -10.336 10.121  8.629   1.00 26.73  ? 296 ASN A C     1 
ATOM   1917  O O     . ASN A  1 268 ? -9.829  10.874  7.808   1.00 33.48  ? 296 ASN A O     1 
ATOM   1918  C CB    . ASN A  1 268 ? -12.600 11.089  8.995   1.00 28.21  ? 296 ASN A CB    1 
ATOM   1919  C CG    . ASN A  1 268 ? -14.054 10.958  8.630   1.00 29.45  ? 296 ASN A CG    1 
ATOM   1920  O OD1   . ASN A  1 268 ? -14.386 10.857  7.455   1.00 33.06  ? 296 ASN A OD1   1 
ATOM   1921  N ND2   . ASN A  1 268 ? -14.926 10.947  9.621   1.00 32.28  ? 296 ASN A ND2   1 
ATOM   1922  N N     . ARG A  1 269 ? -9.649  9.480   9.556   1.00 24.00  ? 297 ARG A N     1 
ATOM   1923  C CA    . ARG A  1 269 ? -8.217  9.483   9.619   1.00 26.06  ? 297 ARG A CA    1 
ATOM   1924  C C     . ARG A  1 269 ? -7.783  8.323   8.749   1.00 28.42  ? 297 ARG A C     1 
ATOM   1925  O O     . ARG A  1 269 ? -8.363  7.245   8.814   1.00 26.32  ? 297 ARG A O     1 
ATOM   1926  C CB    . ARG A  1 269 ? -7.733  9.310   11.074  1.00 23.75  ? 297 ARG A CB    1 
ATOM   1927  C CG    . ARG A  1 269 ? -6.198  9.135   11.263  1.00 23.14  ? 297 ARG A CG    1 
ATOM   1928  C CD    . ARG A  1 269 ? -5.413  10.389  10.967  1.00 19.91  ? 297 ARG A CD    1 
ATOM   1929  N NE    . ARG A  1 269 ? -4.002  10.264  11.368  1.00 22.76  ? 297 ARG A NE    1 
ATOM   1930  C CZ    . ARG A  1 269 ? -3.084  11.215  11.193  1.00 25.16  ? 297 ARG A CZ    1 
ATOM   1931  N NH1   . ARG A  1 269 ? -3.408  12.349  10.595  1.00 27.67  ? 297 ARG A NH1   1 
ATOM   1932  N NH2   . ARG A  1 269 ? -1.832  11.013  11.607  1.00 23.62  ? 297 ARG A NH2   1 
ATOM   1933  N N     . MET A  1 270 ? -6.757  8.563   7.943   1.00 21.90  ? 298 MET A N     1 
ATOM   1934  C CA    . MET A  1 270 ? -6.177  7.552   7.097   1.00 26.52  ? 298 MET A CA    1 
ATOM   1935  C C     . MET A  1 270 ? -4.836  7.155   7.671   1.00 29.52  ? 298 MET A C     1 
ATOM   1936  O O     . MET A  1 270 ? -4.146  7.989   8.273   1.00 28.28  ? 298 MET A O     1 
ATOM   1937  C CB    . MET A  1 270 ? -5.953  8.117   5.698   1.00 29.81  ? 298 MET A CB    1 
ATOM   1938  C CG    . MET A  1 270 ? -7.202  8.649   5.032   1.00 36.18  ? 298 MET A CG    1 
ATOM   1939  S SD    . MET A  1 270 ? -8.103  7.354   4.212   1.00 42.36  ? 298 MET A SD    1 
ATOM   1940  C CE    . MET A  1 270 ? -6.904  6.848   2.976   1.00 38.44  ? 298 MET A CE    1 
ATOM   1941  N N     . ALA A  1 271 ? -4.498  5.879   7.509   1.00 27.93  ? 299 ALA A N     1 
ATOM   1942  C CA    . ALA A  1 271 ? -3.146  5.375   7.743   1.00 29.75  ? 299 ALA A CA    1 
ATOM   1943  C C     . ALA A  1 271 ? -2.973  4.129   6.872   1.00 33.18  ? 299 ALA A C     1 
ATOM   1944  O O     . ALA A  1 271 ? -3.928  3.352   6.681   1.00 27.45  ? 299 ALA A O     1 
ATOM   1945  C CB    . ALA A  1 271 ? -2.911  5.043   9.228   1.00 27.31  ? 299 ALA A CB    1 
ATOM   1946  N N     . PHE A  1 272 ? -1.772  3.972   6.323   1.00 31.37  ? 300 PHE A N     1 
ATOM   1947  C CA    . PHE A  1 272 ? -1.451  2.886   5.374   1.00 33.86  ? 300 PHE A CA    1 
ATOM   1948  C C     . PHE A  1 272 ? -2.514  2.754   4.252   1.00 34.58  ? 300 PHE A C     1 
ATOM   1949  O O     . PHE A  1 272 ? -2.958  1.647   3.911   1.00 34.68  ? 300 PHE A O     1 
ATOM   1950  C CB    . PHE A  1 272 ? -1.243  1.557   6.133   1.00 33.14  ? 300 PHE A CB    1 
ATOM   1951  C CG    . PHE A  1 272 ? -0.246  1.657   7.266   1.00 33.39  ? 300 PHE A CG    1 
ATOM   1952  C CD1   . PHE A  1 272 ? 1.091   1.356   7.052   1.00 37.28  ? 300 PHE A CD1   1 
ATOM   1953  C CD2   . PHE A  1 272 ? -0.638  2.082   8.527   1.00 34.53  ? 300 PHE A CD2   1 
ATOM   1954  C CE1   . PHE A  1 272 ? 2.017   1.460   8.078   1.00 36.35  ? 300 PHE A CE1   1 
ATOM   1955  C CE2   . PHE A  1 272 ? 0.272   2.199   9.550   1.00 34.55  ? 300 PHE A CE2   1 
ATOM   1956  C CZ    . PHE A  1 272 ? 1.609   1.883   9.333   1.00 36.78  ? 300 PHE A CZ    1 
ATOM   1957  N N     . GLY A  1 273 ? -2.935  3.894   3.711   1.00 31.50  ? 301 GLY A N     1 
ATOM   1958  C CA    . GLY A  1 273 ? -3.754  3.928   2.505   1.00 32.57  ? 301 GLY A CA    1 
ATOM   1959  C C     . GLY A  1 273 ? -5.238  3.667   2.673   1.00 36.10  ? 301 GLY A C     1 
ATOM   1960  O O     . GLY A  1 273 ? -5.941  3.482   1.689   1.00 38.52  ? 301 GLY A O     1 
ATOM   1961  N N     . ALA A  1 274 ? -5.720  3.665   3.909   1.00 33.38  ? 302 ALA A N     1 
ATOM   1962  C CA    . ALA A  1 274 ? -7.145  3.423   4.182   1.00 29.24  ? 302 ALA A CA    1 
ATOM   1963  C C     . ALA A  1 274 ? -7.528  4.065   5.511   1.00 27.81  ? 302 ALA A C     1 
ATOM   1964  O O     . ALA A  1 274 ? -6.665  4.398   6.315   1.00 26.84  ? 302 ALA A O     1 
ATOM   1965  C CB    . ALA A  1 274 ? -7.413  1.923   4.234   1.00 26.17  ? 302 ALA A CB    1 
ATOM   1966  N N     . PRO A  1 275 ? -8.837  4.212   5.764   1.00 25.97  ? 303 PRO A N     1 
ATOM   1967  C CA    . PRO A  1 275 ? -9.232  4.685   7.062   1.00 27.61  ? 303 PRO A CA    1 
ATOM   1968  C C     . PRO A  1 275 ? -8.789  3.713   8.164   1.00 27.16  ? 303 PRO A C     1 
ATOM   1969  O O     . PRO A  1 275 ? -8.575  2.507   7.909   1.00 23.25  ? 303 PRO A O     1 
ATOM   1970  C CB    . PRO A  1 275 ? -10.765 4.737   6.967   1.00 26.66  ? 303 PRO A CB    1 
ATOM   1971  C CG    . PRO A  1 275 ? -11.074 4.755   5.512   1.00 29.57  ? 303 PRO A CG    1 
ATOM   1972  C CD    . PRO A  1 275 ? -9.989  3.956   4.883   1.00 26.15  ? 303 PRO A CD    1 
ATOM   1973  N N     . LEU A  1 276 ? -8.655  4.241   9.375   1.00 27.26  ? 304 LEU A N     1 
ATOM   1974  C CA    . LEU A  1 276 ? -8.338  3.432   10.563  1.00 24.55  ? 304 LEU A CA    1 
ATOM   1975  C C     . LEU A  1 276 ? -9.361  2.317   10.800  1.00 23.59  ? 304 LEU A C     1 
ATOM   1976  O O     . LEU A  1 276 ? -9.000  1.234   11.224  1.00 25.55  ? 304 LEU A O     1 
ATOM   1977  C CB    . LEU A  1 276 ? -8.251  4.297   11.831  1.00 22.14  ? 304 LEU A CB    1 
ATOM   1978  C CG    . LEU A  1 276 ? -7.246  5.447   11.926  1.00 20.98  ? 304 LEU A CG    1 
ATOM   1979  C CD1   . LEU A  1 276 ? -7.383  6.117   13.324  1.00 21.69  ? 304 LEU A CD1   1 
ATOM   1980  C CD2   . LEU A  1 276 ? -5.812  4.984   11.636  1.00 20.44  ? 304 LEU A CD2   1 
ATOM   1981  N N     . THR A  1 277 ? -10.635 2.582   10.521  1.00 25.00  ? 305 THR A N     1 
ATOM   1982  C CA    . THR A  1 277 ? -11.675 1.568   10.654  1.00 28.40  ? 305 THR A CA    1 
ATOM   1983  C C     . THR A  1 277 ? -11.535 0.350   9.716   1.00 29.30  ? 305 THR A C     1 
ATOM   1984  O O     . THR A  1 277 ? -12.314 -0.579  9.820   1.00 30.52  ? 305 THR A O     1 
ATOM   1985  C CB    . THR A  1 277 ? -13.073 2.190   10.445  1.00 28.13  ? 305 THR A CB    1 
ATOM   1986  O OG1   . THR A  1 277 ? -13.059 2.959   9.238   1.00 29.09  ? 305 THR A OG1   1 
ATOM   1987  C CG2   . THR A  1 277 ? -13.454 3.090   11.639  1.00 27.75  ? 305 THR A CG2   1 
ATOM   1988  N N     . LYS A  1 278 ? -10.566 0.352   8.800   1.00 26.92  ? 306 LYS A N     1 
ATOM   1989  C CA    . LYS A  1 278 ? -10.296 -0.811  7.976   1.00 28.58  ? 306 LYS A CA    1 
ATOM   1990  C C     . LYS A  1 278 ? -9.338  -1.750  8.705   1.00 28.04  ? 306 LYS A C     1 
ATOM   1991  O O     . LYS A  1 278 ? -9.204  -2.897  8.321   1.00 29.69  ? 306 LYS A O     1 
ATOM   1992  C CB    . LYS A  1 278 ? -9.708  -0.412  6.607   1.00 29.27  ? 306 LYS A CB    1 
ATOM   1993  C CG    . LYS A  1 278 ? -10.740 0.139   5.612   1.00 39.15  ? 306 LYS A CG    1 
ATOM   1994  C CD    . LYS A  1 278 ? -11.350 -0.987  4.782   1.00 47.27  ? 306 LYS A CD    1 
ATOM   1995  C CE    . LYS A  1 278 ? -12.532 -0.510  3.934   1.00 59.48  ? 306 LYS A CE    1 
ATOM   1996  N NZ    . LYS A  1 278 ? -13.815 -0.450  4.694   1.00 55.24  ? 306 LYS A NZ    1 
ATOM   1997  N N     . LEU A  1 279 ? -8.658  -1.256  9.739   1.00 26.00  ? 307 LEU A N     1 
ATOM   1998  C CA    . LEU A  1 279 ? -7.856  -2.104  10.619  1.00 26.99  ? 307 LEU A CA    1 
ATOM   1999  C C     . LEU A  1 279 ? -8.742  -2.885  11.600  1.00 23.88  ? 307 LEU A C     1 
ATOM   2000  O O     . LEU A  1 279 ? -9.586  -2.306  12.280  1.00 24.81  ? 307 LEU A O     1 
ATOM   2001  C CB    . LEU A  1 279 ? -6.829  -1.262  11.390  1.00 26.95  ? 307 LEU A CB    1 
ATOM   2002  C CG    . LEU A  1 279 ? -5.862  -0.429  10.516  1.00 25.37  ? 307 LEU A CG    1 
ATOM   2003  C CD1   . LEU A  1 279 ? -5.256  0.695   11.377  1.00 27.26  ? 307 LEU A CD1   1 
ATOM   2004  C CD2   . LEU A  1 279 ? -4.796  -1.282  9.824   1.00 28.39  ? 307 LEU A CD2   1 
ATOM   2005  N N     . GLN A  1 280 ? -8.542  -4.200  11.669  1.00 27.99  ? 308 GLN A N     1 
ATOM   2006  C CA    . GLN A  1 280 ? -9.320  -5.080  12.569  1.00 30.26  ? 308 GLN A CA    1 
ATOM   2007  C C     . GLN A  1 280 ? -9.254  -4.697  14.037  1.00 25.53  ? 308 GLN A C     1 
ATOM   2008  O O     . GLN A  1 280 ? -10.241 -4.812  14.776  1.00 22.92  ? 308 GLN A O     1 
ATOM   2009  C CB    . GLN A  1 280 ? -8.782  -6.505  12.497  1.00 34.81  ? 308 GLN A CB    1 
ATOM   2010  C CG    . GLN A  1 280 ? -9.086  -7.265  11.254  1.00 43.48  ? 308 GLN A CG    1 
ATOM   2011  C CD    . GLN A  1 280 ? -8.816  -8.748  11.454  1.00 48.01  ? 308 GLN A CD    1 
ATOM   2012  O OE1   . GLN A  1 280 ? -7.719  -9.156  11.867  1.00 30.59  ? 308 GLN A OE1   1 
ATOM   2013  N NE2   . GLN A  1 280 ? -9.827  -9.556  11.190  1.00 30.36  ? 308 GLN A NE2   1 
ATOM   2014  N N     . VAL A  1 281 ? -8.058  -4.316  14.464  1.00 25.79  ? 309 VAL A N     1 
ATOM   2015  C CA    . VAL A  1 281 ? -7.818  -3.994  15.854  1.00 27.75  ? 309 VAL A CA    1 
ATOM   2016  C C     . VAL A  1 281 ? -8.620  -2.767  16.255  1.00 24.41  ? 309 VAL A C     1 
ATOM   2017  O O     . VAL A  1 281 ? -9.147  -2.720  17.356  1.00 23.51  ? 309 VAL A O     1 
ATOM   2018  C CB    . VAL A  1 281 ? -6.306  -3.797  16.143  1.00 30.58  ? 309 VAL A CB    1 
ATOM   2019  C CG1   . VAL A  1 281 ? -6.081  -3.374  17.605  1.00 38.51  ? 309 VAL A CG1   1 
ATOM   2020  C CG2   . VAL A  1 281 ? -5.534  -5.095  15.839  1.00 36.49  ? 309 VAL A CG2   1 
ATOM   2021  N N     . ILE A  1 282 ? -8.726  -1.791  15.350  1.00 23.02  ? 310 ILE A N     1 
ATOM   2022  C CA    . ILE A  1 282 ? -9.538  -0.594  15.581  1.00 23.40  ? 310 ILE A CA    1 
ATOM   2023  C C     . ILE A  1 282 ? -11.015 -0.962  15.680  1.00 21.97  ? 310 ILE A C     1 
ATOM   2024  O O     . ILE A  1 282 ? -11.722 -0.461  16.545  1.00 21.35  ? 310 ILE A O     1 
ATOM   2025  C CB    . ILE A  1 282 ? -9.264  0.488   14.494  1.00 20.70  ? 310 ILE A CB    1 
ATOM   2026  C CG1   . ILE A  1 282 ? -7.819  0.999   14.604  1.00 25.62  ? 310 ILE A CG1   1 
ATOM   2027  C CG2   . ILE A  1 282 ? -10.178 1.667   14.632  1.00 25.38  ? 310 ILE A CG2   1 
ATOM   2028  C CD1   . ILE A  1 282 ? -7.505  1.693   15.954  1.00 20.44  ? 310 ILE A CD1   1 
ATOM   2029  N N     . GLN A  1 283 ? -11.463 -1.879  14.827  1.00 21.24  ? 311 GLN A N     1 
ATOM   2030  C CA    . GLN A  1 283 ? -12.834 -2.367  14.858  1.00 23.70  ? 311 GLN A CA    1 
ATOM   2031  C C     . GLN A  1 283 ? -13.148 -3.093  16.172  1.00 21.33  ? 311 GLN A C     1 
ATOM   2032  O O     . GLN A  1 283 ? -14.234 -2.961  16.732  1.00 20.51  ? 311 GLN A O     1 
ATOM   2033  C CB    . GLN A  1 283 ? -13.069 -3.328  13.689  1.00 23.82  ? 311 GLN A CB    1 
ATOM   2034  C CG    . GLN A  1 283 ? -12.934 -2.732  12.298  1.00 25.98  ? 311 GLN A CG    1 
ATOM   2035  C CD    . GLN A  1 283 ? -13.148 -3.785  11.227  1.00 34.23  ? 311 GLN A CD    1 
ATOM   2036  O OE1   . GLN A  1 283 ? -14.100 -4.569  11.308  1.00 38.25  ? 311 GLN A OE1   1 
ATOM   2037  N NE2   . GLN A  1 283 ? -12.254 -3.835  10.239  1.00 33.30  ? 311 GLN A NE2   1 
ATOM   2038  N N     . PHE A  1 284 ? -12.200 -3.921  16.601  1.00 21.29  ? 312 PHE A N     1 
ATOM   2039  C CA    . PHE A  1 284 ? -12.226 -4.557  17.908  1.00 24.86  ? 312 PHE A CA    1 
ATOM   2040  C C     . PHE A  1 284 ? -12.310 -3.538  19.041  1.00 22.53  ? 312 PHE A C     1 
ATOM   2041  O O     . PHE A  1 284 ? -13.191 -3.673  19.883  1.00 22.19  ? 312 PHE A O     1 
ATOM   2042  C CB    . PHE A  1 284 ? -11.002 -5.486  18.119  1.00 24.50  ? 312 PHE A CB    1 
ATOM   2043  C CG    . PHE A  1 284 ? -11.212 -6.899  17.619  1.00 27.89  ? 312 PHE A CG    1 
ATOM   2044  C CD1   . PHE A  1 284 ? -11.782 -7.144  16.372  1.00 36.47  ? 312 PHE A CD1   1 
ATOM   2045  C CD2   . PHE A  1 284 ? -10.804 -7.991  18.388  1.00 35.04  ? 312 PHE A CD2   1 
ATOM   2046  C CE1   . PHE A  1 284 ? -11.954 -8.451  15.909  1.00 36.49  ? 312 PHE A CE1   1 
ATOM   2047  C CE2   . PHE A  1 284 ? -10.966 -9.292  17.921  1.00 36.09  ? 312 PHE A CE2   1 
ATOM   2048  C CZ    . PHE A  1 284 ? -11.547 -9.520  16.692  1.00 28.21  ? 312 PHE A CZ    1 
ATOM   2049  N N     . LYS A  1 285 ? -11.406 -2.546  19.066  1.00 22.65  ? 313 LYS A N     1 
ATOM   2050  C CA    . LYS A  1 285 ? -11.458 -1.482  20.094  1.00 23.55  ? 313 LYS A CA    1 
ATOM   2051  C C     . LYS A  1 285 ? -12.857 -0.890  20.130  1.00 19.39  ? 313 LYS A C     1 
ATOM   2052  O O     . LYS A  1 285 ? -13.495 -0.824  21.177  1.00 24.50  ? 313 LYS A O     1 
ATOM   2053  C CB    . LYS A  1 285 ? -10.457 -0.353  19.816  1.00 22.55  ? 313 LYS A CB    1 
ATOM   2054  C CG    . LYS A  1 285 ? -9.011  -0.658  20.156  1.00 25.04  ? 313 LYS A CG    1 
ATOM   2055  C CD    . LYS A  1 285 ? -8.137  0.537   19.817  1.00 22.71  ? 313 LYS A CD    1 
ATOM   2056  C CE    . LYS A  1 285 ? -6.667  0.179   19.796  1.00 31.40  ? 313 LYS A CE    1 
ATOM   2057  N NZ    . LYS A  1 285 ? -6.271  -0.344  21.125  1.00 29.22  ? 313 LYS A NZ    1 
ATOM   2058  N N     . LEU A  1 286 ? -13.362 -0.532  18.955  1.00 22.46  ? 314 LEU A N     1 
ATOM   2059  C CA    . LEU A  1 286 ? -14.690 0.074   18.844  1.00 19.12  ? 314 LEU A CA    1 
ATOM   2060  C C     . LEU A  1 286 ? -15.841 -0.851  19.229  1.00 21.97  ? 314 LEU A C     1 
ATOM   2061  O O     . LEU A  1 286 ? -16.827 -0.392  19.794  1.00 21.26  ? 314 LEU A O     1 
ATOM   2062  C CB    . LEU A  1 286 ? -14.899 0.638   17.418  1.00 24.63  ? 314 LEU A CB    1 
ATOM   2063  C CG    . LEU A  1 286 ? -14.006 1.817   16.989  1.00 23.32  ? 314 LEU A CG    1 
ATOM   2064  C CD1   . LEU A  1 286 ? -14.240 2.156   15.501  1.00 25.91  ? 314 LEU A CD1   1 
ATOM   2065  C CD2   . LEU A  1 286 ? -14.210 3.063   17.861  1.00 24.38  ? 314 LEU A CD2   1 
ATOM   2066  N N     . ALA A  1 287 ? -15.755 -2.138  18.913  1.00 23.91  ? 315 ALA A N     1 
ATOM   2067  C CA    . ALA A  1 287 ? -16.814 -3.084  19.336  1.00 23.99  ? 315 ALA A CA    1 
ATOM   2068  C C     . ALA A  1 287 ? -16.886 -3.257  20.877  1.00 22.66  ? 315 ALA A C     1 
ATOM   2069  O O     . ALA A  1 287 ? -17.976 -3.310  21.473  1.00 18.47  ? 315 ALA A O     1 
ATOM   2070  C CB    . ALA A  1 287 ? -16.651 -4.465  18.635  1.00 20.01  ? 315 ALA A CB    1 
ATOM   2071  N N     . ASP A  1 288 ? -15.718 -3.354  21.512  1.00 18.54  ? 316 ASP A N     1 
ATOM   2072  C CA    . ASP A  1 288 ? -15.614 -3.477  22.966  1.00 21.77  ? 316 ASP A CA    1 
ATOM   2073  C C     . ASP A  1 288 ? -16.183 -2.215  23.630  1.00 23.50  ? 316 ASP A C     1 
ATOM   2074  O O     . ASP A  1 288 ? -16.945 -2.295  24.599  1.00 18.04  ? 316 ASP A O     1 
ATOM   2075  C CB    . ASP A  1 288 ? -14.139 -3.698  23.386  1.00 20.07  ? 316 ASP A CB    1 
ATOM   2076  C CG    . ASP A  1 288 ? -13.646 -5.088  23.041  1.00 37.39  ? 316 ASP A CG    1 
ATOM   2077  O OD1   . ASP A  1 288 ? -14.504 -5.968  22.951  1.00 39.00  ? 316 ASP A OD1   1 
ATOM   2078  O OD2   . ASP A  1 288 ? -12.429 -5.312  22.864  1.00 33.06  ? 316 ASP A OD2   1 
ATOM   2079  N N     . MET A  1 289 ? -15.872 -1.054  23.049  1.00 23.41  ? 317 MET A N     1 
ATOM   2080  C CA    . MET A  1 289 ? -16.433 0.199   23.528  1.00 22.79  ? 317 MET A CA    1 
ATOM   2081  C C     . MET A  1 289 ? -17.949 0.177   23.491  1.00 23.73  ? 317 MET A C     1 
ATOM   2082  O O     . MET A  1 289 ? -18.603 0.433   24.515  1.00 19.87  ? 317 MET A O     1 
ATOM   2083  C CB    . MET A  1 289 ? -15.863 1.373   22.747  1.00 24.46  ? 317 MET A CB    1 
ATOM   2084  C CG    . MET A  1 289 ? -14.383 1.575   23.032  1.00 27.00  ? 317 MET A CG    1 
ATOM   2085  S SD    . MET A  1 289 ? -13.469 2.412   21.728  1.00 26.76  ? 317 MET A SD    1 
ATOM   2086  C CE    . MET A  1 289 ? -13.936 4.111   22.133  1.00 18.36  ? 317 MET A CE    1 
ATOM   2087  N N     . ALA A  1 290 ? -18.500 -0.162  22.329  1.00 23.33  ? 318 ALA A N     1 
ATOM   2088  C CA    . ALA A  1 290 ? -19.965 -0.178  22.150  1.00 23.14  ? 318 ALA A CA    1 
ATOM   2089  C C     . ALA A  1 290 ? -20.641 -1.167  23.102  1.00 20.53  ? 318 ALA A C     1 
ATOM   2090  O O     . ALA A  1 290 ? -21.670 -0.855  23.684  1.00 24.42  ? 318 ALA A O     1 
ATOM   2091  C CB    . ALA A  1 290 ? -20.310 -0.498  20.743  1.00 19.42  ? 318 ALA A CB    1 
ATOM   2092  N N     . LEU A  1 291 ? -20.057 -2.361  23.251  1.00 22.73  ? 319 LEU A N     1 
ATOM   2093  C CA    . LEU A  1 291 ? -20.588 -3.379  24.154  1.00 23.48  ? 319 LEU A CA    1 
ATOM   2094  C C     . LEU A  1 291 ? -20.545 -2.922  25.621  1.00 25.42  ? 319 LEU A C     1 
ATOM   2095  O O     . LEU A  1 291 ? -21.537 -3.023  26.304  1.00 20.82  ? 319 LEU A O     1 
ATOM   2096  C CB    . LEU A  1 291 ? -19.854 -4.718  23.999  1.00 24.70  ? 319 LEU A CB    1 
ATOM   2097  C CG    . LEU A  1 291 ? -20.372 -5.886  24.877  1.00 32.14  ? 319 LEU A CG    1 
ATOM   2098  C CD1   . LEU A  1 291 ? -21.876 -6.074  24.694  1.00 34.40  ? 319 LEU A CD1   1 
ATOM   2099  C CD2   . LEU A  1 291 ? -19.652 -7.220  24.576  1.00 29.35  ? 319 LEU A CD2   1 
ATOM   2100  N N     . ALA A  1 292 ? -19.404 -2.401  26.089  1.00 21.72  ? 320 ALA A N     1 
ATOM   2101  C CA    . ALA A  1 292 ? -19.340 -1.880  27.443  1.00 23.01  ? 320 ALA A CA    1 
ATOM   2102  C C     . ALA A  1 292 ? -20.371 -0.786  27.685  1.00 22.05  ? 320 ALA A C     1 
ATOM   2103  O O     . ALA A  1 292 ? -20.962 -0.725  28.753  1.00 19.56  ? 320 ALA A O     1 
ATOM   2104  C CB    . ALA A  1 292 ? -17.965 -1.362  27.762  1.00 20.37  ? 320 ALA A CB    1 
ATOM   2105  N N     . LEU A  1 293 ? -20.576 0.098   26.714  1.00 23.40  ? 321 LEU A N     1 
ATOM   2106  C CA    . LEU A  1 293 ? -21.520 1.191   26.932  1.00 22.19  ? 321 LEU A CA    1 
ATOM   2107  C C     . LEU A  1 293 ? -22.961 0.723   26.965  1.00 19.56  ? 321 LEU A C     1 
ATOM   2108  O O     . LEU A  1 293 ? -23.729 1.106   27.856  1.00 17.32  ? 321 LEU A O     1 
ATOM   2109  C CB    . LEU A  1 293 ? -21.325 2.298   25.902  1.00 22.04  ? 321 LEU A CB    1 
ATOM   2110  C CG    . LEU A  1 293 ? -22.339 3.442   25.844  1.00 23.34  ? 321 LEU A CG    1 
ATOM   2111  C CD1   . LEU A  1 293 ? -22.460 4.137   27.164  1.00 17.80  ? 321 LEU A CD1   1 
ATOM   2112  C CD2   . LEU A  1 293 ? -21.908 4.408   24.746  1.00 24.84  ? 321 LEU A CD2   1 
ATOM   2113  N N     . GLU A  1 294 ? -23.338 -0.111  26.019  1.00 20.45  ? 322 GLU A N     1 
ATOM   2114  C CA    . GLU A  1 294 ? -24.742 -0.534  25.923  1.00 26.53  ? 322 GLU A CA    1 
ATOM   2115  C C     . GLU A  1 294 ? -25.188 -1.387  27.138  1.00 20.85  ? 322 GLU A C     1 
ATOM   2116  O O     . GLU A  1 294 ? -26.317 -1.264  27.641  1.00 21.79  ? 322 GLU A O     1 
ATOM   2117  C CB    . GLU A  1 294 ? -24.977 -1.238  24.575  1.00 27.78  ? 322 GLU A CB    1 
ATOM   2118  C CG    . GLU A  1 294 ? -24.848 -0.252  23.387  1.00 35.83  ? 322 GLU A CG    1 
ATOM   2119  C CD    . GLU A  1 294 ? -25.202 -0.831  22.012  1.00 37.71  ? 322 GLU A CD    1 
ATOM   2120  O OE1   . GLU A  1 294 ? -26.207 -1.574  21.908  1.00 38.18  ? 322 GLU A OE1   1 
ATOM   2121  O OE2   . GLU A  1 294 ? -24.495 -0.507  21.015  1.00 39.61  ? 322 GLU A OE2   1 
ATOM   2122  N N     . SER A  1 295 ? -24.284 -2.265  27.560  1.00 20.65  ? 323 SER A N     1 
ATOM   2123  C CA    . SER A  1 295 ? -24.400 -3.047  28.792  1.00 20.69  ? 323 SER A CA    1 
ATOM   2124  C C     . SER A  1 295 ? -24.634 -2.176  30.057  1.00 21.27  ? 323 SER A C     1 
ATOM   2125  O O     . SER A  1 295 ? -25.599 -2.393  30.804  1.00 19.03  ? 323 SER A O     1 
ATOM   2126  C CB    . SER A  1 295 ? -23.127 -3.919  28.926  1.00 18.28  ? 323 SER A CB    1 
ATOM   2127  O OG    . SER A  1 295 ? -23.286 -4.856  29.927  1.00 36.19  ? 323 SER A OG    1 
ATOM   2128  N N     . ALA A  1 296 ? -23.757 -1.187  30.279  1.00 23.58  ? 324 ALA A N     1 
ATOM   2129  C CA    . ALA A  1 296 ? -23.900 -0.209  31.373  1.00 20.81  ? 324 ALA A CA    1 
ATOM   2130  C C     . ALA A  1 296 ? -25.231 0.539   31.264  1.00 23.73  ? 324 ALA A C     1 
ATOM   2131  O O     . ALA A  1 296 ? -25.952 0.671   32.272  1.00 18.86  ? 324 ALA A O     1 
ATOM   2132  C CB    . ALA A  1 296 ? -22.700 0.767   31.384  1.00 23.24  ? 324 ALA A CB    1 
ATOM   2133  N N     . ARG A  1 297 ? -25.605 0.955   30.046  1.00 22.91  ? 325 ARG A N     1 
ATOM   2134  C CA    . ARG A  1 297 ? -26.879 1.632   29.875  1.00 23.18  ? 325 ARG A CA    1 
ATOM   2135  C C     . ARG A  1 297 ? -28.047 0.750   30.334  1.00 18.66  ? 325 ARG A C     1 
ATOM   2136  O O     . ARG A  1 297 ? -28.905 1.230   31.051  1.00 21.72  ? 325 ARG A O     1 
ATOM   2137  C CB    . ARG A  1 297 ? -27.097 2.128   28.438  1.00 20.72  ? 325 ARG A CB    1 
ATOM   2138  C CG    . ARG A  1 297 ? -28.389 2.968   28.308  1.00 21.77  ? 325 ARG A CG    1 
ATOM   2139  C CD    . ARG A  1 297 ? -28.585 3.598   26.954  1.00 23.76  ? 325 ARG A CD    1 
ATOM   2140  N NE    . ARG A  1 297 ? -27.514 4.531   26.600  1.00 24.08  ? 325 ARG A NE    1 
ATOM   2141  C CZ    . ARG A  1 297 ? -26.510 4.293   25.754  1.00 20.20  ? 325 ARG A CZ    1 
ATOM   2142  N NH1   . ARG A  1 297 ? -26.371 3.106   25.164  1.00 23.71  ? 325 ARG A NH1   1 
ATOM   2143  N NH2   . ARG A  1 297 ? -25.612 5.240   25.490  1.00 26.84  ? 325 ARG A NH2   1 
ATOM   2144  N N     . LEU A  1 298 ? -28.082 -0.514  29.908  1.00 21.76  ? 326 LEU A N     1 
ATOM   2145  C CA    . LEU A  1 298 ? -29.181 -1.407  30.325  1.00 21.88  ? 326 LEU A CA    1 
ATOM   2146  C C     . LEU A  1 298 ? -29.189 -1.598  31.845  1.00 24.59  ? 326 LEU A C     1 
ATOM   2147  O O     . LEU A  1 298 ? -30.242 -1.576  32.437  1.00 13.74  ? 326 LEU A O     1 
ATOM   2148  C CB    . LEU A  1 298 ? -29.158 -2.763  29.615  1.00 18.67  ? 326 LEU A CB    1 
ATOM   2149  C CG    . LEU A  1 298 ? -29.333 -2.818  28.092  1.00 25.64  ? 326 LEU A CG    1 
ATOM   2150  C CD1   . LEU A  1 298 ? -29.039 -4.248  27.537  1.00 22.78  ? 326 LEU A CD1   1 
ATOM   2151  C CD2   . LEU A  1 298 ? -30.706 -2.344  27.673  1.00 25.29  ? 326 LEU A CD2   1 
ATOM   2152  N N     . LEU A  1 299 ? -28.027 -1.738  32.486  1.00 16.75  ? 327 LEU A N     1 
ATOM   2153  C CA    . LEU A  1 299 ? -27.978 -1.780  33.965  1.00 19.51  ? 327 LEU A CA    1 
ATOM   2154  C C     . LEU A  1 299 ? -28.576 -0.533  34.622  1.00 17.59  ? 327 LEU A C     1 
ATOM   2155  O O     . LEU A  1 299 ? -29.245 -0.608  35.656  1.00 19.62  ? 327 LEU A O     1 
ATOM   2156  C CB    . LEU A  1 299 ? -26.518 -1.960  34.475  1.00 15.53  ? 327 LEU A CB    1 
ATOM   2157  C CG    . LEU A  1 299 ? -25.866 -3.331  34.246  1.00 17.49  ? 327 LEU A CG    1 
ATOM   2158  C CD1   . LEU A  1 299 ? -24.352 -3.273  34.529  1.00 15.74  ? 327 LEU A CD1   1 
ATOM   2159  C CD2   . LEU A  1 299 ? -26.514 -4.446  35.034  1.00 19.55  ? 327 LEU A CD2   1 
ATOM   2160  N N     . THR A  1 300 ? -28.307 0.620   34.032  1.00 20.69  ? 328 THR A N     1 
ATOM   2161  C CA    . THR A  1 300 ? -28.803 1.894   34.552  1.00 23.90  ? 328 THR A CA    1 
ATOM   2162  C C     . THR A  1 300 ? -30.302 1.986   34.464  1.00 21.53  ? 328 THR A C     1 
ATOM   2163  O O     . THR A  1 300 ? -30.963 2.377   35.418  1.00 21.75  ? 328 THR A O     1 
ATOM   2164  C CB    . THR A  1 300 ? -28.207 3.050   33.765  1.00 26.68  ? 328 THR A CB    1 
ATOM   2165  O OG1   . THR A  1 300 ? -26.787 3.018   33.932  1.00 15.88  ? 328 THR A OG1   1 
ATOM   2166  C CG2   . THR A  1 300 ? -28.768 4.384   34.234  1.00 21.49  ? 328 THR A CG2   1 
ATOM   2167  N N     . TRP A  1 301 ? -30.821 1.639   33.293  1.00 23.68  ? 329 TRP A N     1 
ATOM   2168  C CA    . TRP A  1 301 ? -32.273 1.678   33.041  1.00 21.02  ? 329 TRP A CA    1 
ATOM   2169  C C     . TRP A  1 301 ? -33.056 0.699   33.889  1.00 19.21  ? 329 TRP A C     1 
ATOM   2170  O O     . TRP A  1 301 ? -34.154 1.018   34.352  1.00 24.92  ? 329 TRP A O     1 
ATOM   2171  C CB    . TRP A  1 301 ? -32.536 1.464   31.551  1.00 24.01  ? 329 TRP A CB    1 
ATOM   2172  C CG    . TRP A  1 301 ? -32.152 2.655   30.694  1.00 31.66  ? 329 TRP A CG    1 
ATOM   2173  C CD1   . TRP A  1 301 ? -31.500 3.805   31.090  1.00 31.33  ? 329 TRP A CD1   1 
ATOM   2174  C CD2   . TRP A  1 301 ? -32.393 2.804   29.294  1.00 33.38  ? 329 TRP A CD2   1 
ATOM   2175  N NE1   . TRP A  1 301 ? -31.348 4.657   30.019  1.00 30.64  ? 329 TRP A NE1   1 
ATOM   2176  C CE2   . TRP A  1 301 ? -31.886 4.072   28.909  1.00 30.51  ? 329 TRP A CE2   1 
ATOM   2177  C CE3   . TRP A  1 301 ? -32.988 1.991   28.325  1.00 33.53  ? 329 TRP A CE3   1 
ATOM   2178  C CZ2   . TRP A  1 301 ? -31.959 4.542   27.594  1.00 33.90  ? 329 TRP A CZ2   1 
ATOM   2179  C CZ3   . TRP A  1 301 ? -33.060 2.463   27.010  1.00 35.63  ? 329 TRP A CZ3   1 
ATOM   2180  C CH2   . TRP A  1 301 ? -32.534 3.720   26.660  1.00 31.93  ? 329 TRP A CH2   1 
ATOM   2181  N N     . ARG A  1 302 ? -32.517 -0.497  34.106  1.00 24.91  ? 330 ARG A N     1 
ATOM   2182  C CA    . ARG A  1 302 ? -33.096 -1.443  35.071  1.00 23.05  ? 330 ARG A CA    1 
ATOM   2183  C C     . ARG A  1 302 ? -33.243 -0.796  36.462  1.00 25.62  ? 330 ARG A C     1 
ATOM   2184  O O     . ARG A  1 302 ? -34.317 -0.853  37.057  1.00 19.18  ? 330 ARG A O     1 
ATOM   2185  C CB    . ARG A  1 302 ? -32.247 -2.738  35.158  1.00 17.17  ? 330 ARG A CB    1 
ATOM   2186  C CG    . ARG A  1 302 ? -32.653 -3.664  36.301  1.00 17.34  ? 330 ARG A CG    1 
ATOM   2187  C CD    . ARG A  1 302 ? -31.926 -4.993  36.337  1.00 23.69  ? 330 ARG A CD    1 
ATOM   2188  N NE    . ARG A  1 302 ? -30.574 -4.847  36.870  1.00 25.46  ? 330 ARG A NE    1 
ATOM   2189  C CZ    . ARG A  1 302 ? -29.857 -5.834  37.398  1.00 29.68  ? 330 ARG A CZ    1 
ATOM   2190  N NH1   . ARG A  1 302 ? -30.345 -7.069  37.472  1.00 30.66  ? 330 ARG A NH1   1 
ATOM   2191  N NH2   . ARG A  1 302 ? -28.637 -5.579  37.845  1.00 28.12  ? 330 ARG A NH2   1 
ATOM   2192  N N     . ALA A  1 303 ? -32.188 -0.153  36.973  1.00 21.94  ? 331 ALA A N     1 
ATOM   2193  C CA    . ALA A  1 303 ? -32.248 0.441   38.327  1.00 25.16  ? 331 ALA A CA    1 
ATOM   2194  C C     . ALA A  1 303 ? -33.279 1.572   38.427  1.00 19.12  ? 331 ALA A C     1 
ATOM   2195  O O     . ALA A  1 303 ? -34.093 1.605   39.377  1.00 24.65  ? 331 ALA A O     1 
ATOM   2196  C CB    . ALA A  1 303 ? -30.852 0.944   38.778  1.00 14.65  ? 331 ALA A CB    1 
ATOM   2197  N N     . ALA A  1 304 ? -33.275 2.458   37.422  1.00 22.54  ? 332 ALA A N     1 
ATOM   2198  C CA    . ALA A  1 304 ? -34.247 3.561   37.324  1.00 21.64  ? 332 ALA A CA    1 
ATOM   2199  C C     . ALA A  1 304 ? -35.651 3.001   37.280  1.00 25.94  ? 332 ALA A C     1 
ATOM   2200  O O     . ALA A  1 304 ? -36.553 3.498   37.940  1.00 21.21  ? 332 ALA A O     1 
ATOM   2201  C CB    . ALA A  1 304 ? -33.957 4.459   36.089  1.00 17.01  ? 332 ALA A CB    1 
ATOM   2202  N N     . MET A  1 305 ? -35.824 1.925   36.529  1.00 28.39  ? 333 MET A N     1 
ATOM   2203  C CA    . MET A  1 305 ? -37.134 1.343   36.381  1.00 28.98  ? 333 MET A CA    1 
ATOM   2204  C C     . MET A  1 305 ? -37.615 0.695   37.679  1.00 28.07  ? 333 MET A C     1 
ATOM   2205  O O     . MET A  1 305 ? -38.761 0.852   38.032  1.00 24.97  ? 333 MET A O     1 
ATOM   2206  C CB    . MET A  1 305 ? -37.141 0.395   35.188  1.00 26.76  ? 333 MET A CB    1 
ATOM   2207  C CG    . MET A  1 305 ? -37.108 1.191   33.850  1.00 39.54  ? 333 MET A CG    1 
ATOM   2208  S SD    . MET A  1 305 ? -37.251 0.210   32.344  1.00 46.71  ? 333 MET A SD    1 
ATOM   2209  C CE    . MET A  1 305 ? -36.082 -1.116  32.658  1.00 45.72  ? 333 MET A CE    1 
ATOM   2210  N N     . LEU A  1 306 ? -36.718 0.036   38.413  1.00 26.69  ? 334 LEU A N     1 
ATOM   2211  C CA    . LEU A  1 306 ? -37.028 -0.490  39.743  1.00 28.67  ? 334 LEU A CA    1 
ATOM   2212  C C     . LEU A  1 306 ? -37.407 0.613   40.718  1.00 27.24  ? 334 LEU A C     1 
ATOM   2213  O O     . LEU A  1 306 ? -38.420 0.511   41.421  1.00 25.13  ? 334 LEU A O     1 
ATOM   2214  C CB    . LEU A  1 306 ? -35.848 -1.307  40.307  1.00 27.81  ? 334 LEU A CB    1 
ATOM   2215  C CG    . LEU A  1 306 ? -35.576 -2.665  39.640  1.00 28.86  ? 334 LEU A CG    1 
ATOM   2216  C CD1   . LEU A  1 306 ? -34.217 -3.173  40.034  1.00 23.43  ? 334 LEU A CD1   1 
ATOM   2217  C CD2   . LEU A  1 306 ? -36.670 -3.681  39.992  1.00 25.44  ? 334 LEU A CD2   1 
ATOM   2218  N N     . LYS A  1 307 ? -36.622 1.685   40.746  1.00 23.92  ? 335 LYS A N     1 
ATOM   2219  C CA    . LYS A  1 307 ? -36.985 2.840   41.565  1.00 30.23  ? 335 LYS A CA    1 
ATOM   2220  C C     . LYS A  1 307 ? -38.386 3.360   41.200  1.00 28.68  ? 335 LYS A C     1 
ATOM   2221  O O     . LYS A  1 307 ? -39.211 3.542   42.076  1.00 31.87  ? 335 LYS A O     1 
ATOM   2222  C CB    . LYS A  1 307 ? -35.960 3.966   41.446  1.00 29.89  ? 335 LYS A CB    1 
ATOM   2223  C CG    . LYS A  1 307 ? -36.470 5.282   42.037  1.00 34.60  ? 335 LYS A CG    1 
ATOM   2224  C CD    . LYS A  1 307 ? -35.383 6.148   42.598  1.00 46.28  ? 335 LYS A CD    1 
ATOM   2225  C CE    . LYS A  1 307 ? -35.894 7.555   42.861  1.00 40.04  ? 335 LYS A CE    1 
ATOM   2226  N NZ    . LYS A  1 307 ? -37.228 7.581   43.494  1.00 39.42  ? 335 LYS A NZ    1 
ATOM   2227  N N     . ASP A  1 308 ? -38.636 3.603   39.911  1.00 28.78  ? 336 ASP A N     1 
ATOM   2228  C CA    . ASP A  1 308 ? -39.936 4.130   39.465  1.00 31.20  ? 336 ASP A CA    1 
ATOM   2229  C C     . ASP A  1 308 ? -41.093 3.196   39.793  1.00 30.37  ? 336 ASP A C     1 
ATOM   2230  O O     . ASP A  1 308 ? -42.229 3.643   39.909  1.00 32.84  ? 336 ASP A O     1 
ATOM   2231  C CB    . ASP A  1 308 ? -39.965 4.403   37.960  1.00 34.56  ? 336 ASP A CB    1 
ATOM   2232  C CG    . ASP A  1 308 ? -39.009 5.504   37.540  1.00 38.20  ? 336 ASP A CG    1 
ATOM   2233  O OD1   . ASP A  1 308 ? -38.627 6.336   38.395  1.00 40.17  ? 336 ASP A OD1   1 
ATOM   2234  O OD2   . ASP A  1 308 ? -38.649 5.546   36.345  1.00 31.82  ? 336 ASP A OD2   1 
ATOM   2235  N N     . ASN A  1 309 ? -40.810 1.908   39.947  1.00 32.91  ? 337 ASN A N     1 
ATOM   2236  C CA    . ASN A  1 309 ? -41.854 0.933   40.291  1.00 32.53  ? 337 ASN A CA    1 
ATOM   2237  C C     . ASN A  1 309 ? -41.976 0.590   41.778  1.00 34.59  ? 337 ASN A C     1 
ATOM   2238  O O     . ASN A  1 309 ? -42.735 -0.304  42.152  1.00 30.72  ? 337 ASN A O     1 
ATOM   2239  C CB    . ASN A  1 309 ? -41.664 -0.311  39.436  1.00 35.39  ? 337 ASN A CB    1 
ATOM   2240  C CG    . ASN A  1 309 ? -42.273 -0.135  38.079  1.00 42.93  ? 337 ASN A CG    1 
ATOM   2241  O OD1   . ASN A  1 309 ? -43.481 -0.288  37.922  1.00 53.63  ? 337 ASN A OD1   1 
ATOM   2242  N ND2   . ASN A  1 309 ? -41.462 0.261   37.102  1.00 45.72  ? 337 ASN A ND2   1 
ATOM   2243  N N     . LYS A  1 310 ? -41.256 1.340   42.613  1.00 30.36  ? 338 LYS A N     1 
ATOM   2244  C CA    . LYS A  1 310 ? -41.272 1.173   44.061  1.00 34.54  ? 338 LYS A CA    1 
ATOM   2245  C C     . LYS A  1 310 ? -40.740 -0.198  44.477  1.00 34.15  ? 338 LYS A C     1 
ATOM   2246  O O     . LYS A  1 310 ? -41.216 -0.790  45.428  1.00 34.44  ? 338 LYS A O     1 
ATOM   2247  C CB    . LYS A  1 310 ? -42.664 1.424   44.659  1.00 37.08  ? 338 LYS A CB    1 
ATOM   2248  C CG    . LYS A  1 310 ? -43.343 2.713   44.200  1.00 47.10  ? 338 LYS A CG    1 
ATOM   2249  C CD    . LYS A  1 310 ? -42.532 3.950   44.539  1.00 46.64  ? 338 LYS A CD    1 
ATOM   2250  N N     . LYS A  1 311 ? -39.730 -0.683  43.765  1.00 33.79  ? 339 LYS A N     1 
ATOM   2251  C CA    . LYS A  1 311 ? -39.051 -1.926  44.117  1.00 31.90  ? 339 LYS A CA    1 
ATOM   2252  C C     . LYS A  1 311 ? -37.645 -1.594  44.609  1.00 32.15  ? 339 LYS A C     1 
ATOM   2253  O O     . LYS A  1 311 ? -37.115 -0.553  44.266  1.00 33.11  ? 339 LYS A O     1 
ATOM   2254  C CB    . LYS A  1 311 ? -38.948 -2.851  42.894  1.00 31.98  ? 339 LYS A CB    1 
ATOM   2255  C CG    . LYS A  1 311 ? -40.243 -3.146  42.185  1.00 34.87  ? 339 LYS A CG    1 
ATOM   2256  C CD    . LYS A  1 311 ? -41.171 -3.981  43.024  1.00 41.52  ? 339 LYS A CD    1 
ATOM   2257  C CE    . LYS A  1 311 ? -42.456 -4.276  42.255  1.00 40.14  ? 339 LYS A CE    1 
ATOM   2258  N NZ    . LYS A  1 311 ? -43.295 -5.272  42.956  1.00 52.02  ? 339 LYS A NZ    1 
ATOM   2259  N N     . PRO A  1 312 ? -37.048 -2.479  45.423  1.00 32.00  ? 340 PRO A N     1 
ATOM   2260  C CA    . PRO A  1 312 ? -35.640 -2.369  45.842  1.00 32.34  ? 340 PRO A CA    1 
ATOM   2261  C C     . PRO A  1 312 ? -34.666 -2.224  44.669  1.00 27.69  ? 340 PRO A C     1 
ATOM   2262  O O     . PRO A  1 312 ? -34.831 -2.903  43.650  1.00 26.94  ? 340 PRO A O     1 
ATOM   2263  C CB    . PRO A  1 312 ? -35.384 -3.690  46.562  1.00 35.68  ? 340 PRO A CB    1 
ATOM   2264  C CG    . PRO A  1 312 ? -36.734 -4.178  46.996  1.00 34.45  ? 340 PRO A CG    1 
ATOM   2265  C CD    . PRO A  1 312 ? -37.726 -3.644  46.025  1.00 30.61  ? 340 PRO A CD    1 
ATOM   2266  N N     . PHE A  1 313 ? -33.672 -1.342  44.807  1.00 25.84  ? 341 PHE A N     1 
ATOM   2267  C CA    . PHE A  1 313 ? -32.743 -1.060  43.693  1.00 25.91  ? 341 PHE A CA    1 
ATOM   2268  C C     . PHE A  1 313 ? -31.322 -0.762  44.140  1.00 24.78  ? 341 PHE A C     1 
ATOM   2269  O O     . PHE A  1 313 ? -30.522 -0.282  43.316  1.00 26.20  ? 341 PHE A O     1 
ATOM   2270  C CB    . PHE A  1 313 ? -33.269 0.078   42.774  1.00 28.12  ? 341 PHE A CB    1 
ATOM   2271  C CG    . PHE A  1 313 ? -33.459 1.397   43.481  1.00 29.95  ? 341 PHE A CG    1 
ATOM   2272  C CD1   . PHE A  1 313 ? -32.431 2.327   43.551  1.00 28.38  ? 341 PHE A CD1   1 
ATOM   2273  C CD2   . PHE A  1 313 ? -34.662 1.696   44.096  1.00 25.87  ? 341 PHE A CD2   1 
ATOM   2274  C CE1   . PHE A  1 313 ? -32.597 3.538   44.238  1.00 27.65  ? 341 PHE A CE1   1 
ATOM   2275  C CE2   . PHE A  1 313 ? -34.840 2.905   44.776  1.00 26.36  ? 341 PHE A CE2   1 
ATOM   2276  C CZ    . PHE A  1 313 ? -33.806 3.825   44.845  1.00 33.47  ? 341 PHE A CZ    1 
ATOM   2277  N N     . ILE A  1 314 ? -30.986 -1.114  45.391  1.00 25.37  ? 342 ILE A N     1 
ATOM   2278  C CA    . ILE A  1 314 ? -29.656 -0.835  45.954  1.00 26.70  ? 342 ILE A CA    1 
ATOM   2279  C C     . ILE A  1 314 ? -28.568 -1.570  45.194  1.00 25.23  ? 342 ILE A C     1 
ATOM   2280  O O     . ILE A  1 314 ? -27.562 -0.978  44.768  1.00 25.74  ? 342 ILE A O     1 
ATOM   2281  C CB    . ILE A  1 314 ? -29.532 -1.245  47.444  1.00 24.93  ? 342 ILE A CB    1 
ATOM   2282  C CG1   . ILE A  1 314 ? -30.540 -0.479  48.310  1.00 32.82  ? 342 ILE A CG1   1 
ATOM   2283  C CG2   . ILE A  1 314 ? -28.113 -0.950  47.964  1.00 23.56  ? 342 ILE A CG2   1 
ATOM   2284  C CD1   . ILE A  1 314 ? -30.665 -1.024  49.704  1.00 32.06  ? 342 ILE A CD1   1 
ATOM   2285  N N     . LYS A  1 315 ? -28.747 -2.878  45.042  1.00 24.10  ? 343 LYS A N     1 
ATOM   2286  C CA    . LYS A  1 315 ? -27.765 -3.667  44.309  1.00 26.20  ? 343 LYS A CA    1 
ATOM   2287  C C     . LYS A  1 315 ? -27.680 -3.168  42.880  1.00 22.20  ? 343 LYS A C     1 
ATOM   2288  O O     . LYS A  1 315 ? -26.580 -2.986  42.328  1.00 18.91  ? 343 LYS A O     1 
ATOM   2289  C CB    . LYS A  1 315 ? -28.118 -5.156  44.323  1.00 27.01  ? 343 LYS A CB    1 
ATOM   2290  C CG    . LYS A  1 315 ? -27.040 -6.058  43.698  1.00 23.70  ? 343 LYS A CG    1 
ATOM   2291  C CD    . LYS A  1 315 ? -27.546 -7.470  43.447  1.00 31.36  ? 343 LYS A CD    1 
ATOM   2292  C CE    . LYS A  1 315 ? -28.531 -7.488  42.265  1.00 42.92  ? 343 LYS A CE    1 
ATOM   2293  N NZ    . LYS A  1 315 ? -29.246 -8.776  42.076  1.00 40.08  ? 343 LYS A NZ    1 
ATOM   2294  N N     . GLU A  1 316 ? -28.846 -2.908  42.298  1.00 20.74  ? 344 GLU A N     1 
ATOM   2295  C CA    . GLU A  1 316 ? -28.944 -2.580  40.876  1.00 22.85  ? 344 GLU A CA    1 
ATOM   2296  C C     . GLU A  1 316 ? -28.331 -1.203  40.601  1.00 24.11  ? 344 GLU A C     1 
ATOM   2297  O O     . GLU A  1 316 ? -27.553 -1.045  39.642  1.00 22.61  ? 344 GLU A O     1 
ATOM   2298  C CB    . GLU A  1 316 ? -30.402 -2.672  40.383  1.00 22.06  ? 344 GLU A CB    1 
ATOM   2299  C CG    . GLU A  1 316 ? -31.014 -4.092  40.447  1.00 28.44  ? 344 GLU A CG    1 
ATOM   2300  C CD    . GLU A  1 316 ? -31.530 -4.481  41.835  1.00 40.78  ? 344 GLU A CD    1 
ATOM   2301  O OE1   . GLU A  1 316 ? -31.210 -3.790  42.833  1.00 27.76  ? 344 GLU A OE1   1 
ATOM   2302  O OE2   . GLU A  1 316 ? -32.250 -5.500  41.928  1.00 39.69  ? 344 GLU A OE2   1 
ATOM   2303  N N     . ALA A  1 317 ? -28.617 -0.228  41.468  1.00 23.87  ? 345 ALA A N     1 
ATOM   2304  C CA    . ALA A  1 317 ? -27.961 1.099   41.369  1.00 25.11  ? 345 ALA A CA    1 
ATOM   2305  C C     . ALA A  1 317 ? -26.438 1.030   41.479  1.00 23.82  ? 345 ALA A C     1 
ATOM   2306  O O     . ALA A  1 317 ? -25.746 1.684   40.717  1.00 21.78  ? 345 ALA A O     1 
ATOM   2307  C CB    . ALA A  1 317 ? -28.516 2.069   42.409  1.00 24.94  ? 345 ALA A CB    1 
ATOM   2308  N N     . ALA A  1 318 ? -25.937 0.237   42.431  1.00 19.85  ? 346 ALA A N     1 
ATOM   2309  C CA    . ALA A  1 318 ? -24.507 0.001   42.599  1.00 20.28  ? 346 ALA A CA    1 
ATOM   2310  C C     . ALA A  1 318 ? -23.872 -0.661  41.358  1.00 20.01  ? 346 ALA A C     1 
ATOM   2311  O O     . ALA A  1 318 ? -22.798 -0.245  40.901  1.00 20.74  ? 346 ALA A O     1 
ATOM   2312  C CB    . ALA A  1 318 ? -24.243 -0.845  43.879  1.00 17.98  ? 346 ALA A CB    1 
ATOM   2313  N N     . MET A  1 319 ? -24.536 -1.674  40.802  1.00 19.34  ? 347 MET A N     1 
ATOM   2314  C CA    . MET A  1 319 ? -24.078 -2.314  39.540  1.00 26.36  ? 347 MET A CA    1 
ATOM   2315  C C     . MET A  1 319 ? -23.951 -1.326  38.359  1.00 20.67  ? 347 MET A C     1 
ATOM   2316  O O     . MET A  1 319 ? -22.936 -1.240  37.658  1.00 17.29  ? 347 MET A O     1 
ATOM   2317  C CB    . MET A  1 319 ? -25.034 -3.469  39.171  1.00 22.06  ? 347 MET A CB    1 
ATOM   2318  C CG    . MET A  1 319 ? -24.832 -4.716  40.006  1.00 28.77  ? 347 MET A CG    1 
ATOM   2319  S SD    . MET A  1 319 ? -25.532 -6.201  39.273  1.00 32.75  ? 347 MET A SD    1 
ATOM   2320  C CE    . MET A  1 319 ? -24.908 -7.456  40.403  1.00 26.15  ? 347 MET A CE    1 
ATOM   2321  N N     . ALA A  1 320 ? -24.980 -0.526  38.202  1.00 18.05  ? 348 ALA A N     1 
ATOM   2322  C CA    . ALA A  1 320 ? -25.039 0.503   37.165  1.00 21.91  ? 348 ALA A CA    1 
ATOM   2323  C C     . ALA A  1 320 ? -23.947 1.557   37.305  1.00 19.64  ? 348 ALA A C     1 
ATOM   2324  O O     . ALA A  1 320 ? -23.241 1.860   36.339  1.00 18.30  ? 348 ALA A O     1 
ATOM   2325  C CB    . ALA A  1 320 ? -26.445 1.153   37.190  1.00 18.83  ? 348 ALA A CB    1 
ATOM   2326  N N     . LYS A  1 321 ? -23.796 2.121   38.506  1.00 22.06  ? 349 LYS A N     1 
ATOM   2327  C CA    . LYS A  1 321 ? -22.745 3.113   38.734  1.00 20.92  ? 349 LYS A CA    1 
ATOM   2328  C C     . LYS A  1 321 ? -21.339 2.525   38.529  1.00 21.30  ? 349 LYS A C     1 
ATOM   2329  O O     . LYS A  1 321 ? -20.442 3.157   37.920  1.00 20.59  ? 349 LYS A O     1 
ATOM   2330  C CB    . LYS A  1 321 ? -22.920 3.742   40.131  1.00 20.06  ? 349 LYS A CB    1 
ATOM   2331  C CG    . LYS A  1 321 ? -22.107 5.011   40.381  1.00 20.07  ? 349 LYS A CG    1 
ATOM   2332  C CD    . LYS A  1 321 ? -20.726 4.698   40.909  1.00 22.84  ? 349 LYS A CD    1 
ATOM   2333  C CE    . LYS A  1 321 ? -20.065 5.947   41.418  1.00 27.36  ? 349 LYS A CE    1 
ATOM   2334  N NZ    . LYS A  1 321 ? -18.657 5.710   41.743  1.00 25.84  ? 349 LYS A NZ    1 
ATOM   2335  N N     . LEU A  1 322 ? -21.158 1.321   39.053  1.00 21.37  ? 350 LEU A N     1 
ATOM   2336  C CA    . LEU A  1 322 ? -19.933 0.585   38.879  1.00 24.50  ? 350 LEU A CA    1 
ATOM   2337  C C     . LEU A  1 322 ? -19.666 0.319   37.392  1.00 21.29  ? 350 LEU A C     1 
ATOM   2338  O O     . LEU A  1 322 ? -18.636 0.687   36.903  1.00 16.43  ? 350 LEU A O     1 
ATOM   2339  C CB    . LEU A  1 322 ? -19.978 -0.727  39.690  1.00 19.40  ? 350 LEU A CB    1 
ATOM   2340  C CG    . LEU A  1 322 ? -18.701 -1.589  39.609  1.00 20.95  ? 350 LEU A CG    1 
ATOM   2341  C CD1   . LEU A  1 322 ? -17.446 -0.773  39.951  1.00 20.79  ? 350 LEU A CD1   1 
ATOM   2342  C CD2   . LEU A  1 322 ? -18.794 -2.793  40.525  1.00 21.93  ? 350 LEU A CD2   1 
ATOM   2343  N N     . ALA A  1 323 ? -20.599 -0.295  36.671  1.00 19.71  ? 351 ALA A N     1 
ATOM   2344  C CA    . ALA A  1 323 ? -20.355 -0.630  35.261  1.00 18.21  ? 351 ALA A CA    1 
ATOM   2345  C C     . ALA A  1 323 ? -20.142 0.597   34.381  1.00 20.95  ? 351 ALA A C     1 
ATOM   2346  O O     . ALA A  1 323 ? -19.259 0.594   33.524  1.00 19.85  ? 351 ALA A O     1 
ATOM   2347  C CB    . ALA A  1 323 ? -21.485 -1.493  34.684  1.00 18.98  ? 351 ALA A CB    1 
ATOM   2348  N N     . ALA A  1 324 ? -20.938 1.641   34.613  1.00 22.77  ? 352 ALA A N     1 
ATOM   2349  C CA    . ALA A  1 324 ? -20.898 2.850   33.793  1.00 22.79  ? 352 ALA A CA    1 
ATOM   2350  C C     . ALA A  1 324 ? -19.580 3.621   33.984  1.00 22.72  ? 352 ALA A C     1 
ATOM   2351  O O     . ALA A  1 324 ? -18.917 4.019   33.007  1.00 21.91  ? 352 ALA A O     1 
ATOM   2352  C CB    . ALA A  1 324 ? -22.149 3.727   34.080  1.00 15.89  ? 352 ALA A CB    1 
ATOM   2353  N N     . SER A  1 325 ? -19.157 3.741   35.242  1.00 19.61  ? 353 SER A N     1 
ATOM   2354  C CA    . SER A  1 325 ? -17.999 4.523   35.587  1.00 20.38  ? 353 SER A CA    1 
ATOM   2355  C C     . SER A  1 325 ? -16.754 3.846   35.054  1.00 18.31  ? 353 SER A C     1 
ATOM   2356  O O     . SER A  1 325 ? -15.862 4.525   34.539  1.00 17.82  ? 353 SER A O     1 
ATOM   2357  C CB    . SER A  1 325 ? -17.891 4.745   37.112  1.00 19.10  ? 353 SER A CB    1 
ATOM   2358  O OG    . SER A  1 325 ? -17.775 3.517   37.833  1.00 21.55  ? 353 SER A OG    1 
ATOM   2359  N N     . GLU A  1 326 ? -16.689 2.524   35.161  1.00 17.25  ? 354 GLU A N     1 
ATOM   2360  C CA    . GLU A  1 326 ? -15.499 1.815   34.639  1.00 22.75  ? 354 GLU A CA    1 
ATOM   2361  C C     . GLU A  1 326 ? -15.493 1.805   33.113  1.00 24.17  ? 354 GLU A C     1 
ATOM   2362  O O     . GLU A  1 326 ? -14.426 1.901   32.505  1.00 17.65  ? 354 GLU A O     1 
ATOM   2363  C CB    . GLU A  1 326 ? -15.366 0.408   35.237  1.00 24.04  ? 354 GLU A CB    1 
ATOM   2364  C CG    . GLU A  1 326 ? -14.915 0.496   36.675  1.00 28.02  ? 354 GLU A CG    1 
ATOM   2365  C CD    . GLU A  1 326 ? -14.522 -0.821  37.318  1.00 35.07  ? 354 GLU A CD    1 
ATOM   2366  O OE1   . GLU A  1 326 ? -14.909 -1.897  36.817  1.00 35.26  ? 354 GLU A OE1   1 
ATOM   2367  O OE2   . GLU A  1 326 ? -13.824 -0.756  38.348  1.00 31.29  ? 354 GLU A OE2   1 
ATOM   2368  N N     . ALA A  1 327 ? -16.682 1.722   32.497  1.00 19.46  ? 355 ALA A N     1 
ATOM   2369  C CA    . ALA A  1 327 ? -16.804 1.863   31.033  1.00 24.54  ? 355 ALA A CA    1 
ATOM   2370  C C     . ALA A  1 327 ? -16.377 3.252   30.528  1.00 22.58  ? 355 ALA A C     1 
ATOM   2371  O O     . ALA A  1 327 ? -15.649 3.357   29.555  1.00 19.34  ? 355 ALA A O     1 
ATOM   2372  C CB    . ALA A  1 327 ? -18.272 1.521   30.534  1.00 15.44  ? 355 ALA A CB    1 
ATOM   2373  N N     . ALA A  1 328 ? -16.828 4.303   31.203  1.00 20.37  ? 356 ALA A N     1 
ATOM   2374  C CA    . ALA A  1 328 ? -16.435 5.667   30.854  1.00 22.94  ? 356 ALA A CA    1 
ATOM   2375  C C     . ALA A  1 328 ? -14.918 5.844   30.858  1.00 20.69  ? 356 ALA A C     1 
ATOM   2376  O O     . ALA A  1 328 ? -14.360 6.435   29.937  1.00 21.27  ? 356 ALA A O     1 
ATOM   2377  C CB    . ALA A  1 328 ? -17.094 6.669   31.764  1.00 24.76  ? 356 ALA A CB    1 
ATOM   2378  N N     . THR A  1 329 ? -14.244 5.313   31.870  1.00 20.36  ? 357 THR A N     1 
ATOM   2379  C CA    . THR A  1 329 ? -12.784 5.397   31.914  1.00 24.34  ? 357 THR A CA    1 
ATOM   2380  C C     . THR A  1 329 ? -12.083 4.546   30.821  1.00 21.36  ? 357 THR A C     1 
ATOM   2381  O O     . THR A  1 329 ? -11.099 5.016   30.172  1.00 20.43  ? 357 THR A O     1 
ATOM   2382  C CB    . THR A  1 329 ? -12.242 5.065   33.337  1.00 27.63  ? 357 THR A CB    1 
ATOM   2383  O OG1   . THR A  1 329 ? -12.393 6.215   34.193  1.00 27.23  ? 357 THR A OG1   1 
ATOM   2384  C CG2   . THR A  1 329 ? -10.804 4.643   33.281  1.00 18.75  ? 357 THR A CG2   1 
ATOM   2385  N N     . ALA A  1 330 ? -12.523 3.299   30.650  1.00 19.79  ? 358 ALA A N     1 
ATOM   2386  C CA    . ALA A  1 330 ? -12.000 2.440   29.568  1.00 20.60  ? 358 ALA A CA    1 
ATOM   2387  C C     . ALA A  1 330 ? -12.297 3.021   28.160  1.00 20.93  ? 358 ALA A C     1 
ATOM   2388  O O     . ALA A  1 330 ? -11.449 3.037   27.286  1.00 17.72  ? 358 ALA A O     1 
ATOM   2389  C CB    . ALA A  1 330 ? -12.562 1.012   29.677  1.00 16.06  ? 358 ALA A CB    1 
ATOM   2390  N N     . ILE A  1 331 ? -13.514 3.493   27.946  1.00 17.54  ? 359 ILE A N     1 
ATOM   2391  C CA    . ILE A  1 331 ? -13.882 4.034   26.642  1.00 20.84  ? 359 ILE A CA    1 
ATOM   2392  C C     . ILE A  1 331 ? -13.116 5.318   26.316  1.00 22.56  ? 359 ILE A C     1 
ATOM   2393  O O     . ILE A  1 331 ? -12.689 5.501   25.178  1.00 20.29  ? 359 ILE A O     1 
ATOM   2394  C CB    . ILE A  1 331 ? -15.402 4.239   26.542  1.00 19.12  ? 359 ILE A CB    1 
ATOM   2395  C CG1   . ILE A  1 331 ? -16.082 2.867   26.508  1.00 18.70  ? 359 ILE A CG1   1 
ATOM   2396  C CG2   . ILE A  1 331 ? -15.724 5.092   25.328  1.00 22.11  ? 359 ILE A CG2   1 
ATOM   2397  C CD1   . ILE A  1 331 ? -17.607 2.878   26.841  1.00 16.52  ? 359 ILE A CD1   1 
ATOM   2398  N N     . SER A  1 332 ? -12.888 6.167   27.326  1.00 20.70  ? 360 SER A N     1 
ATOM   2399  C CA    . SER A  1 332 ? -12.218 7.441   27.113  1.00 19.92  ? 360 SER A CA    1 
ATOM   2400  C C     . SER A  1 332 ? -10.731 7.197   26.898  1.00 19.66  ? 360 SER A C     1 
ATOM   2401  O O     . SER A  1 332 ? -10.081 7.861   26.093  1.00 21.22  ? 360 SER A O     1 
ATOM   2402  C CB    . SER A  1 332 ? -12.476 8.396   28.307  1.00 19.16  ? 360 SER A CB    1 
ATOM   2403  O OG    . SER A  1 332 ? -11.855 7.947   29.507  1.00 25.32  ? 360 SER A OG    1 
ATOM   2404  N N     . HIS A  1 333 ? -10.211 6.209   27.604  1.00 18.26  ? 361 HIS A N     1 
ATOM   2405  C CA    . HIS A  1 333 ? -8.833  5.793   27.397  1.00 22.68  ? 361 HIS A CA    1 
ATOM   2406  C C     . HIS A  1 333 ? -8.602  5.314   25.938  1.00 20.00  ? 361 HIS A C     1 
ATOM   2407  O O     . HIS A  1 333 ? -7.673  5.755   25.247  1.00 19.81  ? 361 HIS A O     1 
ATOM   2408  C CB    . HIS A  1 333 ? -8.440  4.715   28.411  1.00 20.49  ? 361 HIS A CB    1 
ATOM   2409  C CG    . HIS A  1 333 ? -7.021  4.280   28.248  1.00 19.90  ? 361 HIS A CG    1 
ATOM   2410  N ND1   . HIS A  1 333 ? -6.637  3.367   27.290  1.00 23.07  ? 361 HIS A ND1   1 
ATOM   2411  C CD2   . HIS A  1 333 ? -5.887  4.704   28.844  1.00 22.66  ? 361 HIS A CD2   1 
ATOM   2412  C CE1   . HIS A  1 333 ? -5.323  3.225   27.320  1.00 26.96  ? 361 HIS A CE1   1 
ATOM   2413  N NE2   . HIS A  1 333 ? -4.841  4.021   28.259  1.00 18.40  ? 361 HIS A NE2   1 
ATOM   2414  N N     . GLN A  1 334 ? -9.466  4.429   25.470  1.00 23.70  ? 362 GLN A N     1 
ATOM   2415  C CA    . GLN A  1 334 ? -9.399  3.960   24.074  1.00 21.32  ? 362 GLN A CA    1 
ATOM   2416  C C     . GLN A  1 334 ? -9.726  5.016   23.009  1.00 22.02  ? 362 GLN A C     1 
ATOM   2417  O O     . GLN A  1 334 ? -9.219  4.915   21.904  1.00 21.31  ? 362 GLN A O     1 
ATOM   2418  C CB    . GLN A  1 334 ? -10.243 2.698   23.885  1.00 24.70  ? 362 GLN A CB    1 
ATOM   2419  C CG    . GLN A  1 334 ? -9.675  1.490   24.626  1.00 28.29  ? 362 GLN A CG    1 
ATOM   2420  C CD    . GLN A  1 334 ? -8.279  1.131   24.153  1.00 35.79  ? 362 GLN A CD    1 
ATOM   2421  O OE1   . GLN A  1 334 ? -8.111  0.620   23.064  1.00 34.63  ? 362 GLN A OE1   1 
ATOM   2422  N NE2   . GLN A  1 334 ? -7.269  1.423   24.971  1.00 40.11  ? 362 GLN A NE2   1 
ATOM   2423  N N     . ALA A  1 335 ? -10.565 6.008   23.327  1.00 21.25  ? 363 ALA A N     1 
ATOM   2424  C CA    . ALA A  1 335 ? -10.753 7.159   22.435  1.00 23.53  ? 363 ALA A CA    1 
ATOM   2425  C C     . ALA A  1 335 ? -9.443  7.941   22.216  1.00 23.83  ? 363 ALA A C     1 
ATOM   2426  O O     . ALA A  1 335 ? -9.097  8.282   21.078  1.00 23.09  ? 363 ALA A O     1 
ATOM   2427  C CB    . ALA A  1 335 ? -11.827 8.074   22.960  1.00 23.05  ? 363 ALA A CB    1 
ATOM   2428  N N     . ILE A  1 336 ? -8.728  8.224   23.301  1.00 20.11  ? 364 ILE A N     1 
ATOM   2429  C CA    . ILE A  1 336 ? -7.402  8.815   23.181  1.00 21.40  ? 364 ILE A CA    1 
ATOM   2430  C C     . ILE A  1 336 ? -6.497  7.940   22.284  1.00 19.89  ? 364 ILE A C     1 
ATOM   2431  O O     . ILE A  1 336 ? -5.828  8.467   21.382  1.00 20.67  ? 364 ILE A O     1 
ATOM   2432  C CB    . ILE A  1 336 ? -6.724  9.056   24.561  1.00 21.37  ? 364 ILE A CB    1 
ATOM   2433  C CG1   . ILE A  1 336 ? -7.473  10.119  25.367  1.00 23.08  ? 364 ILE A CG1   1 
ATOM   2434  C CG2   . ILE A  1 336 ? -5.316  9.574   24.375  1.00 15.83  ? 364 ILE A CG2   1 
ATOM   2435  C CD1   . ILE A  1 336 ? -6.850  10.429  26.780  1.00 20.72  ? 364 ILE A CD1   1 
ATOM   2436  N N     . GLN A  1 337 ? -6.468  6.624   22.526  1.00 19.56  ? 365 GLN A N     1 
ATOM   2437  C CA    . GLN A  1 337 ? -5.554  5.755   21.777  1.00 20.99  ? 365 GLN A CA    1 
ATOM   2438  C C     . GLN A  1 337 ? -5.850  5.804   20.279  1.00 21.46  ? 365 GLN A C     1 
ATOM   2439  O O     . GLN A  1 337 ? -4.932  5.906   19.494  1.00 20.52  ? 365 GLN A O     1 
ATOM   2440  C CB    . GLN A  1 337 ? -5.544  4.298   22.283  1.00 22.45  ? 365 GLN A CB    1 
ATOM   2441  C CG    . GLN A  1 337 ? -4.335  3.515   21.826  1.00 23.13  ? 365 GLN A CG    1 
ATOM   2442  C CD    . GLN A  1 337 ? -3.035  3.957   22.506  1.00 19.85  ? 365 GLN A CD    1 
ATOM   2443  O OE1   . GLN A  1 337 ? -3.042  4.778   23.430  1.00 20.53  ? 365 GLN A OE1   1 
ATOM   2444  N NE2   . GLN A  1 337 ? -1.914  3.428   22.037  1.00 24.92  ? 365 GLN A NE2   1 
ATOM   2445  N N     . ILE A  1 338 ? -7.131  5.764   19.906  1.00 23.19  ? 366 ILE A N     1 
ATOM   2446  C CA    . ILE A  1 338 ? -7.537  5.800   18.504  1.00 22.88  ? 366 ILE A CA    1 
ATOM   2447  C C     . ILE A  1 338 ? -7.130  7.125   17.824  1.00 20.73  ? 366 ILE A C     1 
ATOM   2448  O O     . ILE A  1 338 ? -6.723  7.111   16.676  1.00 20.93  ? 366 ILE A O     1 
ATOM   2449  C CB    . ILE A  1 338 ? -9.054  5.485   18.359  1.00 20.98  ? 366 ILE A CB    1 
ATOM   2450  C CG1   . ILE A  1 338 ? -9.294  3.994   18.641  1.00 24.38  ? 366 ILE A CG1   1 
ATOM   2451  C CG2   . ILE A  1 338 ? -9.576  5.863   16.950  1.00 27.15  ? 366 ILE A CG2   1 
ATOM   2452  C CD1   . ILE A  1 338 ? -10.776 3.621   19.108  1.00 14.22  ? 366 ILE A CD1   1 
ATOM   2453  N N     . LEU A  1 339 ? -7.168  8.245   18.551  1.00 21.58  ? 367 LEU A N     1 
ATOM   2454  C CA    . LEU A  1 339 ? -6.753  9.558   18.001  1.00 23.02  ? 367 LEU A CA    1 
ATOM   2455  C C     . LEU A  1 339 ? -5.235  9.683   17.891  1.00 21.42  ? 367 LEU A C     1 
ATOM   2456  O O     . LEU A  1 339 ? -4.715  10.539  17.173  1.00 22.97  ? 367 LEU A O     1 
ATOM   2457  C CB    . LEU A  1 339 ? -7.311  10.714  18.834  1.00 23.67  ? 367 LEU A CB    1 
ATOM   2458  C CG    . LEU A  1 339 ? -8.719  11.192  18.448  1.00 20.04  ? 367 LEU A CG    1 
ATOM   2459  C CD1   . LEU A  1 339 ? -9.753  10.031  18.439  1.00 22.68  ? 367 LEU A CD1   1 
ATOM   2460  C CD2   . LEU A  1 339 ? -9.168  12.325  19.360  1.00 23.45  ? 367 LEU A CD2   1 
ATOM   2461  N N     . GLY A  1 340 ? -4.516  8.818   18.580  1.00 25.13  ? 368 GLY A N     1 
ATOM   2462  C CA    . GLY A  1 340 ? -3.055  8.906   18.573  1.00 24.26  ? 368 GLY A CA    1 
ATOM   2463  C C     . GLY A  1 340 ? -2.624  10.219  19.212  1.00 23.81  ? 368 GLY A C     1 
ATOM   2464  O O     . GLY A  1 340 ? -3.134  10.580  20.264  1.00 22.39  ? 368 GLY A O     1 
ATOM   2465  N N     . GLY A  1 341 ? -1.704  10.941  18.563  1.00 24.40  ? 369 GLY A N     1 
ATOM   2466  C CA    . GLY A  1 341 ? -1.223  12.260  19.057  1.00 22.86  ? 369 GLY A CA    1 
ATOM   2467  C C     . GLY A  1 341 ? -2.330  13.285  19.308  1.00 25.85  ? 369 GLY A C     1 
ATOM   2468  O O     . GLY A  1 341 ? -2.322  14.018  20.309  1.00 23.78  ? 369 GLY A O     1 
ATOM   2469  N N     . MET A  1 342 ? -3.304  13.333  18.408  1.00 23.60  ? 370 MET A N     1 
ATOM   2470  C CA    . MET A  1 342 ? -4.426  14.249  18.579  1.00 24.00  ? 370 MET A CA    1 
ATOM   2471  C C     . MET A  1 342 ? -5.218  13.977  19.863  1.00 23.66  ? 370 MET A C     1 
ATOM   2472  O O     . MET A  1 342 ? -5.876  14.880  20.390  1.00 26.03  ? 370 MET A O     1 
ATOM   2473  C CB    . MET A  1 342 ? -5.332  14.195  17.355  1.00 24.51  ? 370 MET A CB    1 
ATOM   2474  C CG    . MET A  1 342 ? -4.698  14.826  16.122  1.00 36.52  ? 370 MET A CG    1 
ATOM   2475  S SD    . MET A  1 342 ? -4.349  16.590  16.310  1.00 31.34  ? 370 MET A SD    1 
ATOM   2476  C CE    . MET A  1 342 ? -6.011  17.213  16.582  1.00 31.69  ? 370 MET A CE    1 
ATOM   2477  N N     . GLY A  1 343 ? -5.125  12.744  20.374  1.00 27.58  ? 371 GLY A N     1 
ATOM   2478  C CA    . GLY A  1 343 ? -5.785  12.366  21.614  1.00 28.54  ? 371 GLY A CA    1 
ATOM   2479  C C     . GLY A  1 343 ? -5.158  12.989  22.842  1.00 25.67  ? 371 GLY A C     1 
ATOM   2480  O O     . GLY A  1 343 ? -5.797  13.087  23.879  1.00 25.81  ? 371 GLY A O     1 
ATOM   2481  N N     . TYR A  1 344 ? -3.898  13.404  22.724  1.00 20.74  ? 372 TYR A N     1 
ATOM   2482  C CA    . TYR A  1 344 ? -3.178  13.989  23.844  1.00 24.05  ? 372 TYR A CA    1 
ATOM   2483  C C     . TYR A  1 344 ? -3.258  15.513  23.983  1.00 25.69  ? 372 TYR A C     1 
ATOM   2484  O O     . TYR A  1 344 ? -2.723  16.051  24.954  1.00 23.40  ? 372 TYR A O     1 
ATOM   2485  C CB    . TYR A  1 344 ? -1.718  13.580  23.758  1.00 22.95  ? 372 TYR A CB    1 
ATOM   2486  C CG    . TYR A  1 344 ? -0.995  13.522  25.088  1.00 26.05  ? 372 TYR A CG    1 
ATOM   2487  C CD1   . TYR A  1 344 ? -1.364  12.589  26.062  1.00 21.34  ? 372 TYR A CD1   1 
ATOM   2488  C CD2   . TYR A  1 344 ? 0.098   14.374  25.353  1.00 23.62  ? 372 TYR A CD2   1 
ATOM   2489  C CE1   . TYR A  1 344 ? -0.685  12.508  27.261  1.00 23.69  ? 372 TYR A CE1   1 
ATOM   2490  C CE2   . TYR A  1 344 ? 0.787   14.308  26.558  1.00 20.19  ? 372 TYR A CE2   1 
ATOM   2491  C CZ    . TYR A  1 344 ? 0.396   13.371  27.507  1.00 19.78  ? 372 TYR A CZ    1 
ATOM   2492  O OH    . TYR A  1 344 ? 1.043   13.262  28.700  1.00 23.93  ? 372 TYR A OH    1 
ATOM   2493  N N     . VAL A  1 345 ? -3.936  16.197  23.053  1.00 25.46  ? 373 VAL A N     1 
ATOM   2494  C CA    . VAL A  1 345 ? -3.952  17.651  23.036  1.00 23.33  ? 373 VAL A CA    1 
ATOM   2495  C C     . VAL A  1 345 ? -5.362  18.182  23.168  1.00 22.97  ? 373 VAL A C     1 
ATOM   2496  O O     . VAL A  1 345 ? -6.326  17.494  22.839  1.00 26.91  ? 373 VAL A O     1 
ATOM   2497  C CB    . VAL A  1 345 ? -3.266  18.250  21.785  1.00 24.84  ? 373 VAL A CB    1 
ATOM   2498  C CG1   . VAL A  1 345 ? -1.786  17.904  21.768  1.00 24.26  ? 373 VAL A CG1   1 
ATOM   2499  C CG2   . VAL A  1 345 ? -3.968  17.793  20.471  1.00 21.95  ? 373 VAL A CG2   1 
ATOM   2500  N N     . THR A  1 346 ? -5.460  19.409  23.686  1.00 26.59  ? 374 THR A N     1 
ATOM   2501  C CA    . THR A  1 346 ? -6.742  20.004  24.040  1.00 27.19  ? 374 THR A CA    1 
ATOM   2502  C C     . THR A  1 346 ? -7.550  20.416  22.796  1.00 29.30  ? 374 THR A C     1 
ATOM   2503  O O     . THR A  1 346 ? -8.731  20.737  22.892  1.00 32.22  ? 374 THR A O     1 
ATOM   2504  C CB    . THR A  1 346 ? -6.561  21.228  24.975  1.00 29.61  ? 374 THR A CB    1 
ATOM   2505  O OG1   . THR A  1 346 ? -5.747  22.206  24.326  1.00 32.48  ? 374 THR A OG1   1 
ATOM   2506  C CG2   . THR A  1 346 ? -5.894  20.825  26.294  1.00 29.74  ? 374 THR A CG2   1 
ATOM   2507  N N     . GLU A  1 347 ? -6.909  20.424  21.636  1.00 30.06  ? 375 GLU A N     1 
ATOM   2508  C CA    . GLU A  1 347 ? -7.593  20.682  20.382  1.00 35.18  ? 375 GLU A CA    1 
ATOM   2509  C C     . GLU A  1 347 ? -8.717  19.696  20.114  1.00 33.44  ? 375 GLU A C     1 
ATOM   2510  O O     . GLU A  1 347 ? -9.709  20.044  19.491  1.00 34.32  ? 375 GLU A O     1 
ATOM   2511  C CB    . GLU A  1 347 ? -6.608  20.616  19.235  1.00 38.24  ? 375 GLU A CB    1 
ATOM   2512  C CG    . GLU A  1 347 ? -7.258  20.876  17.890  1.00 54.36  ? 375 GLU A CG    1 
ATOM   2513  C CD    . GLU A  1 347 ? -6.312  21.502  16.915  1.00 64.06  ? 375 GLU A CD    1 
ATOM   2514  O OE1   . GLU A  1 347 ? -6.606  21.455  15.697  1.00 71.55  ? 375 GLU A OE1   1 
ATOM   2515  O OE2   . GLU A  1 347 ? -5.284  22.048  17.379  1.00 51.64  ? 375 GLU A OE2   1 
ATOM   2516  N N     . MET A  1 348 ? -8.543  18.461  20.563  1.00 30.81  ? 376 MET A N     1 
ATOM   2517  C CA    . MET A  1 348 ? -9.622  17.478  20.549  1.00 27.19  ? 376 MET A CA    1 
ATOM   2518  C C     . MET A  1 348 ? -10.162 17.290  21.956  1.00 27.46  ? 376 MET A C     1 
ATOM   2519  O O     . MET A  1 348 ? -9.449  17.542  22.930  1.00 30.57  ? 376 MET A O     1 
ATOM   2520  C CB    . MET A  1 348 ? -9.093  16.164  19.991  1.00 27.47  ? 376 MET A CB    1 
ATOM   2521  C CG    . MET A  1 348 ? -8.591  16.269  18.560  1.00 33.74  ? 376 MET A CG    1 
ATOM   2522  S SD    . MET A  1 348 ? -9.948  16.529  17.408  1.00 36.29  ? 376 MET A SD    1 
ATOM   2523  C CE    . MET A  1 348 ? -10.812 14.959  17.484  1.00 37.15  ? 376 MET A CE    1 
ATOM   2524  N N     . PRO A  1 349 ? -11.419 16.831  22.074  1.00 24.82  ? 377 PRO A N     1 
ATOM   2525  C CA    . PRO A  1 349 ? -12.122 16.677  23.349  1.00 25.50  ? 377 PRO A CA    1 
ATOM   2526  C C     . PRO A  1 349 ? -11.832 15.411  24.157  1.00 24.52  ? 377 PRO A C     1 
ATOM   2527  O O     . PRO A  1 349 ? -12.292 15.320  25.292  1.00 20.85  ? 377 PRO A O     1 
ATOM   2528  C CB    . PRO A  1 349 ? -13.589 16.677  22.907  1.00 27.30  ? 377 PRO A CB    1 
ATOM   2529  C CG    . PRO A  1 349 ? -13.567 16.012  21.598  1.00 24.49  ? 377 PRO A CG    1 
ATOM   2530  C CD    . PRO A  1 349 ? -12.288 16.459  20.939  1.00 26.34  ? 377 PRO A CD    1 
ATOM   2531  N N     . ALA A  1 350 ? -11.065 14.474  23.582  1.00 27.31  ? 378 ALA A N     1 
ATOM   2532  C CA    . ALA A  1 350 ? -10.802 13.165  24.179  1.00 27.46  ? 378 ALA A CA    1 
ATOM   2533  C C     . ALA A  1 350 ? -10.048 13.231  25.516  1.00 24.49  ? 378 ALA A C     1 
ATOM   2534  O O     . ALA A  1 350 ? -10.361 12.496  26.440  1.00 20.23  ? 378 ALA A O     1 
ATOM   2535  C CB    . ALA A  1 350 ? -10.024 12.232  23.173  1.00 18.68  ? 378 ALA A CB    1 
ATOM   2536  N N     . GLU A  1 351 ? -9.040  14.086  25.612  1.00 26.25  ? 379 GLU A N     1 
ATOM   2537  C CA    . GLU A  1 351 ? -8.297  14.194  26.871  1.00 25.74  ? 379 GLU A CA    1 
ATOM   2538  C C     . GLU A  1 351 ? -9.209  14.735  28.005  1.00 23.08  ? 379 GLU A C     1 
ATOM   2539  O O     . GLU A  1 351 ? -9.145  14.296  29.150  1.00 23.53  ? 379 GLU A O     1 
ATOM   2540  C CB    . GLU A  1 351 ? -6.980  14.974  26.662  1.00 26.53  ? 379 GLU A CB    1 
ATOM   2541  C CG    . GLU A  1 351 ? -7.128  16.448  26.272  1.00 29.73  ? 379 GLU A CG    1 
ATOM   2542  C CD    . GLU A  1 351 ? -7.378  17.365  27.486  1.00 38.11  ? 379 GLU A CD    1 
ATOM   2543  O OE1   . GLU A  1 351 ? -8.275  18.248  27.411  1.00 30.10  ? 379 GLU A OE1   1 
ATOM   2544  O OE2   . GLU A  1 351 ? -6.686  17.199  28.518  1.00 28.16  ? 379 GLU A OE2   1 
ATOM   2545  N N     . ARG A  1 352 ? -10.143 15.605  27.665  1.00 21.49  ? 380 ARG A N     1 
ATOM   2546  C CA    . ARG A  1 352 ? -11.095 16.088  28.628  1.00 23.97  ? 380 ARG A CA    1 
ATOM   2547  C C     . ARG A  1 352 ? -12.070 14.990  29.076  1.00 23.64  ? 380 ARG A C     1 
ATOM   2548  O O     . ARG A  1 352 ? -12.410 14.882  30.264  1.00 23.07  ? 380 ARG A O     1 
ATOM   2549  C CB    . ARG A  1 352 ? -11.850 17.272  28.040  1.00 24.51  ? 380 ARG A CB    1 
ATOM   2550  C CG    . ARG A  1 352 ? -12.755 17.967  29.003  1.00 30.23  ? 380 ARG A CG    1 
ATOM   2551  C CD    . ARG A  1 352 ? -13.505 19.086  28.320  1.00 29.74  ? 380 ARG A CD    1 
ATOM   2552  N NE    . ARG A  1 352 ? -14.845 18.615  28.006  1.00 40.62  ? 380 ARG A NE    1 
ATOM   2553  C CZ    . ARG A  1 352 ? -15.400 18.565  26.805  1.00 35.32  ? 380 ARG A CZ    1 
ATOM   2554  N NH1   . ARG A  1 352 ? -16.624 18.068  26.718  1.00 38.99  ? 380 ARG A NH1   1 
ATOM   2555  N NH2   . ARG A  1 352 ? -14.771 18.982  25.708  1.00 35.71  ? 380 ARG A NH2   1 
ATOM   2556  N N     . HIS A  1 353 ? -12.516 14.166  28.139  1.00 24.33  ? 381 HIS A N     1 
ATOM   2557  C CA    . HIS A  1 353 ? -13.402 13.048  28.489  1.00 24.06  ? 381 HIS A CA    1 
ATOM   2558  C C     . HIS A  1 353 ? -12.697 12.061  29.445  1.00 21.53  ? 381 HIS A C     1 
ATOM   2559  O O     . HIS A  1 353 ? -13.336 11.532  30.328  1.00 21.38  ? 381 HIS A O     1 
ATOM   2560  C CB    . HIS A  1 353 ? -13.884 12.283  27.249  1.00 22.74  ? 381 HIS A CB    1 
ATOM   2561  C CG    . HIS A  1 353 ? -14.598 13.118  26.229  1.00 21.11  ? 381 HIS A CG    1 
ATOM   2562  N ND1   . HIS A  1 353 ? -15.483 14.119  26.560  1.00 29.04  ? 381 HIS A ND1   1 
ATOM   2563  C CD2   . HIS A  1 353 ? -14.565 13.079  24.873  1.00 26.30  ? 381 HIS A CD2   1 
ATOM   2564  C CE1   . HIS A  1 353 ? -15.969 14.662  25.457  1.00 27.62  ? 381 HIS A CE1   1 
ATOM   2565  N NE2   . HIS A  1 353 ? -15.437 14.043  24.416  1.00 27.06  ? 381 HIS A NE2   1 
ATOM   2566  N N     . TYR A  1 354 ? -11.380 11.856  29.263  1.00 17.18  ? 382 TYR A N     1 
ATOM   2567  C CA    . TYR A  1 354 ? -10.579 10.961  30.097  1.00 22.58  ? 382 TYR A CA    1 
ATOM   2568  C C     . TYR A  1 354 ? -10.470 11.511  31.534  1.00 23.21  ? 382 TYR A C     1 
ATOM   2569  O O     . TYR A  1 354 ? -10.565 10.758  32.490  1.00 20.56  ? 382 TYR A O     1 
ATOM   2570  C CB    . TYR A  1 354 ? -9.190  10.774  29.433  1.00 21.77  ? 382 TYR A CB    1 
ATOM   2571  C CG    . TYR A  1 354 ? -8.203  9.760   30.025  1.00 23.11  ? 382 TYR A CG    1 
ATOM   2572  C CD1   . TYR A  1 354 ? -8.531  8.409   30.200  1.00 26.25  ? 382 TYR A CD1   1 
ATOM   2573  C CD2   . TYR A  1 354 ? -6.902  10.149  30.337  1.00 26.88  ? 382 TYR A CD2   1 
ATOM   2574  C CE1   . TYR A  1 354 ? -7.559  7.487   30.720  1.00 23.05  ? 382 TYR A CE1   1 
ATOM   2575  C CE2   . TYR A  1 354 ? -5.960  9.254   30.834  1.00 26.44  ? 382 TYR A CE2   1 
ATOM   2576  C CZ    . TYR A  1 354 ? -6.281  7.928   31.015  1.00 27.72  ? 382 TYR A CZ    1 
ATOM   2577  O OH    . TYR A  1 354 ? -5.301  7.061   31.509  1.00 22.21  ? 382 TYR A OH    1 
ATOM   2578  N N     . ARG A  1 355 ? -10.260 12.822  31.661  1.00 24.51  ? 383 ARG A N     1 
ATOM   2579  C CA    . ARG A  1 355 ? -10.215 13.519  32.946  1.00 22.69  ? 383 ARG A CA    1 
ATOM   2580  C C     . ARG A  1 355 ? -11.570 13.559  33.665  1.00 21.53  ? 383 ARG A C     1 
ATOM   2581  O O     . ARG A  1 355 ? -11.630 13.334  34.870  1.00 23.08  ? 383 ARG A O     1 
ATOM   2582  C CB    . ARG A  1 355 ? -9.710  14.939  32.748  1.00 22.22  ? 383 ARG A CB    1 
ATOM   2583  C CG    . ARG A  1 355 ? -8.257  14.977  32.361  1.00 19.94  ? 383 ARG A CG    1 
ATOM   2584  C CD    . ARG A  1 355 ? -7.659  16.349  32.339  1.00 25.50  ? 383 ARG A CD    1 
ATOM   2585  N NE    . ARG A  1 355 ? -8.146  17.125  31.207  1.00 23.81  ? 383 ARG A NE    1 
ATOM   2586  C CZ    . ARG A  1 355 ? -9.094  18.050  31.259  1.00 21.44  ? 383 ARG A CZ    1 
ATOM   2587  N NH1   . ARG A  1 355 ? -9.706  18.371  32.397  1.00 20.76  ? 383 ARG A NH1   1 
ATOM   2588  N NH2   . ARG A  1 355 ? -9.423  18.673  30.135  1.00 28.34  ? 383 ARG A NH2   1 
ATOM   2589  N N     . ASP A  1 356 ? -12.642 13.831  32.925  1.00 23.15  ? 384 ASP A N     1 
ATOM   2590  C CA    . ASP A  1 356 ? -14.007 13.827  33.486  1.00 25.08  ? 384 ASP A CA    1 
ATOM   2591  C C     . ASP A  1 356 ? -14.469 12.433  33.937  1.00 25.66  ? 384 ASP A C     1 
ATOM   2592  O O     . ASP A  1 356 ? -15.140 12.306  34.974  1.00 24.73  ? 384 ASP A O     1 
ATOM   2593  C CB    . ASP A  1 356 ? -15.048 14.399  32.495  1.00 26.99  ? 384 ASP A CB    1 
ATOM   2594  C CG    . ASP A  1 356 ? -14.857 15.905  32.202  1.00 36.31  ? 384 ASP A CG    1 
ATOM   2595  O OD1   . ASP A  1 356 ? -14.219 16.621  32.995  1.00 24.26  ? 384 ASP A OD1   1 
ATOM   2596  O OD2   . ASP A  1 356 ? -15.365 16.379  31.167  1.00 31.30  ? 384 ASP A OD2   1 
ATOM   2597  N N     . ALA A  1 357 ? -14.146 11.408  33.141  1.00 23.83  ? 385 ALA A N     1 
ATOM   2598  C CA    . ALA A  1 357 ? -14.574 10.024  33.412  1.00 25.20  ? 385 ALA A CA    1 
ATOM   2599  C C     . ALA A  1 357 ? -14.025 9.534   34.756  1.00 18.84  ? 385 ALA A C     1 
ATOM   2600  O O     . ALA A  1 357 ? -14.696 8.837   35.501  1.00 20.96  ? 385 ALA A O     1 
ATOM   2601  C CB    . ALA A  1 357 ? -14.127 9.077   32.293  1.00 17.03  ? 385 ALA A CB    1 
ATOM   2602  N N     . ARG A  1 358 ? -12.807 9.948   35.053  1.00 21.39  ? 386 ARG A N     1 
ATOM   2603  C CA    . ARG A  1 358 ? -12.104 9.479   36.198  1.00 22.11  ? 386 ARG A CA    1 
ATOM   2604  C C     . ARG A  1 358 ? -12.819 9.747   37.524  1.00 26.08  ? 386 ARG A C     1 
ATOM   2605  O O     . ARG A  1 358 ? -12.728 8.933   38.431  1.00 25.78  ? 386 ARG A O     1 
ATOM   2606  C CB    . ARG A  1 358 ? -10.697 10.082  36.200  1.00 24.74  ? 386 ARG A CB    1 
ATOM   2607  C CG    . ARG A  1 358 ? -9.803  9.516   37.272  1.00 23.27  ? 386 ARG A CG    1 
ATOM   2608  C CD    . ARG A  1 358 ? -9.590  8.056   36.966  1.00 24.50  ? 386 ARG A CD    1 
ATOM   2609  N NE    . ARG A  1 358 ? -8.913  7.309   38.010  1.00 20.70  ? 386 ARG A NE    1 
ATOM   2610  C CZ    . ARG A  1 358 ? -9.489  6.762   39.068  1.00 15.36  ? 386 ARG A CZ    1 
ATOM   2611  N NH1   . ARG A  1 358 ? -10.777 6.938   39.324  1.00 23.63  ? 386 ARG A NH1   1 
ATOM   2612  N NH2   . ARG A  1 358 ? -8.731  6.046   39.918  1.00 23.28  ? 386 ARG A NH2   1 
ATOM   2613  N N     . ILE A  1 359 ? -13.544 10.862  37.644  1.00 20.16  ? 387 ILE A N     1 
ATOM   2614  C CA    . ILE A  1 359 ? -14.226 11.161  38.893  1.00 24.66  ? 387 ILE A CA    1 
ATOM   2615  C C     . ILE A  1 359 ? -15.332 10.142  39.162  1.00 24.67  ? 387 ILE A C     1 
ATOM   2616  O O     . ILE A  1 359 ? -15.637 9.859   40.322  1.00 18.26  ? 387 ILE A O     1 
ATOM   2617  C CB    . ILE A  1 359 ? -14.835 12.596  38.892  1.00 21.96  ? 387 ILE A CB    1 
ATOM   2618  C CG1   . ILE A  1 359 ? -15.301 13.034  40.295  1.00 23.60  ? 387 ILE A CG1   1 
ATOM   2619  C CG2   . ILE A  1 359 ? -15.999 12.665  37.873  1.00 19.81  ? 387 ILE A CG2   1 
ATOM   2620  C CD1   . ILE A  1 359 ? -14.386 12.708  41.516  1.00 16.51  ? 387 ILE A CD1   1 
ATOM   2621  N N     . THR A  1 360 ? -15.917 9.587   38.098  1.00 23.47  ? 388 THR A N     1 
ATOM   2622  C CA    . THR A  1 360 ? -17.113 8.737   38.229  1.00 22.86  ? 388 THR A CA    1 
ATOM   2623  C C     . THR A  1 360 ? -16.827 7.418   39.000  1.00 20.03  ? 388 THR A C     1 
ATOM   2624  O O     . THR A  1 360 ? -17.708 6.834   39.581  1.00 19.45  ? 388 THR A O     1 
ATOM   2625  C CB    . THR A  1 360 ? -17.768 8.435   36.840  1.00 24.48  ? 388 THR A CB    1 
ATOM   2626  O OG1   . THR A  1 360 ? -16.843 7.718   36.009  1.00 18.88  ? 388 THR A OG1   1 
ATOM   2627  C CG2   . THR A  1 360 ? -18.171 9.752   36.140  1.00 18.92  ? 388 THR A CG2   1 
ATOM   2628  N N     . GLU A  1 361 ? -15.572 6.995   38.994  1.00 19.72  ? 389 GLU A N     1 
ATOM   2629  C CA    . GLU A  1 361 ? -15.092 5.854   39.763  1.00 22.48  ? 389 GLU A CA    1 
ATOM   2630  C C     . GLU A  1 361 ? -14.857 6.175   41.258  1.00 20.60  ? 389 GLU A C     1 
ATOM   2631  O O     . GLU A  1 361 ? -14.575 5.270   42.052  1.00 23.63  ? 389 GLU A O     1 
ATOM   2632  C CB    . GLU A  1 361 ? -13.780 5.385   39.131  1.00 21.26  ? 389 GLU A CB    1 
ATOM   2633  C CG    . GLU A  1 361 ? -13.948 4.836   37.709  1.00 20.50  ? 389 GLU A CG    1 
ATOM   2634  C CD    . GLU A  1 361 ? -12.652 4.278   37.136  1.00 34.00  ? 389 GLU A CD    1 
ATOM   2635  O OE1   . GLU A  1 361 ? -12.500 3.050   37.191  1.00 37.12  ? 389 GLU A OE1   1 
ATOM   2636  O OE2   . GLU A  1 361 ? -11.772 5.044   36.665  1.00 26.92  ? 389 GLU A OE2   1 
ATOM   2637  N N     . ILE A  1 362 ? -14.961 7.449   41.646  1.00 19.55  ? 390 ILE A N     1 
ATOM   2638  C CA    . ILE A  1 362 ? -14.629 7.872   43.017  1.00 23.50  ? 390 ILE A CA    1 
ATOM   2639  C C     . ILE A  1 362 ? -15.846 8.326   43.783  1.00 24.30  ? 390 ILE A C     1 
ATOM   2640  O O     . ILE A  1 362 ? -16.144 7.779   44.858  1.00 23.35  ? 390 ILE A O     1 
ATOM   2641  C CB    . ILE A  1 362 ? -13.577 8.987   43.026  1.00 23.97  ? 390 ILE A CB    1 
ATOM   2642  C CG1   . ILE A  1 362 ? -12.293 8.471   42.349  1.00 21.62  ? 390 ILE A CG1   1 
ATOM   2643  C CG2   . ILE A  1 362 ? -13.312 9.489   44.481  1.00 18.49  ? 390 ILE A CG2   1 
ATOM   2644  C CD1   . ILE A  1 362 ? -11.397 9.529   41.836  1.00 27.00  ? 390 ILE A CD1   1 
ATOM   2645  N N     . TYR A  1 363 ? -16.559 9.325   43.245  1.00 27.49  ? 391 TYR A N     1 
ATOM   2646  C CA    . TYR A  1 363 ? -17.633 9.927   44.021  1.00 24.31  ? 391 TYR A CA    1 
ATOM   2647  C C     . TYR A  1 363 ? -18.948 9.170   44.036  1.00 25.13  ? 391 TYR A C     1 
ATOM   2648  O O     . TYR A  1 363 ? -19.220 8.330   43.182  1.00 24.95  ? 391 TYR A O     1 
ATOM   2649  C CB    . TYR A  1 363 ? -17.813 11.433  43.759  1.00 26.62  ? 391 TYR A CB    1 
ATOM   2650  C CG    . TYR A  1 363 ? -18.295 11.935  42.416  1.00 27.40  ? 391 TYR A CG    1 
ATOM   2651  C CD1   . TYR A  1 363 ? -18.227 13.305  42.155  1.00 30.26  ? 391 TYR A CD1   1 
ATOM   2652  C CD2   . TYR A  1 363 ? -18.814 11.092  41.411  1.00 22.44  ? 391 TYR A CD2   1 
ATOM   2653  C CE1   . TYR A  1 363 ? -18.614 13.829  40.955  1.00 25.46  ? 391 TYR A CE1   1 
ATOM   2654  C CE2   . TYR A  1 363 ? -19.227 11.612  40.194  1.00 21.96  ? 391 TYR A CE2   1 
ATOM   2655  C CZ    . TYR A  1 363 ? -19.136 12.987  39.970  1.00 29.15  ? 391 TYR A CZ    1 
ATOM   2656  O OH    . TYR A  1 363 ? -19.546 13.549  38.776  1.00 24.70  ? 391 TYR A OH    1 
ATOM   2657  N N     . GLU A  1 364 ? -19.732 9.473   45.064  1.00 22.32  ? 392 GLU A N     1 
ATOM   2658  C CA    . GLU A  1 364 ? -20.939 8.747   45.438  1.00 26.99  ? 392 GLU A CA    1 
ATOM   2659  C C     . GLU A  1 364 ? -20.695 7.269   45.778  1.00 29.36  ? 392 GLU A C     1 
ATOM   2660  O O     . GLU A  1 364 ? -21.586 6.417   45.622  1.00 32.02  ? 392 GLU A O     1 
ATOM   2661  C CB    . GLU A  1 364 ? -22.042 8.968   44.413  1.00 28.75  ? 392 GLU A CB    1 
ATOM   2662  C CG    . GLU A  1 364 ? -22.389 10.464  44.341  1.00 37.16  ? 392 GLU A CG    1 
ATOM   2663  C CD    . GLU A  1 364 ? -23.719 10.768  43.732  1.00 38.98  ? 392 GLU A CD    1 
ATOM   2664  O OE1   . GLU A  1 364 ? -24.686 10.002  43.930  1.00 38.58  ? 392 GLU A OE1   1 
ATOM   2665  O OE2   . GLU A  1 364 ? -23.804 11.818  43.055  1.00 48.43  ? 392 GLU A OE2   1 
ATOM   2666  N N     . GLY A  1 365 ? -19.508 6.992   46.309  1.00 26.49  ? 393 GLY A N     1 
ATOM   2667  C CA    . GLY A  1 365 ? -19.140 5.632   46.662  1.00 25.84  ? 393 GLY A CA    1 
ATOM   2668  C C     . GLY A  1 365 ? -18.201 5.127   45.593  1.00 22.62  ? 393 GLY A C     1 
ATOM   2669  O O     . GLY A  1 365 ? -18.597 4.908   44.425  1.00 22.46  ? 393 GLY A O     1 
ATOM   2670  N N     . THR A  1 366 ? -16.944 4.967   45.983  1.00 21.05  ? 394 THR A N     1 
ATOM   2671  C CA    . THR A  1 366 ? -15.926 4.457   45.090  1.00 21.28  ? 394 THR A CA    1 
ATOM   2672  C C     . THR A  1 366 ? -16.315 3.074   44.533  1.00 18.08  ? 394 THR A C     1 
ATOM   2673  O O     . THR A  1 366 ? -17.186 2.401   45.061  1.00 21.70  ? 394 THR A O     1 
ATOM   2674  C CB    . THR A  1 366 ? -14.571 4.285   45.836  1.00 21.27  ? 394 THR A CB    1 
ATOM   2675  O OG1   . THR A  1 366 ? -14.749 3.333   46.908  1.00 22.24  ? 394 THR A OG1   1 
ATOM   2676  C CG2   . THR A  1 366 ? -14.058 5.629   46.383  1.00 23.64  ? 394 THR A CG2   1 
ATOM   2677  N N     . SER A  1 367 ? -15.597 2.662   43.505  1.00 21.18  ? 395 SER A N     1 
ATOM   2678  C CA    . SER A  1 367 ? -15.770 1.357   42.891  1.00 26.12  ? 395 SER A CA    1 
ATOM   2679  C C     . SER A  1 367 ? -15.649 0.256   43.933  1.00 23.28  ? 395 SER A C     1 
ATOM   2680  O O     . SER A  1 367 ? -16.382 -0.697  43.894  1.00 22.87  ? 395 SER A O     1 
ATOM   2681  C CB    . SER A  1 367 ? -14.719 1.160   41.798  1.00 18.08  ? 395 SER A CB    1 
ATOM   2682  O OG    . SER A  1 367 ? -14.871 2.107   40.757  1.00 20.78  ? 395 SER A OG    1 
ATOM   2683  N N     . GLU A  1 368 ? -14.734 0.418   44.883  1.00 23.16  ? 396 GLU A N     1 
ATOM   2684  C CA    . GLU A  1 368 ? -14.538 -0.574  45.930  1.00 23.12  ? 396 GLU A CA    1 
ATOM   2685  C C     . GLU A  1 368 ? -15.776 -0.693  46.830  1.00 24.66  ? 396 GLU A C     1 
ATOM   2686  O O     . GLU A  1 368 ? -16.250 -1.800  47.136  1.00 23.72  ? 396 GLU A O     1 
ATOM   2687  C CB    . GLU A  1 368 ? -13.300 -0.218  46.735  1.00 21.45  ? 396 GLU A CB    1 
ATOM   2688  C CG    . GLU A  1 368 ? -12.006 -0.315  45.915  1.00 26.84  ? 396 GLU A CG    1 
ATOM   2689  C CD    . GLU A  1 368 ? -11.918 0.712   44.779  1.00 32.03  ? 396 GLU A CD    1 
ATOM   2690  O OE1   . GLU A  1 368 ? -12.325 1.883   45.003  1.00 24.59  ? 396 GLU A OE1   1 
ATOM   2691  O OE2   . GLU A  1 368 ? -11.458 0.342   43.673  1.00 28.23  ? 396 GLU A OE2   1 
ATOM   2692  N N     . ILE A  1 369 ? -16.323 0.457   47.223  1.00 21.61  ? 397 ILE A N     1 
ATOM   2693  C CA    . ILE A  1 369 ? -17.545 0.486   48.012  1.00 22.62  ? 397 ILE A CA    1 
ATOM   2694  C C     . ILE A  1 369 ? -18.700 -0.140  47.245  1.00 21.27  ? 397 ILE A C     1 
ATOM   2695  O O     . ILE A  1 369 ? -19.490 -0.889  47.829  1.00 22.55  ? 397 ILE A O     1 
ATOM   2696  C CB    . ILE A  1 369 ? -17.910 1.930   48.534  1.00 22.86  ? 397 ILE A CB    1 
ATOM   2697  C CG1   . ILE A  1 369 ? -17.171 2.222   49.855  1.00 28.59  ? 397 ILE A CG1   1 
ATOM   2698  C CG2   . ILE A  1 369 ? -19.437 2.072   48.763  1.00 25.88  ? 397 ILE A CG2   1 
ATOM   2699  C CD1   . ILE A  1 369 ? -15.682 1.703   49.896  1.00 27.45  ? 397 ILE A CD1   1 
ATOM   2700  N N     . GLN A  1 370 ? -18.805 0.161   45.956  1.00 21.87  ? 398 GLN A N     1 
ATOM   2701  C CA    . GLN A  1 370 ? -19.871 -0.421  45.120  1.00 25.39  ? 398 GLN A CA    1 
ATOM   2702  C C     . GLN A  1 370 ? -19.823 -1.959  45.167  1.00 20.39  ? 398 GLN A C     1 
ATOM   2703  O O     . GLN A  1 370 ? -20.832 -2.615  45.358  1.00 19.66  ? 398 GLN A O     1 
ATOM   2704  C CB    . GLN A  1 370 ? -19.779 0.052   43.649  1.00 26.36  ? 398 GLN A CB    1 
ATOM   2705  C CG    . GLN A  1 370 ? -19.811 1.559   43.389  1.00 23.56  ? 398 GLN A CG    1 
ATOM   2706  C CD    . GLN A  1 370 ? -21.011 2.268   44.000  1.00 32.91  ? 398 GLN A CD    1 
ATOM   2707  O OE1   . GLN A  1 370 ? -22.079 1.683   44.171  1.00 21.35  ? 398 GLN A OE1   1 
ATOM   2708  N NE2   . GLN A  1 370 ? -20.827 3.548   44.345  1.00 28.56  ? 398 GLN A NE2   1 
ATOM   2709  N N     . ARG A  1 371 ? -18.640 -2.531  44.968  1.00 18.83  ? 399 ARG A N     1 
ATOM   2710  C CA    . ARG A  1 371 ? -18.480 -3.990  45.047  1.00 23.42  ? 399 ARG A CA    1 
ATOM   2711  C C     . ARG A  1 371 ? -18.854 -4.575  46.391  1.00 22.21  ? 399 ARG A C     1 
ATOM   2712  O O     . ARG A  1 371 ? -19.525 -5.612  46.427  1.00 22.52  ? 399 ARG A O     1 
ATOM   2713  C CB    . ARG A  1 371 ? -17.061 -4.407  44.639  1.00 20.60  ? 399 ARG A CB    1 
ATOM   2714  C CG    . ARG A  1 371 ? -16.839 -4.222  43.164  1.00 21.79  ? 399 ARG A CG    1 
ATOM   2715  C CD    . ARG A  1 371 ? -15.396 -4.468  42.741  1.00 24.24  ? 399 ARG A CD    1 
ATOM   2716  N NE    . ARG A  1 371 ? -15.303 -4.555  41.286  1.00 24.64  ? 399 ARG A NE    1 
ATOM   2717  C CZ    . ARG A  1 371 ? -14.788 -3.628  40.459  1.00 31.21  ? 399 ARG A CZ    1 
ATOM   2718  N NH1   . ARG A  1 371 ? -14.293 -2.477  40.902  1.00 29.61  ? 399 ARG A NH1   1 
ATOM   2719  N NH2   . ARG A  1 371 ? -14.771 -3.865  39.149  1.00 26.80  ? 399 ARG A NH2   1 
ATOM   2720  N N     . LEU A  1 372 ? -18.487 -3.895  47.492  1.00 20.49  ? 400 LEU A N     1 
ATOM   2721  C CA    . LEU A  1 372 ? -18.897 -4.320  48.829  1.00 27.17  ? 400 LEU A CA    1 
ATOM   2722  C C     . LEU A  1 372 ? -20.417 -4.281  48.959  1.00 26.76  ? 400 LEU A C     1 
ATOM   2723  O O     . LEU A  1 372 ? -21.027 -5.173  49.563  1.00 22.72  ? 400 LEU A O     1 
ATOM   2724  C CB    . LEU A  1 372 ? -18.275 -3.438  49.929  1.00 24.77  ? 400 LEU A CB    1 
ATOM   2725  C CG    . LEU A  1 372 ? -16.760 -3.589  50.143  1.00 32.97  ? 400 LEU A CG    1 
ATOM   2726  C CD1   . LEU A  1 372 ? -16.280 -2.587  51.190  1.00 31.52  ? 400 LEU A CD1   1 
ATOM   2727  C CD2   . LEU A  1 372 ? -16.399 -5.017  50.553  1.00 31.84  ? 400 LEU A CD2   1 
ATOM   2728  N N     . VAL A  1 373 ? -21.026 -3.246  48.386  1.00 27.34  ? 401 VAL A N     1 
ATOM   2729  C CA    . VAL A  1 373 ? -22.480 -3.107  48.452  1.00 23.72  ? 401 VAL A CA    1 
ATOM   2730  C C     . VAL A  1 373 ? -23.150 -4.252  47.690  1.00 22.35  ? 401 VAL A C     1 
ATOM   2731  O O     . VAL A  1 373 ? -24.052 -4.910  48.218  1.00 25.08  ? 401 VAL A O     1 
ATOM   2732  C CB    . VAL A  1 373 ? -22.946 -1.728  47.909  1.00 29.42  ? 401 VAL A CB    1 
ATOM   2733  C CG1   . VAL A  1 373 ? -24.506 -1.704  47.651  1.00 21.06  ? 401 VAL A CG1   1 
ATOM   2734  C CG2   . VAL A  1 373 ? -22.511 -0.600  48.855  1.00 27.04  ? 401 VAL A CG2   1 
ATOM   2735  N N     . ILE A  1 374 ? -22.721 -4.466  46.451  1.00 22.70  ? 402 ILE A N     1 
ATOM   2736  C CA    . ILE A  1 374 ? -23.226 -5.555  45.600  1.00 29.68  ? 402 ILE A CA    1 
ATOM   2737  C C     . ILE A  1 374 ? -23.075 -6.924  46.249  1.00 25.35  ? 402 ILE A C     1 
ATOM   2738  O O     . ILE A  1 374 ? -24.008 -7.721  46.266  1.00 23.78  ? 402 ILE A O     1 
ATOM   2739  C CB    . ILE A  1 374 ? -22.501 -5.574  44.195  1.00 27.38  ? 402 ILE A CB    1 
ATOM   2740  C CG1   . ILE A  1 374 ? -22.974 -4.378  43.351  1.00 28.49  ? 402 ILE A CG1   1 
ATOM   2741  C CG2   . ILE A  1 374 ? -22.732 -6.919  43.450  1.00 19.24  ? 402 ILE A CG2   1 
ATOM   2742  C CD1   . ILE A  1 374 ? -21.901 -3.744  42.480  1.00 19.43  ? 402 ILE A CD1   1 
ATOM   2743  N N     . ALA A  1 375 ? -21.888 -7.201  46.765  1.00 22.24  ? 403 ALA A N     1 
ATOM   2744  C CA    . ALA A  1 375 ? -21.612 -8.508  47.360  1.00 27.08  ? 403 ALA A CA    1 
ATOM   2745  C C     . ALA A  1 375 ? -22.543 -8.757  48.541  1.00 25.35  ? 403 ALA A C     1 
ATOM   2746  O O     . ALA A  1 375 ? -23.090 -9.845  48.689  1.00 26.81  ? 403 ALA A O     1 
ATOM   2747  C CB    . ALA A  1 375 ? -20.161 -8.603  47.785  1.00 21.47  ? 403 ALA A CB    1 
ATOM   2748  N N     . GLY A  1 376 ? -22.746 -7.728  49.360  1.00 28.87  ? 404 GLY A N     1 
ATOM   2749  C CA    . GLY A  1 376 ? -23.606 -7.801  50.511  1.00 25.32  ? 404 GLY A CA    1 
ATOM   2750  C C     . GLY A  1 376 ? -25.030 -8.157  50.168  1.00 26.04  ? 404 GLY A C     1 
ATOM   2751  O O     . GLY A  1 376 ? -25.656 -8.970  50.856  1.00 24.01  ? 404 GLY A O     1 
ATOM   2752  N N     . HIS A  1 377 ? -25.561 -7.537  49.115  1.00 25.72  ? 405 HIS A N     1 
ATOM   2753  C CA    . HIS A  1 377 ? -26.946 -7.792  48.703  1.00 28.18  ? 405 HIS A CA    1 
ATOM   2754  C C     . HIS A  1 377 ? -27.073 -9.109  47.974  1.00 23.94  ? 405 HIS A C     1 
ATOM   2755  O O     . HIS A  1 377 ? -28.092 -9.788  48.109  1.00 28.21  ? 405 HIS A O     1 
ATOM   2756  C CB    . HIS A  1 377 ? -27.507 -6.630  47.869  1.00 29.76  ? 405 HIS A CB    1 
ATOM   2757  C CG    . HIS A  1 377 ? -27.934 -5.466  48.704  1.00 39.00  ? 405 HIS A CG    1 
ATOM   2758  N ND1   . HIS A  1 377 ? -27.063 -4.468  49.087  1.00 47.21  ? 405 HIS A ND1   1 
ATOM   2759  C CD2   . HIS A  1 377 ? -29.123 -5.170  49.275  1.00 36.55  ? 405 HIS A CD2   1 
ATOM   2760  C CE1   . HIS A  1 377 ? -27.704 -3.597  49.843  1.00 44.72  ? 405 HIS A CE1   1 
ATOM   2761  N NE2   . HIS A  1 377 ? -28.954 -4.002  49.976  1.00 43.17  ? 405 HIS A NE2   1 
ATOM   2762  N N     . LEU A  1 378 ? -26.036 -9.487  47.226  1.00 29.79  ? 406 LEU A N     1 
ATOM   2763  C CA    . LEU A  1 378 ? -26.000 -10.803 46.588  1.00 28.65  ? 406 LEU A CA    1 
ATOM   2764  C C     . LEU A  1 378 ? -26.143 -11.899 47.664  1.00 26.59  ? 406 LEU A C     1 
ATOM   2765  O O     . LEU A  1 378 ? -26.963 -12.798 47.564  1.00 29.04  ? 406 LEU A O     1 
ATOM   2766  C CB    . LEU A  1 378 ? -24.683 -10.980 45.807  1.00 30.34  ? 406 LEU A CB    1 
ATOM   2767  C CG    . LEU A  1 378 ? -24.456 -12.261 44.984  1.00 32.86  ? 406 LEU A CG    1 
ATOM   2768  C CD1   . LEU A  1 378 ? -25.343 -12.314 43.749  1.00 31.96  ? 406 LEU A CD1   1 
ATOM   2769  C CD2   . LEU A  1 378 ? -22.963 -12.403 44.579  1.00 33.01  ? 406 LEU A CD2   1 
ATOM   2770  N N     . LEU A  1 379 ? -25.339 -11.792 48.707  1.00 27.34  ? 407 LEU A N     1 
ATOM   2771  C CA    . LEU A  1 379 ? -25.275 -12.804 49.740  1.00 29.68  ? 407 LEU A CA    1 
ATOM   2772  C C     . LEU A  1 379 ? -26.574 -12.887 50.501  1.00 31.81  ? 407 LEU A C     1 
ATOM   2773  O O     . LEU A  1 379 ? -27.044 -13.976 50.790  1.00 30.89  ? 407 LEU A O     1 
ATOM   2774  C CB    . LEU A  1 379 ? -24.121 -12.533 50.695  1.00 25.15  ? 407 LEU A CB    1 
ATOM   2775  C CG    . LEU A  1 379 ? -22.761 -12.739 50.046  1.00 30.00  ? 407 LEU A CG    1 
ATOM   2776  C CD1   . LEU A  1 379 ? -21.708 -12.370 51.066  1.00 37.65  ? 407 LEU A CD1   1 
ATOM   2777  C CD2   . LEU A  1 379 ? -22.581 -14.180 49.510  1.00 28.49  ? 407 LEU A CD2   1 
ATOM   2778  N N     . ARG A  1 380 ? -27.164 -11.731 50.792  1.00 33.55  ? 408 ARG A N     1 
ATOM   2779  C CA    . ARG A  1 380 ? -28.458 -11.681 51.455  1.00 36.33  ? 408 ARG A CA    1 
ATOM   2780  C C     . ARG A  1 380 ? -29.572 -12.356 50.640  1.00 36.21  ? 408 ARG A C     1 
ATOM   2781  O O     . ARG A  1 380 ? -30.480 -12.953 51.224  1.00 32.79  ? 408 ARG A O     1 
ATOM   2782  C CB    . ARG A  1 380 ? -28.833 -10.234 51.808  1.00 38.46  ? 408 ARG A CB    1 
ATOM   2783  C CG    . ARG A  1 380 ? -28.150 -9.729  53.078  1.00 49.15  ? 408 ARG A CG    1 
ATOM   2784  C CD    . ARG A  1 380 ? -28.729 -8.393  53.606  1.00 50.98  ? 408 ARG A CD    1 
ATOM   2785  N NE    . ARG A  1 380 ? -28.207 -7.231  52.886  1.00 67.22  ? 408 ARG A NE    1 
ATOM   2786  C CZ    . ARG A  1 380 ? -26.954 -6.776  52.966  1.00 68.89  ? 408 ARG A CZ    1 
ATOM   2787  N NH1   . ARG A  1 380 ? -26.048 -7.375  53.739  1.00 77.07  ? 408 ARG A NH1   1 
ATOM   2788  N NH2   . ARG A  1 380 ? -26.595 -5.712  52.255  1.00 58.03  ? 408 ARG A NH2   1 
ATOM   2789  N N     . SER A  1 381 ? -29.495 -12.280 49.308  1.00 36.69  ? 409 SER A N     1 
ATOM   2790  C CA    . SER A  1 381 ? -30.462 -12.959 48.441  1.00 37.32  ? 409 SER A CA    1 
ATOM   2791  C C     . SER A  1 381 ? -30.381 -14.464 48.570  1.00 33.96  ? 409 SER A C     1 
ATOM   2792  O O     . SER A  1 381 ? -31.401 -15.130 48.609  1.00 36.64  ? 409 SER A O     1 
ATOM   2793  C CB    . SER A  1 381 ? -30.263 -12.588 46.969  1.00 37.35  ? 409 SER A CB    1 
ATOM   2794  O OG    . SER A  1 381 ? -30.393 -11.200 46.787  1.00 51.22  ? 409 SER A OG    1 
ATOM   2795  N N     . TYR A  1 382 ? -29.167 -14.998 48.584  1.00 33.71  ? 410 TYR A N     1 
ATOM   2796  C CA    . TYR A  1 382 ? -28.967 -16.436 48.763  1.00 33.93  ? 410 TYR A CA    1 
ATOM   2797  C C     . TYR A  1 382 ? -29.443 -16.907 50.155  1.00 36.82  ? 410 TYR A C     1 
ATOM   2798  O O     . TYR A  1 382 ? -29.980 -18.002 50.282  1.00 40.13  ? 410 TYR A O     1 
ATOM   2799  C CB    . TYR A  1 382 ? -27.502 -16.820 48.512  1.00 31.89  ? 410 TYR A CB    1 
ATOM   2800  C CG    . TYR A  1 382 ? -27.143 -16.893 47.037  1.00 34.52  ? 410 TYR A CG    1 
ATOM   2801  C CD1   . TYR A  1 382 ? -26.699 -15.766 46.344  1.00 32.36  ? 410 TYR A CD1   1 
ATOM   2802  C CD2   . TYR A  1 382 ? -27.258 -18.089 46.336  1.00 39.80  ? 410 TYR A CD2   1 
ATOM   2803  C CE1   . TYR A  1 382 ? -26.383 -15.831 44.991  1.00 37.57  ? 410 TYR A CE1   1 
ATOM   2804  C CE2   . TYR A  1 382 ? -26.944 -18.171 44.974  1.00 36.50  ? 410 TYR A CE2   1 
ATOM   2805  C CZ    . TYR A  1 382 ? -26.506 -17.047 44.310  1.00 33.66  ? 410 TYR A CZ    1 
ATOM   2806  O OH    . TYR A  1 382 ? -26.198 -17.128 42.975  1.00 28.75  ? 410 TYR A OH    1 
ATOM   2807  N N     . ARG A  1 383 ? -29.269 -16.071 51.176  1.00 34.70  ? 411 ARG A N     1 
ATOM   2808  C CA    . ARG A  1 383 ? -29.683 -16.407 52.536  1.00 35.08  ? 411 ARG A CA    1 
ATOM   2809  C C     . ARG A  1 383 ? -31.188 -16.391 52.730  1.00 38.87  ? 411 ARG A C     1 
ATOM   2810  O O     . ARG A  1 383 ? -31.709 -17.156 53.536  1.00 40.31  ? 411 ARG A O     1 
ATOM   2811  C CB    . ARG A  1 383 ? -29.045 -15.452 53.533  1.00 35.77  ? 411 ARG A CB    1 
ATOM   2812  C CG    . ARG A  1 383 ? -27.588 -15.717 53.706  1.00 28.56  ? 411 ARG A CG    1 
ATOM   2813  C CD    . ARG A  1 383 ? -26.915 -14.580 54.433  1.00 39.51  ? 411 ARG A CD    1 
ATOM   2814  N NE    . ARG A  1 383 ? -25.464 -14.729 54.348  1.00 34.30  ? 411 ARG A NE    1 
ATOM   2815  C CZ    . ARG A  1 383 ? -24.588 -13.743 54.538  1.00 40.92  ? 411 ARG A CZ    1 
ATOM   2816  N NH1   . ARG A  1 383 ? -24.994 -12.521 54.849  1.00 42.34  ? 411 ARG A NH1   1 
ATOM   2817  N NH2   . ARG A  1 383 ? -23.287 -13.984 54.421  1.00 37.44  ? 411 ARG A NH2   1 
ATOM   2818  N N     . SER A  1 384 ? -31.866 -15.494 52.022  1.00 42.99  ? 412 SER A N     1 
ATOM   2819  C CA    . SER A  1 384 ? -33.324 -15.425 52.034  1.00 47.39  ? 412 SER A CA    1 
ATOM   2820  C C     . SER A  1 384 ? -33.883 -16.381 50.985  1.00 48.09  ? 412 SER A C     1 
ATOM   2821  O O     . SER A  1 384 ? -34.729 -17.215 51.292  1.00 55.62  ? 412 SER A O     1 
ATOM   2822  C CB    . SER A  1 384 ? -33.792 -13.991 51.756  1.00 45.04  ? 412 SER A CB    1 
ATOM   2823  O OG    . SER A  1 384 ? -33.541 -13.622 50.410  1.00 55.72  ? 412 SER A OG    1 
ATOM   2824  N N     . LEU B  1 6   ? 23.028  -5.798  40.396  1.00 51.03  ? 34  LEU B N     1 
ATOM   2825  C CA    . LEU B  1 6   ? 23.607  -4.654  39.625  1.00 48.74  ? 34  LEU B CA    1 
ATOM   2826  C C     . LEU B  1 6   ? 25.047  -4.419  40.069  1.00 50.29  ? 34  LEU B C     1 
ATOM   2827  O O     . LEU B  1 6   ? 25.340  -4.474  41.267  1.00 52.18  ? 34  LEU B O     1 
ATOM   2828  C CB    . LEU B  1 6   ? 22.789  -3.364  39.840  1.00 46.63  ? 34  LEU B CB    1 
ATOM   2829  C CG    . LEU B  1 6   ? 22.518  -2.499  38.606  1.00 45.32  ? 34  LEU B CG    1 
ATOM   2830  N N     . PRO B  1 7   ? 25.950  -4.163  39.109  1.00 50.22  ? 35  PRO B N     1 
ATOM   2831  C CA    . PRO B  1 7   ? 27.309  -3.684  39.407  1.00 49.42  ? 35  PRO B CA    1 
ATOM   2832  C C     . PRO B  1 7   ? 27.350  -2.469  40.350  1.00 52.09  ? 35  PRO B C     1 
ATOM   2833  O O     . PRO B  1 7   ? 26.422  -1.640  40.351  1.00 53.74  ? 35  PRO B O     1 
ATOM   2834  C CB    . PRO B  1 7   ? 27.852  -3.281  38.031  1.00 48.13  ? 35  PRO B CB    1 
ATOM   2835  C CG    . PRO B  1 7   ? 27.076  -4.094  37.056  1.00 51.44  ? 35  PRO B CG    1 
ATOM   2836  C CD    . PRO B  1 7   ? 25.723  -4.338  37.662  1.00 51.19  ? 35  PRO B CD    1 
ATOM   2837  N N     . GLU B  1 8   ? 28.431  -2.375  41.130  1.00 53.79  ? 36  GLU B N     1 
ATOM   2838  C CA    . GLU B  1 8   ? 28.665  -1.256  42.050  1.00 51.24  ? 36  GLU B CA    1 
ATOM   2839  C C     . GLU B  1 8   ? 28.709  0.084   41.318  1.00 50.74  ? 36  GLU B C     1 
ATOM   2840  O O     . GLU B  1 8   ? 28.247  1.098   41.847  1.00 56.90  ? 36  GLU B O     1 
ATOM   2841  C CB    . GLU B  1 8   ? 29.967  -1.458  42.844  1.00 52.11  ? 36  GLU B CB    1 
ATOM   2842  N N     . THR B  1 9   ? 29.251  0.099   40.106  1.00 48.58  ? 37  THR B N     1 
ATOM   2843  C CA    . THR B  1 9   ? 29.279  1.331   39.314  1.00 47.05  ? 37  THR B CA    1 
ATOM   2844  C C     . THR B  1 9   ? 27.864  1.775   38.968  1.00 46.01  ? 37  THR B C     1 
ATOM   2845  O O     . THR B  1 9   ? 27.540  2.969   39.039  1.00 48.49  ? 37  THR B O     1 
ATOM   2846  C CB    . THR B  1 9   ? 30.055  1.143   38.015  1.00 47.97  ? 37  THR B CB    1 
ATOM   2847  O OG1   . THR B  1 9   ? 29.637  -0.083  37.392  1.00 56.88  ? 37  THR B OG1   1 
ATOM   2848  C CG2   . THR B  1 9   ? 31.570  1.109   38.301  1.00 45.53  ? 37  THR B CG2   1 
ATOM   2849  N N     . HIS B  1 10  ? 27.032  0.806   38.592  1.00 43.32  ? 38  HIS B N     1 
ATOM   2850  C CA    . HIS B  1 10  ? 25.620  1.070   38.316  1.00 42.55  ? 38  HIS B CA    1 
ATOM   2851  C C     . HIS B  1 10  ? 24.842  1.359   39.617  1.00 41.62  ? 38  HIS B C     1 
ATOM   2852  O O     . HIS B  1 10  ? 23.893  2.149   39.613  1.00 41.36  ? 38  HIS B O     1 
ATOM   2853  C CB    . HIS B  1 10  ? 25.000  -0.087  37.516  1.00 42.68  ? 38  HIS B CB    1 
ATOM   2854  C CG    . HIS B  1 10  ? 25.380  -0.087  36.066  1.00 44.82  ? 38  HIS B CG    1 
ATOM   2855  N ND1   . HIS B  1 10  ? 26.647  -0.407  35.627  1.00 55.58  ? 38  HIS B ND1   1 
ATOM   2856  C CD2   . HIS B  1 10  ? 24.656  0.191   34.954  1.00 51.27  ? 38  HIS B CD2   1 
ATOM   2857  C CE1   . HIS B  1 10  ? 26.689  -0.320  34.307  1.00 48.18  ? 38  HIS B CE1   1 
ATOM   2858  N NE2   . HIS B  1 10  ? 25.495  0.043   33.875  1.00 48.34  ? 38  HIS B NE2   1 
ATOM   2859  N N     . GLN B  1 11  ? 25.261  0.740   40.722  1.00 42.83  ? 39  GLN B N     1 
ATOM   2860  C CA    . GLN B  1 11  ? 24.695  1.033   42.051  1.00 42.97  ? 39  GLN B CA    1 
ATOM   2861  C C     . GLN B  1 11  ? 24.970  2.480   42.500  1.00 41.57  ? 39  GLN B C     1 
ATOM   2862  O O     . GLN B  1 11  ? 24.120  3.102   43.137  1.00 41.98  ? 39  GLN B O     1 
ATOM   2863  C CB    . GLN B  1 11  ? 25.209  0.035   43.108  1.00 40.95  ? 39  GLN B CB    1 
ATOM   2864  N N     . MET B  1 12  ? 26.139  3.016   42.149  1.00 40.29  ? 40  MET B N     1 
ATOM   2865  C CA    . MET B  1 12  ? 26.497  4.384   42.535  1.00 45.18  ? 40  MET B CA    1 
ATOM   2866  C C     . MET B  1 12  ? 25.795  5.396   41.637  1.00 43.05  ? 40  MET B C     1 
ATOM   2867  O O     . MET B  1 12  ? 25.397  6.485   42.084  1.00 42.69  ? 40  MET B O     1 
ATOM   2868  C CB    . MET B  1 12  ? 28.020  4.592   42.485  1.00 43.60  ? 40  MET B CB    1 
ATOM   2869  C CG    . MET B  1 12  ? 28.789  3.804   43.575  1.00 57.02  ? 40  MET B CG    1 
ATOM   2870  S SD    . MET B  1 12  ? 30.504  3.413   43.118  1.00 69.94  ? 40  MET B SD    1 
ATOM   2871  C CE    . MET B  1 12  ? 30.844  1.957   44.132  1.00 62.45  ? 40  MET B CE    1 
ATOM   2872  N N     . LEU B  1 13  ? 25.644  5.033   40.367  1.00 39.42  ? 41  LEU B N     1 
ATOM   2873  C CA    . LEU B  1 13  ? 24.969  5.898   39.410  1.00 37.52  ? 41  LEU B CA    1 
ATOM   2874  C C     . LEU B  1 13  ? 23.508  6.065   39.811  1.00 32.92  ? 41  LEU B C     1 
ATOM   2875  O O     . LEU B  1 13  ? 22.949  7.162   39.687  1.00 35.74  ? 41  LEU B O     1 
ATOM   2876  C CB    . LEU B  1 13  ? 25.081  5.317   38.007  1.00 34.26  ? 41  LEU B CB    1 
ATOM   2877  C CG    . LEU B  1 13  ? 24.320  5.998   36.867  1.00 41.71  ? 41  LEU B CG    1 
ATOM   2878  C CD1   . LEU B  1 13  ? 24.644  7.480   36.720  1.00 38.74  ? 41  LEU B CD1   1 
ATOM   2879  C CD2   . LEU B  1 13  ? 24.639  5.252   35.582  1.00 41.74  ? 41  LEU B CD2   1 
ATOM   2880  N N     . LEU B  1 14  ? 22.912  4.996   40.329  1.00 33.38  ? 42  LEU B N     1 
ATOM   2881  C CA    . LEU B  1 14  ? 21.507  5.044   40.749  1.00 35.43  ? 42  LEU B CA    1 
ATOM   2882  C C     . LEU B  1 14  ? 21.338  6.044   41.899  1.00 37.42  ? 42  LEU B C     1 
ATOM   2883  O O     . LEU B  1 14  ? 20.413  6.876   41.895  1.00 28.32  ? 42  LEU B O     1 
ATOM   2884  C CB    . LEU B  1 14  ? 21.008  3.646   41.131  1.00 36.25  ? 42  LEU B CB    1 
ATOM   2885  C CG    . LEU B  1 14  ? 19.508  3.482   41.454  1.00 33.96  ? 42  LEU B CG    1 
ATOM   2886  C CD1   . LEU B  1 14  ? 19.030  2.072   41.142  1.00 41.37  ? 42  LEU B CD1   1 
ATOM   2887  C CD2   . LEU B  1 14  ? 19.207  3.837   42.925  1.00 39.44  ? 42  LEU B CD2   1 
ATOM   2888  N N     . GLN B  1 15  ? 22.259  6.000   42.866  1.00 36.72  ? 43  GLN B N     1 
ATOM   2889  C CA    . GLN B  1 15  ? 22.190  6.918   44.013  1.00 36.38  ? 43  GLN B CA    1 
ATOM   2890  C C     . GLN B  1 15  ? 22.491  8.375   43.632  1.00 34.02  ? 43  GLN B C     1 
ATOM   2891  O O     . GLN B  1 15  ? 21.876  9.289   44.176  1.00 34.63  ? 43  GLN B O     1 
ATOM   2892  C CB    . GLN B  1 15  ? 23.107  6.458   45.158  1.00 39.49  ? 43  GLN B CB    1 
ATOM   2893  C CG    . GLN B  1 15  ? 22.683  7.027   46.530  1.00 45.94  ? 43  GLN B CG    1 
ATOM   2894  C CD    . GLN B  1 15  ? 21.224  6.682   46.894  1.00 51.82  ? 43  GLN B CD    1 
ATOM   2895  O OE1   . GLN B  1 15  ? 20.787  5.531   46.750  1.00 56.71  ? 43  GLN B OE1   1 
ATOM   2896  N NE2   . GLN B  1 15  ? 20.468  7.685   47.352  1.00 50.00  ? 43  GLN B NE2   1 
ATOM   2897  N N     . THR B  1 16  ? 23.407  8.604   42.690  1.00 33.95  ? 44  THR B N     1 
ATOM   2898  C CA    . THR B  1 16  ? 23.630  9.960   42.188  1.00 33.63  ? 44  THR B CA    1 
ATOM   2899  C C     . THR B  1 16  ? 22.380  10.558  41.526  1.00 34.71  ? 44  THR B C     1 
ATOM   2900  O O     . THR B  1 16  ? 22.093  11.755  41.680  1.00 32.31  ? 44  THR B O     1 
ATOM   2901  C CB    . THR B  1 16  ? 24.713  10.015  41.130  1.00 37.16  ? 44  THR B CB    1 
ATOM   2902  O OG1   . THR B  1 16  ? 25.945  9.494   41.654  1.00 41.61  ? 44  THR B OG1   1 
ATOM   2903  C CG2   . THR B  1 16  ? 24.904  11.458  40.650  1.00 37.39  ? 44  THR B CG2   1 
ATOM   2904  N N     . CYS B  1 17  ? 21.671  9.735   40.748  1.00 34.53  ? 45  CYS B N     1 
ATOM   2905  C CA    . CYS B  1 17  ? 20.507  10.197  39.998  1.00 31.59  ? 45  CYS B CA    1 
ATOM   2906  C C     . CYS B  1 17  ? 19.328  10.361  40.922  1.00 29.49  ? 45  CYS B C     1 
ATOM   2907  O O     . CYS B  1 17  ? 18.546  11.304  40.785  1.00 32.40  ? 45  CYS B O     1 
ATOM   2908  C CB    . CYS B  1 17  ? 20.175  9.246   38.842  1.00 33.16  ? 45  CYS B CB    1 
ATOM   2909  S SG    . CYS B  1 17  ? 21.426  9.293   37.527  1.00 38.02  ? 45  CYS B SG    1 
ATOM   2910  N N     . ARG B  1 18  ? 19.210  9.459   41.887  1.00 31.55  ? 46  ARG B N     1 
ATOM   2911  C CA    . ARG B  1 18  ? 18.199  9.599   42.915  1.00 33.84  ? 46  ARG B CA    1 
ATOM   2912  C C     . ARG B  1 18  ? 18.448  10.847  43.750  1.00 32.85  ? 46  ARG B C     1 
ATOM   2913  O O     . ARG B  1 18  ? 17.524  11.635  43.969  1.00 32.26  ? 46  ARG B O     1 
ATOM   2914  C CB    . ARG B  1 18  ? 18.160  8.368   43.809  1.00 33.63  ? 46  ARG B CB    1 
ATOM   2915  C CG    . ARG B  1 18  ? 16.923  8.303   44.685  1.00 42.15  ? 46  ARG B CG    1 
ATOM   2916  C CD    . ARG B  1 18  ? 16.662  6.862   45.127  1.00 49.64  ? 46  ARG B CD    1 
ATOM   2917  N NE    . ARG B  1 18  ? 15.302  6.439   44.802  1.00 67.34  ? 46  ARG B NE    1 
ATOM   2918  C CZ    . ARG B  1 18  ? 14.972  5.250   44.299  1.00 67.07  ? 46  ARG B CZ    1 
ATOM   2919  N NH1   . ARG B  1 18  ? 15.905  4.331   44.042  1.00 65.57  ? 46  ARG B NH1   1 
ATOM   2920  N NH2   . ARG B  1 18  ? 13.696  4.978   44.034  1.00 63.69  ? 46  ARG B NH2   1 
ATOM   2921  N N     . ASP B  1 19  ? 19.687  11.036  44.206  1.00 30.97  ? 47  ASP B N     1 
ATOM   2922  C CA    . ASP B  1 19  ? 20.022  12.239  44.972  1.00 32.97  ? 47  ASP B CA    1 
ATOM   2923  C C     . ASP B  1 19  ? 19.686  13.477  44.143  1.00 33.22  ? 47  ASP B C     1 
ATOM   2924  O O     . ASP B  1 19  ? 18.934  14.350  44.590  1.00 30.74  ? 47  ASP B O     1 
ATOM   2925  C CB    . ASP B  1 19  ? 21.506  12.241  45.403  1.00 36.33  ? 47  ASP B CB    1 
ATOM   2926  C CG    . ASP B  1 19  ? 21.832  11.176  46.474  1.00 43.08  ? 47  ASP B CG    1 
ATOM   2927  O OD1   . ASP B  1 19  ? 20.888  10.611  47.096  1.00 42.49  ? 47  ASP B OD1   1 
ATOM   2928  O OD2   . ASP B  1 19  ? 23.046  10.904  46.697  1.00 50.65  ? 47  ASP B OD2   1 
ATOM   2929  N N     . PHE B  1 20  ? 20.195  13.536  42.911  1.00 30.88  ? 48  PHE B N     1 
ATOM   2930  C CA    . PHE B  1 20  ? 19.872  14.666  42.028  1.00 29.67  ? 48  PHE B CA    1 
ATOM   2931  C C     . PHE B  1 20  ? 18.369  14.950  41.896  1.00 29.04  ? 48  PHE B C     1 
ATOM   2932  O O     . PHE B  1 20  ? 17.934  16.093  42.010  1.00 31.86  ? 48  PHE B O     1 
ATOM   2933  C CB    . PHE B  1 20  ? 20.466  14.462  40.636  1.00 28.40  ? 48  PHE B CB    1 
ATOM   2934  C CG    . PHE B  1 20  ? 20.189  15.593  39.711  1.00 34.44  ? 48  PHE B CG    1 
ATOM   2935  C CD1   . PHE B  1 20  ? 21.047  16.679  39.665  1.00 34.12  ? 48  PHE B CD1   1 
ATOM   2936  C CD2   . PHE B  1 20  ? 19.038  15.605  38.927  1.00 30.38  ? 48  PHE B CD2   1 
ATOM   2937  C CE1   . PHE B  1 20  ? 20.795  17.735  38.826  1.00 41.81  ? 48  PHE B CE1   1 
ATOM   2938  C CE2   . PHE B  1 20  ? 18.769  16.664  38.094  1.00 39.48  ? 48  PHE B CE2   1 
ATOM   2939  C CZ    . PHE B  1 20  ? 19.654  17.733  38.037  1.00 36.65  ? 48  PHE B CZ    1 
ATOM   2940  N N     . ALA B  1 21  ? 17.580  13.913  41.632  1.00 33.70  ? 49  ALA B N     1 
ATOM   2941  C CA    . ALA B  1 21  ? 16.135  14.068  41.410  1.00 32.63  ? 49  ALA B CA    1 
ATOM   2942  C C     . ALA B  1 21  ? 15.405  14.608  42.637  1.00 33.10  ? 49  ALA B C     1 
ATOM   2943  O O     . ALA B  1 21  ? 14.497  15.456  42.534  1.00 30.35  ? 49  ALA B O     1 
ATOM   2944  C CB    . ALA B  1 21  ? 15.514  12.723  40.965  1.00 33.06  ? 49  ALA B CB    1 
ATOM   2945  N N     . GLU B  1 22  ? 15.796  14.110  43.803  1.00 33.35  ? 50  GLU B N     1 
ATOM   2946  C CA    . GLU B  1 22  ? 15.146  14.518  45.046  1.00 37.38  ? 50  GLU B CA    1 
ATOM   2947  C C     . GLU B  1 22  ? 15.507  15.956  45.423  1.00 34.97  ? 50  GLU B C     1 
ATOM   2948  O O     . GLU B  1 22  ? 14.651  16.710  45.875  1.00 35.69  ? 50  GLU B O     1 
ATOM   2949  C CB    . GLU B  1 22  ? 15.399  13.475  46.142  1.00 37.69  ? 50  GLU B CB    1 
ATOM   2950  C CG    . GLU B  1 22  ? 14.835  12.099  45.691  1.00 48.62  ? 50  GLU B CG    1 
ATOM   2951  C CD    . GLU B  1 22  ? 14.864  11.022  46.752  1.00 62.62  ? 50  GLU B CD    1 
ATOM   2952  O OE1   . GLU B  1 22  ? 15.762  11.068  47.622  1.00 57.43  ? 50  GLU B OE1   1 
ATOM   2953  O OE2   . GLU B  1 22  ? 13.987  10.119  46.694  1.00 54.47  ? 50  GLU B OE2   1 
ATOM   2954  N N     . LYS B  1 23  ? 16.742  16.374  45.149  1.00 34.61  ? 51  LYS B N     1 
ATOM   2955  C CA    . LYS B  1 23  ? 17.117  17.770  45.375  1.00 33.27  ? 51  LYS B CA    1 
ATOM   2956  C C     . LYS B  1 23  ? 16.614  18.723  44.268  1.00 33.90  ? 51  LYS B C     1 
ATOM   2957  O O     . LYS B  1 23  ? 16.040  19.780  44.549  1.00 34.06  ? 51  LYS B O     1 
ATOM   2958  C CB    . LYS B  1 23  ? 18.637  17.888  45.518  1.00 34.66  ? 51  LYS B CB    1 
ATOM   2959  C CG    . LYS B  1 23  ? 19.135  19.320  45.660  1.00 40.30  ? 51  LYS B CG    1 
ATOM   2960  C CD    . LYS B  1 23  ? 20.637  19.345  45.937  1.00 44.74  ? 51  LYS B CD    1 
ATOM   2961  C CE    . LYS B  1 23  ? 21.154  20.761  46.043  1.00 47.03  ? 51  LYS B CE    1 
ATOM   2962  N NZ    . LYS B  1 23  ? 21.571  21.272  44.712  1.00 56.88  ? 51  LYS B NZ    1 
ATOM   2963  N N     . GLU B  1 24  ? 16.810  18.352  43.008  1.00 32.89  ? 52  GLU B N     1 
ATOM   2964  C CA    . GLU B  1 24  ? 16.552  19.285  41.915  1.00 30.89  ? 52  GLU B CA    1 
ATOM   2965  C C     . GLU B  1 24  ? 15.220  19.164  41.193  1.00 30.53  ? 52  GLU B C     1 
ATOM   2966  O O     . GLU B  1 24  ? 14.795  20.147  40.590  1.00 28.84  ? 52  GLU B O     1 
ATOM   2967  C CB    . GLU B  1 24  ? 17.651  19.169  40.864  1.00 33.33  ? 52  GLU B CB    1 
ATOM   2968  C CG    . GLU B  1 24  ? 19.046  19.518  41.378  1.00 41.30  ? 52  GLU B CG    1 
ATOM   2969  C CD    . GLU B  1 24  ? 19.208  20.994  41.744  1.00 48.73  ? 52  GLU B CD    1 
ATOM   2970  O OE1   . GLU B  1 24  ? 18.337  21.836  41.393  1.00 48.77  ? 52  GLU B OE1   1 
ATOM   2971  O OE2   . GLU B  1 24  ? 20.230  21.307  42.383  1.00 50.83  ? 52  GLU B OE2   1 
ATOM   2972  N N     . LEU B  1 25  ? 14.601  17.973  41.191  1.00 30.55  ? 53  LEU B N     1 
ATOM   2973  C CA    . LEU B  1 25  ? 13.449  17.714  40.315  1.00 26.07  ? 53  LEU B CA    1 
ATOM   2974  C C     . LEU B  1 25  ? 12.124  17.628  41.058  1.00 27.52  ? 53  LEU B C     1 
ATOM   2975  O O     . LEU B  1 25  ? 11.164  18.269  40.669  1.00 28.94  ? 53  LEU B O     1 
ATOM   2976  C CB    . LEU B  1 25  ? 13.668  16.458  39.472  1.00 21.45  ? 53  LEU B CB    1 
ATOM   2977  C CG    . LEU B  1 25  ? 14.837  16.451  38.492  1.00 29.73  ? 53  LEU B CG    1 
ATOM   2978  C CD1   . LEU B  1 25  ? 14.848  15.109  37.732  1.00 26.33  ? 53  LEU B CD1   1 
ATOM   2979  C CD2   . LEU B  1 25  ? 14.727  17.640  37.536  1.00 26.24  ? 53  LEU B CD2   1 
ATOM   2980  N N     . PHE B  1 26  ? 12.069  16.845  42.123  1.00 31.76  ? 54  PHE B N     1 
ATOM   2981  C CA    . PHE B  1 26  ? 10.842  16.758  42.919  1.00 30.93  ? 54  PHE B CA    1 
ATOM   2982  C C     . PHE B  1 26  ? 10.282  18.137  43.338  1.00 31.24  ? 54  PHE B C     1 
ATOM   2983  O O     . PHE B  1 26  ? 9.069   18.376  43.206  1.00 26.17  ? 54  PHE B O     1 
ATOM   2984  C CB    . PHE B  1 26  ? 11.048  15.843  44.139  1.00 32.86  ? 54  PHE B CB    1 
ATOM   2985  C CG    . PHE B  1 26  ? 10.865  14.374  43.836  1.00 34.83  ? 54  PHE B CG    1 
ATOM   2986  C CD1   . PHE B  1 26  ? 11.942  13.581  43.460  1.00 37.86  ? 54  PHE B CD1   1 
ATOM   2987  C CD2   . PHE B  1 26  ? 9.611   13.792  43.906  1.00 48.74  ? 54  PHE B CD2   1 
ATOM   2988  C CE1   . PHE B  1 26  ? 11.780  12.223  43.188  1.00 36.50  ? 54  PHE B CE1   1 
ATOM   2989  C CE2   . PHE B  1 26  ? 9.436   12.437  43.625  1.00 45.54  ? 54  PHE B CE2   1 
ATOM   2990  C CZ    . PHE B  1 26  ? 10.524  11.657  43.265  1.00 33.24  ? 54  PHE B CZ    1 
ATOM   2991  N N     . PRO B  1 27  ? 11.151  19.064  43.812  1.00 27.48  ? 55  PRO B N     1 
ATOM   2992  C CA    . PRO B  1 27  ? 10.631  20.382  44.223  1.00 31.16  ? 55  PRO B CA    1 
ATOM   2993  C C     . PRO B  1 27  ? 10.029  21.284  43.110  1.00 30.82  ? 55  PRO B C     1 
ATOM   2994  O O     . PRO B  1 27  ? 9.244   22.184  43.438  1.00 33.99  ? 55  PRO B O     1 
ATOM   2995  C CB    . PRO B  1 27  ? 11.869  21.070  44.839  1.00 30.05  ? 55  PRO B CB    1 
ATOM   2996  C CG    . PRO B  1 27  ? 12.819  19.989  45.106  1.00 31.87  ? 55  PRO B CG    1 
ATOM   2997  C CD    . PRO B  1 27  ? 12.612  18.997  44.017  1.00 30.30  ? 55  PRO B CD    1 
ATOM   2998  N N     . ILE B  1 28  ? 10.379  21.053  41.835  1.00 29.29  ? 56  ILE B N     1 
ATOM   2999  C CA    . ILE B  1 28  ? 9.843   21.855  40.705  1.00 29.30  ? 56  ILE B CA    1 
ATOM   3000  C C     . ILE B  1 28  ? 8.769   21.164  39.823  1.00 28.56  ? 56  ILE B C     1 
ATOM   3001  O O     . ILE B  1 28  ? 8.180   21.823  38.955  1.00 26.83  ? 56  ILE B O     1 
ATOM   3002  C CB    . ILE B  1 28  ? 10.953  22.306  39.753  1.00 32.18  ? 56  ILE B CB    1 
ATOM   3003  C CG1   . ILE B  1 28  ? 11.531  21.114  38.977  1.00 32.98  ? 56  ILE B CG1   1 
ATOM   3004  C CG2   . ILE B  1 28  ? 12.049  23.048  40.531  1.00 30.13  ? 56  ILE B CG2   1 
ATOM   3005  C CD1   . ILE B  1 28  ? 12.247  21.492  37.730  1.00 34.12  ? 56  ILE B CD1   1 
ATOM   3006  N N     . ALA B  1 29  ? 8.554   19.858  40.032  1.00 27.32  ? 57  ALA B N     1 
ATOM   3007  C CA    . ALA B  1 29  ? 7.693   19.033  39.163  1.00 30.84  ? 57  ALA B CA    1 
ATOM   3008  C C     . ALA B  1 29  ? 6.325   19.654  38.999  1.00 25.29  ? 57  ALA B C     1 
ATOM   3009  O O     . ALA B  1 29  ? 5.841   19.790  37.868  1.00 29.08  ? 57  ALA B O     1 
ATOM   3010  C CB    . ALA B  1 29  ? 7.547   17.585  39.709  1.00 24.56  ? 57  ALA B CB    1 
ATOM   3011  N N     . ALA B  1 30  ? 5.709   20.044  40.117  1.00 28.32  ? 58  ALA B N     1 
ATOM   3012  C CA    . ALA B  1 30  ? 4.385   20.651  40.076  1.00 26.20  ? 58  ALA B CA    1 
ATOM   3013  C C     . ALA B  1 30  ? 4.402   21.961  39.271  1.00 30.05  ? 58  ALA B C     1 
ATOM   3014  O O     . ALA B  1 30  ? 3.509   22.200  38.458  1.00 29.24  ? 58  ALA B O     1 
ATOM   3015  C CB    . ALA B  1 30  ? 3.851   20.897  41.458  1.00 28.12  ? 58  ALA B CB    1 
ATOM   3016  N N     . GLN B  1 31  ? 5.413   22.806  39.495  1.00 26.90  ? 59  GLN B N     1 
ATOM   3017  C CA    . GLN B  1 31  ? 5.497   24.065  38.781  1.00 29.74  ? 59  GLN B CA    1 
ATOM   3018  C C     . GLN B  1 31  ? 5.701   23.886  37.272  1.00 24.78  ? 59  GLN B C     1 
ATOM   3019  O O     . GLN B  1 31  ? 5.057   24.566  36.473  1.00 26.84  ? 59  GLN B O     1 
ATOM   3020  C CB    . GLN B  1 31  ? 6.615   24.945  39.335  1.00 25.07  ? 59  GLN B CB    1 
ATOM   3021  C CG    . GLN B  1 31  ? 6.562   26.349  38.743  1.00 35.51  ? 59  GLN B CG    1 
ATOM   3022  C CD    . GLN B  1 31  ? 7.817   27.164  38.961  1.00 39.83  ? 59  GLN B CD    1 
ATOM   3023  O OE1   . GLN B  1 31  ? 8.851   26.658  39.418  1.00 41.62  ? 59  GLN B OE1   1 
ATOM   3024  N NE2   . GLN B  1 31  ? 7.736   28.440  38.611  1.00 40.40  ? 59  GLN B NE2   1 
ATOM   3025  N N     . VAL B  1 32  ? 6.612   22.989  36.900  1.00 25.20  ? 60  VAL B N     1 
ATOM   3026  C CA    . VAL B  1 32  ? 6.881   22.684  35.513  1.00 25.34  ? 60  VAL B CA    1 
ATOM   3027  C C     . VAL B  1 32  ? 5.597   22.289  34.771  1.00 29.97  ? 60  VAL B C     1 
ATOM   3028  O O     . VAL B  1 32  ? 5.352   22.737  33.646  1.00 25.94  ? 60  VAL B O     1 
ATOM   3029  C CB    . VAL B  1 32  ? 7.915   21.560  35.406  1.00 29.56  ? 60  VAL B CB    1 
ATOM   3030  C CG1   . VAL B  1 32  ? 7.825   20.857  34.065  1.00 29.34  ? 60  VAL B CG1   1 
ATOM   3031  C CG2   . VAL B  1 32  ? 9.301   22.126  35.618  1.00 22.64  ? 60  VAL B CG2   1 
ATOM   3032  N N     . ASP B  1 33  ? 4.784   21.476  35.444  1.00 26.48  ? 61  ASP B N     1 
ATOM   3033  C CA    . ASP B  1 33  ? 3.522   20.954  34.907  1.00 25.49  ? 61  ASP B CA    1 
ATOM   3034  C C     . ASP B  1 33  ? 2.425   22.009  34.822  1.00 26.18  ? 61  ASP B C     1 
ATOM   3035  O O     . ASP B  1 33  ? 1.724   22.134  33.789  1.00 28.20  ? 61  ASP B O     1 
ATOM   3036  C CB    . ASP B  1 33  ? 3.042   19.831  35.806  1.00 23.25  ? 61  ASP B CB    1 
ATOM   3037  C CG    . ASP B  1 33  ? 1.663   19.323  35.430  1.00 28.86  ? 61  ASP B CG    1 
ATOM   3038  O OD1   . ASP B  1 33  ? 1.548   18.622  34.395  1.00 23.90  ? 61  ASP B OD1   1 
ATOM   3039  O OD2   . ASP B  1 33  ? 0.694   19.649  36.163  1.00 25.51  ? 61  ASP B OD2   1 
ATOM   3040  N N     . LYS B  1 34  ? 2.265   22.757  35.907  1.00 22.64  ? 62  LYS B N     1 
ATOM   3041  C CA    . LYS B  1 34  ? 1.229   23.764  35.981  1.00 28.67  ? 62  LYS B CA    1 
ATOM   3042  C C     . LYS B  1 34  ? 1.485   24.892  34.988  1.00 28.40  ? 62  LYS B C     1 
ATOM   3043  O O     . LYS B  1 34  ? 0.556   25.366  34.355  1.00 28.67  ? 62  LYS B O     1 
ATOM   3044  C CB    . LYS B  1 34  ? 1.063   24.322  37.393  1.00 28.61  ? 62  LYS B CB    1 
ATOM   3045  C CG    . LYS B  1 34  ? -0.030  25.406  37.467  1.00 28.63  ? 62  LYS B CG    1 
ATOM   3046  C CD    . LYS B  1 34  ? -0.230  25.937  38.874  1.00 35.85  ? 62  LYS B CD    1 
ATOM   3047  C CE    . LYS B  1 34  ? -1.338  26.985  38.887  1.00 43.72  ? 62  LYS B CE    1 
ATOM   3048  N NZ    . LYS B  1 34  ? -1.624  27.520  40.240  1.00 51.08  ? 62  LYS B NZ    1 
ATOM   3049  N N     . GLU B  1 35  ? 2.736   25.305  34.836  1.00 30.98  ? 63  GLU B N     1 
ATOM   3050  C CA    . GLU B  1 35  ? 3.041   26.463  34.007  1.00 34.36  ? 63  GLU B CA    1 
ATOM   3051  C C     . GLU B  1 35  ? 3.579   26.074  32.636  1.00 33.74  ? 63  GLU B C     1 
ATOM   3052  O O     . GLU B  1 35  ? 4.026   26.949  31.899  1.00 33.08  ? 63  GLU B O     1 
ATOM   3053  C CB    . GLU B  1 35  ? 4.039   27.386  34.726  1.00 32.77  ? 63  GLU B CB    1 
ATOM   3054  C CG    . GLU B  1 35  ? 3.477   28.102  35.961  1.00 36.58  ? 63  GLU B CG    1 
ATOM   3055  C CD    . GLU B  1 35  ? 4.561   28.875  36.742  1.00 43.57  ? 63  GLU B CD    1 
ATOM   3056  O OE1   . GLU B  1 35  ? 5.657   29.140  36.178  1.00 45.81  ? 63  GLU B OE1   1 
ATOM   3057  O OE2   . GLU B  1 35  ? 4.327   29.199  37.926  1.00 54.08  ? 63  GLU B OE2   1 
ATOM   3058  N N     . HIS B  1 36  ? 3.538   24.788  32.279  1.00 32.66  ? 64  HIS B N     1 
ATOM   3059  C CA    . HIS B  1 36  ? 4.096   24.333  30.996  1.00 31.27  ? 64  HIS B CA    1 
ATOM   3060  C C     . HIS B  1 36  ? 5.510   24.883  30.810  1.00 29.39  ? 64  HIS B C     1 
ATOM   3061  O O     . HIS B  1 36  ? 5.837   25.412  29.748  1.00 31.73  ? 64  HIS B O     1 
ATOM   3062  C CB    . HIS B  1 36  ? 3.233   24.797  29.799  1.00 31.41  ? 64  HIS B CB    1 
ATOM   3063  C CG    . HIS B  1 36  ? 1.812   24.318  29.836  1.00 33.58  ? 64  HIS B CG    1 
ATOM   3064  N ND1   . HIS B  1 36  ? 1.318   23.390  28.944  1.00 40.67  ? 64  HIS B ND1   1 
ATOM   3065  C CD2   . HIS B  1 36  ? 0.783   24.637  30.654  1.00 41.86  ? 64  HIS B CD2   1 
ATOM   3066  C CE1   . HIS B  1 36  ? 0.045   23.158  29.211  1.00 39.30  ? 64  HIS B CE1   1 
ATOM   3067  N NE2   . HIS B  1 36  ? -0.304  23.901  30.245  1.00 37.78  ? 64  HIS B NE2   1 
ATOM   3068  N N     . LEU B  1 37  ? 6.353   24.746  31.827  1.00 32.28  ? 65  LEU B N     1 
ATOM   3069  C CA    . LEU B  1 37  ? 7.617   25.500  31.919  1.00 29.13  ? 65  LEU B CA    1 
ATOM   3070  C C     . LEU B  1 37  ? 8.848   24.614  31.676  1.00 25.01  ? 65  LEU B C     1 
ATOM   3071  O O     . LEU B  1 37  ? 9.099   23.678  32.425  1.00 25.78  ? 65  LEU B O     1 
ATOM   3072  C CB    . LEU B  1 37  ? 7.696   26.142  33.309  1.00 30.57  ? 65  LEU B CB    1 
ATOM   3073  C CG    . LEU B  1 37  ? 8.923   26.952  33.734  1.00 31.53  ? 65  LEU B CG    1 
ATOM   3074  C CD1   . LEU B  1 37  ? 9.352   27.936  32.662  1.00 36.08  ? 65  LEU B CD1   1 
ATOM   3075  C CD2   . LEU B  1 37  ? 8.610   27.659  35.067  1.00 37.00  ? 65  LEU B CD2   1 
ATOM   3076  N N     . PHE B  1 38  ? 9.590   24.898  30.608  1.00 25.54  ? 66  PHE B N     1 
ATOM   3077  C CA    . PHE B  1 38  ? 10.786  24.134  30.277  1.00 26.84  ? 66  PHE B CA    1 
ATOM   3078  C C     . PHE B  1 38  ? 11.763  24.284  31.444  1.00 29.37  ? 66  PHE B C     1 
ATOM   3079  O O     . PHE B  1 38  ? 12.016  25.404  31.892  1.00 30.97  ? 66  PHE B O     1 
ATOM   3080  C CB    . PHE B  1 38  ? 11.391  24.631  28.964  1.00 29.10  ? 66  PHE B CB    1 
ATOM   3081  C CG    . PHE B  1 38  ? 12.652  23.912  28.556  1.00 22.65  ? 66  PHE B CG    1 
ATOM   3082  C CD1   . PHE B  1 38  ? 12.594  22.661  27.955  1.00 25.73  ? 66  PHE B CD1   1 
ATOM   3083  C CD2   . PHE B  1 38  ? 13.898  24.492  28.756  1.00 32.96  ? 66  PHE B CD2   1 
ATOM   3084  C CE1   . PHE B  1 38  ? 13.768  21.986  27.570  1.00 29.56  ? 66  PHE B CE1   1 
ATOM   3085  C CE2   . PHE B  1 38  ? 15.072  23.828  28.389  1.00 31.36  ? 66  PHE B CE2   1 
ATOM   3086  C CZ    . PHE B  1 38  ? 15.008  22.581  27.791  1.00 31.40  ? 66  PHE B CZ    1 
ATOM   3087  N N     . PRO B  1 39  ? 12.281  23.159  31.980  1.00 31.34  ? 67  PRO B N     1 
ATOM   3088  C CA    . PRO B  1 39  ? 13.157  23.222  33.165  1.00 29.05  ? 67  PRO B CA    1 
ATOM   3089  C C     . PRO B  1 39  ? 14.635  23.463  32.841  1.00 28.71  ? 67  PRO B C     1 
ATOM   3090  O O     . PRO B  1 39  ? 15.481  22.608  33.127  1.00 30.15  ? 67  PRO B O     1 
ATOM   3091  C CB    . PRO B  1 39  ? 12.957  21.851  33.820  1.00 26.34  ? 67  PRO B CB    1 
ATOM   3092  C CG    . PRO B  1 39  ? 12.543  20.935  32.678  1.00 28.21  ? 67  PRO B CG    1 
ATOM   3093  C CD    . PRO B  1 39  ? 12.051  21.771  31.536  1.00 30.52  ? 67  PRO B CD    1 
ATOM   3094  N N     . ALA B  1 40  ? 14.920  24.637  32.288  1.00 30.16  ? 68  ALA B N     1 
ATOM   3095  C CA    . ALA B  1 40  ? 16.220  24.952  31.700  1.00 28.26  ? 68  ALA B CA    1 
ATOM   3096  C C     . ALA B  1 40  ? 17.431  24.843  32.651  1.00 28.89  ? 68  ALA B C     1 
ATOM   3097  O O     . ALA B  1 40  ? 18.469  24.266  32.277  1.00 27.78  ? 68  ALA B O     1 
ATOM   3098  C CB    . ALA B  1 40  ? 16.171  26.352  31.044  1.00 29.05  ? 68  ALA B CB    1 
ATOM   3099  N N     . ALA B  1 41  ? 17.313  25.394  33.859  1.00 31.79  ? 69  ALA B N     1 
ATOM   3100  C CA    . ALA B  1 41  ? 18.410  25.324  34.837  1.00 32.02  ? 69  ALA B CA    1 
ATOM   3101  C C     . ALA B  1 41  ? 18.732  23.872  35.228  1.00 32.06  ? 69  ALA B C     1 
ATOM   3102  O O     . ALA B  1 41  ? 19.891  23.475  35.294  1.00 30.36  ? 69  ALA B O     1 
ATOM   3103  C CB    . ALA B  1 41  ? 18.070  26.159  36.078  1.00 34.42  ? 69  ALA B CB    1 
ATOM   3104  N N     . GLN B  1 42  ? 17.693  23.061  35.419  1.00 29.05  ? 70  GLN B N     1 
ATOM   3105  C CA    . GLN B  1 42  ? 17.874  21.661  35.828  1.00 30.69  ? 70  GLN B CA    1 
ATOM   3106  C C     . GLN B  1 42  ? 18.435  20.787  34.695  1.00 27.22  ? 70  GLN B C     1 
ATOM   3107  O O     . GLN B  1 42  ? 19.262  19.895  34.931  1.00 29.66  ? 70  GLN B O     1 
ATOM   3108  C CB    . GLN B  1 42  ? 16.572  21.087  36.383  1.00 30.03  ? 70  GLN B CB    1 
ATOM   3109  C CG    . GLN B  1 42  ? 16.030  21.863  37.594  1.00 32.88  ? 70  GLN B CG    1 
ATOM   3110  C CD    . GLN B  1 42  ? 15.363  23.187  37.236  1.00 32.14  ? 70  GLN B CD    1 
ATOM   3111  O OE1   . GLN B  1 42  ? 15.134  23.497  36.053  1.00 29.26  ? 70  GLN B OE1   1 
ATOM   3112  N NE2   . GLN B  1 42  ? 15.047  23.985  38.264  1.00 28.69  ? 70  GLN B NE2   1 
ATOM   3113  N N     . VAL B  1 43  ? 18.021  21.078  33.463  1.00 29.63  ? 71  VAL B N     1 
ATOM   3114  C CA    . VAL B  1 43  ? 18.569  20.401  32.288  1.00 29.04  ? 71  VAL B CA    1 
ATOM   3115  C C     . VAL B  1 43  ? 20.053  20.739  32.096  1.00 30.38  ? 71  VAL B C     1 
ATOM   3116  O O     . VAL B  1 43  ? 20.818  19.880  31.641  1.00 27.09  ? 71  VAL B O     1 
ATOM   3117  C CB    . VAL B  1 43  ? 17.775  20.767  31.007  1.00 33.06  ? 71  VAL B CB    1 
ATOM   3118  C CG1   . VAL B  1 43  ? 18.509  20.257  29.736  1.00 29.99  ? 71  VAL B CG1   1 
ATOM   3119  C CG2   . VAL B  1 43  ? 16.347  20.207  31.089  1.00 26.24  ? 71  VAL B CG2   1 
ATOM   3120  N N     . LYS B  1 44  ? 20.446  21.985  32.396  1.00 30.96  ? 72  LYS B N     1 
ATOM   3121  C CA    . LYS B  1 44  ? 21.876  22.355  32.350  1.00 32.21  ? 72  LYS B CA    1 
ATOM   3122  C C     . LYS B  1 44  ? 22.679  21.565  33.371  1.00 29.32  ? 72  LYS B C     1 
ATOM   3123  O O     . LYS B  1 44  ? 23.743  21.044  33.040  1.00 34.85  ? 72  LYS B O     1 
ATOM   3124  C CB    . LYS B  1 44  ? 22.100  23.862  32.556  1.00 34.87  ? 72  LYS B CB    1 
ATOM   3125  C CG    . LYS B  1 44  ? 23.602  24.317  32.628  1.00 41.19  ? 72  LYS B CG    1 
ATOM   3126  C CD    . LYS B  1 44  ? 24.377  24.082  31.308  1.00 55.99  ? 72  LYS B CD    1 
ATOM   3127  C CE    . LYS B  1 44  ? 25.904  23.944  31.513  1.00 59.95  ? 72  LYS B CE    1 
ATOM   3128  N NZ    . LYS B  1 44  ? 26.411  22.529  31.742  1.00 41.66  ? 72  LYS B NZ    1 
ATOM   3129  N N     . LYS B  1 45  ? 22.172  21.467  34.600  1.00 32.82  ? 73  LYS B N     1 
ATOM   3130  C CA    . LYS B  1 45  ? 22.860  20.689  35.646  1.00 32.30  ? 73  LYS B CA    1 
ATOM   3131  C C     . LYS B  1 45  ? 22.992  19.223  35.246  1.00 33.10  ? 73  LYS B C     1 
ATOM   3132  O O     . LYS B  1 45  ? 24.051  18.617  35.423  1.00 34.13  ? 73  LYS B O     1 
ATOM   3133  C CB    . LYS B  1 45  ? 22.134  20.808  36.989  1.00 32.27  ? 73  LYS B CB    1 
ATOM   3134  C CG    . LYS B  1 45  ? 22.197  22.200  37.604  1.00 36.10  ? 73  LYS B CG    1 
ATOM   3135  C CD    . LYS B  1 45  ? 21.762  22.179  39.070  1.00 44.97  ? 73  LYS B CD    1 
ATOM   3136  C CE    . LYS B  1 45  ? 21.682  23.590  39.660  1.00 50.24  ? 73  LYS B CE    1 
ATOM   3137  N NZ    . LYS B  1 45  ? 20.500  24.360  39.141  1.00 68.32  ? 73  LYS B NZ    1 
ATOM   3138  N N     . MET B  1 46  ? 21.921  18.659  34.693  1.00 30.33  ? 74  MET B N     1 
ATOM   3139  C CA    . MET B  1 46  ? 21.961  17.292  34.138  1.00 32.52  ? 74  MET B CA    1 
ATOM   3140  C C     . MET B  1 46  ? 23.046  17.141  33.077  1.00 29.94  ? 74  MET B C     1 
ATOM   3141  O O     . MET B  1 46  ? 23.752  16.137  33.043  1.00 27.87  ? 74  MET B O     1 
ATOM   3142  C CB    . MET B  1 46  ? 20.597  16.910  33.565  1.00 32.04  ? 74  MET B CB    1 
ATOM   3143  C CG    . MET B  1 46  ? 19.588  16.577  34.645  1.00 35.72  ? 74  MET B CG    1 
ATOM   3144  S SD    . MET B  1 46  ? 17.896  16.477  34.063  1.00 42.76  ? 74  MET B SD    1 
ATOM   3145  C CE    . MET B  1 46  ? 18.072  15.151  32.864  1.00 37.49  ? 74  MET B CE    1 
ATOM   3146  N N     . GLY B  1 47  ? 23.173  18.151  32.217  1.00 31.41  ? 75  GLY B N     1 
ATOM   3147  C CA    . GLY B  1 47  ? 24.243  18.190  31.231  1.00 32.12  ? 75  GLY B CA    1 
ATOM   3148  C C     . GLY B  1 47  ? 25.628  18.128  31.845  1.00 32.02  ? 75  GLY B C     1 
ATOM   3149  O O     . GLY B  1 47  ? 26.520  17.431  31.335  1.00 34.61  ? 75  GLY B O     1 
ATOM   3150  N N     . GLY B  1 48  ? 25.805  18.864  32.939  1.00 33.99  ? 76  GLY B N     1 
ATOM   3151  C CA    . GLY B  1 48  ? 27.048  18.853  33.704  1.00 35.03  ? 76  GLY B CA    1 
ATOM   3152  C C     . GLY B  1 48  ? 27.365  17.509  34.318  1.00 34.46  ? 76  GLY B C     1 
ATOM   3153  O O     . GLY B  1 48  ? 28.526  17.140  34.418  1.00 37.30  ? 76  GLY B O     1 
ATOM   3154  N N     . LEU B  1 49  ? 26.332  16.774  34.722  1.00 32.84  ? 77  LEU B N     1 
ATOM   3155  C CA    . LEU B  1 49  ? 26.490  15.413  35.244  1.00 30.85  ? 77  LEU B CA    1 
ATOM   3156  C C     . LEU B  1 49  ? 26.723  14.315  34.175  1.00 34.70  ? 77  LEU B C     1 
ATOM   3157  O O     . LEU B  1 49  ? 27.153  13.213  34.514  1.00 37.65  ? 77  LEU B O     1 
ATOM   3158  C CB    . LEU B  1 49  ? 25.269  15.056  36.097  1.00 31.03  ? 77  LEU B CB    1 
ATOM   3159  C CG    . LEU B  1 49  ? 25.202  15.780  37.436  1.00 34.56  ? 77  LEU B CG    1 
ATOM   3160  C CD1   . LEU B  1 49  ? 23.920  15.477  38.148  1.00 36.24  ? 77  LEU B CD1   1 
ATOM   3161  C CD2   . LEU B  1 49  ? 26.403  15.351  38.291  1.00 37.84  ? 77  LEU B CD2   1 
ATOM   3162  N N     . GLY B  1 50  ? 26.439  14.605  32.901  1.00 32.47  ? 78  GLY B N     1 
ATOM   3163  C CA    . GLY B  1 50  ? 26.613  13.621  31.823  1.00 31.11  ? 78  GLY B CA    1 
ATOM   3164  C C     . GLY B  1 50  ? 25.342  12.880  31.413  1.00 29.20  ? 78  GLY B C     1 
ATOM   3165  O O     . GLY B  1 50  ? 25.359  12.049  30.505  1.00 27.25  ? 78  GLY B O     1 
ATOM   3166  N N     . LEU B  1 51  ? 24.230  13.235  32.036  1.00 27.96  ? 79  LEU B N     1 
ATOM   3167  C CA    . LEU B  1 51  ? 22.968  12.514  31.838  1.00 29.35  ? 79  LEU B CA    1 
ATOM   3168  C C     . LEU B  1 51  ? 22.348  12.710  30.444  1.00 28.69  ? 79  LEU B C     1 
ATOM   3169  O O     . LEU B  1 51  ? 21.495  11.929  30.035  1.00 29.17  ? 79  LEU B O     1 
ATOM   3170  C CB    . LEU B  1 51  ? 21.968  12.941  32.919  1.00 28.71  ? 79  LEU B CB    1 
ATOM   3171  C CG    . LEU B  1 51  ? 22.365  12.555  34.337  1.00 31.47  ? 79  LEU B CG    1 
ATOM   3172  C CD1   . LEU B  1 51  ? 21.453  13.232  35.364  1.00 27.21  ? 79  LEU B CD1   1 
ATOM   3173  C CD2   . LEU B  1 51  ? 22.360  11.042  34.499  1.00 30.40  ? 79  LEU B CD2   1 
ATOM   3174  N N     . LEU B  1 52  ? 22.762  13.757  29.732  1.00 30.25  ? 80  LEU B N     1 
ATOM   3175  C CA    . LEU B  1 52  ? 22.219  14.069  28.415  1.00 29.80  ? 80  LEU B CA    1 
ATOM   3176  C C     . LEU B  1 52  ? 23.050  13.442  27.290  1.00 30.32  ? 80  LEU B C     1 
ATOM   3177  O O     . LEU B  1 52  ? 22.690  13.547  26.111  1.00 30.91  ? 80  LEU B O     1 
ATOM   3178  C CB    . LEU B  1 52  ? 22.128  15.584  28.238  1.00 32.25  ? 80  LEU B CB    1 
ATOM   3179  C CG    . LEU B  1 52  ? 21.193  16.287  29.238  1.00 36.24  ? 80  LEU B CG    1 
ATOM   3180  C CD1   . LEU B  1 52  ? 21.308  17.791  29.084  1.00 40.58  ? 80  LEU B CD1   1 
ATOM   3181  C CD2   . LEU B  1 52  ? 19.751  15.833  29.063  1.00 45.33  ? 80  LEU B CD2   1 
ATOM   3182  N N     . ALA B  1 53  ? 24.148  12.782  27.666  1.00 29.07  ? 81  ALA B N     1 
ATOM   3183  C CA    . ALA B  1 53  ? 25.076  12.167  26.720  1.00 27.12  ? 81  ALA B CA    1 
ATOM   3184  C C     . ALA B  1 53  ? 25.748  10.936  27.322  1.00 27.02  ? 81  ALA B C     1 
ATOM   3185  O O     . ALA B  1 53  ? 26.985  10.818  27.318  1.00 34.57  ? 81  ALA B O     1 
ATOM   3186  C CB    . ALA B  1 53  ? 26.125  13.185  26.289  1.00 28.84  ? 81  ALA B CB    1 
ATOM   3187  N N     . MET B  1 54  ? 24.922  9.985   27.763  1.00 33.03  ? 82  MET B N     1 
ATOM   3188  C CA    . MET B  1 54  ? 25.361  8.841   28.583  1.00 33.84  ? 82  MET B CA    1 
ATOM   3189  C C     . MET B  1 54  ? 26.118  7.719   27.858  1.00 32.29  ? 82  MET B C     1 
ATOM   3190  O O     . MET B  1 54  ? 27.118  7.208   28.366  1.00 36.55  ? 82  MET B O     1 
ATOM   3191  C CB    . MET B  1 54  ? 24.146  8.232   29.272  1.00 30.85  ? 82  MET B CB    1 
ATOM   3192  C CG    . MET B  1 54  ? 23.389  9.210   30.110  1.00 37.59  ? 82  MET B CG    1 
ATOM   3193  S SD    . MET B  1 54  ? 22.679  8.427   31.559  1.00 44.95  ? 82  MET B SD    1 
ATOM   3194  C CE    . MET B  1 54  ? 24.200  7.895   32.368  1.00 35.81  ? 82  MET B CE    1 
ATOM   3195  N N     . ASP B  1 55  ? 25.627  7.337   26.682  1.00 31.69  ? 83  ASP B N     1 
ATOM   3196  C CA    . ASP B  1 55  ? 26.216  6.274   25.864  1.00 36.36  ? 83  ASP B CA    1 
ATOM   3197  C C     . ASP B  1 55  ? 27.228  6.842   24.839  1.00 35.77  ? 83  ASP B C     1 
ATOM   3198  O O     . ASP B  1 55  ? 27.623  6.159   23.895  1.00 39.60  ? 83  ASP B O     1 
ATOM   3199  C CB    . ASP B  1 55  ? 25.078  5.517   25.150  1.00 39.06  ? 83  ASP B CB    1 
ATOM   3200  C CG    . ASP B  1 55  ? 25.527  4.189   24.529  1.00 50.91  ? 83  ASP B CG    1 
ATOM   3201  O OD1   . ASP B  1 55  ? 26.226  3.401   25.212  1.00 50.55  ? 83  ASP B OD1   1 
ATOM   3202  O OD2   . ASP B  1 55  ? 25.155  3.928   23.353  1.00 54.92  ? 83  ASP B OD2   1 
ATOM   3203  N N     . VAL B  1 56  ? 27.659  8.085   25.051  1.00 35.23  ? 84  VAL B N     1 
ATOM   3204  C CA    . VAL B  1 56  ? 28.551  8.791   24.126  1.00 30.86  ? 84  VAL B CA    1 
ATOM   3205  C C     . VAL B  1 56  ? 29.984  8.663   24.645  1.00 33.29  ? 84  VAL B C     1 
ATOM   3206  O O     . VAL B  1 56  ? 30.201  8.790   25.842  1.00 30.79  ? 84  VAL B O     1 
ATOM   3207  C CB    . VAL B  1 56  ? 28.127  10.263  24.050  1.00 32.88  ? 84  VAL B CB    1 
ATOM   3208  C CG1   . VAL B  1 56  ? 29.023  11.084  23.132  1.00 27.81  ? 84  VAL B CG1   1 
ATOM   3209  C CG2   . VAL B  1 56  ? 26.681  10.350  23.596  1.00 32.69  ? 84  VAL B CG2   1 
ATOM   3210  N N     . PRO B  1 57  ? 30.959  8.381   23.750  1.00 35.55  ? 85  PRO B N     1 
ATOM   3211  C CA    . PRO B  1 57  ? 32.349  8.244   24.207  1.00 35.95  ? 85  PRO B CA    1 
ATOM   3212  C C     . PRO B  1 57  ? 32.872  9.511   24.887  1.00 31.99  ? 85  PRO B C     1 
ATOM   3213  O O     . PRO B  1 57  ? 32.593  10.634  24.449  1.00 31.49  ? 85  PRO B O     1 
ATOM   3214  C CB    . PRO B  1 57  ? 33.136  7.962   22.914  1.00 35.93  ? 85  PRO B CB    1 
ATOM   3215  C CG    . PRO B  1 57  ? 32.125  7.509   21.928  1.00 38.87  ? 85  PRO B CG    1 
ATOM   3216  C CD    . PRO B  1 57  ? 30.822  8.147   22.302  1.00 33.74  ? 85  PRO B CD    1 
ATOM   3217  N N     . GLU B  1 58  ? 33.652  9.328   25.945  1.00 37.68  ? 86  GLU B N     1 
ATOM   3218  C CA    . GLU B  1 58  ? 34.217  10.476  26.662  1.00 37.33  ? 86  GLU B CA    1 
ATOM   3219  C C     . GLU B  1 58  ? 35.107  11.347  25.761  1.00 35.21  ? 86  GLU B C     1 
ATOM   3220  O O     . GLU B  1 58  ? 35.274  12.538  26.028  1.00 35.77  ? 86  GLU B O     1 
ATOM   3221  C CB    . GLU B  1 58  ? 34.957  10.015  27.916  1.00 38.57  ? 86  GLU B CB    1 
ATOM   3222  C CG    . GLU B  1 58  ? 34.068  9.227   28.891  1.00 49.35  ? 86  GLU B CG    1 
ATOM   3223  C CD    . GLU B  1 58  ? 34.556  9.284   30.331  1.00 70.85  ? 86  GLU B CD    1 
ATOM   3224  O OE1   . GLU B  1 58  ? 35.786  9.246   30.564  1.00 82.69  ? 86  GLU B OE1   1 
ATOM   3225  O OE2   . GLU B  1 58  ? 33.702  9.370   31.239  1.00 87.20  ? 86  GLU B OE2   1 
ATOM   3226  N N     . GLU B  1 59  ? 35.611  10.768  24.673  1.00 37.13  ? 87  GLU B N     1 
ATOM   3227  C CA    . GLU B  1 59  ? 36.354  11.504  23.630  1.00 39.70  ? 87  GLU B CA    1 
ATOM   3228  C C     . GLU B  1 59  ? 35.501  12.543  22.891  1.00 38.29  ? 87  GLU B C     1 
ATOM   3229  O O     . GLU B  1 59  ? 36.032  13.521  22.349  1.00 38.55  ? 87  GLU B O     1 
ATOM   3230  C CB    . GLU B  1 59  ? 36.894  10.539  22.574  1.00 40.06  ? 87  GLU B CB    1 
ATOM   3231  C CG    . GLU B  1 59  ? 37.748  9.397   23.114  1.00 66.83  ? 87  GLU B CG    1 
ATOM   3232  C CD    . GLU B  1 59  ? 37.493  8.091   22.377  1.00 87.51  ? 87  GLU B CD    1 
ATOM   3233  O OE1   . GLU B  1 59  ? 36.324  7.640   22.361  1.00 81.16  ? 87  GLU B OE1   1 
ATOM   3234  O OE2   . GLU B  1 59  ? 38.460  7.519   21.820  1.00 106.12 ? 87  GLU B OE2   1 
ATOM   3235  N N     . LEU B  1 60  ? 34.192  12.309  22.827  1.00 37.39  ? 88  LEU B N     1 
ATOM   3236  C CA    . LEU B  1 60  ? 33.260  13.276  22.245  1.00 33.74  ? 88  LEU B CA    1 
ATOM   3237  C C     . LEU B  1 60  ? 32.515  14.069  23.314  1.00 35.17  ? 88  LEU B C     1 
ATOM   3238  O O     . LEU B  1 60  ? 31.478  14.691  23.032  1.00 38.40  ? 88  LEU B O     1 
ATOM   3239  C CB    . LEU B  1 60  ? 32.256  12.552  21.355  1.00 35.26  ? 88  LEU B CB    1 
ATOM   3240  C CG    . LEU B  1 60  ? 32.818  11.888  20.105  1.00 36.42  ? 88  LEU B CG    1 
ATOM   3241  C CD1   . LEU B  1 60  ? 31.706  11.074  19.453  1.00 34.81  ? 88  LEU B CD1   1 
ATOM   3242  C CD2   . LEU B  1 60  ? 33.405  12.950  19.153  1.00 29.59  ? 88  LEU B CD2   1 
ATOM   3243  N N     . GLY B  1 61  ? 33.039  14.048  24.540  1.00 34.52  ? 89  GLY B N     1 
ATOM   3244  C CA    . GLY B  1 61  ? 32.417  14.766  25.667  1.00 33.90  ? 89  GLY B CA    1 
ATOM   3245  C C     . GLY B  1 61  ? 31.283  14.017  26.350  1.00 33.40  ? 89  GLY B C     1 
ATOM   3246  O O     . GLY B  1 61  ? 30.583  14.578  27.207  1.00 33.43  ? 89  GLY B O     1 
ATOM   3247  N N     . GLY B  1 62  ? 31.095  12.755  25.983  1.00 34.91  ? 90  GLY B N     1 
ATOM   3248  C CA    . GLY B  1 62  ? 30.068  11.933  26.607  1.00 34.01  ? 90  GLY B CA    1 
ATOM   3249  C C     . GLY B  1 62  ? 30.489  11.336  27.935  1.00 35.21  ? 90  GLY B C     1 
ATOM   3250  O O     . GLY B  1 62  ? 31.642  11.499  28.374  1.00 33.08  ? 90  GLY B O     1 
ATOM   3251  N N     . ALA B  1 63  ? 29.547  10.645  28.575  1.00 32.66  ? 91  ALA B N     1 
ATOM   3252  C CA    . ALA B  1 63  ? 29.792  9.982   29.859  1.00 33.56  ? 91  ALA B CA    1 
ATOM   3253  C C     . ALA B  1 63  ? 30.537  8.645   29.695  1.00 31.47  ? 91  ALA B C     1 
ATOM   3254  O O     . ALA B  1 63  ? 31.109  8.121   30.663  1.00 34.48  ? 91  ALA B O     1 
ATOM   3255  C CB    . ALA B  1 63  ? 28.477  9.769   30.617  1.00 29.05  ? 91  ALA B CB    1 
ATOM   3256  N N     . GLY B  1 64  ? 30.508  8.085   28.487  1.00 32.53  ? 92  GLY B N     1 
ATOM   3257  C CA    . GLY B  1 64  ? 31.174  6.820   28.226  1.00 31.87  ? 92  GLY B CA    1 
ATOM   3258  C C     . GLY B  1 64  ? 30.568  5.643   28.961  1.00 33.83  ? 92  GLY B C     1 
ATOM   3259  O O     . GLY B  1 64  ? 31.259  4.681   29.267  1.00 37.47  ? 92  GLY B O     1 
ATOM   3260  N N     . LEU B  1 65  ? 29.271  5.711   29.243  1.00 32.71  ? 93  LEU B N     1 
ATOM   3261  C CA    . LEU B  1 65  ? 28.564  4.620   29.923  1.00 33.36  ? 93  LEU B CA    1 
ATOM   3262  C C     . LEU B  1 65  ? 27.819  3.718   28.913  1.00 34.59  ? 93  LEU B C     1 
ATOM   3263  O O     . LEU B  1 65  ? 28.096  3.743   27.706  1.00 37.67  ? 93  LEU B O     1 
ATOM   3264  C CB    . LEU B  1 65  ? 27.601  5.205   30.975  1.00 31.07  ? 93  LEU B CB    1 
ATOM   3265  C CG    . LEU B  1 65  ? 28.313  5.942   32.116  1.00 34.03  ? 93  LEU B CG    1 
ATOM   3266  C CD1   . LEU B  1 65  ? 27.334  6.522   33.118  1.00 32.91  ? 93  LEU B CD1   1 
ATOM   3267  C CD2   . LEU B  1 65  ? 29.293  4.981   32.812  1.00 31.47  ? 93  LEU B CD2   1 
ATOM   3268  N N     . ASP B  1 66  ? 26.892  2.907   29.404  1.00 36.20  ? 94  ASP B N     1 
ATOM   3269  C CA    . ASP B  1 66  ? 26.173  1.975   28.552  1.00 32.63  ? 94  ASP B CA    1 
ATOM   3270  C C     . ASP B  1 66  ? 24.662  2.171   28.692  1.00 30.78  ? 94  ASP B C     1 
ATOM   3271  O O     . ASP B  1 66  ? 24.207  2.980   29.512  1.00 29.42  ? 94  ASP B O     1 
ATOM   3272  C CB    . ASP B  1 66  ? 26.589  0.539   28.884  1.00 35.77  ? 94  ASP B CB    1 
ATOM   3273  C CG    . ASP B  1 66  ? 26.344  0.158   30.344  1.00 33.89  ? 94  ASP B CG    1 
ATOM   3274  O OD1   . ASP B  1 66  ? 25.527  0.795   31.044  1.00 37.00  ? 94  ASP B OD1   1 
ATOM   3275  O OD2   . ASP B  1 66  ? 26.988  -0.808  30.796  1.00 42.79  ? 94  ASP B OD2   1 
ATOM   3276  N N     . TYR B  1 67  ? 23.894  1.438   27.891  1.00 28.07  ? 95  TYR B N     1 
ATOM   3277  C CA    . TYR B  1 67  ? 22.432  1.590   27.915  1.00 29.26  ? 95  TYR B CA    1 
ATOM   3278  C C     . TYR B  1 67  ? 21.773  1.102   29.189  1.00 24.21  ? 95  TYR B C     1 
ATOM   3279  O O     . TYR B  1 67  ? 20.737  1.645   29.580  1.00 27.29  ? 95  TYR B O     1 
ATOM   3280  C CB    . TYR B  1 67  ? 21.761  0.991   26.666  1.00 26.04  ? 95  TYR B CB    1 
ATOM   3281  C CG    . TYR B  1 67  ? 21.242  2.086   25.770  1.00 31.25  ? 95  TYR B CG    1 
ATOM   3282  C CD1   . TYR B  1 67  ? 19.890  2.203   25.494  1.00 30.22  ? 95  TYR B CD1   1 
ATOM   3283  C CD2   . TYR B  1 67  ? 22.102  3.056   25.260  1.00 29.88  ? 95  TYR B CD2   1 
ATOM   3284  C CE1   . TYR B  1 67  ? 19.410  3.221   24.673  1.00 31.45  ? 95  TYR B CE1   1 
ATOM   3285  C CE2   . TYR B  1 67  ? 21.640  4.085   24.454  1.00 29.98  ? 95  TYR B CE2   1 
ATOM   3286  C CZ    . TYR B  1 67  ? 20.284  4.160   24.158  1.00 31.32  ? 95  TYR B CZ    1 
ATOM   3287  O OH    . TYR B  1 67  ? 19.788  5.171   23.364  1.00 33.97  ? 95  TYR B OH    1 
ATOM   3288  N N     . LEU B  1 68  ? 22.346  0.103   29.848  1.00 24.21  ? 96  LEU B N     1 
ATOM   3289  C CA    . LEU B  1 68  ? 21.893  -0.239  31.204  1.00 27.53  ? 96  LEU B CA    1 
ATOM   3290  C C     . LEU B  1 68  ? 22.013  0.954   32.160  1.00 29.39  ? 96  LEU B C     1 
ATOM   3291  O O     . LEU B  1 68  ? 21.092  1.228   32.935  1.00 23.44  ? 96  LEU B O     1 
ATOM   3292  C CB    . LEU B  1 68  ? 22.631  -1.462  31.769  1.00 23.52  ? 96  LEU B CB    1 
ATOM   3293  C CG    . LEU B  1 68  ? 22.231  -1.987  33.152  1.00 28.86  ? 96  LEU B CG    1 
ATOM   3294  C CD1   . LEU B  1 68  ? 20.794  -2.460  33.212  1.00 26.39  ? 96  LEU B CD1   1 
ATOM   3295  C CD2   . LEU B  1 68  ? 23.169  -3.145  33.563  1.00 27.98  ? 96  LEU B CD2   1 
ATOM   3296  N N     . ALA B  1 69  ? 23.134  1.677   32.114  1.00 27.74  ? 97  ALA B N     1 
ATOM   3297  C CA    . ALA B  1 69  ? 23.271  2.873   32.954  1.00 27.55  ? 97  ALA B CA    1 
ATOM   3298  C C     . ALA B  1 69  ? 22.179  3.894   32.579  1.00 28.91  ? 97  ALA B C     1 
ATOM   3299  O O     . ALA B  1 69  ? 21.477  4.471   33.453  1.00 28.13  ? 97  ALA B O     1 
ATOM   3300  C CB    . ALA B  1 69  ? 24.682  3.477   32.804  1.00 24.97  ? 97  ALA B CB    1 
ATOM   3301  N N     . TYR B  1 70  ? 22.024  4.101   31.273  1.00 27.05  ? 98  TYR B N     1 
ATOM   3302  C CA    . TYR B  1 70  ? 21.024  5.035   30.760  1.00 27.90  ? 98  TYR B CA    1 
ATOM   3303  C C     . TYR B  1 70  ? 19.609  4.705   31.270  1.00 26.75  ? 98  TYR B C     1 
ATOM   3304  O O     . TYR B  1 70  ? 18.892  5.605   31.716  1.00 29.42  ? 98  TYR B O     1 
ATOM   3305  C CB    . TYR B  1 70  ? 21.104  5.103   29.229  1.00 24.55  ? 98  TYR B CB    1 
ATOM   3306  C CG    . TYR B  1 70  ? 20.015  5.878   28.497  1.00 27.00  ? 98  TYR B CG    1 
ATOM   3307  C CD1   . TYR B  1 70  ? 19.777  7.231   28.746  1.00 27.22  ? 98  TYR B CD1   1 
ATOM   3308  C CD2   . TYR B  1 70  ? 19.263  5.252   27.499  1.00 30.24  ? 98  TYR B CD2   1 
ATOM   3309  C CE1   . TYR B  1 70  ? 18.779  7.940   28.036  1.00 23.77  ? 98  TYR B CE1   1 
ATOM   3310  C CE2   . TYR B  1 70  ? 18.277  5.933   26.797  1.00 27.85  ? 98  TYR B CE2   1 
ATOM   3311  C CZ    . TYR B  1 70  ? 18.039  7.267   27.063  1.00 28.17  ? 98  TYR B CZ    1 
ATOM   3312  O OH    . TYR B  1 70  ? 17.058  7.900   26.349  1.00 29.70  ? 98  TYR B OH    1 
ATOM   3313  N N     . ALA B  1 71  ? 19.227  3.430   31.239  1.00 28.03  ? 99  ALA B N     1 
ATOM   3314  C CA    . ALA B  1 71  ? 17.864  3.038   31.634  1.00 26.88  ? 99  ALA B CA    1 
ATOM   3315  C C     . ALA B  1 71  ? 17.616  3.268   33.137  1.00 28.29  ? 99  ALA B C     1 
ATOM   3316  O O     . ALA B  1 71  ? 16.534  3.709   33.533  1.00 24.07  ? 99  ALA B O     1 
ATOM   3317  C CB    . ALA B  1 71  ? 17.604  1.590   31.249  1.00 25.33  ? 99  ALA B CB    1 
ATOM   3318  N N     . ILE B  1 72  ? 18.636  2.995   33.955  1.00 25.03  ? 100 ILE B N     1 
ATOM   3319  C CA    . ILE B  1 72  ? 18.612  3.292   35.393  1.00 27.76  ? 100 ILE B CA    1 
ATOM   3320  C C     . ILE B  1 72  ? 18.497  4.793   35.657  1.00 27.77  ? 100 ILE B C     1 
ATOM   3321  O O     . ILE B  1 72  ? 17.630  5.224   36.406  1.00 24.81  ? 100 ILE B O     1 
ATOM   3322  C CB    . ILE B  1 72  ? 19.895  2.779   36.109  1.00 28.38  ? 100 ILE B CB    1 
ATOM   3323  C CG1   . ILE B  1 72  ? 19.936  1.252   36.130  1.00 30.39  ? 100 ILE B CG1   1 
ATOM   3324  C CG2   . ILE B  1 72  ? 19.988  3.330   37.563  1.00 26.92  ? 100 ILE B CG2   1 
ATOM   3325  C CD1   . ILE B  1 72  ? 21.323  0.711   36.380  1.00 30.53  ? 100 ILE B CD1   1 
ATOM   3326  N N     . ALA B  1 73  ? 19.399  5.577   35.052  1.00 28.43  ? 101 ALA B N     1 
ATOM   3327  C CA    . ALA B  1 73  ? 19.372  7.036   35.192  1.00 28.48  ? 101 ALA B CA    1 
ATOM   3328  C C     . ALA B  1 73  ? 18.027  7.596   34.681  1.00 27.18  ? 101 ALA B C     1 
ATOM   3329  O O     . ALA B  1 73  ? 17.421  8.466   35.334  1.00 28.88  ? 101 ALA B O     1 
ATOM   3330  C CB    . ALA B  1 73  ? 20.574  7.672   34.457  1.00 25.19  ? 101 ALA B CB    1 
ATOM   3331  N N     . MET B  1 74  ? 17.550  7.080   33.541  1.00 24.83  ? 102 MET B N     1 
ATOM   3332  C CA    . MET B  1 74  ? 16.249  7.518   32.974  1.00 24.05  ? 102 MET B CA    1 
ATOM   3333  C C     . MET B  1 74  ? 15.109  7.324   33.950  1.00 23.92  ? 102 MET B C     1 
ATOM   3334  O O     . MET B  1 74  ? 14.208  8.168   34.042  1.00 21.73  ? 102 MET B O     1 
ATOM   3335  C CB    . MET B  1 74  ? 15.896  6.785   31.659  1.00 23.42  ? 102 MET B CB    1 
ATOM   3336  C CG    . MET B  1 74  ? 16.173  7.536   30.369  1.00 37.55  ? 102 MET B CG    1 
ATOM   3337  S SD    . MET B  1 74  ? 15.438  9.171   30.161  1.00 35.79  ? 102 MET B SD    1 
ATOM   3338  C CE    . MET B  1 74  ? 13.689  8.927   30.561  1.00 19.83  ? 102 MET B CE    1 
ATOM   3339  N N     . GLU B  1 75  ? 15.140  6.217   34.683  1.00 24.22  ? 103 GLU B N     1 
ATOM   3340  C CA    . GLU B  1 75  ? 14.036  5.918   35.596  1.00 27.42  ? 103 GLU B CA    1 
ATOM   3341  C C     . GLU B  1 75  ? 14.070  6.866   36.816  1.00 24.48  ? 103 GLU B C     1 
ATOM   3342  O O     . GLU B  1 75  ? 13.062  7.427   37.199  1.00 22.39  ? 103 GLU B O     1 
ATOM   3343  C CB    . GLU B  1 75  ? 14.073  4.444   36.009  1.00 29.03  ? 103 GLU B CB    1 
ATOM   3344  C CG    . GLU B  1 75  ? 12.998  4.070   37.025  1.00 27.92  ? 103 GLU B CG    1 
ATOM   3345  C CD    . GLU B  1 75  ? 13.235  2.720   37.649  1.00 36.52  ? 103 GLU B CD    1 
ATOM   3346  O OE1   . GLU B  1 75  ? 13.771  1.814   36.952  1.00 38.52  ? 103 GLU B OE1   1 
ATOM   3347  O OE2   . GLU B  1 75  ? 12.882  2.562   38.836  1.00 37.96  ? 103 GLU B OE2   1 
ATOM   3348  N N     . GLU B  1 76  ? 15.256  7.086   37.380  1.00 26.12  ? 104 GLU B N     1 
ATOM   3349  C CA    . GLU B  1 76  ? 15.413  8.032   38.488  1.00 24.38  ? 104 GLU B CA    1 
ATOM   3350  C C     . GLU B  1 76  ? 15.059  9.493   38.118  1.00 21.65  ? 104 GLU B C     1 
ATOM   3351  O O     . GLU B  1 76  ? 14.361  10.165  38.884  1.00 27.79  ? 104 GLU B O     1 
ATOM   3352  C CB    . GLU B  1 76  ? 16.834  7.908   39.090  1.00 24.75  ? 104 GLU B CB    1 
ATOM   3353  C CG    . GLU B  1 76  ? 17.079  6.555   39.728  1.00 28.13  ? 104 GLU B CG    1 
ATOM   3354  C CD    . GLU B  1 76  ? 16.058  6.202   40.821  1.00 41.29  ? 104 GLU B CD    1 
ATOM   3355  O OE1   . GLU B  1 76  ? 15.669  7.088   41.635  1.00 34.23  ? 104 GLU B OE1   1 
ATOM   3356  O OE2   . GLU B  1 76  ? 15.632  5.032   40.853  1.00 39.77  ? 104 GLU B OE2   1 
ATOM   3357  N N     . ILE B  1 77  ? 15.508  9.974   36.949  1.00 25.16  ? 105 ILE B N     1 
ATOM   3358  C CA    . ILE B  1 77  ? 15.128  11.316  36.491  1.00 23.15  ? 105 ILE B CA    1 
ATOM   3359  C C     . ILE B  1 77  ? 13.605  11.438  36.338  1.00 22.69  ? 105 ILE B C     1 
ATOM   3360  O O     . ILE B  1 77  ? 12.998  12.367  36.872  1.00 22.84  ? 105 ILE B O     1 
ATOM   3361  C CB    . ILE B  1 77  ? 15.820  11.727  35.182  1.00 24.42  ? 105 ILE B CB    1 
ATOM   3362  C CG1   . ILE B  1 77  ? 17.327  11.953  35.423  1.00 24.09  ? 105 ILE B CG1   1 
ATOM   3363  C CG2   . ILE B  1 77  ? 15.181  12.997  34.606  1.00 22.82  ? 105 ILE B CG2   1 
ATOM   3364  C CD1   . ILE B  1 77  ? 17.647  12.756  36.676  1.00 27.38  ? 105 ILE B CD1   1 
ATOM   3365  N N     . SER B  1 78  ? 13.004  10.458  35.671  1.00 23.32  ? 106 SER B N     1 
ATOM   3366  C CA    . SER B  1 78  ? 11.576  10.511  35.351  1.00 25.49  ? 106 SER B CA    1 
ATOM   3367  C C     . SER B  1 78  ? 10.687  10.355  36.561  1.00 21.72  ? 106 SER B C     1 
ATOM   3368  O O     . SER B  1 78  ? 9.553   10.882  36.605  1.00 25.26  ? 106 SER B O     1 
ATOM   3369  C CB    . SER B  1 78  ? 11.257  9.446   34.300  1.00 29.09  ? 106 SER B CB    1 
ATOM   3370  O OG    . SER B  1 78  ? 12.093  9.661   33.185  1.00 31.58  ? 106 SER B OG    1 
ATOM   3371  N N     . ARG B  1 79  ? 11.177  9.618   37.549  1.00 20.28  ? 107 ARG B N     1 
ATOM   3372  C CA    . ARG B  1 79  ? 10.535  9.528   38.858  1.00 26.98  ? 107 ARG B CA    1 
ATOM   3373  C C     . ARG B  1 79  ? 10.444  10.928  39.485  1.00 27.53  ? 107 ARG B C     1 
ATOM   3374  O O     . ARG B  1 79  ? 9.410   11.300  40.060  1.00 21.05  ? 107 ARG B O     1 
ATOM   3375  C CB    . ARG B  1 79  ? 11.325  8.547   39.731  1.00 29.00  ? 107 ARG B CB    1 
ATOM   3376  C CG    . ARG B  1 79  ? 10.824  8.317   41.101  1.00 30.91  ? 107 ARG B CG    1 
ATOM   3377  C CD    . ARG B  1 79  ? 11.578  7.153   41.763  1.00 36.16  ? 107 ARG B CD    1 
ATOM   3378  N NE    . ARG B  1 79  ? 11.263  7.081   43.191  1.00 39.26  ? 107 ARG B NE    1 
ATOM   3379  C CZ    . ARG B  1 79  ? 11.832  7.841   44.130  1.00 48.29  ? 107 ARG B CZ    1 
ATOM   3380  N NH1   . ARG B  1 79  ? 12.791  8.713   43.824  1.00 34.74  ? 107 ARG B NH1   1 
ATOM   3381  N NH2   . ARG B  1 79  ? 11.456  7.714   45.393  1.00 52.27  ? 107 ARG B NH2   1 
ATOM   3382  N N     . GLY B  1 80  ? 11.497  11.724  39.297  1.00 28.31  ? 108 GLY B N     1 
ATOM   3383  C CA    . GLY B  1 80  ? 11.507  13.137  39.717  1.00 29.70  ? 108 GLY B CA    1 
ATOM   3384  C C     . GLY B  1 80  ? 10.609  14.089  38.918  1.00 29.49  ? 108 GLY B C     1 
ATOM   3385  O O     . GLY B  1 80  ? 9.859   14.885  39.497  1.00 31.17  ? 108 GLY B O     1 
ATOM   3386  N N     . CYS B  1 81  ? 10.717  14.037  37.594  1.00 27.27  ? 109 CYS B N     1 
ATOM   3387  C CA    . CYS B  1 81  ? 9.920   14.896  36.715  1.00 28.87  ? 109 CYS B CA    1 
ATOM   3388  C C     . CYS B  1 81  ? 9.813   14.258  35.332  1.00 26.66  ? 109 CYS B C     1 
ATOM   3389  O O     . CYS B  1 81  ? 10.816  14.054  34.683  1.00 23.14  ? 109 CYS B O     1 
ATOM   3390  C CB    . CYS B  1 81  ? 10.565  16.295  36.603  1.00 27.79  ? 109 CYS B CB    1 
ATOM   3391  S SG    . CYS B  1 81  ? 9.781   17.416  35.396  1.00 32.65  ? 109 CYS B SG    1 
ATOM   3392  N N     . ALA B  1 82  ? 8.597   13.932  34.881  1.00 24.58  ? 110 ALA B N     1 
ATOM   3393  C CA    . ALA B  1 82  ? 8.458   13.195  33.620  1.00 26.79  ? 110 ALA B CA    1 
ATOM   3394  C C     . ALA B  1 82  ? 8.913   13.999  32.369  1.00 27.16  ? 110 ALA B C     1 
ATOM   3395  O O     . ALA B  1 82  ? 9.411   13.420  31.390  1.00 24.72  ? 110 ALA B O     1 
ATOM   3396  C CB    . ALA B  1 82  ? 7.038   12.659  33.458  1.00 23.67  ? 110 ALA B CB    1 
ATOM   3397  N N     . SER B  1 83  ? 8.770   15.324  32.419  1.00 24.75  ? 111 SER B N     1 
ATOM   3398  C CA    . SER B  1 83  ? 9.145   16.180  31.296  1.00 26.80  ? 111 SER B CA    1 
ATOM   3399  C C     . SER B  1 83  ? 10.655  16.232  31.149  1.00 27.15  ? 111 SER B C     1 
ATOM   3400  O O     . SER B  1 83  ? 11.172  16.118  30.031  1.00 25.14  ? 111 SER B O     1 
ATOM   3401  C CB    . SER B  1 83  ? 8.586   17.591  31.455  1.00 24.49  ? 111 SER B CB    1 
ATOM   3402  O OG    . SER B  1 83  ? 7.173   17.583  31.444  1.00 25.68  ? 111 SER B OG    1 
ATOM   3403  N N     . THR B  1 84  ? 11.359  16.350  32.270  1.00 25.31  ? 112 THR B N     1 
ATOM   3404  C CA    . THR B  1 84  ? 12.849  16.285  32.244  1.00 28.01  ? 112 THR B CA    1 
ATOM   3405  C C     . THR B  1 84  ? 13.340  14.941  31.689  1.00 26.06  ? 112 THR B C     1 
ATOM   3406  O O     . THR B  1 84  ? 14.372  14.864  31.002  1.00 26.85  ? 112 THR B O     1 
ATOM   3407  C CB    . THR B  1 84  ? 13.457  16.514  33.655  1.00 27.44  ? 112 THR B CB    1 
ATOM   3408  O OG1   . THR B  1 84  ? 13.316  17.890  34.006  1.00 33.67  ? 112 THR B OG1   1 
ATOM   3409  C CG2   . THR B  1 84  ? 14.920  16.177  33.699  1.00 33.06  ? 112 THR B CG2   1 
ATOM   3410  N N     . GLY B  1 85  ? 12.616  13.880  32.031  1.00 27.64  ? 113 GLY B N     1 
ATOM   3411  C CA    . GLY B  1 85  ? 12.875  12.555  31.495  1.00 26.64  ? 113 GLY B CA    1 
ATOM   3412  C C     . GLY B  1 85  ? 12.786  12.507  29.974  1.00 24.64  ? 113 GLY B C     1 
ATOM   3413  O O     . GLY B  1 85  ? 13.710  12.018  29.334  1.00 23.69  ? 113 GLY B O     1 
ATOM   3414  N N     . VAL B  1 86  ? 11.695  13.014  29.381  1.00 23.75  ? 114 VAL B N     1 
ATOM   3415  C CA    . VAL B  1 86  ? 11.552  12.929  27.906  1.00 22.36  ? 114 VAL B CA    1 
ATOM   3416  C C     . VAL B  1 86  ? 12.549  13.841  27.183  1.00 25.74  ? 114 VAL B C     1 
ATOM   3417  O O     . VAL B  1 86  ? 13.135  13.444  26.167  1.00 24.28  ? 114 VAL B O     1 
ATOM   3418  C CB    . VAL B  1 86  ? 10.108  13.162  27.392  1.00 27.48  ? 114 VAL B CB    1 
ATOM   3419  C CG1   . VAL B  1 86  ? 9.664   14.606  27.537  1.00 23.79  ? 114 VAL B CG1   1 
ATOM   3420  C CG2   . VAL B  1 86  ? 10.011  12.713  25.918  1.00 28.78  ? 114 VAL B CG2   1 
ATOM   3421  N N     . ILE B  1 87  ? 12.785  15.032  27.741  1.00 25.28  ? 115 ILE B N     1 
ATOM   3422  C CA    . ILE B  1 87  ? 13.820  15.937  27.207  1.00 24.63  ? 115 ILE B CA    1 
ATOM   3423  C C     . ILE B  1 87  ? 15.174  15.216  27.133  1.00 22.89  ? 115 ILE B C     1 
ATOM   3424  O O     . ILE B  1 87  ? 15.903  15.330  26.129  1.00 23.37  ? 115 ILE B O     1 
ATOM   3425  C CB    . ILE B  1 87  ? 13.960  17.223  28.070  1.00 25.95  ? 115 ILE B CB    1 
ATOM   3426  C CG1   . ILE B  1 87  ? 12.684  18.075  28.021  1.00 25.82  ? 115 ILE B CG1   1 
ATOM   3427  C CG2   . ILE B  1 87  ? 15.106  18.090  27.593  1.00 26.31  ? 115 ILE B CG2   1 
ATOM   3428  C CD1   . ILE B  1 87  ? 12.603  19.112  29.179  1.00 26.35  ? 115 ILE B CD1   1 
ATOM   3429  N N     . MET B  1 88  ? 15.502  14.480  28.194  1.00 24.14  ? 116 MET B N     1 
ATOM   3430  C CA    . MET B  1 88  ? 16.797  13.780  28.317  1.00 26.71  ? 116 MET B CA    1 
ATOM   3431  C C     . MET B  1 88  ? 16.858  12.582  27.368  1.00 26.73  ? 116 MET B C     1 
ATOM   3432  O O     . MET B  1 88  ? 17.872  12.329  26.697  1.00 25.58  ? 116 MET B O     1 
ATOM   3433  C CB    . MET B  1 88  ? 17.002  13.352  29.776  1.00 25.85  ? 116 MET B CB    1 
ATOM   3434  C CG    . MET B  1 88  ? 18.002  12.232  30.023  1.00 24.13  ? 116 MET B CG    1 
ATOM   3435  S SD    . MET B  1 88  ? 18.069  11.660  31.753  1.00 32.09  ? 116 MET B SD    1 
ATOM   3436  C CE    . MET B  1 88  ? 19.276  10.342  31.627  1.00 26.06  ? 116 MET B CE    1 
ATOM   3437  N N     . SER B  1 89  ? 15.751  11.852  27.303  1.00 26.34  ? 117 SER B N     1 
ATOM   3438  C CA    . SER B  1 89  ? 15.612  10.719  26.379  1.00 27.00  ? 117 SER B CA    1 
ATOM   3439  C C     . SER B  1 89  ? 15.700  11.120  24.892  1.00 25.81  ? 117 SER B C     1 
ATOM   3440  O O     . SER B  1 89  ? 16.372  10.448  24.096  1.00 25.30  ? 117 SER B O     1 
ATOM   3441  C CB    . SER B  1 89  ? 14.282  9.990   26.646  1.00 25.73  ? 117 SER B CB    1 
ATOM   3442  O OG    . SER B  1 89  ? 14.334  8.673   26.161  1.00 33.71  ? 117 SER B OG    1 
ATOM   3443  N N     . VAL B  1 90  ? 15.029  12.208  24.512  1.00 25.16  ? 118 VAL B N     1 
ATOM   3444  C CA    . VAL B  1 90  ? 15.113  12.682  23.132  1.00 25.43  ? 118 VAL B CA    1 
ATOM   3445  C C     . VAL B  1 90  ? 16.564  13.010  22.789  1.00 27.78  ? 118 VAL B C     1 
ATOM   3446  O O     . VAL B  1 90  ? 17.055  12.632  21.738  1.00 30.63  ? 118 VAL B O     1 
ATOM   3447  C CB    . VAL B  1 90  ? 14.201  13.893  22.881  1.00 28.43  ? 118 VAL B CB    1 
ATOM   3448  C CG1   . VAL B  1 90  ? 14.505  14.539  21.514  1.00 27.72  ? 118 VAL B CG1   1 
ATOM   3449  C CG2   . VAL B  1 90  ? 12.747  13.452  22.958  1.00 19.41  ? 118 VAL B CG2   1 
ATOM   3450  N N     . ASN B  1 91  ? 17.268  13.673  23.700  1.00 28.15  ? 119 ASN B N     1 
ATOM   3451  C CA    . ASN B  1 91  ? 18.648  14.077  23.404  1.00 26.88  ? 119 ASN B CA    1 
ATOM   3452  C C     . ASN B  1 91  ? 19.619  12.905  23.311  1.00 24.50  ? 119 ASN B C     1 
ATOM   3453  O O     . ASN B  1 91  ? 20.438  12.844  22.380  1.00 28.47  ? 119 ASN B O     1 
ATOM   3454  C CB    . ASN B  1 91  ? 19.167  15.105  24.409  1.00 29.60  ? 119 ASN B CB    1 
ATOM   3455  C CG    . ASN B  1 91  ? 20.386  15.840  23.880  1.00 27.17  ? 119 ASN B CG    1 
ATOM   3456  O OD1   . ASN B  1 91  ? 20.268  16.679  22.974  1.00 29.32  ? 119 ASN B OD1   1 
ATOM   3457  N ND2   . ASN B  1 91  ? 21.574  15.483  24.386  1.00 28.92  ? 119 ASN B ND2   1 
ATOM   3458  N N     . ASN B  1 92  ? 19.550  11.998  24.286  1.00 25.18  ? 120 ASN B N     1 
ATOM   3459  C CA    . ASN B  1 92  ? 20.350  10.769  24.291  1.00 22.14  ? 120 ASN B CA    1 
ATOM   3460  C C     . ASN B  1 92  ? 20.057  9.804   23.125  1.00 28.32  ? 120 ASN B C     1 
ATOM   3461  O O     . ASN B  1 92  ? 20.958  9.396   22.385  1.00 26.86  ? 120 ASN B O     1 
ATOM   3462  C CB    . ASN B  1 92  ? 20.115  9.995   25.593  1.00 25.51  ? 120 ASN B CB    1 
ATOM   3463  C CG    . ASN B  1 92  ? 20.982  10.477  26.738  1.00 24.61  ? 120 ASN B CG    1 
ATOM   3464  O OD1   . ASN B  1 92  ? 22.110  10.057  26.867  1.00 25.77  ? 120 ASN B OD1   1 
ATOM   3465  N ND2   . ASN B  1 92  ? 20.437  11.343  27.581  1.00 24.48  ? 120 ASN B ND2   1 
ATOM   3466  N N     . SER B  1 93  ? 18.794  9.404   22.985  1.00 26.29  ? 121 SER B N     1 
ATOM   3467  C CA    . SER B  1 93  ? 18.453  8.292   22.099  1.00 23.15  ? 121 SER B CA    1 
ATOM   3468  C C     . SER B  1 93  ? 18.170  8.713   20.673  1.00 25.91  ? 121 SER B C     1 
ATOM   3469  O O     . SER B  1 93  ? 18.558  8.013   19.733  1.00 27.72  ? 121 SER B O     1 
ATOM   3470  C CB    . SER B  1 93  ? 17.200  7.554   22.607  1.00 23.62  ? 121 SER B CB    1 
ATOM   3471  O OG    . SER B  1 93  ? 17.440  6.798   23.746  1.00 27.34  ? 121 SER B OG    1 
ATOM   3472  N N     . LEU B  1 94  ? 17.413  9.801   20.518  1.00 23.16  ? 122 LEU B N     1 
ATOM   3473  C CA    . LEU B  1 94  ? 16.845  10.156  19.224  1.00 26.04  ? 122 LEU B CA    1 
ATOM   3474  C C     . LEU B  1 94  ? 17.705  11.158  18.468  1.00 26.47  ? 122 LEU B C     1 
ATOM   3475  O O     . LEU B  1 94  ? 17.698  11.155  17.237  1.00 28.40  ? 122 LEU B O     1 
ATOM   3476  C CB    . LEU B  1 94  ? 15.403  10.693  19.385  1.00 23.53  ? 122 LEU B CB    1 
ATOM   3477  C CG    . LEU B  1 94  ? 14.352  9.812   20.087  1.00 32.03  ? 122 LEU B CG    1 
ATOM   3478  C CD1   . LEU B  1 94  ? 12.979  10.479  19.966  1.00 18.21  ? 122 LEU B CD1   1 
ATOM   3479  C CD2   . LEU B  1 94  ? 14.290  8.364   19.511  1.00 26.08  ? 122 LEU B CD2   1 
ATOM   3480  N N     . TYR B  1 95  ? 18.458  12.006  19.192  1.00 29.37  ? 123 TYR B N     1 
ATOM   3481  C CA    . TYR B  1 95  ? 19.303  13.003  18.537  1.00 25.70  ? 123 TYR B CA    1 
ATOM   3482  C C     . TYR B  1 95  ? 20.725  12.487  18.393  1.00 27.66  ? 123 TYR B C     1 
ATOM   3483  O O     . TYR B  1 95  ? 21.198  12.269  17.268  1.00 25.78  ? 123 TYR B O     1 
ATOM   3484  C CB    . TYR B  1 95  ? 19.282  14.376  19.241  1.00 26.07  ? 123 TYR B CB    1 
ATOM   3485  C CG    . TYR B  1 95  ? 20.257  15.347  18.598  1.00 28.31  ? 123 TYR B CG    1 
ATOM   3486  C CD1   . TYR B  1 95  ? 20.017  15.862  17.332  1.00 26.97  ? 123 TYR B CD1   1 
ATOM   3487  C CD2   . TYR B  1 95  ? 21.449  15.707  19.235  1.00 28.75  ? 123 TYR B CD2   1 
ATOM   3488  C CE1   . TYR B  1 95  ? 20.932  16.725  16.722  1.00 27.14  ? 123 TYR B CE1   1 
ATOM   3489  C CE2   . TYR B  1 95  ? 22.368  16.557  18.627  1.00 27.05  ? 123 TYR B CE2   1 
ATOM   3490  C CZ    . TYR B  1 95  ? 22.104  17.067  17.375  1.00 28.58  ? 123 TYR B CZ    1 
ATOM   3491  O OH    . TYR B  1 95  ? 23.003  17.927  16.752  1.00 27.12  ? 123 TYR B OH    1 
ATOM   3492  N N     . LEU B  1 96  ? 21.383  12.284  19.534  1.00 28.93  ? 124 LEU B N     1 
ATOM   3493  C CA    . LEU B  1 96  ? 22.792  11.886  19.570  1.00 28.80  ? 124 LEU B CA    1 
ATOM   3494  C C     . LEU B  1 96  ? 22.996  10.465  19.063  1.00 31.93  ? 124 LEU B C     1 
ATOM   3495  O O     . LEU B  1 96  ? 24.011  10.171  18.416  1.00 29.22  ? 124 LEU B O     1 
ATOM   3496  C CB    . LEU B  1 96  ? 23.349  12.014  20.993  1.00 30.12  ? 124 LEU B CB    1 
ATOM   3497  C CG    . LEU B  1 96  ? 23.503  13.415  21.587  1.00 33.86  ? 124 LEU B CG    1 
ATOM   3498  C CD1   . LEU B  1 96  ? 24.003  13.336  23.032  1.00 26.28  ? 124 LEU B CD1   1 
ATOM   3499  C CD2   . LEU B  1 96  ? 24.443  14.263  20.748  1.00 27.39  ? 124 LEU B CD2   1 
ATOM   3500  N N     . GLY B  1 97  ? 22.021  9.593   19.344  1.00 28.90  ? 125 GLY B N     1 
ATOM   3501  C CA    . GLY B  1 97  ? 22.073  8.179   18.960  1.00 30.77  ? 125 GLY B CA    1 
ATOM   3502  C C     . GLY B  1 97  ? 22.340  7.865   17.495  1.00 28.63  ? 125 GLY B C     1 
ATOM   3503  O O     . GLY B  1 97  ? 23.315  7.150   17.181  1.00 27.99  ? 125 GLY B O     1 
ATOM   3504  N N     . PRO B  1 98  ? 21.478  8.365   16.585  1.00 26.11  ? 126 PRO B N     1 
ATOM   3505  C CA    . PRO B  1 98  ? 21.734  8.153   15.156  1.00 28.40  ? 126 PRO B CA    1 
ATOM   3506  C C     . PRO B  1 98  ? 23.019  8.801   14.656  1.00 31.73  ? 126 PRO B C     1 
ATOM   3507  O O     . PRO B  1 98  ? 23.704  8.252   13.772  1.00 29.57  ? 126 PRO B O     1 
ATOM   3508  C CB    . PRO B  1 98  ? 20.511  8.774   14.470  1.00 29.84  ? 126 PRO B CB    1 
ATOM   3509  C CG    . PRO B  1 98  ? 19.879  9.648   15.478  1.00 24.93  ? 126 PRO B CG    1 
ATOM   3510  C CD    . PRO B  1 98  ? 20.214  9.094   16.817  1.00 27.79  ? 126 PRO B CD    1 
ATOM   3511  N N     . ILE B  1 99  ? 23.371  9.944   15.228  1.00 30.98  ? 127 ILE B N     1 
ATOM   3512  C CA    . ILE B  1 99  ? 24.597  10.629  14.798  1.00 29.16  ? 127 ILE B CA    1 
ATOM   3513  C C     . ILE B  1 99  ? 25.801  9.775   15.158  1.00 28.93  ? 127 ILE B C     1 
ATOM   3514  O O     . ILE B  1 99  ? 26.715  9.618   14.335  1.00 28.90  ? 127 ILE B O     1 
ATOM   3515  C CB    . ILE B  1 99  ? 24.723  12.068  15.362  1.00 28.04  ? 127 ILE B CB    1 
ATOM   3516  C CG1   . ILE B  1 99  ? 23.483  12.902  14.998  1.00 26.41  ? 127 ILE B CG1   1 
ATOM   3517  C CG2   . ILE B  1 99  ? 25.989  12.761  14.802  1.00 28.00  ? 127 ILE B CG2   1 
ATOM   3518  C CD1   . ILE B  1 99  ? 23.414  14.280  15.658  1.00 27.05  ? 127 ILE B CD1   1 
ATOM   3519  N N     . LEU B  1 100 ? 25.794  9.218   16.366  1.00 29.60  ? 128 LEU B N     1 
ATOM   3520  C CA    . LEU B  1 100 ? 26.840  8.278   16.779  1.00 32.02  ? 128 LEU B CA    1 
ATOM   3521  C C     . LEU B  1 100 ? 26.901  7.040   15.892  1.00 31.37  ? 128 LEU B C     1 
ATOM   3522  O O     . LEU B  1 100 ? 27.976  6.588   15.482  1.00 32.97  ? 128 LEU B O     1 
ATOM   3523  C CB    . LEU B  1 100 ? 26.632  7.838   18.233  1.00 33.31  ? 128 LEU B CB    1 
ATOM   3524  C CG    . LEU B  1 100 ? 27.248  8.708   19.322  1.00 37.46  ? 128 LEU B CG    1 
ATOM   3525  C CD1   . LEU B  1 100 ? 26.991  8.065   20.677  1.00 44.91  ? 128 LEU B CD1   1 
ATOM   3526  C CD2   . LEU B  1 100 ? 28.764  8.907   19.088  1.00 39.64  ? 128 LEU B CD2   1 
ATOM   3527  N N     . LYS B  1 101 ? 25.739  6.473   15.600  1.00 29.25  ? 129 LYS B N     1 
ATOM   3528  C CA    . LYS B  1 101 ? 25.680  5.205   14.912  1.00 29.59  ? 129 LYS B CA    1 
ATOM   3529  C C     . LYS B  1 101 ? 25.918  5.335   13.410  1.00 31.23  ? 129 LYS B C     1 
ATOM   3530  O O     . LYS B  1 101 ? 26.442  4.412   12.794  1.00 36.32  ? 129 LYS B O     1 
ATOM   3531  C CB    . LYS B  1 101 ? 24.326  4.536   15.177  1.00 30.46  ? 129 LYS B CB    1 
ATOM   3532  C CG    . LYS B  1 101 ? 24.261  3.100   14.705  1.00 38.65  ? 129 LYS B CG    1 
ATOM   3533  C CD    . LYS B  1 101 ? 22.990  2.420   15.156  1.00 41.47  ? 129 LYS B CD    1 
ATOM   3534  C CE    . LYS B  1 101 ? 22.999  0.956   14.781  1.00 42.38  ? 129 LYS B CE    1 
ATOM   3535  N NZ    . LYS B  1 101 ? 21.651  0.358   14.956  1.00 51.41  ? 129 LYS B NZ    1 
ATOM   3536  N N     . PHE B  1 102 ? 25.532  6.465   12.822  1.00 31.04  ? 130 PHE B N     1 
ATOM   3537  C CA    . PHE B  1 102 ? 25.572  6.628   11.364  1.00 31.06  ? 130 PHE B CA    1 
ATOM   3538  C C     . PHE B  1 102 ? 26.406  7.767   10.836  1.00 34.42  ? 130 PHE B C     1 
ATOM   3539  O O     . PHE B  1 102 ? 26.639  7.839   9.620   1.00 36.86  ? 130 PHE B O     1 
ATOM   3540  C CB    . PHE B  1 102 ? 24.152  6.797   10.850  1.00 32.70  ? 130 PHE B CB    1 
ATOM   3541  C CG    . PHE B  1 102 ? 23.295  5.648   11.173  1.00 29.57  ? 130 PHE B CG    1 
ATOM   3542  C CD1   . PHE B  1 102 ? 23.368  4.497   10.406  1.00 33.72  ? 130 PHE B CD1   1 
ATOM   3543  C CD2   . PHE B  1 102 ? 22.432  5.689   12.261  1.00 35.59  ? 130 PHE B CD2   1 
ATOM   3544  C CE1   . PHE B  1 102 ? 22.594  3.394   10.718  1.00 38.86  ? 130 PHE B CE1   1 
ATOM   3545  C CE2   . PHE B  1 102 ? 21.654  4.600   12.575  1.00 32.10  ? 130 PHE B CE2   1 
ATOM   3546  C CZ    . PHE B  1 102 ? 21.732  3.450   11.800  1.00 34.23  ? 130 PHE B CZ    1 
ATOM   3547  N N     . GLY B  1 103 ? 26.862  8.654   11.720  1.00 32.42  ? 131 GLY B N     1 
ATOM   3548  C CA    . GLY B  1 103 ? 27.545  9.869   11.282  1.00 29.84  ? 131 GLY B CA    1 
ATOM   3549  C C     . GLY B  1 103 ? 29.015  9.645   11.004  1.00 31.69  ? 131 GLY B C     1 
ATOM   3550  O O     . GLY B  1 103 ? 29.604  8.661   11.463  1.00 34.37  ? 131 GLY B O     1 
ATOM   3551  N N     . SER B  1 104 ? 29.596  10.575  10.254  1.00 32.12  ? 132 SER B N     1 
ATOM   3552  C CA    . SER B  1 104 ? 31.040  10.622  10.027  1.00 33.80  ? 132 SER B CA    1 
ATOM   3553  C C     . SER B  1 104 ? 31.726  11.214  11.244  1.00 33.16  ? 132 SER B C     1 
ATOM   3554  O O     . SER B  1 104 ? 31.075  11.834  12.098  1.00 34.50  ? 132 SER B O     1 
ATOM   3555  C CB    . SER B  1 104 ? 31.356  11.494  8.805   1.00 32.09  ? 132 SER B CB    1 
ATOM   3556  O OG    . SER B  1 104 ? 31.193  12.878  9.108   1.00 33.01  ? 132 SER B OG    1 
ATOM   3557  N N     . LYS B  1 105 ? 33.050  11.022  11.305  1.00 37.48  ? 133 LYS B N     1 
ATOM   3558  C CA    . LYS B  1 105 ? 33.912  11.654  12.306  1.00 36.75  ? 133 LYS B CA    1 
ATOM   3559  C C     . LYS B  1 105 ? 33.614  13.153  12.445  1.00 39.03  ? 133 LYS B C     1 
ATOM   3560  O O     . LYS B  1 105 ? 33.361  13.652  13.557  1.00 39.29  ? 133 LYS B O     1 
ATOM   3561  C CB    . LYS B  1 105 ? 35.386  11.454  11.923  1.00 36.61  ? 133 LYS B CB    1 
ATOM   3562  N N     . GLU B  1 106 ? 33.621  13.856  11.310  1.00 36.95  ? 134 GLU B N     1 
ATOM   3563  C CA    . GLU B  1 106 ? 33.433  15.305  11.284  1.00 34.43  ? 134 GLU B CA    1 
ATOM   3564  C C     . GLU B  1 106 ? 32.019  15.648  11.754  1.00 34.78  ? 134 GLU B C     1 
ATOM   3565  O O     . GLU B  1 106 ? 31.823  16.593  12.525  1.00 36.72  ? 134 GLU B O     1 
ATOM   3566  C CB    . GLU B  1 106 ? 33.662  15.889  9.886   1.00 34.39  ? 134 GLU B CB    1 
ATOM   3567  C CG    . GLU B  1 106 ? 34.834  15.273  9.109   1.00 58.40  ? 134 GLU B CG    1 
ATOM   3568  C CD    . GLU B  1 106 ? 34.423  14.052  8.282   1.00 71.40  ? 134 GLU B CD    1 
ATOM   3569  O OE1   . GLU B  1 106 ? 33.824  14.231  7.195   1.00 76.15  ? 134 GLU B OE1   1 
ATOM   3570  O OE2   . GLU B  1 106 ? 34.700  12.915  8.727   1.00 69.51  ? 134 GLU B OE2   1 
ATOM   3571  N N     . GLN B  1 107 ? 31.040  14.880  11.282  1.00 33.19  ? 135 GLN B N     1 
ATOM   3572  C CA    . GLN B  1 107 ? 29.653  15.050  11.729  1.00 31.68  ? 135 GLN B CA    1 
ATOM   3573  C C     . GLN B  1 107 ? 29.508  14.906  13.256  1.00 30.67  ? 135 GLN B C     1 
ATOM   3574  O O     . GLN B  1 107 ? 28.734  15.642  13.874  1.00 36.42  ? 135 GLN B O     1 
ATOM   3575  C CB    . GLN B  1 107 ? 28.720  14.070  11.000  1.00 30.31  ? 135 GLN B CB    1 
ATOM   3576  C CG    . GLN B  1 107 ? 28.310  14.552  9.624   1.00 31.38  ? 135 GLN B CG    1 
ATOM   3577  C CD    . GLN B  1 107 ? 27.347  13.604  8.915   1.00 30.33  ? 135 GLN B CD    1 
ATOM   3578  O OE1   . GLN B  1 107 ? 27.365  12.393  9.137   1.00 32.16  ? 135 GLN B OE1   1 
ATOM   3579  N NE2   . GLN B  1 107 ? 26.538  14.154  8.027   1.00 27.05  ? 135 GLN B NE2   1 
ATOM   3580  N N     . LYS B  1 108 ? 30.258  13.977  13.855  1.00 28.94  ? 136 LYS B N     1 
ATOM   3581  C CA    . LYS B  1 108 ? 30.186  13.738  15.296  1.00 30.97  ? 136 LYS B CA    1 
ATOM   3582  C C     . LYS B  1 108 ? 30.742  14.925  16.081  1.00 33.14  ? 136 LYS B C     1 
ATOM   3583  O O     . LYS B  1 108 ? 30.161  15.367  17.075  1.00 29.93  ? 136 LYS B O     1 
ATOM   3584  C CB    . LYS B  1 108 ? 30.951  12.455  15.673  1.00 30.42  ? 136 LYS B CB    1 
ATOM   3585  C CG    . LYS B  1 108 ? 30.211  11.160  15.334  1.00 38.61  ? 136 LYS B CG    1 
ATOM   3586  C CD    . LYS B  1 108 ? 31.168  9.986   15.261  1.00 37.36  ? 136 LYS B CD    1 
ATOM   3587  C CE    . LYS B  1 108 ? 30.479  8.737   14.790  1.00 42.17  ? 136 LYS B CE    1 
ATOM   3588  N NZ    . LYS B  1 108 ? 31.489  7.724   14.381  1.00 45.19  ? 136 LYS B NZ    1 
ATOM   3589  N N     . GLN B  1 109 ? 31.871  15.440  15.610  1.00 33.63  ? 137 GLN B N     1 
ATOM   3590  C CA    . GLN B  1 109 ? 32.524  16.586  16.231  1.00 32.74  ? 137 GLN B CA    1 
ATOM   3591  C C     . GLN B  1 109 ? 31.694  17.862  16.099  1.00 29.07  ? 137 GLN B C     1 
ATOM   3592  O O     . GLN B  1 109 ? 31.614  18.652  17.041  1.00 33.26  ? 137 GLN B O     1 
ATOM   3593  C CB    . GLN B  1 109 ? 33.911  16.772  15.616  1.00 34.72  ? 137 GLN B CB    1 
ATOM   3594  C CG    . GLN B  1 109 ? 34.831  15.573  15.886  1.00 40.02  ? 137 GLN B CG    1 
ATOM   3595  C CD    . GLN B  1 109 ? 36.254  15.749  15.330  1.00 45.24  ? 137 GLN B CD    1 
ATOM   3596  O OE1   . GLN B  1 109 ? 37.228  15.704  16.085  1.00 55.42  ? 137 GLN B OE1   1 
ATOM   3597  N NE2   . GLN B  1 109 ? 36.372  15.939  14.015  1.00 48.89  ? 137 GLN B NE2   1 
ATOM   3598  N N     . ALA B  1 110 ? 31.052  18.046  14.947  1.00 30.30  ? 138 ALA B N     1 
ATOM   3599  C CA    . ALA B  1 110 ? 30.182  19.207  14.721  1.00 29.64  ? 138 ALA B CA    1 
ATOM   3600  C C     . ALA B  1 110 ? 28.847  19.126  15.469  1.00 27.36  ? 138 ALA B C     1 
ATOM   3601  O O     . ALA B  1 110 ? 28.369  20.144  15.966  1.00 31.44  ? 138 ALA B O     1 
ATOM   3602  C CB    . ALA B  1 110 ? 29.919  19.384  13.222  1.00 27.42  ? 138 ALA B CB    1 
ATOM   3603  N N     . TRP B  1 111 ? 28.255  17.930  15.542  1.00 30.69  ? 139 TRP B N     1 
ATOM   3604  C CA    . TRP B  1 111 ? 26.840  17.766  15.909  1.00 26.25  ? 139 TRP B CA    1 
ATOM   3605  C C     . TRP B  1 111 ? 26.558  17.006  17.210  1.00 28.95  ? 139 TRP B C     1 
ATOM   3606  O O     . TRP B  1 111 ? 25.463  17.147  17.790  1.00 30.52  ? 139 TRP B O     1 
ATOM   3607  C CB    . TRP B  1 111 ? 26.091  17.095  14.761  1.00 27.04  ? 139 TRP B CB    1 
ATOM   3608  C CG    . TRP B  1 111 ? 26.101  17.885  13.476  1.00 26.88  ? 139 TRP B CG    1 
ATOM   3609  C CD1   . TRP B  1 111 ? 27.073  17.876  12.504  1.00 27.43  ? 139 TRP B CD1   1 
ATOM   3610  C CD2   . TRP B  1 111 ? 25.095  18.783  13.019  1.00 27.86  ? 139 TRP B CD2   1 
ATOM   3611  N NE1   . TRP B  1 111 ? 26.725  18.709  11.481  1.00 30.48  ? 139 TRP B NE1   1 
ATOM   3612  C CE2   . TRP B  1 111 ? 25.513  19.277  11.767  1.00 29.90  ? 139 TRP B CE2   1 
ATOM   3613  C CE3   . TRP B  1 111 ? 23.881  19.224  13.547  1.00 30.38  ? 139 TRP B CE3   1 
ATOM   3614  C CZ2   . TRP B  1 111 ? 24.758  20.181  11.029  1.00 29.02  ? 139 TRP B CZ2   1 
ATOM   3615  C CZ3   . TRP B  1 111 ? 23.133  20.128  12.819  1.00 28.50  ? 139 TRP B CZ3   1 
ATOM   3616  C CH2   . TRP B  1 111 ? 23.571  20.595  11.566  1.00 27.20  ? 139 TRP B CH2   1 
ATOM   3617  N N     . VAL B  1 112 ? 27.526  16.204  17.664  1.00 29.68  ? 140 VAL B N     1 
ATOM   3618  C CA    . VAL B  1 112 ? 27.446  15.540  18.955  1.00 30.67  ? 140 VAL B CA    1 
ATOM   3619  C C     . VAL B  1 112 ? 28.141  16.371  20.037  1.00 30.55  ? 140 VAL B C     1 
ATOM   3620  O O     . VAL B  1 112 ? 27.487  16.829  20.983  1.00 30.31  ? 140 VAL B O     1 
ATOM   3621  C CB    . VAL B  1 112 ? 28.072  14.126  18.924  1.00 30.39  ? 140 VAL B CB    1 
ATOM   3622  C CG1   . VAL B  1 112 ? 28.102  13.537  20.315  1.00 25.16  ? 140 VAL B CG1   1 
ATOM   3623  C CG2   . VAL B  1 112 ? 27.288  13.221  17.977  1.00 26.13  ? 140 VAL B CG2   1 
ATOM   3624  N N     . THR B  1 113 ? 29.448  16.587  19.870  1.00 34.96  ? 141 THR B N     1 
ATOM   3625  C CA    . THR B  1 113 ? 30.293  17.201  20.915  1.00 32.96  ? 141 THR B CA    1 
ATOM   3626  C C     . THR B  1 113 ? 29.720  18.498  21.526  1.00 33.24  ? 141 THR B C     1 
ATOM   3627  O O     . THR B  1 113 ? 29.801  18.688  22.735  1.00 35.71  ? 141 THR B O     1 
ATOM   3628  C CB    . THR B  1 113 ? 31.747  17.403  20.413  1.00 32.17  ? 141 THR B CB    1 
ATOM   3629  O OG1   . THR B  1 113 ? 32.246  16.157  19.934  1.00 32.79  ? 141 THR B OG1   1 
ATOM   3630  C CG2   . THR B  1 113 ? 32.654  17.858  21.524  1.00 30.65  ? 141 THR B CG2   1 
ATOM   3631  N N     . PRO B  1 114 ? 29.133  19.389  20.697  1.00 31.63  ? 142 PRO B N     1 
ATOM   3632  C CA    . PRO B  1 114 ? 28.491  20.570  21.254  1.00 28.20  ? 142 PRO B CA    1 
ATOM   3633  C C     . PRO B  1 114 ? 27.149  20.327  21.952  1.00 27.76  ? 142 PRO B C     1 
ATOM   3634  O O     . PRO B  1 114 ? 26.618  21.240  22.571  1.00 27.18  ? 142 PRO B O     1 
ATOM   3635  C CB    . PRO B  1 114 ? 28.263  21.467  20.020  1.00 29.21  ? 142 PRO B CB    1 
ATOM   3636  C CG    . PRO B  1 114 ? 29.097  20.883  18.944  1.00 31.43  ? 142 PRO B CG    1 
ATOM   3637  C CD    . PRO B  1 114 ? 29.109  19.421  19.224  1.00 32.32  ? 142 PRO B CD    1 
ATOM   3638  N N     . PHE B  1 115 ? 26.619  19.116  21.869  1.00 29.80  ? 143 PHE B N     1 
ATOM   3639  C CA    . PHE B  1 115 ? 25.298  18.824  22.414  1.00 30.55  ? 143 PHE B CA    1 
ATOM   3640  C C     . PHE B  1 115 ? 25.345  17.813  23.566  1.00 30.73  ? 143 PHE B C     1 
ATOM   3641  O O     . PHE B  1 115 ? 24.372  17.117  23.828  1.00 31.87  ? 143 PHE B O     1 
ATOM   3642  C CB    . PHE B  1 115 ? 24.418  18.290  21.279  1.00 28.60  ? 143 PHE B CB    1 
ATOM   3643  C CG    . PHE B  1 115 ? 24.051  19.320  20.278  1.00 25.64  ? 143 PHE B CG    1 
ATOM   3644  C CD1   . PHE B  1 115 ? 22.784  19.887  20.292  1.00 28.31  ? 143 PHE B CD1   1 
ATOM   3645  C CD2   . PHE B  1 115 ? 24.969  19.756  19.331  1.00 25.62  ? 143 PHE B CD2   1 
ATOM   3646  C CE1   . PHE B  1 115 ? 22.428  20.839  19.376  1.00 24.38  ? 143 PHE B CE1   1 
ATOM   3647  C CE2   . PHE B  1 115 ? 24.620  20.717  18.422  1.00 28.29  ? 143 PHE B CE2   1 
ATOM   3648  C CZ    . PHE B  1 115 ? 23.328  21.256  18.438  1.00 28.32  ? 143 PHE B CZ    1 
ATOM   3649  N N     . THR B  1 116 ? 26.467  17.758  24.271  1.00 28.91  ? 144 THR B N     1 
ATOM   3650  C CA    . THR B  1 116 ? 26.688  16.756  25.309  1.00 28.89  ? 144 THR B CA    1 
ATOM   3651  C C     . THR B  1 116 ? 26.667  17.306  26.753  1.00 31.40  ? 144 THR B C     1 
ATOM   3652  O O     . THR B  1 116 ? 26.742  16.527  27.702  1.00 35.23  ? 144 THR B O     1 
ATOM   3653  C CB    . THR B  1 116 ? 28.049  16.072  25.071  1.00 29.62  ? 144 THR B CB    1 
ATOM   3654  O OG1   . THR B  1 116 ? 29.055  17.074  24.922  1.00 34.96  ? 144 THR B OG1   1 
ATOM   3655  C CG2   . THR B  1 116 ? 28.020  15.228  23.817  1.00 29.43  ? 144 THR B CG2   1 
ATOM   3656  N N     . SER B  1 117 ? 26.521  18.621  26.924  1.00 34.20  ? 145 SER B N     1 
ATOM   3657  C CA    . SER B  1 117 ? 26.785  19.258  28.227  1.00 34.51  ? 145 SER B CA    1 
ATOM   3658  C C     . SER B  1 117 ? 25.640  20.108  28.770  1.00 33.73  ? 145 SER B C     1 
ATOM   3659  O O     . SER B  1 117 ? 25.804  20.803  29.782  1.00 34.63  ? 145 SER B O     1 
ATOM   3660  C CB    . SER B  1 117 ? 28.061  20.123  28.137  1.00 37.35  ? 145 SER B CB    1 
ATOM   3661  O OG    . SER B  1 117 ? 27.748  21.455  27.745  1.00 44.86  ? 145 SER B OG    1 
ATOM   3662  N N     . GLY B  1 118 ? 24.490  20.056  28.100  1.00 32.83  ? 146 GLY B N     1 
ATOM   3663  C CA    . GLY B  1 118 ? 23.280  20.745  28.555  1.00 34.10  ? 146 GLY B CA    1 
ATOM   3664  C C     . GLY B  1 118 ? 23.175  22.181  28.087  1.00 33.49  ? 146 GLY B C     1 
ATOM   3665  O O     . GLY B  1 118 ? 22.189  22.849  28.392  1.00 37.61  ? 146 GLY B O     1 
ATOM   3666  N N     . ASP B  1 119 ? 24.184  22.662  27.357  1.00 36.34  ? 147 ASP B N     1 
ATOM   3667  C CA    . ASP B  1 119 ? 24.141  24.001  26.750  1.00 36.98  ? 147 ASP B CA    1 
ATOM   3668  C C     . ASP B  1 119 ? 23.246  23.973  25.512  1.00 36.60  ? 147 ASP B C     1 
ATOM   3669  O O     . ASP B  1 119 ? 22.406  24.856  25.320  1.00 36.38  ? 147 ASP B O     1 
ATOM   3670  C CB    . ASP B  1 119 ? 25.545  24.472  26.357  1.00 37.46  ? 147 ASP B CB    1 
ATOM   3671  N N     . LYS B  1 120 ? 23.465  22.965  24.668  1.00 34.06  ? 148 LYS B N     1 
ATOM   3672  C CA    . LYS B  1 120 ? 22.676  22.753  23.454  1.00 31.53  ? 148 LYS B CA    1 
ATOM   3673  C C     . LYS B  1 120 ? 22.107  21.324  23.472  1.00 28.99  ? 148 LYS B C     1 
ATOM   3674  O O     . LYS B  1 120 ? 22.831  20.346  23.772  1.00 28.97  ? 148 LYS B O     1 
ATOM   3675  C CB    . LYS B  1 120 ? 23.549  22.936  22.210  1.00 31.89  ? 148 LYS B CB    1 
ATOM   3676  C CG    . LYS B  1 120 ? 23.951  24.368  21.881  1.00 30.58  ? 148 LYS B CG    1 
ATOM   3677  C CD    . LYS B  1 120 ? 24.815  24.408  20.610  1.00 34.67  ? 148 LYS B CD    1 
ATOM   3678  C CE    . LYS B  1 120 ? 25.052  25.826  20.117  1.00 37.17  ? 148 LYS B CE    1 
ATOM   3679  N NZ    . LYS B  1 120 ? 23.815  26.413  19.510  1.00 60.38  ? 148 LYS B NZ    1 
ATOM   3680  N N     . ILE B  1 121 ? 20.804  21.213  23.205  1.00 28.73  ? 149 ILE B N     1 
ATOM   3681  C CA    . ILE B  1 121 ? 20.159  19.924  23.015  1.00 25.97  ? 149 ILE B CA    1 
ATOM   3682  C C     . ILE B  1 121 ? 19.545  19.868  21.628  1.00 26.88  ? 149 ILE B C     1 
ATOM   3683  O O     . ILE B  1 121 ? 19.448  20.886  20.915  1.00 27.21  ? 149 ILE B O     1 
ATOM   3684  C CB    . ILE B  1 121 ? 19.036  19.630  24.078  1.00 26.11  ? 149 ILE B CB    1 
ATOM   3685  C CG1   . ILE B  1 121 ? 17.856  20.605  23.928  1.00 27.90  ? 149 ILE B CG1   1 
ATOM   3686  C CG2   . ILE B  1 121 ? 19.597  19.639  25.494  1.00 25.54  ? 149 ILE B CG2   1 
ATOM   3687  C CD1   . ILE B  1 121 ? 16.700  20.325  24.928  1.00 22.21  ? 149 ILE B CD1   1 
ATOM   3688  N N     . GLY B  1 122 ? 19.081  18.670  21.282  1.00 28.44  ? 150 GLY B N     1 
ATOM   3689  C CA    . GLY B  1 122 ? 18.641  18.355  19.941  1.00 25.58  ? 150 GLY B CA    1 
ATOM   3690  C C     . GLY B  1 122 ? 17.252  17.755  19.919  1.00 26.64  ? 150 GLY B C     1 
ATOM   3691  O O     . GLY B  1 122 ? 16.574  17.644  20.950  1.00 27.30  ? 150 GLY B O     1 
ATOM   3692  N N     . CYS B  1 123 ? 16.829  17.400  18.717  1.00 25.90  ? 151 CYS B N     1 
ATOM   3693  C CA    . CYS B  1 123 ? 15.512  16.822  18.492  1.00 21.77  ? 151 CYS B CA    1 
ATOM   3694  C C     . CYS B  1 123 ? 15.503  15.957  17.212  1.00 26.96  ? 151 CYS B C     1 
ATOM   3695  O O     . CYS B  1 123 ? 16.470  15.940  16.424  1.00 27.18  ? 151 CYS B O     1 
ATOM   3696  C CB    . CYS B  1 123 ? 14.458  17.931  18.443  1.00 17.60  ? 151 CYS B CB    1 
ATOM   3697  S SG    . CYS B  1 123 ? 14.507  19.038  16.967  1.00 31.30  ? 151 CYS B SG    1 
ATOM   3698  N N     . PHE B  1 124 ? 14.388  15.252  17.031  1.00 25.35  ? 152 PHE B N     1 
ATOM   3699  C CA    . PHE B  1 124 ? 14.241  14.147  16.092  1.00 23.58  ? 152 PHE B CA    1 
ATOM   3700  C C     . PHE B  1 124 ? 12.908  14.379  15.401  1.00 24.36  ? 152 PHE B C     1 
ATOM   3701  O O     . PHE B  1 124 ? 11.880  14.454  16.079  1.00 22.85  ? 152 PHE B O     1 
ATOM   3702  C CB    . PHE B  1 124 ? 14.212  12.874  16.925  1.00 26.71  ? 152 PHE B CB    1 
ATOM   3703  C CG    . PHE B  1 124 ? 13.891  11.621  16.166  1.00 25.71  ? 152 PHE B CG    1 
ATOM   3704  C CD1   . PHE B  1 124 ? 14.898  10.869  15.600  1.00 27.80  ? 152 PHE B CD1   1 
ATOM   3705  C CD2   . PHE B  1 124 ? 12.588  11.149  16.100  1.00 23.67  ? 152 PHE B CD2   1 
ATOM   3706  C CE1   . PHE B  1 124 ? 14.609  9.683   14.915  1.00 27.67  ? 152 PHE B CE1   1 
ATOM   3707  C CE2   . PHE B  1 124 ? 12.294  9.970   15.433  1.00 27.58  ? 152 PHE B CE2   1 
ATOM   3708  C CZ    . PHE B  1 124 ? 13.322  9.239   14.839  1.00 28.99  ? 152 PHE B CZ    1 
ATOM   3709  N N     . ALA B  1 125 ? 12.939  14.572  14.082  1.00 26.40  ? 153 ALA B N     1 
ATOM   3710  C CA    . ALA B  1 125 ? 11.717  14.924  13.333  1.00 26.14  ? 153 ALA B CA    1 
ATOM   3711  C C     . ALA B  1 125 ? 11.409  13.916  12.223  1.00 25.17  ? 153 ALA B C     1 
ATOM   3712  O O     . ALA B  1 125 ? 11.986  13.974  11.106  1.00 24.87  ? 153 ALA B O     1 
ATOM   3713  C CB    . ALA B  1 125 ? 11.819  16.359  12.785  1.00 23.71  ? 153 ALA B CB    1 
ATOM   3714  N N     . LEU B  1 126 ? 10.504  12.988  12.566  1.00 26.67  ? 154 LEU B N     1 
ATOM   3715  C CA    . LEU B  1 126 ? 10.015  11.929  11.679  1.00 22.88  ? 154 LEU B CA    1 
ATOM   3716  C C     . LEU B  1 126 ? 8.533   12.111  11.341  1.00 24.59  ? 154 LEU B C     1 
ATOM   3717  O O     . LEU B  1 126 ? 8.143   12.140  10.168  1.00 26.96  ? 154 LEU B O     1 
ATOM   3718  C CB    . LEU B  1 126 ? 10.191  10.577  12.347  1.00 25.70  ? 154 LEU B CB    1 
ATOM   3719  C CG    . LEU B  1 126 ? 9.826   9.323   11.537  1.00 26.70  ? 154 LEU B CG    1 
ATOM   3720  C CD1   . LEU B  1 126 ? 10.584  9.243   10.192  1.00 21.31  ? 154 LEU B CD1   1 
ATOM   3721  C CD2   . LEU B  1 126 ? 10.073  8.091   12.381  1.00 27.47  ? 154 LEU B CD2   1 
ATOM   3722  N N     . SER B  1 127 ? 7.709   12.233  12.374  1.00 25.78  ? 155 SER B N     1 
ATOM   3723  C CA    . SER B  1 127 ? 6.271   12.370  12.183  1.00 23.37  ? 155 SER B CA    1 
ATOM   3724  C C     . SER B  1 127 ? 5.891   13.634  11.434  1.00 26.02  ? 155 SER B C     1 
ATOM   3725  O O     . SER B  1 127 ? 6.633   14.642  11.433  1.00 25.44  ? 155 SER B O     1 
ATOM   3726  C CB    . SER B  1 127 ? 5.540   12.344  13.515  1.00 23.89  ? 155 SER B CB    1 
ATOM   3727  O OG    . SER B  1 127 ? 5.917   11.232  14.296  1.00 26.11  ? 155 SER B OG    1 
ATOM   3728  N N     . GLU B  1 128 ? 4.713   13.559  10.817  1.00 25.52  ? 156 GLU B N     1 
ATOM   3729  C CA    . GLU B  1 128 ? 4.085   14.659  10.079  1.00 28.04  ? 156 GLU B CA    1 
ATOM   3730  C C     . GLU B  1 128 ? 2.602   14.708  10.456  1.00 25.42  ? 156 GLU B C     1 
ATOM   3731  O O     . GLU B  1 128 ? 2.084   13.744  11.029  1.00 27.99  ? 156 GLU B O     1 
ATOM   3732  C CB    . GLU B  1 128 ? 4.278   14.440  8.577   1.00 26.10  ? 156 GLU B CB    1 
ATOM   3733  C CG    . GLU B  1 128 ? 5.780   14.415  8.186   1.00 30.44  ? 156 GLU B CG    1 
ATOM   3734  C CD    . GLU B  1 128 ? 6.036   14.134  6.722   1.00 37.01  ? 156 GLU B CD    1 
ATOM   3735  O OE1   . GLU B  1 128 ? 5.080   13.747  5.999   1.00 42.14  ? 156 GLU B OE1   1 
ATOM   3736  O OE2   . GLU B  1 128 ? 7.208   14.278  6.291   1.00 34.30  ? 156 GLU B OE2   1 
ATOM   3737  N N     . PRO B  1 129 ? 1.903   15.824  10.141  1.00 27.05  ? 157 PRO B N     1 
ATOM   3738  C CA    . PRO B  1 129 ? 0.478   15.911  10.482  1.00 27.17  ? 157 PRO B CA    1 
ATOM   3739  C C     . PRO B  1 129 ? -0.400  14.744  9.973   1.00 30.39  ? 157 PRO B C     1 
ATOM   3740  O O     . PRO B  1 129 ? -1.374  14.364  10.637  1.00 26.55  ? 157 PRO B O     1 
ATOM   3741  C CB    . PRO B  1 129 ? 0.045   17.233  9.832   1.00 28.56  ? 157 PRO B CB    1 
ATOM   3742  C CG    . PRO B  1 129 ? 1.281   18.047  9.753   1.00 28.71  ? 157 PRO B CG    1 
ATOM   3743  C CD    . PRO B  1 129 ? 2.378   17.056  9.475   1.00 26.96  ? 157 PRO B CD    1 
ATOM   3744  N N     . GLY B  1 130 ? -0.059  14.209  8.802   1.00 29.54  ? 158 GLY B N     1 
ATOM   3745  C CA    . GLY B  1 130 ? -0.864  13.191  8.143   1.00 32.82  ? 158 GLY B CA    1 
ATOM   3746  C C     . GLY B  1 130 ? -0.455  11.760  8.413   1.00 32.68  ? 158 GLY B C     1 
ATOM   3747  O O     . GLY B  1 130 ? -1.228  10.834  8.129   1.00 32.04  ? 158 GLY B O     1 
ATOM   3748  N N     . ASN B  1 131 ? 0.741   11.582  8.972   1.00 29.03  ? 159 ASN B N     1 
ATOM   3749  C CA    . ASN B  1 131 ? 1.305   10.269  9.262   1.00 29.19  ? 159 ASN B CA    1 
ATOM   3750  C C     . ASN B  1 131 ? 2.244   10.284  10.474  1.00 29.70  ? 159 ASN B C     1 
ATOM   3751  O O     . ASN B  1 131 ? 3.237   11.020  10.490  1.00 26.30  ? 159 ASN B O     1 
ATOM   3752  C CB    . ASN B  1 131 ? 2.089   9.730   8.054   1.00 33.54  ? 159 ASN B CB    1 
ATOM   3753  C CG    . ASN B  1 131 ? 2.831   10.822  7.289   1.00 35.31  ? 159 ASN B CG    1 
ATOM   3754  O OD1   . ASN B  1 131 ? 2.213   11.643  6.607   1.00 46.95  ? 159 ASN B OD1   1 
ATOM   3755  N ND2   . ASN B  1 131 ? 4.157   10.826  7.390   1.00 44.97  ? 159 ASN B ND2   1 
ATOM   3756  N N     . GLY B  1 132 ? 1.940   9.446   11.464  1.00 30.03  ? 160 GLY B N     1 
ATOM   3757  C CA    . GLY B  1 132 ? 2.851   9.169   12.592  1.00 26.53  ? 160 GLY B CA    1 
ATOM   3758  C C     . GLY B  1 132 ? 3.206   7.690   12.653  1.00 28.04  ? 160 GLY B C     1 
ATOM   3759  O O     . GLY B  1 132 ? 4.346   7.308   12.462  1.00 29.88  ? 160 GLY B O     1 
ATOM   3760  N N     . SER B  1 133 ? 2.214   6.845   12.886  1.00 31.61  ? 161 SER B N     1 
ATOM   3761  C CA    . SER B  1 133 ? 2.429   5.381   12.807  1.00 32.40  ? 161 SER B CA    1 
ATOM   3762  C C     . SER B  1 133 ? 3.008   4.956   11.444  1.00 31.84  ? 161 SER B C     1 
ATOM   3763  O O     . SER B  1 133 ? 3.961   4.164   11.351  1.00 30.33  ? 161 SER B O     1 
ATOM   3764  C CB    . SER B  1 133 ? 1.103   4.665   13.057  1.00 26.78  ? 161 SER B CB    1 
ATOM   3765  O OG    . SER B  1 133 ? 0.600   4.950   14.344  1.00 31.13  ? 161 SER B OG    1 
ATOM   3766  N N     . ASP B  1 134 ? 2.427   5.515   10.386  1.00 36.01  ? 162 ASP B N     1 
ATOM   3767  C CA    . ASP B  1 134 ? 2.837   5.248   9.011   1.00 35.69  ? 162 ASP B CA    1 
ATOM   3768  C C     . ASP B  1 134 ? 4.037   6.161   8.702   1.00 36.65  ? 162 ASP B C     1 
ATOM   3769  O O     . ASP B  1 134 ? 3.941   7.124   7.953   1.00 33.32  ? 162 ASP B O     1 
ATOM   3770  C CB    . ASP B  1 134 ? 1.648   5.509   8.075   1.00 34.34  ? 162 ASP B CB    1 
ATOM   3771  C CG    . ASP B  1 134 ? 1.869   4.989   6.672   1.00 40.73  ? 162 ASP B CG    1 
ATOM   3772  O OD1   . ASP B  1 134 ? 2.962   4.430   6.384   1.00 29.94  ? 162 ASP B OD1   1 
ATOM   3773  O OD2   . ASP B  1 134 ? 0.926   5.132   5.863   1.00 29.60  ? 162 ASP B OD2   1 
ATOM   3774  N N     . ALA B  1 135 ? 5.165   5.832   9.317   1.00 36.74  ? 163 ALA B N     1 
ATOM   3775  C CA    . ALA B  1 135 ? 6.366   6.661   9.292   1.00 40.17  ? 163 ALA B CA    1 
ATOM   3776  C C     . ALA B  1 135 ? 6.957   6.819   7.881   1.00 39.91  ? 163 ALA B C     1 
ATOM   3777  O O     . ALA B  1 135 ? 7.499   7.869   7.547   1.00 39.93  ? 163 ALA B O     1 
ATOM   3778  C CB    . ALA B  1 135 ? 7.417   6.075   10.256  1.00 39.09  ? 163 ALA B CB    1 
ATOM   3779  N N     . GLY B  1 136 ? 6.833   5.781   7.058   1.00 38.57  ? 164 GLY B N     1 
ATOM   3780  C CA    . GLY B  1 136 ? 7.356   5.800   5.694   1.00 39.14  ? 164 GLY B CA    1 
ATOM   3781  C C     . GLY B  1 136 ? 6.563   6.670   4.736   1.00 37.16  ? 164 GLY B C     1 
ATOM   3782  O O     . GLY B  1 136 ? 7.027   6.970   3.636   1.00 37.23  ? 164 GLY B O     1 
ATOM   3783  N N     . ALA B  1 137 ? 5.368   7.088   5.149   1.00 36.57  ? 165 ALA B N     1 
ATOM   3784  C CA    . ALA B  1 137 ? 4.527   7.976   4.347   1.00 36.61  ? 165 ALA B CA    1 
ATOM   3785  C C     . ALA B  1 137 ? 5.011   9.446   4.319   1.00 37.40  ? 165 ALA B C     1 
ATOM   3786  O O     . ALA B  1 137 ? 4.304   10.304  3.791   1.00 39.57  ? 165 ALA B O     1 
ATOM   3787  C CB    . ALA B  1 137 ? 3.086   7.920   4.856   1.00 32.46  ? 165 ALA B CB    1 
ATOM   3788  N N     . ALA B  1 138 ? 6.184   9.730   4.900   1.00 38.70  ? 166 ALA B N     1 
ATOM   3789  C CA    . ALA B  1 138 ? 6.770   11.091  4.940   1.00 38.14  ? 166 ALA B CA    1 
ATOM   3790  C C     . ALA B  1 138 ? 6.692   11.878  3.613   1.00 36.06  ? 166 ALA B C     1 
ATOM   3791  O O     . ALA B  1 138 ? 7.300   11.468  2.629   1.00 39.02  ? 166 ALA B O     1 
ATOM   3792  C CB    . ALA B  1 138 ? 8.237   11.008  5.393   1.00 34.48  ? 166 ALA B CB    1 
ATOM   3793  N N     . SER B  1 139 ? 5.970   13.004  3.608   1.00 31.56  ? 167 SER B N     1 
ATOM   3794  C CA    . SER B  1 139 ? 5.807   13.837  2.406   1.00 33.15  ? 167 SER B CA    1 
ATOM   3795  C C     . SER B  1 139 ? 6.729   15.070  2.368   1.00 34.02  ? 167 SER B C     1 
ATOM   3796  O O     . SER B  1 139 ? 6.819   15.734  1.340   1.00 30.57  ? 167 SER B O     1 
ATOM   3797  C CB    . SER B  1 139 ? 4.348   14.252  2.229   1.00 30.80  ? 167 SER B CB    1 
ATOM   3798  O OG    . SER B  1 139 ? 3.889   14.984  3.342   1.00 43.21  ? 167 SER B OG    1 
ATOM   3799  N N     . THR B  1 140 ? 7.417   15.370  3.470   1.00 31.25  ? 168 THR B N     1 
ATOM   3800  C CA    . THR B  1 140 ? 8.482   16.362  3.439   1.00 28.56  ? 168 THR B CA    1 
ATOM   3801  C C     . THR B  1 140 ? 9.495   15.877  2.405   1.00 31.06  ? 168 THR B C     1 
ATOM   3802  O O     . THR B  1 140 ? 9.775   14.670  2.309   1.00 29.53  ? 168 THR B O     1 
ATOM   3803  C CB    . THR B  1 140 ? 9.144   16.554  4.853   1.00 30.92  ? 168 THR B CB    1 
ATOM   3804  O OG1   . THR B  1 140 ? 8.176   17.089  5.754   1.00 32.40  ? 168 THR B OG1   1 
ATOM   3805  C CG2   . THR B  1 140 ? 10.355  17.518  4.814   1.00 26.34  ? 168 THR B CG2   1 
ATOM   3806  N N     . THR B  1 141 ? 10.016  16.819  1.614   1.00 29.61  ? 169 THR B N     1 
ATOM   3807  C CA    . THR B  1 141 ? 10.944  16.501  0.529   1.00 27.73  ? 169 THR B CA    1 
ATOM   3808  C C     . THR B  1 141 ? 12.256  17.199  0.729   1.00 28.16  ? 169 THR B C     1 
ATOM   3809  O O     . THR B  1 141 ? 12.300  18.297  1.291   1.00 31.46  ? 169 THR B O     1 
ATOM   3810  C CB    . THR B  1 141 ? 10.368  16.887  -0.863  1.00 31.83  ? 169 THR B CB    1 
ATOM   3811  O OG1   . THR B  1 141 ? 10.140  18.302  -0.937  1.00 32.13  ? 169 THR B OG1   1 
ATOM   3812  C CG2   . THR B  1 141 ? 9.035   16.135  -1.102  1.00 28.40  ? 169 THR B CG2   1 
ATOM   3813  N N     . ALA B  1 142 ? 13.316  16.512  0.303   1.00 26.52  ? 170 ALA B N     1 
ATOM   3814  C CA    . ALA B  1 142 ? 14.656  17.057  0.186   1.00 29.68  ? 170 ALA B CA    1 
ATOM   3815  C C     . ALA B  1 142 ? 15.037  16.907  -1.291  1.00 34.09  ? 170 ALA B C     1 
ATOM   3816  O O     . ALA B  1 142 ? 15.043  15.780  -1.810  1.00 35.02  ? 170 ALA B O     1 
ATOM   3817  C CB    . ALA B  1 142 ? 15.627  16.267  1.076   1.00 24.34  ? 170 ALA B CB    1 
ATOM   3818  N N     . ARG B  1 143 ? 15.314  18.028  -1.966  1.00 34.85  ? 171 ARG B N     1 
ATOM   3819  C CA    . ARG B  1 143 ? 15.861  18.009  -3.326  1.00 32.59  ? 171 ARG B CA    1 
ATOM   3820  C C     . ARG B  1 143 ? 17.299  18.517  -3.310  1.00 31.83  ? 171 ARG B C     1 
ATOM   3821  O O     . ARG B  1 143 ? 17.621  19.455  -2.584  1.00 31.78  ? 171 ARG B O     1 
ATOM   3822  C CB    . ARG B  1 143 ? 15.035  18.882  -4.261  1.00 31.50  ? 171 ARG B CB    1 
ATOM   3823  N N     . ALA B  1 144 ? 18.153  17.892  -4.119  1.00 30.46  ? 172 ALA B N     1 
ATOM   3824  C CA    . ALA B  1 144 ? 19.545  18.337  -4.295  1.00 34.51  ? 172 ALA B CA    1 
ATOM   3825  C C     . ALA B  1 144 ? 19.608  19.456  -5.352  1.00 35.86  ? 172 ALA B C     1 
ATOM   3826  O O     . ALA B  1 144 ? 19.403  19.214  -6.547  1.00 39.15  ? 172 ALA B O     1 
ATOM   3827  C CB    . ALA B  1 144 ? 20.449  17.158  -4.701  1.00 31.12  ? 172 ALA B CB    1 
ATOM   3828  N N     . GLU B  1 145 ? 19.838  20.682  -4.887  1.00 38.64  ? 173 GLU B N     1 
ATOM   3829  C CA    . GLU B  1 145 ? 20.060  21.837  -5.750  1.00 39.87  ? 173 GLU B CA    1 
ATOM   3830  C C     . GLU B  1 145 ? 21.482  22.370  -5.491  1.00 42.51  ? 173 GLU B C     1 
ATOM   3831  O O     . GLU B  1 145 ? 21.725  23.075  -4.500  1.00 43.22  ? 173 GLU B O     1 
ATOM   3832  C CB    . GLU B  1 145 ? 18.991  22.909  -5.473  1.00 39.83  ? 173 GLU B CB    1 
ATOM   3833  C CG    . GLU B  1 145 ? 19.074  24.143  -6.367  1.00 57.26  ? 173 GLU B CG    1 
ATOM   3834  N N     . GLY B  1 146 ? 22.422  22.005  -6.366  1.00 42.02  ? 174 GLY B N     1 
ATOM   3835  C CA    . GLY B  1 146 ? 23.809  22.466  -6.255  1.00 41.32  ? 174 GLY B CA    1 
ATOM   3836  C C     . GLY B  1 146 ? 24.560  21.812  -5.107  1.00 40.49  ? 174 GLY B C     1 
ATOM   3837  O O     . GLY B  1 146 ? 24.495  20.596  -4.930  1.00 46.14  ? 174 GLY B O     1 
ATOM   3838  N N     . ASP B  1 147 ? 25.280  22.612  -4.318  1.00 42.91  ? 175 ASP B N     1 
ATOM   3839  C CA    . ASP B  1 147 ? 25.965  22.089  -3.110  1.00 43.41  ? 175 ASP B CA    1 
ATOM   3840  C C     . ASP B  1 147 ? 25.110  22.237  -1.823  1.00 39.54  ? 175 ASP B C     1 
ATOM   3841  O O     . ASP B  1 147 ? 25.638  22.377  -0.702  1.00 37.24  ? 175 ASP B O     1 
ATOM   3842  C CB    . ASP B  1 147 ? 27.366  22.706  -2.951  1.00 43.41  ? 175 ASP B CB    1 
ATOM   3843  C CG    . ASP B  1 147 ? 27.342  24.220  -2.809  1.00 64.09  ? 175 ASP B CG    1 
ATOM   3844  O OD1   . ASP B  1 147 ? 26.287  24.843  -3.083  1.00 81.89  ? 175 ASP B OD1   1 
ATOM   3845  O OD2   . ASP B  1 147 ? 28.397  24.786  -2.438  1.00 80.17  ? 175 ASP B OD2   1 
ATOM   3846  N N     . SER B  1 148 ? 23.788  22.200  -2.015  1.00 38.38  ? 176 SER B N     1 
ATOM   3847  C CA    . SER B  1 148 ? 22.824  22.179  -0.931  1.00 37.79  ? 176 SER B CA    1 
ATOM   3848  C C     . SER B  1 148 ? 21.731  21.121  -1.154  1.00 37.01  ? 176 SER B C     1 
ATOM   3849  O O     . SER B  1 148 ? 21.511  20.652  -2.282  1.00 34.61  ? 176 SER B O     1 
ATOM   3850  C CB    . SER B  1 148 ? 22.142  23.544  -0.811  1.00 37.85  ? 176 SER B CB    1 
ATOM   3851  O OG    . SER B  1 148 ? 23.054  24.529  -0.366  1.00 42.91  ? 176 SER B OG    1 
ATOM   3852  N N     . TRP B  1 149 ? 21.073  20.755  -0.050  1.00 33.51  ? 177 TRP B N     1 
ATOM   3853  C CA    . TRP B  1 149 ? 19.764  20.107  -0.064  1.00 30.62  ? 177 TRP B CA    1 
ATOM   3854  C C     . TRP B  1 149 ? 18.750  21.188  0.201   1.00 27.05  ? 177 TRP B C     1 
ATOM   3855  O O     . TRP B  1 149 ? 19.022  22.110  0.987   1.00 32.56  ? 177 TRP B O     1 
ATOM   3856  C CB    . TRP B  1 149 ? 19.685  19.057  1.036   1.00 30.73  ? 177 TRP B CB    1 
ATOM   3857  C CG    . TRP B  1 149 ? 20.540  17.900  0.764   1.00 30.67  ? 177 TRP B CG    1 
ATOM   3858  C CD1   . TRP B  1 149 ? 21.768  17.648  1.274   1.00 29.15  ? 177 TRP B CD1   1 
ATOM   3859  C CD2   . TRP B  1 149 ? 20.222  16.812  -0.099  1.00 32.82  ? 177 TRP B CD2   1 
ATOM   3860  N NE1   . TRP B  1 149 ? 22.246  16.458  0.784   1.00 33.65  ? 177 TRP B NE1   1 
ATOM   3861  C CE2   . TRP B  1 149 ? 21.310  15.928  -0.069  1.00 27.59  ? 177 TRP B CE2   1 
ATOM   3862  C CE3   . TRP B  1 149 ? 19.102  16.487  -0.883  1.00 26.51  ? 177 TRP B CE3   1 
ATOM   3863  C CZ2   . TRP B  1 149 ? 21.323  14.739  -0.799  1.00 33.27  ? 177 TRP B CZ2   1 
ATOM   3864  C CZ3   . TRP B  1 149 ? 19.124  15.314  -1.609  1.00 33.32  ? 177 TRP B CZ3   1 
ATOM   3865  C CH2   . TRP B  1 149 ? 20.228  14.456  -1.562  1.00 31.28  ? 177 TRP B CH2   1 
ATOM   3866  N N     . VAL B  1 150 ? 17.601  21.113  -0.465  1.00 29.74  ? 178 VAL B N     1 
ATOM   3867  C CA    . VAL B  1 150 ? 16.498  22.057  -0.244  1.00 29.99  ? 178 VAL B CA    1 
ATOM   3868  C C     . VAL B  1 150 ? 15.326  21.260  0.345   1.00 30.24  ? 178 VAL B C     1 
ATOM   3869  O O     . VAL B  1 150 ? 14.893  20.284  -0.262  1.00 29.42  ? 178 VAL B O     1 
ATOM   3870  C CB    . VAL B  1 150 ? 16.075  22.744  -1.558  1.00 31.00  ? 178 VAL B CB    1 
ATOM   3871  C CG1   . VAL B  1 150 ? 14.985  23.771  -1.307  1.00 29.16  ? 178 VAL B CG1   1 
ATOM   3872  C CG2   . VAL B  1 150 ? 17.307  23.412  -2.227  1.00 31.62  ? 178 VAL B CG2   1 
ATOM   3873  N N     . LEU B  1 151 ? 14.855  21.662  1.532   1.00 29.67  ? 179 LEU B N     1 
ATOM   3874  C CA    . LEU B  1 151 ? 13.809  20.924  2.263   1.00 27.50  ? 179 LEU B CA    1 
ATOM   3875  C C     . LEU B  1 151 ? 12.512  21.690  2.172   1.00 26.13  ? 179 LEU B C     1 
ATOM   3876  O O     . LEU B  1 151 ? 12.501  22.914  2.249   1.00 27.89  ? 179 LEU B O     1 
ATOM   3877  C CB    . LEU B  1 151 ? 14.188  20.713  3.734   1.00 26.31  ? 179 LEU B CB    1 
ATOM   3878  C CG    . LEU B  1 151 ? 15.131  19.546  4.020   1.00 31.88  ? 179 LEU B CG    1 
ATOM   3879  C CD1   . LEU B  1 151 ? 16.342  19.628  3.111   1.00 33.90  ? 179 LEU B CD1   1 
ATOM   3880  C CD2   . LEU B  1 151 ? 15.567  19.530  5.485   1.00 36.46  ? 179 LEU B CD2   1 
ATOM   3881  N N     . ASN B  1 152 ? 11.423  20.966  1.952   1.00 29.20  ? 180 ASN B N     1 
ATOM   3882  C CA    . ASN B  1 152 ? 10.101  21.570  1.928   1.00 28.16  ? 180 ASN B CA    1 
ATOM   3883  C C     . ASN B  1 152 ? 9.132   20.632  2.588   1.00 26.39  ? 180 ASN B C     1 
ATOM   3884  O O     . ASN B  1 152 ? 9.096   19.453  2.242   1.00 27.91  ? 180 ASN B O     1 
ATOM   3885  C CB    . ASN B  1 152 ? 9.646   21.879  0.493   1.00 30.17  ? 180 ASN B CB    1 
ATOM   3886  C CG    . ASN B  1 152 ? 10.300  23.130  -0.055  1.00 33.64  ? 180 ASN B CG    1 
ATOM   3887  O OD1   . ASN B  1 152 ? 9.889   24.238  0.249   1.00 34.74  ? 180 ASN B OD1   1 
ATOM   3888  N ND2   . ASN B  1 152 ? 11.322  22.956  -0.845  1.00 20.04  ? 180 ASN B ND2   1 
ATOM   3889  N N     . GLY B  1 153 ? 8.368   21.161  3.541   1.00 27.41  ? 181 GLY B N     1 
ATOM   3890  C CA    . GLY B  1 153 ? 7.333   20.380  4.232   1.00 30.15  ? 181 GLY B CA    1 
ATOM   3891  C C     . GLY B  1 153 ? 7.206   20.699  5.710   1.00 29.10  ? 181 GLY B C     1 
ATOM   3892  O O     . GLY B  1 153 ? 8.028   21.436  6.263   1.00 32.91  ? 181 GLY B O     1 
ATOM   3893  N N     . THR B  1 154 ? 6.178   20.121  6.346   1.00 28.03  ? 182 THR B N     1 
ATOM   3894  C CA    . THR B  1 154 ? 5.949   20.266  7.792   1.00 30.13  ? 182 THR B CA    1 
ATOM   3895  C C     . THR B  1 154 ? 6.102   18.949  8.570   1.00 27.85  ? 182 THR B C     1 
ATOM   3896  O O     . THR B  1 154 ? 5.475   17.925  8.233   1.00 27.95  ? 182 THR B O     1 
ATOM   3897  C CB    . THR B  1 154 ? 4.531   20.812  8.083   1.00 29.14  ? 182 THR B CB    1 
ATOM   3898  O OG1   . THR B  1 154 ? 4.370   22.069  7.422   1.00 33.58  ? 182 THR B OG1   1 
ATOM   3899  C CG2   . THR B  1 154 ? 4.304   20.994  9.601   1.00 29.76  ? 182 THR B CG2   1 
ATOM   3900  N N     . LYS B  1 155 ? 6.950   18.965  9.592   1.00 27.87  ? 183 LYS B N     1 
ATOM   3901  C CA    . LYS B  1 155 ? 7.024   17.840  10.531  1.00 25.87  ? 183 LYS B CA    1 
ATOM   3902  C C     . LYS B  1 155 ? 6.213   18.196  11.759  1.00 26.73  ? 183 LYS B C     1 
ATOM   3903  O O     . LYS B  1 155 ? 6.104   19.375  12.126  1.00 27.81  ? 183 LYS B O     1 
ATOM   3904  C CB    . LYS B  1 155 ? 8.460   17.509  10.921  1.00 25.27  ? 183 LYS B CB    1 
ATOM   3905  C CG    . LYS B  1 155 ? 9.429   17.465  9.776   1.00 30.39  ? 183 LYS B CG    1 
ATOM   3906  C CD    . LYS B  1 155 ? 9.121   16.404  8.710   1.00 33.99  ? 183 LYS B CD    1 
ATOM   3907  C CE    . LYS B  1 155 ? 9.436   15.000  9.163   1.00 30.35  ? 183 LYS B CE    1 
ATOM   3908  N NZ    . LYS B  1 155 ? 9.055   13.970  8.143   1.00 25.91  ? 183 LYS B NZ    1 
ATOM   3909  N N     . ALA B  1 156 ? 5.630   17.173  12.385  1.00 27.12  ? 184 ALA B N     1 
ATOM   3910  C CA    . ALA B  1 156 ? 4.709   17.378  13.480  1.00 27.40  ? 184 ALA B CA    1 
ATOM   3911  C C     . ALA B  1 156 ? 5.166   16.640  14.732  1.00 24.86  ? 184 ALA B C     1 
ATOM   3912  O O     . ALA B  1 156 ? 5.879   15.631  14.648  1.00 22.29  ? 184 ALA B O     1 
ATOM   3913  C CB    . ALA B  1 156 ? 3.252   16.969  13.053  1.00 26.10  ? 184 ALA B CB    1 
ATOM   3914  N N     . TRP B  1 157 ? 4.773   17.198  15.879  1.00 25.65  ? 185 TRP B N     1 
ATOM   3915  C CA    . TRP B  1 157 ? 4.956   16.606  17.214  1.00 27.41  ? 185 TRP B CA    1 
ATOM   3916  C C     . TRP B  1 157 ? 6.387   16.569  17.689  1.00 25.52  ? 185 TRP B C     1 
ATOM   3917  O O     . TRP B  1 157 ? 6.778   15.606  18.320  1.00 28.57  ? 185 TRP B O     1 
ATOM   3918  C CB    . TRP B  1 157 ? 4.433   15.172  17.273  1.00 27.92  ? 185 TRP B CB    1 
ATOM   3919  C CG    . TRP B  1 157 ? 3.072   14.989  16.744  1.00 25.39  ? 185 TRP B CG    1 
ATOM   3920  C CD1   . TRP B  1 157 ? 2.721   14.304  15.619  1.00 26.74  ? 185 TRP B CD1   1 
ATOM   3921  C CD2   . TRP B  1 157 ? 1.857   15.466  17.336  1.00 23.35  ? 185 TRP B CD2   1 
ATOM   3922  N NE1   . TRP B  1 157 ? 1.345   14.342  15.460  1.00 21.82  ? 185 TRP B NE1   1 
ATOM   3923  C CE2   . TRP B  1 157 ? 0.797   15.060  16.494  1.00 24.92  ? 185 TRP B CE2   1 
ATOM   3924  C CE3   . TRP B  1 157 ? 1.563   16.211  18.487  1.00 25.53  ? 185 TRP B CE3   1 
ATOM   3925  C CZ2   . TRP B  1 157 ? -0.534  15.346  16.780  1.00 24.53  ? 185 TRP B CZ2   1 
ATOM   3926  C CZ3   . TRP B  1 157 ? 0.227   16.511  18.766  1.00 28.99  ? 185 TRP B CZ3   1 
ATOM   3927  C CH2   . TRP B  1 157 ? -0.800  16.085  17.911  1.00 29.29  ? 185 TRP B CH2   1 
ATOM   3928  N N     . ILE B  1 158 ? 7.179   17.589  17.387  1.00 25.01  ? 186 ILE B N     1 
ATOM   3929  C CA    . ILE B  1 158 ? 8.607   17.487  17.639  1.00 24.44  ? 186 ILE B CA    1 
ATOM   3930  C C     . ILE B  1 158 ? 8.943   17.929  19.083  1.00 21.29  ? 186 ILE B C     1 
ATOM   3931  O O     . ILE B  1 158 ? 8.795   19.093  19.454  1.00 18.93  ? 186 ILE B O     1 
ATOM   3932  C CB    . ILE B  1 158 ? 9.447   18.265  16.595  1.00 28.58  ? 186 ILE B CB    1 
ATOM   3933  C CG1   . ILE B  1 158 ? 9.017   17.942  15.146  1.00 25.04  ? 186 ILE B CG1   1 
ATOM   3934  C CG2   . ILE B  1 158 ? 10.928  17.942  16.793  1.00 22.32  ? 186 ILE B CG2   1 
ATOM   3935  C CD1   . ILE B  1 158 ? 9.040   16.461  14.761  1.00 24.79  ? 186 ILE B CD1   1 
ATOM   3936  N N     . THR B  1 159 ? 9.368   16.965  19.895  1.00 27.25  ? 187 THR B N     1 
ATOM   3937  C CA    . THR B  1 159 ? 9.750   17.214  21.273  1.00 22.63  ? 187 THR B CA    1 
ATOM   3938  C C     . THR B  1 159 ? 11.073  17.995  21.325  1.00 25.65  ? 187 THR B C     1 
ATOM   3939  O O     . THR B  1 159 ? 12.049  17.601  20.682  1.00 26.78  ? 187 THR B O     1 
ATOM   3940  C CB    . THR B  1 159 ? 9.889   15.889  22.046  1.00 24.24  ? 187 THR B CB    1 
ATOM   3941  O OG1   . THR B  1 159 ? 8.636   15.194  22.038  1.00 26.11  ? 187 THR B OG1   1 
ATOM   3942  C CG2   . THR B  1 159 ? 10.332  16.137  23.504  1.00 24.05  ? 187 THR B CG2   1 
ATOM   3943  N N     . ASN B  1 160 ? 11.093  19.077  22.122  1.00 25.54  ? 188 ASN B N     1 
ATOM   3944  C CA    . ASN B  1 160 ? 12.265  19.978  22.269  1.00 23.81  ? 188 ASN B CA    1 
ATOM   3945  C C     . ASN B  1 160 ? 12.376  20.993  21.112  1.00 25.13  ? 188 ASN B C     1 
ATOM   3946  O O     . ASN B  1 160 ? 13.422  21.645  20.949  1.00 33.28  ? 188 ASN B O     1 
ATOM   3947  C CB    . ASN B  1 160 ? 13.584  19.193  22.413  1.00 24.67  ? 188 ASN B CB    1 
ATOM   3948  C CG    . ASN B  1 160 ? 13.654  18.347  23.689  1.00 24.37  ? 188 ASN B CG    1 
ATOM   3949  O OD1   . ASN B  1 160 ? 12.847  18.497  24.606  1.00 32.75  ? 188 ASN B OD1   1 
ATOM   3950  N ND2   . ASN B  1 160 ? 14.672  17.476  23.762  1.00 26.36  ? 188 ASN B ND2   1 
ATOM   3951  N N     . ALA B  1 161 ? 11.297  21.148  20.330  1.00 28.74  ? 189 ALA B N     1 
ATOM   3952  C CA    . ALA B  1 161 ? 11.313  21.998  19.120  1.00 29.24  ? 189 ALA B CA    1 
ATOM   3953  C C     . ALA B  1 161 ? 11.740  23.425  19.461  1.00 27.64  ? 189 ALA B C     1 
ATOM   3954  O O     . ALA B  1 161 ? 12.579  24.021  18.769  1.00 26.88  ? 189 ALA B O     1 
ATOM   3955  C CB    . ALA B  1 161 ? 9.911   22.025  18.438  1.00 26.57  ? 189 ALA B CB    1 
ATOM   3956  N N     . TRP B  1 162 ? 11.166  23.951  20.542  1.00 28.02  ? 190 TRP B N     1 
ATOM   3957  C CA    . TRP B  1 162 ? 11.375  25.339  20.936  1.00 27.71  ? 190 TRP B CA    1 
ATOM   3958  C C     . TRP B  1 162 ? 12.662  25.576  21.706  1.00 23.68  ? 190 TRP B C     1 
ATOM   3959  O O     . TRP B  1 162 ? 12.986  26.716  21.986  1.00 31.08  ? 190 TRP B O     1 
ATOM   3960  C CB    . TRP B  1 162 ? 10.181  25.874  21.729  1.00 25.00  ? 190 TRP B CB    1 
ATOM   3961  C CG    . TRP B  1 162 ? 9.013   26.259  20.833  1.00 29.28  ? 190 TRP B CG    1 
ATOM   3962  C CD1   . TRP B  1 162 ? 8.370   25.454  19.929  1.00 32.02  ? 190 TRP B CD1   1 
ATOM   3963  C CD2   . TRP B  1 162 ? 8.353   27.536  20.765  1.00 39.06  ? 190 TRP B CD2   1 
ATOM   3964  N NE1   . TRP B  1 162 ? 7.342   26.149  19.314  1.00 29.85  ? 190 TRP B NE1   1 
ATOM   3965  C CE2   . TRP B  1 162 ? 7.309   27.423  19.809  1.00 30.02  ? 190 TRP B CE2   1 
ATOM   3966  C CE3   . TRP B  1 162 ? 8.530   28.758  21.431  1.00 39.28  ? 190 TRP B CE3   1 
ATOM   3967  C CZ2   . TRP B  1 162 ? 6.462   28.491  19.491  1.00 35.32  ? 190 TRP B CZ2   1 
ATOM   3968  C CZ3   . TRP B  1 162 ? 7.674   29.810  21.129  1.00 39.02  ? 190 TRP B CZ3   1 
ATOM   3969  C CH2   . TRP B  1 162 ? 6.657   29.671  20.158  1.00 39.22  ? 190 TRP B CH2   1 
ATOM   3970  N N     . GLU B  1 163 ? 13.383  24.519  22.038  1.00 24.27  ? 191 GLU B N     1 
ATOM   3971  C CA    . GLU B  1 163 ? 14.652  24.630  22.769  1.00 25.49  ? 191 GLU B CA    1 
ATOM   3972  C C     . GLU B  1 163 ? 15.842  24.067  22.012  1.00 28.11  ? 191 GLU B C     1 
ATOM   3973  O O     . GLU B  1 163 ? 16.995  24.341  22.377  1.00 28.69  ? 191 GLU B O     1 
ATOM   3974  C CB    . GLU B  1 163 ? 14.524  23.907  24.112  1.00 27.00  ? 191 GLU B CB    1 
ATOM   3975  C CG    . GLU B  1 163 ? 13.485  24.540  25.047  1.00 27.38  ? 191 GLU B CG    1 
ATOM   3976  C CD    . GLU B  1 163 ? 12.051  24.028  24.855  1.00 36.23  ? 191 GLU B CD    1 
ATOM   3977  O OE1   . GLU B  1 163 ? 11.859  22.933  24.304  1.00 31.06  ? 191 GLU B OE1   1 
ATOM   3978  O OE2   . GLU B  1 163 ? 11.103  24.735  25.276  1.00 28.67  ? 191 GLU B OE2   1 
ATOM   3979  N N     . ALA B  1 164 ? 15.586  23.281  20.971  1.00 25.37  ? 192 ALA B N     1 
ATOM   3980  C CA    . ALA B  1 164 ? 16.651  22.599  20.245  1.00 25.29  ? 192 ALA B CA    1 
ATOM   3981  C C     . ALA B  1 164 ? 17.453  23.556  19.341  1.00 22.70  ? 192 ALA B C     1 
ATOM   3982  O O     . ALA B  1 164 ? 16.928  24.558  18.843  1.00 26.08  ? 192 ALA B O     1 
ATOM   3983  C CB    . ALA B  1 164 ? 16.079  21.398  19.417  1.00 22.42  ? 192 ALA B CB    1 
ATOM   3984  N N     . SER B  1 165 ? 18.735  23.231  19.167  1.00 25.04  ? 193 SER B N     1 
ATOM   3985  C CA    . SER B  1 165 ? 19.664  23.954  18.287  1.00 27.53  ? 193 SER B CA    1 
ATOM   3986  C C     . SER B  1 165 ? 20.020  23.118  17.055  1.00 27.17  ? 193 SER B C     1 
ATOM   3987  O O     . SER B  1 165 ? 20.821  23.544  16.214  1.00 30.76  ? 193 SER B O     1 
ATOM   3988  C CB    . SER B  1 165 ? 20.973  24.283  19.037  1.00 27.44  ? 193 SER B CB    1 
ATOM   3989  O OG    . SER B  1 165 ? 20.764  25.246  20.050  1.00 30.22  ? 193 SER B OG    1 
ATOM   3990  N N     . ALA B  1 166 ? 19.473  21.909  16.981  1.00 28.07  ? 194 ALA B N     1 
ATOM   3991  C CA    . ALA B  1 166 ? 19.669  21.015  15.843  1.00 25.68  ? 194 ALA B CA    1 
ATOM   3992  C C     . ALA B  1 166 ? 18.589  19.934  15.861  1.00 27.31  ? 194 ALA B C     1 
ATOM   3993  O O     . ALA B  1 166 ? 18.067  19.577  16.931  1.00 28.57  ? 194 ALA B O     1 
ATOM   3994  C CB    . ALA B  1 166 ? 21.066  20.371  15.874  1.00 23.15  ? 194 ALA B CB    1 
ATOM   3995  N N     . ALA B  1 167 ? 18.278  19.417  14.670  1.00 28.03  ? 195 ALA B N     1 
ATOM   3996  C CA    . ALA B  1 167 ? 17.256  18.389  14.482  1.00 26.97  ? 195 ALA B CA    1 
ATOM   3997  C C     . ALA B  1 167 ? 17.801  17.328  13.537  1.00 25.52  ? 195 ALA B C     1 
ATOM   3998  O O     . ALA B  1 167 ? 18.577  17.629  12.650  1.00 27.77  ? 195 ALA B O     1 
ATOM   3999  C CB    . ALA B  1 167 ? 15.937  19.021  13.904  1.00 19.04  ? 195 ALA B CB    1 
ATOM   4000  N N     . VAL B  1 168 ? 17.429  16.073  13.764  1.00 30.06  ? 196 VAL B N     1 
ATOM   4001  C CA    . VAL B  1 168 ? 17.616  15.015  12.758  1.00 26.20  ? 196 VAL B CA    1 
ATOM   4002  C C     . VAL B  1 168 ? 16.277  14.916  12.029  1.00 27.78  ? 196 VAL B C     1 
ATOM   4003  O O     . VAL B  1 168 ? 15.287  14.572  12.630  1.00 27.60  ? 196 VAL B O     1 
ATOM   4004  C CB    . VAL B  1 168 ? 17.970  13.667  13.407  1.00 24.70  ? 196 VAL B CB    1 
ATOM   4005  C CG1   . VAL B  1 168 ? 18.351  12.632  12.351  1.00 28.95  ? 196 VAL B CG1   1 
ATOM   4006  C CG2   . VAL B  1 168 ? 19.084  13.838  14.411  1.00 28.09  ? 196 VAL B CG2   1 
ATOM   4007  N N     . VAL B  1 169 ? 16.253  15.277  10.748  1.00 28.56  ? 197 VAL B N     1 
ATOM   4008  C CA    . VAL B  1 169 ? 15.008  15.394  10.003  1.00 27.45  ? 197 VAL B CA    1 
ATOM   4009  C C     . VAL B  1 169 ? 14.951  14.336  8.899   1.00 25.06  ? 197 VAL B C     1 
ATOM   4010  O O     . VAL B  1 169 ? 15.920  14.131  8.173   1.00 25.53  ? 197 VAL B O     1 
ATOM   4011  C CB    . VAL B  1 169 ? 14.886  16.796  9.387   1.00 28.63  ? 197 VAL B CB    1 
ATOM   4012  C CG1   . VAL B  1 169 ? 13.472  17.020  8.771   1.00 26.76  ? 197 VAL B CG1   1 
ATOM   4013  C CG2   . VAL B  1 169 ? 15.249  17.864  10.459  1.00 25.75  ? 197 VAL B CG2   1 
ATOM   4014  N N     . PHE B  1 170 ? 13.801  13.661  8.788   1.00 29.28  ? 198 PHE B N     1 
ATOM   4015  C CA    . PHE B  1 170 ? 13.597  12.631  7.757   1.00 26.92  ? 198 PHE B CA    1 
ATOM   4016  C C     . PHE B  1 170 ? 12.769  13.165  6.593   1.00 28.72  ? 198 PHE B C     1 
ATOM   4017  O O     . PHE B  1 170 ? 11.639  13.640  6.767   1.00 27.96  ? 198 PHE B O     1 
ATOM   4018  C CB    . PHE B  1 170 ? 13.000  11.372  8.370   1.00 26.94  ? 198 PHE B CB    1 
ATOM   4019  C CG    . PHE B  1 170 ? 13.910  10.731  9.395   1.00 25.00  ? 198 PHE B CG    1 
ATOM   4020  C CD1   . PHE B  1 170 ? 14.762  9.696   9.049   1.00 25.34  ? 198 PHE B CD1   1 
ATOM   4021  C CD2   . PHE B  1 170 ? 13.949  11.213  10.683  1.00 23.73  ? 198 PHE B CD2   1 
ATOM   4022  C CE1   . PHE B  1 170 ? 15.583  9.138   9.985   1.00 23.95  ? 198 PHE B CE1   1 
ATOM   4023  C CE2   . PHE B  1 170 ? 14.765  10.648  11.642  1.00 26.80  ? 198 PHE B CE2   1 
ATOM   4024  C CZ    . PHE B  1 170 ? 15.599  9.627   11.294  1.00 25.50  ? 198 PHE B CZ    1 
ATOM   4025  N N     . ALA B  1 171 ? 13.368  13.121  5.404   1.00 26.84  ? 199 ALA B N     1 
ATOM   4026  C CA    . ALA B  1 171 ? 12.755  13.708  4.222   1.00 29.65  ? 199 ALA B CA    1 
ATOM   4027  C C     . ALA B  1 171 ? 12.790  12.729  3.059   1.00 25.95  ? 199 ALA B C     1 
ATOM   4028  O O     . ALA B  1 171 ? 13.725  11.929  2.923   1.00 30.14  ? 199 ALA B O     1 
ATOM   4029  C CB    . ALA B  1 171 ? 13.437  15.039  3.854   1.00 24.64  ? 199 ALA B CB    1 
ATOM   4030  N N     . SER B  1 172 ? 11.745  12.781  2.245   1.00 30.95  ? 200 SER B N     1 
ATOM   4031  C CA    . SER B  1 172 ? 11.632  11.909  1.086   1.00 32.56  ? 200 SER B CA    1 
ATOM   4032  C C     . SER B  1 172 ? 12.521  12.442  -0.026  1.00 32.98  ? 200 SER B C     1 
ATOM   4033  O O     . SER B  1 172 ? 12.397  13.606  -0.451  1.00 32.15  ? 200 SER B O     1 
ATOM   4034  C CB    . SER B  1 172 ? 10.188  11.832  0.591   1.00 33.52  ? 200 SER B CB    1 
ATOM   4035  O OG    . SER B  1 172 ? 10.160  11.102  -0.623  1.00 39.86  ? 200 SER B OG    1 
ATOM   4036  N N     . THR B  1 173 ? 13.427  11.575  -0.469  1.00 36.34  ? 201 THR B N     1 
ATOM   4037  C CA    . THR B  1 173 ? 14.391  11.860  -1.513  1.00 36.28  ? 201 THR B CA    1 
ATOM   4038  C C     . THR B  1 173 ? 14.091  10.942  -2.705  1.00 38.96  ? 201 THR B C     1 
ATOM   4039  O O     . THR B  1 173 ? 13.751  11.423  -3.783  1.00 40.85  ? 201 THR B O     1 
ATOM   4040  C CB    . THR B  1 173 ? 15.812  11.546  -1.014  1.00 38.37  ? 201 THR B CB    1 
ATOM   4041  O OG1   . THR B  1 173 ? 15.790  10.304  -0.282  1.00 40.87  ? 201 THR B OG1   1 
ATOM   4042  C CG2   . THR B  1 173 ? 16.317  12.655  -0.103  1.00 29.83  ? 201 THR B CG2   1 
ATOM   4043  N N     . SER B  1 181 ? 14.122  5.579   -0.376  1.00 44.43  ? 209 SER B N     1 
ATOM   4044  C CA    . SER B  1 181 ? 13.481  6.834   -0.759  1.00 46.29  ? 209 SER B CA    1 
ATOM   4045  C C     . SER B  1 181 ? 13.425  7.898   0.365   1.00 46.34  ? 209 SER B C     1 
ATOM   4046  O O     . SER B  1 181 ? 13.197  9.075   0.083   1.00 49.39  ? 209 SER B O     1 
ATOM   4047  C CB    . SER B  1 181 ? 12.076  6.555   -1.312  1.00 44.72  ? 209 SER B CB    1 
ATOM   4048  O OG    . SER B  1 181 ? 11.327  5.712   -0.455  1.00 56.12  ? 209 SER B OG    1 
ATOM   4049  N N     . ILE B  1 182 ? 13.629  7.496   1.621   1.00 41.54  ? 210 ILE B N     1 
ATOM   4050  C CA    . ILE B  1 182 ? 13.711  8.452   2.730   1.00 38.54  ? 210 ILE B CA    1 
ATOM   4051  C C     . ILE B  1 182 ? 15.170  8.656   3.089   1.00 35.11  ? 210 ILE B C     1 
ATOM   4052  O O     . ILE B  1 182 ? 15.951  7.701   3.110   1.00 31.97  ? 210 ILE B O     1 
ATOM   4053  C CB    . ILE B  1 182 ? 12.904  7.980   3.964   1.00 38.80  ? 210 ILE B CB    1 
ATOM   4054  C CG1   . ILE B  1 182 ? 11.412  8.126   3.688   1.00 38.59  ? 210 ILE B CG1   1 
ATOM   4055  C CG2   . ILE B  1 182 ? 13.252  8.800   5.225   1.00 30.56  ? 210 ILE B CG2   1 
ATOM   4056  C CD1   . ILE B  1 182 ? 10.544  7.357   4.671   1.00 48.64  ? 210 ILE B CD1   1 
ATOM   4057  N N     . SER B  1 183 ? 15.555  9.907   3.341   1.00 31.99  ? 211 SER B N     1 
ATOM   4058  C CA    . SER B  1 183 ? 16.898  10.175  3.890   1.00 28.04  ? 211 SER B CA    1 
ATOM   4059  C C     . SER B  1 183 ? 16.847  10.961  5.225   1.00 27.89  ? 211 SER B C     1 
ATOM   4060  O O     . SER B  1 183 ? 15.825  11.600  5.552   1.00 26.44  ? 211 SER B O     1 
ATOM   4061  C CB    . SER B  1 183 ? 17.773  10.888  2.842   1.00 27.07  ? 211 SER B CB    1 
ATOM   4062  O OG    . SER B  1 183 ? 17.911  10.107  1.660   1.00 28.59  ? 211 SER B OG    1 
ATOM   4063  N N     . ALA B  1 184 ? 17.955  10.886  5.978   1.00 27.47  ? 212 ALA B N     1 
ATOM   4064  C CA    . ALA B  1 184 ? 18.162  11.608  7.241   1.00 28.33  ? 212 ALA B CA    1 
ATOM   4065  C C     . ALA B  1 184 ? 19.129  12.796  7.068   1.00 28.84  ? 212 ALA B C     1 
ATOM   4066  O O     . ALA B  1 184 ? 20.152  12.687  6.385   1.00 27.57  ? 212 ALA B O     1 
ATOM   4067  C CB    . ALA B  1 184 ? 18.706  10.645  8.331   1.00 25.10  ? 212 ALA B CB    1 
ATOM   4068  N N     . PHE B  1 185 ? 18.791  13.915  7.711   1.00 28.53  ? 213 PHE B N     1 
ATOM   4069  C CA    . PHE B  1 185 ? 19.529  15.178  7.574   1.00 28.49  ? 213 PHE B CA    1 
ATOM   4070  C C     . PHE B  1 185 ? 19.712  15.893  8.904   1.00 27.57  ? 213 PHE B C     1 
ATOM   4071  O O     . PHE B  1 185 ? 18.796  15.962  9.725   1.00 30.17  ? 213 PHE B O     1 
ATOM   4072  C CB    . PHE B  1 185 ? 18.787  16.145  6.641   1.00 28.91  ? 213 PHE B CB    1 
ATOM   4073  C CG    . PHE B  1 185 ? 18.601  15.624  5.257   1.00 32.48  ? 213 PHE B CG    1 
ATOM   4074  C CD1   . PHE B  1 185 ? 19.585  15.818  4.299   1.00 29.65  ? 213 PHE B CD1   1 
ATOM   4075  C CD2   . PHE B  1 185 ? 17.437  14.927  4.909   1.00 26.48  ? 213 PHE B CD2   1 
ATOM   4076  C CE1   . PHE B  1 185 ? 19.420  15.329  3.018   1.00 28.58  ? 213 PHE B CE1   1 
ATOM   4077  C CE2   . PHE B  1 185 ? 17.277  14.433  3.624   1.00 33.95  ? 213 PHE B CE2   1 
ATOM   4078  C CZ    . PHE B  1 185 ? 18.270  14.632  2.682   1.00 32.65  ? 213 PHE B CZ    1 
ATOM   4079  N N     . LEU B  1 186 ? 20.902  16.455  9.090   1.00 29.55  ? 214 LEU B N     1 
ATOM   4080  C CA    . LEU B  1 186 ? 21.192  17.303  10.231  1.00 27.98  ? 214 LEU B CA    1 
ATOM   4081  C C     . LEU B  1 186 ? 20.853  18.745  9.846   1.00 31.04  ? 214 LEU B C     1 
ATOM   4082  O O     . LEU B  1 186 ? 21.453  19.301  8.929   1.00 34.52  ? 214 LEU B O     1 
ATOM   4083  C CB    . LEU B  1 186 ? 22.667  17.141  10.639  1.00 27.02  ? 214 LEU B CB    1 
ATOM   4084  C CG    . LEU B  1 186 ? 23.105  15.692  10.869  1.00 28.49  ? 214 LEU B CG    1 
ATOM   4085  C CD1   . LEU B  1 186 ? 24.591  15.575  11.287  1.00 26.56  ? 214 LEU B CD1   1 
ATOM   4086  C CD2   . LEU B  1 186 ? 22.229  15.017  11.913  1.00 27.64  ? 214 LEU B CD2   1 
ATOM   4087  N N     . VAL B  1 187 ? 19.850  19.309  10.522  1.00 29.50  ? 215 VAL B N     1 
ATOM   4088  C CA    . VAL B  1 187 ? 19.360  20.668  10.296  1.00 27.46  ? 215 VAL B CA    1 
ATOM   4089  C C     . VAL B  1 187 ? 19.662  21.545  11.528  1.00 30.03  ? 215 VAL B C     1 
ATOM   4090  O O     . VAL B  1 187 ? 19.306  21.167  12.645  1.00 27.47  ? 215 VAL B O     1 
ATOM   4091  C CB    . VAL B  1 187 ? 17.823  20.676  10.067  1.00 29.14  ? 215 VAL B CB    1 
ATOM   4092  C CG1   . VAL B  1 187 ? 17.333  22.104  9.770   1.00 25.84  ? 215 VAL B CG1   1 
ATOM   4093  C CG2   . VAL B  1 187 ? 17.423  19.681  8.956   1.00 27.61  ? 215 VAL B CG2   1 
ATOM   4094  N N     . PRO B  1 188 ? 20.325  22.713  11.338  1.00 27.61  ? 216 PRO B N     1 
ATOM   4095  C CA    . PRO B  1 188 ? 20.570  23.578  12.497  1.00 25.53  ? 216 PRO B CA    1 
ATOM   4096  C C     . PRO B  1 188 ? 19.345  24.423  12.779  1.00 27.99  ? 216 PRO B C     1 
ATOM   4097  O O     . PRO B  1 188 ? 18.517  24.633  11.883  1.00 29.06  ? 216 PRO B O     1 
ATOM   4098  C CB    . PRO B  1 188 ? 21.762  24.449  12.055  1.00 33.05  ? 216 PRO B CB    1 
ATOM   4099  C CG    . PRO B  1 188 ? 21.776  24.408  10.536  1.00 32.88  ? 216 PRO B CG    1 
ATOM   4100  C CD    . PRO B  1 188 ? 20.832  23.302  10.080  1.00 29.84  ? 216 PRO B CD    1 
ATOM   4101  N N     . MET B  1 189 ? 19.211  24.867  14.017  1.00 27.18  ? 217 MET B N     1 
ATOM   4102  C CA    . MET B  1 189 ? 18.037  25.637  14.449  1.00 29.40  ? 217 MET B CA    1 
ATOM   4103  C C     . MET B  1 189 ? 18.546  26.798  15.312  1.00 27.60  ? 217 MET B C     1 
ATOM   4104  O O     . MET B  1 189 ? 19.288  26.570  16.257  1.00 32.37  ? 217 MET B O     1 
ATOM   4105  C CB    . MET B  1 189 ? 17.094  24.763  15.284  1.00 28.06  ? 217 MET B CB    1 
ATOM   4106  C CG    . MET B  1 189 ? 16.534  23.538  14.564  1.00 31.06  ? 217 MET B CG    1 
ATOM   4107  S SD    . MET B  1 189 ? 15.743  22.305  15.638  1.00 30.59  ? 217 MET B SD    1 
ATOM   4108  C CE    . MET B  1 189 ? 14.183  23.121  15.991  1.00 26.39  ? 217 MET B CE    1 
ATOM   4109  N N     . PRO B  1 190 ? 18.176  28.040  14.982  1.00 29.08  ? 218 PRO B N     1 
ATOM   4110  C CA    . PRO B  1 190 ? 17.328  28.465  13.855  1.00 28.69  ? 218 PRO B CA    1 
ATOM   4111  C C     . PRO B  1 190 ? 18.067  28.386  12.525  1.00 29.90  ? 218 PRO B C     1 
ATOM   4112  O O     . PRO B  1 190 ? 19.278  28.219  12.500  1.00 28.29  ? 218 PRO B O     1 
ATOM   4113  C CB    . PRO B  1 190 ? 17.006  29.924  14.182  1.00 30.20  ? 218 PRO B CB    1 
ATOM   4114  C CG    . PRO B  1 190 ? 18.211  30.392  14.965  1.00 31.72  ? 218 PRO B CG    1 
ATOM   4115  C CD    . PRO B  1 190 ? 18.655  29.190  15.776  1.00 31.92  ? 218 PRO B CD    1 
ATOM   4116  N N     . THR B  1 191 ? 17.327  28.510  11.435  1.00 29.44  ? 219 THR B N     1 
ATOM   4117  C CA    . THR B  1 191 ? 17.930  28.529  10.107  1.00 31.21  ? 219 THR B CA    1 
ATOM   4118  C C     . THR B  1 191 ? 16.981  29.202  9.123   1.00 29.82  ? 219 THR B C     1 
ATOM   4119  O O     . THR B  1 191 ? 15.771  29.158  9.309   1.00 28.44  ? 219 THR B O     1 
ATOM   4120  C CB    . THR B  1 191 ? 18.338  27.086  9.654   1.00 34.28  ? 219 THR B CB    1 
ATOM   4121  O OG1   . THR B  1 191 ? 19.514  27.157  8.841   1.00 34.36  ? 219 THR B OG1   1 
ATOM   4122  C CG2   . THR B  1 191 ? 17.191  26.353  8.924   1.00 27.95  ? 219 THR B CG2   1 
ATOM   4123  N N     . PRO B  1 192 ? 17.529  29.869  8.083   1.00 32.17  ? 220 PRO B N     1 
ATOM   4124  C CA    . PRO B  1 192 ? 16.597  30.443  7.107   1.00 31.92  ? 220 PRO B CA    1 
ATOM   4125  C C     . PRO B  1 192 ? 15.779  29.328  6.411   1.00 30.03  ? 220 PRO B C     1 
ATOM   4126  O O     . PRO B  1 192 ? 16.318  28.277  6.051   1.00 29.62  ? 220 PRO B O     1 
ATOM   4127  C CB    . PRO B  1 192 ? 17.505  31.200  6.122   1.00 29.27  ? 220 PRO B CB    1 
ATOM   4128  C CG    . PRO B  1 192 ? 18.858  31.273  6.796   1.00 30.88  ? 220 PRO B CG    1 
ATOM   4129  C CD    . PRO B  1 192 ? 18.934  30.112  7.733   1.00 31.65  ? 220 PRO B CD    1 
ATOM   4130  N N     . GLY B  1 193 ? 14.481  29.551  6.296   1.00 26.93  ? 221 GLY B N     1 
ATOM   4131  C CA    . GLY B  1 193 ? 13.594  28.592  5.657   1.00 31.71  ? 221 GLY B CA    1 
ATOM   4132  C C     . GLY B  1 193 ? 12.909  27.683  6.657   1.00 30.27  ? 221 GLY B C     1 
ATOM   4133  O O     . GLY B  1 193 ? 12.017  26.931  6.271   1.00 30.51  ? 221 GLY B O     1 
ATOM   4134  N N     . LEU B  1 194 ? 13.337  27.750  7.926   1.00 29.25  ? 222 LEU B N     1 
ATOM   4135  C CA    . LEU B  1 194 ? 12.705  27.005  9.030   1.00 31.15  ? 222 LEU B CA    1 
ATOM   4136  C C     . LEU B  1 194 ? 11.987  27.918  10.030  1.00 29.83  ? 222 LEU B C     1 
ATOM   4137  O O     . LEU B  1 194 ? 12.581  28.850  10.587  1.00 30.14  ? 222 LEU B O     1 
ATOM   4138  C CB    . LEU B  1 194 ? 13.764  26.184  9.761   1.00 31.31  ? 222 LEU B CB    1 
ATOM   4139  C CG    . LEU B  1 194 ? 13.307  25.428  11.020  1.00 34.53  ? 222 LEU B CG    1 
ATOM   4140  C CD1   . LEU B  1 194 ? 12.334  24.286  10.680  1.00 27.62  ? 222 LEU B CD1   1 
ATOM   4141  C CD2   . LEU B  1 194 ? 14.509  24.915  11.777  1.00 32.06  ? 222 LEU B CD2   1 
ATOM   4142  N N     . THR B  1 195 ? 10.704  27.646  10.255  1.00 23.79  ? 223 THR B N     1 
ATOM   4143  C CA    . THR B  1 195 ? 9.952   28.263  11.349  1.00 30.11  ? 223 THR B CA    1 
ATOM   4144  C C     . THR B  1 195 ? 9.261   27.205  12.204  1.00 27.38  ? 223 THR B C     1 
ATOM   4145  O O     . THR B  1 195 ? 9.111   26.063  11.782  1.00 25.41  ? 223 THR B O     1 
ATOM   4146  C CB    . THR B  1 195 ? 8.859   29.217  10.843  1.00 30.24  ? 223 THR B CB    1 
ATOM   4147  O OG1   . THR B  1 195 ? 7.964   28.508  9.976   1.00 32.58  ? 223 THR B OG1   1 
ATOM   4148  C CG2   . THR B  1 195 ? 9.482   30.411  10.093  1.00 34.85  ? 223 THR B CG2   1 
ATOM   4149  N N     . LEU B  1 196 ? 8.838   27.612  13.404  1.00 30.64  ? 224 LEU B N     1 
ATOM   4150  C CA    . LEU B  1 196 ? 8.219   26.705  14.382  1.00 29.23  ? 224 LEU B CA    1 
ATOM   4151  C C     . LEU B  1 196 ? 6.715   26.955  14.460  1.00 28.69  ? 224 LEU B C     1 
ATOM   4152  O O     . LEU B  1 196 ? 6.250   28.078  14.311  1.00 31.27  ? 224 LEU B O     1 
ATOM   4153  C CB    . LEU B  1 196 ? 8.870   26.846  15.765  1.00 30.49  ? 224 LEU B CB    1 
ATOM   4154  C CG    . LEU B  1 196 ? 10.397  26.648  15.814  1.00 30.10  ? 224 LEU B CG    1 
ATOM   4155  C CD1   . LEU B  1 196 ? 10.975  26.748  17.235  1.00 29.17  ? 224 LEU B CD1   1 
ATOM   4156  C CD2   . LEU B  1 196 ? 10.779  25.321  15.185  1.00 29.76  ? 224 LEU B CD2   1 
ATOM   4157  N N     . GLY B  1 197 ? 5.952   25.892  14.657  1.00 26.61  ? 225 GLY B N     1 
ATOM   4158  C CA    . GLY B  1 197 ? 4.518   26.046  14.923  1.00 29.02  ? 225 GLY B CA    1 
ATOM   4159  C C     . GLY B  1 197 ? 4.323   26.419  16.394  1.00 23.65  ? 225 GLY B C     1 
ATOM   4160  O O     . GLY B  1 197 ? 5.274   26.409  17.174  1.00 26.23  ? 225 GLY B O     1 
ATOM   4161  N N     . LYS B  1 198 ? 3.096   26.790  16.745  1.00 26.27  ? 226 LYS B N     1 
ATOM   4162  C CA    . LYS B  1 198 ? 2.695   27.002  18.125  1.00 30.96  ? 226 LYS B CA    1 
ATOM   4163  C C     . LYS B  1 198 ? 3.045   25.735  18.941  1.00 28.11  ? 226 LYS B C     1 
ATOM   4164  O O     . LYS B  1 198 ? 3.050   24.609  18.417  1.00 30.44  ? 226 LYS B O     1 
ATOM   4165  C CB    . LYS B  1 198 ? 1.179   27.313  18.196  1.00 31.41  ? 226 LYS B CB    1 
ATOM   4166  C CG    . LYS B  1 198 ? 0.659   27.770  19.578  1.00 40.37  ? 226 LYS B CG    1 
ATOM   4167  C CD    . LYS B  1 198 ? -0.883  27.798  19.666  1.00 41.08  ? 226 LYS B CD    1 
ATOM   4168  N N     . LYS B  1 199 ? 3.384   25.938  20.203  1.00 29.06  ? 227 LYS B N     1 
ATOM   4169  C CA    . LYS B  1 199 ? 3.530   24.832  21.160  1.00 27.20  ? 227 LYS B CA    1 
ATOM   4170  C C     . LYS B  1 199 ? 2.181   24.130  21.329  1.00 27.03  ? 227 LYS B C     1 
ATOM   4171  O O     . LYS B  1 199 ? 1.156   24.796  21.403  1.00 26.28  ? 227 LYS B O     1 
ATOM   4172  C CB    . LYS B  1 199 ? 3.969   25.363  22.524  1.00 26.84  ? 227 LYS B CB    1 
ATOM   4173  C CG    . LYS B  1 199 ? 5.444   25.724  22.639  1.00 29.73  ? 227 LYS B CG    1 
ATOM   4174  C CD    . LYS B  1 199 ? 5.737   26.384  23.984  1.00 32.37  ? 227 LYS B CD    1 
ATOM   4175  C CE    . LYS B  1 199 ? 7.173   26.855  24.060  1.00 40.03  ? 227 LYS B CE    1 
ATOM   4176  N NZ    . LYS B  1 199 ? 7.519   27.504  25.372  1.00 35.63  ? 227 LYS B NZ    1 
ATOM   4177  N N     . GLU B  1 200 ? 2.181   22.799  21.418  1.00 28.27  ? 228 GLU B N     1 
ATOM   4178  C CA    . GLU B  1 200 ? 0.942   22.051  21.694  1.00 28.23  ? 228 GLU B CA    1 
ATOM   4179  C C     . GLU B  1 200 ? 0.505   22.199  23.158  1.00 25.96  ? 228 GLU B C     1 
ATOM   4180  O O     . GLU B  1 200 ? 1.342   22.217  24.040  1.00 29.39  ? 228 GLU B O     1 
ATOM   4181  C CB    . GLU B  1 200 ? 1.141   20.564  21.400  1.00 26.96  ? 228 GLU B CB    1 
ATOM   4182  C CG    . GLU B  1 200 ? 1.577   20.231  19.970  1.00 30.11  ? 228 GLU B CG    1 
ATOM   4183  C CD    . GLU B  1 200 ? 0.445   20.333  18.957  1.00 38.54  ? 228 GLU B CD    1 
ATOM   4184  O OE1   . GLU B  1 200 ? -0.743  20.434  19.363  1.00 33.86  ? 228 GLU B OE1   1 
ATOM   4185  O OE2   . GLU B  1 200 ? 0.762   20.312  17.743  1.00 41.83  ? 228 GLU B OE2   1 
ATOM   4186  N N     . ASP B  1 201 ? -0.798  22.285  23.406  1.00 24.34  ? 229 ASP B N     1 
ATOM   4187  C CA    . ASP B  1 201 ? -1.345  22.301  24.755  1.00 25.69  ? 229 ASP B CA    1 
ATOM   4188  C C     . ASP B  1 201 ? -1.653  20.843  25.159  1.00 27.10  ? 229 ASP B C     1 
ATOM   4189  O O     . ASP B  1 201 ? -2.624  20.261  24.707  1.00 23.48  ? 229 ASP B O     1 
ATOM   4190  C CB    . ASP B  1 201 ? -2.599  23.167  24.761  1.00 26.20  ? 229 ASP B CB    1 
ATOM   4191  C CG    . ASP B  1 201 ? -3.212  23.339  26.141  1.00 26.07  ? 229 ASP B CG    1 
ATOM   4192  O OD1   . ASP B  1 201 ? -2.596  22.978  27.184  1.00 33.89  ? 229 ASP B OD1   1 
ATOM   4193  O OD2   . ASP B  1 201 ? -4.362  23.832  26.183  1.00 41.18  ? 229 ASP B OD2   1 
ATOM   4194  N N     . LYS B  1 202 ? -0.800  20.251  25.989  1.00 25.50  ? 230 LYS B N     1 
ATOM   4195  C CA    . LYS B  1 202 ? -0.844  18.806  26.231  1.00 24.00  ? 230 LYS B CA    1 
ATOM   4196  C C     . LYS B  1 202 ? -1.495  18.440  27.537  1.00 24.43  ? 230 LYS B C     1 
ATOM   4197  O O     . LYS B  1 202 ? -1.468  19.227  28.487  1.00 25.29  ? 230 LYS B O     1 
ATOM   4198  C CB    . LYS B  1 202 ? 0.563   18.209  26.201  1.00 21.11  ? 230 LYS B CB    1 
ATOM   4199  C CG    . LYS B  1 202 ? 1.257   18.349  24.876  1.00 26.37  ? 230 LYS B CG    1 
ATOM   4200  C CD    . LYS B  1 202 ? 2.564   17.560  24.765  1.00 25.51  ? 230 LYS B CD    1 
ATOM   4201  C CE    . LYS B  1 202 ? 3.635   17.995  25.738  1.00 26.47  ? 230 LYS B CE    1 
ATOM   4202  N NZ    . LYS B  1 202 ? 4.328   19.267  25.387  1.00 23.82  ? 230 LYS B NZ    1 
ATOM   4203  N N     . LEU B  1 203 ? -2.072  17.228  27.554  1.00 22.51  ? 231 LEU B N     1 
ATOM   4204  C CA    . LEU B  1 203 ? -2.578  16.553  28.737  1.00 22.62  ? 231 LEU B CA    1 
ATOM   4205  C C     . LEU B  1 203 ? -1.526  16.388  29.836  1.00 23.58  ? 231 LEU B C     1 
ATOM   4206  O O     . LEU B  1 203 ? -1.808  16.560  31.010  1.00 21.47  ? 231 LEU B O     1 
ATOM   4207  C CB    . LEU B  1 203 ? -3.120  15.159  28.359  1.00 23.50  ? 231 LEU B CB    1 
ATOM   4208  C CG    . LEU B  1 203 ? -3.740  14.307  29.490  1.00 25.98  ? 231 LEU B CG    1 
ATOM   4209  C CD1   . LEU B  1 203 ? -4.952  15.002  30.125  1.00 20.24  ? 231 LEU B CD1   1 
ATOM   4210  C CD2   . LEU B  1 203 ? -4.140  12.905  28.969  1.00 21.64  ? 231 LEU B CD2   1 
ATOM   4211  N N     . GLY B  1 204 ? -0.307  16.078  29.434  1.00 21.54  ? 232 GLY B N     1 
ATOM   4212  C CA    . GLY B  1 204 ? 0.751   15.836  30.375  1.00 21.27  ? 232 GLY B CA    1 
ATOM   4213  C C     . GLY B  1 204 ? 2.082   16.142  29.718  1.00 21.31  ? 232 GLY B C     1 
ATOM   4214  O O     . GLY B  1 204 ? 2.115   16.724  28.630  1.00 22.50  ? 232 GLY B O     1 
ATOM   4215  N N     . ILE B  1 205 ? 3.151   15.702  30.373  1.00 20.28  ? 233 ILE B N     1 
ATOM   4216  C CA    . ILE B  1 205 ? 4.566   16.051  30.032  1.00 23.51  ? 233 ILE B CA    1 
ATOM   4217  C C     . ILE B  1 205 ? 4.722   17.502  29.516  1.00 25.75  ? 233 ILE B C     1 
ATOM   4218  O O     . ILE B  1 205 ? 5.505   17.810  28.590  1.00 27.80  ? 233 ILE B O     1 
ATOM   4219  C CB    . ILE B  1 205 ? 5.268   14.983  29.103  1.00 24.19  ? 233 ILE B CB    1 
ATOM   4220  C CG1   . ILE B  1 205 ? 4.558   14.846  27.735  1.00 27.14  ? 233 ILE B CG1   1 
ATOM   4221  C CG2   . ILE B  1 205 ? 5.354   13.660  29.853  1.00 20.28  ? 233 ILE B CG2   1 
ATOM   4222  C CD1   . ILE B  1 205 ? 5.461   14.325  26.597  1.00 19.38  ? 233 ILE B CD1   1 
ATOM   4223  N N     . ARG B  1 206 ? 4.026   18.390  30.219  1.00 25.84  ? 234 ARG B N     1 
ATOM   4224  C CA    . ARG B  1 206 ? 3.801   19.756  29.771  1.00 27.30  ? 234 ARG B CA    1 
ATOM   4225  C C     . ARG B  1 206 ? 5.029   20.653  29.796  1.00 27.08  ? 234 ARG B C     1 
ATOM   4226  O O     . ARG B  1 206 ? 5.006   21.710  29.173  1.00 28.45  ? 234 ARG B O     1 
ATOM   4227  C CB    . ARG B  1 206 ? 2.708   20.405  30.595  1.00 24.15  ? 234 ARG B CB    1 
ATOM   4228  C CG    . ARG B  1 206 ? 1.390   19.667  30.567  1.00 23.75  ? 234 ARG B CG    1 
ATOM   4229  C CD    . ARG B  1 206 ? 0.442   20.334  31.510  1.00 26.66  ? 234 ARG B CD    1 
ATOM   4230  N NE    . ARG B  1 206 ? -0.872  19.727  31.428  1.00 41.11  ? 234 ARG B NE    1 
ATOM   4231  C CZ    . ARG B  1 206 ? -1.875  19.960  32.269  1.00 53.67  ? 234 ARG B CZ    1 
ATOM   4232  N NH1   . ARG B  1 206 ? -1.715  20.796  33.291  1.00 48.01  ? 234 ARG B NH1   1 
ATOM   4233  N NH2   . ARG B  1 206 ? -3.041  19.326  32.088  1.00 51.51  ? 234 ARG B NH2   1 
ATOM   4234  N N     . GLY B  1 207 ? 6.087   20.234  30.486  1.00 27.57  ? 235 GLY B N     1 
ATOM   4235  C CA    . GLY B  1 207 ? 7.331   20.982  30.530  1.00 27.77  ? 235 GLY B CA    1 
ATOM   4236  C C     . GLY B  1 207 ? 8.251   20.786  29.333  1.00 31.82  ? 235 GLY B C     1 
ATOM   4237  O O     . GLY B  1 207 ? 9.165   21.586  29.103  1.00 28.61  ? 235 GLY B O     1 
ATOM   4238  N N     . SER B  1 208 ? 8.067   19.699  28.588  1.00 30.24  ? 236 SER B N     1 
ATOM   4239  C CA    . SER B  1 208 ? 8.712   19.579  27.296  1.00 26.81  ? 236 SER B CA    1 
ATOM   4240  C C     . SER B  1 208 ? 7.882   20.385  26.309  1.00 27.45  ? 236 SER B C     1 
ATOM   4241  O O     . SER B  1 208 ? 6.677   20.494  26.458  1.00 27.17  ? 236 SER B O     1 
ATOM   4242  C CB    . SER B  1 208 ? 8.821   18.108  26.847  1.00 32.81  ? 236 SER B CB    1 
ATOM   4243  O OG    . SER B  1 208 ? 7.550   17.535  26.565  1.00 28.66  ? 236 SER B OG    1 
ATOM   4244  N N     . SER B  1 209 ? 8.544   20.981  25.332  1.00 24.94  ? 237 SER B N     1 
ATOM   4245  C CA    . SER B  1 209 ? 7.873   21.617  24.225  1.00 24.48  ? 237 SER B CA    1 
ATOM   4246  C C     . SER B  1 209 ? 7.640   20.570  23.112  1.00 25.22  ? 237 SER B C     1 
ATOM   4247  O O     . SER B  1 209 ? 8.463   19.648  22.893  1.00 24.74  ? 237 SER B O     1 
ATOM   4248  C CB    . SER B  1 209 ? 8.697   22.819  23.706  1.00 29.20  ? 237 SER B CB    1 
ATOM   4249  O OG    . SER B  1 209 ? 9.809   22.404  22.927  1.00 24.25  ? 237 SER B OG    1 
ATOM   4250  N N     . THR B  1 210 ? 6.488   20.700  22.459  1.00 26.81  ? 238 THR B N     1 
ATOM   4251  C CA    . THR B  1 210 ? 6.136   19.922  21.275  1.00 25.93  ? 238 THR B CA    1 
ATOM   4252  C C     . THR B  1 210 ? 5.544   20.899  20.249  1.00 23.00  ? 238 THR B C     1 
ATOM   4253  O O     . THR B  1 210 ? 4.673   21.704  20.579  1.00 26.74  ? 238 THR B O     1 
ATOM   4254  C CB    . THR B  1 210 ? 5.085   18.829  21.620  1.00 28.25  ? 238 THR B CB    1 
ATOM   4255  O OG1   . THR B  1 210 ? 5.362   18.289  22.917  1.00 33.86  ? 238 THR B OG1   1 
ATOM   4256  C CG2   . THR B  1 210 ? 5.075   17.687  20.559  1.00 22.05  ? 238 THR B CG2   1 
ATOM   4257  N N     . ALA B  1 211 ? 6.040   20.855  19.023  1.00 25.72  ? 239 ALA B N     1 
ATOM   4258  C CA    . ALA B  1 211 ? 5.551   21.754  17.949  1.00 27.56  ? 239 ALA B CA    1 
ATOM   4259  C C     . ALA B  1 211 ? 5.996   21.307  16.566  1.00 27.13  ? 239 ALA B C     1 
ATOM   4260  O O     . ALA B  1 211 ? 6.897   20.462  16.416  1.00 25.10  ? 239 ALA B O     1 
ATOM   4261  C CB    . ALA B  1 211 ? 6.011   23.183  18.183  1.00 25.03  ? 239 ALA B CB    1 
ATOM   4262  N N     . ASN B  1 212 ? 5.371   21.918  15.560  1.00 28.97  ? 240 ASN B N     1 
ATOM   4263  C CA    . ASN B  1 212 ? 5.709   21.668  14.166  1.00 27.94  ? 240 ASN B CA    1 
ATOM   4264  C C     . ASN B  1 212 ? 7.007   22.340  13.746  1.00 29.19  ? 240 ASN B C     1 
ATOM   4265  O O     . ASN B  1 212 ? 7.337   23.425  14.231  1.00 27.90  ? 240 ASN B O     1 
ATOM   4266  C CB    . ASN B  1 212 ? 4.580   22.130  13.259  1.00 28.96  ? 240 ASN B CB    1 
ATOM   4267  C CG    . ASN B  1 212 ? 3.371   21.221  13.329  1.00 25.49  ? 240 ASN B CG    1 
ATOM   4268  O OD1   . ASN B  1 212 ? 3.344   20.247  14.080  1.00 27.64  ? 240 ASN B OD1   1 
ATOM   4269  N ND2   . ASN B  1 212 ? 2.362   21.532  12.529  1.00 31.23  ? 240 ASN B ND2   1 
ATOM   4270  N N     . LEU B  1 213 ? 7.757   21.645  12.899  1.00 27.23  ? 241 LEU B N     1 
ATOM   4271  C CA    . LEU B  1 213 ? 8.852   22.236  12.118  1.00 28.35  ? 241 LEU B CA    1 
ATOM   4272  C C     . LEU B  1 213 ? 8.382   22.412  10.668  1.00 28.08  ? 241 LEU B C     1 
ATOM   4273  O O     . LEU B  1 213 ? 8.035   21.429  9.994   1.00 29.51  ? 241 LEU B O     1 
ATOM   4274  C CB    . LEU B  1 213 ? 10.085  21.333  12.108  1.00 27.35  ? 241 LEU B CB    1 
ATOM   4275  C CG    . LEU B  1 213 ? 10.767  20.943  13.427  1.00 34.28  ? 241 LEU B CG    1 
ATOM   4276  C CD1   . LEU B  1 213 ? 12.247  20.888  13.213  1.00 31.86  ? 241 LEU B CD1   1 
ATOM   4277  C CD2   . LEU B  1 213 ? 10.444  21.861  14.588  1.00 31.50  ? 241 LEU B CD2   1 
ATOM   4278  N N     . ILE B  1 214 ? 8.407   23.654  10.188  1.00 23.24  ? 242 ILE B N     1 
ATOM   4279  C CA    . ILE B  1 214 ? 7.865   24.033  8.873   1.00 26.06  ? 242 ILE B CA    1 
ATOM   4280  C C     . ILE B  1 214 ? 8.985   24.538  7.992   1.00 26.63  ? 242 ILE B C     1 
ATOM   4281  O O     . ILE B  1 214 ? 9.507   25.627  8.213   1.00 28.29  ? 242 ILE B O     1 
ATOM   4282  C CB    . ILE B  1 214 ? 6.817   25.139  9.016   1.00 25.18  ? 242 ILE B CB    1 
ATOM   4283  C CG1   . ILE B  1 214 ? 5.752   24.728  10.042  1.00 31.28  ? 242 ILE B CG1   1 
ATOM   4284  C CG2   . ILE B  1 214 ? 6.201   25.471  7.637   1.00 28.69  ? 242 ILE B CG2   1 
ATOM   4285  C CD1   . ILE B  1 214 ? 5.113   25.891  10.784  1.00 31.26  ? 242 ILE B CD1   1 
ATOM   4286  N N     . PHE B  1 215 ? 9.367   23.707  7.022   1.00 28.38  ? 243 PHE B N     1 
ATOM   4287  C CA    . PHE B  1 215 ? 10.411  24.017  6.060   1.00 28.76  ? 243 PHE B CA    1 
ATOM   4288  C C     . PHE B  1 215 ? 9.822   24.599  4.770   1.00 30.69  ? 243 PHE B C     1 
ATOM   4289  O O     . PHE B  1 215 ? 8.995   23.970  4.116   1.00 31.88  ? 243 PHE B O     1 
ATOM   4290  C CB    . PHE B  1 215 ? 11.194  22.745  5.738   1.00 26.27  ? 243 PHE B CB    1 
ATOM   4291  C CG    . PHE B  1 215 ? 11.859  22.122  6.945   1.00 31.49  ? 243 PHE B CG    1 
ATOM   4292  C CD1   . PHE B  1 215 ? 13.095  22.571  7.372   1.00 32.72  ? 243 PHE B CD1   1 
ATOM   4293  C CD2   . PHE B  1 215 ? 11.242  21.095  7.653   1.00 30.01  ? 243 PHE B CD2   1 
ATOM   4294  C CE1   . PHE B  1 215 ? 13.737  21.994  8.474   1.00 36.85  ? 243 PHE B CE1   1 
ATOM   4295  C CE2   . PHE B  1 215 ? 11.858  20.518  8.762   1.00 30.12  ? 243 PHE B CE2   1 
ATOM   4296  C CZ    . PHE B  1 215 ? 13.106  20.972  9.181   1.00 31.14  ? 243 PHE B CZ    1 
ATOM   4297  N N     . GLU B  1 216 ? 10.247  25.807  4.420   1.00 30.91  ? 244 GLU B N     1 
ATOM   4298  C CA    . GLU B  1 216 ? 9.862   26.453  3.165   1.00 32.38  ? 244 GLU B CA    1 
ATOM   4299  C C     . GLU B  1 216 ? 11.142  26.866  2.449   1.00 33.42  ? 244 GLU B C     1 
ATOM   4300  O O     . GLU B  1 216 ? 11.790  27.849  2.831   1.00 30.61  ? 244 GLU B O     1 
ATOM   4301  C CB    . GLU B  1 216 ? 9.000   27.683  3.441   1.00 33.35  ? 244 GLU B CB    1 
ATOM   4302  C CG    . GLU B  1 216 ? 8.390   28.342  2.190   1.00 44.59  ? 244 GLU B CG    1 
ATOM   4303  C CD    . GLU B  1 216 ? 7.455   29.528  2.523   1.00 49.75  ? 244 GLU B CD    1 
ATOM   4304  O OE1   . GLU B  1 216 ? 7.306   29.873  3.723   1.00 62.33  ? 244 GLU B OE1   1 
ATOM   4305  O OE2   . GLU B  1 216 ? 6.864   30.122  1.585   1.00 57.31  ? 244 GLU B OE2   1 
ATOM   4306  N N     . ASP B  1 217 ? 11.511  26.094  1.432   1.00 33.29  ? 245 ASP B N     1 
ATOM   4307  C CA    . ASP B  1 217 ? 12.757  26.310  0.689   1.00 34.23  ? 245 ASP B CA    1 
ATOM   4308  C C     . ASP B  1 217 ? 13.914  26.460  1.668   1.00 33.85  ? 245 ASP B C     1 
ATOM   4309  O O     . ASP B  1 217 ? 14.667  27.440  1.640   1.00 34.09  ? 245 ASP B O     1 
ATOM   4310  C CB    . ASP B  1 217 ? 12.649  27.553  -0.214  1.00 37.52  ? 245 ASP B CB    1 
ATOM   4311  C CG    . ASP B  1 217 ? 13.870  27.727  -1.124  1.00 51.50  ? 245 ASP B CG    1 
ATOM   4312  O OD1   . ASP B  1 217 ? 14.217  26.770  -1.851  1.00 63.34  ? 245 ASP B OD1   1 
ATOM   4313  O OD2   . ASP B  1 217 ? 14.485  28.819  -1.104  1.00 67.39  ? 245 ASP B OD2   1 
ATOM   4314  N N     . CYS B  1 218 ? 14.057  25.483  2.544   1.00 32.64  ? 246 CYS B N     1 
ATOM   4315  C CA    . CYS B  1 218 ? 15.095  25.540  3.552   1.00 29.31  ? 246 CYS B CA    1 
ATOM   4316  C C     . CYS B  1 218 ? 16.385  24.924  3.008   1.00 28.74  ? 246 CYS B C     1 
ATOM   4317  O O     . CYS B  1 218 ? 16.452  23.729  2.732   1.00 31.27  ? 246 CYS B O     1 
ATOM   4318  C CB    . CYS B  1 218 ? 14.598  24.827  4.807   1.00 29.08  ? 246 CYS B CB    1 
ATOM   4319  S SG    . CYS B  1 218 ? 15.765  24.738  6.149   1.00 32.46  ? 246 CYS B SG    1 
ATOM   4320  N N     . ARG B  1 219 ? 17.442  25.724  2.895   1.00 31.99  ? 247 ARG B N     1 
ATOM   4321  C CA    . ARG B  1 219 ? 18.681  25.249  2.281   1.00 30.57  ? 247 ARG B CA    1 
ATOM   4322  C C     . ARG B  1 219 ? 19.737  24.842  3.296   1.00 30.19  ? 247 ARG B C     1 
ATOM   4323  O O     . ARG B  1 219 ? 20.082  25.621  4.188   1.00 33.14  ? 247 ARG B O     1 
ATOM   4324  C CB    . ARG B  1 219 ? 19.230  26.320  1.327   1.00 32.91  ? 247 ARG B CB    1 
ATOM   4325  C CG    . ARG B  1 219 ? 18.264  26.647  0.197   1.00 44.76  ? 247 ARG B CG    1 
ATOM   4326  C CD    . ARG B  1 219 ? 18.843  27.625  -0.805  1.00 60.70  ? 247 ARG B CD    1 
ATOM   4327  N NE    . ARG B  1 219 ? 18.242  27.432  -2.124  1.00 64.35  ? 247 ARG B NE    1 
ATOM   4328  C CZ    . ARG B  1 219 ? 18.791  26.748  -3.129  1.00 66.66  ? 247 ARG B CZ    1 
ATOM   4329  N NH1   . ARG B  1 219 ? 18.131  26.648  -4.278  1.00 75.14  ? 247 ARG B NH1   1 
ATOM   4330  N NH2   . ARG B  1 219 ? 19.988  26.169  -3.010  1.00 53.98  ? 247 ARG B NH2   1 
ATOM   4331  N N     . ILE B  1 220 ? 20.254  23.627  3.152   1.00 30.61  ? 248 ILE B N     1 
ATOM   4332  C CA    . ILE B  1 220 ? 21.336  23.128  4.006   1.00 28.82  ? 248 ILE B CA    1 
ATOM   4333  C C     . ILE B  1 220 ? 22.437  22.513  3.151   1.00 28.85  ? 248 ILE B C     1 
ATOM   4334  O O     . ILE B  1 220 ? 22.177  22.002  2.073   1.00 33.27  ? 248 ILE B O     1 
ATOM   4335  C CB    . ILE B  1 220 ? 20.823  22.096  5.080   1.00 30.19  ? 248 ILE B CB    1 
ATOM   4336  C CG1   . ILE B  1 220 ? 20.458  20.754  4.447   1.00 28.89  ? 248 ILE B CG1   1 
ATOM   4337  C CG2   . ILE B  1 220 ? 19.620  22.678  5.885   1.00 27.12  ? 248 ILE B CG2   1 
ATOM   4338  C CD1   . ILE B  1 220 ? 19.833  19.768  5.396   1.00 32.04  ? 248 ILE B CD1   1 
ATOM   4339  N N     . PRO B  1 221 ? 23.678  22.531  3.648   1.00 30.52  ? 249 PRO B N     1 
ATOM   4340  C CA    . PRO B  1 221 ? 24.778  22.013  2.832   1.00 31.84  ? 249 PRO B CA    1 
ATOM   4341  C C     . PRO B  1 221 ? 24.690  20.521  2.517   1.00 32.74  ? 249 PRO B C     1 
ATOM   4342  O O     . PRO B  1 221 ? 24.070  19.755  3.277   1.00 33.12  ? 249 PRO B O     1 
ATOM   4343  C CB    . PRO B  1 221 ? 26.029  22.318  3.672   1.00 32.17  ? 249 PRO B CB    1 
ATOM   4344  C CG    . PRO B  1 221 ? 25.547  22.526  5.055   1.00 34.14  ? 249 PRO B CG    1 
ATOM   4345  C CD    . PRO B  1 221 ? 24.128  23.031  4.959   1.00 28.29  ? 249 PRO B CD    1 
ATOM   4346  N N     . LYS B  1 222 ? 25.318  20.113  1.406   1.00 32.66  ? 250 LYS B N     1 
ATOM   4347  C CA    . LYS B  1 222 ? 25.211  18.734  0.904   1.00 32.96  ? 250 LYS B CA    1 
ATOM   4348  C C     . LYS B  1 222 ? 25.734  17.722  1.922   1.00 31.63  ? 250 LYS B C     1 
ATOM   4349  O O     . LYS B  1 222 ? 25.211  16.612  2.041   1.00 35.69  ? 250 LYS B O     1 
ATOM   4350  C CB    . LYS B  1 222 ? 25.938  18.572  -0.442  1.00 34.43  ? 250 LYS B CB    1 
ATOM   4351  N N     . ASP B  1 223 ? 26.739  18.123  2.687   1.00 32.23  ? 251 ASP B N     1 
ATOM   4352  C CA    . ASP B  1 223 ? 27.287  17.285  3.759   1.00 32.57  ? 251 ASP B CA    1 
ATOM   4353  C C     . ASP B  1 223 ? 26.360  17.079  4.984   1.00 31.74  ? 251 ASP B C     1 
ATOM   4354  O O     . ASP B  1 223 ? 26.715  16.352  5.912   1.00 34.83  ? 251 ASP B O     1 
ATOM   4355  C CB    . ASP B  1 223 ? 28.635  17.856  4.207   1.00 36.60  ? 251 ASP B CB    1 
ATOM   4356  C CG    . ASP B  1 223 ? 28.522  19.293  4.718   1.00 45.91  ? 251 ASP B CG    1 
ATOM   4357  O OD1   . ASP B  1 223 ? 29.093  20.202  4.073   1.00 56.54  ? 251 ASP B OD1   1 
ATOM   4358  O OD2   . ASP B  1 223 ? 27.839  19.522  5.753   1.00 57.01  ? 251 ASP B OD2   1 
ATOM   4359  N N     . SER B  1 224 ? 25.195  17.731  4.992   1.00 30.82  ? 252 SER B N     1 
ATOM   4360  C CA    . SER B  1 224 ? 24.179  17.532  6.030   1.00 31.00  ? 252 SER B CA    1 
ATOM   4361  C C     . SER B  1 224 ? 23.511  16.153  6.047   1.00 33.20  ? 252 SER B C     1 
ATOM   4362  O O     . SER B  1 224 ? 22.904  15.781  7.061   1.00 32.77  ? 252 SER B O     1 
ATOM   4363  C CB    . SER B  1 224 ? 23.073  18.597  5.908   1.00 31.64  ? 252 SER B CB    1 
ATOM   4364  O OG    . SER B  1 224 ? 23.595  19.907  6.082   1.00 36.65  ? 252 SER B OG    1 
ATOM   4365  N N     . ILE B  1 225 ? 23.601  15.393  4.954   1.00 32.47  ? 253 ILE B N     1 
ATOM   4366  C CA    . ILE B  1 225 ? 22.936  14.094  4.930   1.00 31.02  ? 253 ILE B CA    1 
ATOM   4367  C C     . ILE B  1 225 ? 23.641  13.156  5.905   1.00 30.61  ? 253 ILE B C     1 
ATOM   4368  O O     . ILE B  1 225 ? 24.878  13.162  6.008   1.00 30.45  ? 253 ILE B O     1 
ATOM   4369  C CB    . ILE B  1 225 ? 22.819  13.498  3.485   1.00 31.91  ? 253 ILE B CB    1 
ATOM   4370  C CG1   . ILE B  1 225 ? 21.912  12.258  3.470   1.00 29.38  ? 253 ILE B CG1   1 
ATOM   4371  C CG2   . ILE B  1 225 ? 24.194  13.174  2.897   1.00 30.68  ? 253 ILE B CG2   1 
ATOM   4372  C CD1   . ILE B  1 225 ? 21.641  11.711  2.049   1.00 31.35  ? 253 ILE B CD1   1 
ATOM   4373  N N     . LEU B  1 226 ? 22.834  12.405  6.664   1.00 30.44  ? 254 LEU B N     1 
ATOM   4374  C CA    . LEU B  1 226 ? 23.324  11.426  7.643   1.00 31.23  ? 254 LEU B CA    1 
ATOM   4375  C C     . LEU B  1 226 ? 23.213  10.038  7.013   1.00 30.64  ? 254 LEU B C     1 
ATOM   4376  O O     . LEU B  1 226 ? 22.115  9.601   6.647   1.00 35.58  ? 254 LEU B O     1 
ATOM   4377  C CB    . LEU B  1 226 ? 22.506  11.514  8.949   1.00 32.17  ? 254 LEU B CB    1 
ATOM   4378  C CG    . LEU B  1 226 ? 22.919  10.634  10.129  1.00 33.33  ? 254 LEU B CG    1 
ATOM   4379  C CD1   . LEU B  1 226 ? 24.402  10.860  10.516  1.00 28.97  ? 254 LEU B CD1   1 
ATOM   4380  C CD2   . LEU B  1 226 ? 22.000  10.913  11.306  1.00 32.19  ? 254 LEU B CD2   1 
ATOM   4381  N N     . GLY B  1 227 ? 24.340  9.348   6.876   1.00 30.14  ? 255 GLY B N     1 
ATOM   4382  C CA    . GLY B  1 227 ? 24.392  8.123   6.068   1.00 32.97  ? 255 GLY B CA    1 
ATOM   4383  C C     . GLY B  1 227 ? 24.239  8.399   4.570   1.00 36.50  ? 255 GLY B C     1 
ATOM   4384  O O     . GLY B  1 227 ? 24.367  9.549   4.113   1.00 35.28  ? 255 GLY B O     1 
ATOM   4385  N N     . GLU B  1 228 ? 23.948  7.339   3.812   1.00 38.90  ? 256 GLU B N     1 
ATOM   4386  C CA    . GLU B  1 228 ? 23.738  7.420   2.363   1.00 36.06  ? 256 GLU B CA    1 
ATOM   4387  C C     . GLU B  1 228 ? 22.281  7.753   2.013   1.00 36.32  ? 256 GLU B C     1 
ATOM   4388  O O     . GLU B  1 228 ? 21.357  7.471   2.804   1.00 32.76  ? 256 GLU B O     1 
ATOM   4389  C CB    . GLU B  1 228 ? 24.143  6.101   1.707   1.00 39.51  ? 256 GLU B CB    1 
ATOM   4390  N N     . PRO B  1 229 ? 22.061  8.341   0.822   1.00 35.89  ? 257 PRO B N     1 
ATOM   4391  C CA    . PRO B  1 229 ? 20.676  8.594   0.411   1.00 36.25  ? 257 PRO B CA    1 
ATOM   4392  C C     . PRO B  1 229 ? 19.875  7.302   0.392   1.00 33.17  ? 257 PRO B C     1 
ATOM   4393  O O     . PRO B  1 229 ? 20.394  6.254   0.008   1.00 32.97  ? 257 PRO B O     1 
ATOM   4394  C CB    . PRO B  1 229 ? 20.806  9.177   -1.002  1.00 35.49  ? 257 PRO B CB    1 
ATOM   4395  C CG    . PRO B  1 229 ? 22.223  9.574   -1.150  1.00 37.41  ? 257 PRO B CG    1 
ATOM   4396  C CD    . PRO B  1 229 ? 23.036  8.768   -0.201  1.00 36.16  ? 257 PRO B CD    1 
ATOM   4397  N N     . GLY B  1 230 ? 18.630  7.374   0.841   1.00 33.24  ? 258 GLY B N     1 
ATOM   4398  C CA    . GLY B  1 230 ? 17.775  6.208   0.901   1.00 32.86  ? 258 GLY B CA    1 
ATOM   4399  C C     . GLY B  1 230 ? 17.818  5.413   2.196   1.00 32.81  ? 258 GLY B C     1 
ATOM   4400  O O     . GLY B  1 230 ? 16.926  4.596   2.431   1.00 39.28  ? 258 GLY B O     1 
ATOM   4401  N N     . MET B  1 231 ? 18.830  5.645   3.035   1.00 33.03  ? 259 MET B N     1 
ATOM   4402  C CA    . MET B  1 231 ? 18.988  4.955   4.333   1.00 33.92  ? 259 MET B CA    1 
ATOM   4403  C C     . MET B  1 231 ? 18.049  5.482   5.439   1.00 29.24  ? 259 MET B C     1 
ATOM   4404  O O     . MET B  1 231 ? 17.997  4.912   6.518   1.00 33.72  ? 259 MET B O     1 
ATOM   4405  C CB    . MET B  1 231 ? 20.425  5.114   4.857   1.00 34.09  ? 259 MET B CB    1 
ATOM   4406  C CG    . MET B  1 231 ? 21.478  4.219   4.244   1.00 40.27  ? 259 MET B CG    1 
ATOM   4407  S SD    . MET B  1 231 ? 23.136  4.617   4.919   1.00 54.49  ? 259 MET B SD    1 
ATOM   4408  C CE    . MET B  1 231 ? 24.065  3.144   4.449   1.00 46.32  ? 259 MET B CE    1 
ATOM   4409  N N     . GLY B  1 232 ? 17.334  6.571   5.173   1.00 28.61  ? 260 GLY B N     1 
ATOM   4410  C CA    . GLY B  1 232 ? 16.546  7.259   6.202   1.00 29.73  ? 260 GLY B CA    1 
ATOM   4411  C C     . GLY B  1 232 ? 15.591  6.400   7.021   1.00 29.07  ? 260 GLY B C     1 
ATOM   4412  O O     . GLY B  1 232 ? 15.558  6.518   8.241   1.00 27.04  ? 260 GLY B O     1 
ATOM   4413  N N     . PHE B  1 233 ? 14.810  5.542   6.364   1.00 30.29  ? 261 PHE B N     1 
ATOM   4414  C CA    . PHE B  1 233 ? 13.790  4.752   7.073   1.00 29.52  ? 261 PHE B CA    1 
ATOM   4415  C C     . PHE B  1 233 ? 14.442  3.747   8.015   1.00 30.04  ? 261 PHE B C     1 
ATOM   4416  O O     . PHE B  1 233 ? 13.992  3.558   9.139   1.00 29.90  ? 261 PHE B O     1 
ATOM   4417  C CB    . PHE B  1 233 ? 12.841  4.046   6.102   1.00 30.54  ? 261 PHE B CB    1 
ATOM   4418  C CG    . PHE B  1 233 ? 11.681  3.361   6.775   1.00 31.67  ? 261 PHE B CG    1 
ATOM   4419  C CD1   . PHE B  1 233 ? 10.583  4.085   7.197   1.00 40.14  ? 261 PHE B CD1   1 
ATOM   4420  C CD2   . PHE B  1 233 ? 11.688  1.980   6.973   1.00 36.05  ? 261 PHE B CD2   1 
ATOM   4421  C CE1   . PHE B  1 233 ? 9.510   3.449   7.812   1.00 43.49  ? 261 PHE B CE1   1 
ATOM   4422  C CE2   . PHE B  1 233 ? 10.621  1.341   7.592   1.00 38.06  ? 261 PHE B CE2   1 
ATOM   4423  C CZ    . PHE B  1 233 ? 9.540   2.076   8.017   1.00 37.95  ? 261 PHE B CZ    1 
ATOM   4424  N N     . LYS B  1 234 ? 15.504  3.104   7.559   1.00 27.64  ? 262 LYS B N     1 
ATOM   4425  C CA    . LYS B  1 234 ? 16.265  2.210   8.419   1.00 31.88  ? 262 LYS B CA    1 
ATOM   4426  C C     . LYS B  1 234 ? 16.923  2.965   9.607   1.00 29.98  ? 262 LYS B C     1 
ATOM   4427  O O     . LYS B  1 234 ? 16.944  2.457   10.728  1.00 27.96  ? 262 LYS B O     1 
ATOM   4428  C CB    . LYS B  1 234 ? 17.307  1.457   7.567   1.00 30.27  ? 262 LYS B CB    1 
ATOM   4429  C CG    . LYS B  1 234 ? 18.293  0.569   8.340   1.00 50.12  ? 262 LYS B CG    1 
ATOM   4430  C CD    . LYS B  1 234 ? 19.494  0.162   7.455   1.00 45.66  ? 262 LYS B CD    1 
ATOM   4431  C CE    . LYS B  1 234 ? 20.327  -0.978  8.068   1.00 56.55  ? 262 LYS B CE    1 
ATOM   4432  N NZ    . LYS B  1 234 ? 21.172  -1.683  7.057   1.00 62.63  ? 262 LYS B NZ    1 
ATOM   4433  N N     . ILE B  1 235 ? 17.487  4.148   9.351   1.00 29.23  ? 263 ILE B N     1 
ATOM   4434  C CA    . ILE B  1 235 ? 18.138  4.950   10.400  1.00 25.79  ? 263 ILE B CA    1 
ATOM   4435  C C     . ILE B  1 235 ? 17.064  5.324   11.461  1.00 29.55  ? 263 ILE B C     1 
ATOM   4436  O O     . ILE B  1 235 ? 17.285  5.166   12.675  1.00 28.08  ? 263 ILE B O     1 
ATOM   4437  C CB    . ILE B  1 235 ? 18.869  6.198   9.791   1.00 25.48  ? 263 ILE B CB    1 
ATOM   4438  C CG1   . ILE B  1 235 ? 20.140  5.770   9.053   1.00 27.28  ? 263 ILE B CG1   1 
ATOM   4439  C CG2   . ILE B  1 235 ? 19.256  7.223   10.849  1.00 19.82  ? 263 ILE B CG2   1 
ATOM   4440  C CD1   . ILE B  1 235 ? 20.847  6.944   8.326   1.00 26.15  ? 263 ILE B CD1   1 
ATOM   4441  N N     . ALA B  1 236 ? 15.893  5.745   10.977  1.00 26.11  ? 264 ALA B N     1 
ATOM   4442  C CA    . ALA B  1 236 ? 14.760  6.080   11.827  1.00 27.70  ? 264 ALA B CA    1 
ATOM   4443  C C     . ALA B  1 236 ? 14.298  4.881   12.653  1.00 29.62  ? 264 ALA B C     1 
ATOM   4444  O O     . ALA B  1 236 ? 14.030  5.012   13.860  1.00 26.24  ? 264 ALA B O     1 
ATOM   4445  C CB    . ALA B  1 236 ? 13.593  6.645   10.996  1.00 24.61  ? 264 ALA B CB    1 
ATOM   4446  N N     . MET B  1 237 ? 14.225  3.712   12.022  1.00 27.68  ? 265 MET B N     1 
ATOM   4447  C CA    . MET B  1 237 ? 13.783  2.514   12.730  1.00 31.95  ? 265 MET B CA    1 
ATOM   4448  C C     . MET B  1 237 ? 14.794  2.044   13.755  1.00 26.56  ? 265 MET B C     1 
ATOM   4449  O O     . MET B  1 237 ? 14.425  1.671   14.847  1.00 25.42  ? 265 MET B O     1 
ATOM   4450  C CB    . MET B  1 237 ? 13.428  1.387   11.765  1.00 32.81  ? 265 MET B CB    1 
ATOM   4451  C CG    . MET B  1 237 ? 12.222  1.678   10.876  1.00 33.98  ? 265 MET B CG    1 
ATOM   4452  S SD    . MET B  1 237 ? 10.633  1.977   11.694  1.00 42.68  ? 265 MET B SD    1 
ATOM   4453  C CE    . MET B  1 237 ? 10.450  3.742   11.553  1.00 35.39  ? 265 MET B CE    1 
ATOM   4454  N N     . GLN B  1 238 ? 16.081  2.079   13.432  1.00 28.96  ? 266 GLN B N     1 
ATOM   4455  C CA    . GLN B  1 238 ? 17.076  1.681   14.402  1.00 25.61  ? 266 GLN B CA    1 
ATOM   4456  C C     . GLN B  1 238 ? 17.186  2.703   15.537  1.00 27.36  ? 266 GLN B C     1 
ATOM   4457  O O     . GLN B  1 238 ? 17.585  2.349   16.649  1.00 28.37  ? 266 GLN B O     1 
ATOM   4458  C CB    . GLN B  1 238 ? 18.443  1.435   13.734  1.00 27.94  ? 266 GLN B CB    1 
ATOM   4459  C CG    . GLN B  1 238 ? 18.455  0.139   12.948  1.00 32.33  ? 266 GLN B CG    1 
ATOM   4460  C CD    . GLN B  1 238 ? 19.694  -0.059  12.099  1.00 37.62  ? 266 GLN B CD    1 
ATOM   4461  O OE1   . GLN B  1 238 ? 20.787  0.392   12.439  1.00 44.84  ? 266 GLN B OE1   1 
ATOM   4462  N NE2   . GLN B  1 238 ? 19.528  -0.752  10.983  1.00 50.83  ? 266 GLN B NE2   1 
ATOM   4463  N N     . THR B  1 239 ? 16.796  3.955   15.276  1.00 28.74  ? 267 THR B N     1 
ATOM   4464  C CA    . THR B  1 239 ? 16.862  4.995   16.307  1.00 30.00  ? 267 THR B CA    1 
ATOM   4465  C C     . THR B  1 239 ? 15.746  4.752   17.331  1.00 27.37  ? 267 THR B C     1 
ATOM   4466  O O     . THR B  1 239 ? 15.971  4.820   18.538  1.00 26.36  ? 267 THR B O     1 
ATOM   4467  C CB    . THR B  1 239 ? 16.792  6.410   15.688  1.00 26.19  ? 267 THR B CB    1 
ATOM   4468  O OG1   . THR B  1 239 ? 17.927  6.585   14.827  1.00 29.10  ? 267 THR B OG1   1 
ATOM   4469  C CG2   . THR B  1 239 ? 16.830  7.486   16.750  1.00 26.67  ? 267 THR B CG2   1 
ATOM   4470  N N     . LEU B  1 240 ? 14.572  4.406   16.825  1.00 25.35  ? 268 LEU B N     1 
ATOM   4471  C CA    . LEU B  1 240 ? 13.380  4.220   17.644  1.00 29.16  ? 268 LEU B CA    1 
ATOM   4472  C C     . LEU B  1 240 ? 13.419  2.966   18.497  1.00 27.77  ? 268 LEU B C     1 
ATOM   4473  O O     . LEU B  1 240 ? 12.724  2.906   19.520  1.00 28.19  ? 268 LEU B O     1 
ATOM   4474  C CB    . LEU B  1 240 ? 12.121  4.227   16.782  1.00 26.91  ? 268 LEU B CB    1 
ATOM   4475  C CG    . LEU B  1 240 ? 11.691  5.575   16.174  1.00 33.75  ? 268 LEU B CG    1 
ATOM   4476  C CD1   . LEU B  1 240 ? 10.540  5.347   15.197  1.00 29.16  ? 268 LEU B CD1   1 
ATOM   4477  C CD2   . LEU B  1 240 ? 11.307  6.619   17.244  1.00 32.08  ? 268 LEU B CD2   1 
ATOM   4478  N N     . ASP B  1 241 ? 14.207  1.976   18.078  1.00 28.22  ? 269 ASP B N     1 
ATOM   4479  C CA    . ASP B  1 241 ? 14.559  0.825   18.929  1.00 31.64  ? 269 ASP B CA    1 
ATOM   4480  C C     . ASP B  1 241 ? 15.293  1.256   20.205  1.00 30.77  ? 269 ASP B C     1 
ATOM   4481  O O     . ASP B  1 241 ? 14.993  0.755   21.292  1.00 28.51  ? 269 ASP B O     1 
ATOM   4482  C CB    . ASP B  1 241 ? 15.471  -0.166  18.191  1.00 26.72  ? 269 ASP B CB    1 
ATOM   4483  C CG    . ASP B  1 241 ? 14.812  -0.805  16.975  1.00 40.99  ? 269 ASP B CG    1 
ATOM   4484  O OD1   . ASP B  1 241 ? 13.566  -0.876  16.914  1.00 36.42  ? 269 ASP B OD1   1 
ATOM   4485  O OD2   . ASP B  1 241 ? 15.564  -1.239  16.068  1.00 40.06  ? 269 ASP B OD2   1 
ATOM   4486  N N     . MET B  1 242 ? 16.285  2.134   20.053  1.00 30.34  ? 270 MET B N     1 
ATOM   4487  C CA    . MET B  1 242 ? 17.010  2.714   21.195  1.00 33.14  ? 270 MET B CA    1 
ATOM   4488  C C     . MET B  1 242 ? 16.100  3.624   22.020  1.00 27.92  ? 270 MET B C     1 
ATOM   4489  O O     . MET B  1 242 ? 16.035  3.507   23.237  1.00 31.11  ? 270 MET B O     1 
ATOM   4490  C CB    . MET B  1 242 ? 18.230  3.515   20.720  1.00 32.83  ? 270 MET B CB    1 
ATOM   4491  C CG    . MET B  1 242 ? 19.306  2.680   20.059  1.00 40.86  ? 270 MET B CG    1 
ATOM   4492  S SD    . MET B  1 242 ? 20.756  3.686   19.647  1.00 44.64  ? 270 MET B SD    1 
ATOM   4493  C CE    . MET B  1 242 ? 20.319  4.421   18.049  1.00 33.21  ? 270 MET B CE    1 
ATOM   4494  N N     . GLY B  1 243 ? 15.390  4.517   21.339  1.00 26.23  ? 271 GLY B N     1 
ATOM   4495  C CA    . GLY B  1 243 ? 14.438  5.401   21.964  1.00 27.17  ? 271 GLY B CA    1 
ATOM   4496  C C     . GLY B  1 243 ? 13.409  4.665   22.808  1.00 28.02  ? 271 GLY B C     1 
ATOM   4497  O O     . GLY B  1 243 ? 13.004  5.140   23.873  1.00 28.54  ? 271 GLY B O     1 
ATOM   4498  N N     . ARG B  1 244 ? 12.984  3.498   22.342  1.00 28.51  ? 272 ARG B N     1 
ATOM   4499  C CA    . ARG B  1 244 ? 11.989  2.706   23.071  1.00 25.92  ? 272 ARG B CA    1 
ATOM   4500  C C     . ARG B  1 244 ? 12.443  2.217   24.454  1.00 21.34  ? 272 ARG B C     1 
ATOM   4501  O O     . ARG B  1 244 ? 11.627  2.105   25.377  1.00 24.04  ? 272 ARG B O     1 
ATOM   4502  C CB    . ARG B  1 244 ? 11.504  1.527   22.191  1.00 26.58  ? 272 ARG B CB    1 
ATOM   4503  C CG    . ARG B  1 244 ? 10.390  1.935   21.239  1.00 28.93  ? 272 ARG B CG    1 
ATOM   4504  C CD    . ARG B  1 244 ? 10.297  1.037   20.005  1.00 29.61  ? 272 ARG B CD    1 
ATOM   4505  N NE    . ARG B  1 244 ? 9.507   1.671   18.947  1.00 28.86  ? 272 ARG B NE    1 
ATOM   4506  C CZ    . ARG B  1 244 ? 9.217   1.106   17.776  1.00 31.89  ? 272 ARG B CZ    1 
ATOM   4507  N NH1   . ARG B  1 244 ? 9.653   -0.105  17.471  1.00 30.53  ? 272 ARG B NH1   1 
ATOM   4508  N NH2   . ARG B  1 244 ? 8.512   1.777   16.882  1.00 33.51  ? 272 ARG B NH2   1 
ATOM   4509  N N     . ILE B  1 245 ? 13.740  1.923   24.581  1.00 25.59  ? 273 ILE B N     1 
ATOM   4510  C CA    . ILE B  1 245 ? 14.339  1.575   25.853  1.00 25.30  ? 273 ILE B CA    1 
ATOM   4511  C C     . ILE B  1 245 ? 14.258  2.785   26.794  1.00 28.55  ? 273 ILE B C     1 
ATOM   4512  O O     . ILE B  1 245 ? 13.962  2.634   27.979  1.00 25.65  ? 273 ILE B O     1 
ATOM   4513  C CB    . ILE B  1 245 ? 15.825  1.095   25.699  1.00 26.02  ? 273 ILE B CB    1 
ATOM   4514  C CG1   . ILE B  1 245 ? 15.928  -0.168  24.828  1.00 25.84  ? 273 ILE B CG1   1 
ATOM   4515  C CG2   . ILE B  1 245 ? 16.443  0.817   27.078  1.00 29.73  ? 273 ILE B CG2   1 
ATOM   4516  C CD1   . ILE B  1 245 ? 17.420  -0.609  24.559  1.00 24.71  ? 273 ILE B CD1   1 
ATOM   4517  N N     . GLY B  1 246 ? 14.507  3.968   26.232  1.00 29.99  ? 274 GLY B N     1 
ATOM   4518  C CA    . GLY B  1 246 ? 14.404  5.227   26.940  1.00 27.56  ? 274 GLY B CA    1 
ATOM   4519  C C     . GLY B  1 246 ? 13.011  5.540   27.441  1.00 22.73  ? 274 GLY B C     1 
ATOM   4520  O O     . GLY B  1 246 ? 12.843  5.930   28.615  1.00 27.24  ? 274 GLY B O     1 
ATOM   4521  N N     . ILE B  1 247 ? 12.016  5.390   26.567  1.00 23.48  ? 275 ILE B N     1 
ATOM   4522  C CA    . ILE B  1 247 ? 10.613  5.615   26.958  1.00 22.87  ? 275 ILE B CA    1 
ATOM   4523  C C     . ILE B  1 247 ? 10.112  4.559   27.964  1.00 21.68  ? 275 ILE B C     1 
ATOM   4524  O O     . ILE B  1 247 ? 9.449   4.910   28.927  1.00 24.19  ? 275 ILE B O     1 
ATOM   4525  C CB    . ILE B  1 247 ? 9.651   5.757   25.708  1.00 23.19  ? 275 ILE B CB    1 
ATOM   4526  C CG1   . ILE B  1 247 ? 10.072  6.943   24.815  1.00 28.00  ? 275 ILE B CG1   1 
ATOM   4527  C CG2   . ILE B  1 247 ? 8.165   5.866   26.134  1.00 22.09  ? 275 ILE B CG2   1 
ATOM   4528  C CD1   . ILE B  1 247 ? 10.422  8.250   25.542  1.00 26.81  ? 275 ILE B CD1   1 
ATOM   4529  N N     . ALA B  1 248 ? 10.440  3.286   27.741  1.00 26.40  ? 276 ALA B N     1 
ATOM   4530  C CA    . ALA B  1 248 ? 10.252  2.230   28.745  1.00 25.36  ? 276 ALA B CA    1 
ATOM   4531  C C     . ALA B  1 248 ? 10.660  2.749   30.123  1.00 24.35  ? 276 ALA B C     1 
ATOM   4532  O O     . ALA B  1 248 ? 9.861   2.711   31.057  1.00 26.21  ? 276 ALA B O     1 
ATOM   4533  C CB    . ALA B  1 248 ? 11.082  0.963   28.380  1.00 17.78  ? 276 ALA B CB    1 
ATOM   4534  N N     . SER B  1 249 ? 11.890  3.255   30.211  1.00 24.27  ? 277 SER B N     1 
ATOM   4535  C CA    . SER B  1 249 ? 12.478  3.709   31.467  1.00 25.49  ? 277 SER B CA    1 
ATOM   4536  C C     . SER B  1 249 ? 11.797  4.957   32.035  1.00 23.20  ? 277 SER B C     1 
ATOM   4537  O O     . SER B  1 249 ? 11.576  5.043   33.242  1.00 23.24  ? 277 SER B O     1 
ATOM   4538  C CB    . SER B  1 249 ? 13.975  3.985   31.299  1.00 26.54  ? 277 SER B CB    1 
ATOM   4539  O OG    . SER B  1 249 ? 14.685  2.855   30.819  1.00 28.15  ? 277 SER B OG    1 
ATOM   4540  N N     . GLN B  1 250 ? 11.498  5.928   31.170  1.00 18.86  ? 278 GLN B N     1 
ATOM   4541  C CA    . GLN B  1 250 ? 10.700  7.067   31.560  1.00 24.83  ? 278 GLN B CA    1 
ATOM   4542  C C     . GLN B  1 250 ? 9.455   6.535   32.238  1.00 19.41  ? 278 GLN B C     1 
ATOM   4543  O O     . GLN B  1 250 ? 9.131   6.990   33.316  1.00 19.72  ? 278 GLN B O     1 
ATOM   4544  C CB    . GLN B  1 250 ? 10.291  7.960   30.377  1.00 25.65  ? 278 GLN B CB    1 
ATOM   4545  C CG    . GLN B  1 250 ? 9.437   9.170   30.809  1.00 26.01  ? 278 GLN B CG    1 
ATOM   4546  C CD    . GLN B  1 250 ? 8.639   9.817   29.674  1.00 34.05  ? 278 GLN B CD    1 
ATOM   4547  O OE1   . GLN B  1 250 ? 8.277   9.168   28.683  1.00 30.40  ? 278 GLN B OE1   1 
ATOM   4548  N NE2   . GLN B  1 250 ? 8.327   11.098  29.841  1.00 26.83  ? 278 GLN B NE2   1 
ATOM   4549  N N     . ALA B  1 251 ? 8.779   5.573   31.588  1.00 25.88  ? 279 ALA B N     1 
ATOM   4550  C CA    . ALA B  1 251 ? 7.526   4.980   32.083  1.00 19.45  ? 279 ALA B CA    1 
ATOM   4551  C C     . ALA B  1 251 ? 7.685   4.252   33.419  1.00 19.10  ? 279 ALA B C     1 
ATOM   4552  O O     . ALA B  1 251 ? 6.776   4.279   34.261  1.00 20.24  ? 279 ALA B O     1 
ATOM   4553  C CB    . ALA B  1 251 ? 6.923   4.015   31.034  1.00 18.98  ? 279 ALA B CB    1 
ATOM   4554  N N     . LEU B  1 252 ? 8.813   3.566   33.606  1.00 21.86  ? 280 LEU B N     1 
ATOM   4555  C CA    . LEU B  1 252 ? 9.113   2.918   34.880  1.00 22.43  ? 280 LEU B CA    1 
ATOM   4556  C C     . LEU B  1 252 ? 9.225   3.938   36.010  1.00 21.74  ? 280 LEU B C     1 
ATOM   4557  O O     . LEU B  1 252 ? 8.812   3.655   37.118  1.00 22.94  ? 280 LEU B O     1 
ATOM   4558  C CB    . LEU B  1 252 ? 10.410  2.094   34.828  1.00 25.34  ? 280 LEU B CB    1 
ATOM   4559  C CG    . LEU B  1 252 ? 10.583  0.915   33.856  1.00 27.39  ? 280 LEU B CG    1 
ATOM   4560  C CD1   . LEU B  1 252 ? 11.970  0.341   34.043  1.00 25.96  ? 280 LEU B CD1   1 
ATOM   4561  C CD2   . LEU B  1 252 ? 9.509   -0.168  34.033  1.00 22.67  ? 280 LEU B CD2   1 
ATOM   4562  N N     . GLY B  1 253 ? 9.799   5.105   35.728  1.00 21.16  ? 281 GLY B N     1 
ATOM   4563  C CA    . GLY B  1 253 ? 9.925   6.165   36.706  1.00 20.93  ? 281 GLY B CA    1 
ATOM   4564  C C     . GLY B  1 253 ? 8.600   6.738   37.132  1.00 23.44  ? 281 GLY B C     1 
ATOM   4565  O O     . GLY B  1 253 ? 8.370   6.942   38.334  1.00 25.10  ? 281 GLY B O     1 
ATOM   4566  N N     . ILE B  1 254 ? 7.735   7.001   36.141  1.00 20.54  ? 282 ILE B N     1 
ATOM   4567  C CA    . ILE B  1 254 ? 6.379   7.504   36.388  1.00 23.76  ? 282 ILE B CA    1 
ATOM   4568  C C     . ILE B  1 254 ? 5.610   6.522   37.268  1.00 23.65  ? 282 ILE B C     1 
ATOM   4569  O O     . ILE B  1 254 ? 5.044   6.907   38.290  1.00 23.01  ? 282 ILE B O     1 
ATOM   4570  C CB    . ILE B  1 254 ? 5.578   7.727   35.064  1.00 23.81  ? 282 ILE B CB    1 
ATOM   4571  C CG1   . ILE B  1 254 ? 6.155   8.894   34.280  1.00 23.82  ? 282 ILE B CG1   1 
ATOM   4572  C CG2   . ILE B  1 254 ? 4.102   8.063   35.372  1.00 19.33  ? 282 ILE B CG2   1 
ATOM   4573  C CD1   . ILE B  1 254 ? 5.722   8.983   32.841  1.00 21.60  ? 282 ILE B CD1   1 
ATOM   4574  N N     . ALA B  1 255 ? 5.599   5.263   36.839  1.00 24.95  ? 283 ALA B N     1 
ATOM   4575  C CA    . ALA B  1 255 ? 4.995   4.158   37.565  1.00 25.08  ? 283 ALA B CA    1 
ATOM   4576  C C     . ALA B  1 255 ? 5.540   4.019   38.992  1.00 23.46  ? 283 ALA B C     1 
ATOM   4577  O O     . ALA B  1 255 ? 4.796   3.800   39.907  1.00 20.28  ? 283 ALA B O     1 
ATOM   4578  C CB    . ALA B  1 255 ? 5.227   2.861   36.803  1.00 24.08  ? 283 ALA B CB    1 
ATOM   4579  N N     . GLN B  1 256 ? 6.862   4.062   39.145  1.00 20.43  ? 284 GLN B N     1 
ATOM   4580  C CA    . GLN B  1 256 ? 7.488   3.924   40.455  1.00 22.79  ? 284 GLN B CA    1 
ATOM   4581  C C     . GLN B  1 256 ? 7.054   5.050   41.400  1.00 23.38  ? 284 GLN B C     1 
ATOM   4582  O O     . GLN B  1 256 ? 6.657   4.783   42.525  1.00 20.90  ? 284 GLN B O     1 
ATOM   4583  C CB    . GLN B  1 256 ? 9.015   3.898   40.330  1.00 22.80  ? 284 GLN B CB    1 
ATOM   4584  C CG    . GLN B  1 256 ? 9.743   3.706   41.666  1.00 27.70  ? 284 GLN B CG    1 
ATOM   4585  C CD    . GLN B  1 256 ? 9.600   2.312   42.200  1.00 32.78  ? 284 GLN B CD    1 
ATOM   4586  O OE1   . GLN B  1 256 ? 10.167  1.350   41.643  1.00 30.64  ? 284 GLN B OE1   1 
ATOM   4587  N NE2   . GLN B  1 256 ? 8.860   2.179   43.289  1.00 21.16  ? 284 GLN B NE2   1 
ATOM   4588  N N     . THR B  1 257 ? 7.109   6.298   40.924  1.00 23.97  ? 285 THR B N     1 
ATOM   4589  C CA    . THR B  1 257 ? 6.697   7.434   41.737  1.00 26.63  ? 285 THR B CA    1 
ATOM   4590  C C     . THR B  1 257 ? 5.203   7.358   42.095  1.00 22.02  ? 285 THR B C     1 
ATOM   4591  O O     . THR B  1 257 ? 4.798   7.704   43.202  1.00 25.61  ? 285 THR B O     1 
ATOM   4592  C CB    . THR B  1 257 ? 7.050   8.812   41.087  1.00 26.63  ? 285 THR B CB    1 
ATOM   4593  O OG1   . THR B  1 257 ? 7.020   9.827   42.098  1.00 31.05  ? 285 THR B OG1   1 
ATOM   4594  C CG2   . THR B  1 257 ? 6.077   9.183   39.962  1.00 25.37  ? 285 THR B CG2   1 
ATOM   4595  N N     . ALA B  1 258 ? 4.399   6.874   41.164  1.00 24.59  ? 286 ALA B N     1 
ATOM   4596  C CA    . ALA B  1 258 ? 2.972   6.699   41.412  1.00 20.69  ? 286 ALA B CA    1 
ATOM   4597  C C     . ALA B  1 258 ? 2.715   5.662   42.517  1.00 23.44  ? 286 ALA B C     1 
ATOM   4598  O O     . ALA B  1 258 ? 1.834   5.852   43.368  1.00 18.95  ? 286 ALA B O     1 
ATOM   4599  C CB    . ALA B  1 258 ? 2.269   6.295   40.134  1.00 21.38  ? 286 ALA B CB    1 
ATOM   4600  N N     . LEU B  1 259 ? 3.469   4.564   42.474  1.00 23.38  ? 287 LEU B N     1 
ATOM   4601  C CA    . LEU B  1 259 ? 3.389   3.507   43.486  1.00 22.69  ? 287 LEU B CA    1 
ATOM   4602  C C     . LEU B  1 259 ? 3.968   4.011   44.845  1.00 22.62  ? 287 LEU B C     1 
ATOM   4603  O O     . LEU B  1 259 ? 3.369   3.762   45.875  1.00 21.02  ? 287 LEU B O     1 
ATOM   4604  C CB    . LEU B  1 259 ? 4.054   2.196   42.993  1.00 24.48  ? 287 LEU B CB    1 
ATOM   4605  C CG    . LEU B  1 259 ? 4.191   1.033   44.017  1.00 22.61  ? 287 LEU B CG    1 
ATOM   4606  C CD1   . LEU B  1 259 ? 2.793   0.558   44.500  1.00 18.68  ? 287 LEU B CD1   1 
ATOM   4607  C CD2   . LEU B  1 259 ? 5.018   -0.138  43.500  1.00 22.59  ? 287 LEU B CD2   1 
ATOM   4608  N N     . ASP B  1 260 ? 5.099   4.730   44.831  1.00 26.68  ? 288 ASP B N     1 
ATOM   4609  C CA    . ASP B  1 260 ? 5.629   5.360   46.061  1.00 27.33  ? 288 ASP B CA    1 
ATOM   4610  C C     . ASP B  1 260 ? 4.573   6.256   46.721  1.00 26.10  ? 288 ASP B C     1 
ATOM   4611  O O     . ASP B  1 260 ? 4.299   6.160   47.932  1.00 25.78  ? 288 ASP B O     1 
ATOM   4612  C CB    . ASP B  1 260 ? 6.858   6.223   45.765  1.00 27.08  ? 288 ASP B CB    1 
ATOM   4613  C CG    . ASP B  1 260 ? 8.057   5.425   45.285  1.00 29.09  ? 288 ASP B CG    1 
ATOM   4614  O OD1   . ASP B  1 260 ? 8.143   4.209   45.573  1.00 30.90  ? 288 ASP B OD1   1 
ATOM   4615  O OD2   . ASP B  1 260 ? 8.922   6.030   44.605  1.00 31.08  ? 288 ASP B OD2   1 
ATOM   4616  N N     . CYS B  1 261 ? 3.964   7.110   45.911  1.00 26.64  ? 289 CYS B N     1 
ATOM   4617  C CA    . CYS B  1 261 ? 2.854   7.960   46.352  1.00 25.62  ? 289 CYS B CA    1 
ATOM   4618  C C     . CYS B  1 261 ? 1.723   7.174   47.055  1.00 25.04  ? 289 CYS B C     1 
ATOM   4619  O O     . CYS B  1 261 ? 1.374   7.485   48.193  1.00 24.51  ? 289 CYS B O     1 
ATOM   4620  C CB    . CYS B  1 261 ? 2.313   8.764   45.161  1.00 26.86  ? 289 CYS B CB    1 
ATOM   4621  S SG    . CYS B  1 261 ? 0.856   9.800   45.484  1.00 35.76  ? 289 CYS B SG    1 
ATOM   4622  N N     . ALA B  1 262 ? 1.155   6.183   46.362  1.00 26.83  ? 290 ALA B N     1 
ATOM   4623  C CA    . ALA B  1 262 ? 0.080   5.314   46.874  1.00 22.87  ? 290 ALA B CA    1 
ATOM   4624  C C     . ALA B  1 262 ? 0.395   4.618   48.208  1.00 20.61  ? 290 ALA B C     1 
ATOM   4625  O O     . ALA B  1 262 ? -0.422  4.600   49.131  1.00 20.29  ? 290 ALA B O     1 
ATOM   4626  C CB    . ALA B  1 262 ? -0.293  4.258   45.826  1.00 16.56  ? 290 ALA B CB    1 
ATOM   4627  N N     . VAL B  1 263 ? 1.575   4.033   48.296  1.00 24.06  ? 291 VAL B N     1 
ATOM   4628  C CA    . VAL B  1 263 ? 1.987   3.330   49.506  1.00 25.38  ? 291 VAL B CA    1 
ATOM   4629  C C     . VAL B  1 263 ? 2.114   4.280   50.714  1.00 24.12  ? 291 VAL B C     1 
ATOM   4630  O O     . VAL B  1 263 ? 1.640   3.961   51.786  1.00 26.29  ? 291 VAL B O     1 
ATOM   4631  C CB    . VAL B  1 263 ? 3.301   2.539   49.281  1.00 20.77  ? 291 VAL B CB    1 
ATOM   4632  C CG1   . VAL B  1 263 ? 3.849   1.989   50.601  1.00 28.71  ? 291 VAL B CG1   1 
ATOM   4633  C CG2   . VAL B  1 263 ? 3.061   1.377   48.334  1.00 21.06  ? 291 VAL B CG2   1 
ATOM   4634  N N     . ASN B  1 264 ? 2.734   5.445   50.528  1.00 26.96  ? 292 ASN B N     1 
ATOM   4635  C CA    . ASN B  1 264 ? 2.849   6.431   51.613  1.00 27.14  ? 292 ASN B CA    1 
ATOM   4636  C C     . ASN B  1 264 ? 1.504   6.856   52.102  1.00 25.97  ? 292 ASN B C     1 
ATOM   4637  O O     . ASN B  1 264 ? 1.270   6.964   53.295  1.00 26.06  ? 292 ASN B O     1 
ATOM   4638  C CB    . ASN B  1 264 ? 3.566   7.677   51.147  1.00 27.82  ? 292 ASN B CB    1 
ATOM   4639  C CG    . ASN B  1 264 ? 5.018   7.637   51.449  1.00 48.88  ? 292 ASN B CG    1 
ATOM   4640  O OD1   . ASN B  1 264 ? 5.786   6.945   50.770  1.00 56.97  ? 292 ASN B OD1   1 
ATOM   4641  N ND2   . ASN B  1 264 ? 5.422   8.370   52.491  1.00 56.42  ? 292 ASN B ND2   1 
ATOM   4642  N N     . TYR B  1 265 ? 0.623   7.109   51.151  1.00 25.32  ? 293 TYR B N     1 
ATOM   4643  C CA    . TYR B  1 265 ? -0.687  7.606   51.464  1.00 23.68  ? 293 TYR B CA    1 
ATOM   4644  C C     . TYR B  1 265 ? -1.517  6.571   52.240  1.00 21.38  ? 293 TYR B C     1 
ATOM   4645  O O     . TYR B  1 265 ? -2.151  6.885   53.241  1.00 26.16  ? 293 TYR B O     1 
ATOM   4646  C CB    . TYR B  1 265 ? -1.402  8.062   50.176  1.00 21.49  ? 293 TYR B CB    1 
ATOM   4647  C CG    . TYR B  1 265 ? -2.666  8.764   50.526  1.00 23.22  ? 293 TYR B CG    1 
ATOM   4648  C CD1   . TYR B  1 265 ? -2.634  10.088  50.960  1.00 29.91  ? 293 TYR B CD1   1 
ATOM   4649  C CD2   . TYR B  1 265 ? -3.878  8.098   50.513  1.00 21.17  ? 293 TYR B CD2   1 
ATOM   4650  C CE1   . TYR B  1 265 ? -3.780  10.734  51.337  1.00 24.08  ? 293 TYR B CE1   1 
ATOM   4651  C CE2   . TYR B  1 265 ? -5.026  8.732   50.905  1.00 27.06  ? 293 TYR B CE2   1 
ATOM   4652  C CZ    . TYR B  1 265 ? -4.971  10.055  51.301  1.00 31.19  ? 293 TYR B CZ    1 
ATOM   4653  O OH    . TYR B  1 265 ? -6.100  10.710  51.698  1.00 20.98  ? 293 TYR B OH    1 
ATOM   4654  N N     . ALA B  1 266 ? -1.557  5.359   51.716  1.00 21.26  ? 294 ALA B N     1 
ATOM   4655  C CA    . ALA B  1 266 ? -2.344  4.278   52.252  1.00 22.62  ? 294 ALA B CA    1 
ATOM   4656  C C     . ALA B  1 266 ? -1.854  3.840   53.633  1.00 23.24  ? 294 ALA B C     1 
ATOM   4657  O O     . ALA B  1 266 ? -2.612  3.304   54.421  1.00 23.58  ? 294 ALA B O     1 
ATOM   4658  C CB    . ALA B  1 266 ? -2.315  3.104   51.295  1.00 18.79  ? 294 ALA B CB    1 
ATOM   4659  N N     . GLU B  1 267 ? -0.568  4.048   53.902  1.00 24.98  ? 295 GLU B N     1 
ATOM   4660  C CA    . GLU B  1 267 ? -0.013  3.718   55.211  1.00 27.63  ? 295 GLU B CA    1 
ATOM   4661  C C     . GLU B  1 267 ? -0.482  4.707   56.264  1.00 28.83  ? 295 GLU B C     1 
ATOM   4662  O O     . GLU B  1 267 ? -0.518  4.369   57.422  1.00 26.12  ? 295 GLU B O     1 
ATOM   4663  C CB    . GLU B  1 267 ? 1.517   3.684   55.185  1.00 26.37  ? 295 GLU B CB    1 
ATOM   4664  C CG    . GLU B  1 267 ? 2.124   2.503   54.396  1.00 34.66  ? 295 GLU B CG    1 
ATOM   4665  C CD    . GLU B  1 267 ? 2.338   1.248   55.231  1.00 48.40  ? 295 GLU B CD    1 
ATOM   4666  O OE1   . GLU B  1 267 ? 1.344   0.684   55.743  1.00 42.67  ? 295 GLU B OE1   1 
ATOM   4667  O OE2   . GLU B  1 267 ? 3.506   0.817   55.351  1.00 52.99  ? 295 GLU B OE2   1 
ATOM   4668  N N     . ASN B  1 268 ? -0.852  5.915   55.838  1.00 28.37  ? 296 ASN B N     1 
ATOM   4669  C CA    . ASN B  1 268 ? -1.137  7.009   56.744  1.00 30.14  ? 296 ASN B CA    1 
ATOM   4670  C C     . ASN B  1 268 ? -2.564  7.536   56.676  1.00 28.79  ? 296 ASN B C     1 
ATOM   4671  O O     . ASN B  1 268 ? -2.952  8.354   57.507  1.00 35.62  ? 296 ASN B O     1 
ATOM   4672  C CB    . ASN B  1 268 ? -0.120  8.137   56.485  1.00 31.77  ? 296 ASN B CB    1 
ATOM   4673  C CG    . ASN B  1 268 ? 1.301   7.730   56.852  1.00 33.22  ? 296 ASN B CG    1 
ATOM   4674  O OD1   . ASN B  1 268 ? 1.600   7.532   58.025  1.00 38.71  ? 296 ASN B OD1   1 
ATOM   4675  N ND2   . ASN B  1 268 ? 2.187   7.598   55.849  1.00 35.23  ? 296 ASN B ND2   1 
ATOM   4676  N N     . ARG B  1 269 ? -3.347  7.064   55.706  1.00 23.85  ? 297 ARG B N     1 
ATOM   4677  C CA    . ARG B  1 269 ? -4.771  7.366   55.640  1.00 26.64  ? 297 ARG B CA    1 
ATOM   4678  C C     . ARG B  1 269 ? -5.508  6.318   56.476  1.00 27.82  ? 297 ARG B C     1 
ATOM   4679  O O     . ARG B  1 269 ? -5.349  5.124   56.251  1.00 23.43  ? 297 ARG B O     1 
ATOM   4680  C CB    . ARG B  1 269 ? -5.269  7.359   54.166  1.00 21.62  ? 297 ARG B CB    1 
ATOM   4681  C CG    . ARG B  1 269 ? -6.766  7.558   53.997  1.00 24.38  ? 297 ARG B CG    1 
ATOM   4682  C CD    . ARG B  1 269 ? -7.243  8.915   54.483  1.00 20.48  ? 297 ARG B CD    1 
ATOM   4683  N NE    . ARG B  1 269 ? -8.631  9.173   54.098  1.00 21.45  ? 297 ARG B NE    1 
ATOM   4684  C CZ    . ARG B  1 269 ? -9.285  10.318  54.318  1.00 23.27  ? 297 ARG B CZ    1 
ATOM   4685  N NH1   . ARG B  1 269 ? -8.723  11.308  54.987  1.00 26.19  ? 297 ARG B NH1   1 
ATOM   4686  N NH2   . ARG B  1 269 ? -10.535 10.450  53.900  1.00 24.07  ? 297 ARG B NH2   1 
ATOM   4687  N N     . MET B  1 270 ? -6.295  6.769   57.448  1.00 23.03  ? 298 MET B N     1 
ATOM   4688  C CA    . MET B  1 270 ? -7.118  5.877   58.247  1.00 27.86  ? 298 MET B CA    1 
ATOM   4689  C C     . MET B  1 270 ? -8.514  5.804   57.670  1.00 30.66  ? 298 MET B C     1 
ATOM   4690  O O     . MET B  1 270 ? -9.045  6.794   57.138  1.00 29.67  ? 298 MET B O     1 
ATOM   4691  C CB    . MET B  1 270 ? -7.219  6.371   59.691  1.00 31.32  ? 298 MET B CB    1 
ATOM   4692  C CG    . MET B  1 270 ? -5.867  6.634   60.372  1.00 36.27  ? 298 MET B CG    1 
ATOM   4693  S SD    . MET B  1 270 ? -4.985  5.105   60.746  1.00 42.25  ? 298 MET B SD    1 
ATOM   4694  C CE    . MET B  1 270 ? -6.193  4.291   61.767  1.00 36.99  ? 298 MET B CE    1 
ATOM   4695  N N     . ALA B  1 271 ? -9.109  4.625   57.784  1.00 30.76  ? 299 ALA B N     1 
ATOM   4696  C CA    . ALA B  1 271 ? -10.481 4.419   57.374  1.00 30.67  ? 299 ALA B CA    1 
ATOM   4697  C C     . ALA B  1 271 ? -10.969 3.173   58.067  1.00 32.92  ? 299 ALA B C     1 
ATOM   4698  O O     . ALA B  1 271 ? -10.219 2.205   58.206  1.00 32.18  ? 299 ALA B O     1 
ATOM   4699  C CB    . ALA B  1 271 ? -10.569 4.256   55.873  1.00 29.61  ? 299 ALA B CB    1 
ATOM   4700  N N     . PHE B  1 272 ? -12.224 3.200   58.500  1.00 31.40  ? 300 PHE B N     1 
ATOM   4701  C CA    . PHE B  1 272 ? -12.799 2.121   59.296  1.00 32.71  ? 300 PHE B CA    1 
ATOM   4702  C C     . PHE B  1 272 ? -11.871 1.607   60.416  1.00 33.53  ? 300 PHE B C     1 
ATOM   4703  O O     . PHE B  1 272 ? -11.845 0.418   60.704  1.00 36.33  ? 300 PHE B O     1 
ATOM   4704  C CB    . PHE B  1 272 ? -13.233 0.977   58.370  1.00 32.89  ? 300 PHE B CB    1 
ATOM   4705  C CG    . PHE B  1 272 ? -14.271 1.378   57.383  1.00 32.97  ? 300 PHE B CG    1 
ATOM   4706  C CD1   . PHE B  1 272 ? -15.612 1.278   57.702  1.00 34.75  ? 300 PHE B CD1   1 
ATOM   4707  C CD2   . PHE B  1 272 ? -13.912 1.869   56.132  1.00 33.93  ? 300 PHE B CD2   1 
ATOM   4708  C CE1   . PHE B  1 272 ? -16.577 1.654   56.789  1.00 35.53  ? 300 PHE B CE1   1 
ATOM   4709  C CE2   . PHE B  1 272 ? -14.875 2.259   55.224  1.00 31.23  ? 300 PHE B CE2   1 
ATOM   4710  C CZ    . PHE B  1 272 ? -16.203 2.152   55.548  1.00 35.09  ? 300 PHE B CZ    1 
ATOM   4711  N N     . GLY B  1 273 ? -11.131 2.514   61.049  1.00 31.08  ? 301 GLY B N     1 
ATOM   4712  C CA    . GLY B  1 273 ? -10.342 2.194   62.236  1.00 32.56  ? 301 GLY B CA    1 
ATOM   4713  C C     . GLY B  1 273 ? -8.939  1.646   62.033  1.00 35.49  ? 301 GLY B C     1 
ATOM   4714  O O     . GLY B  1 273 ? -8.341  1.140   62.979  1.00 39.53  ? 301 GLY B O     1 
ATOM   4715  N N     . ALA B  1 274 ? -8.397  1.730   60.822  1.00 33.78  ? 302 ALA B N     1 
ATOM   4716  C CA    . ALA B  1 274 ? -7.023  1.271   60.588  1.00 28.24  ? 302 ALA B CA    1 
ATOM   4717  C C     . ALA B  1 274 ? -6.468  1.924   59.337  1.00 26.33  ? 302 ALA B C     1 
ATOM   4718  O O     . ALA B  1 274 ? -7.216  2.522   58.587  1.00 30.04  ? 302 ALA B O     1 
ATOM   4719  C CB    . ALA B  1 274 ? -6.998  -0.243  60.462  1.00 24.88  ? 302 ALA B CB    1 
ATOM   4720  N N     . PRO B  1 275 ? -5.150  1.850   59.121  1.00 29.73  ? 303 PRO B N     1 
ATOM   4721  C CA    . PRO B  1 275 ? -4.638  2.338   57.838  1.00 27.62  ? 303 PRO B CA    1 
ATOM   4722  C C     . PRO B  1 275 ? -5.305  1.593   56.663  1.00 27.73  ? 303 PRO B C     1 
ATOM   4723  O O     . PRO B  1 275 ? -5.818  0.456   56.825  1.00 22.93  ? 303 PRO B O     1 
ATOM   4724  C CB    . PRO B  1 275 ? -3.142  2.075   57.927  1.00 29.45  ? 303 PRO B CB    1 
ATOM   4725  C CG    . PRO B  1 275 ? -2.861  2.020   59.431  1.00 28.36  ? 303 PRO B CG    1 
ATOM   4726  C CD    . PRO B  1 275 ? -4.072  1.372   60.012  1.00 26.46  ? 303 PRO B CD    1 
ATOM   4727  N N     . LEU B  1 276 ? -5.337  2.252   55.513  1.00 27.50  ? 304 LEU B N     1 
ATOM   4728  C CA    . LEU B  1 276 ? -5.853  1.642   54.278  1.00 25.76  ? 304 LEU B CA    1 
ATOM   4729  C C     . LEU B  1 276 ? -5.101  0.356   53.936  1.00 21.27  ? 304 LEU B C     1 
ATOM   4730  O O     . LEU B  1 276 ? -5.686  -0.577  53.453  1.00 21.24  ? 304 LEU B O     1 
ATOM   4731  C CB    . LEU B  1 276 ? -5.744  2.607   53.088  1.00 25.47  ? 304 LEU B CB    1 
ATOM   4732  C CG    . LEU B  1 276 ? -6.615  3.861   53.097  1.00 20.67  ? 304 LEU B CG    1 
ATOM   4733  C CD1   . LEU B  1 276 ? -6.312  4.692   51.857  1.00 20.28  ? 304 LEU B CD1   1 
ATOM   4734  C CD2   . LEU B  1 276 ? -8.147  3.580   53.262  1.00 21.41  ? 304 LEU B CD2   1 
ATOM   4735  N N     . THR B  1 277 ? -3.805  0.317   54.229  1.00 22.90  ? 305 THR B N     1 
ATOM   4736  C CA    . THR B  1 277 ? -2.975  -0.845  53.942  1.00 27.84  ? 305 THR B CA    1 
ATOM   4737  C C     . THR B  1 277 ? -3.369  -2.091  54.738  1.00 28.08  ? 305 THR B C     1 
ATOM   4738  O O     . THR B  1 277 ? -2.873  -3.177  54.442  1.00 31.37  ? 305 THR B O     1 
ATOM   4739  C CB    . THR B  1 277 ? -1.493  -0.536  54.195  1.00 26.30  ? 305 THR B CB    1 
ATOM   4740  O OG1   . THR B  1 277 ? -1.359  0.079   55.480  1.00 29.73  ? 305 THR B OG1   1 
ATOM   4741  C CG2   . THR B  1 277 ? -0.933  0.399   53.120  1.00 29.19  ? 305 THR B CG2   1 
ATOM   4742  N N     . LYS B  1 278 ? -4.240  -1.947  55.736  1.00 26.62  ? 306 LYS B N     1 
ATOM   4743  C CA    . LYS B  1 278 ? -4.794  -3.094  56.444  1.00 28.03  ? 306 LYS B CA    1 
ATOM   4744  C C     . LYS B  1 278 ? -5.960  -3.732  55.718  1.00 27.44  ? 306 LYS B C     1 
ATOM   4745  O O     . LYS B  1 278 ? -6.352  -4.847  56.061  1.00 29.04  ? 306 LYS B O     1 
ATOM   4746  C CB    . LYS B  1 278 ? -5.175  -2.728  57.886  1.00 29.70  ? 306 LYS B CB    1 
ATOM   4747  C CG    . LYS B  1 278 ? -3.957  -2.325  58.758  1.00 39.17  ? 306 LYS B CG    1 
ATOM   4748  C CD    . LYS B  1 278 ? -2.989  -3.506  58.995  1.00 53.77  ? 306 LYS B CD    1 
ATOM   4749  C CE    . LYS B  1 278 ? -1.714  -3.110  59.752  1.00 43.07  ? 306 LYS B CE    1 
ATOM   4750  N NZ    . LYS B  1 278 ? -0.587  -4.033  59.406  1.00 58.44  ? 306 LYS B NZ    1 
ATOM   4751  N N     . LEU B  1 279 ? -6.504  -3.050  54.708  1.00 26.45  ? 307 LEU B N     1 
ATOM   4752  C CA    . LEU B  1 279 ? -7.574  -3.609  53.870  1.00 27.86  ? 307 LEU B CA    1 
ATOM   4753  C C     . LEU B  1 279 ? -6.991  -4.526  52.812  1.00 23.68  ? 307 LEU B C     1 
ATOM   4754  O O     . LEU B  1 279 ? -6.054  -4.154  52.115  1.00 22.83  ? 307 LEU B O     1 
ATOM   4755  C CB    . LEU B  1 279 ? -8.368  -2.507  53.154  1.00 27.88  ? 307 LEU B CB    1 
ATOM   4756  C CG    . LEU B  1 279 ? -9.071  -1.506  54.068  1.00 23.98  ? 307 LEU B CG    1 
ATOM   4757  C CD1   . LEU B  1 279 ? -9.472  -0.317  53.225  1.00 24.25  ? 307 LEU B CD1   1 
ATOM   4758  C CD2   . LEU B  1 279 ? -10.252 -2.110  54.804  1.00 28.79  ? 307 LEU B CD2   1 
ATOM   4759  N N     . GLN B  1 280 ? -7.583  -5.714  52.697  1.00 26.06  ? 308 GLN B N     1 
ATOM   4760  C CA    . GLN B  1 280 ? -7.134  -6.776  51.796  1.00 30.10  ? 308 GLN B CA    1 
ATOM   4761  C C     . GLN B  1 280 ? -7.148  -6.339  50.332  1.00 26.75  ? 308 GLN B C     1 
ATOM   4762  O O     . GLN B  1 280 ? -6.234  -6.654  49.556  1.00 22.60  ? 308 GLN B O     1 
ATOM   4763  C CB    . GLN B  1 280 ? -8.060  -7.990  51.976  1.00 34.94  ? 308 GLN B CB    1 
ATOM   4764  C CG    . GLN B  1 280 ? -7.431  -9.290  51.609  1.00 46.95  ? 308 GLN B CG    1 
ATOM   4765  C CD    . GLN B  1 280 ? -8.225  -10.481 52.082  1.00 48.76  ? 308 GLN B CD    1 
ATOM   4766  O OE1   . GLN B  1 280 ? -9.438  -10.588 51.838  1.00 30.02  ? 308 GLN B OE1   1 
ATOM   4767  N NE2   . GLN B  1 280 ? -7.542  -11.390 52.781  1.00 27.41  ? 308 GLN B NE2   1 
ATOM   4768  N N     . VAL B  1 281 ? -8.198  -5.592  49.975  1.00 25.04  ? 309 VAL B N     1 
ATOM   4769  C CA    . VAL B  1 281 ? -8.350  -4.985  48.657  1.00 25.78  ? 309 VAL B CA    1 
ATOM   4770  C C     . VAL B  1 281 ? -7.195  -4.029  48.269  1.00 25.64  ? 309 VAL B C     1 
ATOM   4771  O O     . VAL B  1 281 ? -6.646  -4.100  47.159  1.00 22.65  ? 309 VAL B O     1 
ATOM   4772  C CB    . VAL B  1 281 ? -9.726  -4.255  48.592  1.00 33.51  ? 309 VAL B CB    1 
ATOM   4773  C CG1   . VAL B  1 281 ? -9.828  -3.391  47.357  1.00 37.83  ? 309 VAL B CG1   1 
ATOM   4774  C CG2   . VAL B  1 281 ? -10.869 -5.301  48.642  1.00 35.06  ? 309 VAL B CG2   1 
ATOM   4775  N N     . ILE B  1 282 ? -6.817  -3.159  49.194  1.00 22.08  ? 310 ILE B N     1 
ATOM   4776  C CA    . ILE B  1 282 ? -5.725  -2.236  48.969  1.00 24.78  ? 310 ILE B CA    1 
ATOM   4777  C C     . ILE B  1 282 ? -4.412  -3.012  48.816  1.00 22.77  ? 310 ILE B C     1 
ATOM   4778  O O     . ILE B  1 282 ? -3.595  -2.688  47.957  1.00 23.62  ? 310 ILE B O     1 
ATOM   4779  C CB    . ILE B  1 282 ? -5.643  -1.190  50.110  1.00 21.73  ? 310 ILE B CB    1 
ATOM   4780  C CG1   . ILE B  1 282 ? -6.904  -0.323  50.142  1.00 24.79  ? 310 ILE B CG1   1 
ATOM   4781  C CG2   . ILE B  1 282 ? -4.399  -0.334  49.980  1.00 22.12  ? 310 ILE B CG2   1 
ATOM   4782  C CD1   . ILE B  1 282 ? -7.206  0.443   48.817  1.00 22.01  ? 310 ILE B CD1   1 
ATOM   4783  N N     . GLN B  1 283 ? -4.231  -4.059  49.623  1.00 25.05  ? 311 GLN B N     1 
ATOM   4784  C CA    . GLN B  1 283 ? -3.050  -4.933  49.487  1.00 23.93  ? 311 GLN B CA    1 
ATOM   4785  C C     . GLN B  1 283 ? -2.932  -5.583  48.114  1.00 20.71  ? 311 GLN B C     1 
ATOM   4786  O O     . GLN B  1 283 ? -1.841  -5.668  47.557  1.00 22.09  ? 311 GLN B O     1 
ATOM   4787  C CB    . GLN B  1 283 ? -3.048  -6.012  50.571  1.00 25.08  ? 311 GLN B CB    1 
ATOM   4788  C CG    . GLN B  1 283 ? -2.745  -5.486  51.955  1.00 27.19  ? 311 GLN B CG    1 
ATOM   4789  C CD    . GLN B  1 283 ? -2.935  -6.539  53.045  1.00 34.01  ? 311 GLN B CD    1 
ATOM   4790  O OE1   . GLN B  1 283 ? -2.685  -7.723  52.829  1.00 37.58  ? 311 GLN B OE1   1 
ATOM   4791  N NE2   . GLN B  1 283 ? -3.366  -6.103  54.221  1.00 34.52  ? 311 GLN B NE2   1 
ATOM   4792  N N     . PHE B  1 284 ? -4.051  -6.071  47.591  1.00 22.96  ? 312 PHE B N     1 
ATOM   4793  C CA    . PHE B  1 284 ? -4.119  -6.647  46.244  1.00 25.56  ? 312 PHE B CA    1 
ATOM   4794  C C     . PHE B  1 284 ? -3.770  -5.629  45.135  1.00 24.57  ? 312 PHE B C     1 
ATOM   4795  O O     . PHE B  1 284 ? -2.934  -5.916  44.258  1.00 20.92  ? 312 PHE B O     1 
ATOM   4796  C CB    . PHE B  1 284 ? -5.510  -7.243  45.980  1.00 22.32  ? 312 PHE B CB    1 
ATOM   4797  C CG    . PHE B  1 284 ? -5.685  -8.674  46.483  1.00 29.76  ? 312 PHE B CG    1 
ATOM   4798  C CD1   . PHE B  1 284 ? -5.216  -9.065  47.746  1.00 36.47  ? 312 PHE B CD1   1 
ATOM   4799  C CD2   . PHE B  1 284 ? -6.347  -9.620  45.700  1.00 37.28  ? 312 PHE B CD2   1 
ATOM   4800  C CE1   . PHE B  1 284 ? -5.401  -10.384 48.204  1.00 39.04  ? 312 PHE B CE1   1 
ATOM   4801  C CE2   . PHE B  1 284 ? -6.534  -10.926 46.154  1.00 33.63  ? 312 PHE B CE2   1 
ATOM   4802  C CZ    . PHE B  1 284 ? -6.059  -11.307 47.403  1.00 31.62  ? 312 PHE B CZ    1 
ATOM   4803  N N     . LYS B  1 285 ? -4.381  -4.442  45.196  1.00 23.33  ? 313 LYS B N     1 
ATOM   4804  C CA    . LYS B  1 285 ? -4.038  -3.367  44.265  1.00 22.33  ? 313 LYS B CA    1 
ATOM   4805  C C     . LYS B  1 285 ? -2.521  -3.125  44.281  1.00 24.42  ? 313 LYS B C     1 
ATOM   4806  O O     . LYS B  1 285 ? -1.838  -3.110  43.228  1.00 23.28  ? 313 LYS B O     1 
ATOM   4807  C CB    . LYS B  1 285 ? -4.784  -2.068  44.624  1.00 25.14  ? 313 LYS B CB    1 
ATOM   4808  C CG    . LYS B  1 285 ? -6.279  -2.076  44.362  1.00 25.33  ? 313 LYS B CG    1 
ATOM   4809  C CD    . LYS B  1 285 ? -6.893  -0.738  44.827  1.00 25.93  ? 313 LYS B CD    1 
ATOM   4810  C CE    . LYS B  1 285 ? -8.422  -0.768  44.827  1.00 32.51  ? 313 LYS B CE    1 
ATOM   4811  N NZ    . LYS B  1 285 ? -8.941  -0.920  43.467  1.00 26.70  ? 313 LYS B NZ    1 
ATOM   4812  N N     . LEU B  1 286 ? -1.987  -2.969  45.485  1.00 24.44  ? 314 LEU B N     1 
ATOM   4813  C CA    . LEU B  1 286 ? -0.560  -2.716  45.640  1.00 19.48  ? 314 LEU B CA    1 
ATOM   4814  C C     . LEU B  1 286 ? 0.295   -3.859  45.118  1.00 21.91  ? 314 LEU B C     1 
ATOM   4815  O O     . LEU B  1 286 ? 1.337   -3.605  44.491  1.00 21.01  ? 314 LEU B O     1 
ATOM   4816  C CB    . LEU B  1 286 ? -0.225  -2.408  47.106  1.00 22.61  ? 314 LEU B CB    1 
ATOM   4817  C CG    . LEU B  1 286 ? -0.722  -1.047  47.629  1.00 17.74  ? 314 LEU B CG    1 
ATOM   4818  C CD1   . LEU B  1 286 ? -0.532  -0.960  49.157  1.00 21.16  ? 314 LEU B CD1   1 
ATOM   4819  C CD2   . LEU B  1 286 ? -0.100  0.160   46.882  1.00 23.57  ? 314 LEU B CD2   1 
ATOM   4820  N N     . ALA B  1 287 ? -0.138  -5.107  45.352  1.00 23.07  ? 315 ALA B N     1 
ATOM   4821  C CA    . ALA B  1 287 ? 0.623   -6.274  44.872  1.00 26.87  ? 315 ALA B CA    1 
ATOM   4822  C C     . ALA B  1 287 ? 0.649   -6.292  43.353  1.00 23.39  ? 315 ALA B C     1 
ATOM   4823  O O     . ALA B  1 287 ? 1.694   -6.519  42.755  1.00 21.89  ? 315 ALA B O     1 
ATOM   4824  C CB    . ALA B  1 287 ? 0.067   -7.588  45.413  1.00 20.94  ? 315 ALA B CB    1 
ATOM   4825  N N     . ASP B  1 288 ? -0.493  -6.004  42.734  1.00 22.30  ? 316 ASP B N     1 
ATOM   4826  C CA    . ASP B  1 288 ? -0.590  -5.992  41.271  1.00 21.93  ? 316 ASP B CA    1 
ATOM   4827  C C     . ASP B  1 288 ? 0.244   -4.901  40.663  1.00 22.78  ? 316 ASP B C     1 
ATOM   4828  O O     . ASP B  1 288 ? 0.899   -5.106  39.625  1.00 21.85  ? 316 ASP B O     1 
ATOM   4829  C CB    . ASP B  1 288 ? -2.057  -5.899  40.830  1.00 25.52  ? 316 ASP B CB    1 
ATOM   4830  C CG    . ASP B  1 288 ? -2.803  -7.217  41.059  1.00 38.12  ? 316 ASP B CG    1 
ATOM   4831  O OD1   . ASP B  1 288 ? -2.117  -8.258  40.995  1.00 40.25  ? 316 ASP B OD1   1 
ATOM   4832  O OD2   . ASP B  1 288 ? -4.027  -7.225  41.329  1.00 30.08  ? 316 ASP B OD2   1 
ATOM   4833  N N     . MET B  1 289 ? 0.304   -3.767  41.357  1.00 22.15  ? 317 MET B N     1 
ATOM   4834  C CA    . MET B  1 289 ? 1.100   -2.645  40.906  1.00 22.78  ? 317 MET B CA    1 
ATOM   4835  C C     . MET B  1 289 ? 2.589   -3.022  40.901  1.00 20.42  ? 317 MET B C     1 
ATOM   4836  O O     . MET B  1 289 ? 3.291   -2.841  39.897  1.00 20.53  ? 317 MET B O     1 
ATOM   4837  C CB    . MET B  1 289 ? 0.822   -1.422  41.791  1.00 21.86  ? 317 MET B CB    1 
ATOM   4838  C CG    . MET B  1 289 ? -0.542  -0.792  41.557  1.00 26.77  ? 317 MET B CG    1 
ATOM   4839  S SD    . MET B  1 289 ? -1.171  0.166   42.968  1.00 27.61  ? 317 MET B SD    1 
ATOM   4840  C CE    . MET B  1 289 ? -0.519  1.797   42.647  1.00 19.98  ? 317 MET B CE    1 
ATOM   4841  N N     . ALA B  1 290 ? 3.038   -3.576  42.018  1.00 21.21  ? 318 ALA B N     1 
ATOM   4842  C CA    . ALA B  1 290 ? 4.444   -3.955  42.184  1.00 24.34  ? 318 ALA B CA    1 
ATOM   4843  C C     . ALA B  1 290 ? 4.834   -5.027  41.163  1.00 19.92  ? 318 ALA B C     1 
ATOM   4844  O O     . ALA B  1 290 ? 5.907   -4.974  40.603  1.00 24.72  ? 318 ALA B O     1 
ATOM   4845  C CB    . ALA B  1 290 ? 4.703   -4.426  43.608  1.00 20.90  ? 318 ALA B CB    1 
ATOM   4846  N N     . LEU B  1 291 ? 3.937   -5.990  40.935  1.00 22.68  ? 319 LEU B N     1 
ATOM   4847  C CA    . LEU B  1 291 ? 4.152   -7.036  39.942  1.00 25.51  ? 319 LEU B CA    1 
ATOM   4848  C C     . LEU B  1 291 ? 4.290   -6.450  38.534  1.00 23.97  ? 319 LEU B C     1 
ATOM   4849  O O     . LEU B  1 291 ? 5.256   -6.737  37.868  1.00 22.59  ? 319 LEU B O     1 
ATOM   4850  C CB    . LEU B  1 291 ? 3.016   -8.083  39.983  1.00 25.90  ? 319 LEU B CB    1 
ATOM   4851  C CG    . LEU B  1 291 ? 3.204   -9.326  39.090  1.00 32.97  ? 319 LEU B CG    1 
ATOM   4852  C CD1   . LEU B  1 291 ? 4.599   -9.914  39.292  1.00 35.89  ? 319 LEU B CD1   1 
ATOM   4853  C CD2   . LEU B  1 291 ? 2.152   -10.419 39.371  1.00 30.80  ? 319 LEU B CD2   1 
ATOM   4854  N N     . ALA B  1 292 ? 3.349   -5.592  38.109  1.00 22.92  ? 320 ALA B N     1 
ATOM   4855  C CA    . ALA B  1 292 ? 3.440   -4.944  36.783  1.00 21.88  ? 320 ALA B CA    1 
ATOM   4856  C C     . ALA B  1 292 ? 4.740   -4.136  36.609  1.00 24.69  ? 320 ALA B C     1 
ATOM   4857  O O     . ALA B  1 292 ? 5.393   -4.262  35.577  1.00 23.22  ? 320 ALA B O     1 
ATOM   4858  C CB    . ALA B  1 292 ? 2.197   -4.068  36.504  1.00 23.89  ? 320 ALA B CB    1 
ATOM   4859  N N     . LEU B  1 293 ? 5.148   -3.377  37.638  1.00 23.19  ? 321 LEU B N     1 
ATOM   4860  C CA    . LEU B  1 293 ? 6.339   -2.531  37.529  1.00 23.09  ? 321 LEU B CA    1 
ATOM   4861  C C     . LEU B  1 293 ? 7.619   -3.360  37.417  1.00 19.41  ? 321 LEU B C     1 
ATOM   4862  O O     . LEU B  1 293 ? 8.480   -3.084  36.550  1.00 23.86  ? 321 LEU B O     1 
ATOM   4863  C CB    . LEU B  1 293 ? 6.416   -1.554  38.709  1.00 21.06  ? 321 LEU B CB    1 
ATOM   4864  C CG    . LEU B  1 293 ? 7.653   -0.630  38.810  1.00 23.59  ? 321 LEU B CG    1 
ATOM   4865  C CD1   . LEU B  1 293 ? 7.879   0.185   37.531  1.00 19.64  ? 321 LEU B CD1   1 
ATOM   4866  C CD2   . LEU B  1 293 ? 7.539   0.288   40.042  1.00 25.33  ? 321 LEU B CD2   1 
ATOM   4867  N N     . GLU B  1 294 ? 7.748   -4.345  38.301  1.00 19.42  ? 322 GLU B N     1 
ATOM   4868  C CA    . GLU B  1 294 ? 8.972   -5.133  38.418  1.00 26.23  ? 322 GLU B CA    1 
ATOM   4869  C C     . GLU B  1 294 ? 9.179   -5.977  37.169  1.00 22.08  ? 322 GLU B C     1 
ATOM   4870  O O     . GLU B  1 294 ? 10.281  -6.035  36.640  1.00 21.40  ? 322 GLU B O     1 
ATOM   4871  C CB    . GLU B  1 294 ? 8.960   -5.955  39.723  1.00 28.28  ? 322 GLU B CB    1 
ATOM   4872  C CG    . GLU B  1 294 ? 9.106   -5.024  40.969  1.00 37.53  ? 322 GLU B CG    1 
ATOM   4873  C CD    . GLU B  1 294 ? 9.271   -5.724  42.328  1.00 36.60  ? 322 GLU B CD    1 
ATOM   4874  O OE1   . GLU B  1 294 ? 10.136  -6.616  42.465  1.00 39.36  ? 322 GLU B OE1   1 
ATOM   4875  O OE2   . GLU B  1 294 ? 8.566   -5.338  43.290  1.00 37.99  ? 322 GLU B OE2   1 
ATOM   4876  N N     . SER B  1 295 ? 8.104   -6.596  36.673  1.00 23.17  ? 323 SER B N     1 
ATOM   4877  C CA    . SER B  1 295 ? 8.170   -7.304  35.391  1.00 23.81  ? 323 SER B CA    1 
ATOM   4878  C C     . SER B  1 295 ? 8.564   -6.399  34.211  1.00 21.35  ? 323 SER B C     1 
ATOM   4879  O O     . SER B  1 295 ? 9.400   -6.788  33.386  1.00 21.38  ? 323 SER B O     1 
ATOM   4880  C CB    . SER B  1 295 ? 6.864   -8.074  35.100  1.00 24.84  ? 323 SER B CB    1 
ATOM   4881  O OG    . SER B  1 295 ? 5.724   -7.325  35.429  1.00 40.62  ? 323 SER B OG    1 
ATOM   4882  N N     . ALA B  1 296 ? 8.013   -5.187  34.156  1.00 21.88  ? 324 ALA B N     1 
ATOM   4883  C CA    . ALA B  1 296 ? 8.339   -4.243  33.095  1.00 20.87  ? 324 ALA B CA    1 
ATOM   4884  C C     . ALA B  1 296 ? 9.797   -3.817  33.192  1.00 21.54  ? 324 ALA B C     1 
ATOM   4885  O O     . ALA B  1 296 ? 10.447  -3.704  32.182  1.00 17.59  ? 324 ALA B O     1 
ATOM   4886  C CB    . ALA B  1 296 ? 7.419   -3.031  33.148  1.00 19.89  ? 324 ALA B CB    1 
ATOM   4887  N N     . ARG B  1 297 ? 10.311  -3.638  34.410  1.00 24.25  ? 325 ARG B N     1 
ATOM   4888  C CA    . ARG B  1 297 ? 11.714  -3.250  34.598  1.00 21.21  ? 325 ARG B CA    1 
ATOM   4889  C C     . ARG B  1 297 ? 12.659  -4.354  34.077  1.00 20.36  ? 325 ARG B C     1 
ATOM   4890  O O     . ARG B  1 297 ? 13.636  -4.057  33.407  1.00 25.56  ? 325 ARG B O     1 
ATOM   4891  C CB    . ARG B  1 297 ? 11.996  -2.914  36.084  1.00 18.74  ? 325 ARG B CB    1 
ATOM   4892  C CG    . ARG B  1 297 ? 13.453  -2.488  36.354  1.00 20.96  ? 325 ARG B CG    1 
ATOM   4893  C CD    . ARG B  1 297 ? 13.701  -2.073  37.809  1.00 28.32  ? 325 ARG B CD    1 
ATOM   4894  N NE    . ARG B  1 297 ? 12.926  -0.905  38.226  1.00 24.08  ? 325 ARG B NE    1 
ATOM   4895  C CZ    . ARG B  1 297 ? 11.820  -0.938  38.971  1.00 26.11  ? 325 ARG B CZ    1 
ATOM   4896  N NH1   . ARG B  1 297 ? 11.305  -2.080  39.404  1.00 24.00  ? 325 ARG B NH1   1 
ATOM   4897  N NH2   . ARG B  1 297 ? 11.209  0.196   39.277  1.00 32.37  ? 325 ARG B NH2   1 
ATOM   4898  N N     . LEU B  1 298 ? 12.371  -5.614  34.410  1.00 22.12  ? 326 LEU B N     1 
ATOM   4899  C CA    . LEU B  1 298 ? 13.167  -6.730  33.905  1.00 24.83  ? 326 LEU B CA    1 
ATOM   4900  C C     . LEU B  1 298 ? 13.175  -6.796  32.374  1.00 24.51  ? 326 LEU B C     1 
ATOM   4901  O O     . LEU B  1 298 ? 14.209  -6.985  31.788  1.00 17.77  ? 326 LEU B O     1 
ATOM   4902  C CB    . LEU B  1 298 ? 12.725  -8.064  34.520  1.00 22.02  ? 326 LEU B CB    1 
ATOM   4903  C CG    . LEU B  1 298 ? 13.000  -8.274  36.011  1.00 24.19  ? 326 LEU B CG    1 
ATOM   4904  C CD1   . LEU B  1 298 ? 12.532  -9.654  36.454  1.00 23.66  ? 326 LEU B CD1   1 
ATOM   4905  C CD2   . LEU B  1 298 ? 14.501  -8.058  36.354  1.00 24.68  ? 326 LEU B CD2   1 
ATOM   4906  N N     . LEU B  1 299 ? 12.027  -6.624  31.726  1.00 19.63  ? 327 LEU B N     1 
ATOM   4907  C CA    . LEU B  1 299 ? 11.977  -6.523  30.260  1.00 20.52  ? 327 LEU B CA    1 
ATOM   4908  C C     . LEU B  1 299 ? 12.798  -5.363  29.727  1.00 22.31  ? 327 LEU B C     1 
ATOM   4909  O O     . LEU B  1 299 ? 13.486  -5.469  28.685  1.00 23.47  ? 327 LEU B O     1 
ATOM   4910  C CB    . LEU B  1 299 ? 10.504  -6.302  29.806  1.00 18.54  ? 327 LEU B CB    1 
ATOM   4911  C CG    . LEU B  1 299 ? 9.586   -7.521  29.903  1.00 21.90  ? 327 LEU B CG    1 
ATOM   4912  C CD1   . LEU B  1 299 ? 8.173   -7.106  29.518  1.00 17.14  ? 327 LEU B CD1   1 
ATOM   4913  C CD2   . LEU B  1 299 ? 10.068  -8.638  28.988  1.00 23.36  ? 327 LEU B CD2   1 
ATOM   4914  N N     . THR B  1 300 ? 12.717  -4.239  30.430  1.00 21.69  ? 328 THR B N     1 
ATOM   4915  C CA    . THR B  1 300 ? 13.454  -3.050  30.048  1.00 26.47  ? 328 THR B CA    1 
ATOM   4916  C C     . THR B  1 300 ? 14.968  -3.286  30.144  1.00 22.13  ? 328 THR B C     1 
ATOM   4917  O O     . THR B  1 300 ? 15.690  -2.986  29.182  1.00 25.43  ? 328 THR B O     1 
ATOM   4918  C CB    . THR B  1 300 ? 13.016  -1.824  30.876  1.00 25.31  ? 328 THR B CB    1 
ATOM   4919  O OG1   . THR B  1 300 ? 11.618  -1.561  30.646  1.00 26.68  ? 328 THR B OG1   1 
ATOM   4920  C CG2   . THR B  1 300 ? 13.827  -0.632  30.492  1.00 25.45  ? 328 THR B CG2   1 
ATOM   4921  N N     . TRP B  1 301 ? 15.437  -3.854  31.259  1.00 26.84  ? 329 TRP B N     1 
ATOM   4922  C CA    . TRP B  1 301 ? 16.883  -4.191  31.428  1.00 20.92  ? 329 TRP B CA    1 
ATOM   4923  C C     . TRP B  1 301 ? 17.418  -5.266  30.476  1.00 22.36  ? 329 TRP B C     1 
ATOM   4924  O O     . TRP B  1 301 ? 18.558  -5.170  30.028  1.00 26.45  ? 329 TRP B O     1 
ATOM   4925  C CB    . TRP B  1 301 ? 17.186  -4.601  32.880  1.00 25.91  ? 329 TRP B CB    1 
ATOM   4926  C CG    . TRP B  1 301 ? 17.102  -3.476  33.854  1.00 29.01  ? 329 TRP B CG    1 
ATOM   4927  C CD1   . TRP B  1 301 ? 16.731  -2.183  33.591  1.00 30.76  ? 329 TRP B CD1   1 
ATOM   4928  C CD2   . TRP B  1 301 ? 17.363  -3.539  35.257  1.00 33.66  ? 329 TRP B CD2   1 
ATOM   4929  N NE1   . TRP B  1 301 ? 16.765  -1.446  34.739  1.00 36.32  ? 329 TRP B NE1   1 
ATOM   4930  C CE2   . TRP B  1 301 ? 17.150  -2.249  35.778  1.00 36.58  ? 329 TRP B CE2   1 
ATOM   4931  C CE3   . TRP B  1 301 ? 17.784  -4.556  36.121  1.00 33.88  ? 329 TRP B CE3   1 
ATOM   4932  C CZ2   . TRP B  1 301 ? 17.328  -1.947  37.132  1.00 34.55  ? 329 TRP B CZ2   1 
ATOM   4933  C CZ3   . TRP B  1 301 ? 17.960  -4.257  37.459  1.00 34.72  ? 329 TRP B CZ3   1 
ATOM   4934  C CH2   . TRP B  1 301 ? 17.731  -2.964  37.950  1.00 33.36  ? 329 TRP B CH2   1 
ATOM   4935  N N     . ARG B  1 302 ? 16.631  -6.303  30.208  1.00 23.07  ? 330 ARG B N     1 
ATOM   4936  C CA    . ARG B  1 302 ? 16.948  -7.247  29.147  1.00 23.53  ? 330 ARG B CA    1 
ATOM   4937  C C     . ARG B  1 302 ? 17.252  -6.564  27.798  1.00 26.48  ? 330 ARG B C     1 
ATOM   4938  O O     . ARG B  1 302 ? 18.271  -6.877  27.159  1.00 20.68  ? 330 ARG B O     1 
ATOM   4939  C CB    . ARG B  1 302 ? 15.848  -8.307  28.988  1.00 21.86  ? 330 ARG B CB    1 
ATOM   4940  C CG    . ARG B  1 302 ? 16.116  -9.264  27.825  1.00 22.46  ? 330 ARG B CG    1 
ATOM   4941  C CD    . ARG B  1 302 ? 15.082  -10.349 27.674  1.00 24.73  ? 330 ARG B CD    1 
ATOM   4942  N NE    . ARG B  1 302 ? 13.829  -9.834  27.111  1.00 26.87  ? 330 ARG B NE    1 
ATOM   4943  C CZ    . ARG B  1 302 ? 12.942  -10.570 26.440  1.00 31.74  ? 330 ARG B CZ    1 
ATOM   4944  N NH1   . ARG B  1 302 ? 13.170  -11.857 26.224  1.00 33.35  ? 330 ARG B NH1   1 
ATOM   4945  N NH2   . ARG B  1 302 ? 11.830  -10.019 25.956  1.00 27.85  ? 330 ARG B NH2   1 
ATOM   4946  N N     . ALA B  1 303 ? 16.399  -5.623  27.386  1.00 24.51  ? 331 ALA B N     1 
ATOM   4947  C CA    . ALA B  1 303 ? 16.585  -4.875  26.135  1.00 26.65  ? 331 ALA B CA    1 
ATOM   4948  C C     . ALA B  1 303 ? 17.876  -4.034  26.143  1.00 22.78  ? 331 ALA B C     1 
ATOM   4949  O O     . ALA B  1 303 ? 18.619  -4.013  25.153  1.00 29.02  ? 331 ALA B O     1 
ATOM   4950  C CB    . ALA B  1 303 ? 15.386  -3.976  25.873  1.00 16.65  ? 331 ALA B CB    1 
ATOM   4951  N N     . ALA B  1 304 ? 18.143  -3.361  27.265  1.00 24.06  ? 332 ALA B N     1 
ATOM   4952  C CA    . ALA B  1 304 ? 19.347  -2.518  27.408  1.00 25.45  ? 332 ALA B CA    1 
ATOM   4953  C C     . ALA B  1 304 ? 20.634  -3.335  27.391  1.00 26.38  ? 332 ALA B C     1 
ATOM   4954  O O     . ALA B  1 304 ? 21.646  -2.906  26.845  1.00 25.63  ? 332 ALA B O     1 
ATOM   4955  C CB    . ALA B  1 304 ? 19.274  -1.715  28.693  1.00 25.02  ? 332 ALA B CB    1 
ATOM   4956  N N     . MET B  1 305 ? 20.583  -4.512  27.987  1.00 29.46  ? 333 MET B N     1 
ATOM   4957  C CA    . MET B  1 305 ? 21.731  -5.400  28.022  1.00 28.38  ? 333 MET B CA    1 
ATOM   4958  C C     . MET B  1 305 ? 22.010  -6.058  26.662  1.00 29.61  ? 333 MET B C     1 
ATOM   4959  O O     . MET B  1 305 ? 23.172  -6.188  26.264  1.00 30.88  ? 333 MET B O     1 
ATOM   4960  C CB    . MET B  1 305 ? 21.541  -6.425  29.132  1.00 26.76  ? 333 MET B CB    1 
ATOM   4961  C CG    . MET B  1 305 ? 21.517  -5.777  30.508  1.00 39.26  ? 333 MET B CG    1 
ATOM   4962  S SD    . MET B  1 305 ? 21.415  -6.944  31.864  1.00 46.80  ? 333 MET B SD    1 
ATOM   4963  C CE    . MET B  1 305 ? 19.729  -7.535  31.733  1.00 45.16  ? 333 MET B CE    1 
ATOM   4964  N N     . LEU B  1 306 ? 20.959  -6.448  25.935  1.00 29.45  ? 334 LEU B N     1 
ATOM   4965  C CA    . LEU B  1 306 ? 21.133  -6.928  24.564  1.00 30.04  ? 334 LEU B CA    1 
ATOM   4966  C C     . LEU B  1 306 ? 21.792  -5.876  23.680  1.00 29.69  ? 334 LEU B C     1 
ATOM   4967  O O     . LEU B  1 306 ? 22.710  -6.185  22.935  1.00 32.68  ? 334 LEU B O     1 
ATOM   4968  C CB    . LEU B  1 306 ? 19.799  -7.379  23.948  1.00 25.64  ? 334 LEU B CB    1 
ATOM   4969  C CG    . LEU B  1 306 ? 19.164  -8.635  24.533  1.00 33.25  ? 334 LEU B CG    1 
ATOM   4970  C CD1   . LEU B  1 306 ? 17.704  -8.722  24.077  1.00 27.73  ? 334 LEU B CD1   1 
ATOM   4971  C CD2   . LEU B  1 306 ? 19.925  -9.912  24.162  1.00 29.34  ? 334 LEU B CD2   1 
ATOM   4972  N N     . LYS B  1 307 ? 21.335  -4.629  23.772  1.00 30.18  ? 335 LYS B N     1 
ATOM   4973  C CA    . LYS B  1 307 ? 21.977  -3.526  23.056  1.00 32.13  ? 335 LYS B CA    1 
ATOM   4974  C C     . LYS B  1 307 ? 23.455  -3.352  23.444  1.00 31.06  ? 335 LYS B C     1 
ATOM   4975  O O     . LYS B  1 307 ? 24.300  -3.158  22.562  1.00 36.76  ? 335 LYS B O     1 
ATOM   4976  C CB    . LYS B  1 307 ? 21.225  -2.201  23.257  1.00 30.61  ? 335 LYS B CB    1 
ATOM   4977  C CG    . LYS B  1 307 ? 22.043  -0.987  22.772  1.00 36.23  ? 335 LYS B CG    1 
ATOM   4978  C CD    . LYS B  1 307 ? 21.228  0.219   22.396  1.00 47.00  ? 335 LYS B CD    1 
ATOM   4979  C CE    . LYS B  1 307 ? 22.147  1.421   22.178  1.00 41.58  ? 335 LYS B CE    1 
ATOM   4980  N NZ    . LYS B  1 307 ? 23.245  1.166   21.216  1.00 39.65  ? 335 LYS B NZ    1 
ATOM   4981  N N     . ASP B  1 308 ? 23.759  -3.406  24.741  1.00 31.91  ? 336 ASP B N     1 
ATOM   4982  C CA    . ASP B  1 308 ? 25.150  -3.234  25.241  1.00 33.09  ? 336 ASP B CA    1 
ATOM   4983  C C     . ASP B  1 308 ? 26.096  -4.346  24.793  1.00 34.00  ? 336 ASP B C     1 
ATOM   4984  O O     . ASP B  1 308 ? 27.314  -4.138  24.671  1.00 34.20  ? 336 ASP B O     1 
ATOM   4985  C CB    . ASP B  1 308 ? 25.182  -3.161  26.777  1.00 35.99  ? 336 ASP B CB    1 
ATOM   4986  C CG    . ASP B  1 308 ? 24.534  -1.902  27.327  1.00 35.90  ? 336 ASP B CG    1 
ATOM   4987  O OD1   . ASP B  1 308 ? 24.427  -0.907  26.583  1.00 42.06  ? 336 ASP B OD1   1 
ATOM   4988  O OD2   . ASP B  1 308 ? 24.153  -1.893  28.521  1.00 33.71  ? 336 ASP B OD2   1 
ATOM   4989  N N     . ASN B  1 309 ? 25.529  -5.517  24.537  1.00 34.20  ? 337 ASN B N     1 
ATOM   4990  C CA    . ASN B  1 309 ? 26.282  -6.659  24.065  1.00 33.01  ? 337 ASN B CA    1 
ATOM   4991  C C     . ASN B  1 309 ? 26.257  -6.835  22.538  1.00 33.73  ? 337 ASN B C     1 
ATOM   4992  O O     . ASN B  1 309 ? 26.651  -7.883  22.046  1.00 33.04  ? 337 ASN B O     1 
ATOM   4993  C CB    . ASN B  1 309 ? 25.764  -7.927  24.774  1.00 37.21  ? 337 ASN B CB    1 
ATOM   4994  C CG    . ASN B  1 309 ? 26.293  -8.053  26.194  1.00 45.44  ? 337 ASN B CG    1 
ATOM   4995  O OD1   . ASN B  1 309 ? 27.487  -8.311  26.395  1.00 55.18  ? 337 ASN B OD1   1 
ATOM   4996  N ND2   . ASN B  1 309 ? 25.413  -7.871  27.189  1.00 46.69  ? 337 ASN B ND2   1 
ATOM   4997  N N     . LYS B  1 310 ? 25.801  -5.812  21.806  1.00 35.06  ? 338 LYS B N     1 
ATOM   4998  C CA    . LYS B  1 310 ? 25.702  -5.827  20.326  1.00 35.51  ? 338 LYS B CA    1 
ATOM   4999  C C     . LYS B  1 310 ? 24.812  -6.978  19.785  1.00 36.69  ? 338 LYS B C     1 
ATOM   5000  O O     . LYS B  1 310 ? 25.058  -7.536  18.709  1.00 35.79  ? 338 LYS B O     1 
ATOM   5001  C CB    . LYS B  1 310 ? 27.097  -5.860  19.668  1.00 38.22  ? 338 LYS B CB    1 
ATOM   5002  C CG    . LYS B  1 310 ? 28.059  -4.704  20.091  1.00 43.64  ? 338 LYS B CG    1 
ATOM   5003  C CD    . LYS B  1 310 ? 28.816  -5.025  21.388  1.00 50.46  ? 338 LYS B CD    1 
ATOM   5004  N N     . LYS B  1 311 ? 23.784  -7.327  20.549  1.00 37.47  ? 339 LYS B N     1 
ATOM   5005  C CA    . LYS B  1 311 ? 22.821  -8.340  20.147  1.00 31.05  ? 339 LYS B CA    1 
ATOM   5006  C C     . LYS B  1 311 ? 21.524  -7.677  19.676  1.00 33.95  ? 339 LYS B C     1 
ATOM   5007  O O     . LYS B  1 311 ? 21.232  -6.541  20.065  1.00 34.22  ? 339 LYS B O     1 
ATOM   5008  C CB    . LYS B  1 311 ? 22.532  -9.291  21.311  1.00 32.29  ? 339 LYS B CB    1 
ATOM   5009  C CG    . LYS B  1 311 ? 23.745  -10.097 21.811  1.00 35.22  ? 339 LYS B CG    1 
ATOM   5010  C CD    . LYS B  1 311 ? 24.266  -11.080 20.765  1.00 42.55  ? 339 LYS B CD    1 
ATOM   5011  C CE    . LYS B  1 311 ? 25.647  -11.648 21.133  1.00 57.40  ? 339 LYS B CE    1 
ATOM   5012  N NZ    . LYS B  1 311 ? 26.445  -12.044 19.916  1.00 45.53  ? 339 LYS B NZ    1 
ATOM   5013  N N     . PRO B  1 312 ? 20.740  -8.380  18.830  1.00 32.11  ? 340 PRO B N     1 
ATOM   5014  C CA    . PRO B  1 312 ? 19.446  -7.850  18.394  1.00 33.03  ? 340 PRO B CA    1 
ATOM   5015  C C     . PRO B  1 312 ? 18.513  -7.602  19.588  1.00 26.24  ? 340 PRO B C     1 
ATOM   5016  O O     . PRO B  1 312 ? 18.520  -8.370  20.549  1.00 27.78  ? 340 PRO B O     1 
ATOM   5017  C CB    . PRO B  1 312 ? 18.880  -8.958  17.504  1.00 35.47  ? 340 PRO B CB    1 
ATOM   5018  C CG    . PRO B  1 312 ? 20.043  -9.810  17.136  1.00 35.13  ? 340 PRO B CG    1 
ATOM   5019  C CD    . PRO B  1 312 ? 21.016  -9.705  18.247  1.00 32.93  ? 340 PRO B CD    1 
ATOM   5020  N N     . PHE B  1 313 ? 17.768  -6.506  19.539  1.00 27.18  ? 341 PHE B N     1 
ATOM   5021  C CA    . PHE B  1 313 ? 16.912  -6.121  20.647  1.00 29.28  ? 341 PHE B CA    1 
ATOM   5022  C C     . PHE B  1 313 ? 15.628  -5.451  20.199  1.00 27.24  ? 341 PHE B C     1 
ATOM   5023  O O     . PHE B  1 313 ? 14.977  -4.798  21.014  1.00 26.19  ? 341 PHE B O     1 
ATOM   5024  C CB    . PHE B  1 313 ? 17.680  -5.209  21.628  1.00 29.99  ? 341 PHE B CB    1 
ATOM   5025  C CG    . PHE B  1 313 ? 18.071  -3.869  21.054  1.00 30.66  ? 341 PHE B CG    1 
ATOM   5026  C CD1   . PHE B  1 313 ? 17.328  -2.725  21.341  1.00 33.49  ? 341 PHE B CD1   1 
ATOM   5027  C CD2   . PHE B  1 313 ? 19.196  -3.741  20.248  1.00 26.61  ? 341 PHE B CD2   1 
ATOM   5028  C CE1   . PHE B  1 313 ? 17.687  -1.478  20.804  1.00 31.09  ? 341 PHE B CE1   1 
ATOM   5029  C CE2   . PHE B  1 313 ? 19.555  -2.506  19.708  1.00 26.26  ? 341 PHE B CE2   1 
ATOM   5030  C CZ    . PHE B  1 313 ? 18.806  -1.373  19.988  1.00 35.93  ? 341 PHE B CZ    1 
ATOM   5031  N N     . ILE B  1 314 ? 15.258  -5.613  18.924  1.00 28.43  ? 342 ILE B N     1 
ATOM   5032  C CA    . ILE B  1 314 ? 14.060  -4.938  18.378  1.00 25.54  ? 342 ILE B CA    1 
ATOM   5033  C C     . ILE B  1 314 ? 12.811  -5.412  19.125  1.00 26.26  ? 342 ILE B C     1 
ATOM   5034  O O     . ILE B  1 314 ? 12.049  -4.603  19.638  1.00 29.08  ? 342 ILE B O     1 
ATOM   5035  C CB    . ILE B  1 314 ? 13.868  -5.178  16.868  1.00 26.91  ? 342 ILE B CB    1 
ATOM   5036  C CG1   . ILE B  1 314 ? 15.040  -4.588  16.057  1.00 32.27  ? 342 ILE B CG1   1 
ATOM   5037  C CG2   . ILE B  1 314 ? 12.562  -4.544  16.373  1.00 24.44  ? 342 ILE B CG2   1 
ATOM   5038  C CD1   . ILE B  1 314 ? 15.166  -5.164  14.680  1.00 30.16  ? 342 ILE B CD1   1 
ATOM   5039  N N     . LYS B  1 315 ? 12.611  -6.722  19.181  1.00 24.50  ? 343 LYS B N     1 
ATOM   5040  C CA    . LYS B  1 315 ? 11.425  -7.304  19.813  1.00 26.25  ? 343 LYS B CA    1 
ATOM   5041  C C     . LYS B  1 315 ? 11.395  -7.021  21.320  1.00 24.99  ? 343 LYS B C     1 
ATOM   5042  O O     . LYS B  1 315 ? 10.338  -6.729  21.899  1.00 23.53  ? 343 LYS B O     1 
ATOM   5043  C CB    . LYS B  1 315 ? 11.385  -8.815  19.549  1.00 27.77  ? 343 LYS B CB    1 
ATOM   5044  C CG    . LYS B  1 315 ? 10.092  -9.501  20.015  1.00 25.02  ? 343 LYS B CG    1 
ATOM   5045  C CD    . LYS B  1 315 ? 10.288  -11.005 20.257  1.00 33.44  ? 343 LYS B CD    1 
ATOM   5046  C CE    . LYS B  1 315 ? 10.963  -11.239 21.611  1.00 42.36  ? 343 LYS B CE    1 
ATOM   5047  N NZ    . LYS B  1 315 ? 11.508  -12.606 21.757  1.00 40.79  ? 343 LYS B NZ    1 
ATOM   5048  N N     . GLU B  1 316 ? 12.568  -7.107  21.942  1.00 25.68  ? 344 GLU B N     1 
ATOM   5049  C CA    . GLU B  1 316 ? 12.741  -6.910  23.385  1.00 25.22  ? 344 GLU B CA    1 
ATOM   5050  C C     . GLU B  1 316 ? 12.513  -5.457  23.790  1.00 26.33  ? 344 GLU B C     1 
ATOM   5051  O O     . GLU B  1 316 ? 11.900  -5.215  24.819  1.00 28.77  ? 344 GLU B O     1 
ATOM   5052  C CB    . GLU B  1 316 ? 14.155  -7.360  23.801  1.00 24.10  ? 344 GLU B CB    1 
ATOM   5053  C CG    . GLU B  1 316 ? 14.348  -8.873  23.676  1.00 28.29  ? 344 GLU B CG    1 
ATOM   5054  C CD    . GLU B  1 316 ? 14.652  -9.361  22.247  1.00 42.94  ? 344 GLU B CD    1 
ATOM   5055  O OE1   . GLU B  1 316 ? 14.581  -8.568  21.267  1.00 33.14  ? 344 GLU B OE1   1 
ATOM   5056  O OE2   . GLU B  1 316 ? 14.947  -10.565 22.113  1.00 37.73  ? 344 GLU B OE2   1 
ATOM   5057  N N     . ALA B  1 317 ? 12.975  -4.503  22.969  1.00 26.42  ? 345 ALA B N     1 
ATOM   5058  C CA    . ALA B  1 317 ? 12.703  -3.065  23.174  1.00 25.03  ? 345 ALA B CA    1 
ATOM   5059  C C     . ALA B  1 317 ? 11.206  -2.742  23.091  1.00 25.66  ? 345 ALA B C     1 
ATOM   5060  O O     . ALA B  1 317 ? 10.661  -1.962  23.901  1.00 25.02  ? 345 ALA B O     1 
ATOM   5061  C CB    . ALA B  1 317 ? 13.464  -2.235  22.144  1.00 25.36  ? 345 ALA B CB    1 
ATOM   5062  N N     . ALA B  1 318 ? 10.566  -3.336  22.084  1.00 19.64  ? 346 ALA B N     1 
ATOM   5063  C CA    . ALA B  1 318 ? 9.120   -3.217  21.858  1.00 22.69  ? 346 ALA B CA    1 
ATOM   5064  C C     . ALA B  1 318 ? 8.303   -3.752  23.036  1.00 20.35  ? 346 ALA B C     1 
ATOM   5065  O O     . ALA B  1 318 ? 7.313   -3.121  23.460  1.00 23.27  ? 346 ALA B O     1 
ATOM   5066  C CB    . ALA B  1 318 ? 8.741   -3.965  20.557  1.00 16.53  ? 346 ALA B CB    1 
ATOM   5067  N N     . MET B  1 319 ? 8.674   -4.940  23.520  1.00 20.30  ? 347 MET B N     1 
ATOM   5068  C CA    . MET B  1 319 ? 8.061   -5.528  24.709  1.00 24.88  ? 347 MET B CA    1 
ATOM   5069  C C     . MET B  1 319 ? 8.238   -4.662  25.976  1.00 23.94  ? 347 MET B C     1 
ATOM   5070  O O     . MET B  1 319 ? 7.293   -4.438  26.728  1.00 18.96  ? 347 MET B O     1 
ATOM   5071  C CB    . MET B  1 319 ? 8.633   -6.919  24.982  1.00 27.35  ? 347 MET B CB    1 
ATOM   5072  C CG    . MET B  1 319 ? 8.176   -8.014  24.030  1.00 29.08  ? 347 MET B CG    1 
ATOM   5073  S SD    . MET B  1 319 ? 8.574   -9.647  24.690  1.00 30.57  ? 347 MET B SD    1 
ATOM   5074  C CE    . MET B  1 319 ? 7.779   -10.702 23.439  1.00 26.80  ? 347 MET B CE    1 
ATOM   5075  N N     . ALA B  1 320 ? 9.454   -4.171  26.190  1.00 24.56  ? 348 ALA B N     1 
ATOM   5076  C CA    . ALA B  1 320 ? 9.750   -3.279  27.327  1.00 23.18  ? 348 ALA B CA    1 
ATOM   5077  C C     . ALA B  1 320 ? 8.897   -2.005  27.295  1.00 22.26  ? 348 ALA B C     1 
ATOM   5078  O O     . ALA B  1 320 ? 8.228   -1.687  28.271  1.00 22.31  ? 348 ALA B O     1 
ATOM   5079  C CB    . ALA B  1 320 ? 11.245  -2.940  27.340  1.00 20.65  ? 348 ALA B CB    1 
ATOM   5080  N N     . LYS B  1 321 ? 8.840   -1.339  26.147  1.00 24.27  ? 349 LYS B N     1 
ATOM   5081  C CA    . LYS B  1 321 ? 8.075   -0.097  26.000  1.00 22.03  ? 349 LYS B CA    1 
ATOM   5082  C C     . LYS B  1 321 ? 6.576   -0.329  26.211  1.00 21.96  ? 349 LYS B C     1 
ATOM   5083  O O     . LYS B  1 321 ? 5.923   0.431   26.909  1.00 24.47  ? 349 LYS B O     1 
ATOM   5084  C CB    . LYS B  1 321 ? 8.347   0.528   24.620  1.00 22.08  ? 349 LYS B CB    1 
ATOM   5085  C CG    . LYS B  1 321 ? 7.882   1.971   24.443  1.00 22.70  ? 349 LYS B CG    1 
ATOM   5086  C CD    . LYS B  1 321 ? 6.428   2.097   24.045  1.00 25.54  ? 349 LYS B CD    1 
ATOM   5087  C CE    . LYS B  1 321 ? 6.141   3.486   23.534  1.00 29.04  ? 349 LYS B CE    1 
ATOM   5088  N NZ    . LYS B  1 321 ? 4.720   3.678   23.211  1.00 25.28  ? 349 LYS B NZ    1 
ATOM   5089  N N     . LEU B  1 322 ? 6.070   -1.396  25.608  1.00 20.11  ? 350 LEU B N     1 
ATOM   5090  C CA    . LEU B  1 322 ? 4.657   -1.803  25.712  1.00 23.90  ? 350 LEU B CA    1 
ATOM   5091  C C     . LEU B  1 322 ? 4.277   -2.146  27.168  1.00 24.06  ? 350 LEU B C     1 
ATOM   5092  O O     . LEU B  1 322 ? 3.332   -1.583  27.725  1.00 18.10  ? 350 LEU B O     1 
ATOM   5093  C CB    . LEU B  1 322 ? 4.400   -2.998  24.775  1.00 20.88  ? 350 LEU B CB    1 
ATOM   5094  C CG    . LEU B  1 322 ? 2.970   -3.588  24.777  1.00 21.68  ? 350 LEU B CG    1 
ATOM   5095  C CD1   . LEU B  1 322 ? 1.965   -2.444  24.574  1.00 20.76  ? 350 LEU B CD1   1 
ATOM   5096  C CD2   . LEU B  1 322 ? 2.766   -4.713  23.736  1.00 25.13  ? 350 LEU B CD2   1 
ATOM   5097  N N     . ALA B  1 323 ? 5.040   -3.053  27.781  1.00 22.90  ? 351 ALA B N     1 
ATOM   5098  C CA    . ALA B  1 323 ? 4.841   -3.430  29.189  1.00 22.55  ? 351 ALA B CA    1 
ATOM   5099  C C     . ALA B  1 323 ? 4.944   -2.240  30.132  1.00 24.26  ? 351 ALA B C     1 
ATOM   5100  O O     . ALA B  1 323 ? 4.092   -2.079  30.990  1.00 21.31  ? 351 ALA B O     1 
ATOM   5101  C CB    . ALA B  1 323 ? 5.838   -4.524  29.629  1.00 20.04  ? 351 ALA B CB    1 
ATOM   5102  N N     . ALA B  1 324 ? 5.980   -1.418  29.963  1.00 24.24  ? 352 ALA B N     1 
ATOM   5103  C CA    . ALA B  1 324 ? 6.259   -0.327  30.891  1.00 24.27  ? 352 ALA B CA    1 
ATOM   5104  C C     . ALA B  1 324 ? 5.207   0.745   30.817  1.00 18.90  ? 352 ALA B C     1 
ATOM   5105  O O     . ALA B  1 324 ? 4.740   1.226   31.854  1.00 23.74  ? 352 ALA B O     1 
ATOM   5106  C CB    . ALA B  1 324 ? 7.630   0.271   30.623  1.00 17.25  ? 352 ALA B CB    1 
ATOM   5107  N N     . SER B  1 325 ? 4.800   1.078   29.584  1.00 21.30  ? 353 SER B N     1 
ATOM   5108  C CA    . SER B  1 325 ? 3.780   2.105   29.320  1.00 22.20  ? 353 SER B CA    1 
ATOM   5109  C C     . SER B  1 325 ? 2.400   1.700   29.814  1.00 17.31  ? 353 SER B C     1 
ATOM   5110  O O     . SER B  1 325 ? 1.640   2.537   30.364  1.00 19.58  ? 353 SER B O     1 
ATOM   5111  C CB    . SER B  1 325 ? 3.711   2.421   27.818  1.00 23.72  ? 353 SER B CB    1 
ATOM   5112  O OG    . SER B  1 325 ? 3.080   1.398   27.063  1.00 23.01  ? 353 SER B OG    1 
ATOM   5113  N N     . GLU B  1 326 ? 2.048   0.442   29.614  1.00 19.69  ? 354 GLU B N     1 
ATOM   5114  C CA    . GLU B  1 326 ? 0.734   -0.031  30.071  1.00 20.86  ? 354 GLU B CA    1 
ATOM   5115  C C     . GLU B  1 326 ? 0.668   -0.139  31.605  1.00 22.99  ? 354 GLU B C     1 
ATOM   5116  O O     . GLU B  1 326 ? -0.392  0.094   32.221  1.00 23.20  ? 354 GLU B O     1 
ATOM   5117  C CB    . GLU B  1 326 ? 0.351   -1.321  29.352  1.00 24.92  ? 354 GLU B CB    1 
ATOM   5118  C CG    . GLU B  1 326 ? 0.077   -1.013  27.866  1.00 29.92  ? 354 GLU B CG    1 
ATOM   5119  C CD    . GLU B  1 326 ? -0.608  -2.121  27.098  1.00 34.69  ? 354 GLU B CD    1 
ATOM   5120  O OE1   . GLU B  1 326 ? -0.595  -3.286  27.542  1.00 35.15  ? 354 GLU B OE1   1 
ATOM   5121  O OE2   . GLU B  1 326 ? -1.160  -1.806  26.029  1.00 32.24  ? 354 GLU B OE2   1 
ATOM   5122  N N     . ALA B  1 327 ? 1.815   -0.449  32.206  1.00 22.46  ? 355 ALA B N     1 
ATOM   5123  C CA    . ALA B  1 327 ? 1.978   -0.499  33.653  1.00 22.91  ? 355 ALA B CA    1 
ATOM   5124  C C     . ALA B  1 327 ? 1.894   0.898   34.264  1.00 24.15  ? 355 ALA B C     1 
ATOM   5125  O O     . ALA B  1 327 ? 1.224   1.082   35.288  1.00 18.79  ? 355 ALA B O     1 
ATOM   5126  C CB    . ALA B  1 327 ? 3.331   -1.181  34.009  1.00 18.50  ? 355 ALA B CB    1 
ATOM   5127  N N     . ALA B  1 328 ? 2.550   1.878   33.627  1.00 21.99  ? 356 ALA B N     1 
ATOM   5128  C CA    . ALA B  1 328 ? 2.494   3.263   34.088  1.00 23.54  ? 356 ALA B CA    1 
ATOM   5129  C C     . ALA B  1 328 ? 1.063   3.772   34.121  1.00 23.42  ? 356 ALA B C     1 
ATOM   5130  O O     . ALA B  1 328 ? 0.690   4.431   35.083  1.00 25.73  ? 356 ALA B O     1 
ATOM   5131  C CB    . ALA B  1 328 ? 3.394   4.202   33.234  1.00 25.22  ? 356 ALA B CB    1 
ATOM   5132  N N     . THR B  1 329 ? 0.247   3.427   33.116  1.00 21.98  ? 357 THR B N     1 
ATOM   5133  C CA    . THR B  1 329 ? -1.155  3.876   33.082  1.00 24.76  ? 357 THR B CA    1 
ATOM   5134  C C     . THR B  1 329 ? -2.042  3.175   34.104  1.00 19.27  ? 357 THR B C     1 
ATOM   5135  O O     . THR B  1 329 ? -2.776  3.850   34.842  1.00 20.69  ? 357 THR B O     1 
ATOM   5136  C CB    . THR B  1 329 ? -1.780  3.799   31.684  1.00 25.86  ? 357 THR B CB    1 
ATOM   5137  O OG1   . THR B  1 329 ? -1.346  4.932   30.926  1.00 29.26  ? 357 THR B OG1   1 
ATOM   5138  C CG2   . THR B  1 329 ? -3.321  3.831   31.762  1.00 20.76  ? 357 THR B CG2   1 
ATOM   5139  N N     . ALA B  1 330 ? -1.950  1.851   34.166  1.00 20.90  ? 358 ALA B N     1 
ATOM   5140  C CA    . ALA B  1 330 ? -2.651  1.053   35.183  1.00 22.68  ? 358 ALA B CA    1 
ATOM   5141  C C     . ALA B  1 330 ? -2.260  1.421   36.652  1.00 21.48  ? 358 ALA B C     1 
ATOM   5142  O O     . ALA B  1 330 ? -3.127  1.560   37.535  1.00 16.42  ? 358 ALA B O     1 
ATOM   5143  C CB    . ALA B  1 330 ? -2.447  -0.453  34.921  1.00 18.34  ? 358 ALA B CB    1 
ATOM   5144  N N     . ILE B  1 331 ? -0.971  1.633   36.904  1.00 16.31  ? 359 ILE B N     1 
ATOM   5145  C CA    . ILE B  1 331 ? -0.516  1.930   38.263  1.00 20.26  ? 359 ILE B CA    1 
ATOM   5146  C C     . ILE B  1 331 ? -0.923  3.353   38.704  1.00 22.97  ? 359 ILE B C     1 
ATOM   5147  O O     . ILE B  1 331 ? -1.385  3.559   39.857  1.00 17.88  ? 359 ILE B O     1 
ATOM   5148  C CB    . ILE B  1 331 ? 1.034   1.745   38.394  1.00 18.09  ? 359 ILE B CB    1 
ATOM   5149  C CG1   . ILE B  1 331 ? 1.439   0.269   38.220  1.00 21.78  ? 359 ILE B CG1   1 
ATOM   5150  C CG2   . ILE B  1 331 ? 1.515   2.314   39.738  1.00 23.65  ? 359 ILE B CG2   1 
ATOM   5151  C CD1   . ILE B  1 331 ? 2.985   0.076   37.854  1.00 17.10  ? 359 ILE B CD1   1 
ATOM   5152  N N     . SER B  1 332 ? -0.779  4.325   37.783  1.00 23.61  ? 360 SER B N     1 
ATOM   5153  C CA    . SER B  1 332 ? -1.166  5.714   38.056  1.00 19.78  ? 360 SER B CA    1 
ATOM   5154  C C     . SER B  1 332 ? -2.669  5.800   38.294  1.00 21.81  ? 360 SER B C     1 
ATOM   5155  O O     . SER B  1 332 ? -3.135  6.507   39.209  1.00 20.48  ? 360 SER B O     1 
ATOM   5156  C CB    . SER B  1 332 ? -0.697  6.672   36.930  1.00 20.13  ? 360 SER B CB    1 
ATOM   5157  O OG    . SER B  1 332 ? -1.383  6.467   35.688  1.00 25.58  ? 360 SER B OG    1 
ATOM   5158  N N     . HIS B  1 333 ? -3.417  5.038   37.507  1.00 19.78  ? 361 HIS B N     1 
ATOM   5159  C CA    . HIS B  1 333 ? -4.854  4.908   37.726  1.00 20.45  ? 361 HIS B CA    1 
ATOM   5160  C C     . HIS B  1 333 ? -5.175  4.404   39.139  1.00 21.42  ? 361 HIS B C     1 
ATOM   5161  O O     . HIS B  1 333 ? -6.031  4.945   39.835  1.00 18.85  ? 361 HIS B O     1 
ATOM   5162  C CB    . HIS B  1 333 ? -5.486  3.986   36.706  1.00 23.27  ? 361 HIS B CB    1 
ATOM   5163  C CG    . HIS B  1 333 ? -6.985  3.960   36.808  1.00 16.56  ? 361 HIS B CG    1 
ATOM   5164  N ND1   . HIS B  1 333 ? -7.652  3.127   37.683  1.00 24.28  ? 361 HIS B ND1   1 
ATOM   5165  C CD2   . HIS B  1 333 ? -7.933  4.706   36.199  1.00 26.31  ? 361 HIS B CD2   1 
ATOM   5166  C CE1   . HIS B  1 333 ? -8.952  3.356   37.596  1.00 25.72  ? 361 HIS B CE1   1 
ATOM   5167  N NE2   . HIS B  1 333 ? -9.148  4.311   36.704  1.00 16.97  ? 361 HIS B NE2   1 
ATOM   5168  N N     . GLN B  1 334 ? -4.461  3.376   39.577  1.00 23.71  ? 362 GLN B N     1 
ATOM   5169  C CA    . GLN B  1 334 ? -4.749  2.799   40.876  1.00 25.44  ? 362 GLN B CA    1 
ATOM   5170  C C     . GLN B  1 334 ? -4.229  3.685   42.002  1.00 21.35  ? 362 GLN B C     1 
ATOM   5171  O O     . GLN B  1 334 ? -4.744  3.643   43.083  1.00 17.10  ? 362 GLN B O     1 
ATOM   5172  C CB    . GLN B  1 334 ? -4.209  1.361   40.990  1.00 26.73  ? 362 GLN B CB    1 
ATOM   5173  C CG    . GLN B  1 334 ? -5.092  0.312   40.278  1.00 27.15  ? 362 GLN B CG    1 
ATOM   5174  C CD    . GLN B  1 334 ? -6.564  0.357   40.703  1.00 36.32  ? 362 GLN B CD    1 
ATOM   5175  O OE1   . GLN B  1 334 ? -6.925  -0.138  41.765  1.00 34.65  ? 362 GLN B OE1   1 
ATOM   5176  N NE2   . GLN B  1 334 ? -7.410  0.947   39.865  1.00 37.83  ? 362 GLN B NE2   1 
ATOM   5177  N N     . ALA B  1 335 ? -3.191  4.469   41.729  1.00 22.12  ? 363 ALA B N     1 
ATOM   5178  C CA    . ALA B  1 335 ? -2.695  5.442   42.670  1.00 23.17  ? 363 ALA B CA    1 
ATOM   5179  C C     . ALA B  1 335 ? -3.776  6.479   43.001  1.00 23.35  ? 363 ALA B C     1 
ATOM   5180  O O     . ALA B  1 335 ? -4.012  6.771   44.183  1.00 24.90  ? 363 ALA B O     1 
ATOM   5181  C CB    . ALA B  1 335 ? -1.445  6.110   42.125  1.00 21.39  ? 363 ALA B CB    1 
ATOM   5182  N N     . ILE B  1 336 ? -4.431  7.011   41.961  1.00 21.36  ? 364 ILE B N     1 
ATOM   5183  C CA    . ILE B  1 336 ? -5.549  7.929   42.132  1.00 21.03  ? 364 ILE B CA    1 
ATOM   5184  C C     . ILE B  1 336 ? -6.652  7.235   42.926  1.00 19.66  ? 364 ILE B C     1 
ATOM   5185  O O     . ILE B  1 336 ? -7.244  7.862   43.824  1.00 19.23  ? 364 ILE B O     1 
ATOM   5186  C CB    . ILE B  1 336 ? -6.158  8.457   40.773  1.00 19.40  ? 364 ILE B CB    1 
ATOM   5187  C CG1   . ILE B  1 336 ? -5.187  9.368   40.024  1.00 21.81  ? 364 ILE B CG1   1 
ATOM   5188  C CG2   . ILE B  1 336 ? -7.517  9.232   41.014  1.00 16.50  ? 364 ILE B CG2   1 
ATOM   5189  C CD1   . ILE B  1 336 ? -5.676  9.884   38.670  1.00 18.55  ? 364 ILE B CD1   1 
ATOM   5190  N N     . GLN B  1 337 ? -6.938  5.969   42.600  1.00 19.50  ? 365 GLN B N     1 
ATOM   5191  C CA    . GLN B  1 337 ? -8.043  5.262   43.295  1.00 18.77  ? 365 GLN B CA    1 
ATOM   5192  C C     . GLN B  1 337 ? -7.743  5.091   44.798  1.00 21.74  ? 365 GLN B C     1 
ATOM   5193  O O     . GLN B  1 337 ? -8.607  5.283   45.639  1.00 18.91  ? 365 GLN B O     1 
ATOM   5194  C CB    . GLN B  1 337 ? -8.340  3.882   42.668  1.00 20.61  ? 365 GLN B CB    1 
ATOM   5195  C CG    . GLN B  1 337 ? -9.706  3.328   43.083  1.00 24.78  ? 365 GLN B CG    1 
ATOM   5196  C CD    . GLN B  1 337 ? -10.858 4.108   42.442  1.00 16.48  ? 365 GLN B CD    1 
ATOM   5197  O OE1   . GLN B  1 337 ? -10.629 4.899   41.523  1.00 19.51  ? 365 GLN B OE1   1 
ATOM   5198  N NE2   . GLN B  1 337 ? -12.109 3.858   42.886  1.00 24.46  ? 365 GLN B NE2   1 
ATOM   5199  N N     . ILE B  1 338 ? -6.502  4.730   45.134  1.00 19.93  ? 366 ILE B N     1 
ATOM   5200  C CA    . ILE B  1 338 ? -6.120  4.552   46.545  1.00 22.26  ? 366 ILE B CA    1 
ATOM   5201  C C     . ILE B  1 338 ? -6.199  5.858   47.340  1.00 19.66  ? 366 ILE B C     1 
ATOM   5202  O O     . ILE B  1 338 ? -6.652  5.841   48.483  1.00 18.92  ? 366 ILE B O     1 
ATOM   5203  C CB    . ILE B  1 338 ? -4.725  3.877   46.684  1.00 20.74  ? 366 ILE B CB    1 
ATOM   5204  C CG1   . ILE B  1 338 ? -4.810  2.421   46.226  1.00 23.31  ? 366 ILE B CG1   1 
ATOM   5205  C CG2   . ILE B  1 338 ? -4.198  3.961   48.141  1.00 25.96  ? 366 ILE B CG2   1 
ATOM   5206  C CD1   . ILE B  1 338 ? -3.437  1.798   45.827  1.00 16.83  ? 366 ILE B CD1   1 
ATOM   5207  N N     . LEU B  1 339 ? -5.832  6.975   46.710  1.00 19.39  ? 367 LEU B N     1 
ATOM   5208  C CA    . LEU B  1 339 ? -5.929  8.304   47.297  1.00 24.00  ? 367 LEU B CA    1 
ATOM   5209  C C     . LEU B  1 339 ? -7.377  8.806   47.479  1.00 21.29  ? 367 LEU B C     1 
ATOM   5210  O O     . LEU B  1 339 ? -7.620  9.693   48.276  1.00 24.13  ? 367 LEU B O     1 
ATOM   5211  C CB    . LEU B  1 339 ? -5.131  9.315   46.471  1.00 24.94  ? 367 LEU B CB    1 
ATOM   5212  C CG    . LEU B  1 339 ? -3.702  9.551   46.947  1.00 22.71  ? 367 LEU B CG    1 
ATOM   5213  C CD1   . LEU B  1 339 ? -2.894  8.225   46.950  1.00 22.89  ? 367 LEU B CD1   1 
ATOM   5214  C CD2   . LEU B  1 339 ? -3.014  10.655  46.100  1.00 24.31  ? 367 LEU B CD2   1 
ATOM   5215  N N     . GLY B  1 340 ? -8.328  8.205   46.778  1.00 26.74  ? 368 GLY B N     1 
ATOM   5216  C CA    . GLY B  1 340 ? -9.723  8.649   46.832  1.00 25.94  ? 368 GLY B CA    1 
ATOM   5217  C C     . GLY B  1 340 ? -9.871  10.053  46.261  1.00 21.75  ? 368 GLY B C     1 
ATOM   5218  O O     . GLY B  1 340 ? -9.251  10.387  45.231  1.00 21.60  ? 368 GLY B O     1 
ATOM   5219  N N     . GLY B  1 341 ? -10.658 10.890  46.942  1.00 20.91  ? 369 GLY B N     1 
ATOM   5220  C CA    . GLY B  1 341 ? -10.796 12.311  46.574  1.00 21.13  ? 369 GLY B CA    1 
ATOM   5221  C C     . GLY B  1 341 ? -9.462  13.043  46.369  1.00 21.13  ? 369 GLY B C     1 
ATOM   5222  O O     . GLY B  1 341 ? -9.284  13.845  45.418  1.00 18.16  ? 369 GLY B O     1 
ATOM   5223  N N     . MET B  1 342 ? -8.515  12.788  47.263  1.00 22.75  ? 370 MET B N     1 
ATOM   5224  C CA    . MET B  1 342 ? -7.202  13.422  47.155  1.00 22.28  ? 370 MET B CA    1 
ATOM   5225  C C     . MET B  1 342 ? -6.501  13.084  45.838  1.00 21.75  ? 370 MET B C     1 
ATOM   5226  O O     . MET B  1 342 ? -5.623  13.839  45.390  1.00 27.43  ? 370 MET B O     1 
ATOM   5227  C CB    . MET B  1 342 ? -6.299  13.021  48.325  1.00 22.58  ? 370 MET B CB    1 
ATOM   5228  C CG    . MET B  1 342 ? -6.602  13.697  49.644  1.00 34.41  ? 370 MET B CG    1 
ATOM   5229  S SD    . MET B  1 342 ? -6.672  15.507  49.563  1.00 33.78  ? 370 MET B SD    1 
ATOM   5230  C CE    . MET B  1 342 ? -5.060  15.966  48.926  1.00 28.61  ? 370 MET B CE    1 
ATOM   5231  N N     . GLY B  1 343 ? -6.861  11.955  45.223  1.00 22.31  ? 371 GLY B N     1 
ATOM   5232  C CA    . GLY B  1 343 ? -6.271  11.555  43.963  1.00 25.81  ? 371 GLY B CA    1 
ATOM   5233  C C     . GLY B  1 343 ? -6.705  12.414  42.789  1.00 26.89  ? 371 GLY B C     1 
ATOM   5234  O O     . GLY B  1 343 ? -6.016  12.482  41.764  1.00 28.22  ? 371 GLY B O     1 
ATOM   5235  N N     . TYR B  1 344 ? -7.843  13.081  42.952  1.00 22.66  ? 372 TYR B N     1 
ATOM   5236  C CA    . TYR B  1 344 ? -8.437  13.910  41.908  1.00 23.33  ? 372 TYR B CA    1 
ATOM   5237  C C     . TYR B  1 344 ? -8.057  15.395  41.968  1.00 24.81  ? 372 TYR B C     1 
ATOM   5238  O O     . TYR B  1 344 ? -8.455  16.164  41.081  1.00 22.75  ? 372 TYR B O     1 
ATOM   5239  C CB    . TYR B  1 344 ? -9.960  13.756  41.984  1.00 23.47  ? 372 TYR B CB    1 
ATOM   5240  C CG    . TYR B  1 344 ? -10.666 13.985  40.672  1.00 23.98  ? 372 TYR B CG    1 
ATOM   5241  C CD1   . TYR B  1 344 ? -10.501 13.095  39.608  1.00 23.68  ? 372 TYR B CD1   1 
ATOM   5242  C CD2   . TYR B  1 344 ? -11.497 15.090  40.494  1.00 23.48  ? 372 TYR B CD2   1 
ATOM   5243  C CE1   . TYR B  1 344 ? -11.164 13.305  38.397  1.00 24.25  ? 372 TYR B CE1   1 
ATOM   5244  C CE2   . TYR B  1 344 ? -12.175 15.309  39.301  1.00 19.42  ? 372 TYR B CE2   1 
ATOM   5245  C CZ    . TYR B  1 344 ? -11.994 14.417  38.247  1.00 22.66  ? 372 TYR B CZ    1 
ATOM   5246  O OH    . TYR B  1 344 ? -12.649 14.604  37.048  1.00 22.86  ? 372 TYR B OH    1 
ATOM   5247  N N     . VAL B  1 345 ? -7.270  15.807  42.974  1.00 24.00  ? 373 VAL B N     1 
ATOM   5248  C CA    . VAL B  1 345 ? -6.880  17.218  43.104  1.00 23.94  ? 373 VAL B CA    1 
ATOM   5249  C C     . VAL B  1 345 ? -5.377  17.418  42.968  1.00 23.77  ? 373 VAL B C     1 
ATOM   5250  O O     . VAL B  1 345 ? -4.606  16.497  43.195  1.00 28.73  ? 373 VAL B O     1 
ATOM   5251  C CB    . VAL B  1 345 ? -7.399  17.843  44.424  1.00 27.13  ? 373 VAL B CB    1 
ATOM   5252  C CG1   . VAL B  1 345 ? -8.912  17.797  44.446  1.00 22.20  ? 373 VAL B CG1   1 
ATOM   5253  C CG2   . VAL B  1 345 ? -6.816  17.118  45.647  1.00 25.69  ? 373 VAL B CG2   1 
ATOM   5254  N N     . THR B  1 346 ? -4.982  18.629  42.591  1.00 23.69  ? 374 THR B N     1 
ATOM   5255  C CA    . THR B  1 346 ? -3.593  18.966  42.341  1.00 27.19  ? 374 THR B CA    1 
ATOM   5256  C C     . THR B  1 346 ? -2.738  19.089  43.640  1.00 28.75  ? 374 THR B C     1 
ATOM   5257  O O     . THR B  1 346 ? -1.512  19.166  43.582  1.00 29.72  ? 374 THR B O     1 
ATOM   5258  C CB    . THR B  1 346 ? -3.476  20.247  41.426  1.00 29.94  ? 374 THR B CB    1 
ATOM   5259  O OG1   . THR B  1 346 ? -3.961  21.407  42.121  1.00 29.11  ? 374 THR B OG1   1 
ATOM   5260  C CG2   . THR B  1 346 ? -4.280  20.063  40.129  1.00 27.40  ? 374 THR B CG2   1 
ATOM   5261  N N     . GLU B  1 347 ? -3.382  19.072  44.798  1.00 30.59  ? 375 GLU B N     1 
ATOM   5262  C CA    . GLU B  1 347 ? -2.663  19.023  46.076  1.00 37.03  ? 375 GLU B CA    1 
ATOM   5263  C C     . GLU B  1 347 ? -1.754  17.797  46.170  1.00 35.30  ? 375 GLU B C     1 
ATOM   5264  O O     . GLU B  1 347 ? -0.726  17.849  46.842  1.00 35.92  ? 375 GLU B O     1 
ATOM   5265  C CB    . GLU B  1 347 ? -3.645  19.028  47.249  1.00 37.19  ? 375 GLU B CB    1 
ATOM   5266  C CG    . GLU B  1 347 ? -3.001  19.184  48.624  1.00 57.66  ? 375 GLU B CG    1 
ATOM   5267  C CD    . GLU B  1 347 ? -3.865  19.976  49.611  1.00 76.52  ? 375 GLU B CD    1 
ATOM   5268  O OE1   . GLU B  1 347 ? -3.300  20.481  50.606  1.00 92.86  ? 375 GLU B OE1   1 
ATOM   5269  O OE2   . GLU B  1 347 ? -5.096  20.103  49.398  1.00 83.75  ? 375 GLU B OE2   1 
ATOM   5270  N N     . MET B  1 348 ? -2.143  16.710  45.500  1.00 30.80  ? 376 MET B N     1 
ATOM   5271  C CA    . MET B  1 348 ? -1.332  15.494  45.425  1.00 28.20  ? 376 MET B CA    1 
ATOM   5272  C C     . MET B  1 348 ? -0.749  15.302  44.007  1.00 26.56  ? 376 MET B C     1 
ATOM   5273  O O     . MET B  1 348 ? -1.275  15.842  43.036  1.00 25.17  ? 376 MET B O     1 
ATOM   5274  C CB    . MET B  1 348 ? -2.180  14.290  45.832  1.00 28.52  ? 376 MET B CB    1 
ATOM   5275  C CG    . MET B  1 348 ? -2.757  14.409  47.228  1.00 35.06  ? 376 MET B CG    1 
ATOM   5276  S SD    . MET B  1 348 ? -1.468  14.214  48.487  1.00 40.31  ? 376 MET B SD    1 
ATOM   5277  C CE    . MET B  1 348 ? -1.488  12.434  48.681  1.00 36.38  ? 376 MET B CE    1 
ATOM   5278  N N     . PRO B  1 349 ? 0.351   14.532  43.892  1.00 23.53  ? 377 PRO B N     1 
ATOM   5279  C CA    . PRO B  1 349 ? 0.978   14.347  42.591  1.00 24.56  ? 377 PRO B CA    1 
ATOM   5280  C C     . PRO B  1 349 ? 0.341   13.234  41.733  1.00 24.70  ? 377 PRO B C     1 
ATOM   5281  O O     . PRO B  1 349 ? 0.735   13.075  40.597  1.00 23.26  ? 377 PRO B O     1 
ATOM   5282  C CB    . PRO B  1 349 ? 2.446   14.025  42.948  1.00 26.20  ? 377 PRO B CB    1 
ATOM   5283  C CG    . PRO B  1 349 ? 2.412   13.458  44.324  1.00 26.52  ? 377 PRO B CG    1 
ATOM   5284  C CD    . PRO B  1 349 ? 1.032   13.772  44.949  1.00 22.96  ? 377 PRO B CD    1 
ATOM   5285  N N     . ALA B  1 350 ? -0.649  12.502  42.259  1.00 25.52  ? 378 ALA B N     1 
ATOM   5286  C CA    . ALA B  1 350 ? -1.248  11.356  41.539  1.00 26.33  ? 378 ALA B CA    1 
ATOM   5287  C C     . ALA B  1 350 ? -1.911  11.722  40.216  1.00 24.23  ? 378 ALA B C     1 
ATOM   5288  O O     . ALA B  1 350 ? -1.727  11.023  39.231  1.00 23.47  ? 378 ALA B O     1 
ATOM   5289  C CB    . ALA B  1 350 ? -2.229  10.600  42.426  1.00 19.56  ? 378 ALA B CB    1 
ATOM   5290  N N     . GLU B  1 351 ? -2.689  12.798  40.192  1.00 27.03  ? 379 GLU B N     1 
ATOM   5291  C CA    . GLU B  1 351 ? -3.379  13.200  38.961  1.00 26.28  ? 379 GLU B CA    1 
ATOM   5292  C C     . GLU B  1 351 ? -2.383  13.601  37.849  1.00 24.91  ? 379 GLU B C     1 
ATOM   5293  O O     . GLU B  1 351 ? -2.612  13.357  36.668  1.00 21.27  ? 379 GLU B O     1 
ATOM   5294  C CB    . GLU B  1 351 ? -4.460  14.261  39.251  1.00 28.33  ? 379 GLU B CB    1 
ATOM   5295  C CG    . GLU B  1 351 ? -3.960  15.633  39.676  1.00 28.64  ? 379 GLU B CG    1 
ATOM   5296  C CD    . GLU B  1 351 ? -3.607  16.534  38.512  1.00 34.92  ? 379 GLU B CD    1 
ATOM   5297  O OE1   . GLU B  1 351 ? -2.617  17.289  38.605  1.00 27.23  ? 379 GLU B OE1   1 
ATOM   5298  O OE2   . GLU B  1 351 ? -4.327  16.500  37.498  1.00 30.79  ? 379 GLU B OE2   1 
ATOM   5299  N N     . ARG B  1 352 ? -1.253  14.174  38.240  1.00 22.69  ? 380 ARG B N     1 
ATOM   5300  C CA    . ARG B  1 352 ? -0.187  14.440  37.311  1.00 24.86  ? 380 ARG B CA    1 
ATOM   5301  C C     . ARG B  1 352 ? 0.474   13.158  36.786  1.00 25.55  ? 380 ARG B C     1 
ATOM   5302  O O     . ARG B  1 352 ? 0.871   13.091  35.620  1.00 25.84  ? 380 ARG B O     1 
ATOM   5303  C CB    . ARG B  1 352 ? 0.849   15.360  37.955  1.00 22.45  ? 380 ARG B CB    1 
ATOM   5304  C CG    . ARG B  1 352 ? 2.079   15.634  37.059  1.00 29.08  ? 380 ARG B CG    1 
ATOM   5305  C CD    . ARG B  1 352 ? 2.946   16.753  37.595  1.00 28.63  ? 380 ARG B CD    1 
ATOM   5306  N NE    . ARG B  1 352 ? 3.294   16.579  39.004  1.00 38.08  ? 380 ARG B NE    1 
ATOM   5307  C CZ    . ARG B  1 352 ? 4.327   15.871  39.462  1.00 39.90  ? 380 ARG B CZ    1 
ATOM   5308  N NH1   . ARG B  1 352 ? 5.140   15.211  38.644  1.00 38.23  ? 380 ARG B NH1   1 
ATOM   5309  N NH2   . ARG B  1 352 ? 4.526   15.799  40.770  1.00 35.83  ? 380 ARG B NH2   1 
ATOM   5310  N N     . HIS B  1 353 ? 0.617   12.140  37.625  1.00 23.53  ? 381 HIS B N     1 
ATOM   5311  C CA    . HIS B  1 353 ? 1.256   10.908  37.151  1.00 24.60  ? 381 HIS B CA    1 
ATOM   5312  C C     . HIS B  1 353 ? 0.351   10.214  36.119  1.00 21.34  ? 381 HIS B C     1 
ATOM   5313  O O     . HIS B  1 353 ? 0.838   9.666   35.156  1.00 21.85  ? 381 HIS B O     1 
ATOM   5314  C CB    . HIS B  1 353 ? 1.610   9.958   38.296  1.00 20.62  ? 381 HIS B CB    1 
ATOM   5315  C CG    . HIS B  1 353 ? 2.470   10.580  39.358  1.00 22.12  ? 381 HIS B CG    1 
ATOM   5316  N ND1   . HIS B  1 353 ? 3.490   11.466  39.066  1.00 28.57  ? 381 HIS B ND1   1 
ATOM   5317  C CD2   . HIS B  1 353 ? 2.475   10.429  40.705  1.00 24.70  ? 381 HIS B CD2   1 
ATOM   5318  C CE1   . HIS B  1 353 ? 4.073   11.846  40.190  1.00 28.01  ? 381 HIS B CE1   1 
ATOM   5319  N NE2   . HIS B  1 353 ? 3.485   11.220  41.199  1.00 29.88  ? 381 HIS B NE2   1 
ATOM   5320  N N     . TYR B  1 354 ? -0.962  10.284  36.342  1.00 21.58  ? 382 TYR B N     1 
ATOM   5321  C CA    . TYR B  1 354 ? -1.943  9.712   35.439  1.00 22.61  ? 382 TYR B CA    1 
ATOM   5322  C C     . TYR B  1 354 ? -1.861  10.365  34.045  1.00 23.64  ? 382 TYR B C     1 
ATOM   5323  O O     . TYR B  1 354 ? -1.888  9.664   33.017  1.00 22.36  ? 382 TYR B O     1 
ATOM   5324  C CB    . TYR B  1 354 ? -3.337  9.901   36.048  1.00 23.41  ? 382 TYR B CB    1 
ATOM   5325  C CG    . TYR B  1 354 ? -4.477  9.130   35.421  1.00 23.06  ? 382 TYR B CG    1 
ATOM   5326  C CD1   . TYR B  1 354 ? -4.403  7.745   35.186  1.00 27.65  ? 382 TYR B CD1   1 
ATOM   5327  C CD2   . TYR B  1 354 ? -5.686  9.770   35.148  1.00 25.70  ? 382 TYR B CD2   1 
ATOM   5328  C CE1   . TYR B  1 354 ? -5.514  7.049   34.661  1.00 22.97  ? 382 TYR B CE1   1 
ATOM   5329  C CE2   . TYR B  1 354 ? -6.759  9.102   34.630  1.00 24.95  ? 382 TYR B CE2   1 
ATOM   5330  C CZ    . TYR B  1 354 ? -6.685  7.746   34.391  1.00 28.85  ? 382 TYR B CZ    1 
ATOM   5331  O OH    . TYR B  1 354 ? -7.804  7.121   33.869  1.00 23.51  ? 382 TYR B OH    1 
ATOM   5332  N N     . ARG B  1 355 ? -1.750  11.694  34.039  1.00 22.86  ? 383 ARG B N     1 
ATOM   5333  C CA    . ARG B  1 355 ? -1.632  12.499  32.818  1.00 23.53  ? 383 ARG B CA    1 
ATOM   5334  C C     . ARG B  1 355 ? -0.304  12.262  32.072  1.00 22.55  ? 383 ARG B C     1 
ATOM   5335  O O     . ARG B  1 355 ? -0.290  12.138  30.844  1.00 24.72  ? 383 ARG B O     1 
ATOM   5336  C CB    . ARG B  1 355 ? -1.834  13.985  33.137  1.00 18.54  ? 383 ARG B CB    1 
ATOM   5337  C CG    . ARG B  1 355 ? -3.275  14.364  33.554  1.00 22.21  ? 383 ARG B CG    1 
ATOM   5338  C CD    . ARG B  1 355 ? -3.496  15.892  33.745  1.00 25.70  ? 383 ARG B CD    1 
ATOM   5339  N NE    . ARG B  1 355 ? -2.830  16.418  34.937  1.00 23.47  ? 383 ARG B NE    1 
ATOM   5340  C CZ    . ARG B  1 355 ? -1.688  17.096  34.952  1.00 21.92  ? 383 ARG B CZ    1 
ATOM   5341  N NH1   . ARG B  1 355 ? -1.030  17.394  33.838  1.00 21.54  ? 383 ARG B NH1   1 
ATOM   5342  N NH2   . ARG B  1 355 ? -1.196  17.493  36.116  1.00 29.73  ? 383 ARG B NH2   1 
ATOM   5343  N N     . ASP B  1 356 ? 0.792   12.187  32.811  1.00 25.36  ? 384 ASP B N     1 
ATOM   5344  C CA    . ASP B  1 356 ? 2.116   11.910  32.250  1.00 25.85  ? 384 ASP B CA    1 
ATOM   5345  C C     . ASP B  1 356 ? 2.278   10.484  31.656  1.00 26.16  ? 384 ASP B C     1 
ATOM   5346  O O     . ASP B  1 356 ? 2.850   10.308  30.551  1.00 24.78  ? 384 ASP B O     1 
ATOM   5347  C CB    . ASP B  1 356 ? 3.210   12.144  33.301  1.00 28.30  ? 384 ASP B CB    1 
ATOM   5348  C CG    . ASP B  1 356 ? 3.402   13.629  33.667  1.00 38.41  ? 384 ASP B CG    1 
ATOM   5349  O OD1   . ASP B  1 356 ? 2.890   14.512  32.926  1.00 29.66  ? 384 ASP B OD1   1 
ATOM   5350  O OD2   . ASP B  1 356 ? 4.069   13.903  34.714  1.00 31.53  ? 384 ASP B OD2   1 
ATOM   5351  N N     . ALA B  1 357 ? 1.824   9.489   32.413  1.00 24.15  ? 385 ALA B N     1 
ATOM   5352  C CA    . ALA B  1 357 ? 1.804   8.086   31.999  1.00 23.53  ? 385 ALA B CA    1 
ATOM   5353  C C     . ALA B  1 357 ? 1.169   7.888   30.612  1.00 20.46  ? 385 ALA B C     1 
ATOM   5354  O O     . ALA B  1 357 ? 1.650   7.092   29.798  1.00 22.57  ? 385 ALA B O     1 
ATOM   5355  C CB    . ALA B  1 357 ? 1.054   7.233   33.051  1.00 19.38  ? 385 ALA B CB    1 
ATOM   5356  N N     . ARG B  1 358 ? 0.094   8.622   30.359  1.00 22.89  ? 386 ARG B N     1 
ATOM   5357  C CA    . ARG B  1 358 ? -0.746  8.393   29.199  1.00 22.81  ? 386 ARG B CA    1 
ATOM   5358  C C     . ARG B  1 358 ? 0.016   8.572   27.882  1.00 26.40  ? 386 ARG B C     1 
ATOM   5359  O O     . ARG B  1 358 ? -0.282  7.880   26.912  1.00 22.97  ? 386 ARG B O     1 
ATOM   5360  C CB    . ARG B  1 358 ? -1.987  9.289   29.287  1.00 23.26  ? 386 ARG B CB    1 
ATOM   5361  C CG    . ARG B  1 358 ? -3.079  9.006   28.269  1.00 23.90  ? 386 ARG B CG    1 
ATOM   5362  C CD    . ARG B  1 358 ? -3.599  7.594   28.409  1.00 24.45  ? 386 ARG B CD    1 
ATOM   5363  N NE    . ARG B  1 358 ? -4.415  7.111   27.295  1.00 20.52  ? 386 ARG B NE    1 
ATOM   5364  C CZ    . ARG B  1 358 ? -3.942  6.627   26.141  1.00 16.63  ? 386 ARG B CZ    1 
ATOM   5365  N NH1   . ARG B  1 358 ? -2.641  6.610   25.871  1.00 23.01  ? 386 ARG B NH1   1 
ATOM   5366  N NH2   . ARG B  1 358 ? -4.787  6.166   25.251  1.00 26.03  ? 386 ARG B NH2   1 
ATOM   5367  N N     . ILE B  1 359 ? 1.015   9.465   27.839  1.00 21.79  ? 387 ILE B N     1 
ATOM   5368  C CA    . ILE B  1 359 ? 1.741   9.711   26.581  1.00 25.64  ? 387 ILE B CA    1 
ATOM   5369  C C     . ILE B  1 359 ? 2.601   8.502   26.190  1.00 26.02  ? 387 ILE B C     1 
ATOM   5370  O O     . ILE B  1 359 ? 2.833   8.271   25.010  1.00 23.96  ? 387 ILE B O     1 
ATOM   5371  C CB    . ILE B  1 359 ? 2.660   10.996  26.617  1.00 19.32  ? 387 ILE B CB    1 
ATOM   5372  C CG1   . ILE B  1 359 ? 3.264   11.336  25.231  1.00 23.37  ? 387 ILE B CG1   1 
ATOM   5373  C CG2   . ILE B  1 359 ? 3.860   10.820  27.562  1.00 18.98  ? 387 ILE B CG2   1 
ATOM   5374  C CD1   . ILE B  1 359 ? 2.313   11.492  24.020  1.00 20.97  ? 387 ILE B CD1   1 
ATOM   5375  N N     . THR B  1 360 ? 3.066   7.751   27.193  1.00 25.10  ? 388 THR B N     1 
ATOM   5376  C CA    . THR B  1 360 ? 4.033   6.670   26.982  1.00 24.48  ? 388 THR B CA    1 
ATOM   5377  C C     . THR B  1 360 ? 3.442   5.503   26.174  1.00 24.21  ? 388 THR B C     1 
ATOM   5378  O O     . THR B  1 360 ? 4.193   4.737   25.576  1.00 23.20  ? 388 THR B O     1 
ATOM   5379  C CB    . THR B  1 360 ? 4.662   6.157   28.306  1.00 25.74  ? 388 THR B CB    1 
ATOM   5380  O OG1   . THR B  1 360 ? 3.686   5.450   29.080  1.00 22.43  ? 388 THR B OG1   1 
ATOM   5381  C CG2   . THR B  1 360 ? 5.241   7.330   29.129  1.00 18.71  ? 388 THR B CG2   1 
ATOM   5382  N N     . GLU B  1 361 ? 2.109   5.390   26.159  1.00 19.48  ? 389 GLU B N     1 
ATOM   5383  C CA    . GLU B  1 361 ? 1.410   4.444   25.280  1.00 22.42  ? 389 GLU B CA    1 
ATOM   5384  C C     . GLU B  1 361 ? 1.295   4.914   23.812  1.00 23.34  ? 389 GLU B C     1 
ATOM   5385  O O     . GLU B  1 361 ? 0.830   4.159   22.939  1.00 24.30  ? 389 GLU B O     1 
ATOM   5386  C CB    . GLU B  1 361 ? 0.027   4.170   25.822  1.00 21.61  ? 389 GLU B CB    1 
ATOM   5387  C CG    . GLU B  1 361 ? 0.015   3.738   27.273  1.00 22.34  ? 389 GLU B CG    1 
ATOM   5388  C CD    . GLU B  1 361 ? -1.374  3.381   27.743  1.00 32.14  ? 389 GLU B CD    1 
ATOM   5389  O OE1   . GLU B  1 361 ? -1.763  2.229   27.505  1.00 36.81  ? 389 GLU B OE1   1 
ATOM   5390  O OE2   . GLU B  1 361 ? -2.066  4.236   28.359  1.00 25.92  ? 389 GLU B OE2   1 
ATOM   5391  N N     . ILE B  1 362 ? 1.703   6.150   23.538  1.00 23.35  ? 390 ILE B N     1 
ATOM   5392  C CA    . ILE B  1 362 ? 1.469   6.749   22.216  1.00 26.02  ? 390 ILE B CA    1 
ATOM   5393  C C     . ILE B  1 362 ? 2.756   6.999   21.473  1.00 26.71  ? 390 ILE B C     1 
ATOM   5394  O O     . ILE B  1 362 ? 2.962   6.479   20.374  1.00 23.95  ? 390 ILE B O     1 
ATOM   5395  C CB    . ILE B  1 362 ? 0.665   8.069   22.325  1.00 23.55  ? 390 ILE B CB    1 
ATOM   5396  C CG1   . ILE B  1 362 ? -0.715  7.778   22.910  1.00 23.05  ? 390 ILE B CG1   1 
ATOM   5397  C CG2   . ILE B  1 362 ? 0.609   8.779   20.955  1.00 20.85  ? 390 ILE B CG2   1 
ATOM   5398  C CD1   . ILE B  1 362 ? -1.471  9.009   23.357  1.00 24.53  ? 390 ILE B CD1   1 
ATOM   5399  N N     . TYR B  1 363 ? 3.625   7.816   22.049  1.00 29.03  ? 391 TYR B N     1 
ATOM   5400  C CA    . TYR B  1 363 ? 4.815   8.177   21.305  1.00 25.33  ? 391 TYR B CA    1 
ATOM   5401  C C     . TYR B  1 363 ? 5.893   7.086   21.234  1.00 28.39  ? 391 TYR B C     1 
ATOM   5402  O O     . TYR B  1 363 ? 5.898   6.129   22.005  1.00 26.24  ? 391 TYR B O     1 
ATOM   5403  C CB    . TYR B  1 363 ? 5.357   9.564   21.673  1.00 26.25  ? 391 TYR B CB    1 
ATOM   5404  C CG    . TYR B  1 363 ? 5.901   9.827   23.063  1.00 27.66  ? 391 TYR B CG    1 
ATOM   5405  C CD1   . TYR B  1 363 ? 6.273   11.125  23.402  1.00 29.80  ? 391 TYR B CD1   1 
ATOM   5406  C CD2   . TYR B  1 363 ? 6.040   8.830   24.031  1.00 22.54  ? 391 TYR B CD2   1 
ATOM   5407  C CE1   . TYR B  1 363 ? 6.754   11.436  24.647  1.00 27.79  ? 391 TYR B CE1   1 
ATOM   5408  C CE2   . TYR B  1 363 ? 6.520   9.131   25.298  1.00 23.01  ? 391 TYR B CE2   1 
ATOM   5409  C CZ    . TYR B  1 363 ? 6.886   10.446  25.587  1.00 28.34  ? 391 TYR B CZ    1 
ATOM   5410  O OH    . TYR B  1 363 ? 7.369   10.809  26.811  1.00 28.45  ? 391 TYR B OH    1 
ATOM   5411  N N     . GLU B  1 364 ? 6.787   7.265   20.266  1.00 25.29  ? 392 GLU B N     1 
ATOM   5412  C CA    . GLU B  1 364 ? 7.764   6.257   19.861  1.00 29.69  ? 392 GLU B CA    1 
ATOM   5413  C C     . GLU B  1 364 ? 7.104   4.941   19.419  1.00 27.67  ? 392 GLU B C     1 
ATOM   5414  O O     . GLU B  1 364 ? 7.663   3.869   19.547  1.00 29.95  ? 392 GLU B O     1 
ATOM   5415  C CB    . GLU B  1 364 ? 8.823   6.095   20.953  1.00 29.32  ? 392 GLU B CB    1 
ATOM   5416  C CG    . GLU B  1 364 ? 9.440   7.449   21.314  1.00 38.27  ? 392 GLU B CG    1 
ATOM   5417  C CD    . GLU B  1 364 ? 10.909  7.383   21.622  1.00 38.68  ? 392 GLU B CD    1 
ATOM   5418  O OE1   . GLU B  1 364 ? 11.525  6.347   21.329  1.00 42.31  ? 392 GLU B OE1   1 
ATOM   5419  O OE2   . GLU B  1 364 ? 11.447  8.371   22.169  1.00 47.63  ? 392 GLU B OE2   1 
ATOM   5420  N N     . GLY B  1 365 ? 5.919   5.061   18.832  1.00 27.32  ? 393 GLY B N     1 
ATOM   5421  C CA    . GLY B  1 365 ? 5.170   3.902   18.377  1.00 26.12  ? 393 GLY B CA    1 
ATOM   5422  C C     . GLY B  1 365 ? 4.100   3.537   19.366  1.00 21.50  ? 393 GLY B C     1 
ATOM   5423  O O     . GLY B  1 365 ? 4.391   3.138   20.516  1.00 24.59  ? 393 GLY B O     1 
ATOM   5424  N N     . THR B  1 366 ? 2.855   3.671   18.926  1.00 21.97  ? 394 THR B N     1 
ATOM   5425  C CA    . THR B  1 366 ? 1.725   3.371   19.766  1.00 19.92  ? 394 THR B CA    1 
ATOM   5426  C C     . THR B  1 366 ? 1.815   1.928   20.248  1.00 17.55  ? 394 THR B C     1 
ATOM   5427  O O     . THR B  1 366 ? 2.542   1.107   19.664  1.00 24.88  ? 394 THR B O     1 
ATOM   5428  C CB    . THR B  1 366 ? 0.397   3.532   19.004  1.00 20.63  ? 394 THR B CB    1 
ATOM   5429  O OG1   . THR B  1 366 ? 0.320   2.540   17.975  1.00 23.09  ? 394 THR B OG1   1 
ATOM   5430  C CG2   . THR B  1 366 ? 0.261   4.913   18.389  1.00 25.84  ? 394 THR B CG2   1 
ATOM   5431  N N     . SER B  1 367 ? 1.048   1.612   21.280  1.00 24.90  ? 395 SER B N     1 
ATOM   5432  C CA    . SER B  1 367 ? 0.961   0.247   21.794  1.00 26.88  ? 395 SER B CA    1 
ATOM   5433  C C     . SER B  1 367 ? 0.619   -0.742  20.682  1.00 22.49  ? 395 SER B C     1 
ATOM   5434  O O     . SER B  1 367 ? 1.145   -1.867  20.666  1.00 23.52  ? 395 SER B O     1 
ATOM   5435  C CB    . SER B  1 367 ? -0.066  0.156   22.927  1.00 20.02  ? 395 SER B CB    1 
ATOM   5436  O OG    . SER B  1 367 ? 0.315   0.963   24.033  1.00 20.69  ? 395 SER B OG    1 
ATOM   5437  N N     . GLU B  1 368 ? -0.235  -0.318  19.752  1.00 25.09  ? 396 GLU B N     1 
ATOM   5438  C CA    . GLU B  1 368 ? -0.653  -1.156  18.617  1.00 23.38  ? 396 GLU B CA    1 
ATOM   5439  C C     . GLU B  1 368 ? 0.510   -1.470  17.655  1.00 22.66  ? 396 GLU B C     1 
ATOM   5440  O O     . GLU B  1 368 ? 0.666   -2.595  17.197  1.00 24.43  ? 396 GLU B O     1 
ATOM   5441  C CB    . GLU B  1 368 ? -1.787  -0.489  17.843  1.00 25.31  ? 396 GLU B CB    1 
ATOM   5442  C CG    . GLU B  1 368 ? -3.141  -0.386  18.612  1.00 26.12  ? 396 GLU B CG    1 
ATOM   5443  C CD    . GLU B  1 368 ? -3.090  0.535   19.834  1.00 33.75  ? 396 GLU B CD    1 
ATOM   5444  O OE1   . GLU B  1 368 ? -2.471  1.624   19.708  1.00 22.65  ? 396 GLU B OE1   1 
ATOM   5445  O OE2   . GLU B  1 368 ? -3.689  0.178   20.901  1.00 30.63  ? 396 GLU B OE2   1 
ATOM   5446  N N     . ILE B  1 369 ? 1.320   -0.456  17.358  1.00 19.52  ? 397 ILE B N     1 
ATOM   5447  C CA    . ILE B  1 369 ? 2.516   -0.644  16.572  1.00 23.94  ? 397 ILE B CA    1 
ATOM   5448  C C     . ILE B  1 369 ? 3.471   -1.601  17.295  1.00 21.91  ? 397 ILE B C     1 
ATOM   5449  O O     . ILE B  1 369 ? 4.001   -2.524  16.657  1.00 23.15  ? 397 ILE B O     1 
ATOM   5450  C CB    . ILE B  1 369 ? 3.152   0.701   16.169  1.00 20.44  ? 397 ILE B CB    1 
ATOM   5451  C CG1   . ILE B  1 369 ? 2.515   1.244   14.885  1.00 27.21  ? 397 ILE B CG1   1 
ATOM   5452  C CG2   . ILE B  1 369 ? 4.711   0.564   15.939  1.00 26.05  ? 397 ILE B CG2   1 
ATOM   5453  C CD1   . ILE B  1 369 ? 0.979   1.104   14.769  1.00 28.87  ? 397 ILE B CD1   1 
ATOM   5454  N N     . GLN B  1 370 ? 3.644   -1.433  18.614  1.00 23.16  ? 398 GLN B N     1 
ATOM   5455  C CA    . GLN B  1 370 ? 4.499   -2.354  19.394  1.00 24.35  ? 398 GLN B CA    1 
ATOM   5456  C C     . GLN B  1 370 ? 4.081   -3.823  19.242  1.00 22.33  ? 398 GLN B C     1 
ATOM   5457  O O     . GLN B  1 370 ? 4.920   -4.695  19.012  1.00 20.63  ? 398 GLN B O     1 
ATOM   5458  C CB    . GLN B  1 370 ? 4.529   -2.001  20.895  1.00 28.11  ? 398 GLN B CB    1 
ATOM   5459  C CG    . GLN B  1 370 ? 4.960   -0.584  21.283  1.00 26.71  ? 398 GLN B CG    1 
ATOM   5460  C CD    . GLN B  1 370 ? 6.244   -0.139  20.652  1.00 30.73  ? 398 GLN B CD    1 
ATOM   5461  O OE1   . GLN B  1 370 ? 7.167   -0.936  20.440  1.00 30.69  ? 398 GLN B OE1   1 
ATOM   5462  N NE2   . GLN B  1 370 ? 6.327   1.145   20.351  1.00 30.94  ? 398 GLN B NE2   1 
ATOM   5463  N N     . ARG B  1 371 ? 2.784   -4.092  19.400  1.00 17.70  ? 399 ARG B N     1 
ATOM   5464  C CA    . ARG B  1 371 ? 2.226   -5.417  19.168  1.00 24.06  ? 399 ARG B CA    1 
ATOM   5465  C C     . ARG B  1 371 ? 2.496   -5.978  17.776  1.00 23.53  ? 399 ARG B C     1 
ATOM   5466  O O     . ARG B  1 371 ? 2.784   -7.169  17.653  1.00 25.05  ? 399 ARG B O     1 
ATOM   5467  C CB    . ARG B  1 371 ? 0.707   -5.425  19.490  1.00 20.68  ? 399 ARG B CB    1 
ATOM   5468  C CG    . ARG B  1 371 ? 0.454   -5.290  20.946  1.00 18.59  ? 399 ARG B CG    1 
ATOM   5469  C CD    . ARG B  1 371 ? -1.041  -5.363  21.328  1.00 28.36  ? 399 ARG B CD    1 
ATOM   5470  N NE    . ARG B  1 371 ? -1.177  -5.551  22.771  1.00 28.31  ? 399 ARG B NE    1 
ATOM   5471  C CZ    . ARG B  1 371 ? -1.388  -4.607  23.693  1.00 30.87  ? 399 ARG B CZ    1 
ATOM   5472  N NH1   . ARG B  1 371 ? -1.514  -3.330  23.366  1.00 30.77  ? 399 ARG B NH1   1 
ATOM   5473  N NH2   . ARG B  1 371 ? -1.467  -4.964  24.977  1.00 27.03  ? 399 ARG B NH2   1 
ATOM   5474  N N     . LEU B  1 372 ? 2.387   -5.143  16.734  1.00 24.31  ? 400 LEU B N     1 
ATOM   5475  C CA    . LEU B  1 372 ? 2.724   -5.559  15.368  1.00 28.54  ? 400 LEU B CA    1 
ATOM   5476  C C     . LEU B  1 372 ? 4.188   -5.940  15.246  1.00 27.96  ? 400 LEU B C     1 
ATOM   5477  O O     . LEU B  1 372 ? 4.497   -6.972  14.652  1.00 24.60  ? 400 LEU B O     1 
ATOM   5478  C CB    . LEU B  1 372 ? 2.408   -4.470  14.331  1.00 26.00  ? 400 LEU B CB    1 
ATOM   5479  C CG    . LEU B  1 372 ? 0.935   -4.271  13.939  1.00 35.36  ? 400 LEU B CG    1 
ATOM   5480  C CD1   . LEU B  1 372 ? 0.866   -3.282  12.770  1.00 33.93  ? 400 LEU B CD1   1 
ATOM   5481  C CD2   . LEU B  1 372 ? 0.216   -5.581  13.571  1.00 33.33  ? 400 LEU B CD2   1 
ATOM   5482  N N     . VAL B  1 373 ? 5.067   -5.105  15.813  1.00 27.17  ? 401 VAL B N     1 
ATOM   5483  C CA    . VAL B  1 373 ? 6.522   -5.325  15.768  1.00 25.60  ? 401 VAL B CA    1 
ATOM   5484  C C     . VAL B  1 373 ? 6.853   -6.629  16.482  1.00 25.73  ? 401 VAL B C     1 
ATOM   5485  O O     . VAL B  1 373 ? 7.597   -7.458  15.949  1.00 29.39  ? 401 VAL B O     1 
ATOM   5486  C CB    . VAL B  1 373 ? 7.360   -4.146  16.395  1.00 28.55  ? 401 VAL B CB    1 
ATOM   5487  C CG1   . VAL B  1 373 ? 8.818   -4.568  16.629  1.00 23.91  ? 401 VAL B CG1   1 
ATOM   5488  C CG2   . VAL B  1 373 ? 7.342   -2.906  15.519  1.00 28.78  ? 401 VAL B CG2   1 
ATOM   5489  N N     . ILE B  1 374 ? 6.289   -6.808  17.682  1.00 26.62  ? 402 ILE B N     1 
ATOM   5490  C CA    . ILE B  1 374 ? 6.482   -8.038  18.451  1.00 27.04  ? 402 ILE B CA    1 
ATOM   5491  C C     . ILE B  1 374 ? 6.012   -9.276  17.662  1.00 25.36  ? 402 ILE B C     1 
ATOM   5492  O O     . ILE B  1 374 ? 6.749   -10.232 17.519  1.00 22.91  ? 402 ILE B O     1 
ATOM   5493  C CB    . ILE B  1 374 ? 5.771   -7.981  19.843  1.00 26.74  ? 402 ILE B CB    1 
ATOM   5494  C CG1   . ILE B  1 374 ? 6.394   -6.917  20.771  1.00 28.51  ? 402 ILE B CG1   1 
ATOM   5495  C CG2   . ILE B  1 374 ? 5.803   -9.344  20.508  1.00 23.22  ? 402 ILE B CG2   1 
ATOM   5496  C CD1   . ILE B  1 374 ? 5.428   -6.427  21.886  1.00 21.64  ? 402 ILE B CD1   1 
ATOM   5497  N N     . ALA B  1 375 ? 4.779   -9.276  17.180  1.00 22.82  ? 403 ALA B N     1 
ATOM   5498  C CA    . ALA B  1 375 ? 4.253   -10.398 16.380  1.00 27.94  ? 403 ALA B CA    1 
ATOM   5499  C C     . ALA B  1 375 ? 5.132   -10.746 15.146  1.00 28.06  ? 403 ALA B C     1 
ATOM   5500  O O     . ALA B  1 375 ? 5.409   -11.919 14.870  1.00 27.10  ? 403 ALA B O     1 
ATOM   5501  C CB    . ALA B  1 375 ? 2.796   -10.117 15.951  1.00 24.66  ? 403 ALA B CB    1 
ATOM   5502  N N     . GLY B  1 376 ? 5.573   -9.734  14.407  1.00 29.31  ? 404 GLY B N     1 
ATOM   5503  C CA    . GLY B  1 376 ? 6.449   -9.964  13.274  1.00 26.89  ? 404 GLY B CA    1 
ATOM   5504  C C     . GLY B  1 376 ? 7.685   -10.758 13.667  1.00 29.37  ? 404 GLY B C     1 
ATOM   5505  O O     . GLY B  1 376 ? 8.029   -11.773 13.027  1.00 27.31  ? 404 GLY B O     1 
ATOM   5506  N N     . HIS B  1 377 ? 8.343   -10.319 14.741  1.00 28.71  ? 405 HIS B N     1 
ATOM   5507  C CA    . HIS B  1 377 ? 9.569   -10.968 15.184  1.00 28.45  ? 405 HIS B CA    1 
ATOM   5508  C C     . HIS B  1 377 ? 9.280   -12.356 15.711  1.00 27.36  ? 405 HIS B C     1 
ATOM   5509  O O     . HIS B  1 377 ? 10.046  -13.279 15.450  1.00 31.72  ? 405 HIS B O     1 
ATOM   5510  C CB    . HIS B  1 377 ? 10.339  -10.104 16.199  1.00 29.36  ? 405 HIS B CB    1 
ATOM   5511  C CG    . HIS B  1 377 ? 11.159  -9.041  15.551  1.00 36.35  ? 405 HIS B CG    1 
ATOM   5512  N ND1   . HIS B  1 377 ? 10.655  -7.792  15.253  1.00 46.77  ? 405 HIS B ND1   1 
ATOM   5513  C CD2   . HIS B  1 377 ? 12.422  -9.065  15.065  1.00 37.31  ? 405 HIS B CD2   1 
ATOM   5514  C CE1   . HIS B  1 377 ? 11.585  -7.081  14.643  1.00 45.86  ? 405 HIS B CE1   1 
ATOM   5515  N NE2   . HIS B  1 377 ? 12.666  -7.831  14.514  1.00 44.01  ? 405 HIS B NE2   1 
ATOM   5516  N N     . LEU B  1 378 ? 8.175   -12.512 16.438  1.00 31.32  ? 406 LEU B N     1 
ATOM   5517  C CA    . LEU B  1 378 ? 7.835   -13.806 16.994  1.00 29.06  ? 406 LEU B CA    1 
ATOM   5518  C C     . LEU B  1 378 ? 7.700   -14.824 15.860  1.00 29.32  ? 406 LEU B C     1 
ATOM   5519  O O     . LEU B  1 378 ? 8.334   -15.882 15.897  1.00 27.16  ? 406 LEU B O     1 
ATOM   5520  C CB    . LEU B  1 378 ? 6.544   -13.744 17.818  1.00 31.30  ? 406 LEU B CB    1 
ATOM   5521  C CG    . LEU B  1 378 ? 6.053   -15.052 18.460  1.00 32.39  ? 406 LEU B CG    1 
ATOM   5522  C CD1   . LEU B  1 378 ? 6.891   -15.409 19.674  1.00 32.98  ? 406 LEU B CD1   1 
ATOM   5523  C CD2   . LEU B  1 378 ? 4.571   -14.950 18.826  1.00 31.10  ? 406 LEU B CD2   1 
ATOM   5524  N N     . LEU B  1 379 ? 6.889   -14.501 14.853  1.00 26.11  ? 407 LEU B N     1 
ATOM   5525  C CA    . LEU B  1 379 ? 6.652   -15.426 13.743  1.00 28.80  ? 407 LEU B CA    1 
ATOM   5526  C C     . LEU B  1 379 ? 7.951   -15.771 12.987  1.00 33.88  ? 407 LEU B C     1 
ATOM   5527  O O     . LEU B  1 379 ? 8.157   -16.942 12.637  1.00 28.92  ? 407 LEU B O     1 
ATOM   5528  C CB    . LEU B  1 379 ? 5.557   -14.884 12.802  1.00 27.92  ? 407 LEU B CB    1 
ATOM   5529  C CG    . LEU B  1 379 ? 4.168   -14.833 13.460  1.00 31.19  ? 407 LEU B CG    1 
ATOM   5530  C CD1   . LEU B  1 379 ? 3.181   -13.993 12.665  1.00 38.60  ? 407 LEU B CD1   1 
ATOM   5531  C CD2   . LEU B  1 379 ? 3.619   -16.238 13.660  1.00 28.15  ? 407 LEU B CD2   1 
ATOM   5532  N N     . ARG B  1 380 ? 8.833   -14.781 12.790  1.00 31.99  ? 408 ARG B N     1 
ATOM   5533  C CA    . ARG B  1 380 ? 10.119  -15.022 12.121  1.00 38.19  ? 408 ARG B CA    1 
ATOM   5534  C C     . ARG B  1 380 ? 11.018  -15.965 12.920  1.00 36.67  ? 408 ARG B C     1 
ATOM   5535  O O     . ARG B  1 380 ? 11.720  -16.799 12.331  1.00 36.32  ? 408 ARG B O     1 
ATOM   5536  C CB    . ARG B  1 380 ? 10.865  -13.715 11.805  1.00 39.01  ? 408 ARG B CB    1 
ATOM   5537  C CG    . ARG B  1 380 ? 10.284  -12.964 10.608  1.00 57.22  ? 408 ARG B CG    1 
ATOM   5538  C CD    . ARG B  1 380 ? 11.248  -11.909 10.065  1.00 71.93  ? 408 ARG B CD    1 
ATOM   5539  N NE    . ARG B  1 380 ? 11.387  -10.756 10.955  1.00 77.77  ? 408 ARG B NE    1 
ATOM   5540  C CZ    . ARG B  1 380 ? 10.491  -9.774  11.085  1.00 78.02  ? 408 ARG B CZ    1 
ATOM   5541  N NH1   . ARG B  1 380 ? 9.351   -9.782  10.395  1.00 78.81  ? 408 ARG B NH1   1 
ATOM   5542  N NH2   . ARG B  1 380 ? 10.734  -8.778  11.926  1.00 73.61  ? 408 ARG B NH2   1 
ATOM   5543  N N     . SER B  1 381 ? 10.971  -15.853 14.248  1.00 35.45  ? 409 SER B N     1 
ATOM   5544  C CA    . SER B  1 381 ? 11.664  -16.793 15.120  1.00 38.37  ? 409 SER B CA    1 
ATOM   5545  C C     . SER B  1 381 ? 11.191  -18.241 14.879  1.00 37.77  ? 409 SER B C     1 
ATOM   5546  O O     . SER B  1 381 ? 12.003  -19.159 14.889  1.00 37.55  ? 409 SER B O     1 
ATOM   5547  C CB    . SER B  1 381 ? 11.505  -16.406 16.597  1.00 39.32  ? 409 SER B CB    1 
ATOM   5548  O OG    . SER B  1 381 ? 10.310  -16.922 17.156  1.00 47.92  ? 409 SER B OG    1 
ATOM   5549  N N     . TYR B  1 382 ? 9.897   -18.441 14.633  1.00 32.87  ? 410 TYR B N     1 
ATOM   5550  C CA    . TYR B  1 382 ? 9.384   -19.779 14.365  1.00 34.31  ? 410 TYR B CA    1 
ATOM   5551  C C     . TYR B  1 382 ? 9.634   -20.241 12.924  1.00 36.35  ? 410 TYR B C     1 
ATOM   5552  O O     . TYR B  1 382 ? 9.474   -21.425 12.627  1.00 39.81  ? 410 TYR B O     1 
ATOM   5553  C CB    . TYR B  1 382 ? 7.878   -19.870 14.650  1.00 29.90  ? 410 TYR B CB    1 
ATOM   5554  C CG    . TYR B  1 382 ? 7.494   -20.015 16.112  1.00 36.52  ? 410 TYR B CG    1 
ATOM   5555  C CD1   . TYR B  1 382 ? 7.381   -18.897 16.938  1.00 32.94  ? 410 TYR B CD1   1 
ATOM   5556  C CD2   . TYR B  1 382 ? 7.188   -21.263 16.657  1.00 39.74  ? 410 TYR B CD2   1 
ATOM   5557  C CE1   . TYR B  1 382 ? 7.008   -19.011 18.264  1.00 36.59  ? 410 TYR B CE1   1 
ATOM   5558  C CE2   . TYR B  1 382 ? 6.801   -21.388 17.988  1.00 36.21  ? 410 TYR B CE2   1 
ATOM   5559  C CZ    . TYR B  1 382 ? 6.717   -20.254 18.791  1.00 32.97  ? 410 TYR B CZ    1 
ATOM   5560  O OH    . TYR B  1 382 ? 6.324   -20.351 20.120  1.00 29.78  ? 410 TYR B OH    1 
ATOM   5561  N N     . ARG B  1 383 ? 9.954   -19.312 12.026  1.00 36.32  ? 411 ARG B N     1 
ATOM   5562  C CA    . ARG B  1 383 ? 10.342  -19.656 10.655  1.00 37.96  ? 411 ARG B CA    1 
ATOM   5563  C C     . ARG B  1 383 ? 11.857  -19.694 10.586  1.00 40.20  ? 411 ARG B C     1 
ATOM   5564  O O     . ARG B  1 383 ? 12.415  -20.612 10.002  1.00 43.15  ? 411 ARG B O     1 
ATOM   5565  C CB    . ARG B  1 383 ? 9.828   -18.614 9.658   1.00 38.42  ? 411 ARG B CB    1 
ATOM   5566  C CG    . ARG B  1 383 ? 8.328   -18.426 9.636   1.00 33.48  ? 411 ARG B CG    1 
ATOM   5567  C CD    . ARG B  1 383 ? 7.962   -17.029 9.150   1.00 38.95  ? 411 ARG B CD    1 
ATOM   5568  N NE    . ARG B  1 383 ? 6.506   -16.832 9.092   1.00 33.48  ? 411 ARG B NE    1 
ATOM   5569  C CZ    . ARG B  1 383 ? 5.919   -15.662 8.861   1.00 41.77  ? 411 ARG B CZ    1 
ATOM   5570  N NH1   . ARG B  1 383 ? 6.650   -14.575 8.628   1.00 43.47  ? 411 ARG B NH1   1 
ATOM   5571  N NH2   . ARG B  1 383 ? 4.586   -15.577 8.832   1.00 37.62  ? 411 ARG B NH2   1 
ATOM   5572  N N     . LEU C  1 6   ? -40.648 -9.324  34.778  1.00 49.86  ? 34  LEU C N     1 
ATOM   5573  C CA    . LEU C  1 6   ? -41.180 -10.295 33.767  1.00 49.31  ? 34  LEU C CA    1 
ATOM   5574  C C     . LEU C  1 6   ? -42.705 -10.369 33.811  1.00 50.38  ? 34  LEU C C     1 
ATOM   5575  O O     . LEU C  1 6   ? -43.304 -10.165 34.868  1.00 52.56  ? 34  LEU C O     1 
ATOM   5576  C CB    . LEU C  1 6   ? -40.605 -11.701 33.991  1.00 46.01  ? 34  LEU C CB    1 
ATOM   5577  C CG    . LEU C  1 6   ? -39.283 -12.029 33.298  1.00 46.92  ? 34  LEU C CG    1 
ATOM   5578  C CD1   . LEU C  1 6   ? -38.681 -13.315 33.861  1.00 45.90  ? 34  LEU C CD1   1 
ATOM   5579  C CD2   . LEU C  1 6   ? -39.469 -12.133 31.786  1.00 53.64  ? 34  LEU C CD2   1 
ATOM   5580  N N     . PRO C  1 7   ? -43.336 -10.669 32.661  1.00 50.67  ? 35  PRO C N     1 
ATOM   5581  C CA    . PRO C  1 7   ? -44.770 -10.977 32.673  1.00 49.65  ? 35  PRO C CA    1 
ATOM   5582  C C     . PRO C  1 7   ? -45.092 -12.203 33.529  1.00 52.13  ? 35  PRO C C     1 
ATOM   5583  O O     . PRO C  1 7   ? -44.200 -13.000 33.820  1.00 53.71  ? 35  PRO C O     1 
ATOM   5584  C CB    . PRO C  1 7   ? -45.094 -11.270 31.196  1.00 48.73  ? 35  PRO C CB    1 
ATOM   5585  C CG    . PRO C  1 7   ? -43.975 -10.669 30.405  1.00 51.97  ? 35  PRO C CG    1 
ATOM   5586  C CD    . PRO C  1 7   ? -42.767 -10.712 31.299  1.00 50.58  ? 35  PRO C CD    1 
ATOM   5587  N N     . GLU C  1 8   ? -46.365 -12.344 33.908  1.00 53.27  ? 36  GLU C N     1 
ATOM   5588  C CA    . GLU C  1 8   ? -46.825 -13.458 34.748  1.00 52.76  ? 36  GLU C CA    1 
ATOM   5589  C C     . GLU C  1 8   ? -46.549 -14.805 34.080  1.00 51.05  ? 36  GLU C C     1 
ATOM   5590  O O     . GLU C  1 8   ? -45.921 -15.691 34.677  1.00 54.97  ? 36  GLU C O     1 
ATOM   5591  C CB    . GLU C  1 8   ? -48.325 -13.322 35.054  1.00 52.04  ? 36  GLU C CB    1 
ATOM   5592  N N     . THR C  1 9   ? -47.008 -14.937 32.837  1.00 48.30  ? 37  THR C N     1 
ATOM   5593  C CA    . THR C  1 9   ? -46.767 -16.137 32.034  1.00 46.99  ? 37  THR C CA    1 
ATOM   5594  C C     . THR C  1 9   ? -45.301 -16.548 32.092  1.00 45.24  ? 37  THR C C     1 
ATOM   5595  O O     . THR C  1 9   ? -44.985 -17.693 32.421  1.00 47.27  ? 37  THR C O     1 
ATOM   5596  C CB    . THR C  1 9   ? -47.149 -15.909 30.556  1.00 48.58  ? 37  THR C CB    1 
ATOM   5597  O OG1   . THR C  1 9   ? -46.566 -14.679 30.103  1.00 57.22  ? 37  THR C OG1   1 
ATOM   5598  C CG2   . THR C  1 9   ? -48.678 -15.845 30.389  1.00 44.64  ? 37  THR C CG2   1 
ATOM   5599  N N     . HIS C  1 10  ? -44.419 -15.597 31.794  1.00 43.77  ? 38  HIS C N     1 
ATOM   5600  C CA    . HIS C  1 10  ? -42.971 -15.855 31.741  1.00 42.99  ? 38  HIS C CA    1 
ATOM   5601  C C     . HIS C  1 10  ? -42.381 -16.222 33.113  1.00 42.29  ? 38  HIS C C     1 
ATOM   5602  O O     . HIS C  1 10  ? -41.394 -16.974 33.181  1.00 41.27  ? 38  HIS C O     1 
ATOM   5603  C CB    . HIS C  1 10  ? -42.237 -14.661 31.107  1.00 42.71  ? 38  HIS C CB    1 
ATOM   5604  C CG    . HIS C  1 10  ? -42.457 -14.543 29.629  1.00 42.92  ? 38  HIS C CG    1 
ATOM   5605  N ND1   . HIS C  1 10  ? -43.702 -14.327 29.077  1.00 56.04  ? 38  HIS C ND1   1 
ATOM   5606  C CD2   . HIS C  1 10  ? -41.597 -14.637 28.588  1.00 51.34  ? 38  HIS C CD2   1 
ATOM   5607  C CE1   . HIS C  1 10  ? -43.598 -14.290 27.761  1.00 47.86  ? 38  HIS C CE1   1 
ATOM   5608  N NE2   . HIS C  1 10  ? -42.331 -14.473 27.438  1.00 43.90  ? 38  HIS C NE2   1 
ATOM   5609  N N     . GLN C  1 11  ? -42.993 -15.712 34.189  1.00 42.46  ? 39  GLN C N     1 
ATOM   5610  C CA    . GLN C  1 11  ? -42.627 -16.083 35.565  1.00 43.08  ? 39  GLN C CA    1 
ATOM   5611  C C     . GLN C  1 11  ? -43.003 -17.533 35.890  1.00 43.20  ? 39  GLN C C     1 
ATOM   5612  O O     . GLN C  1 11  ? -42.223 -18.251 36.535  1.00 43.80  ? 39  GLN C O     1 
ATOM   5613  C CB    . GLN C  1 11  ? -43.289 -15.142 36.580  1.00 42.35  ? 39  GLN C CB    1 
ATOM   5614  N N     . MET C  1 12  ? -44.194 -17.956 35.448  1.00 41.95  ? 40  MET C N     1 
ATOM   5615  C CA    . MET C  1 12  ? -44.649 -19.342 35.619  1.00 42.36  ? 40  MET C CA    1 
ATOM   5616  C C     . MET C  1 12  ? -43.751 -20.296 34.821  1.00 42.06  ? 40  MET C C     1 
ATOM   5617  O O     . MET C  1 12  ? -43.241 -21.286 35.368  1.00 42.81  ? 40  MET C O     1 
ATOM   5618  C CB    . MET C  1 12  ? -46.114 -19.490 35.183  1.00 42.14  ? 40  MET C CB    1 
ATOM   5619  N N     . LEU C  1 13  ? -43.557 -19.976 33.537  1.00 39.94  ? 41  LEU C N     1 
ATOM   5620  C CA    . LEU C  1 13  ? -42.615 -20.690 32.652  1.00 38.41  ? 41  LEU C CA    1 
ATOM   5621  C C     . LEU C  1 13  ? -41.260 -20.916 33.328  1.00 31.65  ? 41  LEU C C     1 
ATOM   5622  O O     . LEU C  1 13  ? -40.718 -22.025 33.320  1.00 34.29  ? 41  LEU C O     1 
ATOM   5623  C CB    . LEU C  1 13  ? -42.390 -19.896 31.355  1.00 36.28  ? 41  LEU C CB    1 
ATOM   5624  C CG    . LEU C  1 13  ? -41.418 -20.537 30.351  1.00 42.07  ? 41  LEU C CG    1 
ATOM   5625  C CD1   . LEU C  1 13  ? -42.069 -21.775 29.724  1.00 36.31  ? 41  LEU C CD1   1 
ATOM   5626  C CD2   . LEU C  1 13  ? -40.939 -19.560 29.261  1.00 40.67  ? 41  LEU C CD2   1 
ATOM   5627  N N     . LEU C  1 14  ? -40.716 -19.850 33.893  1.00 33.98  ? 42  LEU C N     1 
ATOM   5628  C CA    . LEU C  1 14  ? -39.443 -19.909 34.584  1.00 35.08  ? 42  LEU C CA    1 
ATOM   5629  C C     . LEU C  1 14  ? -39.491 -20.954 35.706  1.00 35.91  ? 42  LEU C C     1 
ATOM   5630  O O     . LEU C  1 14  ? -38.580 -21.783 35.826  1.00 31.39  ? 42  LEU C O     1 
ATOM   5631  C CB    . LEU C  1 14  ? -39.058 -18.519 35.122  1.00 36.69  ? 42  LEU C CB    1 
ATOM   5632  C CG    . LEU C  1 14  ? -37.651 -18.357 35.704  1.00 34.43  ? 42  LEU C CG    1 
ATOM   5633  C CD1   . LEU C  1 14  ? -37.144 -16.931 35.518  1.00 41.06  ? 42  LEU C CD1   1 
ATOM   5634  C CD2   . LEU C  1 14  ? -37.648 -18.772 37.180  1.00 37.82  ? 42  LEU C CD2   1 
ATOM   5635  N N     . GLN C  1 15  ? -40.564 -20.926 36.497  1.00 35.44  ? 43  GLN C N     1 
ATOM   5636  C CA    . GLN C  1 15  ? -40.723 -21.859 37.617  1.00 36.77  ? 43  GLN C CA    1 
ATOM   5637  C C     . GLN C  1 15  ? -40.903 -23.314 37.167  1.00 34.42  ? 43  GLN C C     1 
ATOM   5638  O O     . GLN C  1 15  ? -40.338 -24.214 37.790  1.00 37.05  ? 43  GLN C O     1 
ATOM   5639  C CB    . GLN C  1 15  ? -41.879 -21.431 38.541  1.00 38.74  ? 43  GLN C CB    1 
ATOM   5640  C CG    . GLN C  1 15  ? -41.808 -22.038 39.943  1.00 47.22  ? 43  GLN C CG    1 
ATOM   5641  C CD    . GLN C  1 15  ? -40.439 -21.847 40.612  1.00 50.58  ? 43  GLN C CD    1 
ATOM   5642  O OE1   . GLN C  1 15  ? -39.934 -20.726 40.723  1.00 56.54  ? 43  GLN C OE1   1 
ATOM   5643  N NE2   . GLN C  1 15  ? -39.833 -22.949 41.043  1.00 50.25  ? 43  GLN C NE2   1 
ATOM   5644  N N     . THR C  1 16  ? -41.673 -23.543 36.098  1.00 33.12  ? 44  THR C N     1 
ATOM   5645  C CA    . THR C  1 16  ? -41.789 -24.865 35.486  1.00 33.20  ? 44  THR C CA    1 
ATOM   5646  C C     . THR C  1 16  ? -40.408 -25.385 35.015  1.00 34.66  ? 44  THR C C     1 
ATOM   5647  O O     . THR C  1 16  ? -40.033 -26.554 35.249  1.00 31.71  ? 44  THR C O     1 
ATOM   5648  C CB    . THR C  1 16  ? -42.759 -24.816 34.273  1.00 38.43  ? 44  THR C CB    1 
ATOM   5649  O OG1   . THR C  1 16  ? -44.080 -24.498 34.728  1.00 40.16  ? 44  THR C OG1   1 
ATOM   5650  C CG2   . THR C  1 16  ? -42.787 -26.149 33.501  1.00 36.01  ? 44  THR C CG2   1 
ATOM   5651  N N     . CYS C  1 17  ? -39.650 -24.511 34.363  1.00 33.10  ? 45  CYS C N     1 
ATOM   5652  C CA    . CYS C  1 17  ? -38.356 -24.909 33.804  1.00 31.86  ? 45  CYS C CA    1 
ATOM   5653  C C     . CYS C  1 17  ? -37.334 -25.183 34.890  1.00 28.81  ? 45  CYS C C     1 
ATOM   5654  O O     . CYS C  1 17  ? -36.503 -26.084 34.754  1.00 33.82  ? 45  CYS C O     1 
ATOM   5655  C CB    . CYS C  1 17  ? -37.819 -23.849 32.828  1.00 34.86  ? 45  CYS C CB    1 
ATOM   5656  S SG    . CYS C  1 17  ? -38.619 -23.842 31.220  1.00 37.68  ? 45  CYS C SG    1 
ATOM   5657  N N     . ARG C  1 18  ? -37.381 -24.395 35.954  1.00 31.57  ? 46  ARG C N     1 
ATOM   5658  C CA    . ARG C  1 18  ? -36.449 -24.558 37.061  1.00 33.41  ? 46  ARG C CA    1 
ATOM   5659  C C     . ARG C  1 18  ? -36.766 -25.826 37.844  1.00 33.07  ? 46  ARG C C     1 
ATOM   5660  O O     . ARG C  1 18  ? -35.859 -26.548 38.255  1.00 27.96  ? 46  ARG C O     1 
ATOM   5661  C CB    . ARG C  1 18  ? -36.457 -23.332 37.973  1.00 31.77  ? 46  ARG C CB    1 
ATOM   5662  C CG    . ARG C  1 18  ? -35.641 -23.519 39.272  1.00 42.10  ? 46  ARG C CG    1 
ATOM   5663  C CD    . ARG C  1 18  ? -34.588 -22.445 39.491  1.00 50.08  ? 46  ARG C CD    1 
ATOM   5664  N NE    . ARG C  1 18  ? -35.030 -21.102 39.126  1.00 58.88  ? 46  ARG C NE    1 
ATOM   5665  C CZ    . ARG C  1 18  ? -34.212 -20.072 38.918  1.00 66.72  ? 46  ARG C CZ    1 
ATOM   5666  N NH1   . ARG C  1 18  ? -32.890 -20.212 39.029  1.00 66.16  ? 46  ARG C NH1   1 
ATOM   5667  N NH2   . ARG C  1 18  ? -34.718 -18.892 38.587  1.00 65.73  ? 46  ARG C NH2   1 
ATOM   5668  N N     . ASP C  1 19  ? -38.055 -26.105 38.030  1.00 31.04  ? 47  ASP C N     1 
ATOM   5669  C CA    . ASP C  1 19  ? -38.476 -27.345 38.655  1.00 31.98  ? 47  ASP C CA    1 
ATOM   5670  C C     . ASP C  1 19  ? -38.032 -28.532 37.828  1.00 30.71  ? 47  ASP C C     1 
ATOM   5671  O O     . ASP C  1 19  ? -37.431 -29.470 38.350  1.00 32.41  ? 47  ASP C O     1 
ATOM   5672  C CB    . ASP C  1 19  ? -40.001 -27.366 38.837  1.00 32.50  ? 47  ASP C CB    1 
ATOM   5673  C CG    . ASP C  1 19  ? -40.477 -26.420 39.928  1.00 42.76  ? 47  ASP C CG    1 
ATOM   5674  O OD1   . ASP C  1 19  ? -39.623 -25.802 40.617  1.00 42.35  ? 47  ASP C OD1   1 
ATOM   5675  O OD2   . ASP C  1 19  ? -41.712 -26.292 40.098  1.00 50.63  ? 47  ASP C OD2   1 
ATOM   5676  N N     . PHE C  1 20  ? -38.306 -28.492 36.528  1.00 30.34  ? 48  PHE C N     1 
ATOM   5677  C CA    . PHE C  1 20  ? -37.838 -29.548 35.644  1.00 27.92  ? 48  PHE C CA    1 
ATOM   5678  C C     . PHE C  1 20  ? -36.349 -29.784 35.778  1.00 29.81  ? 48  PHE C C     1 
ATOM   5679  O O     . PHE C  1 20  ? -35.910 -30.929 35.893  1.00 30.69  ? 48  PHE C O     1 
ATOM   5680  C CB    . PHE C  1 20  ? -38.179 -29.242 34.186  1.00 29.20  ? 48  PHE C CB    1 
ATOM   5681  C CG    . PHE C  1 20  ? -37.862 -30.363 33.257  1.00 31.18  ? 48  PHE C CG    1 
ATOM   5682  C CD1   . PHE C  1 20  ? -38.779 -31.377 33.045  1.00 33.98  ? 48  PHE C CD1   1 
ATOM   5683  C CD2   . PHE C  1 20  ? -36.643 -30.414 32.597  1.00 29.79  ? 48  PHE C CD2   1 
ATOM   5684  C CE1   . PHE C  1 20  ? -38.486 -32.417 32.174  1.00 40.99  ? 48  PHE C CE1   1 
ATOM   5685  C CE2   . PHE C  1 20  ? -36.335 -31.454 31.745  1.00 40.32  ? 48  PHE C CE2   1 
ATOM   5686  C CZ    . PHE C  1 20  ? -37.255 -32.464 31.535  1.00 34.16  ? 48  PHE C CZ    1 
ATOM   5687  N N     . ALA C  1 21  ? -35.573 -28.701 35.754  1.00 30.06  ? 49  ALA C N     1 
ATOM   5688  C CA    . ALA C  1 21  ? -34.118 -28.779 35.787  1.00 31.05  ? 49  ALA C CA    1 
ATOM   5689  C C     . ALA C  1 21  ? -33.602 -29.426 37.076  1.00 30.31  ? 49  ALA C C     1 
ATOM   5690  O O     . ALA C  1 21  ? -32.728 -30.287 37.040  1.00 27.31  ? 49  ALA C O     1 
ATOM   5691  C CB    . ALA C  1 21  ? -33.532 -27.400 35.626  1.00 32.78  ? 49  ALA C CB    1 
ATOM   5692  N N     . GLU C  1 22  ? -34.151 -28.984 38.204  1.00 32.84  ? 50  GLU C N     1 
ATOM   5693  C CA    . GLU C  1 22  ? -33.826 -29.531 39.520  1.00 37.09  ? 50  GLU C CA    1 
ATOM   5694  C C     . GLU C  1 22  ? -34.272 -30.998 39.654  1.00 34.85  ? 50  GLU C C     1 
ATOM   5695  O O     . GLU C  1 22  ? -33.522 -31.837 40.182  1.00 33.24  ? 50  GLU C O     1 
ATOM   5696  C CB    . GLU C  1 22  ? -34.436 -28.663 40.639  1.00 38.50  ? 50  GLU C CB    1 
ATOM   5697  C CG    . GLU C  1 22  ? -33.762 -27.292 40.826  1.00 40.22  ? 50  GLU C CG    1 
ATOM   5698  N N     . LYS C  1 23  ? -35.469 -31.316 39.165  1.00 34.30  ? 51  LYS C N     1 
ATOM   5699  C CA    . LYS C  1 23  ? -35.966 -32.702 39.196  1.00 32.96  ? 51  LYS C CA    1 
ATOM   5700  C C     . LYS C  1 23  ? -35.225 -33.658 38.236  1.00 33.66  ? 51  LYS C C     1 
ATOM   5701  O O     . LYS C  1 23  ? -34.802 -34.746 38.638  1.00 35.85  ? 51  LYS C O     1 
ATOM   5702  C CB    . LYS C  1 23  ? -37.465 -32.730 38.883  1.00 34.22  ? 51  LYS C CB    1 
ATOM   5703  C CG    . LYS C  1 23  ? -38.086 -34.083 39.048  1.00 37.08  ? 51  LYS C CG    1 
ATOM   5704  C CD    . LYS C  1 23  ? -39.597 -34.059 38.836  1.00 44.68  ? 51  LYS C CD    1 
ATOM   5705  C CE    . LYS C  1 23  ? -40.251 -35.266 39.494  1.00 47.28  ? 51  LYS C CE    1 
ATOM   5706  N NZ    . LYS C  1 23  ? -39.485 -36.525 39.256  1.00 57.71  ? 51  LYS C NZ    1 
ATOM   5707  N N     . GLU C  1 24  ? -35.044 -33.241 36.985  1.00 32.18  ? 52  GLU C N     1 
ATOM   5708  C CA    . GLU C  1 24  ? -34.621 -34.149 35.904  1.00 31.07  ? 52  GLU C CA    1 
ATOM   5709  C C     . GLU C  1 24  ? -33.186 -34.012 35.413  1.00 26.79  ? 52  GLU C C     1 
ATOM   5710  O O     . GLU C  1 24  ? -32.659 -34.960 34.828  1.00 27.49  ? 52  GLU C O     1 
ATOM   5711  C CB    . GLU C  1 24  ? -35.540 -33.999 34.690  1.00 32.05  ? 52  GLU C CB    1 
ATOM   5712  C CG    . GLU C  1 24  ? -37.032 -34.270 34.989  1.00 38.39  ? 52  GLU C CG    1 
ATOM   5713  C CD    . GLU C  1 24  ? -37.367 -35.752 35.233  1.00 49.13  ? 52  GLU C CD    1 
ATOM   5714  O OE1   . GLU C  1 24  ? -36.503 -36.637 35.006  1.00 47.15  ? 52  GLU C OE1   1 
ATOM   5715  O OE2   . GLU C  1 24  ? -38.513 -36.026 35.652  1.00 48.90  ? 52  GLU C OE2   1 
ATOM   5716  N N     . LEU C  1 25  ? -32.591 -32.828 35.577  1.00 28.68  ? 53  LEU C N     1 
ATOM   5717  C CA    . LEU C  1 25  ? -31.300 -32.513 34.962  1.00 26.01  ? 53  LEU C CA    1 
ATOM   5718  C C     . LEU C  1 25  ? -30.115 -32.509 35.943  1.00 27.41  ? 53  LEU C C     1 
ATOM   5719  O O     . LEU C  1 25  ? -29.127 -33.158 35.687  1.00 24.34  ? 53  LEU C O     1 
ATOM   5720  C CB    . LEU C  1 25  ? -31.388 -31.192 34.160  1.00 21.47  ? 53  LEU C CB    1 
ATOM   5721  C CG    . LEU C  1 25  ? -32.269 -31.229 32.892  1.00 31.69  ? 53  LEU C CG    1 
ATOM   5722  C CD1   . LEU C  1 25  ? -32.111 -29.955 32.040  1.00 27.30  ? 53  LEU C CD1   1 
ATOM   5723  C CD2   . LEU C  1 25  ? -31.978 -32.461 32.010  1.00 25.08  ? 53  LEU C CD2   1 
ATOM   5724  N N     . PHE C  1 26  ? -30.211 -31.761 37.043  1.00 30.63  ? 54  PHE C N     1 
ATOM   5725  C CA    . PHE C  1 26  ? -29.158 -31.753 38.072  1.00 31.86  ? 54  PHE C CA    1 
ATOM   5726  C C     . PHE C  1 26  ? -28.682 -33.159 38.489  1.00 30.21  ? 54  PHE C C     1 
ATOM   5727  O O     . PHE C  1 26  ? -27.471 -33.386 38.570  1.00 28.24  ? 54  PHE C O     1 
ATOM   5728  C CB    . PHE C  1 26  ? -29.588 -30.942 39.318  1.00 32.39  ? 54  PHE C CB    1 
ATOM   5729  C CG    . PHE C  1 26  ? -29.409 -29.446 39.166  1.00 36.72  ? 54  PHE C CG    1 
ATOM   5730  C CD1   . PHE C  1 26  ? -30.417 -28.653 38.619  1.00 37.41  ? 54  PHE C CD1   1 
ATOM   5731  C CD2   . PHE C  1 26  ? -28.221 -28.830 39.555  1.00 50.57  ? 54  PHE C CD2   1 
ATOM   5732  C CE1   . PHE C  1 26  ? -30.263 -27.272 38.478  1.00 37.11  ? 54  PHE C CE1   1 
ATOM   5733  C CE2   . PHE C  1 26  ? -28.049 -27.446 39.408  1.00 45.91  ? 54  PHE C CE2   1 
ATOM   5734  C CZ    . PHE C  1 26  ? -29.070 -26.670 38.864  1.00 33.77  ? 54  PHE C CZ    1 
ATOM   5735  N N     . PRO C  1 27  ? -29.624 -34.105 38.719  1.00 29.38  ? 55  PRO C N     1 
ATOM   5736  C CA    . PRO C  1 27  ? -29.243 -35.473 39.121  1.00 30.84  ? 55  PRO C CA    1 
ATOM   5737  C C     . PRO C  1 27  ? -28.495 -36.311 38.076  1.00 30.38  ? 55  PRO C C     1 
ATOM   5738  O O     . PRO C  1 27  ? -27.861 -37.302 38.436  1.00 32.24  ? 55  PRO C O     1 
ATOM   5739  C CB    . PRO C  1 27  ? -30.603 -36.138 39.458  1.00 30.31  ? 55  PRO C CB    1 
ATOM   5740  C CG    . PRO C  1 27  ? -31.563 -35.019 39.623  1.00 32.50  ? 55  PRO C CG    1 
ATOM   5741  C CD    . PRO C  1 27  ? -31.096 -33.984 38.626  1.00 25.80  ? 55  PRO C CD    1 
ATOM   5742  N N     . ILE C  1 28  ? -28.558 -35.927 36.798  1.00 31.25  ? 56  ILE C N     1 
ATOM   5743  C CA    . ILE C  1 28  ? -27.851 -36.659 35.729  1.00 28.63  ? 56  ILE C CA    1 
ATOM   5744  C C     . ILE C  1 28  ? -26.645 -35.958 35.133  1.00 29.28  ? 56  ILE C C     1 
ATOM   5745  O O     . ILE C  1 28  ? -25.852 -36.592 34.414  1.00 27.14  ? 56  ILE C O     1 
ATOM   5746  C CB    . ILE C  1 28  ? -28.830 -37.031 34.582  1.00 32.94  ? 56  ILE C CB    1 
ATOM   5747  C CG1   . ILE C  1 28  ? -29.297 -35.801 33.790  1.00 33.34  ? 56  ILE C CG1   1 
ATOM   5748  C CG2   . ILE C  1 28  ? -30.036 -37.737 35.149  1.00 28.73  ? 56  ILE C CG2   1 
ATOM   5749  C CD1   . ILE C  1 28  ? -30.019 -36.142 32.533  1.00 35.93  ? 56  ILE C CD1   1 
ATOM   5750  N N     . ALA C  1 29  ? -26.493 -34.663 35.425  1.00 28.03  ? 57  ALA C N     1 
ATOM   5751  C CA    . ALA C  1 29  ? -25.475 -33.818 34.755  1.00 29.12  ? 57  ALA C CA    1 
ATOM   5752  C C     . ALA C  1 29  ? -24.077 -34.422 34.808  1.00 27.33  ? 57  ALA C C     1 
ATOM   5753  O O     . ALA C  1 29  ? -23.351 -34.421 33.787  1.00 25.81  ? 57  ALA C O     1 
ATOM   5754  C CB    . ALA C  1 29  ? -25.448 -32.405 35.363  1.00 23.98  ? 57  ALA C CB    1 
ATOM   5755  N N     . ALA C  1 30  ? -23.707 -34.922 35.997  1.00 29.18  ? 58  ALA C N     1 
ATOM   5756  C CA    . ALA C  1 30  ? -22.401 -35.543 36.219  1.00 26.72  ? 58  ALA C CA    1 
ATOM   5757  C C     . ALA C  1 30  ? -22.220 -36.781 35.323  1.00 28.45  ? 58  ALA C C     1 
ATOM   5758  O O     . ALA C  1 30  ? -21.190 -36.919 34.667  1.00 27.75  ? 58  ALA C O     1 
ATOM   5759  C CB    . ALA C  1 30  ? -22.198 -35.891 37.719  1.00 27.57  ? 58  ALA C CB    1 
ATOM   5760  N N     . GLN C  1 31  ? -23.241 -37.637 35.281  1.00 28.41  ? 59  GLN C N     1 
ATOM   5761  C CA    . GLN C  1 31  ? -23.236 -38.857 34.468  1.00 31.51  ? 59  GLN C CA    1 
ATOM   5762  C C     . GLN C  1 31  ? -23.117 -38.556 32.954  1.00 27.87  ? 59  GLN C C     1 
ATOM   5763  O O     . GLN C  1 31  ? -22.205 -39.071 32.267  1.00 26.83  ? 59  GLN C O     1 
ATOM   5764  C CB    . GLN C  1 31  ? -24.518 -39.676 34.770  1.00 28.30  ? 59  GLN C CB    1 
ATOM   5765  C CG    . GLN C  1 31  ? -24.598 -41.056 34.084  1.00 33.39  ? 59  GLN C CG    1 
ATOM   5766  C CD    . GLN C  1 31  ? -25.918 -41.787 34.343  1.00 38.80  ? 59  GLN C CD    1 
ATOM   5767  O OE1   . GLN C  1 31  ? -26.848 -41.250 34.957  1.00 43.62  ? 59  GLN C OE1   1 
ATOM   5768  N NE2   . GLN C  1 31  ? -26.000 -43.031 33.869  1.00 43.30  ? 59  GLN C NE2   1 
ATOM   5769  N N     . VAL C  1 32  ? -24.024 -37.701 32.467  1.00 25.03  ? 60  VAL C N     1 
ATOM   5770  C CA    . VAL C  1 32  ? -24.085 -37.276 31.064  1.00 25.73  ? 60  VAL C CA    1 
ATOM   5771  C C     . VAL C  1 32  ? -22.695 -36.831 30.616  1.00 29.02  ? 60  VAL C C     1 
ATOM   5772  O O     . VAL C  1 32  ? -22.203 -37.254 29.560  1.00 27.40  ? 60  VAL C O     1 
ATOM   5773  C CB    . VAL C  1 32  ? -25.176 -36.157 30.844  1.00 29.59  ? 60  VAL C CB    1 
ATOM   5774  C CG1   . VAL C  1 32  ? -25.073 -35.483 29.455  1.00 26.13  ? 60  VAL C CG1   1 
ATOM   5775  C CG2   . VAL C  1 32  ? -26.569 -36.716 31.046  1.00 21.94  ? 60  VAL C CG2   1 
ATOM   5776  N N     . ASP C  1 33  ? -22.025 -36.056 31.473  1.00 26.41  ? 61  ASP C N     1 
ATOM   5777  C CA    . ASP C  1 33  ? -20.679 -35.559 31.188  1.00 24.03  ? 61  ASP C CA    1 
ATOM   5778  C C     . ASP C  1 33  ? -19.594 -36.622 31.217  1.00 26.25  ? 61  ASP C C     1 
ATOM   5779  O O     . ASP C  1 33  ? -18.706 -36.679 30.332  1.00 26.90  ? 61  ASP C O     1 
ATOM   5780  C CB    . ASP C  1 33  ? -20.320 -34.465 32.209  1.00 23.91  ? 61  ASP C CB    1 
ATOM   5781  C CG    . ASP C  1 33  ? -18.915 -33.996 32.086  1.00 25.49  ? 61  ASP C CG    1 
ATOM   5782  O OD1   . ASP C  1 33  ? -18.622 -33.275 31.111  1.00 25.85  ? 61  ASP C OD1   1 
ATOM   5783  O OD2   . ASP C  1 33  ? -18.074 -34.368 32.950  1.00 29.54  ? 61  ASP C OD2   1 
ATOM   5784  N N     . LYS C  1 34  ? -19.624 -37.435 32.259  1.00 24.64  ? 62  LYS C N     1 
ATOM   5785  C CA    . LYS C  1 34  ? -18.575 -38.422 32.467  1.00 28.64  ? 62  LYS C CA    1 
ATOM   5786  C C     . LYS C  1 34  ? -18.539 -39.473 31.347  1.00 29.86  ? 62  LYS C C     1 
ATOM   5787  O O     . LYS C  1 34  ? -17.464 -39.849 30.858  1.00 25.36  ? 62  LYS C O     1 
ATOM   5788  C CB    . LYS C  1 34  ? -18.759 -39.091 33.823  1.00 29.76  ? 62  LYS C CB    1 
ATOM   5789  C CG    . LYS C  1 34  ? -17.692 -40.132 34.140  1.00 29.43  ? 62  LYS C CG    1 
ATOM   5790  C CD    . LYS C  1 34  ? -18.028 -40.866 35.429  1.00 36.99  ? 62  LYS C CD    1 
ATOM   5791  C CE    . LYS C  1 34  ? -17.035 -41.979 35.746  1.00 43.70  ? 62  LYS C CE    1 
ATOM   5792  N NZ    . LYS C  1 34  ? -16.848 -42.122 37.223  1.00 49.60  ? 62  LYS C NZ    1 
ATOM   5793  N N     . GLU C  1 35  ? -19.724 -39.895 30.940  1.00 29.64  ? 63  GLU C N     1 
ATOM   5794  C CA    . GLU C  1 35  ? -19.915 -41.001 30.005  1.00 33.81  ? 63  GLU C CA    1 
ATOM   5795  C C     . GLU C  1 35  ? -20.177 -40.548 28.561  1.00 35.27  ? 63  GLU C C     1 
ATOM   5796  O O     . GLU C  1 35  ? -20.367 -41.396 27.691  1.00 32.14  ? 63  GLU C O     1 
ATOM   5797  C CB    . GLU C  1 35  ? -21.094 -41.865 30.484  1.00 32.88  ? 63  GLU C CB    1 
ATOM   5798  C CG    . GLU C  1 35  ? -20.867 -42.517 31.838  1.00 33.86  ? 63  GLU C CG    1 
ATOM   5799  C CD    . GLU C  1 35  ? -22.086 -43.291 32.362  1.00 43.70  ? 63  GLU C CD    1 
ATOM   5800  O OE1   . GLU C  1 35  ? -23.154 -43.300 31.700  1.00 47.87  ? 63  GLU C OE1   1 
ATOM   5801  O OE2   . GLU C  1 35  ? -21.980 -43.882 33.456  1.00 55.01  ? 63  GLU C OE2   1 
ATOM   5802  N N     . HIS C  1 36  ? -20.169 -39.232 28.304  1.00 33.24  ? 64  HIS C N     1 
ATOM   5803  C CA    . HIS C  1 36  ? -20.555 -38.658 27.000  1.00 29.28  ? 64  HIS C CA    1 
ATOM   5804  C C     . HIS C  1 36  ? -21.917 -39.199 26.585  1.00 24.54  ? 64  HIS C C     1 
ATOM   5805  O O     . HIS C  1 36  ? -22.086 -39.684 25.490  1.00 28.53  ? 64  HIS C O     1 
ATOM   5806  C CB    . HIS C  1 36  ? -19.539 -38.970 25.885  1.00 29.92  ? 64  HIS C CB    1 
ATOM   5807  C CG    . HIS C  1 36  ? -18.133 -38.564 26.198  1.00 35.16  ? 64  HIS C CG    1 
ATOM   5808  N ND1   . HIS C  1 36  ? -17.376 -37.789 25.344  1.00 43.52  ? 64  HIS C ND1   1 
ATOM   5809  C CD2   . HIS C  1 36  ? -17.338 -38.836 27.260  1.00 42.95  ? 64  HIS C CD2   1 
ATOM   5810  C CE1   . HIS C  1 36  ? -16.179 -37.593 25.871  1.00 39.51  ? 64  HIS C CE1   1 
ATOM   5811  N NE2   . HIS C  1 36  ? -16.131 -38.212 27.036  1.00 39.66  ? 64  HIS C NE2   1 
ATOM   5812  N N     . LEU C  1 37  ? -22.889 -39.085 27.456  1.00 29.06  ? 65  LEU C N     1 
ATOM   5813  C CA    . LEU C  1 37  ? -24.130 -39.821 27.284  1.00 28.46  ? 65  LEU C CA    1 
ATOM   5814  C C     . LEU C  1 37  ? -25.282 -38.912 26.862  1.00 26.49  ? 65  LEU C C     1 
ATOM   5815  O O     . LEU C  1 37  ? -25.599 -37.937 27.540  1.00 28.75  ? 65  LEU C O     1 
ATOM   5816  C CB    . LEU C  1 37  ? -24.433 -40.535 28.603  1.00 31.42  ? 65  LEU C CB    1 
ATOM   5817  C CG    . LEU C  1 37  ? -25.704 -41.373 28.773  1.00 34.28  ? 65  LEU C CG    1 
ATOM   5818  C CD1   . LEU C  1 37  ? -25.865 -42.409 27.665  1.00 37.71  ? 65  LEU C CD1   1 
ATOM   5819  C CD2   . LEU C  1 37  ? -25.681 -42.069 30.147  1.00 38.21  ? 65  LEU C CD2   1 
ATOM   5820  N N     . PHE C  1 38  ? -25.926 -39.242 25.747  1.00 27.17  ? 66  PHE C N     1 
ATOM   5821  C CA    . PHE C  1 38  ? -27.044 -38.453 25.239  1.00 26.54  ? 66  PHE C CA    1 
ATOM   5822  C C     . PHE C  1 38  ? -28.244 -38.637 26.169  1.00 30.53  ? 66  PHE C C     1 
ATOM   5823  O O     . PHE C  1 38  ? -28.617 -39.765 26.468  1.00 28.43  ? 66  PHE C O     1 
ATOM   5824  C CB    . PHE C  1 38  ? -27.379 -38.851 23.791  1.00 29.74  ? 66  PHE C CB    1 
ATOM   5825  C CG    . PHE C  1 38  ? -28.526 -38.074 23.191  1.00 25.11  ? 66  PHE C CG    1 
ATOM   5826  C CD1   . PHE C  1 38  ? -28.298 -36.851 22.551  1.00 22.06  ? 66  PHE C CD1   1 
ATOM   5827  C CD2   . PHE C  1 38  ? -29.835 -38.545 23.285  1.00 28.71  ? 66  PHE C CD2   1 
ATOM   5828  C CE1   . PHE C  1 38  ? -29.345 -36.128 22.018  1.00 31.49  ? 66  PHE C CE1   1 
ATOM   5829  C CE2   . PHE C  1 38  ? -30.889 -37.830 22.754  1.00 30.31  ? 66  PHE C CE2   1 
ATOM   5830  C CZ    . PHE C  1 38  ? -30.658 -36.621 22.117  1.00 28.08  ? 66  PHE C CZ    1 
ATOM   5831  N N     . PRO C  1 39  ? -28.795 -37.531 26.701  1.00 31.00  ? 67  PRO C N     1 
ATOM   5832  C CA    . PRO C  1 39  ? -29.920 -37.570 27.658  1.00 30.94  ? 67  PRO C CA    1 
ATOM   5833  C C     . PRO C  1 39  ? -31.290 -37.858 27.038  1.00 28.29  ? 67  PRO C C     1 
ATOM   5834  O O     . PRO C  1 39  ? -32.194 -37.015 27.060  1.00 29.06  ? 67  PRO C O     1 
ATOM   5835  C CB    . PRO C  1 39  ? -29.871 -36.164 28.302  1.00 30.76  ? 67  PRO C CB    1 
ATOM   5836  C CG    . PRO C  1 39  ? -29.342 -35.299 27.248  1.00 29.10  ? 67  PRO C CG    1 
ATOM   5837  C CD    . PRO C  1 39  ? -28.323 -36.147 26.476  1.00 31.56  ? 67  PRO C CD    1 
ATOM   5838  N N     . ALA C  1 40  ? -31.432 -39.083 26.535  1.00 30.80  ? 68  ALA C N     1 
ATOM   5839  C CA    . ALA C  1 40  ? -32.588 -39.525 25.740  1.00 26.54  ? 68  ALA C CA    1 
ATOM   5840  C C     . ALA C  1 40  ? -33.946 -39.310 26.410  1.00 28.42  ? 68  ALA C C     1 
ATOM   5841  O O     . ALA C  1 40  ? -34.819 -38.644 25.850  1.00 27.67  ? 68  ALA C O     1 
ATOM   5842  C CB    . ALA C  1 40  ? -32.418 -41.034 25.336  1.00 26.44  ? 68  ALA C CB    1 
ATOM   5843  N N     . ALA C  1 41  ? -34.127 -39.906 27.584  1.00 30.90  ? 69  ALA C N     1 
ATOM   5844  C CA    . ALA C  1 41  ? -35.383 -39.791 28.330  1.00 30.78  ? 69  ALA C CA    1 
ATOM   5845  C C     . ALA C  1 41  ? -35.733 -38.332 28.628  1.00 29.99  ? 69  ALA C C     1 
ATOM   5846  O O     . ALA C  1 41  ? -36.881 -37.917 28.502  1.00 29.10  ? 69  ALA C O     1 
ATOM   5847  C CB    . ALA C  1 41  ? -35.303 -40.591 29.637  1.00 32.14  ? 69  ALA C CB    1 
ATOM   5848  N N     . GLN C  1 42  ? -34.731 -37.544 29.000  1.00 29.81  ? 70  GLN C N     1 
ATOM   5849  C CA    . GLN C  1 42  ? -34.959 -36.139 29.383  1.00 30.65  ? 70  GLN C CA    1 
ATOM   5850  C C     . GLN C  1 42  ? -35.344 -35.238 28.192  1.00 27.78  ? 70  GLN C C     1 
ATOM   5851  O O     . GLN C  1 42  ? -36.273 -34.414 28.296  1.00 26.06  ? 70  GLN C O     1 
ATOM   5852  C CB    . GLN C  1 42  ? -33.743 -35.599 30.132  1.00 30.67  ? 70  GLN C CB    1 
ATOM   5853  C CG    . GLN C  1 42  ? -33.523 -36.287 31.471  1.00 31.91  ? 70  GLN C CG    1 
ATOM   5854  C CD    . GLN C  1 42  ? -32.864 -37.636 31.336  1.00 31.31  ? 70  GLN C CD    1 
ATOM   5855  O OE1   . GLN C  1 42  ? -32.377 -37.991 30.267  1.00 29.54  ? 70  GLN C OE1   1 
ATOM   5856  N NE2   . GLN C  1 42  ? -32.851 -38.400 32.417  1.00 29.61  ? 70  GLN C NE2   1 
ATOM   5857  N N     . VAL C  1 43  ? -34.666 -35.427 27.060  1.00 27.14  ? 71  VAL C N     1 
ATOM   5858  C CA    . VAL C  1 43  ? -35.011 -34.702 25.829  1.00 28.20  ? 71  VAL C CA    1 
ATOM   5859  C C     . VAL C  1 43  ? -36.476 -34.953 25.449  1.00 29.14  ? 71  VAL C C     1 
ATOM   5860  O O     . VAL C  1 43  ? -37.180 -34.022 25.058  1.00 29.06  ? 71  VAL C O     1 
ATOM   5861  C CB    . VAL C  1 43  ? -34.067 -35.084 24.664  1.00 32.01  ? 71  VAL C CB    1 
ATOM   5862  C CG1   . VAL C  1 43  ? -34.589 -34.561 23.332  1.00 27.20  ? 71  VAL C CG1   1 
ATOM   5863  C CG2   . VAL C  1 43  ? -32.629 -34.573 24.952  1.00 26.51  ? 71  VAL C CG2   1 
ATOM   5864  N N     . LYS C  1 44  ? -36.936 -36.201 25.611  1.00 33.39  ? 72  LYS C N     1 
ATOM   5865  C CA    . LYS C  1 44  ? -38.318 -36.591 25.271  1.00 29.43  ? 72  LYS C CA    1 
ATOM   5866  C C     . LYS C  1 44  ? -39.377 -35.970 26.216  1.00 31.40  ? 72  LYS C C     1 
ATOM   5867  O O     . LYS C  1 44  ? -40.448 -35.526 25.765  1.00 29.45  ? 72  LYS C O     1 
ATOM   5868  C CB    . LYS C  1 44  ? -38.421 -38.135 25.227  1.00 35.22  ? 72  LYS C CB    1 
ATOM   5869  C CG    . LYS C  1 44  ? -39.841 -38.751 25.162  1.00 40.69  ? 72  LYS C CG    1 
ATOM   5870  C CD    . LYS C  1 44  ? -40.571 -38.470 23.854  1.00 55.92  ? 72  LYS C CD    1 
ATOM   5871  C CE    . LYS C  1 44  ? -41.907 -39.200 23.815  1.00 52.21  ? 72  LYS C CE    1 
ATOM   5872  N NZ    . LYS C  1 44  ? -42.739 -38.844 22.624  1.00 57.04  ? 72  LYS C NZ    1 
ATOM   5873  N N     . LYS C  1 45  ? -39.077 -35.955 27.515  1.00 31.30  ? 73  LYS C N     1 
ATOM   5874  C CA    . LYS C  1 45  ? -39.904 -35.249 28.496  1.00 31.57  ? 73  LYS C CA    1 
ATOM   5875  C C     . LYS C  1 45  ? -39.976 -33.758 28.159  1.00 33.00  ? 73  LYS C C     1 
ATOM   5876  O O     . LYS C  1 45  ? -41.052 -33.159 28.184  1.00 31.79  ? 73  LYS C O     1 
ATOM   5877  C CB    . LYS C  1 45  ? -39.321 -35.401 29.907  1.00 33.07  ? 73  LYS C CB    1 
ATOM   5878  C CG    . LYS C  1 45  ? -39.359 -36.806 30.471  1.00 36.54  ? 73  LYS C CG    1 
ATOM   5879  C CD    . LYS C  1 45  ? -40.651 -37.046 31.249  1.00 45.34  ? 73  LYS C CD    1 
ATOM   5880  C CE    . LYS C  1 45  ? -40.579 -36.537 32.699  1.00 51.46  ? 73  LYS C CE    1 
ATOM   5881  N NZ    . LYS C  1 45  ? -41.712 -37.076 33.538  1.00 44.33  ? 73  LYS C NZ    1 
ATOM   5882  N N     . MET C  1 46  ? -38.816 -33.163 27.871  1.00 31.71  ? 74  MET C N     1 
ATOM   5883  C CA    . MET C  1 46  ? -38.755 -31.756 27.437  1.00 32.95  ? 74  MET C CA    1 
ATOM   5884  C C     . MET C  1 46  ? -39.589 -31.490 26.191  1.00 30.66  ? 74  MET C C     1 
ATOM   5885  O O     . MET C  1 46  ? -40.228 -30.430 26.068  1.00 29.39  ? 74  MET C O     1 
ATOM   5886  C CB    . MET C  1 46  ? -37.317 -31.355 27.142  1.00 32.90  ? 74  MET C CB    1 
ATOM   5887  C CG    . MET C  1 46  ? -36.451 -31.239 28.370  1.00 34.36  ? 74  MET C CG    1 
ATOM   5888  S SD    . MET C  1 46  ? -34.740 -31.047 27.917  1.00 38.42  ? 74  MET C SD    1 
ATOM   5889  C CE    . MET C  1 46  ? -34.738 -29.366 27.309  1.00 36.91  ? 74  MET C CE    1 
ATOM   5890  N N     . GLY C  1 47  ? -39.545 -32.455 25.268  1.00 32.72  ? 75  GLY C N     1 
ATOM   5891  C CA    . GLY C  1 47  ? -40.362 -32.449 24.065  1.00 30.83  ? 75  GLY C CA    1 
ATOM   5892  C C     . GLY C  1 47  ? -41.839 -32.331 24.347  1.00 30.48  ? 75  GLY C C     1 
ATOM   5893  O O     . GLY C  1 47  ? -42.541 -31.550 23.698  1.00 32.45  ? 75  GLY C O     1 
ATOM   5894  N N     . GLY C  1 48  ? -42.304 -33.119 25.315  1.00 34.63  ? 76  GLY C N     1 
ATOM   5895  C CA    . GLY C  1 48  ? -43.687 -33.085 25.774  1.00 33.80  ? 76  GLY C CA    1 
ATOM   5896  C C     . GLY C  1 48  ? -44.076 -31.785 26.445  1.00 35.36  ? 76  GLY C C     1 
ATOM   5897  O O     . GLY C  1 48  ? -45.244 -31.391 26.401  1.00 36.06  ? 76  GLY C O     1 
ATOM   5898  N N     . LEU C  1 49  ? -43.096 -31.107 27.050  1.00 33.83  ? 77  LEU C N     1 
ATOM   5899  C CA    . LEU C  1 49  ? -43.326 -29.822 27.715  1.00 30.69  ? 77  LEU C CA    1 
ATOM   5900  C C     . LEU C  1 49  ? -43.369 -28.633 26.734  1.00 35.39  ? 77  LEU C C     1 
ATOM   5901  O O     . LEU C  1 49  ? -43.807 -27.543 27.107  1.00 40.40  ? 77  LEU C O     1 
ATOM   5902  C CB    . LEU C  1 49  ? -42.260 -29.596 28.800  1.00 31.99  ? 77  LEU C CB    1 
ATOM   5903  C CG    . LEU C  1 49  ? -42.387 -30.476 30.050  1.00 36.12  ? 77  LEU C CG    1 
ATOM   5904  C CD1   . LEU C  1 49  ? -41.383 -30.088 31.109  1.00 38.43  ? 77  LEU C CD1   1 
ATOM   5905  C CD2   . LEU C  1 49  ? -43.792 -30.382 30.632  1.00 37.56  ? 77  LEU C CD2   1 
ATOM   5906  N N     . GLY C  1 50  ? -42.913 -28.842 25.492  1.00 33.42  ? 78  GLY C N     1 
ATOM   5907  C CA    . GLY C  1 50  ? -42.934 -27.803 24.470  1.00 30.97  ? 78  GLY C CA    1 
ATOM   5908  C C     . GLY C  1 50  ? -41.611 -27.074 24.322  1.00 29.58  ? 78  GLY C C     1 
ATOM   5909  O O     . GLY C  1 50  ? -41.512 -26.155 23.521  1.00 30.66  ? 78  GLY C O     1 
ATOM   5910  N N     . LEU C  1 51  ? -40.597 -27.514 25.067  1.00 28.31  ? 79  LEU C N     1 
ATOM   5911  C CA    . LEU C  1 51  ? -39.301 -26.821 25.145  1.00 30.41  ? 79  LEU C CA    1 
ATOM   5912  C C     . LEU C  1 51  ? -38.436 -26.985 23.897  1.00 29.37  ? 79  LEU C C     1 
ATOM   5913  O O     . LEU C  1 51  ? -37.518 -26.188 23.656  1.00 28.94  ? 79  LEU C O     1 
ATOM   5914  C CB    . LEU C  1 51  ? -38.533 -27.288 26.381  1.00 28.52  ? 79  LEU C CB    1 
ATOM   5915  C CG    . LEU C  1 51  ? -39.164 -26.969 27.734  1.00 29.94  ? 79  LEU C CG    1 
ATOM   5916  C CD1   . LEU C  1 51  ? -38.296 -27.477 28.845  1.00 30.00  ? 79  LEU C CD1   1 
ATOM   5917  C CD2   . LEU C  1 51  ? -39.408 -25.477 27.889  1.00 33.72  ? 79  LEU C CD2   1 
ATOM   5918  N N     . LEU C  1 52  ? -38.728 -28.004 23.090  1.00 29.22  ? 80  LEU C N     1 
ATOM   5919  C CA    . LEU C  1 52  ? -38.003 -28.200 21.843  1.00 31.17  ? 80  LEU C CA    1 
ATOM   5920  C C     . LEU C  1 52  ? -38.680 -27.438 20.681  1.00 28.57  ? 80  LEU C C     1 
ATOM   5921  O O     . LEU C  1 52  ? -38.156 -27.397 19.583  1.00 31.59  ? 80  LEU C O     1 
ATOM   5922  C CB    . LEU C  1 52  ? -37.867 -29.696 21.540  1.00 31.80  ? 80  LEU C CB    1 
ATOM   5923  C CG    . LEU C  1 52  ? -37.181 -30.567 22.603  1.00 42.51  ? 80  LEU C CG    1 
ATOM   5924  C CD1   . LEU C  1 52  ? -37.288 -32.045 22.229  1.00 40.79  ? 80  LEU C CD1   1 
ATOM   5925  C CD2   . LEU C  1 52  ? -35.726 -30.158 22.782  1.00 40.76  ? 80  LEU C CD2   1 
ATOM   5926  N N     . ALA C  1 53  ? -39.816 -26.797 20.943  1.00 27.09  ? 81  ALA C N     1 
ATOM   5927  C CA    . ALA C  1 53  ? -40.514 -26.077 19.884  1.00 29.92  ? 81  ALA C CA    1 
ATOM   5928  C C     . ALA C  1 53  ? -41.222 -24.857 20.438  1.00 30.10  ? 81  ALA C C     1 
ATOM   5929  O O     . ALA C  1 53  ? -42.434 -24.689 20.268  1.00 31.95  ? 81  ALA C O     1 
ATOM   5930  C CB    . ALA C  1 53  ? -41.494 -27.001 19.180  1.00 27.04  ? 81  ALA C CB    1 
ATOM   5931  N N     . MET C  1 54  ? -40.451 -23.993 21.089  1.00 30.56  ? 82  MET C N     1 
ATOM   5932  C CA    . MET C  1 54  ? -41.024 -22.906 21.886  1.00 33.74  ? 82  MET C CA    1 
ATOM   5933  C C     . MET C  1 54  ? -41.689 -21.824 21.046  1.00 28.99  ? 82  MET C C     1 
ATOM   5934  O O     . MET C  1 54  ? -42.780 -21.362 21.376  1.00 33.49  ? 82  MET C O     1 
ATOM   5935  C CB    . MET C  1 54  ? -39.928 -22.294 22.763  1.00 32.61  ? 82  MET C CB    1 
ATOM   5936  C CG    . MET C  1 54  ? -39.251 -23.323 23.642  1.00 35.02  ? 82  MET C CG    1 
ATOM   5937  S SD    . MET C  1 54  ? -38.889 -22.695 25.277  1.00 42.89  ? 82  MET C SD    1 
ATOM   5938  C CE    . MET C  1 54  ? -40.563 -22.340 25.840  1.00 32.71  ? 82  MET C CE    1 
ATOM   5939  N N     . ASP C  1 55  ? -41.024 -21.427 19.960  1.00 30.25  ? 83  ASP C N     1 
ATOM   5940  C CA    . ASP C  1 55  ? -41.498 -20.338 19.093  1.00 36.23  ? 83  ASP C CA    1 
ATOM   5941  C C     . ASP C  1 55  ? -42.332 -20.877 17.917  1.00 33.44  ? 83  ASP C C     1 
ATOM   5942  O O     . ASP C  1 55  ? -42.623 -20.153 16.983  1.00 37.75  ? 83  ASP C O     1 
ATOM   5943  C CB    . ASP C  1 55  ? -40.296 -19.521 18.566  1.00 37.16  ? 83  ASP C CB    1 
ATOM   5944  C CG    . ASP C  1 55  ? -40.696 -18.140 17.992  1.00 49.48  ? 83  ASP C CG    1 
ATOM   5945  O OD1   . ASP C  1 55  ? -41.417 -17.380 18.674  1.00 47.68  ? 83  ASP C OD1   1 
ATOM   5946  O OD2   . ASP C  1 55  ? -40.265 -17.800 16.861  1.00 52.08  ? 83  ASP C OD2   1 
ATOM   5947  N N     . VAL C  1 56  ? -42.707 -22.151 17.960  1.00 35.50  ? 84  VAL C N     1 
ATOM   5948  C CA    . VAL C  1 56  ? -43.453 -22.754 16.861  1.00 31.62  ? 84  VAL C CA    1 
ATOM   5949  C C     . VAL C  1 56  ? -44.933 -22.555 17.148  1.00 32.91  ? 84  VAL C C     1 
ATOM   5950  O O     . VAL C  1 56  ? -45.394 -22.797 18.271  1.00 34.33  ? 84  VAL C O     1 
ATOM   5951  C CB    . VAL C  1 56  ? -43.126 -24.250 16.713  1.00 32.70  ? 84  VAL C CB    1 
ATOM   5952  C CG1   . VAL C  1 56  ? -43.870 -24.858 15.524  1.00 26.74  ? 84  VAL C CG1   1 
ATOM   5953  C CG2   . VAL C  1 56  ? -41.618 -24.469 16.571  1.00 29.73  ? 84  VAL C CG2   1 
ATOM   5954  N N     . PRO C  1 57  ? -45.691 -22.090 16.141  1.00 34.80  ? 85  PRO C N     1 
ATOM   5955  C CA    . PRO C  1 57  ? -47.144 -21.968 16.329  1.00 34.17  ? 85  PRO C CA    1 
ATOM   5956  C C     . PRO C  1 57  ? -47.780 -23.258 16.866  1.00 31.57  ? 85  PRO C C     1 
ATOM   5957  O O     . PRO C  1 57  ? -47.396 -24.369 16.462  1.00 31.65  ? 85  PRO C O     1 
ATOM   5958  C CB    . PRO C  1 57  ? -47.662 -21.659 14.926  1.00 32.85  ? 85  PRO C CB    1 
ATOM   5959  C CG    . PRO C  1 57  ? -46.484 -21.063 14.196  1.00 39.02  ? 85  PRO C CG    1 
ATOM   5960  C CD    . PRO C  1 57  ? -45.249 -21.655 14.802  1.00 29.63  ? 85  PRO C CD    1 
ATOM   5961  N N     . GLU C  1 58  ? -48.743 -23.108 17.771  1.00 35.06  ? 86  GLU C N     1 
ATOM   5962  C CA    . GLU C  1 58  ? -49.452 -24.261 18.329  1.00 35.66  ? 86  GLU C CA    1 
ATOM   5963  C C     . GLU C  1 58  ? -50.097 -25.095 17.219  1.00 36.30  ? 86  GLU C C     1 
ATOM   5964  O O     . GLU C  1 58  ? -50.234 -26.323 17.358  1.00 35.17  ? 86  GLU C O     1 
ATOM   5965  C CB    . GLU C  1 58  ? -50.511 -23.826 19.365  1.00 38.66  ? 86  GLU C CB    1 
ATOM   5966  C CG    A GLU C  1 58  ? -49.823 -23.870 20.735  0.50 38.28  ? 86  GLU C CG    1 
ATOM   5967  C CG    B GLU C  1 58  ? -51.785 -23.507 18.587  0.50 34.11  ? 86  GLU C CG    1 
ATOM   5968  C CD    A GLU C  1 58  ? -50.736 -23.435 21.874  0.50 44.96  ? 86  GLU C CD    1 
ATOM   5969  O OE1   A GLU C  1 58  ? -50.293 -22.643 22.732  0.50 48.25  ? 86  GLU C OE1   1 
ATOM   5970  O OE2   A GLU C  1 58  ? -51.899 -23.888 21.911  0.50 51.82  ? 86  GLU C OE2   1 
ATOM   5971  N N     . GLU C  1 59  ? -50.492 -24.432 16.127  1.00 36.51  ? 87  GLU C N     1 
ATOM   5972  C CA    . GLU C  1 59  ? -51.131 -25.119 15.003  1.00 36.86  ? 87  GLU C CA    1 
ATOM   5973  C C     . GLU C  1 59  ? -50.153 -26.089 14.322  1.00 38.47  ? 87  GLU C C     1 
ATOM   5974  O O     . GLU C  1 59  ? -50.566 -27.132 13.822  1.00 39.06  ? 87  GLU C O     1 
ATOM   5975  C CB    . GLU C  1 59  ? -51.691 -24.113 13.993  1.00 36.40  ? 87  GLU C CB    1 
ATOM   5976  N N     . LEU C  1 60  ? -48.860 -25.759 14.318  1.00 35.04  ? 88  LEU C N     1 
ATOM   5977  C CA    . LEU C  1 60  ? -47.841 -26.649 13.745  1.00 32.38  ? 88  LEU C CA    1 
ATOM   5978  C C     . LEU C  1 60  ? -47.280 -27.652 14.767  1.00 31.54  ? 88  LEU C C     1 
ATOM   5979  O O     . LEU C  1 60  ? -46.380 -28.437 14.453  1.00 36.97  ? 88  LEU C O     1 
ATOM   5980  C CB    . LEU C  1 60  ? -46.699 -25.829 13.136  1.00 33.73  ? 88  LEU C CB    1 
ATOM   5981  C CG    . LEU C  1 60  ? -46.896 -25.299 11.721  1.00 36.77  ? 88  LEU C CG    1 
ATOM   5982  C CD1   . LEU C  1 60  ? -45.905 -24.155 11.443  1.00 35.02  ? 88  LEU C CD1   1 
ATOM   5983  C CD2   . LEU C  1 60  ? -46.745 -26.420 10.677  1.00 29.12  ? 88  LEU C CD2   1 
ATOM   5984  N N     . GLY C  1 61  ? -47.812 -27.617 15.986  1.00 33.26  ? 89  GLY C N     1 
ATOM   5985  C CA    . GLY C  1 61  ? -47.421 -28.539 17.041  1.00 33.22  ? 89  GLY C CA    1 
ATOM   5986  C C     . GLY C  1 61  ? -46.522 -27.968 18.127  1.00 31.88  ? 89  GLY C C     1 
ATOM   5987  O O     . GLY C  1 61  ? -46.065 -28.707 18.993  1.00 33.06  ? 89  GLY C O     1 
ATOM   5988  N N     . GLY C  1 62  ? -46.280 -26.658 18.108  1.00 36.81  ? 90  GLY C N     1 
ATOM   5989  C CA    . GLY C  1 62  ? -45.328 -26.032 19.046  1.00 33.88  ? 90  GLY C CA    1 
ATOM   5990  C C     . GLY C  1 62  ? -45.959 -25.403 20.276  1.00 35.83  ? 90  GLY C C     1 
ATOM   5991  O O     . GLY C  1 62  ? -47.175 -25.469 20.468  1.00 29.85  ? 90  GLY C O     1 
ATOM   5992  N N     . ALA C  1 63  ? -45.123 -24.769 21.102  1.00 32.15  ? 91  ALA C N     1 
ATOM   5993  C CA    . ALA C  1 63  ? -45.570 -24.148 22.355  1.00 31.74  ? 91  ALA C CA    1 
ATOM   5994  C C     . ALA C  1 63  ? -46.331 -22.830 22.133  1.00 27.67  ? 91  ALA C C     1 
ATOM   5995  O O     . ALA C  1 63  ? -47.088 -22.399 23.007  1.00 33.25  ? 91  ALA C O     1 
ATOM   5996  C CB    . ALA C  1 63  ? -44.363 -23.926 23.303  1.00 27.29  ? 91  ALA C CB    1 
ATOM   5997  N N     . GLY C  1 64  ? -46.133 -22.200 20.971  1.00 33.54  ? 92  GLY C N     1 
ATOM   5998  C CA    . GLY C  1 64  ? -46.771 -20.918 20.636  1.00 33.42  ? 92  GLY C CA    1 
ATOM   5999  C C     . GLY C  1 64  ? -46.294 -19.770 21.523  1.00 35.65  ? 92  GLY C C     1 
ATOM   6000  O O     . GLY C  1 64  ? -47.072 -18.879 21.893  1.00 34.05  ? 92  GLY C O     1 
ATOM   6001  N N     . LEU C  1 65  ? -45.016 -19.790 21.884  1.00 31.10  ? 93  LEU C N     1 
ATOM   6002  C CA    . LEU C  1 65  ? -44.480 -18.794 22.822  1.00 32.48  ? 93  LEU C CA    1 
ATOM   6003  C C     . LEU C  1 65  ? -43.576 -17.820 22.067  1.00 32.29  ? 93  LEU C C     1 
ATOM   6004  O O     . LEU C  1 65  ? -43.631 -17.749 20.851  1.00 36.10  ? 93  LEU C O     1 
ATOM   6005  C CB    . LEU C  1 65  ? -43.738 -19.502 23.963  1.00 32.37  ? 93  LEU C CB    1 
ATOM   6006  C CG    . LEU C  1 65  ? -44.587 -20.378 24.882  1.00 33.38  ? 93  LEU C CG    1 
ATOM   6007  C CD1   . LEU C  1 65  ? -43.670 -21.136 25.822  1.00 34.83  ? 93  LEU C CD1   1 
ATOM   6008  C CD2   . LEU C  1 65  ? -45.580 -19.539 25.659  1.00 31.74  ? 93  LEU C CD2   1 
ATOM   6009  N N     . ASP C  1 66  ? -42.737 -17.072 22.767  1.00 35.82  ? 94  ASP C N     1 
ATOM   6010  C CA    . ASP C  1 66  ? -41.860 -16.105 22.085  1.00 33.19  ? 94  ASP C CA    1 
ATOM   6011  C C     . ASP C  1 66  ? -40.399 -16.389 22.425  1.00 28.71  ? 94  ASP C C     1 
ATOM   6012  O O     . ASP C  1 66  ? -40.116 -17.303 23.197  1.00 27.81  ? 94  ASP C O     1 
ATOM   6013  C CB    . ASP C  1 66  ? -42.270 -14.658 22.442  1.00 35.28  ? 94  ASP C CB    1 
ATOM   6014  C CG    . ASP C  1 66  ? -42.251 -14.383 23.953  1.00 34.83  ? 94  ASP C CG    1 
ATOM   6015  O OD1   . ASP C  1 66  ? -41.391 -14.943 24.665  1.00 36.12  ? 94  ASP C OD1   1 
ATOM   6016  O OD2   . ASP C  1 66  ? -43.108 -13.603 24.432  1.00 41.24  ? 94  ASP C OD2   1 
ATOM   6017  N N     . TYR C  1 67  ? -39.495 -15.619 21.826  1.00 27.09  ? 95  TYR C N     1 
ATOM   6018  C CA    . TYR C  1 67  ? -38.067 -15.767 22.070  1.00 28.36  ? 95  TYR C CA    1 
ATOM   6019  C C     . TYR C  1 67  ? -37.579 -15.325 23.434  1.00 24.71  ? 95  TYR C C     1 
ATOM   6020  O O     . TYR C  1 67  ? -36.529 -15.789 23.852  1.00 25.96  ? 95  TYR C O     1 
ATOM   6021  C CB    . TYR C  1 67  ? -37.219 -15.112 20.968  1.00 28.13  ? 95  TYR C CB    1 
ATOM   6022  C CG    . TYR C  1 67  ? -36.552 -16.136 20.109  1.00 32.54  ? 95  TYR C CG    1 
ATOM   6023  C CD1   . TYR C  1 67  ? -35.169 -16.173 19.972  1.00 28.22  ? 95  TYR C CD1   1 
ATOM   6024  C CD2   . TYR C  1 67  ? -37.295 -17.116 19.478  1.00 25.84  ? 95  TYR C CD2   1 
ATOM   6025  C CE1   . TYR C  1 67  ? -34.562 -17.139 19.200  1.00 29.95  ? 95  TYR C CE1   1 
ATOM   6026  C CE2   . TYR C  1 67  ? -36.700 -18.093 18.708  1.00 27.30  ? 95  TYR C CE2   1 
ATOM   6027  C CZ    . TYR C  1 67  ? -35.329 -18.107 18.571  1.00 30.54  ? 95  TYR C CZ    1 
ATOM   6028  O OH    . TYR C  1 67  ? -34.728 -19.080 17.795  1.00 31.82  ? 95  TYR C OH    1 
ATOM   6029  N N     . LEU C  1 68  ? -38.326 -14.465 24.125  1.00 27.00  ? 96  LEU C N     1 
ATOM   6030  C CA    . LEU C  1 68  ? -38.021 -14.148 25.524  1.00 27.20  ? 96  LEU C CA    1 
ATOM   6031  C C     . LEU C  1 68  ? -38.221 -15.391 26.403  1.00 26.87  ? 96  LEU C C     1 
ATOM   6032  O O     . LEU C  1 68  ? -37.330 -15.753 27.188  1.00 22.30  ? 96  LEU C O     1 
ATOM   6033  C CB    . LEU C  1 68  ? -38.867 -12.975 26.048  1.00 24.33  ? 96  LEU C CB    1 
ATOM   6034  C CG    . LEU C  1 68  ? -38.643 -12.525 27.496  1.00 29.87  ? 96  LEU C CG    1 
ATOM   6035  C CD1   . LEU C  1 68  ? -37.193 -11.998 27.693  1.00 22.52  ? 96  LEU C CD1   1 
ATOM   6036  C CD2   . LEU C  1 68  ? -39.703 -11.464 27.917  1.00 24.31  ? 96  LEU C CD2   1 
ATOM   6037  N N     . ALA C  1 69  ? -39.384 -16.033 26.264  1.00 26.21  ? 97  ALA C N     1 
ATOM   6038  C CA    . ALA C  1 69  ? -39.683 -17.309 26.926  1.00 26.32  ? 97  ALA C CA    1 
ATOM   6039  C C     . ALA C  1 69  ? -38.612 -18.375 26.642  1.00 26.92  ? 97  ALA C C     1 
ATOM   6040  O O     . ALA C  1 69  ? -38.175 -19.125 27.537  1.00 26.40  ? 97  ALA C O     1 
ATOM   6041  C CB    . ALA C  1 69  ? -41.042 -17.824 26.456  1.00 24.86  ? 97  ALA C CB    1 
ATOM   6042  N N     . TYR C  1 70  ? -38.218 -18.453 25.386  1.00 27.37  ? 98  TYR C N     1 
ATOM   6043  C CA    . TYR C  1 70  ? -37.168 -19.370 24.977  1.00 25.64  ? 98  TYR C CA    1 
ATOM   6044  C C     . TYR C  1 70  ? -35.859 -19.058 25.695  1.00 26.51  ? 98  TYR C C     1 
ATOM   6045  O O     . TYR C  1 70  ? -35.157 -19.971 26.164  1.00 28.63  ? 98  TYR C O     1 
ATOM   6046  C CB    . TYR C  1 70  ? -37.022 -19.272 23.470  1.00 25.09  ? 98  TYR C CB    1 
ATOM   6047  C CG    . TYR C  1 70  ? -35.847 -19.957 22.859  1.00 22.51  ? 98  TYR C CG    1 
ATOM   6048  C CD1   . TYR C  1 70  ? -35.650 -21.321 23.012  1.00 23.64  ? 98  TYR C CD1   1 
ATOM   6049  C CD2   . TYR C  1 70  ? -34.934 -19.236 22.097  1.00 27.86  ? 98  TYR C CD2   1 
ATOM   6050  C CE1   . TYR C  1 70  ? -34.570 -21.953 22.426  1.00 23.13  ? 98  TYR C CE1   1 
ATOM   6051  C CE2   . TYR C  1 70  ? -33.853 -19.861 21.505  1.00 30.83  ? 98  TYR C CE2   1 
ATOM   6052  C CZ    . TYR C  1 70  ? -33.668 -21.221 21.684  1.00 27.10  ? 98  TYR C CZ    1 
ATOM   6053  O OH    . TYR C  1 70  ? -32.596 -21.837 21.092  1.00 25.94  ? 98  TYR C OH    1 
ATOM   6054  N N     . ALA C  1 71  ? -35.522 -17.775 25.765  1.00 25.82  ? 99  ALA C N     1 
ATOM   6055  C CA    . ALA C  1 71  ? -34.302 -17.342 26.421  1.00 29.04  ? 99  ALA C CA    1 
ATOM   6056  C C     . ALA C  1 71  ? -34.313 -17.745 27.905  1.00 26.80  ? 99  ALA C C     1 
ATOM   6057  O O     . ALA C  1 71  ? -33.317 -18.246 28.433  1.00 24.21  ? 99  ALA C O     1 
ATOM   6058  C CB    . ALA C  1 71  ? -34.134 -15.815 26.270  1.00 28.53  ? 99  ALA C CB    1 
ATOM   6059  N N     . ILE C  1 72  ? -35.457 -17.538 28.555  1.00 25.01  ? 100 ILE C N     1 
ATOM   6060  C CA    . ILE C  1 72  ? -35.645 -17.871 29.951  1.00 27.80  ? 100 ILE C CA    1 
ATOM   6061  C C     . ILE C  1 72  ? -35.553 -19.377 30.192  1.00 30.74  ? 100 ILE C C     1 
ATOM   6062  O O     . ILE C  1 72  ? -34.852 -19.823 31.116  1.00 28.22  ? 100 ILE C O     1 
ATOM   6063  C CB    . ILE C  1 72  ? -37.012 -17.358 30.463  1.00 26.14  ? 100 ILE C CB    1 
ATOM   6064  C CG1   . ILE C  1 72  ? -36.993 -15.831 30.588  1.00 28.78  ? 100 ILE C CG1   1 
ATOM   6065  C CG2   . ILE C  1 72  ? -37.371 -18.011 31.795  1.00 27.62  ? 100 ILE C CG2   1 
ATOM   6066  C CD1   . ILE C  1 72  ? -38.380 -15.221 30.706  1.00 30.03  ? 100 ILE C CD1   1 
ATOM   6067  N N     . ALA C  1 73  ? -36.249 -20.146 29.346  1.00 27.22  ? 101 ALA C N     1 
ATOM   6068  C CA    . ALA C  1 73  ? -36.238 -21.603 29.434  1.00 29.79  ? 101 ALA C CA    1 
ATOM   6069  C C     . ALA C  1 73  ? -34.831 -22.141 29.176  1.00 23.78  ? 101 ALA C C     1 
ATOM   6070  O O     . ALA C  1 73  ? -34.343 -22.986 29.925  1.00 27.89  ? 101 ALA C O     1 
ATOM   6071  C CB    . ALA C  1 73  ? -37.229 -22.208 28.462  1.00 22.13  ? 101 ALA C CB    1 
ATOM   6072  N N     . MET C  1 74  ? -34.180 -21.642 28.137  1.00 23.54  ? 102 MET C N     1 
ATOM   6073  C CA    . MET C  1 74  ? -32.813 -22.073 27.803  1.00 20.38  ? 102 MET C CA    1 
ATOM   6074  C C     . MET C  1 74  ? -31.840 -21.938 28.982  1.00 21.58  ? 102 MET C C     1 
ATOM   6075  O O     . MET C  1 74  ? -31.024 -22.825 29.219  1.00 21.32  ? 102 MET C O     1 
ATOM   6076  C CB    . MET C  1 74  ? -32.248 -21.257 26.632  1.00 24.62  ? 102 MET C CB    1 
ATOM   6077  C CG    . MET C  1 74  ? -32.404 -21.903 25.238  1.00 37.68  ? 102 MET C CG    1 
ATOM   6078  S SD    . MET C  1 74  ? -31.679 -23.561 25.024  1.00 33.39  ? 102 MET C SD    1 
ATOM   6079  C CE    . MET C  1 74  ? -29.945 -23.328 25.375  1.00 21.66  ? 102 MET C CE    1 
ATOM   6080  N N     . GLU C  1 75  ? -31.896 -20.800 29.667  1.00 22.86  ? 103 GLU C N     1 
ATOM   6081  C CA    . GLU C  1 75  ? -31.049 -20.534 30.831  1.00 25.89  ? 103 GLU C CA    1 
ATOM   6082  C C     . GLU C  1 75  ? -31.264 -21.561 31.948  1.00 24.55  ? 103 GLU C C     1 
ATOM   6083  O O     . GLU C  1 75  ? -30.303 -22.116 32.471  1.00 24.33  ? 103 GLU C O     1 
ATOM   6084  C CB    . GLU C  1 75  ? -31.301 -19.115 31.366  1.00 26.58  ? 103 GLU C CB    1 
ATOM   6085  C CG    . GLU C  1 75  ? -30.326 -18.680 32.458  1.00 30.40  ? 103 GLU C CG    1 
ATOM   6086  C CD    . GLU C  1 75  ? -30.730 -17.406 33.202  1.00 34.31  ? 103 GLU C CD    1 
ATOM   6087  O OE1   . GLU C  1 75  ? -31.204 -16.433 32.570  1.00 34.04  ? 103 GLU C OE1   1 
ATOM   6088  O OE2   . GLU C  1 75  ? -30.539 -17.377 34.437  1.00 34.84  ? 103 GLU C OE2   1 
ATOM   6089  N N     . GLU C  1 76  ? -32.520 -21.779 32.310  1.00 23.88  ? 104 GLU C N     1 
ATOM   6090  C CA    . GLU C  1 76  ? -32.900 -22.738 33.343  1.00 25.49  ? 104 GLU C CA    1 
ATOM   6091  C C     . GLU C  1 76  ? -32.538 -24.175 33.038  1.00 21.70  ? 104 GLU C C     1 
ATOM   6092  O O     . GLU C  1 76  ? -32.248 -24.933 33.959  1.00 28.41  ? 104 GLU C O     1 
ATOM   6093  C CB    . GLU C  1 76  ? -34.421 -22.688 33.594  1.00 22.98  ? 104 GLU C CB    1 
ATOM   6094  C CG    . GLU C  1 76  ? -34.933 -21.436 34.268  1.00 30.08  ? 104 GLU C CG    1 
ATOM   6095  C CD    . GLU C  1 76  ? -34.137 -21.006 35.495  1.00 42.59  ? 104 GLU C CD    1 
ATOM   6096  O OE1   . GLU C  1 76  ? -33.668 -21.854 36.306  1.00 33.57  ? 104 GLU C OE1   1 
ATOM   6097  O OE2   . GLU C  1 76  ? -33.990 -19.787 35.643  1.00 38.35  ? 104 GLU C OE2   1 
ATOM   6098  N N     . ILE C  1 77  ? -32.611 -24.559 31.758  1.00 24.64  ? 105 ILE C N     1 
ATOM   6099  C CA    . ILE C  1 77  ? -32.278 -25.902 31.326  1.00 20.74  ? 105 ILE C CA    1 
ATOM   6100  C C     . ILE C  1 77  ? -30.775 -26.083 31.395  1.00 23.11  ? 105 ILE C C     1 
ATOM   6101  O O     . ILE C  1 77  ? -30.316 -27.061 31.958  1.00 22.29  ? 105 ILE C O     1 
ATOM   6102  C CB    . ILE C  1 77  ? -32.796 -26.209 29.894  1.00 22.58  ? 105 ILE C CB    1 
ATOM   6103  C CG1   . ILE C  1 77  ? -34.322 -26.366 29.920  1.00 24.06  ? 105 ILE C CG1   1 
ATOM   6104  C CG2   . ILE C  1 77  ? -32.204 -27.499 29.305  1.00 20.11  ? 105 ILE C CG2   1 
ATOM   6105  C CD1   . ILE C  1 77  ? -34.796 -27.467 30.803  1.00 29.19  ? 105 ILE C CD1   1 
ATOM   6106  N N     . SER C  1 78  ? -30.040 -25.099 30.878  1.00 23.16  ? 106 SER C N     1 
ATOM   6107  C CA    . SER C  1 78  ? -28.578 -25.160 30.783  1.00 24.63  ? 106 SER C CA    1 
ATOM   6108  C C     . SER C  1 78  ? -27.900 -25.124 32.148  1.00 20.19  ? 106 SER C C     1 
ATOM   6109  O O     . SER C  1 78  ? -26.813 -25.685 32.360  1.00 22.84  ? 106 SER C O     1 
ATOM   6110  C CB    . SER C  1 78  ? -28.086 -24.017 29.911  1.00 27.38  ? 106 SER C CB    1 
ATOM   6111  O OG    . SER C  1 78  ? -28.743 -24.030 28.661  1.00 29.51  ? 106 SER C OG    1 
ATOM   6112  N N     . ARG C  1 79  ? -28.553 -24.439 33.073  1.00 21.51  ? 107 ARG C N     1 
ATOM   6113  C CA    . ARG C  1 79  ? -28.196 -24.409 34.465  1.00 24.19  ? 107 ARG C CA    1 
ATOM   6114  C C     . ARG C  1 79  ? -28.173 -25.821 35.042  1.00 27.83  ? 107 ARG C C     1 
ATOM   6115  O O     . ARG C  1 79  ? -27.274 -26.140 35.814  1.00 23.84  ? 107 ARG C O     1 
ATOM   6116  C CB    . ARG C  1 79  ? -29.171 -23.492 35.211  1.00 26.51  ? 107 ARG C CB    1 
ATOM   6117  C CG    . ARG C  1 79  ? -28.943 -23.334 36.659  1.00 31.19  ? 107 ARG C CG    1 
ATOM   6118  C CD    . ARG C  1 79  ? -29.811 -22.216 37.221  1.00 32.67  ? 107 ARG C CD    1 
ATOM   6119  N NE    . ARG C  1 79  ? -29.740 -22.189 38.681  1.00 36.23  ? 107 ARG C NE    1 
ATOM   6120  C CZ    . ARG C  1 79  ? -30.444 -22.984 39.490  1.00 48.34  ? 107 ARG C CZ    1 
ATOM   6121  N NH1   . ARG C  1 79  ? -31.312 -23.872 39.005  1.00 36.26  ? 107 ARG C NH1   1 
ATOM   6122  N NH2   . ARG C  1 79  ? -30.301 -22.882 40.808  1.00 53.67  ? 107 ARG C NH2   1 
ATOM   6123  N N     . GLY C  1 80  ? -29.128 -26.666 34.628  1.00 27.19  ? 108 GLY C N     1 
ATOM   6124  C CA    . GLY C  1 80  ? -29.177 -28.064 35.048  1.00 30.11  ? 108 GLY C CA    1 
ATOM   6125  C C     . GLY C  1 80  ? -28.198 -28.944 34.294  1.00 30.26  ? 108 GLY C C     1 
ATOM   6126  O O     . GLY C  1 80  ? -27.397 -29.654 34.906  1.00 28.80  ? 108 GLY C O     1 
ATOM   6127  N N     . CYS C  1 81  ? -28.272 -28.904 32.963  1.00 29.13  ? 109 CYS C N     1 
ATOM   6128  C CA    . CYS C  1 81  ? -27.339 -29.653 32.097  1.00 26.90  ? 109 CYS C CA    1 
ATOM   6129  C C     . CYS C  1 81  ? -27.017 -28.837 30.844  1.00 25.42  ? 109 CYS C C     1 
ATOM   6130  O O     . CYS C  1 81  ? -27.895 -28.512 30.058  1.00 20.84  ? 109 CYS C O     1 
ATOM   6131  C CB    . CYS C  1 81  ? -27.947 -31.020 31.711  1.00 26.86  ? 109 CYS C CB    1 
ATOM   6132  S SG    . CYS C  1 81  ? -26.895 -32.030 30.612  1.00 29.66  ? 109 CYS C SG    1 
ATOM   6133  N N     . ALA C  1 82  ? -25.758 -28.489 30.658  1.00 22.78  ? 110 ALA C N     1 
ATOM   6134  C CA    . ALA C  1 82  ? -25.379 -27.682 29.506  1.00 26.76  ? 110 ALA C CA    1 
ATOM   6135  C C     . ALA C  1 82  ? -25.567 -28.422 28.166  1.00 26.99  ? 110 ALA C C     1 
ATOM   6136  O O     . ALA C  1 82  ? -25.887 -27.803 27.143  1.00 25.21  ? 110 ALA C O     1 
ATOM   6137  C CB    . ALA C  1 82  ? -23.975 -27.211 29.649  1.00 20.47  ? 110 ALA C CB    1 
ATOM   6138  N N     . SER C  1 83  ? -25.403 -29.741 28.187  1.00 26.83  ? 111 SER C N     1 
ATOM   6139  C CA    . SER C  1 83  ? -25.521 -30.566 26.973  1.00 25.49  ? 111 SER C CA    1 
ATOM   6140  C C     . SER C  1 83  ? -26.971 -30.595 26.519  1.00 25.95  ? 111 SER C C     1 
ATOM   6141  O O     . SER C  1 83  ? -27.263 -30.417 25.331  1.00 23.48  ? 111 SER C O     1 
ATOM   6142  C CB    . SER C  1 83  ? -24.994 -31.997 27.196  1.00 20.75  ? 111 SER C CB    1 
ATOM   6143  O OG    . SER C  1 83  ? -23.578 -32.033 27.150  1.00 25.88  ? 111 SER C OG    1 
ATOM   6144  N N     . THR C  1 84  ? -27.863 -30.833 27.471  1.00 24.14  ? 112 THR C N     1 
ATOM   6145  C CA    . THR C  1 84  ? -29.286 -30.722 27.232  1.00 26.78  ? 112 THR C CA    1 
ATOM   6146  C C     . THR C  1 84  ? -29.676 -29.356 26.654  1.00 27.97  ? 112 THR C C     1 
ATOM   6147  O O     . THR C  1 84  ? -30.532 -29.275 25.767  1.00 24.21  ? 112 THR C O     1 
ATOM   6148  C CB    . THR C  1 84  ? -30.081 -30.940 28.530  1.00 27.45  ? 112 THR C CB    1 
ATOM   6149  O OG1   . THR C  1 84  ? -29.803 -32.241 29.044  1.00 34.56  ? 112 THR C OG1   1 
ATOM   6150  C CG2   . THR C  1 84  ? -31.536 -30.853 28.260  1.00 32.68  ? 112 THR C CG2   1 
ATOM   6151  N N     . GLY C  1 85  ? -29.061 -28.293 27.183  1.00 27.23  ? 113 GLY C N     1 
ATOM   6152  C CA    . GLY C  1 85  ? -29.208 -26.948 26.635  1.00 26.75  ? 113 GLY C CA    1 
ATOM   6153  C C     . GLY C  1 85  ? -28.859 -26.806 25.165  1.00 22.32  ? 113 GLY C C     1 
ATOM   6154  O O     . GLY C  1 85  ? -29.627 -26.258 24.408  1.00 21.36  ? 113 GLY C O     1 
ATOM   6155  N N     . VAL C  1 86  ? -27.683 -27.272 24.744  1.00 20.24  ? 114 VAL C N     1 
ATOM   6156  C CA    . VAL C  1 86  ? -27.308 -27.120 23.358  1.00 21.59  ? 114 VAL C CA    1 
ATOM   6157  C C     . VAL C  1 86  ? -28.214 -27.966 22.422  1.00 25.91  ? 114 VAL C C     1 
ATOM   6158  O O     . VAL C  1 86  ? -28.478 -27.562 21.297  1.00 20.24  ? 114 VAL C O     1 
ATOM   6159  C CB    . VAL C  1 86  ? -25.796 -27.414 23.117  1.00 27.12  ? 114 VAL C CB    1 
ATOM   6160  C CG1   . VAL C  1 86  ? -25.500 -28.903 23.252  1.00 24.78  ? 114 VAL C CG1   1 
ATOM   6161  C CG2   . VAL C  1 86  ? -25.375 -26.891 21.750  1.00 29.32  ? 114 VAL C CG2   1 
ATOM   6162  N N     . ILE C  1 87  ? -28.701 -29.116 22.910  1.00 26.16  ? 115 ILE C N     1 
ATOM   6163  C CA    . ILE C  1 87  ? -29.553 -30.013 22.111  1.00 23.14  ? 115 ILE C CA    1 
ATOM   6164  C C     . ILE C  1 87  ? -30.865 -29.297 21.802  1.00 24.54  ? 115 ILE C C     1 
ATOM   6165  O O     . ILE C  1 87  ? -31.332 -29.243 20.644  1.00 24.10  ? 115 ILE C O     1 
ATOM   6166  C CB    . ILE C  1 87  ? -29.765 -31.387 22.835  1.00 25.28  ? 115 ILE C CB    1 
ATOM   6167  C CG1   . ILE C  1 87  ? -28.415 -32.174 22.913  1.00 19.87  ? 115 ILE C CG1   1 
ATOM   6168  C CG2   . ILE C  1 87  ? -30.801 -32.255 22.118  1.00 22.97  ? 115 ILE C CG2   1 
ATOM   6169  C CD1   . ILE C  1 87  ? -28.337 -33.204 23.995  1.00 19.25  ? 115 ILE C CD1   1 
ATOM   6170  N N     . MET C  1 88  ? -31.421 -28.713 22.847  1.00 25.85  ? 116 MET C N     1 
ATOM   6171  C CA    . MET C  1 88  ? -32.644 -27.896 22.763  1.00 26.56  ? 116 MET C CA    1 
ATOM   6172  C C     . MET C  1 88  ? -32.421 -26.646 21.882  1.00 27.46  ? 116 MET C C     1 
ATOM   6173  O O     . MET C  1 88  ? -33.245 -26.314 21.030  1.00 24.22  ? 116 MET C O     1 
ATOM   6174  C CB    . MET C  1 88  ? -33.085 -27.556 24.187  1.00 23.72  ? 116 MET C CB    1 
ATOM   6175  C CG    . MET C  1 88  ? -34.004 -26.398 24.364  1.00 25.16  ? 116 MET C CG    1 
ATOM   6176  S SD    . MET C  1 88  ? -34.390 -26.118 26.104  1.00 30.38  ? 116 MET C SD    1 
ATOM   6177  C CE    . MET C  1 88  ? -35.383 -24.623 25.908  1.00 26.80  ? 116 MET C CE    1 
ATOM   6178  N N     . SER C  1 89  ? -31.292 -25.969 22.060  1.00 24.43  ? 117 SER C N     1 
ATOM   6179  C CA    . SER C  1 89  ? -31.021 -24.772 21.267  1.00 25.41  ? 117 SER C CA    1 
ATOM   6180  C C     . SER C  1 89  ? -30.869 -25.050 19.755  1.00 22.03  ? 117 SER C C     1 
ATOM   6181  O O     . SER C  1 89  ? -31.261 -24.230 18.929  1.00 23.79  ? 117 SER C O     1 
ATOM   6182  C CB    . SER C  1 89  ? -29.745 -24.078 21.771  1.00 22.50  ? 117 SER C CB    1 
ATOM   6183  O OG    . SER C  1 89  ? -29.622 -22.815 21.171  1.00 31.30  ? 117 SER C OG    1 
ATOM   6184  N N     . VAL C  1 90  ? -30.204 -26.152 19.412  1.00 22.14  ? 118 VAL C N     1 
ATOM   6185  C CA    . VAL C  1 90  ? -30.043 -26.531 18.018  1.00 25.61  ? 118 VAL C CA    1 
ATOM   6186  C C     . VAL C  1 90  ? -31.411 -26.810 17.398  1.00 26.46  ? 118 VAL C C     1 
ATOM   6187  O O     . VAL C  1 90  ? -31.679 -26.340 16.303  1.00 24.84  ? 118 VAL C O     1 
ATOM   6188  C CB    . VAL C  1 90  ? -29.083 -27.714 17.841  1.00 26.67  ? 118 VAL C CB    1 
ATOM   6189  C CG1   . VAL C  1 90  ? -29.157 -28.314 16.410  1.00 26.51  ? 118 VAL C CG1   1 
ATOM   6190  C CG2   . VAL C  1 90  ? -27.664 -27.251 18.147  1.00 22.89  ? 118 VAL C CG2   1 
ATOM   6191  N N     . ASN C  1 91  ? -32.280 -27.521 18.113  1.00 26.26  ? 119 ASN C N     1 
ATOM   6192  C CA    . ASN C  1 91  ? -33.602 -27.871 17.553  1.00 27.82  ? 119 ASN C CA    1 
ATOM   6193  C C     . ASN C  1 91  ? -34.505 -26.654 17.325  1.00 26.83  ? 119 ASN C C     1 
ATOM   6194  O O     . ASN C  1 91  ? -35.162 -26.543 16.268  1.00 27.20  ? 119 ASN C O     1 
ATOM   6195  C CB    . ASN C  1 91  ? -34.352 -28.887 18.428  1.00 32.23  ? 119 ASN C CB    1 
ATOM   6196  C CG    . ASN C  1 91  ? -35.398 -29.687 17.633  1.00 28.07  ? 119 ASN C CG    1 
ATOM   6197  O OD1   . ASN C  1 91  ? -35.034 -30.462 16.746  1.00 32.16  ? 119 ASN C OD1   1 
ATOM   6198  N ND2   . ASN C  1 91  ? -36.683 -29.487 17.928  1.00 27.21  ? 119 ASN C ND2   1 
ATOM   6199  N N     . ASN C  1 92  ? -34.591 -25.789 18.344  1.00 21.98  ? 120 ASN C N     1 
ATOM   6200  C CA    . ASN C  1 92  ? -35.369 -24.549 18.255  1.00 19.78  ? 120 ASN C CA    1 
ATOM   6201  C C     . ASN C  1 92  ? -34.883 -23.545 17.229  1.00 25.43  ? 120 ASN C C     1 
ATOM   6202  O O     . ASN C  1 92  ? -35.630 -23.129 16.356  1.00 25.66  ? 120 ASN C O     1 
ATOM   6203  C CB    . ASN C  1 92  ? -35.407 -23.818 19.609  1.00 21.91  ? 120 ASN C CB    1 
ATOM   6204  C CG    . ASN C  1 92  ? -36.337 -24.453 20.605  1.00 25.64  ? 120 ASN C CG    1 
ATOM   6205  O OD1   . ASN C  1 92  ? -37.539 -24.150 20.631  1.00 21.65  ? 120 ASN C OD1   1 
ATOM   6206  N ND2   . ASN C  1 92  ? -35.778 -25.250 21.511  1.00 20.55  ? 120 ASN C ND2   1 
ATOM   6207  N N     . SER C  1 93  ? -33.619 -23.132 17.371  1.00 24.91  ? 121 SER C N     1 
ATOM   6208  C CA    . SER C  1 93  ? -33.058 -22.016 16.619  1.00 22.33  ? 121 SER C CA    1 
ATOM   6209  C C     . SER C  1 93  ? -32.487 -22.416 15.264  1.00 24.03  ? 121 SER C C     1 
ATOM   6210  O O     . SER C  1 93  ? -32.712 -21.725 14.284  1.00 24.48  ? 121 SER C O     1 
ATOM   6211  C CB    . SER C  1 93  ? -31.917 -21.344 17.408  1.00 23.40  ? 121 SER C CB    1 
ATOM   6212  O OG    . SER C  1 93  ? -32.404 -20.626 18.515  1.00 30.38  ? 121 SER C OG    1 
ATOM   6213  N N     . LEU C  1 94  ? -31.698 -23.492 15.228  1.00 19.08  ? 122 LEU C N     1 
ATOM   6214  C CA    . LEU C  1 94  ? -30.981 -23.852 14.029  1.00 24.96  ? 122 LEU C CA    1 
ATOM   6215  C C     . LEU C  1 94  ? -31.716 -24.813 13.088  1.00 25.56  ? 122 LEU C C     1 
ATOM   6216  O O     . LEU C  1 94  ? -31.457 -24.797 11.896  1.00 24.55  ? 122 LEU C O     1 
ATOM   6217  C CB    . LEU C  1 94  ? -29.591 -24.404 14.376  1.00 23.05  ? 122 LEU C CB    1 
ATOM   6218  C CG    . LEU C  1 94  ? -28.713 -23.574 15.310  1.00 29.37  ? 122 LEU C CG    1 
ATOM   6219  C CD1   . LEU C  1 94  ? -27.322 -24.278 15.356  1.00 19.08  ? 122 LEU C CD1   1 
ATOM   6220  C CD2   . LEU C  1 94  ? -28.577 -22.077 14.880  1.00 26.13  ? 122 LEU C CD2   1 
ATOM   6221  N N     . TYR C  1 95  ? -32.630 -25.624 13.622  1.00 28.59  ? 123 TYR C N     1 
ATOM   6222  C CA    . TYR C  1 95  ? -33.373 -26.566 12.790  1.00 27.21  ? 123 TYR C CA    1 
ATOM   6223  C C     . TYR C  1 95  ? -34.743 -26.001 12.460  1.00 25.06  ? 123 TYR C C     1 
ATOM   6224  O O     . TYR C  1 95  ? -35.017 -25.684 11.316  1.00 28.69  ? 123 TYR C O     1 
ATOM   6225  C CB    . TYR C  1 95  ? -33.469 -27.957 13.438  1.00 27.26  ? 123 TYR C CB    1 
ATOM   6226  C CG    . TYR C  1 95  ? -34.248 -28.888 12.563  1.00 25.09  ? 123 TYR C CG    1 
ATOM   6227  C CD1   . TYR C  1 95  ? -33.755 -29.262 11.317  1.00 28.37  ? 123 TYR C CD1   1 
ATOM   6228  C CD2   . TYR C  1 95  ? -35.523 -29.311 12.923  1.00 28.07  ? 123 TYR C CD2   1 
ATOM   6229  C CE1   . TYR C  1 95  ? -34.492 -30.074 10.468  1.00 26.88  ? 123 TYR C CE1   1 
ATOM   6230  C CE2   . TYR C  1 95  ? -36.270 -30.127 12.077  1.00 28.11  ? 123 TYR C CE2   1 
ATOM   6231  C CZ    . TYR C  1 95  ? -35.744 -30.507 10.856  1.00 28.52  ? 123 TYR C CZ    1 
ATOM   6232  O OH    . TYR C  1 95  ? -36.467 -31.299 10.007  1.00 28.65  ? 123 TYR C OH    1 
ATOM   6233  N N     . LEU C  1 96  ? -35.585 -25.860 13.471  1.00 27.02  ? 124 LEU C N     1 
ATOM   6234  C CA    . LEU C  1 96  ? -36.960 -25.426 13.272  1.00 28.17  ? 124 LEU C CA    1 
ATOM   6235  C C     . LEU C  1 96  ? -37.051 -23.972 12.826  1.00 30.06  ? 124 LEU C C     1 
ATOM   6236  O O     . LEU C  1 96  ? -37.943 -23.608 12.039  1.00 31.53  ? 124 LEU C O     1 
ATOM   6237  C CB    . LEU C  1 96  ? -37.767 -25.634 14.537  1.00 26.23  ? 124 LEU C CB    1 
ATOM   6238  C CG    . LEU C  1 96  ? -38.086 -27.067 14.976  1.00 32.81  ? 124 LEU C CG    1 
ATOM   6239  C CD1   . LEU C  1 96  ? -38.818 -27.001 16.313  1.00 26.78  ? 124 LEU C CD1   1 
ATOM   6240  C CD2   . LEU C  1 96  ? -38.932 -27.845 13.956  1.00 25.27  ? 124 LEU C CD2   1 
ATOM   6241  N N     . GLY C  1 97  ? -36.118 -23.154 13.324  1.00 29.67  ? 125 GLY C N     1 
ATOM   6242  C CA    . GLY C  1 97  ? -36.051 -21.725 13.023  1.00 30.50  ? 125 GLY C CA    1 
ATOM   6243  C C     . GLY C  1 97  ? -36.132 -21.389 11.547  1.00 28.44  ? 125 GLY C C     1 
ATOM   6244  O O     . GLY C  1 97  ? -37.097 -20.739 11.112  1.00 26.46  ? 125 GLY C O     1 
ATOM   6245  N N     . PRO C  1 98  ? -35.135 -21.834 10.762  1.00 23.86  ? 126 PRO C N     1 
ATOM   6246  C CA    . PRO C  1 98  ? -35.117 -21.505 9.337   1.00 27.99  ? 126 PRO C CA    1 
ATOM   6247  C C     . PRO C  1 98  ? -36.261 -22.099 8.541   1.00 27.12  ? 126 PRO C C     1 
ATOM   6248  O O     . PRO C  1 98  ? -36.669 -21.511 7.546   1.00 30.75  ? 126 PRO C O     1 
ATOM   6249  C CB    . PRO C  1 98  ? -33.785 -22.091 8.842   1.00 23.40  ? 126 PRO C CB    1 
ATOM   6250  C CG    . PRO C  1 98  ? -33.374 -23.064 9.874   1.00 26.42  ? 126 PRO C CG    1 
ATOM   6251  C CD    . PRO C  1 98  ? -33.950 -22.620 11.160  1.00 28.24  ? 126 PRO C CD    1 
ATOM   6252  N N     . ILE C  1 99  ? -36.769 -23.253 8.966   1.00 31.67  ? 127 ILE C N     1 
ATOM   6253  C CA    . ILE C  1 99  ? -37.903 -23.900 8.283   1.00 27.72  ? 127 ILE C CA    1 
ATOM   6254  C C     . ILE C  1 99  ? -39.178 -23.051 8.459   1.00 29.09  ? 127 ILE C C     1 
ATOM   6255  O O     . ILE C  1 99  ? -39.884 -22.783 7.473   1.00 29.88  ? 127 ILE C O     1 
ATOM   6256  C CB    . ILE C  1 99  ? -38.119 -25.395 8.730   1.00 28.52  ? 127 ILE C CB    1 
ATOM   6257  C CG1   . ILE C  1 99  ? -36.864 -26.240 8.468   1.00 25.87  ? 127 ILE C CG1   1 
ATOM   6258  C CG2   . ILE C  1 99  ? -39.317 -26.054 7.967   1.00 26.95  ? 127 ILE C CG2   1 
ATOM   6259  C CD1   . ILE C  1 99  ? -36.873 -27.644 9.095   1.00 25.61  ? 127 ILE C CD1   1 
ATOM   6260  N N     . LEU C  1 100 ? -39.447 -22.589 9.680   1.00 30.67  ? 128 LEU C N     1 
ATOM   6261  C CA    . LEU C  1 100 ? -40.589 -21.683 9.919   1.00 31.56  ? 128 LEU C CA    1 
ATOM   6262  C C     . LEU C  1 100 ? -40.421 -20.375 9.166   1.00 29.27  ? 128 LEU C C     1 
ATOM   6263  O O     . LEU C  1 100 ? -41.374 -19.845 8.582   1.00 32.50  ? 128 LEU C O     1 
ATOM   6264  C CB    . LEU C  1 100 ? -40.783 -21.379 11.401  1.00 32.90  ? 128 LEU C CB    1 
ATOM   6265  C CG    . LEU C  1 100 ? -41.381 -22.462 12.291  1.00 34.18  ? 128 LEU C CG    1 
ATOM   6266  C CD1   . LEU C  1 100 ? -41.031 -22.170 13.741  1.00 42.30  ? 128 LEU C CD1   1 
ATOM   6267  C CD2   . LEU C  1 100 ? -42.899 -22.555 12.116  1.00 39.89  ? 128 LEU C CD2   1 
ATOM   6268  N N     . LYS C  1 101 ? -39.207 -19.847 9.169   1.00 30.20  ? 129 LYS C N     1 
ATOM   6269  C CA    . LYS C  1 101 ? -38.950 -18.580 8.496   1.00 30.62  ? 129 LYS C CA    1 
ATOM   6270  C C     . LYS C  1 101 ? -39.008 -18.632 6.964   1.00 30.10  ? 129 LYS C C     1 
ATOM   6271  O O     . LYS C  1 101 ? -39.572 -17.739 6.365   1.00 32.97  ? 129 LYS C O     1 
ATOM   6272  C CB    . LYS C  1 101 ? -37.620 -17.989 8.936   1.00 29.29  ? 129 LYS C CB    1 
ATOM   6273  C CG    . LYS C  1 101 ? -37.412 -16.552 8.469   1.00 38.20  ? 129 LYS C CG    1 
ATOM   6274  C CD    . LYS C  1 101 ? -36.666 -15.745 9.506   1.00 43.42  ? 129 LYS C CD    1 
ATOM   6275  C CE    . LYS C  1 101 ? -36.334 -14.354 9.013   1.00 44.03  ? 129 LYS C CE    1 
ATOM   6276  N NZ    . LYS C  1 101 ? -34.876 -14.280 8.756   1.00 53.12  ? 129 LYS C NZ    1 
ATOM   6277  N N     . PHE C  1 102 ? -38.406 -19.645 6.342   1.00 30.43  ? 130 PHE C N     1 
ATOM   6278  C CA    . PHE C  1 102 ? -38.225 -19.671 4.887   1.00 29.42  ? 130 PHE C CA    1 
ATOM   6279  C C     . PHE C  1 102 ? -38.939 -20.821 4.178   1.00 30.78  ? 130 PHE C C     1 
ATOM   6280  O O     . PHE C  1 102 ? -38.844 -20.936 2.950   1.00 34.70  ? 130 PHE C O     1 
ATOM   6281  C CB    . PHE C  1 102 ? -36.735 -19.754 4.537   1.00 29.22  ? 130 PHE C CB    1 
ATOM   6282  C CG    . PHE C  1 102 ? -35.891 -18.659 5.157   1.00 32.61  ? 130 PHE C CG    1 
ATOM   6283  C CD1   . PHE C  1 102 ? -35.869 -17.378 4.608   1.00 33.82  ? 130 PHE C CD1   1 
ATOM   6284  C CD2   . PHE C  1 102 ? -35.108 -18.910 6.275   1.00 37.31  ? 130 PHE C CD2   1 
ATOM   6285  C CE1   . PHE C  1 102 ? -35.097 -16.383 5.169   1.00 35.27  ? 130 PHE C CE1   1 
ATOM   6286  C CE2   . PHE C  1 102 ? -34.334 -17.906 6.838   1.00 31.46  ? 130 PHE C CE2   1 
ATOM   6287  C CZ    . PHE C  1 102 ? -34.335 -16.651 6.279   1.00 32.80  ? 130 PHE C CZ    1 
ATOM   6288  N N     . GLY C  1 103 ? -39.639 -21.671 4.927   1.00 34.31  ? 131 GLY C N     1 
ATOM   6289  C CA    . GLY C  1 103 ? -40.281 -22.856 4.357   1.00 30.24  ? 131 GLY C CA    1 
ATOM   6290  C C     . GLY C  1 103 ? -41.690 -22.630 3.818   1.00 32.31  ? 131 GLY C C     1 
ATOM   6291  O O     . GLY C  1 103 ? -42.414 -21.747 4.283   1.00 32.64  ? 131 GLY C O     1 
ATOM   6292  N N     . SER C  1 104 ? -42.071 -23.457 2.842   1.00 32.21  ? 132 SER C N     1 
ATOM   6293  C CA    . SER C  1 104 ? -43.451 -23.520 2.345   1.00 33.87  ? 132 SER C CA    1 
ATOM   6294  C C     . SER C  1 104 ? -44.368 -24.158 3.387   1.00 32.45  ? 132 SER C C     1 
ATOM   6295  O O     . SER C  1 104 ? -43.896 -24.796 4.327   1.00 33.49  ? 132 SER C O     1 
ATOM   6296  C CB    . SER C  1 104 ? -43.499 -24.350 1.066   1.00 32.62  ? 132 SER C CB    1 
ATOM   6297  O OG    . SER C  1 104 ? -43.241 -25.719 1.337   1.00 32.98  ? 132 SER C OG    1 
ATOM   6298  N N     . LYS C  1 105 ? -45.679 -24.015 3.185   1.00 37.58  ? 133 LYS C N     1 
ATOM   6299  C CA    . LYS C  1 105 ? -46.688 -24.653 4.035   1.00 36.98  ? 133 LYS C CA    1 
ATOM   6300  C C     . LYS C  1 105 ? -46.405 -26.146 4.166   1.00 37.54  ? 133 LYS C C     1 
ATOM   6301  O O     . LYS C  1 105 ? -46.580 -26.736 5.237   1.00 38.32  ? 133 LYS C O     1 
ATOM   6302  C CB    . LYS C  1 105 ? -48.095 -24.442 3.452   1.00 38.22  ? 133 LYS C CB    1 
ATOM   6303  C CG    . LYS C  1 105 ? -49.225 -24.718 4.431   1.00 43.85  ? 133 LYS C CG    1 
ATOM   6304  C CD    . LYS C  1 105 ? -50.588 -24.505 3.778   1.00 46.07  ? 133 LYS C CD    1 
ATOM   6305  N N     . GLU C  1 106 ? -45.927 -26.734 3.073   1.00 36.42  ? 134 GLU C N     1 
ATOM   6306  C CA    . GLU C  1 106 ? -45.742 -28.179 2.970   1.00 34.63  ? 134 GLU C CA    1 
ATOM   6307  C C     . GLU C  1 106 ? -44.475 -28.622 3.654   1.00 33.92  ? 134 GLU C C     1 
ATOM   6308  O O     . GLU C  1 106 ? -44.450 -29.669 4.300   1.00 34.30  ? 134 GLU C O     1 
ATOM   6309  C CB    . GLU C  1 106 ? -45.714 -28.607 1.495   1.00 37.51  ? 134 GLU C CB    1 
ATOM   6310  C CG    . GLU C  1 106 ? -47.087 -28.604 0.821   1.00 50.96  ? 134 GLU C CG    1 
ATOM   6311  C CD    . GLU C  1 106 ? -47.755 -27.230 0.836   1.00 78.24  ? 134 GLU C CD    1 
ATOM   6312  O OE1   . GLU C  1 106 ? -47.080 -26.241 0.453   1.00 76.38  ? 134 GLU C OE1   1 
ATOM   6313  O OE2   . GLU C  1 106 ? -48.945 -27.143 1.235   1.00 81.40  ? 134 GLU C OE2   1 
ATOM   6314  N N     . GLN C  1 107 ? -43.415 -27.835 3.495   1.00 31.17  ? 135 GLN C N     1 
ATOM   6315  C CA    . GLN C  1 107 ? -42.164 -28.131 4.167   1.00 32.09  ? 135 GLN C CA    1 
ATOM   6316  C C     . GLN C  1 107 ? -42.331 -28.080 5.693   1.00 29.48  ? 135 GLN C C     1 
ATOM   6317  O O     . GLN C  1 107 ? -41.773 -28.907 6.403   1.00 34.75  ? 135 GLN C O     1 
ATOM   6318  C CB    . GLN C  1 107 ? -41.074 -27.183 3.688   1.00 28.58  ? 135 GLN C CB    1 
ATOM   6319  C CG    . GLN C  1 107 ? -40.543 -27.562 2.345   1.00 29.34  ? 135 GLN C CG    1 
ATOM   6320  C CD    . GLN C  1 107 ? -39.588 -26.556 1.779   1.00 27.36  ? 135 GLN C CD    1 
ATOM   6321  O OE1   . GLN C  1 107 ? -39.682 -25.370 2.065   1.00 29.59  ? 135 GLN C OE1   1 
ATOM   6322  N NE2   . GLN C  1 107 ? -38.655 -27.023 0.956   1.00 27.58  ? 135 GLN C NE2   1 
ATOM   6323  N N     . LYS C  1 108 ? -43.104 -27.107 6.163   1.00 27.86  ? 136 LYS C N     1 
ATOM   6324  C CA    . LYS C  1 108 ? -43.458 -26.962 7.564   1.00 31.48  ? 136 LYS C CA    1 
ATOM   6325  C C     . LYS C  1 108 ? -44.224 -28.166 8.092   1.00 33.52  ? 136 LYS C C     1 
ATOM   6326  O O     . LYS C  1 108 ? -43.881 -28.701 9.143   1.00 27.91  ? 136 LYS C O     1 
ATOM   6327  C CB    . LYS C  1 108 ? -44.299 -25.689 7.777   1.00 30.91  ? 136 LYS C CB    1 
ATOM   6328  C CG    . LYS C  1 108 ? -43.500 -24.400 7.664   1.00 37.19  ? 136 LYS C CG    1 
ATOM   6329  C CD    . LYS C  1 108 ? -44.396 -23.175 7.742   1.00 36.50  ? 136 LYS C CD    1 
ATOM   6330  C CE    . LYS C  1 108 ? -43.611 -21.900 7.482   1.00 42.15  ? 136 LYS C CE    1 
ATOM   6331  N NZ    . LYS C  1 108 ? -44.489 -20.696 7.422   1.00 44.36  ? 136 LYS C NZ    1 
ATOM   6332  N N     . GLN C  1 109 ? -45.252 -28.603 7.358   1.00 34.66  ? 137 GLN C N     1 
ATOM   6333  C CA    . GLN C  1 109 ? -46.008 -29.790 7.761   1.00 32.36  ? 137 GLN C CA    1 
ATOM   6334  C C     . GLN C  1 109 ? -45.097 -31.022 7.877   1.00 28.22  ? 137 GLN C C     1 
ATOM   6335  O O     . GLN C  1 109 ? -45.170 -31.759 8.851   1.00 32.68  ? 137 GLN C O     1 
ATOM   6336  C CB    . GLN C  1 109 ? -47.144 -30.084 6.779   1.00 34.17  ? 137 GLN C CB    1 
ATOM   6337  C CG    . GLN C  1 109 ? -48.301 -29.094 6.840   1.00 39.99  ? 137 GLN C CG    1 
ATOM   6338  C CD    . GLN C  1 109 ? -49.356 -29.364 5.757   1.00 45.65  ? 137 GLN C CD    1 
ATOM   6339  O OE1   . GLN C  1 109 ? -49.442 -30.470 5.216   1.00 55.74  ? 137 GLN C OE1   1 
ATOM   6340  N NE2   . GLN C  1 109 ? -50.158 -28.349 5.440   1.00 48.22  ? 137 GLN C NE2   1 
ATOM   6341  N N     . ALA C  1 110 ? -44.252 -31.235 6.876   1.00 29.03  ? 138 ALA C N     1 
ATOM   6342  C CA    . ALA C  1 110 ? -43.384 -32.408 6.821   1.00 27.61  ? 138 ALA C CA    1 
ATOM   6343  C C     . ALA C  1 110 ? -42.163 -32.344 7.742   1.00 29.34  ? 138 ALA C C     1 
ATOM   6344  O O     . ALA C  1 110 ? -41.735 -33.383 8.235   1.00 30.49  ? 138 ALA C O     1 
ATOM   6345  C CB    . ALA C  1 110 ? -42.905 -32.626 5.400   1.00 27.08  ? 138 ALA C CB    1 
ATOM   6346  N N     . TRP C  1 111 ? -41.572 -31.158 7.927   1.00 30.78  ? 139 TRP C N     1 
ATOM   6347  C CA    . TRP C  1 111 ? -40.239 -31.058 8.576   1.00 27.50  ? 139 TRP C CA    1 
ATOM   6348  C C     . TRP C  1 111 ? -40.174 -30.333 9.933   1.00 29.51  ? 139 TRP C C     1 
ATOM   6349  O O     . TRP C  1 111 ? -39.111 -30.379 10.617  1.00 27.32  ? 139 TRP C O     1 
ATOM   6350  C CB    . TRP C  1 111 ? -39.262 -30.373 7.637   1.00 25.54  ? 139 TRP C CB    1 
ATOM   6351  C CG    . TRP C  1 111 ? -39.034 -31.081 6.366   1.00 29.77  ? 139 TRP C CG    1 
ATOM   6352  C CD1   . TRP C  1 111 ? -39.797 -31.001 5.227   1.00 27.65  ? 139 TRP C CD1   1 
ATOM   6353  C CD2   . TRP C  1 111 ? -37.955 -31.962 6.064   1.00 26.68  ? 139 TRP C CD2   1 
ATOM   6354  N NE1   . TRP C  1 111 ? -39.264 -31.790 4.248   1.00 30.71  ? 139 TRP C NE1   1 
ATOM   6355  C CE2   . TRP C  1 111 ? -38.127 -32.389 4.727   1.00 33.13  ? 139 TRP C CE2   1 
ATOM   6356  C CE3   . TRP C  1 111 ? -36.860 -32.443 6.792   1.00 31.58  ? 139 TRP C CE3   1 
ATOM   6357  C CZ2   . TRP C  1 111 ? -37.230 -33.262 4.094   1.00 22.95  ? 139 TRP C CZ2   1 
ATOM   6358  C CZ3   . TRP C  1 111 ? -35.969 -33.323 6.163   1.00 29.09  ? 139 TRP C CZ3   1 
ATOM   6359  C CH2   . TRP C  1 111 ? -36.180 -33.738 4.833   1.00 27.69  ? 139 TRP C CH2   1 
ATOM   6360  N N     . VAL C  1 112 ? -41.261 -29.641 10.288  1.00 27.95  ? 140 VAL C N     1 
ATOM   6361  C CA    . VAL C  1 112 ? -41.412 -28.982 11.583  1.00 29.73  ? 140 VAL C CA    1 
ATOM   6362  C C     . VAL C  1 112 ? -42.201 -29.915 12.503  1.00 31.20  ? 140 VAL C C     1 
ATOM   6363  O O     . VAL C  1 112 ? -41.676 -30.451 13.504  1.00 27.45  ? 140 VAL C O     1 
ATOM   6364  C CB    . VAL C  1 112 ? -42.148 -27.583 11.459  1.00 28.15  ? 140 VAL C CB    1 
ATOM   6365  C CG1   . VAL C  1 112 ? -42.602 -27.033 12.833  1.00 26.54  ? 140 VAL C CG1   1 
ATOM   6366  C CG2   . VAL C  1 112 ? -41.272 -26.558 10.729  1.00 28.84  ? 140 VAL C CG2   1 
ATOM   6367  N N     . THR C  1 113 ? -43.468 -30.122 12.144  1.00 32.24  ? 141 THR C N     1 
ATOM   6368  C CA    . THR C  1 113 ? -44.437 -30.802 13.012  1.00 31.43  ? 141 THR C CA    1 
ATOM   6369  C C     . THR C  1 113 ? -43.994 -32.118 13.651  1.00 30.16  ? 141 THR C C     1 
ATOM   6370  O O     . THR C  1 113 ? -44.243 -32.330 14.829  1.00 34.05  ? 141 THR C O     1 
ATOM   6371  C CB    . THR C  1 113 ? -45.778 -31.004 12.257  1.00 29.43  ? 141 THR C CB    1 
ATOM   6372  O OG1   . THR C  1 113 ? -46.266 -29.719 11.857  1.00 31.69  ? 141 THR C OG1   1 
ATOM   6373  C CG2   . THR C  1 113 ? -46.810 -31.673 13.127  1.00 30.64  ? 141 THR C CG2   1 
ATOM   6374  N N     . PRO C  1 114 ? -43.360 -33.014 12.881  1.00 29.98  ? 142 PRO C N     1 
ATOM   6375  C CA    . PRO C  1 114 ? -42.834 -34.239 13.507  1.00 28.63  ? 142 PRO C CA    1 
ATOM   6376  C C     . PRO C  1 114 ? -41.571 -34.057 14.383  1.00 29.13  ? 142 PRO C C     1 
ATOM   6377  O O     . PRO C  1 114 ? -41.103 -35.025 15.009  1.00 29.19  ? 142 PRO C O     1 
ATOM   6378  C CB    . PRO C  1 114 ? -42.503 -35.136 12.306  1.00 30.44  ? 142 PRO C CB    1 
ATOM   6379  C CG    . PRO C  1 114 ? -43.064 -34.432 11.085  1.00 30.25  ? 142 PRO C CG    1 
ATOM   6380  C CD    . PRO C  1 114 ? -43.113 -32.988 11.426  1.00 31.42  ? 142 PRO C CD    1 
ATOM   6381  N N     . PHE C  1 115 ? -41.019 -32.848 14.408  1.00 33.38  ? 143 PHE C N     1 
ATOM   6382  C CA    . PHE C  1 115 ? -39.803 -32.552 15.167  1.00 27.42  ? 143 PHE C CA    1 
ATOM   6383  C C     . PHE C  1 115 ? -40.088 -31.583 16.324  1.00 29.47  ? 143 PHE C C     1 
ATOM   6384  O O     . PHE C  1 115 ? -39.184 -30.873 16.794  1.00 31.77  ? 143 PHE C O     1 
ATOM   6385  C CB    . PHE C  1 115 ? -38.753 -31.950 14.233  1.00 27.75  ? 143 PHE C CB    1 
ATOM   6386  C CG    . PHE C  1 115 ? -38.202 -32.917 13.241  1.00 25.82  ? 143 PHE C CG    1 
ATOM   6387  C CD1   . PHE C  1 115 ? -36.929 -33.441 13.408  1.00 28.24  ? 143 PHE C CD1   1 
ATOM   6388  C CD2   . PHE C  1 115 ? -38.945 -33.300 12.132  1.00 23.76  ? 143 PHE C CD2   1 
ATOM   6389  C CE1   . PHE C  1 115 ? -36.388 -34.338 12.480  1.00 28.02  ? 143 PHE C CE1   1 
ATOM   6390  C CE2   . PHE C  1 115 ? -38.441 -34.202 11.211  1.00 27.62  ? 143 PHE C CE2   1 
ATOM   6391  C CZ    . PHE C  1 115 ? -37.151 -34.729 11.370  1.00 26.40  ? 143 PHE C CZ    1 
ATOM   6392  N N     . THR C  1 116 ? -41.325 -31.552 16.801  1.00 24.71  ? 144 THR C N     1 
ATOM   6393  C CA    . THR C  1 116 ? -41.729 -30.589 17.824  1.00 26.65  ? 144 THR C CA    1 
ATOM   6394  C C     . THR C  1 116 ? -41.911 -31.204 19.214  1.00 32.19  ? 144 THR C C     1 
ATOM   6395  O O     . THR C  1 116 ? -42.073 -30.468 20.190  1.00 34.85  ? 144 THR C O     1 
ATOM   6396  C CB    . THR C  1 116 ? -43.067 -29.897 17.478  1.00 30.07  ? 144 THR C CB    1 
ATOM   6397  O OG1   . THR C  1 116 ? -44.028 -30.883 17.113  1.00 32.74  ? 144 THR C OG1   1 
ATOM   6398  C CG2   . THR C  1 116 ? -42.929 -28.857 16.375  1.00 23.43  ? 144 THR C CG2   1 
ATOM   6399  N N     . SER C  1 117 ? -41.893 -32.532 19.313  1.00 34.14  ? 145 SER C N     1 
ATOM   6400  C CA    . SER C  1 117 ? -42.347 -33.226 20.521  1.00 32.87  ? 145 SER C CA    1 
ATOM   6401  C C     . SER C  1 117 ? -41.291 -34.108 21.188  1.00 29.66  ? 145 SER C C     1 
ATOM   6402  O O     . SER C  1 117 ? -41.557 -34.749 22.201  1.00 36.24  ? 145 SER C O     1 
ATOM   6403  C CB    . SER C  1 117 ? -43.580 -34.072 20.172  1.00 35.54  ? 145 SER C CB    1 
ATOM   6404  O OG    . SER C  1 117 ? -43.234 -35.084 19.237  1.00 42.43  ? 145 SER C OG    1 
ATOM   6405  N N     . GLY C  1 118 ? -40.076 -34.124 20.655  1.00 33.73  ? 146 GLY C N     1 
ATOM   6406  C CA    . GLY C  1 118 ? -39.030 -34.951 21.223  1.00 32.40  ? 146 GLY C CA    1 
ATOM   6407  C C     . GLY C  1 118 ? -38.987 -36.357 20.657  1.00 35.08  ? 146 GLY C C     1 
ATOM   6408  O O     . GLY C  1 118 ? -38.092 -37.124 21.011  1.00 38.17  ? 146 GLY C O     1 
ATOM   6409  N N     . ASP C  1 119 ? -39.944 -36.699 19.786  1.00 35.82  ? 147 ASP C N     1 
ATOM   6410  C CA    . ASP C  1 119 ? -39.905 -37.970 19.054  1.00 36.87  ? 147 ASP C CA    1 
ATOM   6411  C C     . ASP C  1 119 ? -38.781 -37.953 18.013  1.00 34.75  ? 147 ASP C C     1 
ATOM   6412  O O     . ASP C  1 119 ? -38.066 -38.947 17.845  1.00 33.15  ? 147 ASP C O     1 
ATOM   6413  C CB    . ASP C  1 119 ? -41.264 -38.257 18.392  1.00 37.29  ? 147 ASP C CB    1 
ATOM   6414  C CG    . ASP C  1 119 ? -42.360 -38.582 19.410  1.00 52.29  ? 147 ASP C CG    1 
ATOM   6415  O OD1   . ASP C  1 119 ? -42.059 -39.232 20.447  1.00 43.78  ? 147 ASP C OD1   1 
ATOM   6416  O OD2   . ASP C  1 119 ? -43.531 -38.202 19.166  1.00 75.82  ? 147 ASP C OD2   1 
ATOM   6417  N N     . LYS C  1 120 ? -38.636 -36.815 17.330  1.00 32.24  ? 148 LYS C N     1 
ATOM   6418  C CA    . LYS C  1 120 ? -37.506 -36.559 16.422  1.00 31.22  ? 148 LYS C CA    1 
ATOM   6419  C C     . LYS C  1 120 ? -36.934 -35.168 16.671  1.00 27.46  ? 148 LYS C C     1 
ATOM   6420  O O     . LYS C  1 120 ? -37.680 -34.241 16.999  1.00 25.45  ? 148 LYS C O     1 
ATOM   6421  C CB    . LYS C  1 120 ? -37.944 -36.646 14.954  1.00 31.42  ? 148 LYS C CB    1 
ATOM   6422  C CG    . LYS C  1 120 ? -38.340 -38.047 14.466  1.00 30.95  ? 148 LYS C CG    1 
ATOM   6423  C CD    . LYS C  1 120 ? -38.888 -37.991 13.021  1.00 37.35  ? 148 LYS C CD    1 
ATOM   6424  C CE    . LYS C  1 120 ? -39.610 -39.286 12.629  1.00 37.70  ? 148 LYS C CE    1 
ATOM   6425  N NZ    . LYS C  1 120 ? -39.444 -39.550 11.164  1.00 56.20  ? 148 LYS C NZ    1 
ATOM   6426  N N     . ILE C  1 121 ? -35.616 -35.033 16.481  1.00 24.48  ? 149 ILE C N     1 
ATOM   6427  C CA    . ILE C  1 121 ? -34.926 -33.740 16.552  1.00 26.84  ? 149 ILE C CA    1 
ATOM   6428  C C     . ILE C  1 121 ? -34.152 -33.533 15.256  1.00 26.43  ? 149 ILE C C     1 
ATOM   6429  O O     . ILE C  1 121 ? -33.961 -34.484 14.502  1.00 27.31  ? 149 ILE C O     1 
ATOM   6430  C CB    . ILE C  1 121 ? -33.934 -33.640 17.790  1.00 22.05  ? 149 ILE C CB    1 
ATOM   6431  C CG1   . ILE C  1 121 ? -32.799 -34.675 17.704  1.00 27.31  ? 149 ILE C CG1   1 
ATOM   6432  C CG2   . ILE C  1 121 ? -34.655 -33.807 19.116  1.00 26.07  ? 149 ILE C CG2   1 
ATOM   6433  C CD1   . ILE C  1 121 ? -31.788 -34.558 18.863  1.00 26.22  ? 149 ILE C CD1   1 
ATOM   6434  N N     . GLY C  1 122 ? -33.706 -32.299 15.006  1.00 25.73  ? 150 GLY C N     1 
ATOM   6435  C CA    . GLY C  1 122 ? -32.917 -31.967 13.816  1.00 25.04  ? 150 GLY C CA    1 
ATOM   6436  C C     . GLY C  1 122 ? -31.516 -31.438 14.103  1.00 26.26  ? 150 GLY C C     1 
ATOM   6437  O O     . GLY C  1 122 ? -31.073 -31.388 15.253  1.00 26.96  ? 150 GLY C O     1 
ATOM   6438  N N     . CYS C  1 123 ? -30.827 -31.053 13.041  1.00 25.60  ? 151 CYS C N     1 
ATOM   6439  C CA    . CYS C  1 123 ? -29.485 -30.500 13.122  1.00 22.04  ? 151 CYS C CA    1 
ATOM   6440  C C     . CYS C  1 123 ? -29.217 -29.515 11.975  1.00 25.77  ? 151 CYS C C     1 
ATOM   6441  O O     . CYS C  1 123 ? -30.022 -29.377 11.067  1.00 24.62  ? 151 CYS C O     1 
ATOM   6442  C CB    . CYS C  1 123 ? -28.444 -31.607 13.166  1.00 26.19  ? 151 CYS C CB    1 
ATOM   6443  S SG    . CYS C  1 123 ? -28.222 -32.588 11.652  1.00 27.75  ? 151 CYS C SG    1 
ATOM   6444  N N     . PHE C  1 124 ? -28.075 -28.828 12.047  1.00 24.06  ? 152 PHE C N     1 
ATOM   6445  C CA    . PHE C  1 124 ? -27.752 -27.668 11.221  1.00 19.85  ? 152 PHE C CA    1 
ATOM   6446  C C     . PHE C  1 124 ? -26.339 -27.892 10.728  1.00 21.89  ? 152 PHE C C     1 
ATOM   6447  O O     . PHE C  1 124 ? -25.450 -28.079 11.520  1.00 20.56  ? 152 PHE C O     1 
ATOM   6448  C CB    . PHE C  1 124 ? -27.837 -26.416 12.103  1.00 24.50  ? 152 PHE C CB    1 
ATOM   6449  C CG    . PHE C  1 124 ? -27.490 -25.107 11.422  1.00 23.74  ? 152 PHE C CG    1 
ATOM   6450  C CD1   . PHE C  1 124 ? -28.473 -24.362 10.765  1.00 26.90  ? 152 PHE C CD1   1 
ATOM   6451  C CD2   . PHE C  1 124 ? -26.210 -24.565 11.524  1.00 23.27  ? 152 PHE C CD2   1 
ATOM   6452  C CE1   . PHE C  1 124 ? -28.163 -23.137 10.187  1.00 26.13  ? 152 PHE C CE1   1 
ATOM   6453  C CE2   . PHE C  1 124 ? -25.898 -23.363 10.933  1.00 24.99  ? 152 PHE C CE2   1 
ATOM   6454  C CZ    . PHE C  1 124 ? -26.880 -22.640 10.269  1.00 28.09  ? 152 PHE C CZ    1 
ATOM   6455  N N     . ALA C  1 125 ? -26.154 -27.918 9.423   1.00 25.31  ? 153 ALA C N     1 
ATOM   6456  C CA    . ALA C  1 125 ? -24.867 -28.275 8.837   1.00 21.72  ? 153 ALA C CA    1 
ATOM   6457  C C     . ALA C  1 125 ? -24.362 -27.211 7.882   1.00 22.34  ? 153 ALA C C     1 
ATOM   6458  O O     . ALA C  1 125 ? -24.687 -27.196 6.677   1.00 23.09  ? 153 ALA C O     1 
ATOM   6459  C CB    . ALA C  1 125 ? -24.976 -29.625 8.159   1.00 21.86  ? 153 ALA C CB    1 
ATOM   6460  N N     . LEU C  1 126 ? -23.538 -26.314 8.426   1.00 27.00  ? 154 LEU C N     1 
ATOM   6461  C CA    . LEU C  1 126 ? -22.947 -25.213 7.676   1.00 23.36  ? 154 LEU C CA    1 
ATOM   6462  C C     . LEU C  1 126 ? -21.427 -25.376 7.576   1.00 23.46  ? 154 LEU C C     1 
ATOM   6463  O O     . LEU C  1 126 ? -20.837 -25.273 6.483   1.00 24.37  ? 154 LEU C O     1 
ATOM   6464  C CB    . LEU C  1 126 ? -23.289 -23.894 8.373   1.00 27.25  ? 154 LEU C CB    1 
ATOM   6465  C CG    . LEU C  1 126 ? -22.812 -22.571 7.765   1.00 27.67  ? 154 LEU C CG    1 
ATOM   6466  C CD1   . LEU C  1 126 ? -23.313 -22.397 6.297   1.00 22.10  ? 154 LEU C CD1   1 
ATOM   6467  C CD2   . LEU C  1 126 ? -23.275 -21.415 8.666   1.00 27.82  ? 154 LEU C CD2   1 
ATOM   6468  N N     . SER C  1 127 ? -20.797 -25.634 8.719   1.00 20.58  ? 155 SER C N     1 
ATOM   6469  C CA    . SER C  1 127 ? -19.343 -25.745 8.775   1.00 25.70  ? 155 SER C CA    1 
ATOM   6470  C C     . SER C  1 127 ? -18.810 -26.964 8.020   1.00 23.29  ? 155 SER C C     1 
ATOM   6471  O O     . SER C  1 127 ? -19.500 -27.969 7.864   1.00 27.48  ? 155 SER C O     1 
ATOM   6472  C CB    . SER C  1 127 ? -18.876 -25.763 10.235  1.00 25.22  ? 155 SER C CB    1 
ATOM   6473  O OG    . SER C  1 127 ? -19.482 -24.710 10.969  1.00 26.35  ? 155 SER C OG    1 
ATOM   6474  N N     . GLU C  1 128 ? -17.573 -26.858 7.565   1.00 25.68  ? 156 GLU C N     1 
ATOM   6475  C CA    . GLU C  1 128 ? -16.885 -27.940 6.897   1.00 28.54  ? 156 GLU C CA    1 
ATOM   6476  C C     . GLU C  1 128 ? -15.480 -28.032 7.455   1.00 26.51  ? 156 GLU C C     1 
ATOM   6477  O O     . GLU C  1 128 ? -15.006 -27.091 8.070   1.00 31.53  ? 156 GLU C O     1 
ATOM   6478  C CB    . GLU C  1 128 ? -16.827 -27.668 5.408   1.00 28.68  ? 156 GLU C CB    1 
ATOM   6479  C CG    . GLU C  1 128 ? -18.199 -27.416 4.829   1.00 30.85  ? 156 GLU C CG    1 
ATOM   6480  C CD    . GLU C  1 128 ? -18.185 -27.268 3.333   1.00 38.69  ? 156 GLU C CD    1 
ATOM   6481  O OE1   . GLU C  1 128 ? -17.079 -27.127 2.747   1.00 42.55  ? 156 GLU C OE1   1 
ATOM   6482  O OE2   . GLU C  1 128 ? -19.296 -27.263 2.750   1.00 35.77  ? 156 GLU C OE2   1 
ATOM   6483  N N     . PRO C  1 129 ? -14.809 -29.167 7.259   1.00 28.40  ? 157 PRO C N     1 
ATOM   6484  C CA    . PRO C  1 129 ? -13.476 -29.277 7.848   1.00 28.70  ? 157 PRO C CA    1 
ATOM   6485  C C     . PRO C  1 129 ? -12.521 -28.119 7.544   1.00 32.75  ? 157 PRO C C     1 
ATOM   6486  O O     . PRO C  1 129 ? -11.736 -27.747 8.420   1.00 29.14  ? 157 PRO C O     1 
ATOM   6487  C CB    . PRO C  1 129 ? -12.947 -30.582 7.253   1.00 28.60  ? 157 PRO C CB    1 
ATOM   6488  C CG    . PRO C  1 129 ? -14.182 -31.387 6.986   1.00 32.00  ? 157 PRO C CG    1 
ATOM   6489  C CD    . PRO C  1 129 ? -15.207 -30.410 6.566   1.00 25.19  ? 157 PRO C CD    1 
ATOM   6490  N N     . GLY C  1 130 ? -12.602 -27.549 6.340   1.00 30.67  ? 158 GLY C N     1 
ATOM   6491  C CA    . GLY C  1 130 ? -11.707 -26.469 5.933   1.00 31.27  ? 158 GLY C CA    1 
ATOM   6492  C C     . GLY C  1 130 ? -12.225 -25.070 6.209   1.00 31.20  ? 158 GLY C C     1 
ATOM   6493  O O     . GLY C  1 130 ? -11.522 -24.096 5.943   1.00 29.96  ? 158 GLY C O     1 
ATOM   6494  N N     . ASN C  1 131 ? -13.441 -24.956 6.728   1.00 29.59  ? 159 ASN C N     1 
ATOM   6495  C CA    . ASN C  1 131 ? -14.052 -23.646 6.991   1.00 29.61  ? 159 ASN C CA    1 
ATOM   6496  C C     . ASN C  1 131 ? -15.217 -23.658 7.980   1.00 29.71  ? 159 ASN C C     1 
ATOM   6497  O O     . ASN C  1 131 ? -16.201 -24.371 7.778   1.00 29.65  ? 159 ASN C O     1 
ATOM   6498  C CB    . ASN C  1 131 ? -14.518 -22.985 5.677   1.00 34.38  ? 159 ASN C CB    1 
ATOM   6499  C CG    . ASN C  1 131 ? -15.489 -23.857 4.870   1.00 36.06  ? 159 ASN C CG    1 
ATOM   6500  O OD1   . ASN C  1 131 ? -15.079 -24.748 4.132   1.00 47.50  ? 159 ASN C OD1   1 
ATOM   6501  N ND2   . ASN C  1 131 ? -16.778 -23.573 4.993   1.00 48.80  ? 159 ASN C ND2   1 
ATOM   6502  N N     . GLY C  1 132 ? -15.106 -22.852 9.038   1.00 27.66  ? 160 GLY C N     1 
ATOM   6503  C CA    . GLY C  1 132 ? -16.212 -22.615 9.983   1.00 26.18  ? 160 GLY C CA    1 
ATOM   6504  C C     . GLY C  1 132 ? -16.551 -21.138 10.177  1.00 29.37  ? 160 GLY C C     1 
ATOM   6505  O O     . GLY C  1 132 ? -17.713 -20.758 10.145  1.00 34.74  ? 160 GLY C O     1 
ATOM   6506  N N     . SER C  1 133 ? -15.541 -20.302 10.382  1.00 33.51  ? 161 SER C N     1 
ATOM   6507  C CA    . SER C  1 133 ? -15.742 -18.844 10.475  1.00 31.53  ? 161 SER C CA    1 
ATOM   6508  C C     . SER C  1 133 ? -16.040 -18.285 9.089   1.00 32.76  ? 161 SER C C     1 
ATOM   6509  O O     . SER C  1 133 ? -16.933 -17.456 8.903   1.00 30.21  ? 161 SER C O     1 
ATOM   6510  C CB    . SER C  1 133 ? -14.490 -18.181 11.047  1.00 27.09  ? 161 SER C CB    1 
ATOM   6511  O OG    . SER C  1 133 ? -14.196 -18.720 12.329  1.00 33.00  ? 161 SER C OG    1 
ATOM   6512  N N     . ASP C  1 134 ? -15.287 -18.780 8.121   1.00 34.92  ? 162 ASP C N     1 
ATOM   6513  C CA    . ASP C  1 134 ? -15.449 -18.423 6.720   1.00 36.71  ? 162 ASP C CA    1 
ATOM   6514  C C     . ASP C  1 134 ? -16.551 -19.283 6.119   1.00 38.43  ? 162 ASP C C     1 
ATOM   6515  O O     . ASP C  1 134 ? -16.296 -20.187 5.318   1.00 38.79  ? 162 ASP C O     1 
ATOM   6516  C CB    . ASP C  1 134 ? -14.118 -18.626 5.998   1.00 35.99  ? 162 ASP C CB    1 
ATOM   6517  C CG    . ASP C  1 134 ? -14.103 -18.032 4.616   1.00 42.21  ? 162 ASP C CG    1 
ATOM   6518  O OD1   . ASP C  1 134 ? -15.087 -17.357 4.226   1.00 35.83  ? 162 ASP C OD1   1 
ATOM   6519  O OD2   . ASP C  1 134 ? -13.077 -18.235 3.930   1.00 33.98  ? 162 ASP C OD2   1 
ATOM   6520  N N     . ALA C  1 135 ? -17.782 -18.962 6.511   1.00 38.95  ? 163 ALA C N     1 
ATOM   6521  C CA    . ALA C  1 135 ? -18.973 -19.749 6.183   1.00 42.19  ? 163 ALA C CA    1 
ATOM   6522  C C     . ALA C  1 135 ? -19.216 -19.891 4.674   1.00 40.43  ? 163 ALA C C     1 
ATOM   6523  O O     . ALA C  1 135 ? -19.543 -20.978 4.187   1.00 43.62  ? 163 ALA C O     1 
ATOM   6524  C CB    . ALA C  1 135 ? -20.209 -19.123 6.862   1.00 39.10  ? 163 ALA C CB    1 
ATOM   6525  N N     . GLY C  1 136 ? -19.053 -18.799 3.938   1.00 39.38  ? 164 GLY C N     1 
ATOM   6526  C CA    . GLY C  1 136 ? -19.304 -18.793 2.491   1.00 39.19  ? 164 GLY C CA    1 
ATOM   6527  C C     . GLY C  1 136 ? -18.359 -19.651 1.654   1.00 38.97  ? 164 GLY C C     1 
ATOM   6528  O O     . GLY C  1 136 ? -18.633 -19.888 0.478   1.00 37.87  ? 164 GLY C O     1 
ATOM   6529  N N     . ALA C  1 137 ? -17.262 -20.135 2.246   1.00 37.76  ? 165 ALA C N     1 
ATOM   6530  C CA    . ALA C  1 137 ? -16.299 -20.987 1.525   1.00 38.44  ? 165 ALA C CA    1 
ATOM   6531  C C     . ALA C  1 137 ? -16.708 -22.481 1.450   1.00 38.00  ? 165 ALA C C     1 
ATOM   6532  O O     . ALA C  1 137 ? -15.841 -23.360 1.319   1.00 39.21  ? 165 ALA C O     1 
ATOM   6533  C CB    . ALA C  1 137 ? -14.878 -20.841 2.150   1.00 33.10  ? 165 ALA C CB    1 
ATOM   6534  N N     . ALA C  1 138 ? -18.012 -22.763 1.532   1.00 39.41  ? 166 ALA C N     1 
ATOM   6535  C CA    . ALA C  1 138 ? -18.530 -24.139 1.428   1.00 38.36  ? 166 ALA C CA    1 
ATOM   6536  C C     . ALA C  1 138 ? -18.120 -24.822 0.115   1.00 35.00  ? 166 ALA C C     1 
ATOM   6537  O O     . ALA C  1 138 ? -18.400 -24.312 -0.965  1.00 38.52  ? 166 ALA C O     1 
ATOM   6538  C CB    . ALA C  1 138 ? -20.044 -24.152 1.563   1.00 36.98  ? 166 ALA C CB    1 
ATOM   6539  N N     . SER C  1 139 ? -17.459 -25.975 0.243   1.00 32.43  ? 167 SER C N     1 
ATOM   6540  C CA    . SER C  1 139 ? -17.019 -26.815 -0.874  1.00 33.63  ? 167 SER C CA    1 
ATOM   6541  C C     . SER C  1 139 ? -17.954 -27.996 -1.112  1.00 35.41  ? 167 SER C C     1 
ATOM   6542  O O     . SER C  1 139 ? -17.848 -28.673 -2.132  1.00 34.02  ? 167 SER C O     1 
ATOM   6543  C CB    . SER C  1 139 ? -15.622 -27.361 -0.592  1.00 32.55  ? 167 SER C CB    1 
ATOM   6544  O OG    . SER C  1 139 ? -14.788 -26.320 -0.144  1.00 44.51  ? 167 SER C OG    1 
ATOM   6545  N N     . THR C  1 140 ? -18.854 -28.253 -0.166  1.00 32.71  ? 168 THR C N     1 
ATOM   6546  C CA    . THR C  1 140 ? -19.913 -29.223 -0.388  1.00 30.43  ? 168 THR C CA    1 
ATOM   6547  C C     . THR C  1 140 ? -20.830 -28.716 -1.515  1.00 29.87  ? 168 THR C C     1 
ATOM   6548  O O     . THR C  1 140 ? -21.252 -27.564 -1.507  1.00 31.11  ? 168 THR C O     1 
ATOM   6549  C CB    . THR C  1 140 ? -20.692 -29.490 0.892   1.00 32.47  ? 168 THR C CB    1 
ATOM   6550  O OG1   . THR C  1 140 ? -19.804 -30.080 1.864   1.00 33.23  ? 168 THR C OG1   1 
ATOM   6551  C CG2   . THR C  1 140 ? -21.898 -30.425 0.627   1.00 27.27  ? 168 THR C CG2   1 
ATOM   6552  N N     . THR C  1 141 ? -21.130 -29.591 -2.471  1.00 27.44  ? 169 THR C N     1 
ATOM   6553  C CA    . THR C  1 141 ? -21.849 -29.194 -3.689  1.00 29.73  ? 169 THR C CA    1 
ATOM   6554  C C     . THR C  1 141 ? -23.236 -29.810 -3.796  1.00 28.11  ? 169 THR C C     1 
ATOM   6555  O O     . THR C  1 141 ? -23.454 -30.953 -3.370  1.00 29.35  ? 169 THR C O     1 
ATOM   6556  C CB    . THR C  1 141 ? -21.012 -29.516 -4.944  1.00 30.97  ? 169 THR C CB    1 
ATOM   6557  O OG1   . THR C  1 141 ? -20.584 -30.884 -4.931  1.00 35.17  ? 169 THR C OG1   1 
ATOM   6558  C CG2   . THR C  1 141 ? -19.768 -28.618 -4.959  1.00 28.97  ? 169 THR C CG2   1 
ATOM   6559  N N     . ALA C  1 142 ? -24.182 -29.015 -4.299  1.00 29.45  ? 170 ALA C N     1 
ATOM   6560  C CA    . ALA C  1 142 ? -25.505 -29.504 -4.702  1.00 29.46  ? 170 ALA C CA    1 
ATOM   6561  C C     . ALA C  1 142 ? -25.641 -29.285 -6.216  1.00 32.89  ? 170 ALA C C     1 
ATOM   6562  O O     . ALA C  1 142 ? -25.435 -28.167 -6.715  1.00 31.88  ? 170 ALA C O     1 
ATOM   6563  C CB    . ALA C  1 142 ? -26.611 -28.776 -3.958  1.00 24.90  ? 170 ALA C CB    1 
ATOM   6564  N N     . ARG C  1 143 ? -25.967 -30.355 -6.945  1.00 34.41  ? 171 ARG C N     1 
ATOM   6565  C CA    . ARG C  1 143 ? -26.138 -30.289 -8.409  1.00 35.03  ? 171 ARG C CA    1 
ATOM   6566  C C     . ARG C  1 143 ? -27.508 -30.833 -8.773  1.00 29.02  ? 171 ARG C C     1 
ATOM   6567  O O     . ARG C  1 143 ? -27.851 -31.937 -8.340  1.00 31.56  ? 171 ARG C O     1 
ATOM   6568  C CB    . ARG C  1 143 ? -25.061 -31.130 -9.099  1.00 34.49  ? 171 ARG C CB    1 
ATOM   6569  C CG    . ARG C  1 143 ? -25.077 -31.064 -10.631 1.00 45.34  ? 171 ARG C CG    1 
ATOM   6570  C CD    . ARG C  1 143 ? -23.954 -31.893 -11.257 1.00 48.02  ? 171 ARG C CD    1 
ATOM   6571  N NE    . ARG C  1 143 ? -24.249 -33.330 -11.278 1.00 64.10  ? 171 ARG C NE    1 
ATOM   6572  C CZ    . ARG C  1 143 ? -23.873 -34.210 -10.346 1.00 76.10  ? 171 ARG C CZ    1 
ATOM   6573  N NH1   . ARG C  1 143 ? -23.170 -33.832 -9.276  1.00 78.46  ? 171 ARG C NH1   1 
ATOM   6574  N NH2   . ARG C  1 143 ? -24.209 -35.490 -10.480 1.00 72.44  ? 171 ARG C NH2   1 
ATOM   6575  N N     . ALA C  1 144 ? -28.299 -30.059 -9.532  1.00 30.73  ? 172 ALA C N     1 
ATOM   6576  C CA    . ALA C  1 144 ? -29.596 -30.544 -10.036 1.00 33.61  ? 172 ALA C CA    1 
ATOM   6577  C C     . ALA C  1 144 ? -29.391 -31.592 -11.142 1.00 34.15  ? 172 ALA C C     1 
ATOM   6578  O O     . ALA C  1 144 ? -28.607 -31.385 -12.071 1.00 38.28  ? 172 ALA C O     1 
ATOM   6579  C CB    . ALA C  1 144 ? -30.455 -29.402 -10.543 1.00 29.94  ? 172 ALA C CB    1 
ATOM   6580  N N     . GLU C  1 145 ? -30.061 -32.731 -11.008 1.00 35.74  ? 173 GLU C N     1 
ATOM   6581  C CA    . GLU C  1 145 ? -30.008 -33.791 -12.008 1.00 37.84  ? 173 GLU C CA    1 
ATOM   6582  C C     . GLU C  1 145 ? -31.331 -34.557 -11.983 1.00 41.77  ? 173 GLU C C     1 
ATOM   6583  O O     . GLU C  1 145 ? -31.587 -35.368 -11.081 1.00 43.55  ? 173 GLU C O     1 
ATOM   6584  C CB    . GLU C  1 145 ? -28.836 -34.748 -11.752 1.00 37.99  ? 173 GLU C CB    1 
ATOM   6585  C CG    . GLU C  1 145 ? -27.447 -34.131 -11.884 1.00 54.80  ? 173 GLU C CG    1 
ATOM   6586  N N     . GLY C  1 146 ? -32.176 -34.279 -12.967 1.00 41.80  ? 174 GLY C N     1 
ATOM   6587  C CA    . GLY C  1 146 ? -33.479 -34.938 -13.076 1.00 40.99  ? 174 GLY C CA    1 
ATOM   6588  C C     . GLY C  1 146 ? -34.431 -34.332 -12.072 1.00 39.98  ? 174 GLY C C     1 
ATOM   6589  O O     . GLY C  1 146 ? -34.509 -33.107 -11.958 1.00 46.27  ? 174 GLY C O     1 
ATOM   6590  N N     . ASP C  1 147 ? -35.137 -35.188 -11.330 1.00 42.90  ? 175 ASP C N     1 
ATOM   6591  C CA    . ASP C  1 147 ? -36.028 -34.746 -10.241 1.00 42.67  ? 175 ASP C CA    1 
ATOM   6592  C C     . ASP C  1 147 ? -35.282 -34.679 -8.886  1.00 39.24  ? 175 ASP C C     1 
ATOM   6593  O O     . ASP C  1 147 ? -35.906 -34.800 -7.818  1.00 40.15  ? 175 ASP C O     1 
ATOM   6594  C CB    . ASP C  1 147 ? -37.239 -35.687 -10.135 1.00 41.98  ? 175 ASP C CB    1 
ATOM   6595  N N     . SER C  1 148 ? -33.962 -34.472 -8.932  1.00 37.72  ? 176 SER C N     1 
ATOM   6596  C CA    . SER C  1 148 ? -33.121 -34.510 -7.728  1.00 37.48  ? 176 SER C CA    1 
ATOM   6597  C C     . SER C  1 148 ? -31.983 -33.466 -7.691  1.00 37.98  ? 176 SER C C     1 
ATOM   6598  O O     . SER C  1 148 ? -31.465 -33.013 -8.737  1.00 32.40  ? 176 SER C O     1 
ATOM   6599  C CB    . SER C  1 148 ? -32.487 -35.899 -7.572  1.00 38.35  ? 176 SER C CB    1 
ATOM   6600  O OG    . SER C  1 148 ? -33.351 -36.808 -6.918  1.00 39.97  ? 176 SER C OG    1 
ATOM   6601  N N     . TRP C  1 149 ? -31.617 -33.110 -6.454  1.00 35.72  ? 177 TRP C N     1 
ATOM   6602  C CA    . TRP C  1 149 ? -30.352 -32.447 -6.146  1.00 31.19  ? 177 TRP C CA    1 
ATOM   6603  C C     . TRP C  1 149 ? -29.409 -33.545 -5.744  1.00 26.81  ? 177 TRP C C     1 
ATOM   6604  O O     . TRP C  1 149 ? -29.812 -34.466 -5.044  1.00 30.12  ? 177 TRP C O     1 
ATOM   6605  C CB    . TRP C  1 149 ? -30.530 -31.467 -4.978  1.00 29.52  ? 177 TRP C CB    1 
ATOM   6606  C CG    . TRP C  1 149 ? -31.430 -30.292 -5.288  1.00 32.03  ? 177 TRP C CG    1 
ATOM   6607  C CD1   . TRP C  1 149 ? -32.736 -30.143 -4.943  1.00 30.89  ? 177 TRP C CD1   1 
ATOM   6608  C CD2   . TRP C  1 149 ? -31.063 -29.108 -5.999  1.00 30.03  ? 177 TRP C CD2   1 
ATOM   6609  N NE1   . TRP C  1 149 ? -33.212 -28.930 -5.396  1.00 33.94  ? 177 TRP C NE1   1 
ATOM   6610  C CE2   . TRP C  1 149 ? -32.206 -28.284 -6.060  1.00 26.14  ? 177 TRP C CE2   1 
ATOM   6611  C CE3   . TRP C  1 149 ? -29.877 -28.670 -6.596  1.00 26.64  ? 177 TRP C CE3   1 
ATOM   6612  C CZ2   . TRP C  1 149 ? -32.196 -27.038 -6.664  1.00 31.64  ? 177 TRP C CZ2   1 
ATOM   6613  C CZ3   . TRP C  1 149 ? -29.867 -27.432 -7.213  1.00 34.05  ? 177 TRP C CZ3   1 
ATOM   6614  C CH2   . TRP C  1 149 ? -31.020 -26.625 -7.237  1.00 30.56  ? 177 TRP C CH2   1 
ATOM   6615  N N     . VAL C  1 150 ? -28.172 -33.497 -6.220  1.00 28.34  ? 178 VAL C N     1 
ATOM   6616  C CA    . VAL C  1 150 ? -27.175 -34.479 -5.819  1.00 30.73  ? 178 VAL C CA    1 
ATOM   6617  C C     . VAL C  1 150 ? -26.109 -33.793 -4.953  1.00 30.19  ? 178 VAL C C     1 
ATOM   6618  O O     . VAL C  1 150 ? -25.427 -32.865 -5.406  1.00 30.94  ? 178 VAL C O     1 
ATOM   6619  C CB    . VAL C  1 150 ? -26.537 -35.174 -7.039  1.00 31.71  ? 178 VAL C CB    1 
ATOM   6620  C CG1   . VAL C  1 150 ? -25.577 -36.252 -6.596  1.00 29.97  ? 178 VAL C CG1   1 
ATOM   6621  C CG2   . VAL C  1 150 ? -27.663 -35.772 -7.942  1.00 34.97  ? 178 VAL C CG2   1 
ATOM   6622  N N     . LEU C  1 151 ? -25.969 -34.269 -3.714  1.00 31.25  ? 179 LEU C N     1 
ATOM   6623  C CA    . LEU C  1 151 ? -25.081 -33.640 -2.727  1.00 29.33  ? 179 LEU C CA    1 
ATOM   6624  C C     . LEU C  1 151 ? -23.767 -34.402 -2.572  1.00 27.06  ? 179 LEU C C     1 
ATOM   6625  O O     . LEU C  1 151 ? -23.753 -35.626 -2.397  1.00 32.52  ? 179 LEU C O     1 
ATOM   6626  C CB    . LEU C  1 151 ? -25.783 -33.500 -1.370  1.00 28.14  ? 179 LEU C CB    1 
ATOM   6627  C CG    . LEU C  1 151 ? -26.606 -32.229 -1.153  1.00 34.37  ? 179 LEU C CG    1 
ATOM   6628  C CD1   . LEU C  1 151 ? -27.601 -31.975 -2.296  1.00 33.96  ? 179 LEU C CD1   1 
ATOM   6629  C CD2   . LEU C  1 151 ? -27.326 -32.285 0.204   1.00 35.65  ? 179 LEU C CD2   1 
ATOM   6630  N N     . ASN C  1 152 ? -22.661 -33.671 -2.669  1.00 29.66  ? 180 ASN C N     1 
ATOM   6631  C CA    . ASN C  1 152 ? -21.335 -34.238 -2.442  1.00 26.67  ? 180 ASN C CA    1 
ATOM   6632  C C     . ASN C  1 152 ? -20.498 -33.354 -1.536  1.00 28.71  ? 180 ASN C C     1 
ATOM   6633  O O     . ASN C  1 152 ? -20.261 -32.179 -1.853  1.00 29.54  ? 180 ASN C O     1 
ATOM   6634  C CB    . ASN C  1 152 ? -20.592 -34.411 -3.758  1.00 29.99  ? 180 ASN C CB    1 
ATOM   6635  C CG    . ASN C  1 152 ? -21.085 -35.598 -4.540  1.00 36.68  ? 180 ASN C CG    1 
ATOM   6636  O OD1   . ASN C  1 152 ? -20.736 -36.746 -4.234  1.00 32.72  ? 180 ASN C OD1   1 
ATOM   6637  N ND2   . ASN C  1 152 ? -21.929 -35.337 -5.536  1.00 26.31  ? 180 ASN C ND2   1 
ATOM   6638  N N     . GLY C  1 153 ? -20.003 -33.940 -0.446  1.00 30.56  ? 181 GLY C N     1 
ATOM   6639  C CA    . GLY C  1 153 ? -18.984 -33.288 0.389   1.00 30.77  ? 181 GLY C CA    1 
ATOM   6640  C C     . GLY C  1 153 ? -19.117 -33.643 1.854   1.00 29.59  ? 181 GLY C C     1 
ATOM   6641  O O     . GLY C  1 153 ? -19.968 -34.442 2.230   1.00 30.98  ? 181 GLY C O     1 
ATOM   6642  N N     . THR C  1 154 ? -18.273 -33.033 2.688   1.00 30.69  ? 182 THR C N     1 
ATOM   6643  C CA    . THR C  1 154 ? -18.289 -33.295 4.139   1.00 29.89  ? 182 THR C CA    1 
ATOM   6644  C C     . THR C  1 154 ? -18.608 -32.027 4.912   1.00 25.36  ? 182 THR C C     1 
ATOM   6645  O O     . THR C  1 154 ? -18.014 -30.990 4.675   1.00 25.78  ? 182 THR C O     1 
ATOM   6646  C CB    . THR C  1 154 ? -16.956 -33.923 4.600   1.00 28.93  ? 182 THR C CB    1 
ATOM   6647  O OG1   . THR C  1 154 ? -16.835 -35.192 3.968   1.00 35.81  ? 182 THR C OG1   1 
ATOM   6648  C CG2   . THR C  1 154 ? -16.924 -34.146 6.112   1.00 30.08  ? 182 THR C CG2   1 
ATOM   6649  N N     . LYS C  1 155 ? -19.641 -32.095 5.744   1.00 26.53  ? 183 LYS C N     1 
ATOM   6650  C CA    . LYS C  1 155 ? -19.904 -31.060 6.736   1.00 28.37  ? 183 LYS C CA    1 
ATOM   6651  C C     . LYS C  1 155 ? -19.225 -31.489 8.044   1.00 25.99  ? 183 LYS C C     1 
ATOM   6652  O O     . LYS C  1 155 ? -19.087 -32.684 8.314   1.00 31.11  ? 183 LYS C O     1 
ATOM   6653  C CB    . LYS C  1 155 ? -21.414 -30.836 6.914   1.00 24.29  ? 183 LYS C CB    1 
ATOM   6654  C CG    . LYS C  1 155 ? -22.177 -30.610 5.608   1.00 30.18  ? 183 LYS C CG    1 
ATOM   6655  C CD    . LYS C  1 155 ? -21.599 -29.516 4.693   1.00 30.97  ? 183 LYS C CD    1 
ATOM   6656  C CE    . LYS C  1 155 ? -21.954 -28.103 5.139   1.00 31.22  ? 183 LYS C CE    1 
ATOM   6657  N NZ    . LYS C  1 155 ? -21.710 -27.101 4.067   1.00 26.19  ? 183 LYS C NZ    1 
ATOM   6658  N N     . ALA C  1 156 ? -18.748 -30.520 8.819   1.00 27.62  ? 184 ALA C N     1 
ATOM   6659  C CA    . ALA C  1 156 ? -18.003 -30.799 10.064  1.00 26.30  ? 184 ALA C CA    1 
ATOM   6660  C C     . ALA C  1 156 ? -18.677 -30.188 11.308  1.00 25.71  ? 184 ALA C C     1 
ATOM   6661  O O     . ALA C  1 156 ? -19.411 -29.194 11.219  1.00 23.15  ? 184 ALA C O     1 
ATOM   6662  C CB    . ALA C  1 156 ? -16.603 -30.302 9.940   1.00 27.29  ? 184 ALA C CB    1 
ATOM   6663  N N     . TRP C  1 157 ? -18.407 -30.807 12.457  1.00 25.68  ? 185 TRP C N     1 
ATOM   6664  C CA    . TRP C  1 157 ? -18.841 -30.324 13.782  1.00 27.95  ? 185 TRP C CA    1 
ATOM   6665  C C     . TRP C  1 157 ? -20.353 -30.294 14.008  1.00 24.78  ? 185 TRP C C     1 
ATOM   6666  O O     . TRP C  1 157 ? -20.851 -29.400 14.667  1.00 26.00  ? 185 TRP C O     1 
ATOM   6667  C CB    . TRP C  1 157 ? -18.325 -28.903 14.051  1.00 27.88  ? 185 TRP C CB    1 
ATOM   6668  C CG    . TRP C  1 157 ? -16.903 -28.680 13.758  1.00 23.61  ? 185 TRP C CG    1 
ATOM   6669  C CD1   . TRP C  1 157 ? -16.396 -27.920 12.768  1.00 25.50  ? 185 TRP C CD1   1 
ATOM   6670  C CD2   . TRP C  1 157 ? -15.789 -29.206 14.485  1.00 23.25  ? 185 TRP C CD2   1 
ATOM   6671  N NE1   . TRP C  1 157 ? -15.030 -27.945 12.808  1.00 22.55  ? 185 TRP C NE1   1 
ATOM   6672  C CE2   . TRP C  1 157 ? -14.623 -28.719 13.860  1.00 26.51  ? 185 TRP C CE2   1 
ATOM   6673  C CE3   . TRP C  1 157 ? -15.664 -30.034 15.598  1.00 26.65  ? 185 TRP C CE3   1 
ATOM   6674  C CZ2   . TRP C  1 157 ? -13.333 -29.036 14.312  1.00 23.18  ? 185 TRP C CZ2   1 
ATOM   6675  C CZ3   . TRP C  1 157 ? -14.398 -30.349 16.051  1.00 26.33  ? 185 TRP C CZ3   1 
ATOM   6676  C CH2   . TRP C  1 157 ? -13.242 -29.858 15.401  1.00 30.12  ? 185 TRP C CH2   1 
ATOM   6677  N N     . ILE C  1 158 ? -21.089 -31.256 13.483  1.00 24.18  ? 186 ILE C N     1 
ATOM   6678  C CA    . ILE C  1 158 ? -22.560 -31.142 13.492  1.00 23.80  ? 186 ILE C CA    1 
ATOM   6679  C C     . ILE C  1 158 ? -23.157 -31.669 14.817  1.00 23.04  ? 186 ILE C C     1 
ATOM   6680  O O     . ILE C  1 158 ? -23.103 -32.866 15.124  1.00 23.80  ? 186 ILE C O     1 
ATOM   6681  C CB    . ILE C  1 158 ? -23.200 -31.823 12.236  1.00 27.33  ? 186 ILE C CB    1 
ATOM   6682  C CG1   . ILE C  1 158 ? -22.519 -31.384 10.912  1.00 25.99  ? 186 ILE C CG1   1 
ATOM   6683  C CG2   . ILE C  1 158 ? -24.695 -31.571 12.190  1.00 21.78  ? 186 ILE C CG2   1 
ATOM   6684  C CD1   . ILE C  1 158 ? -22.215 -29.861 10.746  1.00 26.29  ? 186 ILE C CD1   1 
ATOM   6685  N N     . THR C  1 159 ? -23.693 -30.746 15.615  1.00 25.82  ? 187 THR C N     1 
ATOM   6686  C CA    . THR C  1 159 ? -24.367 -31.054 16.868  1.00 23.28  ? 187 THR C CA    1 
ATOM   6687  C C     . THR C  1 159 ? -25.662 -31.805 16.584  1.00 25.77  ? 187 THR C C     1 
ATOM   6688  O O     . THR C  1 159 ? -26.466 -31.384 15.740  1.00 25.78  ? 187 THR C O     1 
ATOM   6689  C CB    . THR C  1 159 ? -24.679 -29.773 17.641  1.00 24.35  ? 187 THR C CB    1 
ATOM   6690  O OG1   . THR C  1 159 ? -23.457 -29.081 17.882  1.00 23.41  ? 187 THR C OG1   1 
ATOM   6691  C CG2   . THR C  1 159 ? -25.415 -30.030 18.974  1.00 22.97  ? 187 THR C CG2   1 
ATOM   6692  N N     . ASN C  1 160 ? -25.859 -32.889 17.331  1.00 24.56  ? 188 ASN C N     1 
ATOM   6693  C CA    . ASN C  1 160 ? -27.012 -33.813 17.191  1.00 24.21  ? 188 ASN C CA    1 
ATOM   6694  C C     . ASN C  1 160 ? -26.901 -34.765 16.001  1.00 27.09  ? 188 ASN C C     1 
ATOM   6695  O O     . ASN C  1 160 ? -27.882 -35.437 15.655  1.00 28.70  ? 188 ASN C O     1 
ATOM   6696  C CB    . ASN C  1 160 ? -28.369 -33.094 17.113  1.00 26.83  ? 188 ASN C CB    1 
ATOM   6697  C CG    . ASN C  1 160 ? -28.707 -32.294 18.352  1.00 26.97  ? 188 ASN C CG    1 
ATOM   6698  O OD1   . ASN C  1 160 ? -28.030 -32.370 19.388  1.00 32.80  ? 188 ASN C OD1   1 
ATOM   6699  N ND2   . ASN C  1 160 ? -29.779 -31.515 18.253  1.00 23.81  ? 188 ASN C ND2   1 
ATOM   6700  N N     . ALA C  1 161 ? -25.717 -34.839 15.392  1.00 25.47  ? 189 ALA C N     1 
ATOM   6701  C CA    . ALA C  1 161 ? -25.516 -35.645 14.193  1.00 29.72  ? 189 ALA C CA    1 
ATOM   6702  C C     . ALA C  1 161 ? -25.992 -37.097 14.405  1.00 29.19  ? 189 ALA C C     1 
ATOM   6703  O O     . ALA C  1 161 ? -26.686 -37.650 13.543  1.00 22.11  ? 189 ALA C O     1 
ATOM   6704  C CB    . ALA C  1 161 ? -24.059 -35.609 13.750  1.00 24.97  ? 189 ALA C CB    1 
ATOM   6705  N N     . TRP C  1 162 ? -25.669 -37.675 15.566  1.00 26.00  ? 190 TRP C N     1 
ATOM   6706  C CA    . TRP C  1 162 ? -25.983 -39.069 15.842  1.00 24.77  ? 190 TRP C CA    1 
ATOM   6707  C C     . TRP C  1 162 ? -27.411 -39.329 16.290  1.00 23.80  ? 190 TRP C C     1 
ATOM   6708  O O     . TRP C  1 162 ? -27.846 -40.473 16.294  1.00 30.69  ? 190 TRP C O     1 
ATOM   6709  C CB    . TRP C  1 162 ? -24.978 -39.666 16.824  1.00 28.41  ? 190 TRP C CB    1 
ATOM   6710  C CG    . TRP C  1 162 ? -23.737 -40.106 16.121  1.00 23.86  ? 190 TRP C CG    1 
ATOM   6711  C CD1   . TRP C  1 162 ? -22.817 -39.311 15.512  1.00 31.28  ? 190 TRP C CD1   1 
ATOM   6712  C CD2   . TRP C  1 162 ? -23.285 -41.453 15.948  1.00 36.10  ? 190 TRP C CD2   1 
ATOM   6713  N NE1   . TRP C  1 162 ? -21.807 -40.078 14.971  1.00 29.66  ? 190 TRP C NE1   1 
ATOM   6714  C CE2   . TRP C  1 162 ? -22.068 -41.397 15.230  1.00 27.80  ? 190 TRP C CE2   1 
ATOM   6715  C CE3   . TRP C  1 162 ? -23.777 -42.700 16.349  1.00 38.13  ? 190 TRP C CE3   1 
ATOM   6716  C CZ2   . TRP C  1 162 ? -21.351 -42.539 14.874  1.00 36.28  ? 190 TRP C CZ2   1 
ATOM   6717  C CZ3   . TRP C  1 162 ? -23.055 -43.840 16.007  1.00 38.83  ? 190 TRP C CZ3   1 
ATOM   6718  C CH2   . TRP C  1 162 ? -21.855 -43.749 15.272  1.00 36.47  ? 190 TRP C CH2   1 
ATOM   6719  N N     . GLU C  1 163 ? -28.143 -38.288 16.657  1.00 23.47  ? 191 GLU C N     1 
ATOM   6720  C CA    . GLU C  1 163 ? -29.542 -38.450 17.077  1.00 24.75  ? 191 GLU C CA    1 
ATOM   6721  C C     . GLU C  1 163 ? -30.556 -37.819 16.140  1.00 24.10  ? 191 GLU C C     1 
ATOM   6722  O O     . GLU C  1 163 ? -31.771 -38.056 16.282  1.00 27.84  ? 191 GLU C O     1 
ATOM   6723  C CB    . GLU C  1 163 ? -29.718 -37.860 18.471  1.00 26.45  ? 191 GLU C CB    1 
ATOM   6724  C CG    . GLU C  1 163 ? -28.794 -38.488 19.518  1.00 26.66  ? 191 GLU C CG    1 
ATOM   6725  C CD    . GLU C  1 163 ? -27.379 -37.884 19.558  1.00 37.26  ? 191 GLU C CD    1 
ATOM   6726  O OE1   . GLU C  1 163 ? -27.149 -36.750 19.075  1.00 31.53  ? 191 GLU C OE1   1 
ATOM   6727  O OE2   . GLU C  1 163 ? -26.484 -38.571 20.076  1.00 27.94  ? 191 GLU C OE2   1 
ATOM   6728  N N     . ALA C  1 164 ? -30.091 -36.999 15.203  1.00 22.80  ? 192 ALA C N     1 
ATOM   6729  C CA    . ALA C  1 164 ? -30.987 -36.212 14.335  1.00 26.55  ? 192 ALA C CA    1 
ATOM   6730  C C     . ALA C  1 164 ? -31.702 -37.091 13.287  1.00 21.67  ? 192 ALA C C     1 
ATOM   6731  O O     . ALA C  1 164 ? -31.133 -38.072 12.827  1.00 23.92  ? 192 ALA C O     1 
ATOM   6732  C CB    . ALA C  1 164 ? -30.183 -35.088 13.623  1.00 19.87  ? 192 ALA C CB    1 
ATOM   6733  N N     . SER C  1 165 ? -32.945 -36.749 12.936  1.00 27.16  ? 193 SER C N     1 
ATOM   6734  C CA    . SER C  1 165 ? -33.682 -37.414 11.834  1.00 26.49  ? 193 SER C CA    1 
ATOM   6735  C C     . SER C  1 165 ? -33.737 -36.554 10.568  1.00 28.42  ? 193 SER C C     1 
ATOM   6736  O O     . SER C  1 165 ? -34.346 -36.942 9.569   1.00 29.86  ? 193 SER C O     1 
ATOM   6737  C CB    . SER C  1 165 ? -35.117 -37.743 12.252  1.00 26.44  ? 193 SER C CB    1 
ATOM   6738  O OG    . SER C  1 165 ? -35.124 -38.637 13.327  1.00 28.47  ? 193 SER C OG    1 
ATOM   6739  N N     . ALA C  1 166 ? -33.119 -35.376 10.633  1.00 25.32  ? 194 ALA C N     1 
ATOM   6740  C CA    . ALA C  1 166 ? -33.154 -34.390 9.554   1.00 25.26  ? 194 ALA C CA    1 
ATOM   6741  C C     . ALA C  1 166 ? -32.090 -33.317 9.769   1.00 26.92  ? 194 ALA C C     1 
ATOM   6742  O O     . ALA C  1 166 ? -31.697 -33.013 10.911  1.00 27.35  ? 194 ALA C O     1 
ATOM   6743  C CB    . ALA C  1 166 ? -34.524 -33.724 9.468   1.00 23.95  ? 194 ALA C CB    1 
ATOM   6744  N N     . ALA C  1 167 ? -31.651 -32.734 8.666   1.00 23.98  ? 195 ALA C N     1 
ATOM   6745  C CA    . ALA C  1 167 ? -30.669 -31.664 8.691   1.00 26.63  ? 195 ALA C CA    1 
ATOM   6746  C C     . ALA C  1 167 ? -31.010 -30.579 7.679   1.00 24.49  ? 195 ALA C C     1 
ATOM   6747  O O     . ALA C  1 167 ? -31.360 -30.868 6.532   1.00 28.65  ? 195 ALA C O     1 
ATOM   6748  C CB    . ALA C  1 167 ? -29.270 -32.209 8.390   1.00 17.20  ? 195 ALA C CB    1 
ATOM   6749  N N     . VAL C  1 168 ? -30.872 -29.329 8.109   1.00 29.17  ? 196 VAL C N     1 
ATOM   6750  C CA    . VAL C  1 168 ? -30.771 -28.209 7.196   1.00 23.97  ? 196 VAL C CA    1 
ATOM   6751  C C     . VAL C  1 168 ? -29.287 -28.137 6.801   1.00 24.86  ? 196 VAL C C     1 
ATOM   6752  O O     . VAL C  1 168 ? -28.434 -27.896 7.634   1.00 29.55  ? 196 VAL C O     1 
ATOM   6753  C CB    . VAL C  1 168 ? -31.236 -26.901 7.855   1.00 24.25  ? 196 VAL C CB    1 
ATOM   6754  C CG1   . VAL C  1 168 ? -31.130 -25.728 6.853   1.00 24.45  ? 196 VAL C CG1   1 
ATOM   6755  C CG2   . VAL C  1 168 ? -32.672 -27.050 8.415   1.00 25.04  ? 196 VAL C CG2   1 
ATOM   6756  N N     . VAL C  1 169 ? -29.014 -28.341 5.512   1.00 26.96  ? 197 VAL C N     1 
ATOM   6757  C CA    . VAL C  1 169 ? -27.669 -28.464 4.972   1.00 25.75  ? 197 VAL C CA    1 
ATOM   6758  C C     . VAL C  1 169 ? -27.419 -27.369 3.919   1.00 25.19  ? 197 VAL C C     1 
ATOM   6759  O O     . VAL C  1 169 ? -28.235 -27.127 3.029   1.00 26.60  ? 197 VAL C O     1 
ATOM   6760  C CB    . VAL C  1 169 ? -27.458 -29.869 4.330   1.00 27.34  ? 197 VAL C CB    1 
ATOM   6761  C CG1   . VAL C  1 169 ? -25.990 -30.048 3.844   1.00 25.74  ? 197 VAL C CG1   1 
ATOM   6762  C CG2   . VAL C  1 169 ? -27.887 -30.993 5.316   1.00 25.13  ? 197 VAL C CG2   1 
ATOM   6763  N N     . PHE C  1 170 ? -26.264 -26.726 4.021   1.00 24.34  ? 198 PHE C N     1 
ATOM   6764  C CA    . PHE C  1 170 ? -25.898 -25.620 3.154   1.00 23.52  ? 198 PHE C CA    1 
ATOM   6765  C C     . PHE C  1 170 ? -24.842 -26.117 2.188   1.00 28.14  ? 198 PHE C C     1 
ATOM   6766  O O     . PHE C  1 170 ? -23.793 -26.626 2.609   1.00 27.17  ? 198 PHE C O     1 
ATOM   6767  C CB    . PHE C  1 170 ? -25.395 -24.428 3.984   1.00 27.24  ? 198 PHE C CB    1 
ATOM   6768  C CG    . PHE C  1 170 ? -26.460 -23.847 4.866   1.00 24.24  ? 198 PHE C CG    1 
ATOM   6769  C CD1   . PHE C  1 170 ? -27.320 -22.873 4.382   1.00 26.56  ? 198 PHE C CD1   1 
ATOM   6770  C CD2   . PHE C  1 170 ? -26.648 -24.335 6.149   1.00 21.52  ? 198 PHE C CD2   1 
ATOM   6771  C CE1   . PHE C  1 170 ? -28.345 -22.357 5.202   1.00 22.72  ? 198 PHE C CE1   1 
ATOM   6772  C CE2   . PHE C  1 170 ? -27.645 -23.834 6.963   1.00 24.60  ? 198 PHE C CE2   1 
ATOM   6773  C CZ    . PHE C  1 170 ? -28.505 -22.846 6.478   1.00 23.22  ? 198 PHE C CZ    1 
ATOM   6774  N N     . ALA C  1 171 ? -25.159 -26.008 0.892   1.00 27.07  ? 199 ALA C N     1 
ATOM   6775  C CA    . ALA C  1 171 ? -24.319 -26.532 -0.183  1.00 28.49  ? 199 ALA C CA    1 
ATOM   6776  C C     . ALA C  1 171 ? -24.127 -25.487 -1.282  1.00 26.70  ? 199 ALA C C     1 
ATOM   6777  O O     . ALA C  1 171 ? -25.019 -24.705 -1.580  1.00 27.56  ? 199 ALA C O     1 
ATOM   6778  C CB    . ALA C  1 171 ? -24.910 -27.832 -0.763  1.00 24.74  ? 199 ALA C CB    1 
ATOM   6779  N N     . SER C  1 172 ? -22.944 -25.488 -1.874  1.00 29.97  ? 200 SER C N     1 
ATOM   6780  C CA    . SER C  1 172 ? -22.647 -24.628 -3.024  1.00 31.47  ? 200 SER C CA    1 
ATOM   6781  C C     . SER C  1 172 ? -23.354 -25.109 -4.304  1.00 34.15  ? 200 SER C C     1 
ATOM   6782  O O     . SER C  1 172 ? -23.134 -26.240 -4.772  1.00 34.00  ? 200 SER C O     1 
ATOM   6783  C CB    . SER C  1 172 ? -21.137 -24.586 -3.256  1.00 31.44  ? 200 SER C CB    1 
ATOM   6784  O OG    . SER C  1 172 ? -20.815 -23.602 -4.207  1.00 38.71  ? 200 SER C OG    1 
ATOM   6785  N N     . THR C  1 173 ? -24.195 -24.240 -4.858  1.00 33.54  ? 201 THR C N     1 
ATOM   6786  C CA    . THR C  1 173 ? -24.921 -24.526 -6.080  1.00 38.06  ? 201 THR C CA    1 
ATOM   6787  C C     . THR C  1 173 ? -24.350 -23.805 -7.307  1.00 41.42  ? 201 THR C C     1 
ATOM   6788  O O     . THR C  1 173 ? -24.847 -24.017 -8.413  1.00 42.04  ? 201 THR C O     1 
ATOM   6789  C CB    . THR C  1 173 ? -26.438 -24.199 -5.930  1.00 35.77  ? 201 THR C CB    1 
ATOM   6790  O OG1   . THR C  1 173 ? -26.609 -23.076 -5.054  1.00 39.80  ? 201 THR C OG1   1 
ATOM   6791  C CG2   . THR C  1 173 ? -27.170 -25.401 -5.366  1.00 33.17  ? 201 THR C CG2   1 
ATOM   6792  N N     . ASP C  1 174 ? -23.325 -22.969 -7.111  1.00 50.65  ? 202 ASP C N     1 
ATOM   6793  C CA    . ASP C  1 174 ? -22.629 -22.280 -8.209  1.00 58.22  ? 202 ASP C CA    1 
ATOM   6794  C C     . ASP C  1 174 ? -21.420 -21.484 -7.693  1.00 60.45  ? 202 ASP C C     1 
ATOM   6795  O O     . ASP C  1 174 ? -20.327 -22.028 -7.492  1.00 60.82  ? 202 ASP C O     1 
ATOM   6796  C CB    . ASP C  1 174 ? -23.584 -21.327 -8.954  1.00 61.82  ? 202 ASP C CB    1 
ATOM   6797  C CG    . ASP C  1 174 ? -23.311 -21.276 -10.453 1.00 69.44  ? 202 ASP C CG    1 
ATOM   6798  O OD1   . ASP C  1 174 ? -22.132 -21.396 -10.856 1.00 80.42  ? 202 ASP C OD1   1 
ATOM   6799  O OD2   . ASP C  1 174 ? -24.280 -21.115 -11.227 1.00 76.58  ? 202 ASP C OD2   1 
ATOM   6800  N N     . SER C  1 181 ? -24.597 -18.033 -4.345  1.00 49.05  ? 209 SER C N     1 
ATOM   6801  C CA    . SER C  1 181 ? -24.075 -19.329 -4.793  1.00 49.61  ? 209 SER C CA    1 
ATOM   6802  C C     . SER C  1 181 ? -24.242 -20.487 -3.801  1.00 46.04  ? 209 SER C C     1 
ATOM   6803  O O     . SER C  1 181 ? -23.878 -21.617 -4.118  1.00 47.23  ? 209 SER C O     1 
ATOM   6804  C CB    . SER C  1 181 ? -22.587 -19.194 -5.120  1.00 50.38  ? 209 SER C CB    1 
ATOM   6805  O OG    . SER C  1 181 ? -21.869 -18.730 -3.989  1.00 51.87  ? 209 SER C OG    1 
ATOM   6806  N N     . ILE C  1 182 ? -24.745 -20.213 -2.599  1.00 42.12  ? 210 ILE C N     1 
ATOM   6807  C CA    . ILE C  1 182 ? -25.021 -21.258 -1.626  1.00 33.05  ? 210 ILE C CA    1 
ATOM   6808  C C     . ILE C  1 182 ? -26.526 -21.376 -1.494  1.00 27.46  ? 210 ILE C C     1 
ATOM   6809  O O     . ILE C  1 182 ? -27.258 -20.378 -1.591  1.00 25.44  ? 210 ILE C O     1 
ATOM   6810  C CB    . ILE C  1 182 ? -24.355 -20.973 -0.250  1.00 39.16  ? 210 ILE C CB    1 
ATOM   6811  C CG1   . ILE C  1 182 ? -22.839 -21.131 -0.384  1.00 31.33  ? 210 ILE C CG1   1 
ATOM   6812  C CG2   . ILE C  1 182 ? -24.917 -21.906 0.857   1.00 27.73  ? 210 ILE C CG2   1 
ATOM   6813  C CD1   . ILE C  1 182 ? -22.071 -20.351 0.659   1.00 46.34  ? 210 ILE C CD1   1 
ATOM   6814  N N     . SER C  1 183 ? -26.984 -22.608 -1.327  1.00 30.10  ? 211 SER C N     1 
ATOM   6815  C CA    . SER C  1 183 ? -28.395 -22.878 -1.037  1.00 27.27  ? 211 SER C CA    1 
ATOM   6816  C C     . SER C  1 183 ? -28.564 -23.773 0.209   1.00 26.54  ? 211 SER C C     1 
ATOM   6817  O O     . SER C  1 183 ? -27.627 -24.492 0.618   1.00 25.70  ? 211 SER C O     1 
ATOM   6818  C CB    . SER C  1 183 ? -29.054 -23.532 -2.262  1.00 28.09  ? 211 SER C CB    1 
ATOM   6819  O OG    . SER C  1 183 ? -28.854 -22.751 -3.425  1.00 29.16  ? 211 SER C OG    1 
ATOM   6820  N N     . ALA C  1 184 ? -29.764 -23.704 0.798   1.00 26.04  ? 212 ALA C N     1 
ATOM   6821  C CA    . ALA C  1 184 ? -30.182 -24.549 1.929   1.00 28.62  ? 212 ALA C CA    1 
ATOM   6822  C C     . ALA C  1 184 ? -31.041 -25.727 1.452   1.00 27.97  ? 212 ALA C C     1 
ATOM   6823  O O     . ALA C  1 184 ? -31.933 -25.546 0.620   1.00 29.46  ? 212 ALA C O     1 
ATOM   6824  C CB    . ALA C  1 184 ? -30.987 -23.725 2.981   1.00 23.18  ? 212 ALA C CB    1 
ATOM   6825  N N     . PHE C  1 185 ? -30.816 -26.905 2.034   1.00 28.87  ? 213 PHE C N     1 
ATOM   6826  C CA    . PHE C  1 185 ? -31.579 -28.111 1.702   1.00 27.52  ? 213 PHE C CA    1 
ATOM   6827  C C     . PHE C  1 185 ? -32.070 -28.847 2.946   1.00 27.40  ? 213 PHE C C     1 
ATOM   6828  O O     . PHE C  1 185 ? -31.358 -28.930 3.963   1.00 28.55  ? 213 PHE C O     1 
ATOM   6829  C CB    . PHE C  1 185 ? -30.710 -29.042 0.861   1.00 27.24  ? 213 PHE C CB    1 
ATOM   6830  C CG    . PHE C  1 185 ? -30.180 -28.407 -0.398  1.00 29.35  ? 213 PHE C CG    1 
ATOM   6831  C CD1   . PHE C  1 185 ? -30.896 -28.495 -1.591  1.00 29.76  ? 213 PHE C CD1   1 
ATOM   6832  C CD2   . PHE C  1 185 ? -28.952 -27.741 -0.402  1.00 27.17  ? 213 PHE C CD2   1 
ATOM   6833  C CE1   . PHE C  1 185 ? -30.415 -27.915 -2.756  1.00 27.87  ? 213 PHE C CE1   1 
ATOM   6834  C CE2   . PHE C  1 185 ? -28.463 -27.149 -1.570  1.00 31.73  ? 213 PHE C CE2   1 
ATOM   6835  C CZ    . PHE C  1 185 ? -29.193 -27.243 -2.754  1.00 32.61  ? 213 PHE C CZ    1 
ATOM   6836  N N     . LEU C  1 186 ? -33.308 -29.338 2.888   1.00 28.56  ? 214 LEU C N     1 
ATOM   6837  C CA    . LEU C  1 186 ? -33.831 -30.258 3.900   1.00 25.96  ? 214 LEU C CA    1 
ATOM   6838  C C     . LEU C  1 186 ? -33.426 -31.687 3.500   1.00 30.29  ? 214 LEU C C     1 
ATOM   6839  O O     . LEU C  1 186 ? -33.780 -32.145 2.427   1.00 29.58  ? 214 LEU C O     1 
ATOM   6840  C CB    . LEU C  1 186 ? -35.354 -30.118 4.035   1.00 27.58  ? 214 LEU C CB    1 
ATOM   6841  C CG    . LEU C  1 186 ? -35.888 -28.708 4.303   1.00 27.12  ? 214 LEU C CG    1 
ATOM   6842  C CD1   . LEU C  1 186 ? -37.433 -28.619 4.240   1.00 28.36  ? 214 LEU C CD1   1 
ATOM   6843  C CD2   . LEU C  1 186 ? -35.356 -28.228 5.655   1.00 30.86  ? 214 LEU C CD2   1 
ATOM   6844  N N     . VAL C  1 187 ? -32.639 -32.355 4.355   1.00 29.30  ? 215 VAL C N     1 
ATOM   6845  C CA    . VAL C  1 187 ? -32.115 -33.699 4.105   1.00 24.58  ? 215 VAL C CA    1 
ATOM   6846  C C     . VAL C  1 187 ? -32.603 -34.642 5.212   1.00 29.18  ? 215 VAL C C     1 
ATOM   6847  O O     . VAL C  1 187 ? -32.385 -34.367 6.393   1.00 28.57  ? 215 VAL C O     1 
ATOM   6848  C CB    . VAL C  1 187 ? -30.573 -33.674 4.129   1.00 28.99  ? 215 VAL C CB    1 
ATOM   6849  C CG1   . VAL C  1 187 ? -29.977 -35.077 3.967   1.00 26.03  ? 215 VAL C CG1   1 
ATOM   6850  C CG2   . VAL C  1 187 ? -30.027 -32.648 3.097   1.00 24.12  ? 215 VAL C CG2   1 
ATOM   6851  N N     . PRO C  1 188 ? -33.273 -35.756 4.844   1.00 29.80  ? 216 PRO C N     1 
ATOM   6852  C CA    . PRO C  1 188 ? -33.659 -36.728 5.874   1.00 28.54  ? 216 PRO C CA    1 
ATOM   6853  C C     . PRO C  1 188 ? -32.470 -37.530 6.353   1.00 25.74  ? 216 PRO C C     1 
ATOM   6854  O O     . PRO C  1 188 ? -31.484 -37.673 5.625   1.00 29.62  ? 216 PRO C O     1 
ATOM   6855  C CB    . PRO C  1 188 ? -34.642 -37.648 5.152   1.00 29.84  ? 216 PRO C CB    1 
ATOM   6856  C CG    . PRO C  1 188 ? -34.308 -37.549 3.729   1.00 27.90  ? 216 PRO C CG    1 
ATOM   6857  C CD    . PRO C  1 188 ? -33.681 -36.195 3.492   1.00 27.56  ? 216 PRO C CD    1 
ATOM   6858  N N     . MET C  1 189 ? -32.558 -38.035 7.576   1.00 26.54  ? 217 MET C N     1 
ATOM   6859  C CA    . MET C  1 189 ? -31.465 -38.824 8.170   1.00 29.02  ? 217 MET C CA    1 
ATOM   6860  C C     . MET C  1 189 ? -32.131 -40.026 8.856   1.00 27.90  ? 217 MET C C     1 
ATOM   6861  O O     . MET C  1 189 ? -33.081 -39.835 9.594   1.00 29.55  ? 217 MET C O     1 
ATOM   6862  C CB    . MET C  1 189 ? -30.687 -37.995 9.204   1.00 26.44  ? 217 MET C CB    1 
ATOM   6863  C CG    . MET C  1 189 ? -29.793 -36.898 8.641   1.00 33.15  ? 217 MET C CG    1 
ATOM   6864  S SD    . MET C  1 189 ? -29.149 -35.797 9.945   1.00 32.37  ? 217 MET C SD    1 
ATOM   6865  C CE    . MET C  1 189 ? -27.662 -36.612 10.474  1.00 23.97  ? 217 MET C CE    1 
ATOM   6866  N N     . PRO C  1 190 ? -31.706 -41.269 8.538   1.00 29.08  ? 218 PRO C N     1 
ATOM   6867  C CA    . PRO C  1 190 ? -30.724 -41.607 7.524   1.00 27.19  ? 218 PRO C CA    1 
ATOM   6868  C C     . PRO C  1 190 ? -31.270 -41.446 6.104   1.00 27.65  ? 218 PRO C C     1 
ATOM   6869  O O     . PRO C  1 190 ? -32.475 -41.214 5.899   1.00 27.72  ? 218 PRO C O     1 
ATOM   6870  C CB    . PRO C  1 190 ? -30.374 -43.070 7.847   1.00 30.67  ? 218 PRO C CB    1 
ATOM   6871  C CG    . PRO C  1 190 ? -31.577 -43.617 8.497   1.00 29.96  ? 218 PRO C CG    1 
ATOM   6872  C CD    . PRO C  1 190 ? -32.232 -42.471 9.219   1.00 27.48  ? 218 PRO C CD    1 
ATOM   6873  N N     . THR C  1 191 ? -30.361 -41.496 5.151   1.00 28.58  ? 219 THR C N     1 
ATOM   6874  C CA    . THR C  1 191 ? -30.690 -41.425 3.731   1.00 30.60  ? 219 THR C CA    1 
ATOM   6875  C C     . THR C  1 191 ? -29.508 -41.989 2.927   1.00 28.93  ? 219 THR C C     1 
ATOM   6876  O O     . THR C  1 191 ? -28.340 -41.869 3.340   1.00 31.71  ? 219 THR C O     1 
ATOM   6877  C CB    . THR C  1 191 ? -31.049 -39.974 3.275   1.00 33.67  ? 219 THR C CB    1 
ATOM   6878  O OG1   . THR C  1 191 ? -31.832 -40.017 2.078   1.00 33.80  ? 219 THR C OG1   1 
ATOM   6879  C CG2   . THR C  1 191 ? -29.782 -39.104 3.026   1.00 29.89  ? 219 THR C CG2   1 
ATOM   6880  N N     . PRO C  1 192 ? -29.794 -42.653 1.794   1.00 32.38  ? 220 PRO C N     1 
ATOM   6881  C CA    . PRO C  1 192 ? -28.712 -43.200 0.962   1.00 29.77  ? 220 PRO C CA    1 
ATOM   6882  C C     . PRO C  1 192 ? -27.691 -42.151 0.484   1.00 29.53  ? 220 PRO C C     1 
ATOM   6883  O O     . PRO C  1 192 ? -28.075 -41.089 0.008   1.00 29.26  ? 220 PRO C O     1 
ATOM   6884  C CB    . PRO C  1 192 ? -29.464 -43.840 -0.223  1.00 32.78  ? 220 PRO C CB    1 
ATOM   6885  C CG    . PRO C  1 192 ? -30.860 -44.087 0.297   1.00 26.59  ? 220 PRO C CG    1 
ATOM   6886  C CD    . PRO C  1 192 ? -31.134 -42.994 1.267   1.00 33.15  ? 220 PRO C CD    1 
ATOM   6887  N N     . GLY C  1 193 ? -26.403 -42.460 0.603   1.00 27.41  ? 221 GLY C N     1 
ATOM   6888  C CA    . GLY C  1 193 ? -25.339 -41.502 0.247   1.00 29.35  ? 221 GLY C CA    1 
ATOM   6889  C C     . GLY C  1 193 ? -24.926 -40.521 1.353   1.00 28.64  ? 221 GLY C C     1 
ATOM   6890  O O     . GLY C  1 193 ? -24.099 -39.636 1.110   1.00 26.05  ? 221 GLY C O     1 
ATOM   6891  N N     . LEU C  1 194 ? -25.518 -40.682 2.543   1.00 29.64  ? 222 LEU C N     1 
ATOM   6892  C CA    . LEU C  1 194 ? -25.156 -39.940 3.761   1.00 29.27  ? 222 LEU C CA    1 
ATOM   6893  C C     . LEU C  1 194 ? -24.596 -40.915 4.799   1.00 29.38  ? 222 LEU C C     1 
ATOM   6894  O O     . LEU C  1 194 ? -25.264 -41.873 5.183   1.00 31.27  ? 222 LEU C O     1 
ATOM   6895  C CB    . LEU C  1 194 ? -26.387 -39.228 4.344   1.00 29.74  ? 222 LEU C CB    1 
ATOM   6896  C CG    . LEU C  1 194 ? -26.222 -38.580 5.734   1.00 35.16  ? 222 LEU C CG    1 
ATOM   6897  C CD1   . LEU C  1 194 ? -25.138 -37.459 5.687   1.00 29.07  ? 222 LEU C CD1   1 
ATOM   6898  C CD2   . LEU C  1 194 ? -27.550 -38.052 6.229   1.00 27.99  ? 222 LEU C CD2   1 
ATOM   6899  N N     . THR C  1 195 ? -23.356 -40.691 5.225   1.00 28.44  ? 223 THR C N     1 
ATOM   6900  C CA    . THR C  1 195 ? -22.780 -41.431 6.333   1.00 27.42  ? 223 THR C CA    1 
ATOM   6901  C C     . THR C  1 195 ? -22.320 -40.433 7.397   1.00 28.01  ? 223 THR C C     1 
ATOM   6902  O O     . THR C  1 195 ? -22.123 -39.245 7.122   1.00 27.20  ? 223 THR C O     1 
ATOM   6903  C CB    . THR C  1 195 ? -21.608 -42.330 5.912   1.00 29.16  ? 223 THR C CB    1 
ATOM   6904  O OG1   . THR C  1 195 ? -20.627 -41.554 5.221   1.00 34.41  ? 223 THR C OG1   1 
ATOM   6905  C CG2   . THR C  1 195 ? -22.093 -43.466 5.005   1.00 35.20  ? 223 THR C CG2   1 
ATOM   6906  N N     . LEU C  1 196 ? -22.178 -40.939 8.614   1.00 31.44  ? 224 LEU C N     1 
ATOM   6907  C CA    . LEU C  1 196 ? -21.776 -40.134 9.758   1.00 31.00  ? 224 LEU C CA    1 
ATOM   6908  C C     . LEU C  1 196 ? -20.309 -40.374 10.027  1.00 27.57  ? 224 LEU C C     1 
ATOM   6909  O O     . LEU C  1 196 ? -19.845 -41.498 9.927   1.00 32.43  ? 224 LEU C O     1 
ATOM   6910  C CB    . LEU C  1 196 ? -22.575 -40.533 10.986  1.00 29.40  ? 224 LEU C CB    1 
ATOM   6911  C CG    . LEU C  1 196 ? -24.083 -40.276 10.986  1.00 28.10  ? 224 LEU C CG    1 
ATOM   6912  C CD1   . LEU C  1 196 ? -24.645 -40.512 12.392  1.00 29.11  ? 224 LEU C CD1   1 
ATOM   6913  C CD2   . LEU C  1 196 ? -24.399 -38.897 10.508  1.00 27.58  ? 224 LEU C CD2   1 
ATOM   6914  N N     . GLY C  1 197 ? -19.577 -39.316 10.358  1.00 28.45  ? 225 GLY C N     1 
ATOM   6915  C CA    . GLY C  1 197 ? -18.248 -39.467 10.958  1.00 28.02  ? 225 GLY C CA    1 
ATOM   6916  C C     . GLY C  1 197 ? -18.340 -39.966 12.395  1.00 24.06  ? 225 GLY C C     1 
ATOM   6917  O O     . GLY C  1 197 ? -19.445 -40.101 12.963  1.00 27.77  ? 225 GLY C O     1 
ATOM   6918  N N     . LYS C  1 198 ? -17.180 -40.268 12.973  1.00 27.26  ? 226 LYS C N     1 
ATOM   6919  C CA    . LYS C  1 198 ? -17.076 -40.643 14.391  1.00 30.35  ? 226 LYS C CA    1 
ATOM   6920  C C     . LYS C  1 198 ? -17.435 -39.454 15.285  1.00 26.04  ? 226 LYS C C     1 
ATOM   6921  O O     . LYS C  1 198 ? -17.227 -38.296 14.921  1.00 27.26  ? 226 LYS C O     1 
ATOM   6922  C CB    . LYS C  1 198 ? -15.657 -41.126 14.742  1.00 31.58  ? 226 LYS C CB    1 
ATOM   6923  N N     . LYS C  1 199 ? -18.011 -39.764 16.435  1.00 27.59  ? 227 LYS C N     1 
ATOM   6924  C CA    . LYS C  1 199 ? -18.371 -38.763 17.425  1.00 28.17  ? 227 LYS C CA    1 
ATOM   6925  C C     . LYS C  1 199 ? -17.073 -38.092 17.886  1.00 26.16  ? 227 LYS C C     1 
ATOM   6926  O O     . LYS C  1 199 ? -16.110 -38.782 18.162  1.00 28.37  ? 227 LYS C O     1 
ATOM   6927  C CB    . LYS C  1 199 ? -19.070 -39.422 18.603  1.00 26.05  ? 227 LYS C CB    1 
ATOM   6928  C CG    . LYS C  1 199 ? -20.565 -39.699 18.412  1.00 29.59  ? 227 LYS C CG    1 
ATOM   6929  C CD    . LYS C  1 199 ? -21.138 -40.258 19.690  1.00 28.77  ? 227 LYS C CD    1 
ATOM   6930  C CE    . LYS C  1 199 ? -22.601 -40.647 19.554  1.00 39.51  ? 227 LYS C CE    1 
ATOM   6931  N NZ    . LYS C  1 199 ? -23.073 -41.324 20.800  1.00 33.55  ? 227 LYS C NZ    1 
ATOM   6932  N N     . GLU C  1 200 ? -17.041 -36.760 17.915  1.00 27.95  ? 228 GLU C N     1 
ATOM   6933  C CA    . GLU C  1 200 ? -15.890 -36.027 18.447  1.00 27.72  ? 228 GLU C CA    1 
ATOM   6934  C C     . GLU C  1 200 ? -15.769 -36.262 19.950  1.00 27.73  ? 228 GLU C C     1 
ATOM   6935  O O     . GLU C  1 200 ? -16.777 -36.372 20.641  1.00 22.75  ? 228 GLU C O     1 
ATOM   6936  C CB    . GLU C  1 200 ? -16.035 -34.518 18.223  1.00 27.40  ? 228 GLU C CB    1 
ATOM   6937  C CG    . GLU C  1 200 ? -16.223 -34.070 16.770  1.00 28.81  ? 228 GLU C CG    1 
ATOM   6938  C CD    . GLU C  1 200 ? -14.993 -34.259 15.906  1.00 38.36  ? 228 GLU C CD    1 
ATOM   6939  O OE1   . GLU C  1 200 ? -13.889 -34.503 16.443  1.00 36.46  ? 228 GLU C OE1   1 
ATOM   6940  O OE2   . GLU C  1 200 ? -15.134 -34.149 14.669  1.00 43.45  ? 228 GLU C OE2   1 
ATOM   6941  N N     . ASP C  1 201 ? -14.528 -36.312 20.426  1.00 23.34  ? 229 ASP C N     1 
ATOM   6942  C CA    . ASP C  1 201 ? -14.183 -36.411 21.853  1.00 29.33  ? 229 ASP C CA    1 
ATOM   6943  C C     . ASP C  1 201 ? -13.851 -34.991 22.400  1.00 25.37  ? 229 ASP C C     1 
ATOM   6944  O O     . ASP C  1 201 ? -12.744 -34.480 22.214  1.00 24.94  ? 229 ASP C O     1 
ATOM   6945  C CB    . ASP C  1 201 ? -13.003 -37.379 22.005  1.00 26.70  ? 229 ASP C CB    1 
ATOM   6946  C CG    . ASP C  1 201 ? -12.544 -37.579 23.460  1.00 29.29  ? 229 ASP C CG    1 
ATOM   6947  O OD1   . ASP C  1 201 ? -13.328 -37.422 24.417  1.00 35.47  ? 229 ASP C OD1   1 
ATOM   6948  O OD2   . ASP C  1 201 ? -11.351 -37.919 23.627  1.00 42.49  ? 229 ASP C OD2   1 
ATOM   6949  N N     . LYS C  1 202 ? -14.842 -34.386 23.055  1.00 26.99  ? 230 LYS C N     1 
ATOM   6950  C CA    . LYS C  1 202 ? -14.832 -32.968 23.411  1.00 26.14  ? 230 LYS C CA    1 
ATOM   6951  C C     . LYS C  1 202 ? -14.399 -32.647 24.862  1.00 24.43  ? 230 LYS C C     1 
ATOM   6952  O O     . LYS C  1 202 ? -14.542 -33.467 25.774  1.00 25.95  ? 230 LYS C O     1 
ATOM   6953  C CB    . LYS C  1 202 ? -16.225 -32.398 23.195  1.00 25.05  ? 230 LYS C CB    1 
ATOM   6954  C CG    . LYS C  1 202 ? -16.689 -32.460 21.774  1.00 26.70  ? 230 LYS C CG    1 
ATOM   6955  C CD    . LYS C  1 202 ? -17.960 -31.658 21.549  1.00 27.76  ? 230 LYS C CD    1 
ATOM   6956  C CE    . LYS C  1 202 ? -19.153 -32.221 22.261  1.00 22.37  ? 230 LYS C CE    1 
ATOM   6957  N NZ    . LYS C  1 202 ? -19.567 -33.583 21.901  1.00 24.25  ? 230 LYS C NZ    1 
ATOM   6958  N N     . LEU C  1 203 ? -13.873 -31.434 25.047  1.00 23.00  ? 231 LEU C N     1 
ATOM   6959  C CA    . LEU C  1 203 ? -13.537 -30.906 26.349  1.00 22.78  ? 231 LEU C CA    1 
ATOM   6960  C C     . LEU C  1 203 ? -14.765 -30.833 27.267  1.00 24.39  ? 231 LEU C C     1 
ATOM   6961  O O     . LEU C  1 203 ? -14.674 -31.148 28.439  1.00 23.97  ? 231 LEU C O     1 
ATOM   6962  C CB    . LEU C  1 203 ? -12.856 -29.535 26.206  1.00 22.64  ? 231 LEU C CB    1 
ATOM   6963  C CG    . LEU C  1 203 ? -12.616 -28.717 27.470  1.00 23.89  ? 231 LEU C CG    1 
ATOM   6964  C CD1   . LEU C  1 203 ? -11.750 -29.508 28.441  1.00 17.77  ? 231 LEU C CD1   1 
ATOM   6965  C CD2   . LEU C  1 203 ? -11.988 -27.373 27.115  1.00 22.35  ? 231 LEU C CD2   1 
ATOM   6966  N N     . GLY C  1 204 ? -15.908 -30.467 26.703  1.00 21.68  ? 232 GLY C N     1 
ATOM   6967  C CA    . GLY C  1 204 ? -17.146 -30.307 27.446  1.00 22.56  ? 232 GLY C CA    1 
ATOM   6968  C C     . GLY C  1 204 ? -18.349 -30.468 26.520  1.00 18.45  ? 232 GLY C C     1 
ATOM   6969  O O     . GLY C  1 204 ? -18.195 -30.951 25.394  1.00 22.92  ? 232 GLY C O     1 
ATOM   6970  N N     . ILE C  1 205 ? -19.528 -30.037 26.975  1.00 22.31  ? 233 ILE C N     1 
ATOM   6971  C CA    . ILE C  1 205 ? -20.846 -30.445 26.397  1.00 22.24  ? 233 ILE C CA    1 
ATOM   6972  C C     . ILE C  1 205 ? -20.841 -31.884 25.797  1.00 25.34  ? 233 ILE C C     1 
ATOM   6973  O O     . ILE C  1 205 ? -21.376 -32.162 24.695  1.00 25.05  ? 233 ILE C O     1 
ATOM   6974  C CB    . ILE C  1 205 ? -21.465 -29.385 25.388  1.00 23.58  ? 233 ILE C CB    1 
ATOM   6975  C CG1   . ILE C  1 205 ? -20.533 -29.127 24.203  1.00 30.25  ? 233 ILE C CG1   1 
ATOM   6976  C CG2   . ILE C  1 205 ? -21.864 -28.061 26.127  1.00 19.50  ? 233 ILE C CG2   1 
ATOM   6977  C CD1   . ILE C  1 205 ? -21.220 -28.439 23.022  1.00 18.13  ? 233 ILE C CD1   1 
ATOM   6978  N N     . ARG C  1 206 ? -20.289 -32.808 26.585  1.00 25.08  ? 234 ARG C N     1 
ATOM   6979  C CA    . ARG C  1 206 ? -19.980 -34.162 26.133  1.00 25.22  ? 234 ARG C CA    1 
ATOM   6980  C C     . ARG C  1 206 ? -21.200 -35.042 25.861  1.00 25.51  ? 234 ARG C C     1 
ATOM   6981  O O     . ARG C  1 206 ? -21.109 -35.989 25.087  1.00 30.20  ? 234 ARG C O     1 
ATOM   6982  C CB    . ARG C  1 206 ? -19.085 -34.853 27.153  1.00 22.18  ? 234 ARG C CB    1 
ATOM   6983  C CG    . ARG C  1 206 ? -17.709 -34.225 27.236  1.00 25.44  ? 234 ARG C CG    1 
ATOM   6984  C CD    . ARG C  1 206 ? -16.952 -34.869 28.360  1.00 26.14  ? 234 ARG C CD    1 
ATOM   6985  N NE    . ARG C  1 206 ? -15.604 -34.366 28.451  1.00 41.01  ? 234 ARG C NE    1 
ATOM   6986  C CZ    . ARG C  1 206 ? -14.785 -34.619 29.468  1.00 53.85  ? 234 ARG C CZ    1 
ATOM   6987  N NH1   . ARG C  1 206 ? -15.197 -35.361 30.497  1.00 48.38  ? 234 ARG C NH1   1 
ATOM   6988  N NH2   . ARG C  1 206 ? -13.551 -34.099 29.468  1.00 51.84  ? 234 ARG C NH2   1 
ATOM   6989  N N     . GLY C  1 207 ? -22.328 -34.724 26.483  1.00 24.82  ? 235 GLY C N     1 
ATOM   6990  C CA    . GLY C  1 207 ? -23.584 -35.424 26.210  1.00 27.58  ? 235 GLY C CA    1 
ATOM   6991  C C     . GLY C  1 207 ? -24.241 -35.169 24.864  1.00 29.41  ? 235 GLY C C     1 
ATOM   6992  O O     . GLY C  1 207 ? -25.111 -35.939 24.421  1.00 28.68  ? 235 GLY C O     1 
ATOM   6993  N N     . SER C  1 208 ? -23.875 -34.086 24.199  1.00 29.07  ? 236 SER C N     1 
ATOM   6994  C CA    . SER C  1 208 ? -24.359 -33.892 22.834  1.00 27.36  ? 236 SER C CA    1 
ATOM   6995  C C     . SER C  1 208 ? -23.381 -34.553 21.858  1.00 30.35  ? 236 SER C C     1 
ATOM   6996  O O     . SER C  1 208 ? -22.173 -34.559 22.099  1.00 27.34  ? 236 SER C O     1 
ATOM   6997  C CB    . SER C  1 208 ? -24.547 -32.406 22.528  1.00 33.90  ? 236 SER C CB    1 
ATOM   6998  O OG    . SER C  1 208 ? -23.317 -31.720 22.422  1.00 21.85  ? 236 SER C OG    1 
ATOM   6999  N N     . SER C  1 209 ? -23.905 -35.133 20.779  1.00 24.31  ? 237 SER C N     1 
ATOM   7000  C CA    . SER C  1 209 ? -23.048 -35.658 19.722  1.00 26.95  ? 237 SER C CA    1 
ATOM   7001  C C     . SER C  1 209 ? -22.571 -34.552 18.769  1.00 25.30  ? 237 SER C C     1 
ATOM   7002  O O     . SER C  1 209 ? -23.258 -33.556 18.537  1.00 28.07  ? 237 SER C O     1 
ATOM   7003  C CB    . SER C  1 209 ? -23.741 -36.796 18.937  1.00 28.05  ? 237 SER C CB    1 
ATOM   7004  O OG    . SER C  1 209 ? -24.861 -36.345 18.193  1.00 23.88  ? 237 SER C OG    1 
ATOM   7005  N N     . THR C  1 210 ? -21.354 -34.737 18.270  1.00 24.25  ? 238 THR C N     1 
ATOM   7006  C CA    . THR C  1 210 ? -20.740 -33.876 17.291  1.00 26.79  ? 238 THR C CA    1 
ATOM   7007  C C     . THR C  1 210 ? -19.984 -34.810 16.353  1.00 24.07  ? 238 THR C C     1 
ATOM   7008  O O     . THR C  1 210 ? -19.173 -35.634 16.796  1.00 26.56  ? 238 THR C O     1 
ATOM   7009  C CB    . THR C  1 210 ? -19.743 -32.863 17.896  1.00 24.91  ? 238 THR C CB    1 
ATOM   7010  O OG1   . THR C  1 210 ? -20.218 -32.420 19.165  1.00 30.77  ? 238 THR C OG1   1 
ATOM   7011  C CG2   . THR C  1 210 ? -19.566 -31.662 16.942  1.00 22.82  ? 238 THR C CG2   1 
ATOM   7012  N N     . ALA C  1 211 ? -20.292 -34.697 15.072  1.00 25.04  ? 239 ALA C N     1 
ATOM   7013  C CA    . ALA C  1 211 ? -19.747 -35.591 14.057  1.00 27.80  ? 239 ALA C CA    1 
ATOM   7014  C C     . ALA C  1 211 ? -19.911 -34.977 12.680  1.00 25.29  ? 239 ALA C C     1 
ATOM   7015  O O     . ALA C  1 211 ? -20.794 -34.137 12.459  1.00 24.81  ? 239 ALA C O     1 
ATOM   7016  C CB    . ALA C  1 211 ? -20.440 -36.951 14.115  1.00 25.66  ? 239 ALA C CB    1 
ATOM   7017  N N     . ASN C  1 212 ? -19.023 -35.387 11.782  1.00 26.87  ? 240 ASN C N     1 
ATOM   7018  C CA    . ASN C  1 212 ? -19.116 -35.050 10.362  1.00 28.09  ? 240 ASN C CA    1 
ATOM   7019  C C     . ASN C  1 212 ? -20.318 -35.687 9.651   1.00 25.33  ? 240 ASN C C     1 
ATOM   7020  O O     . ASN C  1 212 ? -20.736 -36.792 9.987   1.00 27.02  ? 240 ASN C O     1 
ATOM   7021  C CB    . ASN C  1 212 ? -17.859 -35.509 9.627   1.00 25.10  ? 240 ASN C CB    1 
ATOM   7022  C CG    . ASN C  1 212 ? -16.633 -34.721 9.997   1.00 26.41  ? 240 ASN C CG    1 
ATOM   7023  O OD1   . ASN C  1 212 ? -16.654 -33.859 10.873  1.00 28.44  ? 240 ASN C OD1   1 
ATOM   7024  N ND2   . ASN C  1 212 ? -15.550 -34.996 9.299   1.00 31.07  ? 240 ASN C ND2   1 
ATOM   7025  N N     . LEU C  1 213 ? -20.851 -34.972 8.669   1.00 24.27  ? 241 LEU C N     1 
ATOM   7026  C CA    . LEU C  1 213 ? -21.856 -35.503 7.732   1.00 28.08  ? 241 LEU C CA    1 
ATOM   7027  C C     . LEU C  1 213 ? -21.189 -35.668 6.367   1.00 27.75  ? 241 LEU C C     1 
ATOM   7028  O O     . LEU C  1 213 ? -20.642 -34.698 5.816   1.00 29.53  ? 241 LEU C O     1 
ATOM   7029  C CB    . LEU C  1 213 ? -23.082 -34.575 7.649   1.00 28.25  ? 241 LEU C CB    1 
ATOM   7030  C CG    . LEU C  1 213 ? -24.248 -34.934 8.584   1.00 34.95  ? 241 LEU C CG    1 
ATOM   7031  C CD1   . LEU C  1 213 ? -23.764 -35.159 10.012  1.00 31.93  ? 241 LEU C CD1   1 
ATOM   7032  C CD2   . LEU C  1 213 ? -25.350 -33.871 8.575   1.00 33.53  ? 241 LEU C CD2   1 
ATOM   7033  N N     . ILE C  1 214 ? -21.201 -36.898 5.844   1.00 23.80  ? 242 ILE C N     1 
ATOM   7034  C CA    . ILE C  1 214 ? -20.458 -37.239 4.609   1.00 27.72  ? 242 ILE C CA    1 
ATOM   7035  C C     . ILE C  1 214 ? -21.447 -37.626 3.493   1.00 26.67  ? 242 ILE C C     1 
ATOM   7036  O O     . ILE C  1 214 ? -22.167 -38.639 3.571   1.00 27.54  ? 242 ILE C O     1 
ATOM   7037  C CB    . ILE C  1 214 ? -19.375 -38.326 4.863   1.00 26.15  ? 242 ILE C CB    1 
ATOM   7038  C CG1   . ILE C  1 214 ? -18.544 -37.975 6.117   1.00 28.77  ? 242 ILE C CG1   1 
ATOM   7039  C CG2   . ILE C  1 214 ? -18.434 -38.493 3.649   1.00 27.86  ? 242 ILE C CG2   1 
ATOM   7040  C CD1   . ILE C  1 214 ? -18.241 -39.190 7.030   1.00 32.28  ? 242 ILE C CD1   1 
ATOM   7041  N N     . PHE C  1 215 ? -21.501 -36.749 2.495   1.00 26.75  ? 243 PHE C N     1 
ATOM   7042  C CA    . PHE C  1 215 ? -22.336 -36.910 1.321   1.00 30.28  ? 243 PHE C CA    1 
ATOM   7043  C C     . PHE C  1 215 ? -21.483 -37.394 0.174   1.00 27.49  ? 243 PHE C C     1 
ATOM   7044  O O     . PHE C  1 215 ? -20.499 -36.746 -0.196  1.00 33.94  ? 243 PHE C O     1 
ATOM   7045  C CB    . PHE C  1 215 ? -22.999 -35.588 0.951   1.00 29.00  ? 243 PHE C CB    1 
ATOM   7046  C CG    . PHE C  1 215 ? -23.901 -35.060 2.015   1.00 31.90  ? 243 PHE C CG    1 
ATOM   7047  C CD1   . PHE C  1 215 ? -25.227 -35.468 2.083   1.00 30.75  ? 243 PHE C CD1   1 
ATOM   7048  C CD2   . PHE C  1 215 ? -23.422 -34.153 2.959   1.00 30.50  ? 243 PHE C CD2   1 
ATOM   7049  C CE1   . PHE C  1 215 ? -26.058 -34.998 3.061   1.00 34.68  ? 243 PHE C CE1   1 
ATOM   7050  C CE2   . PHE C  1 215 ? -24.250 -33.666 3.947   1.00 29.48  ? 243 PHE C CE2   1 
ATOM   7051  C CZ    . PHE C  1 215 ? -25.587 -34.076 4.000   1.00 30.76  ? 243 PHE C CZ    1 
ATOM   7052  N N     . GLU C  1 216 ? -21.873 -38.541 -0.377  1.00 31.20  ? 244 GLU C N     1 
ATOM   7053  C CA    . GLU C  1 216 ? -21.268 -39.124 -1.564  1.00 33.21  ? 244 GLU C CA    1 
ATOM   7054  C C     . GLU C  1 216 ? -22.411 -39.484 -2.510  1.00 34.53  ? 244 GLU C C     1 
ATOM   7055  O O     . GLU C  1 216 ? -23.128 -40.471 -2.291  1.00 36.04  ? 244 GLU C O     1 
ATOM   7056  C CB    . GLU C  1 216 ? -20.456 -40.371 -1.209  1.00 36.44  ? 244 GLU C CB    1 
ATOM   7057  C CG    . GLU C  1 216 ? -19.681 -40.971 -2.379  1.00 44.45  ? 244 GLU C CG    1 
ATOM   7058  C CD    . GLU C  1 216 ? -18.816 -42.163 -1.974  1.00 48.68  ? 244 GLU C CD    1 
ATOM   7059  O OE1   . GLU C  1 216 ? -18.794 -42.507 -0.768  1.00 61.16  ? 244 GLU C OE1   1 
ATOM   7060  O OE2   . GLU C  1 216 ? -18.163 -42.761 -2.867  1.00 56.04  ? 244 GLU C OE2   1 
ATOM   7061  N N     . ASP C  1 217 ? -22.579 -38.653 -3.539  1.00 32.24  ? 245 ASP C N     1 
ATOM   7062  C CA    . ASP C  1 217 ? -23.678 -38.754 -4.498  1.00 33.84  ? 245 ASP C CA    1 
ATOM   7063  C C     . ASP C  1 217 ? -25.011 -39.033 -3.809  1.00 32.95  ? 245 ASP C C     1 
ATOM   7064  O O     . ASP C  1 217 ? -25.773 -39.921 -4.204  1.00 32.16  ? 245 ASP C O     1 
ATOM   7065  C CB    . ASP C  1 217 ? -23.354 -39.776 -5.602  1.00 37.25  ? 245 ASP C CB    1 
ATOM   7066  C CG    . ASP C  1 217 ? -23.083 -39.110 -6.951  1.00 58.04  ? 245 ASP C CG    1 
ATOM   7067  O OD1   . ASP C  1 217 ? -23.842 -39.408 -7.900  1.00 83.98  ? 245 ASP C OD1   1 
ATOM   7068  O OD2   . ASP C  1 217 ? -22.133 -38.283 -7.062  1.00 55.86  ? 245 ASP C OD2   1 
ATOM   7069  N N     . CYS C  1 218 ? -25.277 -38.248 -2.768  1.00 32.77  ? 246 CYS C N     1 
ATOM   7070  C CA    . CYS C  1 218 ? -26.529 -38.316 -2.031  1.00 28.69  ? 246 CYS C CA    1 
ATOM   7071  C C     . CYS C  1 218 ? -27.613 -37.560 -2.812  1.00 30.26  ? 246 CYS C C     1 
ATOM   7072  O O     . CYS C  1 218 ? -27.458 -36.371 -3.084  1.00 28.26  ? 246 CYS C O     1 
ATOM   7073  C CB    . CYS C  1 218 ? -26.334 -37.711 -0.635  1.00 29.36  ? 246 CYS C CB    1 
ATOM   7074  S SG    . CYS C  1 218 ? -27.843 -37.604 0.348   1.00 35.03  ? 246 CYS C SG    1 
ATOM   7075  N N     . ARG C  1 219 ? -28.703 -38.257 -3.167  1.00 28.34  ? 247 ARG C N     1 
ATOM   7076  C CA    . ARG C  1 219 ? -29.804 -37.685 -3.944  1.00 32.28  ? 247 ARG C CA    1 
ATOM   7077  C C     . ARG C  1 219 ? -30.966 -37.389 -3.050  1.00 27.10  ? 247 ARG C C     1 
ATOM   7078  O O     . ARG C  1 219 ? -31.340 -38.214 -2.229  1.00 32.46  ? 247 ARG C O     1 
ATOM   7079  C CB    . ARG C  1 219 ? -30.317 -38.650 -5.030  1.00 32.38  ? 247 ARG C CB    1 
ATOM   7080  C CG    A ARG C  1 219 ? -29.249 -39.093 -6.030  0.50 41.78  ? 247 ARG C CG    1 
ATOM   7081  C CG    B ARG C  1 219 ? -29.302 -39.027 -6.091  0.50 41.90  ? 247 ARG C CG    1 
ATOM   7082  C CD    A ARG C  1 219 ? -29.860 -39.718 -7.293  0.50 37.72  ? 247 ARG C CD    1 
ATOM   7083  C CD    B ARG C  1 219 ? -29.906 -40.010 -7.102  0.50 37.69  ? 247 ARG C CD    1 
ATOM   7084  N NE    A ARG C  1 219 ? -29.887 -38.762 -8.401  0.50 48.71  ? 247 ARG C NE    1 
ATOM   7085  N NE    B ARG C  1 219 ? -29.360 -39.812 -8.445  0.50 46.23  ? 247 ARG C NE    1 
ATOM   7086  C CZ    A ARG C  1 219 ? -28.879 -38.539 -9.250  0.50 44.55  ? 247 ARG C CZ    1 
ATOM   7087  C CZ    B ARG C  1 219 ? -29.921 -39.080 -9.415  0.50 47.01  ? 247 ARG C CZ    1 
ATOM   7088  N NH1   A ARG C  1 219 ? -29.025 -37.630 -10.209 0.50 40.57  ? 247 ARG C NH1   1 
ATOM   7089  N NH1   B ARG C  1 219 ? -29.306 -38.988 -10.589 0.50 51.94  ? 247 ARG C NH1   1 
ATOM   7090  N NH2   A ARG C  1 219 ? -27.729 -39.211 -9.155  0.50 31.17  ? 247 ARG C NH2   1 
ATOM   7091  N NH2   B ARG C  1 219 ? -31.078 -38.441 -9.237  0.50 25.47  ? 247 ARG C NH2   1 
ATOM   7092  N N     . ILE C  1 220 ? -31.539 -36.210 -3.235  1.00 27.96  ? 248 ILE C N     1 
ATOM   7093  C CA    . ILE C  1 220 ? -32.709 -35.778 -2.504  1.00 29.09  ? 248 ILE C CA    1 
ATOM   7094  C C     . ILE C  1 220 ? -33.612 -35.098 -3.514  1.00 27.75  ? 248 ILE C C     1 
ATOM   7095  O O     . ILE C  1 220 ? -33.134 -34.531 -4.490  1.00 32.68  ? 248 ILE C O     1 
ATOM   7096  C CB    . ILE C  1 220 ? -32.340 -34.794 -1.341  1.00 29.52  ? 248 ILE C CB    1 
ATOM   7097  C CG1   . ILE C  1 220 ? -31.546 -33.599 -1.859  1.00 30.10  ? 248 ILE C CG1   1 
ATOM   7098  C CG2   . ILE C  1 220 ? -31.533 -35.524 -0.219  1.00 28.74  ? 248 ILE C CG2   1 
ATOM   7099  C CD1   . ILE C  1 220 ? -30.949 -32.755 -0.724  1.00 31.51  ? 248 ILE C CD1   1 
ATOM   7100  N N     . PRO C  1 221 ? -34.924 -35.145 -3.291  1.00 30.10  ? 249 PRO C N     1 
ATOM   7101  C CA    . PRO C  1 221 ? -35.837 -34.510 -4.244  1.00 30.56  ? 249 PRO C CA    1 
ATOM   7102  C C     . PRO C  1 221 ? -35.634 -33.019 -4.442  1.00 31.91  ? 249 PRO C C     1 
ATOM   7103  O O     . PRO C  1 221 ? -35.125 -32.331 -3.552  1.00 32.37  ? 249 PRO C O     1 
ATOM   7104  C CB    . PRO C  1 221 ? -37.230 -34.771 -3.648  1.00 31.69  ? 249 PRO C CB    1 
ATOM   7105  C CG    . PRO C  1 221 ? -37.019 -35.426 -2.340  1.00 32.59  ? 249 PRO C CG    1 
ATOM   7106  C CD    . PRO C  1 221 ? -35.613 -35.819 -2.179  1.00 28.89  ? 249 PRO C CD    1 
ATOM   7107  N N     . LYS C  1 222 ? -36.070 -32.514 -5.592  1.00 34.12  ? 250 LYS C N     1 
ATOM   7108  C CA    . LYS C  1 222 ? -35.949 -31.080 -5.922  1.00 32.86  ? 250 LYS C CA    1 
ATOM   7109  C C     . LYS C  1 222 ? -36.607 -30.096 -4.938  1.00 32.51  ? 250 LYS C C     1 
ATOM   7110  O O     . LYS C  1 222 ? -36.061 -29.022 -4.695  1.00 34.00  ? 250 LYS C O     1 
ATOM   7111  C CB    . LYS C  1 222 ? -36.493 -30.794 -7.337  1.00 32.38  ? 250 LYS C CB    1 
ATOM   7112  C CG    . LYS C  1 222 ? -35.636 -31.344 -8.444  1.00 33.34  ? 250 LYS C CG    1 
ATOM   7113  C CD    . LYS C  1 222 ? -34.276 -30.649 -8.580  1.00 47.86  ? 250 LYS C CD    1 
ATOM   7114  C CE    . LYS C  1 222 ? -34.405 -29.246 -9.146  1.00 57.03  ? 250 LYS C CE    1 
ATOM   7115  N NZ    . LYS C  1 222 ? -33.068 -28.683 -9.462  1.00 66.98  ? 250 LYS C NZ    1 
ATOM   7116  N N     . ASP C  1 223 ? -37.776 -30.431 -4.400  1.00 29.46  ? 251 ASP C N     1 
ATOM   7117  C CA    . ASP C  1 223 ? -38.439 -29.548 -3.437  1.00 32.17  ? 251 ASP C CA    1 
ATOM   7118  C C     . ASP C  1 223 ? -37.814 -29.621 -2.018  1.00 31.30  ? 251 ASP C C     1 
ATOM   7119  O O     . ASP C  1 223 ? -38.382 -29.126 -1.041  1.00 34.15  ? 251 ASP C O     1 
ATOM   7120  C CB    . ASP C  1 223 ? -39.954 -29.829 -3.401  1.00 33.22  ? 251 ASP C CB    1 
ATOM   7121  C CG    . ASP C  1 223 ? -40.288 -31.216 -2.912  1.00 43.63  ? 251 ASP C CG    1 
ATOM   7122  O OD1   . ASP C  1 223 ? -39.397 -32.091 -2.921  1.00 54.94  ? 251 ASP C OD1   1 
ATOM   7123  O OD2   . ASP C  1 223 ? -41.460 -31.432 -2.522  1.00 56.91  ? 251 ASP C OD2   1 
ATOM   7124  N N     . SER C  1 224 ? -36.651 -30.260 -1.915  1.00 32.05  ? 252 SER C N     1 
ATOM   7125  C CA    . SER C  1 224 ? -35.874 -30.284 -0.677  1.00 32.05  ? 252 SER C CA    1 
ATOM   7126  C C     . SER C  1 224 ? -35.160 -28.945 -0.413  1.00 31.93  ? 252 SER C C     1 
ATOM   7127  O O     . SER C  1 224 ? -34.685 -28.702 0.705   1.00 31.96  ? 252 SER C O     1 
ATOM   7128  C CB    . SER C  1 224 ? -34.825 -31.390 -0.736  1.00 32.68  ? 252 SER C CB    1 
ATOM   7129  O OG    . SER C  1 224 ? -35.419 -32.673 -0.828  1.00 36.08  ? 252 SER C OG    1 
ATOM   7130  N N     . ILE C  1 225 ? -35.058 -28.108 -1.445  1.00 27.71  ? 253 ILE C N     1 
ATOM   7131  C CA    . ILE C  1 225 ? -34.433 -26.805 -1.333  1.00 29.99  ? 253 ILE C CA    1 
ATOM   7132  C C     . ILE C  1 225 ? -35.321 -25.940 -0.459  1.00 29.56  ? 253 ILE C C     1 
ATOM   7133  O O     . ILE C  1 225 ? -36.543 -25.941 -0.603  1.00 32.42  ? 253 ILE C O     1 
ATOM   7134  C CB    . ILE C  1 225 ? -34.158 -26.170 -2.729  1.00 29.95  ? 253 ILE C CB    1 
ATOM   7135  C CG1   . ILE C  1 225 ? -33.346 -24.881 -2.607  1.00 29.87  ? 253 ILE C CG1   1 
ATOM   7136  C CG2   . ILE C  1 225 ? -35.448 -25.906 -3.504  1.00 31.19  ? 253 ILE C CG2   1 
ATOM   7137  C CD1   . ILE C  1 225 ? -33.073 -24.258 -3.939  1.00 32.10  ? 253 ILE C CD1   1 
ATOM   7138  N N     . LEU C  1 226 ? -34.695 -25.264 0.505   1.00 30.95  ? 254 LEU C N     1 
ATOM   7139  C CA    . LEU C  1 226 ? -35.375 -24.352 1.416   1.00 30.56  ? 254 LEU C CA    1 
ATOM   7140  C C     . LEU C  1 226 ? -35.151 -22.952 0.851   1.00 29.70  ? 254 LEU C C     1 
ATOM   7141  O O     . LEU C  1 226 ? -34.009 -22.537 0.635   1.00 33.03  ? 254 LEU C O     1 
ATOM   7142  C CB    . LEU C  1 226 ? -34.797 -24.498 2.840   1.00 33.22  ? 254 LEU C CB    1 
ATOM   7143  C CG    . LEU C  1 226 ? -35.380 -23.665 3.982   1.00 31.32  ? 254 LEU C CG    1 
ATOM   7144  C CD1   . LEU C  1 226 ? -36.816 -24.057 4.282   1.00 32.41  ? 254 LEU C CD1   1 
ATOM   7145  C CD2   . LEU C  1 226 ? -34.505 -23.800 5.255   1.00 29.67  ? 254 LEU C CD2   1 
ATOM   7146  N N     . GLY C  1 227 ? -36.236 -22.237 0.563   1.00 31.91  ? 255 GLY C N     1 
ATOM   7147  C CA    . GLY C  1 227 ? -36.128 -20.979 -0.203  1.00 33.48  ? 255 GLY C CA    1 
ATOM   7148  C C     . GLY C  1 227 ? -35.692 -21.155 -1.657  1.00 36.00  ? 255 GLY C C     1 
ATOM   7149  O O     . GLY C  1 227 ? -35.945 -22.200 -2.273  1.00 36.23  ? 255 GLY C O     1 
ATOM   7150  N N     . GLU C  1 228 ? -35.029 -20.135 -2.203  1.00 37.02  ? 256 GLU C N     1 
ATOM   7151  C CA    . GLU C  1 228 ? -34.591 -20.130 -3.602  1.00 36.23  ? 256 GLU C CA    1 
ATOM   7152  C C     . GLU C  1 228 ? -33.105 -20.379 -3.673  1.00 37.26  ? 256 GLU C C     1 
ATOM   7153  O O     . GLU C  1 228 ? -32.391 -20.076 -2.713  1.00 32.72  ? 256 GLU C O     1 
ATOM   7154  C CB    . GLU C  1 228 ? -34.878 -18.778 -4.243  1.00 39.61  ? 256 GLU C CB    1 
ATOM   7155  C CG    . GLU C  1 228 ? -36.378 -18.432 -4.335  1.00 51.05  ? 256 GLU C CG    1 
ATOM   7156  C CD    . GLU C  1 228 ? -36.991 -18.789 -5.685  1.00 73.24  ? 256 GLU C CD    1 
ATOM   7157  O OE1   . GLU C  1 228 ? -36.398 -18.433 -6.732  1.00 71.08  ? 256 GLU C OE1   1 
ATOM   7158  O OE2   . GLU C  1 228 ? -38.076 -19.412 -5.696  1.00 83.37  ? 256 GLU C OE2   1 
ATOM   7159  N N     . PRO C  1 229 ? -32.626 -20.918 -4.809  1.00 36.23  ? 257 PRO C N     1 
ATOM   7160  C CA    . PRO C  1 229 ? -31.186 -21.125 -4.978  1.00 34.77  ? 257 PRO C CA    1 
ATOM   7161  C C     . PRO C  1 229 ? -30.380 -19.831 -4.821  1.00 33.92  ? 257 PRO C C     1 
ATOM   7162  O O     . PRO C  1 229 ? -30.725 -18.805 -5.413  1.00 34.24  ? 257 PRO C O     1 
ATOM   7163  C CB    . PRO C  1 229 ? -31.066 -21.665 -6.401  1.00 36.34  ? 257 PRO C CB    1 
ATOM   7164  C CG    . PRO C  1 229 ? -32.440 -22.192 -6.745  1.00 36.98  ? 257 PRO C CG    1 
ATOM   7165  C CD    . PRO C  1 229 ? -33.405 -21.376 -5.984  1.00 35.84  ? 257 PRO C CD    1 
ATOM   7166  N N     . GLY C  1 230 ? -29.311 -19.879 -4.036  1.00 34.42  ? 258 GLY C N     1 
ATOM   7167  C CA    . GLY C  1 230 ? -28.531 -18.681 -3.727  1.00 31.86  ? 258 GLY C CA    1 
ATOM   7168  C C     . GLY C  1 230 ? -28.957 -17.977 -2.436  1.00 31.98  ? 258 GLY C C     1 
ATOM   7169  O O     . GLY C  1 230 ? -28.199 -17.174 -1.907  1.00 38.30  ? 258 GLY C O     1 
ATOM   7170  N N     . MET C  1 231 ? -30.151 -18.275 -1.914  1.00 30.83  ? 259 MET C N     1 
ATOM   7171  C CA    . MET C  1 231 ? -30.602 -17.720 -0.634  1.00 32.17  ? 259 MET C CA    1 
ATOM   7172  C C     . MET C  1 231 ? -29.854 -18.299 0.580   1.00 29.82  ? 259 MET C C     1 
ATOM   7173  O O     . MET C  1 231 ? -30.061 -17.836 1.695   1.00 35.30  ? 259 MET C O     1 
ATOM   7174  C CB    . MET C  1 231 ? -32.099 -17.972 -0.408  1.00 33.32  ? 259 MET C CB    1 
ATOM   7175  C CG    . MET C  1 231 ? -33.051 -16.955 -1.034  1.00 39.67  ? 259 MET C CG    1 
ATOM   7176  S SD    . MET C  1 231 ? -34.792 -17.222 -0.583  1.00 54.02  ? 259 MET C SD    1 
ATOM   7177  C CE    . MET C  1 231 ? -34.778 -16.916 1.189   1.00 43.68  ? 259 MET C CE    1 
ATOM   7178  N N     . GLY C  1 232 ? -29.001 -19.299 0.373   1.00 27.35  ? 260 GLY C N     1 
ATOM   7179  C CA    . GLY C  1 232 ? -28.434 -20.068 1.481   1.00 29.01  ? 260 GLY C CA    1 
ATOM   7180  C C     . GLY C  1 232 ? -27.641 -19.242 2.470   1.00 30.47  ? 260 GLY C C     1 
ATOM   7181  O O     . GLY C  1 232 ? -27.858 -19.361 3.673   1.00 28.89  ? 260 GLY C O     1 
ATOM   7182  N N     . PHE C  1 233 ? -26.698 -18.442 1.960   1.00 30.74  ? 261 PHE C N     1 
ATOM   7183  C CA    . PHE C  1 233 ? -25.827 -17.676 2.818   1.00 29.27  ? 261 PHE C CA    1 
ATOM   7184  C C     . PHE C  1 233 ? -26.641 -16.732 3.709   1.00 32.23  ? 261 PHE C C     1 
ATOM   7185  O O     . PHE C  1 233 ? -26.329 -16.605 4.888   1.00 26.28  ? 261 PHE C O     1 
ATOM   7186  C CB    . PHE C  1 233 ? -24.751 -16.914 2.033   1.00 30.44  ? 261 PHE C CB    1 
ATOM   7187  C CG    . PHE C  1 233 ? -23.739 -16.234 2.928   1.00 34.48  ? 261 PHE C CG    1 
ATOM   7188  C CD1   . PHE C  1 233 ? -22.670 -16.956 3.458   1.00 42.97  ? 261 PHE C CD1   1 
ATOM   7189  C CD2   . PHE C  1 233 ? -23.893 -14.895 3.287   1.00 36.16  ? 261 PHE C CD2   1 
ATOM   7190  C CE1   . PHE C  1 233 ? -21.760 -16.345 4.303   1.00 44.63  ? 261 PHE C CE1   1 
ATOM   7191  C CE2   . PHE C  1 233 ? -22.996 -14.278 4.130   1.00 37.78  ? 261 PHE C CE2   1 
ATOM   7192  C CZ    . PHE C  1 233 ? -21.923 -14.996 4.636   1.00 40.75  ? 261 PHE C CZ    1 
ATOM   7193  N N     . LYS C  1 234 ? -27.689 -16.112 3.147   1.00 30.10  ? 262 LYS C N     1 
ATOM   7194  C CA    . LYS C  1 234 ? -28.629 -15.290 3.910   1.00 31.51  ? 262 LYS C CA    1 
ATOM   7195  C C     . LYS C  1 234 ? -29.469 -16.087 4.922   1.00 31.31  ? 262 LYS C C     1 
ATOM   7196  O O     . LYS C  1 234 ? -29.728 -15.597 6.026   1.00 25.39  ? 262 LYS C O     1 
ATOM   7197  C CB    . LYS C  1 234 ? -29.554 -14.483 2.960   1.00 31.54  ? 262 LYS C CB    1 
ATOM   7198  C CG    . LYS C  1 234 ? -30.829 -13.918 3.596   1.00 41.39  ? 262 LYS C CG    1 
ATOM   7199  N N     . ILE C  1 235 ? -29.938 -17.275 4.520   1.00 30.23  ? 263 ILE C N     1 
ATOM   7200  C CA    . ILE C  1 235 ? -30.641 -18.170 5.429   1.00 25.95  ? 263 ILE C CA    1 
ATOM   7201  C C     . ILE C  1 235 ? -29.714 -18.563 6.603   1.00 25.87  ? 263 ILE C C     1 
ATOM   7202  O O     . ILE C  1 235 ? -30.115 -18.501 7.740   1.00 26.21  ? 263 ILE C O     1 
ATOM   7203  C CB    . ILE C  1 235 ? -31.204 -19.433 4.711   1.00 26.79  ? 263 ILE C CB    1 
ATOM   7204  C CG1   . ILE C  1 235 ? -32.358 -19.033 3.777   1.00 27.66  ? 263 ILE C CG1   1 
ATOM   7205  C CG2   . ILE C  1 235 ? -31.688 -20.497 5.740   1.00 21.69  ? 263 ILE C CG2   1 
ATOM   7206  C CD1   . ILE C  1 235 ? -32.848 -20.159 2.774   1.00 20.62  ? 263 ILE C CD1   1 
ATOM   7207  N N     . ALA C  1 236 ? -28.466 -18.917 6.302   1.00 24.13  ? 264 ALA C N     1 
ATOM   7208  C CA    . ALA C  1 236 ? -27.519 -19.303 7.306   1.00 25.56  ? 264 ALA C CA    1 
ATOM   7209  C C     . ALA C  1 236 ? -27.241 -18.158 8.293   1.00 30.08  ? 264 ALA C C     1 
ATOM   7210  O O     . ALA C  1 236 ? -27.152 -18.401 9.499   1.00 27.22  ? 264 ALA C O     1 
ATOM   7211  C CB    . ALA C  1 236 ? -26.213 -19.763 6.653   1.00 22.09  ? 264 ALA C CB    1 
ATOM   7212  N N     . MET C  1 237 ? -27.079 -16.933 7.774   1.00 28.42  ? 265 MET C N     1 
ATOM   7213  C CA    . MET C  1 237 ? -26.689 -15.790 8.607   1.00 31.31  ? 265 MET C CA    1 
ATOM   7214  C C     . MET C  1 237 ? -27.847 -15.369 9.494   1.00 28.84  ? 265 MET C C     1 
ATOM   7215  O O     . MET C  1 237 ? -27.656 -15.102 10.675  1.00 28.82  ? 265 MET C O     1 
ATOM   7216  C CB    . MET C  1 237 ? -26.199 -14.597 7.782   1.00 28.76  ? 265 MET C CB    1 
ATOM   7217  C CG    . MET C  1 237 ? -24.837 -14.757 7.137   1.00 35.56  ? 265 MET C CG    1 
ATOM   7218  S SD    . MET C  1 237 ? -23.512 -15.375 8.219   1.00 43.65  ? 265 MET C SD    1 
ATOM   7219  C CE    . MET C  1 237 ? -23.405 -17.099 7.684   1.00 36.63  ? 265 MET C CE    1 
ATOM   7220  N N     . GLN C  1 238 ? -29.056 -15.357 8.946   1.00 27.61  ? 266 GLN C N     1 
ATOM   7221  C CA    . GLN C  1 238 ? -30.219 -15.014 9.745   1.00 26.59  ? 266 GLN C CA    1 
ATOM   7222  C C     . GLN C  1 238 ? -30.557 -16.072 10.779  1.00 26.80  ? 266 GLN C C     1 
ATOM   7223  O O     . GLN C  1 238 ? -31.105 -15.758 11.856  1.00 24.88  ? 266 GLN C O     1 
ATOM   7224  C CB    . GLN C  1 238 ? -31.420 -14.727 8.844   1.00 28.69  ? 266 GLN C CB    1 
ATOM   7225  C CG    . GLN C  1 238 ? -31.200 -13.483 8.008   1.00 30.55  ? 266 GLN C CG    1 
ATOM   7226  C CD    . GLN C  1 238 ? -32.373 -13.128 7.100   1.00 34.89  ? 266 GLN C CD    1 
ATOM   7227  O OE1   . GLN C  1 238 ? -33.459 -13.677 7.214   1.00 41.60  ? 266 GLN C OE1   1 
ATOM   7228  N NE2   . GLN C  1 238 ? -32.148 -12.187 6.204   1.00 51.29  ? 266 GLN C NE2   1 
ATOM   7229  N N     . THR C  1 239 ? -30.227 -17.325 10.482  1.00 28.30  ? 267 THR C N     1 
ATOM   7230  C CA    . THR C  1 239 ? -30.527 -18.401 11.433  1.00 30.02  ? 267 THR C CA    1 
ATOM   7231  C C     . THR C  1 239 ? -29.561 -18.289 12.621  1.00 25.62  ? 267 THR C C     1 
ATOM   7232  O O     . THR C  1 239 ? -29.966 -18.410 13.775  1.00 23.29  ? 267 THR C O     1 
ATOM   7233  C CB    . THR C  1 239 ? -30.530 -19.809 10.755  1.00 26.82  ? 267 THR C CB    1 
ATOM   7234  O OG1   . THR C  1 239 ? -31.612 -19.852 9.808   1.00 28.77  ? 267 THR C OG1   1 
ATOM   7235  C CG2   . THR C  1 239 ? -30.728 -20.946 11.793  1.00 25.78  ? 267 THR C CG2   1 
ATOM   7236  N N     . LEU C  1 240 ? -28.300 -18.022 12.317  1.00 23.37  ? 268 LEU C N     1 
ATOM   7237  C CA    . LEU C  1 240 ? -27.292 -17.789 13.343  1.00 28.60  ? 268 LEU C CA    1 
ATOM   7238  C C     . LEU C  1 240 ? -27.573 -16.590 14.275  1.00 27.43  ? 268 LEU C C     1 
ATOM   7239  O O     . LEU C  1 240 ? -27.184 -16.622 15.447  1.00 24.55  ? 268 LEU C O     1 
ATOM   7240  C CB    . LEU C  1 240 ? -25.898 -17.658 12.696  1.00 25.14  ? 268 LEU C CB    1 
ATOM   7241  C CG    . LEU C  1 240 ? -25.265 -18.942 12.158  1.00 29.90  ? 268 LEU C CG    1 
ATOM   7242  C CD1   . LEU C  1 240 ? -24.122 -18.593 11.210  1.00 28.79  ? 268 LEU C CD1   1 
ATOM   7243  C CD2   . LEU C  1 240 ? -24.767 -19.846 13.282  1.00 31.87  ? 268 LEU C CD2   1 
ATOM   7244  N N     . ASP C  1 241 ? -28.234 -15.542 13.769  1.00 28.46  ? 269 ASP C N     1 
ATOM   7245  C CA    . ASP C  1 241 ? -28.699 -14.420 14.614  1.00 30.00  ? 269 ASP C CA    1 
ATOM   7246  C C     . ASP C  1 241 ? -29.610 -14.931 15.715  1.00 27.80  ? 269 ASP C C     1 
ATOM   7247  O O     . ASP C  1 241 ? -29.481 -14.542 16.899  1.00 27.34  ? 269 ASP C O     1 
ATOM   7248  C CB    . ASP C  1 241 ? -29.461 -13.346 13.806  1.00 29.15  ? 269 ASP C CB    1 
ATOM   7249  C CG    . ASP C  1 241 ? -28.591 -12.644 12.766  1.00 39.93  ? 269 ASP C CG    1 
ATOM   7250  O OD1   . ASP C  1 241 ? -27.385 -12.449 13.032  1.00 39.57  ? 269 ASP C OD1   1 
ATOM   7251  O OD2   . ASP C  1 241 ? -29.120 -12.276 11.682  1.00 39.29  ? 269 ASP C OD2   1 
ATOM   7252  N N     . MET C  1 242 ? -30.547 -15.792 15.330  1.00 29.09  ? 270 MET C N     1 
ATOM   7253  C CA    . MET C  1 242 ? -31.475 -16.381 16.287  1.00 31.11  ? 270 MET C CA    1 
ATOM   7254  C C     . MET C  1 242 ? -30.752 -17.363 17.214  1.00 24.73  ? 270 MET C C     1 
ATOM   7255  O O     . MET C  1 242 ? -30.935 -17.343 18.416  1.00 27.40  ? 270 MET C O     1 
ATOM   7256  C CB    . MET C  1 242 ? -32.579 -17.134 15.565  1.00 31.98  ? 270 MET C CB    1 
ATOM   7257  C CG    . MET C  1 242 ? -33.424 -16.289 14.625  1.00 41.37  ? 270 MET C CG    1 
ATOM   7258  S SD    . MET C  1 242 ? -34.766 -17.288 13.950  1.00 43.18  ? 270 MET C SD    1 
ATOM   7259  C CE    . MET C  1 242 ? -34.038 -18.192 12.570  1.00 33.00  ? 270 MET C CE    1 
ATOM   7260  N N     . GLY C  1 243 ? -29.926 -18.218 16.630  1.00 25.98  ? 271 GLY C N     1 
ATOM   7261  C CA    . GLY C  1 243 ? -29.149 -19.185 17.383  1.00 25.17  ? 271 GLY C CA    1 
ATOM   7262  C C     . GLY C  1 243 ? -28.297 -18.540 18.465  1.00 27.22  ? 271 GLY C C     1 
ATOM   7263  O O     . GLY C  1 243 ? -28.141 -19.104 19.560  1.00 23.24  ? 271 GLY C O     1 
ATOM   7264  N N     . ARG C  1 244 ? -27.742 -17.372 18.138  1.00 27.89  ? 272 ARG C N     1 
ATOM   7265  C CA    . ARG C  1 244 ? -26.850 -16.632 19.033  1.00 23.99  ? 272 ARG C CA    1 
ATOM   7266  C C     . ARG C  1 244 ? -27.507 -16.244 20.342  1.00 23.45  ? 272 ARG C C     1 
ATOM   7267  O O     . ARG C  1 244 ? -26.840 -16.186 21.378  1.00 21.81  ? 272 ARG C O     1 
ATOM   7268  C CB    . ARG C  1 244 ? -26.278 -15.409 18.338  1.00 22.03  ? 272 ARG C CB    1 
ATOM   7269  C CG    . ARG C  1 244 ? -25.006 -15.745 17.600  1.00 27.38  ? 272 ARG C CG    1 
ATOM   7270  C CD    . ARG C  1 244 ? -24.738 -14.814 16.463  1.00 27.27  ? 272 ARG C CD    1 
ATOM   7271  N NE    . ARG C  1 244 ? -23.709 -15.358 15.584  1.00 31.33  ? 272 ARG C NE    1 
ATOM   7272  C CZ    . ARG C  1 244 ? -23.211 -14.719 14.534  1.00 33.18  ? 272 ARG C CZ    1 
ATOM   7273  N NH1   . ARG C  1 244 ? -23.661 -13.512 14.214  1.00 31.41  ? 272 ARG C NH1   1 
ATOM   7274  N NH2   . ARG C  1 244 ? -22.274 -15.299 13.792  1.00 31.69  ? 272 ARG C NH2   1 
ATOM   7275  N N     . ILE C  1 245 ? -28.816 -16.020 20.297  1.00 19.48  ? 273 ILE C N     1 
ATOM   7276  C CA    . ILE C  1 245 ? -29.606 -15.749 21.478  1.00 25.12  ? 273 ILE C CA    1 
ATOM   7277  C C     . ILE C  1 245 ? -29.728 -17.003 22.355  1.00 28.61  ? 273 ILE C C     1 
ATOM   7278  O O     . ILE C  1 245 ? -29.626 -16.918 23.588  1.00 28.68  ? 273 ILE C O     1 
ATOM   7279  C CB    . ILE C  1 245 ? -31.034 -15.203 21.089  1.00 22.13  ? 273 ILE C CB    1 
ATOM   7280  C CG1   . ILE C  1 245 ? -30.899 -13.878 20.332  1.00 25.36  ? 273 ILE C CG1   1 
ATOM   7281  C CG2   . ILE C  1 245 ? -31.900 -14.985 22.323  1.00 26.47  ? 273 ILE C CG2   1 
ATOM   7282  C CD1   . ILE C  1 245 ? -32.222 -13.332 19.769  1.00 23.49  ? 273 ILE C CD1   1 
ATOM   7283  N N     . GLY C  1 246 ? -29.962 -18.148 21.710  1.00 28.94  ? 274 GLY C N     1 
ATOM   7284  C CA    . GLY C  1 246 ? -29.985 -19.433 22.386  1.00 24.96  ? 274 GLY C CA    1 
ATOM   7285  C C     . GLY C  1 246 ? -28.688 -19.781 23.076  1.00 23.55  ? 274 GLY C C     1 
ATOM   7286  O O     . GLY C  1 246 ? -28.700 -20.260 24.217  1.00 25.02  ? 274 GLY C O     1 
ATOM   7287  N N     . ILE C  1 247 ? -27.580 -19.543 22.387  1.00 20.61  ? 275 ILE C N     1 
ATOM   7288  C CA    . ILE C  1 247 ? -26.256 -19.801 22.962  1.00 22.83  ? 275 ILE C CA    1 
ATOM   7289  C C     . ILE C  1 247 ? -25.938 -18.807 24.083  1.00 20.46  ? 275 ILE C C     1 
ATOM   7290  O O     . ILE C  1 247 ? -25.327 -19.186 25.079  1.00 22.30  ? 275 ILE C O     1 
ATOM   7291  C CB    . ILE C  1 247 ? -25.154 -19.812 21.902  1.00 21.28  ? 275 ILE C CB    1 
ATOM   7292  C CG1   . ILE C  1 247 ? -25.385 -20.946 20.902  1.00 29.72  ? 275 ILE C CG1   1 
ATOM   7293  C CG2   . ILE C  1 247 ? -23.782 -20.027 22.537  1.00 18.23  ? 275 ILE C CG2   1 
ATOM   7294  C CD1   . ILE C  1 247 ? -25.511 -22.316 21.547  1.00 27.05  ? 275 ILE C CD1   1 
ATOM   7295  N N     . ALA C  1 248 ? -26.361 -17.552 23.923  1.00 25.25  ? 276 ALA C N     1 
ATOM   7296  C CA    . ALA C  1 248 ? -26.243 -16.555 25.001  1.00 25.77  ? 276 ALA C CA    1 
ATOM   7297  C C     . ALA C  1 248 ? -26.970 -17.070 26.250  1.00 24.05  ? 276 ALA C C     1 
ATOM   7298  O O     . ALA C  1 248 ? -26.440 -17.028 27.352  1.00 23.03  ? 276 ALA C O     1 
ATOM   7299  C CB    . ALA C  1 248 ? -26.777 -15.180 24.552  1.00 17.76  ? 276 ALA C CB    1 
ATOM   7300  N N     . SER C  1 249 ? -28.163 -17.616 26.066  1.00 24.40  ? 277 SER C N     1 
ATOM   7301  C CA    . SER C  1 249 ? -28.932 -18.121 27.185  1.00 25.21  ? 277 SER C CA    1 
ATOM   7302  C C     . SER C  1 249 ? -28.279 -19.352 27.833  1.00 25.43  ? 277 SER C C     1 
ATOM   7303  O O     . SER C  1 249 ? -28.328 -19.523 29.059  1.00 24.37  ? 277 SER C O     1 
ATOM   7304  C CB    . SER C  1 249 ? -30.342 -18.442 26.738  1.00 27.32  ? 277 SER C CB    1 
ATOM   7305  O OG    . SER C  1 249 ? -30.918 -17.307 26.118  1.00 28.53  ? 277 SER C OG    1 
ATOM   7306  N N     . GLN C  1 250 ? -27.672 -20.203 27.012  1.00 20.16  ? 278 GLN C N     1 
ATOM   7307  C CA    . GLN C  1 250 ? -27.042 -21.379 27.521  1.00 22.94  ? 278 GLN C CA    1 
ATOM   7308  C C     . GLN C  1 250 ? -25.856 -20.954 28.396  1.00 22.38  ? 278 GLN C C     1 
ATOM   7309  O O     . GLN C  1 250 ? -25.647 -21.494 29.487  1.00 20.38  ? 278 GLN C O     1 
ATOM   7310  C CB    . GLN C  1 250 ? -26.570 -22.263 26.379  1.00 26.15  ? 278 GLN C CB    1 
ATOM   7311  C CG    . GLN C  1 250 ? -25.983 -23.597 26.849  1.00 26.44  ? 278 GLN C CG    1 
ATOM   7312  C CD    . GLN C  1 250 ? -24.967 -24.176 25.873  1.00 33.09  ? 278 GLN C CD    1 
ATOM   7313  O OE1   . GLN C  1 250 ? -24.447 -23.479 24.991  1.00 26.84  ? 278 GLN C OE1   1 
ATOM   7314  N NE2   . GLN C  1 250 ? -24.684 -25.472 26.027  1.00 28.78  ? 278 GLN C NE2   1 
ATOM   7315  N N     . ALA C  1 251 ? -25.114 -19.965 27.911  1.00 21.90  ? 279 ALA C N     1 
ATOM   7316  C CA    . ALA C  1 251 ? -23.956 -19.425 28.612  1.00 19.64  ? 279 ALA C CA    1 
ATOM   7317  C C     . ALA C  1 251 ? -24.386 -18.783 29.931  1.00 18.21  ? 279 ALA C C     1 
ATOM   7318  O O     . ALA C  1 251 ? -23.725 -18.972 30.949  1.00 19.81  ? 279 ALA C O     1 
ATOM   7319  C CB    . ALA C  1 251 ? -23.227 -18.425 27.736  1.00 17.03  ? 279 ALA C CB    1 
ATOM   7320  N N     . LEU C  1 252 ? -25.532 -18.103 29.938  1.00 22.67  ? 280 LEU C N     1 
ATOM   7321  C CA    . LEU C  1 252 ? -26.125 -17.599 31.187  1.00 21.55  ? 280 LEU C CA    1 
ATOM   7322  C C     . LEU C  1 252 ? -26.446 -18.676 32.213  1.00 21.43  ? 280 LEU C C     1 
ATOM   7323  O O     . LEU C  1 252 ? -26.276 -18.438 33.406  1.00 20.01  ? 280 LEU C O     1 
ATOM   7324  C CB    . LEU C  1 252 ? -27.403 -16.796 30.954  1.00 23.98  ? 280 LEU C CB    1 
ATOM   7325  C CG    . LEU C  1 252 ? -27.334 -15.612 29.984  1.00 29.84  ? 280 LEU C CG    1 
ATOM   7326  C CD1   . LEU C  1 252 ? -28.720 -15.078 29.723  1.00 19.70  ? 280 LEU C CD1   1 
ATOM   7327  C CD2   . LEU C  1 252 ? -26.415 -14.515 30.461  1.00 22.85  ? 280 LEU C CD2   1 
ATOM   7328  N N     . GLY C  1 253 ? -26.955 -19.822 31.765  1.00 21.43  ? 281 GLY C N     1 
ATOM   7329  C CA    . GLY C  1 253 ? -27.260 -20.946 32.662  1.00 22.38  ? 281 GLY C CA    1 
ATOM   7330  C C     . GLY C  1 253 ? -26.006 -21.551 33.280  1.00 21.50  ? 281 GLY C C     1 
ATOM   7331  O O     . GLY C  1 253 ? -25.956 -21.833 34.477  1.00 25.07  ? 281 GLY C O     1 
ATOM   7332  N N     . ILE C  1 254 ? -24.991 -21.711 32.451  1.00 20.40  ? 282 ILE C N     1 
ATOM   7333  C CA    . ILE C  1 254 ? -23.680 -22.205 32.887  1.00 21.70  ? 282 ILE C CA    1 
ATOM   7334  C C     . ILE C  1 254 ? -23.042 -21.279 33.929  1.00 24.59  ? 282 ILE C C     1 
ATOM   7335  O O     . ILE C  1 254 ? -22.572 -21.741 34.987  1.00 18.51  ? 282 ILE C O     1 
ATOM   7336  C CB    . ILE C  1 254 ? -22.718 -22.348 31.688  1.00 23.06  ? 282 ILE C CB    1 
ATOM   7337  C CG1   . ILE C  1 254 ? -23.177 -23.484 30.755  1.00 23.15  ? 282 ILE C CG1   1 
ATOM   7338  C CG2   . ILE C  1 254 ? -21.244 -22.595 32.163  1.00 17.97  ? 282 ILE C CG2   1 
ATOM   7339  C CD1   . ILE C  1 254 ? -22.439 -23.527 29.435  1.00 18.43  ? 282 ILE C CD1   1 
ATOM   7340  N N     . ALA C  1 255 ? -22.992 -19.986 33.595  1.00 22.25  ? 283 ALA C N     1 
ATOM   7341  C CA    . ALA C  1 255 ? -22.552 -18.949 34.519  1.00 24.24  ? 283 ALA C CA    1 
ATOM   7342  C C     . ALA C  1 255 ? -23.402 -18.894 35.814  1.00 22.56  ? 283 ALA C C     1 
ATOM   7343  O O     . ALA C  1 255 ? -22.859 -18.812 36.908  1.00 22.26  ? 283 ALA C O     1 
ATOM   7344  C CB    . ALA C  1 255 ? -22.531 -17.621 33.813  1.00 21.53  ? 283 ALA C CB    1 
ATOM   7345  N N     . GLN C  1 256 ? -24.727 -18.941 35.700  1.00 21.00  ? 284 GLN C N     1 
ATOM   7346  C CA    . GLN C  1 256 ? -25.587 -18.893 36.891  1.00 22.13  ? 284 GLN C CA    1 
ATOM   7347  C C     . GLN C  1 256 ? -25.329 -20.050 37.863  1.00 24.48  ? 284 GLN C C     1 
ATOM   7348  O O     . GLN C  1 256 ? -25.227 -19.845 39.070  1.00 20.61  ? 284 GLN C O     1 
ATOM   7349  C CB    . GLN C  1 256 ? -27.075 -18.869 36.537  1.00 23.05  ? 284 GLN C CB    1 
ATOM   7350  C CG    . GLN C  1 256 ? -27.982 -18.785 37.776  1.00 23.22  ? 284 GLN C CG    1 
ATOM   7351  C CD    . GLN C  1 256 ? -27.894 -17.440 38.485  1.00 31.44  ? 284 GLN C CD    1 
ATOM   7352  O OE1   . GLN C  1 256 ? -28.382 -16.445 37.968  1.00 31.79  ? 284 GLN C OE1   1 
ATOM   7353  N NE2   . GLN C  1 256 ? -27.278 -17.406 39.673  1.00 23.55  ? 284 GLN C NE2   1 
ATOM   7354  N N     . THR C  1 257 ? -25.217 -21.256 37.320  1.00 23.32  ? 285 THR C N     1 
ATOM   7355  C CA    . THR C  1 257 ? -24.966 -22.420 38.128  1.00 24.74  ? 285 THR C CA    1 
ATOM   7356  C C     . THR C  1 257 ? -23.524 -22.406 38.720  1.00 19.51  ? 285 THR C C     1 
ATOM   7357  O O     . THR C  1 257 ? -23.338 -22.796 39.865  1.00 22.62  ? 285 THR C O     1 
ATOM   7358  C CB    . THR C  1 257 ? -25.292 -23.738 37.360  1.00 25.88  ? 285 THR C CB    1 
ATOM   7359  O OG1   . THR C  1 257 ? -25.574 -24.768 38.307  1.00 29.18  ? 285 THR C OG1   1 
ATOM   7360  C CG2   . THR C  1 257 ? -24.142 -24.149 36.465  1.00 22.74  ? 285 THR C CG2   1 
ATOM   7361  N N     . ALA C  1 258 ? -22.541 -21.912 37.974  1.00 23.80  ? 286 ALA C N     1 
ATOM   7362  C CA    . ALA C  1 258 ? -21.176 -21.773 38.514  1.00 19.42  ? 286 ALA C CA    1 
ATOM   7363  C C     . ALA C  1 258 ? -21.118 -20.784 39.710  1.00 23.54  ? 286 ALA C C     1 
ATOM   7364  O O     . ALA C  1 258 ? -20.425 -21.030 40.736  1.00 19.73  ? 286 ALA C O     1 
ATOM   7365  C CB    . ALA C  1 258 ? -20.221 -21.350 37.422  1.00 16.30  ? 286 ALA C CB    1 
ATOM   7366  N N     . LEU C  1 259 ? -21.825 -19.663 39.561  1.00 22.60  ? 287 LEU C N     1 
ATOM   7367  C CA    . LEU C  1 259 ? -21.979 -18.668 40.621  1.00 22.36  ? 287 LEU C CA    1 
ATOM   7368  C C     . LEU C  1 259 ? -22.700 -19.237 41.841  1.00 23.22  ? 287 LEU C C     1 
ATOM   7369  O O     . LEU C  1 259 ? -22.269 -18.996 42.990  1.00 19.67  ? 287 LEU C O     1 
ATOM   7370  C CB    . LEU C  1 259 ? -22.715 -17.407 40.110  1.00 21.27  ? 287 LEU C CB    1 
ATOM   7371  C CG    . LEU C  1 259 ? -22.983 -16.282 41.134  1.00 24.91  ? 287 LEU C CG    1 
ATOM   7372  C CD1   . LEU C  1 259 ? -21.672 -15.927 41.892  1.00 17.68  ? 287 LEU C CD1   1 
ATOM   7373  C CD2   . LEU C  1 259 ? -23.624 -15.017 40.469  1.00 24.10  ? 287 LEU C CD2   1 
ATOM   7374  N N     . ASP C  1 260 ? -23.790 -19.975 41.606  1.00 24.88  ? 288 ASP C N     1 
ATOM   7375  C CA    . ASP C  1 260 ? -24.517 -20.639 42.690  1.00 25.72  ? 288 ASP C CA    1 
ATOM   7376  C C     . ASP C  1 260 ? -23.605 -21.562 43.484  1.00 24.92  ? 288 ASP C C     1 
ATOM   7377  O O     . ASP C  1 260 ? -23.666 -21.615 44.704  1.00 28.02  ? 288 ASP C O     1 
ATOM   7378  C CB    . ASP C  1 260 ? -25.650 -21.498 42.174  1.00 26.18  ? 288 ASP C CB    1 
ATOM   7379  C CG    . ASP C  1 260 ? -26.779 -20.701 41.570  1.00 31.19  ? 288 ASP C CG    1 
ATOM   7380  O OD1   . ASP C  1 260 ? -26.854 -19.477 41.795  1.00 31.72  ? 288 ASP C OD1   1 
ATOM   7381  O OD2   . ASP C  1 260 ? -27.594 -21.324 40.861  1.00 31.49  ? 288 ASP C OD2   1 
ATOM   7382  N N     . CYS C  1 261 ? -22.787 -22.301 42.755  1.00 27.70  ? 289 CYS C N     1 
ATOM   7383  C CA    . CYS C  1 261 ? -21.834 -23.214 43.321  1.00 25.30  ? 289 CYS C CA    1 
ATOM   7384  C C     . CYS C  1 261 ? -20.792 -22.478 44.208  1.00 26.56  ? 289 CYS C C     1 
ATOM   7385  O O     . CYS C  1 261 ? -20.521 -22.889 45.337  1.00 24.33  ? 289 CYS C O     1 
ATOM   7386  C CB    . CYS C  1 261 ? -21.164 -23.986 42.176  1.00 27.15  ? 289 CYS C CB    1 
ATOM   7387  S SG    . CYS C  1 261 ? -19.785 -24.976 42.702  1.00 35.48  ? 289 CYS C SG    1 
ATOM   7388  N N     . ALA C  1 262 ? -20.231 -21.388 43.697  1.00 27.42  ? 290 ALA C N     1 
ATOM   7389  C CA    . ALA C  1 262 ? -19.263 -20.600 44.449  1.00 24.12  ? 290 ALA C CA    1 
ATOM   7390  C C     . ALA C  1 262 ? -19.855 -20.013 45.754  1.00 25.29  ? 290 ALA C C     1 
ATOM   7391  O O     . ALA C  1 262 ? -19.226 -20.087 46.815  1.00 22.91  ? 290 ALA C O     1 
ATOM   7392  C CB    . ALA C  1 262 ? -18.640 -19.509 43.559  1.00 20.03  ? 290 ALA C CB    1 
ATOM   7393  N N     . VAL C  1 263 ? -21.086 -19.495 45.688  1.00 21.85  ? 291 VAL C N     1 
ATOM   7394  C CA    . VAL C  1 263 ? -21.691 -18.804 46.806  1.00 23.81  ? 291 VAL C CA    1 
ATOM   7395  C C     . VAL C  1 263 ? -21.958 -19.759 47.983  1.00 24.92  ? 291 VAL C C     1 
ATOM   7396  O O     . VAL C  1 263 ? -21.610 -19.466 49.115  1.00 25.68  ? 291 VAL C O     1 
ATOM   7397  C CB    . VAL C  1 263 ? -22.987 -18.076 46.384  1.00 22.75  ? 291 VAL C CB    1 
ATOM   7398  C CG1   . VAL C  1 263 ? -23.838 -17.674 47.605  1.00 29.11  ? 291 VAL C CG1   1 
ATOM   7399  C CG2   . VAL C  1 263 ? -22.672 -16.854 45.564  1.00 18.54  ? 291 VAL C CG2   1 
ATOM   7400  N N     . ASN C  1 264 ? -22.564 -20.897 47.683  1.00 28.69  ? 292 ASN C N     1 
ATOM   7401  C CA    . ASN C  1 264 ? -22.848 -21.916 48.669  1.00 26.47  ? 292 ASN C CA    1 
ATOM   7402  C C     . ASN C  1 264 ? -21.576 -22.468 49.306  1.00 27.02  ? 292 ASN C C     1 
ATOM   7403  O O     . ASN C  1 264 ? -21.473 -22.633 50.537  1.00 25.32  ? 292 ASN C O     1 
ATOM   7404  C CB    . ASN C  1 264 ? -23.622 -23.049 48.015  1.00 27.63  ? 292 ASN C CB    1 
ATOM   7405  C CG    . ASN C  1 264 ? -24.818 -23.431 48.809  1.00 53.97  ? 292 ASN C CG    1 
ATOM   7406  O OD1   . ASN C  1 264 ? -25.812 -22.699 48.811  1.00 63.98  ? 292 ASN C OD1   1 
ATOM   7407  N ND2   . ASN C  1 264 ? -24.734 -24.557 49.527  1.00 47.12  ? 292 ASN C ND2   1 
ATOM   7408  N N     . TYR C  1 265 ? -20.593 -22.735 48.464  1.00 22.70  ? 293 TYR C N     1 
ATOM   7409  C CA    . TYR C  1 265 ? -19.321 -23.201 48.967  1.00 23.64  ? 293 TYR C CA    1 
ATOM   7410  C C     . TYR C  1 265 ? -18.703 -22.206 49.938  1.00 25.50  ? 293 TYR C C     1 
ATOM   7411  O O     . TYR C  1 265 ? -18.425 -22.553 51.082  1.00 23.58  ? 293 TYR C O     1 
ATOM   7412  C CB    . TYR C  1 265 ? -18.337 -23.493 47.852  1.00 20.94  ? 293 TYR C CB    1 
ATOM   7413  C CG    . TYR C  1 265 ? -17.148 -24.241 48.370  1.00 20.51  ? 293 TYR C CG    1 
ATOM   7414  C CD1   . TYR C  1 265 ? -17.255 -25.588 48.690  1.00 28.75  ? 293 TYR C CD1   1 
ATOM   7415  C CD2   . TYR C  1 265 ? -15.911 -23.609 48.545  1.00 23.33  ? 293 TYR C CD2   1 
ATOM   7416  C CE1   . TYR C  1 265 ? -16.188 -26.285 49.198  1.00 23.06  ? 293 TYR C CE1   1 
ATOM   7417  C CE2   . TYR C  1 265 ? -14.827 -24.306 49.049  1.00 25.21  ? 293 TYR C CE2   1 
ATOM   7418  C CZ    . TYR C  1 265 ? -14.977 -25.645 49.368  1.00 32.60  ? 293 TYR C CZ    1 
ATOM   7419  O OH    . TYR C  1 265 ? -13.923 -26.359 49.849  1.00 22.02  ? 293 TYR C OH    1 
ATOM   7420  N N     . ALA C  1 266 ? -18.508 -20.977 49.462  1.00 25.89  ? 294 ALA C N     1 
ATOM   7421  C CA    . ALA C  1 266 ? -17.858 -19.920 50.210  1.00 24.17  ? 294 ALA C CA    1 
ATOM   7422  C C     . ALA C  1 266 ? -18.577 -19.519 51.512  1.00 24.63  ? 294 ALA C C     1 
ATOM   7423  O O     . ALA C  1 266 ? -17.947 -19.065 52.456  1.00 23.62  ? 294 ALA C O     1 
ATOM   7424  C CB    . ALA C  1 266 ? -17.698 -18.720 49.319  1.00 21.58  ? 294 ALA C CB    1 
ATOM   7425  N N     . GLU C  1 267 ? -19.893 -19.698 51.557  1.00 22.01  ? 295 GLU C N     1 
ATOM   7426  C CA    . GLU C  1 267 ? -20.656 -19.463 52.767  1.00 28.77  ? 295 GLU C CA    1 
ATOM   7427  C C     . GLU C  1 267 ? -20.405 -20.512 53.844  1.00 29.75  ? 295 GLU C C     1 
ATOM   7428  O O     . GLU C  1 267 ? -20.546 -20.222 55.025  1.00 28.38  ? 295 GLU C O     1 
ATOM   7429  C CB    . GLU C  1 267 ? -22.154 -19.451 52.461  1.00 24.60  ? 295 GLU C CB    1 
ATOM   7430  C CG    . GLU C  1 267 ? -22.617 -18.228 51.698  1.00 33.88  ? 295 GLU C CG    1 
ATOM   7431  C CD    . GLU C  1 267 ? -22.853 -17.041 52.586  1.00 48.50  ? 295 GLU C CD    1 
ATOM   7432  O OE1   . GLU C  1 267 ? -21.865 -16.411 53.051  1.00 41.35  ? 295 GLU C OE1   1 
ATOM   7433  O OE2   . GLU C  1 267 ? -24.037 -16.736 52.801  1.00 51.96  ? 295 GLU C OE2   1 
ATOM   7434  N N     . ASN C  1 268 ? -20.054 -21.728 53.430  1.00 30.29  ? 296 ASN C N     1 
ATOM   7435  C CA    . ASN C  1 268 ? -19.913 -22.861 54.348  1.00 30.54  ? 296 ASN C CA    1 
ATOM   7436  C C     . ASN C  1 268 ? -18.470 -23.280 54.654  1.00 28.86  ? 296 ASN C C     1 
ATOM   7437  O O     . ASN C  1 268 ? -18.222 -23.892 55.688  1.00 33.37  ? 296 ASN C O     1 
ATOM   7438  C CB    . ASN C  1 268 ? -20.714 -24.036 53.812  1.00 29.89  ? 296 ASN C CB    1 
ATOM   7439  C CG    . ASN C  1 268 ? -22.207 -23.791 53.896  1.00 32.46  ? 296 ASN C CG    1 
ATOM   7440  O OD1   . ASN C  1 268 ? -22.782 -23.820 54.985  1.00 35.45  ? 296 ASN C OD1   1 
ATOM   7441  N ND2   . ASN C  1 268 ? -22.838 -23.516 52.755  1.00 35.31  ? 296 ASN C ND2   1 
ATOM   7442  N N     . ARG C  1 269 ? -17.543 -22.919 53.770  1.00 27.30  ? 297 ARG C N     1 
ATOM   7443  C CA    . ARG C  1 269 ? -16.114 -23.119 53.969  1.00 27.28  ? 297 ARG C CA    1 
ATOM   7444  C C     . ARG C  1 269 ? -15.526 -22.057 54.900  1.00 29.42  ? 297 ARG C C     1 
ATOM   7445  O O     . ARG C  1 269 ? -15.653 -20.872 54.654  1.00 27.71  ? 297 ARG C O     1 
ATOM   7446  C CB    . ARG C  1 269 ? -15.406 -23.091 52.605  1.00 27.80  ? 297 ARG C CB    1 
ATOM   7447  C CG    . ARG C  1 269 ? -13.913 -23.347 52.616  1.00 22.96  ? 297 ARG C CG    1 
ATOM   7448  C CD    . ARG C  1 269 ? -13.542 -24.730 53.069  1.00 21.84  ? 297 ARG C CD    1 
ATOM   7449  N NE    . ARG C  1 269 ? -12.113 -24.992 52.838  1.00 21.80  ? 297 ARG C NE    1 
ATOM   7450  C CZ    . ARG C  1 269 ? -11.520 -26.157 53.113  1.00 24.53  ? 297 ARG C CZ    1 
ATOM   7451  N NH1   . ARG C  1 269 ? -12.205 -27.151 53.682  1.00 26.19  ? 297 ARG C NH1   1 
ATOM   7452  N NH2   . ARG C  1 269 ? -10.233 -26.320 52.849  1.00 24.55  ? 297 ARG C NH2   1 
ATOM   7453  N N     . MET C  1 270 ? -14.842 -22.521 55.944  1.00 25.37  ? 298 MET C N     1 
ATOM   7454  C CA    . MET C  1 270 ? -14.245 -21.689 56.968  1.00 28.89  ? 298 MET C CA    1 
ATOM   7455  C C     . MET C  1 270 ? -12.783 -21.550 56.677  1.00 27.80  ? 298 MET C C     1 
ATOM   7456  O O     . MET C  1 270 ? -12.149 -22.492 56.226  1.00 32.83  ? 298 MET C O     1 
ATOM   7457  C CB    . MET C  1 270 ? -14.395 -22.356 58.330  1.00 31.97  ? 298 MET C CB    1 
ATOM   7458  C CG    . MET C  1 270 ? -15.816 -22.692 58.684  1.00 37.79  ? 298 MET C CG    1 
ATOM   7459  S SD    . MET C  1 270 ? -16.784 -21.204 58.960  1.00 47.33  ? 298 MET C SD    1 
ATOM   7460  C CE    . MET C  1 270 ? -15.886 -20.529 60.360  1.00 38.44  ? 298 MET C CE    1 
ATOM   7461  N N     . ALA C  1 271 ? -12.238 -20.375 56.908  1.00 28.85  ? 299 ALA C N     1 
ATOM   7462  C CA    . ALA C  1 271 ? -10.782 -20.188 56.774  1.00 31.52  ? 299 ALA C CA    1 
ATOM   7463  C C     . ALA C  1 271 ? -10.374 -19.034 57.657  1.00 33.72  ? 299 ALA C C     1 
ATOM   7464  O O     . ALA C  1 271 ? -11.142 -18.078 57.832  1.00 34.01  ? 299 ALA C O     1 
ATOM   7465  C CB    . ALA C  1 271 ? -10.381 -19.923 55.319  1.00 31.64  ? 299 ALA C CB    1 
ATOM   7466  N N     . PHE C  1 272 ? -9.186  -19.147 58.246  1.00 34.06  ? 300 PHE C N     1 
ATOM   7467  C CA    . PHE C  1 272 ? -8.695  -18.165 59.207  1.00 35.19  ? 300 PHE C CA    1 
ATOM   7468  C C     . PHE C  1 272 ? -9.775  -17.679 60.185  1.00 34.48  ? 300 PHE C C     1 
ATOM   7469  O O     . PHE C  1 272 ? -9.854  -16.484 60.469  1.00 39.39  ? 300 PHE C O     1 
ATOM   7470  C CB    . PHE C  1 272 ? -8.056  -16.980 58.462  1.00 34.74  ? 300 PHE C CB    1 
ATOM   7471  C CG    . PHE C  1 272 ? -6.879  -17.365 57.609  1.00 35.60  ? 300 PHE C CG    1 
ATOM   7472  C CD1   . PHE C  1 272 ? -5.593  -17.365 58.140  1.00 35.34  ? 300 PHE C CD1   1 
ATOM   7473  C CD2   . PHE C  1 272 ? -7.061  -17.737 56.272  1.00 36.91  ? 300 PHE C CD2   1 
ATOM   7474  C CE1   . PHE C  1 272 ? -4.476  -17.721 57.348  1.00 37.47  ? 300 PHE C CE1   1 
ATOM   7475  C CE2   . PHE C  1 272 ? -5.961  -18.103 55.465  1.00 37.92  ? 300 PHE C CE2   1 
ATOM   7476  C CZ    . PHE C  1 272 ? -4.656  -18.094 56.009  1.00 36.59  ? 300 PHE C CZ    1 
ATOM   7477  N N     . GLY C  1 273 ? -10.601 -18.605 60.680  1.00 32.46  ? 301 GLY C N     1 
ATOM   7478  C CA    . GLY C  1 273 ? -11.607 -18.320 61.704  1.00 34.20  ? 301 GLY C CA    1 
ATOM   7479  C C     . GLY C  1 273 ? -13.051 -18.069 61.292  1.00 36.88  ? 301 GLY C C     1 
ATOM   7480  O O     . GLY C  1 273 ? -13.915 -17.999 62.161  1.00 40.86  ? 301 GLY C O     1 
ATOM   7481  N N     . ALA C  1 274 ? -13.338 -17.939 59.990  1.00 36.53  ? 302 ALA C N     1 
ATOM   7482  C CA    . ALA C  1 274 ? -14.694 -17.526 59.527  1.00 31.39  ? 302 ALA C CA    1 
ATOM   7483  C C     . ALA C  1 274 ? -15.022 -18.014 58.098  1.00 27.72  ? 302 ALA C C     1 
ATOM   7484  O O     . ALA C  1 274 ? -14.134 -18.461 57.373  1.00 27.09  ? 302 ALA C O     1 
ATOM   7485  C CB    . ALA C  1 274 ? -14.815 -15.979 59.596  1.00 28.37  ? 302 ALA C CB    1 
ATOM   7486  N N     . PRO C  1 275 ? -16.296 -17.897 57.669  1.00 26.12  ? 303 PRO C N     1 
ATOM   7487  C CA    . PRO C  1 275 ? -16.643 -18.236 56.275  1.00 26.19  ? 303 PRO C CA    1 
ATOM   7488  C C     . PRO C  1 275 ? -15.789 -17.470 55.277  1.00 26.21  ? 303 PRO C C     1 
ATOM   7489  O O     . PRO C  1 275 ? -15.331 -16.352 55.577  1.00 27.60  ? 303 PRO C O     1 
ATOM   7490  C CB    . PRO C  1 275 ? -18.111 -17.817 56.146  1.00 26.71  ? 303 PRO C CB    1 
ATOM   7491  C CG    . PRO C  1 275 ? -18.622 -17.801 57.572  1.00 29.36  ? 303 PRO C CG    1 
ATOM   7492  C CD    . PRO C  1 275 ? -17.468 -17.466 58.454  1.00 30.85  ? 303 PRO C CD    1 
ATOM   7493  N N     . LEU C  1 276 ? -15.539 -18.067 54.119  1.00 25.30  ? 304 LEU C N     1 
ATOM   7494  C CA    . LEU C  1 276 ? -14.777 -17.370 53.060  1.00 26.35  ? 304 LEU C CA    1 
ATOM   7495  C C     . LEU C  1 276 ? -15.457 -16.048 52.657  1.00 21.03  ? 304 LEU C C     1 
ATOM   7496  O O     . LEU C  1 276 ? -14.803 -15.086 52.341  1.00 20.24  ? 304 LEU C O     1 
ATOM   7497  C CB    . LEU C  1 276 ? -14.562 -18.257 51.834  1.00 24.42  ? 304 LEU C CB    1 
ATOM   7498  C CG    . LEU C  1 276 ? -13.662 -19.505 51.922  1.00 19.17  ? 304 LEU C CG    1 
ATOM   7499  C CD1   . LEU C  1 276 ? -13.667 -20.159 50.545  1.00 24.95  ? 304 LEU C CD1   1 
ATOM   7500  C CD2   . LEU C  1 276 ? -12.195 -19.222 52.404  1.00 25.93  ? 304 LEU C CD2   1 
ATOM   7501  N N     . THR C  1 277 ? -16.781 -15.997 52.759  1.00 22.27  ? 305 THR C N     1 
ATOM   7502  C CA    . THR C  1 277 ? -17.543 -14.789 52.420  1.00 29.44  ? 305 THR C CA    1 
ATOM   7503  C C     . THR C  1 277 ? -17.338 -13.575 53.363  1.00 30.22  ? 305 THR C C     1 
ATOM   7504  O O     . THR C  1 277 ? -17.889 -12.498 53.103  1.00 30.14  ? 305 THR C O     1 
ATOM   7505  C CB    . THR C  1 277 ? -19.052 -15.124 52.337  1.00 25.98  ? 305 THR C CB    1 
ATOM   7506  O OG1   . THR C  1 277 ? -19.441 -15.804 53.532  1.00 30.72  ? 305 THR C OG1   1 
ATOM   7507  C CG2   . THR C  1 277 ? -19.334 -16.018 51.143  1.00 28.60  ? 305 THR C CG2   1 
ATOM   7508  N N     . LYS C  1 278 ? -16.589 -13.761 54.453  1.00 26.44  ? 306 LYS C N     1 
ATOM   7509  C CA    . LYS C  1 278 ? -16.094 -12.652 55.288  1.00 30.07  ? 306 LYS C CA    1 
ATOM   7510  C C     . LYS C  1 278 ? -14.827 -11.998 54.720  1.00 26.97  ? 306 LYS C C     1 
ATOM   7511  O O     . LYS C  1 278 ? -14.498 -10.874 55.071  1.00 30.21  ? 306 LYS C O     1 
ATOM   7512  C CB    . LYS C  1 278 ? -15.833 -13.115 56.734  1.00 29.55  ? 306 LYS C CB    1 
ATOM   7513  C CG    . LYS C  1 278 ? -17.104 -13.503 57.499  1.00 35.26  ? 306 LYS C CG    1 
ATOM   7514  N N     . LEU C  1 279 ? -14.106 -12.702 53.867  1.00 24.08  ? 307 LEU C N     1 
ATOM   7515  C CA    . LEU C  1 279 ? -12.948 -12.131 53.190  1.00 26.55  ? 307 LEU C CA    1 
ATOM   7516  C C     . LEU C  1 279 ? -13.361 -11.166 52.064  1.00 23.20  ? 307 LEU C C     1 
ATOM   7517  O O     . LEU C  1 279 ? -14.090 -11.549 51.157  1.00 24.04  ? 307 LEU C O     1 
ATOM   7518  C CB    . LEU C  1 279 ? -12.076 -13.243 52.586  1.00 26.81  ? 307 LEU C CB    1 
ATOM   7519  C CG    . LEU C  1 279 ? -11.540 -14.330 53.537  1.00 26.31  ? 307 LEU C CG    1 
ATOM   7520  C CD1   . LEU C  1 279 ? -10.820 -15.395 52.705  1.00 23.50  ? 307 LEU C CD1   1 
ATOM   7521  C CD2   . LEU C  1 279 ? -10.628 -13.731 54.574  1.00 25.99  ? 307 LEU C CD2   1 
ATOM   7522  N N     . GLN C  1 280 ? -12.835 -9.945  52.128  1.00 25.24  ? 308 GLN C N     1 
ATOM   7523  C CA    . GLN C  1 280 ? -13.053 -8.899  51.115  1.00 30.96  ? 308 GLN C CA    1 
ATOM   7524  C C     . GLN C  1 280 ? -12.838 -9.348  49.683  1.00 25.04  ? 308 GLN C C     1 
ATOM   7525  O O     . GLN C  1 280 ? -13.657 -9.055  48.806  1.00 20.83  ? 308 GLN C O     1 
ATOM   7526  C CB    . GLN C  1 280 ? -12.094 -7.720  51.349  1.00 33.86  ? 308 GLN C CB    1 
ATOM   7527  C CG    . GLN C  1 280 ? -12.573 -6.735  52.356  1.00 45.14  ? 308 GLN C CG    1 
ATOM   7528  C CD    . GLN C  1 280 ? -11.902 -5.387  52.210  1.00 47.71  ? 308 GLN C CD    1 
ATOM   7529  O OE1   . GLN C  1 280 ? -10.703 -5.274  51.881  1.00 32.87  ? 308 GLN C OE1   1 
ATOM   7530  N NE2   . GLN C  1 280 ? -12.676 -4.349  52.464  1.00 28.52  ? 308 GLN C NE2   1 
ATOM   7531  N N     . VAL C  1 281 ? -11.711 -10.004 49.442  1.00 26.44  ? 309 VAL C N     1 
ATOM   7532  C CA    . VAL C  1 281 ? -11.356 -10.429 48.093  1.00 26.84  ? 309 VAL C CA    1 
ATOM   7533  C C     . VAL C  1 281 ? -12.393 -11.408 47.534  1.00 24.39  ? 309 VAL C C     1 
ATOM   7534  O O     . VAL C  1 281 ? -12.735 -11.362 46.343  1.00 24.65  ? 309 VAL C O     1 
ATOM   7535  C CB    . VAL C  1 281 ? -9.943  -11.072 48.028  1.00 32.10  ? 309 VAL C CB    1 
ATOM   7536  C CG1   . VAL C  1 281 ? -8.881  -10.088 48.524  1.00 37.94  ? 309 VAL C CG1   1 
ATOM   7537  C CG2   . VAL C  1 281 ? -9.908  -12.358 48.810  1.00 37.37  ? 309 VAL C CG2   1 
ATOM   7538  N N     . ILE C  1 282 ? -12.898 -12.289 48.388  1.00 23.77  ? 310 ILE C N     1 
ATOM   7539  C CA    . ILE C  1 282 ? -13.970 -13.225 47.975  1.00 23.28  ? 310 ILE C CA    1 
ATOM   7540  C C     . ILE C  1 282 ? -15.264 -12.483 47.604  1.00 23.98  ? 310 ILE C C     1 
ATOM   7541  O O     . ILE C  1 282 ? -15.921 -12.816 46.593  1.00 25.23  ? 310 ILE C O     1 
ATOM   7542  C CB    . ILE C  1 282 ? -14.232 -14.282 49.061  1.00 20.06  ? 310 ILE C CB    1 
ATOM   7543  C CG1   . ILE C  1 282 ? -12.975 -15.162 49.265  1.00 24.00  ? 310 ILE C CG1   1 
ATOM   7544  C CG2   . ILE C  1 282 ? -15.459 -15.138 48.730  1.00 21.38  ? 310 ILE C CG2   1 
ATOM   7545  C CD1   . ILE C  1 282 ? -12.601 -16.033 48.060  1.00 20.07  ? 310 ILE C CD1   1 
ATOM   7546  N N     . GLN C  1 283 ? -15.612 -11.478 48.402  1.00 23.32  ? 311 GLN C N     1 
ATOM   7547  C CA    . GLN C  1 283 ? -16.817 -10.670 48.155  1.00 25.15  ? 311 GLN C CA    1 
ATOM   7548  C C     . GLN C  1 283 ? -16.726 -9.954  46.813  1.00 24.69  ? 311 GLN C C     1 
ATOM   7549  O O     . GLN C  1 283 ? -17.698 -9.884  46.059  1.00 19.21  ? 311 GLN C O     1 
ATOM   7550  C CB    . GLN C  1 283 ? -17.018 -9.644  49.277  1.00 24.02  ? 311 GLN C CB    1 
ATOM   7551  C CG    . GLN C  1 283 ? -17.477 -10.248 50.617  1.00 24.48  ? 311 GLN C CG    1 
ATOM   7552  C CD    . GLN C  1 283 ? -17.297 -9.274  51.784  1.00 32.26  ? 311 GLN C CD    1 
ATOM   7553  O OE1   . GLN C  1 283 ? -17.198 -8.072  51.582  1.00 35.98  ? 311 GLN C OE1   1 
ATOM   7554  N NE2   . GLN C  1 283 ? -17.249 -9.797  53.001  1.00 33.62  ? 311 GLN C NE2   1 
ATOM   7555  N N     . PHE C  1 284 ? -15.547 -9.414  46.541  1.00 18.33  ? 312 PHE C N     1 
ATOM   7556  C CA    . PHE C  1 284 ? -15.200 -8.783  45.265  1.00 22.37  ? 312 PHE C CA    1 
ATOM   7557  C C     . PHE C  1 284 ? -15.284 -9.701  44.044  1.00 23.49  ? 312 PHE C C     1 
ATOM   7558  O O     . PHE C  1 284 ? -15.804 -9.286  43.020  1.00 19.70  ? 312 PHE C O     1 
ATOM   7559  C CB    . PHE C  1 284 ? -13.770 -8.225  45.314  1.00 20.98  ? 312 PHE C CB    1 
ATOM   7560  C CG    . PHE C  1 284 ? -13.667 -6.805  45.813  1.00 24.86  ? 312 PHE C CG    1 
ATOM   7561  C CD1   . PHE C  1 284 ? -14.368 -6.385  46.937  1.00 34.81  ? 312 PHE C CD1   1 
ATOM   7562  C CD2   . PHE C  1 284 ? -12.832 -5.889  45.168  1.00 35.30  ? 312 PHE C CD2   1 
ATOM   7563  C CE1   . PHE C  1 284 ? -14.253 -5.071  47.414  1.00 37.73  ? 312 PHE C CE1   1 
ATOM   7564  C CE2   . PHE C  1 284 ? -12.715 -4.576  45.636  1.00 33.95  ? 312 PHE C CE2   1 
ATOM   7565  C CZ    . PHE C  1 284 ? -13.438 -4.176  46.767  1.00 26.84  ? 312 PHE C CZ    1 
ATOM   7566  N N     . LYS C  1 285 ? -14.700 -10.903 44.139  1.00 24.09  ? 313 LYS C N     1 
ATOM   7567  C CA    . LYS C  1 285 ? -14.848 -11.945 43.114  1.00 24.27  ? 313 LYS C CA    1 
ATOM   7568  C C     . LYS C  1 285 ? -16.342 -12.158 42.824  1.00 21.66  ? 313 LYS C C     1 
ATOM   7569  O O     . LYS C  1 285 ? -16.802 -12.091 41.672  1.00 20.86  ? 313 LYS C O     1 
ATOM   7570  C CB    . LYS C  1 285 ? -14.247 -13.276 43.577  1.00 19.52  ? 313 LYS C CB    1 
ATOM   7571  C CG    . LYS C  1 285 ? -12.720 -13.345 43.581  1.00 26.51  ? 313 LYS C CG    1 
ATOM   7572  C CD    . LYS C  1 285 ? -12.245 -14.717 44.088  1.00 24.84  ? 313 LYS C CD    1 
ATOM   7573  C CE    . LYS C  1 285 ? -10.734 -14.749 44.292  1.00 33.55  ? 313 LYS C CE    1 
ATOM   7574  N NZ    . LYS C  1 285 ? -10.048 -14.368 43.046  1.00 30.71  ? 313 LYS C NZ    1 
ATOM   7575  N N     . LEU C  1 286 ? -17.079 -12.398 43.882  1.00 20.97  ? 314 LEU C N     1 
ATOM   7576  C CA    . LEU C  1 286 ? -18.495 -12.681 43.755  1.00 21.22  ? 314 LEU C CA    1 
ATOM   7577  C C     . LEU C  1 286 ? -19.274 -11.500 43.171  1.00 22.73  ? 314 LEU C C     1 
ATOM   7578  O O     . LEU C  1 286 ? -20.215 -11.705 42.399  1.00 22.11  ? 314 LEU C O     1 
ATOM   7579  C CB    . LEU C  1 286 ? -19.073 -13.088 45.103  1.00 21.33  ? 314 LEU C CB    1 
ATOM   7580  C CG    . LEU C  1 286 ? -18.671 -14.458 45.665  1.00 20.59  ? 314 LEU C CG    1 
ATOM   7581  C CD1   . LEU C  1 286 ? -19.322 -14.622 47.063  1.00 27.33  ? 314 LEU C CD1   1 
ATOM   7582  C CD2   . LEU C  1 286 ? -19.081 -15.600 44.753  1.00 20.40  ? 314 LEU C CD2   1 
ATOM   7583  N N     . ALA C  1 287 ? -18.910 -10.274 43.548  1.00 24.87  ? 315 ALA C N     1 
ATOM   7584  C CA    . ALA C  1 287 ? -19.626 -9.094  43.047  1.00 25.14  ? 315 ALA C CA    1 
ATOM   7585  C C     . ALA C  1 287 ? -19.363 -8.941  41.549  1.00 22.66  ? 315 ALA C C     1 
ATOM   7586  O O     . ALA C  1 287 ? -20.282 -8.693  40.777  1.00 20.79  ? 315 ALA C O     1 
ATOM   7587  C CB    . ALA C  1 287 ? -19.272 -7.798  43.861  1.00 21.94  ? 315 ALA C CB    1 
ATOM   7588  N N     . ASP C  1 288 ? -18.115 -9.136  41.135  1.00 19.00  ? 316 ASP C N     1 
ATOM   7589  C CA    . ASP C  1 288 ? -17.764 -9.088  39.715  1.00 23.70  ? 316 ASP C CA    1 
ATOM   7590  C C     . ASP C  1 288 ? -18.455 -10.180 38.883  1.00 22.96  ? 316 ASP C C     1 
ATOM   7591  O O     . ASP C  1 288 ? -18.966 -9.928  37.784  1.00 18.50  ? 316 ASP C O     1 
ATOM   7592  C CB    . ASP C  1 288 ? -16.255 -9.154  39.546  1.00 24.25  ? 316 ASP C CB    1 
ATOM   7593  C CG    . ASP C  1 288 ? -15.582 -7.872  40.006  1.00 37.71  ? 316 ASP C CG    1 
ATOM   7594  O OD1   . ASP C  1 288 ? -16.316 -6.906  40.276  1.00 38.92  ? 316 ASP C OD1   1 
ATOM   7595  O OD2   . ASP C  1 288 ? -14.347 -7.831  40.118  1.00 33.81  ? 316 ASP C OD2   1 
ATOM   7596  N N     . MET C  1 289 ? -18.521 -11.370 39.453  1.00 23.59  ? 317 MET C N     1 
ATOM   7597  C CA    . MET C  1 289 ? -19.270 -12.475 38.866  1.00 22.23  ? 317 MET C CA    1 
ATOM   7598  C C     . MET C  1 289 ? -20.732 -12.112 38.653  1.00 23.78  ? 317 MET C C     1 
ATOM   7599  O O     . MET C  1 289 ? -21.259 -12.272 37.542  1.00 18.97  ? 317 MET C O     1 
ATOM   7600  C CB    . MET C  1 289 ? -19.132 -13.724 39.731  1.00 18.22  ? 317 MET C CB    1 
ATOM   7601  C CG    . MET C  1 289 ? -17.710 -14.309 39.703  1.00 27.03  ? 317 MET C CG    1 
ATOM   7602  S SD    . MET C  1 289 ? -17.417 -15.379 41.137  1.00 26.75  ? 317 MET C SD    1 
ATOM   7603  C CE    . MET C  1 289 ? -18.242 -16.882 40.563  1.00 21.22  ? 317 MET C CE    1 
ATOM   7604  N N     . ALA C  1 290 ? -21.370 -11.594 39.701  1.00 22.68  ? 318 ALA C N     1 
ATOM   7605  C CA    . ALA C  1 290 ? -22.773 -11.188 39.616  1.00 22.47  ? 318 ALA C CA    1 
ATOM   7606  C C     . ALA C  1 290 ? -23.008 -10.046 38.596  1.00 24.36  ? 318 ALA C C     1 
ATOM   7607  O O     . ALA C  1 290 ? -23.977 -10.068 37.837  1.00 20.77  ? 318 ALA C O     1 
ATOM   7608  C CB    . ALA C  1 290 ? -23.297 -10.800 40.976  1.00 22.39  ? 318 ALA C CB    1 
ATOM   7609  N N     . LEU C  1 291 ? -22.119 -9.063  38.581  1.00 22.11  ? 319 LEU C N     1 
ATOM   7610  C CA    . LEU C  1 291 ? -22.203 -7.967  37.623  1.00 22.72  ? 319 LEU C CA    1 
ATOM   7611  C C     . LEU C  1 291 ? -22.104 -8.484  36.190  1.00 22.16  ? 319 LEU C C     1 
ATOM   7612  O O     . LEU C  1 291 ? -22.946 -8.141  35.352  1.00 23.82  ? 319 LEU C O     1 
ATOM   7613  C CB    . LEU C  1 291 ? -21.099 -6.912  37.871  1.00 24.35  ? 319 LEU C CB    1 
ATOM   7614  C CG    . LEU C  1 291 ? -21.172 -5.639  36.984  1.00 30.28  ? 319 LEU C CG    1 
ATOM   7615  C CD1   . LEU C  1 291 ? -22.564 -5.060  37.015  1.00 33.33  ? 319 LEU C CD1   1 
ATOM   7616  C CD2   . LEU C  1 291 ? -20.196 -4.549  37.409  1.00 30.49  ? 319 LEU C CD2   1 
ATOM   7617  N N     . ALA C  1 292 ? -21.099 -9.313  35.904  1.00 22.10  ? 320 ALA C N     1 
ATOM   7618  C CA    . ALA C  1 292 ? -20.930 -9.819  34.541  1.00 24.38  ? 320 ALA C CA    1 
ATOM   7619  C C     . ALA C  1 292 ? -22.137 -10.619 34.061  1.00 23.04  ? 320 ALA C C     1 
ATOM   7620  O O     . ALA C  1 292 ? -22.482 -10.555 32.884  1.00 25.01  ? 320 ALA C O     1 
ATOM   7621  C CB    . ALA C  1 292 ? -19.627 -10.635 34.381  1.00 19.07  ? 320 ALA C CB    1 
ATOM   7622  N N     . LEU C  1 293 ? -22.786 -11.333 34.978  1.00 22.48  ? 321 LEU C N     1 
ATOM   7623  C CA    . LEU C  1 293 ? -23.834 -12.251 34.637  1.00 20.83  ? 321 LEU C CA    1 
ATOM   7624  C C     . LEU C  1 293 ? -25.144 -11.501 34.380  1.00 23.65  ? 321 LEU C C     1 
ATOM   7625  O O     . LEU C  1 293 ? -25.850 -11.787 33.398  1.00 18.15  ? 321 LEU C O     1 
ATOM   7626  C CB    . LEU C  1 293 ? -24.023 -13.276 35.756  1.00 23.11  ? 321 LEU C CB    1 
ATOM   7627  C CG    . LEU C  1 293 ? -25.224 -14.243 35.697  1.00 21.70  ? 321 LEU C CG    1 
ATOM   7628  C CD1   . LEU C  1 293 ? -25.246 -14.941 34.334  1.00 20.97  ? 321 LEU C CD1   1 
ATOM   7629  C CD2   . LEU C  1 293 ? -25.139 -15.253 36.823  1.00 23.91  ? 321 LEU C CD2   1 
ATOM   7630  N N     . GLU C  1 294 ? -25.429 -10.540 35.248  1.00 18.99  ? 322 GLU C N     1 
ATOM   7631  C CA    . GLU C  1 294 ? -26.681 -9.783  35.183  1.00 28.83  ? 322 GLU C CA    1 
ATOM   7632  C C     . GLU C  1 294 ? -26.671 -8.871  33.954  1.00 24.43  ? 322 GLU C C     1 
ATOM   7633  O O     . GLU C  1 294 ? -27.669 -8.721  33.262  1.00 21.68  ? 322 GLU C O     1 
ATOM   7634  C CB    . GLU C  1 294 ? -26.905 -9.036  36.514  1.00 27.73  ? 322 GLU C CB    1 
ATOM   7635  C CG    . GLU C  1 294 ? -27.170 -10.054 37.669  1.00 38.81  ? 322 GLU C CG    1 
ATOM   7636  C CD    . GLU C  1 294 ? -27.607 -9.477  39.025  1.00 38.43  ? 322 GLU C CD    1 
ATOM   7637  O OE1   . GLU C  1 294 ? -28.417 -8.519  39.076  1.00 39.19  ? 322 GLU C OE1   1 
ATOM   7638  O OE2   . GLU C  1 294 ? -27.169 -10.035 40.060  1.00 37.88  ? 322 GLU C OE2   1 
ATOM   7639  N N     . SER C  1 295 ? -25.504 -8.301  33.684  1.00 20.93  ? 323 SER C N     1 
ATOM   7640  C CA    . SER C  1 295 ? -25.252 -7.505  32.512  1.00 21.21  ? 323 SER C CA    1 
ATOM   7641  C C     . SER C  1 295 ? -25.483 -8.308  31.203  1.00 22.08  ? 323 SER C C     1 
ATOM   7642  O O     . SER C  1 295 ? -26.097 -7.817  30.265  1.00 17.25  ? 323 SER C O     1 
ATOM   7643  C CB    . SER C  1 295 ? -23.783 -7.020  32.583  1.00 20.24  ? 323 SER C CB    1 
ATOM   7644  O OG    . SER C  1 295 ? -23.555 -6.015  31.646  1.00 35.01  ? 323 SER C OG    1 
ATOM   7645  N N     . ALA C  1 296 ? -24.943 -9.525  31.155  1.00 22.80  ? 324 ALA C N     1 
ATOM   7646  C CA    . ALA C  1 296 ? -25.064 -10.425 30.007  1.00 21.44  ? 324 ALA C CA    1 
ATOM   7647  C C     . ALA C  1 296 ? -26.527 -10.815 29.821  1.00 22.58  ? 324 ALA C C     1 
ATOM   7648  O O     . ALA C  1 296 ? -27.024 -10.857 28.705  1.00 19.47  ? 324 ALA C O     1 
ATOM   7649  C CB    . ALA C  1 296 ? -24.190 -11.682 30.211  1.00 17.31  ? 324 ALA C CB    1 
ATOM   7650  N N     . ARG C  1 297 ? -27.213 -11.020 30.928  1.00 21.42  ? 325 ARG C N     1 
ATOM   7651  C CA    . ARG C  1 297 ? -28.610 -11.380 30.887  1.00 22.22  ? 325 ARG C CA    1 
ATOM   7652  C C     . ARG C  1 297 ? -29.457 -10.280 30.245  1.00 21.34  ? 325 ARG C C     1 
ATOM   7653  O O     . ARG C  1 297 ? -30.279 -10.567 29.361  1.00 23.14  ? 325 ARG C O     1 
ATOM   7654  C CB    . ARG C  1 297 ? -29.136 -11.725 32.267  1.00 21.59  ? 325 ARG C CB    1 
ATOM   7655  C CG    . ARG C  1 297 ? -30.609 -12.213 32.212  1.00 17.90  ? 325 ARG C CG    1 
ATOM   7656  C CD    . ARG C  1 297 ? -31.152 -12.749 33.528  1.00 24.65  ? 325 ARG C CD    1 
ATOM   7657  N NE    . ARG C  1 297 ? -30.447 -13.950 33.985  1.00 28.42  ? 325 ARG C NE    1 
ATOM   7658  C CZ    . ARG C  1 297 ? -29.535 -13.995 34.965  1.00 25.21  ? 325 ARG C CZ    1 
ATOM   7659  N NH1   . ARG C  1 297 ? -29.174 -12.904 35.625  1.00 23.83  ? 325 ARG C NH1   1 
ATOM   7660  N NH2   . ARG C  1 297 ? -28.990 -15.152 35.310  1.00 28.47  ? 325 ARG C NH2   1 
ATOM   7661  N N     . LEU C  1 298 ? -29.276 -9.039  30.689  1.00 21.45  ? 326 LEU C N     1 
ATOM   7662  C CA    . LEU C  1 298 ? -30.056 -7.920  30.124  1.00 23.17  ? 326 LEU C CA    1 
ATOM   7663  C C     . LEU C  1 298 ? -29.807 -7.763  28.616  1.00 22.70  ? 326 LEU C C     1 
ATOM   7664  O O     . LEU C  1 298 ? -30.721 -7.507  27.886  1.00 16.62  ? 326 LEU C O     1 
ATOM   7665  C CB    . LEU C  1 298 ? -29.753 -6.598  30.843  1.00 19.65  ? 326 LEU C CB    1 
ATOM   7666  C CG    . LEU C  1 298 ? -30.099 -6.494  32.324  1.00 23.79  ? 326 LEU C CG    1 
ATOM   7667  C CD1   . LEU C  1 298 ? -29.502 -5.223  32.886  1.00 22.58  ? 326 LEU C CD1   1 
ATOM   7668  C CD2   . LEU C  1 298 ? -31.630 -6.518  32.536  1.00 25.66  ? 326 LEU C CD2   1 
ATOM   7669  N N     . LEU C  1 299 ? -28.562 -7.906  28.166  1.00 19.02  ? 327 LEU C N     1 
ATOM   7670  C CA    . LEU C  1 299 ? -28.237 -7.910  26.747  1.00 20.19  ? 327 LEU C CA    1 
ATOM   7671  C C     . LEU C  1 299 ? -28.955 -9.020  25.990  1.00 22.70  ? 327 LEU C C     1 
ATOM   7672  O O     . LEU C  1 299 ? -29.337 -8.835  24.829  1.00 20.74  ? 327 LEU C O     1 
ATOM   7673  C CB    . LEU C  1 299 ? -26.733 -8.099  26.515  1.00 13.84  ? 327 LEU C CB    1 
ATOM   7674  C CG    . LEU C  1 299 ? -25.814 -6.917  26.856  1.00 20.64  ? 327 LEU C CG    1 
ATOM   7675  C CD1   . LEU C  1 299 ? -24.373 -7.369  26.713  1.00 17.69  ? 327 LEU C CD1   1 
ATOM   7676  C CD2   . LEU C  1 299 ? -26.129 -5.704  25.976  1.00 22.04  ? 327 LEU C CD2   1 
ATOM   7677  N N     . THR C  1 300 ? -29.108 -10.179 26.632  1.00 20.39  ? 328 THR C N     1 
ATOM   7678  C CA    . THR C  1 300 ? -29.778 -11.303 26.006  1.00 22.60  ? 328 THR C CA    1 
ATOM   7679  C C     . THR C  1 300 ? -31.251 -11.036 25.848  1.00 23.43  ? 328 THR C C     1 
ATOM   7680  O O     . THR C  1 300 ? -31.818 -11.276 24.773  1.00 21.40  ? 328 THR C O     1 
ATOM   7681  C CB    . THR C  1 300 ? -29.568 -12.588 26.805  1.00 25.40  ? 328 THR C CB    1 
ATOM   7682  O OG1   . THR C  1 300 ? -28.163 -12.889 26.788  1.00 18.55  ? 328 THR C OG1   1 
ATOM   7683  C CG2   . THR C  1 300 ? -30.358 -13.754 26.191  1.00 23.54  ? 328 THR C CG2   1 
ATOM   7684  N N     . TRP C  1 301 ? -31.864 -10.578 26.926  1.00 24.76  ? 329 TRP C N     1 
ATOM   7685  C CA    . TRP C  1 301 ? -33.302 -10.262 26.916  1.00 19.40  ? 329 TRP C CA    1 
ATOM   7686  C C     . TRP C  1 301 ? -33.633 -9.149  25.935  1.00 20.50  ? 329 TRP C C     1 
ATOM   7687  O O     . TRP C  1 301 ? -34.673 -9.199  25.285  1.00 25.36  ? 329 TRP C O     1 
ATOM   7688  C CB    . TRP C  1 301 ? -33.749 -9.886  28.308  1.00 20.97  ? 329 TRP C CB    1 
ATOM   7689  C CG    . TRP C  1 301 ? -33.835 -11.073 29.255  1.00 31.04  ? 329 TRP C CG    1 
ATOM   7690  C CD1   . TRP C  1 301 ? -33.360 -12.347 29.036  1.00 31.60  ? 329 TRP C CD1   1 
ATOM   7691  C CD2   . TRP C  1 301 ? -34.440 -11.099 30.555  1.00 34.82  ? 329 TRP C CD2   1 
ATOM   7692  N NE1   . TRP C  1 301 ? -33.643 -13.148 30.106  1.00 32.72  ? 329 TRP C NE1   1 
ATOM   7693  C CE2   . TRP C  1 301 ? -34.294 -12.413 31.060  1.00 34.78  ? 329 TRP C CE2   1 
ATOM   7694  C CE3   . TRP C  1 301 ? -35.084 -10.142 31.347  1.00 34.08  ? 329 TRP C CE3   1 
ATOM   7695  C CZ2   . TRP C  1 301 ? -34.758 -12.789 32.327  1.00 33.65  ? 329 TRP C CZ2   1 
ATOM   7696  C CZ3   . TRP C  1 301 ? -35.551 -10.522 32.608  1.00 35.49  ? 329 TRP C CZ3   1 
ATOM   7697  C CH2   . TRP C  1 301 ? -35.383 -11.836 33.082  1.00 33.57  ? 329 TRP C CH2   1 
ATOM   7698  N N     . ARG C  1 302 ? -32.789 -8.120  25.872  1.00 21.91  ? 330 ARG C N     1 
ATOM   7699  C CA    . ARG C  1 302 ? -32.897 -7.090  24.821  1.00 23.85  ? 330 ARG C CA    1 
ATOM   7700  C C     . ARG C  1 302 ? -32.988 -7.696  23.394  1.00 23.56  ? 330 ARG C C     1 
ATOM   7701  O O     . ARG C  1 302 ? -33.931 -7.379  22.639  1.00 19.89  ? 330 ARG C O     1 
ATOM   7702  C CB    . ARG C  1 302 ? -31.747 -6.072  24.899  1.00 22.54  ? 330 ARG C CB    1 
ATOM   7703  C CG    . ARG C  1 302 ? -31.759 -5.093  23.693  1.00 19.05  ? 330 ARG C CG    1 
ATOM   7704  C CD    . ARG C  1 302 ? -30.773 -3.967  23.746  1.00 26.05  ? 330 ARG C CD    1 
ATOM   7705  N NE    . ARG C  1 302 ? -29.414 -4.426  23.482  1.00 22.43  ? 330 ARG C NE    1 
ATOM   7706  C CZ    . ARG C  1 302 ? -28.416 -3.645  23.081  1.00 29.77  ? 330 ARG C CZ    1 
ATOM   7707  N NH1   . ARG C  1 302 ? -28.608 -2.347  22.867  1.00 29.81  ? 330 ARG C NH1   1 
ATOM   7708  N NH2   . ARG C  1 302 ? -27.211 -4.169  22.879  1.00 26.78  ? 330 ARG C NH2   1 
ATOM   7709  N N     . ALA C  1 303 ? -32.026 -8.563  23.048  1.00 20.87  ? 331 ALA C N     1 
ATOM   7710  C CA    . ALA C  1 303 ? -31.957 -9.222  21.749  1.00 22.71  ? 331 ALA C CA    1 
ATOM   7711  C C     . ALA C  1 303 ? -33.204 -10.081 21.516  1.00 22.22  ? 331 ALA C C     1 
ATOM   7712  O O     . ALA C  1 303 ? -33.799 -10.036 20.428  1.00 25.67  ? 331 ALA C O     1 
ATOM   7713  C CB    . ALA C  1 303 ? -30.712 -10.075 21.615  1.00 15.98  ? 331 ALA C CB    1 
ATOM   7714  N N     . ALA C  1 304 ? -33.608 -10.837 22.532  1.00 23.19  ? 332 ALA C N     1 
ATOM   7715  C CA    . ALA C  1 304 ? -34.882 -11.600 22.460  1.00 24.16  ? 332 ALA C CA    1 
ATOM   7716  C C     . ALA C  1 304 ? -36.107 -10.727 22.180  1.00 27.19  ? 332 ALA C C     1 
ATOM   7717  O O     . ALA C  1 304 ? -36.957 -11.065 21.342  1.00 21.37  ? 332 ALA C O     1 
ATOM   7718  C CB    . ALA C  1 304 ? -35.118 -12.408 23.767  1.00 18.87  ? 332 ALA C CB    1 
ATOM   7719  N N     . MET C  1 305 ? -36.243 -9.641  22.925  1.00 30.61  ? 333 MET C N     1 
ATOM   7720  C CA    . MET C  1 305 ? -37.430 -8.791  22.802  1.00 28.65  ? 333 MET C CA    1 
ATOM   7721  C C     . MET C  1 305 ? -37.487 -8.058  21.447  1.00 28.94  ? 333 MET C C     1 
ATOM   7722  O O     . MET C  1 305 ? -38.563 -7.828  20.903  1.00 28.41  ? 333 MET C O     1 
ATOM   7723  C CB    . MET C  1 305 ? -37.488 -7.805  23.967  1.00 25.96  ? 333 MET C CB    1 
ATOM   7724  C CG    . MET C  1 305 ? -37.782 -8.467  25.325  1.00 39.24  ? 333 MET C CG    1 
ATOM   7725  S SD    . MET C  1 305 ? -37.512 -7.363  26.741  1.00 45.59  ? 333 MET C SD    1 
ATOM   7726  C CE    . MET C  1 305 ? -37.686 -8.471  28.141  1.00 46.88  ? 333 MET C CE    1 
ATOM   7727  N N     . LEU C  1 306 ? -36.330 -7.682  20.922  1.00 23.89  ? 334 LEU C N     1 
ATOM   7728  C CA    . LEU C  1 306 ? -36.230 -7.087  19.612  1.00 27.95  ? 334 LEU C CA    1 
ATOM   7729  C C     . LEU C  1 306 ? -36.709 -8.056  18.547  1.00 29.43  ? 334 LEU C C     1 
ATOM   7730  O O     . LEU C  1 306 ? -37.529 -7.687  17.705  1.00 30.31  ? 334 LEU C O     1 
ATOM   7731  C CB    . LEU C  1 306 ? -34.790 -6.669  19.302  1.00 25.54  ? 334 LEU C CB    1 
ATOM   7732  C CG    . LEU C  1 306 ? -34.290 -5.383  19.978  1.00 33.15  ? 334 LEU C CG    1 
ATOM   7733  C CD1   . LEU C  1 306 ? -32.788 -5.311  19.821  1.00 26.61  ? 334 LEU C CD1   1 
ATOM   7734  C CD2   . LEU C  1 306 ? -34.947 -4.085  19.455  1.00 26.73  ? 334 LEU C CD2   1 
ATOM   7735  N N     . LYS C  1 307 ? -36.194 -9.286  18.586  1.00 24.33  ? 335 LYS C N     1 
ATOM   7736  C CA    . LYS C  1 307 ? -36.625 -10.326 17.664  1.00 31.77  ? 335 LYS C CA    1 
ATOM   7737  C C     . LYS C  1 307 ? -38.151 -10.502 17.783  1.00 28.92  ? 335 LYS C C     1 
ATOM   7738  O O     . LYS C  1 307 ? -38.843 -10.512 16.760  1.00 34.06  ? 335 LYS C O     1 
ATOM   7739  C CB    . LYS C  1 307 ? -35.862 -11.648 17.893  1.00 27.22  ? 335 LYS C CB    1 
ATOM   7740  C CG    . LYS C  1 307 ? -36.631 -12.894 17.444  1.00 35.37  ? 335 LYS C CG    1 
ATOM   7741  C CD    . LYS C  1 307 ? -35.749 -13.933 16.795  1.00 46.55  ? 335 LYS C CD    1 
ATOM   7742  C CE    . LYS C  1 307 ? -36.513 -15.229 16.509  1.00 41.28  ? 335 LYS C CE    1 
ATOM   7743  N NZ    . LYS C  1 307 ? -37.966 -15.056 16.150  1.00 38.48  ? 335 LYS C NZ    1 
ATOM   7744  N N     . ASP C  1 308 ? -38.678 -10.589 19.008  1.00 29.62  ? 336 ASP C N     1 
ATOM   7745  C CA    . ASP C  1 308 ? -40.144 -10.756 19.223  1.00 28.78  ? 336 ASP C CA    1 
ATOM   7746  C C     . ASP C  1 308 ? -41.009 -9.579  18.737  1.00 34.16  ? 336 ASP C C     1 
ATOM   7747  O O     . ASP C  1 308 ? -42.230 -9.722  18.520  1.00 33.58  ? 336 ASP C O     1 
ATOM   7748  C CB    . ASP C  1 308 ? -40.471 -10.955 20.713  1.00 35.93  ? 336 ASP C CB    1 
ATOM   7749  C CG    . ASP C  1 308 ? -39.991 -12.305 21.269  1.00 39.97  ? 336 ASP C CG    1 
ATOM   7750  O OD1   . ASP C  1 308 ? -39.924 -13.269 20.473  1.00 42.12  ? 336 ASP C OD1   1 
ATOM   7751  O OD2   . ASP C  1 308 ? -39.718 -12.405 22.506  1.00 30.12  ? 336 ASP C OD2   1 
ATOM   7752  N N     . ASN C  1 309 ? -40.408 -8.405  18.623  1.00 34.51  ? 337 ASN C N     1 
ATOM   7753  C CA    . ASN C  1 309 ? -41.115 -7.232  18.122  1.00 32.21  ? 337 ASN C CA    1 
ATOM   7754  C C     . ASN C  1 309 ? -40.815 -6.925  16.666  1.00 31.97  ? 337 ASN C C     1 
ATOM   7755  O O     . ASN C  1 309 ? -41.080 -5.820  16.202  1.00 32.35  ? 337 ASN C O     1 
ATOM   7756  C CB    . ASN C  1 309 ? -40.847 -6.042  19.037  1.00 32.36  ? 337 ASN C CB    1 
ATOM   7757  C CG    . ASN C  1 309 ? -41.693 -6.103  20.286  1.00 44.57  ? 337 ASN C CG    1 
ATOM   7758  O OD1   . ASN C  1 309 ? -42.856 -5.684  20.280  1.00 54.64  ? 337 ASN C OD1   1 
ATOM   7759  N ND2   . ASN C  1 309 ? -41.136 -6.667  21.358  1.00 45.80  ? 337 ASN C ND2   1 
ATOM   7760  N N     . LYS C  1 310 ? -40.294 -7.934  15.963  1.00 30.16  ? 338 LYS C N     1 
ATOM   7761  C CA    . LYS C  1 310 ? -39.939 -7.872  14.541  1.00 34.37  ? 338 LYS C CA    1 
ATOM   7762  C C     . LYS C  1 310 ? -39.017 -6.675  14.222  1.00 35.81  ? 338 LYS C C     1 
ATOM   7763  O O     . LYS C  1 310 ? -39.105 -6.074  13.150  1.00 36.46  ? 338 LYS C O     1 
ATOM   7764  C CB    . LYS C  1 310 ? -41.214 -7.850  13.675  1.00 37.52  ? 338 LYS C CB    1 
ATOM   7765  C CG    . LYS C  1 310 ? -42.177 -9.014  13.943  1.00 39.49  ? 338 LYS C CG    1 
ATOM   7766  C CD    . LYS C  1 310 ? -41.975 -10.176 12.972  1.00 59.38  ? 338 LYS C CD    1 
ATOM   7767  C CE    . LYS C  1 310 ? -42.935 -11.340 13.258  1.00 54.52  ? 338 LYS C CE    1 
ATOM   7768  N NZ    . LYS C  1 310 ? -44.372 -10.952 13.147  1.00 59.07  ? 338 LYS C NZ    1 
ATOM   7769  N N     . LYS C  1 311 ? -38.142 -6.341  15.167  1.00 33.55  ? 339 LYS C N     1 
ATOM   7770  C CA    . LYS C  1 311 ? -37.145 -5.302  14.971  1.00 30.01  ? 339 LYS C CA    1 
ATOM   7771  C C     . LYS C  1 311 ? -35.810 -5.973  14.691  1.00 32.86  ? 339 LYS C C     1 
ATOM   7772  O O     . LYS C  1 311 ? -35.645 -7.149  15.024  1.00 34.53  ? 339 LYS C O     1 
ATOM   7773  C CB    . LYS C  1 311 ? -37.039 -4.422  16.215  1.00 28.59  ? 339 LYS C CB    1 
ATOM   7774  C CG    . LYS C  1 311 ? -38.361 -3.804  16.696  1.00 36.86  ? 339 LYS C CG    1 
ATOM   7775  C CD    . LYS C  1 311 ? -39.041 -2.977  15.595  1.00 42.97  ? 339 LYS C CD    1 
ATOM   7776  C CE    . LYS C  1 311 ? -39.893 -1.840  16.165  1.00 56.09  ? 339 LYS C CE    1 
ATOM   7777  N NZ    . LYS C  1 311 ? -40.712 -2.240  17.346  1.00 61.24  ? 339 LYS C NZ    1 
ATOM   7778  N N     . PRO C  1 312 ? -34.859 -5.235  14.071  1.00 31.55  ? 340 PRO C N     1 
ATOM   7779  C CA    . PRO C  1 312 ? -33.503 -5.758  13.819  1.00 32.96  ? 340 PRO C CA    1 
ATOM   7780  C C     . PRO C  1 312 ? -32.739 -6.044  15.102  1.00 27.17  ? 340 PRO C C     1 
ATOM   7781  O O     . PRO C  1 312 ? -32.860 -5.285  16.073  1.00 29.80  ? 340 PRO C O     1 
ATOM   7782  C CB    . PRO C  1 312 ? -32.813 -4.631  13.032  1.00 34.57  ? 340 PRO C CB    1 
ATOM   7783  C CG    . PRO C  1 312 ? -33.912 -3.751  12.535  1.00 34.84  ? 340 PRO C CG    1 
ATOM   7784  C CD    . PRO C  1 312 ? -35.019 -3.866  13.538  1.00 30.50  ? 340 PRO C CD    1 
ATOM   7785  N N     . PHE C  1 313 ? -31.965 -7.130  15.102  1.00 27.01  ? 341 PHE C N     1 
ATOM   7786  C CA    . PHE C  1 313 ? -31.300 -7.606  16.316  1.00 27.42  ? 341 PHE C CA    1 
ATOM   7787  C C     . PHE C  1 313 ? -29.931 -8.252  16.092  1.00 26.84  ? 341 PHE C C     1 
ATOM   7788  O O     . PHE C  1 313 ? -29.381 -8.877  17.006  1.00 26.09  ? 341 PHE C O     1 
ATOM   7789  C CB    . PHE C  1 313 ? -32.226 -8.550  17.096  1.00 29.66  ? 341 PHE C CB    1 
ATOM   7790  C CG    . PHE C  1 313 ? -32.587 -9.819  16.356  1.00 31.88  ? 341 PHE C CG    1 
ATOM   7791  C CD1   . PHE C  1 313 ? -31.783 -10.949 16.450  1.00 29.45  ? 341 PHE C CD1   1 
ATOM   7792  C CD2   . PHE C  1 313 ? -33.758 -9.898  15.601  1.00 27.70  ? 341 PHE C CD2   1 
ATOM   7793  C CE1   . PHE C  1 313 ? -32.124 -12.132 15.776  1.00 28.95  ? 341 PHE C CE1   1 
ATOM   7794  C CE2   . PHE C  1 313 ? -34.100 -11.097 14.916  1.00 26.04  ? 341 PHE C CE2   1 
ATOM   7795  C CZ    . PHE C  1 313 ? -33.274 -12.196 15.011  1.00 36.11  ? 341 PHE C CZ    1 
ATOM   7796  N N     . ILE C  1 314 ? -29.364 -8.057  14.908  1.00 26.28  ? 342 ILE C N     1 
ATOM   7797  C CA    . ILE C  1 314 ? -28.091 -8.686  14.546  1.00 26.04  ? 342 ILE C CA    1 
ATOM   7798  C C     . ILE C  1 314 ? -26.976 -8.263  15.510  1.00 27.34  ? 342 ILE C C     1 
ATOM   7799  O O     . ILE C  1 314 ? -26.219 -9.102  16.033  1.00 27.61  ? 342 ILE C O     1 
ATOM   7800  C CB    . ILE C  1 314 ? -27.654 -8.306  13.105  1.00 25.87  ? 342 ILE C CB    1 
ATOM   7801  C CG1   . ILE C  1 314 ? -28.700 -8.786  12.061  1.00 30.94  ? 342 ILE C CG1   1 
ATOM   7802  C CG2   . ILE C  1 314 ? -26.260 -8.881  12.801  1.00 23.25  ? 342 ILE C CG2   1 
ATOM   7803  C CD1   . ILE C  1 314 ? -28.460 -8.261  10.654  1.00 28.11  ? 342 ILE C CD1   1 
ATOM   7804  N N     . LYS C  1 315 ? -26.862 -6.957  15.723  1.00 24.20  ? 343 LYS C N     1 
ATOM   7805  C CA    . LYS C  1 315 ? -25.803 -6.411  16.581  1.00 27.70  ? 343 LYS C CA    1 
ATOM   7806  C C     . LYS C  1 315 ? -26.099 -6.867  17.998  1.00 22.21  ? 343 LYS C C     1 
ATOM   7807  O O     . LYS C  1 315 ? -25.211 -7.304  18.732  1.00 20.08  ? 343 LYS C O     1 
ATOM   7808  C CB    . LYS C  1 315 ? -25.761 -4.876  16.486  1.00 24.54  ? 343 LYS C CB    1 
ATOM   7809  C CG    . LYS C  1 315 ? -24.707 -4.213  17.383  1.00 28.20  ? 343 LYS C CG    1 
ATOM   7810  C CD    . LYS C  1 315 ? -24.956 -2.713  17.643  1.00 33.09  ? 343 LYS C CD    1 
ATOM   7811  C CE    . LYS C  1 315 ? -26.033 -2.499  18.717  1.00 44.10  ? 343 LYS C CE    1 
ATOM   7812  N NZ    . LYS C  1 315 ? -26.252 -1.044  19.029  1.00 40.63  ? 343 LYS C NZ    1 
ATOM   7813  N N     . GLU C  1 316 ? -27.373 -6.824  18.358  1.00 23.06  ? 344 GLU C N     1 
ATOM   7814  C CA    . GLU C  1 316 ? -27.778 -7.101  19.729  1.00 24.40  ? 344 GLU C CA    1 
ATOM   7815  C C     . GLU C  1 316 ? -27.560 -8.565  20.143  1.00 25.40  ? 344 GLU C C     1 
ATOM   7816  O O     . GLU C  1 316 ? -27.255 -8.836  21.312  1.00 25.92  ? 344 GLU C O     1 
ATOM   7817  C CB    . GLU C  1 316 ? -29.250 -6.686  19.957  1.00 22.26  ? 344 GLU C CB    1 
ATOM   7818  C CG    . GLU C  1 316 ? -29.469 -5.156  19.922  1.00 26.92  ? 344 GLU C CG    1 
ATOM   7819  C CD    . GLU C  1 316 ? -29.523 -4.551  18.504  1.00 39.72  ? 344 GLU C CD    1 
ATOM   7820  O OE1   . GLU C  1 316 ? -29.452 -5.267  17.480  1.00 30.35  ? 344 GLU C OE1   1 
ATOM   7821  O OE2   . GLU C  1 316 ? -29.634 -3.324  18.414  1.00 37.87  ? 344 GLU C OE2   1 
ATOM   7822  N N     . ALA C  1 317 ? -27.748 -9.491  19.199  1.00 23.95  ? 345 ALA C N     1 
ATOM   7823  C CA    . ALA C  1 317 ? -27.558 -10.922 19.443  1.00 23.44  ? 345 ALA C CA    1 
ATOM   7824  C C     . ALA C  1 317 ? -26.088 -11.241 19.560  1.00 23.40  ? 345 ALA C C     1 
ATOM   7825  O O     . ALA C  1 317 ? -25.686 -12.065 20.388  1.00 22.43  ? 345 ALA C O     1 
ATOM   7826  C CB    . ALA C  1 317 ? -28.166 -11.754 18.323  1.00 22.11  ? 345 ALA C CB    1 
ATOM   7827  N N     . ALA C  1 318 ? -25.295 -10.592 18.712  1.00 17.69  ? 346 ALA C N     1 
ATOM   7828  C CA    . ALA C  1 318 ? -23.850 -10.743 18.736  1.00 22.38  ? 346 ALA C CA    1 
ATOM   7829  C C     . ALA C  1 318 ? -23.268 -10.250 20.083  1.00 20.24  ? 346 ALA C C     1 
ATOM   7830  O O     . ALA C  1 318 ? -22.396 -10.913 20.681  1.00 20.30  ? 346 ALA C O     1 
ATOM   7831  C CB    . ALA C  1 318 ? -23.237 -10.037 17.584  1.00 18.88  ? 346 ALA C CB    1 
ATOM   7832  N N     . MET C  1 319 ? -23.757 -9.117  20.555  1.00 20.42  ? 347 MET C N     1 
ATOM   7833  C CA    . MET C  1 319 ? -23.369 -8.574  21.866  1.00 25.46  ? 347 MET C CA    1 
ATOM   7834  C C     . MET C  1 319 ? -23.750 -9.493  23.013  1.00 21.64  ? 347 MET C C     1 
ATOM   7835  O O     . MET C  1 319 ? -22.960 -9.712  23.907  1.00 17.14  ? 347 MET C O     1 
ATOM   7836  C CB    . MET C  1 319 ? -24.005 -7.197  22.112  1.00 28.89  ? 347 MET C CB    1 
ATOM   7837  C CG    . MET C  1 319 ? -23.408 -6.052  21.309  1.00 28.03  ? 347 MET C CG    1 
ATOM   7838  S SD    . MET C  1 319 ? -23.999 -4.451  21.889  1.00 33.81  ? 347 MET C SD    1 
ATOM   7839  C CE    . MET C  1 319 ? -22.835 -3.371  21.041  1.00 26.53  ? 347 MET C CE    1 
ATOM   7840  N N     . ALA C  1 320 ? -24.977 -10.002 23.012  1.00 20.83  ? 348 ALA C N     1 
ATOM   7841  C CA    . ALA C  1 320 ? -25.434 -10.933 24.032  1.00 21.19  ? 348 ALA C CA    1 
ATOM   7842  C C     . ALA C  1 320 ? -24.570 -12.241 24.065  1.00 20.17  ? 348 ALA C C     1 
ATOM   7843  O O     . ALA C  1 320 ? -24.068 -12.666 25.112  1.00 16.45  ? 348 ALA C O     1 
ATOM   7844  C CB    . ALA C  1 320 ? -26.979 -11.221 23.828  1.00 16.61  ? 348 ALA C CB    1 
ATOM   7845  N N     . LYS C  1 321 ? -24.303 -12.809 22.900  1.00 22.85  ? 349 LYS C N     1 
ATOM   7846  C CA    . LYS C  1 321 ? -23.593 -14.061 22.810  1.00 22.50  ? 349 LYS C CA    1 
ATOM   7847  C C     . LYS C  1 321 ? -22.167 -13.860 23.288  1.00 20.49  ? 349 LYS C C     1 
ATOM   7848  O O     . LYS C  1 321 ? -21.685 -14.631 24.082  1.00 22.44  ? 349 LYS C O     1 
ATOM   7849  C CB    . LYS C  1 321 ? -23.644 -14.600 21.384  1.00 20.27  ? 349 LYS C CB    1 
ATOM   7850  C CG    . LYS C  1 321 ? -23.290 -16.064 21.244  1.00 23.44  ? 349 LYS C CG    1 
ATOM   7851  C CD    . LYS C  1 321 ? -21.857 -16.221 20.889  1.00 20.09  ? 349 LYS C CD    1 
ATOM   7852  C CE    . LYS C  1 321 ? -21.479 -17.619 20.579  1.00 28.40  ? 349 LYS C CE    1 
ATOM   7853  N NZ    . LYS C  1 321 ? -19.988 -17.684 20.459  1.00 19.57  ? 349 LYS C NZ    1 
ATOM   7854  N N     . LEU C  1 322 ? -21.555 -12.785 22.806  1.00 17.97  ? 350 LEU C N     1 
ATOM   7855  C CA    . LEU C  1 322 ? -20.243 -12.336 23.210  1.00 24.01  ? 350 LEU C CA    1 
ATOM   7856  C C     . LEU C  1 322 ? -20.164 -12.078 24.734  1.00 23.72  ? 350 LEU C C     1 
ATOM   7857  O O     . LEU C  1 322 ? -19.407 -12.735 25.408  1.00 16.71  ? 350 LEU C O     1 
ATOM   7858  C CB    . LEU C  1 322 ? -19.873 -11.093 22.395  1.00 18.16  ? 350 LEU C CB    1 
ATOM   7859  C CG    . LEU C  1 322 ? -18.465 -10.589 22.659  1.00 19.21  ? 350 LEU C CG    1 
ATOM   7860  C CD1   . LEU C  1 322 ? -17.517 -11.734 22.347  1.00 20.22  ? 350 LEU C CD1   1 
ATOM   7861  C CD2   . LEU C  1 322 ? -18.103 -9.317  21.876  1.00 22.87  ? 350 LEU C CD2   1 
ATOM   7862  N N     . ALA C  1 323 ? -21.021 -11.210 25.278  1.00 22.10  ? 351 ALA C N     1 
ATOM   7863  C CA    . ALA C  1 323 ? -21.013 -10.917 26.701  1.00 24.27  ? 351 ALA C CA    1 
ATOM   7864  C C     . ALA C  1 323 ? -21.241 -12.179 27.560  1.00 25.37  ? 351 ALA C C     1 
ATOM   7865  O O     . ALA C  1 323 ? -20.516 -12.397 28.545  1.00 19.07  ? 351 ALA C O     1 
ATOM   7866  C CB    . ALA C  1 323 ? -22.043 -9.815  27.063  1.00 17.35  ? 351 ALA C CB    1 
ATOM   7867  N N     . ALA C  1 324 ? -22.227 -12.993 27.193  1.00 22.26  ? 352 ALA C N     1 
ATOM   7868  C CA    . ALA C  1 324 ? -22.587 -14.151 28.010  1.00 24.38  ? 352 ALA C CA    1 
ATOM   7869  C C     . ALA C  1 324 ? -21.477 -15.226 28.001  1.00 22.87  ? 352 ALA C C     1 
ATOM   7870  O O     . ALA C  1 324 ? -21.152 -15.796 29.036  1.00 23.68  ? 352 ALA C O     1 
ATOM   7871  C CB    . ALA C  1 324 ? -23.953 -14.720 27.584  1.00 19.34  ? 352 ALA C CB    1 
ATOM   7872  N N     . SER C  1 325 ? -20.892 -15.474 26.843  1.00 19.97  ? 353 SER C N     1 
ATOM   7873  C CA    . SER C  1 325 ? -19.923 -16.516 26.688  1.00 23.93  ? 353 SER C CA    1 
ATOM   7874  C C     . SER C  1 325 ? -18.670 -16.186 27.471  1.00 19.58  ? 353 SER C C     1 
ATOM   7875  O O     . SER C  1 325 ? -18.097 -17.073 28.116  1.00 18.73  ? 353 SER C O     1 
ATOM   7876  C CB    . SER C  1 325 ? -19.600 -16.794 25.210  1.00 22.92  ? 353 SER C CB    1 
ATOM   7877  O OG    . SER C  1 325 ? -18.858 -15.761 24.555  1.00 23.48  ? 353 SER C OG    1 
ATOM   7878  N N     . GLU C  1 326 ? -18.264 -14.920 27.426  1.00 20.95  ? 354 GLU C N     1 
ATOM   7879  C CA    . GLU C  1 326 ? -17.067 -14.491 28.145  1.00 23.10  ? 354 GLU C CA    1 
ATOM   7880  C C     . GLU C  1 326 ? -17.356 -14.414 29.633  1.00 20.77  ? 354 GLU C C     1 
ATOM   7881  O O     . GLU C  1 326 ? -16.533 -14.812 30.415  1.00 17.44  ? 354 GLU C O     1 
ATOM   7882  C CB    . GLU C  1 326 ? -16.505 -13.205 27.563  1.00 24.91  ? 354 GLU C CB    1 
ATOM   7883  C CG    . GLU C  1 326 ? -15.895 -13.492 26.223  1.00 31.09  ? 354 GLU C CG    1 
ATOM   7884  C CD    . GLU C  1 326 ? -15.275 -12.311 25.530  1.00 34.57  ? 354 GLU C CD    1 
ATOM   7885  O OE1   . GLU C  1 326 ? -15.462 -11.144 25.939  1.00 34.93  ? 354 GLU C OE1   1 
ATOM   7886  O OE2   . GLU C  1 326 ? -14.587 -12.575 24.542  1.00 33.54  ? 354 GLU C OE2   1 
ATOM   7887  N N     . ALA C  1 327 ? -18.568 -14.034 30.029  1.00 20.39  ? 355 ALA C N     1 
ATOM   7888  C CA    . ALA C  1 327 ? -18.948 -14.151 31.429  1.00 20.75  ? 355 ALA C CA    1 
ATOM   7889  C C     . ALA C  1 327 ? -18.944 -15.589 31.933  1.00 23.52  ? 355 ALA C C     1 
ATOM   7890  O O     . ALA C  1 327 ? -18.494 -15.839 33.043  1.00 19.84  ? 355 ALA C O     1 
ATOM   7891  C CB    . ALA C  1 327 ? -20.340 -13.501 31.719  1.00 13.86  ? 355 ALA C CB    1 
ATOM   7892  N N     . ALA C  1 328 ? -19.486 -16.517 31.146  1.00 22.70  ? 356 ALA C N     1 
ATOM   7893  C CA    . ALA C  1 328 ? -19.528 -17.931 31.510  1.00 22.92  ? 356 ALA C CA    1 
ATOM   7894  C C     . ALA C  1 328 ? -18.114 -18.459 31.774  1.00 18.87  ? 356 ALA C C     1 
ATOM   7895  O O     . ALA C  1 328 ? -17.904 -19.194 32.738  1.00 22.67  ? 356 ALA C O     1 
ATOM   7896  C CB    . ALA C  1 328 ? -20.178 -18.754 30.397  1.00 23.15  ? 356 ALA C CB    1 
ATOM   7897  N N     . THR C  1 329 ? -17.159 -18.092 30.922  1.00 21.43  ? 357 THR C N     1 
ATOM   7898  C CA    . THR C  1 329 ? -15.758 -18.528 31.104  1.00 22.62  ? 357 THR C CA    1 
ATOM   7899  C C     . THR C  1 329 ? -15.036 -17.871 32.316  1.00 23.41  ? 357 THR C C     1 
ATOM   7900  O O     . THR C  1 329 ? -14.397 -18.575 33.097  1.00 21.45  ? 357 THR C O     1 
ATOM   7901  C CB    . THR C  1 329 ? -14.917 -18.395 29.828  1.00 26.62  ? 357 THR C CB    1 
ATOM   7902  O OG1   . THR C  1 329 ? -15.126 -19.536 29.000  1.00 26.48  ? 357 THR C OG1   1 
ATOM   7903  C CG2   . THR C  1 329 ? -13.400 -18.352 30.137  1.00 14.54  ? 357 THR C CG2   1 
ATOM   7904  N N     . ALA C  1 330 ? -15.134 -16.551 32.447  1.00 21.82  ? 358 ALA C N     1 
ATOM   7905  C CA    . ALA C  1 330 ? -14.685 -15.818 33.639  1.00 20.68  ? 358 ALA C CA    1 
ATOM   7906  C C     . ALA C  1 330 ? -15.291 -16.319 34.963  1.00 21.74  ? 358 ALA C C     1 
ATOM   7907  O O     . ALA C  1 330 ? -14.587 -16.488 35.942  1.00 18.48  ? 358 ALA C O     1 
ATOM   7908  C CB    . ALA C  1 330 ? -14.981 -14.311 33.480  1.00 18.60  ? 358 ALA C CB    1 
ATOM   7909  N N     . ILE C  1 331 ? -16.606 -16.512 34.995  1.00 17.70  ? 359 ILE C N     1 
ATOM   7910  C CA    . ILE C  1 331 ? -17.310 -16.858 36.204  1.00 20.54  ? 359 ILE C CA    1 
ATOM   7911  C C     . ILE C  1 331 ? -16.950 -18.274 36.640  1.00 24.84  ? 359 ILE C C     1 
ATOM   7912  O O     . ILE C  1 331 ? -16.675 -18.526 37.825  1.00 21.17  ? 359 ILE C O     1 
ATOM   7913  C CB    . ILE C  1 331 ? -18.869 -16.669 36.032  1.00 17.77  ? 359 ILE C CB    1 
ATOM   7914  C CG1   . ILE C  1 331 ? -19.188 -15.171 35.926  1.00 19.43  ? 359 ILE C CG1   1 
ATOM   7915  C CG2   . ILE C  1 331 ? -19.642 -17.291 37.181  1.00 20.65  ? 359 ILE C CG2   1 
ATOM   7916  C CD1   . ILE C  1 331 ? -20.640 -14.842 35.549  1.00 18.35  ? 359 ILE C CD1   1 
ATOM   7917  N N     . SER C  1 332 ? -16.893 -19.174 35.663  1.00 23.18  ? 360 SER C N     1 
ATOM   7918  C CA    . SER C  1 332 ? -16.586 -20.569 35.908  1.00 18.69  ? 360 SER C CA    1 
ATOM   7919  C C     . SER C  1 332 ? -15.147 -20.729 36.418  1.00 18.79  ? 360 SER C C     1 
ATOM   7920  O O     . SER C  1 332 ? -14.934 -21.497 37.329  1.00 18.88  ? 360 SER C O     1 
ATOM   7921  C CB    . SER C  1 332 ? -16.907 -21.439 34.658  1.00 19.00  ? 360 SER C CB    1 
ATOM   7922  O OG    . SER C  1 332 ? -16.052 -21.159 33.550  1.00 27.47  ? 360 SER C OG    1 
ATOM   7923  N N     . HIS C  1 333 ? -14.205 -19.980 35.847  1.00 19.80  ? 361 HIS C N     1 
ATOM   7924  C CA    . HIS C  1 333 ? -12.817 -19.914 36.332  1.00 21.99  ? 361 HIS C CA    1 
ATOM   7925  C C     . HIS C  1 333 ? -12.764 -19.492 37.812  1.00 21.62  ? 361 HIS C C     1 
ATOM   7926  O O     . HIS C  1 333 ? -12.070 -20.085 38.604  1.00 21.95  ? 361 HIS C O     1 
ATOM   7927  C CB    . HIS C  1 333 ? -11.997 -18.935 35.488  1.00 22.62  ? 361 HIS C CB    1 
ATOM   7928  C CG    . HIS C  1 333 ? -10.536 -18.857 35.870  1.00 22.29  ? 361 HIS C CG    1 
ATOM   7929  N ND1   . HIS C  1 333 ? -10.048 -17.931 36.773  1.00 26.11  ? 361 HIS C ND1   1 
ATOM   7930  C CD2   . HIS C  1 333 ? -9.462  -19.572 35.458  1.00 26.42  ? 361 HIS C CD2   1 
ATOM   7931  C CE1   . HIS C  1 333 ? -8.746  -18.096 36.917  1.00 27.59  ? 361 HIS C CE1   1 
ATOM   7932  N NE2   . HIS C  1 333 ? -8.364  -19.092 36.141  1.00 16.77  ? 361 HIS C NE2   1 
ATOM   7933  N N     . GLN C  1 334 ? -13.521 -18.465 38.167  1.00 25.28  ? 362 GLN C N     1 
ATOM   7934  C CA    . GLN C  1 334 ? -13.508 -17.926 39.514  1.00 22.65  ? 362 GLN C CA    1 
ATOM   7935  C C     . GLN C  1 334 ? -14.245 -18.792 40.531  1.00 23.09  ? 362 GLN C C     1 
ATOM   7936  O O     . GLN C  1 334 ? -13.912 -18.788 41.712  1.00 20.45  ? 362 GLN C O     1 
ATOM   7937  C CB    . GLN C  1 334 ? -14.050 -16.487 39.507  1.00 25.05  ? 362 GLN C CB    1 
ATOM   7938  C CG    . GLN C  1 334 ? -13.051 -15.507 38.907  1.00 26.93  ? 362 GLN C CG    1 
ATOM   7939  C CD    . GLN C  1 334 ? -11.722 -15.536 39.651  1.00 36.22  ? 362 GLN C CD    1 
ATOM   7940  O OE1   . GLN C  1 334 ? -11.647 -15.106 40.789  1.00 33.76  ? 362 GLN C OE1   1 
ATOM   7941  N NE2   . GLN C  1 334 ? -10.679 -16.066 39.015  1.00 39.57  ? 362 GLN C NE2   1 
ATOM   7942  N N     . ALA C  1 335 ? -15.245 -19.524 40.072  1.00 22.01  ? 363 ALA C N     1 
ATOM   7943  C CA    . ALA C  1 335 ? -15.829 -20.602 40.860  1.00 23.97  ? 363 ALA C CA    1 
ATOM   7944  C C     . ALA C  1 335 ? -14.786 -21.696 41.238  1.00 22.52  ? 363 ALA C C     1 
ATOM   7945  O O     . ALA C  1 335 ? -14.703 -22.133 42.399  1.00 24.28  ? 363 ALA C O     1 
ATOM   7946  C CB    . ALA C  1 335 ? -16.977 -21.199 40.111  1.00 21.24  ? 363 ALA C CB    1 
ATOM   7947  N N     . ILE C  1 336 ? -13.992 -22.143 40.270  1.00 21.70  ? 364 ILE C N     1 
ATOM   7948  C CA    . ILE C  1 336 ? -12.937 -23.080 40.583  1.00 21.14  ? 364 ILE C CA    1 
ATOM   7949  C C     . ILE C  1 336 ? -12.041 -22.434 41.666  1.00 22.05  ? 364 ILE C C     1 
ATOM   7950  O O     . ILE C  1 336 ? -11.694 -23.093 42.641  1.00 21.36  ? 364 ILE C O     1 
ATOM   7951  C CB    . ILE C  1 336 ? -12.110 -23.497 39.348  1.00 20.88  ? 364 ILE C CB    1 
ATOM   7952  C CG1   . ILE C  1 336 ? -12.920 -24.464 38.481  1.00 22.05  ? 364 ILE C CG1   1 
ATOM   7953  C CG2   . ILE C  1 336 ? -10.759 -24.152 39.774  1.00 15.51  ? 364 ILE C CG2   1 
ATOM   7954  C CD1   . ILE C  1 336 ? -12.395 -24.677 37.087  1.00 16.45  ? 364 ILE C CD1   1 
ATOM   7955  N N     . GLN C  1 337 ? -11.693 -21.156 41.482  1.00 21.15  ? 365 GLN C N     1 
ATOM   7956  C CA    . GLN C  1 337 ? -10.716 -20.516 42.343  1.00 21.39  ? 365 GLN C CA    1 
ATOM   7957  C C     . GLN C  1 337 ? -11.213 -20.417 43.795  1.00 21.97  ? 365 GLN C C     1 
ATOM   7958  O O     . GLN C  1 337 ? -10.464 -20.653 44.728  1.00 21.14  ? 365 GLN C O     1 
ATOM   7959  C CB    . GLN C  1 337 ? -10.349 -19.136 41.823  1.00 24.50  ? 365 GLN C CB    1 
ATOM   7960  C CG    . GLN C  1 337 ? -9.113  -18.570 42.449  1.00 21.91  ? 365 GLN C CG    1 
ATOM   7961  C CD    . GLN C  1 337 ? -7.835  -19.286 42.006  1.00 22.18  ? 365 GLN C CD    1 
ATOM   7962  O OE1   . GLN C  1 337 ? -7.830  -20.080 41.060  1.00 22.58  ? 365 GLN C OE1   1 
ATOM   7963  N NE2   . GLN C  1 337 ? -6.760  -19.028 42.710  1.00 22.91  ? 365 GLN C NE2   1 
ATOM   7964  N N     . ILE C  1 338 ? -12.491 -20.113 43.957  1.00 22.25  ? 366 ILE C N     1 
ATOM   7965  C CA    . ILE C  1 338 ? -13.108 -19.971 45.254  1.00 21.61  ? 366 ILE C CA    1 
ATOM   7966  C C     . ILE C  1 338 ? -13.229 -21.294 45.996  1.00 22.96  ? 366 ILE C C     1 
ATOM   7967  O O     . ILE C  1 338 ? -13.064 -21.330 47.220  1.00 18.80  ? 366 ILE C O     1 
ATOM   7968  C CB    . ILE C  1 338 ? -14.510 -19.323 45.089  1.00 23.20  ? 366 ILE C CB    1 
ATOM   7969  C CG1   . ILE C  1 338 ? -14.312 -17.810 44.916  1.00 27.08  ? 366 ILE C CG1   1 
ATOM   7970  C CG2   . ILE C  1 338 ? -15.406 -19.641 46.259  1.00 22.01  ? 366 ILE C CG2   1 
ATOM   7971  C CD1   . ILE C  1 338 ? -15.479 -17.100 44.249  1.00 15.09  ? 366 ILE C CD1   1 
ATOM   7972  N N     . LEU C  1 339 ? -13.521 -22.363 45.249  1.00 22.31  ? 367 LEU C N     1 
ATOM   7973  C CA    . LEU C  1 339 ? -13.544 -23.727 45.773  1.00 24.96  ? 367 LEU C CA    1 
ATOM   7974  C C     . LEU C  1 339 ? -12.157 -24.243 46.150  1.00 19.68  ? 367 LEU C C     1 
ATOM   7975  O O     . LEU C  1 339 ? -12.054 -25.155 46.972  1.00 26.50  ? 367 LEU C O     1 
ATOM   7976  C CB    . LEU C  1 339 ? -14.195 -24.713 44.786  1.00 23.27  ? 367 LEU C CB    1 
ATOM   7977  C CG    . LEU C  1 339 ? -15.687 -25.008 44.941  1.00 24.43  ? 367 LEU C CG    1 
ATOM   7978  C CD1   . LEU C  1 339 ? -16.493 -23.737 44.813  1.00 26.42  ? 367 LEU C CD1   1 
ATOM   7979  C CD2   . LEU C  1 339 ? -16.084 -26.031 43.889  1.00 22.03  ? 367 LEU C CD2   1 
ATOM   7980  N N     . GLY C  1 340 ? -11.109 -23.664 45.574  1.00 26.43  ? 368 GLY C N     1 
ATOM   7981  C CA    . GLY C  1 340 ? -9.729  -24.115 45.819  1.00 24.26  ? 368 GLY C CA    1 
ATOM   7982  C C     . GLY C  1 340 ? -9.421  -25.484 45.202  1.00 24.34  ? 368 GLY C C     1 
ATOM   7983  O O     . GLY C  1 340 ? -9.764  -25.736 44.043  1.00 22.08  ? 368 GLY C O     1 
ATOM   7984  N N     . GLY C  1 341 ? -8.792  -26.371 45.985  1.00 21.74  ? 369 GLY C N     1 
ATOM   7985  C CA    . GLY C  1 341 ? -8.569  -27.767 45.595  1.00 19.53  ? 369 GLY C CA    1 
ATOM   7986  C C     . GLY C  1 341 ? -9.858  -28.447 45.141  1.00 22.45  ? 369 GLY C C     1 
ATOM   7987  O O     . GLY C  1 341 ? -9.876  -29.157 44.130  1.00 22.22  ? 369 GLY C O     1 
ATOM   7988  N N     . MET C  1 342 ? -10.941 -28.211 45.872  1.00 22.37  ? 370 MET C N     1 
ATOM   7989  C CA    . MET C  1 342 ? -12.231 -28.814 45.537  1.00 22.83  ? 370 MET C CA    1 
ATOM   7990  C C     . MET C  1 342 ? -12.676 -28.396 44.122  1.00 22.92  ? 370 MET C C     1 
ATOM   7991  O O     . MET C  1 342 ? -13.376 -29.145 43.436  1.00 26.24  ? 370 MET C O     1 
ATOM   7992  C CB    . MET C  1 342 ? -13.290 -28.462 46.599  1.00 27.47  ? 370 MET C CB    1 
ATOM   7993  C CG    . MET C  1 342 ? -13.143 -29.228 47.922  1.00 38.03  ? 370 MET C CG    1 
ATOM   7994  S SD    . MET C  1 342 ? -13.023 -31.045 47.784  1.00 39.31  ? 370 MET C SD    1 
ATOM   7995  C CE    . MET C  1 342 ? -14.608 -31.427 47.052  1.00 30.06  ? 370 MET C CE    1 
ATOM   7996  N N     . GLY C  1 343 ? -12.217 -27.225 43.671  1.00 26.56  ? 371 GLY C N     1 
ATOM   7997  C CA    . GLY C  1 343 ? -12.467 -26.754 42.304  1.00 30.07  ? 371 GLY C CA    1 
ATOM   7998  C C     . GLY C  1 343 ? -11.840 -27.580 41.183  1.00 27.04  ? 371 GLY C C     1 
ATOM   7999  O O     . GLY C  1 343 ? -12.328 -27.577 40.056  1.00 27.09  ? 371 GLY C O     1 
ATOM   8000  N N     . TYR C  1 344 ? -10.791 -28.324 41.502  1.00 22.48  ? 372 TYR C N     1 
ATOM   8001  C CA    . TYR C  1 344 ? -10.038 -29.073 40.495  1.00 23.22  ? 372 TYR C CA    1 
ATOM   8002  C C     . TYR C  1 344 ? -10.425 -30.538 40.319  1.00 23.94  ? 372 TYR C C     1 
ATOM   8003  O O     . TYR C  1 344 ? -9.966  -31.191 39.380  1.00 22.95  ? 372 TYR C O     1 
ATOM   8004  C CB    . TYR C  1 344 ? -8.554  -28.943 40.802  1.00 21.35  ? 372 TYR C CB    1 
ATOM   8005  C CG    . TYR C  1 344 ? -7.650  -29.113 39.603  1.00 22.71  ? 372 TYR C CG    1 
ATOM   8006  C CD1   . TYR C  1 344 ? -7.643  -28.185 38.564  1.00 21.33  ? 372 TYR C CD1   1 
ATOM   8007  C CD2   . TYR C  1 344 ? -6.767  -30.189 39.527  1.00 24.07  ? 372 TYR C CD2   1 
ATOM   8008  C CE1   . TYR C  1 344 ? -6.775  -28.325 37.481  1.00 22.29  ? 372 TYR C CE1   1 
ATOM   8009  C CE2   . TYR C  1 344 ? -5.909  -30.342 38.452  1.00 19.29  ? 372 TYR C CE2   1 
ATOM   8010  C CZ    . TYR C  1 344 ? -5.918  -29.415 37.428  1.00 17.36  ? 372 TYR C CZ    1 
ATOM   8011  O OH    . TYR C  1 344 ? -5.045  -29.573 36.391  1.00 24.34  ? 372 TYR C OH    1 
ATOM   8012  N N     . VAL C  1 345 ? -11.335 -31.036 41.147  1.00 26.78  ? 373 VAL C N     1 
ATOM   8013  C CA    . VAL C  1 345 ? -11.706 -32.452 41.113  1.00 25.80  ? 373 VAL C CA    1 
ATOM   8014  C C     . VAL C  1 345 ? -13.181 -32.621 40.766  1.00 24.66  ? 373 VAL C C     1 
ATOM   8015  O O     . VAL C  1 345 ? -13.952 -31.719 40.991  1.00 26.28  ? 373 VAL C O     1 
ATOM   8016  C CB    . VAL C  1 345 ? -11.378 -33.146 42.459  1.00 24.81  ? 373 VAL C CB    1 
ATOM   8017  C CG1   . VAL C  1 345 ? -9.822  -33.132 42.687  1.00 23.82  ? 373 VAL C CG1   1 
ATOM   8018  C CG2   . VAL C  1 345 ? -12.145 -32.493 43.610  1.00 23.48  ? 373 VAL C CG2   1 
ATOM   8019  N N     . THR C  1 346 ? -13.533 -33.795 40.245  1.00 25.40  ? 374 THR C N     1 
ATOM   8020  C CA    . THR C  1 346 ? -14.892 -34.099 39.745  1.00 27.79  ? 374 THR C CA    1 
ATOM   8021  C C     . THR C  1 346 ? -15.891 -34.355 40.864  1.00 26.46  ? 374 THR C C     1 
ATOM   8022  O O     . THR C  1 346 ? -17.078 -34.540 40.610  1.00 33.86  ? 374 THR C O     1 
ATOM   8023  C CB    . THR C  1 346 ? -14.877 -35.305 38.747  1.00 28.56  ? 374 THR C CB    1 
ATOM   8024  O OG1   . THR C  1 346 ? -14.553 -36.514 39.442  1.00 30.77  ? 374 THR C OG1   1 
ATOM   8025  C CG2   . THR C  1 346 ? -13.855 -35.071 37.618  1.00 26.69  ? 374 THR C CG2   1 
ATOM   8026  N N     . GLU C  1 347 ? -15.416 -34.367 42.104  1.00 30.18  ? 375 GLU C N     1 
ATOM   8027  C CA    . GLU C  1 347 ? -16.279 -34.355 43.295  1.00 36.86  ? 375 GLU C CA    1 
ATOM   8028  C C     . GLU C  1 347 ? -17.254 -33.151 43.324  1.00 35.05  ? 375 GLU C C     1 
ATOM   8029  O O     . GLU C  1 347 ? -18.377 -33.250 43.833  1.00 29.38  ? 375 GLU C O     1 
ATOM   8030  C CB    . GLU C  1 347 ? -15.395 -34.326 44.546  1.00 37.97  ? 375 GLU C CB    1 
ATOM   8031  C CG    . GLU C  1 347 ? -16.114 -34.522 45.887  1.00 60.73  ? 375 GLU C CG    1 
ATOM   8032  C CD    . GLU C  1 347 ? -16.498 -35.974 46.150  1.00 77.91  ? 375 GLU C CD    1 
ATOM   8033  O OE1   . GLU C  1 347 ? -15.746 -36.877 45.708  1.00 80.39  ? 375 GLU C OE1   1 
ATOM   8034  O OE2   . GLU C  1 347 ? -17.545 -36.205 46.805  1.00 67.80  ? 375 GLU C OE2   1 
ATOM   8035  N N     . MET C  1 348 ? -16.795 -32.010 42.813  1.00 31.37  ? 376 MET C N     1 
ATOM   8036  C CA    . MET C  1 348 ? -17.615 -30.813 42.737  1.00 27.39  ? 376 MET C CA    1 
ATOM   8037  C C     . MET C  1 348 ? -17.895 -30.498 41.256  1.00 26.93  ? 376 MET C C     1 
ATOM   8038  O O     . MET C  1 348 ? -17.129 -30.915 40.394  1.00 28.47  ? 376 MET C O     1 
ATOM   8039  C CB    . MET C  1 348 ? -16.897 -29.646 43.425  1.00 26.99  ? 376 MET C CB    1 
ATOM   8040  C CG    . MET C  1 348 ? -16.724 -29.811 44.944  1.00 36.01  ? 376 MET C CG    1 
ATOM   8041  S SD    . MET C  1 348 ? -18.288 -29.783 45.837  1.00 40.91  ? 376 MET C SD    1 
ATOM   8042  C CE    . MET C  1 348 ? -18.743 -28.046 45.714  1.00 36.37  ? 376 MET C CE    1 
ATOM   8043  N N     . PRO C  1 349 ? -18.986 -29.751 40.961  1.00 25.39  ? 377 PRO C N     1 
ATOM   8044  C CA    . PRO C  1 349 ? -19.374 -29.459 39.569  1.00 24.74  ? 377 PRO C CA    1 
ATOM   8045  C C     . PRO C  1 349 ? -18.597 -28.332 38.870  1.00 26.04  ? 377 PRO C C     1 
ATOM   8046  O O     . PRO C  1 349 ? -18.763 -28.136 37.676  1.00 25.33  ? 377 PRO C O     1 
ATOM   8047  C CB    . PRO C  1 349 ? -20.871 -29.144 39.686  1.00 26.57  ? 377 PRO C CB    1 
ATOM   8048  C CG    . PRO C  1 349 ? -21.038 -28.591 41.033  1.00 26.84  ? 377 PRO C CG    1 
ATOM   8049  C CD    . PRO C  1 349 ? -19.916 -29.153 41.918  1.00 23.87  ? 377 PRO C CD    1 
ATOM   8050  N N     . ALA C  1 350 ? -17.742 -27.618 39.599  1.00 26.66  ? 378 ALA C N     1 
ATOM   8051  C CA    . ALA C  1 350 ? -17.085 -26.426 39.074  1.00 27.69  ? 378 ALA C CA    1 
ATOM   8052  C C     . ALA C  1 350 ? -16.186 -26.693 37.868  1.00 22.77  ? 378 ALA C C     1 
ATOM   8053  O O     . ALA C  1 350 ? -16.215 -25.943 36.896  1.00 22.55  ? 378 ALA C O     1 
ATOM   8054  C CB    . ALA C  1 350 ? -16.317 -25.734 40.178  1.00 21.42  ? 378 ALA C CB    1 
ATOM   8055  N N     . GLU C  1 351 ? -15.414 -27.768 37.906  1.00 26.11  ? 379 GLU C N     1 
ATOM   8056  C CA    . GLU C  1 351 ? -14.532 -28.084 36.781  1.00 26.07  ? 379 GLU C CA    1 
ATOM   8057  C C     . GLU C  1 351 ? -15.322 -28.421 35.477  1.00 23.05  ? 379 GLU C C     1 
ATOM   8058  O O     . GLU C  1 351 ? -14.889 -28.074 34.398  1.00 21.56  ? 379 GLU C O     1 
ATOM   8059  C CB    . GLU C  1 351 ? -13.509 -29.166 37.169  1.00 29.02  ? 379 GLU C CB    1 
ATOM   8060  C CG    . GLU C  1 351 ? -14.104 -30.543 37.464  1.00 31.29  ? 379 GLU C CG    1 
ATOM   8061  C CD    . GLU C  1 351 ? -14.266 -31.399 36.211  1.00 36.91  ? 379 GLU C CD    1 
ATOM   8062  O OE1   . GLU C  1 351 ? -15.307 -32.070 36.073  1.00 27.10  ? 379 GLU C OE1   1 
ATOM   8063  O OE2   . GLU C  1 351 ? -13.348 -31.398 35.373  1.00 25.85  ? 379 GLU C OE2   1 
ATOM   8064  N N     . ARG C  1 352 ? -16.491 -29.058 35.600  1.00 21.22  ? 380 ARG C N     1 
ATOM   8065  C CA    . ARG C  1 352 ? -17.373 -29.257 34.477  1.00 26.17  ? 380 ARG C CA    1 
ATOM   8066  C C     . ARG C  1 352 ? -17.897 -27.917 33.915  1.00 25.50  ? 380 ARG C C     1 
ATOM   8067  O O     . ARG C  1 352 ? -17.959 -27.731 32.696  1.00 24.22  ? 380 ARG C O     1 
ATOM   8068  C CB    . ARG C  1 352 ? -18.540 -30.179 34.882  1.00 24.17  ? 380 ARG C CB    1 
ATOM   8069  C CG    . ARG C  1 352 ? -19.583 -30.390 33.818  1.00 30.75  ? 380 ARG C CG    1 
ATOM   8070  C CD    . ARG C  1 352 ? -20.557 -31.492 34.188  1.00 29.32  ? 380 ARG C CD    1 
ATOM   8071  N NE    . ARG C  1 352 ? -21.134 -31.374 35.531  1.00 36.88  ? 380 ARG C NE    1 
ATOM   8072  C CZ    . ARG C  1 352 ? -22.241 -30.699 35.839  1.00 39.85  ? 380 ARG C CZ    1 
ATOM   8073  N NH1   . ARG C  1 352 ? -22.905 -29.997 34.927  1.00 35.13  ? 380 ARG C NH1   1 
ATOM   8074  N NH2   . ARG C  1 352 ? -22.677 -30.707 37.090  1.00 37.43  ? 380 ARG C NH2   1 
ATOM   8075  N N     . HIS C  1 353 ? -18.253 -26.986 34.799  1.00 23.16  ? 381 HIS C N     1 
ATOM   8076  C CA    . HIS C  1 353 ? -18.669 -25.675 34.354  1.00 22.29  ? 381 HIS C CA    1 
ATOM   8077  C C     . HIS C  1 353 ? -17.615 -24.970 33.510  1.00 22.44  ? 381 HIS C C     1 
ATOM   8078  O O     . HIS C  1 353 ? -17.940 -24.418 32.467  1.00 24.12  ? 381 HIS C O     1 
ATOM   8079  C CB    . HIS C  1 353 ? -19.164 -24.814 35.522  1.00 23.56  ? 381 HIS C CB    1 
ATOM   8080  C CG    . HIS C  1 353 ? -20.294 -25.447 36.289  1.00 23.39  ? 381 HIS C CG    1 
ATOM   8081  N ND1   . HIS C  1 353 ? -21.210 -26.280 35.692  1.00 27.41  ? 381 HIS C ND1   1 
ATOM   8082  C CD2   . HIS C  1 353 ? -20.625 -25.407 37.605  1.00 23.89  ? 381 HIS C CD2   1 
ATOM   8083  C CE1   . HIS C  1 353 ? -22.065 -26.723 36.600  1.00 26.03  ? 381 HIS C CE1   1 
ATOM   8084  N NE2   . HIS C  1 353 ? -21.737 -26.198 37.770  1.00 28.04  ? 381 HIS C NE2   1 
ATOM   8085  N N     . TYR C  1 354 ? -16.357 -25.040 33.929  1.00 19.65  ? 382 TYR C N     1 
ATOM   8086  C CA    . TYR C  1 354 ? -15.252 -24.408 33.209  1.00 22.50  ? 382 TYR C CA    1 
ATOM   8087  C C     . TYR C  1 354 ? -15.112 -25.039 31.805  1.00 25.56  ? 382 TYR C C     1 
ATOM   8088  O O     . TYR C  1 354 ? -14.822 -24.338 30.826  1.00 23.83  ? 382 TYR C O     1 
ATOM   8089  C CB    . TYR C  1 354 ? -13.978 -24.568 34.054  1.00 20.70  ? 382 TYR C CB    1 
ATOM   8090  C CG    . TYR C  1 354 ? -12.711 -23.811 33.651  1.00 22.11  ? 382 TYR C CG    1 
ATOM   8091  C CD1   . TYR C  1 354 ? -12.693 -22.431 33.489  1.00 20.26  ? 382 TYR C CD1   1 
ATOM   8092  C CD2   . TYR C  1 354 ? -11.492 -24.484 33.575  1.00 25.64  ? 382 TYR C CD2   1 
ATOM   8093  C CE1   . TYR C  1 354 ? -11.468 -21.753 33.165  1.00 24.00  ? 382 TYR C CE1   1 
ATOM   8094  C CE2   . TYR C  1 354 ? -10.301 -23.824 33.266  1.00 25.33  ? 382 TYR C CE2   1 
ATOM   8095  C CZ    . TYR C  1 354 ? -10.283 -22.465 33.070  1.00 25.72  ? 382 TYR C CZ    1 
ATOM   8096  O OH    . TYR C  1 354 ? -9.060  -21.848 32.764  1.00 23.25  ? 382 TYR C OH    1 
ATOM   8097  N N     . ARG C  1 355 ? -15.368 -26.347 31.722  1.00 24.78  ? 383 ARG C N     1 
ATOM   8098  C CA    . ARG C  1 355 ? -15.253 -27.096 30.464  1.00 24.63  ? 383 ARG C CA    1 
ATOM   8099  C C     . ARG C  1 355 ? -16.388 -26.802 29.460  1.00 20.90  ? 383 ARG C C     1 
ATOM   8100  O O     . ARG C  1 355 ? -16.090 -26.605 28.282  1.00 22.74  ? 383 ARG C O     1 
ATOM   8101  C CB    . ARG C  1 355 ? -15.078 -28.598 30.717  1.00 19.30  ? 383 ARG C CB    1 
ATOM   8102  C CG    . ARG C  1 355 ? -13.682 -28.988 31.248  1.00 23.94  ? 383 ARG C CG    1 
ATOM   8103  C CD    . ARG C  1 355 ? -13.479 -30.521 31.411  1.00 23.31  ? 383 ARG C CD    1 
ATOM   8104  N NE    . ARG C  1 355 ? -14.353 -31.072 32.448  1.00 22.04  ? 383 ARG C NE    1 
ATOM   8105  C CZ    . ARG C  1 355 ? -15.475 -31.747 32.230  1.00 24.15  ? 383 ARG C CZ    1 
ATOM   8106  N NH1   . ARG C  1 355 ? -15.901 -31.991 30.986  1.00 22.23  ? 383 ARG C NH1   1 
ATOM   8107  N NH2   . ARG C  1 355 ? -16.190 -32.181 33.269  1.00 28.01  ? 383 ARG C NH2   1 
ATOM   8108  N N     . ASP C  1 356 ? -17.637 -26.748 29.946  1.00 22.84  ? 384 ASP C N     1 
ATOM   8109  C CA    . ASP C  1 356 ? -18.813 -26.434 29.161  1.00 25.57  ? 384 ASP C CA    1 
ATOM   8110  C C     . ASP C  1 356 ? -18.827 -24.988 28.698  1.00 28.56  ? 384 ASP C C     1 
ATOM   8111  O O     . ASP C  1 356 ? -19.166 -24.715 27.530  1.00 23.60  ? 384 ASP C O     1 
ATOM   8112  C CB    . ASP C  1 356 ? -20.121 -26.697 29.951  1.00 26.03  ? 384 ASP C CB    1 
ATOM   8113  C CG    . ASP C  1 356 ? -20.329 -28.180 30.306  1.00 38.23  ? 384 ASP C CG    1 
ATOM   8114  O OD1   . ASP C  1 356 ? -19.528 -29.017 29.831  1.00 25.56  ? 384 ASP C OD1   1 
ATOM   8115  O OD2   . ASP C  1 356 ? -21.288 -28.506 31.057  1.00 31.19  ? 384 ASP C OD2   1 
ATOM   8116  N N     . ALA C  1 357 ? -18.483 -24.075 29.621  1.00 24.87  ? 385 ALA C N     1 
ATOM   8117  C CA    . ALA C  1 357 ? -18.387 -22.649 29.337  1.00 22.67  ? 385 ALA C CA    1 
ATOM   8118  C C     . ALA C  1 357 ? -17.517 -22.378 28.125  1.00 19.00  ? 385 ALA C C     1 
ATOM   8119  O O     . ALA C  1 357 ? -17.833 -21.526 27.314  1.00 18.40  ? 385 ALA C O     1 
ATOM   8120  C CB    . ALA C  1 357 ? -17.872 -21.875 30.572  1.00 18.06  ? 385 ALA C CB    1 
ATOM   8121  N N     . ARG C  1 358 ? -16.426 -23.124 27.999  1.00 17.34  ? 386 ARG C N     1 
ATOM   8122  C CA    . ARG C  1 358 ? -15.417 -22.830 27.003  1.00 22.12  ? 386 ARG C CA    1 
ATOM   8123  C C     . ARG C  1 358 ? -15.924 -22.908 25.537  1.00 25.94  ? 386 ARG C C     1 
ATOM   8124  O O     . ARG C  1 358 ? -15.385 -22.231 24.681  1.00 22.46  ? 386 ARG C O     1 
ATOM   8125  C CB    . ARG C  1 358 ? -14.212 -23.738 27.221  1.00 21.58  ? 386 ARG C CB    1 
ATOM   8126  C CG    . ARG C  1 358 ? -13.012 -23.405 26.375  1.00 23.74  ? 386 ARG C CG    1 
ATOM   8127  C CD    . ARG C  1 358 ? -12.557 -21.993 26.654  1.00 19.89  ? 386 ARG C CD    1 
ATOM   8128  N NE    . ARG C  1 358 ? -11.508 -21.491 25.758  1.00 20.22  ? 386 ARG C NE    1 
ATOM   8129  C CZ    . ARG C  1 358 ? -11.720 -20.844 24.607  1.00 18.94  ? 386 ARG C CZ    1 
ATOM   8130  N NH1   . ARG C  1 358 ? -12.948 -20.740 24.092  1.00 25.34  ? 386 ARG C NH1   1 
ATOM   8131  N NH2   . ARG C  1 358 ? -10.687 -20.350 23.933  1.00 26.64  ? 386 ARG C NH2   1 
ATOM   8132  N N     . ILE C  1 359 ? -16.955 -23.724 25.261  1.00 21.47  ? 387 ILE C N     1 
ATOM   8133  C CA    . ILE C  1 359 ? -17.458 -23.865 23.886  1.00 25.61  ? 387 ILE C CA    1 
ATOM   8134  C C     . ILE C  1 359 ? -18.278 -22.643 23.450  1.00 26.03  ? 387 ILE C C     1 
ATOM   8135  O O     . ILE C  1 359 ? -18.353 -22.350 22.266  1.00 23.17  ? 387 ILE C O     1 
ATOM   8136  C CB    . ILE C  1 359 ? -18.337 -25.155 23.718  1.00 21.25  ? 387 ILE C CB    1 
ATOM   8137  C CG1   . ILE C  1 359 ? -18.692 -25.434 22.251  1.00 25.91  ? 387 ILE C CG1   1 
ATOM   8138  C CG2   . ILE C  1 359 ? -19.595 -25.055 24.507  1.00 17.29  ? 387 ILE C CG2   1 
ATOM   8139  C CD1   . ILE C  1 359 ? -17.513 -25.622 21.339  1.00 16.56  ? 387 ILE C CD1   1 
ATOM   8140  N N     . THR C  1 360 ? -18.899 -21.951 24.409  1.00 23.53  ? 388 THR C N     1 
ATOM   8141  C CA    . THR C  1 360 ? -19.748 -20.800 24.108  1.00 22.17  ? 388 THR C CA    1 
ATOM   8142  C C     . THR C  1 360 ? -18.989 -19.645 23.435  1.00 22.39  ? 388 THR C C     1 
ATOM   8143  O O     . THR C  1 360 ? -19.591 -18.800 22.801  1.00 22.43  ? 388 THR C O     1 
ATOM   8144  C CB    . THR C  1 360 ? -20.488 -20.293 25.367  1.00 25.66  ? 388 THR C CB    1 
ATOM   8145  O OG1   . THR C  1 360 ? -19.547 -19.733 26.297  1.00 20.40  ? 388 THR C OG1   1 
ATOM   8146  C CG2   . THR C  1 360 ? -21.257 -21.432 26.041  1.00 17.89  ? 388 THR C CG2   1 
ATOM   8147  N N     . GLU C  1 361 ? -17.667 -19.607 23.589  1.00 17.01  ? 389 GLU C N     1 
ATOM   8148  C CA    . GLU C  1 361 ? -16.814 -18.597 22.946  1.00 23.04  ? 389 GLU C CA    1 
ATOM   8149  C C     . GLU C  1 361 ? -16.429 -18.976 21.504  1.00 21.70  ? 389 GLU C C     1 
ATOM   8150  O O     . GLU C  1 361 ? -15.815 -18.177 20.783  1.00 23.90  ? 389 GLU C O     1 
ATOM   8151  C CB    . GLU C  1 361 ? -15.527 -18.406 23.776  1.00 20.00  ? 389 GLU C CB    1 
ATOM   8152  C CG    . GLU C  1 361 ? -15.764 -17.843 25.211  1.00 21.77  ? 389 GLU C CG    1 
ATOM   8153  C CD    . GLU C  1 361 ? -14.451 -17.701 26.016  1.00 33.01  ? 389 GLU C CD    1 
ATOM   8154  O OE1   . GLU C  1 361 ? -13.888 -16.598 25.991  1.00 33.61  ? 389 GLU C OE1   1 
ATOM   8155  O OE2   . GLU C  1 361 ? -13.972 -18.672 26.660  1.00 27.77  ? 389 GLU C OE2   1 
ATOM   8156  N N     . ILE C  1 362 ? -16.761 -20.199 21.099  1.00 22.71  ? 390 ILE C N     1 
ATOM   8157  C CA    . ILE C  1 362 ? -16.322 -20.740 19.816  1.00 26.40  ? 390 ILE C CA    1 
ATOM   8158  C C     . ILE C  1 362 ? -17.498 -20.874 18.865  1.00 26.15  ? 390 ILE C C     1 
ATOM   8159  O O     . ILE C  1 362 ? -17.499 -20.312 17.767  1.00 22.74  ? 390 ILE C O     1 
ATOM   8160  C CB    . ILE C  1 362 ? -15.606 -22.125 19.995  1.00 28.06  ? 390 ILE C CB    1 
ATOM   8161  C CG1   . ILE C  1 362 ? -14.435 -21.993 20.984  1.00 22.20  ? 390 ILE C CG1   1 
ATOM   8162  C CG2   . ILE C  1 362 ? -15.097 -22.710 18.621  1.00 18.58  ? 390 ILE C CG2   1 
ATOM   8163  C CD1   . ILE C  1 362 ? -13.771 -23.304 21.319  1.00 27.21  ? 390 ILE C CD1   1 
ATOM   8164  N N     . TYR C  1 363 ? -18.507 -21.632 19.269  1.00 28.57  ? 391 TYR C N     1 
ATOM   8165  C CA    . TYR C  1 363 ? -19.496 -22.032 18.294  1.00 26.46  ? 391 TYR C CA    1 
ATOM   8166  C C     . TYR C  1 363 ? -20.578 -20.969 18.097  1.00 27.51  ? 391 TYR C C     1 
ATOM   8167  O O     . TYR C  1 363 ? -20.726 -20.054 18.899  1.00 25.25  ? 391 TYR C O     1 
ATOM   8168  C CB    . TYR C  1 363 ? -20.024 -23.467 18.518  1.00 25.64  ? 391 TYR C CB    1 
ATOM   8169  C CG    . TYR C  1 363 ? -20.872 -23.806 19.725  1.00 26.16  ? 391 TYR C CG    1 
ATOM   8170  C CD1   . TYR C  1 363 ? -21.317 -25.122 19.896  1.00 28.09  ? 391 TYR C CD1   1 
ATOM   8171  C CD2   . TYR C  1 363 ? -21.247 -22.862 20.688  1.00 23.90  ? 391 TYR C CD2   1 
ATOM   8172  C CE1   . TYR C  1 363 ? -22.102 -25.499 20.988  1.00 25.08  ? 391 TYR C CE1   1 
ATOM   8173  C CE2   . TYR C  1 363 ? -22.041 -23.231 21.787  1.00 23.32  ? 391 TYR C CE2   1 
ATOM   8174  C CZ    . TYR C  1 363 ? -22.460 -24.551 21.932  1.00 27.91  ? 391 TYR C CZ    1 
ATOM   8175  O OH    . TYR C  1 363 ? -23.240 -24.934 22.999  1.00 24.53  ? 391 TYR C OH    1 
ATOM   8176  N N     . GLU C  1 364 ? -21.285 -21.097 16.976  1.00 26.67  ? 392 GLU C N     1 
ATOM   8177  C CA    . GLU C  1 364 ? -22.185 -20.068 16.444  1.00 26.25  ? 392 GLU C CA    1 
ATOM   8178  C C     . GLU C  1 364 ? -21.478 -18.732 16.194  1.00 27.05  ? 392 GLU C C     1 
ATOM   8179  O O     . GLU C  1 364 ? -22.057 -17.673 16.366  1.00 31.65  ? 392 GLU C O     1 
ATOM   8180  C CB    . GLU C  1 364 ? -23.437 -19.941 17.298  1.00 29.82  ? 392 GLU C CB    1 
ATOM   8181  C CG    . GLU C  1 364 ? -24.213 -21.292 17.353  1.00 38.94  ? 392 GLU C CG    1 
ATOM   8182  C CD    . GLU C  1 364 ? -25.684 -21.130 17.617  1.00 39.18  ? 392 GLU C CD    1 
ATOM   8183  O OE1   . GLU C  1 364 ? -26.211 -20.064 17.252  1.00 44.35  ? 392 GLU C OE1   1 
ATOM   8184  O OE2   . GLU C  1 364 ? -26.320 -22.060 18.189  1.00 44.17  ? 392 GLU C OE2   1 
ATOM   8185  N N     . GLY C  1 365 ? -20.228 -18.819 15.756  1.00 25.09  ? 393 GLY C N     1 
ATOM   8186  C CA    . GLY C  1 365 ? -19.413 -17.657 15.467  1.00 27.58  ? 393 GLY C CA    1 
ATOM   8187  C C     . GLY C  1 365 ? -18.516 -17.367 16.639  1.00 20.70  ? 393 GLY C C     1 
ATOM   8188  O O     . GLY C  1 365 ? -18.977 -17.054 17.733  1.00 23.85  ? 393 GLY C O     1 
ATOM   8189  N N     . THR C  1 366 ? -17.216 -17.445 16.413  1.00 22.35  ? 394 THR C N     1 
ATOM   8190  C CA    . THR C  1 366 ? -16.277 -17.221 17.496  1.00 21.12  ? 394 THR C CA    1 
ATOM   8191  C C     . THR C  1 366 ? -16.462 -15.785 18.058  1.00 21.22  ? 394 THR C C     1 
ATOM   8192  O O     . THR C  1 366 ? -17.136 -14.926 17.446  1.00 25.78  ? 394 THR C O     1 
ATOM   8193  C CB    . THR C  1 366 ? -14.825 -17.425 17.021  1.00 19.78  ? 394 THR C CB    1 
ATOM   8194  O OG1   . THR C  1 366 ? -14.528 -16.485 15.980  1.00 20.63  ? 394 THR C OG1   1 
ATOM   8195  C CG2   . THR C  1 366 ? -14.602 -18.838 16.508  1.00 24.08  ? 394 THR C CG2   1 
ATOM   8196  N N     . SER C  1 367 ? -15.854 -15.531 19.205  1.00 23.20  ? 395 SER C N     1 
ATOM   8197  C CA    . SER C  1 367 ? -15.832 -14.192 19.804  1.00 24.17  ? 395 SER C CA    1 
ATOM   8198  C C     . SER C  1 367 ? -15.298 -13.134 18.833  1.00 21.27  ? 395 SER C C     1 
ATOM   8199  O O     . SER C  1 367 ? -15.817 -12.023 18.761  1.00 18.67  ? 395 SER C O     1 
ATOM   8200  C CB    . SER C  1 367 ? -14.988 -14.207 21.078  1.00 20.16  ? 395 SER C CB    1 
ATOM   8201  O OG    . SER C  1 367 ? -15.541 -15.072 22.056  1.00 25.10  ? 395 SER C OG    1 
ATOM   8202  N N     . GLU C  1 368 ? -14.222 -13.484 18.134  1.00 23.10  ? 396 GLU C N     1 
ATOM   8203  C CA    . GLU C  1 368 ? -13.635 -12.650 17.102  1.00 22.39  ? 396 GLU C CA    1 
ATOM   8204  C C     . GLU C  1 368 ? -14.652 -12.253 16.020  1.00 25.12  ? 396 GLU C C     1 
ATOM   8205  O O     . GLU C  1 368 ? -14.760 -11.089 15.648  1.00 22.29  ? 396 GLU C O     1 
ATOM   8206  C CB    . GLU C  1 368 ? -12.469 -13.391 16.457  1.00 25.63  ? 396 GLU C CB    1 
ATOM   8207  C CG    . GLU C  1 368 ? -11.265 -13.579 17.396  1.00 27.16  ? 396 GLU C CG    1 
ATOM   8208  C CD    . GLU C  1 368 ? -11.556 -14.534 18.566  1.00 33.70  ? 396 GLU C CD    1 
ATOM   8209  O OE1   . GLU C  1 368 ? -12.193 -15.592 18.324  1.00 25.48  ? 396 GLU C OE1   1 
ATOM   8210  O OE2   . GLU C  1 368 ? -11.165 -14.210 19.723  1.00 29.56  ? 396 GLU C OE2   1 
ATOM   8211  N N     . ILE C  1 369 ? -15.379 -13.246 15.519  1.00 20.87  ? 397 ILE C N     1 
ATOM   8212  C CA    . ILE C  1 369 ? -16.400 -13.017 14.528  1.00 24.18  ? 397 ILE C CA    1 
ATOM   8213  C C     . ILE C  1 369 ? -17.472 -12.074 15.101  1.00 19.78  ? 397 ILE C C     1 
ATOM   8214  O O     . ILE C  1 369 ? -17.815 -11.103 14.445  1.00 21.42  ? 397 ILE C O     1 
ATOM   8215  C CB    . ILE C  1 369 ? -16.970 -14.365 13.960  1.00 24.33  ? 397 ILE C CB    1 
ATOM   8216  C CG1   . ILE C  1 369 ? -16.173 -14.778 12.717  1.00 26.97  ? 397 ILE C CG1   1 
ATOM   8217  C CG2   . ILE C  1 369 ? -18.507 -14.258 13.681  1.00 28.08  ? 397 ILE C CG2   1 
ATOM   8218  C CD1   . ILE C  1 369 ? -14.635 -14.856 12.915  1.00 29.11  ? 397 ILE C CD1   1 
ATOM   8219  N N     . GLN C  1 370 ? -17.917 -12.328 16.330  1.00 19.57  ? 398 GLN C N     1 
ATOM   8220  C CA    . GLN C  1 370 ? -18.909 -11.494 17.020  1.00 24.50  ? 398 GLN C CA    1 
ATOM   8221  C C     . GLN C  1 370 ? -18.473 -10.033 17.078  1.00 25.37  ? 398 GLN C C     1 
ATOM   8222  O O     . GLN C  1 370 ? -19.254 -9.151  16.813  1.00 18.50  ? 398 GLN C O     1 
ATOM   8223  C CB    . GLN C  1 370 ? -19.174 -11.945 18.468  1.00 29.07  ? 398 GLN C CB    1 
ATOM   8224  C CG    . GLN C  1 370 ? -19.731 -13.372 18.705  1.00 26.84  ? 398 GLN C CG    1 
ATOM   8225  C CD    . GLN C  1 370 ? -20.912 -13.731 17.842  1.00 33.52  ? 398 GLN C CD    1 
ATOM   8226  O OE1   . GLN C  1 370 ? -21.726 -12.879 17.500  1.00 25.68  ? 398 GLN C OE1   1 
ATOM   8227  N NE2   . GLN C  1 370 ? -21.028 -15.018 17.503  1.00 30.52  ? 398 GLN C NE2   1 
ATOM   8228  N N     . ARG C  1 371 ? -17.216 -9.772  17.436  1.00 18.13  ? 399 ARG C N     1 
ATOM   8229  C CA    . ARG C  1 371 ? -16.715 -8.407  17.445  1.00 22.61  ? 399 ARG C CA    1 
ATOM   8230  C C     . ARG C  1 371 ? -16.756 -7.755  16.072  1.00 23.38  ? 399 ARG C C     1 
ATOM   8231  O O     . ARG C  1 371 ? -17.024 -6.553  15.968  1.00 21.41  ? 399 ARG C O     1 
ATOM   8232  C CB    . ARG C  1 371 ? -15.289 -8.355  18.038  1.00 21.14  ? 399 ARG C CB    1 
ATOM   8233  C CG    . ARG C  1 371 ? -15.262 -8.714  19.520  1.00 22.18  ? 399 ARG C CG    1 
ATOM   8234  C CD    . ARG C  1 371 ? -13.855 -8.651  20.141  1.00 24.57  ? 399 ARG C CD    1 
ATOM   8235  N NE    . ARG C  1 371 ? -14.032 -8.554  21.582  1.00 24.41  ? 399 ARG C NE    1 
ATOM   8236  C CZ    . ARG C  1 371 ? -13.979 -9.562  22.466  1.00 29.96  ? 399 ARG C CZ    1 
ATOM   8237  N NH1   . ARG C  1 371 ? -13.697 -10.804 22.104  1.00 33.85  ? 399 ARG C NH1   1 
ATOM   8238  N NH2   . ARG C  1 371 ? -14.196 -9.311  23.752  1.00 25.77  ? 399 ARG C NH2   1 
ATOM   8239  N N     . LEU C  1 372 ? -16.486 -8.541  15.025  1.00 22.36  ? 400 LEU C N     1 
ATOM   8240  C CA    . LEU C  1 372 ? -16.464 -8.018  13.661  1.00 29.22  ? 400 LEU C CA    1 
ATOM   8241  C C     . LEU C  1 372 ? -17.866 -7.668  13.236  1.00 25.20  ? 400 LEU C C     1 
ATOM   8242  O O     . LEU C  1 372 ? -18.072 -6.657  12.552  1.00 22.64  ? 400 LEU C O     1 
ATOM   8243  C CB    . LEU C  1 372 ? -15.833 -9.018  12.680  1.00 27.52  ? 400 LEU C CB    1 
ATOM   8244  C CG    . LEU C  1 372 ? -14.312 -9.201  12.783  1.00 34.26  ? 400 LEU C CG    1 
ATOM   8245  C CD1   . LEU C  1 372 ? -13.818 -10.192 11.747  1.00 30.52  ? 400 LEU C CD1   1 
ATOM   8246  C CD2   . LEU C  1 372 ? -13.584 -7.863  12.644  1.00 31.68  ? 400 LEU C CD2   1 
ATOM   8247  N N     . VAL C  1 373 ? -18.828 -8.484  13.668  1.00 25.02  ? 401 VAL C N     1 
ATOM   8248  C CA    . VAL C  1 373 ? -20.239 -8.236  13.397  1.00 23.90  ? 401 VAL C CA    1 
ATOM   8249  C C     . VAL C  1 373 ? -20.716 -6.954  14.095  1.00 23.91  ? 401 VAL C C     1 
ATOM   8250  O O     . VAL C  1 373 ? -21.398 -6.120  13.490  1.00 24.46  ? 401 VAL C O     1 
ATOM   8251  C CB    . VAL C  1 373 ? -21.134 -9.448  13.845  1.00 28.08  ? 401 VAL C CB    1 
ATOM   8252  C CG1   . VAL C  1 373 ? -22.614 -9.081  13.891  1.00 22.90  ? 401 VAL C CG1   1 
ATOM   8253  C CG2   . VAL C  1 373 ? -20.885 -10.687 12.935  1.00 29.81  ? 401 VAL C CG2   1 
ATOM   8254  N N     . ILE C  1 374 ? -20.415 -6.827  15.387  1.00 25.46  ? 402 ILE C N     1 
ATOM   8255  C CA    . ILE C  1 374 ? -20.810 -5.638  16.148  1.00 26.91  ? 402 ILE C CA    1 
ATOM   8256  C C     . ILE C  1 374 ? -20.199 -4.360  15.539  1.00 25.21  ? 402 ILE C C     1 
ATOM   8257  O O     . ILE C  1 374 ? -20.907 -3.378  15.331  1.00 21.40  ? 402 ILE C O     1 
ATOM   8258  C CB    . ILE C  1 374 ? -20.395 -5.732  17.639  1.00 25.36  ? 402 ILE C CB    1 
ATOM   8259  C CG1   . ILE C  1 374 ? -21.080 -6.914  18.351  1.00 29.24  ? 402 ILE C CG1   1 
ATOM   8260  C CG2   . ILE C  1 374 ? -20.643 -4.383  18.352  1.00 22.11  ? 402 ILE C CG2   1 
ATOM   8261  C CD1   . ILE C  1 374 ? -20.190 -7.537  19.510  1.00 20.17  ? 402 ILE C CD1   1 
ATOM   8262  N N     . ALA C  1 375 ? -18.886 -4.384  15.289  1.00 17.84  ? 403 ALA C N     1 
ATOM   8263  C CA    . ALA C  1 375 ? -18.161 -3.264  14.678  1.00 25.04  ? 403 ALA C CA    1 
ATOM   8264  C C     . ALA C  1 375 ? -18.759 -2.857  13.340  1.00 26.65  ? 403 ALA C C     1 
ATOM   8265  O O     . ALA C  1 375 ? -18.907 -1.671  13.068  1.00 22.52  ? 403 ALA C O     1 
ATOM   8266  C CB    . ALA C  1 375 ? -16.675 -3.596  14.510  1.00 23.04  ? 403 ALA C CB    1 
ATOM   8267  N N     . GLY C  1 376 ? -19.112 -3.843  12.518  1.00 28.02  ? 404 GLY C N     1 
ATOM   8268  C CA    . GLY C  1 376 ? -19.678 -3.578  11.204  1.00 27.12  ? 404 GLY C CA    1 
ATOM   8269  C C     . GLY C  1 376 ? -20.995 -2.842  11.313  1.00 27.07  ? 404 GLY C C     1 
ATOM   8270  O O     . GLY C  1 376 ? -21.247 -1.888  10.589  1.00 26.19  ? 404 GLY C O     1 
ATOM   8271  N N     . HIS C  1 377 ? -21.832 -3.288  12.240  1.00 27.55  ? 405 HIS C N     1 
ATOM   8272  C CA    . HIS C  1 377 ? -23.129 -2.662  12.451  1.00 28.94  ? 405 HIS C CA    1 
ATOM   8273  C C     . HIS C  1 377 ? -23.030 -1.307  13.116  1.00 29.36  ? 405 HIS C C     1 
ATOM   8274  O O     . HIS C  1 377 ? -23.850 -0.417  12.858  1.00 31.25  ? 405 HIS C O     1 
ATOM   8275  C CB    . HIS C  1 377 ? -24.055 -3.600  13.232  1.00 29.82  ? 405 HIS C CB    1 
ATOM   8276  C CG    . HIS C  1 377 ? -24.721 -4.609  12.355  1.00 40.30  ? 405 HIS C CG    1 
ATOM   8277  N ND1   . HIS C  1 377 ? -24.094 -5.767  11.941  1.00 46.04  ? 405 HIS C ND1   1 
ATOM   8278  C CD2   . HIS C  1 377 ? -25.936 -4.604  11.760  1.00 35.21  ? 405 HIS C CD2   1 
ATOM   8279  C CE1   . HIS C  1 377 ? -24.908 -6.444  11.153  1.00 44.88  ? 405 HIS C CE1   1 
ATOM   8280  N NE2   . HIS C  1 377 ? -26.031 -5.759  11.025  1.00 42.68  ? 405 HIS C NE2   1 
ATOM   8281  N N     . LEU C  1 378 ? -22.021 -1.152  13.971  1.00 31.04  ? 406 LEU C N     1 
ATOM   8282  C CA    . LEU C  1 378 ? -21.766 0.117   14.612  1.00 30.09  ? 406 LEU C CA    1 
ATOM   8283  C C     . LEU C  1 378 ? -21.393 1.125   13.532  1.00 29.24  ? 406 LEU C C     1 
ATOM   8284  O O     . LEU C  1 378 ? -21.989 2.190   13.445  1.00 26.53  ? 406 LEU C O     1 
ATOM   8285  C CB    . LEU C  1 378 ? -20.650 -0.026  15.665  1.00 29.49  ? 406 LEU C CB    1 
ATOM   8286  C CG    . LEU C  1 378 ? -20.351 1.186   16.531  1.00 33.15  ? 406 LEU C CG    1 
ATOM   8287  C CD1   . LEU C  1 378 ? -21.465 1.387   17.519  1.00 33.74  ? 406 LEU C CD1   1 
ATOM   8288  C CD2   . LEU C  1 378 ? -18.968 1.021   17.237  1.00 33.04  ? 406 LEU C CD2   1 
ATOM   8289  N N     . LEU C  1 379 ? -20.412 0.775   12.705  1.00 25.52  ? 407 LEU C N     1 
ATOM   8290  C CA    . LEU C  1 379 ? -19.957 1.671   11.654  1.00 26.91  ? 407 LEU C CA    1 
ATOM   8291  C C     . LEU C  1 379 ? -21.025 1.989   10.569  1.00 33.22  ? 407 LEU C C     1 
ATOM   8292  O O     . LEU C  1 379 ? -21.068 3.124   10.039  1.00 28.37  ? 407 LEU C O     1 
ATOM   8293  C CB    . LEU C  1 379 ? -18.651 1.152   11.038  1.00 25.12  ? 407 LEU C CB    1 
ATOM   8294  C CG    . LEU C  1 379 ? -17.499 1.126   12.050  1.00 31.01  ? 407 LEU C CG    1 
ATOM   8295  C CD1   . LEU C  1 379 ? -16.200 0.511   11.450  1.00 36.44  ? 407 LEU C CD1   1 
ATOM   8296  C CD2   . LEU C  1 379 ? -17.251 2.553   12.589  1.00 27.62  ? 407 LEU C CD2   1 
ATOM   8297  N N     . ARG C  1 380 ? -21.882 1.020   10.245  1.00 31.42  ? 408 ARG C N     1 
ATOM   8298  C CA    . ARG C  1 380 ? -22.970 1.270   9.298   1.00 37.42  ? 408 ARG C CA    1 
ATOM   8299  C C     . ARG C  1 380 ? -23.976 2.264   9.866   1.00 35.52  ? 408 ARG C C     1 
ATOM   8300  O O     . ARG C  1 380 ? -24.454 3.146   9.142   1.00 34.70  ? 408 ARG C O     1 
ATOM   8301  C CB    . ARG C  1 380 ? -23.685 -0.019  8.881   1.00 37.36  ? 408 ARG C CB    1 
ATOM   8302  C CG    . ARG C  1 380 ? -23.006 -0.754  7.750   1.00 43.95  ? 408 ARG C CG    1 
ATOM   8303  C CD    . ARG C  1 380 ? -23.851 -1.928  7.246   1.00 63.01  ? 408 ARG C CD    1 
ATOM   8304  N NE    . ARG C  1 380 ? -23.726 -3.120  8.087   1.00 77.07  ? 408 ARG C NE    1 
ATOM   8305  C CZ    . ARG C  1 380 ? -22.682 -3.955  8.085   1.00 76.29  ? 408 ARG C CZ    1 
ATOM   8306  N NH1   . ARG C  1 380 ? -22.688 -5.010  8.891   1.00 68.30  ? 408 ARG C NH1   1 
ATOM   8307  N NH2   . ARG C  1 380 ? -21.628 -3.745  7.296   1.00 78.01  ? 408 ARG C NH2   1 
ATOM   8308  N N     . SER C  1 381 ? -24.276 2.132   11.155  1.00 34.89  ? 409 SER C N     1 
ATOM   8309  C CA    . SER C  1 381 ? -25.220 3.029   11.808  1.00 38.07  ? 409 SER C CA    1 
ATOM   8310  C C     . SER C  1 381 ? -24.738 4.489   11.781  1.00 37.46  ? 409 SER C C     1 
ATOM   8311  O O     . SER C  1 381 ? -25.536 5.404   11.562  1.00 36.87  ? 409 SER C O     1 
ATOM   8312  C CB    . SER C  1 381 ? -25.512 2.568   13.232  1.00 38.22  ? 409 SER C CB    1 
ATOM   8313  O OG    . SER C  1 381 ? -25.723 3.672   14.087  1.00 51.44  ? 409 SER C OG    1 
ATOM   8314  N N     . TYR C  1 382 ? -23.438 4.708   11.980  1.00 34.41  ? 410 TYR C N     1 
ATOM   8315  C CA    . TYR C  1 382 ? -22.904 6.062   11.968  1.00 33.72  ? 410 TYR C CA    1 
ATOM   8316  C C     . TYR C  1 382 ? -22.880 6.611   10.529  1.00 37.32  ? 410 TYR C C     1 
ATOM   8317  O O     . TYR C  1 382 ? -23.113 7.802   10.324  1.00 38.64  ? 410 TYR C O     1 
ATOM   8318  C CB    . TYR C  1 382 ? -21.514 6.118   12.626  1.00 31.60  ? 410 TYR C CB    1 
ATOM   8319  C CG    . TYR C  1 382 ? -21.472 6.186   14.171  1.00 36.11  ? 410 TYR C CG    1 
ATOM   8320  C CD1   . TYR C  1 382 ? -21.585 5.025   14.964  1.00 33.87  ? 410 TYR C CD1   1 
ATOM   8321  C CD2   . TYR C  1 382 ? -21.247 7.398   14.838  1.00 41.43  ? 410 TYR C CD2   1 
ATOM   8322  C CE1   . TYR C  1 382 ? -21.511 5.075   16.364  1.00 36.93  ? 410 TYR C CE1   1 
ATOM   8323  C CE2   . TYR C  1 382 ? -21.171 7.458   16.266  1.00 37.61  ? 410 TYR C CE2   1 
ATOM   8324  C CZ    . TYR C  1 382 ? -21.304 6.292   17.017  1.00 36.15  ? 410 TYR C CZ    1 
ATOM   8325  O OH    . TYR C  1 382 ? -21.212 6.340   18.408  1.00 32.26  ? 410 TYR C OH    1 
ATOM   8326  N N     . ARG C  1 383 ? -22.619 5.750   9.537   1.00 35.42  ? 411 ARG C N     1 
ATOM   8327  C CA    . ARG C  1 383 ? -22.585 6.165   8.126   1.00 35.37  ? 411 ARG C CA    1 
ATOM   8328  C C     . ARG C  1 383 ? -23.946 6.575   7.605   1.00 37.70  ? 411 ARG C C     1 
ATOM   8329  O O     . ARG C  1 383 ? -24.056 7.479   6.772   1.00 36.05  ? 411 ARG C O     1 
ATOM   8330  C CB    . ARG C  1 383 ? -22.087 5.039   7.242   1.00 36.82  ? 411 ARG C CB    1 
ATOM   8331  C CG    . ARG C  1 383 ? -20.585 4.898   7.254   1.00 28.59  ? 411 ARG C CG    1 
ATOM   8332  C CD    . ARG C  1 383 ? -20.173 3.524   6.860   1.00 37.61  ? 411 ARG C CD    1 
ATOM   8333  N NE    . ARG C  1 383 ? -18.732 3.326   7.054   1.00 33.05  ? 411 ARG C NE    1 
ATOM   8334  C CZ    . ARG C  1 383 ? -18.132 2.141   7.023   1.00 41.01  ? 411 ARG C CZ    1 
ATOM   8335  N NH1   . ARG C  1 383 ? -18.834 1.038   6.801   1.00 40.57  ? 411 ARG C NH1   1 
ATOM   8336  N NH2   . ARG C  1 383 ? -16.826 2.055   7.215   1.00 36.05  ? 411 ARG C NH2   1 
ATOM   8337  N N     . SER C  1 384 ? -24.962 5.873   8.088   1.00 30.86  ? 412 SER C N     1 
ATOM   8338  C CA    . SER C  1 384 ? -26.348 6.200   7.813   1.00 34.36  ? 412 SER C CA    1 
ATOM   8339  C C     . SER C  1 384 ? -26.736 7.565   8.389   1.00 44.56  ? 412 SER C C     1 
ATOM   8340  O O     . SER C  1 384 ? -27.399 8.363   7.722   1.00 49.04  ? 412 SER C O     1 
ATOM   8341  C CB    . SER C  1 384 ? -27.252 5.138   8.432   1.00 33.85  ? 412 SER C CB    1 
ATOM   8342  O OG    . SER C  1 384 ? -27.030 3.873   7.852   1.00 43.91  ? 412 SER C OG    1 
ATOM   8343  N N     . ALA C  1 385 ? -26.350 7.804   9.641   1.00 42.65  ? 413 ALA C N     1 
ATOM   8344  C CA    . ALA C  1 385 ? -26.618 9.072   10.321  1.00 42.96  ? 413 ALA C CA    1 
ATOM   8345  C C     . ALA C  1 385 ? -25.907 10.249  9.628   1.00 41.41  ? 413 ALA C C     1 
ATOM   8346  O O     . ALA C  1 385 ? -26.468 11.344  9.515   1.00 41.92  ? 413 ALA C O     1 
ATOM   8347  C CB    . ALA C  1 385 ? -26.201 8.982   11.779  1.00 40.90  ? 413 ALA C CB    1 
ATOM   8348  N N     . GLU C  1 386 ? -24.681 10.012  9.169   1.00 34.15  ? 414 GLU C N     1 
ATOM   8349  C CA    . GLU C  1 386 ? -23.939 10.987  8.360   1.00 41.55  ? 414 GLU C CA    1 
ATOM   8350  C C     . GLU C  1 386 ? -24.614 11.322  7.029   1.00 46.12  ? 414 GLU C C     1 
ATOM   8351  O O     . GLU C  1 386 ? -24.610 12.484  6.610   1.00 51.89  ? 414 GLU C O     1 
ATOM   8352  C CB    . GLU C  1 386 ? -22.533 10.472  8.030   1.00 41.21  ? 414 GLU C CB    1 
ATOM   8353  C CG    . GLU C  1 386 ? -21.551 10.450  9.187   1.00 48.98  ? 414 GLU C CG    1 
ATOM   8354  C CD    . GLU C  1 386 ? -21.140 11.833  9.634   1.00 58.78  ? 414 GLU C CD    1 
ATOM   8355  O OE1   . GLU C  1 386 ? -21.967 12.482  10.319  1.00 47.88  ? 414 GLU C OE1   1 
ATOM   8356  O OE2   . GLU C  1 386 ? -19.994 12.257  9.316   1.00 43.17  ? 414 GLU C OE2   1 
ATOM   8357  N N     . ASN C  1 387 ? -25.147 10.311  6.347   1.00 48.02  ? 415 ASN C N     1 
ATOM   8358  C CA    . ASN C  1 387 ? -25.768 10.520  5.030   1.00 53.63  ? 415 ASN C CA    1 
ATOM   8359  C C     . ASN C  1 387 ? -27.034 11.367  5.076   1.00 55.73  ? 415 ASN C C     1 
ATOM   8360  O O     . ASN C  1 387 ? -27.340 12.072  4.115   1.00 55.98  ? 415 ASN C O     1 
ATOM   8361  C CB    . ASN C  1 387 ? -26.096 9.186   4.352   1.00 53.17  ? 415 ASN C CB    1 
ATOM   8362  C CG    . ASN C  1 387 ? -24.861 8.370   4.038   1.00 58.93  ? 415 ASN C CG    1 
ATOM   8363  O OD1   . ASN C  1 387 ? -23.737 8.874   4.088   1.00 70.78  ? 415 ASN C OD1   1 
ATOM   8364  N ND2   . ASN C  1 387 ? -25.061 7.092   3.728   1.00 68.24  ? 415 ASN C ND2   1 
ATOM   8365  N N     . LEU C  1 388 ? -27.776 11.294  6.177   1.00 56.31  ? 416 LEU C N     1 
ATOM   8366  C CA    . LEU C  1 388 ? -29.023 12.049  6.288   1.00 60.67  ? 416 LEU C CA    1 
ATOM   8367  C C     . LEU C  1 388 ? -28.794 13.543  6.099   1.00 62.65  ? 416 LEU C C     1 
ATOM   8368  O O     . LEU C  1 388 ? -29.700 14.246  5.659   1.00 66.58  ? 416 LEU C O     1 
ATOM   8369  C CB    . LEU C  1 388 ? -29.729 11.794  7.626   1.00 60.50  ? 416 LEU C CB    1 
ATOM   8370  C CG    . LEU C  1 388 ? -30.665 10.586  7.704   1.00 65.36  ? 416 LEU C CG    1 
ATOM   8371  C CD1   . LEU C  1 388 ? -31.468 10.646  9.003   1.00 57.16  ? 416 LEU C CD1   1 
ATOM   8372  C CD2   . LEU C  1 388 ? -31.603 10.514  6.498   1.00 56.66  ? 416 LEU C CD2   1 
ATOM   8373  N N     . TYR C  1 389 ? -27.592 14.019  6.433   1.00 63.05  ? 417 TYR C N     1 
ATOM   8374  C CA    . TYR C  1 389 ? -27.202 15.404  6.165   1.00 65.30  ? 417 TYR C CA    1 
ATOM   8375  C C     . TYR C  1 389 ? -27.135 15.718  4.660   1.00 68.21  ? 417 TYR C C     1 
ATOM   8376  O O     . TYR C  1 389 ? -27.312 16.875  4.264   1.00 68.29  ? 417 TYR C O     1 
ATOM   8377  C CB    . TYR C  1 389 ? -25.858 15.728  6.824   1.00 65.59  ? 417 TYR C CB    1 
ATOM   8378  C CG    . TYR C  1 389 ? -25.924 15.839  8.332   1.00 73.53  ? 417 TYR C CG    1 
ATOM   8379  C CD1   . TYR C  1 389 ? -25.710 14.725  9.147   1.00 68.37  ? 417 TYR C CD1   1 
ATOM   8380  C CD2   . TYR C  1 389 ? -26.198 17.062  8.947   1.00 77.63  ? 417 TYR C CD2   1 
ATOM   8381  C CE1   . TYR C  1 389 ? -25.768 14.825  10.534  1.00 70.16  ? 417 TYR C CE1   1 
ATOM   8382  C CE2   . TYR C  1 389 ? -26.260 17.176  10.335  1.00 79.53  ? 417 TYR C CE2   1 
ATOM   8383  C CZ    . TYR C  1 389 ? -26.045 16.054  11.124  1.00 81.77  ? 417 TYR C CZ    1 
ATOM   8384  O OH    . TYR C  1 389 ? -26.110 16.166  12.499  1.00 77.00  ? 417 TYR C OH    1 
ATOM   8385  N N     . PHE C  1 390 ? -26.885 14.691  3.837   1.00 69.09  ? 418 PHE C N     1 
ATOM   8386  C CA    . PHE C  1 390 ? -26.719 14.848  2.382   1.00 67.30  ? 418 PHE C CA    1 
ATOM   8387  C C     . PHE C  1 390 ? -27.754 14.067  1.573   1.00 68.48  ? 418 PHE C C     1 
ATOM   8388  O O     . PHE C  1 390 ? -28.919 13.961  1.959   1.00 69.65  ? 418 PHE C O     1 
ATOM   8389  C CB    . PHE C  1 390 ? -25.323 14.383  1.987   1.00 62.83  ? 418 PHE C CB    1 
ATOM   8390  C CG    . PHE C  1 390 ? -24.230 15.156  2.646   1.00 57.51  ? 418 PHE C CG    1 
ATOM   8391  C CD1   . PHE C  1 390 ? -23.682 14.726  3.849   1.00 59.20  ? 418 PHE C CD1   1 
ATOM   8392  C CD2   . PHE C  1 390 ? -23.754 16.327  2.070   1.00 57.97  ? 418 PHE C CD2   1 
ATOM   8393  C CE1   . PHE C  1 390 ? -22.664 15.447  4.464   1.00 64.58  ? 418 PHE C CE1   1 
ATOM   8394  C CE2   . PHE C  1 390 ? -22.745 17.052  2.672   1.00 57.40  ? 418 PHE C CE2   1 
ATOM   8395  C CZ    . PHE C  1 390 ? -22.196 16.612  3.874   1.00 64.46  ? 418 PHE C CZ    1 
ATOM   8396  N N     . LEU D  1 6   ? 22.526  -16.892 29.005  1.00 50.29  ? 34  LEU D N     1 
ATOM   8397  C CA    . LEU D  1 6   ? 22.721  -18.197 29.711  1.00 48.65  ? 34  LEU D CA    1 
ATOM   8398  C C     . LEU D  1 6   ? 24.165  -18.704 29.580  1.00 50.57  ? 34  LEU D C     1 
ATOM   8399  O O     . LEU D  1 6   ? 24.725  -18.683 28.483  1.00 53.68  ? 34  LEU D O     1 
ATOM   8400  C CB    . LEU D  1 6   ? 21.755  -19.254 29.155  1.00 46.93  ? 34  LEU D CB    1 
ATOM   8401  C CG    . LEU D  1 6   ? 20.337  -19.304 29.736  1.00 47.12  ? 34  LEU D CG    1 
ATOM   8402  C CD1   . LEU D  1 6   ? 19.488  -20.400 29.033  1.00 40.98  ? 34  LEU D CD1   1 
ATOM   8403  C CD2   . LEU D  1 6   ? 20.379  -19.520 31.249  1.00 42.53  ? 34  LEU D CD2   1 
ATOM   8404  N N     . PRO D  1 7   ? 24.772  -19.162 30.693  1.00 50.67  ? 35  PRO D N     1 
ATOM   8405  C CA    . PRO D  1 7   ? 26.060  -19.877 30.635  1.00 50.30  ? 35  PRO D CA    1 
ATOM   8406  C C     . PRO D  1 7   ? 26.051  -21.059 29.653  1.00 52.72  ? 35  PRO D C     1 
ATOM   8407  O O     . PRO D  1 7   ? 25.001  -21.678 29.444  1.00 56.06  ? 35  PRO D O     1 
ATOM   8408  C CB    . PRO D  1 7   ? 26.242  -20.406 32.064  1.00 47.43  ? 35  PRO D CB    1 
ATOM   8409  C CG    . PRO D  1 7   ? 25.425  -19.495 32.926  1.00 51.20  ? 35  PRO D CG    1 
ATOM   8410  C CD    . PRO D  1 7   ? 24.280  -19.009 32.077  1.00 51.66  ? 35  PRO D CD    1 
ATOM   8411  N N     . GLU D  1 8   ? 27.212  -21.369 29.070  1.00 53.44  ? 36  GLU D N     1 
ATOM   8412  C CA    . GLU D  1 8   ? 27.345  -22.514 28.147  1.00 52.98  ? 36  GLU D CA    1 
ATOM   8413  C C     . GLU D  1 8   ? 26.739  -23.781 28.752  1.00 51.83  ? 36  GLU D C     1 
ATOM   8414  O O     . GLU D  1 8   ? 26.042  -24.538 28.059  1.00 56.26  ? 36  GLU D O     1 
ATOM   8415  C CB    . GLU D  1 8   ? 28.827  -22.764 27.793  1.00 53.71  ? 36  GLU D CB    1 
ATOM   8416  C CG    . GLU D  1 8   ? 29.138  -24.167 27.249  1.00 60.48  ? 36  GLU D CG    1 
ATOM   8417  N N     . THR D  1 9   ? 26.998  -23.987 30.045  1.00 48.79  ? 37  THR D N     1 
ATOM   8418  C CA    . THR D  1 9   ? 26.535  -25.187 30.754  1.00 48.15  ? 37  THR D CA    1 
ATOM   8419  C C     . THR D  1 9   ? 25.007  -25.256 30.855  1.00 45.76  ? 37  THR D C     1 
ATOM   8420  O O     . THR D  1 9   ? 24.418  -26.333 30.743  1.00 47.61  ? 37  THR D O     1 
ATOM   8421  C CB    . THR D  1 9   ? 27.120  -25.251 32.180  1.00 49.71  ? 37  THR D CB    1 
ATOM   8422  O OG1   . THR D  1 9   ? 26.601  -24.161 32.961  1.00 57.27  ? 37  THR D OG1   1 
ATOM   8423  C CG2   . THR D  1 9   ? 28.662  -25.172 32.137  1.00 45.54  ? 37  THR D CG2   1 
ATOM   8424  N N     . HIS D  1 10  ? 24.385  -24.106 31.098  1.00 42.85  ? 38  HIS D N     1 
ATOM   8425  C CA    . HIS D  1 10  ? 22.929  -24.011 31.159  1.00 43.55  ? 38  HIS D CA    1 
ATOM   8426  C C     . HIS D  1 10  ? 22.294  -24.120 29.762  1.00 41.85  ? 38  HIS D C     1 
ATOM   8427  O O     . HIS D  1 10  ? 21.119  -24.516 29.636  1.00 43.01  ? 38  HIS D O     1 
ATOM   8428  C CB    . HIS D  1 10  ? 22.502  -22.709 31.863  1.00 42.61  ? 38  HIS D CB    1 
ATOM   8429  C CG    . HIS D  1 10  ? 22.708  -22.728 33.348  1.00 42.75  ? 38  HIS D CG    1 
ATOM   8430  N ND1   . HIS D  1 10  ? 23.953  -22.821 33.929  1.00 55.59  ? 38  HIS D ND1   1 
ATOM   8431  C CD2   . HIS D  1 10  ? 21.823  -22.661 34.369  1.00 52.32  ? 38  HIS D CD2   1 
ATOM   8432  C CE1   . HIS D  1 10  ? 23.825  -22.823 35.244  1.00 48.26  ? 38  HIS D CE1   1 
ATOM   8433  N NE2   . HIS D  1 10  ? 22.543  -22.717 35.537  1.00 46.47  ? 38  HIS D NE2   1 
ATOM   8434  N N     . GLN D  1 11  ? 23.054  -23.755 28.723  1.00 43.08  ? 39  GLN D N     1 
ATOM   8435  C CA    . GLN D  1 11  ? 22.629  -23.961 27.330  1.00 42.47  ? 39  GLN D CA    1 
ATOM   8436  C C     . GLN D  1 11  ? 22.629  -25.449 26.969  1.00 41.17  ? 39  GLN D C     1 
ATOM   8437  O O     . GLN D  1 11  ? 21.705  -25.943 26.314  1.00 44.60  ? 39  GLN D O     1 
ATOM   8438  C CB    . GLN D  1 11  ? 23.510  -23.165 26.348  1.00 43.21  ? 39  GLN D CB    1 
ATOM   8439  N N     . MET D  1 12  ? 23.655  -26.172 27.402  1.00 42.55  ? 40  MET D N     1 
ATOM   8440  C CA    . MET D  1 12  ? 23.736  -27.603 27.138  1.00 44.80  ? 40  MET D CA    1 
ATOM   8441  C C     . MET D  1 12  ? 22.705  -28.400 27.936  1.00 42.31  ? 40  MET D C     1 
ATOM   8442  O O     . MET D  1 12  ? 22.250  -29.456 27.498  1.00 44.28  ? 40  MET D O     1 
ATOM   8443  C CB    . MET D  1 12  ? 25.127  -28.125 27.473  1.00 45.27  ? 40  MET D CB    1 
ATOM   8444  C CG    . MET D  1 12  ? 26.176  -27.869 26.412  1.00 59.51  ? 40  MET D CG    1 
ATOM   8445  S SD    . MET D  1 12  ? 27.800  -28.431 26.979  1.00 72.36  ? 40  MET D SD    1 
ATOM   8446  C CE    . MET D  1 12  ? 27.473  -30.150 27.423  1.00 71.85  ? 40  MET D CE    1 
ATOM   8447  N N     . LEU D  1 13  ? 22.364  -27.918 29.127  1.00 41.56  ? 41  LEU D N     1 
ATOM   8448  C CA    . LEU D  1 13  ? 21.293  -28.530 29.918  1.00 37.16  ? 41  LEU D CA    1 
ATOM   8449  C C     . LEU D  1 13  ? 19.956  -28.335 29.213  1.00 31.61  ? 41  LEU D C     1 
ATOM   8450  O O     . LEU D  1 13  ? 19.166  -29.267 29.095  1.00 34.85  ? 41  LEU D O     1 
ATOM   8451  C CB    . LEU D  1 13  ? 21.239  -27.908 31.311  1.00 34.83  ? 41  LEU D CB    1 
ATOM   8452  C CG    . LEU D  1 13  ? 20.017  -28.231 32.165  1.00 40.17  ? 41  LEU D CG    1 
ATOM   8453  C CD1   . LEU D  1 13  ? 20.033  -29.669 32.616  1.00 36.37  ? 41  LEU D CD1   1 
ATOM   8454  C CD2   . LEU D  1 13  ? 20.014  -27.305 33.350  1.00 44.23  ? 41  LEU D CD2   1 
ATOM   8455  N N     . LEU D  1 14  ? 19.694  -27.116 28.760  1.00 35.35  ? 42  LEU D N     1 
ATOM   8456  C CA    . LEU D  1 14  ? 18.404  -26.822 28.115  1.00 34.51  ? 42  LEU D CA    1 
ATOM   8457  C C     . LEU D  1 14  ? 18.177  -27.804 26.936  1.00 37.28  ? 42  LEU D C     1 
ATOM   8458  O O     . LEU D  1 14  ? 17.114  -28.438 26.833  1.00 34.33  ? 42  LEU D O     1 
ATOM   8459  C CB    . LEU D  1 14  ? 18.347  -25.350 27.673  1.00 34.27  ? 42  LEU D CB    1 
ATOM   8460  C CG    . LEU D  1 14  ? 17.043  -24.819 27.041  1.00 35.71  ? 42  LEU D CG    1 
ATOM   8461  C CD1   . LEU D  1 14  ? 16.945  -23.300 27.212  1.00 40.46  ? 42  LEU D CD1   1 
ATOM   8462  C CD2   . LEU D  1 14  ? 16.938  -25.198 25.566  1.00 37.03  ? 42  LEU D CD2   1 
ATOM   8463  N N     . GLN D  1 15  ? 19.206  -27.969 26.099  1.00 35.79  ? 43  GLN D N     1 
ATOM   8464  C CA    . GLN D  1 15  ? 19.150  -28.865 24.951  1.00 36.32  ? 43  GLN D CA    1 
ATOM   8465  C C     . GLN D  1 15  ? 18.976  -30.329 25.328  1.00 35.68  ? 43  GLN D C     1 
ATOM   8466  O O     . GLN D  1 15  ? 18.206  -31.050 24.691  1.00 33.24  ? 43  GLN D O     1 
ATOM   8467  C CB    . GLN D  1 15  ? 20.421  -28.704 24.107  1.00 40.83  ? 43  GLN D CB    1 
ATOM   8468  C CG    . GLN D  1 15  ? 20.351  -29.382 22.726  1.00 47.82  ? 43  GLN D CG    1 
ATOM   8469  C CD    . GLN D  1 15  ? 19.214  -28.849 21.851  1.00 50.59  ? 43  GLN D CD    1 
ATOM   8470  O OE1   . GLN D  1 15  ? 18.764  -27.711 22.004  1.00 54.79  ? 43  GLN D OE1   1 
ATOM   8471  N NE2   . GLN D  1 15  ? 18.751  -29.680 20.927  1.00 52.30  ? 43  GLN D NE2   1 
ATOM   8472  N N     . THR D  1 16  ? 19.719  -30.783 26.339  1.00 35.54  ? 44  THR D N     1 
ATOM   8473  C CA    . THR D  1 16  ? 19.560  -32.138 26.876  1.00 33.67  ? 44  THR D CA    1 
ATOM   8474  C C     . THR D  1 16  ? 18.105  -32.396 27.267  1.00 36.14  ? 44  THR D C     1 
ATOM   8475  O O     . THR D  1 16  ? 17.491  -33.401 26.869  1.00 31.88  ? 44  THR D O     1 
ATOM   8476  C CB    . THR D  1 16  ? 20.467  -32.324 28.110  1.00 37.44  ? 44  THR D CB    1 
ATOM   8477  O OG1   . THR D  1 16  ? 21.832  -32.181 27.708  1.00 41.03  ? 44  THR D OG1   1 
ATOM   8478  C CG2   . THR D  1 16  ? 20.261  -33.681 28.776  1.00 36.59  ? 44  THR D CG2   1 
ATOM   8479  N N     . CYS D  1 17  ? 17.556  -31.463 28.033  1.00 34.71  ? 45  CYS D N     1 
ATOM   8480  C CA    . CYS D  1 17  ? 16.169  -31.543 28.471  1.00 32.48  ? 45  CYS D CA    1 
ATOM   8481  C C     . CYS D  1 17  ? 15.177  -31.444 27.310  1.00 31.22  ? 45  CYS D C     1 
ATOM   8482  O O     . CYS D  1 17  ? 14.221  -32.218 27.247  1.00 31.46  ? 45  CYS D O     1 
ATOM   8483  C CB    . CYS D  1 17  ? 15.893  -30.461 29.511  1.00 34.12  ? 45  CYS D CB    1 
ATOM   8484  S SG    . CYS D  1 17  ? 16.802  -30.737 31.049  1.00 39.68  ? 45  CYS D SG    1 
ATOM   8485  N N     . ARG D  1 18  ? 15.414  -30.515 26.389  1.00 32.86  ? 46  ARG D N     1 
ATOM   8486  C CA    . ARG D  1 18  ? 14.561  -30.399 25.202  1.00 34.81  ? 46  ARG D CA    1 
ATOM   8487  C C     . ARG D  1 18  ? 14.571  -31.720 24.420  1.00 33.29  ? 46  ARG D C     1 
ATOM   8488  O O     . ARG D  1 18  ? 13.518  -32.281 24.101  1.00 29.44  ? 46  ARG D O     1 
ATOM   8489  C CB    . ARG D  1 18  ? 14.992  -29.211 24.318  1.00 32.35  ? 46  ARG D CB    1 
ATOM   8490  C CG    . ARG D  1 18  ? 13.995  -28.910 23.165  1.00 42.65  ? 46  ARG D CG    1 
ATOM   8491  C CD    . ARG D  1 18  ? 13.967  -27.436 22.771  1.00 48.27  ? 46  ARG D CD    1 
ATOM   8492  N N     . ASP D  1 19  ? 15.773  -32.239 24.165  1.00 32.83  ? 47  ASP D N     1 
ATOM   8493  C CA    . ASP D  1 19  ? 15.918  -33.509 23.460  1.00 34.29  ? 47  ASP D CA    1 
ATOM   8494  C C     . ASP D  1 19  ? 15.235  -34.650 24.197  1.00 31.47  ? 47  ASP D C     1 
ATOM   8495  O O     . ASP D  1 19  ? 14.633  -35.520 23.562  1.00 32.03  ? 47  ASP D O     1 
ATOM   8496  C CB    . ASP D  1 19  ? 17.398  -33.840 23.234  1.00 34.38  ? 47  ASP D CB    1 
ATOM   8497  C CG    . ASP D  1 19  ? 18.070  -32.922 22.202  1.00 42.58  ? 47  ASP D CG    1 
ATOM   8498  O OD1   . ASP D  1 19  ? 17.384  -32.102 21.547  1.00 41.64  ? 47  ASP D OD1   1 
ATOM   8499  O OD2   . ASP D  1 19  ? 19.309  -33.014 22.053  1.00 50.76  ? 47  ASP D OD2   1 
ATOM   8500  N N     . PHE D  1 20  ? 15.304  -34.654 25.529  1.00 31.05  ? 48  PHE D N     1 
ATOM   8501  C CA    . PHE D  1 20  ? 14.657  -35.719 26.307  1.00 29.24  ? 48  PHE D CA    1 
ATOM   8502  C C     . PHE D  1 20  ? 13.127  -35.620 26.244  1.00 29.10  ? 48  PHE D C     1 
ATOM   8503  O O     . PHE D  1 20  ? 12.422  -36.624 26.032  1.00 30.93  ? 48  PHE D O     1 
ATOM   8504  C CB    . PHE D  1 20  ? 15.134  -35.730 27.776  1.00 28.95  ? 48  PHE D CB    1 
ATOM   8505  C CG    . PHE D  1 20  ? 14.393  -36.728 28.639  1.00 30.45  ? 48  PHE D CG    1 
ATOM   8506  C CD1   . PHE D  1 20  ? 14.815  -38.048 28.712  1.00 34.40  ? 48  PHE D CD1   1 
ATOM   8507  C CD2   . PHE D  1 20  ? 13.262  -36.353 29.344  1.00 30.09  ? 48  PHE D CD2   1 
ATOM   8508  C CE1   . PHE D  1 20  ? 14.133  -38.976 29.492  1.00 41.17  ? 48  PHE D CE1   1 
ATOM   8509  C CE2   . PHE D  1 20  ? 12.543  -37.278 30.113  1.00 38.68  ? 48  PHE D CE2   1 
ATOM   8510  C CZ    . PHE D  1 20  ? 12.986  -38.592 30.194  1.00 36.29  ? 48  PHE D CZ    1 
ATOM   8511  N N     . ALA D  1 21  ? 12.597  -34.419 26.457  1.00 30.74  ? 49  ALA D N     1 
ATOM   8512  C CA    . ALA D  1 21  ? 11.147  -34.223 26.381  1.00 31.32  ? 49  ALA D CA    1 
ATOM   8513  C C     . ALA D  1 21  ? 10.578  -34.630 25.001  1.00 29.58  ? 49  ALA D C     1 
ATOM   8514  O O     . ALA D  1 21  ? 9.568   -35.347 24.914  1.00 30.01  ? 49  ALA D O     1 
ATOM   8515  C CB    . ALA D  1 21  ? 10.784  -32.767 26.720  1.00 33.48  ? 49  ALA D CB    1 
ATOM   8516  N N     . GLU D  1 22  ? 11.241  -34.209 23.930  1.00 32.11  ? 50  GLU D N     1 
ATOM   8517  C CA    . GLU D  1 22  ? 10.786  -34.542 22.568  1.00 38.07  ? 50  GLU D CA    1 
ATOM   8518  C C     . GLU D  1 22  ? 10.772  -36.045 22.293  1.00 36.15  ? 50  GLU D C     1 
ATOM   8519  O O     . GLU D  1 22  ? 9.812   -36.581 21.729  1.00 32.65  ? 50  GLU D O     1 
ATOM   8520  C CB    . GLU D  1 22  ? 11.582  -33.766 21.509  1.00 37.53  ? 50  GLU D CB    1 
ATOM   8521  C CG    . GLU D  1 22  ? 10.983  -32.368 21.274  1.00 54.27  ? 50  GLU D CG    1 
ATOM   8522  C CD    . GLU D  1 22  ? 11.985  -31.328 20.805  1.00 66.53  ? 50  GLU D CD    1 
ATOM   8523  O OE1   . GLU D  1 22  ? 13.086  -31.714 20.342  1.00 64.38  ? 50  GLU D OE1   1 
ATOM   8524  O OE2   . GLU D  1 22  ? 11.657  -30.119 20.907  1.00 59.80  ? 50  GLU D OE2   1 
ATOM   8525  N N     . LYS D  1 23  ? 11.806  -36.736 22.751  1.00 36.54  ? 51  LYS D N     1 
ATOM   8526  C CA    . LYS D  1 23  ? 11.883  -38.167 22.549  1.00 33.73  ? 51  LYS D CA    1 
ATOM   8527  C C     . LYS D  1 23  ? 10.973  -38.937 23.494  1.00 34.27  ? 51  LYS D C     1 
ATOM   8528  O O     . LYS D  1 23  ? 10.336  -39.904 23.082  1.00 34.92  ? 51  LYS D O     1 
ATOM   8529  C CB    . LYS D  1 23  ? 13.322  -38.624 22.747  1.00 33.62  ? 51  LYS D CB    1 
ATOM   8530  C CG    . LYS D  1 23  ? 13.557  -40.096 22.503  1.00 39.23  ? 51  LYS D CG    1 
ATOM   8531  C CD    . LYS D  1 23  ? 15.004  -40.441 22.820  1.00 43.46  ? 51  LYS D CD    1 
ATOM   8532  C CE    . LYS D  1 23  ? 15.381  -41.841 22.354  1.00 48.06  ? 51  LYS D CE    1 
ATOM   8533  N NZ    . LYS D  1 23  ? 15.415  -41.923 20.861  1.00 57.18  ? 51  LYS D NZ    1 
ATOM   8534  N N     . GLU D  1 24  ? 10.914  -38.530 24.760  1.00 31.32  ? 52  GLU D N     1 
ATOM   8535  C CA    . GLU D  1 24  ? 10.367  -39.405 25.803  1.00 30.78  ? 52  GLU D CA    1 
ATOM   8536  C C     . GLU D  1 24  ? 9.035   -38.975 26.368  1.00 27.56  ? 52  GLU D C     1 
ATOM   8537  O O     . GLU D  1 24  ? 8.267   -39.811 26.829  1.00 26.85  ? 52  GLU D O     1 
ATOM   8538  C CB    . GLU D  1 24  ? 11.353  -39.531 26.967  1.00 33.63  ? 52  GLU D CB    1 
ATOM   8539  C CG    . GLU D  1 24  ? 12.739  -40.057 26.566  1.00 39.17  ? 52  GLU D CG    1 
ATOM   8540  C CD    . GLU D  1 24  ? 12.773  -41.551 26.262  1.00 47.68  ? 52  GLU D CD    1 
ATOM   8541  O OE1   . GLU D  1 24  ? 11.756  -42.252 26.478  1.00 47.91  ? 52  GLU D OE1   1 
ATOM   8542  O OE2   . GLU D  1 24  ? 13.840  -42.020 25.805  1.00 51.02  ? 52  GLU D OE2   1 
ATOM   8543  N N     . LEU D  1 25  ? 8.777   -37.673 26.374  1.00 29.08  ? 53  LEU D N     1 
ATOM   8544  C CA    . LEU D  1 25  ? 7.549   -37.154 26.984  1.00 26.51  ? 53  LEU D CA    1 
ATOM   8545  C C     . LEU D  1 25  ? 6.454   -36.772 25.995  1.00 26.57  ? 53  LEU D C     1 
ATOM   8546  O O     . LEU D  1 25  ? 5.298   -37.117 26.209  1.00 27.02  ? 53  LEU D O     1 
ATOM   8547  C CB    . LEU D  1 25  ? 7.885   -35.982 27.911  1.00 21.91  ? 53  LEU D CB    1 
ATOM   8548  C CG    . LEU D  1 25  ? 8.829   -36.344 29.055  1.00 31.55  ? 53  LEU D CG    1 
ATOM   8549  C CD1   . LEU D  1 25  ? 9.319   -35.096 29.828  1.00 28.46  ? 53  LEU D CD1   1 
ATOM   8550  C CD2   . LEU D  1 25  ? 8.102   -37.331 29.969  1.00 25.73  ? 53  LEU D CD2   1 
ATOM   8551  N N     . PHE D  1 26  ? 6.791   -36.050 24.936  1.00 26.73  ? 54  PHE D N     1 
ATOM   8552  C CA    . PHE D  1 26  ? 5.779   -35.664 23.934  1.00 31.05  ? 54  PHE D CA    1 
ATOM   8553  C C     . PHE D  1 26  ? 4.950   -36.852 23.383  1.00 31.30  ? 54  PHE D C     1 
ATOM   8554  O O     . PHE D  1 26  ? 3.720   -36.766 23.267  1.00 28.26  ? 54  PHE D O     1 
ATOM   8555  C CB    . PHE D  1 26  ? 6.420   -34.853 22.791  1.00 31.04  ? 54  PHE D CB    1 
ATOM   8556  C CG    . PHE D  1 26  ? 6.502   -33.383 23.069  1.00 34.22  ? 54  PHE D CG    1 
ATOM   8557  C CD1   . PHE D  1 26  ? 7.657   -32.812 23.567  1.00 35.65  ? 54  PHE D CD1   1 
ATOM   8558  C CD2   . PHE D  1 26  ? 5.394   -32.565 22.855  1.00 49.45  ? 54  PHE D CD2   1 
ATOM   8559  C CE1   . PHE D  1 26  ? 7.730   -31.461 23.831  1.00 35.42  ? 54  PHE D CE1   1 
ATOM   8560  C CE2   . PHE D  1 26  ? 5.460   -31.208 23.123  1.00 46.08  ? 54  PHE D CE2   1 
ATOM   8561  C CZ    . PHE D  1 26  ? 6.634   -30.659 23.612  1.00 33.93  ? 54  PHE D CZ    1 
ATOM   8562  N N     . PRO D  1 27  ? 5.615   -37.976 23.065  1.00 31.02  ? 55  PRO D N     1 
ATOM   8563  C CA    . PRO D  1 27  ? 4.881   -39.137 22.572  1.00 31.72  ? 55  PRO D CA    1 
ATOM   8564  C C     . PRO D  1 27  ? 3.947   -39.810 23.587  1.00 29.77  ? 55  PRO D C     1 
ATOM   8565  O O     . PRO D  1 27  ? 2.975   -40.434 23.172  1.00 35.61  ? 55  PRO D O     1 
ATOM   8566  C CB    . PRO D  1 27  ? 5.992   -40.090 22.129  1.00 30.84  ? 55  PRO D CB    1 
ATOM   8567  C CG    . PRO D  1 27  ? 7.214   -39.244 22.006  1.00 32.92  ? 55  PRO D CG    1 
ATOM   8568  C CD    . PRO D  1 27  ? 7.066   -38.217 23.071  1.00 29.11  ? 55  PRO D CD    1 
ATOM   8569  N N     . ILE D  1 28  ? 4.214   -39.679 24.887  1.00 29.38  ? 56  ILE D N     1 
ATOM   8570  C CA    . ILE D  1 28  ? 3.331   -40.265 25.914  1.00 29.39  ? 56  ILE D CA    1 
ATOM   8571  C C     . ILE D  1 28  ? 2.323   -39.321 26.556  1.00 27.69  ? 56  ILE D C     1 
ATOM   8572  O O     . ILE D  1 28  ? 1.403   -39.782 27.238  1.00 27.35  ? 56  ILE D O     1 
ATOM   8573  C CB    . ILE D  1 28  ? 4.134   -40.963 27.058  1.00 32.22  ? 56  ILE D CB    1 
ATOM   8574  C CG1   . ILE D  1 28  ? 4.897   -39.943 27.924  1.00 32.43  ? 56  ILE D CG1   1 
ATOM   8575  C CG2   . ILE D  1 28  ? 5.067   -41.983 26.482  1.00 27.52  ? 56  ILE D CG2   1 
ATOM   8576  C CD1   . ILE D  1 28  ? 5.356   -40.505 29.208  1.00 35.24  ? 56  ILE D CD1   1 
ATOM   8577  N N     . ALA D  1 29  ? 2.465   -38.008 26.353  1.00 28.39  ? 57  ALA D N     1 
ATOM   8578  C CA    . ALA D  1 29  ? 1.610   -37.029 27.082  1.00 29.66  ? 57  ALA D CA    1 
ATOM   8579  C C     . ALA D  1 29  ? 0.102   -37.307 27.009  1.00 26.49  ? 57  ALA D C     1 
ATOM   8580  O O     . ALA D  1 29  ? -0.624  -37.241 28.026  1.00 23.24  ? 57  ALA D O     1 
ATOM   8581  C CB    . ALA D  1 29  ? 1.897   -35.607 26.591  1.00 26.55  ? 57  ALA D CB    1 
ATOM   8582  N N     . ALA D  1 30  ? -0.384  -37.588 25.803  1.00 31.19  ? 58  ALA D N     1 
ATOM   8583  C CA    . ALA D  1 30  ? -1.831  -37.804 25.612  1.00 26.98  ? 58  ALA D CA    1 
ATOM   8584  C C     . ALA D  1 30  ? -2.358  -39.004 26.400  1.00 26.38  ? 58  ALA D C     1 
ATOM   8585  O O     . ALA D  1 30  ? -3.417  -38.936 27.035  1.00 27.40  ? 58  ALA D O     1 
ATOM   8586  C CB    . ALA D  1 30  ? -2.173  -37.931 24.125  1.00 30.39  ? 58  ALA D CB    1 
ATOM   8587  N N     . GLN D  1 31  ? -1.607  -40.099 26.374  1.00 28.45  ? 59  GLN D N     1 
ATOM   8588  C CA    . GLN D  1 31  ? -2.013  -41.338 27.057  1.00 30.53  ? 59  GLN D CA    1 
ATOM   8589  C C     . GLN D  1 31  ? -1.987  -41.192 28.590  1.00 26.70  ? 59  GLN D C     1 
ATOM   8590  O O     . GLN D  1 31  ? -2.926  -41.635 29.274  1.00 28.40  ? 59  GLN D O     1 
ATOM   8591  C CB    . GLN D  1 31  ? -1.098  -42.481 26.623  1.00 27.22  ? 59  GLN D CB    1 
ATOM   8592  C CG    . GLN D  1 31  ? -1.312  -43.791 27.380  1.00 32.56  ? 59  GLN D CG    1 
ATOM   8593  C CD    . GLN D  1 31  ? -0.234  -44.810 27.095  1.00 39.56  ? 59  GLN D CD    1 
ATOM   8594  O OE1   . GLN D  1 31  ? 0.742   -44.521 26.392  1.00 44.18  ? 59  GLN D OE1   1 
ATOM   8595  N NE2   . GLN D  1 31  ? -0.395  -46.011 27.646  1.00 39.94  ? 59  GLN D NE2   1 
ATOM   8596  N N     . VAL D  1 32  ? -0.923  -40.562 29.106  1.00 25.04  ? 60  VAL D N     1 
ATOM   8597  C CA    . VAL D  1 32  ? -0.790  -40.256 30.541  1.00 27.06  ? 60  VAL D CA    1 
ATOM   8598  C C     . VAL D  1 32  ? -2.015  -39.515 31.034  1.00 28.79  ? 60  VAL D C     1 
ATOM   8599  O O     . VAL D  1 32  ? -2.626  -39.870 32.039  1.00 25.43  ? 60  VAL D O     1 
ATOM   8600  C CB    . VAL D  1 32  ? 0.474   -39.415 30.824  1.00 29.06  ? 60  VAL D CB    1 
ATOM   8601  C CG1   . VAL D  1 32  ? 0.434   -38.798 32.226  1.00 28.29  ? 60  VAL D CG1   1 
ATOM   8602  C CG2   . VAL D  1 32  ? 1.696   -40.271 30.706  1.00 19.59  ? 60  VAL D CG2   1 
ATOM   8603  N N     . ASP D  1 33  ? -2.373  -38.482 30.285  1.00 25.68  ? 61  ASP D N     1 
ATOM   8604  C CA    . ASP D  1 33  ? -3.524  -37.658 30.602  1.00 24.18  ? 61  ASP D CA    1 
ATOM   8605  C C     . ASP D  1 33  ? -4.844  -38.418 30.483  1.00 24.05  ? 61  ASP D C     1 
ATOM   8606  O O     . ASP D  1 33  ? -5.691  -38.346 31.375  1.00 26.00  ? 61  ASP D O     1 
ATOM   8607  C CB    . ASP D  1 33  ? -3.525  -36.456 29.663  1.00 22.98  ? 61  ASP D CB    1 
ATOM   8608  C CG    . ASP D  1 33  ? -4.796  -35.657 29.762  1.00 28.05  ? 61  ASP D CG    1 
ATOM   8609  O OD1   . ASP D  1 33  ? -5.031  -35.031 30.824  1.00 22.90  ? 61  ASP D OD1   1 
ATOM   8610  O OD2   . ASP D  1 33  ? -5.561  -35.681 28.776  1.00 30.56  ? 61  ASP D OD2   1 
ATOM   8611  N N     . LYS D  1 34  ? -5.010  -39.144 29.379  1.00 22.74  ? 62  LYS D N     1 
ATOM   8612  C CA    . LYS D  1 34  ? -6.233  -39.904 29.127  1.00 28.76  ? 62  LYS D CA    1 
ATOM   8613  C C     . LYS D  1 34  ? -6.483  -41.010 30.174  1.00 28.28  ? 62  LYS D C     1 
ATOM   8614  O O     . LYS D  1 34  ? -7.590  -41.173 30.706  1.00 30.38  ? 62  LYS D O     1 
ATOM   8615  C CB    . LYS D  1 34  ? -6.170  -40.509 27.715  1.00 29.02  ? 62  LYS D CB    1 
ATOM   8616  C CG    . LYS D  1 34  ? -7.457  -41.177 27.285  1.00 27.97  ? 62  LYS D CG    1 
ATOM   8617  C CD    . LYS D  1 34  ? -7.364  -41.775 25.901  1.00 36.69  ? 62  LYS D CD    1 
ATOM   8618  C CE    . LYS D  1 34  ? -8.537  -42.728 25.643  1.00 43.56  ? 62  LYS D CE    1 
ATOM   8619  N NZ    . LYS D  1 34  ? -9.848  -42.054 25.855  1.00 49.29  ? 62  LYS D NZ    1 
ATOM   8620  N N     . GLU D  1 35  ? -5.431  -41.756 30.484  1.00 32.60  ? 63  GLU D N     1 
ATOM   8621  C CA    . GLU D  1 35  ? -5.555  -42.911 31.373  1.00 34.90  ? 63  GLU D CA    1 
ATOM   8622  C C     . GLU D  1 35  ? -5.270  -42.642 32.856  1.00 34.38  ? 63  GLU D C     1 
ATOM   8623  O O     . GLU D  1 35  ? -5.432  -43.550 33.667  1.00 32.87  ? 63  GLU D O     1 
ATOM   8624  C CB    . GLU D  1 35  ? -4.646  -44.019 30.857  1.00 33.73  ? 63  GLU D CB    1 
ATOM   8625  C CG    . GLU D  1 35  ? -4.951  -44.385 29.409  1.00 35.36  ? 63  GLU D CG    1 
ATOM   8626  C CD    . GLU D  1 35  ? -4.045  -45.484 28.868  1.00 44.17  ? 63  GLU D CD    1 
ATOM   8627  O OE1   . GLU D  1 35  ? -3.091  -45.891 29.564  1.00 45.94  ? 63  GLU D OE1   1 
ATOM   8628  O OE2   . GLU D  1 35  ? -4.284  -45.934 27.733  1.00 54.03  ? 63  GLU D OE2   1 
ATOM   8629  N N     . HIS D  1 36  ? -4.897  -41.404 33.213  1.00 32.80  ? 64  HIS D N     1 
ATOM   8630  C CA    . HIS D  1 36  ? -4.491  -41.049 34.592  1.00 29.36  ? 64  HIS D CA    1 
ATOM   8631  C C     . HIS D  1 36  ? -3.334  -41.944 35.004  1.00 27.97  ? 64  HIS D C     1 
ATOM   8632  O O     . HIS D  1 36  ? -3.352  -42.563 36.072  1.00 31.82  ? 64  HIS D O     1 
ATOM   8633  C CB    . HIS D  1 36  ? -5.631  -41.228 35.605  1.00 28.30  ? 64  HIS D CB    1 
ATOM   8634  C CG    . HIS D  1 36  ? -6.868  -40.448 35.293  1.00 36.33  ? 64  HIS D CG    1 
ATOM   8635  N ND1   . HIS D  1 36  ? -7.276  -39.365 36.046  1.00 43.84  ? 64  HIS D ND1   1 
ATOM   8636  C CD2   . HIS D  1 36  ? -7.817  -40.621 34.343  1.00 44.22  ? 64  HIS D CD2   1 
ATOM   8637  C CE1   . HIS D  1 36  ? -8.414  -38.897 35.561  1.00 40.32  ? 64  HIS D CE1   1 
ATOM   8638  N NE2   . HIS D  1 36  ? -8.760  -39.636 34.524  1.00 37.05  ? 64  HIS D NE2   1 
ATOM   8639  N N     . LEU D  1 37  ? -2.323  -42.002 34.151  1.00 32.53  ? 65  LEU D N     1 
ATOM   8640  C CA    . LEU D  1 37  ? -1.314  -43.044 34.219  1.00 28.09  ? 65  LEU D CA    1 
ATOM   8641  C C     . LEU D  1 37  ? 0.039   -42.479 34.618  1.00 26.25  ? 65  LEU D C     1 
ATOM   8642  O O     . LEU D  1 37  ? 0.596   -41.651 33.911  1.00 28.59  ? 65  LEU D O     1 
ATOM   8643  C CB    . LEU D  1 37  ? -1.201  -43.686 32.849  1.00 32.11  ? 65  LEU D CB    1 
ATOM   8644  C CG    . LEU D  1 37  ? -0.136  -44.758 32.637  1.00 35.52  ? 65  LEU D CG    1 
ATOM   8645  C CD1   . LEU D  1 37  ? -0.424  -45.942 33.554  1.00 35.91  ? 65  LEU D CD1   1 
ATOM   8646  C CD2   . LEU D  1 37  ? -0.118  -45.154 31.145  1.00 36.71  ? 65  LEU D CD2   1 
ATOM   8647  N N     . PHE D  1 38  ? 0.565   -42.958 35.739  1.00 28.32  ? 66  PHE D N     1 
ATOM   8648  C CA    . PHE D  1 38  ? 1.851   -42.517 36.252  1.00 27.31  ? 66  PHE D CA    1 
ATOM   8649  C C     . PHE D  1 38  ? 2.954   -42.877 35.276  1.00 28.20  ? 66  PHE D C     1 
ATOM   8650  O O     . PHE D  1 38  ? 3.063   -44.020 34.879  1.00 30.71  ? 66  PHE D O     1 
ATOM   8651  C CB    . PHE D  1 38  ? 2.111   -43.167 37.612  1.00 29.30  ? 66  PHE D CB    1 
ATOM   8652  C CG    . PHE D  1 38  ? 3.379   -42.723 38.244  1.00 25.01  ? 66  PHE D CG    1 
ATOM   8653  C CD1   . PHE D  1 38  ? 3.450   -41.495 38.876  1.00 23.25  ? 66  PHE D CD1   1 
ATOM   8654  C CD2   . PHE D  1 38  ? 4.505   -43.518 38.193  1.00 30.96  ? 66  PHE D CD2   1 
ATOM   8655  C CE1   . PHE D  1 38  ? 4.632   -41.071 39.460  1.00 31.41  ? 66  PHE D CE1   1 
ATOM   8656  C CE2   . PHE D  1 38  ? 5.689   -43.100 38.779  1.00 29.41  ? 66  PHE D CE2   1 
ATOM   8657  C CZ    . PHE D  1 38  ? 5.750   -41.870 39.403  1.00 32.60  ? 66  PHE D CZ    1 
ATOM   8658  N N     . PRO D  1 39  ? 3.760   -41.896 34.858  1.00 30.88  ? 67  PRO D N     1 
ATOM   8659  C CA    . PRO D  1 39  ? 4.816   -42.129 33.867  1.00 28.11  ? 67  PRO D CA    1 
ATOM   8660  C C     . PRO D  1 39  ? 6.098   -42.764 34.437  1.00 28.37  ? 67  PRO D C     1 
ATOM   8661  O O     . PRO D  1 39  ? 7.212   -42.218 34.302  1.00 29.29  ? 67  PRO D O     1 
ATOM   8662  C CB    . PRO D  1 39  ? 5.062   -40.736 33.309  1.00 27.55  ? 67  PRO D CB    1 
ATOM   8663  C CG    . PRO D  1 39  ? 4.729   -39.807 34.449  1.00 29.27  ? 67  PRO D CG    1 
ATOM   8664  C CD    . PRO D  1 39  ? 3.678   -40.482 35.268  1.00 28.16  ? 67  PRO D CD    1 
ATOM   8665  N N     . ALA D  1 40  ? 5.922   -43.944 35.017  1.00 29.83  ? 68  ALA D N     1 
ATOM   8666  C CA    . ALA D  1 40  ? 6.936   -44.598 35.827  1.00 26.29  ? 68  ALA D CA    1 
ATOM   8667  C C     . ALA D  1 40  ? 8.281   -44.805 35.105  1.00 26.76  ? 68  ALA D C     1 
ATOM   8668  O O     . ALA D  1 40  ? 9.321   -44.519 35.671  1.00 28.77  ? 68  ALA D O     1 
ATOM   8669  C CB    . ALA D  1 40  ? 6.403   -45.922 36.363  1.00 26.76  ? 68  ALA D CB    1 
ATOM   8670  N N     . ALA D  1 41  ? 8.250   -45.259 33.852  1.00 30.95  ? 69  ALA D N     1 
ATOM   8671  C CA    . ALA D  1 41  ? 9.486   -45.553 33.113  1.00 30.95  ? 69  ALA D CA    1 
ATOM   8672  C C     . ALA D  1 41  ? 10.240  -44.280 32.788  1.00 31.51  ? 69  ALA D C     1 
ATOM   8673  O O     . ALA D  1 41  ? 11.465  -44.235 32.844  1.00 29.43  ? 69  ALA D O     1 
ATOM   8674  C CB    . ALA D  1 41  ? 9.172   -46.316 31.843  1.00 31.48  ? 69  ALA D CB    1 
ATOM   8675  N N     . GLN D  1 42  ? 9.500   -43.218 32.476  1.00 30.76  ? 70  GLN D N     1 
ATOM   8676  C CA    . GLN D  1 42  ? 10.133  -41.948 32.114  1.00 30.12  ? 70  GLN D CA    1 
ATOM   8677  C C     . GLN D  1 42  ? 10.724  -41.253 33.338  1.00 27.26  ? 70  GLN D C     1 
ATOM   8678  O O     . GLN D  1 42  ? 11.783  -40.635 33.241  1.00 28.88  ? 70  GLN D O     1 
ATOM   8679  C CB    . GLN D  1 42  ? 9.135   -41.057 31.386  1.00 28.75  ? 70  GLN D CB    1 
ATOM   8680  C CG    . GLN D  1 42  ? 8.692   -41.644 30.053  1.00 31.99  ? 70  GLN D CG    1 
ATOM   8681  C CD    . GLN D  1 42  ? 7.604   -42.712 30.170  1.00 31.77  ? 70  GLN D CD    1 
ATOM   8682  O OE1   . GLN D  1 42  ? 7.028   -42.938 31.231  1.00 28.25  ? 70  GLN D OE1   1 
ATOM   8683  N NE2   . GLN D  1 42  ? 7.332   -43.375 29.065  1.00 29.74  ? 70  GLN D NE2   1 
ATOM   8684  N N     . VAL D  1 43  ? 10.056  -41.381 34.484  1.00 27.15  ? 71  VAL D N     1 
ATOM   8685  C CA    . VAL D  1 43  ? 10.573  -40.798 35.732  1.00 29.46  ? 71  VAL D CA    1 
ATOM   8686  C C     . VAL D  1 43  ? 11.909  -41.429 36.141  1.00 30.61  ? 71  VAL D C     1 
ATOM   8687  O O     . VAL D  1 43  ? 12.853  -40.713 36.516  1.00 27.57  ? 71  VAL D O     1 
ATOM   8688  C CB    . VAL D  1 43  ? 9.547   -40.897 36.861  1.00 31.94  ? 71  VAL D CB    1 
ATOM   8689  C CG1   . VAL D  1 43  ? 10.187  -40.560 38.223  1.00 28.66  ? 71  VAL D CG1   1 
ATOM   8690  C CG2   . VAL D  1 43  ? 8.381   -39.971 36.555  1.00 26.35  ? 71  VAL D CG2   1 
ATOM   8691  N N     . LYS D  1 44  ? 11.983  -42.757 36.008  1.00 31.54  ? 72  LYS D N     1 
ATOM   8692  C CA    . LYS D  1 44  ? 13.204  -43.516 36.270  1.00 32.57  ? 72  LYS D CA    1 
ATOM   8693  C C     . LYS D  1 44  ? 14.319  -43.060 35.335  1.00 30.01  ? 72  LYS D C     1 
ATOM   8694  O O     . LYS D  1 44  ? 15.463  -42.903 35.771  1.00 32.01  ? 72  LYS D O     1 
ATOM   8695  C CB    . LYS D  1 44  ? 12.939  -45.019 36.127  1.00 33.86  ? 72  LYS D CB    1 
ATOM   8696  C CG    . LYS D  1 44  ? 14.176  -45.912 36.233  1.00 40.82  ? 72  LYS D CG    1 
ATOM   8697  C CD    . LYS D  1 44  ? 14.924  -45.735 37.574  1.00 44.70  ? 72  LYS D CD    1 
ATOM   8698  C CE    . LYS D  1 44  ? 16.070  -46.740 37.721  1.00 53.29  ? 72  LYS D CE    1 
ATOM   8699  N NZ    . LYS D  1 44  ? 16.960  -46.813 36.533  1.00 57.16  ? 72  LYS D NZ    1 
ATOM   8700  N N     . LYS D  1 45  ? 13.997  -42.849 34.056  1.00 31.63  ? 73  LYS D N     1 
ATOM   8701  C CA    . LYS D  1 45  ? 14.984  -42.296 33.123  1.00 31.23  ? 73  LYS D CA    1 
ATOM   8702  C C     . LYS D  1 45  ? 15.452  -40.894 33.530  1.00 32.87  ? 73  LYS D C     1 
ATOM   8703  O O     . LYS D  1 45  ? 16.648  -40.602 33.493  1.00 34.34  ? 73  LYS D O     1 
ATOM   8704  C CB    . LYS D  1 45  ? 14.436  -42.277 31.689  1.00 34.84  ? 73  LYS D CB    1 
ATOM   8705  C CG    . LYS D  1 45  ? 14.241  -43.657 31.092  1.00 38.51  ? 73  LYS D CG    1 
ATOM   8706  C CD    . LYS D  1 45  ? 13.747  -43.588 29.664  1.00 45.06  ? 73  LYS D CD    1 
ATOM   8707  C CE    . LYS D  1 45  ? 13.620  -44.979 29.049  1.00 50.89  ? 73  LYS D CE    1 
ATOM   8708  N NZ    . LYS D  1 45  ? 13.652  -44.900 27.558  1.00 68.04  ? 73  LYS D NZ    1 
ATOM   8709  N N     . MET D  1 46  ? 14.511  -40.027 33.900  1.00 31.83  ? 74  MET D N     1 
ATOM   8710  C CA    . MET D  1 46  ? 14.840  -38.698 34.473  1.00 33.83  ? 74  MET D CA    1 
ATOM   8711  C C     . MET D  1 46  ? 15.710  -38.782 35.735  1.00 29.19  ? 74  MET D C     1 
ATOM   8712  O O     . MET D  1 46  ? 16.636  -37.983 35.921  1.00 29.70  ? 74  MET D O     1 
ATOM   8713  C CB    . MET D  1 46  ? 13.551  -37.936 34.804  1.00 31.17  ? 74  MET D CB    1 
ATOM   8714  C CG    . MET D  1 46  ? 12.808  -37.455 33.576  1.00 34.68  ? 74  MET D CG    1 
ATOM   8715  S SD    . MET D  1 46  ? 11.139  -36.921 33.954  1.00 39.96  ? 74  MET D SD    1 
ATOM   8716  C CE    . MET D  1 46  ? 11.484  -35.449 34.931  1.00 34.93  ? 74  MET D CE    1 
ATOM   8717  N N     . GLY D  1 47  ? 15.367  -39.730 36.606  1.00 29.65  ? 75  GLY D N     1 
ATOM   8718  C CA    . GLY D  1 47  ? 16.194  -40.079 37.751  1.00 31.74  ? 75  GLY D CA    1 
ATOM   8719  C C     . GLY D  1 47  ? 17.658  -40.260 37.374  1.00 31.57  ? 75  GLY D C     1 
ATOM   8720  O O     . GLY D  1 47  ? 18.530  -39.613 37.950  1.00 30.91  ? 75  GLY D O     1 
ATOM   8721  N N     . GLY D  1 48  ? 17.912  -41.123 36.390  1.00 33.29  ? 76  GLY D N     1 
ATOM   8722  C CA    . GLY D  1 48  ? 19.270  -41.392 35.901  1.00 34.84  ? 76  GLY D CA    1 
ATOM   8723  C C     . GLY D  1 48  ? 19.993  -40.197 35.317  1.00 36.25  ? 76  GLY D C     1 
ATOM   8724  O O     . GLY D  1 48  ? 21.235  -40.141 35.334  1.00 37.91  ? 76  GLY D O     1 
ATOM   8725  N N     . LEU D  1 49  ? 19.241  -39.239 34.781  1.00 34.13  ? 77  LEU D N     1 
ATOM   8726  C CA    . LEU D  1 49  ? 19.847  -38.015 34.234  1.00 30.29  ? 77  LEU D CA    1 
ATOM   8727  C C     . LEU D  1 49  ? 20.096  -36.924 35.287  1.00 33.20  ? 77  LEU D C     1 
ATOM   8728  O O     . LEU D  1 49  ? 20.628  -35.871 34.960  1.00 37.47  ? 77  LEU D O     1 
ATOM   8729  C CB    . LEU D  1 49  ? 18.990  -37.456 33.089  1.00 30.30  ? 77  LEU D CB    1 
ATOM   8730  C CG    . LEU D  1 49  ? 19.057  -38.202 31.750  1.00 36.53  ? 77  LEU D CG    1 
ATOM   8731  C CD1   . LEU D  1 49  ? 17.974  -37.733 30.791  1.00 37.02  ? 77  LEU D CD1   1 
ATOM   8732  C CD2   . LEU D  1 49  ? 20.443  -38.051 31.103  1.00 37.45  ? 77  LEU D CD2   1 
ATOM   8733  N N     . GLY D  1 50  ? 19.710  -37.161 36.541  1.00 31.57  ? 78  GLY D N     1 
ATOM   8734  C CA    . GLY D  1 50  ? 19.909  -36.175 37.604  1.00 30.60  ? 78  GLY D CA    1 
ATOM   8735  C C     . GLY D  1 50  ? 18.782  -35.163 37.791  1.00 29.98  ? 78  GLY D C     1 
ATOM   8736  O O     . GLY D  1 50  ? 18.904  -34.250 38.606  1.00 32.13  ? 78  GLY D O     1 
ATOM   8737  N N     . LEU D  1 51  ? 17.674  -35.346 37.078  1.00 31.01  ? 79  LEU D N     1 
ATOM   8738  C CA    . LEU D  1 51  ? 16.610  -34.343 37.010  1.00 29.21  ? 79  LEU D CA    1 
ATOM   8739  C C     . LEU D  1 51  ? 15.694  -34.363 38.214  1.00 29.49  ? 79  LEU D C     1 
ATOM   8740  O O     . LEU D  1 51  ? 14.983  -33.392 38.458  1.00 25.83  ? 79  LEU D O     1 
ATOM   8741  C CB    . LEU D  1 51  ? 15.746  -34.542 35.747  1.00 28.47  ? 79  LEU D CB    1 
ATOM   8742  C CG    . LEU D  1 51  ? 16.379  -34.345 34.372  1.00 29.14  ? 79  LEU D CG    1 
ATOM   8743  C CD1   . LEU D  1 51  ? 15.393  -34.781 33.282  1.00 31.86  ? 79  LEU D CD1   1 
ATOM   8744  C CD2   . LEU D  1 51  ? 16.815  -32.884 34.200  1.00 30.97  ? 79  LEU D CD2   1 
ATOM   8745  N N     . LEU D  1 52  ? 15.673  -35.470 38.952  1.00 29.49  ? 80  LEU D N     1 
ATOM   8746  C CA    . LEU D  1 52  ? 14.892  -35.523 40.190  1.00 31.16  ? 80  LEU D CA    1 
ATOM   8747  C C     . LEU D  1 52  ? 15.699  -35.043 41.423  1.00 29.97  ? 80  LEU D C     1 
ATOM   8748  O O     . LEU D  1 52  ? 15.142  -34.999 42.524  1.00 33.65  ? 80  LEU D O     1 
ATOM   8749  C CB    . LEU D  1 52  ? 14.341  -36.924 40.420  1.00 31.46  ? 80  LEU D CB    1 
ATOM   8750  C CG    . LEU D  1 52  ? 13.707  -37.627 39.217  1.00 30.34  ? 80  LEU D CG    1 
ATOM   8751  C CD1   . LEU D  1 52  ? 13.137  -38.966 39.689  1.00 30.46  ? 80  LEU D CD1   1 
ATOM   8752  C CD2   . LEU D  1 52  ? 12.635  -36.771 38.559  1.00 40.62  ? 80  LEU D CD2   1 
ATOM   8753  N N     . ALA D  1 53  ? 16.970  -34.665 41.232  1.00 26.82  ? 81  ALA D N     1 
ATOM   8754  C CA    . ALA D  1 53  ? 17.805  -34.099 42.322  1.00 28.78  ? 81  ALA D CA    1 
ATOM   8755  C C     . ALA D  1 53  ? 18.852  -33.099 41.824  1.00 29.88  ? 81  ALA D C     1 
ATOM   8756  O O     . ALA D  1 53  ? 20.078  -33.290 41.973  1.00 30.16  ? 81  ALA D O     1 
ATOM   8757  C CB    . ALA D  1 53  ? 18.488  -35.233 43.133  1.00 26.51  ? 81  ALA D CB    1 
ATOM   8758  N N     . MET D  1 54  ? 18.376  -31.998 41.275  1.00 31.04  ? 82  MET D N     1 
ATOM   8759  C CA    . MET D  1 54  ? 19.238  -31.098 40.509  1.00 31.61  ? 82  MET D CA    1 
ATOM   8760  C C     . MET D  1 54  ? 20.173  -30.246 41.368  1.00 29.82  ? 82  MET D C     1 
ATOM   8761  O O     . MET D  1 54  ? 21.351  -30.028 41.017  1.00 34.38  ? 82  MET D O     1 
ATOM   8762  C CB    . MET D  1 54  ? 18.360  -30.180 39.682  1.00 32.34  ? 82  MET D CB    1 
ATOM   8763  C CG    . MET D  1 54  ? 17.460  -30.914 38.717  1.00 33.25  ? 82  MET D CG    1 
ATOM   8764  S SD    . MET D  1 54  ? 17.553  -30.079 37.152  1.00 46.21  ? 82  MET D SD    1 
ATOM   8765  C CE    . MET D  1 54  ? 19.088  -30.753 36.533  1.00 35.28  ? 82  MET D CE    1 
ATOM   8766  N N     . ASP D  1 55  ? 19.628  -29.781 42.488  1.00 30.36  ? 83  ASP D N     1 
ATOM   8767  C CA    . ASP D  1 55  ? 20.291  -28.870 43.415  1.00 35.68  ? 83  ASP D CA    1 
ATOM   8768  C C     . ASP D  1 55  ? 20.861  -29.659 44.594  1.00 35.08  ? 83  ASP D C     1 
ATOM   8769  O O     . ASP D  1 55  ? 21.160  -29.092 45.638  1.00 41.15  ? 83  ASP D O     1 
ATOM   8770  C CB    . ASP D  1 55  ? 19.258  -27.845 43.915  1.00 37.62  ? 83  ASP D CB    1 
ATOM   8771  C CG    . ASP D  1 55  ? 19.885  -26.614 44.568  1.00 50.16  ? 83  ASP D CG    1 
ATOM   8772  O OD1   . ASP D  1 55  ? 20.908  -26.099 44.062  1.00 48.62  ? 83  ASP D OD1   1 
ATOM   8773  O OD2   . ASP D  1 55  ? 19.321  -26.144 45.585  1.00 51.98  ? 83  ASP D OD2   1 
ATOM   8774  N N     . VAL D  1 56  ? 20.968  -30.976 44.443  1.00 34.81  ? 84  VAL D N     1 
ATOM   8775  C CA    . VAL D  1 56  ? 21.569  -31.834 45.462  1.00 31.10  ? 84  VAL D CA    1 
ATOM   8776  C C     . VAL D  1 56  ? 23.062  -32.018 45.141  1.00 31.31  ? 84  VAL D C     1 
ATOM   8777  O O     . VAL D  1 56  ? 23.438  -32.262 43.994  1.00 32.44  ? 84  VAL D O     1 
ATOM   8778  C CB    . VAL D  1 56  ? 20.829  -33.181 45.534  1.00 32.74  ? 84  VAL D CB    1 
ATOM   8779  C CG1   . VAL D  1 56  ? 21.392  -34.070 46.611  1.00 26.04  ? 84  VAL D CG1   1 
ATOM   8780  C CG2   . VAL D  1 56  ? 19.320  -32.945 45.774  1.00 27.53  ? 84  VAL D CG2   1 
ATOM   8781  N N     . PRO D  1 57  ? 23.924  -31.877 46.150  1.00 34.69  ? 85  PRO D N     1 
ATOM   8782  C CA    . PRO D  1 57  ? 25.359  -32.075 45.893  1.00 33.80  ? 85  PRO D CA    1 
ATOM   8783  C C     . PRO D  1 57  ? 25.642  -33.479 45.354  1.00 31.43  ? 85  PRO D C     1 
ATOM   8784  O O     . PRO D  1 57  ? 24.997  -34.444 45.779  1.00 30.40  ? 85  PRO D O     1 
ATOM   8785  C CB    . PRO D  1 57  ? 25.991  -31.899 47.275  1.00 33.97  ? 85  PRO D CB    1 
ATOM   8786  C CG    . PRO D  1 57  ? 24.984  -31.170 48.083  1.00 36.18  ? 85  PRO D CG    1 
ATOM   8787  C CD    . PRO D  1 57  ? 23.654  -31.563 47.567  1.00 32.64  ? 85  PRO D CD    1 
ATOM   8788  N N     . GLU D  1 58  ? 26.586  -33.596 44.422  1.00 33.98  ? 86  GLU D N     1 
ATOM   8789  C CA    . GLU D  1 58  ? 26.915  -34.897 43.844  1.00 36.67  ? 86  GLU D CA    1 
ATOM   8790  C C     . GLU D  1 58  ? 27.271  -35.917 44.908  1.00 34.26  ? 86  GLU D C     1 
ATOM   8791  O O     . GLU D  1 58  ? 26.872  -37.070 44.787  1.00 33.16  ? 86  GLU D O     1 
ATOM   8792  C CB    . GLU D  1 58  ? 28.046  -34.792 42.823  1.00 38.39  ? 86  GLU D CB    1 
ATOM   8793  C CG    . GLU D  1 58  ? 27.596  -34.194 41.502  1.00 49.71  ? 86  GLU D CG    1 
ATOM   8794  C CD    . GLU D  1 58  ? 28.762  -33.777 40.640  1.00 63.95  ? 86  GLU D CD    1 
ATOM   8795  O OE1   . GLU D  1 58  ? 29.399  -32.749 40.965  1.00 70.57  ? 86  GLU D OE1   1 
ATOM   8796  O OE2   . GLU D  1 58  ? 29.040  -34.478 39.641  1.00 63.91  ? 86  GLU D OE2   1 
ATOM   8797  N N     . GLU D  1 59  ? 27.966  -35.487 45.966  1.00 37.70  ? 87  GLU D N     1 
ATOM   8798  C CA    . GLU D  1 59  ? 28.403  -36.408 47.021  1.00 38.66  ? 87  GLU D CA    1 
ATOM   8799  C C     . GLU D  1 59  ? 27.228  -37.057 47.758  1.00 37.76  ? 87  GLU D C     1 
ATOM   8800  O O     . GLU D  1 59  ? 27.409  -38.085 48.408  1.00 38.28  ? 87  GLU D O     1 
ATOM   8801  C CB    . GLU D  1 59  ? 29.365  -35.737 48.013  1.00 37.49  ? 87  GLU D CB    1 
ATOM   8802  C CG    . GLU D  1 59  ? 28.771  -34.608 48.843  1.00 60.70  ? 87  GLU D CG    1 
ATOM   8803  C CD    . GLU D  1 59  ? 29.297  -34.594 50.273  1.00 71.25  ? 87  GLU D CD    1 
ATOM   8804  O OE1   . GLU D  1 59  ? 28.466  -34.521 51.204  1.00 72.50  ? 87  GLU D OE1   1 
ATOM   8805  O OE2   . GLU D  1 59  ? 30.532  -34.671 50.467  1.00 76.93  ? 87  GLU D OE2   1 
ATOM   8806  N N     . LEU D  1 60  ? 26.036  -36.459 47.652  1.00 36.90  ? 88  LEU D N     1 
ATOM   8807  C CA    . LEU D  1 60  ? 24.797  -37.065 48.156  1.00 32.25  ? 88  LEU D CA    1 
ATOM   8808  C C     . LEU D  1 60  ? 24.011  -37.752 47.030  1.00 32.17  ? 88  LEU D C     1 
ATOM   8809  O O     . LEU D  1 60  ? 22.924  -38.314 47.251  1.00 35.17  ? 88  LEU D O     1 
ATOM   8810  C CB    . LEU D  1 60  ? 23.936  -36.011 48.859  1.00 33.52  ? 88  LEU D CB    1 
ATOM   8811  C CG    . LEU D  1 60  ? 24.326  -35.553 50.272  1.00 35.47  ? 88  LEU D CG    1 
ATOM   8812  C CD1   . LEU D  1 60  ? 23.550  -34.279 50.632  1.00 33.86  ? 88  LEU D CD1   1 
ATOM   8813  C CD2   . LEU D  1 60  ? 24.072  -36.660 51.312  1.00 28.61  ? 88  LEU D CD2   1 
ATOM   8814  N N     . GLY D  1 61  ? 24.571  -37.688 45.826  1.00 31.64  ? 89  GLY D N     1 
ATOM   8815  C CA    . GLY D  1 61  ? 24.052  -38.378 44.668  1.00 32.85  ? 89  GLY D CA    1 
ATOM   8816  C C     . GLY D  1 61  ? 23.178  -37.536 43.760  1.00 33.36  ? 89  GLY D C     1 
ATOM   8817  O O     . GLY D  1 61  ? 22.445  -38.088 42.948  1.00 33.95  ? 89  GLY D O     1 
ATOM   8818  N N     . GLY D  1 62  ? 23.262  -36.215 43.895  1.00 34.44  ? 90  GLY D N     1 
ATOM   8819  C CA    . GLY D  1 62  ? 22.513  -35.274 43.055  1.00 33.51  ? 90  GLY D CA    1 
ATOM   8820  C C     . GLY D  1 62  ? 23.333  -34.765 41.883  1.00 35.44  ? 90  GLY D C     1 
ATOM   8821  O O     . GLY D  1 62  ? 24.475  -35.167 41.726  1.00 33.03  ? 90  GLY D O     1 
ATOM   8822  N N     . ALA D  1 63  ? 22.753  -33.888 41.058  1.00 30.92  ? 91  ALA D N     1 
ATOM   8823  C CA    . ALA D  1 63  ? 23.451  -33.351 39.889  1.00 30.82  ? 91  ALA D CA    1 
ATOM   8824  C C     . ALA D  1 63  ? 24.461  -32.232 40.207  1.00 30.78  ? 91  ALA D C     1 
ATOM   8825  O O     . ALA D  1 63  ? 25.300  -31.884 39.369  1.00 30.48  ? 91  ALA D O     1 
ATOM   8826  C CB    . ALA D  1 63  ? 22.438  -32.872 38.832  1.00 29.26  ? 91  ALA D CB    1 
ATOM   8827  N N     . GLY D  1 64  ? 24.378  -31.650 41.400  1.00 33.77  ? 92  GLY D N     1 
ATOM   8828  C CA    . GLY D  1 64  ? 25.296  -30.564 41.773  1.00 32.29  ? 92  GLY D CA    1 
ATOM   8829  C C     . GLY D  1 64  ? 25.110  -29.280 40.966  1.00 32.89  ? 92  GLY D C     1 
ATOM   8830  O O     . GLY D  1 64  ? 26.048  -28.506 40.809  1.00 33.06  ? 92  GLY D O     1 
ATOM   8831  N N     . LEU D  1 65  ? 23.903  -29.058 40.450  1.00 32.44  ? 93  LEU D N     1 
ATOM   8832  C CA    . LEU D  1 65  ? 23.567  -27.845 39.682  1.00 32.10  ? 93  LEU D CA    1 
ATOM   8833  C C     . LEU D  1 65  ? 22.917  -26.819 40.607  1.00 32.70  ? 93  LEU D C     1 
ATOM   8834  O O     . LEU D  1 65  ? 23.018  -26.939 41.818  1.00 36.93  ? 93  LEU D O     1 
ATOM   8835  C CB    . LEU D  1 65  ? 22.626  -28.208 38.531  1.00 31.29  ? 93  LEU D CB    1 
ATOM   8836  C CG    . LEU D  1 65  ? 23.177  -29.224 37.535  1.00 34.07  ? 93  LEU D CG    1 
ATOM   8837  C CD1   . LEU D  1 65  ? 22.223  -29.400 36.377  1.00 31.01  ? 93  LEU D CD1   1 
ATOM   8838  C CD2   . LEU D  1 65  ? 24.489  -28.704 37.056  1.00 29.89  ? 93  LEU D CD2   1 
ATOM   8839  N N     . ASP D  1 66  ? 22.243  -25.817 40.050  1.00 35.85  ? 94  ASP D N     1 
ATOM   8840  C CA    . ASP D  1 66  ? 21.661  -24.743 40.864  1.00 32.60  ? 94  ASP D CA    1 
ATOM   8841  C C     . ASP D  1 66  ? 20.180  -24.566 40.529  1.00 29.82  ? 94  ASP D C     1 
ATOM   8842  O O     . ASP D  1 66  ? 19.620  -25.344 39.744  1.00 25.96  ? 94  ASP D O     1 
ATOM   8843  C CB    . ASP D  1 66  ? 22.452  -23.450 40.663  1.00 32.95  ? 94  ASP D CB    1 
ATOM   8844  C CG    . ASP D  1 66  ? 22.516  -23.013 39.209  1.00 32.32  ? 94  ASP D CG    1 
ATOM   8845  O OD1   . ASP D  1 66  ? 21.661  -23.418 38.385  1.00 34.61  ? 94  ASP D OD1   1 
ATOM   8846  O OD2   . ASP D  1 66  ? 23.447  -22.258 38.888  1.00 42.16  ? 94  ASP D OD2   1 
ATOM   8847  N N     . TYR D  1 67  ? 19.541  -23.578 41.141  1.00 29.84  ? 95  TYR D N     1 
ATOM   8848  C CA    . TYR D  1 67  ? 18.109  -23.366 40.894  1.00 26.07  ? 95  TYR D CA    1 
ATOM   8849  C C     . TYR D  1 67  ? 17.783  -22.732 39.539  1.00 26.04  ? 95  TYR D C     1 
ATOM   8850  O O     . TYR D  1 67  ? 16.656  -22.845 39.082  1.00 25.81  ? 95  TYR D O     1 
ATOM   8851  C CB    . TYR D  1 67  ? 17.415  -22.618 42.054  1.00 26.24  ? 95  TYR D CB    1 
ATOM   8852  C CG    . TYR D  1 67  ? 16.477  -23.521 42.825  1.00 32.22  ? 95  TYR D CG    1 
ATOM   8853  C CD1   . TYR D  1 67  ? 15.138  -23.205 42.982  1.00 28.74  ? 95  TYR D CD1   1 
ATOM   8854  C CD2   . TYR D  1 67  ? 16.930  -24.716 43.365  1.00 24.24  ? 95  TYR D CD2   1 
ATOM   8855  C CE1   . TYR D  1 67  ? 14.287  -24.055 43.672  1.00 28.53  ? 95  TYR D CE1   1 
ATOM   8856  C CE2   . TYR D  1 67  ? 16.107  -25.555 44.047  1.00 26.36  ? 95  TYR D CE2   1 
ATOM   8857  C CZ    . TYR D  1 67  ? 14.775  -25.227 44.205  1.00 29.70  ? 95  TYR D CZ    1 
ATOM   8858  O OH    . TYR D  1 67  ? 13.945  -26.095 44.883  1.00 32.74  ? 95  TYR D OH    1 
ATOM   8859  N N     . LEU D  1 68  ? 18.738  -22.060 38.910  1.00 26.69  ? 96  LEU D N     1 
ATOM   8860  C CA    . LEU D  1 68  ? 18.532  -21.557 37.562  1.00 26.86  ? 96  LEU D CA    1 
ATOM   8861  C C     . LEU D  1 68  ? 18.427  -22.743 36.600  1.00 26.86  ? 96  LEU D C     1 
ATOM   8862  O O     . LEU D  1 68  ? 17.564  -22.763 35.721  1.00 21.85  ? 96  LEU D O     1 
ATOM   8863  C CB    . LEU D  1 68  ? 19.658  -20.591 37.141  1.00 24.72  ? 96  LEU D CB    1 
ATOM   8864  C CG    . LEU D  1 68  ? 19.592  -20.015 35.710  1.00 28.67  ? 96  LEU D CG    1 
ATOM   8865  C CD1   . LEU D  1 68  ? 18.315  -19.218 35.490  1.00 25.74  ? 96  LEU D CD1   1 
ATOM   8866  C CD2   . LEU D  1 68  ? 20.793  -19.145 35.401  1.00 27.09  ? 96  LEU D CD2   1 
ATOM   8867  N N     . ALA D  1 69  ? 19.319  -23.719 36.771  1.00 26.07  ? 97  ALA D N     1 
ATOM   8868  C CA    . ALA D  1 69  ? 19.340  -24.925 35.960  1.00 26.02  ? 97  ALA D CA    1 
ATOM   8869  C C     . ALA D  1 69  ? 18.071  -25.711 36.158  1.00 25.68  ? 97  ALA D C     1 
ATOM   8870  O O     . ALA D  1 69  ? 17.512  -26.257 35.204  1.00 27.88  ? 97  ALA D O     1 
ATOM   8871  C CB    . ALA D  1 69  ? 20.556  -25.786 36.303  1.00 23.40  ? 97  ALA D CB    1 
ATOM   8872  N N     . TYR D  1 70  ? 17.630  -25.752 37.407  1.00 27.37  ? 98  TYR D N     1 
ATOM   8873  C CA    . TYR D  1 70  ? 16.402  -26.406 37.782  1.00 27.64  ? 98  TYR D CA    1 
ATOM   8874  C C     . TYR D  1 70  ? 15.194  -25.811 37.075  1.00 25.17  ? 98  TYR D C     1 
ATOM   8875  O O     . TYR D  1 70  ? 14.405  -26.556 36.507  1.00 27.94  ? 98  TYR D O     1 
ATOM   8876  C CB    . TYR D  1 70  ? 16.246  -26.335 39.287  1.00 28.49  ? 98  TYR D CB    1 
ATOM   8877  C CG    . TYR D  1 70  ? 14.922  -26.791 39.817  1.00 26.06  ? 98  TYR D CG    1 
ATOM   8878  C CD1   . TYR D  1 70  ? 14.406  -28.044 39.493  1.00 26.84  ? 98  TYR D CD1   1 
ATOM   8879  C CD2   . TYR D  1 70  ? 14.195  -25.983 40.680  1.00 29.32  ? 98  TYR D CD2   1 
ATOM   8880  C CE1   . TYR D  1 70  ? 13.198  -28.467 40.015  1.00 24.73  ? 98  TYR D CE1   1 
ATOM   8881  C CE2   . TYR D  1 70  ? 12.989  -26.401 41.211  1.00 27.87  ? 98  TYR D CE2   1 
ATOM   8882  C CZ    . TYR D  1 70  ? 12.487  -27.630 40.874  1.00 28.27  ? 98  TYR D CZ    1 
ATOM   8883  O OH    . TYR D  1 70  ? 11.283  -28.020 41.415  1.00 27.74  ? 98  TYR D OH    1 
ATOM   8884  N N     . ALA D  1 71  ? 15.077  -24.484 37.089  1.00 27.04  ? 99  ALA D N     1 
ATOM   8885  C CA    . ALA D  1 71  ? 13.936  -23.809 36.456  1.00 28.85  ? 99  ALA D CA    1 
ATOM   8886  C C     . ALA D  1 71  ? 13.912  -24.033 34.941  1.00 27.93  ? 99  ALA D C     1 
ATOM   8887  O O     . ALA D  1 71  ? 12.843  -24.252 34.369  1.00 23.47  ? 99  ALA D O     1 
ATOM   8888  C CB    . ALA D  1 71  ? 13.902  -22.309 36.801  1.00 23.74  ? 99  ALA D CB    1 
ATOM   8889  N N     . ILE D  1 72  ? 15.091  -24.030 34.317  1.00 24.32  ? 100 ILE D N     1 
ATOM   8890  C CA    . ILE D  1 72  ? 15.225  -24.317 32.895  1.00 29.20  ? 100 ILE D CA    1 
ATOM   8891  C C     . ILE D  1 72  ? 14.817  -25.728 32.492  1.00 28.48  ? 100 ILE D C     1 
ATOM   8892  O O     . ILE D  1 72  ? 14.072  -25.905 31.521  1.00 27.02  ? 100 ILE D O     1 
ATOM   8893  C CB    . ILE D  1 72  ? 16.671  -24.097 32.403  1.00 23.98  ? 100 ILE D CB    1 
ATOM   8894  C CG1   . ILE D  1 72  ? 16.968  -22.602 32.362  1.00 30.45  ? 100 ILE D CG1   1 
ATOM   8895  C CG2   . ILE D  1 72  ? 16.852  -24.753 31.018  1.00 27.58  ? 100 ILE D CG2   1 
ATOM   8896  C CD1   . ILE D  1 72  ? 18.416  -22.237 32.350  1.00 31.62  ? 100 ILE D CD1   1 
ATOM   8897  N N     . ALA D  1 73  ? 15.353  -26.711 33.216  1.00 26.93  ? 101 ALA D N     1 
ATOM   8898  C CA    . ALA D  1 73  ? 15.023  -28.124 33.047  1.00 28.13  ? 101 ALA D CA    1 
ATOM   8899  C C     . ALA D  1 73  ? 13.550  -28.344 33.316  1.00 23.91  ? 101 ALA D C     1 
ATOM   8900  O O     . ALA D  1 73  ? 12.861  -29.060 32.594  1.00 29.71  ? 101 ALA D O     1 
ATOM   8901  C CB    . ALA D  1 73  ? 15.848  -28.967 34.007  1.00 22.68  ? 101 ALA D CB    1 
ATOM   8902  N N     . MET D  1 74  ? 13.058  -27.698 34.362  1.00 25.67  ? 102 MET D N     1 
ATOM   8903  C CA    . MET D  1 74  ? 11.658  -27.839 34.750  1.00 22.22  ? 102 MET D CA    1 
ATOM   8904  C C     . MET D  1 74  ? 10.686  -27.334 33.657  1.00 23.86  ? 102 MET D C     1 
ATOM   8905  O O     . MET D  1 74  ? 9.601   -27.936 33.399  1.00 22.11  ? 102 MET D O     1 
ATOM   8906  C CB    . MET D  1 74  ? 11.465  -27.096 36.059  1.00 25.45  ? 102 MET D CB    1 
ATOM   8907  C CG    . MET D  1 74  ? 10.242  -27.399 36.814  1.00 36.25  ? 102 MET D CG    1 
ATOM   8908  S SD    . MET D  1 74  ? 9.965   -29.072 37.398  1.00 36.32  ? 102 MET D SD    1 
ATOM   8909  C CE    . MET D  1 74  ? 8.212   -28.929 37.113  1.00 23.83  ? 102 MET D CE    1 
ATOM   8910  N N     . GLU D  1 75  ? 11.081  -26.243 33.011  1.00 25.66  ? 103 GLU D N     1 
ATOM   8911  C CA    . GLU D  1 75  ? 10.327  -25.692 31.893  1.00 26.25  ? 103 GLU D CA    1 
ATOM   8912  C C     . GLU D  1 75  ? 10.302  -26.643 30.680  1.00 24.09  ? 103 GLU D C     1 
ATOM   8913  O O     . GLU D  1 75  ? 9.256   -26.920 30.134  1.00 23.99  ? 103 GLU D O     1 
ATOM   8914  C CB    . GLU D  1 75  ? 10.882  -24.339 31.492  1.00 26.19  ? 103 GLU D CB    1 
ATOM   8915  C CG    . GLU D  1 75  ? 9.934   -23.587 30.605  1.00 31.88  ? 103 GLU D CG    1 
ATOM   8916  C CD    . GLU D  1 75  ? 10.548  -22.407 29.921  1.00 34.87  ? 103 GLU D CD    1 
ATOM   8917  O OE1   . GLU D  1 75  ? 11.223  -21.606 30.600  1.00 36.71  ? 103 GLU D OE1   1 
ATOM   8918  O OE2   . GLU D  1 75  ? 10.320  -22.270 28.693  1.00 38.65  ? 103 GLU D OE2   1 
ATOM   8919  N N     . GLU D  1 76  ? 11.458  -27.156 30.291  1.00 25.63  ? 104 GLU D N     1 
ATOM   8920  C CA    . GLU D  1 76  ? 11.551  -28.092 29.180  1.00 24.94  ? 104 GLU D CA    1 
ATOM   8921  C C     . GLU D  1 76  ? 10.781  -29.394 29.449  1.00 23.78  ? 104 GLU D C     1 
ATOM   8922  O O     . GLU D  1 76  ? 10.102  -29.888 28.557  1.00 25.70  ? 104 GLU D O     1 
ATOM   8923  C CB    . GLU D  1 76  ? 13.024  -28.404 28.872  1.00 27.69  ? 104 GLU D CB    1 
ATOM   8924  C CG    . GLU D  1 76  ? 13.820  -27.237 28.316  1.00 30.24  ? 104 GLU D CG    1 
ATOM   8925  C CD    . GLU D  1 76  ? 13.188  -26.635 27.061  1.00 41.49  ? 104 GLU D CD    1 
ATOM   8926  O OE1   . GLU D  1 76  ? 12.804  -27.405 26.150  1.00 34.09  ? 104 GLU D OE1   1 
ATOM   8927  O OE2   . GLU D  1 76  ? 13.061  -25.390 27.001  1.00 42.79  ? 104 GLU D OE2   1 
ATOM   8928  N N     . ILE D  1 77  ? 10.872  -29.940 30.663  1.00 24.94  ? 105 ILE D N     1 
ATOM   8929  C CA    . ILE D  1 77  ? 10.110  -31.143 31.008  1.00 24.01  ? 105 ILE D CA    1 
ATOM   8930  C C     . ILE D  1 77  ? 8.602   -30.947 30.898  1.00 25.86  ? 105 ILE D C     1 
ATOM   8931  O O     . ILE D  1 77  ? 7.899   -31.812 30.358  1.00 22.74  ? 105 ILE D O     1 
ATOM   8932  C CB    . ILE D  1 77  ? 10.466  -31.691 32.418  1.00 24.11  ? 105 ILE D CB    1 
ATOM   8933  C CG1   . ILE D  1 77  ? 11.906  -32.242 32.423  1.00 24.89  ? 105 ILE D CG1   1 
ATOM   8934  C CG2   . ILE D  1 77  ? 9.488   -32.797 32.840  1.00 23.60  ? 105 ILE D CG2   1 
ATOM   8935  C CD1   . ILE D  1 77  ? 12.297  -33.050 31.174  1.00 26.18  ? 105 ILE D CD1   1 
ATOM   8936  N N     . SER D  1 78  ? 8.129   -29.820 31.413  1.00 25.01  ? 106 SER D N     1 
ATOM   8937  C CA    . SER D  1 78  ? 6.688   -29.545 31.517  1.00 23.95  ? 106 SER D CA    1 
ATOM   8938  C C     . SER D  1 78  ? 6.076   -29.183 30.164  1.00 21.62  ? 106 SER D C     1 
ATOM   8939  O O     . SER D  1 78  ? 4.877   -29.402 29.921  1.00 24.12  ? 106 SER D O     1 
ATOM   8940  C CB    . SER D  1 78  ? 6.455   -28.409 32.510  1.00 30.26  ? 106 SER D CB    1 
ATOM   8941  O OG    . SER D  1 78  ? 7.146   -28.633 33.723  1.00 28.46  ? 106 SER D OG    1 
ATOM   8942  N N     . ARG D  1 79  ? 6.898   -28.569 29.320  1.00 21.07  ? 107 ARG D N     1 
ATOM   8943  C CA    . ARG D  1 79  ? 6.611   -28.375 27.904  1.00 26.92  ? 107 ARG D CA    1 
ATOM   8944  C C     . ARG D  1 79  ? 6.243   -29.710 27.250  1.00 28.95  ? 107 ARG D C     1 
ATOM   8945  O O     . ARG D  1 79  ? 5.267   -29.782 26.510  1.00 22.74  ? 107 ARG D O     1 
ATOM   8946  C CB    . ARG D  1 79  ? 7.820   -27.741 27.215  1.00 29.70  ? 107 ARG D CB    1 
ATOM   8947  C CG    . ARG D  1 79  ? 7.604   -27.270 25.797  1.00 31.74  ? 107 ARG D CG    1 
ATOM   8948  C CD    . ARG D  1 79  ? 8.786   -26.466 25.309  1.00 33.74  ? 107 ARG D CD    1 
ATOM   8949  N NE    . ARG D  1 79  ? 8.791   -26.348 23.856  1.00 38.83  ? 107 ARG D NE    1 
ATOM   8950  C CZ    . ARG D  1 79  ? 9.277   -27.260 23.001  1.00 48.53  ? 107 ARG D CZ    1 
ATOM   8951  N NH1   . ARG D  1 79  ? 9.850   -28.394 23.412  1.00 33.31  ? 107 ARG D NH1   1 
ATOM   8952  N NH2   . ARG D  1 79  ? 9.200   -27.029 21.695  1.00 53.22  ? 107 ARG D NH2   1 
ATOM   8953  N N     . GLY D  1 80  ? 7.016   -30.760 27.569  1.00 29.51  ? 108 GLY D N     1 
ATOM   8954  C CA    . GLY D  1 80  ? 6.735   -32.132 27.154  1.00 29.07  ? 108 GLY D CA    1 
ATOM   8955  C C     . GLY D  1 80  ? 5.558   -32.821 27.850  1.00 28.62  ? 108 GLY D C     1 
ATOM   8956  O O     . GLY D  1 80  ? 4.701   -33.363 27.181  1.00 28.60  ? 108 GLY D O     1 
ATOM   8957  N N     . CYS D  1 81  ? 5.527   -32.840 29.180  1.00 26.79  ? 109 CYS D N     1 
ATOM   8958  C CA    . CYS D  1 81  ? 4.386   -33.433 29.922  1.00 26.61  ? 109 CYS D CA    1 
ATOM   8959  C C     . CYS D  1 81  ? 4.221   -32.726 31.278  1.00 27.58  ? 109 CYS D C     1 
ATOM   8960  O O     . CYS D  1 81  ? 5.127   -32.719 32.088  1.00 22.35  ? 109 CYS D O     1 
ATOM   8961  C CB    . CYS D  1 81  ? 4.562   -34.964 30.090  1.00 26.29  ? 109 CYS D CB    1 
ATOM   8962  S SG    . CYS D  1 81  ? 3.352   -35.830 31.182  1.00 31.37  ? 109 CYS D SG    1 
ATOM   8963  N N     . ALA D  1 82  ? 3.063   -32.106 31.514  1.00 23.74  ? 110 ALA D N     1 
ATOM   8964  C CA    . ALA D  1 82  ? 2.877   -31.336 32.735  1.00 27.96  ? 110 ALA D CA    1 
ATOM   8965  C C     . ALA D  1 82  ? 2.918   -32.200 34.009  1.00 25.71  ? 110 ALA D C     1 
ATOM   8966  O O     . ALA D  1 82  ? 3.374   -31.726 35.049  1.00 22.25  ? 110 ALA D O     1 
ATOM   8967  C CB    . ALA D  1 82  ? 1.581   -30.505 32.682  1.00 18.32  ? 110 ALA D CB    1 
ATOM   8968  N N     . SER D  1 83  ? 2.440   -33.443 33.927  1.00 24.09  ? 111 SER D N     1 
ATOM   8969  C CA    . SER D  1 83  ? 2.395   -34.339 35.085  1.00 24.50  ? 111 SER D CA    1 
ATOM   8970  C C     . SER D  1 83  ? 3.797   -34.747 35.532  1.00 28.14  ? 111 SER D C     1 
ATOM   8971  O O     . SER D  1 83  ? 4.096   -34.717 36.721  1.00 25.63  ? 111 SER D O     1 
ATOM   8972  C CB    . SER D  1 83  ? 1.571   -35.587 34.813  1.00 24.79  ? 111 SER D CB    1 
ATOM   8973  O OG    . SER D  1 83  ? 0.234   -35.235 34.610  1.00 25.13  ? 111 SER D OG    1 
ATOM   8974  N N     . THR D  1 84  ? 4.618   -35.125 34.562  1.00 25.01  ? 112 THR D N     1 
ATOM   8975  C CA    . THR D  1 84  ? 6.023   -35.433 34.783  1.00 28.27  ? 112 THR D CA    1 
ATOM   8976  C C     . THR D  1 84  ? 6.704   -34.223 35.439  1.00 27.87  ? 112 THR D C     1 
ATOM   8977  O O     . THR D  1 84  ? 7.505   -34.380 36.360  1.00 28.44  ? 112 THR D O     1 
ATOM   8978  C CB    . THR D  1 84  ? 6.688   -35.822 33.458  1.00 29.78  ? 112 THR D CB    1 
ATOM   8979  O OG1   . THR D  1 84  ? 6.049   -36.996 32.936  1.00 33.41  ? 112 THR D OG1   1 
ATOM   8980  C CG2   . THR D  1 84  ? 8.170   -36.113 33.639  1.00 32.70  ? 112 THR D CG2   1 
ATOM   8981  N N     . GLY D  1 85  ? 6.354   -33.031 34.954  1.00 27.60  ? 113 GLY D N     1 
ATOM   8982  C CA    . GLY D  1 85  ? 6.718   -31.760 35.583  1.00 28.36  ? 113 GLY D CA    1 
ATOM   8983  C C     . GLY D  1 85  ? 6.431   -31.662 37.086  1.00 24.42  ? 113 GLY D C     1 
ATOM   8984  O O     . GLY D  1 85  ? 7.342   -31.393 37.860  1.00 22.74  ? 113 GLY D O     1 
ATOM   8985  N N     . VAL D  1 86  ? 5.183   -31.845 37.517  1.00 20.46  ? 114 VAL D N     1 
ATOM   8986  C CA    . VAL D  1 86  ? 4.875   -31.684 38.932  1.00 23.93  ? 114 VAL D CA    1 
ATOM   8987  C C     . VAL D  1 86  ? 5.596   -32.800 39.759  1.00 27.45  ? 114 VAL D C     1 
ATOM   8988  O O     . VAL D  1 86  ? 6.080   -32.537 40.856  1.00 23.29  ? 114 VAL D O     1 
ATOM   8989  C CB    . VAL D  1 86  ? 3.321   -31.552 39.242  1.00 26.73  ? 114 VAL D CB    1 
ATOM   8990  C CG1   . VAL D  1 86  ? 2.566   -32.809 38.900  1.00 26.14  ? 114 VAL D CG1   1 
ATOM   8991  C CG2   . VAL D  1 86  ? 3.073   -31.172 40.726  1.00 26.62  ? 114 VAL D CG2   1 
ATOM   8992  N N     . ILE D  1 87  ? 5.728   -33.996 39.181  1.00 25.47  ? 115 ILE D N     1 
ATOM   8993  C CA    . ILE D  1 87  ? 6.347   -35.127 39.886  1.00 25.17  ? 115 ILE D CA    1 
ATOM   8994  C C     . ILE D  1 87  ? 7.811   -34.785 40.171  1.00 23.20  ? 115 ILE D C     1 
ATOM   8995  O O     . ILE D  1 87  ? 8.275   -34.985 41.293  1.00 25.36  ? 115 ILE D O     1 
ATOM   8996  C CB    . ILE D  1 87  ? 6.270   -36.447 39.079  1.00 25.81  ? 115 ILE D CB    1 
ATOM   8997  C CG1   . ILE D  1 87  ? 4.824   -36.949 38.980  1.00 21.96  ? 115 ILE D CG1   1 
ATOM   8998  C CG2   . ILE D  1 87  ? 7.073   -37.552 39.764  1.00 23.58  ? 115 ILE D CG2   1 
ATOM   8999  C CD1   . ILE D  1 87  ? 4.564   -37.827 37.716  1.00 22.82  ? 115 ILE D CD1   1 
ATOM   9000  N N     . MET D  1 88  ? 8.489   -34.236 39.168  1.00 23.33  ? 116 MET D N     1 
ATOM   9001  C CA    . MET D  1 88  ? 9.894   -33.807 39.270  1.00 24.87  ? 116 MET D CA    1 
ATOM   9002  C C     . MET D  1 88  ? 10.017  -32.657 40.268  1.00 28.88  ? 116 MET D C     1 
ATOM   9003  O O     . MET D  1 88  ? 10.981  -32.586 41.046  1.00 24.60  ? 116 MET D O     1 
ATOM   9004  C CB    . MET D  1 88  ? 10.412  -33.393 37.892  1.00 23.72  ? 116 MET D CB    1 
ATOM   9005  C CG    . MET D  1 88  ? 11.707  -32.608 37.859  1.00 26.91  ? 116 MET D CG    1 
ATOM   9006  S SD    . MET D  1 88  ? 12.242  -32.180 36.181  1.00 32.38  ? 116 MET D SD    1 
ATOM   9007  C CE    . MET D  1 88  ? 13.588  -31.038 36.564  1.00 24.94  ? 116 MET D CE    1 
ATOM   9008  N N     . SER D  1 89  ? 9.034   -31.759 40.258  1.00 26.24  ? 117 SER D N     1 
ATOM   9009  C CA    . SER D  1 89  ? 9.098   -30.589 41.133  1.00 26.80  ? 117 SER D CA    1 
ATOM   9010  C C     . SER D  1 89  ? 8.860   -30.934 42.606  1.00 24.22  ? 117 SER D C     1 
ATOM   9011  O O     . SER D  1 89  ? 9.544   -30.387 43.483  1.00 25.49  ? 117 SER D O     1 
ATOM   9012  C CB    . SER D  1 89  ? 8.102   -29.501 40.690  1.00 26.01  ? 117 SER D CB    1 
ATOM   9013  O OG    . SER D  1 89  ? 8.539   -28.230 41.164  1.00 32.17  ? 117 SER D OG    1 
ATOM   9014  N N     . VAL D  1 90  ? 7.851   -31.762 42.880  1.00 24.63  ? 118 VAL D N     1 
ATOM   9015  C CA    . VAL D  1 90  ? 7.622   -32.231 44.234  1.00 25.30  ? 118 VAL D CA    1 
ATOM   9016  C C     . VAL D  1 90  ? 8.873   -32.910 44.819  1.00 29.33  ? 118 VAL D C     1 
ATOM   9017  O O     . VAL D  1 90  ? 9.264   -32.595 45.946  1.00 27.79  ? 118 VAL D O     1 
ATOM   9018  C CB    . VAL D  1 90  ? 6.441   -33.198 44.347  1.00 26.97  ? 118 VAL D CB    1 
ATOM   9019  C CG1   . VAL D  1 90  ? 6.410   -33.853 45.752  1.00 28.99  ? 118 VAL D CG1   1 
ATOM   9020  C CG2   . VAL D  1 90  ? 5.137   -32.453 44.104  1.00 24.42  ? 118 VAL D CG2   1 
ATOM   9021  N N     . ASN D  1 91  ? 9.494   -33.822 44.067  1.00 26.60  ? 119 ASN D N     1 
ATOM   9022  C CA    . ASN D  1 91  ? 10.696  -34.494 44.564  1.00 24.56  ? 119 ASN D CA    1 
ATOM   9023  C C     . ASN D  1 91  ? 11.832  -33.522 44.831  1.00 24.94  ? 119 ASN D C     1 
ATOM   9024  O O     . ASN D  1 91  ? 12.456  -33.580 45.894  1.00 24.45  ? 119 ASN D O     1 
ATOM   9025  C CB    . ASN D  1 91  ? 11.206  -35.603 43.624  1.00 29.22  ? 119 ASN D CB    1 
ATOM   9026  C CG    . ASN D  1 91  ? 12.156  -36.581 44.352  1.00 25.18  ? 119 ASN D CG    1 
ATOM   9027  O OD1   . ASN D  1 91  ? 11.727  -37.294 45.271  1.00 26.04  ? 119 ASN D OD1   1 
ATOM   9028  N ND2   . ASN D  1 91  ? 13.453  -36.580 43.972  1.00 27.19  ? 119 ASN D ND2   1 
ATOM   9029  N N     . ASN D  1 92  ? 12.111  -32.654 43.863  1.00 23.94  ? 120 ASN D N     1 
ATOM   9030  C CA    . ASN D  1 92  ? 13.201  -31.682 43.975  1.00 21.30  ? 120 ASN D CA    1 
ATOM   9031  C C     . ASN D  1 92  ? 12.994  -30.674 45.115  1.00 26.24  ? 120 ASN D C     1 
ATOM   9032  O O     . ASN D  1 92  ? 13.842  -30.523 45.989  1.00 24.60  ? 120 ASN D O     1 
ATOM   9033  C CB    . ASN D  1 92  ? 13.401  -30.907 42.663  1.00 22.57  ? 120 ASN D CB    1 
ATOM   9034  C CG    . ASN D  1 92  ? 14.282  -31.627 41.669  1.00 28.05  ? 120 ASN D CG    1 
ATOM   9035  O OD1   . ASN D  1 92  ? 15.505  -31.500 41.718  1.00 23.45  ? 120 ASN D OD1   1 
ATOM   9036  N ND2   . ASN D  1 92  ? 13.669  -32.320 40.711  1.00 23.92  ? 120 ASN D ND2   1 
ATOM   9037  N N     . SER D  1 93  ? 11.869  -29.964 45.086  1.00 24.33  ? 121 SER D N     1 
ATOM   9038  C CA    . SER D  1 93  ? 11.686  -28.777 45.908  1.00 21.48  ? 121 SER D CA    1 
ATOM   9039  C C     . SER D  1 93  ? 11.001  -29.087 47.229  1.00 23.26  ? 121 SER D C     1 
ATOM   9040  O O     . SER D  1 93  ? 11.391  -28.564 48.268  1.00 27.91  ? 121 SER D O     1 
ATOM   9041  C CB    . SER D  1 93  ? 10.837  -27.723 45.147  1.00 26.97  ? 121 SER D CB    1 
ATOM   9042  O OG    . SER D  1 93  ? 11.602  -27.026 44.162  1.00 30.77  ? 121 SER D OG    1 
ATOM   9043  N N     . LEU D  1 94  ? 9.943   -29.892 47.183  1.00 20.16  ? 122 LEU D N     1 
ATOM   9044  C CA    . LEU D  1 94  ? 9.119   -30.093 48.349  1.00 24.00  ? 122 LEU D CA    1 
ATOM   9045  C C     . LEU D  1 94  ? 9.603   -31.233 49.243  1.00 24.95  ? 122 LEU D C     1 
ATOM   9046  O O     . LEU D  1 94  ? 9.418   -31.166 50.456  1.00 27.65  ? 122 LEU D O     1 
ATOM   9047  C CB    . LEU D  1 94  ? 7.643   -30.296 47.964  1.00 23.77  ? 122 LEU D CB    1 
ATOM   9048  C CG    . LEU D  1 94  ? 6.929   -29.219 47.133  1.00 27.81  ? 122 LEU D CG    1 
ATOM   9049  C CD1   . LEU D  1 94  ? 5.470   -29.597 47.041  1.00 24.97  ? 122 LEU D CD1   1 
ATOM   9050  C CD2   . LEU D  1 94  ? 7.061   -27.843 47.728  1.00 28.06  ? 122 LEU D CD2   1 
ATOM   9051  N N     . TYR D  1 95  ? 10.209  -32.271 48.658  1.00 26.51  ? 123 TYR D N     1 
ATOM   9052  C CA    . TYR D  1 95  ? 10.696  -33.409 49.436  1.00 26.65  ? 123 TYR D CA    1 
ATOM   9053  C C     . TYR D  1 95  ? 12.188  -33.238 49.758  1.00 26.82  ? 123 TYR D C     1 
ATOM   9054  O O     . TYR D  1 95  ? 12.582  -33.110 50.935  1.00 24.10  ? 123 TYR D O     1 
ATOM   9055  C CB    . TYR D  1 95  ? 10.436  -34.775 48.756  1.00 25.46  ? 123 TYR D CB    1 
ATOM   9056  C CG    . TYR D  1 95  ? 11.075  -35.909 49.549  1.00 24.86  ? 123 TYR D CG    1 
ATOM   9057  C CD1   . TYR D  1 95  ? 10.539  -36.315 50.758  1.00 25.46  ? 123 TYR D CD1   1 
ATOM   9058  C CD2   . TYR D  1 95  ? 12.257  -36.504 49.129  1.00 26.08  ? 123 TYR D CD2   1 
ATOM   9059  C CE1   . TYR D  1 95  ? 11.131  -37.311 51.507  1.00 25.84  ? 123 TYR D CE1   1 
ATOM   9060  C CE2   . TYR D  1 95  ? 12.861  -37.499 49.873  1.00 26.38  ? 123 TYR D CE2   1 
ATOM   9061  C CZ    . TYR D  1 95  ? 12.282  -37.902 51.064  1.00 27.00  ? 123 TYR D CZ    1 
ATOM   9062  O OH    . TYR D  1 95  ? 12.870  -38.892 51.824  1.00 27.80  ? 123 TYR D OH    1 
ATOM   9063  N N     . LEU D  1 96  ? 13.003  -33.214 48.718  1.00 27.85  ? 124 LEU D N     1 
ATOM   9064  C CA    . LEU D  1 96  ? 14.435  -33.182 48.913  1.00 28.16  ? 124 LEU D CA    1 
ATOM   9065  C C     . LEU D  1 96  ? 14.868  -31.840 49.502  1.00 31.66  ? 124 LEU D C     1 
ATOM   9066  O O     . LEU D  1 96  ? 15.785  -31.796 50.343  1.00 26.97  ? 124 LEU D O     1 
ATOM   9067  C CB    . LEU D  1 96  ? 15.185  -33.487 47.618  1.00 29.11  ? 124 LEU D CB    1 
ATOM   9068  C CG    . LEU D  1 96  ? 15.234  -34.932 47.078  1.00 34.27  ? 124 LEU D CG    1 
ATOM   9069  C CD1   . LEU D  1 96  ? 15.921  -34.946 45.710  1.00 24.42  ? 124 LEU D CD1   1 
ATOM   9070  C CD2   . LEU D  1 96  ? 15.949  -35.919 48.054  1.00 25.99  ? 124 LEU D CD2   1 
ATOM   9071  N N     . GLY D  1 97  ? 14.188  -30.764 49.091  1.00 26.50  ? 125 GLY D N     1 
ATOM   9072  C CA    . GLY D  1 97  ? 14.565  -29.406 49.495  1.00 30.28  ? 125 GLY D CA    1 
ATOM   9073  C C     . GLY D  1 97  ? 14.619  -29.141 50.998  1.00 28.00  ? 125 GLY D C     1 
ATOM   9074  O O     . GLY D  1 97  ? 15.609  -28.597 51.495  1.00 23.29  ? 125 GLY D O     1 
ATOM   9075  N N     . PRO D  1 98  ? 13.529  -29.453 51.719  1.00 25.35  ? 126 PRO D N     1 
ATOM   9076  C CA    . PRO D  1 98  ? 13.554  -29.276 53.169  1.00 27.43  ? 126 PRO D CA    1 
ATOM   9077  C C     . PRO D  1 98  ? 14.614  -30.142 53.888  1.00 31.33  ? 126 PRO D C     1 
ATOM   9078  O O     . PRO D  1 98  ? 15.202  -29.681 54.873  1.00 27.29  ? 126 PRO D O     1 
ATOM   9079  C CB    . PRO D  1 98  ? 12.146  -29.659 53.609  1.00 27.29  ? 126 PRO D CB    1 
ATOM   9080  C CG    . PRO D  1 98  ? 11.525  -30.337 52.468  1.00 26.38  ? 126 PRO D CG    1 
ATOM   9081  C CD    . PRO D  1 98  ? 12.220  -29.926 51.233  1.00 26.35  ? 126 PRO D CD    1 
ATOM   9082  N N     . ILE D  1 99  ? 14.904  -31.342 53.366  1.00 29.00  ? 127 ILE D N     1 
ATOM   9083  C CA    . ILE D  1 99  ? 15.877  -32.226 54.023  1.00 29.00  ? 127 ILE D CA    1 
ATOM   9084  C C     . ILE D  1 99  ? 17.284  -31.699 53.822  1.00 29.52  ? 127 ILE D C     1 
ATOM   9085  O O     . ILE D  1 99  ? 18.088  -31.742 54.754  1.00 30.71  ? 127 ILE D O     1 
ATOM   9086  C CB    . ILE D  1 99  ? 15.777  -33.714 53.568  1.00 27.72  ? 127 ILE D CB    1 
ATOM   9087  C CG1   . ILE D  1 99  ? 14.341  -34.218 53.658  1.00 23.32  ? 127 ILE D CG1   1 
ATOM   9088  C CG2   . ILE D  1 99  ? 16.640  -34.626 54.466  1.00 20.37  ? 127 ILE D CG2   1 
ATOM   9089  C CD1   . ILE D  1 99  ? 14.113  -35.454 52.895  1.00 22.89  ? 127 ILE D CD1   1 
ATOM   9090  N N     . LEU D  1 100 ? 17.592  -31.189 52.625  1.00 31.25  ? 128 LEU D N     1 
ATOM   9091  C CA    . LEU D  1 100 ? 18.897  -30.535 52.408  1.00 29.99  ? 128 LEU D CA    1 
ATOM   9092  C C     . LEU D  1 100 ? 19.058  -29.302 53.278  1.00 28.89  ? 128 LEU D C     1 
ATOM   9093  O O     . LEU D  1 100 ? 20.142  -29.021 53.773  1.00 32.68  ? 128 LEU D O     1 
ATOM   9094  C CB    . LEU D  1 100 ? 19.080  -30.103 50.959  1.00 29.71  ? 128 LEU D CB    1 
ATOM   9095  C CG    . LEU D  1 100 ? 19.250  -31.186 49.905  1.00 37.76  ? 128 LEU D CG    1 
ATOM   9096  C CD1   . LEU D  1 100 ? 19.102  -30.580 48.497  1.00 40.27  ? 128 LEU D CD1   1 
ATOM   9097  C CD2   . LEU D  1 100 ? 20.598  -31.873 50.081  1.00 38.05  ? 128 LEU D CD2   1 
ATOM   9098  N N     . LYS D  1 101 ? 17.982  -28.537 53.439  1.00 29.07  ? 129 LYS D N     1 
ATOM   9099  C CA    . LYS D  1 101 ? 18.080  -27.267 54.129  1.00 29.83  ? 129 LYS D CA    1 
ATOM   9100  C C     . LYS D  1 101 ? 18.092  -27.447 55.640  1.00 30.86  ? 129 LYS D C     1 
ATOM   9101  O O     . LYS D  1 101 ? 18.858  -26.779 56.312  1.00 33.79  ? 129 LYS D O     1 
ATOM   9102  C CB    . LYS D  1 101 ? 16.943  -26.334 53.720  1.00 30.56  ? 129 LYS D CB    1 
ATOM   9103  C CG    . LYS D  1 101 ? 17.154  -24.894 54.135  1.00 35.96  ? 129 LYS D CG    1 
ATOM   9104  C CD    . LYS D  1 101 ? 15.980  -24.020 53.687  1.00 43.33  ? 129 LYS D CD    1 
ATOM   9105  C CE    . LYS D  1 101 ? 16.178  -22.566 54.092  1.00 42.44  ? 129 LYS D CE    1 
ATOM   9106  N NZ    . LYS D  1 101 ? 17.283  -21.913 53.359  1.00 50.22  ? 129 LYS D NZ    1 
ATOM   9107  N N     . PHE D  1 102 ? 17.270  -28.361 56.159  1.00 25.94  ? 130 PHE D N     1 
ATOM   9108  C CA    . PHE D  1 102 ? 17.056  -28.458 57.592  1.00 28.10  ? 130 PHE D CA    1 
ATOM   9109  C C     . PHE D  1 102 ? 17.482  -29.774 58.228  1.00 29.50  ? 130 PHE D C     1 
ATOM   9110  O O     . PHE D  1 102 ? 17.333  -29.929 59.433  1.00 31.65  ? 130 PHE D O     1 
ATOM   9111  C CB    . PHE D  1 102 ? 15.581  -28.235 57.923  1.00 31.03  ? 130 PHE D CB    1 
ATOM   9112  C CG    . PHE D  1 102 ? 15.052  -26.929 57.461  1.00 32.46  ? 130 PHE D CG    1 
ATOM   9113  C CD1   . PHE D  1 102 ? 15.417  -25.759 58.113  1.00 31.32  ? 130 PHE D CD1   1 
ATOM   9114  C CD2   . PHE D  1 102 ? 14.152  -26.863 56.388  1.00 34.96  ? 130 PHE D CD2   1 
ATOM   9115  C CE1   . PHE D  1 102 ? 14.916  -24.536 57.700  1.00 37.65  ? 130 PHE D CE1   1 
ATOM   9116  C CE2   . PHE D  1 102 ? 13.655  -25.646 55.964  1.00 32.32  ? 130 PHE D CE2   1 
ATOM   9117  C CZ    . PHE D  1 102 ? 14.036  -24.471 56.633  1.00 32.13  ? 130 PHE D CZ    1 
ATOM   9118  N N     . GLY D  1 103 ? 18.003  -30.705 57.436  1.00 31.57  ? 131 GLY D N     1 
ATOM   9119  C CA    . GLY D  1 103 ? 18.353  -32.025 57.935  1.00 31.51  ? 131 GLY D CA    1 
ATOM   9120  C C     . GLY D  1 103 ? 19.768  -32.132 58.490  1.00 28.82  ? 131 GLY D C     1 
ATOM   9121  O O     . GLY D  1 103 ? 20.662  -31.344 58.147  1.00 28.37  ? 131 GLY D O     1 
ATOM   9122  N N     . SER D  1 104 ? 19.951  -33.130 59.348  1.00 30.18  ? 132 SER D N     1 
ATOM   9123  C CA    . SER D  1 104 ? 21.260  -33.510 59.848  1.00 33.08  ? 132 SER D CA    1 
ATOM   9124  C C     . SER D  1 104 ? 21.979  -34.234 58.726  1.00 31.07  ? 132 SER D C     1 
ATOM   9125  O O     . SER D  1 104 ? 21.345  -34.676 57.771  1.00 29.69  ? 132 SER D O     1 
ATOM   9126  C CB    . SER D  1 104 ? 21.124  -34.420 61.087  1.00 30.17  ? 132 SER D CB    1 
ATOM   9127  O OG    . SER D  1 104 ? 20.386  -35.618 60.834  1.00 30.67  ? 132 SER D OG    1 
ATOM   9128  N N     . LYS D  1 105 ? 23.299  -34.353 58.838  1.00 35.30  ? 133 LYS D N     1 
ATOM   9129  C CA    . LYS D  1 105 ? 24.087  -35.142 57.888  1.00 36.18  ? 133 LYS D CA    1 
ATOM   9130  C C     . LYS D  1 105 ? 23.545  -36.577 57.741  1.00 36.35  ? 133 LYS D C     1 
ATOM   9131  O O     . LYS D  1 105 ? 23.359  -37.073 56.623  1.00 38.69  ? 133 LYS D O     1 
ATOM   9132  C CB    . LYS D  1 105 ? 25.573  -35.165 58.309  1.00 35.65  ? 133 LYS D CB    1 
ATOM   9133  C CG    . LYS D  1 105 ? 26.540  -35.540 57.196  1.00 43.68  ? 133 LYS D CG    1 
ATOM   9134  C CD    . LYS D  1 105 ? 28.002  -35.245 57.593  1.00 30.75  ? 133 LYS D CD    1 
ATOM   9135  N N     . GLU D  1 106 ? 23.285  -37.235 58.870  1.00 35.53  ? 134 GLU D N     1 
ATOM   9136  C CA    . GLU D  1 106 ? 22.689  -38.575 58.866  1.00 34.91  ? 134 GLU D CA    1 
ATOM   9137  C C     . GLU D  1 106 ? 21.315  -38.634 58.172  1.00 33.13  ? 134 GLU D C     1 
ATOM   9138  O O     . GLU D  1 106 ? 21.038  -39.577 57.431  1.00 31.07  ? 134 GLU D O     1 
ATOM   9139  C CB    . GLU D  1 106 ? 22.575  -39.122 60.292  1.00 34.34  ? 134 GLU D CB    1 
ATOM   9140  C CG    . GLU D  1 106 ? 23.938  -39.456 60.927  1.00 36.32  ? 134 GLU D CG    1 
ATOM   9141  C CD    . GLU D  1 106 ? 23.829  -40.331 62.183  1.00 44.17  ? 134 GLU D CD    1 
ATOM   9142  O OE1   . GLU D  1 106 ? 24.588  -40.075 63.147  1.00 35.87  ? 134 GLU D OE1   1 
ATOM   9143  O OE2   . GLU D  1 106 ? 22.982  -41.259 62.216  1.00 47.33  ? 134 GLU D OE2   1 
ATOM   9144  N N     . GLN D  1 107 ? 20.462  -37.638 58.415  1.00 31.39  ? 135 GLN D N     1 
ATOM   9145  C CA    . GLN D  1 107 ? 19.163  -37.558 57.755  1.00 30.55  ? 135 GLN D CA    1 
ATOM   9146  C C     . GLN D  1 107 ? 19.278  -37.433 56.220  1.00 30.03  ? 135 GLN D C     1 
ATOM   9147  O O     . GLN D  1 107 ? 18.489  -38.027 55.487  1.00 32.40  ? 135 GLN D O     1 
ATOM   9148  C CB    . GLN D  1 107 ? 18.309  -36.417 58.342  1.00 27.10  ? 135 GLN D CB    1 
ATOM   9149  C CG    . GLN D  1 107 ? 17.515  -36.830 59.558  1.00 28.27  ? 135 GLN D CG    1 
ATOM   9150  C CD    . GLN D  1 107 ? 16.861  -35.672 60.292  1.00 27.60  ? 135 GLN D CD    1 
ATOM   9151  O OE1   . GLN D  1 107 ? 17.284  -34.529 60.181  1.00 26.99  ? 135 GLN D OE1   1 
ATOM   9152  N NE2   . GLN D  1 107 ? 15.799  -35.971 61.035  1.00 26.21  ? 135 GLN D NE2   1 
ATOM   9153  N N     . LYS D  1 108 ? 20.256  -36.666 55.748  1.00 26.37  ? 136 LYS D N     1 
ATOM   9154  C CA    . LYS D  1 108 ? 20.472  -36.501 54.325  1.00 29.11  ? 136 LYS D CA    1 
ATOM   9155  C C     . LYS D  1 108 ? 20.911  -37.819 53.683  1.00 30.92  ? 136 LYS D C     1 
ATOM   9156  O O     . LYS D  1 108 ? 20.470  -38.168 52.596  1.00 27.97  ? 136 LYS D O     1 
ATOM   9157  C CB    . LYS D  1 108 ? 21.495  -35.394 54.065  1.00 28.76  ? 136 LYS D CB    1 
ATOM   9158  C CG    . LYS D  1 108 ? 20.980  -33.988 54.357  1.00 35.06  ? 136 LYS D CG    1 
ATOM   9159  C CD    . LYS D  1 108 ? 22.093  -32.963 54.274  1.00 33.95  ? 136 LYS D CD    1 
ATOM   9160  C CE    . LYS D  1 108 ? 21.699  -31.663 54.909  1.00 40.89  ? 136 LYS D CE    1 
ATOM   9161  N NZ    . LYS D  1 108 ? 22.754  -30.644 54.701  1.00 42.25  ? 136 LYS D NZ    1 
ATOM   9162  N N     . GLN D  1 109 ? 21.744  -38.579 54.377  1.00 31.82  ? 137 GLN D N     1 
ATOM   9163  C CA    . GLN D  1 109 ? 22.191  -39.865 53.854  1.00 30.01  ? 137 GLN D CA    1 
ATOM   9164  C C     . GLN D  1 109 ? 21.036  -40.872 53.774  1.00 27.11  ? 137 GLN D C     1 
ATOM   9165  O O     . GLN D  1 109 ? 20.955  -41.635 52.821  1.00 28.82  ? 137 GLN D O     1 
ATOM   9166  C CB    . GLN D  1 109 ? 23.333  -40.407 54.699  1.00 35.02  ? 137 GLN D CB    1 
ATOM   9167  C CG    . GLN D  1 109 ? 24.602  -39.573 54.593  1.00 37.24  ? 137 GLN D CG    1 
ATOM   9168  C CD    . GLN D  1 109 ? 25.710  -40.075 55.517  1.00 47.46  ? 137 GLN D CD    1 
ATOM   9169  O OE1   . GLN D  1 109 ? 25.616  -41.175 56.080  1.00 56.43  ? 137 GLN D OE1   1 
ATOM   9170  N NE2   . GLN D  1 109 ? 26.759  -39.275 55.675  1.00 45.44  ? 137 GLN D NE2   1 
ATOM   9171  N N     . ALA D  1 110 ? 20.159  -40.851 54.770  1.00 23.61  ? 138 ALA D N     1 
ATOM   9172  C CA    . ALA D  1 110 ? 19.035  -41.787 54.880  1.00 28.92  ? 138 ALA D CA    1 
ATOM   9173  C C     . ALA D  1 110 ? 17.841  -41.436 53.984  1.00 27.34  ? 138 ALA D C     1 
ATOM   9174  O O     . ALA D  1 110 ? 17.175  -42.330 53.443  1.00 31.21  ? 138 ALA D O     1 
ATOM   9175  C CB    . ALA D  1 110 ? 18.567  -41.860 56.327  1.00 26.83  ? 138 ALA D CB    1 
ATOM   9176  N N     . TRP D  1 111 ? 17.552  -40.146 53.847  1.00 29.32  ? 139 TRP D N     1 
ATOM   9177  C CA    . TRP D  1 111 ? 16.279  -39.698 53.256  1.00 26.88  ? 139 TRP D CA    1 
ATOM   9178  C C     . TRP D  1 111 ? 16.430  -38.945 51.942  1.00 27.73  ? 139 TRP D C     1 
ATOM   9179  O O     . TRP D  1 111 ? 15.459  -38.800 51.205  1.00 28.15  ? 139 TRP D O     1 
ATOM   9180  C CB    . TRP D  1 111 ? 15.534  -38.830 54.272  1.00 21.25  ? 139 TRP D CB    1 
ATOM   9181  C CG    . TRP D  1 111 ? 15.127  -39.600 55.485  1.00 28.65  ? 139 TRP D CG    1 
ATOM   9182  C CD1   . TRP D  1 111 ? 15.884  -39.863 56.601  1.00 25.82  ? 139 TRP D CD1   1 
ATOM   9183  C CD2   . TRP D  1 111 ? 13.874  -40.241 55.694  1.00 26.71  ? 139 TRP D CD2   1 
ATOM   9184  N NE1   . TRP D  1 111 ? 15.168  -40.621 57.485  1.00 28.69  ? 139 TRP D NE1   1 
ATOM   9185  C CE2   . TRP D  1 111 ? 13.920  -40.846 56.964  1.00 30.06  ? 139 TRP D CE2   1 
ATOM   9186  C CE3   . TRP D  1 111 ? 12.691  -40.320 54.948  1.00 31.80  ? 139 TRP D CE3   1 
ATOM   9187  C CZ2   . TRP D  1 111 ? 12.843  -41.540 57.495  1.00 25.26  ? 139 TRP D CZ2   1 
ATOM   9188  C CZ3   . TRP D  1 111 ? 11.625  -40.996 55.476  1.00 24.56  ? 139 TRP D CZ3   1 
ATOM   9189  C CH2   . TRP D  1 111 ? 11.710  -41.616 56.737  1.00 28.75  ? 139 TRP D CH2   1 
ATOM   9190  N N     . VAL D  1 112 ? 17.636  -38.476 51.645  1.00 26.39  ? 140 VAL D N     1 
ATOM   9191  C CA    . VAL D  1 112 ? 17.916  -37.804 50.376  1.00 28.58  ? 140 VAL D CA    1 
ATOM   9192  C C     . VAL D  1 112 ? 18.507  -38.783 49.375  1.00 30.72  ? 140 VAL D C     1 
ATOM   9193  O O     . VAL D  1 112 ? 17.916  -39.028 48.317  1.00 28.48  ? 140 VAL D O     1 
ATOM   9194  C CB    . VAL D  1 112 ? 18.858  -36.579 50.573  1.00 28.74  ? 140 VAL D CB    1 
ATOM   9195  C CG1   . VAL D  1 112 ? 19.492  -36.093 49.238  1.00 24.21  ? 140 VAL D CG1   1 
ATOM   9196  C CG2   . VAL D  1 112 ? 18.099  -35.461 51.285  1.00 25.58  ? 140 VAL D CG2   1 
ATOM   9197  N N     . THR D  1 113 ? 19.660  -39.362 49.722  1.00 32.56  ? 141 THR D N     1 
ATOM   9198  C CA    . THR D  1 113 ? 20.427  -40.183 48.768  1.00 32.60  ? 141 THR D CA    1 
ATOM   9199  C C     . THR D  1 113 ? 19.641  -41.302 48.061  1.00 30.35  ? 141 THR D C     1 
ATOM   9200  O O     . THR D  1 113 ? 19.793  -41.463 46.859  1.00 34.34  ? 141 THR D O     1 
ATOM   9201  C CB    . THR D  1 113 ? 21.747  -40.710 49.401  1.00 31.22  ? 141 THR D CB    1 
ATOM   9202  O OG1   . THR D  1 113 ? 22.505  -39.590 49.872  1.00 28.44  ? 141 THR D OG1   1 
ATOM   9203  C CG2   . THR D  1 113 ? 22.572  -41.440 48.373  1.00 32.31  ? 141 THR D CG2   1 
ATOM   9204  N N     . PRO D  1 114 ? 18.761  -42.047 48.771  1.00 29.99  ? 142 PRO D N     1 
ATOM   9205  C CA    . PRO D  1 114 ? 17.977  -43.069 48.057  1.00 27.57  ? 142 PRO D CA    1 
ATOM   9206  C C     . PRO D  1 114 ? 16.815  -42.540 47.208  1.00 27.15  ? 142 PRO D C     1 
ATOM   9207  O O     . PRO D  1 114 ? 16.044  -43.338 46.677  1.00 27.10  ? 142 PRO D O     1 
ATOM   9208  C CB    . PRO D  1 114 ? 17.403  -43.939 49.189  1.00 26.94  ? 142 PRO D CB    1 
ATOM   9209  C CG    . PRO D  1 114 ? 18.098  -43.468 50.444  1.00 30.26  ? 142 PRO D CG    1 
ATOM   9210  C CD    . PRO D  1 114 ? 18.463  -42.055 50.206  1.00 30.72  ? 142 PRO D CD    1 
ATOM   9211  N N     . PHE D  1 115 ? 16.658  -41.218 47.169  1.00 29.78  ? 143 PHE D N     1 
ATOM   9212  C CA    . PHE D  1 115 ? 15.595  -40.554 46.439  1.00 28.15  ? 143 PHE D CA    1 
ATOM   9213  C C     . PHE D  1 115 ? 16.198  -39.598 45.429  1.00 27.54  ? 143 PHE D C     1 
ATOM   9214  O O     . PHE D  1 115 ? 15.567  -38.643 45.026  1.00 29.54  ? 143 PHE D O     1 
ATOM   9215  C CB    . PHE D  1 115 ? 14.685  -39.785 47.403  1.00 28.94  ? 143 PHE D CB    1 
ATOM   9216  C CG    . PHE D  1 115 ? 13.946  -40.653 48.358  1.00 23.76  ? 143 PHE D CG    1 
ATOM   9217  C CD1   . PHE D  1 115 ? 12.595  -40.852 48.219  1.00 29.47  ? 143 PHE D CD1   1 
ATOM   9218  C CD2   . PHE D  1 115 ? 14.609  -41.281 49.420  1.00 26.60  ? 143 PHE D CD2   1 
ATOM   9219  C CE1   . PHE D  1 115 ? 11.906  -41.650 49.094  1.00 29.66  ? 143 PHE D CE1   1 
ATOM   9220  C CE2   . PHE D  1 115 ? 13.918  -42.091 50.293  1.00 27.73  ? 143 PHE D CE2   1 
ATOM   9221  C CZ    . PHE D  1 115 ? 12.569  -42.271 50.135  1.00 27.32  ? 143 PHE D CZ    1 
ATOM   9222  N N     . THR D  1 116 ? 17.422  -39.868 44.994  1.00 24.83  ? 144 THR D N     1 
ATOM   9223  C CA    . THR D  1 116 ? 18.099  -38.995 44.046  1.00 28.86  ? 144 THR D CA    1 
ATOM   9224  C C     . THR D  1 116 ? 18.234  -39.558 42.617  1.00 31.58  ? 144 THR D C     1 
ATOM   9225  O O     . THR D  1 116 ? 18.797  -38.885 41.769  1.00 35.04  ? 144 THR D O     1 
ATOM   9226  C CB    . THR D  1 116 ? 19.540  -38.696 44.533  1.00 26.57  ? 144 THR D CB    1 
ATOM   9227  O OG1   . THR D  1 116 ? 20.220  -39.931 44.748  1.00 31.02  ? 144 THR D OG1   1 
ATOM   9228  C CG2   . THR D  1 116 ? 19.537  -37.873 45.812  1.00 26.56  ? 144 THR D CG2   1 
ATOM   9229  N N     . SER D  1 117 ? 17.724  -40.765 42.354  1.00 34.44  ? 145 SER D N     1 
ATOM   9230  C CA    . SER D  1 117 ? 18.061  -41.521 41.125  1.00 32.96  ? 145 SER D CA    1 
ATOM   9231  C C     . SER D  1 117 ? 16.906  -42.118 40.327  1.00 31.58  ? 145 SER D C     1 
ATOM   9232  O O     . SER D  1 117 ? 17.152  -42.764 39.313  1.00 34.95  ? 145 SER D O     1 
ATOM   9233  C CB    . SER D  1 117 ? 18.984  -42.688 41.495  1.00 34.76  ? 145 SER D CB    1 
ATOM   9234  O OG    . SER D  1 117 ? 18.223  -43.747 42.063  1.00 42.59  ? 145 SER D OG    1 
ATOM   9235  N N     . GLY D  1 118 ? 15.668  -41.960 40.800  1.00 32.20  ? 146 GLY D N     1 
ATOM   9236  C CA    . GLY D  1 118 ? 14.482  -42.466 40.103  1.00 33.84  ? 146 GLY D CA    1 
ATOM   9237  C C     . GLY D  1 118 ? 13.818  -43.674 40.748  1.00 33.53  ? 146 GLY D C     1 
ATOM   9238  O O     . GLY D  1 118 ? 12.654  -43.980 40.477  1.00 39.52  ? 146 GLY D O     1 
ATOM   9239  N N     . ASP D  1 119 ? 14.541  -44.358 41.618  1.00 34.47  ? 147 ASP D N     1 
ATOM   9240  C CA    . ASP D  1 119 ? 14.055  -45.594 42.201  1.00 35.84  ? 147 ASP D CA    1 
ATOM   9241  C C     . ASP D  1 119 ? 13.061  -45.324 43.306  1.00 32.45  ? 147 ASP D C     1 
ATOM   9242  O O     . ASP D  1 119 ? 12.046  -46.009 43.414  1.00 33.79  ? 147 ASP D O     1 
ATOM   9243  C CB    . ASP D  1 119 ? 15.241  -46.443 42.676  1.00 38.41  ? 147 ASP D CB    1 
ATOM   9244  C CG    . ASP D  1 119 ? 16.094  -46.956 41.497  1.00 53.77  ? 147 ASP D CG    1 
ATOM   9245  O OD1   . ASP D  1 119 ? 15.516  -47.393 40.465  1.00 49.49  ? 147 ASP D OD1   1 
ATOM   9246  O OD2   . ASP D  1 119 ? 17.338  -46.911 41.594  1.00 58.05  ? 147 ASP D OD2   1 
ATOM   9247  N N     . LYS D  1 120 ? 13.340  -44.300 44.102  1.00 32.07  ? 148 LYS D N     1 
ATOM   9248  C CA    . LYS D  1 120 ? 12.393  -43.806 45.086  1.00 31.61  ? 148 LYS D CA    1 
ATOM   9249  C C     . LYS D  1 120 ? 12.182  -42.305 44.904  1.00 23.20  ? 148 LYS D C     1 
ATOM   9250  O O     . LYS D  1 120 ? 13.104  -41.581 44.550  1.00 27.62  ? 148 LYS D O     1 
ATOM   9251  C CB    . LYS D  1 120 ? 12.871  -44.130 46.508  1.00 29.47  ? 148 LYS D CB    1 
ATOM   9252  C CG    . LYS D  1 120 ? 12.793  -45.624 46.855  1.00 29.99  ? 148 LYS D CG    1 
ATOM   9253  C CD    . LYS D  1 120 ? 13.402  -45.901 48.240  1.00 36.29  ? 148 LYS D CD    1 
ATOM   9254  C CE    . LYS D  1 120 ? 13.243  -47.370 48.653  1.00 37.79  ? 148 LYS D CE    1 
ATOM   9255  N NZ    . LYS D  1 120 ? 13.233  -47.549 50.133  1.00 51.29  ? 148 LYS D NZ    1 
ATOM   9256  N N     . ILE D  1 121 ? 10.938  -41.870 45.094  1.00 25.40  ? 149 ILE D N     1 
ATOM   9257  C CA    . ILE D  1 121 ? 10.578  -40.452 45.140  1.00 26.52  ? 149 ILE D CA    1 
ATOM   9258  C C     . ILE D  1 121 ? 9.781   -40.171 46.417  1.00 24.75  ? 149 ILE D C     1 
ATOM   9259  O O     . ILE D  1 121 ? 9.198   -41.079 47.031  1.00 25.69  ? 149 ILE D O     1 
ATOM   9260  C CB    . ILE D  1 121 ? 9.705   -39.991 43.907  1.00 23.85  ? 149 ILE D CB    1 
ATOM   9261  C CG1   . ILE D  1 121 ? 8.352   -40.727 43.898  1.00 24.68  ? 149 ILE D CG1   1 
ATOM   9262  C CG2   . ILE D  1 121 ? 10.467  -40.175 42.599  1.00 23.53  ? 149 ILE D CG2   1 
ATOM   9263  C CD1   . ILE D  1 121 ? 7.356   -40.244 42.817  1.00 26.29  ? 149 ILE D CD1   1 
ATOM   9264  N N     . GLY D  1 122 ? 9.724   -38.896 46.781  1.00 26.37  ? 150 GLY D N     1 
ATOM   9265  C CA    . GLY D  1 122 ? 8.992   -38.473 47.978  1.00 26.56  ? 150 GLY D CA    1 
ATOM   9266  C C     . GLY D  1 122 ? 7.747   -37.630 47.729  1.00 25.84  ? 150 GLY D C     1 
ATOM   9267  O O     . GLY D  1 122 ? 7.328   -37.397 46.589  1.00 25.79  ? 150 GLY D O     1 
ATOM   9268  N N     . CYS D  1 123 ? 7.170   -37.177 48.832  1.00 25.37  ? 151 CYS D N     1 
ATOM   9269  C CA    . CYS D  1 123 ? 6.048   -36.264 48.811  1.00 23.83  ? 151 CYS D CA    1 
ATOM   9270  C C     . CYS D  1 123 ? 6.071   -35.310 50.023  1.00 25.36  ? 151 CYS D C     1 
ATOM   9271  O O     . CYS D  1 123 ? 6.812   -35.504 50.976  1.00 28.17  ? 151 CYS D O     1 
ATOM   9272  C CB    . CYS D  1 123 ? 4.764   -37.066 48.766  1.00 23.37  ? 151 CYS D CB    1 
ATOM   9273  S SG    . CYS D  1 123 ? 4.495   -38.103 50.196  1.00 27.37  ? 151 CYS D SG    1 
ATOM   9274  N N     . PHE D  1 124 ? 5.214   -34.299 49.966  1.00 27.20  ? 152 PHE D N     1 
ATOM   9275  C CA    . PHE D  1 124 ? 5.139   -33.204 50.929  1.00 24.05  ? 152 PHE D CA    1 
ATOM   9276  C C     . PHE D  1 124 ? 3.711   -33.141 51.437  1.00 21.95  ? 152 PHE D C     1 
ATOM   9277  O O     . PHE D  1 124 ? 2.784   -33.043 50.637  1.00 21.42  ? 152 PHE D O     1 
ATOM   9278  C CB    . PHE D  1 124 ? 5.498   -31.941 50.163  1.00 26.34  ? 152 PHE D CB    1 
ATOM   9279  C CG    . PHE D  1 124 ? 5.444   -30.664 50.960  1.00 27.23  ? 152 PHE D CG    1 
ATOM   9280  C CD1   . PHE D  1 124 ? 6.557   -30.226 51.683  1.00 26.63  ? 152 PHE D CD1   1 
ATOM   9281  C CD2   . PHE D  1 124 ? 4.316   -29.849 50.909  1.00 25.84  ? 152 PHE D CD2   1 
ATOM   9282  C CE1   . PHE D  1 124 ? 6.529   -29.005 52.381  1.00 23.00  ? 152 PHE D CE1   1 
ATOM   9283  C CE2   . PHE D  1 124 ? 4.277   -28.621 51.604  1.00 27.42  ? 152 PHE D CE2   1 
ATOM   9284  C CZ    . PHE D  1 124 ? 5.397   -28.205 52.335  1.00 29.40  ? 152 PHE D CZ    1 
ATOM   9285  N N     . ALA D  1 125 ? 3.519   -33.193 52.753  1.00 25.49  ? 153 ALA D N     1 
ATOM   9286  C CA    . ALA D  1 125 ? 2.161   -33.290 53.298  1.00 24.09  ? 153 ALA D CA    1 
ATOM   9287  C C     . ALA D  1 125 ? 1.864   -32.225 54.357  1.00 23.52  ? 153 ALA D C     1 
ATOM   9288  O O     . ALA D  1 125 ? 2.166   -32.366 55.559  1.00 22.18  ? 153 ALA D O     1 
ATOM   9289  C CB    . ALA D  1 125 ? 1.909   -34.684 53.828  1.00 21.97  ? 153 ALA D CB    1 
ATOM   9290  N N     . LEU D  1 126 ? 1.276   -31.137 53.881  1.00 23.84  ? 154 LEU D N     1 
ATOM   9291  C CA    . LEU D  1 126 ? 1.002   -29.980 54.698  1.00 21.60  ? 154 LEU D CA    1 
ATOM   9292  C C     . LEU D  1 126 ? -0.491  -29.767 54.814  1.00 23.28  ? 154 LEU D C     1 
ATOM   9293  O O     . LEU D  1 126 ? -1.028  -29.635 55.913  1.00 24.77  ? 154 LEU D O     1 
ATOM   9294  C CB    . LEU D  1 126 ? 1.679   -28.761 54.077  1.00 25.62  ? 154 LEU D CB    1 
ATOM   9295  C CG    . LEU D  1 126 ? 1.434   -27.399 54.742  1.00 24.84  ? 154 LEU D CG    1 
ATOM   9296  C CD1   . LEU D  1 126 ? 1.614   -27.463 56.288  1.00 22.24  ? 154 LEU D CD1   1 
ATOM   9297  C CD2   . LEU D  1 126 ? 2.310   -26.319 54.079  1.00 26.72  ? 154 LEU D CD2   1 
ATOM   9298  N N     . SER D  1 127 ? -1.152  -29.752 53.663  1.00 23.98  ? 155 SER D N     1 
ATOM   9299  C CA    . SER D  1 127 ? -2.582  -29.487 53.584  1.00 23.28  ? 155 SER D CA    1 
ATOM   9300  C C     . SER D  1 127 ? -3.437  -30.573 54.245  1.00 23.99  ? 155 SER D C     1 
ATOM   9301  O O     . SER D  1 127 ? -3.055  -31.741 54.341  1.00 24.81  ? 155 SER D O     1 
ATOM   9302  C CB    . SER D  1 127 ? -3.003  -29.319 52.116  1.00 23.88  ? 155 SER D CB    1 
ATOM   9303  O OG    . SER D  1 127 ? -2.203  -28.340 51.467  1.00 24.19  ? 155 SER D OG    1 
ATOM   9304  N N     . GLU D  1 128 ? -4.612  -30.174 54.705  1.00 27.33  ? 156 GLU D N     1 
ATOM   9305  C CA    . GLU D  1 128 ? -5.579  -31.100 55.298  1.00 27.92  ? 156 GLU D CA    1 
ATOM   9306  C C     . GLU D  1 128 ? -6.932  -30.792 54.699  1.00 26.21  ? 156 GLU D C     1 
ATOM   9307  O O     . GLU D  1 128 ? -7.106  -29.733 54.081  1.00 29.02  ? 156 GLU D O     1 
ATOM   9308  C CB    . GLU D  1 128 ? -5.616  -30.922 56.824  1.00 27.32  ? 156 GLU D CB    1 
ATOM   9309  C CG    . GLU D  1 128 ? -4.218  -31.028 57.459  1.00 28.76  ? 156 GLU D CG    1 
ATOM   9310  C CD    . GLU D  1 128 ? -4.228  -30.971 58.992  1.00 36.71  ? 156 GLU D CD    1 
ATOM   9311  O OE1   . GLU D  1 128 ? -5.139  -30.322 59.579  1.00 39.03  ? 156 GLU D OE1   1 
ATOM   9312  O OE2   . GLU D  1 128 ? -3.306  -31.569 59.612  1.00 31.19  ? 156 GLU D OE2   1 
ATOM   9313  N N     . PRO D  1 129 ? -7.891  -31.716 54.840  1.00 26.74  ? 157 PRO D N     1 
ATOM   9314  C CA    . PRO D  1 129 ? -9.243  -31.466 54.311  1.00 29.75  ? 157 PRO D CA    1 
ATOM   9315  C C     . PRO D  1 129 ? -9.901  -30.138 54.722  1.00 30.81  ? 157 PRO D C     1 
ATOM   9316  O O     . PRO D  1 129 ? -10.578 -29.487 53.906  1.00 27.63  ? 157 PRO D O     1 
ATOM   9317  C CB    . PRO D  1 129 ? -10.048 -32.652 54.851  1.00 28.22  ? 157 PRO D CB    1 
ATOM   9318  C CG    . PRO D  1 129 ? -9.022  -33.751 54.995  1.00 30.44  ? 157 PRO D CG    1 
ATOM   9319  C CD    . PRO D  1 129 ? -7.763  -33.069 55.413  1.00 27.60  ? 157 PRO D CD    1 
ATOM   9320  N N     . GLY D  1 130 ? -9.711  -29.746 55.974  1.00 30.95  ? 158 GLY D N     1 
ATOM   9321  C CA    . GLY D  1 130 ? -10.350 -28.560 56.498  1.00 31.21  ? 158 GLY D CA    1 
ATOM   9322  C C     . GLY D  1 130 ? -9.530  -27.303 56.268  1.00 32.05  ? 158 GLY D C     1 
ATOM   9323  O O     . GLY D  1 130 ? -10.001 -26.215 56.573  1.00 31.62  ? 158 GLY D O     1 
ATOM   9324  N N     . ASN D  1 131 ? -8.310  -27.439 55.753  1.00 28.32  ? 159 ASN D N     1 
ATOM   9325  C CA    . ASN D  1 131 ? -7.388  -26.304 55.644  1.00 29.94  ? 159 ASN D CA    1 
ATOM   9326  C C     . ASN D  1 131 ? -6.215  -26.524 54.689  1.00 28.91  ? 159 ASN D C     1 
ATOM   9327  O O     . ASN D  1 131 ? -5.420  -27.444 54.880  1.00 27.24  ? 159 ASN D O     1 
ATOM   9328  C CB    . ASN D  1 131 ? -6.839  -25.922 57.040  1.00 34.85  ? 159 ASN D CB    1 
ATOM   9329  C CG    . ASN D  1 131 ? -6.384  -27.137 57.871  1.00 36.43  ? 159 ASN D CG    1 
ATOM   9330  O OD1   . ASN D  1 131 ? -7.199  -27.846 58.451  1.00 47.01  ? 159 ASN D OD1   1 
ATOM   9331  N ND2   . ASN D  1 131 ? -5.073  -27.344 57.956  1.00 47.43  ? 159 ASN D ND2   1 
ATOM   9332  N N     . GLY D  1 132 ? -6.101  -25.661 53.671  1.00 27.25  ? 160 GLY D N     1 
ATOM   9333  C CA    . GLY D  1 132 ? -4.964  -25.643 52.757  1.00 26.13  ? 160 GLY D CA    1 
ATOM   9334  C C     . GLY D  1 132 ? -4.253  -24.301 52.704  1.00 30.13  ? 160 GLY D C     1 
ATOM   9335  O O     . GLY D  1 132 ? -3.060  -24.225 52.896  1.00 33.63  ? 160 GLY D O     1 
ATOM   9336  N N     . SER D  1 133 ? -4.988  -23.225 52.459  1.00 32.41  ? 161 SER D N     1 
ATOM   9337  C CA    . SER D  1 133 ? -4.392  -21.881 52.499  1.00 32.37  ? 161 SER D CA    1 
ATOM   9338  C C     . SER D  1 133 ? -3.989  -21.513 53.934  1.00 31.37  ? 161 SER D C     1 
ATOM   9339  O O     . SER D  1 133 ? -2.961  -20.866 54.172  1.00 30.45  ? 161 SER D O     1 
ATOM   9340  C CB    . SER D  1 133 ? -5.379  -20.851 51.908  1.00 24.58  ? 161 SER D CB    1 
ATOM   9341  O OG    . SER D  1 133 ? -5.490  -21.029 50.509  1.00 31.19  ? 161 SER D OG    1 
ATOM   9342  N N     . ASP D  1 134 ? -4.806  -21.965 54.876  1.00 35.39  ? 162 ASP D N     1 
ATOM   9343  C CA    . ASP D  1 134 ? -4.620  -21.708 56.292  1.00 37.27  ? 162 ASP D CA    1 
ATOM   9344  C C     . ASP D  1 134 ? -3.757  -22.847 56.801  1.00 39.77  ? 162 ASP D C     1 
ATOM   9345  O O     . ASP D  1 134 ? -4.260  -23.792 57.436  1.00 37.29  ? 162 ASP D O     1 
ATOM   9346  C CB    . ASP D  1 134 ? -5.987  -21.663 57.009  1.00 38.14  ? 162 ASP D CB    1 
ATOM   9347  C CG    . ASP D  1 134 ? -5.897  -21.101 58.431  1.00 42.58  ? 162 ASP D CG    1 
ATOM   9348  O OD1   . ASP D  1 134 ? -4.771  -20.830 58.914  1.00 33.44  ? 162 ASP D OD1   1 
ATOM   9349  O OD2   . ASP D  1 134 ? -6.973  -20.926 59.057  1.00 33.81  ? 162 ASP D OD2   1 
ATOM   9350  N N     . ALA D  1 135 ? -2.461  -22.732 56.499  1.00 37.57  ? 163 ALA D N     1 
ATOM   9351  C CA    . ALA D  1 135 ? -1.478  -23.789 56.735  1.00 41.31  ? 163 ALA D CA    1 
ATOM   9352  C C     . ALA D  1 135 ? -1.342  -24.109 58.216  1.00 42.09  ? 163 ALA D C     1 
ATOM   9353  O O     . ALA D  1 135 ? -1.431  -25.281 58.621  1.00 42.53  ? 163 ALA D O     1 
ATOM   9354  C CB    . ALA D  1 135 ? -0.127  -23.387 56.168  1.00 39.07  ? 163 ALA D CB    1 
ATOM   9355  N N     . GLY D  1 136 ? -1.133  -23.063 59.019  1.00 40.83  ? 164 GLY D N     1 
ATOM   9356  C CA    . GLY D  1 136 ? -0.968  -23.199 60.471  1.00 38.91  ? 164 GLY D CA    1 
ATOM   9357  C C     . GLY D  1 136 ? -2.154  -23.825 61.203  1.00 36.39  ? 164 GLY D C     1 
ATOM   9358  O O     . GLY D  1 136 ? -2.034  -24.164 62.367  1.00 35.71  ? 164 GLY D O     1 
ATOM   9359  N N     . ALA D  1 137 ? -3.297  -23.994 60.541  1.00 35.01  ? 165 ALA D N     1 
ATOM   9360  C CA    . ALA D  1 137 ? -4.452  -24.664 61.179  1.00 37.52  ? 165 ALA D CA    1 
ATOM   9361  C C     . ALA D  1 137 ? -4.375  -26.217 61.187  1.00 38.56  ? 165 ALA D C     1 
ATOM   9362  O O     . ALA D  1 137 ? -5.412  -26.880 61.370  1.00 40.58  ? 165 ALA D O     1 
ATOM   9363  C CB    . ALA D  1 137 ? -5.772  -24.193 60.543  1.00 33.42  ? 165 ALA D CB    1 
ATOM   9364  N N     . ALA D  1 138 ? -3.168  -26.780 61.003  1.00 39.65  ? 166 ALA D N     1 
ATOM   9365  C CA    . ALA D  1 138 ? -2.942  -28.246 61.012  1.00 37.65  ? 166 ALA D CA    1 
ATOM   9366  C C     . ALA D  1 138 ? -3.527  -28.929 62.256  1.00 35.22  ? 166 ALA D C     1 
ATOM   9367  O O     . ALA D  1 138 ? -3.101  -28.655 63.372  1.00 37.40  ? 166 ALA D O     1 
ATOM   9368  C CB    . ALA D  1 138 ? -1.417  -28.564 60.904  1.00 36.75  ? 166 ALA D CB    1 
ATOM   9369  N N     . SER D  1 139 ? -4.507  -29.809 62.061  1.00 32.41  ? 167 SER D N     1 
ATOM   9370  C CA    . SER D  1 139 ? -5.115  -30.541 63.167  1.00 34.36  ? 167 SER D CA    1 
ATOM   9371  C C     . SER D  1 139 ? -4.636  -32.002 63.254  1.00 33.67  ? 167 SER D C     1 
ATOM   9372  O O     . SER D  1 139 ? -5.122  -32.748 64.094  1.00 33.18  ? 167 SER D O     1 
ATOM   9373  C CB    . SER D  1 139 ? -6.633  -30.491 63.061  1.00 32.65  ? 167 SER D CB    1 
ATOM   9374  O OG    . SER D  1 139 ? -7.084  -31.267 61.981  1.00 41.23  ? 167 SER D OG    1 
ATOM   9375  N N     . THR D  1 140 ? -3.706  -32.394 62.380  1.00 32.40  ? 168 THR D N     1 
ATOM   9376  C CA    . THR D  1 140 ? -2.970  -33.650 62.529  1.00 29.56  ? 168 THR D CA    1 
ATOM   9377  C C     . THR D  1 140 ? -2.035  -33.479 63.725  1.00 29.47  ? 168 THR D C     1 
ATOM   9378  O O     . THR D  1 140 ? -1.355  -32.464 63.849  1.00 31.28  ? 168 THR D O     1 
ATOM   9379  C CB    . THR D  1 140 ? -2.164  -34.013 61.254  1.00 32.18  ? 168 THR D CB    1 
ATOM   9380  O OG1   . THR D  1 140 ? -3.068  -34.206 60.157  1.00 34.50  ? 168 THR D OG1   1 
ATOM   9381  C CG2   . THR D  1 140 ? -1.368  -35.289 61.456  1.00 24.94  ? 168 THR D CG2   1 
ATOM   9382  N N     . THR D  1 141 ? -2.021  -34.469 64.608  1.00 28.55  ? 169 THR D N     1 
ATOM   9383  C CA    . THR D  1 141 ? -1.349  -34.342 65.896  1.00 29.96  ? 169 THR D CA    1 
ATOM   9384  C C     . THR D  1 141 ? -0.203  -35.330 65.934  1.00 26.44  ? 169 THR D C     1 
ATOM   9385  O O     . THR D  1 141 ? -0.289  -36.408 65.350  1.00 28.81  ? 169 THR D O     1 
ATOM   9386  C CB    . THR D  1 141 ? -2.293  -34.605 67.101  1.00 28.31  ? 169 THR D CB    1 
ATOM   9387  O OG1   . THR D  1 141 ? -2.847  -35.919 67.005  1.00 32.34  ? 169 THR D OG1   1 
ATOM   9388  C CG2   . THR D  1 141 ? -3.433  -33.572 67.172  1.00 30.66  ? 169 THR D CG2   1 
ATOM   9389  N N     . ALA D  1 142 ? 0.881   -34.915 66.580  1.00 28.52  ? 170 ALA D N     1 
ATOM   9390  C CA    . ALA D  1 142 ? 2.029   -35.766 66.842  1.00 28.80  ? 170 ALA D CA    1 
ATOM   9391  C C     . ALA D  1 142 ? 2.244   -35.728 68.352  1.00 33.91  ? 170 ALA D C     1 
ATOM   9392  O O     . ALA D  1 142 ? 2.401   -34.648 68.941  1.00 34.04  ? 170 ALA D O     1 
ATOM   9393  C CB    . ALA D  1 142 ? 3.239   -35.245 66.127  1.00 25.72  ? 170 ALA D CB    1 
ATOM   9394  N N     . ARG D  1 143 ? 2.232   -36.902 68.982  1.00 34.39  ? 171 ARG D N     1 
ATOM   9395  C CA    . ARG D  1 143 ? 2.358   -36.988 70.423  1.00 33.34  ? 171 ARG D CA    1 
ATOM   9396  C C     . ARG D  1 143 ? 3.555   -37.848 70.774  1.00 30.89  ? 171 ARG D C     1 
ATOM   9397  O O     . ARG D  1 143 ? 3.689   -38.968 70.290  1.00 30.41  ? 171 ARG D O     1 
ATOM   9398  C CB    . ARG D  1 143 ? 1.080   -37.570 71.009  1.00 33.95  ? 171 ARG D CB    1 
ATOM   9399  C CG    . ARG D  1 143 ? 1.050   -37.653 72.547  1.00 48.82  ? 171 ARG D CG    1 
ATOM   9400  C CD    . ARG D  1 143 ? -0.033  -38.608 73.016  1.00 62.45  ? 171 ARG D CD    1 
ATOM   9401  N NE    . ARG D  1 143 ? 0.111   -39.909 72.364  1.00 81.32  ? 171 ARG D NE    1 
ATOM   9402  C CZ    . ARG D  1 143 ? -0.766  -40.903 72.452  1.00 84.82  ? 171 ARG D CZ    1 
ATOM   9403  N NH1   . ARG D  1 143 ? -1.864  -40.780 73.192  1.00 97.43  ? 171 ARG D NH1   1 
ATOM   9404  N NH2   . ARG D  1 143 ? -0.534  -42.037 71.799  1.00 84.58  ? 171 ARG D NH2   1 
ATOM   9405  N N     . ALA D  1 144 ? 4.442   -37.307 71.597  1.00 32.51  ? 172 ALA D N     1 
ATOM   9406  C CA    . ALA D  1 144 ? 5.638   -38.052 72.046  1.00 34.25  ? 172 ALA D CA    1 
ATOM   9407  C C     . ALA D  1 144 ? 5.251   -39.145 73.061  1.00 35.02  ? 172 ALA D C     1 
ATOM   9408  O O     . ALA D  1 144 ? 4.744   -38.837 74.131  1.00 35.90  ? 172 ALA D O     1 
ATOM   9409  C CB    . ALA D  1 144 ? 6.643   -37.103 72.649  1.00 32.13  ? 172 ALA D CB    1 
ATOM   9410  N N     . GLU D  1 145 ? 5.470   -40.414 72.704  1.00 38.97  ? 173 GLU D N     1 
ATOM   9411  C CA    . GLU D  1 145 ? 5.181   -41.549 73.592  1.00 40.31  ? 173 GLU D CA    1 
ATOM   9412  C C     . GLU D  1 145 ? 6.290   -42.606 73.541  1.00 42.49  ? 173 GLU D C     1 
ATOM   9413  O O     . GLU D  1 145 ? 6.312   -43.464 72.648  1.00 43.08  ? 173 GLU D O     1 
ATOM   9414  C CB    . GLU D  1 145 ? 3.836   -42.192 73.230  1.00 39.12  ? 173 GLU D CB    1 
ATOM   9415  C CG    . GLU D  1 145 ? 3.499   -43.430 74.087  1.00 54.92  ? 173 GLU D CG    1 
ATOM   9416  C CD    . GLU D  1 145 ? 2.069   -43.923 73.906  1.00 53.95  ? 173 GLU D CD    1 
ATOM   9417  O OE1   . GLU D  1 145 ? 1.536   -43.822 72.780  1.00 86.85  ? 173 GLU D OE1   1 
ATOM   9418  O OE2   . GLU D  1 145 ? 1.484   -44.424 74.894  1.00 83.52  ? 173 GLU D OE2   1 
ATOM   9419  N N     . GLY D  1 146 ? 7.211   -42.536 74.500  1.00 43.16  ? 174 GLY D N     1 
ATOM   9420  C CA    . GLY D  1 146 ? 8.283   -43.515 74.601  1.00 41.30  ? 174 GLY D CA    1 
ATOM   9421  C C     . GLY D  1 146 ? 9.340   -43.300 73.544  1.00 39.91  ? 174 GLY D C     1 
ATOM   9422  O O     . GLY D  1 146 ? 9.872   -42.198 73.406  1.00 45.97  ? 174 GLY D O     1 
ATOM   9423  N N     . ASP D  1 147 ? 9.635   -44.362 72.797  1.00 40.71  ? 175 ASP D N     1 
ATOM   9424  C CA    . ASP D  1 147 ? 10.641  -44.331 71.735  1.00 41.63  ? 175 ASP D CA    1 
ATOM   9425  C C     . ASP D  1 147 ? 10.090  -43.795 70.405  1.00 39.93  ? 175 ASP D C     1 
ATOM   9426  O O     . ASP D  1 147 ? 10.838  -43.714 69.421  1.00 35.35  ? 175 ASP D O     1 
ATOM   9427  C CB    . ASP D  1 147 ? 11.196  -45.741 71.505  1.00 41.53  ? 175 ASP D CB    1 
ATOM   9428  N N     . SER D  1 148 ? 8.798   -43.428 70.385  1.00 37.55  ? 176 SER D N     1 
ATOM   9429  C CA    . SER D  1 148 ? 8.138   -42.987 69.167  1.00 36.56  ? 176 SER D CA    1 
ATOM   9430  C C     . SER D  1 148 ? 7.390   -41.639 69.276  1.00 36.22  ? 176 SER D C     1 
ATOM   9431  O O     . SER D  1 148 ? 6.989   -41.177 70.364  1.00 35.23  ? 176 SER D O     1 
ATOM   9432  C CB    . SER D  1 148 ? 7.146   -44.075 68.696  1.00 38.25  ? 176 SER D CB    1 
ATOM   9433  O OG    . SER D  1 148 ? 7.808   -45.164 68.054  1.00 40.28  ? 176 SER D OG    1 
ATOM   9434  N N     . TRP D  1 149 ? 7.214   -41.017 68.111  1.00 33.80  ? 177 TRP D N     1 
ATOM   9435  C CA    . TRP D  1 149 ? 6.177   -40.006 67.906  1.00 30.92  ? 177 TRP D CA    1 
ATOM   9436  C C     . TRP D  1 149 ? 4.958   -40.753 67.396  1.00 28.36  ? 177 TRP D C     1 
ATOM   9437  O O     . TRP D  1 149 ? 5.096   -41.652 66.567  1.00 31.91  ? 177 TRP D O     1 
ATOM   9438  C CB    . TRP D  1 149 ? 6.602   -39.003 66.854  1.00 29.68  ? 177 TRP D CB    1 
ATOM   9439  C CG    . TRP D  1 149 ? 7.663   -38.075 67.260  1.00 30.87  ? 177 TRP D CG    1 
ATOM   9440  C CD1   . TRP D  1 149 ? 8.965   -38.092 66.864  1.00 30.70  ? 177 TRP D CD1   1 
ATOM   9441  C CD2   . TRP D  1 149 ? 7.509   -36.937 68.098  1.00 32.42  ? 177 TRP D CD2   1 
ATOM   9442  N NE1   . TRP D  1 149 ? 9.639   -37.028 67.411  1.00 32.28  ? 177 TRP D NE1   1 
ATOM   9443  C CE2   . TRP D  1 149 ? 8.767   -36.305 68.178  1.00 25.22  ? 177 TRP D CE2   1 
ATOM   9444  C CE3   . TRP D  1 149 ? 6.425   -36.378 68.779  1.00 26.85  ? 177 TRP D CE3   1 
ATOM   9445  C CZ2   . TRP D  1 149 ? 8.974   -35.150 68.923  1.00 32.34  ? 177 TRP D CZ2   1 
ATOM   9446  C CZ3   . TRP D  1 149 ? 6.631   -35.237 69.528  1.00 33.79  ? 177 TRP D CZ3   1 
ATOM   9447  C CH2   . TRP D  1 149 ? 7.896   -34.637 69.599  1.00 33.23  ? 177 TRP D CH2   1 
ATOM   9448  N N     . VAL D  1 150 ? 3.781   -40.397 67.900  1.00 28.99  ? 178 VAL D N     1 
ATOM   9449  C CA    . VAL D  1 150 ? 2.528   -40.992 67.438  1.00 30.46  ? 178 VAL D CA    1 
ATOM   9450  C C     . VAL D  1 150 ? 1.704   -39.980 66.625  1.00 29.77  ? 178 VAL D C     1 
ATOM   9451  O O     . VAL D  1 150 ? 1.298   -38.942 67.144  1.00 30.04  ? 178 VAL D O     1 
ATOM   9452  C CB    . VAL D  1 150 ? 1.688   -41.501 68.603  1.00 29.84  ? 178 VAL D CB    1 
ATOM   9453  C CG1   . VAL D  1 150 ? 0.506   -42.307 68.074  1.00 29.83  ? 178 VAL D CG1   1 
ATOM   9454  C CG2   . VAL D  1 150 ? 2.544   -42.363 69.534  1.00 32.31  ? 178 VAL D CG2   1 
ATOM   9455  N N     . LEU D  1 151 ? 1.453   -40.306 65.355  1.00 29.56  ? 179 LEU D N     1 
ATOM   9456  C CA    . LEU D  1 151 ? 0.718   -39.411 64.439  1.00 27.37  ? 179 LEU D CA    1 
ATOM   9457  C C     . LEU D  1 151 ? -0.738  -39.841 64.311  1.00 26.98  ? 179 LEU D C     1 
ATOM   9458  O O     . LEU D  1 151 ? -1.041  -41.042 64.151  1.00 29.67  ? 179 LEU D O     1 
ATOM   9459  C CB    . LEU D  1 151 ? 1.379   -39.364 63.067  1.00 26.93  ? 179 LEU D CB    1 
ATOM   9460  C CG    . LEU D  1 151 ? 2.598   -38.458 62.913  1.00 31.69  ? 179 LEU D CG    1 
ATOM   9461  C CD1   . LEU D  1 151 ? 3.558   -38.590 64.077  1.00 34.02  ? 179 LEU D CD1   1 
ATOM   9462  C CD2   . LEU D  1 151 ? 3.304   -38.729 61.590  1.00 34.52  ? 179 LEU D CD2   1 
ATOM   9463  N N     . ASN D  1 152 ? -1.627  -38.849 64.408  1.00 29.00  ? 180 ASN D N     1 
ATOM   9464  C CA    . ASN D  1 152 ? -3.063  -39.029 64.206  1.00 25.80  ? 180 ASN D CA    1 
ATOM   9465  C C     . ASN D  1 152 ? -3.670  -37.889 63.359  1.00 29.94  ? 180 ASN D C     1 
ATOM   9466  O O     . ASN D  1 152 ? -3.465  -36.719 63.666  1.00 29.35  ? 180 ASN D O     1 
ATOM   9467  C CB    . ASN D  1 152 ? -3.755  -39.084 65.559  1.00 29.64  ? 180 ASN D CB    1 
ATOM   9468  C CG    . ASN D  1 152 ? -3.750  -40.468 66.153  1.00 37.22  ? 180 ASN D CG    1 
ATOM   9469  O OD1   . ASN D  1 152 ? -4.580  -41.318 65.776  1.00 28.41  ? 180 ASN D OD1   1 
ATOM   9470  N ND2   . ASN D  1 152 ? -2.804  -40.718 67.094  1.00 25.97  ? 180 ASN D ND2   1 
ATOM   9471  N N     . GLY D  1 153 ? -4.386  -38.231 62.288  1.00 27.44  ? 181 GLY D N     1 
ATOM   9472  C CA    . GLY D  1 153 ? -4.991  -37.227 61.409  1.00 28.75  ? 181 GLY D CA    1 
ATOM   9473  C C     . GLY D  1 153 ? -4.922  -37.541 59.930  1.00 28.24  ? 181 GLY D C     1 
ATOM   9474  O O     . GLY D  1 153 ? -4.272  -38.488 59.526  1.00 32.03  ? 181 GLY D O     1 
ATOM   9475  N N     . THR D  1 154 ? -5.575  -36.712 59.119  1.00 29.99  ? 182 THR D N     1 
ATOM   9476  C CA    . THR D  1 154 ? -5.557  -36.869 57.653  1.00 29.72  ? 182 THR D CA    1 
ATOM   9477  C C     . THR D  1 154 ? -4.881  -35.674 56.975  1.00 25.82  ? 182 THR D C     1 
ATOM   9478  O O     . THR D  1 154 ? -5.148  -34.513 57.297  1.00 23.45  ? 182 THR D O     1 
ATOM   9479  C CB    . THR D  1 154 ? -6.981  -37.121 57.122  1.00 28.34  ? 182 THR D CB    1 
ATOM   9480  O OG1   . THR D  1 154 ? -7.471  -38.337 57.705  1.00 35.64  ? 182 THR D OG1   1 
ATOM   9481  C CG2   . THR D  1 154 ? -7.045  -37.241 55.573  1.00 28.76  ? 182 THR D CG2   1 
ATOM   9482  N N     . LYS D  1 155 ? -3.923  -35.963 56.100  1.00 28.37  ? 183 LYS D N     1 
ATOM   9483  C CA    . LYS D  1 155 ? -3.403  -34.952 55.191  1.00 26.04  ? 183 LYS D CA    1 
ATOM   9484  C C     . LYS D  1 155 ? -4.142  -35.104 53.868  1.00 26.70  ? 183 LYS D C     1 
ATOM   9485  O O     . LYS D  1 155 ? -4.505  -36.210 53.492  1.00 26.77  ? 183 LYS D O     1 
ATOM   9486  C CB    . LYS D  1 155 ? -1.879  -35.057 55.018  1.00 25.32  ? 183 LYS D CB    1 
ATOM   9487  C CG    . LYS D  1 155 ? -1.104  -35.151 56.322  1.00 29.44  ? 183 LYS D CG    1 
ATOM   9488  C CD    . LYS D  1 155 ? -1.405  -34.030 57.337  1.00 31.28  ? 183 LYS D CD    1 
ATOM   9489  C CE    . LYS D  1 155 ? -0.581  -32.798 57.081  1.00 29.81  ? 183 LYS D CE    1 
ATOM   9490  N NZ    . LYS D  1 155 ? -0.859  -31.726 58.062  1.00 25.74  ? 183 LYS D NZ    1 
ATOM   9491  N N     . ALA D  1 156 ? -4.402  -33.985 53.195  1.00 27.77  ? 184 ALA D N     1 
ATOM   9492  C CA    . ALA D  1 156 ? -5.138  -33.988 51.940  1.00 26.10  ? 184 ALA D CA    1 
ATOM   9493  C C     . ALA D  1 156 ? -4.311  -33.434 50.779  1.00 24.79  ? 184 ALA D C     1 
ATOM   9494  O O     . ALA D  1 156 ? -3.409  -32.610 50.965  1.00 22.99  ? 184 ALA D O     1 
ATOM   9495  C CB    . ALA D  1 156 ? -6.445  -33.214 52.104  1.00 23.28  ? 184 ALA D CB    1 
ATOM   9496  N N     . TRP D  1 157 ? -4.628  -33.927 49.581  1.00 26.38  ? 185 TRP D N     1 
ATOM   9497  C CA    . TRP D  1 157 ? -4.102  -33.425 48.300  1.00 26.88  ? 185 TRP D CA    1 
ATOM   9498  C C     . TRP D  1 157 ? -2.657  -33.753 48.051  1.00 26.02  ? 185 TRP D C     1 
ATOM   9499  O O     . TRP D  1 157 ? -1.945  -32.960 47.444  1.00 25.95  ? 185 TRP D O     1 
ATOM   9500  C CB    . TRP D  1 157 ? -4.229  -31.914 48.176  1.00 27.73  ? 185 TRP D CB    1 
ATOM   9501  C CG    . TRP D  1 157 ? -5.539  -31.422 48.461  1.00 23.79  ? 185 TRP D CG    1 
ATOM   9502  C CD1   . TRP D  1 157 ? -5.907  -30.673 49.535  1.00 28.45  ? 185 TRP D CD1   1 
ATOM   9503  C CD2   . TRP D  1 157 ? -6.693  -31.566 47.648  1.00 23.87  ? 185 TRP D CD2   1 
ATOM   9504  N NE1   . TRP D  1 157 ? -7.240  -30.380 49.472  1.00 19.72  ? 185 TRP D NE1   1 
ATOM   9505  C CE2   . TRP D  1 157 ? -7.756  -30.907 48.321  1.00 28.26  ? 185 TRP D CE2   1 
ATOM   9506  C CE3   . TRP D  1 157 ? -6.956  -32.220 46.444  1.00 25.11  ? 185 TRP D CE3   1 
ATOM   9507  C CZ2   . TRP D  1 157 ? -9.058  -30.868 47.816  1.00 27.84  ? 185 TRP D CZ2   1 
ATOM   9508  C CZ3   . TRP D  1 157 ? -8.256  -32.191 45.938  1.00 29.61  ? 185 TRP D CZ3   1 
ATOM   9509  C CH2   . TRP D  1 157 ? -9.293  -31.513 46.622  1.00 29.66  ? 185 TRP D CH2   1 
ATOM   9510  N N     . ILE D  1 158 ? -2.203  -34.911 48.500  1.00 27.15  ? 186 ILE D N     1 
ATOM   9511  C CA    . ILE D  1 158 ? -0.781  -35.152 48.449  1.00 22.67  ? 186 ILE D CA    1 
ATOM   9512  C C     . ILE D  1 158 ? -0.409  -35.700 47.085  1.00 19.55  ? 186 ILE D C     1 
ATOM   9513  O O     . ILE D  1 158 ? -0.790  -36.804 46.719  1.00 22.24  ? 186 ILE D O     1 
ATOM   9514  C CB    . ILE D  1 158 ? -0.280  -36.055 49.591  1.00 27.01  ? 186 ILE D CB    1 
ATOM   9515  C CG1   . ILE D  1 158 ? -0.758  -35.541 50.968  1.00 26.63  ? 186 ILE D CG1   1 
ATOM   9516  C CG2   . ILE D  1 158 ? 1.230   -36.188 49.504  1.00 23.12  ? 186 ILE D CG2   1 
ATOM   9517  C CD1   . ILE D  1 158 ? -0.540  -34.078 51.253  1.00 25.48  ? 186 ILE D CD1   1 
ATOM   9518  N N     . THR D  1 159 ? 0.337   -34.890 46.338  1.00 22.63  ? 187 THR D N     1 
ATOM   9519  C CA    . THR D  1 159 ? 0.891   -35.266 45.057  1.00 22.03  ? 187 THR D CA    1 
ATOM   9520  C C     . THR D  1 159 ? 1.965   -36.360 45.291  1.00 25.62  ? 187 THR D C     1 
ATOM   9521  O O     . THR D  1 159 ? 2.800   -36.219 46.179  1.00 26.60  ? 187 THR D O     1 
ATOM   9522  C CB    . THR D  1 159 ? 1.526   -34.031 44.369  1.00 25.27  ? 187 THR D CB    1 
ATOM   9523  O OG1   . THR D  1 159 ? 0.517   -33.029 44.175  1.00 22.51  ? 187 THR D OG1   1 
ATOM   9524  C CG2   . THR D  1 159 ? 2.203   -34.386 43.018  1.00 22.73  ? 187 THR D CG2   1 
ATOM   9525  N N     . ASN D  1 160 ? 1.947   -37.410 44.470  1.00 21.49  ? 188 ASN D N     1 
ATOM   9526  C CA    . ASN D  1 160 ? 2.896   -38.550 44.575  1.00 24.20  ? 188 ASN D CA    1 
ATOM   9527  C C     . ASN D  1 160 ? 2.546   -39.543 45.701  1.00 26.28  ? 188 ASN D C     1 
ATOM   9528  O O     . ASN D  1 160 ? 3.343   -40.448 45.987  1.00 27.70  ? 188 ASN D O     1 
ATOM   9529  C CB    . ASN D  1 160 ? 4.375   -38.103 44.743  1.00 23.67  ? 188 ASN D CB    1 
ATOM   9530  C CG    . ASN D  1 160 ? 4.973   -37.413 43.526  1.00 26.34  ? 188 ASN D CG    1 
ATOM   9531  O OD1   . ASN D  1 160 ? 4.409   -37.389 42.426  1.00 33.18  ? 188 ASN D OD1   1 
ATOM   9532  N ND2   . ASN D  1 160 ? 6.164   -36.840 43.732  1.00 25.40  ? 188 ASN D ND2   1 
ATOM   9533  N N     . ALA D  1 161 ? 1.347   -39.428 46.288  1.00 22.99  ? 189 ALA D N     1 
ATOM   9534  C CA    . ALA D  1 161 ? 0.959   -40.260 47.433  1.00 29.07  ? 189 ALA D CA    1 
ATOM   9535  C C     . ALA D  1 161 ? 1.062   -41.757 47.150  1.00 29.46  ? 189 ALA D C     1 
ATOM   9536  O O     . ALA D  1 161 ? 1.521   -42.540 48.014  1.00 24.76  ? 189 ALA D O     1 
ATOM   9537  C CB    . ALA D  1 161 ? -0.459  -39.938 47.897  1.00 24.33  ? 189 ALA D CB    1 
ATOM   9538  N N     . TRP D  1 162 ? 0.614   -42.155 45.960  1.00 28.87  ? 190 TRP D N     1 
ATOM   9539  C CA    . TRP D  1 162 ? 0.551   -43.574 45.598  1.00 26.34  ? 190 TRP D CA    1 
ATOM   9540  C C     . TRP D  1 162 ? 1.865   -44.141 45.074  1.00 24.18  ? 190 TRP D C     1 
ATOM   9541  O O     . TRP D  1 162 ? 2.011   -45.349 44.976  1.00 30.69  ? 190 TRP D O     1 
ATOM   9542  C CB    . TRP D  1 162 ? -0.594  -43.832 44.628  1.00 28.81  ? 190 TRP D CB    1 
ATOM   9543  C CG    . TRP D  1 162 ? -1.907  -43.886 45.315  1.00 25.82  ? 190 TRP D CG    1 
ATOM   9544  C CD1   . TRP D  1 162 ? -2.605  -42.833 45.837  1.00 30.80  ? 190 TRP D CD1   1 
ATOM   9545  C CD2   . TRP D  1 162 ? -2.682  -45.050 45.581  1.00 35.91  ? 190 TRP D CD2   1 
ATOM   9546  N NE1   . TRP D  1 162 ? -3.787  -43.270 46.389  1.00 30.46  ? 190 TRP D NE1   1 
ATOM   9547  C CE2   . TRP D  1 162 ? -3.864  -44.628 46.239  1.00 27.99  ? 190 TRP D CE2   1 
ATOM   9548  C CE3   . TRP D  1 162 ? -2.515  -46.408 45.299  1.00 39.55  ? 190 TRP D CE3   1 
ATOM   9549  C CZ2   . TRP D  1 162 ? -4.852  -45.518 46.644  1.00 37.46  ? 190 TRP D CZ2   1 
ATOM   9550  C CZ3   . TRP D  1 162 ? -3.498  -47.293 45.696  1.00 38.76  ? 190 TRP D CZ3   1 
ATOM   9551  C CH2   . TRP D  1 162 ? -4.659  -46.844 46.357  1.00 40.26  ? 190 TRP D CH2   1 
ATOM   9552  N N     . GLU D  1 163 ? 2.840   -43.301 44.773  1.00 24.97  ? 191 GLU D N     1 
ATOM   9553  C CA    . GLU D  1 163 ? 4.136   -43.798 44.321  1.00 27.03  ? 191 GLU D CA    1 
ATOM   9554  C C     . GLU D  1 163 ? 5.279   -43.494 45.276  1.00 27.24  ? 191 GLU D C     1 
ATOM   9555  O O     . GLU D  1 163 ? 6.396   -44.008 45.076  1.00 24.71  ? 191 GLU D O     1 
ATOM   9556  C CB    . GLU D  1 163 ? 4.495   -43.213 42.958  1.00 28.14  ? 191 GLU D CB    1 
ATOM   9557  C CG    . GLU D  1 163 ? 3.478   -43.486 41.876  1.00 29.43  ? 191 GLU D CG    1 
ATOM   9558  C CD    . GLU D  1 163 ? 2.271   -42.543 41.932  1.00 37.98  ? 191 GLU D CD    1 
ATOM   9559  O OE1   . GLU D  1 163 ? 2.389   -41.405 42.448  1.00 30.43  ? 191 GLU D OE1   1 
ATOM   9560  O OE2   . GLU D  1 163 ? 1.204   -42.971 41.466  1.00 30.16  ? 191 GLU D OE2   1 
ATOM   9561  N N     . ALA D  1 164 ? 5.019   -42.638 46.267  1.00 24.08  ? 192 ALA D N     1 
ATOM   9562  C CA    . ALA D  1 164 ? 6.047   -42.146 47.185  1.00 25.58  ? 192 ALA D CA    1 
ATOM   9563  C C     . ALA D  1 164 ? 6.494   -43.206 48.207  1.00 20.90  ? 192 ALA D C     1 
ATOM   9564  O O     . ALA D  1 164 ? 5.684   -43.995 48.702  1.00 25.23  ? 192 ALA D O     1 
ATOM   9565  C CB    . ALA D  1 164 ? 5.561   -40.866 47.910  1.00 21.84  ? 192 ALA D CB    1 
ATOM   9566  N N     . SER D  1 165 ? 7.793   -43.209 48.500  1.00 26.71  ? 193 SER D N     1 
ATOM   9567  C CA    . SER D  1 165 ? 8.396   -44.059 49.531  1.00 27.24  ? 193 SER D CA    1 
ATOM   9568  C C     . SER D  1 165 ? 8.713   -43.318 50.843  1.00 27.71  ? 193 SER D C     1 
ATOM   9569  O O     . SER D  1 165 ? 9.138   -43.949 51.816  1.00 27.17  ? 193 SER D O     1 
ATOM   9570  C CB    . SER D  1 165 ? 9.685   -44.683 48.996  1.00 25.59  ? 193 SER D CB    1 
ATOM   9571  O OG    . SER D  1 165 ? 9.429   -45.578 47.929  1.00 30.40  ? 193 SER D OG    1 
ATOM   9572  N N     . ALA D  1 166 ? 8.513   -41.997 50.867  1.00 25.86  ? 194 ALA D N     1 
ATOM   9573  C CA    . ALA D  1 166 ? 8.712   -41.165 52.071  1.00 25.15  ? 194 ALA D CA    1 
ATOM   9574  C C     . ALA D  1 166 ? 7.932   -39.841 51.968  1.00 25.10  ? 194 ALA D C     1 
ATOM   9575  O O     . ALA D  1 166 ? 7.664   -39.352 50.877  1.00 26.86  ? 194 ALA D O     1 
ATOM   9576  C CB    . ALA D  1 166 ? 10.195  -40.855 52.289  1.00 24.96  ? 194 ALA D CB    1 
ATOM   9577  N N     . ALA D  1 167 ? 7.567   -39.297 53.121  1.00 25.83  ? 195 ALA D N     1 
ATOM   9578  C CA    . ALA D  1 167 ? 6.860   -38.024 53.205  1.00 27.14  ? 195 ALA D CA    1 
ATOM   9579  C C     . ALA D  1 167 ? 7.528   -37.060 54.212  1.00 28.39  ? 195 ALA D C     1 
ATOM   9580  O O     . ALA D  1 167 ? 8.194   -37.488 55.186  1.00 29.36  ? 195 ALA D O     1 
ATOM   9581  C CB    . ALA D  1 167 ? 5.409   -38.280 53.569  1.00 20.42  ? 195 ALA D CB    1 
ATOM   9582  N N     . VAL D  1 168 ? 7.403   -35.758 53.940  1.00 28.28  ? 196 VAL D N     1 
ATOM   9583  C CA    . VAL D  1 168 ? 7.662   -34.722 54.929  1.00 25.12  ? 196 VAL D CA    1 
ATOM   9584  C C     . VAL D  1 168 ? 6.257   -34.339 55.409  1.00 26.07  ? 196 VAL D C     1 
ATOM   9585  O O     . VAL D  1 168 ? 5.515   -33.764 54.669  1.00 30.53  ? 196 VAL D O     1 
ATOM   9586  C CB    . VAL D  1 168 ? 8.470   -33.540 54.337  1.00 26.20  ? 196 VAL D CB    1 
ATOM   9587  C CG1   . VAL D  1 168 ? 8.651   -32.398 55.356  1.00 22.98  ? 196 VAL D CG1   1 
ATOM   9588  C CG2   . VAL D  1 168 ? 9.855   -34.021 53.854  1.00 22.70  ? 196 VAL D CG2   1 
ATOM   9589  N N     . VAL D  1 169 ? 5.913   -34.723 56.635  1.00 25.13  ? 197 VAL D N     1 
ATOM   9590  C CA    . VAL D  1 169 ? 4.568   -34.539 57.197  1.00 27.75  ? 197 VAL D CA    1 
ATOM   9591  C C     . VAL D  1 169 ? 4.607   -33.477 58.298  1.00 25.36  ? 197 VAL D C     1 
ATOM   9592  O O     . VAL D  1 169 ? 5.546   -33.440 59.124  1.00 28.90  ? 197 VAL D O     1 
ATOM   9593  C CB    . VAL D  1 169 ? 4.040   -35.870 57.729  1.00 26.19  ? 197 VAL D CB    1 
ATOM   9594  C CG1   . VAL D  1 169 ? 2.639   -35.728 58.320  1.00 26.55  ? 197 VAL D CG1   1 
ATOM   9595  C CG2   . VAL D  1 169 ? 4.080   -36.933 56.600  1.00 25.20  ? 197 VAL D CG2   1 
ATOM   9596  N N     . PHE D  1 170 ? 3.631   -32.572 58.264  1.00 24.40  ? 198 PHE D N     1 
ATOM   9597  C CA    . PHE D  1 170 ? 3.533   -31.497 59.237  1.00 23.04  ? 198 PHE D CA    1 
ATOM   9598  C C     . PHE D  1 170 ? 2.387   -31.790 60.168  1.00 27.28  ? 198 PHE D C     1 
ATOM   9599  O O     . PHE D  1 170 ? 1.297   -32.167 59.718  1.00 25.96  ? 198 PHE D O     1 
ATOM   9600  C CB    . PHE D  1 170 ? 3.382   -30.151 58.546  1.00 26.12  ? 198 PHE D CB    1 
ATOM   9601  C CG    . PHE D  1 170 ? 4.567   -29.787 57.695  1.00 22.15  ? 198 PHE D CG    1 
ATOM   9602  C CD1   . PHE D  1 170 ? 5.568   -28.980 58.182  1.00 22.00  ? 198 PHE D CD1   1 
ATOM   9603  C CD2   . PHE D  1 170 ? 4.672   -30.258 56.406  1.00 20.68  ? 198 PHE D CD2   1 
ATOM   9604  C CE1   . PHE D  1 170 ? 6.665   -28.667 57.397  1.00 26.37  ? 198 PHE D CE1   1 
ATOM   9605  C CE2   . PHE D  1 170 ? 5.729   -29.931 55.603  1.00 24.65  ? 198 PHE D CE2   1 
ATOM   9606  C CZ    . PHE D  1 170 ? 6.754   -29.135 56.107  1.00 23.61  ? 198 PHE D CZ    1 
ATOM   9607  N N     . ALA D  1 171 ? 2.673   -31.692 61.472  1.00 27.20  ? 199 ALA D N     1 
ATOM   9608  C CA    . ALA D  1 171 ? 1.733   -32.080 62.534  1.00 28.22  ? 199 ALA D CA    1 
ATOM   9609  C C     . ALA D  1 171 ? 1.883   -31.196 63.763  1.00 27.33  ? 199 ALA D C     1 
ATOM   9610  O O     . ALA D  1 171 ? 2.973   -30.724 64.086  1.00 24.92  ? 199 ALA D O     1 
ATOM   9611  C CB    . ALA D  1 171 ? 1.911   -33.556 62.920  1.00 24.93  ? 199 ALA D CB    1 
ATOM   9612  N N     . SER D  1 172 ? 0.762   -30.954 64.431  1.00 29.56  ? 200 SER D N     1 
ATOM   9613  C CA    . SER D  1 172 ? 0.740   -30.127 65.617  1.00 30.50  ? 200 SER D CA    1 
ATOM   9614  C C     . SER D  1 172 ? 1.274   -30.913 66.823  1.00 33.04  ? 200 SER D C     1 
ATOM   9615  O O     . SER D  1 172 ? 0.743   -31.970 67.183  1.00 30.82  ? 200 SER D O     1 
ATOM   9616  C CB    . SER D  1 172 ? -0.674  -29.656 65.920  1.00 32.11  ? 200 SER D CB    1 
ATOM   9617  O OG    . SER D  1 172 ? -0.659  -28.870 67.096  1.00 37.70  ? 200 SER D OG    1 
ATOM   9618  N N     . THR D  1 173 ? 2.315   -30.365 67.436  1.00 33.04  ? 201 THR D N     1 
ATOM   9619  C CA    . THR D  1 173 ? 2.922   -30.935 68.636  1.00 38.38  ? 201 THR D CA    1 
ATOM   9620  C C     . THR D  1 173 ? 2.548   -30.209 69.925  1.00 40.36  ? 201 THR D C     1 
ATOM   9621  O O     . THR D  1 173 ? 2.884   -30.689 70.992  1.00 42.32  ? 201 THR D O     1 
ATOM   9622  C CB    . THR D  1 173 ? 4.463   -30.962 68.506  1.00 37.93  ? 201 THR D CB    1 
ATOM   9623  O OG1   . THR D  1 173 ? 4.903   -29.822 67.738  1.00 42.07  ? 201 THR D OG1   1 
ATOM   9624  C CG2   . THR D  1 173 ? 4.882   -32.237 67.809  1.00 32.11  ? 201 THR D CG2   1 
ATOM   9625  N N     . ASP D  1 174 ? 1.841   -29.079 69.840  1.00 51.20  ? 202 ASP D N     1 
ATOM   9626  C CA    . ASP D  1 174 ? 1.470   -28.297 71.041  1.00 54.58  ? 202 ASP D CA    1 
ATOM   9627  C C     . ASP D  1 174 ? -0.036  -28.016 71.090  1.00 55.74  ? 202 ASP D C     1 
ATOM   9628  O O     . ASP D  1 174 ? -0.603  -27.444 70.158  1.00 54.59  ? 202 ASP D O     1 
ATOM   9629  C CB    . ASP D  1 174 ? 2.250   -26.978 71.079  1.00 54.67  ? 202 ASP D CB    1 
ATOM   9630  N N     . LYS D  1 180 ? 4.486   -21.552 66.560  1.00 53.28  ? 208 LYS D N     1 
ATOM   9631  C CA    . LYS D  1 180 ? 5.571   -22.471 66.945  1.00 54.55  ? 208 LYS D CA    1 
ATOM   9632  C C     . LYS D  1 180 ? 5.037   -23.834 67.430  1.00 49.50  ? 208 LYS D C     1 
ATOM   9633  O O     . LYS D  1 180 ? 5.740   -24.568 68.114  1.00 53.92  ? 208 LYS D O     1 
ATOM   9634  C CB    . LYS D  1 180 ? 6.470   -21.823 68.020  1.00 57.30  ? 208 LYS D CB    1 
ATOM   9635  C CG    . LYS D  1 180 ? 7.839   -22.491 68.211  1.00 45.03  ? 208 LYS D CG    1 
ATOM   9636  N N     . SER D  1 181 ? 3.808   -24.178 67.051  1.00 45.89  ? 209 SER D N     1 
ATOM   9637  C CA    . SER D  1 181 ? 3.162   -25.415 67.509  1.00 46.73  ? 209 SER D CA    1 
ATOM   9638  C C     . SER D  1 181 ? 3.214   -26.569 66.497  1.00 41.21  ? 209 SER D C     1 
ATOM   9639  O O     . SER D  1 181 ? 2.678   -27.643 66.763  1.00 39.58  ? 209 SER D O     1 
ATOM   9640  C CB    . SER D  1 181 ? 1.702   -25.134 67.880  1.00 47.80  ? 209 SER D CB    1 
ATOM   9641  O OG    . SER D  1 181 ? 1.001   -24.573 66.781  1.00 50.87  ? 209 SER D OG    1 
ATOM   9642  N N     . ILE D  1 182 ? 3.869   -26.357 65.357  1.00 36.49  ? 210 ILE D N     1 
ATOM   9643  C CA    . ILE D  1 182 ? 3.905   -27.372 64.305  1.00 32.98  ? 210 ILE D CA    1 
ATOM   9644  C C     . ILE D  1 182 ? 5.320   -27.875 64.138  1.00 27.38  ? 210 ILE D C     1 
ATOM   9645  O O     . ILE D  1 182 ? 6.288   -27.107 64.266  1.00 25.74  ? 210 ILE D O     1 
ATOM   9646  C CB    . ILE D  1 182 ? 3.345   -26.848 62.960  1.00 32.22  ? 210 ILE D CB    1 
ATOM   9647  C CG1   . ILE D  1 182 ? 1.845   -26.562 63.110  1.00 34.39  ? 210 ILE D CG1   1 
ATOM   9648  C CG2   . ILE D  1 182 ? 3.571   -27.876 61.841  1.00 21.30  ? 210 ILE D CG2   1 
ATOM   9649  C CD1   . ILE D  1 182 ? 1.269   -25.761 61.987  1.00 52.90  ? 210 ILE D CD1   1 
ATOM   9650  N N     . SER D  1 183 ? 5.440   -29.172 63.882  1.00 28.44  ? 211 SER D N     1 
ATOM   9651  C CA    . SER D  1 183 ? 6.750   -29.769 63.586  1.00 29.53  ? 211 SER D CA    1 
ATOM   9652  C C     . SER D  1 183 ? 6.705   -30.560 62.281  1.00 24.43  ? 211 SER D C     1 
ATOM   9653  O O     . SER D  1 183 ? 5.646   -30.985 61.827  1.00 29.83  ? 211 SER D O     1 
ATOM   9654  C CB    . SER D  1 183 ? 7.206   -30.670 64.743  1.00 28.88  ? 211 SER D CB    1 
ATOM   9655  O OG    . SER D  1 183 ? 7.253   -29.944 65.967  1.00 31.24  ? 211 SER D OG    1 
ATOM   9656  N N     . ALA D  1 184 ? 7.881   -30.724 61.695  1.00 29.16  ? 212 ALA D N     1 
ATOM   9657  C CA    . ALA D  1 184 ? 8.070   -31.437 60.449  1.00 28.32  ? 212 ALA D CA    1 
ATOM   9658  C C     . ALA D  1 184 ? 8.625   -32.838 60.752  1.00 29.33  ? 212 ALA D C     1 
ATOM   9659  O O     . ALA D  1 184 ? 9.561   -32.977 61.551  1.00 27.93  ? 212 ALA D O     1 
ATOM   9660  C CB    . ALA D  1 184 ? 9.032   -30.635 59.539  1.00 20.10  ? 212 ALA D CB    1 
ATOM   9661  N N     . PHE D  1 185 ? 8.060   -33.864 60.103  1.00 27.48  ? 213 PHE D N     1 
ATOM   9662  C CA    . PHE D  1 185 ? 8.482   -35.253 60.335  1.00 28.37  ? 213 PHE D CA    1 
ATOM   9663  C C     . PHE D  1 185 ? 8.797   -36.015 59.049  1.00 26.72  ? 213 PHE D C     1 
ATOM   9664  O O     . PHE D  1 185 ? 8.071   -35.904 58.055  1.00 26.23  ? 213 PHE D O     1 
ATOM   9665  C CB    . PHE D  1 185 ? 7.397   -36.019 61.097  1.00 24.61  ? 213 PHE D CB    1 
ATOM   9666  C CG    . PHE D  1 185 ? 7.104   -35.466 62.452  1.00 28.85  ? 213 PHE D CG    1 
ATOM   9667  C CD1   . PHE D  1 185 ? 7.822   -35.898 63.570  1.00 30.44  ? 213 PHE D CD1   1 
ATOM   9668  C CD2   . PHE D  1 185 ? 6.070   -34.541 62.637  1.00 28.81  ? 213 PHE D CD2   1 
ATOM   9669  C CE1   . PHE D  1 185 ? 7.530   -35.398 64.841  1.00 28.05  ? 213 PHE D CE1   1 
ATOM   9670  C CE2   . PHE D  1 185 ? 5.773   -34.045 63.903  1.00 33.32  ? 213 PHE D CE2   1 
ATOM   9671  C CZ    . PHE D  1 185 ? 6.502   -34.471 65.005  1.00 33.07  ? 213 PHE D CZ    1 
ATOM   9672  N N     . LEU D  1 186 ? 9.887   -36.796 59.081  1.00 28.70  ? 214 LEU D N     1 
ATOM   9673  C CA    . LEU D  1 186 ? 10.222  -37.759 58.014  1.00 26.51  ? 214 LEU D CA    1 
ATOM   9674  C C     . LEU D  1 186 ? 9.539   -39.112 58.271  1.00 28.65  ? 214 LEU D C     1 
ATOM   9675  O O     . LEU D  1 186 ? 9.849   -39.800 59.245  1.00 29.01  ? 214 LEU D O     1 
ATOM   9676  C CB    . LEU D  1 186 ? 11.738  -37.924 57.903  1.00 26.98  ? 214 LEU D CB    1 
ATOM   9677  C CG    . LEU D  1 186 ? 12.541  -36.635 57.732  1.00 28.92  ? 214 LEU D CG    1 
ATOM   9678  C CD1   . LEU D  1 186 ? 14.011  -36.974 57.551  1.00 29.13  ? 214 LEU D CD1   1 
ATOM   9679  C CD2   . LEU D  1 186 ? 12.023  -35.772 56.554  1.00 27.93  ? 214 LEU D CD2   1 
ATOM   9680  N N     . VAL D  1 187 ? 8.592   -39.469 57.405  1.00 24.95  ? 215 VAL D N     1 
ATOM   9681  C CA    . VAL D  1 187 ? 7.733   -40.624 57.573  1.00 25.62  ? 215 VAL D CA    1 
ATOM   9682  C C     . VAL D  1 187 ? 7.929   -41.597 56.402  1.00 30.03  ? 215 VAL D C     1 
ATOM   9683  O O     . VAL D  1 187 ? 7.851   -41.180 55.243  1.00 27.93  ? 215 VAL D O     1 
ATOM   9684  C CB    . VAL D  1 187 ? 6.245   -40.187 57.611  1.00 24.49  ? 215 VAL D CB    1 
ATOM   9685  C CG1   . VAL D  1 187 ? 5.330   -41.367 57.930  1.00 26.50  ? 215 VAL D CG1   1 
ATOM   9686  C CG2   . VAL D  1 187 ? 6.061   -39.056 58.606  1.00 23.77  ? 215 VAL D CG2   1 
ATOM   9687  N N     . PRO D  1 188 ? 8.202   -42.902 56.694  1.00 31.51  ? 216 PRO D N     1 
ATOM   9688  C CA    . PRO D  1 188 ? 8.342   -43.861 55.592  1.00 26.81  ? 216 PRO D CA    1 
ATOM   9689  C C     . PRO D  1 188 ? 6.995   -44.282 55.058  1.00 26.19  ? 216 PRO D C     1 
ATOM   9690  O O     . PRO D  1 188 ? 5.990   -44.225 55.772  1.00 24.94  ? 216 PRO D O     1 
ATOM   9691  C CB    . PRO D  1 188 ? 9.054   -45.052 56.243  1.00 32.30  ? 216 PRO D CB    1 
ATOM   9692  C CG    . PRO D  1 188 ? 8.654   -45.001 57.683  1.00 29.44  ? 216 PRO D CG    1 
ATOM   9693  C CD    . PRO D  1 188 ? 8.369   -43.556 58.011  1.00 28.38  ? 216 PRO D CD    1 
ATOM   9694  N N     . MET D  1 189 ? 6.984   -44.682 53.790  1.00 28.94  ? 217 MET D N     1 
ATOM   9695  C CA    . MET D  1 189 ? 5.774   -45.156 53.129  1.00 28.51  ? 217 MET D CA    1 
ATOM   9696  C C     . MET D  1 189 ? 6.180   -46.413 52.338  1.00 29.26  ? 217 MET D C     1 
ATOM   9697  O O     . MET D  1 189 ? 7.075   -46.358 51.508  1.00 28.55  ? 217 MET D O     1 
ATOM   9698  C CB    . MET D  1 189 ? 5.226   -44.084 52.177  1.00 27.65  ? 217 MET D CB    1 
ATOM   9699  C CG    . MET D  1 189 ? 4.887   -42.750 52.834  1.00 29.77  ? 217 MET D CG    1 
ATOM   9700  S SD    . MET D  1 189 ? 4.354   -41.482 51.650  1.00 28.31  ? 217 MET D SD    1 
ATOM   9701  C CE    . MET D  1 189 ? 2.774   -42.195 51.067  1.00 24.79  ? 217 MET D CE    1 
ATOM   9702  N N     . PRO D  1 190 ? 5.528   -47.546 52.607  1.00 30.60  ? 218 PRO D N     1 
ATOM   9703  C CA    . PRO D  1 190 ? 4.467   -47.676 53.589  1.00 26.92  ? 218 PRO D CA    1 
ATOM   9704  C C     . PRO D  1 190 ? 4.979   -47.782 55.051  1.00 29.68  ? 218 PRO D C     1 
ATOM   9705  O O     . PRO D  1 190 ? 6.203   -47.850 55.310  1.00 25.07  ? 218 PRO D O     1 
ATOM   9706  C CB    . PRO D  1 190 ? 3.749   -48.952 53.146  1.00 29.88  ? 218 PRO D CB    1 
ATOM   9707  C CG    . PRO D  1 190 ? 4.813   -49.765 52.508  1.00 29.96  ? 218 PRO D CG    1 
ATOM   9708  C CD    . PRO D  1 190 ? 5.803   -48.815 51.915  1.00 28.16  ? 218 PRO D CD    1 
ATOM   9709  N N     . THR D  1 191 ? 4.043   -47.726 55.995  1.00 26.09  ? 219 THR D N     1 
ATOM   9710  C CA    . THR D  1 191 ? 4.359   -47.880 57.410  1.00 27.70  ? 219 THR D CA    1 
ATOM   9711  C C     . THR D  1 191 ? 3.064   -48.177 58.143  1.00 30.40  ? 219 THR D C     1 
ATOM   9712  O O     . THR D  1 191 ? 2.019   -47.685 57.738  1.00 27.46  ? 219 THR D O     1 
ATOM   9713  C CB    . THR D  1 191 ? 5.095   -46.623 58.009  1.00 33.61  ? 219 THR D CB    1 
ATOM   9714  O OG1   . THR D  1 191 ? 5.925   -47.011 59.109  1.00 33.14  ? 219 THR D OG1   1 
ATOM   9715  C CG2   . THR D  1 191 ? 4.128   -45.516 58.473  1.00 25.55  ? 219 THR D CG2   1 
ATOM   9716  N N     . PRO D  1 192 ? 3.125   -49.000 59.209  1.00 32.50  ? 220 PRO D N     1 
ATOM   9717  C CA    . PRO D  1 192 ? 1.938   -49.313 60.009  1.00 29.26  ? 220 PRO D CA    1 
ATOM   9718  C C     . PRO D  1 192 ? 1.234   -48.088 60.561  1.00 28.19  ? 220 PRO D C     1 
ATOM   9719  O O     . PRO D  1 192 ? 1.875   -47.192 61.095  1.00 30.09  ? 220 PRO D O     1 
ATOM   9720  C CB    . PRO D  1 192 ? 2.499   -50.157 61.171  1.00 30.99  ? 220 PRO D CB    1 
ATOM   9721  C CG    . PRO D  1 192 ? 3.806   -50.684 60.672  1.00 28.46  ? 220 PRO D CG    1 
ATOM   9722  C CD    . PRO D  1 192 ? 4.326   -49.716 59.688  1.00 32.33  ? 220 PRO D CD    1 
ATOM   9723  N N     . GLY D  1 193 ? -0.085  -48.065 60.443  1.00 26.04  ? 221 GLY D N     1 
ATOM   9724  C CA    . GLY D  1 193 ? -0.885  -46.918 60.892  1.00 30.36  ? 221 GLY D CA    1 
ATOM   9725  C C     . GLY D  1 193 ? -1.131  -45.842 59.830  1.00 30.95  ? 221 GLY D C     1 
ATOM   9726  O O     . GLY D  1 193 ? -1.818  -44.852 60.113  1.00 28.88  ? 221 GLY D O     1 
ATOM   9727  N N     . LEU D  1 194 ? -0.539  -46.020 58.640  1.00 30.12  ? 222 LEU D N     1 
ATOM   9728  C CA    . LEU D  1 194 ? -0.755  -45.143 57.492  1.00 28.97  ? 222 LEU D CA    1 
ATOM   9729  C C     . LEU D  1 194 ? -1.507  -45.872 56.382  1.00 28.08  ? 222 LEU D C     1 
ATOM   9730  O O     . LEU D  1 194 ? -1.065  -46.924 55.884  1.00 28.87  ? 222 LEU D O     1 
ATOM   9731  C CB    . LEU D  1 194 ? 0.580   -44.613 56.937  1.00 27.87  ? 222 LEU D CB    1 
ATOM   9732  C CG    . LEU D  1 194 ? 0.534   -43.791 55.622  1.00 34.22  ? 222 LEU D CG    1 
ATOM   9733  C CD1   . LEU D  1 194 ? -0.130  -42.404 55.813  1.00 28.86  ? 222 LEU D CD1   1 
ATOM   9734  C CD2   . LEU D  1 194 ? 1.923   -43.653 54.990  1.00 29.71  ? 222 LEU D CD2   1 
ATOM   9735  N N     . THR D  1 195 ? -2.647  -45.303 55.991  1.00 27.20  ? 223 THR D N     1 
ATOM   9736  C CA    . THR D  1 195 ? -3.339  -45.729 54.786  1.00 26.99  ? 223 THR D CA    1 
ATOM   9737  C C     . THR D  1 195 ? -3.472  -44.549 53.799  1.00 25.56  ? 223 THR D C     1 
ATOM   9738  O O     . THR D  1 195 ? -3.498  -43.386 54.194  1.00 28.59  ? 223 THR D O     1 
ATOM   9739  C CB    . THR D  1 195 ? -4.712  -46.338 55.119  1.00 28.49  ? 223 THR D CB    1 
ATOM   9740  O OG1   . THR D  1 195 ? -5.448  -45.436 55.935  1.00 33.10  ? 223 THR D OG1   1 
ATOM   9741  C CG2   . THR D  1 195 ? -4.552  -47.657 55.872  1.00 35.76  ? 223 THR D CG2   1 
ATOM   9742  N N     . LEU D  1 196 ? -3.528  -44.864 52.510  1.00 27.81  ? 224 LEU D N     1 
ATOM   9743  C CA    . LEU D  1 196 ? -3.757  -43.861 51.471  1.00 28.66  ? 224 LEU D CA    1 
ATOM   9744  C C     . LEU D  1 196 ? -5.260  -43.735 51.188  1.00 26.49  ? 224 LEU D C     1 
ATOM   9745  O O     . LEU D  1 196 ? -5.995  -44.705 51.281  1.00 29.00  ? 224 LEU D O     1 
ATOM   9746  C CB    . LEU D  1 196 ? -3.045  -44.255 50.195  1.00 29.40  ? 224 LEU D CB    1 
ATOM   9747  C CG    . LEU D  1 196 ? -1.530  -44.474 50.269  1.00 29.14  ? 224 LEU D CG    1 
ATOM   9748  C CD1   . LEU D  1 196 ? -1.008  -44.622 48.853  1.00 27.97  ? 224 LEU D CD1   1 
ATOM   9749  C CD2   . LEU D  1 196 ? -0.817  -43.337 51.032  1.00 28.90  ? 224 LEU D CD2   1 
ATOM   9750  N N     . GLY D  1 197 ? -5.711  -42.530 50.849  1.00 29.29  ? 225 GLY D N     1 
ATOM   9751  C CA    . GLY D  1 197 ? -7.084  -42.345 50.348  1.00 25.92  ? 225 GLY D CA    1 
ATOM   9752  C C     . GLY D  1 197 ? -7.158  -42.727 48.873  1.00 24.83  ? 225 GLY D C     1 
ATOM   9753  O O     . GLY D  1 197 ? -6.133  -42.960 48.218  1.00 25.29  ? 225 GLY D O     1 
ATOM   9754  N N     . LYS D  1 198 ? -8.381  -42.791 48.349  1.00 26.78  ? 226 LYS D N     1 
ATOM   9755  C CA    . LYS D  1 198 ? -8.618  -42.944 46.913  1.00 28.58  ? 226 LYS D CA    1 
ATOM   9756  C C     . LYS D  1 198 ? -7.943  -41.813 46.108  1.00 26.73  ? 226 LYS D C     1 
ATOM   9757  O O     . LYS D  1 198 ? -7.867  -40.660 46.554  1.00 28.20  ? 226 LYS D O     1 
ATOM   9758  C CB    . LYS D  1 198 ? -10.129 -42.998 46.658  1.00 31.62  ? 226 LYS D CB    1 
ATOM   9759  C CG    . LYS D  1 198 ? -10.559 -43.289 45.225  1.00 45.03  ? 226 LYS D CG    1 
ATOM   9760  C CD    . LYS D  1 198 ? -12.075 -43.229 45.098  1.00 41.03  ? 226 LYS D CD    1 
ATOM   9761  N N     . LYS D  1 199 ? -7.344  -42.178 44.984  1.00 28.24  ? 227 LYS D N     1 
ATOM   9762  C CA    . LYS D  1 199 ? -6.846  -41.189 44.034  1.00 27.78  ? 227 LYS D CA    1 
ATOM   9763  C C     . LYS D  1 199 ? -7.943  -40.188 43.648  1.00 25.46  ? 227 LYS D C     1 
ATOM   9764  O O     . LYS D  1 199 ? -9.080  -40.574 43.390  1.00 28.14  ? 227 LYS D O     1 
ATOM   9765  C CB    . LYS D  1 199 ? -6.316  -41.866 42.793  1.00 28.88  ? 227 LYS D CB    1 
ATOM   9766  C CG    . LYS D  1 199 ? -4.929  -42.480 42.934  1.00 27.40  ? 227 LYS D CG    1 
ATOM   9767  C CD    . LYS D  1 199 ? -4.627  -43.272 41.680  1.00 31.02  ? 227 LYS D CD    1 
ATOM   9768  C CE    . LYS D  1 199 ? -3.316  -43.975 41.762  1.00 38.98  ? 227 LYS D CE    1 
ATOM   9769  N NZ    . LYS D  1 199 ? -3.011  -44.581 40.447  1.00 35.16  ? 227 LYS D NZ    1 
ATOM   9770  N N     . GLU D  1 200 ? -7.596  -38.901 43.669  1.00 28.33  ? 228 GLU D N     1 
ATOM   9771  C CA    . GLU D  1 200 ? -8.475  -37.845 43.154  1.00 27.41  ? 228 GLU D CA    1 
ATOM   9772  C C     . GLU D  1 200 ? -8.614  -37.920 41.626  1.00 26.61  ? 228 GLU D C     1 
ATOM   9773  O O     . GLU D  1 200 ? -7.644  -38.197 40.895  1.00 26.72  ? 228 GLU D O     1 
ATOM   9774  C CB    . GLU D  1 200 ? -7.957  -36.444 43.517  1.00 27.06  ? 228 GLU D CB    1 
ATOM   9775  C CG    . GLU D  1 200 ? -7.761  -36.152 44.998  1.00 27.50  ? 228 GLU D CG    1 
ATOM   9776  C CD    . GLU D  1 200 ? -9.038  -36.025 45.794  1.00 37.50  ? 228 GLU D CD    1 
ATOM   9777  O OE1   . GLU D  1 200 ? -10.141 -35.952 45.218  1.00 35.40  ? 228 GLU D OE1   1 
ATOM   9778  O OE2   . GLU D  1 200 ? -8.923  -35.976 47.028  1.00 43.71  ? 228 GLU D OE2   1 
ATOM   9779  N N     . ASP D  1 201 ? -9.836  -37.665 41.169  1.00 27.52  ? 229 ASP D N     1 
ATOM   9780  C CA    . ASP D  1 201 ? -10.179 -37.578 39.747  1.00 27.50  ? 229 ASP D CA    1 
ATOM   9781  C C     . ASP D  1 201 ? -10.074 -36.096 39.323  1.00 24.87  ? 229 ASP D C     1 
ATOM   9782  O O     . ASP D  1 201 ? -10.967 -35.313 39.579  1.00 26.74  ? 229 ASP D O     1 
ATOM   9783  C CB    . ASP D  1 201 ? -11.593 -38.136 39.556  1.00 27.77  ? 229 ASP D CB    1 
ATOM   9784  C CG    . ASP D  1 201 ? -11.996 -38.263 38.100  1.00 27.42  ? 229 ASP D CG    1 
ATOM   9785  O OD1   . ASP D  1 201 ? -11.126 -38.182 37.199  1.00 33.70  ? 229 ASP D OD1   1 
ATOM   9786  O OD2   . ASP D  1 201 ? -13.206 -38.447 37.865  1.00 41.12  ? 229 ASP D OD2   1 
ATOM   9787  N N     . LYS D  1 202 ? -8.950  -35.724 38.702  1.00 27.81  ? 230 LYS D N     1 
ATOM   9788  C CA    . LYS D  1 202 ? -8.591  -34.323 38.491  1.00 24.63  ? 230 LYS D CA    1 
ATOM   9789  C C     . LYS D  1 202 ? -8.926  -33.809 37.096  1.00 22.71  ? 230 LYS D C     1 
ATOM   9790  O O     . LYS D  1 202 ? -9.114  -34.580 36.158  1.00 22.92  ? 230 LYS D O     1 
ATOM   9791  C CB    . LYS D  1 202 ? -7.085  -34.117 38.744  1.00 23.56  ? 230 LYS D CB    1 
ATOM   9792  C CG    . LYS D  1 202 ? -6.609  -34.445 40.157  1.00 27.86  ? 230 LYS D CG    1 
ATOM   9793  C CD    . LYS D  1 202 ? -5.094  -34.073 40.378  1.00 24.11  ? 230 LYS D CD    1 
ATOM   9794  C CE    . LYS D  1 202 ? -4.108  -34.887 39.569  1.00 26.08  ? 230 LYS D CE    1 
ATOM   9795  N NZ    . LYS D  1 202 ? -3.997  -36.334 39.946  1.00 24.27  ? 230 LYS D NZ    1 
ATOM   9796  N N     . LEU D  1 203 ? -8.956  -32.481 36.970  1.00 22.41  ? 231 LEU D N     1 
ATOM   9797  C CA    . LEU D  1 203 ? -9.225  -31.800 35.699  1.00 22.83  ? 231 LEU D CA    1 
ATOM   9798  C C     . LEU D  1 203 ? -8.017  -31.932 34.777  1.00 23.26  ? 231 LEU D C     1 
ATOM   9799  O O     . LEU D  1 203 ? -8.143  -32.060 33.568  1.00 23.08  ? 231 LEU D O     1 
ATOM   9800  C CB    . LEU D  1 203 ? -9.588  -30.322 35.961  1.00 23.61  ? 231 LEU D CB    1 
ATOM   9801  C CG    . LEU D  1 203 ? -9.811  -29.395 34.764  1.00 25.11  ? 231 LEU D CG    1 
ATOM   9802  C CD1   . LEU D  1 203 ? -11.068 -29.818 33.937  1.00 18.07  ? 231 LEU D CD1   1 
ATOM   9803  C CD2   . LEU D  1 203 ? -9.944  -27.948 35.278  1.00 20.81  ? 231 LEU D CD2   1 
ATOM   9804  N N     . GLY D  1 204 ? -6.841  -31.911 35.381  1.00 22.38  ? 232 GLY D N     1 
ATOM   9805  C CA    . GLY D  1 204 ? -5.583  -32.008 34.669  1.00 23.20  ? 232 GLY D CA    1 
ATOM   9806  C C     . GLY D  1 204 ? -4.506  -32.570 35.574  1.00 19.49  ? 232 GLY D C     1 
ATOM   9807  O O     . GLY D  1 204 ? -4.805  -33.150 36.623  1.00 21.43  ? 232 GLY D O     1 
ATOM   9808  N N     . ILE D  1 205 ? -3.254  -32.407 35.152  1.00 21.00  ? 233 ILE D N     1 
ATOM   9809  C CA    . ILE D  1 205 ? -2.087  -33.133 35.707  1.00 23.22  ? 233 ILE D CA    1 
ATOM   9810  C C     . ILE D  1 205 ? -2.443  -34.570 36.164  1.00 24.29  ? 233 ILE D C     1 
ATOM   9811  O O     . ILE D  1 205 ? -2.056  -35.043 37.250  1.00 24.59  ? 233 ILE D O     1 
ATOM   9812  C CB    . ILE D  1 205 ? -1.318  -32.310 36.813  1.00 25.68  ? 233 ILE D CB    1 
ATOM   9813  C CG1   . ILE D  1 205 ? -2.284  -31.837 37.915  1.00 28.82  ? 233 ILE D CG1   1 
ATOM   9814  C CG2   . ILE D  1 205 ? -0.546  -31.136 36.185  1.00 19.94  ? 233 ILE D CG2   1 
ATOM   9815  C CD1   . ILE D  1 205 ? -1.624  -31.647 39.297  1.00 20.93  ? 233 ILE D CD1   1 
ATOM   9816  N N     . ARG D  1 206 ? -3.155  -35.284 35.293  1.00 25.04  ? 234 ARG D N     1 
ATOM   9817  C CA    . ARG D  1 206 ? -3.759  -36.566 35.648  1.00 24.22  ? 234 ARG D CA    1 
ATOM   9818  C C     . ARG D  1 206 ? -2.767  -37.730 35.818  1.00 23.92  ? 234 ARG D C     1 
ATOM   9819  O O     . ARG D  1 206 ? -3.081  -38.692 36.486  1.00 30.11  ? 234 ARG D O     1 
ATOM   9820  C CB    . ARG D  1 206 ? -4.834  -36.950 34.639  1.00 27.64  ? 234 ARG D CB    1 
ATOM   9821  C CG    . ARG D  1 206 ? -6.050  -36.041 34.656  1.00 25.89  ? 234 ARG D CG    1 
ATOM   9822  C CD    . ARG D  1 206 ? -6.922  -36.337 33.434  1.00 30.25  ? 234 ARG D CD    1 
ATOM   9823  N NE    . ARG D  1 206 ? -8.106  -35.496 33.382  1.00 41.26  ? 234 ARG D NE    1 
ATOM   9824  C CZ    . ARG D  1 206 ? -8.911  -35.388 32.326  1.00 53.29  ? 234 ARG D CZ    1 
ATOM   9825  N NH1   . ARG D  1 206 ? -8.666  -36.066 31.200  1.00 48.30  ? 234 ARG D NH1   1 
ATOM   9826  N NH2   . ARG D  1 206 ? -9.963  -34.569 32.393  1.00 52.86  ? 234 ARG D NH2   1 
ATOM   9827  N N     . GLY D  1 207 ? -1.569  -37.606 35.263  1.00 25.13  ? 235 GLY D N     1 
ATOM   9828  C CA    . GLY D  1 207 ? -0.506  -38.594 35.478  1.00 29.08  ? 235 GLY D CA    1 
ATOM   9829  C C     . GLY D  1 207 ? 0.066   -38.621 36.892  1.00 29.81  ? 235 GLY D C     1 
ATOM   9830  O O     . GLY D  1 207 ? 0.527   -39.668 37.354  1.00 30.22  ? 235 GLY D O     1 
ATOM   9831  N N     . SER D  1 208 ? 0.075   -37.465 37.561  1.00 30.40  ? 236 SER D N     1 
ATOM   9832  C CA    . SER D  1 208 ? 0.504   -37.364 38.957  1.00 27.78  ? 236 SER D CA    1 
ATOM   9833  C C     . SER D  1 208 ? -0.616  -37.927 39.822  1.00 27.18  ? 236 SER D C     1 
ATOM   9834  O O     . SER D  1 208 ? -1.784  -37.723 39.503  1.00 31.82  ? 236 SER D O     1 
ATOM   9835  C CB    . SER D  1 208 ? 0.831   -35.897 39.338  1.00 29.11  ? 236 SER D CB    1 
ATOM   9836  O OG    . SER D  1 208 ? -0.342  -35.131 39.642  1.00 26.25  ? 236 SER D OG    1 
ATOM   9837  N N     . SER D  1 209 ? -0.281  -38.661 40.888  1.00 27.35  ? 237 SER D N     1 
ATOM   9838  C CA    . SER D  1 209 ? -1.320  -39.119 41.837  1.00 27.08  ? 237 SER D CA    1 
ATOM   9839  C C     . SER D  1 209 ? -1.497  -38.067 42.914  1.00 22.77  ? 237 SER D C     1 
ATOM   9840  O O     . SER D  1 209 ? -0.550  -37.329 43.242  1.00 26.48  ? 237 SER D O     1 
ATOM   9841  C CB    . SER D  1 209 ? -1.019  -40.491 42.466  1.00 28.61  ? 237 SER D CB    1 
ATOM   9842  O OG    . SER D  1 209 ? 0.148   -40.490 43.288  1.00 25.97  ? 237 SER D OG    1 
ATOM   9843  N N     . THR D  1 210 ? -2.723  -37.989 43.418  1.00 25.08  ? 238 THR D N     1 
ATOM   9844  C CA    . THR D  1 210 ? -3.118  -37.063 44.472  1.00 27.20  ? 238 THR D CA    1 
ATOM   9845  C C     . THR D  1 210 ? -4.085  -37.816 45.384  1.00 24.37  ? 238 THR D C     1 
ATOM   9846  O O     . THR D  1 210 ? -5.099  -38.328 44.928  1.00 25.27  ? 238 THR D O     1 
ATOM   9847  C CB    . THR D  1 210 ? -3.823  -35.782 43.899  1.00 27.55  ? 238 THR D CB    1 
ATOM   9848  O OG1   . THR D  1 210 ? -3.090  -35.278 42.774  1.00 28.61  ? 238 THR D OG1   1 
ATOM   9849  C CG2   . THR D  1 210 ? -3.929  -34.695 44.959  1.00 18.76  ? 238 THR D CG2   1 
ATOM   9850  N N     . ALA D  1 211 ? -3.746  -37.925 46.669  1.00 26.53  ? 239 ALA D N     1 
ATOM   9851  C CA    . ALA D  1 211 ? -4.655  -38.575 47.619  1.00 27.65  ? 239 ALA D CA    1 
ATOM   9852  C C     . ALA D  1 211 ? -4.362  -38.215 49.052  1.00 24.28  ? 239 ALA D C     1 
ATOM   9853  O O     . ALA D  1 211 ? -3.315  -37.642 49.386  1.00 23.77  ? 239 ALA D O     1 
ATOM   9854  C CB    . ALA D  1 211 ? -4.637  -40.116 47.457  1.00 24.05  ? 239 ALA D CB    1 
ATOM   9855  N N     . ASN D  1 212 ? -5.327  -38.549 49.899  1.00 29.99  ? 240 ASN D N     1 
ATOM   9856  C CA    . ASN D  1 212 ? -5.170  -38.394 51.344  1.00 28.23  ? 240 ASN D CA    1 
ATOM   9857  C C     . ASN D  1 212 ? -4.128  -39.361 51.963  1.00 27.65  ? 240 ASN D C     1 
ATOM   9858  O O     . ASN D  1 212 ? -4.008  -40.526 51.553  1.00 24.38  ? 240 ASN D O     1 
ATOM   9859  C CB    . ASN D  1 212 ? -6.507  -38.574 52.042  1.00 26.32  ? 240 ASN D CB    1 
ATOM   9860  C CG    . ASN D  1 212 ? -7.483  -37.431 51.779  1.00 25.45  ? 240 ASN D CG    1 
ATOM   9861  O OD1   . ASN D  1 212 ? -7.161  -36.427 51.135  1.00 28.69  ? 240 ASN D OD1   1 
ATOM   9862  N ND2   . ASN D  1 212 ? -8.676  -37.571 52.312  1.00 29.07  ? 240 ASN D ND2   1 
ATOM   9863  N N     . LEU D  1 213 ? -3.362  -38.838 52.925  1.00 25.54  ? 241 LEU D N     1 
ATOM   9864  C CA    . LEU D  1 213 ? -2.548  -39.636 53.848  1.00 28.33  ? 241 LEU D CA    1 
ATOM   9865  C C     . LEU D  1 213 ? -3.299  -39.738 55.195  1.00 27.98  ? 241 LEU D C     1 
ATOM   9866  O O     . LEU D  1 213 ? -3.495  -38.731 55.892  1.00 28.52  ? 241 LEU D O     1 
ATOM   9867  C CB    . LEU D  1 213 ? -1.161  -38.999 54.018  1.00 26.52  ? 241 LEU D CB    1 
ATOM   9868  C CG    . LEU D  1 213 ? -0.006  -39.498 53.134  1.00 32.21  ? 241 LEU D CG    1 
ATOM   9869  C CD1   . LEU D  1 213 ? -0.292  -39.516 51.639  1.00 32.00  ? 241 LEU D CD1   1 
ATOM   9870  C CD2   . LEU D  1 213 ? 1.241   -38.670 53.406  1.00 29.40  ? 241 LEU D CD2   1 
ATOM   9871  N N     . ILE D  1 214 ? -3.755  -40.947 55.542  1.00 24.81  ? 242 ILE D N     1 
ATOM   9872  C CA    . ILE D  1 214 ? -4.556  -41.162 56.771  1.00 28.37  ? 242 ILE D CA    1 
ATOM   9873  C C     . ILE D  1 214 ? -3.732  -41.873 57.872  1.00 24.44  ? 242 ILE D C     1 
ATOM   9874  O O     . ILE D  1 214 ? -3.374  -43.041 57.728  1.00 26.22  ? 242 ILE D O     1 
ATOM   9875  C CB    . ILE D  1 214 ? -5.843  -41.974 56.480  1.00 25.85  ? 242 ILE D CB    1 
ATOM   9876  C CG1   . ILE D  1 214 ? -6.626  -41.375 55.296  1.00 30.60  ? 242 ILE D CG1   1 
ATOM   9877  C CG2   . ILE D  1 214 ? -6.713  -42.043 57.724  1.00 30.18  ? 242 ILE D CG2   1 
ATOM   9878  C CD1   . ILE D  1 214 ? -7.163  -42.412 54.289  1.00 27.80  ? 242 ILE D CD1   1 
ATOM   9879  N N     . PHE D  1 215 ? -3.434  -41.138 58.947  1.00 25.71  ? 243 PHE D N     1 
ATOM   9880  C CA    . PHE D  1 215 ? -2.660  -41.637 60.095  1.00 30.02  ? 243 PHE D CA    1 
ATOM   9881  C C     . PHE D  1 215 ? -3.567  -42.037 61.236  1.00 27.77  ? 243 PHE D C     1 
ATOM   9882  O O     . PHE D  1 215 ? -4.350  -41.232 61.722  1.00 29.60  ? 243 PHE D O     1 
ATOM   9883  C CB    . PHE D  1 215 ? -1.689  -40.573 60.594  1.00 25.05  ? 243 PHE D CB    1 
ATOM   9884  C CG    . PHE D  1 215 ? -0.664  -40.187 59.577  1.00 32.48  ? 243 PHE D CG    1 
ATOM   9885  C CD1   . PHE D  1 215 ? 0.470   -40.968 59.388  1.00 29.50  ? 243 PHE D CD1   1 
ATOM   9886  C CD2   . PHE D  1 215 ? -0.832  -39.058 58.785  1.00 27.53  ? 243 PHE D CD2   1 
ATOM   9887  C CE1   . PHE D  1 215 ? 1.430   -40.617 58.441  1.00 34.52  ? 243 PHE D CE1   1 
ATOM   9888  C CE2   . PHE D  1 215 ? 0.115   -38.703 57.834  1.00 29.88  ? 243 PHE D CE2   1 
ATOM   9889  C CZ    . PHE D  1 215 ? 1.250   -39.484 57.656  1.00 29.64  ? 243 PHE D CZ    1 
ATOM   9890  N N     . GLU D  1 216 ? -3.461  -43.287 61.667  1.00 29.07  ? 244 GLU D N     1 
ATOM   9891  C CA    . GLU D  1 216 ? -4.131  -43.723 62.876  1.00 31.14  ? 244 GLU D CA    1 
ATOM   9892  C C     . GLU D  1 216 ? -3.109  -44.408 63.796  1.00 32.30  ? 244 GLU D C     1 
ATOM   9893  O O     . GLU D  1 216 ? -2.617  -45.489 63.477  1.00 31.89  ? 244 GLU D O     1 
ATOM   9894  C CB    . GLU D  1 216 ? -5.261  -44.679 62.528  1.00 33.37  ? 244 GLU D CB    1 
ATOM   9895  C CG    . GLU D  1 216 ? -6.175  -44.970 63.675  1.00 42.94  ? 244 GLU D CG    1 
ATOM   9896  C CD    . GLU D  1 216 ? -7.256  -45.954 63.304  1.00 50.24  ? 244 GLU D CD    1 
ATOM   9897  O OE1   . GLU D  1 216 ? -7.682  -45.962 62.123  1.00 61.98  ? 244 GLU D OE1   1 
ATOM   9898  O OE2   . GLU D  1 216 ? -7.683  -46.723 64.198  1.00 57.01  ? 244 GLU D OE2   1 
ATOM   9899  N N     . ASP D  1 217 ? -2.815  -43.766 64.929  1.00 32.48  ? 245 ASP D N     1 
ATOM   9900  C CA    . ASP D  1 217 ? -1.843  -44.267 65.925  1.00 32.74  ? 245 ASP D CA    1 
ATOM   9901  C C     . ASP D  1 217 ? -0.562  -44.696 65.238  1.00 33.32  ? 245 ASP D C     1 
ATOM   9902  O O     . ASP D  1 217 ? 0.017   -45.728 65.539  1.00 32.27  ? 245 ASP D O     1 
ATOM   9903  C CB    . ASP D  1 217 ? -2.426  -45.419 66.766  1.00 36.99  ? 245 ASP D CB    1 
ATOM   9904  N N     . CYS D  1 218 ? -0.115  -43.877 64.304  1.00 32.82  ? 246 CYS D N     1 
ATOM   9905  C CA    . CYS D  1 218 ? 1.024   -44.212 63.487  1.00 29.28  ? 246 CYS D CA    1 
ATOM   9906  C C     . CYS D  1 218 ? 2.303   -43.835 64.206  1.00 30.48  ? 246 CYS D C     1 
ATOM   9907  O O     . CYS D  1 218 ? 2.542   -42.656 64.458  1.00 29.02  ? 246 CYS D O     1 
ATOM   9908  C CB    . CYS D  1 218 ? 0.917   -43.465 62.176  1.00 29.09  ? 246 CYS D CB    1 
ATOM   9909  S SG    . CYS D  1 218 ? 2.222   -43.787 61.091  1.00 30.58  ? 246 CYS D SG    1 
ATOM   9910  N N     . ARG D  1 219 ? 3.132   -44.845 64.513  1.00 28.64  ? 247 ARG D N     1 
ATOM   9911  C CA    . ARG D  1 219 ? 4.302   -44.666 65.343  1.00 30.83  ? 247 ARG D CA    1 
ATOM   9912  C C     . ARG D  1 219 ? 5.524   -44.553 64.450  1.00 27.14  ? 247 ARG D C     1 
ATOM   9913  O O     . ARG D  1 219 ? 5.701   -45.341 63.527  1.00 31.28  ? 247 ARG D O     1 
ATOM   9914  C CB    . ARG D  1 219 ? 4.452   -45.836 66.341  1.00 32.43  ? 247 ARG D CB    1 
ATOM   9915  C CG    . ARG D  1 219 ? 3.400   -45.862 67.454  1.00 41.79  ? 247 ARG D CG    1 
ATOM   9916  C CD    . ARG D  1 219 ? 3.577   -47.081 68.378  1.00 44.13  ? 247 ARG D CD    1 
ATOM   9917  N NE    . ARG D  1 219 ? 4.675   -46.899 69.334  1.00 45.45  ? 247 ARG D NE    1 
ATOM   9918  C CZ    . ARG D  1 219 ? 4.565   -46.310 70.527  1.00 53.16  ? 247 ARG D CZ    1 
ATOM   9919  N NH1   . ARG D  1 219 ? 3.394   -45.836 70.963  1.00 54.77  ? 247 ARG D NH1   1 
ATOM   9920  N NH2   . ARG D  1 219 ? 5.641   -46.197 71.297  1.00 63.73  ? 247 ARG D NH2   1 
ATOM   9921  N N     . ILE D  1 220 ? 6.346   -43.549 64.716  1.00 28.04  ? 248 ILE D N     1 
ATOM   9922  C CA    . ILE D  1 220 ? 7.590   -43.359 63.991  1.00 27.76  ? 248 ILE D CA    1 
ATOM   9923  C C     . ILE D  1 220 ? 8.655   -43.071 65.024  1.00 27.94  ? 248 ILE D C     1 
ATOM   9924  O O     . ILE D  1 220 ? 8.364   -42.573 66.115  1.00 32.33  ? 248 ILE D O     1 
ATOM   9925  C CB    . ILE D  1 220 ? 7.503   -42.224 62.896  1.00 28.30  ? 248 ILE D CB    1 
ATOM   9926  C CG1   . ILE D  1 220 ? 7.269   -40.848 63.528  1.00 30.57  ? 248 ILE D CG1   1 
ATOM   9927  C CG2   . ILE D  1 220 ? 6.372   -42.524 61.907  1.00 28.66  ? 248 ILE D CG2   1 
ATOM   9928  C CD1   . ILE D  1 220 ? 6.914   -39.748 62.544  1.00 28.21  ? 248 ILE D CD1   1 
ATOM   9929  N N     . PRO D  1 221 ? 9.905   -43.396 64.699  1.00 28.12  ? 249 PRO D N     1 
ATOM   9930  C CA    . PRO D  1 221 ? 10.935  -43.162 65.720  1.00 29.96  ? 249 PRO D CA    1 
ATOM   9931  C C     . PRO D  1 221 ? 11.065  -41.693 66.125  1.00 31.49  ? 249 PRO D C     1 
ATOM   9932  O O     . PRO D  1 221 ? 10.739  -40.801 65.340  1.00 30.47  ? 249 PRO D O     1 
ATOM   9933  C CB    . PRO D  1 221 ? 12.219  -43.683 65.070  1.00 30.23  ? 249 PRO D CB    1 
ATOM   9934  C CG    . PRO D  1 221 ? 11.920  -43.861 63.610  1.00 33.97  ? 249 PRO D CG    1 
ATOM   9935  C CD    . PRO D  1 221 ? 10.432  -43.978 63.453  1.00 27.65  ? 249 PRO D CD    1 
ATOM   9936  N N     . LYS D  1 222 ? 11.553  -41.454 67.346  1.00 31.76  ? 250 LYS D N     1 
ATOM   9937  C CA    . LYS D  1 222 ? 11.779  -40.093 67.852  1.00 31.93  ? 250 LYS D CA    1 
ATOM   9938  C C     . LYS D  1 222 ? 12.740  -39.253 67.008  1.00 31.01  ? 250 LYS D C     1 
ATOM   9939  O O     . LYS D  1 222 ? 12.584  -38.016 66.893  1.00 32.90  ? 250 LYS D O     1 
ATOM   9940  C CB    . LYS D  1 222 ? 12.250  -40.123 69.322  1.00 34.13  ? 250 LYS D CB    1 
ATOM   9941  C CG    . LYS D  1 222 ? 11.144  -40.374 70.357  1.00 37.31  ? 250 LYS D CG    1 
ATOM   9942  C CD    . LYS D  1 222 ? 10.021  -39.336 70.271  1.00 47.66  ? 250 LYS D CD    1 
ATOM   9943  C CE    . LYS D  1 222 ? 9.559   -38.835 71.618  1.00 56.51  ? 250 LYS D CE    1 
ATOM   9944  N NZ    . LYS D  1 222 ? 10.303  -37.593 72.004  1.00 52.63  ? 250 LYS D NZ    1 
ATOM   9945  N N     . ASP D  1 223 ? 13.715  -39.897 66.385  1.00 29.75  ? 251 ASP D N     1 
ATOM   9946  C CA    . ASP D  1 223 ? 14.645  -39.174 65.515  1.00 33.14  ? 251 ASP D CA    1 
ATOM   9947  C C     . ASP D  1 223 ? 14.058  -38.747 64.139  1.00 30.90  ? 251 ASP D C     1 
ATOM   9948  O O     . ASP D  1 223 ? 14.787  -38.252 63.281  1.00 33.05  ? 251 ASP D O     1 
ATOM   9949  C CB    . ASP D  1 223 ? 15.935  -39.993 65.338  1.00 33.88  ? 251 ASP D CB    1 
ATOM   9950  C CG    . ASP D  1 223 ? 15.753  -41.254 64.469  1.00 44.40  ? 251 ASP D CG    1 
ATOM   9951  O OD1   . ASP D  1 223 ? 16.798  -41.845 64.116  1.00 55.25  ? 251 ASP D OD1   1 
ATOM   9952  O OD2   . ASP D  1 223 ? 14.610  -41.656 64.131  1.00 56.66  ? 251 ASP D OD2   1 
ATOM   9953  N N     . SER D  1 224 ? 12.759  -38.978 63.930  1.00 30.09  ? 252 SER D N     1 
ATOM   9954  C CA    . SER D  1 224 ? 12.085  -38.668 62.653  1.00 30.72  ? 252 SER D CA    1 
ATOM   9955  C C     . SER D  1 224 ? 11.855  -37.167 62.418  1.00 31.32  ? 252 SER D C     1 
ATOM   9956  O O     . SER D  1 224 ? 11.635  -36.769 61.285  1.00 29.18  ? 252 SER D O     1 
ATOM   9957  C CB    . SER D  1 224 ? 10.709  -39.366 62.580  1.00 29.90  ? 252 SER D CB    1 
ATOM   9958  O OG    . SER D  1 224 ? 10.817  -40.771 62.719  1.00 33.44  ? 252 SER D OG    1 
ATOM   9959  N N     . ILE D  1 225 ? 11.903  -36.362 63.487  1.00 29.58  ? 253 ILE D N     1 
ATOM   9960  C CA    . ILE D  1 225 ? 11.682  -34.914 63.413  1.00 30.22  ? 253 ILE D CA    1 
ATOM   9961  C C     . ILE D  1 225 ? 12.703  -34.212 62.518  1.00 29.45  ? 253 ILE D C     1 
ATOM   9962  O O     . ILE D  1 225 ? 13.903  -34.483 62.589  1.00 27.11  ? 253 ILE D O     1 
ATOM   9963  C CB    . ILE D  1 225 ? 11.678  -34.279 64.846  1.00 29.82  ? 253 ILE D CB    1 
ATOM   9964  C CG1   . ILE D  1 225 ? 11.021  -32.904 64.845  1.00 29.30  ? 253 ILE D CG1   1 
ATOM   9965  C CG2   . ILE D  1 225 ? 13.117  -34.199 65.443  1.00 31.17  ? 253 ILE D CG2   1 
ATOM   9966  C CD1   . ILE D  1 225 ? 10.463  -32.552 66.192  1.00 34.10  ? 253 ILE D CD1   1 
ATOM   9967  N N     . LEU D  1 226 ? 12.221  -33.333 61.643  1.00 27.35  ? 254 LEU D N     1 
ATOM   9968  C CA    . LEU D  1 226 ? 13.106  -32.557 60.784  1.00 28.96  ? 254 LEU D CA    1 
ATOM   9969  C C     . LEU D  1 226 ? 13.273  -31.178 61.431  1.00 29.29  ? 254 LEU D C     1 
ATOM   9970  O O     . LEU D  1 226 ? 12.291  -30.480 61.660  1.00 32.00  ? 254 LEU D O     1 
ATOM   9971  C CB    . LEU D  1 226 ? 12.527  -32.461 59.358  1.00 31.11  ? 254 LEU D CB    1 
ATOM   9972  C CG    . LEU D  1 226 ? 13.336  -31.649 58.331  1.00 30.35  ? 254 LEU D CG    1 
ATOM   9973  C CD1   . LEU D  1 226 ? 14.763  -32.206 58.178  1.00 26.17  ? 254 LEU D CD1   1 
ATOM   9974  C CD2   . LEU D  1 226 ? 12.643  -31.618 56.972  1.00 28.46  ? 254 LEU D CD2   1 
ATOM   9975  N N     . GLY D  1 227 ? 14.513  -30.803 61.766  1.00 30.14  ? 255 GLY D N     1 
ATOM   9976  C CA    . GLY D  1 227 ? 14.750  -29.624 62.596  1.00 31.95  ? 255 GLY D CA    1 
ATOM   9977  C C     . GLY D  1 227 ? 14.317  -29.822 64.049  1.00 35.10  ? 255 GLY D C     1 
ATOM   9978  O O     . GLY D  1 227 ? 14.349  -30.934 64.575  1.00 34.63  ? 255 GLY D O     1 
ATOM   9979  N N     . GLU D  1 228 ? 13.917  -28.738 64.706  1.00 37.75  ? 256 GLU D N     1 
ATOM   9980  C CA    . GLU D  1 228 ? 13.573  -28.771 66.133  1.00 36.74  ? 256 GLU D CA    1 
ATOM   9981  C C     . GLU D  1 228 ? 12.065  -28.688 66.272  1.00 36.37  ? 256 GLU D C     1 
ATOM   9982  O O     . GLU D  1 228 ? 11.402  -28.177 65.369  1.00 32.03  ? 256 GLU D O     1 
ATOM   9983  C CB    . GLU D  1 228 ? 14.241  -27.605 66.879  1.00 40.60  ? 256 GLU D CB    1 
ATOM   9984  C CG    . GLU D  1 228 ? 15.767  -27.672 66.900  1.00 39.24  ? 256 GLU D CG    1 
ATOM   9985  N N     . PRO D  1 229 ? 11.511  -29.180 67.395  1.00 35.92  ? 257 PRO D N     1 
ATOM   9986  C CA    . PRO D  1 229 ? 10.067  -29.054 67.559  1.00 35.43  ? 257 PRO D CA    1 
ATOM   9987  C C     . PRO D  1 229 ? 9.592   -27.600 67.538  1.00 33.66  ? 257 PRO D C     1 
ATOM   9988  O O     . PRO D  1 229 ? 10.259  -26.716 68.079  1.00 28.80  ? 257 PRO D O     1 
ATOM   9989  C CB    . PRO D  1 229 ? 9.797   -29.716 68.915  1.00 37.01  ? 257 PRO D CB    1 
ATOM   9990  C CG    . PRO D  1 229 ? 10.990  -30.592 69.160  1.00 36.18  ? 257 PRO D CG    1 
ATOM   9991  C CD    . PRO D  1 229 ? 12.136  -29.878 68.535  1.00 34.85  ? 257 PRO D CD    1 
ATOM   9992  N N     . GLY D  1 230 ? 8.453   -27.364 66.891  1.00 32.70  ? 258 GLY D N     1 
ATOM   9993  C CA    . GLY D  1 230 ? 7.946   -26.016 66.674  1.00 31.94  ? 258 GLY D CA    1 
ATOM   9994  C C     . GLY D  1 230 ? 8.490   -25.248 65.475  1.00 32.10  ? 258 GLY D C     1 
ATOM   9995  O O     . GLY D  1 230 ? 7.990   -24.160 65.164  1.00 36.22  ? 258 GLY D O     1 
ATOM   9996  N N     . MET D  1 231 ? 9.493   -25.792 64.785  1.00 29.86  ? 259 MET D N     1 
ATOM   9997  C CA    . MET D  1 231 ? 10.006  -25.177 63.541  1.00 33.83  ? 259 MET D CA    1 
ATOM   9998  C C     . MET D  1 231 ? 9.153   -25.488 62.305  1.00 29.44  ? 259 MET D C     1 
ATOM   9999  O O     . MET D  1 231 ? 9.465   -25.013 61.219  1.00 31.70  ? 259 MET D O     1 
ATOM   10000 C CB    . MET D  1 231 ? 11.423  -25.675 63.226  1.00 33.54  ? 259 MET D CB    1 
ATOM   10001 C CG    . MET D  1 231 ? 12.527  -24.904 63.870  1.00 40.37  ? 259 MET D CG    1 
ATOM   10002 S SD    . MET D  1 231 ? 14.131  -25.731 63.616  1.00 53.71  ? 259 MET D SD    1 
ATOM   10003 C CE    . MET D  1 231 ? 14.393  -25.655 61.834  1.00 45.21  ? 259 MET D CE    1 
ATOM   10004 N N     . GLY D  1 232 ? 8.111   -26.306 62.464  1.00 25.05  ? 260 GLY D N     1 
ATOM   10005 C CA    . GLY D  1 232 ? 7.330   -26.809 61.334  1.00 28.15  ? 260 GLY D CA    1 
ATOM   10006 C C     . GLY D  1 232 ? 6.802   -25.745 60.396  1.00 28.14  ? 260 GLY D C     1 
ATOM   10007 O O     . GLY D  1 232 ? 7.016   -25.833 59.179  1.00 25.65  ? 260 GLY D O     1 
ATOM   10008 N N     . PHE D  1 233 ? 6.137   -24.727 60.947  1.00 31.38  ? 261 PHE D N     1 
ATOM   10009 C CA    . PHE D  1 233 ? 5.543   -23.680 60.102  1.00 29.39  ? 261 PHE D CA    1 
ATOM   10010 C C     . PHE D  1 233 ? 6.588   -22.963 59.238  1.00 31.35  ? 261 PHE D C     1 
ATOM   10011 O O     . PHE D  1 233 ? 6.382   -22.733 58.035  1.00 28.84  ? 261 PHE D O     1 
ATOM   10012 C CB    . PHE D  1 233 ? 4.742   -22.658 60.916  1.00 31.82  ? 261 PHE D CB    1 
ATOM   10013 C CG    . PHE D  1 233 ? 3.882   -21.790 60.053  1.00 31.38  ? 261 PHE D CG    1 
ATOM   10014 C CD1   . PHE D  1 233 ? 2.681   -22.280 59.541  1.00 42.58  ? 261 PHE D CD1   1 
ATOM   10015 C CD2   . PHE D  1 233 ? 4.307   -20.524 59.676  1.00 36.27  ? 261 PHE D CD2   1 
ATOM   10016 C CE1   . PHE D  1 233 ? 1.898   -21.499 58.698  1.00 43.33  ? 261 PHE D CE1   1 
ATOM   10017 C CE2   . PHE D  1 233 ? 3.524   -19.731 58.842  1.00 40.59  ? 261 PHE D CE2   1 
ATOM   10018 C CZ    . PHE D  1 233 ? 2.324   -20.220 58.350  1.00 37.50  ? 261 PHE D CZ    1 
ATOM   10019 N N     . LYS D  1 234 ? 7.713   -22.641 59.858  1.00 27.39  ? 262 LYS D N     1 
ATOM   10020 C CA    . LYS D  1 234 ? 8.815   -21.994 59.180  1.00 30.05  ? 262 LYS D CA    1 
ATOM   10021 C C     . LYS D  1 234 ? 9.398   -22.877 58.059  1.00 29.17  ? 262 LYS D C     1 
ATOM   10022 O O     . LYS D  1 234 ? 9.725   -22.376 56.967  1.00 27.53  ? 262 LYS D O     1 
ATOM   10023 C CB    . LYS D  1 234 ? 9.883   -21.618 60.217  1.00 28.43  ? 262 LYS D CB    1 
ATOM   10024 C CG    . LYS D  1 234 ? 11.225  -21.160 59.646  1.00 44.11  ? 262 LYS D CG    1 
ATOM   10025 C CD    . LYS D  1 234 ? 12.341  -21.234 60.715  1.00 35.23  ? 262 LYS D CD    1 
ATOM   10026 C CE    . LYS D  1 234 ? 13.716  -21.606 60.131  1.00 52.61  ? 262 LYS D CE    1 
ATOM   10027 N NZ    . LYS D  1 234 ? 14.636  -22.166 61.171  1.00 56.34  ? 262 LYS D NZ    1 
ATOM   10028 N N     . ILE D  1 235 ? 9.532   -24.178 58.331  1.00 26.77  ? 263 ILE D N     1 
ATOM   10029 C CA    . ILE D  1 235 ? 10.062  -25.122 57.354  1.00 27.28  ? 263 ILE D CA    1 
ATOM   10030 C C     . ILE D  1 235 ? 9.152   -25.189 56.138  1.00 23.40  ? 263 ILE D C     1 
ATOM   10031 O O     . ILE D  1 235 ? 9.602   -25.091 55.014  1.00 25.40  ? 263 ILE D O     1 
ATOM   10032 C CB    . ILE D  1 235 ? 10.241  -26.549 57.973  1.00 27.90  ? 263 ILE D CB    1 
ATOM   10033 C CG1   . ILE D  1 235 ? 11.387  -26.518 58.987  1.00 25.59  ? 263 ILE D CG1   1 
ATOM   10034 C CG2   . ILE D  1 235 ? 10.541  -27.608 56.880  1.00 21.20  ? 263 ILE D CG2   1 
ATOM   10035 C CD1   . ILE D  1 235 ? 11.417  -27.712 59.945  1.00 23.86  ? 263 ILE D CD1   1 
ATOM   10036 N N     . ALA D  1 236 ? 7.868   -25.357 56.400  1.00 24.53  ? 264 ALA D N     1 
ATOM   10037 C CA    . ALA D  1 236 ? 6.865   -25.388 55.375  1.00 26.57  ? 264 ALA D CA    1 
ATOM   10038 C C     . ALA D  1 236 ? 6.936   -24.118 54.507  1.00 28.45  ? 264 ALA D C     1 
ATOM   10039 O O     . ALA D  1 236 ? 6.997   -24.215 53.289  1.00 26.80  ? 264 ALA D O     1 
ATOM   10040 C CB    . ALA D  1 236 ? 5.506   -25.542 56.008  1.00 21.95  ? 264 ALA D CB    1 
ATOM   10041 N N     . MET D  1 237 ? 7.000   -22.942 55.140  1.00 27.95  ? 265 MET D N     1 
ATOM   10042 C CA    . MET D  1 237 ? 6.937   -21.669 54.414  1.00 31.07  ? 265 MET D CA    1 
ATOM   10043 C C     . MET D  1 237 ? 8.161   -21.445 53.561  1.00 25.86  ? 265 MET D C     1 
ATOM   10044 O O     . MET D  1 237 ? 8.046   -20.998 52.433  1.00 24.67  ? 265 MET D O     1 
ATOM   10045 C CB    . MET D  1 237 ? 6.724   -20.477 55.352  1.00 31.00  ? 265 MET D CB    1 
ATOM   10046 C CG    . MET D  1 237 ? 5.373   -20.456 56.039  1.00 34.84  ? 265 MET D CG    1 
ATOM   10047 S SD    . MET D  1 237 ? 3.933   -20.476 54.929  1.00 43.78  ? 265 MET D SD    1 
ATOM   10048 C CE    . MET D  1 237 ? 3.306   -22.154 55.125  1.00 34.42  ? 265 MET D CE    1 
ATOM   10049 N N     . GLN D  1 238 ? 9.335   -21.777 54.083  1.00 27.27  ? 266 GLN D N     1 
ATOM   10050 C CA    . GLN D  1 238 ? 10.550  -21.682 53.310  1.00 26.89  ? 266 GLN D CA    1 
ATOM   10051 C C     . GLN D  1 238 ? 10.627  -22.761 52.228  1.00 29.05  ? 266 GLN D C     1 
ATOM   10052 O O     . GLN D  1 238 ? 11.347  -22.579 51.229  1.00 28.72  ? 266 GLN D O     1 
ATOM   10053 C CB    . GLN D  1 238 ? 11.787  -21.772 54.213  1.00 28.86  ? 266 GLN D CB    1 
ATOM   10054 C CG    . GLN D  1 238 ? 11.914  -20.628 55.205  1.00 34.41  ? 266 GLN D CG    1 
ATOM   10055 C CD    . GLN D  1 238 ? 13.187  -20.719 56.034  1.00 32.95  ? 266 GLN D CD    1 
ATOM   10056 O OE1   . GLN D  1 238 ? 14.271  -20.875 55.502  1.00 42.53  ? 266 GLN D OE1   1 
ATOM   10057 N NE2   . GLN D  1 238 ? 13.050  -20.601 57.335  1.00 50.33  ? 266 GLN D NE2   1 
ATOM   10058 N N     . THR D  1 239 ? 9.913   -23.872 52.424  1.00 27.46  ? 267 THR D N     1 
ATOM   10059 C CA    . THR D  1 239 ? 9.914   -24.939 51.421  1.00 30.92  ? 267 THR D CA    1 
ATOM   10060 C C     . THR D  1 239 ? 9.074   -24.479 50.244  1.00 27.28  ? 267 THR D C     1 
ATOM   10061 O O     . THR D  1 239 ? 9.504   -24.568 49.097  1.00 26.06  ? 267 THR D O     1 
ATOM   10062 C CB    . THR D  1 239 ? 9.373   -26.288 51.956  1.00 27.41  ? 267 THR D CB    1 
ATOM   10063 O OG1   . THR D  1 239 ? 10.205  -26.741 53.032  1.00 29.36  ? 267 THR D OG1   1 
ATOM   10064 C CG2   . THR D  1 239 ? 9.356   -27.365 50.846  1.00 22.85  ? 267 THR D CG2   1 
ATOM   10065 N N     . LEU D  1 240 ? 7.894   -23.955 50.559  1.00 25.80  ? 268 LEU D N     1 
ATOM   10066 C CA    . LEU D  1 240 ? 6.985   -23.429 49.543  1.00 28.43  ? 268 LEU D CA    1 
ATOM   10067 C C     . LEU D  1 240 ? 7.593   -22.305 48.721  1.00 29.42  ? 268 LEU D C     1 
ATOM   10068 O O     . LEU D  1 240 ? 7.306   -22.194 47.526  1.00 26.67  ? 268 LEU D O     1 
ATOM   10069 C CB    . LEU D  1 240 ? 5.691   -22.967 50.179  1.00 28.00  ? 268 LEU D CB    1 
ATOM   10070 C CG    . LEU D  1 240 ? 4.802   -24.055 50.762  1.00 29.28  ? 268 LEU D CG    1 
ATOM   10071 C CD1   . LEU D  1 240 ? 3.802   -23.379 51.666  1.00 29.83  ? 268 LEU D CD1   1 
ATOM   10072 C CD2   . LEU D  1 240 ? 4.140   -24.878 49.655  1.00 34.66  ? 268 LEU D CD2   1 
ATOM   10073 N N     . ASP D  1 241 ? 8.450   -21.494 49.337  1.00 27.36  ? 269 ASP D N     1 
ATOM   10074 C CA    . ASP D  1 241 ? 9.172   -20.480 48.603  1.00 28.64  ? 269 ASP D CA    1 
ATOM   10075 C C     . ASP D  1 241 ? 9.969   -21.120 47.464  1.00 30.69  ? 269 ASP D C     1 
ATOM   10076 O O     . ASP D  1 241 ? 9.902   -20.642 46.314  1.00 26.55  ? 269 ASP D O     1 
ATOM   10077 C CB    . ASP D  1 241 ? 10.105  -19.668 49.517  1.00 29.03  ? 269 ASP D CB    1 
ATOM   10078 C CG    . ASP D  1 241 ? 9.344   -18.843 50.573  1.00 39.94  ? 269 ASP D CG    1 
ATOM   10079 O OD1   . ASP D  1 241 ? 8.191   -18.397 50.320  1.00 39.30  ? 269 ASP D OD1   1 
ATOM   10080 O OD2   . ASP D  1 241 ? 9.902   -18.638 51.676  1.00 39.54  ? 269 ASP D OD2   1 
ATOM   10081 N N     . MET D  1 242 ? 10.724  -22.178 47.774  1.00 27.75  ? 270 MET D N     1 
ATOM   10082 C CA    . MET D  1 242 ? 11.490  -22.913 46.744  1.00 31.01  ? 270 MET D CA    1 
ATOM   10083 C C     . MET D  1 242 ? 10.562  -23.599 45.754  1.00 24.66  ? 270 MET D C     1 
ATOM   10084 O O     . MET D  1 242 ? 10.779  -23.548 44.550  1.00 27.58  ? 270 MET D O     1 
ATOM   10085 C CB    . MET D  1 242 ? 12.427  -23.969 47.363  1.00 32.99  ? 270 MET D CB    1 
ATOM   10086 C CG    . MET D  1 242 ? 13.509  -23.401 48.273  1.00 39.74  ? 270 MET D CG    1 
ATOM   10087 S SD    . MET D  1 242 ? 14.596  -24.698 48.961  1.00 42.31  ? 270 MET D SD    1 
ATOM   10088 C CE    . MET D  1 242 ? 13.431  -25.647 49.949  1.00 32.01  ? 270 MET D CE    1 
ATOM   10089 N N     . GLY D  1 243 ? 9.503   -24.214 46.271  1.00 26.13  ? 271 GLY D N     1 
ATOM   10090 C CA    . GLY D  1 243 ? 8.542   -24.915 45.442  1.00 24.99  ? 271 GLY D CA    1 
ATOM   10091 C C     . GLY D  1 243 ? 7.930   -24.011 44.391  1.00 27.84  ? 271 GLY D C     1 
ATOM   10092 O O     . GLY D  1 243 ? 7.746   -24.408 43.228  1.00 24.43  ? 271 GLY D O     1 
ATOM   10093 N N     . ARG D  1 244 ? 7.630   -22.785 44.811  1.00 27.50  ? 272 ARG D N     1 
ATOM   10094 C CA    . ARG D  1 244 ? 6.989   -21.806 43.956  1.00 25.48  ? 272 ARG D CA    1 
ATOM   10095 C C     . ARG D  1 244 ? 7.840   -21.493 42.715  1.00 25.31  ? 272 ARG D C     1 
ATOM   10096 O O     . ARG D  1 244 ? 7.290   -21.192 41.671  1.00 25.48  ? 272 ARG D O     1 
ATOM   10097 C CB    . ARG D  1 244 ? 6.642   -20.543 44.769  1.00 23.23  ? 272 ARG D CB    1 
ATOM   10098 C CG    . ARG D  1 244 ? 5.408   -20.729 45.640  1.00 27.55  ? 272 ARG D CG    1 
ATOM   10099 C CD    . ARG D  1 244 ? 5.324   -19.732 46.789  1.00 27.20  ? 272 ARG D CD    1 
ATOM   10100 N NE    . ARG D  1 244 ? 4.159   -20.050 47.622  1.00 30.06  ? 272 ARG D NE    1 
ATOM   10101 C CZ    . ARG D  1 244 ? 3.815   -19.408 48.739  1.00 33.92  ? 272 ARG D CZ    1 
ATOM   10102 N NH1   . ARG D  1 244 ? 4.531   -18.387 49.186  1.00 29.03  ? 272 ARG D NH1   1 
ATOM   10103 N NH2   . ARG D  1 244 ? 2.729   -19.790 49.410  1.00 32.51  ? 272 ARG D NH2   1 
ATOM   10104 N N     . ILE D  1 245 ? 9.167   -21.608 42.803  1.00 23.34  ? 273 ILE D N     1 
ATOM   10105 C CA    . ILE D  1 245 ? 10.005  -21.382 41.624  1.00 25.70  ? 273 ILE D CA    1 
ATOM   10106 C C     . ILE D  1 245 ? 9.861   -22.572 40.672  1.00 26.69  ? 273 ILE D C     1 
ATOM   10107 O O     . ILE D  1 245 ? 9.895   -22.418 39.453  1.00 22.29  ? 273 ILE D O     1 
ATOM   10108 C CB    . ILE D  1 245 ? 11.480  -21.173 42.003  1.00 25.66  ? 273 ILE D CB    1 
ATOM   10109 C CG1   . ILE D  1 245 ? 11.605  -19.945 42.916  1.00 27.46  ? 273 ILE D CG1   1 
ATOM   10110 C CG2   . ILE D  1 245 ? 12.366  -21.050 40.733  1.00 28.83  ? 273 ILE D CG2   1 
ATOM   10111 C CD1   . ILE D  1 245 ? 12.948  -19.834 43.623  1.00 20.60  ? 273 ILE D CD1   1 
ATOM   10112 N N     . GLY D  1 246 ? 9.679   -23.750 41.256  1.00 29.48  ? 274 GLY D N     1 
ATOM   10113 C CA    . GLY D  1 246 ? 9.390   -24.959 40.501  1.00 27.36  ? 274 GLY D CA    1 
ATOM   10114 C C     . GLY D  1 246 ? 8.060   -24.901 39.778  1.00 23.42  ? 274 GLY D C     1 
ATOM   10115 O O     . GLY D  1 246 ? 7.990   -25.214 38.605  1.00 28.14  ? 274 GLY D O     1 
ATOM   10116 N N     . ILE D  1 247 ? 7.009   -24.501 40.476  1.00 23.41  ? 275 ILE D N     1 
ATOM   10117 C CA    . ILE D  1 247 ? 5.687   -24.407 39.860  1.00 22.83  ? 275 ILE D CA    1 
ATOM   10118 C C     . ILE D  1 247 ? 5.634   -23.288 38.811  1.00 23.18  ? 275 ILE D C     1 
ATOM   10119 O O     . ILE D  1 247 ? 5.021   -23.460 37.765  1.00 23.91  ? 275 ILE D O     1 
ATOM   10120 C CB    . ILE D  1 247 ? 4.535   -24.288 40.910  1.00 24.43  ? 275 ILE D CB    1 
ATOM   10121 C CG1   . ILE D  1 247 ? 4.499   -25.527 41.820  1.00 29.99  ? 275 ILE D CG1   1 
ATOM   10122 C CG2   . ILE D  1 247 ? 3.173   -24.098 40.249  1.00 19.93  ? 275 ILE D CG2   1 
ATOM   10123 C CD1   . ILE D  1 247 ? 4.607   -26.910 41.095  1.00 23.20  ? 275 ILE D CD1   1 
ATOM   10124 N N     . ALA D  1 248 ? 6.260   -22.148 39.081  1.00 26.10  ? 276 ALA D N     1 
ATOM   10125 C CA    . ALA D  1 248 ? 6.391   -21.124 38.060  1.00 25.71  ? 276 ALA D CA    1 
ATOM   10126 C C     . ALA D  1 248 ? 7.025   -21.699 36.788  1.00 23.12  ? 276 ALA D C     1 
ATOM   10127 O O     . ALA D  1 248 ? 6.546   -21.417 35.678  1.00 24.27  ? 276 ALA D O     1 
ATOM   10128 C CB    . ALA D  1 248 ? 7.169   -19.915 38.574  1.00 17.77  ? 276 ALA D CB    1 
ATOM   10129 N N     . SER D  1 249 ? 8.082   -22.505 36.936  1.00 27.52  ? 277 SER D N     1 
ATOM   10130 C CA    . SER D  1 249 ? 8.748   -23.118 35.788  1.00 22.76  ? 277 SER D CA    1 
ATOM   10131 C C     . SER D  1 249 ? 7.869   -24.142 35.034  1.00 23.64  ? 277 SER D C     1 
ATOM   10132 O O     . SER D  1 249 ? 7.969   -24.228 33.806  1.00 23.83  ? 277 SER D O     1 
ATOM   10133 C CB    . SER D  1 249 ? 10.047  -23.770 36.219  1.00 28.86  ? 277 SER D CB    1 
ATOM   10134 O OG    . SER D  1 249 ? 10.970  -22.800 36.672  1.00 25.71  ? 277 SER D OG    1 
ATOM   10135 N N     . GLN D  1 250 ? 7.060   -24.927 35.762  1.00 20.05  ? 278 GLN D N     1 
ATOM   10136 C CA    . GLN D  1 250 ? 6.062   -25.819 35.162  1.00 25.24  ? 278 GLN D CA    1 
ATOM   10137 C C     . GLN D  1 250 ? 5.029   -25.022 34.338  1.00 23.49  ? 278 GLN D C     1 
ATOM   10138 O O     . GLN D  1 250 ? 4.680   -25.413 33.227  1.00 21.27  ? 278 GLN D O     1 
ATOM   10139 C CB    . GLN D  1 250 ? 5.323   -26.620 36.241  1.00 23.82  ? 278 GLN D CB    1 
ATOM   10140 C CG    . GLN D  1 250 ? 4.339   -27.679 35.724  1.00 25.09  ? 278 GLN D CG    1 
ATOM   10141 C CD    . GLN D  1 250 ? 3.161   -27.967 36.679  1.00 32.25  ? 278 GLN D CD    1 
ATOM   10142 O OE1   . GLN D  1 250 ? 2.903   -27.230 37.647  1.00 28.35  ? 278 GLN D OE1   1 
ATOM   10143 N NE2   . GLN D  1 250 ? 2.430   -29.036 36.385  1.00 28.62  ? 278 GLN D NE2   1 
ATOM   10144 N N     . ALA D  1 251 ? 4.514   -23.942 34.924  1.00 22.51  ? 279 ALA D N     1 
ATOM   10145 C CA    . ALA D  1 251 ? 3.579   -23.042 34.257  1.00 20.66  ? 279 ALA D CA    1 
ATOM   10146 C C     . ALA D  1 251 ? 4.164   -22.438 32.977  1.00 23.51  ? 279 ALA D C     1 
ATOM   10147 O O     . ALA D  1 251 ? 3.493   -22.310 31.964  1.00 18.58  ? 279 ALA D O     1 
ATOM   10148 C CB    . ALA D  1 251 ? 3.135   -21.931 35.221  1.00 17.01  ? 279 ALA D CB    1 
ATOM   10149 N N     . LEU D  1 252 ? 5.441   -22.076 33.025  1.00 17.86  ? 280 LEU D N     1 
ATOM   10150 C CA    . LEU D  1 252 ? 6.130   -21.612 31.847  1.00 21.24  ? 280 LEU D CA    1 
ATOM   10151 C C     . LEU D  1 252 ? 6.175   -22.651 30.723  1.00 23.36  ? 280 LEU D C     1 
ATOM   10152 O O     . LEU D  1 252 ? 6.056   -22.292 29.553  1.00 21.19  ? 280 LEU D O     1 
ATOM   10153 C CB    . LEU D  1 252 ? 7.550   -21.219 32.218  1.00 22.29  ? 280 LEU D CB    1 
ATOM   10154 C CG    . LEU D  1 252 ? 7.778   -19.990 33.096  1.00 29.85  ? 280 LEU D CG    1 
ATOM   10155 C CD1   . LEU D  1 252 ? 9.280   -19.944 33.452  1.00 22.70  ? 280 LEU D CD1   1 
ATOM   10156 C CD2   . LEU D  1 252 ? 7.314   -18.684 32.409  1.00 25.03  ? 280 LEU D CD2   1 
ATOM   10157 N N     . GLY D  1 253 ? 6.415   -23.914 31.089  1.00 23.15  ? 281 GLY D N     1 
ATOM   10158 C CA    . GLY D  1 253 ? 6.497   -24.999 30.144  1.00 21.62  ? 281 GLY D CA    1 
ATOM   10159 C C     . GLY D  1 253 ? 5.150   -25.261 29.504  1.00 20.36  ? 281 GLY D C     1 
ATOM   10160 O O     . GLY D  1 253 ? 5.087   -25.515 28.308  1.00 20.29  ? 281 GLY D O     1 
ATOM   10161 N N     . ILE D  1 254 ? 4.086   -25.168 30.296  1.00 20.05  ? 282 ILE D N     1 
ATOM   10162 C CA    . ILE D  1 254 ? 2.740   -25.338 29.773  1.00 23.75  ? 282 ILE D CA    1 
ATOM   10163 C C     . ILE D  1 254 ? 2.379   -24.177 28.807  1.00 23.58  ? 282 ILE D C     1 
ATOM   10164 O O     . ILE D  1 254 ? 1.873   -24.402 27.714  1.00 20.57  ? 282 ILE D O     1 
ATOM   10165 C CB    . ILE D  1 254 ? 1.717   -25.438 30.918  1.00 23.27  ? 282 ILE D CB    1 
ATOM   10166 C CG1   . ILE D  1 254 ? 1.921   -26.727 31.709  1.00 26.91  ? 282 ILE D CG1   1 
ATOM   10167 C CG2   . ILE D  1 254 ? 0.304   -25.386 30.377  1.00 20.71  ? 282 ILE D CG2   1 
ATOM   10168 C CD1   . ILE D  1 254 ? 1.186   -26.781 33.039  1.00 22.44  ? 282 ILE D CD1   1 
ATOM   10169 N N     . ALA D  1 255 ? 2.646   -22.942 29.233  1.00 22.40  ? 283 ALA D N     1 
ATOM   10170 C CA    . ALA D  1 255 ? 2.493   -21.774 28.392  1.00 24.62  ? 283 ALA D CA    1 
ATOM   10171 C C     . ALA D  1 255 ? 3.307   -21.841 27.092  1.00 23.92  ? 283 ALA D C     1 
ATOM   10172 O O     . ALA D  1 255 ? 2.818   -21.505 26.027  1.00 20.34  ? 283 ALA D O     1 
ATOM   10173 C CB    . ALA D  1 255 ? 2.848   -20.486 29.206  1.00 22.03  ? 283 ALA D CB    1 
ATOM   10174 N N     . GLN D  1 256 ? 4.570   -22.243 27.167  1.00 24.81  ? 284 GLN D N     1 
ATOM   10175 C CA    . GLN D  1 256 ? 5.381   -22.279 25.975  1.00 22.01  ? 284 GLN D CA    1 
ATOM   10176 C C     . GLN D  1 256 ? 4.851   -23.272 24.926  1.00 25.06  ? 284 GLN D C     1 
ATOM   10177 O O     . GLN D  1 256 ? 4.898   -22.989 23.734  1.00 21.49  ? 284 GLN D O     1 
ATOM   10178 C CB    . GLN D  1 256 ? 6.822   -22.637 26.310  1.00 23.63  ? 284 GLN D CB    1 
ATOM   10179 C CG    . GLN D  1 256 ? 7.753   -22.618 25.107  1.00 27.08  ? 284 GLN D CG    1 
ATOM   10180 C CD    . GLN D  1 256 ? 7.993   -21.226 24.544  1.00 33.89  ? 284 GLN D CD    1 
ATOM   10181 O OE1   . GLN D  1 256 ? 8.656   -20.412 25.172  1.00 34.80  ? 284 GLN D OE1   1 
ATOM   10182 N NE2   . GLN D  1 256 ? 7.497   -20.965 23.329  1.00 25.41  ? 284 GLN D NE2   1 
ATOM   10183 N N     . THR D  1 257 ? 4.377   -24.434 25.379  1.00 24.61  ? 285 THR D N     1 
ATOM   10184 C CA    . THR D  1 257 ? 3.982   -25.484 24.467  1.00 25.17  ? 285 THR D CA    1 
ATOM   10185 C C     . THR D  1 257 ? 2.599   -25.137 23.879  1.00 21.79  ? 285 THR D C     1 
ATOM   10186 O O     . THR D  1 257 ? 2.328   -25.429 22.710  1.00 24.06  ? 285 THR D O     1 
ATOM   10187 C CB    . THR D  1 257 ? 4.048   -26.901 25.123  1.00 28.20  ? 285 THR D CB    1 
ATOM   10188 O OG1   . THR D  1 257 ? 4.041   -27.908 24.103  1.00 32.43  ? 285 THR D OG1   1 
ATOM   10189 C CG2   . THR D  1 257 ? 2.926   -27.142 26.088  1.00 19.66  ? 285 THR D CG2   1 
ATOM   10190 N N     . ALA D  1 258 ? 1.774   -24.464 24.677  1.00 22.84  ? 286 ALA D N     1 
ATOM   10191 C CA    . ALA D  1 258 ? 0.482   -23.945 24.188  1.00 21.83  ? 286 ALA D CA    1 
ATOM   10192 C C     . ALA D  1 258 ? 0.675   -22.866 23.095  1.00 24.05  ? 286 ALA D C     1 
ATOM   10193 O O     . ALA D  1 258 ? -0.025  -22.871 22.084  1.00 22.85  ? 286 ALA D O     1 
ATOM   10194 C CB    . ALA D  1 258 ? -0.339  -23.433 25.327  1.00 20.66  ? 286 ALA D CB    1 
ATOM   10195 N N     . LEU D  1 259 ? 1.637   -21.968 23.304  1.00 26.66  ? 287 LEU D N     1 
ATOM   10196 C CA    . LEU D  1 259 ? 2.018   -20.955 22.323  1.00 26.09  ? 287 LEU D CA    1 
ATOM   10197 C C     . LEU D  1 259 ? 2.650   -21.599 21.063  1.00 22.69  ? 287 LEU D C     1 
ATOM   10198 O O     . LEU D  1 259 ? 2.337   -21.197 19.935  1.00 22.61  ? 287 LEU D O     1 
ATOM   10199