data_2VJD
# 
_entry.id   2VJD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VJD         
PDBE  EBI-34721    
WWPDB D_1290034721 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VJD 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Colletier, J.P.' 1 
'Bourgeois, D.'   2 
'Fournier, D.'    3 
'Silman, I.'      4 
'Sussman, J.L.'   5 
'Weik, M.'        6 
# 
_citation.id                        primary 
_citation.title                     
'Shoot-and-Trap: Use of Specific X-Ray Damage to Study Structural Protein Dynamics by Temperature-Controlled Cryo-Crystallography.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            105 
_citation.page_first                11742 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18701720 
_citation.pdbx_database_id_DOI      10.1073/PNAS.0804828105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Colletier, J.P.' 1 ? 
primary 'Bourgeois, D.'   2 ? 
primary 'Sanson, B.'      3 ? 
primary 'Fournier, D.'    4 ? 
primary 'Sussman, J.L.'   5 ? 
primary 'Silman, I.'      6 ? 
primary 'Weik, M.'        7 ? 
# 
_cell.entry_id           2VJD 
_cell.length_a           91.980 
_cell.length_b           107.540 
_cell.length_c           151.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VJD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                             60736.516 2    3.1.1.7 ? 'RESIDUES 22-558' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose         221.208   4    ?       ? ?                 ? 
3 non-polymer syn 'CHLORIDE ION'                                   35.453    4    ?       ? ?                 ? 
4 non-polymer syn '(4R)-4-HYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM' 146.250   4    ?       ? ?                 ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'                             150.173   3    ?       ? ?                 ? 
6 water       nat water                                            18.015    1601 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2VJD A 1 ? 537 ? P04058 22 ? 558 ? 1 537 
2 1 2VJD B 1 ? 537 ? P04058 22 ? 558 ? 1 537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                  ? 'C4 H7 N O4'     133.103 
CCD non-polymer                  . '(4R)-4-HYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM' ? 'C8 H20 N O 1'   146.250 
CL  non-polymer                  . 'CHLORIDE ION'                                   ? 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                       ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose         
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                             ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VJD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   52.77 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'32% PEG200, 150MM MES, PH6, 4 DEG. C. 2 HOURS SOAKING IN MOTHER LIQUOR SOLUTION CONTAINING 0.5 MM OTMA, pH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           150 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-09-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.932240 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.932240 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VJD 
_reflns.observed_criterion_sigma_I   3.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   59320 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.10 
_reflns.B_iso_Wilson_estimate        21.8 
_reflns.pdbx_redundancy              7.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.60 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VJD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     67283 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3501668.02 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.99 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.196 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3366 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.1 
_refine.aniso_B[1][1]                            -5.25 
_refine.aniso_B[2][2]                            15.06 
_refine.aniso_B[3][3]                            -9.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 58.7597 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1W75' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2VJD 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.35 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8454 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         130 
_refine_hist.number_atoms_solvent             1601 
_refine_hist.number_atoms_total               10185 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        45.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.31  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.08  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.11  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             10527 
_refine_ls_shell.R_factor_R_work                  0.268 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             555 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 3 CARBOHYDRATE.PARAM ION.TOP          
'X-RAY DIFFRACTION' 4 ION.PARAM          CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 5 AS.PARAM           AS.TOP           
# 
_struct.entry_id                  2VJD 
_struct.title                     
;Torpedo Californica Acetylcholinesterase In Complex With A Non Hydrolysable Substrate Analogue, 4-Oxo-N,N,N- Trimethylpentanaminium - Orthorhombic space group - Dataset C at 150K
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VJD 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, NEUROTRANSMITTER DEGRADATION, KINETIC CRYSTALLOGRAPHY, STRUCTURAL DYNAMICS, XRAY DAMAGE, SUBSTRATE ANALOGUE, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION, SYNAPSE, MEMBRANE, HYDROLASE, GPI-ANCHOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 2 ? 
M N N 2 ? 
N N N 4 ? 
O N N 4 ? 
P N N 5 ? 
Q N N 3 ? 
R N N 6 ? 
S N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 10 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 11 SER A 258 ? ARG A 267 ? SER A 258 ARG A 267 1 ? 10 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
HELX_P HELX_P27 27 VAL B 40  ? ARG B 44  ? VAL B 40  ARG B 44  5 ? 5  
HELX_P HELX_P28 28 PHE B 78  ? MET B 83  ? PHE B 78  MET B 83  1 ? 6  
HELX_P HELX_P29 29 LEU B 127 ? ASN B 131 ? LEU B 127 ASN B 131 5 ? 5  
HELX_P HELX_P30 30 GLY B 132 ? GLU B 140 ? GLY B 132 GLU B 140 1 ? 9  
HELX_P HELX_P31 31 GLY B 151 ? LEU B 156 ? GLY B 151 LEU B 156 1 ? 6  
HELX_P HELX_P32 32 ASN B 167 ? ILE B 184 ? ASN B 167 ILE B 184 1 ? 18 
HELX_P HELX_P33 33 GLN B 185 ? PHE B 187 ? GLN B 185 PHE B 187 5 ? 3  
HELX_P HELX_P34 34 SER B 200 ? SER B 212 ? SER B 200 SER B 212 1 ? 13 
HELX_P HELX_P35 35 SER B 215 ? PHE B 219 ? SER B 215 PHE B 219 5 ? 5  
HELX_P HELX_P36 36 SER B 237 ? LEU B 252 ? SER B 237 LEU B 252 1 ? 16 
HELX_P HELX_P37 37 SER B 258 ? LYS B 269 ? SER B 258 LYS B 269 1 ? 12 
HELX_P HELX_P38 38 LYS B 270 ? GLU B 278 ? LYS B 270 GLU B 278 1 ? 9  
HELX_P HELX_P39 39 TRP B 279 ? LEU B 282 ? TRP B 279 LEU B 282 5 ? 4  
HELX_P HELX_P40 40 SER B 304 ? GLY B 312 ? SER B 304 GLY B 312 1 ? 9  
HELX_P HELX_P41 41 GLY B 328 ? ALA B 336 ? GLY B 328 ALA B 336 1 ? 9  
HELX_P HELX_P42 42 SER B 348 ? VAL B 360 ? SER B 348 VAL B 360 1 ? 13 
HELX_P HELX_P43 43 ASN B 364 ? TYR B 375 ? ASN B 364 TYR B 375 1 ? 12 
HELX_P HELX_P44 44 ASN B 383 ? VAL B 400 ? ASN B 383 VAL B 400 1 ? 18 
HELX_P HELX_P45 45 VAL B 400 ? LYS B 413 ? VAL B 400 LYS B 413 1 ? 14 
HELX_P HELX_P46 46 PRO B 433 ? GLY B 437 ? PRO B 433 GLY B 437 5 ? 5  
HELX_P HELX_P47 47 GLU B 443 ? PHE B 448 ? GLU B 443 PHE B 448 1 ? 6  
HELX_P HELX_P48 48 GLY B 449 ? VAL B 453 ? GLY B 449 VAL B 453 5 ? 5  
HELX_P HELX_P49 49 VAL B 453 ? ASN B 457 ? VAL B 453 ASN B 457 5 ? 5  
HELX_P HELX_P50 50 THR B 459 ? GLY B 480 ? THR B 459 GLY B 480 1 ? 22 
HELX_P HELX_P51 51 ARG B 517 ? GLN B 526 ? ARG B 517 GLN B 526 1 ? 10 
HELX_P HELX_P52 52 GLN B 526 ? ASN B 533 ? GLN B 526 ASN B 533 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf4 disulf ?    ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG ? ? B CYS 67  B CYS 94   1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf5 disulf ?    ? B CYS 254 SG  ? ? ? 1_555 B CYS 265 SG ? ? B CYS 254 B CYS 265  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf6 disulf ?    ? B CYS 402 SG  ? ? ? 1_555 B CYS 521 SG ? ? B CYS 402 B CYS 521  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 1536 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale2 covale none ? A SER 200 OG  ? ? ? 1_555 H CCD .   C5 ? ? A SER 200 A CCD 1541 1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 1537 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale4 covale one  ? B ASN 59  ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 59  B NAG 1536 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5 covale none ? B SER 200 OG  ? ? ? 1_555 N CCD .   C5 ? ? B SER 200 B CCD 1539 1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale6 covale one  ? B ASN 416 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 416 B NAG 1537 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 0.17 
2 SER 103 B . ? SER 103 B PRO 104 B ? PRO 104 B 1 0.21 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
BA ? 3  ? 
BB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AB 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AB 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
BA 1  LEU B 7   ? THR B 10  ? LEU B 7   THR B 10  
BA 2  GLY B 13  ? MET B 16  ? GLY B 13  MET B 16  
BA 3  VAL B 57  ? ASN B 59  ? VAL B 57  ASN B 59  
BB 1  THR B 18  ? VAL B 22  ? THR B 18  VAL B 22  
BB 2  SER B 25  ? PRO B 34  ? SER B 25  PRO B 34  
BB 3  TYR B 96  ? VAL B 101 ? TYR B 96  VAL B 101 
BB 4  VAL B 142 ? SER B 145 ? VAL B 142 SER B 145 
BB 5  THR B 109 ? ILE B 115 ? THR B 109 ILE B 115 
BB 6  GLY B 189 ? GLU B 199 ? GLY B 189 GLU B 199 
BB 7  ARG B 221 ? GLN B 225 ? ARG B 221 GLN B 225 
BB 8  ILE B 319 ? ASN B 324 ? ILE B 319 ASN B 324 
BB 9  THR B 418 ? PHE B 423 ? THR B 418 PHE B 423 
BB 10 LYS B 501 ? LEU B 505 ? LYS B 501 LEU B 505 
BB 11 VAL B 512 ? GLN B 514 ? VAL B 512 GLN B 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
BA 1  2  N THR B 10  ? N THR B 10  O GLY B 13  ? O GLY B 13  
BA 2  3  N MET B 16  ? N MET B 16  O TRP B 58  ? O TRP B 58  
BB 1  2  N VAL B 22  ? N VAL B 22  O SER B 25  ? O SER B 25  
BB 2  3  N ILE B 33  ? N ILE B 33  O LEU B 97  ? O LEU B 97  
BB 3  4  N TRP B 100 ? N TRP B 100 O LEU B 143 ? O LEU B 143 
BB 4  5  N VAL B 142 ? N VAL B 142 O THR B 110 ? O THR B 110 
BB 5  6  O THR B 109 ? O THR B 109 N ASP B 190 ? N ASP B 190 
BB 6  7  N ILE B 196 ? N ILE B 196 O ARG B 221 ? O ARG B 221 
BB 7  8  N LEU B 224 ? N LEU B 224 O LEU B 320 ? O LEU B 320 
BB 8  9  N LEU B 321 ? N LEU B 321 O TYR B 419 ? O TYR B 419 
BB 9  10 N PHE B 422 ? N PHE B 422 O ILE B 503 ? O ILE B 503 
BB 10 11 N PHE B 502 ? N PHE B 502 O HIS B 513 ? O HIS B 513 
# 
_database_PDB_matrix.entry_id          2VJD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VJD 
_atom_sites.fract_transf_matrix[1][1]   0.010872 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009299 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006608 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 4   ? 70.087  43.786 -9.311  1.00 67.17  ? 4    SER A N   1 
ATOM   2     C  CA  . SER A 1 4   ? 70.990  42.655 -8.941  1.00 65.83  ? 4    SER A CA  1 
ATOM   3     C  C   . SER A 1 4   ? 71.102  42.555 -7.425  1.00 64.33  ? 4    SER A C   1 
ATOM   4     O  O   . SER A 1 4   ? 70.673  43.456 -6.700  1.00 64.81  ? 4    SER A O   1 
ATOM   5     C  CB  . SER A 1 4   ? 72.381  42.873 -9.550  1.00 66.55  ? 4    SER A CB  1 
ATOM   6     O  OG  . SER A 1 4   ? 73.244  41.780 -9.287  1.00 66.42  ? 4    SER A OG  1 
ATOM   7     N  N   . GLU A 1 5   ? 71.667  41.452 -6.946  1.00 61.61  ? 5    GLU A N   1 
ATOM   8     C  CA  . GLU A 1 5   ? 71.841  41.264 -5.513  1.00 58.88  ? 5    GLU A CA  1 
ATOM   9     C  C   . GLU A 1 5   ? 73.009  42.139 -5.087  1.00 55.58  ? 5    GLU A C   1 
ATOM   10    O  O   . GLU A 1 5   ? 73.148  42.488 -3.917  1.00 55.80  ? 5    GLU A O   1 
ATOM   11    C  CB  . GLU A 1 5   ? 72.148  39.799 -5.194  1.00 59.87  ? 5    GLU A CB  1 
ATOM   12    C  CG  . GLU A 1 5   ? 72.062  39.451 -3.714  1.00 60.15  ? 5    GLU A CG  1 
ATOM   13    C  CD  . GLU A 1 5   ? 72.465  38.014 -3.427  1.00 60.82  ? 5    GLU A CD  1 
ATOM   14    O  OE1 . GLU A 1 5   ? 72.281  37.551 -2.282  1.00 59.42  ? 5    GLU A OE1 1 
ATOM   15    O  OE2 . GLU A 1 5   ? 72.974  37.349 -4.351  1.00 61.83  ? 5    GLU A OE2 1 
ATOM   16    N  N   . LEU A 1 6   ? 73.841  42.501 -6.056  1.00 51.84  ? 6    LEU A N   1 
ATOM   17    C  CA  . LEU A 1 6   ? 75.003  43.329 -5.793  1.00 48.95  ? 6    LEU A CA  1 
ATOM   18    C  C   . LEU A 1 6   ? 74.818  44.781 -6.216  1.00 47.28  ? 6    LEU A C   1 
ATOM   19    O  O   . LEU A 1 6   ? 75.589  45.648 -5.812  1.00 47.31  ? 6    LEU A O   1 
ATOM   20    C  CB  . LEU A 1 6   ? 76.226  42.738 -6.491  1.00 47.18  ? 6    LEU A CB  1 
ATOM   21    C  CG  . LEU A 1 6   ? 76.612  41.336 -6.012  1.00 46.63  ? 6    LEU A CG  1 
ATOM   22    C  CD1 . LEU A 1 6   ? 77.765  40.796 -6.845  1.00 44.98  ? 6    LEU A CD1 1 
ATOM   23    C  CD2 . LEU A 1 6   ? 76.995  41.396 -4.540  1.00 46.52  ? 6    LEU A CD2 1 
ATOM   24    N  N   . LEU A 1 7   ? 73.802  45.050 -7.028  1.00 46.66  ? 7    LEU A N   1 
ATOM   25    C  CA  . LEU A 1 7   ? 73.548  46.412 -7.485  1.00 46.55  ? 7    LEU A CA  1 
ATOM   26    C  C   . LEU A 1 7   ? 72.371  46.969 -6.696  1.00 45.38  ? 7    LEU A C   1 
ATOM   27    O  O   . LEU A 1 7   ? 71.239  46.515 -6.850  1.00 46.94  ? 7    LEU A O   1 
ATOM   28    C  CB  . LEU A 1 7   ? 73.230  46.426 -8.983  1.00 47.69  ? 7    LEU A CB  1 
ATOM   29    C  CG  . LEU A 1 7   ? 73.493  47.716 -9.775  1.00 50.22  ? 7    LEU A CG  1 
ATOM   30    C  CD1 . LEU A 1 7   ? 72.961  47.541 -11.194 1.00 50.41  ? 7    LEU A CD1 1 
ATOM   31    C  CD2 . LEU A 1 7   ? 72.826  48.916 -9.111  1.00 50.84  ? 7    LEU A CD2 1 
ATOM   32    N  N   . VAL A 1 8   ? 72.647  47.954 -5.850  1.00 43.26  ? 8    VAL A N   1 
ATOM   33    C  CA  . VAL A 1 8   ? 71.622  48.563 -5.017  1.00 42.02  ? 8    VAL A CA  1 
ATOM   34    C  C   . VAL A 1 8   ? 71.508  50.055 -5.296  1.00 42.72  ? 8    VAL A C   1 
ATOM   35    O  O   . VAL A 1 8   ? 72.518  50.738 -5.456  1.00 43.86  ? 8    VAL A O   1 
ATOM   36    C  CB  . VAL A 1 8   ? 71.950  48.356 -3.518  1.00 41.61  ? 8    VAL A CB  1 
ATOM   37    C  CG1 . VAL A 1 8   ? 70.854  48.939 -2.651  1.00 40.24  ? 8    VAL A CG1 1 
ATOM   38    C  CG2 . VAL A 1 8   ? 72.130  46.880 -3.230  1.00 38.24  ? 8    VAL A CG2 1 
ATOM   39    N  N   . ASN A 1 9   ? 70.277  50.556 -5.358  1.00 43.15  ? 9    ASN A N   1 
ATOM   40    C  CA  . ASN A 1 9   ? 70.037  51.975 -5.606  1.00 44.14  ? 9    ASN A CA  1 
ATOM   41    C  C   . ASN A 1 9   ? 69.719  52.693 -4.296  1.00 43.05  ? 9    ASN A C   1 
ATOM   42    O  O   . ASN A 1 9   ? 68.630  52.549 -3.742  1.00 43.38  ? 9    ASN A O   1 
ATOM   43    C  CB  . ASN A 1 9   ? 68.870  52.161 -6.578  1.00 48.01  ? 9    ASN A CB  1 
ATOM   44    C  CG  . ASN A 1 9   ? 69.100  51.465 -7.909  1.00 54.26  ? 9    ASN A CG  1 
ATOM   45    O  OD1 . ASN A 1 9   ? 69.322  50.250 -7.962  1.00 57.45  ? 9    ASN A OD1 1 
ATOM   46    N  ND2 . ASN A 1 9   ? 69.044  52.231 -8.997  1.00 56.60  ? 9    ASN A ND2 1 
ATOM   47    N  N   . THR A 1 10  ? 70.671  53.473 -3.808  1.00 40.47  ? 10   THR A N   1 
ATOM   48    C  CA  . THR A 1 10  ? 70.486  54.209 -2.566  1.00 38.96  ? 10   THR A CA  1 
ATOM   49    C  C   . THR A 1 10  ? 69.963  55.593 -2.897  1.00 39.71  ? 10   THR A C   1 
ATOM   50    O  O   . THR A 1 10  ? 69.898  55.965 -4.063  1.00 41.70  ? 10   THR A O   1 
ATOM   51    C  CB  . THR A 1 10  ? 71.806  54.345 -1.819  1.00 36.97  ? 10   THR A CB  1 
ATOM   52    O  OG1 . THR A 1 10  ? 72.684  55.201 -2.561  1.00 34.57  ? 10   THR A OG1 1 
ATOM   53    C  CG2 . THR A 1 10  ? 72.458  52.986 -1.672  1.00 36.21  ? 10   THR A CG2 1 
ATOM   54    N  N   . LYS A 1 11  ? 69.604  56.364 -1.879  1.00 39.00  ? 11   LYS A N   1 
ATOM   55    C  CA  . LYS A 1 11  ? 69.080  57.700 -2.111  1.00 40.89  ? 11   LYS A CA  1 
ATOM   56    C  C   . LYS A 1 11  ? 70.108  58.694 -2.651  1.00 41.18  ? 11   LYS A C   1 
ATOM   57    O  O   . LYS A 1 11  ? 69.753  59.817 -3.021  1.00 43.32  ? 11   LYS A O   1 
ATOM   58    C  CB  . LYS A 1 11  ? 68.447  58.238 -0.828  1.00 42.37  ? 11   LYS A CB  1 
ATOM   59    C  CG  . LYS A 1 11  ? 67.300  57.376 -0.332  1.00 44.40  ? 11   LYS A CG  1 
ATOM   60    C  CD  . LYS A 1 11  ? 66.543  58.030 0.809   1.00 47.45  ? 11   LYS A CD  1 
ATOM   61    C  CE  . LYS A 1 11  ? 65.433  57.109 1.312   1.00 48.39  ? 11   LYS A CE  1 
ATOM   62    N  NZ  . LYS A 1 11  ? 64.523  56.677 0.206   1.00 49.39  ? 11   LYS A NZ  1 
ATOM   63    N  N   . SER A 1 12  ? 71.372  58.289 -2.710  1.00 39.47  ? 12   SER A N   1 
ATOM   64    C  CA  . SER A 1 12  ? 72.415  59.169 -3.226  1.00 40.66  ? 12   SER A CA  1 
ATOM   65    C  C   . SER A 1 12  ? 72.993  58.688 -4.554  1.00 39.43  ? 12   SER A C   1 
ATOM   66    O  O   . SER A 1 12  ? 73.726  59.415 -5.224  1.00 39.53  ? 12   SER A O   1 
ATOM   67    C  CB  . SER A 1 12  ? 73.546  59.315 -2.204  1.00 43.58  ? 12   SER A CB  1 
ATOM   68    O  OG  . SER A 1 12  ? 73.153  60.139 -1.119  1.00 48.13  ? 12   SER A OG  1 
ATOM   69    N  N   . GLY A 1 13  ? 72.657  57.463 -4.936  1.00 38.15  ? 13   GLY A N   1 
ATOM   70    C  CA  . GLY A 1 13  ? 73.159  56.921 -6.182  1.00 36.90  ? 13   GLY A CA  1 
ATOM   71    C  C   . GLY A 1 13  ? 73.274  55.417 -6.097  1.00 37.16  ? 13   GLY A C   1 
ATOM   72    O  O   . GLY A 1 13  ? 72.990  54.833 -5.051  1.00 36.26  ? 13   GLY A O   1 
ATOM   73    N  N   . LYS A 1 14  ? 73.691  54.793 -7.194  1.00 36.94  ? 14   LYS A N   1 
ATOM   74    C  CA  . LYS A 1 14  ? 73.842  53.340 -7.252  1.00 38.98  ? 14   LYS A CA  1 
ATOM   75    C  C   . LYS A 1 14  ? 75.202  52.872 -6.742  1.00 37.95  ? 14   LYS A C   1 
ATOM   76    O  O   . LYS A 1 14  ? 76.186  53.601 -6.823  1.00 36.83  ? 14   LYS A O   1 
ATOM   77    C  CB  . LYS A 1 14  ? 73.658  52.848 -8.691  1.00 39.64  ? 14   LYS A CB  1 
ATOM   78    C  CG  . LYS A 1 14  ? 72.293  53.148 -9.278  1.00 43.30  ? 14   LYS A CG  1 
ATOM   79    C  CD  . LYS A 1 14  ? 72.238  52.819 -10.762 1.00 45.92  ? 14   LYS A CD  1 
ATOM   80    C  CE  . LYS A 1 14  ? 70.874  53.159 -11.346 1.00 46.88  ? 14   LYS A CE  1 
ATOM   81    N  NZ  . LYS A 1 14  ? 70.871  53.045 -12.831 1.00 47.93  ? 14   LYS A NZ  1 
ATOM   82    N  N   . VAL A 1 15  ? 75.236  51.649 -6.220  1.00 38.05  ? 15   VAL A N   1 
ATOM   83    C  CA  . VAL A 1 15  ? 76.460  51.043 -5.713  1.00 38.93  ? 15   VAL A CA  1 
ATOM   84    C  C   . VAL A 1 15  ? 76.504  49.577 -6.131  1.00 39.31  ? 15   VAL A C   1 
ATOM   85    O  O   . VAL A 1 15  ? 75.494  48.868 -6.089  1.00 37.03  ? 15   VAL A O   1 
ATOM   86    C  CB  . VAL A 1 15  ? 76.561  51.116 -4.159  1.00 38.27  ? 15   VAL A CB  1 
ATOM   87    C  CG1 . VAL A 1 15  ? 76.560  52.566 -3.700  1.00 37.06  ? 15   VAL A CG1 1 
ATOM   88    C  CG2 . VAL A 1 15  ? 75.415  50.348 -3.523  1.00 39.11  ? 15   VAL A CG2 1 
ATOM   89    N  N   . MET A 1 16  ? 77.686  49.137 -6.541  1.00 40.08  ? 16   MET A N   1 
ATOM   90    C  CA  . MET A 1 16  ? 77.888  47.769 -6.974  1.00 42.54  ? 16   MET A CA  1 
ATOM   91    C  C   . MET A 1 16  ? 78.749  47.051 -5.943  1.00 43.26  ? 16   MET A C   1 
ATOM   92    O  O   . MET A 1 16  ? 79.919  47.394 -5.750  1.00 42.34  ? 16   MET A O   1 
ATOM   93    C  CB  . MET A 1 16  ? 78.583  47.751 -8.341  1.00 45.18  ? 16   MET A CB  1 
ATOM   94    C  CG  . MET A 1 16  ? 78.833  46.362 -8.910  1.00 48.15  ? 16   MET A CG  1 
ATOM   95    S  SD  . MET A 1 16  ? 77.294  45.472 -9.246  1.00 55.83  ? 16   MET A SD  1 
ATOM   96    C  CE  . MET A 1 16  ? 76.918  46.055 -10.924 1.00 54.15  ? 16   MET A CE  1 
ATOM   97    N  N   . GLY A 1 17  ? 78.158  46.060 -5.282  1.00 43.44  ? 17   GLY A N   1 
ATOM   98    C  CA  . GLY A 1 17  ? 78.878  45.302 -4.279  1.00 44.19  ? 17   GLY A CA  1 
ATOM   99    C  C   . GLY A 1 17  ? 79.695  44.189 -4.902  1.00 46.54  ? 17   GLY A C   1 
ATOM   100   O  O   . GLY A 1 17  ? 79.963  44.198 -6.100  1.00 48.49  ? 17   GLY A O   1 
ATOM   101   N  N   . THR A 1 18  ? 80.089  43.221 -4.084  1.00 47.61  ? 18   THR A N   1 
ATOM   102   C  CA  . THR A 1 18  ? 80.885  42.099 -4.554  1.00 48.29  ? 18   THR A CA  1 
ATOM   103   C  C   . THR A 1 18  ? 80.605  40.841 -3.738  1.00 48.75  ? 18   THR A C   1 
ATOM   104   O  O   . THR A 1 18  ? 80.533  40.887 -2.511  1.00 48.40  ? 18   THR A O   1 
ATOM   105   C  CB  . THR A 1 18  ? 82.385  42.419 -4.470  1.00 48.62  ? 18   THR A CB  1 
ATOM   106   O  OG1 . THR A 1 18  ? 83.134  41.207 -4.612  1.00 52.71  ? 18   THR A OG1 1 
ATOM   107   C  CG2 . THR A 1 18  ? 82.723  43.067 -3.134  1.00 49.19  ? 18   THR A CG2 1 
ATOM   108   N  N   . ARG A 1 19  ? 80.440  39.719 -4.430  1.00 49.63  ? 19   ARG A N   1 
ATOM   109   C  CA  . ARG A 1 19  ? 80.169  38.447 -3.772  1.00 49.52  ? 19   ARG A CA  1 
ATOM   110   C  C   . ARG A 1 19  ? 81.454  37.935 -3.132  1.00 48.33  ? 19   ARG A C   1 
ATOM   111   O  O   . ARG A 1 19  ? 82.453  37.729 -3.817  1.00 47.73  ? 19   ARG A O   1 
ATOM   112   C  CB  . ARG A 1 19  ? 79.641  37.440 -4.797  1.00 50.57  ? 19   ARG A CB  1 
ATOM   113   C  CG  . ARG A 1 19  ? 79.068  36.175 -4.201  1.00 52.64  ? 19   ARG A CG  1 
ATOM   114   C  CD  . ARG A 1 19  ? 77.979  35.619 -5.104  1.00 55.27  ? 19   ARG A CD  1 
ATOM   115   N  NE  . ARG A 1 19  ? 77.312  34.455 -4.525  1.00 58.59  ? 19   ARG A NE  1 
ATOM   116   C  CZ  . ARG A 1 19  ? 77.842  33.237 -4.473  1.00 60.16  ? 19   ARG A CZ  1 
ATOM   117   N  NH1 . ARG A 1 19  ? 79.052  33.017 -4.969  1.00 60.72  ? 19   ARG A NH1 1 
ATOM   118   N  NH2 . ARG A 1 19  ? 77.160  32.236 -3.929  1.00 60.39  ? 19   ARG A NH2 1 
ATOM   119   N  N   . VAL A 1 20  ? 81.432  37.745 -1.816  1.00 47.21  ? 20   VAL A N   1 
ATOM   120   C  CA  . VAL A 1 20  ? 82.617  37.276 -1.110  1.00 46.97  ? 20   VAL A CA  1 
ATOM   121   C  C   . VAL A 1 20  ? 82.449  35.920 -0.438  1.00 46.71  ? 20   VAL A C   1 
ATOM   122   O  O   . VAL A 1 20  ? 81.370  35.575 0.046   1.00 45.79  ? 20   VAL A O   1 
ATOM   123   C  CB  . VAL A 1 20  ? 83.072  38.293 -0.035  1.00 48.24  ? 20   VAL A CB  1 
ATOM   124   C  CG1 . VAL A 1 20  ? 83.463  39.602 -0.693  1.00 48.61  ? 20   VAL A CG1 1 
ATOM   125   C  CG2 . VAL A 1 20  ? 81.968  38.516 0.979   1.00 47.63  ? 20   VAL A CG2 1 
ATOM   126   N  N   . PRO A 1 21  ? 83.529  35.128 -0.404  1.00 46.88  ? 21   PRO A N   1 
ATOM   127   C  CA  . PRO A 1 21  ? 83.527  33.800 0.209   1.00 47.58  ? 21   PRO A CA  1 
ATOM   128   C  C   . PRO A 1 21  ? 83.652  33.901 1.728   1.00 48.24  ? 21   PRO A C   1 
ATOM   129   O  O   . PRO A 1 21  ? 84.352  34.773 2.243   1.00 47.58  ? 21   PRO A O   1 
ATOM   130   C  CB  . PRO A 1 21  ? 84.741  33.137 -0.429  1.00 48.08  ? 21   PRO A CB  1 
ATOM   131   C  CG  . PRO A 1 21  ? 85.698  34.280 -0.532  1.00 48.42  ? 21   PRO A CG  1 
ATOM   132   C  CD  . PRO A 1 21  ? 84.821  35.396 -1.063  1.00 47.26  ? 21   PRO A CD  1 
ATOM   133   N  N   . VAL A 1 22  ? 82.971  33.008 2.440   1.00 48.06  ? 22   VAL A N   1 
ATOM   134   C  CA  . VAL A 1 22  ? 83.015  33.007 3.895   1.00 48.65  ? 22   VAL A CA  1 
ATOM   135   C  C   . VAL A 1 22  ? 82.586  31.663 4.471   1.00 49.02  ? 22   VAL A C   1 
ATOM   136   O  O   . VAL A 1 22  ? 81.418  31.278 4.386   1.00 48.02  ? 22   VAL A O   1 
ATOM   137   C  CB  . VAL A 1 22  ? 82.120  34.136 4.486   1.00 49.28  ? 22   VAL A CB  1 
ATOM   138   C  CG1 . VAL A 1 22  ? 80.735  34.088 3.866   1.00 48.33  ? 22   VAL A CG1 1 
ATOM   139   C  CG2 . VAL A 1 22  ? 82.023  33.991 6.002   1.00 48.47  ? 22   VAL A CG2 1 
ATOM   140   N  N   . LEU A 1 23  ? 83.550  30.952 5.050   1.00 49.82  ? 23   LEU A N   1 
ATOM   141   C  CA  . LEU A 1 23  ? 83.308  29.649 5.663   1.00 51.11  ? 23   LEU A CA  1 
ATOM   142   C  C   . LEU A 1 23  ? 82.580  28.697 4.710   1.00 51.68  ? 23   LEU A C   1 
ATOM   143   O  O   . LEU A 1 23  ? 81.460  28.259 4.981   1.00 51.65  ? 23   LEU A O   1 
ATOM   144   C  CB  . LEU A 1 23  ? 82.503  29.830 6.957   1.00 50.29  ? 23   LEU A CB  1 
ATOM   145   C  CG  . LEU A 1 23  ? 83.134  30.760 8.002   1.00 49.92  ? 23   LEU A CG  1 
ATOM   146   C  CD1 . LEU A 1 23  ? 82.155  31.014 9.146   1.00 48.38  ? 23   LEU A CD1 1 
ATOM   147   C  CD2 . LEU A 1 23  ? 84.431  30.144 8.512   1.00 48.18  ? 23   LEU A CD2 1 
ATOM   148   N  N   . SER A 1 24  ? 83.237  28.381 3.598   1.00 52.03  ? 24   SER A N   1 
ATOM   149   C  CA  . SER A 1 24  ? 82.686  27.495 2.578   1.00 54.18  ? 24   SER A CA  1 
ATOM   150   C  C   . SER A 1 24  ? 81.284  27.920 2.169   1.00 53.88  ? 24   SER A C   1 
ATOM   151   O  O   . SER A 1 24  ? 80.350  27.119 2.175   1.00 55.25  ? 24   SER A O   1 
ATOM   152   C  CB  . SER A 1 24  ? 82.672  26.041 3.070   1.00 54.35  ? 24   SER A CB  1 
ATOM   153   O  OG  . SER A 1 24  ? 81.791  25.870 4.162   1.00 57.20  ? 24   SER A OG  1 
ATOM   154   N  N   . SER A 1 25  ? 81.153  29.197 1.821   1.00 53.51  ? 25   SER A N   1 
ATOM   155   C  CA  . SER A 1 25  ? 79.886  29.783 1.389   1.00 51.05  ? 25   SER A CA  1 
ATOM   156   C  C   . SER A 1 25  ? 80.167  31.214 0.949   1.00 49.26  ? 25   SER A C   1 
ATOM   157   O  O   . SER A 1 25  ? 81.323  31.571 0.727   1.00 49.33  ? 25   SER A O   1 
ATOM   158   C  CB  . SER A 1 25  ? 78.863  29.773 2.524   1.00 50.69  ? 25   SER A CB  1 
ATOM   159   O  OG  . SER A 1 25  ? 77.606  30.246 2.068   1.00 51.02  ? 25   SER A OG  1 
ATOM   160   N  N   . HIS A 1 26  ? 79.129  32.035 0.821   1.00 48.13  ? 26   HIS A N   1 
ATOM   161   C  CA  . HIS A 1 26  ? 79.329  33.416 0.387   1.00 47.65  ? 26   HIS A CA  1 
ATOM   162   C  C   . HIS A 1 26  ? 78.297  34.393 0.932   1.00 45.54  ? 26   HIS A C   1 
ATOM   163   O  O   . HIS A 1 26  ? 77.263  33.994 1.467   1.00 45.31  ? 26   HIS A O   1 
ATOM   164   C  CB  . HIS A 1 26  ? 79.299  33.506 -1.146  1.00 50.42  ? 26   HIS A CB  1 
ATOM   165   C  CG  . HIS A 1 26  ? 80.187  32.518 -1.837  1.00 53.70  ? 26   HIS A CG  1 
ATOM   166   N  ND1 . HIS A 1 26  ? 79.923  31.165 -1.854  1.00 55.95  ? 26   HIS A ND1 1 
ATOM   167   C  CD2 . HIS A 1 26  ? 81.340  32.686 -2.527  1.00 54.75  ? 26   HIS A CD2 1 
ATOM   168   C  CE1 . HIS A 1 26  ? 80.875  30.542 -2.526  1.00 56.70  ? 26   HIS A CE1 1 
ATOM   169   N  NE2 . HIS A 1 26  ? 81.747  31.442 -2.945  1.00 55.60  ? 26   HIS A NE2 1 
ATOM   170   N  N   . ILE A 1 27  ? 78.604  35.681 0.791   1.00 43.08  ? 27   ILE A N   1 
ATOM   171   C  CA  . ILE A 1 27  ? 77.712  36.763 1.200   1.00 41.87  ? 27   ILE A CA  1 
ATOM   172   C  C   . ILE A 1 27  ? 78.043  37.992 0.360   1.00 38.74  ? 27   ILE A C   1 
ATOM   173   O  O   . ILE A 1 27  ? 79.056  38.024 -0.335  1.00 37.70  ? 27   ILE A O   1 
ATOM   174   C  CB  . ILE A 1 27  ? 77.853  37.147 2.700   1.00 42.56  ? 27   ILE A CB  1 
ATOM   175   C  CG1 . ILE A 1 27  ? 79.219  37.772 2.966   1.00 44.61  ? 27   ILE A CG1 1 
ATOM   176   C  CG2 . ILE A 1 27  ? 77.652  35.930 3.575   1.00 46.91  ? 27   ILE A CG2 1 
ATOM   177   C  CD1 . ILE A 1 27  ? 79.348  38.337 4.361   1.00 47.00  ? 27   ILE A CD1 1 
ATOM   178   N  N   . SER A 1 28  ? 77.181  38.997 0.424   1.00 36.61  ? 28   SER A N   1 
ATOM   179   C  CA  . SER A 1 28  ? 77.384  40.228 -0.326  1.00 36.46  ? 28   SER A CA  1 
ATOM   180   C  C   . SER A 1 28  ? 78.191  41.214 0.510   1.00 35.72  ? 28   SER A C   1 
ATOM   181   O  O   . SER A 1 28  ? 78.020  41.292 1.726   1.00 36.08  ? 28   SER A O   1 
ATOM   182   C  CB  . SER A 1 28  ? 76.036  40.854 -0.683  1.00 36.53  ? 28   SER A CB  1 
ATOM   183   O  OG  . SER A 1 28  ? 75.194  39.925 -1.341  1.00 38.90  ? 28   SER A OG  1 
ATOM   184   N  N   . ALA A 1 29  ? 79.066  41.967 -0.147  1.00 34.31  ? 29   ALA A N   1 
ATOM   185   C  CA  . ALA A 1 29  ? 79.889  42.950 0.539   1.00 34.45  ? 29   ALA A CA  1 
ATOM   186   C  C   . ALA A 1 29  ? 79.957  44.267 -0.230  1.00 34.70  ? 29   ALA A C   1 
ATOM   187   O  O   . ALA A 1 29  ? 80.366  44.297 -1.387  1.00 35.49  ? 29   ALA A O   1 
ATOM   188   C  CB  . ALA A 1 29  ? 81.291  42.401 0.746   1.00 32.39  ? 29   ALA A CB  1 
ATOM   189   N  N   . PHE A 1 30  ? 79.549  45.351 0.420   1.00 34.42  ? 30   PHE A N   1 
ATOM   190   C  CA  . PHE A 1 30  ? 79.586  46.678 -0.190  1.00 35.14  ? 30   PHE A CA  1 
ATOM   191   C  C   . PHE A 1 30  ? 80.596  47.497 0.600   1.00 34.93  ? 30   PHE A C   1 
ATOM   192   O  O   . PHE A 1 30  ? 80.276  48.065 1.643   1.00 35.54  ? 30   PHE A O   1 
ATOM   193   C  CB  . PHE A 1 30  ? 78.202  47.334 -0.138  1.00 35.70  ? 30   PHE A CB  1 
ATOM   194   C  CG  . PHE A 1 30  ? 77.118  46.495 -0.751  1.00 36.95  ? 30   PHE A CG  1 
ATOM   195   C  CD1 . PHE A 1 30  ? 76.583  45.414 -0.058  1.00 36.26  ? 30   PHE A CD1 1 
ATOM   196   C  CD2 . PHE A 1 30  ? 76.677  46.744 -2.048  1.00 36.12  ? 30   PHE A CD2 1 
ATOM   197   C  CE1 . PHE A 1 30  ? 75.630  44.589 -0.648  1.00 36.96  ? 30   PHE A CE1 1 
ATOM   198   C  CE2 . PHE A 1 30  ? 75.722  45.921 -2.647  1.00 36.20  ? 30   PHE A CE2 1 
ATOM   199   C  CZ  . PHE A 1 30  ? 75.199  44.842 -1.946  1.00 35.96  ? 30   PHE A CZ  1 
ATOM   200   N  N   . LEU A 1 31  ? 81.820  47.553 0.087   1.00 33.85  ? 31   LEU A N   1 
ATOM   201   C  CA  . LEU A 1 31  ? 82.899  48.257 0.756   1.00 31.70  ? 31   LEU A CA  1 
ATOM   202   C  C   . LEU A 1 31  ? 83.152  49.688 0.284   1.00 31.09  ? 31   LEU A C   1 
ATOM   203   O  O   . LEU A 1 31  ? 83.073  49.989 -0.900  1.00 32.18  ? 31   LEU A O   1 
ATOM   204   C  CB  . LEU A 1 31  ? 84.181  47.427 0.616   1.00 32.10  ? 31   LEU A CB  1 
ATOM   205   C  CG  . LEU A 1 31  ? 84.026  45.940 0.982   1.00 32.11  ? 31   LEU A CG  1 
ATOM   206   C  CD1 . LEU A 1 31  ? 85.335  45.224 0.731   1.00 29.78  ? 31   LEU A CD1 1 
ATOM   207   C  CD2 . LEU A 1 31  ? 83.598  45.779 2.445   1.00 29.67  ? 31   LEU A CD2 1 
ATOM   208   N  N   . GLY A 1 32  ? 83.451  50.565 1.235   1.00 31.17  ? 32   GLY A N   1 
ATOM   209   C  CA  . GLY A 1 32  ? 83.756  51.953 0.925   1.00 31.36  ? 32   GLY A CA  1 
ATOM   210   C  C   . GLY A 1 32  ? 82.670  52.837 0.339   1.00 30.02  ? 32   GLY A C   1 
ATOM   211   O  O   . GLY A 1 32  ? 82.911  53.516 -0.649  1.00 30.22  ? 32   GLY A O   1 
ATOM   212   N  N   . ILE A 1 33  ? 81.486  52.842 0.944   1.00 29.00  ? 33   ILE A N   1 
ATOM   213   C  CA  . ILE A 1 33  ? 80.386  53.673 0.468   1.00 27.30  ? 33   ILE A CA  1 
ATOM   214   C  C   . ILE A 1 33  ? 80.474  55.030 1.157   1.00 27.18  ? 33   ILE A C   1 
ATOM   215   O  O   . ILE A 1 33  ? 80.484  55.111 2.376   1.00 26.69  ? 33   ILE A O   1 
ATOM   216   C  CB  . ILE A 1 33  ? 79.022  53.022 0.779   1.00 27.93  ? 33   ILE A CB  1 
ATOM   217   C  CG1 . ILE A 1 33  ? 78.894  51.712 -0.008  1.00 27.87  ? 33   ILE A CG1 1 
ATOM   218   C  CG2 . ILE A 1 33  ? 77.878  53.978 0.420   1.00 27.90  ? 33   ILE A CG2 1 
ATOM   219   C  CD1 . ILE A 1 33  ? 77.653  50.919 0.304   1.00 24.55  ? 33   ILE A CD1 1 
ATOM   220   N  N   . PRO A 1 34  ? 80.538  56.119 0.377   1.00 28.48  ? 34   PRO A N   1 
ATOM   221   C  CA  . PRO A 1 34  ? 80.631  57.462 0.955   1.00 28.27  ? 34   PRO A CA  1 
ATOM   222   C  C   . PRO A 1 34  ? 79.331  57.885 1.607   1.00 28.83  ? 34   PRO A C   1 
ATOM   223   O  O   . PRO A 1 34  ? 78.261  57.715 1.025   1.00 30.02  ? 34   PRO A O   1 
ATOM   224   C  CB  . PRO A 1 34  ? 80.963  58.322 -0.254  1.00 28.03  ? 34   PRO A CB  1 
ATOM   225   C  CG  . PRO A 1 34  ? 80.151  57.674 -1.323  1.00 28.09  ? 34   PRO A CG  1 
ATOM   226   C  CD  . PRO A 1 34  ? 80.415  56.192 -1.090  1.00 28.24  ? 34   PRO A CD  1 
ATOM   227   N  N   . PHE A 1 35  ? 79.418  58.436 2.815   1.00 28.50  ? 35   PHE A N   1 
ATOM   228   C  CA  . PHE A 1 35  ? 78.222  58.884 3.514   1.00 27.22  ? 35   PHE A CA  1 
ATOM   229   C  C   . PHE A 1 35  ? 78.289  60.380 3.792   1.00 29.20  ? 35   PHE A C   1 
ATOM   230   O  O   . PHE A 1 35  ? 77.359  60.962 4.345   1.00 30.85  ? 35   PHE A O   1 
ATOM   231   C  CB  . PHE A 1 35  ? 78.025  58.084 4.813   1.00 26.51  ? 35   PHE A CB  1 
ATOM   232   C  CG  . PHE A 1 35  ? 79.084  58.319 5.869   1.00 26.89  ? 35   PHE A CG  1 
ATOM   233   C  CD1 . PHE A 1 35  ? 79.095  59.490 6.624   1.00 24.46  ? 35   PHE A CD1 1 
ATOM   234   C  CD2 . PHE A 1 35  ? 80.037  57.340 6.144   1.00 24.21  ? 35   PHE A CD2 1 
ATOM   235   C  CE1 . PHE A 1 35  ? 80.034  59.678 7.639   1.00 26.61  ? 35   PHE A CE1 1 
ATOM   236   C  CE2 . PHE A 1 35  ? 80.980  57.517 7.156   1.00 24.03  ? 35   PHE A CE2 1 
ATOM   237   C  CZ  . PHE A 1 35  ? 80.979  58.687 7.906   1.00 24.43  ? 35   PHE A CZ  1 
ATOM   238   N  N   . ALA A 1 36  ? 79.388  61.007 3.388   1.00 29.13  ? 36   ALA A N   1 
ATOM   239   C  CA  . ALA A 1 36  ? 79.563  62.438 3.600   1.00 31.10  ? 36   ALA A CA  1 
ATOM   240   C  C   . ALA A 1 36  ? 80.480  63.017 2.532   1.00 32.99  ? 36   ALA A C   1 
ATOM   241   O  O   . ALA A 1 36  ? 81.081  62.282 1.754   1.00 33.83  ? 36   ALA A O   1 
ATOM   242   C  CB  . ALA A 1 36  ? 80.153  62.692 4.981   1.00 30.22  ? 36   ALA A CB  1 
ATOM   243   N  N   . GLU A 1 37  ? 80.570  64.339 2.484   1.00 34.50  ? 37   GLU A N   1 
ATOM   244   C  CA  . GLU A 1 37  ? 81.446  64.988 1.525   1.00 36.18  ? 37   GLU A CA  1 
ATOM   245   C  C   . GLU A 1 37  ? 82.854  64.989 2.111   1.00 37.55  ? 37   GLU A C   1 
ATOM   246   O  O   . GLU A 1 37  ? 83.034  65.204 3.314   1.00 37.90  ? 37   GLU A O   1 
ATOM   247   C  CB  . GLU A 1 37  ? 80.983  66.422 1.265   1.00 36.94  ? 37   GLU A CB  1 
ATOM   248   C  CG  . GLU A 1 37  ? 79.781  66.523 0.326   1.00 38.78  ? 37   GLU A CG  1 
ATOM   249   C  CD  . GLU A 1 37  ? 80.131  66.137 -1.100  1.00 40.32  ? 37   GLU A CD  1 
ATOM   250   O  OE1 . GLU A 1 37  ? 80.899  66.891 -1.739  1.00 43.27  ? 37   GLU A OE1 1 
ATOM   251   O  OE2 . GLU A 1 37  ? 79.653  65.083 -1.578  1.00 39.15  ? 37   GLU A OE2 1 
ATOM   252   N  N   . PRO A 1 38  ? 83.869  64.725 1.275   1.00 37.61  ? 38   PRO A N   1 
ATOM   253   C  CA  . PRO A 1 38  ? 85.269  64.703 1.725   1.00 36.61  ? 38   PRO A CA  1 
ATOM   254   C  C   . PRO A 1 38  ? 85.626  65.959 2.518   1.00 36.16  ? 38   PRO A C   1 
ATOM   255   O  O   . PRO A 1 38  ? 85.604  67.066 1.986   1.00 37.30  ? 38   PRO A O   1 
ATOM   256   C  CB  . PRO A 1 38  ? 86.048  64.607 0.418   1.00 36.53  ? 38   PRO A CB  1 
ATOM   257   C  CG  . PRO A 1 38  ? 85.121  63.771 -0.451  1.00 37.23  ? 38   PRO A CG  1 
ATOM   258   C  CD  . PRO A 1 38  ? 83.759  64.368 -0.153  1.00 36.11  ? 38   PRO A CD  1 
ATOM   259   N  N   . PRO A 1 39  ? 85.959  65.802 3.808   1.00 36.93  ? 39   PRO A N   1 
ATOM   260   C  CA  . PRO A 1 39  ? 86.310  66.963 4.632   1.00 35.58  ? 39   PRO A CA  1 
ATOM   261   C  C   . PRO A 1 39  ? 87.738  67.437 4.399   1.00 35.53  ? 39   PRO A C   1 
ATOM   262   O  O   . PRO A 1 39  ? 88.582  67.324 5.283   1.00 34.62  ? 39   PRO A O   1 
ATOM   263   C  CB  . PRO A 1 39  ? 86.092  66.445 6.052   1.00 35.46  ? 39   PRO A CB  1 
ATOM   264   C  CG  . PRO A 1 39  ? 86.555  65.026 5.943   1.00 36.23  ? 39   PRO A CG  1 
ATOM   265   C  CD  . PRO A 1 39  ? 85.924  64.570 4.624   1.00 36.70  ? 39   PRO A CD  1 
ATOM   266   N  N   . VAL A 1 40  ? 88.009  67.962 3.208   1.00 36.24  ? 40   VAL A N   1 
ATOM   267   C  CA  . VAL A 1 40  ? 89.351  68.443 2.885   1.00 35.91  ? 40   VAL A CA  1 
ATOM   268   C  C   . VAL A 1 40  ? 89.390  69.961 2.702   1.00 36.47  ? 40   VAL A C   1 
ATOM   269   O  O   . VAL A 1 40  ? 88.354  70.621 2.674   1.00 35.84  ? 40   VAL A O   1 
ATOM   270   C  CB  . VAL A 1 40  ? 89.878  67.789 1.599   1.00 36.25  ? 40   VAL A CB  1 
ATOM   271   C  CG1 . VAL A 1 40  ? 90.052  66.299 1.803   1.00 35.49  ? 40   VAL A CG1 1 
ATOM   272   C  CG2 . VAL A 1 40  ? 88.909  68.052 0.459   1.00 38.50  ? 40   VAL A CG2 1 
ATOM   273   N  N   . GLY A 1 41  ? 90.597  70.503 2.580   1.00 36.88  ? 41   GLY A N   1 
ATOM   274   C  CA  . GLY A 1 41  ? 90.758  71.932 2.391   1.00 38.44  ? 41   GLY A CA  1 
ATOM   275   C  C   . GLY A 1 41  ? 90.088  72.772 3.460   1.00 39.50  ? 41   GLY A C   1 
ATOM   276   O  O   . GLY A 1 41  ? 90.328  72.587 4.655   1.00 39.56  ? 41   GLY A O   1 
ATOM   277   N  N   . ASN A 1 42  ? 89.243  73.701 3.032   1.00 39.58  ? 42   ASN A N   1 
ATOM   278   C  CA  . ASN A 1 42  ? 88.543  74.578 3.964   1.00 41.49  ? 42   ASN A CA  1 
ATOM   279   C  C   . ASN A 1 42  ? 87.533  73.856 4.836   1.00 39.42  ? 42   ASN A C   1 
ATOM   280   O  O   . ASN A 1 42  ? 86.954  74.445 5.751   1.00 37.26  ? 42   ASN A O   1 
ATOM   281   C  CB  . ASN A 1 42  ? 87.840  75.699 3.203   1.00 45.46  ? 42   ASN A CB  1 
ATOM   282   C  CG  . ASN A 1 42  ? 88.706  76.922 3.059   1.00 50.04  ? 42   ASN A CG  1 
ATOM   283   O  OD1 . ASN A 1 42  ? 89.870  76.831 2.652   1.00 51.48  ? 42   ASN A OD1 1 
ATOM   284   N  ND2 . ASN A 1 42  ? 88.148  78.081 3.393   1.00 52.85  ? 42   ASN A ND2 1 
ATOM   285   N  N   . MET A 1 43  ? 87.324  72.577 4.562   1.00 38.20  ? 43   MET A N   1 
ATOM   286   C  CA  . MET A 1 43  ? 86.371  71.816 5.346   1.00 39.31  ? 43   MET A CA  1 
ATOM   287   C  C   . MET A 1 43  ? 87.007  71.099 6.526   1.00 37.74  ? 43   MET A C   1 
ATOM   288   O  O   . MET A 1 43  ? 86.320  70.425 7.291   1.00 39.79  ? 43   MET A O   1 
ATOM   289   C  CB  . MET A 1 43  ? 85.628  70.836 4.442   1.00 41.78  ? 43   MET A CB  1 
ATOM   290   C  CG  . MET A 1 43  ? 84.768  71.565 3.422   1.00 47.18  ? 43   MET A CG  1 
ATOM   291   S  SD  . MET A 1 43  ? 83.712  70.503 2.440   1.00 54.81  ? 43   MET A SD  1 
ATOM   292   C  CE  . MET A 1 43  ? 82.349  70.217 3.594   1.00 53.72  ? 43   MET A CE  1 
ATOM   293   N  N   . ARG A 1 44  ? 88.316  71.260 6.692   1.00 34.81  ? 44   ARG A N   1 
ATOM   294   C  CA  . ARG A 1 44  ? 89.001  70.620 7.808   1.00 32.88  ? 44   ARG A CA  1 
ATOM   295   C  C   . ARG A 1 44  ? 88.502  71.228 9.115   1.00 32.06  ? 44   ARG A C   1 
ATOM   296   O  O   . ARG A 1 44  ? 88.367  72.452 9.226   1.00 30.63  ? 44   ARG A O   1 
ATOM   297   C  CB  . ARG A 1 44  ? 90.522  70.801 7.693   1.00 31.33  ? 44   ARG A CB  1 
ATOM   298   C  CG  . ARG A 1 44  ? 91.312  70.095 8.792   1.00 29.69  ? 44   ARG A CG  1 
ATOM   299   C  CD  . ARG A 1 44  ? 92.807  70.370 8.696   1.00 26.21  ? 44   ARG A CD  1 
ATOM   300   N  NE  . ARG A 1 44  ? 93.441  69.703 7.564   1.00 25.75  ? 44   ARG A NE  1 
ATOM   301   C  CZ  . ARG A 1 44  ? 94.701  69.915 7.189   1.00 25.69  ? 44   ARG A CZ  1 
ATOM   302   N  NH1 . ARG A 1 44  ? 95.457  70.784 7.851   1.00 25.61  ? 44   ARG A NH1 1 
ATOM   303   N  NH2 . ARG A 1 44  ? 95.214  69.240 6.176   1.00 20.46  ? 44   ARG A NH2 1 
ATOM   304   N  N   . PHE A 1 45  ? 88.216  70.360 10.086  1.00 30.97  ? 45   PHE A N   1 
ATOM   305   C  CA  . PHE A 1 45  ? 87.733  70.759 11.412  1.00 29.95  ? 45   PHE A CA  1 
ATOM   306   C  C   . PHE A 1 45  ? 86.262  71.135 11.405  1.00 30.51  ? 45   PHE A C   1 
ATOM   307   O  O   . PHE A 1 45  ? 85.673  71.368 12.457  1.00 31.48  ? 45   PHE A O   1 
ATOM   308   C  CB  . PHE A 1 45  ? 88.523  71.953 11.955  1.00 28.77  ? 45   PHE A CB  1 
ATOM   309   C  CG  . PHE A 1 45  ? 90.011  71.765 11.941  1.00 28.26  ? 45   PHE A CG  1 
ATOM   310   C  CD1 . PHE A 1 45  ? 90.596  70.662 12.551  1.00 28.29  ? 45   PHE A CD1 1 
ATOM   311   C  CD2 . PHE A 1 45  ? 90.832  72.713 11.336  1.00 28.58  ? 45   PHE A CD2 1 
ATOM   312   C  CE1 . PHE A 1 45  ? 91.980  70.501 12.564  1.00 27.73  ? 45   PHE A CE1 1 
ATOM   313   C  CE2 . PHE A 1 45  ? 92.218  72.567 11.340  1.00 29.26  ? 45   PHE A CE2 1 
ATOM   314   C  CZ  . PHE A 1 45  ? 92.794  71.455 11.958  1.00 29.03  ? 45   PHE A CZ  1 
ATOM   315   N  N   . ARG A 1 46  ? 85.668  71.181 10.220  1.00 31.54  ? 46   ARG A N   1 
ATOM   316   C  CA  . ARG A 1 46  ? 84.274  71.572 10.084  1.00 33.83  ? 46   ARG A CA  1 
ATOM   317   C  C   . ARG A 1 46  ? 83.315  70.388 10.147  1.00 32.51  ? 46   ARG A C   1 
ATOM   318   O  O   . ARG A 1 46  ? 83.680  69.261 9.808   1.00 32.48  ? 46   ARG A O   1 
ATOM   319   C  CB  . ARG A 1 46  ? 84.099  72.322 8.759   1.00 38.53  ? 46   ARG A CB  1 
ATOM   320   C  CG  . ARG A 1 46  ? 82.951  73.316 8.733   1.00 46.00  ? 46   ARG A CG  1 
ATOM   321   C  CD  . ARG A 1 46  ? 82.868  74.037 7.383   1.00 49.70  ? 46   ARG A CD  1 
ATOM   322   N  NE  . ARG A 1 46  ? 83.993  74.941 7.141   1.00 52.11  ? 46   ARG A NE  1 
ATOM   323   C  CZ  . ARG A 1 46  ? 84.210  75.561 5.982   1.00 54.07  ? 46   ARG A CZ  1 
ATOM   324   N  NH1 . ARG A 1 46  ? 85.250  76.371 5.839   1.00 53.73  ? 46   ARG A NH1 1 
ATOM   325   N  NH2 . ARG A 1 46  ? 83.387  75.367 4.959   1.00 55.18  ? 46   ARG A NH2 1 
ATOM   326   N  N   . ARG A 1 47  ? 82.089  70.654 10.587  1.00 31.21  ? 47   ARG A N   1 
ATOM   327   C  CA  . ARG A 1 47  ? 81.058  69.626 10.677  1.00 32.87  ? 47   ARG A CA  1 
ATOM   328   C  C   . ARG A 1 47  ? 80.916  68.914 9.340   1.00 32.45  ? 47   ARG A C   1 
ATOM   329   O  O   . ARG A 1 47  ? 81.063  69.530 8.291   1.00 32.49  ? 47   ARG A O   1 
ATOM   330   C  CB  . ARG A 1 47  ? 79.706  70.247 11.024  1.00 34.80  ? 47   ARG A CB  1 
ATOM   331   C  CG  . ARG A 1 47  ? 79.610  70.823 12.414  1.00 38.88  ? 47   ARG A CG  1 
ATOM   332   C  CD  . ARG A 1 47  ? 78.168  71.195 12.748  1.00 43.94  ? 47   ARG A CD  1 
ATOM   333   N  NE  . ARG A 1 47  ? 78.035  71.592 14.148  1.00 48.68  ? 47   ARG A NE  1 
ATOM   334   C  CZ  . ARG A 1 47  ? 78.537  72.711 14.660  1.00 51.17  ? 47   ARG A CZ  1 
ATOM   335   N  NH1 . ARG A 1 47  ? 78.372  72.978 15.950  1.00 53.91  ? 47   ARG A NH1 1 
ATOM   336   N  NH2 . ARG A 1 47  ? 79.187  73.573 13.884  1.00 51.06  ? 47   ARG A NH2 1 
ATOM   337   N  N   . PRO A 1 48  ? 80.620  67.606 9.358   1.00 31.56  ? 48   PRO A N   1 
ATOM   338   C  CA  . PRO A 1 48  ? 80.467  66.888 8.091   1.00 30.64  ? 48   PRO A CA  1 
ATOM   339   C  C   . PRO A 1 48  ? 79.235  67.366 7.328   1.00 31.79  ? 48   PRO A C   1 
ATOM   340   O  O   . PRO A 1 48  ? 78.243  67.786 7.921   1.00 31.15  ? 48   PRO A O   1 
ATOM   341   C  CB  . PRO A 1 48  ? 80.329  65.440 8.536   1.00 29.19  ? 48   PRO A CB  1 
ATOM   342   C  CG  . PRO A 1 48  ? 79.601  65.572 9.838   1.00 28.74  ? 48   PRO A CG  1 
ATOM   343   C  CD  . PRO A 1 48  ? 80.337  66.719 10.500  1.00 30.85  ? 48   PRO A CD  1 
ATOM   344   N  N   . GLU A 1 49  ? 79.310  67.306 6.006   1.00 34.93  ? 49   GLU A N   1 
ATOM   345   C  CA  . GLU A 1 49  ? 78.202  67.707 5.158   1.00 37.37  ? 49   GLU A CA  1 
ATOM   346   C  C   . GLU A 1 49  ? 77.817  66.455 4.377   1.00 37.93  ? 49   GLU A C   1 
ATOM   347   O  O   . GLU A 1 49  ? 78.688  65.692 3.946   1.00 36.15  ? 49   GLU A O   1 
ATOM   348   C  CB  . GLU A 1 49  ? 78.643  68.817 4.202   1.00 41.46  ? 49   GLU A CB  1 
ATOM   349   C  CG  . GLU A 1 49  ? 77.628  69.933 4.025   1.00 48.80  ? 49   GLU A CG  1 
ATOM   350   C  CD  . GLU A 1 49  ? 77.429  70.749 5.291   1.00 51.77  ? 49   GLU A CD  1 
ATOM   351   O  OE1 . GLU A 1 49  ? 78.420  71.320 5.796   1.00 54.12  ? 49   GLU A OE1 1 
ATOM   352   O  OE2 . GLU A 1 49  ? 76.282  70.820 5.782   1.00 54.77  ? 49   GLU A OE2 1 
ATOM   353   N  N   . PRO A 1 50  ? 76.508  66.220 4.192   1.00 38.46  ? 50   PRO A N   1 
ATOM   354   C  CA  . PRO A 1 50  ? 76.039  65.038 3.458   1.00 38.34  ? 50   PRO A CA  1 
ATOM   355   C  C   . PRO A 1 50  ? 76.614  64.880 2.057   1.00 38.64  ? 50   PRO A C   1 
ATOM   356   O  O   . PRO A 1 50  ? 76.815  65.854 1.332   1.00 38.34  ? 50   PRO A O   1 
ATOM   357   C  CB  . PRO A 1 50  ? 74.517  65.204 3.461   1.00 37.63  ? 50   PRO A CB  1 
ATOM   358   C  CG  . PRO A 1 50  ? 74.329  66.694 3.585   1.00 39.28  ? 50   PRO A CG  1 
ATOM   359   C  CD  . PRO A 1 50  ? 75.380  67.081 4.588   1.00 38.66  ? 50   PRO A CD  1 
ATOM   360   N  N   . LYS A 1 51  ? 76.893  63.633 1.697   1.00 39.32  ? 51   LYS A N   1 
ATOM   361   C  CA  . LYS A 1 51  ? 77.443  63.305 0.393   1.00 39.87  ? 51   LYS A CA  1 
ATOM   362   C  C   . LYS A 1 51  ? 76.447  63.640 -0.712  1.00 42.67  ? 51   LYS A C   1 
ATOM   363   O  O   . LYS A 1 51  ? 75.331  63.118 -0.728  1.00 42.95  ? 51   LYS A O   1 
ATOM   364   C  CB  . LYS A 1 51  ? 77.781  61.814 0.335   1.00 36.87  ? 51   LYS A CB  1 
ATOM   365   C  CG  . LYS A 1 51  ? 78.213  61.309 -1.037  1.00 34.28  ? 51   LYS A CG  1 
ATOM   366   C  CD  . LYS A 1 51  ? 79.486  61.990 -1.520  1.00 32.92  ? 51   LYS A CD  1 
ATOM   367   C  CE  . LYS A 1 51  ? 79.948  61.402 -2.844  1.00 31.50  ? 51   LYS A CE  1 
ATOM   368   N  NZ  . LYS A 1 51  ? 81.229  62.000 -3.311  1.00 33.74  ? 51   LYS A NZ  1 
ATOM   369   N  N   . LYS A 1 52  ? 76.853  64.511 -1.632  1.00 44.47  ? 52   LYS A N   1 
ATOM   370   C  CA  . LYS A 1 52  ? 75.998  64.895 -2.747  1.00 45.43  ? 52   LYS A CA  1 
ATOM   371   C  C   . LYS A 1 52  ? 75.850  63.731 -3.726  1.00 44.88  ? 52   LYS A C   1 
ATOM   372   O  O   . LYS A 1 52  ? 76.820  63.041 -4.041  1.00 43.10  ? 52   LYS A O   1 
ATOM   373   C  CB  . LYS A 1 52  ? 76.575  66.123 -3.455  1.00 47.22  ? 52   LYS A CB  1 
ATOM   374   C  CG  . LYS A 1 52  ? 76.357  67.414 -2.675  1.00 50.13  ? 52   LYS A CG  1 
ATOM   375   C  CD  . LYS A 1 52  ? 76.858  68.633 -3.432  1.00 54.11  ? 52   LYS A CD  1 
ATOM   376   C  CE  . LYS A 1 52  ? 78.377  68.665 -3.493  1.00 55.61  ? 52   LYS A CE  1 
ATOM   377   N  NZ  . LYS A 1 52  ? 78.973  68.715 -2.125  1.00 57.74  ? 52   LYS A NZ  1 
ATOM   378   N  N   . PRO A 1 53  ? 74.619  63.494 -4.206  1.00 45.87  ? 53   PRO A N   1 
ATOM   379   C  CA  . PRO A 1 53  ? 74.279  62.422 -5.148  1.00 44.95  ? 53   PRO A CA  1 
ATOM   380   C  C   . PRO A 1 53  ? 75.246  62.310 -6.316  1.00 45.45  ? 53   PRO A C   1 
ATOM   381   O  O   . PRO A 1 53  ? 75.830  63.305 -6.752  1.00 46.99  ? 53   PRO A O   1 
ATOM   382   C  CB  . PRO A 1 53  ? 72.878  62.802 -5.601  1.00 44.88  ? 53   PRO A CB  1 
ATOM   383   C  CG  . PRO A 1 53  ? 72.300  63.407 -4.370  1.00 46.26  ? 53   PRO A CG  1 
ATOM   384   C  CD  . PRO A 1 53  ? 73.425  64.299 -3.888  1.00 45.39  ? 53   PRO A CD  1 
ATOM   385   N  N   . TRP A 1 54  ? 75.413  61.095 -6.822  1.00 43.75  ? 54   TRP A N   1 
ATOM   386   C  CA  . TRP A 1 54  ? 76.309  60.867 -7.942  1.00 42.84  ? 54   TRP A CA  1 
ATOM   387   C  C   . TRP A 1 54  ? 75.583  60.106 -9.036  1.00 44.48  ? 54   TRP A C   1 
ATOM   388   O  O   . TRP A 1 54  ? 74.639  59.369 -8.767  1.00 45.29  ? 54   TRP A O   1 
ATOM   389   C  CB  . TRP A 1 54  ? 77.536  60.075 -7.482  1.00 39.43  ? 54   TRP A CB  1 
ATOM   390   C  CG  . TRP A 1 54  ? 77.212  58.725 -6.920  1.00 36.73  ? 54   TRP A CG  1 
ATOM   391   C  CD1 . TRP A 1 54  ? 76.995  57.573 -7.618  1.00 35.17  ? 54   TRP A CD1 1 
ATOM   392   C  CD2 . TRP A 1 54  ? 77.022  58.399 -5.540  1.00 36.39  ? 54   TRP A CD2 1 
ATOM   393   N  NE1 . TRP A 1 54  ? 76.676  56.549 -6.761  1.00 33.58  ? 54   TRP A NE1 1 
ATOM   394   C  CE2 . TRP A 1 54  ? 76.684  57.026 -5.478  1.00 35.76  ? 54   TRP A CE2 1 
ATOM   395   C  CE3 . TRP A 1 54  ? 77.100  59.135 -4.348  1.00 34.35  ? 54   TRP A CE3 1 
ATOM   396   C  CZ2 . TRP A 1 54  ? 76.423  56.369 -4.266  1.00 35.83  ? 54   TRP A CZ2 1 
ATOM   397   C  CZ3 . TRP A 1 54  ? 76.841  58.483 -3.141  1.00 35.07  ? 54   TRP A CZ3 1 
ATOM   398   C  CH2 . TRP A 1 54  ? 76.506  57.111 -3.112  1.00 35.21  ? 54   TRP A CH2 1 
ATOM   399   N  N   . SER A 1 55  ? 76.011  60.301 -10.275 1.00 45.97  ? 55   SER A N   1 
ATOM   400   C  CA  . SER A 1 55  ? 75.400  59.599 -11.390 1.00 47.77  ? 55   SER A CA  1 
ATOM   401   C  C   . SER A 1 55  ? 76.284  58.389 -11.658 1.00 47.58  ? 55   SER A C   1 
ATOM   402   O  O   . SER A 1 55  ? 77.450  58.374 -11.266 1.00 47.96  ? 55   SER A O   1 
ATOM   403   C  CB  . SER A 1 55  ? 75.336  60.509 -12.620 1.00 48.85  ? 55   SER A CB  1 
ATOM   404   O  OG  . SER A 1 55  ? 76.609  61.057 -12.918 1.00 52.82  ? 55   SER A OG  1 
ATOM   405   N  N   . GLY A 1 56  ? 75.733  57.369 -12.305 1.00 47.07  ? 56   GLY A N   1 
ATOM   406   C  CA  . GLY A 1 56  ? 76.525  56.186 -12.584 1.00 45.93  ? 56   GLY A CA  1 
ATOM   407   C  C   . GLY A 1 56  ? 76.567  55.254 -11.391 1.00 45.54  ? 56   GLY A C   1 
ATOM   408   O  O   . GLY A 1 56  ? 75.881  55.486 -10.398 1.00 46.40  ? 56   GLY A O   1 
ATOM   409   N  N   . VAL A 1 57  ? 77.380  54.208 -11.484 1.00 44.68  ? 57   VAL A N   1 
ATOM   410   C  CA  . VAL A 1 57  ? 77.503  53.215 -10.422 1.00 43.40  ? 57   VAL A CA  1 
ATOM   411   C  C   . VAL A 1 57  ? 78.791  53.348 -9.613  1.00 42.62  ? 57   VAL A C   1 
ATOM   412   O  O   . VAL A 1 57  ? 79.897  53.310 -10.167 1.00 40.59  ? 57   VAL A O   1 
ATOM   413   C  CB  . VAL A 1 57  ? 77.451  51.783 -11.007 1.00 45.08  ? 57   VAL A CB  1 
ATOM   414   C  CG1 . VAL A 1 57  ? 77.518  50.751 -9.890  1.00 44.18  ? 57   VAL A CG1 1 
ATOM   415   C  CG2 . VAL A 1 57  ? 76.182  51.606 -11.825 1.00 46.42  ? 57   VAL A CG2 1 
ATOM   416   N  N   . TRP A 1 58  ? 78.640  53.490 -8.299  1.00 41.59  ? 58   TRP A N   1 
ATOM   417   C  CA  . TRP A 1 58  ? 79.784  53.611 -7.402  1.00 40.04  ? 58   TRP A CA  1 
ATOM   418   C  C   . TRP A 1 58  ? 80.380  52.235 -7.158  1.00 39.88  ? 58   TRP A C   1 
ATOM   419   O  O   . TRP A 1 58  ? 79.687  51.318 -6.724  1.00 40.05  ? 58   TRP A O   1 
ATOM   420   C  CB  . TRP A 1 58  ? 79.364  54.225 -6.063  1.00 38.78  ? 58   TRP A CB  1 
ATOM   421   C  CG  . TRP A 1 58  ? 80.533  54.591 -5.203  1.00 37.19  ? 58   TRP A CG  1 
ATOM   422   C  CD1 . TRP A 1 58  ? 81.379  53.736 -4.554  1.00 35.06  ? 58   TRP A CD1 1 
ATOM   423   C  CD2 . TRP A 1 58  ? 81.034  55.909 -4.964  1.00 36.34  ? 58   TRP A CD2 1 
ATOM   424   N  NE1 . TRP A 1 58  ? 82.381  54.442 -3.931  1.00 34.69  ? 58   TRP A NE1 1 
ATOM   425   C  CE2 . TRP A 1 58  ? 82.195  55.778 -4.167  1.00 35.44  ? 58   TRP A CE2 1 
ATOM   426   C  CE3 . TRP A 1 58  ? 80.617  57.191 -5.348  1.00 36.83  ? 58   TRP A CE3 1 
ATOM   427   C  CZ2 . TRP A 1 58  ? 82.945  56.882 -3.746  1.00 36.31  ? 58   TRP A CZ2 1 
ATOM   428   C  CZ3 . TRP A 1 58  ? 81.364  58.294 -4.929  1.00 37.27  ? 58   TRP A CZ3 1 
ATOM   429   C  CH2 . TRP A 1 58  ? 82.515  58.128 -4.136  1.00 36.55  ? 58   TRP A CH2 1 
ATOM   430   N  N   . ASN A 1 59  ? 81.670  52.104 -7.444  1.00 41.64  ? 59   ASN A N   1 
ATOM   431   C  CA  . ASN A 1 59  ? 82.393  50.847 -7.265  1.00 43.11  ? 59   ASN A CA  1 
ATOM   432   C  C   . ASN A 1 59  ? 82.620  50.594 -5.772  1.00 41.10  ? 59   ASN A C   1 
ATOM   433   O  O   . ASN A 1 59  ? 83.460  51.247 -5.151  1.00 40.34  ? 59   ASN A O   1 
ATOM   434   C  CB  . ASN A 1 59  ? 83.740  50.935 -7.984  1.00 47.14  ? 59   ASN A CB  1 
ATOM   435   C  CG  . ASN A 1 59  ? 84.510  49.634 -7.949  1.00 51.73  ? 59   ASN A CG  1 
ATOM   436   O  OD1 . ASN A 1 59  ? 84.479  48.914 -6.950  1.00 52.36  ? 59   ASN A OD1 1 
ATOM   437   N  ND2 . ASN A 1 59  ? 85.221  49.344 -9.036  1.00 56.42  ? 59   ASN A ND2 1 
ATOM   438   N  N   . ALA A 1 60  ? 81.872  49.650 -5.206  1.00 38.01  ? 60   ALA A N   1 
ATOM   439   C  CA  . ALA A 1 60  ? 81.980  49.330 -3.786  1.00 37.17  ? 60   ALA A CA  1 
ATOM   440   C  C   . ALA A 1 60  ? 82.576  47.944 -3.586  1.00 36.64  ? 60   ALA A C   1 
ATOM   441   O  O   . ALA A 1 60  ? 82.073  47.146 -2.795  1.00 37.46  ? 60   ALA A O   1 
ATOM   442   C  CB  . ALA A 1 60  ? 80.602  49.407 -3.135  1.00 33.03  ? 60   ALA A CB  1 
ATOM   443   N  N   . SER A 1 61  ? 83.663  47.664 -4.290  1.00 36.62  ? 61   SER A N   1 
ATOM   444   C  CA  . SER A 1 61  ? 84.292  46.356 -4.204  1.00 37.38  ? 61   SER A CA  1 
ATOM   445   C  C   . SER A 1 61  ? 85.564  46.293 -3.354  1.00 36.57  ? 61   SER A C   1 
ATOM   446   O  O   . SER A 1 61  ? 86.075  45.205 -3.087  1.00 37.96  ? 61   SER A O   1 
ATOM   447   C  CB  . SER A 1 61  ? 84.617  45.856 -5.608  1.00 36.87  ? 61   SER A CB  1 
ATOM   448   O  OG  . SER A 1 61  ? 85.736  46.554 -6.118  1.00 38.12  ? 61   SER A OG  1 
ATOM   449   N  N   . THR A 1 62  ? 86.085  47.441 -2.936  1.00 35.34  ? 62   THR A N   1 
ATOM   450   C  CA  . THR A 1 62  ? 87.300  47.446 -2.132  1.00 36.12  ? 62   THR A CA  1 
ATOM   451   C  C   . THR A 1 62  ? 87.256  48.457 -0.985  1.00 35.64  ? 62   THR A C   1 
ATOM   452   O  O   . THR A 1 62  ? 86.555  49.467 -1.058  1.00 35.57  ? 62   THR A O   1 
ATOM   453   C  CB  . THR A 1 62  ? 88.533  47.738 -3.006  1.00 38.04  ? 62   THR A CB  1 
ATOM   454   O  OG1 . THR A 1 62  ? 88.414  49.047 -3.573  1.00 41.07  ? 62   THR A OG1 1 
ATOM   455   C  CG2 . THR A 1 62  ? 88.639  46.722 -4.135  1.00 39.28  ? 62   THR A CG2 1 
ATOM   456   N  N   . TYR A 1 63  ? 88.010  48.177 0.074   1.00 33.67  ? 63   TYR A N   1 
ATOM   457   C  CA  . TYR A 1 63  ? 88.056  49.065 1.232   1.00 32.36  ? 63   TYR A CA  1 
ATOM   458   C  C   . TYR A 1 63  ? 88.496  50.481 0.876   1.00 29.17  ? 63   TYR A C   1 
ATOM   459   O  O   . TYR A 1 63  ? 89.233  50.692 -0.076  1.00 27.79  ? 63   TYR A O   1 
ATOM   460   C  CB  . TYR A 1 63  ? 89.004  48.507 2.299   1.00 32.77  ? 63   TYR A CB  1 
ATOM   461   C  CG  . TYR A 1 63  ? 88.400  47.431 3.166   1.00 33.47  ? 63   TYR A CG  1 
ATOM   462   C  CD1 . TYR A 1 63  ? 87.174  47.632 3.800   1.00 32.01  ? 63   TYR A CD1 1 
ATOM   463   C  CD2 . TYR A 1 63  ? 89.061  46.219 3.375   1.00 35.04  ? 63   TYR A CD2 1 
ATOM   464   C  CE1 . TYR A 1 63  ? 86.617  46.658 4.616   1.00 32.06  ? 63   TYR A CE1 1 
ATOM   465   C  CE2 . TYR A 1 63  ? 88.509  45.229 4.200   1.00 34.56  ? 63   TYR A CE2 1 
ATOM   466   C  CZ  . TYR A 1 63  ? 87.286  45.461 4.812   1.00 34.83  ? 63   TYR A CZ  1 
ATOM   467   O  OH  . TYR A 1 63  ? 86.720  44.497 5.607   1.00 36.37  ? 63   TYR A OH  1 
ATOM   468   N  N   . PRO A 1 64  ? 88.029  51.472 1.638   1.00 29.32  ? 64   PRO A N   1 
ATOM   469   C  CA  . PRO A 1 64  ? 88.393  52.874 1.394   1.00 29.57  ? 64   PRO A CA  1 
ATOM   470   C  C   . PRO A 1 64  ? 89.691  53.219 2.121   1.00 30.43  ? 64   PRO A C   1 
ATOM   471   O  O   . PRO A 1 64  ? 90.285  52.369 2.785   1.00 29.64  ? 64   PRO A O   1 
ATOM   472   C  CB  . PRO A 1 64  ? 87.214  53.637 1.985   1.00 27.61  ? 64   PRO A CB  1 
ATOM   473   C  CG  . PRO A 1 64  ? 86.882  52.792 3.186   1.00 27.38  ? 64   PRO A CG  1 
ATOM   474   C  CD  . PRO A 1 64  ? 86.930  51.381 2.618   1.00 27.27  ? 64   PRO A CD  1 
ATOM   475   N  N   . ASN A 1 65  ? 90.117  54.471 1.999   1.00 31.57  ? 65   ASN A N   1 
ATOM   476   C  CA  . ASN A 1 65  ? 91.310  54.932 2.688   1.00 30.64  ? 65   ASN A CA  1 
ATOM   477   C  C   . ASN A 1 65  ? 90.950  55.077 4.164   1.00 29.44  ? 65   ASN A C   1 
ATOM   478   O  O   . ASN A 1 65  ? 89.774  55.192 4.512   1.00 26.83  ? 65   ASN A O   1 
ATOM   479   C  CB  . ASN A 1 65  ? 91.760  56.300 2.155   1.00 34.63  ? 65   ASN A CB  1 
ATOM   480   C  CG  . ASN A 1 65  ? 92.290  56.237 0.735   1.00 36.92  ? 65   ASN A CG  1 
ATOM   481   O  OD1 . ASN A 1 65  ? 93.149  55.416 0.415   1.00 37.51  ? 65   ASN A OD1 1 
ATOM   482   N  ND2 . ASN A 1 65  ? 91.785  57.119 -0.124  1.00 39.44  ? 65   ASN A ND2 1 
ATOM   483   N  N   . ASN A 1 66  ? 91.965  55.063 5.025   1.00 26.92  ? 66   ASN A N   1 
ATOM   484   C  CA  . ASN A 1 66  ? 91.760  55.236 6.458   1.00 25.94  ? 66   ASN A CA  1 
ATOM   485   C  C   . ASN A 1 66  ? 92.050  56.708 6.720   1.00 28.37  ? 66   ASN A C   1 
ATOM   486   O  O   . ASN A 1 66  ? 92.763  57.349 5.942   1.00 27.38  ? 66   ASN A O   1 
ATOM   487   C  CB  . ASN A 1 66  ? 92.733  54.358 7.240   1.00 25.23  ? 66   ASN A CB  1 
ATOM   488   C  CG  . ASN A 1 66  ? 92.558  52.884 6.932   1.00 24.86  ? 66   ASN A CG  1 
ATOM   489   O  OD1 . ASN A 1 66  ? 93.529  52.150 6.803   1.00 25.72  ? 66   ASN A OD1 1 
ATOM   490   N  ND2 . ASN A 1 66  ? 91.311  52.445 6.810   1.00 24.76  ? 66   ASN A ND2 1 
ATOM   491   N  N   . CYS A 1 67  ? 91.490  57.247 7.797   1.00 28.13  ? 67   CYS A N   1 
ATOM   492   C  CA  . CYS A 1 67  ? 91.692  58.647 8.132   1.00 29.87  ? 67   CYS A CA  1 
ATOM   493   C  C   . CYS A 1 67  ? 93.141  58.904 8.555   1.00 31.17  ? 67   CYS A C   1 
ATOM   494   O  O   . CYS A 1 67  ? 93.880  57.968 8.887   1.00 29.55  ? 67   CYS A O   1 
ATOM   495   C  CB  . CYS A 1 67  ? 90.725  59.058 9.248   1.00 31.87  ? 67   CYS A CB  1 
ATOM   496   S  SG  . CYS A 1 67  ? 88.953  58.873 8.811   1.00 37.09  ? 67   CYS A SG  1 
ATOM   497   N  N   . GLN A 1 68  ? 93.551  60.169 8.516   1.00 30.72  ? 68   GLN A N   1 
ATOM   498   C  CA  . GLN A 1 68  ? 94.902  60.542 8.912   1.00 30.67  ? 68   GLN A CA  1 
ATOM   499   C  C   . GLN A 1 68  ? 95.031  60.299 10.409  1.00 31.11  ? 68   GLN A C   1 
ATOM   500   O  O   . GLN A 1 68  ? 94.188  60.739 11.196  1.00 31.32  ? 68   GLN A O   1 
ATOM   501   C  CB  . GLN A 1 68  ? 95.165  62.017 8.598   1.00 32.39  ? 68   GLN A CB  1 
ATOM   502   C  CG  . GLN A 1 68  ? 95.235  62.340 7.103   1.00 34.28  ? 68   GLN A CG  1 
ATOM   503   C  CD  . GLN A 1 68  ? 96.510  61.833 6.436   1.00 36.00  ? 68   GLN A CD  1 
ATOM   504   O  OE1 . GLN A 1 68  ? 96.726  62.051 5.247   1.00 40.13  ? 68   GLN A OE1 1 
ATOM   505   N  NE2 . GLN A 1 68  ? 97.357  61.159 7.200   1.00 36.57  ? 68   GLN A NE2 1 
ATOM   506   N  N   . GLN A 1 69  ? 96.090  59.603 10.806  1.00 28.78  ? 69   GLN A N   1 
ATOM   507   C  CA  . GLN A 1 69  ? 96.282  59.294 12.212  1.00 26.56  ? 69   GLN A CA  1 
ATOM   508   C  C   . GLN A 1 69  ? 97.722  58.961 12.588  1.00 25.95  ? 69   GLN A C   1 
ATOM   509   O  O   . GLN A 1 69  ? 98.565  58.695 11.738  1.00 25.74  ? 69   GLN A O   1 
ATOM   510   C  CB  . GLN A 1 69  ? 95.376  58.115 12.597  1.00 24.21  ? 69   GLN A CB  1 
ATOM   511   C  CG  . GLN A 1 69  ? 95.579  56.877 11.736  1.00 21.92  ? 69   GLN A CG  1 
ATOM   512   C  CD  . GLN A 1 69  ? 94.538  55.793 11.991  1.00 27.52  ? 69   GLN A CD  1 
ATOM   513   O  OE1 . GLN A 1 69  ? 94.612  55.053 12.975  1.00 24.19  ? 69   GLN A OE1 1 
ATOM   514   N  NE2 . GLN A 1 69  ? 93.553  55.701 11.097  1.00 26.03  ? 69   GLN A NE2 1 
ATOM   515   N  N   . TYR A 1 70  ? 97.981  58.988 13.887  1.00 27.65  ? 70   TYR A N   1 
ATOM   516   C  CA  . TYR A 1 70  ? 99.282  58.641 14.428  1.00 29.56  ? 70   TYR A CA  1 
ATOM   517   C  C   . TYR A 1 70  ? 99.437  57.131 14.197  1.00 29.79  ? 70   TYR A C   1 
ATOM   518   O  O   . TYR A 1 70  ? 98.483  56.375 14.372  1.00 28.47  ? 70   TYR A O   1 
ATOM   519   C  CB  . TYR A 1 70  ? 99.298  58.942 15.922  1.00 31.37  ? 70   TYR A CB  1 
ATOM   520   C  CG  . TYR A 1 70  ? 100.445 58.308 16.657  1.00 36.44  ? 70   TYR A CG  1 
ATOM   521   C  CD1 . TYR A 1 70  ? 101.702 58.902 16.673  1.00 37.87  ? 70   TYR A CD1 1 
ATOM   522   C  CD2 . TYR A 1 70  ? 100.279 57.088 17.322  1.00 38.38  ? 70   TYR A CD2 1 
ATOM   523   C  CE1 . TYR A 1 70  ? 102.768 58.301 17.334  1.00 40.80  ? 70   TYR A CE1 1 
ATOM   524   C  CE2 . TYR A 1 70  ? 101.333 56.480 17.980  1.00 39.73  ? 70   TYR A CE2 1 
ATOM   525   C  CZ  . TYR A 1 70  ? 102.571 57.092 17.983  1.00 40.54  ? 70   TYR A CZ  1 
ATOM   526   O  OH  . TYR A 1 70  ? 103.612 56.504 18.652  1.00 44.32  ? 70   TYR A OH  1 
ATOM   527   N  N   . VAL A 1 71  ? 100.623 56.693 13.793  1.00 29.19  ? 71   VAL A N   1 
ATOM   528   C  CA  . VAL A 1 71  ? 100.843 55.274 13.551  1.00 31.35  ? 71   VAL A CA  1 
ATOM   529   C  C   . VAL A 1 71  ? 101.856 54.711 14.540  1.00 33.05  ? 71   VAL A C   1 
ATOM   530   O  O   . VAL A 1 71  ? 102.964 55.232 14.676  1.00 31.92  ? 71   VAL A O   1 
ATOM   531   C  CB  . VAL A 1 71  ? 101.347 55.024 12.115  1.00 31.81  ? 71   VAL A CB  1 
ATOM   532   C  CG1 . VAL A 1 71  ? 101.492 53.528 11.870  1.00 28.98  ? 71   VAL A CG1 1 
ATOM   533   C  CG2 . VAL A 1 71  ? 100.380 55.640 11.114  1.00 29.06  ? 71   VAL A CG2 1 
ATOM   534   N  N   . ASP A 1 72  ? 101.463 53.645 15.231  1.00 34.71  ? 72   ASP A N   1 
ATOM   535   C  CA  . ASP A 1 72  ? 102.321 53.003 16.217  1.00 35.96  ? 72   ASP A CA  1 
ATOM   536   C  C   . ASP A 1 72  ? 103.454 52.203 15.582  1.00 35.97  ? 72   ASP A C   1 
ATOM   537   O  O   . ASP A 1 72  ? 103.217 51.182 14.938  1.00 33.89  ? 72   ASP A O   1 
ATOM   538   C  CB  . ASP A 1 72  ? 101.494 52.083 17.120  1.00 35.88  ? 72   ASP A CB  1 
ATOM   539   C  CG  . ASP A 1 72  ? 102.362 51.226 18.021  1.00 38.61  ? 72   ASP A CG  1 
ATOM   540   O  OD1 . ASP A 1 72  ? 103.360 51.761 18.555  1.00 39.77  ? 72   ASP A OD1 1 
ATOM   541   O  OD2 . ASP A 1 72  ? 102.053 50.024 18.196  1.00 39.59  ? 72   ASP A OD2 1 
ATOM   542   N  N   . GLU A 1 73  ? 104.683 52.668 15.787  1.00 36.66  ? 73   GLU A N   1 
ATOM   543   C  CA  . GLU A 1 73  ? 105.858 51.998 15.240  1.00 40.38  ? 73   GLU A CA  1 
ATOM   544   C  C   . GLU A 1 73  ? 106.772 51.459 16.343  1.00 39.51  ? 73   GLU A C   1 
ATOM   545   O  O   . GLU A 1 73  ? 107.965 51.270 16.126  1.00 39.96  ? 73   GLU A O   1 
ATOM   546   C  CB  . GLU A 1 73  ? 106.649 52.964 14.350  1.00 43.20  ? 73   GLU A CB  1 
ATOM   547   C  CG  . GLU A 1 73  ? 105.885 53.482 13.131  1.00 48.50  ? 73   GLU A CG  1 
ATOM   548   C  CD  . GLU A 1 73  ? 106.585 54.656 12.454  1.00 50.85  ? 73   GLU A CD  1 
ATOM   549   O  OE1 . GLU A 1 73  ? 107.787 54.531 12.135  1.00 51.94  ? 73   GLU A OE1 1 
ATOM   550   O  OE2 . GLU A 1 73  ? 105.931 55.702 12.236  1.00 52.29  ? 73   GLU A OE2 1 
ATOM   551   N  N   . GLN A 1 74  ? 106.212 51.213 17.522  1.00 38.74  ? 74   GLN A N   1 
ATOM   552   C  CA  . GLN A 1 74  ? 106.986 50.703 18.648  1.00 38.03  ? 74   GLN A CA  1 
ATOM   553   C  C   . GLN A 1 74  ? 107.593 49.333 18.391  1.00 36.40  ? 74   GLN A C   1 
ATOM   554   O  O   . GLN A 1 74  ? 108.730 49.075 18.770  1.00 35.60  ? 74   GLN A O   1 
ATOM   555   C  CB  . GLN A 1 74  ? 106.110 50.626 19.901  1.00 41.02  ? 74   GLN A CB  1 
ATOM   556   C  CG  . GLN A 1 74  ? 106.218 51.830 20.818  1.00 47.07  ? 74   GLN A CG  1 
ATOM   557   C  CD  . GLN A 1 74  ? 107.531 51.865 21.580  1.00 48.96  ? 74   GLN A CD  1 
ATOM   558   O  OE1 . GLN A 1 74  ? 107.837 52.841 22.264  1.00 52.74  ? 74   GLN A OE1 1 
ATOM   559   N  NE2 . GLN A 1 74  ? 108.311 50.793 21.471  1.00 50.66  ? 74   GLN A NE2 1 
ATOM   560   N  N   . PHE A 1 75  ? 106.831 48.459 17.747  1.00 35.01  ? 75   PHE A N   1 
ATOM   561   C  CA  . PHE A 1 75  ? 107.284 47.101 17.470  1.00 35.52  ? 75   PHE A CA  1 
ATOM   562   C  C   . PHE A 1 75  ? 107.043 46.731 16.016  1.00 35.72  ? 75   PHE A C   1 
ATOM   563   O  O   . PHE A 1 75  ? 106.038 46.108 15.694  1.00 35.48  ? 75   PHE A O   1 
ATOM   564   C  CB  . PHE A 1 75  ? 106.526 46.128 18.365  1.00 35.15  ? 75   PHE A CB  1 
ATOM   565   C  CG  . PHE A 1 75  ? 106.594 46.470 19.824  1.00 34.62  ? 75   PHE A CG  1 
ATOM   566   C  CD1 . PHE A 1 75  ? 107.808 46.422 20.507  1.00 33.77  ? 75   PHE A CD1 1 
ATOM   567   C  CD2 . PHE A 1 75  ? 105.442 46.823 20.521  1.00 33.05  ? 75   PHE A CD2 1 
ATOM   568   C  CE1 . PHE A 1 75  ? 107.872 46.717 21.865  1.00 32.89  ? 75   PHE A CE1 1 
ATOM   569   C  CE2 . PHE A 1 75  ? 105.494 47.120 21.874  1.00 32.53  ? 75   PHE A CE2 1 
ATOM   570   C  CZ  . PHE A 1 75  ? 106.711 47.066 22.550  1.00 32.67  ? 75   PHE A CZ  1 
ATOM   571   N  N   . PRO A 1 76  ? 107.977 47.091 15.122  1.00 36.87  ? 76   PRO A N   1 
ATOM   572   C  CA  . PRO A 1 76  ? 107.877 46.809 13.685  1.00 37.26  ? 76   PRO A CA  1 
ATOM   573   C  C   . PRO A 1 76  ? 107.812 45.327 13.333  1.00 37.70  ? 76   PRO A C   1 
ATOM   574   O  O   . PRO A 1 76  ? 108.644 44.536 13.777  1.00 36.56  ? 76   PRO A O   1 
ATOM   575   C  CB  . PRO A 1 76  ? 109.136 47.463 13.116  1.00 37.96  ? 76   PRO A CB  1 
ATOM   576   C  CG  . PRO A 1 76  ? 109.443 48.550 14.097  1.00 38.76  ? 76   PRO A CG  1 
ATOM   577   C  CD  . PRO A 1 76  ? 109.204 47.852 15.413  1.00 37.19  ? 76   PRO A CD  1 
ATOM   578   N  N   . GLY A 1 77  ? 106.829 44.955 12.520  1.00 38.23  ? 77   GLY A N   1 
ATOM   579   C  CA  . GLY A 1 77  ? 106.702 43.564 12.120  1.00 37.82  ? 77   GLY A CA  1 
ATOM   580   C  C   . GLY A 1 77  ? 105.925 42.718 13.108  1.00 36.94  ? 77   GLY A C   1 
ATOM   581   O  O   . GLY A 1 77  ? 105.375 41.679 12.740  1.00 38.39  ? 77   GLY A O   1 
ATOM   582   N  N   . PHE A 1 78  ? 105.880 43.157 14.362  1.00 34.46  ? 78   PHE A N   1 
ATOM   583   C  CA  . PHE A 1 78  ? 105.159 42.438 15.401  1.00 33.87  ? 78   PHE A CA  1 
ATOM   584   C  C   . PHE A 1 78  ? 103.655 42.556 15.148  1.00 34.15  ? 78   PHE A C   1 
ATOM   585   O  O   . PHE A 1 78  ? 103.088 43.649 15.172  1.00 33.23  ? 78   PHE A O   1 
ATOM   586   C  CB  . PHE A 1 78  ? 105.538 43.001 16.775  1.00 33.80  ? 78   PHE A CB  1 
ATOM   587   C  CG  . PHE A 1 78  ? 104.844 42.327 17.922  1.00 36.38  ? 78   PHE A CG  1 
ATOM   588   C  CD1 . PHE A 1 78  ? 104.826 40.933 18.026  1.00 36.32  ? 78   PHE A CD1 1 
ATOM   589   C  CD2 . PHE A 1 78  ? 104.210 43.081 18.907  1.00 35.89  ? 78   PHE A CD2 1 
ATOM   590   C  CE1 . PHE A 1 78  ? 104.184 40.303 19.094  1.00 35.51  ? 78   PHE A CE1 1 
ATOM   591   C  CE2 . PHE A 1 78  ? 103.565 42.458 19.982  1.00 36.99  ? 78   PHE A CE2 1 
ATOM   592   C  CZ  . PHE A 1 78  ? 103.553 41.066 20.073  1.00 35.17  ? 78   PHE A CZ  1 
ATOM   593   N  N   . SER A 1 79  ? 103.020 41.416 14.903  1.00 34.57  ? 79   SER A N   1 
ATOM   594   C  CA  . SER A 1 79  ? 101.594 41.360 14.605  1.00 36.48  ? 79   SER A CA  1 
ATOM   595   C  C   . SER A 1 79  ? 100.659 41.866 15.700  1.00 36.56  ? 79   SER A C   1 
ATOM   596   O  O   . SER A 1 79  ? 99.573  42.368 15.410  1.00 35.83  ? 79   SER A O   1 
ATOM   597   C  CB  . SER A 1 79  ? 101.207 39.924 14.246  1.00 38.81  ? 79   SER A CB  1 
ATOM   598   O  OG  . SER A 1 79  ? 101.482 39.045 15.326  1.00 43.13  ? 79   SER A OG  1 
ATOM   599   N  N   . GLY A 1 80  ? 101.072 41.731 16.955  1.00 35.97  ? 80   GLY A N   1 
ATOM   600   C  CA  . GLY A 1 80  ? 100.228 42.168 18.050  1.00 35.25  ? 80   GLY A CA  1 
ATOM   601   C  C   . GLY A 1 80  ? 99.920  43.653 18.053  1.00 36.36  ? 80   GLY A C   1 
ATOM   602   O  O   . GLY A 1 80  ? 98.839  44.075 18.483  1.00 35.57  ? 80   GLY A O   1 
ATOM   603   N  N   . SER A 1 81  ? 100.863 44.457 17.582  1.00 35.06  ? 81   SER A N   1 
ATOM   604   C  CA  . SER A 1 81  ? 100.657 45.895 17.568  1.00 36.71  ? 81   SER A CA  1 
ATOM   605   C  C   . SER A 1 81  ? 100.244 46.391 16.189  1.00 37.22  ? 81   SER A C   1 
ATOM   606   O  O   . SER A 1 81  ? 99.478  47.345 16.067  1.00 36.68  ? 81   SER A O   1 
ATOM   607   C  CB  . SER A 1 81  ? 101.936 46.612 18.012  1.00 35.69  ? 81   SER A CB  1 
ATOM   608   O  OG  . SER A 1 81  ? 103.014 46.316 17.138  1.00 35.84  ? 81   SER A OG  1 
ATOM   609   N  N   . GLU A 1 82  ? 100.740 45.731 15.150  1.00 37.57  ? 82   GLU A N   1 
ATOM   610   C  CA  . GLU A 1 82  ? 100.438 46.141 13.786  1.00 39.21  ? 82   GLU A CA  1 
ATOM   611   C  C   . GLU A 1 82  ? 99.006  45.903 13.323  1.00 37.35  ? 82   GLU A C   1 
ATOM   612   O  O   . GLU A 1 82  ? 98.503  46.636 12.473  1.00 36.19  ? 82   GLU A O   1 
ATOM   613   C  CB  . GLU A 1 82  ? 101.416 45.475 12.822  1.00 41.67  ? 82   GLU A CB  1 
ATOM   614   C  CG  . GLU A 1 82  ? 102.349 46.462 12.162  1.00 46.63  ? 82   GLU A CG  1 
ATOM   615   C  CD  . GLU A 1 82  ? 103.774 45.972 12.119  1.00 50.18  ? 82   GLU A CD  1 
ATOM   616   O  OE1 . GLU A 1 82  ? 103.985 44.784 11.786  1.00 51.45  ? 82   GLU A OE1 1 
ATOM   617   O  OE2 . GLU A 1 82  ? 104.685 46.781 12.409  1.00 52.85  ? 82   GLU A OE2 1 
ATOM   618   N  N   . MET A 1 83  ? 98.350  44.890 13.882  1.00 35.07  ? 83   MET A N   1 
ATOM   619   C  CA  . MET A 1 83  ? 96.975  44.577 13.511  1.00 32.71  ? 83   MET A CA  1 
ATOM   620   C  C   . MET A 1 83  ? 96.031  45.733 13.841  1.00 31.86  ? 83   MET A C   1 
ATOM   621   O  O   . MET A 1 83  ? 94.854  45.686 13.508  1.00 31.10  ? 83   MET A O   1 
ATOM   622   C  CB  . MET A 1 83  ? 96.497  43.312 14.231  1.00 32.93  ? 83   MET A CB  1 
ATOM   623   C  CG  . MET A 1 83  ? 96.349  43.463 15.742  1.00 34.47  ? 83   MET A CG  1 
ATOM   624   S  SD  . MET A 1 83  ? 95.883  41.899 16.549  1.00 37.62  ? 83   MET A SD  1 
ATOM   625   C  CE  . MET A 1 83  ? 94.111  42.075 16.747  1.00 35.48  ? 83   MET A CE  1 
ATOM   626   N  N   . TRP A 1 84  ? 96.538  46.768 14.498  1.00 29.64  ? 84   TRP A N   1 
ATOM   627   C  CA  . TRP A 1 84  ? 95.684  47.899 14.841  1.00 30.25  ? 84   TRP A CA  1 
ATOM   628   C  C   . TRP A 1 84  ? 96.007  49.107 13.985  1.00 28.84  ? 84   TRP A C   1 
ATOM   629   O  O   . TRP A 1 84  ? 95.273  50.088 13.996  1.00 28.48  ? 84   TRP A O   1 
ATOM   630   C  CB  . TRP A 1 84  ? 95.825  48.263 16.324  1.00 30.82  ? 84   TRP A CB  1 
ATOM   631   C  CG  . TRP A 1 84  ? 95.531  47.125 17.232  1.00 31.33  ? 84   TRP A CG  1 
ATOM   632   C  CD1 . TRP A 1 84  ? 96.436  46.389 17.942  1.00 31.14  ? 84   TRP A CD1 1 
ATOM   633   C  CD2 . TRP A 1 84  ? 94.249  46.533 17.476  1.00 31.72  ? 84   TRP A CD2 1 
ATOM   634   N  NE1 . TRP A 1 84  ? 95.799  45.369 18.608  1.00 33.93  ? 84   TRP A NE1 1 
ATOM   635   C  CE2 . TRP A 1 84  ? 94.456  45.432 18.341  1.00 33.00  ? 84   TRP A CE2 1 
ATOM   636   C  CE3 . TRP A 1 84  ? 92.946  46.821 17.046  1.00 31.78  ? 84   TRP A CE3 1 
ATOM   637   C  CZ2 . TRP A 1 84  ? 93.404  44.613 18.784  1.00 33.45  ? 84   TRP A CZ2 1 
ATOM   638   C  CZ3 . TRP A 1 84  ? 91.890  46.003 17.489  1.00 31.14  ? 84   TRP A CZ3 1 
ATOM   639   C  CH2 . TRP A 1 84  ? 92.132  44.913 18.349  1.00 31.77  ? 84   TRP A CH2 1 
ATOM   640   N  N   . ASN A 1 85  ? 97.109  49.028 13.244  1.00 28.81  ? 85   ASN A N   1 
ATOM   641   C  CA  . ASN A 1 85  ? 97.522  50.126 12.379  1.00 28.72  ? 85   ASN A CA  1 
ATOM   642   C  C   . ASN A 1 85  ? 96.745  50.139 11.076  1.00 28.23  ? 85   ASN A C   1 
ATOM   643   O  O   . ASN A 1 85  ? 96.220  49.115 10.648  1.00 26.85  ? 85   ASN A O   1 
ATOM   644   C  CB  . ASN A 1 85  ? 99.008  50.029 12.044  1.00 28.45  ? 85   ASN A CB  1 
ATOM   645   C  CG  . ASN A 1 85  ? 99.896  50.293 13.236  1.00 27.77  ? 85   ASN A CG  1 
ATOM   646   O  OD1 . ASN A 1 85  ? 99.514  51.003 14.165  1.00 29.03  ? 85   ASN A OD1 1 
ATOM   647   N  ND2 . ASN A 1 85  ? 101.102 49.738 13.205  1.00 28.18  ? 85   ASN A ND2 1 
ATOM   648   N  N   . PRO A 1 86  ? 96.652  51.310 10.432  1.00 27.44  ? 86   PRO A N   1 
ATOM   649   C  CA  . PRO A 1 86  ? 95.929  51.413 9.161   1.00 29.24  ? 86   PRO A CA  1 
ATOM   650   C  C   . PRO A 1 86  ? 96.482  50.399 8.160   1.00 30.13  ? 86   PRO A C   1 
ATOM   651   O  O   . PRO A 1 86  ? 97.698  50.295 7.986   1.00 31.22  ? 86   PRO A O   1 
ATOM   652   C  CB  . PRO A 1 86  ? 96.207  52.846 8.726   1.00 28.03  ? 86   PRO A CB  1 
ATOM   653   C  CG  . PRO A 1 86  ? 96.301  53.577 10.031  1.00 27.82  ? 86   PRO A CG  1 
ATOM   654   C  CD  . PRO A 1 86  ? 97.119  52.633 10.885  1.00 26.35  ? 86   PRO A CD  1 
ATOM   655   N  N   . ASN A 1 87  ? 95.602  49.650 7.506   1.00 31.24  ? 87   ASN A N   1 
ATOM   656   C  CA  . ASN A 1 87  ? 96.050  48.665 6.532   1.00 33.23  ? 87   ASN A CA  1 
ATOM   657   C  C   . ASN A 1 87  ? 95.859  49.155 5.102   1.00 35.27  ? 87   ASN A C   1 
ATOM   658   O  O   . ASN A 1 87  ? 95.733  48.365 4.171   1.00 37.03  ? 87   ASN A O   1 
ATOM   659   C  CB  . ASN A 1 87  ? 95.336  47.327 6.748   1.00 33.79  ? 87   ASN A CB  1 
ATOM   660   C  CG  . ASN A 1 87  ? 93.838  47.452 6.689   1.00 33.64  ? 87   ASN A CG  1 
ATOM   661   O  OD1 . ASN A 1 87  ? 93.287  48.536 6.875   1.00 35.69  ? 87   ASN A OD1 1 
ATOM   662   N  ND2 . ASN A 1 87  ? 93.163  46.336 6.446   1.00 35.70  ? 87   ASN A ND2 1 
ATOM   663   N  N   . ARG A 1 88  ? 95.836  50.472 4.944   1.00 36.11  ? 88   ARG A N   1 
ATOM   664   C  CA  . ARG A 1 88  ? 95.716  51.095 3.639   1.00 38.30  ? 88   ARG A CA  1 
ATOM   665   C  C   . ARG A 1 88  ? 96.031  52.583 3.710   1.00 38.41  ? 88   ARG A C   1 
ATOM   666   O  O   . ARG A 1 88  ? 96.091  53.167 4.789   1.00 37.90  ? 88   ARG A O   1 
ATOM   667   C  CB  . ARG A 1 88  ? 94.329  50.857 3.042   1.00 41.67  ? 88   ARG A CB  1 
ATOM   668   C  CG  . ARG A 1 88  ? 93.257  50.548 4.040   1.00 46.51  ? 88   ARG A CG  1 
ATOM   669   C  CD  . ARG A 1 88  ? 92.036  49.972 3.354   1.00 49.74  ? 88   ARG A CD  1 
ATOM   670   N  NE  . ARG A 1 88  ? 92.304  48.682 2.723   1.00 51.94  ? 88   ARG A NE  1 
ATOM   671   C  CZ  . ARG A 1 88  ? 92.831  48.525 1.513   1.00 52.59  ? 88   ARG A CZ  1 
ATOM   672   N  NH1 . ARG A 1 88  ? 93.155  49.584 0.785   1.00 53.47  ? 88   ARG A NH1 1 
ATOM   673   N  NH2 . ARG A 1 88  ? 93.024  47.305 1.026   1.00 53.40  ? 88   ARG A NH2 1 
ATOM   674   N  N   . GLU A 1 89  ? 96.250  53.177 2.546   1.00 38.47  ? 89   GLU A N   1 
ATOM   675   C  CA  . GLU A 1 89  ? 96.589  54.587 2.429   1.00 40.24  ? 89   GLU A CA  1 
ATOM   676   C  C   . GLU A 1 89  ? 95.743  55.507 3.311   1.00 38.17  ? 89   GLU A C   1 
ATOM   677   O  O   . GLU A 1 89  ? 94.523  55.382 3.372   1.00 36.75  ? 89   GLU A O   1 
ATOM   678   C  CB  . GLU A 1 89  ? 96.457  55.021 0.967   1.00 43.96  ? 89   GLU A CB  1 
ATOM   679   C  CG  . GLU A 1 89  ? 97.658  55.775 0.418   1.00 52.51  ? 89   GLU A CG  1 
ATOM   680   C  CD  . GLU A 1 89  ? 98.935  54.943 0.422   1.00 57.42  ? 89   GLU A CD  1 
ATOM   681   O  OE1 . GLU A 1 89  ? 99.520  54.739 1.510   1.00 60.24  ? 89   GLU A OE1 1 
ATOM   682   O  OE2 . GLU A 1 89  ? 99.351  54.488 -0.668  1.00 59.58  ? 89   GLU A OE2 1 
ATOM   683   N  N   . MET A 1 90  ? 96.405  56.435 3.992   1.00 36.07  ? 90   MET A N   1 
ATOM   684   C  CA  . MET A 1 90  ? 95.709  57.386 4.845   1.00 34.41  ? 90   MET A CA  1 
ATOM   685   C  C   . MET A 1 90  ? 95.383  58.633 4.036   1.00 32.76  ? 90   MET A C   1 
ATOM   686   O  O   . MET A 1 90  ? 96.153  59.041 3.170   1.00 32.78  ? 90   MET A O   1 
ATOM   687   C  CB  . MET A 1 90  ? 96.566  57.757 6.055   1.00 32.12  ? 90   MET A CB  1 
ATOM   688   C  CG  . MET A 1 90  ? 96.765  56.614 7.032   1.00 30.34  ? 90   MET A CG  1 
ATOM   689   S  SD  . MET A 1 90  ? 97.568  57.191 8.528   1.00 33.39  ? 90   MET A SD  1 
ATOM   690   C  CE  . MET A 1 90  ? 99.299  57.261 7.977   1.00 31.80  ? 90   MET A CE  1 
ATOM   691   N  N   . SER A 1 91  ? 94.239  59.233 4.327   1.00 31.67  ? 91   SER A N   1 
ATOM   692   C  CA  . SER A 1 91  ? 93.803  60.420 3.610   1.00 32.34  ? 91   SER A CA  1 
ATOM   693   C  C   . SER A 1 91  ? 92.721  61.140 4.402   1.00 31.52  ? 91   SER A C   1 
ATOM   694   O  O   . SER A 1 91  ? 91.983  60.512 5.164   1.00 30.47  ? 91   SER A O   1 
ATOM   695   C  CB  . SER A 1 91  ? 93.260  60.010 2.236   1.00 32.72  ? 91   SER A CB  1 
ATOM   696   O  OG  . SER A 1 91  ? 92.587  61.085 1.611   1.00 35.39  ? 91   SER A OG  1 
ATOM   697   N  N   . GLU A 1 92  ? 92.636  62.457 4.234   1.00 31.61  ? 92   GLU A N   1 
ATOM   698   C  CA  . GLU A 1 92  ? 91.621  63.236 4.929   1.00 30.46  ? 92   GLU A CA  1 
ATOM   699   C  C   . GLU A 1 92  ? 90.239  62.892 4.379   1.00 31.49  ? 92   GLU A C   1 
ATOM   700   O  O   . GLU A 1 92  ? 89.225  63.080 5.054   1.00 32.78  ? 92   GLU A O   1 
ATOM   701   C  CB  . GLU A 1 92  ? 91.906  64.734 4.797   1.00 31.46  ? 92   GLU A CB  1 
ATOM   702   C  CG  . GLU A 1 92  ? 92.904  65.240 5.832   1.00 32.63  ? 92   GLU A CG  1 
ATOM   703   C  CD  . GLU A 1 92  ? 93.049  66.758 5.850   1.00 35.39  ? 92   GLU A CD  1 
ATOM   704   O  OE1 . GLU A 1 92  ? 93.893  67.284 5.088   1.00 36.89  ? 92   GLU A OE1 1 
ATOM   705   O  OE2 . GLU A 1 92  ? 92.316  67.422 6.621   1.00 32.25  ? 92   GLU A OE2 1 
ATOM   706   N  N   . ASP A 1 93  ? 90.201  62.387 3.150   1.00 30.63  ? 93   ASP A N   1 
ATOM   707   C  CA  . ASP A 1 93  ? 88.946  61.974 2.538   1.00 31.51  ? 93   ASP A CA  1 
ATOM   708   C  C   . ASP A 1 93  ? 88.809  60.515 2.956   1.00 30.61  ? 93   ASP A C   1 
ATOM   709   O  O   . ASP A 1 93  ? 89.257  59.609 2.259   1.00 30.32  ? 93   ASP A O   1 
ATOM   710   C  CB  . ASP A 1 93  ? 89.031  62.115 1.018   1.00 32.54  ? 93   ASP A CB  1 
ATOM   711   C  CG  . ASP A 1 93  ? 87.894  61.411 0.298   1.00 34.26  ? 93   ASP A CG  1 
ATOM   712   O  OD1 . ASP A 1 93  ? 86.752  61.435 0.796   1.00 37.01  ? 93   ASP A OD1 1 
ATOM   713   O  OD2 . ASP A 1 93  ? 88.139  60.840 -0.778  1.00 36.10  ? 93   ASP A OD2 1 
ATOM   714   N  N   . CYS A 1 94  ? 88.178  60.298 4.104   1.00 30.84  ? 94   CYS A N   1 
ATOM   715   C  CA  . CYS A 1 94  ? 88.051  58.956 4.654   1.00 30.71  ? 94   CYS A CA  1 
ATOM   716   C  C   . CYS A 1 94  ? 86.673  58.623 5.202   1.00 29.61  ? 94   CYS A C   1 
ATOM   717   O  O   . CYS A 1 94  ? 86.509  57.606 5.872   1.00 30.51  ? 94   CYS A O   1 
ATOM   718   C  CB  . CYS A 1 94  ? 89.070  58.807 5.780   1.00 30.17  ? 94   CYS A CB  1 
ATOM   719   S  SG  . CYS A 1 94  ? 88.770  60.010 7.128   1.00 31.60  ? 94   CYS A SG  1 
ATOM   720   N  N   . LEU A 1 95  ? 85.682  59.464 4.930   1.00 30.14  ? 95   LEU A N   1 
ATOM   721   C  CA  . LEU A 1 95  ? 84.347  59.210 5.453   1.00 29.31  ? 95   LEU A CA  1 
ATOM   722   C  C   . LEU A 1 95  ? 83.531  58.233 4.618   1.00 28.70  ? 95   LEU A C   1 
ATOM   723   O  O   . LEU A 1 95  ? 82.737  58.634 3.774   1.00 28.58  ? 95   LEU A O   1 
ATOM   724   C  CB  . LEU A 1 95  ? 83.596  60.530 5.614   1.00 28.88  ? 95   LEU A CB  1 
ATOM   725   C  CG  . LEU A 1 95  ? 84.300  61.527 6.538   1.00 29.14  ? 95   LEU A CG  1 
ATOM   726   C  CD1 . LEU A 1 95  ? 83.376  62.703 6.818   1.00 25.73  ? 95   LEU A CD1 1 
ATOM   727   C  CD2 . LEU A 1 95  ? 84.685  60.828 7.843   1.00 25.77  ? 95   LEU A CD2 1 
ATOM   728   N  N   . TYR A 1 96  ? 83.735  56.944 4.873   1.00 28.88  ? 96   TYR A N   1 
ATOM   729   C  CA  . TYR A 1 96  ? 83.029  55.887 4.161   1.00 28.87  ? 96   TYR A CA  1 
ATOM   730   C  C   . TYR A 1 96  ? 82.532  54.833 5.145   1.00 29.18  ? 96   TYR A C   1 
ATOM   731   O  O   . TYR A 1 96  ? 82.871  54.875 6.328   1.00 30.11  ? 96   TYR A O   1 
ATOM   732   C  CB  . TYR A 1 96  ? 83.961  55.234 3.134   1.00 28.92  ? 96   TYR A CB  1 
ATOM   733   C  CG  . TYR A 1 96  ? 84.518  56.210 2.121   1.00 31.16  ? 96   TYR A CG  1 
ATOM   734   C  CD1 . TYR A 1 96  ? 85.609  57.018 2.428   1.00 31.26  ? 96   TYR A CD1 1 
ATOM   735   C  CD2 . TYR A 1 96  ? 83.915  56.367 0.872   1.00 32.18  ? 96   TYR A CD2 1 
ATOM   736   C  CE1 . TYR A 1 96  ? 86.084  57.962 1.522   1.00 32.16  ? 96   TYR A CE1 1 
ATOM   737   C  CE2 . TYR A 1 96  ? 84.382  57.306 -0.042  1.00 32.06  ? 96   TYR A CE2 1 
ATOM   738   C  CZ  . TYR A 1 96  ? 85.463  58.102 0.289   1.00 33.70  ? 96   TYR A CZ  1 
ATOM   739   O  OH  . TYR A 1 96  ? 85.907  59.054 -0.604  1.00 34.63  ? 96   TYR A OH  1 
ATOM   740   N  N   . LEU A 1 97  ? 81.716  53.904 4.659   1.00 28.41  ? 97   LEU A N   1 
ATOM   741   C  CA  . LEU A 1 97  ? 81.197  52.822 5.487   1.00 27.96  ? 97   LEU A CA  1 
ATOM   742   C  C   . LEU A 1 97  ? 81.168  51.520 4.692   1.00 27.86  ? 97   LEU A C   1 
ATOM   743   O  O   . LEU A 1 97  ? 81.232  51.535 3.462   1.00 29.07  ? 97   LEU A O   1 
ATOM   744   C  CB  . LEU A 1 97  ? 79.807  53.176 6.033   1.00 27.66  ? 97   LEU A CB  1 
ATOM   745   C  CG  . LEU A 1 97  ? 78.669  53.603 5.108   1.00 28.51  ? 97   LEU A CG  1 
ATOM   746   C  CD1 . LEU A 1 97  ? 78.137  52.405 4.346   1.00 26.76  ? 97   LEU A CD1 1 
ATOM   747   C  CD2 . LEU A 1 97  ? 77.560  54.233 5.943   1.00 28.03  ? 97   LEU A CD2 1 
ATOM   748   N  N   . ASN A 1 98  ? 81.099  50.396 5.401   1.00 28.73  ? 98   ASN A N   1 
ATOM   749   C  CA  . ASN A 1 98  ? 81.087  49.071 4.778   1.00 29.08  ? 98   ASN A CA  1 
ATOM   750   C  C   . ASN A 1 98  ? 79.875  48.292 5.238   1.00 29.34  ? 98   ASN A C   1 
ATOM   751   O  O   . ASN A 1 98  ? 79.449  48.423 6.379   1.00 31.76  ? 98   ASN A O   1 
ATOM   752   C  CB  . ASN A 1 98  ? 82.338  48.283 5.167   1.00 29.45  ? 98   ASN A CB  1 
ATOM   753   C  CG  . ASN A 1 98  ? 83.602  49.060 4.940   1.00 29.68  ? 98   ASN A CG  1 
ATOM   754   O  OD1 . ASN A 1 98  ? 84.016  49.280 3.807   1.00 31.49  ? 98   ASN A OD1 1 
ATOM   755   N  ND2 . ASN A 1 98  ? 84.220  49.497 6.021   1.00 31.42  ? 98   ASN A ND2 1 
ATOM   756   N  N   . ILE A 1 99  ? 79.338  47.462 4.355   1.00 31.42  ? 99   ILE A N   1 
ATOM   757   C  CA  . ILE A 1 99  ? 78.169  46.664 4.684   1.00 32.53  ? 99   ILE A CA  1 
ATOM   758   C  C   . ILE A 1 99  ? 78.310  45.224 4.205   1.00 33.84  ? 99   ILE A C   1 
ATOM   759   O  O   . ILE A 1 99  ? 78.785  44.970 3.099   1.00 34.64  ? 99   ILE A O   1 
ATOM   760   C  CB  . ILE A 1 99  ? 76.904  47.243 4.037   1.00 34.26  ? 99   ILE A CB  1 
ATOM   761   C  CG1 . ILE A 1 99  ? 76.806  48.743 4.316   1.00 33.42  ? 99   ILE A CG1 1 
ATOM   762   C  CG2 . ILE A 1 99  ? 75.671  46.519 4.574   1.00 33.99  ? 99   ILE A CG2 1 
ATOM   763   C  CD1 . ILE A 1 99  ? 75.627  49.406 3.611   1.00 34.64  ? 99   ILE A CD1 1 
ATOM   764   N  N   . TRP A 1 100 ? 77.896  44.286 5.050   1.00 33.64  ? 100  TRP A N   1 
ATOM   765   C  CA  . TRP A 1 100 ? 77.931  42.867 4.724   1.00 32.62  ? 100  TRP A CA  1 
ATOM   766   C  C   . TRP A 1 100 ? 76.495  42.370 4.846   1.00 34.37  ? 100  TRP A C   1 
ATOM   767   O  O   . TRP A 1 100 ? 75.883  42.478 5.909   1.00 33.23  ? 100  TRP A O   1 
ATOM   768   C  CB  . TRP A 1 100 ? 78.836  42.121 5.698   1.00 31.38  ? 100  TRP A CB  1 
ATOM   769   C  CG  . TRP A 1 100 ? 80.291  42.301 5.418   1.00 30.51  ? 100  TRP A CG  1 
ATOM   770   C  CD1 . TRP A 1 100 ? 81.058  41.552 4.576   1.00 29.59  ? 100  TRP A CD1 1 
ATOM   771   C  CD2 . TRP A 1 100 ? 81.159  43.290 5.979   1.00 28.43  ? 100  TRP A CD2 1 
ATOM   772   N  NE1 . TRP A 1 100 ? 82.350  42.008 4.581   1.00 28.15  ? 100  TRP A NE1 1 
ATOM   773   C  CE2 . TRP A 1 100 ? 82.442  43.075 5.434   1.00 29.07  ? 100  TRP A CE2 1 
ATOM   774   C  CE3 . TRP A 1 100 ? 80.979  44.338 6.892   1.00 28.90  ? 100  TRP A CE3 1 
ATOM   775   C  CZ2 . TRP A 1 100 ? 83.548  43.871 5.774   1.00 26.79  ? 100  TRP A CZ2 1 
ATOM   776   C  CZ3 . TRP A 1 100 ? 82.076  45.127 7.229   1.00 28.80  ? 100  TRP A CZ3 1 
ATOM   777   C  CH2 . TRP A 1 100 ? 83.345  44.885 6.669   1.00 26.61  ? 100  TRP A CH2 1 
ATOM   778   N  N   . VAL A 1 101 ? 75.957  41.844 3.749   1.00 36.19  ? 101  VAL A N   1 
ATOM   779   C  CA  . VAL A 1 101 ? 74.580  41.354 3.718   1.00 37.57  ? 101  VAL A CA  1 
ATOM   780   C  C   . VAL A 1 101 ? 74.531  39.851 3.446   1.00 38.68  ? 101  VAL A C   1 
ATOM   781   O  O   . VAL A 1 101 ? 75.212  39.352 2.550   1.00 38.78  ? 101  VAL A O   1 
ATOM   782   C  CB  . VAL A 1 101 ? 73.770  42.066 2.604   1.00 37.05  ? 101  VAL A CB  1 
ATOM   783   C  CG1 . VAL A 1 101 ? 72.286  41.749 2.740   1.00 35.63  ? 101  VAL A CG1 1 
ATOM   784   C  CG2 . VAL A 1 101 ? 74.016  43.562 2.664   1.00 38.92  ? 101  VAL A CG2 1 
ATOM   785   N  N   . PRO A 1 102 ? 73.739  39.103 4.226   1.00 38.93  ? 102  PRO A N   1 
ATOM   786   C  CA  . PRO A 1 102 ? 73.697  37.666 3.947   1.00 41.09  ? 102  PRO A CA  1 
ATOM   787   C  C   . PRO A 1 102 ? 73.052  37.387 2.585   1.00 43.51  ? 102  PRO A C   1 
ATOM   788   O  O   . PRO A 1 102 ? 72.269  38.193 2.076   1.00 42.66  ? 102  PRO A O   1 
ATOM   789   C  CB  . PRO A 1 102 ? 72.892  37.106 5.119   1.00 39.80  ? 102  PRO A CB  1 
ATOM   790   C  CG  . PRO A 1 102 ? 72.052  38.262 5.562   1.00 40.37  ? 102  PRO A CG  1 
ATOM   791   C  CD  . PRO A 1 102 ? 72.992  39.430 5.451   1.00 38.75  ? 102  PRO A CD  1 
ATOM   792   N  N   . SER A 1 103 ? 73.407  36.254 1.992   1.00 46.42  ? 103  SER A N   1 
ATOM   793   C  CA  . SER A 1 103 ? 72.875  35.866 0.691   1.00 49.86  ? 103  SER A CA  1 
ATOM   794   C  C   . SER A 1 103 ? 72.055  34.588 0.826   1.00 50.49  ? 103  SER A C   1 
ATOM   795   O  O   . SER A 1 103 ? 72.539  33.593 1.361   1.00 52.54  ? 103  SER A O   1 
ATOM   796   C  CB  . SER A 1 103 ? 74.026  35.646 -0.298  1.00 50.07  ? 103  SER A CB  1 
ATOM   797   O  OG  . SER A 1 103 ? 73.539  35.282 -1.578  1.00 53.37  ? 103  SER A OG  1 
ATOM   798   N  N   . PRO A 1 104 ? 70.806  34.590 0.328   1.00 51.36  ? 104  PRO A N   1 
ATOM   799   C  CA  . PRO A 1 104 ? 70.103  35.687 -0.352  1.00 50.59  ? 104  PRO A CA  1 
ATOM   800   C  C   . PRO A 1 104 ? 69.751  36.857 0.560   1.00 49.47  ? 104  PRO A C   1 
ATOM   801   O  O   . PRO A 1 104 ? 69.646  36.696 1.771   1.00 49.67  ? 104  PRO A O   1 
ATOM   802   C  CB  . PRO A 1 104 ? 68.861  34.999 -0.912  1.00 50.12  ? 104  PRO A CB  1 
ATOM   803   C  CG  . PRO A 1 104 ? 68.560  33.985 0.137   1.00 50.96  ? 104  PRO A CG  1 
ATOM   804   C  CD  . PRO A 1 104 ? 69.932  33.406 0.433   1.00 50.99  ? 104  PRO A CD  1 
ATOM   805   N  N   . ARG A 1 105 ? 69.559  38.030 -0.037  1.00 49.32  ? 105  ARG A N   1 
ATOM   806   C  CA  . ARG A 1 105 ? 69.229  39.237 0.713   1.00 49.49  ? 105  ARG A CA  1 
ATOM   807   C  C   . ARG A 1 105 ? 67.991  39.077 1.579   1.00 50.44  ? 105  ARG A C   1 
ATOM   808   O  O   . ARG A 1 105 ? 66.883  38.919 1.074   1.00 53.15  ? 105  ARG A O   1 
ATOM   809   C  CB  . ARG A 1 105 ? 69.015  40.413 -0.234  1.00 48.55  ? 105  ARG A CB  1 
ATOM   810   C  CG  . ARG A 1 105 ? 68.634  41.696 0.479   1.00 48.78  ? 105  ARG A CG  1 
ATOM   811   C  CD  . ARG A 1 105 ? 68.315  42.794 -0.518  1.00 50.06  ? 105  ARG A CD  1 
ATOM   812   N  NE  . ARG A 1 105 ? 69.438  43.063 -1.410  1.00 49.93  ? 105  ARG A NE  1 
ATOM   813   C  CZ  . ARG A 1 105 ? 69.360  43.823 -2.497  1.00 51.14  ? 105  ARG A CZ  1 
ATOM   814   N  NH1 . ARG A 1 105 ? 68.204  44.391 -2.827  1.00 51.55  ? 105  ARG A NH1 1 
ATOM   815   N  NH2 . ARG A 1 105 ? 70.433  44.014 -3.255  1.00 50.83  ? 105  ARG A NH2 1 
ATOM   816   N  N   . PRO A 1 106 ? 68.163  39.136 2.905   1.00 50.60  ? 106  PRO A N   1 
ATOM   817   C  CA  . PRO A 1 106 ? 67.029  38.994 3.816   1.00 50.50  ? 106  PRO A CA  1 
ATOM   818   C  C   . PRO A 1 106 ? 66.076  40.178 3.697   1.00 51.18  ? 106  PRO A C   1 
ATOM   819   O  O   . PRO A 1 106 ? 66.301  41.089 2.899   1.00 51.13  ? 106  PRO A O   1 
ATOM   820   C  CB  . PRO A 1 106 ? 67.706  38.921 5.180   1.00 50.76  ? 106  PRO A CB  1 
ATOM   821   C  CG  . PRO A 1 106 ? 68.872  39.843 5.005   1.00 49.64  ? 106  PRO A CG  1 
ATOM   822   C  CD  . PRO A 1 106 ? 69.401  39.430 3.649   1.00 50.24  ? 106  PRO A CD  1 
ATOM   823   N  N   . LYS A 1 107 ? 65.018  40.160 4.501   1.00 52.46  ? 107  LYS A N   1 
ATOM   824   C  CA  . LYS A 1 107 ? 64.018  41.222 4.497   1.00 52.63  ? 107  LYS A CA  1 
ATOM   825   C  C   . LYS A 1 107 ? 63.849  41.840 5.883   1.00 52.00  ? 107  LYS A C   1 
ATOM   826   O  O   . LYS A 1 107 ? 63.543  41.141 6.851   1.00 52.42  ? 107  LYS A O   1 
ATOM   827   C  CB  . LYS A 1 107 ? 62.668  40.665 4.030   1.00 53.49  ? 107  LYS A CB  1 
ATOM   828   C  CG  . LYS A 1 107 ? 62.693  40.060 2.640   1.00 55.14  ? 107  LYS A CG  1 
ATOM   829   C  CD  . LYS A 1 107 ? 61.365  39.394 2.294   1.00 57.97  ? 107  LYS A CD  1 
ATOM   830   C  CE  . LYS A 1 107 ? 60.205  40.379 2.303   1.00 57.42  ? 107  LYS A CE  1 
ATOM   831   N  NZ  . LYS A 1 107 ? 58.928  39.706 1.934   1.00 56.64  ? 107  LYS A NZ  1 
ATOM   832   N  N   . SER A 1 108 ? 64.054  43.150 5.975   1.00 50.55  ? 108  SER A N   1 
ATOM   833   C  CA  . SER A 1 108 ? 63.895  43.863 7.238   1.00 49.82  ? 108  SER A CA  1 
ATOM   834   C  C   . SER A 1 108 ? 64.597  43.181 8.428   1.00 47.79  ? 108  SER A C   1 
ATOM   835   O  O   . SER A 1 108 ? 64.085  43.188 9.547   1.00 47.37  ? 108  SER A O   1 
ATOM   836   C  CB  . SER A 1 108 ? 62.395  44.023 7.531   1.00 50.84  ? 108  SER A CB  1 
ATOM   837   O  OG  . SER A 1 108 ? 62.155  44.776 8.711   1.00 55.09  ? 108  SER A OG  1 
ATOM   838   N  N   . THR A 1 109 ? 65.772  42.603 8.190   1.00 45.13  ? 109  THR A N   1 
ATOM   839   C  CA  . THR A 1 109 ? 66.507  41.930 9.255   1.00 43.12  ? 109  THR A CA  1 
ATOM   840   C  C   . THR A 1 109 ? 67.223  42.916 10.192  1.00 40.51  ? 109  THR A C   1 
ATOM   841   O  O   . THR A 1 109 ? 67.302  44.113 9.909   1.00 40.43  ? 109  THR A O   1 
ATOM   842   C  CB  . THR A 1 109 ? 67.539  40.944 8.676   1.00 44.61  ? 109  THR A CB  1 
ATOM   843   O  OG1 . THR A 1 109 ? 68.084  40.147 9.734   1.00 47.41  ? 109  THR A OG1 1 
ATOM   844   C  CG2 . THR A 1 109 ? 68.670  41.690 7.994   1.00 46.33  ? 109  THR A CG2 1 
ATOM   845   N  N   . THR A 1 110 ? 67.733  42.404 11.309  1.00 37.25  ? 110  THR A N   1 
ATOM   846   C  CA  . THR A 1 110 ? 68.433  43.222 12.297  1.00 34.60  ? 110  THR A CA  1 
ATOM   847   C  C   . THR A 1 110 ? 69.741  43.805 11.770  1.00 30.80  ? 110  THR A C   1 
ATOM   848   O  O   . THR A 1 110 ? 70.469  43.154 11.023  1.00 30.11  ? 110  THR A O   1 
ATOM   849   C  CB  . THR A 1 110 ? 68.748  42.404 13.558  1.00 37.19  ? 110  THR A CB  1 
ATOM   850   O  OG1 . THR A 1 110 ? 67.538  41.834 14.063  1.00 40.66  ? 110  THR A OG1 1 
ATOM   851   C  CG2 . THR A 1 110 ? 69.359  43.292 14.635  1.00 37.76  ? 110  THR A CG2 1 
ATOM   852   N  N   . VAL A 1 111 ? 70.036  45.035 12.172  1.00 28.49  ? 111  VAL A N   1 
ATOM   853   C  CA  . VAL A 1 111 ? 71.255  45.708 11.738  1.00 26.26  ? 111  VAL A CA  1 
ATOM   854   C  C   . VAL A 1 111 ? 72.158  46.032 12.927  1.00 24.64  ? 111  VAL A C   1 
ATOM   855   O  O   . VAL A 1 111 ? 71.676  46.437 13.978  1.00 23.20  ? 111  VAL A O   1 
ATOM   856   C  CB  . VAL A 1 111 ? 70.930  47.031 11.002  1.00 27.37  ? 111  VAL A CB  1 
ATOM   857   C  CG1 . VAL A 1 111 ? 72.208  47.688 10.516  1.00 25.43  ? 111  VAL A CG1 1 
ATOM   858   C  CG2 . VAL A 1 111 ? 69.995  46.762 9.840   1.00 25.63  ? 111  VAL A CG2 1 
ATOM   859   N  N   . MET A 1 112 ? 73.466  45.849 12.747  1.00 25.12  ? 112  MET A N   1 
ATOM   860   C  CA  . MET A 1 112 ? 74.452  46.135 13.790  1.00 24.02  ? 112  MET A CA  1 
ATOM   861   C  C   . MET A 1 112 ? 75.506  47.087 13.217  1.00 23.91  ? 112  MET A C   1 
ATOM   862   O  O   . MET A 1 112 ? 76.123  46.797 12.198  1.00 24.46  ? 112  MET A O   1 
ATOM   863   C  CB  . MET A 1 112 ? 75.115  44.837 14.280  1.00 23.81  ? 112  MET A CB  1 
ATOM   864   C  CG  . MET A 1 112 ? 74.173  43.896 15.049  1.00 26.50  ? 112  MET A CG  1 
ATOM   865   S  SD  . MET A 1 112 ? 74.915  42.302 15.539  1.00 29.06  ? 112  MET A SD  1 
ATOM   866   C  CE  . MET A 1 112 ? 75.641  42.736 17.107  1.00 26.16  ? 112  MET A CE  1 
ATOM   867   N  N   . VAL A 1 113 ? 75.700  48.226 13.872  1.00 22.87  ? 113  VAL A N   1 
ATOM   868   C  CA  . VAL A 1 113 ? 76.668  49.218 13.411  1.00 22.34  ? 113  VAL A CA  1 
ATOM   869   C  C   . VAL A 1 113 ? 77.902  49.269 14.311  1.00 22.48  ? 113  VAL A C   1 
ATOM   870   O  O   . VAL A 1 113 ? 77.808  49.634 15.480  1.00 23.80  ? 113  VAL A O   1 
ATOM   871   C  CB  . VAL A 1 113 ? 76.017  50.624 13.353  1.00 22.09  ? 113  VAL A CB  1 
ATOM   872   C  CG1 . VAL A 1 113 ? 77.020  51.655 12.872  1.00 22.45  ? 113  VAL A CG1 1 
ATOM   873   C  CG2 . VAL A 1 113 ? 74.826  50.592 12.424  1.00 22.08  ? 113  VAL A CG2 1 
ATOM   874   N  N   . TRP A 1 114 ? 79.055  48.906 13.751  1.00 22.70  ? 114  TRP A N   1 
ATOM   875   C  CA  . TRP A 1 114 ? 80.326  48.890 14.476  1.00 22.04  ? 114  TRP A CA  1 
ATOM   876   C  C   . TRP A 1 114 ? 81.061  50.224 14.484  1.00 22.47  ? 114  TRP A C   1 
ATOM   877   O  O   . TRP A 1 114 ? 81.257  50.832 13.439  1.00 22.13  ? 114  TRP A O   1 
ATOM   878   C  CB  . TRP A 1 114 ? 81.260  47.834 13.880  1.00 21.84  ? 114  TRP A CB  1 
ATOM   879   C  CG  . TRP A 1 114 ? 82.625  47.808 14.528  1.00 23.92  ? 114  TRP A CG  1 
ATOM   880   C  CD1 . TRP A 1 114 ? 83.823  48.168 13.961  1.00 20.93  ? 114  TRP A CD1 1 
ATOM   881   C  CD2 . TRP A 1 114 ? 82.923  47.419 15.873  1.00 22.18  ? 114  TRP A CD2 1 
ATOM   882   N  NE1 . TRP A 1 114 ? 84.845  48.025 14.877  1.00 21.04  ? 114  TRP A NE1 1 
ATOM   883   C  CE2 . TRP A 1 114 ? 84.318  47.566 16.056  1.00 23.89  ? 114  TRP A CE2 1 
ATOM   884   C  CE3 . TRP A 1 114 ? 82.146  46.959 16.941  1.00 24.17  ? 114  TRP A CE3 1 
ATOM   885   C  CZ2 . TRP A 1 114 ? 84.947  47.267 17.268  1.00 24.16  ? 114  TRP A CZ2 1 
ATOM   886   C  CZ3 . TRP A 1 114 ? 82.777  46.660 18.150  1.00 23.50  ? 114  TRP A CZ3 1 
ATOM   887   C  CH2 . TRP A 1 114 ? 84.162  46.816 18.299  1.00 23.43  ? 114  TRP A CH2 1 
ATOM   888   N  N   . ILE A 1 115 ? 81.474  50.667 15.668  1.00 22.97  ? 115  ILE A N   1 
ATOM   889   C  CA  . ILE A 1 115 ? 82.226  51.910 15.815  1.00 23.11  ? 115  ILE A CA  1 
ATOM   890   C  C   . ILE A 1 115 ? 83.601  51.617 16.439  1.00 22.21  ? 115  ILE A C   1 
ATOM   891   O  O   . ILE A 1 115 ? 83.703  51.405 17.646  1.00 21.29  ? 115  ILE A O   1 
ATOM   892   C  CB  . ILE A 1 115 ? 81.481  52.903 16.714  1.00 23.32  ? 115  ILE A CB  1 
ATOM   893   C  CG1 . ILE A 1 115 ? 80.047  53.074 16.215  1.00 22.84  ? 115  ILE A CG1 1 
ATOM   894   C  CG2 . ILE A 1 115 ? 82.209  54.250 16.708  1.00 23.06  ? 115  ILE A CG2 1 
ATOM   895   C  CD1 . ILE A 1 115 ? 79.235  54.029 17.053  1.00 25.46  ? 115  ILE A CD1 1 
ATOM   896   N  N   . TYR A 1 116 ? 84.656  51.619 15.627  1.00 21.23  ? 116  TYR A N   1 
ATOM   897   C  CA  . TYR A 1 116 ? 85.995  51.316 16.135  1.00 21.89  ? 116  TYR A CA  1 
ATOM   898   C  C   . TYR A 1 116 ? 86.521  52.220 17.242  1.00 23.49  ? 116  TYR A C   1 
ATOM   899   O  O   . TYR A 1 116 ? 86.121  53.379 17.379  1.00 22.35  ? 116  TYR A O   1 
ATOM   900   C  CB  . TYR A 1 116 ? 87.028  51.271 14.989  1.00 21.74  ? 116  TYR A CB  1 
ATOM   901   C  CG  . TYR A 1 116 ? 87.190  52.554 14.197  1.00 21.37  ? 116  TYR A CG  1 
ATOM   902   C  CD1 . TYR A 1 116 ? 87.768  53.691 14.767  1.00 22.73  ? 116  TYR A CD1 1 
ATOM   903   C  CD2 . TYR A 1 116 ? 86.782  52.622 12.868  1.00 20.46  ? 116  TYR A CD2 1 
ATOM   904   C  CE1 . TYR A 1 116 ? 87.936  54.874 14.019  1.00 22.70  ? 116  TYR A CE1 1 
ATOM   905   C  CE2 . TYR A 1 116 ? 86.943  53.787 12.118  1.00 21.28  ? 116  TYR A CE2 1 
ATOM   906   C  CZ  . TYR A 1 116 ? 87.519  54.906 12.696  1.00 21.65  ? 116  TYR A CZ  1 
ATOM   907   O  OH  . TYR A 1 116 ? 87.681  56.038 11.941  1.00 21.36  ? 116  TYR A OH  1 
ATOM   908   N  N   . GLY A 1 117 ? 87.432  51.661 18.032  1.00 25.29  ? 117  GLY A N   1 
ATOM   909   C  CA  . GLY A 1 117 ? 88.038  52.402 19.124  1.00 25.75  ? 117  GLY A CA  1 
ATOM   910   C  C   . GLY A 1 117 ? 89.389  52.928 18.692  1.00 24.93  ? 117  GLY A C   1 
ATOM   911   O  O   . GLY A 1 117 ? 89.711  52.912 17.505  1.00 27.51  ? 117  GLY A O   1 
ATOM   912   N  N   . GLY A 1 118 ? 90.190  53.388 19.643  1.00 24.61  ? 118  GLY A N   1 
ATOM   913   C  CA  . GLY A 1 118 ? 91.498  53.910 19.294  1.00 23.54  ? 118  GLY A CA  1 
ATOM   914   C  C   . GLY A 1 118 ? 91.804  55.211 20.006  1.00 23.32  ? 118  GLY A C   1 
ATOM   915   O  O   . GLY A 1 118 ? 92.606  56.003 19.531  1.00 25.60  ? 118  GLY A O   1 
ATOM   916   N  N   . GLY A 1 119 ? 91.150  55.427 21.141  1.00 22.56  ? 119  GLY A N   1 
ATOM   917   C  CA  . GLY A 1 119 ? 91.368  56.622 21.936  1.00 24.80  ? 119  GLY A CA  1 
ATOM   918   C  C   . GLY A 1 119 ? 91.027  57.939 21.268  1.00 26.20  ? 119  GLY A C   1 
ATOM   919   O  O   . GLY A 1 119 ? 91.475  58.999 21.716  1.00 25.56  ? 119  GLY A O   1 
ATOM   920   N  N   . PHE A 1 120 ? 90.222  57.875 20.212  1.00 25.94  ? 120  PHE A N   1 
ATOM   921   C  CA  . PHE A 1 120 ? 89.834  59.059 19.452  1.00 26.32  ? 120  PHE A CA  1 
ATOM   922   C  C   . PHE A 1 120 ? 90.999  59.660 18.644  1.00 27.24  ? 120  PHE A C   1 
ATOM   923   O  O   . PHE A 1 120 ? 90.840  60.704 18.006  1.00 28.36  ? 120  PHE A O   1 
ATOM   924   C  CB  . PHE A 1 120 ? 89.242  60.128 20.381  1.00 23.07  ? 120  PHE A CB  1 
ATOM   925   C  CG  . PHE A 1 120 ? 87.900  59.758 20.958  1.00 22.66  ? 120  PHE A CG  1 
ATOM   926   C  CD1 . PHE A 1 120 ? 86.789  59.618 20.134  1.00 21.57  ? 120  PHE A CD1 1 
ATOM   927   C  CD2 . PHE A 1 120 ? 87.745  59.560 22.327  1.00 20.46  ? 120  PHE A CD2 1 
ATOM   928   C  CE1 . PHE A 1 120 ? 85.541  59.284 20.667  1.00 22.81  ? 120  PHE A CE1 1 
ATOM   929   C  CE2 . PHE A 1 120 ? 86.506  59.228 22.870  1.00 20.46  ? 120  PHE A CE2 1 
ATOM   930   C  CZ  . PHE A 1 120 ? 85.400  59.090 22.043  1.00 20.46  ? 120  PHE A CZ  1 
ATOM   931   N  N   . TYR A 1 121 ? 92.161  59.007 18.666  1.00 25.73  ? 121  TYR A N   1 
ATOM   932   C  CA  . TYR A 1 121 ? 93.329  59.506 17.922  1.00 24.99  ? 121  TYR A CA  1 
ATOM   933   C  C   . TYR A 1 121 ? 93.716  58.535 16.808  1.00 23.76  ? 121  TYR A C   1 
ATOM   934   O  O   . TYR A 1 121 ? 94.615  58.806 16.018  1.00 24.02  ? 121  TYR A O   1 
ATOM   935   C  CB  . TYR A 1 121 ? 94.531  59.712 18.864  1.00 24.32  ? 121  TYR A CB  1 
ATOM   936   C  CG  . TYR A 1 121 ? 95.151  58.425 19.382  1.00 25.06  ? 121  TYR A CG  1 
ATOM   937   C  CD1 . TYR A 1 121 ? 96.115  57.739 18.644  1.00 26.58  ? 121  TYR A CD1 1 
ATOM   938   C  CD2 . TYR A 1 121 ? 94.756  57.886 20.605  1.00 27.15  ? 121  TYR A CD2 1 
ATOM   939   C  CE1 . TYR A 1 121 ? 96.668  56.549 19.115  1.00 28.29  ? 121  TYR A CE1 1 
ATOM   940   C  CE2 . TYR A 1 121 ? 95.297  56.703 21.085  1.00 27.34  ? 121  TYR A CE2 1 
ATOM   941   C  CZ  . TYR A 1 121 ? 96.249  56.039 20.340  1.00 30.94  ? 121  TYR A CZ  1 
ATOM   942   O  OH  . TYR A 1 121 ? 96.771  54.859 20.827  1.00 32.92  ? 121  TYR A OH  1 
ATOM   943   N  N   . SER A 1 122 ? 93.028  57.403 16.746  1.00 23.83  ? 122  SER A N   1 
ATOM   944   C  CA  . SER A 1 122 ? 93.324  56.405 15.728  1.00 24.00  ? 122  SER A CA  1 
ATOM   945   C  C   . SER A 1 122 ? 92.183  55.426 15.517  1.00 23.82  ? 122  SER A C   1 
ATOM   946   O  O   . SER A 1 122 ? 91.133  55.530 16.145  1.00 21.83  ? 122  SER A O   1 
ATOM   947   C  CB  . SER A 1 122 ? 94.579  55.626 16.110  1.00 25.95  ? 122  SER A CB  1 
ATOM   948   O  OG  . SER A 1 122 ? 94.375  54.933 17.325  1.00 28.66  ? 122  SER A OG  1 
ATOM   949   N  N   . GLY A 1 123 ? 92.409  54.469 14.622  1.00 24.95  ? 123  GLY A N   1 
ATOM   950   C  CA  . GLY A 1 123 ? 91.403  53.469 14.334  1.00 25.55  ? 123  GLY A CA  1 
ATOM   951   C  C   . GLY A 1 123 ? 91.036  53.446 12.867  1.00 26.13  ? 123  GLY A C   1 
ATOM   952   O  O   . GLY A 1 123 ? 91.166  54.442 12.169  1.00 26.03  ? 123  GLY A O   1 
ATOM   953   N  N   . SER A 1 124 ? 90.583  52.294 12.397  1.00 27.46  ? 124  SER A N   1 
ATOM   954   C  CA  . SER A 1 124 ? 90.188  52.134 11.007  1.00 29.09  ? 124  SER A CA  1 
ATOM   955   C  C   . SER A 1 124 ? 89.051  51.137 10.954  1.00 28.97  ? 124  SER A C   1 
ATOM   956   O  O   . SER A 1 124 ? 88.928  50.276 11.826  1.00 27.84  ? 124  SER A O   1 
ATOM   957   C  CB  . SER A 1 124 ? 91.354  51.612 10.163  1.00 28.93  ? 124  SER A CB  1 
ATOM   958   O  OG  . SER A 1 124 ? 92.428  52.534 10.150  1.00 30.89  ? 124  SER A OG  1 
ATOM   959   N  N   . SER A 1 125 ? 88.225  51.255 9.923   1.00 29.17  ? 125  SER A N   1 
ATOM   960   C  CA  . SER A 1 125 ? 87.095  50.364 9.755   1.00 29.83  ? 125  SER A CA  1 
ATOM   961   C  C   . SER A 1 125 ? 87.532  49.167 8.933   1.00 29.30  ? 125  SER A C   1 
ATOM   962   O  O   . SER A 1 125 ? 86.824  48.167 8.851   1.00 30.51  ? 125  SER A O   1 
ATOM   963   C  CB  . SER A 1 125 ? 85.971  51.086 9.009   1.00 27.76  ? 125  SER A CB  1 
ATOM   964   O  OG  . SER A 1 125 ? 86.310  51.268 7.648   1.00 27.73  ? 125  SER A OG  1 
ATOM   965   N  N   . THR A 1 126 ? 88.713  49.287 8.336   1.00 29.76  ? 126  THR A N   1 
ATOM   966   C  CA  . THR A 1 126 ? 89.258  48.265 7.446   1.00 28.17  ? 126  THR A CA  1 
ATOM   967   C  C   . THR A 1 126 ? 90.132  47.172 8.046   1.00 28.50  ? 126  THR A C   1 
ATOM   968   O  O   . THR A 1 126 ? 90.628  46.318 7.310   1.00 29.70  ? 126  THR A O   1 
ATOM   969   C  CB  . THR A 1 126 ? 90.060  48.938 6.326   1.00 27.80  ? 126  THR A CB  1 
ATOM   970   O  OG1 . THR A 1 126 ? 91.153  49.658 6.900   1.00 22.35  ? 126  THR A OG1 1 
ATOM   971   C  CG2 . THR A 1 126 ? 89.187  49.921 5.560   1.00 27.72  ? 126  THR A CG2 1 
ATOM   972   N  N   . LEU A 1 127 ? 90.324  47.191 9.363   1.00 28.53  ? 127  LEU A N   1 
ATOM   973   C  CA  . LEU A 1 127 ? 91.157  46.196 10.028  1.00 28.91  ? 127  LEU A CA  1 
ATOM   974   C  C   . LEU A 1 127 ? 90.655  44.770 9.846   1.00 30.35  ? 127  LEU A C   1 
ATOM   975   O  O   . LEU A 1 127 ? 89.453  44.521 9.818   1.00 29.40  ? 127  LEU A O   1 
ATOM   976   C  CB  . LEU A 1 127 ? 91.258  46.494 11.524  1.00 28.13  ? 127  LEU A CB  1 
ATOM   977   C  CG  . LEU A 1 127 ? 91.858  47.836 11.951  1.00 29.53  ? 127  LEU A CG  1 
ATOM   978   C  CD1 . LEU A 1 127 ? 92.047  47.840 13.464  1.00 24.92  ? 127  LEU A CD1 1 
ATOM   979   C  CD2 . LEU A 1 127 ? 93.193  48.057 11.252  1.00 27.25  ? 127  LEU A CD2 1 
ATOM   980   N  N   . ASP A 1 128 ? 91.591  43.837 9.730   1.00 32.13  ? 128  ASP A N   1 
ATOM   981   C  CA  . ASP A 1 128 ? 91.258  42.429 9.568   1.00 35.37  ? 128  ASP A CA  1 
ATOM   982   C  C   . ASP A 1 128 ? 90.306  41.965 10.660  1.00 34.82  ? 128  ASP A C   1 
ATOM   983   O  O   . ASP A 1 128 ? 89.313  41.291 10.375  1.00 35.94  ? 128  ASP A O   1 
ATOM   984   C  CB  . ASP A 1 128 ? 92.528  41.575 9.612   1.00 39.77  ? 128  ASP A CB  1 
ATOM   985   C  CG  . ASP A 1 128 ? 93.390  41.743 8.375   1.00 44.66  ? 128  ASP A CG  1 
ATOM   986   O  OD1 . ASP A 1 128 ? 93.133  42.685 7.592   1.00 46.95  ? 128  ASP A OD1 1 
ATOM   987   O  OD2 . ASP A 1 128 ? 94.332  40.937 8.184   1.00 49.03  ? 128  ASP A OD2 1 
ATOM   988   N  N   . VAL A 1 129 ? 90.606  42.326 11.908  1.00 34.22  ? 129  VAL A N   1 
ATOM   989   C  CA  . VAL A 1 129 ? 89.768  41.929 13.039  1.00 33.52  ? 129  VAL A CA  1 
ATOM   990   C  C   . VAL A 1 129 ? 88.355  42.507 13.017  1.00 32.63  ? 129  VAL A C   1 
ATOM   991   O  O   . VAL A 1 129 ? 87.512  42.121 13.828  1.00 32.91  ? 129  VAL A O   1 
ATOM   992   C  CB  . VAL A 1 129 ? 90.424  42.293 14.401  1.00 35.87  ? 129  VAL A CB  1 
ATOM   993   C  CG1 . VAL A 1 129 ? 91.661  41.441 14.620  1.00 36.10  ? 129  VAL A CG1 1 
ATOM   994   C  CG2 . VAL A 1 129 ? 90.778  43.777 14.442  1.00 34.91  ? 129  VAL A CG2 1 
ATOM   995   N  N   . TYR A 1 130 ? 88.090  43.436 12.104  1.00 32.14  ? 130  TYR A N   1 
ATOM   996   C  CA  . TYR A 1 130 ? 86.752  44.016 12.010  1.00 30.63  ? 130  TYR A CA  1 
ATOM   997   C  C   . TYR A 1 130 ? 86.055  43.509 10.753  1.00 30.68  ? 130  TYR A C   1 
ATOM   998   O  O   . TYR A 1 130 ? 85.046  44.070 10.326  1.00 31.95  ? 130  TYR A O   1 
ATOM   999   C  CB  . TYR A 1 130 ? 86.797  45.548 11.963  1.00 28.86  ? 130  TYR A CB  1 
ATOM   1000  C  CG  . TYR A 1 130 ? 87.472  46.231 13.134  1.00 27.75  ? 130  TYR A CG  1 
ATOM   1001  C  CD1 . TYR A 1 130 ? 87.510  45.640 14.401  1.00 26.88  ? 130  TYR A CD1 1 
ATOM   1002  C  CD2 . TYR A 1 130 ? 88.039  47.499 12.981  1.00 27.42  ? 130  TYR A CD2 1 
ATOM   1003  C  CE1 . TYR A 1 130 ? 88.097  46.298 15.483  1.00 26.23  ? 130  TYR A CE1 1 
ATOM   1004  C  CE2 . TYR A 1 130 ? 88.624  48.165 14.054  1.00 25.89  ? 130  TYR A CE2 1 
ATOM   1005  C  CZ  . TYR A 1 130 ? 88.653  47.565 15.299  1.00 25.55  ? 130  TYR A CZ  1 
ATOM   1006  O  OH  . TYR A 1 130 ? 89.241  48.227 16.351  1.00 22.53  ? 130  TYR A OH  1 
ATOM   1007  N  N   . ASN A 1 131 ? 86.607  42.461 10.148  1.00 31.43  ? 131  ASN A N   1 
ATOM   1008  C  CA  . ASN A 1 131 ? 86.011  41.880 8.951   1.00 31.33  ? 131  ASN A CA  1 
ATOM   1009  C  C   . ASN A 1 131 ? 84.633  41.378 9.358   1.00 30.89  ? 131  ASN A C   1 
ATOM   1010  O  O   . ASN A 1 131 ? 84.522  40.388 10.084  1.00 31.53  ? 131  ASN A O   1 
ATOM   1011  C  CB  . ASN A 1 131 ? 86.848  40.708 8.459   1.00 34.49  ? 131  ASN A CB  1 
ATOM   1012  C  CG  . ASN A 1 131 ? 86.404  40.210 7.100   1.00 37.22  ? 131  ASN A CG  1 
ATOM   1013  O  OD1 . ASN A 1 131 ? 85.216  40.232 6.772   1.00 39.63  ? 131  ASN A OD1 1 
ATOM   1014  N  ND2 . ASN A 1 131 ? 87.358  39.743 6.302   1.00 38.95  ? 131  ASN A ND2 1 
ATOM   1015  N  N   . GLY A 1 132 ? 83.589  42.049 8.881   1.00 28.79  ? 132  GLY A N   1 
ATOM   1016  C  CA  . GLY A 1 132 ? 82.236  41.667 9.249   1.00 29.09  ? 132  GLY A CA  1 
ATOM   1017  C  C   . GLY A 1 132 ? 81.542  40.485 8.582   1.00 29.78  ? 132  GLY A C   1 
ATOM   1018  O  O   . GLY A 1 132 ? 80.398  40.188 8.926   1.00 27.05  ? 132  GLY A O   1 
ATOM   1019  N  N   . LYS A 1 133 ? 82.207  39.795 7.658   1.00 29.65  ? 133  LYS A N   1 
ATOM   1020  C  CA  . LYS A 1 133 ? 81.572  38.671 6.969   1.00 31.53  ? 133  LYS A CA  1 
ATOM   1021  C  C   . LYS A 1 133 ? 81.176  37.477 7.846   1.00 31.98  ? 133  LYS A C   1 
ATOM   1022  O  O   . LYS A 1 133 ? 80.101  36.907 7.666   1.00 32.88  ? 133  LYS A O   1 
ATOM   1023  C  CB  . LYS A 1 133 ? 82.453  38.187 5.812   1.00 30.90  ? 133  LYS A CB  1 
ATOM   1024  C  CG  . LYS A 1 133 ? 83.798  37.621 6.211   1.00 31.90  ? 133  LYS A CG  1 
ATOM   1025  C  CD  . LYS A 1 133 ? 84.559  37.165 4.973   1.00 33.31  ? 133  LYS A CD  1 
ATOM   1026  C  CE  . LYS A 1 133 ? 85.940  36.641 5.320   1.00 33.41  ? 133  LYS A CE  1 
ATOM   1027  N  NZ  . LYS A 1 133 ? 86.635  36.054 4.145   1.00 32.78  ? 133  LYS A NZ  1 
ATOM   1028  N  N   . TYR A 1 134 ? 82.027  37.103 8.794   1.00 31.53  ? 134  TYR A N   1 
ATOM   1029  C  CA  . TYR A 1 134 ? 81.736  35.967 9.661   1.00 32.87  ? 134  TYR A CA  1 
ATOM   1030  C  C   . TYR A 1 134 ? 80.501  36.182 10.530  1.00 33.44  ? 134  TYR A C   1 
ATOM   1031  O  O   . TYR A 1 134 ? 79.641  35.307 10.628  1.00 34.84  ? 134  TYR A O   1 
ATOM   1032  C  CB  . TYR A 1 134 ? 82.937  35.659 10.558  1.00 33.68  ? 134  TYR A CB  1 
ATOM   1033  C  CG  . TYR A 1 134 ? 84.246  35.549 9.808   1.00 35.07  ? 134  TYR A CG  1 
ATOM   1034  C  CD1 . TYR A 1 134 ? 85.186  36.580 9.853   1.00 33.81  ? 134  TYR A CD1 1 
ATOM   1035  C  CD2 . TYR A 1 134 ? 84.540  34.420 9.035   1.00 34.20  ? 134  TYR A CD2 1 
ATOM   1036  C  CE1 . TYR A 1 134 ? 86.387  36.492 9.150   1.00 34.41  ? 134  TYR A CE1 1 
ATOM   1037  C  CE2 . TYR A 1 134 ? 85.741  34.324 8.325   1.00 33.73  ? 134  TYR A CE2 1 
ATOM   1038  C  CZ  . TYR A 1 134 ? 86.657  35.363 8.391   1.00 33.74  ? 134  TYR A CZ  1 
ATOM   1039  O  OH  . TYR A 1 134 ? 87.847  35.271 7.709   1.00 34.28  ? 134  TYR A OH  1 
ATOM   1040  N  N   . LEU A 1 135 ? 80.415  37.343 11.163  1.00 33.44  ? 135  LEU A N   1 
ATOM   1041  C  CA  . LEU A 1 135 ? 79.284  37.649 12.029  1.00 34.76  ? 135  LEU A CA  1 
ATOM   1042  C  C   . LEU A 1 135 ? 77.983  37.813 11.242  1.00 36.37  ? 135  LEU A C   1 
ATOM   1043  O  O   . LEU A 1 135 ? 76.936  37.290 11.635  1.00 37.28  ? 135  LEU A O   1 
ATOM   1044  C  CB  . LEU A 1 135 ? 79.584  38.912 12.837  1.00 33.92  ? 135  LEU A CB  1 
ATOM   1045  C  CG  . LEU A 1 135 ? 78.497  39.497 13.737  1.00 34.38  ? 135  LEU A CG  1 
ATOM   1046  C  CD1 . LEU A 1 135 ? 77.976  38.455 14.705  1.00 34.27  ? 135  LEU A CD1 1 
ATOM   1047  C  CD2 . LEU A 1 135 ? 79.083  40.672 14.495  1.00 34.98  ? 135  LEU A CD2 1 
ATOM   1048  N  N   . ALA A 1 136 ? 78.049  38.530 10.127  1.00 36.67  ? 136  ALA A N   1 
ATOM   1049  C  CA  . ALA A 1 136 ? 76.865  38.746 9.308   1.00 37.28  ? 136  ALA A CA  1 
ATOM   1050  C  C   . ALA A 1 136 ? 76.296  37.408 8.843   1.00 37.97  ? 136  ALA A C   1 
ATOM   1051  O  O   . ALA A 1 136 ? 75.092  37.167 8.922   1.00 37.27  ? 136  ALA A O   1 
ATOM   1052  C  CB  . ALA A 1 136 ? 77.211  39.616 8.106   1.00 34.30  ? 136  ALA A CB  1 
ATOM   1053  N  N   . TYR A 1 137 ? 77.175  36.537 8.367   1.00 37.74  ? 137  TYR A N   1 
ATOM   1054  C  CA  . TYR A 1 137 ? 76.769  35.225 7.884   1.00 40.36  ? 137  TYR A CA  1 
ATOM   1055  C  C   . TYR A 1 137 ? 76.243  34.326 9.006   1.00 40.95  ? 137  TYR A C   1 
ATOM   1056  O  O   . TYR A 1 137 ? 75.079  33.913 9.004   1.00 41.38  ? 137  TYR A O   1 
ATOM   1057  C  CB  . TYR A 1 137 ? 77.960  34.566 7.182   1.00 41.91  ? 137  TYR A CB  1 
ATOM   1058  C  CG  . TYR A 1 137 ? 77.774  33.108 6.842   1.00 44.00  ? 137  TYR A CG  1 
ATOM   1059  C  CD1 . TYR A 1 137 ? 78.302  32.112 7.659   1.00 44.21  ? 137  TYR A CD1 1 
ATOM   1060  C  CD2 . TYR A 1 137 ? 77.074  32.721 5.699   1.00 45.92  ? 137  TYR A CD2 1 
ATOM   1061  C  CE1 . TYR A 1 137 ? 78.143  30.767 7.350   1.00 45.56  ? 137  TYR A CE1 1 
ATOM   1062  C  CE2 . TYR A 1 137 ? 76.907  31.371 5.378   1.00 45.93  ? 137  TYR A CE2 1 
ATOM   1063  C  CZ  . TYR A 1 137 ? 77.446  30.404 6.209   1.00 45.82  ? 137  TYR A CZ  1 
ATOM   1064  O  OH  . TYR A 1 137 ? 77.286  29.076 5.907   1.00 48.12  ? 137  TYR A OH  1 
ATOM   1065  N  N   . THR A 1 138 ? 77.108  34.043 9.972   1.00 40.19  ? 138  THR A N   1 
ATOM   1066  C  CA  . THR A 1 138 ? 76.768  33.189 11.096  1.00 38.88  ? 138  THR A CA  1 
ATOM   1067  C  C   . THR A 1 138 ? 75.461  33.560 11.794  1.00 38.97  ? 138  THR A C   1 
ATOM   1068  O  O   . THR A 1 138 ? 74.625  32.697 12.044  1.00 38.39  ? 138  THR A O   1 
ATOM   1069  C  CB  . THR A 1 138 ? 77.908  33.192 12.137  1.00 39.13  ? 138  THR A CB  1 
ATOM   1070  O  OG1 . THR A 1 138 ? 79.138  32.824 11.498  1.00 35.86  ? 138  THR A OG1 1 
ATOM   1071  C  CG2 . THR A 1 138 ? 77.605  32.210 13.263  1.00 37.38  ? 138  THR A CG2 1 
ATOM   1072  N  N   . GLU A 1 139 ? 75.278  34.838 12.110  1.00 39.16  ? 139  GLU A N   1 
ATOM   1073  C  CA  . GLU A 1 139 ? 74.067  35.270 12.806  1.00 38.68  ? 139  GLU A CA  1 
ATOM   1074  C  C   . GLU A 1 139 ? 72.988  35.854 11.906  1.00 39.69  ? 139  GLU A C   1 
ATOM   1075  O  O   . GLU A 1 139 ? 71.907  36.215 12.370  1.00 38.93  ? 139  GLU A O   1 
ATOM   1076  C  CB  . GLU A 1 139 ? 74.430  36.274 13.895  1.00 38.09  ? 139  GLU A CB  1 
ATOM   1077  C  CG  . GLU A 1 139 ? 75.261  35.671 15.009  1.00 37.83  ? 139  GLU A CG  1 
ATOM   1078  C  CD  . GLU A 1 139 ? 74.551  34.522 15.694  1.00 37.86  ? 139  GLU A CD  1 
ATOM   1079  O  OE1 . GLU A 1 139 ? 73.416  34.725 16.177  1.00 39.81  ? 139  GLU A OE1 1 
ATOM   1080  O  OE2 . GLU A 1 139 ? 75.122  33.417 15.754  1.00 38.91  ? 139  GLU A OE2 1 
ATOM   1081  N  N   . GLU A 1 140 ? 73.296  35.947 10.619  1.00 42.21  ? 140  GLU A N   1 
ATOM   1082  C  CA  . GLU A 1 140 ? 72.367  36.466 9.623   1.00 44.43  ? 140  GLU A CA  1 
ATOM   1083  C  C   . GLU A 1 140 ? 71.808  37.850 9.958   1.00 43.02  ? 140  GLU A C   1 
ATOM   1084  O  O   . GLU A 1 140 ? 70.605  38.029 10.139  1.00 45.02  ? 140  GLU A O   1 
ATOM   1085  C  CB  . GLU A 1 140 ? 71.236  35.455 9.410   1.00 47.78  ? 140  GLU A CB  1 
ATOM   1086  C  CG  . GLU A 1 140 ? 71.769  34.028 9.262   1.00 55.60  ? 140  GLU A CG  1 
ATOM   1087  C  CD  . GLU A 1 140 ? 70.759  33.055 8.678   1.00 59.62  ? 140  GLU A CD  1 
ATOM   1088  O  OE1 . GLU A 1 140 ? 70.471  33.156 7.461   1.00 61.68  ? 140  GLU A OE1 1 
ATOM   1089  O  OE2 . GLU A 1 140 ? 70.258  32.193 9.438   1.00 59.79  ? 140  GLU A OE2 1 
ATOM   1090  N  N   . VAL A 1 141 ? 72.706  38.824 10.045  1.00 39.85  ? 141  VAL A N   1 
ATOM   1091  C  CA  . VAL A 1 141 ? 72.334  40.202 10.324  1.00 36.37  ? 141  VAL A CA  1 
ATOM   1092  C  C   . VAL A 1 141 ? 73.077  41.025 9.298   1.00 32.80  ? 141  VAL A C   1 
ATOM   1093  O  O   . VAL A 1 141 ? 74.009  40.539 8.671   1.00 30.91  ? 141  VAL A O   1 
ATOM   1094  C  CB  . VAL A 1 141 ? 72.799  40.690 11.734  1.00 37.31  ? 141  VAL A CB  1 
ATOM   1095  C  CG1 . VAL A 1 141 ? 72.171  39.845 12.828  1.00 38.47  ? 141  VAL A CG1 1 
ATOM   1096  C  CG2 . VAL A 1 141 ? 74.318  40.651 11.826  1.00 35.44  ? 141  VAL A CG2 1 
ATOM   1097  N  N   . VAL A 1 142 ? 72.652  42.266 9.118   1.00 31.26  ? 142  VAL A N   1 
ATOM   1098  C  CA  . VAL A 1 142 ? 73.324  43.157 8.194   1.00 30.38  ? 142  VAL A CA  1 
ATOM   1099  C  C   . VAL A 1 142 ? 74.313  43.915 9.069   1.00 30.26  ? 142  VAL A C   1 
ATOM   1100  O  O   . VAL A 1 142 ? 73.921  44.625 9.993   1.00 30.59  ? 142  VAL A O   1 
ATOM   1101  C  CB  . VAL A 1 142 ? 72.331  44.137 7.533   1.00 30.65  ? 142  VAL A CB  1 
ATOM   1102  C  CG1 . VAL A 1 142 ? 73.084  45.172 6.704   1.00 28.63  ? 142  VAL A CG1 1 
ATOM   1103  C  CG2 . VAL A 1 142 ? 71.350  43.359 6.656   1.00 30.08  ? 142  VAL A CG2 1 
ATOM   1104  N  N   . LEU A 1 143 ? 75.598  43.736 8.792   1.00 30.90  ? 143  LEU A N   1 
ATOM   1105  C  CA  . LEU A 1 143 ? 76.638  44.384 9.573   1.00 29.91  ? 143  LEU A CA  1 
ATOM   1106  C  C   . LEU A 1 143 ? 77.214  45.595 8.863   1.00 28.75  ? 143  LEU A C   1 
ATOM   1107  O  O   . LEU A 1 143 ? 77.644  45.510 7.714   1.00 30.41  ? 143  LEU A O   1 
ATOM   1108  C  CB  . LEU A 1 143 ? 77.759  43.389 9.872   1.00 32.22  ? 143  LEU A CB  1 
ATOM   1109  C  CG  . LEU A 1 143 ? 78.825  43.836 10.873  1.00 32.27  ? 143  LEU A CG  1 
ATOM   1110  C  CD1 . LEU A 1 143 ? 78.187  44.152 12.219  1.00 30.56  ? 143  LEU A CD1 1 
ATOM   1111  C  CD2 . LEU A 1 143 ? 79.837  42.729 11.027  1.00 36.04  ? 143  LEU A CD2 1 
ATOM   1112  N  N   . VAL A 1 144 ? 77.225  46.718 9.565   1.00 26.46  ? 144  VAL A N   1 
ATOM   1113  C  CA  . VAL A 1 144 ? 77.745  47.963 9.030   1.00 24.93  ? 144  VAL A CA  1 
ATOM   1114  C  C   . VAL A 1 144 ? 78.902  48.433 9.896   1.00 25.56  ? 144  VAL A C   1 
ATOM   1115  O  O   . VAL A 1 144 ? 78.831  48.368 11.123  1.00 24.92  ? 144  VAL A O   1 
ATOM   1116  C  CB  . VAL A 1 144 ? 76.665  49.091 9.051   1.00 24.35  ? 144  VAL A CB  1 
ATOM   1117  C  CG1 . VAL A 1 144 ? 77.281  50.431 8.644   1.00 20.46  ? 144  VAL A CG1 1 
ATOM   1118  C  CG2 . VAL A 1 144 ? 75.511  48.735 8.137   1.00 24.21  ? 144  VAL A CG2 1 
ATOM   1119  N  N   . SER A 1 145 ? 79.972  48.884 9.255   1.00 24.97  ? 145  SER A N   1 
ATOM   1120  C  CA  . SER A 1 145 ? 81.104  49.433 9.980   1.00 25.23  ? 145  SER A CA  1 
ATOM   1121  C  C   . SER A 1 145 ? 81.319  50.826 9.369   1.00 25.46  ? 145  SER A C   1 
ATOM   1122  O  O   . SER A 1 145 ? 81.461  50.970 8.155   1.00 24.64  ? 145  SER A O   1 
ATOM   1123  C  CB  . SER A 1 145 ? 82.348  48.542 9.834   1.00 24.05  ? 145  SER A CB  1 
ATOM   1124  O  OG  . SER A 1 145 ? 82.790  48.442 8.494   1.00 30.01  ? 145  SER A OG  1 
ATOM   1125  N  N   . LEU A 1 146 ? 81.312  51.850 10.216  1.00 24.28  ? 146  LEU A N   1 
ATOM   1126  C  CA  . LEU A 1 146 ? 81.479  53.222 9.764   1.00 24.10  ? 146  LEU A CA  1 
ATOM   1127  C  C   . LEU A 1 146 ? 82.859  53.760 10.118  1.00 25.57  ? 146  LEU A C   1 
ATOM   1128  O  O   . LEU A 1 146 ? 83.665  53.070 10.729  1.00 26.64  ? 146  LEU A O   1 
ATOM   1129  C  CB  . LEU A 1 146 ? 80.387  54.096 10.396  1.00 21.31  ? 146  LEU A CB  1 
ATOM   1130  C  CG  . LEU A 1 146 ? 80.223  54.074 11.919  1.00 20.46  ? 146  LEU A CG  1 
ATOM   1131  C  CD1 . LEU A 1 146 ? 81.255  54.976 12.572  1.00 21.97  ? 146  LEU A CD1 1 
ATOM   1132  C  CD2 . LEU A 1 146 ? 78.840  54.550 12.290  1.00 22.50  ? 146  LEU A CD2 1 
ATOM   1133  N  N   . SER A 1 147 ? 83.142  54.994 9.727   1.00 26.17  ? 147  SER A N   1 
ATOM   1134  C  CA  . SER A 1 147 ? 84.432  55.582 10.056  1.00 26.68  ? 147  SER A CA  1 
ATOM   1135  C  C   . SER A 1 147 ? 84.181  57.007 10.492  1.00 26.77  ? 147  SER A C   1 
ATOM   1136  O  O   . SER A 1 147 ? 83.094  57.535 10.277  1.00 28.43  ? 147  SER A O   1 
ATOM   1137  C  CB  . SER A 1 147 ? 85.369  55.561 8.847   1.00 29.45  ? 147  SER A CB  1 
ATOM   1138  O  OG  . SER A 1 147 ? 84.868  56.380 7.810   1.00 35.41  ? 147  SER A OG  1 
ATOM   1139  N  N   . TYR A 1 148 ? 85.171  57.620 11.129  1.00 25.38  ? 148  TYR A N   1 
ATOM   1140  C  CA  . TYR A 1 148 ? 85.040  58.996 11.581  1.00 23.62  ? 148  TYR A CA  1 
ATOM   1141  C  C   . TYR A 1 148 ? 86.414  59.604 11.815  1.00 22.86  ? 148  TYR A C   1 
ATOM   1142  O  O   . TYR A 1 148 ? 87.370  58.900 12.137  1.00 21.57  ? 148  TYR A O   1 
ATOM   1143  C  CB  . TYR A 1 148 ? 84.210  59.073 12.875  1.00 23.67  ? 148  TYR A CB  1 
ATOM   1144  C  CG  . TYR A 1 148 ? 84.777  58.265 14.017  1.00 22.32  ? 148  TYR A CG  1 
ATOM   1145  C  CD1 . TYR A 1 148 ? 84.602  56.880 14.070  1.00 21.36  ? 148  TYR A CD1 1 
ATOM   1146  C  CD2 . TYR A 1 148 ? 85.517  58.879 15.030  1.00 21.47  ? 148  TYR A CD2 1 
ATOM   1147  C  CE1 . TYR A 1 148 ? 85.146  56.130 15.097  1.00 20.46  ? 148  TYR A CE1 1 
ATOM   1148  C  CE2 . TYR A 1 148 ? 86.072  58.136 16.067  1.00 20.46  ? 148  TYR A CE2 1 
ATOM   1149  C  CZ  . TYR A 1 148 ? 85.880  56.760 16.092  1.00 21.47  ? 148  TYR A CZ  1 
ATOM   1150  O  OH  . TYR A 1 148 ? 86.416  56.012 17.111  1.00 20.75  ? 148  TYR A OH  1 
ATOM   1151  N  N   . ARG A 1 149 ? 86.501  60.919 11.656  1.00 22.45  ? 149  ARG A N   1 
ATOM   1152  C  CA  . ARG A 1 149 ? 87.756  61.626 11.851  1.00 22.79  ? 149  ARG A CA  1 
ATOM   1153  C  C   . ARG A 1 149 ? 88.272  61.507 13.288  1.00 23.17  ? 149  ARG A C   1 
ATOM   1154  O  O   . ARG A 1 149 ? 87.504  61.581 14.251  1.00 21.82  ? 149  ARG A O   1 
ATOM   1155  C  CB  . ARG A 1 149 ? 87.588  63.098 11.464  1.00 23.53  ? 149  ARG A CB  1 
ATOM   1156  C  CG  . ARG A 1 149 ? 87.540  63.334 9.950   1.00 24.29  ? 149  ARG A CG  1 
ATOM   1157  C  CD  . ARG A 1 149 ? 87.152  64.768 9.607   1.00 23.64  ? 149  ARG A CD  1 
ATOM   1158  N  NE  . ARG A 1 149 ? 85.723  64.997 9.798   1.00 25.47  ? 149  ARG A NE  1 
ATOM   1159  C  CZ  . ARG A 1 149 ? 85.122  66.178 9.682   1.00 25.14  ? 149  ARG A CZ  1 
ATOM   1160  N  NH1 . ARG A 1 149 ? 85.823  67.265 9.379   1.00 24.22  ? 149  ARG A NH1 1 
ATOM   1161  N  NH2 . ARG A 1 149 ? 83.812  66.270 9.861   1.00 23.35  ? 149  ARG A NH2 1 
ATOM   1162  N  N   . VAL A 1 150 ? 89.583  61.313 13.416  1.00 22.27  ? 150  VAL A N   1 
ATOM   1163  C  CA  . VAL A 1 150 ? 90.226  61.187 14.712  1.00 22.64  ? 150  VAL A CA  1 
ATOM   1164  C  C   . VAL A 1 150 ? 91.296  62.258 14.878  1.00 24.86  ? 150  VAL A C   1 
ATOM   1165  O  O   . VAL A 1 150 ? 91.630  62.966 13.926  1.00 25.02  ? 150  VAL A O   1 
ATOM   1166  C  CB  . VAL A 1 150 ? 90.878  59.803 14.874  1.00 22.80  ? 150  VAL A CB  1 
ATOM   1167  C  CG1 . VAL A 1 150 ? 89.809  58.711 14.820  1.00 20.46  ? 150  VAL A CG1 1 
ATOM   1168  C  CG2 . VAL A 1 150 ? 91.917  59.594 13.788  1.00 20.46  ? 150  VAL A CG2 1 
ATOM   1169  N  N   . GLY A 1 151 ? 91.833  62.367 16.089  1.00 24.54  ? 151  GLY A N   1 
ATOM   1170  C  CA  . GLY A 1 151 ? 92.855  63.360 16.352  1.00 25.23  ? 151  GLY A CA  1 
ATOM   1171  C  C   . GLY A 1 151 ? 92.320  64.770 16.168  1.00 26.20  ? 151  GLY A C   1 
ATOM   1172  O  O   . GLY A 1 151 ? 91.107  64.999 16.239  1.00 24.46  ? 151  GLY A O   1 
ATOM   1173  N  N   . ALA A 1 152 ? 93.222  65.718 15.927  1.00 25.35  ? 152  ALA A N   1 
ATOM   1174  C  CA  . ALA A 1 152 ? 92.821  67.112 15.733  1.00 26.51  ? 152  ALA A CA  1 
ATOM   1175  C  C   . ALA A 1 152 ? 91.798  67.238 14.604  1.00 25.90  ? 152  ALA A C   1 
ATOM   1176  O  O   . ALA A 1 152 ? 90.873  68.035 14.685  1.00 25.65  ? 152  ALA A O   1 
ATOM   1177  C  CB  . ALA A 1 152 ? 94.045  67.975 15.430  1.00 27.61  ? 152  ALA A CB  1 
ATOM   1178  N  N   . PHE A 1 153 ? 91.960  66.431 13.562  1.00 24.89  ? 153  PHE A N   1 
ATOM   1179  C  CA  . PHE A 1 153 ? 91.057  66.477 12.422  1.00 26.97  ? 153  PHE A CA  1 
ATOM   1180  C  C   . PHE A 1 153 ? 89.604  66.287 12.826  1.00 28.08  ? 153  PHE A C   1 
ATOM   1181  O  O   . PHE A 1 153 ? 88.708  66.875 12.222  1.00 30.39  ? 153  PHE A O   1 
ATOM   1182  C  CB  . PHE A 1 153 ? 91.440  65.404 11.402  1.00 26.03  ? 153  PHE A CB  1 
ATOM   1183  C  CG  . PHE A 1 153 ? 92.851  65.509 10.921  1.00 27.79  ? 153  PHE A CG  1 
ATOM   1184  C  CD1 . PHE A 1 153 ? 93.232  66.531 10.059  1.00 28.07  ? 153  PHE A CD1 1 
ATOM   1185  C  CD2 . PHE A 1 153 ? 93.811  64.588 11.339  1.00 28.29  ? 153  PHE A CD2 1 
ATOM   1186  C  CE1 . PHE A 1 153 ? 94.560  66.634 9.616   1.00 29.61  ? 153  PHE A CE1 1 
ATOM   1187  C  CE2 . PHE A 1 153 ? 95.136  64.682 10.905  1.00 28.99  ? 153  PHE A CE2 1 
ATOM   1188  C  CZ  . PHE A 1 153 ? 95.509  65.706 10.043  1.00 29.83  ? 153  PHE A CZ  1 
ATOM   1189  N  N   . GLY A 1 154 ? 89.365  65.468 13.845  1.00 27.61  ? 154  GLY A N   1 
ATOM   1190  C  CA  . GLY A 1 154 ? 87.997  65.230 14.264  1.00 25.36  ? 154  GLY A CA  1 
ATOM   1191  C  C   . GLY A 1 154 ? 87.590  65.801 15.606  1.00 23.33  ? 154  GLY A C   1 
ATOM   1192  O  O   . GLY A 1 154 ? 86.400  65.818 15.931  1.00 22.03  ? 154  GLY A O   1 
ATOM   1193  N  N   . PHE A 1 155 ? 88.553  66.287 16.383  1.00 22.15  ? 155  PHE A N   1 
ATOM   1194  C  CA  . PHE A 1 155 ? 88.210  66.797 17.698  1.00 22.79  ? 155  PHE A CA  1 
ATOM   1195  C  C   . PHE A 1 155 ? 88.812  68.110 18.172  1.00 23.85  ? 155  PHE A C   1 
ATOM   1196  O  O   . PHE A 1 155 ? 88.682  68.454 19.345  1.00 22.82  ? 155  PHE A O   1 
ATOM   1197  C  CB  . PHE A 1 155 ? 88.452  65.690 18.716  1.00 20.46  ? 155  PHE A CB  1 
ATOM   1198  C  CG  . PHE A 1 155 ? 87.561  64.500 18.501  1.00 21.87  ? 155  PHE A CG  1 
ATOM   1199  C  CD1 . PHE A 1 155 ? 86.227  64.533 18.912  1.00 20.54  ? 155  PHE A CD1 1 
ATOM   1200  C  CD2 . PHE A 1 155 ? 88.018  63.389 17.796  1.00 20.46  ? 155  PHE A CD2 1 
ATOM   1201  C  CE1 . PHE A 1 155 ? 85.357  63.480 18.618  1.00 23.19  ? 155  PHE A CE1 1 
ATOM   1202  C  CE2 . PHE A 1 155 ? 87.161  62.329 17.495  1.00 21.56  ? 155  PHE A CE2 1 
ATOM   1203  C  CZ  . PHE A 1 155 ? 85.826  62.372 17.904  1.00 22.11  ? 155  PHE A CZ  1 
ATOM   1204  N  N   . LEU A 1 156 ? 89.460  68.847 17.270  1.00 25.45  ? 156  LEU A N   1 
ATOM   1205  C  CA  . LEU A 1 156 ? 90.018  70.148 17.629  1.00 26.67  ? 156  LEU A CA  1 
ATOM   1206  C  C   . LEU A 1 156 ? 88.800  70.961 18.045  1.00 26.97  ? 156  LEU A C   1 
ATOM   1207  O  O   . LEU A 1 156 ? 87.843  71.072 17.282  1.00 26.03  ? 156  LEU A O   1 
ATOM   1208  C  CB  . LEU A 1 156 ? 90.679  70.818 16.425  1.00 27.30  ? 156  LEU A CB  1 
ATOM   1209  C  CG  . LEU A 1 156 ? 91.400  72.134 16.745  1.00 28.21  ? 156  LEU A CG  1 
ATOM   1210  C  CD1 . LEU A 1 156 ? 92.797  71.813 17.217  1.00 26.47  ? 156  LEU A CD1 1 
ATOM   1211  C  CD2 . LEU A 1 156 ? 91.462  73.037 15.522  1.00 27.93  ? 156  LEU A CD2 1 
ATOM   1212  N  N   . ALA A 1 157 ? 88.824  71.521 19.248  1.00 27.45  ? 157  ALA A N   1 
ATOM   1213  C  CA  . ALA A 1 157 ? 87.683  72.287 19.726  1.00 30.09  ? 157  ALA A CA  1 
ATOM   1214  C  C   . ALA A 1 157 ? 87.977  73.745 20.066  1.00 32.58  ? 157  ALA A C   1 
ATOM   1215  O  O   . ALA A 1 157 ? 88.805  74.054 20.930  1.00 31.32  ? 157  ALA A O   1 
ATOM   1216  C  CB  . ALA A 1 157 ? 87.074  71.598 20.933  1.00 28.55  ? 157  ALA A CB  1 
ATOM   1217  N  N   . LEU A 1 158 ? 87.278  74.637 19.375  1.00 33.25  ? 158  LEU A N   1 
ATOM   1218  C  CA  . LEU A 1 158 ? 87.412  76.070 19.595  1.00 35.13  ? 158  LEU A CA  1 
ATOM   1219  C  C   . LEU A 1 158 ? 85.996  76.600 19.732  1.00 36.41  ? 158  LEU A C   1 
ATOM   1220  O  O   . LEU A 1 158 ? 85.482  77.283 18.850  1.00 37.00  ? 158  LEU A O   1 
ATOM   1221  C  CB  . LEU A 1 158 ? 88.135  76.731 18.417  1.00 32.68  ? 158  LEU A CB  1 
ATOM   1222  C  CG  . LEU A 1 158 ? 89.648  76.470 18.391  1.00 32.30  ? 158  LEU A CG  1 
ATOM   1223  C  CD1 . LEU A 1 158 ? 90.265  77.037 17.120  1.00 32.76  ? 158  LEU A CD1 1 
ATOM   1224  C  CD2 . LEU A 1 158 ? 90.296  77.098 19.624  1.00 28.29  ? 158  LEU A CD2 1 
ATOM   1225  N  N   . HIS A 1 159 ? 85.366  76.240 20.845  1.00 37.66  ? 159  HIS A N   1 
ATOM   1226  C  CA  . HIS A 1 159 ? 84.003  76.641 21.140  1.00 39.15  ? 159  HIS A CA  1 
ATOM   1227  C  C   . HIS A 1 159 ? 83.797  78.108 20.776  1.00 41.36  ? 159  HIS A C   1 
ATOM   1228  O  O   . HIS A 1 159 ? 84.638  78.953 21.075  1.00 40.10  ? 159  HIS A O   1 
ATOM   1229  C  CB  . HIS A 1 159 ? 83.709  76.410 22.622  1.00 40.07  ? 159  HIS A CB  1 
ATOM   1230  C  CG  . HIS A 1 159 ? 82.253  76.472 22.962  1.00 40.89  ? 159  HIS A CG  1 
ATOM   1231  N  ND1 . HIS A 1 159 ? 81.300  75.752 22.274  1.00 40.78  ? 159  HIS A ND1 1 
ATOM   1232  C  CD2 . HIS A 1 159 ? 81.588  77.157 23.922  1.00 40.12  ? 159  HIS A CD2 1 
ATOM   1233  C  CE1 . HIS A 1 159 ? 80.110  75.991 22.794  1.00 41.74  ? 159  HIS A CE1 1 
ATOM   1234  N  NE2 . HIS A 1 159 ? 80.257  76.840 23.795  1.00 42.10  ? 159  HIS A NE2 1 
ATOM   1235  N  N   . GLY A 1 160 ? 82.672  78.396 20.126  1.00 42.84  ? 160  GLY A N   1 
ATOM   1236  C  CA  . GLY A 1 160 ? 82.381  79.753 19.701  1.00 43.63  ? 160  GLY A CA  1 
ATOM   1237  C  C   . GLY A 1 160 ? 82.460  79.807 18.188  1.00 44.67  ? 160  GLY A C   1 
ATOM   1238  O  O   . GLY A 1 160 ? 81.548  80.291 17.519  1.00 43.59  ? 160  GLY A O   1 
ATOM   1239  N  N   . SER A 1 161 ? 83.563  79.296 17.649  1.00 45.11  ? 161  SER A N   1 
ATOM   1240  C  CA  . SER A 1 161 ? 83.778  79.255 16.206  1.00 46.32  ? 161  SER A CA  1 
ATOM   1241  C  C   . SER A 1 161 ? 82.895  78.179 15.580  1.00 46.57  ? 161  SER A C   1 
ATOM   1242  O  O   . SER A 1 161 ? 82.439  77.262 16.266  1.00 47.20  ? 161  SER A O   1 
ATOM   1243  C  CB  . SER A 1 161 ? 85.250  78.947 15.908  1.00 46.79  ? 161  SER A CB  1 
ATOM   1244  O  OG  . SER A 1 161 ? 85.417  78.427 14.597  1.00 47.76  ? 161  SER A OG  1 
ATOM   1245  N  N   . GLN A 1 162 ? 82.640  78.297 14.283  1.00 44.97  ? 162  GLN A N   1 
ATOM   1246  C  CA  . GLN A 1 162 ? 81.834  77.304 13.595  1.00 45.13  ? 162  GLN A CA  1 
ATOM   1247  C  C   . GLN A 1 162 ? 82.672  76.653 12.502  1.00 43.49  ? 162  GLN A C   1 
ATOM   1248  O  O   . GLN A 1 162 ? 82.171  75.865 11.697  1.00 42.61  ? 162  GLN A O   1 
ATOM   1249  C  CB  . GLN A 1 162 ? 80.573  77.941 13.005  1.00 48.96  ? 162  GLN A CB  1 
ATOM   1250  C  CG  . GLN A 1 162 ? 79.542  78.367 14.057  1.00 53.54  ? 162  GLN A CG  1 
ATOM   1251  C  CD  . GLN A 1 162 ? 79.090  77.212 14.956  1.00 56.20  ? 162  GLN A CD  1 
ATOM   1252  O  OE1 . GLN A 1 162 ? 78.626  76.172 14.476  1.00 56.08  ? 162  GLN A OE1 1 
ATOM   1253  N  NE2 . GLN A 1 162 ? 79.220  77.400 16.269  1.00 57.03  ? 162  GLN A NE2 1 
ATOM   1254  N  N   . GLU A 1 163 ? 83.958  76.993 12.490  1.00 40.86  ? 163  GLU A N   1 
ATOM   1255  C  CA  . GLU A 1 163 ? 84.903  76.440 11.529  1.00 39.48  ? 163  GLU A CA  1 
ATOM   1256  C  C   . GLU A 1 163 ? 85.622  75.254 12.178  1.00 37.65  ? 163  GLU A C   1 
ATOM   1257  O  O   . GLU A 1 163 ? 86.140  74.372 11.492  1.00 35.45  ? 163  GLU A O   1 
ATOM   1258  C  CB  . GLU A 1 163 ? 85.914  77.510 11.102  1.00 40.23  ? 163  GLU A CB  1 
ATOM   1259  C  CG  . GLU A 1 163 ? 85.331  78.571 10.179  1.00 41.88  ? 163  GLU A CG  1 
ATOM   1260  C  CD  . GLU A 1 163 ? 84.871  77.998 8.846   1.00 43.76  ? 163  GLU A CD  1 
ATOM   1261  O  OE1 . GLU A 1 163 ? 85.724  77.523 8.068   1.00 42.57  ? 163  GLU A OE1 1 
ATOM   1262  O  OE2 . GLU A 1 163 ? 83.654  78.019 8.571   1.00 46.42  ? 163  GLU A OE2 1 
ATOM   1263  N  N   . ALA A 1 164 ? 85.650  75.257 13.509  1.00 36.82  ? 164  ALA A N   1 
ATOM   1264  C  CA  . ALA A 1 164 ? 86.258  74.186 14.301  1.00 34.58  ? 164  ALA A CA  1 
ATOM   1265  C  C   . ALA A 1 164 ? 85.554  74.201 15.653  1.00 32.24  ? 164  ALA A C   1 
ATOM   1266  O  O   . ALA A 1 164 ? 86.156  74.536 16.671  1.00 32.20  ? 164  ALA A O   1 
ATOM   1267  C  CB  . ALA A 1 164 ? 87.756  74.426 14.481  1.00 34.51  ? 164  ALA A CB  1 
ATOM   1268  N  N   . PRO A 1 165 ? 84.261  73.828 15.672  1.00 31.98  ? 165  PRO A N   1 
ATOM   1269  C  CA  . PRO A 1 165 ? 83.412  73.786 16.872  1.00 31.49  ? 165  PRO A CA  1 
ATOM   1270  C  C   . PRO A 1 165 ? 83.628  72.625 17.843  1.00 31.30  ? 165  PRO A C   1 
ATOM   1271  O  O   . PRO A 1 165 ? 83.116  72.651 18.961  1.00 31.90  ? 165  PRO A O   1 
ATOM   1272  C  CB  . PRO A 1 165 ? 82.006  73.775 16.287  1.00 30.19  ? 165  PRO A CB  1 
ATOM   1273  C  CG  . PRO A 1 165 ? 82.181  72.927 15.075  1.00 30.33  ? 165  PRO A CG  1 
ATOM   1274  C  CD  . PRO A 1 165 ? 83.497  73.407 14.481  1.00 30.44  ? 165  PRO A CD  1 
ATOM   1275  N  N   . GLY A 1 166 ? 84.377  71.610 17.426  1.00 30.30  ? 166  GLY A N   1 
ATOM   1276  C  CA  . GLY A 1 166 ? 84.598  70.470 18.298  1.00 29.96  ? 166  GLY A CA  1 
ATOM   1277  C  C   . GLY A 1 166 ? 83.552  69.384 18.108  1.00 29.28  ? 166  GLY A C   1 
ATOM   1278  O  O   . GLY A 1 166 ? 82.422  69.661 17.716  1.00 28.47  ? 166  GLY A O   1 
ATOM   1279  N  N   . ASN A 1 167 ? 83.940  68.140 18.378  1.00 29.29  ? 167  ASN A N   1 
ATOM   1280  C  CA  . ASN A 1 167 ? 83.062  66.976 18.249  1.00 26.79  ? 167  ASN A CA  1 
ATOM   1281  C  C   . ASN A 1 167 ? 82.690  66.543 16.836  1.00 25.69  ? 167  ASN A C   1 
ATOM   1282  O  O   . ASN A 1 167 ? 81.787  65.726 16.675  1.00 27.41  ? 167  ASN A O   1 
ATOM   1283  C  CB  . ASN A 1 167 ? 81.769  67.178 19.043  1.00 25.02  ? 167  ASN A CB  1 
ATOM   1284  C  CG  . ASN A 1 167 ? 82.000  67.210 20.537  1.00 26.23  ? 167  ASN A CG  1 
ATOM   1285  O  OD1 . ASN A 1 167 ? 82.835  66.473 21.063  1.00 26.57  ? 167  ASN A OD1 1 
ATOM   1286  N  ND2 . ASN A 1 167 ? 81.249  68.055 21.235  1.00 23.69  ? 167  ASN A ND2 1 
ATOM   1287  N  N   . VAL A 1 168 ? 83.373  67.051 15.815  1.00 24.72  ? 168  VAL A N   1 
ATOM   1288  C  CA  . VAL A 1 168 ? 83.019  66.656 14.457  1.00 25.20  ? 168  VAL A CA  1 
ATOM   1289  C  C   . VAL A 1 168 ? 83.185  65.162 14.182  1.00 24.20  ? 168  VAL A C   1 
ATOM   1290  O  O   . VAL A 1 168 ? 82.565  64.638 13.266  1.00 24.47  ? 168  VAL A O   1 
ATOM   1291  C  CB  . VAL A 1 168 ? 83.807  67.454 13.386  1.00 24.06  ? 168  VAL A CB  1 
ATOM   1292  C  CG1 . VAL A 1 168 ? 83.532  68.914 13.552  1.00 24.41  ? 168  VAL A CG1 1 
ATOM   1293  C  CG2 . VAL A 1 168 ? 85.294  67.167 13.479  1.00 25.84  ? 168  VAL A CG2 1 
ATOM   1294  N  N   . GLY A 1 169 ? 84.018  64.476 14.963  1.00 25.19  ? 169  GLY A N   1 
ATOM   1295  C  CA  . GLY A 1 169 ? 84.190  63.043 14.760  1.00 22.30  ? 169  GLY A CA  1 
ATOM   1296  C  C   . GLY A 1 169 ? 82.921  62.313 15.179  1.00 22.64  ? 169  GLY A C   1 
ATOM   1297  O  O   . GLY A 1 169 ? 82.516  61.315 14.579  1.00 21.04  ? 169  GLY A O   1 
ATOM   1298  N  N   . LEU A 1 170 ? 82.282  62.820 16.226  1.00 22.37  ? 170  LEU A N   1 
ATOM   1299  C  CA  . LEU A 1 170 ? 81.050  62.222 16.706  1.00 24.30  ? 170  LEU A CA  1 
ATOM   1300  C  C   . LEU A 1 170 ? 79.953  62.562 15.701  1.00 25.51  ? 170  LEU A C   1 
ATOM   1301  O  O   . LEU A 1 170 ? 79.093  61.741 15.398  1.00 25.19  ? 170  LEU A O   1 
ATOM   1302  C  CB  . LEU A 1 170 ? 80.705  62.757 18.099  1.00 22.58  ? 170  LEU A CB  1 
ATOM   1303  C  CG  . LEU A 1 170 ? 81.568  62.215 19.243  1.00 23.50  ? 170  LEU A CG  1 
ATOM   1304  C  CD1 . LEU A 1 170 ? 81.229  62.935 20.535  1.00 24.04  ? 170  LEU A CD1 1 
ATOM   1305  C  CD2 . LEU A 1 170 ? 81.328  60.718 19.406  1.00 21.71  ? 170  LEU A CD2 1 
ATOM   1306  N  N   . LEU A 1 171 ? 80.005  63.773 15.161  1.00 26.95  ? 171  LEU A N   1 
ATOM   1307  C  CA  . LEU A 1 171 ? 79.016  64.181 14.181  1.00 27.53  ? 171  LEU A CA  1 
ATOM   1308  C  C   . LEU A 1 171 ? 79.165  63.338 12.917  1.00 27.13  ? 171  LEU A C   1 
ATOM   1309  O  O   . LEU A 1 171 ? 78.180  63.074 12.233  1.00 28.52  ? 171  LEU A O   1 
ATOM   1310  C  CB  . LEU A 1 171 ? 79.156  65.672 13.876  1.00 27.59  ? 171  LEU A CB  1 
ATOM   1311  C  CG  . LEU A 1 171 ? 78.655  66.542 15.032  1.00 29.16  ? 171  LEU A CG  1 
ATOM   1312  C  CD1 . LEU A 1 171 ? 78.965  68.006 14.776  1.00 29.10  ? 171  LEU A CD1 1 
ATOM   1313  C  CD2 . LEU A 1 171 ? 77.159  66.333 15.195  1.00 29.06  ? 171  LEU A CD2 1 
ATOM   1314  N  N   . ASP A 1 172 ? 80.388  62.903 12.616  1.00 25.74  ? 172  ASP A N   1 
ATOM   1315  C  CA  . ASP A 1 172 ? 80.613  62.060 11.444  1.00 24.91  ? 172  ASP A CA  1 
ATOM   1316  C  C   . ASP A 1 172 ? 79.910  60.722 11.685  1.00 24.23  ? 172  ASP A C   1 
ATOM   1317  O  O   . ASP A 1 172 ? 79.301  60.157 10.783  1.00 23.55  ? 172  ASP A O   1 
ATOM   1318  C  CB  . ASP A 1 172 ? 82.110  61.796 11.212  1.00 26.38  ? 172  ASP A CB  1 
ATOM   1319  C  CG  . ASP A 1 172 ? 82.894  63.053 10.811  1.00 32.32  ? 172  ASP A CG  1 
ATOM   1320  O  OD1 . ASP A 1 172 ? 82.283  64.008 10.270  1.00 31.59  ? 172  ASP A OD1 1 
ATOM   1321  O  OD2 . ASP A 1 172 ? 84.137  63.073 11.021  1.00 30.32  ? 172  ASP A OD2 1 
ATOM   1322  N  N   . GLN A 1 173 ? 80.000  60.219 12.913  1.00 24.99  ? 173  GLN A N   1 
ATOM   1323  C  CA  . GLN A 1 173 ? 79.368  58.946 13.258  1.00 24.77  ? 173  GLN A CA  1 
ATOM   1324  C  C   . GLN A 1 173 ? 77.859  59.085 13.116  1.00 25.92  ? 173  GLN A C   1 
ATOM   1325  O  O   . GLN A 1 173 ? 77.194  58.194 12.596  1.00 26.37  ? 173  GLN A O   1 
ATOM   1326  C  CB  . GLN A 1 173 ? 79.703  58.545 14.699  1.00 24.44  ? 173  GLN A CB  1 
ATOM   1327  C  CG  . GLN A 1 173 ? 81.184  58.532 15.016  1.00 24.42  ? 173  GLN A CG  1 
ATOM   1328  C  CD  . GLN A 1 173 ? 81.473  58.057 16.417  1.00 24.88  ? 173  GLN A CD  1 
ATOM   1329  O  OE1 . GLN A 1 173 ? 80.621  58.139 17.304  1.00 25.78  ? 173  GLN A OE1 1 
ATOM   1330  N  NE2 . GLN A 1 173 ? 82.689  57.571 16.635  1.00 23.04  ? 173  GLN A NE2 1 
ATOM   1331  N  N   . ARG A 1 174 ? 77.328  60.211 13.583  1.00 25.18  ? 174  ARG A N   1 
ATOM   1332  C  CA  . ARG A 1 174 ? 75.901  60.470 13.511  1.00 26.67  ? 174  ARG A CA  1 
ATOM   1333  C  C   . ARG A 1 174 ? 75.416  60.490 12.061  1.00 27.26  ? 174  ARG A C   1 
ATOM   1334  O  O   . ARG A 1 174 ? 74.342  59.972 11.759  1.00 25.80  ? 174  ARG A O   1 
ATOM   1335  C  CB  . ARG A 1 174 ? 75.568  61.800 14.194  1.00 26.29  ? 174  ARG A CB  1 
ATOM   1336  C  CG  . ARG A 1 174 ? 74.089  62.177 14.142  1.00 26.66  ? 174  ARG A CG  1 
ATOM   1337  C  CD  . ARG A 1 174 ? 73.837  63.552 14.770  1.00 25.05  ? 174  ARG A CD  1 
ATOM   1338  N  NE  . ARG A 1 174 ? 74.001  63.532 16.224  1.00 23.08  ? 174  ARG A NE  1 
ATOM   1339  C  CZ  . ARG A 1 174 ? 73.936  64.607 17.000  1.00 23.25  ? 174  ARG A CZ  1 
ATOM   1340  N  NH1 . ARG A 1 174 ? 73.712  65.805 16.465  1.00 25.01  ? 174  ARG A NH1 1 
ATOM   1341  N  NH2 . ARG A 1 174 ? 74.088  64.486 18.312  1.00 22.93  ? 174  ARG A NH2 1 
ATOM   1342  N  N   . MET A 1 175 ? 76.217  61.067 11.166  1.00 27.60  ? 175  MET A N   1 
ATOM   1343  C  CA  . MET A 1 175 ? 75.837  61.137 9.759   1.00 26.55  ? 175  MET A CA  1 
ATOM   1344  C  C   . MET A 1 175 ? 75.852  59.765 9.105   1.00 25.97  ? 175  MET A C   1 
ATOM   1345  O  O   . MET A 1 175 ? 75.112  59.514 8.158   1.00 24.22  ? 175  MET A O   1 
ATOM   1346  C  CB  . MET A 1 175 ? 76.749  62.095 8.987   1.00 27.27  ? 175  MET A CB  1 
ATOM   1347  C  CG  . MET A 1 175 ? 76.194  62.457 7.608   1.00 30.58  ? 175  MET A CG  1 
ATOM   1348  S  SD  . MET A 1 175 ? 76.881  63.986 6.918   1.00 36.81  ? 175  MET A SD  1 
ATOM   1349  C  CE  . MET A 1 175 ? 76.086  65.213 7.973   1.00 29.76  ? 175  MET A CE  1 
ATOM   1350  N  N   . ALA A 1 176 ? 76.697  58.870 9.601   1.00 26.57  ? 176  ALA A N   1 
ATOM   1351  C  CA  . ALA A 1 176 ? 76.735  57.523 9.041   1.00 27.00  ? 176  ALA A CA  1 
ATOM   1352  C  C   . ALA A 1 176 ? 75.468  56.790 9.510   1.00 27.23  ? 176  ALA A C   1 
ATOM   1353  O  O   . ALA A 1 176 ? 74.831  56.069 8.740   1.00 26.32  ? 176  ALA A O   1 
ATOM   1354  C  CB  . ALA A 1 176 ? 77.993  56.782 9.504   1.00 25.44  ? 176  ALA A CB  1 
ATOM   1355  N  N   . LEU A 1 177 ? 75.093  56.994 10.770  1.00 25.89  ? 177  LEU A N   1 
ATOM   1356  C  CA  . LEU A 1 177 ? 73.893  56.352 11.305  1.00 26.83  ? 177  LEU A CA  1 
ATOM   1357  C  C   . LEU A 1 177 ? 72.647  56.888 10.600  1.00 27.10  ? 177  LEU A C   1 
ATOM   1358  O  O   . LEU A 1 177 ? 71.695  56.149 10.364  1.00 25.87  ? 177  LEU A O   1 
ATOM   1359  C  CB  . LEU A 1 177 ? 73.779  56.596 12.813  1.00 24.60  ? 177  LEU A CB  1 
ATOM   1360  C  CG  . LEU A 1 177 ? 74.899  56.008 13.674  1.00 26.95  ? 177  LEU A CG  1 
ATOM   1361  C  CD1 . LEU A 1 177 ? 74.724  56.478 15.108  1.00 26.81  ? 177  LEU A CD1 1 
ATOM   1362  C  CD2 . LEU A 1 177 ? 74.894  54.485 13.579  1.00 23.84  ? 177  LEU A CD2 1 
ATOM   1363  N  N   . GLN A 1 178 ? 72.669  58.181 10.278  1.00 26.69  ? 178  GLN A N   1 
ATOM   1364  C  CA  . GLN A 1 178 ? 71.561  58.835 9.594   1.00 27.06  ? 178  GLN A CA  1 
ATOM   1365  C  C   . GLN A 1 178 ? 71.433  58.215 8.215   1.00 26.95  ? 178  GLN A C   1 
ATOM   1366  O  O   . GLN A 1 178 ? 70.327  57.986 7.721   1.00 24.35  ? 178  GLN A O   1 
ATOM   1367  C  CB  . GLN A 1 178 ? 71.831  60.335 9.452   1.00 28.87  ? 178  GLN A CB  1 
ATOM   1368  C  CG  . GLN A 1 178 ? 70.762  61.079 8.658   1.00 30.54  ? 178  GLN A CG  1 
ATOM   1369  C  CD  . GLN A 1 178 ? 69.418  61.096 9.364   1.00 32.44  ? 178  GLN A CD  1 
ATOM   1370  O  OE1 . GLN A 1 178 ? 69.313  61.552 10.503  1.00 33.60  ? 178  GLN A OE1 1 
ATOM   1371  N  NE2 . GLN A 1 178 ? 68.382  60.600 8.690   1.00 27.19  ? 178  GLN A NE2 1 
ATOM   1372  N  N   . TRP A 1 179 ? 72.586  57.956 7.604   1.00 25.68  ? 179  TRP A N   1 
ATOM   1373  C  CA  . TRP A 1 179 ? 72.647  57.344 6.287   1.00 26.22  ? 179  TRP A CA  1 
ATOM   1374  C  C   . TRP A 1 179 ? 72.051  55.937 6.353   1.00 27.35  ? 179  TRP A C   1 
ATOM   1375  O  O   . TRP A 1 179 ? 71.345  55.517 5.440   1.00 27.14  ? 179  TRP A O   1 
ATOM   1376  C  CB  . TRP A 1 179 ? 74.098  57.256 5.808   1.00 25.22  ? 179  TRP A CB  1 
ATOM   1377  C  CG  . TRP A 1 179 ? 74.230  56.747 4.407   1.00 25.91  ? 179  TRP A CG  1 
ATOM   1378  C  CD1 . TRP A 1 179 ? 74.311  57.496 3.263   1.00 26.38  ? 179  TRP A CD1 1 
ATOM   1379  C  CD2 . TRP A 1 179 ? 74.262  55.375 3.991   1.00 25.29  ? 179  TRP A CD2 1 
ATOM   1380  N  NE1 . TRP A 1 179 ? 74.392  56.672 2.166   1.00 26.54  ? 179  TRP A NE1 1 
ATOM   1381  C  CE2 . TRP A 1 179 ? 74.364  55.366 2.585   1.00 26.02  ? 179  TRP A CE2 1 
ATOM   1382  C  CE3 . TRP A 1 179 ? 74.215  54.150 4.672   1.00 28.22  ? 179  TRP A CE3 1 
ATOM   1383  C  CZ2 . TRP A 1 179 ? 74.420  54.178 1.845   1.00 26.92  ? 179  TRP A CZ2 1 
ATOM   1384  C  CZ3 . TRP A 1 179 ? 74.272  52.967 3.932   1.00 26.10  ? 179  TRP A CZ3 1 
ATOM   1385  C  CH2 . TRP A 1 179 ? 74.373  52.994 2.532   1.00 26.36  ? 179  TRP A CH2 1 
ATOM   1386  N  N   . VAL A 1 180 ? 72.348  55.205 7.428   1.00 27.93  ? 180  VAL A N   1 
ATOM   1387  C  CA  . VAL A 1 180 ? 71.824  53.850 7.585   1.00 28.17  ? 180  VAL A CA  1 
ATOM   1388  C  C   . VAL A 1 180 ? 70.310  53.946 7.775   1.00 28.23  ? 180  VAL A C   1 
ATOM   1389  O  O   . VAL A 1 180 ? 69.549  53.151 7.230   1.00 28.30  ? 180  VAL A O   1 
ATOM   1390  C  CB  . VAL A 1 180 ? 72.458  53.120 8.809   1.00 27.94  ? 180  VAL A CB  1 
ATOM   1391  C  CG1 . VAL A 1 180 ? 71.935  51.695 8.892   1.00 31.15  ? 180  VAL A CG1 1 
ATOM   1392  C  CG2 . VAL A 1 180 ? 73.973  53.083 8.680   1.00 27.66  ? 180  VAL A CG2 1 
ATOM   1393  N  N   . HIS A 1 181 ? 69.889  54.939 8.549   1.00 28.30  ? 181  HIS A N   1 
ATOM   1394  C  CA  . HIS A 1 181 ? 68.480  55.187 8.820   1.00 30.61  ? 181  HIS A CA  1 
ATOM   1395  C  C   . HIS A 1 181 ? 67.682  55.349 7.515   1.00 32.88  ? 181  HIS A C   1 
ATOM   1396  O  O   . HIS A 1 181 ? 66.539  54.888 7.416   1.00 31.89  ? 181  HIS A O   1 
ATOM   1397  C  CB  . HIS A 1 181 ? 68.349  56.453 9.675   1.00 32.33  ? 181  HIS A CB  1 
ATOM   1398  C  CG  . HIS A 1 181 ? 66.940  56.804 10.042  1.00 35.99  ? 181  HIS A CG  1 
ATOM   1399  N  ND1 . HIS A 1 181 ? 66.092  57.474 9.187   1.00 37.11  ? 181  HIS A ND1 1 
ATOM   1400  C  CD2 . HIS A 1 181 ? 66.220  56.545 11.161  1.00 37.24  ? 181  HIS A CD2 1 
ATOM   1401  C  CE1 . HIS A 1 181 ? 64.909  57.609 9.761   1.00 37.65  ? 181  HIS A CE1 1 
ATOM   1402  N  NE2 . HIS A 1 181 ? 64.959  57.053 10.959  1.00 36.50  ? 181  HIS A NE2 1 
ATOM   1403  N  N   . ASP A 1 182 ? 68.297  55.982 6.515   1.00 32.26  ? 182  ASP A N   1 
ATOM   1404  C  CA  . ASP A 1 182 ? 67.639  56.223 5.235   1.00 32.49  ? 182  ASP A CA  1 
ATOM   1405  C  C   . ASP A 1 182 ? 67.933  55.233 4.113   1.00 32.46  ? 182  ASP A C   1 
ATOM   1406  O  O   . ASP A 1 182 ? 67.211  55.222 3.112   1.00 32.56  ? 182  ASP A O   1 
ATOM   1407  C  CB  . ASP A 1 182 ? 67.992  57.612 4.697   1.00 33.71  ? 182  ASP A CB  1 
ATOM   1408  C  CG  . ASP A 1 182 ? 67.740  58.708 5.693   1.00 35.61  ? 182  ASP A CG  1 
ATOM   1409  O  OD1 . ASP A 1 182 ? 66.707  58.654 6.398   1.00 36.84  ? 182  ASP A OD1 1 
ATOM   1410  O  OD2 . ASP A 1 182 ? 68.575  59.637 5.753   1.00 36.71  ? 182  ASP A OD2 1 
ATOM   1411  N  N   . ASN A 1 183 ? 68.966  54.405 4.260   1.00 29.82  ? 183  ASN A N   1 
ATOM   1412  C  CA  . ASN A 1 183 ? 69.327  53.494 3.179   1.00 30.14  ? 183  ASN A CA  1 
ATOM   1413  C  C   . ASN A 1 183 ? 69.473  52.005 3.490   1.00 31.48  ? 183  ASN A C   1 
ATOM   1414  O  O   . ASN A 1 183 ? 69.495  51.184 2.567   1.00 31.42  ? 183  ASN A O   1 
ATOM   1415  C  CB  . ASN A 1 183 ? 70.633  53.974 2.541   1.00 29.44  ? 183  ASN A CB  1 
ATOM   1416  C  CG  . ASN A 1 183 ? 70.545  55.394 2.034   1.00 30.77  ? 183  ASN A CG  1 
ATOM   1417  O  OD1 . ASN A 1 183 ? 69.970  55.654 0.978   1.00 33.43  ? 183  ASN A OD1 1 
ATOM   1418  N  ND2 . ASN A 1 183 ? 71.107  56.327 2.789   1.00 30.29  ? 183  ASN A ND2 1 
ATOM   1419  N  N   . ILE A 1 184 ? 69.585  51.643 4.762   1.00 30.29  ? 184  ILE A N   1 
ATOM   1420  C  CA  . ILE A 1 184 ? 69.766  50.237 5.083   1.00 31.38  ? 184  ILE A CA  1 
ATOM   1421  C  C   . ILE A 1 184 ? 68.615  49.377 4.566   1.00 31.87  ? 184  ILE A C   1 
ATOM   1422  O  O   . ILE A 1 184 ? 68.810  48.214 4.212   1.00 29.18  ? 184  ILE A O   1 
ATOM   1423  C  CB  . ILE A 1 184 ? 69.953  50.021 6.610   1.00 31.20  ? 184  ILE A CB  1 
ATOM   1424  C  CG1 . ILE A 1 184 ? 70.634  48.670 6.856   1.00 32.37  ? 184  ILE A CG1 1 
ATOM   1425  C  CG2 . ILE A 1 184 ? 68.612  50.072 7.325   1.00 31.92  ? 184  ILE A CG2 1 
ATOM   1426  C  CD1 . ILE A 1 184 ? 72.001  48.542 6.193   1.00 31.10  ? 184  ILE A CD1 1 
ATOM   1427  N  N   . GLN A 1 185 ? 67.420  49.957 4.501   1.00 34.67  ? 185  GLN A N   1 
ATOM   1428  C  CA  . GLN A 1 185 ? 66.254  49.219 4.016   1.00 37.46  ? 185  GLN A CA  1 
ATOM   1429  C  C   . GLN A 1 185 ? 66.493  48.670 2.623   1.00 36.08  ? 185  GLN A C   1 
ATOM   1430  O  O   . GLN A 1 185 ? 65.989  47.606 2.289   1.00 37.00  ? 185  GLN A O   1 
ATOM   1431  C  CB  . GLN A 1 185 ? 64.998  50.103 4.011   1.00 38.67  ? 185  GLN A CB  1 
ATOM   1432  C  CG  . GLN A 1 185 ? 65.032  51.271 3.045   1.00 42.73  ? 185  GLN A CG  1 
ATOM   1433  C  CD  . GLN A 1 185 ? 63.956  52.304 3.353   1.00 47.42  ? 185  GLN A CD  1 
ATOM   1434  O  OE1 . GLN A 1 185 ? 63.938  52.896 4.437   1.00 47.62  ? 185  GLN A OE1 1 
ATOM   1435  N  NE2 . GLN A 1 185 ? 63.051  52.522 2.402   1.00 49.11  ? 185  GLN A NE2 1 
ATOM   1436  N  N   . PHE A 1 186 ? 67.268  49.388 1.815   1.00 36.05  ? 186  PHE A N   1 
ATOM   1437  C  CA  . PHE A 1 186 ? 67.556  48.938 0.456   1.00 37.06  ? 186  PHE A CA  1 
ATOM   1438  C  C   . PHE A 1 186 ? 68.531  47.767 0.434   1.00 36.71  ? 186  PHE A C   1 
ATOM   1439  O  O   . PHE A 1 186 ? 68.746  47.156 -0.609  1.00 36.28  ? 186  PHE A O   1 
ATOM   1440  C  CB  . PHE A 1 186 ? 68.118  50.087 -0.393  1.00 37.04  ? 186  PHE A CB  1 
ATOM   1441  C  CG  . PHE A 1 186 ? 67.246  51.312 -0.410  1.00 36.50  ? 186  PHE A CG  1 
ATOM   1442  C  CD1 . PHE A 1 186 ? 65.867  51.201 -0.589  1.00 36.29  ? 186  PHE A CD1 1 
ATOM   1443  C  CD2 . PHE A 1 186 ? 67.798  52.575 -0.232  1.00 35.73  ? 186  PHE A CD2 1 
ATOM   1444  C  CE1 . PHE A 1 186 ? 65.049  52.330 -0.585  1.00 36.85  ? 186  PHE A CE1 1 
ATOM   1445  C  CE2 . PHE A 1 186 ? 66.992  53.710 -0.228  1.00 38.29  ? 186  PHE A CE2 1 
ATOM   1446  C  CZ  . PHE A 1 186 ? 65.610  53.586 -0.403  1.00 37.35  ? 186  PHE A CZ  1 
ATOM   1447  N  N   . PHE A 1 187 ? 69.121  47.452 1.583   1.00 37.55  ? 187  PHE A N   1 
ATOM   1448  C  CA  . PHE A 1 187 ? 70.066  46.339 1.659   1.00 38.48  ? 187  PHE A CA  1 
ATOM   1449  C  C   . PHE A 1 187 ? 69.489  45.141 2.406   1.00 39.75  ? 187  PHE A C   1 
ATOM   1450  O  O   . PHE A 1 187 ? 70.193  44.159 2.643   1.00 41.71  ? 187  PHE A O   1 
ATOM   1451  C  CB  . PHE A 1 187 ? 71.371  46.773 2.337   1.00 35.50  ? 187  PHE A CB  1 
ATOM   1452  C  CG  . PHE A 1 187 ? 72.145  47.793 1.561   1.00 32.39  ? 187  PHE A CG  1 
ATOM   1453  C  CD1 . PHE A 1 187 ? 71.772  49.134 1.582   1.00 28.89  ? 187  PHE A CD1 1 
ATOM   1454  C  CD2 . PHE A 1 187 ? 73.239  47.409 0.792   1.00 31.00  ? 187  PHE A CD2 1 
ATOM   1455  C  CE1 . PHE A 1 187 ? 72.476  50.081 0.848   1.00 28.07  ? 187  PHE A CE1 1 
ATOM   1456  C  CE2 . PHE A 1 187 ? 73.950  48.348 0.054   1.00 30.88  ? 187  PHE A CE2 1 
ATOM   1457  C  CZ  . PHE A 1 187 ? 73.566  49.690 0.083   1.00 27.66  ? 187  PHE A CZ  1 
ATOM   1458  N  N   . GLY A 1 188 ? 68.215  45.225 2.774   1.00 39.89  ? 188  GLY A N   1 
ATOM   1459  C  CA  . GLY A 1 188 ? 67.580  44.132 3.487   1.00 40.95  ? 188  GLY A CA  1 
ATOM   1460  C  C   . GLY A 1 188 ? 67.606  44.313 4.994   1.00 41.46  ? 188  GLY A C   1 
ATOM   1461  O  O   . GLY A 1 188 ? 67.263  43.396 5.748   1.00 40.66  ? 188  GLY A O   1 
ATOM   1462  N  N   . GLY A 1 189 ? 68.011  45.500 5.435   1.00 40.95  ? 189  GLY A N   1 
ATOM   1463  C  CA  . GLY A 1 189 ? 68.070  45.782 6.857   1.00 40.02  ? 189  GLY A CA  1 
ATOM   1464  C  C   . GLY A 1 189 ? 66.836  46.509 7.358   1.00 40.60  ? 189  GLY A C   1 
ATOM   1465  O  O   . GLY A 1 189 ? 66.131  47.161 6.585   1.00 40.15  ? 189  GLY A O   1 
ATOM   1466  N  N   . ASP A 1 190 ? 66.583  46.396 8.660   1.00 39.35  ? 190  ASP A N   1 
ATOM   1467  C  CA  . ASP A 1 190 ? 65.438  47.033 9.294   1.00 37.89  ? 190  ASP A CA  1 
ATOM   1468  C  C   . ASP A 1 190 ? 65.857  48.303 10.035  1.00 37.27  ? 190  ASP A C   1 
ATOM   1469  O  O   . ASP A 1 190 ? 66.338  48.256 11.168  1.00 36.79  ? 190  ASP A O   1 
ATOM   1470  C  CB  . ASP A 1 190 ? 64.782  46.054 10.262  1.00 38.77  ? 190  ASP A CB  1 
ATOM   1471  C  CG  . ASP A 1 190 ? 63.659  46.682 11.052  1.00 42.02  ? 190  ASP A CG  1 
ATOM   1472  O  OD1 . ASP A 1 190 ? 63.370  47.882 10.838  1.00 41.62  ? 190  ASP A OD1 1 
ATOM   1473  O  OD2 . ASP A 1 190 ? 63.065  45.973 11.893  1.00 45.65  ? 190  ASP A OD2 1 
ATOM   1474  N  N   . PRO A 1 191 ? 65.646  49.467 9.411   1.00 36.87  ? 191  PRO A N   1 
ATOM   1475  C  CA  . PRO A 1 191 ? 66.015  50.747 10.020  1.00 36.56  ? 191  PRO A CA  1 
ATOM   1476  C  C   . PRO A 1 191 ? 65.484  50.988 11.432  1.00 37.24  ? 191  PRO A C   1 
ATOM   1477  O  O   . PRO A 1 191 ? 66.033  51.799 12.174  1.00 37.30  ? 191  PRO A O   1 
ATOM   1478  C  CB  . PRO A 1 191 ? 65.505  51.770 9.002   1.00 36.75  ? 191  PRO A CB  1 
ATOM   1479  C  CG  . PRO A 1 191 ? 64.351  51.068 8.352   1.00 37.91  ? 191  PRO A CG  1 
ATOM   1480  C  CD  . PRO A 1 191 ? 64.902  49.675 8.158   1.00 36.62  ? 191  PRO A CD  1 
ATOM   1481  N  N   . LYS A 1 192 ? 64.422  50.289 11.814  1.00 38.82  ? 192  LYS A N   1 
ATOM   1482  C  CA  . LYS A 1 192 ? 63.869  50.468 13.153  1.00 38.79  ? 192  LYS A CA  1 
ATOM   1483  C  C   . LYS A 1 192 ? 64.533  49.538 14.169  1.00 37.62  ? 192  LYS A C   1 
ATOM   1484  O  O   . LYS A 1 192 ? 64.294  49.656 15.367  1.00 38.38  ? 192  LYS A O   1 
ATOM   1485  C  CB  . LYS A 1 192 ? 62.353  50.232 13.145  1.00 40.95  ? 192  LYS A CB  1 
ATOM   1486  C  CG  . LYS A 1 192 ? 61.586  51.158 12.207  1.00 44.60  ? 192  LYS A CG  1 
ATOM   1487  C  CD  . LYS A 1 192 ? 60.077  50.912 12.266  1.00 45.25  ? 192  LYS A CD  1 
ATOM   1488  C  CE  . LYS A 1 192 ? 59.396  51.775 13.318  1.00 46.91  ? 192  LYS A CE  1 
ATOM   1489  N  NZ  . LYS A 1 192 ? 59.970  51.620 14.687  1.00 50.14  ? 192  LYS A NZ  1 
ATOM   1490  N  N   . THR A 1 193 ? 65.368  48.619 13.697  1.00 35.27  ? 193  THR A N   1 
ATOM   1491  C  CA  . THR A 1 193 ? 66.050  47.698 14.603  1.00 34.92  ? 193  THR A CA  1 
ATOM   1492  C  C   . THR A 1 193 ? 67.566  47.732 14.407  1.00 33.06  ? 193  THR A C   1 
ATOM   1493  O  O   . THR A 1 193 ? 68.185  46.746 14.004  1.00 30.38  ? 193  THR A O   1 
ATOM   1494  C  CB  . THR A 1 193 ? 65.552  46.261 14.405  1.00 35.34  ? 193  THR A CB  1 
ATOM   1495  O  OG1 . THR A 1 193 ? 64.117  46.258 14.400  1.00 36.28  ? 193  THR A OG1 1 
ATOM   1496  C  CG2 . THR A 1 193 ? 66.040  45.370 15.546  1.00 35.16  ? 193  THR A CG2 1 
ATOM   1497  N  N   . VAL A 1 194 ? 68.154  48.886 14.700  1.00 30.77  ? 194  VAL A N   1 
ATOM   1498  C  CA  . VAL A 1 194 ? 69.589  49.071 14.557  1.00 29.21  ? 194  VAL A CA  1 
ATOM   1499  C  C   . VAL A 1 194 ? 70.292  49.046 15.911  1.00 28.20  ? 194  VAL A C   1 
ATOM   1500  O  O   . VAL A 1 194 ? 69.860  49.686 16.870  1.00 27.69  ? 194  VAL A O   1 
ATOM   1501  C  CB  . VAL A 1 194 ? 69.907  50.429 13.855  1.00 29.31  ? 194  VAL A CB  1 
ATOM   1502  C  CG1 . VAL A 1 194 ? 71.393  50.746 13.964  1.00 28.92  ? 194  VAL A CG1 1 
ATOM   1503  C  CG2 . VAL A 1 194 ? 69.445  50.390 12.396  1.00 26.66  ? 194  VAL A CG2 1 
ATOM   1504  N  N   . THR A 1 195 ? 71.371  48.286 15.991  1.00 27.29  ? 195  THR A N   1 
ATOM   1505  C  CA  . THR A 1 195 ? 72.149  48.224 17.223  1.00 27.11  ? 195  THR A CA  1 
ATOM   1506  C  C   . THR A 1 195 ? 73.538  48.767 16.930  1.00 25.86  ? 195  THR A C   1 
ATOM   1507  O  O   . THR A 1 195 ? 74.211  48.296 16.014  1.00 25.76  ? 195  THR A O   1 
ATOM   1508  C  CB  . THR A 1 195 ? 72.298  46.773 17.747  1.00 26.52  ? 195  THR A CB  1 
ATOM   1509  O  OG1 . THR A 1 195 ? 71.026  46.289 18.180  1.00 27.19  ? 195  THR A OG1 1 
ATOM   1510  C  CG2 . THR A 1 195 ? 73.262  46.722 18.925  1.00 27.12  ? 195  THR A CG2 1 
ATOM   1511  N  N   . ILE A 1 196 ? 73.957  49.774 17.688  1.00 26.06  ? 196  ILE A N   1 
ATOM   1512  C  CA  . ILE A 1 196 ? 75.294  50.329 17.508  1.00 26.50  ? 196  ILE A CA  1 
ATOM   1513  C  C   . ILE A 1 196 ? 76.168  49.721 18.597  1.00 27.47  ? 196  ILE A C   1 
ATOM   1514  O  O   . ILE A 1 196 ? 75.728  49.584 19.746  1.00 29.70  ? 196  ILE A O   1 
ATOM   1515  C  CB  . ILE A 1 196 ? 75.315  51.880 17.644  1.00 24.50  ? 196  ILE A CB  1 
ATOM   1516  C  CG1 . ILE A 1 196 ? 74.740  52.300 18.998  1.00 23.68  ? 196  ILE A CG1 1 
ATOM   1517  C  CG2 . ILE A 1 196 ? 74.521  52.514 16.501  1.00 25.55  ? 196  ILE A CG2 1 
ATOM   1518  C  CD1 . ILE A 1 196 ? 74.789  53.798 19.267  1.00 23.02  ? 196  ILE A CD1 1 
ATOM   1519  N  N   . PHE A 1 197 ? 77.387  49.330 18.236  1.00 26.36  ? 197  PHE A N   1 
ATOM   1520  C  CA  . PHE A 1 197 ? 78.306  48.751 19.206  1.00 25.31  ? 197  PHE A CA  1 
ATOM   1521  C  C   . PHE A 1 197 ? 79.749  49.106 18.877  1.00 24.45  ? 197  PHE A C   1 
ATOM   1522  O  O   . PHE A 1 197 ? 80.105  49.293 17.717  1.00 24.61  ? 197  PHE A O   1 
ATOM   1523  C  CB  . PHE A 1 197 ? 78.114  47.223 19.302  1.00 24.21  ? 197  PHE A CB  1 
ATOM   1524  C  CG  . PHE A 1 197 ? 78.528  46.449 18.073  1.00 23.25  ? 197  PHE A CG  1 
ATOM   1525  C  CD1 . PHE A 1 197 ? 78.003  46.748 16.819  1.00 23.49  ? 197  PHE A CD1 1 
ATOM   1526  C  CD2 . PHE A 1 197 ? 79.386  45.357 18.191  1.00 23.64  ? 197  PHE A CD2 1 
ATOM   1527  C  CE1 . PHE A 1 197 ? 78.323  45.966 15.700  1.00 22.56  ? 197  PHE A CE1 1 
ATOM   1528  C  CE2 . PHE A 1 197 ? 79.711  44.570 17.084  1.00 23.58  ? 197  PHE A CE2 1 
ATOM   1529  C  CZ  . PHE A 1 197 ? 79.178  44.874 15.835  1.00 22.42  ? 197  PHE A CZ  1 
ATOM   1530  N  N   . GLY A 1 198 ? 80.571  49.222 19.912  1.00 24.02  ? 198  GLY A N   1 
ATOM   1531  C  CA  . GLY A 1 198 ? 81.962  49.575 19.711  1.00 24.91  ? 198  GLY A CA  1 
ATOM   1532  C  C   . GLY A 1 198 ? 82.791  49.343 20.957  1.00 26.12  ? 198  GLY A C   1 
ATOM   1533  O  O   . GLY A 1 198 ? 82.252  49.199 22.053  1.00 25.54  ? 198  GLY A O   1 
ATOM   1534  N  N   . GLU A 1 199 ? 84.108  49.319 20.784  1.00 26.24  ? 199  GLU A N   1 
ATOM   1535  C  CA  . GLU A 1 199 ? 85.019  49.079 21.883  1.00 26.80  ? 199  GLU A CA  1 
ATOM   1536  C  C   . GLU A 1 199 ? 85.902  50.297 22.187  1.00 28.11  ? 199  GLU A C   1 
ATOM   1537  O  O   . GLU A 1 199 ? 86.200  51.099 21.305  1.00 27.60  ? 199  GLU A O   1 
ATOM   1538  C  CB  . GLU A 1 199 ? 85.868  47.846 21.551  1.00 25.17  ? 199  GLU A CB  1 
ATOM   1539  C  CG  . GLU A 1 199 ? 86.753  47.320 22.681  1.00 26.81  ? 199  GLU A CG  1 
ATOM   1540  C  CD  . GLU A 1 199 ? 88.168  47.875 22.623  1.00 30.85  ? 199  GLU A CD  1 
ATOM   1541  O  OE1 . GLU A 1 199 ? 88.567  48.381 21.549  1.00 33.42  ? 199  GLU A OE1 1 
ATOM   1542  O  OE2 . GLU A 1 199 ? 88.892  47.798 23.639  1.00 31.19  ? 199  GLU A OE2 1 
ATOM   1543  N  N   . SER A 1 200 ? 86.308  50.417 23.449  1.00 30.08  ? 200  SER A N   1 
ATOM   1544  C  CA  . SER A 1 200 ? 87.156  51.512 23.925  1.00 32.10  ? 200  SER A CA  1 
ATOM   1545  C  C   . SER A 1 200 ? 86.552  52.864 23.540  1.00 30.61  ? 200  SER A C   1 
ATOM   1546  O  O   . SER A 1 200 ? 85.492  53.232 24.048  1.00 29.26  ? 200  SER A O   1 
ATOM   1547  C  CB  . SER A 1 200 ? 88.577  51.376 23.359  1.00 33.27  ? 200  SER A CB  1 
ATOM   1548  O  OG  . SER A 1 200 ? 89.498  52.090 24.178  1.00 40.49  ? 200  SER A OG  1 
ATOM   1549  N  N   . ALA A 1 201 ? 87.215  53.603 22.657  1.00 27.44  ? 201  ALA A N   1 
ATOM   1550  C  CA  . ALA A 1 201 ? 86.685  54.890 22.229  1.00 27.17  ? 201  ALA A CA  1 
ATOM   1551  C  C   . ALA A 1 201 ? 85.359  54.646 21.512  1.00 26.43  ? 201  ALA A C   1 
ATOM   1552  O  O   . ALA A 1 201 ? 84.474  55.500 21.512  1.00 24.49  ? 201  ALA A O   1 
ATOM   1553  C  CB  . ALA A 1 201 ? 87.660  55.582 21.304  1.00 25.97  ? 201  ALA A CB  1 
ATOM   1554  N  N   . GLY A 1 202 ? 85.233  53.467 20.910  1.00 25.40  ? 202  GLY A N   1 
ATOM   1555  C  CA  . GLY A 1 202 ? 84.015  53.109 20.208  1.00 25.98  ? 202  GLY A CA  1 
ATOM   1556  C  C   . GLY A 1 202 ? 82.887  52.861 21.188  1.00 26.23  ? 202  GLY A C   1 
ATOM   1557  O  O   . GLY A 1 202 ? 81.720  53.087 20.876  1.00 29.00  ? 202  GLY A O   1 
ATOM   1558  N  N   . GLY A 1 203 ? 83.240  52.383 22.375  1.00 25.11  ? 203  GLY A N   1 
ATOM   1559  C  CA  . GLY A 1 203 ? 82.249  52.132 23.407  1.00 24.36  ? 203  GLY A CA  1 
ATOM   1560  C  C   . GLY A 1 203 ? 81.834  53.446 24.039  1.00 23.55  ? 203  GLY A C   1 
ATOM   1561  O  O   . GLY A 1 203 ? 80.668  53.649 24.368  1.00 24.96  ? 203  GLY A O   1 
ATOM   1562  N  N   . ALA A 1 204 ? 82.799  54.340 24.219  1.00 22.37  ? 204  ALA A N   1 
ATOM   1563  C  CA  . ALA A 1 204 ? 82.520  55.652 24.770  1.00 23.41  ? 204  ALA A CA  1 
ATOM   1564  C  C   . ALA A 1 204 ? 81.631  56.425 23.778  1.00 24.49  ? 204  ALA A C   1 
ATOM   1565  O  O   . ALA A 1 204 ? 80.758  57.190 24.188  1.00 24.41  ? 204  ALA A O   1 
ATOM   1566  C  CB  . ALA A 1 204 ? 83.821  56.407 25.005  1.00 22.63  ? 204  ALA A CB  1 
ATOM   1567  N  N   . SER A 1 205 ? 81.858  56.221 22.478  1.00 22.42  ? 205  SER A N   1 
ATOM   1568  C  CA  . SER A 1 205 ? 81.063  56.900 21.458  1.00 22.97  ? 205  SER A CA  1 
ATOM   1569  C  C   . SER A 1 205 ? 79.613  56.435 21.543  1.00 23.81  ? 205  SER A C   1 
ATOM   1570  O  O   . SER A 1 205 ? 78.698  57.257 21.539  1.00 23.07  ? 205  SER A O   1 
ATOM   1571  C  CB  . SER A 1 205 ? 81.619  56.630 20.057  1.00 22.04  ? 205  SER A CB  1 
ATOM   1572  O  OG  . SER A 1 205 ? 82.808  57.362 19.825  1.00 22.38  ? 205  SER A OG  1 
ATOM   1573  N  N   . VAL A 1 206 ? 79.414  55.117 21.620  1.00 23.32  ? 206  VAL A N   1 
ATOM   1574  C  CA  . VAL A 1 206 ? 78.077  54.552 21.734  1.00 21.75  ? 206  VAL A CA  1 
ATOM   1575  C  C   . VAL A 1 206 ? 77.372  55.206 22.922  1.00 23.39  ? 206  VAL A C   1 
ATOM   1576  O  O   . VAL A 1 206 ? 76.229  55.664 22.811  1.00 22.94  ? 206  VAL A O   1 
ATOM   1577  C  CB  . VAL A 1 206 ? 78.123  53.018 21.964  1.00 22.87  ? 206  VAL A CB  1 
ATOM   1578  C  CG1 . VAL A 1 206 ? 76.765  52.516 22.422  1.00 20.46  ? 206  VAL A CG1 1 
ATOM   1579  C  CG2 . VAL A 1 206 ? 78.531  52.307 20.684  1.00 22.77  ? 206  VAL A CG2 1 
ATOM   1580  N  N   . GLY A 1 207 ? 78.066  55.253 24.055  1.00 20.46  ? 207  GLY A N   1 
ATOM   1581  C  CA  . GLY A 1 207 ? 77.492  55.859 25.238  1.00 23.18  ? 207  GLY A CA  1 
ATOM   1582  C  C   . GLY A 1 207 ? 77.135  57.325 25.045  1.00 25.13  ? 207  GLY A C   1 
ATOM   1583  O  O   . GLY A 1 207 ? 76.150  57.803 25.603  1.00 25.19  ? 207  GLY A O   1 
ATOM   1584  N  N   . MET A 1 208 ? 77.937  58.042 24.261  1.00 24.78  ? 208  MET A N   1 
ATOM   1585  C  CA  . MET A 1 208 ? 77.690  59.460 24.017  1.00 26.10  ? 208  MET A CA  1 
ATOM   1586  C  C   . MET A 1 208 ? 76.483  59.677 23.112  1.00 26.09  ? 208  MET A C   1 
ATOM   1587  O  O   . MET A 1 208 ? 75.822  60.707 23.209  1.00 24.60  ? 208  MET A O   1 
ATOM   1588  C  CB  . MET A 1 208 ? 78.935  60.117 23.417  1.00 26.00  ? 208  MET A CB  1 
ATOM   1589  C  CG  . MET A 1 208 ? 80.135  60.060 24.346  1.00 26.00  ? 208  MET A CG  1 
ATOM   1590  S  SD  . MET A 1 208 ? 81.661  60.629 23.590  1.00 29.06  ? 208  MET A SD  1 
ATOM   1591  C  CE  . MET A 1 208 ? 82.679  60.897 25.016  1.00 24.91  ? 208  MET A CE  1 
ATOM   1592  N  N   . HIS A 1 209 ? 76.199  58.718 22.233  1.00 24.77  ? 209  HIS A N   1 
ATOM   1593  C  CA  . HIS A 1 209 ? 75.039  58.834 21.354  1.00 27.86  ? 209  HIS A CA  1 
ATOM   1594  C  C   . HIS A 1 209 ? 73.780  58.559 22.158  1.00 28.55  ? 209  HIS A C   1 
ATOM   1595  O  O   . HIS A 1 209 ? 72.710  59.083 21.851  1.00 28.80  ? 209  HIS A O   1 
ATOM   1596  C  CB  . HIS A 1 209 ? 75.128  57.864 20.175  1.00 28.08  ? 209  HIS A CB  1 
ATOM   1597  C  CG  . HIS A 1 209 ? 76.126  58.279 19.140  1.00 28.88  ? 209  HIS A CG  1 
ATOM   1598  N  ND1 . HIS A 1 209 ? 76.069  59.501 18.505  1.00 28.60  ? 209  HIS A ND1 1 
ATOM   1599  C  CD2 . HIS A 1 209 ? 77.234  57.661 18.670  1.00 27.96  ? 209  HIS A CD2 1 
ATOM   1600  C  CE1 . HIS A 1 209 ? 77.102  59.619 17.690  1.00 30.50  ? 209  HIS A CE1 1 
ATOM   1601  N  NE2 . HIS A 1 209 ? 77.825  58.516 17.773  1.00 29.83  ? 209  HIS A NE2 1 
ATOM   1602  N  N   . ILE A 1 210 ? 73.918  57.732 23.188  1.00 27.12  ? 210  ILE A N   1 
ATOM   1603  C  CA  . ILE A 1 210 ? 72.803  57.417 24.058  1.00 27.95  ? 210  ILE A CA  1 
ATOM   1604  C  C   . ILE A 1 210 ? 72.448  58.686 24.826  1.00 29.51  ? 210  ILE A C   1 
ATOM   1605  O  O   . ILE A 1 210 ? 71.287  58.925 25.151  1.00 29.73  ? 210  ILE A O   1 
ATOM   1606  C  CB  . ILE A 1 210 ? 73.172  56.302 25.061  1.00 29.45  ? 210  ILE A CB  1 
ATOM   1607  C  CG1 . ILE A 1 210 ? 73.158  54.941 24.354  1.00 30.08  ? 210  ILE A CG1 1 
ATOM   1608  C  CG2 . ILE A 1 210 ? 72.209  56.312 26.239  1.00 28.75  ? 210  ILE A CG2 1 
ATOM   1609  C  CD1 . ILE A 1 210 ? 73.531  53.784 25.252  1.00 28.25  ? 210  ILE A CD1 1 
ATOM   1610  N  N   . LEU A 1 211 ? 73.456  59.508 25.091  1.00 31.08  ? 211  LEU A N   1 
ATOM   1611  C  CA  . LEU A 1 211 ? 73.253  60.747 25.832  1.00 32.92  ? 211  LEU A CA  1 
ATOM   1612  C  C   . LEU A 1 211 ? 72.874  61.939 24.968  1.00 33.89  ? 211  LEU A C   1 
ATOM   1613  O  O   . LEU A 1 211 ? 72.201  62.851 25.431  1.00 37.89  ? 211  LEU A O   1 
ATOM   1614  C  CB  . LEU A 1 211 ? 74.514  61.108 26.623  1.00 32.25  ? 211  LEU A CB  1 
ATOM   1615  C  CG  . LEU A 1 211 ? 74.961  60.161 27.736  1.00 32.62  ? 211  LEU A CG  1 
ATOM   1616  C  CD1 . LEU A 1 211 ? 76.303  60.615 28.279  1.00 31.17  ? 211  LEU A CD1 1 
ATOM   1617  C  CD2 . LEU A 1 211 ? 73.911  60.137 28.835  1.00 34.24  ? 211  LEU A CD2 1 
ATOM   1618  N  N   . SER A 1 212 ? 73.297  61.941 23.714  1.00 33.93  ? 212  SER A N   1 
ATOM   1619  C  CA  . SER A 1 212 ? 73.007  63.076 22.850  1.00 33.77  ? 212  SER A CA  1 
ATOM   1620  C  C   . SER A 1 212 ? 71.616  63.046 22.245  1.00 34.04  ? 212  SER A C   1 
ATOM   1621  O  O   . SER A 1 212 ? 71.219  62.061 21.621  1.00 34.22  ? 212  SER A O   1 
ATOM   1622  C  CB  . SER A 1 212 ? 74.049  63.172 21.734  1.00 33.42  ? 212  SER A CB  1 
ATOM   1623  O  OG  . SER A 1 212 ? 73.862  64.344 20.958  1.00 31.80  ? 212  SER A OG  1 
ATOM   1624  N  N   . PRO A 1 213 ? 70.852  64.137 22.430  1.00 35.14  ? 213  PRO A N   1 
ATOM   1625  C  CA  . PRO A 1 213 ? 69.488  64.271 21.905  1.00 34.47  ? 213  PRO A CA  1 
ATOM   1626  C  C   . PRO A 1 213 ? 69.426  64.083 20.389  1.00 34.49  ? 213  PRO A C   1 
ATOM   1627  O  O   . PRO A 1 213 ? 68.524  63.422 19.873  1.00 35.60  ? 213  PRO A O   1 
ATOM   1628  C  CB  . PRO A 1 213 ? 69.099  65.681 22.332  1.00 35.77  ? 213  PRO A CB  1 
ATOM   1629  C  CG  . PRO A 1 213 ? 69.802  65.818 23.654  1.00 35.93  ? 213  PRO A CG  1 
ATOM   1630  C  CD  . PRO A 1 213 ? 71.172  65.249 23.346  1.00 34.30  ? 213  PRO A CD  1 
ATOM   1631  N  N   . GLY A 1 214 ? 70.399  64.652 19.682  1.00 33.83  ? 214  GLY A N   1 
ATOM   1632  C  CA  . GLY A 1 214 ? 70.431  64.533 18.231  1.00 33.17  ? 214  GLY A CA  1 
ATOM   1633  C  C   . GLY A 1 214 ? 70.788  63.163 17.663  1.00 33.17  ? 214  GLY A C   1 
ATOM   1634  O  O   . GLY A 1 214 ? 70.691  62.949 16.453  1.00 31.86  ? 214  GLY A O   1 
ATOM   1635  N  N   . SER A 1 215 ? 71.190  62.228 18.521  1.00 32.88  ? 215  SER A N   1 
ATOM   1636  C  CA  . SER A 1 215 ? 71.560  60.888 18.064  1.00 32.36  ? 215  SER A CA  1 
ATOM   1637  C  C   . SER A 1 215 ? 70.541  59.825 18.456  1.00 32.90  ? 215  SER A C   1 
ATOM   1638  O  O   . SER A 1 215 ? 70.377  58.826 17.757  1.00 32.84  ? 215  SER A O   1 
ATOM   1639  C  CB  . SER A 1 215 ? 72.921  60.480 18.650  1.00 32.42  ? 215  SER A CB  1 
ATOM   1640  O  OG  . SER A 1 215 ? 73.981  61.312 18.209  1.00 30.23  ? 215  SER A OG  1 
ATOM   1641  N  N   . ARG A 1 216 ? 69.852  60.057 19.570  1.00 33.97  ? 216  ARG A N   1 
ATOM   1642  C  CA  . ARG A 1 216 ? 68.890  59.101 20.116  1.00 35.95  ? 216  ARG A CA  1 
ATOM   1643  C  C   . ARG A 1 216 ? 67.920  58.406 19.168  1.00 35.69  ? 216  ARG A C   1 
ATOM   1644  O  O   . ARG A 1 216 ? 67.702  57.200 19.283  1.00 35.14  ? 216  ARG A O   1 
ATOM   1645  C  CB  . ARG A 1 216 ? 68.104  59.750 21.258  1.00 37.85  ? 216  ARG A CB  1 
ATOM   1646  C  CG  . ARG A 1 216 ? 68.970  60.124 22.463  1.00 41.54  ? 216  ARG A CG  1 
ATOM   1647  C  CD  . ARG A 1 216 ? 68.131  60.750 23.571  1.00 43.90  ? 216  ARG A CD  1 
ATOM   1648  N  NE  . ARG A 1 216 ? 68.942  61.526 24.504  1.00 43.76  ? 216  ARG A NE  1 
ATOM   1649  C  CZ  . ARG A 1 216 ? 68.456  62.484 25.287  1.00 44.86  ? 216  ARG A CZ  1 
ATOM   1650  N  NH1 . ARG A 1 216 ? 69.257  63.148 26.110  1.00 45.20  ? 216  ARG A NH1 1 
ATOM   1651  N  NH2 . ARG A 1 216 ? 67.165  62.780 25.245  1.00 46.47  ? 216  ARG A NH2 1 
ATOM   1652  N  N   . ASP A 1 217 ? 67.342  59.147 18.233  1.00 35.60  ? 217  ASP A N   1 
ATOM   1653  C  CA  . ASP A 1 217 ? 66.381  58.551 17.319  1.00 37.24  ? 217  ASP A CA  1 
ATOM   1654  C  C   . ASP A 1 217 ? 67.018  57.780 16.176  1.00 35.38  ? 217  ASP A C   1 
ATOM   1655  O  O   . ASP A 1 217 ? 66.319  57.206 15.342  1.00 34.09  ? 217  ASP A O   1 
ATOM   1656  C  CB  . ASP A 1 217 ? 65.450  59.634 16.767  1.00 40.93  ? 217  ASP A CB  1 
ATOM   1657  C  CG  . ASP A 1 217 ? 64.696  60.358 17.866  1.00 45.70  ? 217  ASP A CG  1 
ATOM   1658  O  OD1 . ASP A 1 217 ? 64.061  59.667 18.697  1.00 48.17  ? 217  ASP A OD1 1 
ATOM   1659  O  OD2 . ASP A 1 217 ? 64.736  61.611 17.905  1.00 47.88  ? 217  ASP A OD2 1 
ATOM   1660  N  N   . LEU A 1 218 ? 68.345  57.743 16.151  1.00 34.29  ? 218  LEU A N   1 
ATOM   1661  C  CA  . LEU A 1 218 ? 69.043  57.044 15.083  1.00 32.78  ? 218  LEU A CA  1 
ATOM   1662  C  C   . LEU A 1 218 ? 69.370  55.580 15.356  1.00 32.62  ? 218  LEU A C   1 
ATOM   1663  O  O   . LEU A 1 218 ? 69.954  54.914 14.504  1.00 30.68  ? 218  LEU A O   1 
ATOM   1664  C  CB  . LEU A 1 218 ? 70.316  57.806 14.710  1.00 33.48  ? 218  LEU A CB  1 
ATOM   1665  C  CG  . LEU A 1 218 ? 70.064  59.191 14.100  1.00 32.93  ? 218  LEU A CG  1 
ATOM   1666  C  CD1 . LEU A 1 218 ? 71.389  59.845 13.756  1.00 33.02  ? 218  LEU A CD1 1 
ATOM   1667  C  CD2 . LEU A 1 218 ? 69.194  59.053 12.855  1.00 32.38  ? 218  LEU A CD2 1 
ATOM   1668  N  N   . PHE A 1 219 ? 69.009  55.078 16.537  1.00 31.18  ? 219  PHE A N   1 
ATOM   1669  C  CA  . PHE A 1 219 ? 69.259  53.672 16.853  1.00 29.56  ? 219  PHE A CA  1 
ATOM   1670  C  C   . PHE A 1 219 ? 68.314  53.130 17.923  1.00 29.30  ? 219  PHE A C   1 
ATOM   1671  O  O   . PHE A 1 219 ? 67.732  53.888 18.694  1.00 29.60  ? 219  PHE A O   1 
ATOM   1672  C  CB  . PHE A 1 219 ? 70.713  53.442 17.281  1.00 27.84  ? 219  PHE A CB  1 
ATOM   1673  C  CG  . PHE A 1 219 ? 71.070  54.095 18.576  1.00 27.07  ? 219  PHE A CG  1 
ATOM   1674  C  CD1 . PHE A 1 219 ? 71.306  55.461 18.636  1.00 23.51  ? 219  PHE A CD1 1 
ATOM   1675  C  CD2 . PHE A 1 219 ? 71.140  53.345 19.746  1.00 24.84  ? 219  PHE A CD2 1 
ATOM   1676  C  CE1 . PHE A 1 219 ? 71.606  56.074 19.841  1.00 26.09  ? 219  PHE A CE1 1 
ATOM   1677  C  CE2 . PHE A 1 219 ? 71.440  53.952 20.959  1.00 27.56  ? 219  PHE A CE2 1 
ATOM   1678  C  CZ  . PHE A 1 219 ? 71.673  55.317 21.008  1.00 26.14  ? 219  PHE A CZ  1 
ATOM   1679  N  N   . ARG A 1 220 ? 68.184  51.808 17.966  1.00 29.52  ? 220  ARG A N   1 
ATOM   1680  C  CA  . ARG A 1 220 ? 67.293  51.132 18.897  1.00 31.65  ? 220  ARG A CA  1 
ATOM   1681  C  C   . ARG A 1 220 ? 67.961  50.664 20.196  1.00 33.13  ? 220  ARG A C   1 
ATOM   1682  O  O   . ARG A 1 220 ? 67.489  50.986 21.286  1.00 35.25  ? 220  ARG A O   1 
ATOM   1683  C  CB  . ARG A 1 220 ? 66.641  49.941 18.181  1.00 33.08  ? 220  ARG A CB  1 
ATOM   1684  C  CG  . ARG A 1 220 ? 65.599  49.184 18.980  1.00 35.52  ? 220  ARG A CG  1 
ATOM   1685  C  CD  . ARG A 1 220 ? 64.400  50.060 19.325  1.00 39.62  ? 220  ARG A CD  1 
ATOM   1686  N  NE  . ARG A 1 220 ? 63.337  49.303 19.988  1.00 43.18  ? 220  ARG A NE  1 
ATOM   1687  C  CZ  . ARG A 1 220 ? 62.645  48.322 19.410  1.00 46.86  ? 220  ARG A CZ  1 
ATOM   1688  N  NH1 . ARG A 1 220 ? 62.903  47.976 18.152  1.00 46.25  ? 220  ARG A NH1 1 
ATOM   1689  N  NH2 . ARG A 1 220 ? 61.693  47.686 20.086  1.00 46.94  ? 220  ARG A NH2 1 
ATOM   1690  N  N   . ARG A 1 221 ? 69.045  49.900 20.080  1.00 32.29  ? 221  ARG A N   1 
ATOM   1691  C  CA  . ARG A 1 221 ? 69.756  49.383 21.250  1.00 31.66  ? 221  ARG A CA  1 
ATOM   1692  C  C   . ARG A 1 221 ? 71.244  49.703 21.171  1.00 29.12  ? 221  ARG A C   1 
ATOM   1693  O  O   . ARG A 1 221 ? 71.719  50.174 20.149  1.00 29.23  ? 221  ARG A O   1 
ATOM   1694  C  CB  . ARG A 1 221 ? 69.587  47.870 21.346  1.00 32.47  ? 221  ARG A CB  1 
ATOM   1695  C  CG  . ARG A 1 221 ? 68.161  47.395 21.421  1.00 36.20  ? 221  ARG A CG  1 
ATOM   1696  C  CD  . ARG A 1 221 ? 68.142  45.894 21.382  1.00 36.16  ? 221  ARG A CD  1 
ATOM   1697  N  NE  . ARG A 1 221 ? 67.142  45.382 20.454  1.00 40.76  ? 221  ARG A NE  1 
ATOM   1698  C  CZ  . ARG A 1 221 ? 65.835  45.441 20.659  1.00 40.51  ? 221  ARG A CZ  1 
ATOM   1699  N  NH1 . ARG A 1 221 ? 65.362  45.997 21.762  1.00 42.63  ? 221  ARG A NH1 1 
ATOM   1700  N  NH2 . ARG A 1 221 ? 65.002  44.921 19.772  1.00 44.63  ? 221  ARG A NH2 1 
ATOM   1701  N  N   . ALA A 1 222 ? 71.978  49.415 22.241  1.00 27.29  ? 222  ALA A N   1 
ATOM   1702  C  CA  . ALA A 1 222 ? 73.407  49.711 22.278  1.00 27.29  ? 222  ALA A CA  1 
ATOM   1703  C  C   . ALA A 1 222 ? 74.243  48.690 23.044  1.00 26.37  ? 222  ALA A C   1 
ATOM   1704  O  O   . ALA A 1 222 ? 73.806  48.130 24.049  1.00 25.34  ? 222  ALA A O   1 
ATOM   1705  C  CB  . ALA A 1 222 ? 73.628  51.098 22.877  1.00 25.04  ? 222  ALA A CB  1 
ATOM   1706  N  N   . ILE A 1 223 ? 75.457  48.471 22.555  1.00 26.21  ? 223  ILE A N   1 
ATOM   1707  C  CA  . ILE A 1 223 ? 76.405  47.554 23.173  1.00 25.94  ? 223  ILE A CA  1 
ATOM   1708  C  C   . ILE A 1 223 ? 77.711  48.316 23.370  1.00 26.55  ? 223  ILE A C   1 
ATOM   1709  O  O   . ILE A 1 223 ? 78.262  48.854 22.413  1.00 28.01  ? 223  ILE A O   1 
ATOM   1710  C  CB  . ILE A 1 223 ? 76.673  46.332 22.276  1.00 25.14  ? 223  ILE A CB  1 
ATOM   1711  C  CG1 . ILE A 1 223 ? 75.411  45.478 22.177  1.00 23.20  ? 223  ILE A CG1 1 
ATOM   1712  C  CG2 . ILE A 1 223 ? 77.852  45.526 22.819  1.00 25.55  ? 223  ILE A CG2 1 
ATOM   1713  C  CD1 . ILE A 1 223 ? 75.603  44.196 21.391  1.00 20.46  ? 223  ILE A CD1 1 
ATOM   1714  N  N   . LEU A 1 224 ? 78.188  48.376 24.611  1.00 26.36  ? 224  LEU A N   1 
ATOM   1715  C  CA  . LEU A 1 224 ? 79.431  49.072 24.932  1.00 25.97  ? 224  LEU A CA  1 
ATOM   1716  C  C   . LEU A 1 224 ? 80.478  48.087 25.433  1.00 26.58  ? 224  LEU A C   1 
ATOM   1717  O  O   . LEU A 1 224 ? 80.270  47.415 26.439  1.00 26.50  ? 224  LEU A O   1 
ATOM   1718  C  CB  . LEU A 1 224 ? 79.199  50.133 26.011  1.00 24.33  ? 224  LEU A CB  1 
ATOM   1719  C  CG  . LEU A 1 224 ? 78.206  51.260 25.719  1.00 24.88  ? 224  LEU A CG  1 
ATOM   1720  C  CD1 . LEU A 1 224 ? 76.784  50.727 25.765  1.00 20.46  ? 224  LEU A CD1 1 
ATOM   1721  C  CD2 . LEU A 1 224 ? 78.388  52.365 26.738  1.00 22.96  ? 224  LEU A CD2 1 
ATOM   1722  N  N   . GLN A 1 225 ? 81.604  48.006 24.733  1.00 26.01  ? 225  GLN A N   1 
ATOM   1723  C  CA  . GLN A 1 225 ? 82.676  47.102 25.130  1.00 25.85  ? 225  GLN A CA  1 
ATOM   1724  C  C   . GLN A 1 225 ? 83.884  47.871 25.631  1.00 26.10  ? 225  GLN A C   1 
ATOM   1725  O  O   . GLN A 1 225 ? 84.569  48.532 24.847  1.00 27.67  ? 225  GLN A O   1 
ATOM   1726  C  CB  . GLN A 1 225 ? 83.098  46.218 23.950  1.00 25.76  ? 225  GLN A CB  1 
ATOM   1727  C  CG  . GLN A 1 225 ? 81.950  45.442 23.316  1.00 25.31  ? 225  GLN A CG  1 
ATOM   1728  C  CD  . GLN A 1 225 ? 82.343  44.768 22.015  1.00 24.81  ? 225  GLN A CD  1 
ATOM   1729  O  OE1 . GLN A 1 225 ? 81.484  44.354 21.241  1.00 22.62  ? 225  GLN A OE1 1 
ATOM   1730  N  NE2 . GLN A 1 225 ? 83.648  44.651 21.771  1.00 24.70  ? 225  GLN A NE2 1 
ATOM   1731  N  N   . SER A 1 226 ? 84.136  47.784 26.936  1.00 25.14  ? 226  SER A N   1 
ATOM   1732  C  CA  . SER A 1 226 ? 85.284  48.436 27.569  1.00 24.19  ? 226  SER A CA  1 
ATOM   1733  C  C   . SER A 1 226 ? 85.364  49.945 27.359  1.00 24.03  ? 226  SER A C   1 
ATOM   1734  O  O   . SER A 1 226 ? 86.435  50.492 27.100  1.00 23.83  ? 226  SER A O   1 
ATOM   1735  C  CB  . SER A 1 226 ? 86.580  47.801 27.074  1.00 21.59  ? 226  SER A CB  1 
ATOM   1736  O  OG  . SER A 1 226 ? 86.602  46.417 27.357  1.00 28.41  ? 226  SER A OG  1 
ATOM   1737  N  N   . GLY A 1 227 ? 84.232  50.619 27.478  1.00 23.93  ? 227  GLY A N   1 
ATOM   1738  C  CA  . GLY A 1 227 ? 84.230  52.052 27.289  1.00 23.18  ? 227  GLY A CA  1 
ATOM   1739  C  C   . GLY A 1 227 ? 82.891  52.637 27.663  1.00 23.95  ? 227  GLY A C   1 
ATOM   1740  O  O   . GLY A 1 227 ? 81.848  52.021 27.440  1.00 23.18  ? 227  GLY A O   1 
ATOM   1741  N  N   . SER A 1 228 ? 82.925  53.825 28.249  1.00 23.13  ? 228  SER A N   1 
ATOM   1742  C  CA  . SER A 1 228 ? 81.715  54.516 28.651  1.00 25.84  ? 228  SER A CA  1 
ATOM   1743  C  C   . SER A 1 228 ? 81.963  56.005 28.466  1.00 26.41  ? 228  SER A C   1 
ATOM   1744  O  O   . SER A 1 228 ? 83.102  56.472 28.536  1.00 25.07  ? 228  SER A O   1 
ATOM   1745  C  CB  . SER A 1 228 ? 81.367  54.200 30.114  1.00 25.48  ? 228  SER A CB  1 
ATOM   1746  O  OG  . SER A 1 228 ? 82.455  54.476 30.977  1.00 29.09  ? 228  SER A OG  1 
ATOM   1747  N  N   . PRO A 1 229 ? 80.892  56.775 28.245  1.00 27.29  ? 229  PRO A N   1 
ATOM   1748  C  CA  . PRO A 1 229 ? 81.020  58.218 28.042  1.00 27.71  ? 229  PRO A CA  1 
ATOM   1749  C  C   . PRO A 1 229 ? 81.724  58.976 29.160  1.00 28.59  ? 229  PRO A C   1 
ATOM   1750  O  O   . PRO A 1 229 ? 82.367  59.999 28.915  1.00 28.98  ? 229  PRO A O   1 
ATOM   1751  C  CB  . PRO A 1 229 ? 79.573  58.664 27.836  1.00 27.71  ? 229  PRO A CB  1 
ATOM   1752  C  CG  . PRO A 1 229 ? 78.799  57.701 28.682  1.00 27.69  ? 229  PRO A CG  1 
ATOM   1753  C  CD  . PRO A 1 229 ? 79.477  56.380 28.360  1.00 28.19  ? 229  PRO A CD  1 
ATOM   1754  N  N   . ASN A 1 230 ? 81.631  58.465 30.381  1.00 27.48  ? 230  ASN A N   1 
ATOM   1755  C  CA  . ASN A 1 230 ? 82.243  59.138 31.520  1.00 27.75  ? 230  ASN A CA  1 
ATOM   1756  C  C   . ASN A 1 230 ? 83.705  58.793 31.841  1.00 26.70  ? 230  ASN A C   1 
ATOM   1757  O  O   . ASN A 1 230 ? 84.240  59.271 32.835  1.00 27.98  ? 230  ASN A O   1 
ATOM   1758  C  CB  . ASN A 1 230 ? 81.375  58.917 32.765  1.00 27.66  ? 230  ASN A CB  1 
ATOM   1759  C  CG  . ASN A 1 230 ? 81.093  57.444 33.021  1.00 27.80  ? 230  ASN A CG  1 
ATOM   1760  O  OD1 . ASN A 1 230 ? 80.610  56.735 32.138  1.00 27.84  ? 230  ASN A OD1 1 
ATOM   1761  N  ND2 . ASN A 1 230 ? 81.389  56.982 34.230  1.00 25.88  ? 230  ASN A ND2 1 
ATOM   1762  N  N   . CYS A 1 231 ? 84.361  57.976 31.024  1.00 26.99  ? 231  CYS A N   1 
ATOM   1763  C  CA  . CYS A 1 231 ? 85.762  57.655 31.301  1.00 26.82  ? 231  CYS A CA  1 
ATOM   1764  C  C   . CYS A 1 231 ? 86.547  58.959 31.410  1.00 28.52  ? 231  CYS A C   1 
ATOM   1765  O  O   . CYS A 1 231 ? 86.230  59.935 30.731  1.00 29.87  ? 231  CYS A O   1 
ATOM   1766  C  CB  . CYS A 1 231 ? 86.348  56.784 30.198  1.00 25.18  ? 231  CYS A CB  1 
ATOM   1767  S  SG  . CYS A 1 231 ? 85.767  55.074 30.264  1.00 28.14  ? 231  CYS A SG  1 
ATOM   1768  N  N   . PRO A 1 232 ? 87.584  58.992 32.262  1.00 27.77  ? 232  PRO A N   1 
ATOM   1769  C  CA  . PRO A 1 232 ? 88.406  60.191 32.457  1.00 27.79  ? 232  PRO A CA  1 
ATOM   1770  C  C   . PRO A 1 232 ? 89.167  60.672 31.223  1.00 27.20  ? 232  PRO A C   1 
ATOM   1771  O  O   . PRO A 1 232 ? 89.544  61.838 31.136  1.00 28.33  ? 232  PRO A O   1 
ATOM   1772  C  CB  . PRO A 1 232 ? 89.337  59.789 33.605  1.00 27.38  ? 232  PRO A CB  1 
ATOM   1773  C  CG  . PRO A 1 232 ? 89.504  58.311 33.391  1.00 28.81  ? 232  PRO A CG  1 
ATOM   1774  C  CD  . PRO A 1 232 ? 88.095  57.866 33.065  1.00 27.56  ? 232  PRO A CD  1 
ATOM   1775  N  N   . TRP A 1 233 ? 89.383  59.778 30.269  1.00 25.44  ? 233  TRP A N   1 
ATOM   1776  C  CA  . TRP A 1 233 ? 90.103  60.127 29.049  1.00 26.31  ? 233  TRP A CA  1 
ATOM   1777  C  C   . TRP A 1 233 ? 89.175  60.456 27.867  1.00 25.71  ? 233  TRP A C   1 
ATOM   1778  O  O   . TRP A 1 233 ? 89.602  61.040 26.880  1.00 24.39  ? 233  TRP A O   1 
ATOM   1779  C  CB  . TRP A 1 233 ? 91.009  58.963 28.647  1.00 25.38  ? 233  TRP A CB  1 
ATOM   1780  C  CG  . TRP A 1 233 ? 90.266  57.650 28.609  1.00 25.65  ? 233  TRP A CG  1 
ATOM   1781  C  CD1 . TRP A 1 233 ? 90.174  56.725 29.617  1.00 24.03  ? 233  TRP A CD1 1 
ATOM   1782  C  CD2 . TRP A 1 233 ? 89.463  57.148 27.530  1.00 25.28  ? 233  TRP A CD2 1 
ATOM   1783  N  NE1 . TRP A 1 233 ? 89.362  55.681 29.229  1.00 25.29  ? 233  TRP A NE1 1 
ATOM   1784  C  CE2 . TRP A 1 233 ? 88.913  55.914 27.956  1.00 24.11  ? 233  TRP A CE2 1 
ATOM   1785  C  CE3 . TRP A 1 233 ? 89.154  57.622 26.244  1.00 24.60  ? 233  TRP A CE3 1 
ATOM   1786  C  CZ2 . TRP A 1 233 ? 88.073  55.147 27.143  1.00 23.64  ? 233  TRP A CZ2 1 
ATOM   1787  C  CZ3 . TRP A 1 233 ? 88.314  56.854 25.429  1.00 24.09  ? 233  TRP A CZ3 1 
ATOM   1788  C  CH2 . TRP A 1 233 ? 87.784  55.631 25.885  1.00 24.46  ? 233  TRP A CH2 1 
ATOM   1789  N  N   . ALA A 1 234 ? 87.906  60.084 27.983  1.00 25.73  ? 234  ALA A N   1 
ATOM   1790  C  CA  . ALA A 1 234 ? 86.935  60.276 26.912  1.00 25.28  ? 234  ALA A CA  1 
ATOM   1791  C  C   . ALA A 1 234 ? 86.414  61.687 26.611  1.00 25.03  ? 234  ALA A C   1 
ATOM   1792  O  O   . ALA A 1 234 ? 85.728  61.873 25.616  1.00 24.98  ? 234  ALA A O   1 
ATOM   1793  C  CB  . ALA A 1 234 ? 85.759  59.339 27.137  1.00 21.71  ? 234  ALA A CB  1 
ATOM   1794  N  N   . SER A 1 235 ? 86.719  62.680 27.440  1.00 24.61  ? 235  SER A N   1 
ATOM   1795  C  CA  . SER A 1 235 ? 86.219  64.024 27.150  1.00 25.85  ? 235  SER A CA  1 
ATOM   1796  C  C   . SER A 1 235 ? 86.920  65.127 27.923  1.00 25.57  ? 235  SER A C   1 
ATOM   1797  O  O   . SER A 1 235 ? 87.526  64.870 28.952  1.00 27.23  ? 235  SER A O   1 
ATOM   1798  C  CB  . SER A 1 235 ? 84.719  64.101 27.443  1.00 27.18  ? 235  SER A CB  1 
ATOM   1799  O  OG  . SER A 1 235 ? 84.477  64.237 28.836  1.00 27.40  ? 235  SER A OG  1 
ATOM   1800  N  N   . VAL A 1 236 ? 86.833  66.354 27.415  1.00 24.72  ? 236  VAL A N   1 
ATOM   1801  C  CA  . VAL A 1 236 ? 87.429  67.510 28.080  1.00 25.91  ? 236  VAL A CA  1 
ATOM   1802  C  C   . VAL A 1 236 ? 86.453  68.680 28.045  1.00 28.76  ? 236  VAL A C   1 
ATOM   1803  O  O   . VAL A 1 236 ? 85.470  68.662 27.306  1.00 30.36  ? 236  VAL A O   1 
ATOM   1804  C  CB  . VAL A 1 236 ? 88.756  67.972 27.402  1.00 26.18  ? 236  VAL A CB  1 
ATOM   1805  C  CG1 . VAL A 1 236 ? 89.784  66.866 27.453  1.00 27.85  ? 236  VAL A CG1 1 
ATOM   1806  C  CG2 . VAL A 1 236 ? 88.500  68.396 25.965  1.00 24.06  ? 236  VAL A CG2 1 
ATOM   1807  N  N   . SER A 1 237 ? 86.733  69.699 28.847  1.00 30.90  ? 237  SER A N   1 
ATOM   1808  C  CA  . SER A 1 237 ? 85.900  70.899 28.903  1.00 31.91  ? 237  SER A CA  1 
ATOM   1809  C  C   . SER A 1 237 ? 86.206  71.789 27.696  1.00 32.09  ? 237  SER A C   1 
ATOM   1810  O  O   . SER A 1 237 ? 87.184  71.563 26.980  1.00 31.42  ? 237  SER A O   1 
ATOM   1811  C  CB  . SER A 1 237 ? 86.209  71.680 30.179  1.00 32.21  ? 237  SER A CB  1 
ATOM   1812  O  OG  . SER A 1 237 ? 87.570  72.091 30.184  1.00 34.77  ? 237  SER A OG  1 
ATOM   1813  N  N   . VAL A 1 238 ? 85.380  72.806 27.475  1.00 33.17  ? 238  VAL A N   1 
ATOM   1814  C  CA  . VAL A 1 238 ? 85.614  73.714 26.359  1.00 34.21  ? 238  VAL A CA  1 
ATOM   1815  C  C   . VAL A 1 238 ? 86.919  74.460 26.583  1.00 33.52  ? 238  VAL A C   1 
ATOM   1816  O  O   . VAL A 1 238 ? 87.661  74.714 25.643  1.00 36.00  ? 238  VAL A O   1 
ATOM   1817  C  CB  . VAL A 1 238 ? 84.458  74.738 26.182  1.00 34.40  ? 238  VAL A CB  1 
ATOM   1818  C  CG1 . VAL A 1 238 ? 83.189  74.019 25.764  1.00 32.96  ? 238  VAL A CG1 1 
ATOM   1819  C  CG2 . VAL A 1 238 ? 84.226  75.500 27.469  1.00 35.92  ? 238  VAL A CG2 1 
ATOM   1820  N  N   . ALA A 1 239 ? 87.205  74.783 27.838  1.00 33.94  ? 239  ALA A N   1 
ATOM   1821  C  CA  . ALA A 1 239 ? 88.429  75.497 28.194  1.00 34.42  ? 239  ALA A CA  1 
ATOM   1822  C  C   . ALA A 1 239 ? 89.693  74.684 27.893  1.00 34.10  ? 239  ALA A C   1 
ATOM   1823  O  O   . ALA A 1 239 ? 90.652  75.213 27.336  1.00 33.26  ? 239  ALA A O   1 
ATOM   1824  C  CB  . ALA A 1 239 ? 88.394  75.880 29.674  1.00 33.03  ? 239  ALA A CB  1 
ATOM   1825  N  N   . GLU A 1 240 ? 89.698  73.407 28.275  1.00 34.50  ? 240  GLU A N   1 
ATOM   1826  C  CA  . GLU A 1 240 ? 90.852  72.542 28.026  1.00 34.59  ? 240  GLU A CA  1 
ATOM   1827  C  C   . GLU A 1 240 ? 90.974  72.291 26.523  1.00 33.06  ? 240  GLU A C   1 
ATOM   1828  O  O   . GLU A 1 240 ? 92.076  72.173 25.993  1.00 30.74  ? 240  GLU A O   1 
ATOM   1829  C  CB  . GLU A 1 240 ? 90.698  71.214 28.778  1.00 36.26  ? 240  GLU A CB  1 
ATOM   1830  C  CG  . GLU A 1 240 ? 91.815  70.184 28.545  1.00 38.41  ? 240  GLU A CG  1 
ATOM   1831  C  CD  . GLU A 1 240 ? 93.168  70.618 29.100  1.00 40.52  ? 240  GLU A CD  1 
ATOM   1832  O  OE1 . GLU A 1 240 ? 93.197  71.219 30.197  1.00 42.20  ? 240  GLU A OE1 1 
ATOM   1833  O  OE2 . GLU A 1 240 ? 94.207  70.350 28.452  1.00 37.19  ? 240  GLU A OE2 1 
ATOM   1834  N  N   . GLY A 1 241 ? 89.833  72.217 25.841  1.00 32.95  ? 241  GLY A N   1 
ATOM   1835  C  CA  . GLY A 1 241 ? 89.850  72.009 24.402  1.00 31.64  ? 241  GLY A CA  1 
ATOM   1836  C  C   . GLY A 1 241 ? 90.518  73.180 23.697  1.00 32.38  ? 241  GLY A C   1 
ATOM   1837  O  O   . GLY A 1 241 ? 91.336  72.989 22.794  1.00 32.62  ? 241  GLY A O   1 
ATOM   1838  N  N   . ARG A 1 242 ? 90.170  74.398 24.110  1.00 32.41  ? 242  ARG A N   1 
ATOM   1839  C  CA  . ARG A 1 242 ? 90.745  75.605 23.517  1.00 32.62  ? 242  ARG A CA  1 
ATOM   1840  C  C   . ARG A 1 242 ? 92.225  75.721 23.858  1.00 30.10  ? 242  ARG A C   1 
ATOM   1841  O  O   . ARG A 1 242 ? 93.049  76.014 22.998  1.00 28.17  ? 242  ARG A O   1 
ATOM   1842  C  CB  . ARG A 1 242 ? 90.007  76.860 24.010  1.00 32.31  ? 242  ARG A CB  1 
ATOM   1843  C  CG  . ARG A 1 242 ? 90.671  78.178 23.586  1.00 33.99  ? 242  ARG A CG  1 
ATOM   1844  C  CD  . ARG A 1 242 ? 89.831  79.393 23.999  1.00 34.48  ? 242  ARG A CD  1 
ATOM   1845  N  NE  . ARG A 1 242 ? 88.558  79.419 23.283  1.00 35.07  ? 242  ARG A NE  1 
ATOM   1846  C  CZ  . ARG A 1 242 ? 88.437  79.739 22.000  1.00 33.71  ? 242  ARG A CZ  1 
ATOM   1847  N  NH1 . ARG A 1 242 ? 87.246  79.728 21.419  1.00 33.44  ? 242  ARG A NH1 1 
ATOM   1848  N  NH2 . ARG A 1 242 ? 89.510  80.093 21.302  1.00 35.34  ? 242  ARG A NH2 1 
ATOM   1849  N  N   . ARG A 1 243 ? 92.557  75.480 25.119  1.00 32.16  ? 243  ARG A N   1 
ATOM   1850  C  CA  . ARG A 1 243 ? 93.942  75.559 25.557  1.00 33.02  ? 243  ARG A CA  1 
ATOM   1851  C  C   . ARG A 1 243 ? 94.797  74.617 24.718  1.00 32.33  ? 243  ARG A C   1 
ATOM   1852  O  O   . ARG A 1 243 ? 95.862  75.006 24.232  1.00 34.48  ? 243  ARG A O   1 
ATOM   1853  C  CB  . ARG A 1 243 ? 94.063  75.183 27.032  1.00 35.74  ? 243  ARG A CB  1 
ATOM   1854  C  CG  . ARG A 1 243 ? 95.312  75.740 27.715  1.00 41.81  ? 243  ARG A CG  1 
ATOM   1855  C  CD  . ARG A 1 243 ? 96.025  74.688 28.546  1.00 44.88  ? 243  ARG A CD  1 
ATOM   1856  N  NE  . ARG A 1 243 ? 96.953  73.905 27.736  1.00 48.79  ? 243  ARG A NE  1 
ATOM   1857  C  CZ  . ARG A 1 243 ? 97.097  72.588 27.825  1.00 48.87  ? 243  ARG A CZ  1 
ATOM   1858  N  NH1 . ARG A 1 243 ? 96.369  71.894 28.687  1.00 50.02  ? 243  ARG A NH1 1 
ATOM   1859  N  NH2 . ARG A 1 243 ? 97.974  71.969 27.050  1.00 49.37  ? 243  ARG A NH2 1 
ATOM   1860  N  N   . ARG A 1 244 ? 94.331  73.383 24.542  1.00 29.47  ? 244  ARG A N   1 
ATOM   1861  C  CA  . ARG A 1 244 ? 95.072  72.408 23.752  1.00 28.17  ? 244  ARG A CA  1 
ATOM   1862  C  C   . ARG A 1 244 ? 95.140  72.827 22.297  1.00 28.82  ? 244  ARG A C   1 
ATOM   1863  O  O   . ARG A 1 244 ? 96.170  72.676 21.648  1.00 28.49  ? 244  ARG A O   1 
ATOM   1864  C  CB  . ARG A 1 244 ? 94.429  71.024 23.854  1.00 28.59  ? 244  ARG A CB  1 
ATOM   1865  C  CG  . ARG A 1 244 ? 94.486  70.439 25.240  1.00 27.77  ? 244  ARG A CG  1 
ATOM   1866  C  CD  . ARG A 1 244 ? 94.007  69.009 25.266  1.00 27.32  ? 244  ARG A CD  1 
ATOM   1867  N  NE  . ARG A 1 244 ? 94.015  68.502 26.634  1.00 27.26  ? 244  ARG A NE  1 
ATOM   1868  C  CZ  . ARG A 1 244 ? 93.674  67.266 26.984  1.00 26.02  ? 244  ARG A CZ  1 
ATOM   1869  N  NH1 . ARG A 1 244 ? 93.292  66.390 26.064  1.00 23.52  ? 244  ARG A NH1 1 
ATOM   1870  N  NH2 . ARG A 1 244 ? 93.721  66.911 28.260  1.00 22.80  ? 244  ARG A NH2 1 
ATOM   1871  N  N   . ALA A 1 245 ? 94.036  73.356 21.784  1.00 29.96  ? 245  ALA A N   1 
ATOM   1872  C  CA  . ALA A 1 245 ? 93.995  73.800 20.398  1.00 32.36  ? 245  ALA A CA  1 
ATOM   1873  C  C   . ALA A 1 245 ? 94.992  74.936 20.181  1.00 34.04  ? 245  ALA A C   1 
ATOM   1874  O  O   . ALA A 1 245 ? 95.723  74.953 19.189  1.00 34.52  ? 245  ALA A O   1 
ATOM   1875  C  CB  . ALA A 1 245 ? 92.588  74.259 20.033  1.00 32.41  ? 245  ALA A CB  1 
ATOM   1876  N  N   . VAL A 1 246 ? 95.029  75.884 21.107  1.00 34.48  ? 246  VAL A N   1 
ATOM   1877  C  CA  . VAL A 1 246 ? 95.951  76.994 20.964  1.00 35.88  ? 246  VAL A CA  1 
ATOM   1878  C  C   . VAL A 1 246 ? 97.394  76.504 21.063  1.00 36.67  ? 246  VAL A C   1 
ATOM   1879  O  O   . VAL A 1 246 ? 98.269  76.983 20.338  1.00 36.15  ? 246  VAL A O   1 
ATOM   1880  C  CB  . VAL A 1 246 ? 95.682  78.078 22.027  1.00 36.61  ? 246  VAL A CB  1 
ATOM   1881  C  CG1 . VAL A 1 246 ? 96.763  79.148 21.965  1.00 38.60  ? 246  VAL A CG1 1 
ATOM   1882  C  CG2 . VAL A 1 246 ? 94.315  78.703 21.784  1.00 35.48  ? 246  VAL A CG2 1 
ATOM   1883  N  N   . GLU A 1 247 ? 97.642  75.539 21.943  1.00 37.11  ? 247  GLU A N   1 
ATOM   1884  C  CA  . GLU A 1 247 ? 98.995  75.012 22.101  1.00 37.77  ? 247  GLU A CA  1 
ATOM   1885  C  C   . GLU A 1 247 ? 99.433  74.273 20.839  1.00 36.86  ? 247  GLU A C   1 
ATOM   1886  O  O   . GLU A 1 247 ? 100.630 74.125 20.578  1.00 36.02  ? 247  GLU A O   1 
ATOM   1887  C  CB  . GLU A 1 247 ? 99.082  74.076 23.311  1.00 40.97  ? 247  GLU A CB  1 
ATOM   1888  C  CG  . GLU A 1 247 ? 100.492 73.578 23.595  1.00 45.98  ? 247  GLU A CG  1 
ATOM   1889  C  CD  . GLU A 1 247 ? 101.454 74.700 23.994  1.00 50.03  ? 247  GLU A CD  1 
ATOM   1890  O  OE1 . GLU A 1 247 ? 102.685 74.470 23.957  1.00 50.81  ? 247  GLU A OE1 1 
ATOM   1891  O  OE2 . GLU A 1 247 ? 100.983 75.803 24.357  1.00 50.03  ? 247  GLU A OE2 1 
ATOM   1892  N  N   . LEU A 1 248 ? 98.466  73.802 20.057  1.00 35.18  ? 248  LEU A N   1 
ATOM   1893  C  CA  . LEU A 1 248 ? 98.797  73.109 18.819  1.00 34.99  ? 248  LEU A CA  1 
ATOM   1894  C  C   . LEU A 1 248 ? 99.349  74.169 17.869  1.00 36.36  ? 248  LEU A C   1 
ATOM   1895  O  O   . LEU A 1 248 ? 100.381 73.971 17.229  1.00 36.83  ? 248  LEU A O   1 
ATOM   1896  C  CB  . LEU A 1 248 ? 97.557  72.455 18.200  1.00 33.21  ? 248  LEU A CB  1 
ATOM   1897  C  CG  . LEU A 1 248 ? 97.832  71.506 17.024  1.00 31.61  ? 248  LEU A CG  1 
ATOM   1898  C  CD1 . LEU A 1 248 ? 98.676  70.339 17.500  1.00 32.68  ? 248  LEU A CD1 1 
ATOM   1899  C  CD2 . LEU A 1 248 ? 96.525  70.999 16.441  1.00 30.80  ? 248  LEU A CD2 1 
ATOM   1900  N  N   . GLY A 1 249 ? 98.660  75.303 17.795  1.00 36.26  ? 249  GLY A N   1 
ATOM   1901  C  CA  . GLY A 1 249 ? 99.112  76.379 16.934  1.00 38.62  ? 249  GLY A CA  1 
ATOM   1902  C  C   . GLY A 1 249 ? 100.525 76.790 17.295  1.00 39.54  ? 249  GLY A C   1 
ATOM   1903  O  O   . GLY A 1 249 ? 101.397 76.860 16.432  1.00 39.05  ? 249  GLY A O   1 
ATOM   1904  N  N   . ARG A 1 250 ? 100.745 77.057 18.580  1.00 41.84  ? 250  ARG A N   1 
ATOM   1905  C  CA  . ARG A 1 250 ? 102.056 77.451 19.084  1.00 44.20  ? 250  ARG A CA  1 
ATOM   1906  C  C   . ARG A 1 250 ? 103.148 76.474 18.646  1.00 44.75  ? 250  ARG A C   1 
ATOM   1907  O  O   . ARG A 1 250 ? 104.200 76.886 18.157  1.00 45.28  ? 250  ARG A O   1 
ATOM   1908  C  CB  . ARG A 1 250 ? 102.019 77.540 20.612  1.00 46.74  ? 250  ARG A CB  1 
ATOM   1909  C  CG  . ARG A 1 250 ? 103.386 77.726 21.265  1.00 50.81  ? 250  ARG A CG  1 
ATOM   1910  C  CD  . ARG A 1 250 ? 103.268 77.931 22.770  1.00 52.48  ? 250  ARG A CD  1 
ATOM   1911  N  NE  . ARG A 1 250 ? 102.496 79.130 23.089  1.00 55.57  ? 250  ARG A NE  1 
ATOM   1912  C  CZ  . ARG A 1 250 ? 101.180 79.153 23.290  1.00 57.73  ? 250  ARG A CZ  1 
ATOM   1913  N  NH1 . ARG A 1 250 ? 100.574 80.301 23.569  1.00 57.43  ? 250  ARG A NH1 1 
ATOM   1914  N  NH2 . ARG A 1 250 ? 100.472 78.030 23.234  1.00 57.71  ? 250  ARG A NH2 1 
ATOM   1915  N  N   . ASN A 1 251 ? 102.891 75.181 18.826  1.00 44.45  ? 251  ASN A N   1 
ATOM   1916  C  CA  . ASN A 1 251 ? 103.843 74.141 18.445  1.00 43.80  ? 251  ASN A CA  1 
ATOM   1917  C  C   . ASN A 1 251 ? 104.217 74.232 16.974  1.00 45.35  ? 251  ASN A C   1 
ATOM   1918  O  O   . ASN A 1 251 ? 105.309 73.826 16.577  1.00 46.76  ? 251  ASN A O   1 
ATOM   1919  C  CB  . ASN A 1 251 ? 103.251 72.757 18.723  1.00 42.81  ? 251  ASN A CB  1 
ATOM   1920  C  CG  . ASN A 1 251 ? 103.577 72.251 20.111  1.00 43.19  ? 251  ASN A CG  1 
ATOM   1921  O  OD1 . ASN A 1 251 ? 104.660 71.722 20.346  1.00 42.82  ? 251  ASN A OD1 1 
ATOM   1922  N  ND2 . ASN A 1 251 ? 102.647 72.423 21.043  1.00 41.98  ? 251  ASN A ND2 1 
ATOM   1923  N  N   . LEU A 1 252 ? 103.309 74.767 16.167  1.00 45.77  ? 252  LEU A N   1 
ATOM   1924  C  CA  . LEU A 1 252 ? 103.546 74.886 14.737  1.00 46.88  ? 252  LEU A CA  1 
ATOM   1925  C  C   . LEU A 1 252 ? 103.849 76.320 14.291  1.00 48.32  ? 252  LEU A C   1 
ATOM   1926  O  O   . LEU A 1 252 ? 103.985 76.582 13.096  1.00 48.90  ? 252  LEU A O   1 
ATOM   1927  C  CB  . LEU A 1 252 ? 102.332 74.344 13.975  1.00 46.22  ? 252  LEU A CB  1 
ATOM   1928  C  CG  . LEU A 1 252 ? 101.952 72.876 14.228  1.00 45.52  ? 252  LEU A CG  1 
ATOM   1929  C  CD1 . LEU A 1 252 ? 100.606 72.568 13.574  1.00 42.29  ? 252  LEU A CD1 1 
ATOM   1930  C  CD2 . LEU A 1 252 ? 103.040 71.956 13.680  1.00 43.45  ? 252  LEU A CD2 1 
ATOM   1931  N  N   . ASN A 1 253 ? 103.963 77.240 15.250  1.00 48.89  ? 253  ASN A N   1 
ATOM   1932  C  CA  . ASN A 1 253 ? 104.247 78.648 14.951  1.00 49.78  ? 253  ASN A CA  1 
ATOM   1933  C  C   . ASN A 1 253 ? 103.118 79.300 14.173  1.00 48.94  ? 253  ASN A C   1 
ATOM   1934  O  O   . ASN A 1 253 ? 103.335 79.867 13.103  1.00 48.10  ? 253  ASN A O   1 
ATOM   1935  C  CB  . ASN A 1 253 ? 105.546 78.783 14.155  1.00 52.00  ? 253  ASN A CB  1 
ATOM   1936  C  CG  . ASN A 1 253 ? 106.776 78.662 15.026  1.00 56.23  ? 253  ASN A CG  1 
ATOM   1937  O  OD1 . ASN A 1 253 ? 106.986 79.471 15.936  1.00 57.66  ? 253  ASN A OD1 1 
ATOM   1938  N  ND2 . ASN A 1 253 ? 107.600 77.650 14.757  1.00 57.41  ? 253  ASN A ND2 1 
ATOM   1939  N  N   . CYS A 1 254 ? 101.915 79.221 14.724  1.00 49.08  ? 254  CYS A N   1 
ATOM   1940  C  CA  . CYS A 1 254 ? 100.737 79.791 14.088  1.00 49.45  ? 254  CYS A CA  1 
ATOM   1941  C  C   . CYS A 1 254 ? 100.370 81.144 14.663  1.00 49.65  ? 254  CYS A C   1 
ATOM   1942  O  O   . CYS A 1 254 ? 100.768 81.485 15.776  1.00 50.47  ? 254  CYS A O   1 
ATOM   1943  C  CB  . CYS A 1 254 ? 99.542  78.852 14.257  1.00 50.05  ? 254  CYS A CB  1 
ATOM   1944  S  SG  . CYS A 1 254 ? 99.371  77.595 12.956  1.00 51.40  ? 254  CYS A SG  1 
ATOM   1945  N  N   . ASN A 1 255 ? 99.604  81.914 13.899  1.00 49.75  ? 255  ASN A N   1 
ATOM   1946  C  CA  . ASN A 1 255 ? 99.159  83.215 14.361  1.00 49.21  ? 255  ASN A CA  1 
ATOM   1947  C  C   . ASN A 1 255 ? 98.103  82.909 15.408  1.00 48.63  ? 255  ASN A C   1 
ATOM   1948  O  O   . ASN A 1 255 ? 97.077  82.310 15.103  1.00 48.49  ? 255  ASN A O   1 
ATOM   1949  C  CB  . ASN A 1 255 ? 98.534  84.012 13.219  1.00 50.72  ? 255  ASN A CB  1 
ATOM   1950  C  CG  . ASN A 1 255 ? 98.200  85.441 13.623  1.00 52.22  ? 255  ASN A CG  1 
ATOM   1951  O  OD1 . ASN A 1 255 ? 97.548  85.675 14.642  1.00 50.29  ? 255  ASN A OD1 1 
ATOM   1952  N  ND2 . ASN A 1 255 ? 98.646  86.403 12.820  1.00 53.34  ? 255  ASN A ND2 1 
ATOM   1953  N  N   . LEU A 1 256 ? 98.356  83.314 16.645  1.00 48.59  ? 256  LEU A N   1 
ATOM   1954  C  CA  . LEU A 1 256 ? 97.416  83.050 17.722  1.00 48.88  ? 256  LEU A CA  1 
ATOM   1955  C  C   . LEU A 1 256 ? 96.582  84.269 18.105  1.00 49.75  ? 256  LEU A C   1 
ATOM   1956  O  O   . LEU A 1 256 ? 96.077  84.346 19.226  1.00 50.58  ? 256  LEU A O   1 
ATOM   1957  C  CB  . LEU A 1 256 ? 98.178  82.539 18.946  1.00 47.50  ? 256  LEU A CB  1 
ATOM   1958  C  CG  . LEU A 1 256 ? 99.137  81.375 18.682  1.00 47.91  ? 256  LEU A CG  1 
ATOM   1959  C  CD1 . LEU A 1 256 ? 99.832  80.981 19.982  1.00 48.09  ? 256  LEU A CD1 1 
ATOM   1960  C  CD2 . LEU A 1 256 ? 98.373  80.194 18.105  1.00 46.95  ? 256  LEU A CD2 1 
ATOM   1961  N  N   . ASN A 1 257 ? 96.432  85.217 17.180  1.00 50.40  ? 257  ASN A N   1 
ATOM   1962  C  CA  . ASN A 1 257 ? 95.654  86.428 17.452  1.00 51.06  ? 257  ASN A CA  1 
ATOM   1963  C  C   . ASN A 1 257 ? 94.159  86.179 17.592  1.00 50.37  ? 257  ASN A C   1 
ATOM   1964  O  O   . ASN A 1 257 ? 93.503  86.796 18.430  1.00 51.69  ? 257  ASN A O   1 
ATOM   1965  C  CB  . ASN A 1 257 ? 95.884  87.487 16.364  1.00 52.97  ? 257  ASN A CB  1 
ATOM   1966  C  CG  . ASN A 1 257 ? 97.258  88.136 16.459  1.00 54.29  ? 257  ASN A CG  1 
ATOM   1967  O  OD1 . ASN A 1 257 ? 97.717  88.488 17.549  1.00 52.72  ? 257  ASN A OD1 1 
ATOM   1968  N  ND2 . ASN A 1 257 ? 97.912  88.311 15.314  1.00 55.40  ? 257  ASN A ND2 1 
ATOM   1969  N  N   . SER A 1 258 ? 93.620  85.280 16.774  1.00 48.89  ? 258  SER A N   1 
ATOM   1970  C  CA  . SER A 1 258 ? 92.197  84.967 16.822  1.00 47.33  ? 258  SER A CA  1 
ATOM   1971  C  C   . SER A 1 258 ? 91.933  83.548 16.317  1.00 46.52  ? 258  SER A C   1 
ATOM   1972  O  O   . SER A 1 258 ? 92.821  82.905 15.752  1.00 43.67  ? 258  SER A O   1 
ATOM   1973  C  CB  . SER A 1 258 ? 91.409  85.964 15.964  1.00 47.11  ? 258  SER A CB  1 
ATOM   1974  O  OG  . SER A 1 258 ? 91.596  85.704 14.581  1.00 45.62  ? 258  SER A OG  1 
ATOM   1975  N  N   . ASP A 1 259 ? 90.703  83.077 16.509  1.00 45.95  ? 259  ASP A N   1 
ATOM   1976  C  CA  . ASP A 1 259 ? 90.318  81.739 16.073  1.00 46.60  ? 259  ASP A CA  1 
ATOM   1977  C  C   . ASP A 1 259 ? 90.429  81.572 14.563  1.00 47.00  ? 259  ASP A C   1 
ATOM   1978  O  O   . ASP A 1 259 ? 91.000  80.588 14.085  1.00 46.93  ? 259  ASP A O   1 
ATOM   1979  C  CB  . ASP A 1 259 ? 88.890  81.423 16.514  1.00 47.33  ? 259  ASP A CB  1 
ATOM   1980  C  CG  . ASP A 1 259 ? 88.710  81.526 18.014  1.00 50.14  ? 259  ASP A CG  1 
ATOM   1981  O  OD1 . ASP A 1 259 ? 89.707  81.337 18.745  1.00 52.25  ? 259  ASP A OD1 1 
ATOM   1982  O  OD2 . ASP A 1 259 ? 87.572  81.785 18.466  1.00 52.04  ? 259  ASP A OD2 1 
ATOM   1983  N  N   . GLU A 1 260 ? 89.881  82.524 13.810  1.00 47.79  ? 260  GLU A N   1 
ATOM   1984  C  CA  . GLU A 1 260 ? 89.946  82.447 12.354  1.00 48.05  ? 260  GLU A CA  1 
ATOM   1985  C  C   . GLU A 1 260 ? 91.396  82.387 11.887  1.00 46.61  ? 260  GLU A C   1 
ATOM   1986  O  O   . GLU A 1 260 ? 91.738  81.580 11.026  1.00 46.44  ? 260  GLU A O   1 
ATOM   1987  C  CB  . GLU A 1 260 ? 89.241  83.644 11.702  1.00 49.86  ? 260  GLU A CB  1 
ATOM   1988  C  CG  . GLU A 1 260 ? 87.721  83.501 11.557  1.00 53.80  ? 260  GLU A CG  1 
ATOM   1989  C  CD  . GLU A 1 260 ? 87.302  82.334 10.654  1.00 58.08  ? 260  GLU A CD  1 
ATOM   1990  O  OE1 . GLU A 1 260 ? 87.865  82.195 9.542   1.00 58.95  ? 260  GLU A OE1 1 
ATOM   1991  O  OE2 . GLU A 1 260 ? 86.396  81.560 11.050  1.00 58.97  ? 260  GLU A OE2 1 
ATOM   1992  N  N   . GLU A 1 261 ? 92.249  83.227 12.465  1.00 45.43  ? 261  GLU A N   1 
ATOM   1993  C  CA  . GLU A 1 261 ? 93.659  83.244 12.089  1.00 44.87  ? 261  GLU A CA  1 
ATOM   1994  C  C   . GLU A 1 261 ? 94.331  81.927 12.476  1.00 43.20  ? 261  GLU A C   1 
ATOM   1995  O  O   . GLU A 1 261 ? 95.141  81.378 11.723  1.00 41.87  ? 261  GLU A O   1 
ATOM   1996  C  CB  . GLU A 1 261 ? 94.373  84.422 12.762  1.00 46.70  ? 261  GLU A CB  1 
ATOM   1997  C  CG  . GLU A 1 261 ? 93.755  85.777 12.436  1.00 50.46  ? 261  GLU A CG  1 
ATOM   1998  C  CD  . GLU A 1 261 ? 94.620  86.949 12.882  1.00 53.67  ? 261  GLU A CD  1 
ATOM   1999  O  OE1 . GLU A 1 261 ? 95.720  87.134 12.309  1.00 55.00  ? 261  GLU A OE1 1 
ATOM   2000  O  OE2 . GLU A 1 261 ? 94.202  87.684 13.804  1.00 53.75  ? 261  GLU A OE2 1 
ATOM   2001  N  N   . LEU A 1 262 ? 93.990  81.425 13.657  1.00 41.17  ? 262  LEU A N   1 
ATOM   2002  C  CA  . LEU A 1 262 ? 94.546  80.167 14.132  1.00 40.55  ? 262  LEU A CA  1 
ATOM   2003  C  C   . LEU A 1 262 ? 94.128  79.044 13.195  1.00 39.45  ? 262  LEU A C   1 
ATOM   2004  O  O   . LEU A 1 262 ? 94.964  78.294 12.693  1.00 37.23  ? 262  LEU A O   1 
ATOM   2005  C  CB  . LEU A 1 262 ? 94.046  79.865 15.543  1.00 39.18  ? 262  LEU A CB  1 
ATOM   2006  C  CG  . LEU A 1 262 ? 94.409  78.478 16.072  1.00 40.11  ? 262  LEU A CG  1 
ATOM   2007  C  CD1 . LEU A 1 262 ? 95.922  78.272 16.015  1.00 39.97  ? 262  LEU A CD1 1 
ATOM   2008  C  CD2 . LEU A 1 262 ? 93.887  78.337 17.497  1.00 39.72  ? 262  LEU A CD2 1 
ATOM   2009  N  N   . ILE A 1 263 ? 92.825  78.949 12.952  1.00 39.07  ? 263  ILE A N   1 
ATOM   2010  C  CA  . ILE A 1 263 ? 92.278  77.920 12.081  1.00 39.28  ? 263  ILE A CA  1 
ATOM   2011  C  C   . ILE A 1 263 ? 92.853  77.991 10.673  1.00 40.01  ? 263  ILE A C   1 
ATOM   2012  O  O   . ILE A 1 263 ? 93.306  76.984 10.131  1.00 40.68  ? 263  ILE A O   1 
ATOM   2013  C  CB  . ILE A 1 263 ? 90.742  78.019 12.007  1.00 37.83  ? 263  ILE A CB  1 
ATOM   2014  C  CG1 . ILE A 1 263 ? 90.148  77.755 13.389  1.00 37.32  ? 263  ILE A CG1 1 
ATOM   2015  C  CG2 . ILE A 1 263 ? 90.196  77.013 11.004  1.00 37.41  ? 263  ILE A CG2 1 
ATOM   2016  C  CD1 . ILE A 1 263 ? 88.632  77.840 13.433  1.00 37.75  ? 263  ILE A CD1 1 
ATOM   2017  N  N   . HIS A 1 264 ? 92.833  79.177 10.077  1.00 42.48  ? 264  HIS A N   1 
ATOM   2018  C  CA  . HIS A 1 264 ? 93.363  79.328 8.732   1.00 45.65  ? 264  HIS A CA  1 
ATOM   2019  C  C   . HIS A 1 264 ? 94.801  78.814 8.676   1.00 44.75  ? 264  HIS A C   1 
ATOM   2020  O  O   . HIS A 1 264 ? 95.203  78.168 7.708   1.00 44.14  ? 264  HIS A O   1 
ATOM   2021  C  CB  . HIS A 1 264 ? 93.296  80.796 8.285   1.00 50.77  ? 264  HIS A CB  1 
ATOM   2022  C  CG  . HIS A 1 264 ? 91.898  81.311 8.102   1.00 58.23  ? 264  HIS A CG  1 
ATOM   2023  N  ND1 . HIS A 1 264 ? 90.916  80.589 7.456   1.00 61.40  ? 264  HIS A ND1 1 
ATOM   2024  C  CD2 . HIS A 1 264 ? 91.325  82.486 8.459   1.00 59.62  ? 264  HIS A CD2 1 
ATOM   2025  C  CE1 . HIS A 1 264 ? 89.800  81.298 7.424   1.00 61.54  ? 264  HIS A CE1 1 
ATOM   2026  N  NE2 . HIS A 1 264 ? 90.022  82.453 8.025   1.00 60.53  ? 264  HIS A NE2 1 
ATOM   2027  N  N   . CYS A 1 265 ? 95.570  79.093 9.721   1.00 43.84  ? 265  CYS A N   1 
ATOM   2028  C  CA  . CYS A 1 265 ? 96.953  78.642 9.781   1.00 45.11  ? 265  CYS A CA  1 
ATOM   2029  C  C   . CYS A 1 265 ? 97.016  77.116 9.819   1.00 43.61  ? 265  CYS A C   1 
ATOM   2030  O  O   . CYS A 1 265 ? 97.745  76.491 9.041   1.00 41.81  ? 265  CYS A O   1 
ATOM   2031  C  CB  . CYS A 1 265 ? 97.630  79.209 11.028  1.00 48.10  ? 265  CYS A CB  1 
ATOM   2032  S  SG  . CYS A 1 265 ? 99.371  78.719 11.254  1.00 55.74  ? 265  CYS A SG  1 
ATOM   2033  N  N   . LEU A 1 266 ? 96.246  76.524 10.730  1.00 41.32  ? 266  LEU A N   1 
ATOM   2034  C  CA  . LEU A 1 266 ? 96.212  75.076 10.887  1.00 39.86  ? 266  LEU A CA  1 
ATOM   2035  C  C   . LEU A 1 266 ? 95.665  74.354 9.656   1.00 39.29  ? 266  LEU A C   1 
ATOM   2036  O  O   . LEU A 1 266 ? 95.953  73.176 9.446   1.00 38.86  ? 266  LEU A O   1 
ATOM   2037  C  CB  . LEU A 1 266 ? 95.391  74.702 12.123  1.00 37.43  ? 266  LEU A CB  1 
ATOM   2038  C  CG  . LEU A 1 266 ? 95.984  75.138 13.464  1.00 37.06  ? 266  LEU A CG  1 
ATOM   2039  C  CD1 . LEU A 1 266 ? 95.029  74.778 14.595  1.00 36.17  ? 266  LEU A CD1 1 
ATOM   2040  C  CD2 . LEU A 1 266 ? 97.331  74.464 13.668  1.00 35.75  ? 266  LEU A CD2 1 
ATOM   2041  N  N   . ARG A 1 267 ? 94.881  75.058 8.844   1.00 38.77  ? 267  ARG A N   1 
ATOM   2042  C  CA  . ARG A 1 267 ? 94.319  74.463 7.636   1.00 39.54  ? 267  ARG A CA  1 
ATOM   2043  C  C   . ARG A 1 267 ? 95.308  74.437 6.478   1.00 40.23  ? 267  ARG A C   1 
ATOM   2044  O  O   . ARG A 1 267 ? 95.065  73.783 5.465   1.00 40.55  ? 267  ARG A O   1 
ATOM   2045  C  CB  . ARG A 1 267 ? 93.057  75.208 7.204   1.00 38.61  ? 267  ARG A CB  1 
ATOM   2046  C  CG  . ARG A 1 267 ? 91.807  74.808 7.969   1.00 40.17  ? 267  ARG A CG  1 
ATOM   2047  C  CD  . ARG A 1 267 ? 90.602  75.622 7.524   1.00 39.33  ? 267  ARG A CD  1 
ATOM   2048  N  NE  . ARG A 1 267 ? 89.368  75.096 8.091   1.00 41.29  ? 267  ARG A NE  1 
ATOM   2049  C  CZ  . ARG A 1 267 ? 88.227  75.771 8.163   1.00 41.61  ? 267  ARG A CZ  1 
ATOM   2050  N  NH1 . ARG A 1 267 ? 88.159  77.013 7.700   1.00 41.92  ? 267  ARG A NH1 1 
ATOM   2051  N  NH2 . ARG A 1 267 ? 87.161  75.204 8.711   1.00 39.99  ? 267  ARG A NH2 1 
ATOM   2052  N  N   . GLU A 1 268 ? 96.425  75.144 6.622   1.00 42.32  ? 268  GLU A N   1 
ATOM   2053  C  CA  . GLU A 1 268 ? 97.436  75.176 5.565   1.00 44.80  ? 268  GLU A CA  1 
ATOM   2054  C  C   . GLU A 1 268 ? 98.504  74.100 5.768   1.00 43.10  ? 268  GLU A C   1 
ATOM   2055  O  O   . GLU A 1 268 ? 99.243  73.763 4.843   1.00 42.67  ? 268  GLU A O   1 
ATOM   2056  C  CB  . GLU A 1 268 ? 98.107  76.554 5.514   1.00 47.41  ? 268  GLU A CB  1 
ATOM   2057  C  CG  . GLU A 1 268 ? 97.122  77.709 5.520   1.00 55.21  ? 268  GLU A CG  1 
ATOM   2058  C  CD  . GLU A 1 268 ? 96.034  77.570 4.464   1.00 59.34  ? 268  GLU A CD  1 
ATOM   2059  O  OE1 . GLU A 1 268 ? 95.042  78.333 4.528   1.00 61.35  ? 268  GLU A OE1 1 
ATOM   2060  O  OE2 . GLU A 1 268 ? 96.170  76.706 3.567   1.00 61.06  ? 268  GLU A OE2 1 
ATOM   2061  N  N   . LYS A 1 269 ? 98.571  73.560 6.979   1.00 41.87  ? 269  LYS A N   1 
ATOM   2062  C  CA  . LYS A 1 269 ? 99.559  72.543 7.308   1.00 41.53  ? 269  LYS A CA  1 
ATOM   2063  C  C   . LYS A 1 269 ? 99.196  71.176 6.738   1.00 40.41  ? 269  LYS A C   1 
ATOM   2064  O  O   . LYS A 1 269 ? 98.025  70.820 6.638   1.00 38.99  ? 269  LYS A O   1 
ATOM   2065  C  CB  . LYS A 1 269 ? 99.709  72.424 8.828   1.00 42.28  ? 269  LYS A CB  1 
ATOM   2066  C  CG  . LYS A 1 269 ? 99.343  73.677 9.610   1.00 45.22  ? 269  LYS A CG  1 
ATOM   2067  C  CD  . LYS A 1 269 ? 100.205 74.877 9.244   1.00 47.78  ? 269  LYS A CD  1 
ATOM   2068  C  CE  . LYS A 1 269 ? 101.629 74.716 9.722   1.00 48.07  ? 269  LYS A CE  1 
ATOM   2069  N  NZ  . LYS A 1 269 ? 102.418 75.960 9.480   1.00 50.30  ? 269  LYS A NZ  1 
ATOM   2070  N  N   . LYS A 1 270 ? 100.212 70.415 6.358   1.00 41.00  ? 270  LYS A N   1 
ATOM   2071  C  CA  . LYS A 1 270 ? 99.993  69.078 5.828   1.00 41.84  ? 270  LYS A CA  1 
ATOM   2072  C  C   . LYS A 1 270 ? 99.590  68.191 7.003   1.00 39.79  ? 270  LYS A C   1 
ATOM   2073  O  O   . LYS A 1 270 ? 100.050 68.394 8.126   1.00 38.88  ? 270  LYS A O   1 
ATOM   2074  C  CB  . LYS A 1 270 ? 101.275 68.550 5.180   1.00 43.97  ? 270  LYS A CB  1 
ATOM   2075  C  CG  . LYS A 1 270 ? 101.767 69.425 4.035   1.00 48.51  ? 270  LYS A CG  1 
ATOM   2076  C  CD  . LYS A 1 270 ? 103.019 68.867 3.372   1.00 50.50  ? 270  LYS A CD  1 
ATOM   2077  C  CE  . LYS A 1 270 ? 103.490 69.788 2.252   1.00 52.31  ? 270  LYS A CE  1 
ATOM   2078  N  NZ  . LYS A 1 270 ? 104.701 69.264 1.560   1.00 53.99  ? 270  LYS A NZ  1 
ATOM   2079  N  N   . PRO A 1 271 ? 98.720  67.202 6.760   1.00 39.13  ? 271  PRO A N   1 
ATOM   2080  C  CA  . PRO A 1 271 ? 98.254  66.286 7.807   1.00 39.70  ? 271  PRO A CA  1 
ATOM   2081  C  C   . PRO A 1 271 ? 99.335  65.779 8.763   1.00 39.15  ? 271  PRO A C   1 
ATOM   2082  O  O   . PRO A 1 271 ? 99.186  65.864 9.986   1.00 38.30  ? 271  PRO A O   1 
ATOM   2083  C  CB  . PRO A 1 271 ? 97.613  65.157 7.008   1.00 39.02  ? 271  PRO A CB  1 
ATOM   2084  C  CG  . PRO A 1 271 ? 97.015  65.901 5.852   1.00 39.79  ? 271  PRO A CG  1 
ATOM   2085  C  CD  . PRO A 1 271 ? 98.133  66.845 5.456   1.00 38.06  ? 271  PRO A CD  1 
ATOM   2086  N  N   . GLN A 1 272 ? 100.428 65.269 8.211   1.00 39.32  ? 272  GLN A N   1 
ATOM   2087  C  CA  . GLN A 1 272 ? 101.497 64.738 9.046   1.00 40.15  ? 272  GLN A CA  1 
ATOM   2088  C  C   . GLN A 1 272 ? 102.156 65.767 9.968   1.00 39.23  ? 272  GLN A C   1 
ATOM   2089  O  O   . GLN A 1 272 ? 102.733 65.399 10.991  1.00 37.30  ? 272  GLN A O   1 
ATOM   2090  C  CB  . GLN A 1 272 ? 102.555 64.060 8.177   1.00 42.17  ? 272  GLN A CB  1 
ATOM   2091  C  CG  . GLN A 1 272 ? 103.458 63.105 8.949   1.00 46.12  ? 272  GLN A CG  1 
ATOM   2092  C  CD  . GLN A 1 272 ? 102.682 61.973 9.612   1.00 47.01  ? 272  GLN A CD  1 
ATOM   2093  O  OE1 . GLN A 1 272 ? 102.019 61.179 8.941   1.00 47.25  ? 272  GLN A OE1 1 
ATOM   2094  N  NE2 . GLN A 1 272 ? 102.763 61.899 10.936  1.00 46.71  ? 272  GLN A NE2 1 
ATOM   2095  N  N   . GLU A 1 273 ? 102.070 67.049 9.621   1.00 39.05  ? 273  GLU A N   1 
ATOM   2096  C  CA  . GLU A 1 273 ? 102.672 68.083 10.458  1.00 38.76  ? 273  GLU A CA  1 
ATOM   2097  C  C   . GLU A 1 273 ? 101.922 68.183 11.777  1.00 37.99  ? 273  GLU A C   1 
ATOM   2098  O  O   . GLU A 1 273 ? 102.532 68.304 12.842  1.00 37.14  ? 273  GLU A O   1 
ATOM   2099  C  CB  . GLU A 1 273 ? 102.636 69.450 9.768   1.00 42.54  ? 273  GLU A CB  1 
ATOM   2100  C  CG  . GLU A 1 273 ? 103.520 69.602 8.538   1.00 46.37  ? 273  GLU A CG  1 
ATOM   2101  C  CD  . GLU A 1 273 ? 103.495 71.033 8.003   1.00 49.07  ? 273  GLU A CD  1 
ATOM   2102  O  OE1 . GLU A 1 273 ? 104.009 71.940 8.701   1.00 47.92  ? 273  GLU A OE1 1 
ATOM   2103  O  OE2 . GLU A 1 273 ? 102.949 71.251 6.897   1.00 49.09  ? 273  GLU A OE2 1 
ATOM   2104  N  N   . LEU A 1 274 ? 100.596 68.147 11.705  1.00 35.43  ? 274  LEU A N   1 
ATOM   2105  C  CA  . LEU A 1 274 ? 99.777  68.223 12.909  1.00 35.99  ? 274  LEU A CA  1 
ATOM   2106  C  C   . LEU A 1 274 ? 100.008 66.990 13.768  1.00 34.76  ? 274  LEU A C   1 
ATOM   2107  O  O   . LEU A 1 274 ? 100.274 67.084 14.962  1.00 35.45  ? 274  LEU A O   1 
ATOM   2108  C  CB  . LEU A 1 274 ? 98.296  68.307 12.546  1.00 35.87  ? 274  LEU A CB  1 
ATOM   2109  C  CG  . LEU A 1 274 ? 97.749  69.681 12.170  1.00 36.55  ? 274  LEU A CG  1 
ATOM   2110  C  CD1 . LEU A 1 274 ? 98.623  70.322 11.110  1.00 36.86  ? 274  LEU A CD1 1 
ATOM   2111  C  CD2 . LEU A 1 274 ? 96.318  69.526 11.679  1.00 36.87  ? 274  LEU A CD2 1 
ATOM   2112  N  N   . ILE A 1 275 ? 99.906  65.830 13.140  1.00 34.00  ? 275  ILE A N   1 
ATOM   2113  C  CA  . ILE A 1 275 ? 100.090 64.569 13.828  1.00 33.10  ? 275  ILE A CA  1 
ATOM   2114  C  C   . ILE A 1 275 ? 101.426 64.508 14.560  1.00 34.26  ? 275  ILE A C   1 
ATOM   2115  O  O   . ILE A 1 275 ? 101.493 64.003 15.676  1.00 34.26  ? 275  ILE A O   1 
ATOM   2116  C  CB  . ILE A 1 275 ? 99.980  63.410 12.827  1.00 32.61  ? 275  ILE A CB  1 
ATOM   2117  C  CG1 . ILE A 1 275 ? 98.562  63.389 12.245  1.00 31.11  ? 275  ILE A CG1 1 
ATOM   2118  C  CG2 . ILE A 1 275 ? 100.323 62.093 13.498  1.00 33.85  ? 275  ILE A CG2 1 
ATOM   2119  C  CD1 . ILE A 1 275 ? 98.367  62.417 11.101  1.00 31.17  ? 275  ILE A CD1 1 
ATOM   2120  N  N   . ASP A 1 276 ? 102.481 65.042 13.951  1.00 34.02  ? 276  ASP A N   1 
ATOM   2121  C  CA  . ASP A 1 276 ? 103.800 65.016 14.578  1.00 35.27  ? 276  ASP A CA  1 
ATOM   2122  C  C   . ASP A 1 276 ? 103.886 65.704 15.939  1.00 34.34  ? 276  ASP A C   1 
ATOM   2123  O  O   . ASP A 1 276 ? 104.669 65.293 16.787  1.00 34.85  ? 276  ASP A O   1 
ATOM   2124  C  CB  . ASP A 1 276 ? 104.859 65.623 13.647  1.00 37.71  ? 276  ASP A CB  1 
ATOM   2125  C  CG  . ASP A 1 276 ? 105.199 64.717 12.477  1.00 40.33  ? 276  ASP A CG  1 
ATOM   2126  O  OD1 . ASP A 1 276 ? 105.195 63.480 12.663  1.00 41.79  ? 276  ASP A OD1 1 
ATOM   2127  O  OD2 . ASP A 1 276 ? 105.486 65.237 11.375  1.00 40.68  ? 276  ASP A OD2 1 
ATOM   2128  N  N   . VAL A 1 277 ? 103.093 66.747 16.157  1.00 33.40  ? 277  VAL A N   1 
ATOM   2129  C  CA  . VAL A 1 277 ? 103.133 67.460 17.434  1.00 32.40  ? 277  VAL A CA  1 
ATOM   2130  C  C   . VAL A 1 277 ? 101.908 67.217 18.319  1.00 33.15  ? 277  VAL A C   1 
ATOM   2131  O  O   . VAL A 1 277 ? 101.804 67.779 19.411  1.00 31.91  ? 277  VAL A O   1 
ATOM   2132  C  CB  . VAL A 1 277 ? 103.266 68.983 17.213  1.00 32.78  ? 277  VAL A CB  1 
ATOM   2133  C  CG1 . VAL A 1 277 ? 104.580 69.294 16.508  1.00 29.96  ? 277  VAL A CG1 1 
ATOM   2134  C  CG2 . VAL A 1 277 ? 102.081 69.496 16.397  1.00 30.34  ? 277  VAL A CG2 1 
ATOM   2135  N  N   . GLU A 1 278 ? 100.997 66.371 17.850  1.00 32.83  ? 278  GLU A N   1 
ATOM   2136  C  CA  . GLU A 1 278 ? 99.764  66.061 18.570  1.00 34.43  ? 278  GLU A CA  1 
ATOM   2137  C  C   . GLU A 1 278 ? 99.907  65.794 20.073  1.00 34.72  ? 278  GLU A C   1 
ATOM   2138  O  O   . GLU A 1 278 ? 99.177  66.370 20.887  1.00 32.32  ? 278  GLU A O   1 
ATOM   2139  C  CB  . GLU A 1 278 ? 99.081  64.865 17.911  1.00 36.33  ? 278  GLU A CB  1 
ATOM   2140  C  CG  . GLU A 1 278 ? 97.710  64.561 18.464  1.00 41.07  ? 278  GLU A CG  1 
ATOM   2141  C  CD  . GLU A 1 278 ? 97.126  63.286 17.891  1.00 43.15  ? 278  GLU A CD  1 
ATOM   2142  O  OE1 . GLU A 1 278 ? 97.212  63.080 16.659  1.00 43.16  ? 278  GLU A OE1 1 
ATOM   2143  O  OE2 . GLU A 1 278 ? 96.569  62.493 18.677  1.00 46.34  ? 278  GLU A OE2 1 
ATOM   2144  N  N   . TRP A 1 279 ? 100.839 64.920 20.442  1.00 34.52  ? 279  TRP A N   1 
ATOM   2145  C  CA  . TRP A 1 279 ? 101.041 64.579 21.847  1.00 35.39  ? 279  TRP A CA  1 
ATOM   2146  C  C   . TRP A 1 279 ? 101.677 65.685 22.690  1.00 35.27  ? 279  TRP A C   1 
ATOM   2147  O  O   . TRP A 1 279 ? 101.678 65.611 23.918  1.00 35.82  ? 279  TRP A O   1 
ATOM   2148  C  CB  . TRP A 1 279 ? 101.886 63.305 21.960  1.00 36.74  ? 279  TRP A CB  1 
ATOM   2149  C  CG  . TRP A 1 279 ? 101.339 62.166 21.149  1.00 39.49  ? 279  TRP A CG  1 
ATOM   2150  C  CD1 . TRP A 1 279 ? 101.704 61.810 19.880  1.00 40.44  ? 279  TRP A CD1 1 
ATOM   2151  C  CD2 . TRP A 1 279 ? 100.287 61.272 21.529  1.00 39.37  ? 279  TRP A CD2 1 
ATOM   2152  N  NE1 . TRP A 1 279 ? 100.942 60.751 19.447  1.00 40.25  ? 279  TRP A NE1 1 
ATOM   2153  C  CE2 . TRP A 1 279 ? 100.064 60.401 20.439  1.00 41.22  ? 279  TRP A CE2 1 
ATOM   2154  C  CE3 . TRP A 1 279 ? 99.508  61.124 22.686  1.00 40.07  ? 279  TRP A CE3 1 
ATOM   2155  C  CZ2 . TRP A 1 279 ? 99.089  59.392 20.469  1.00 42.54  ? 279  TRP A CZ2 1 
ATOM   2156  C  CZ3 . TRP A 1 279 ? 98.536  60.120 22.718  1.00 40.78  ? 279  TRP A CZ3 1 
ATOM   2157  C  CH2 . TRP A 1 279 ? 98.337  59.267 21.613  1.00 41.36  ? 279  TRP A CH2 1 
ATOM   2158  N  N   . ASN A 1 280 ? 102.211 66.712 22.039  1.00 34.91  ? 280  ASN A N   1 
ATOM   2159  C  CA  . ASN A 1 280 ? 102.847 67.812 22.758  1.00 35.06  ? 280  ASN A CA  1 
ATOM   2160  C  C   . ASN A 1 280 ? 101.866 68.735 23.476  1.00 33.84  ? 280  ASN A C   1 
ATOM   2161  O  O   . ASN A 1 280 ? 102.288 69.617 24.216  1.00 35.35  ? 280  ASN A O   1 
ATOM   2162  C  CB  . ASN A 1 280 ? 103.701 68.659 21.802  1.00 36.90  ? 280  ASN A CB  1 
ATOM   2163  C  CG  . ASN A 1 280 ? 104.831 67.869 21.159  1.00 38.43  ? 280  ASN A CG  1 
ATOM   2164  O  OD1 . ASN A 1 280 ? 105.037 66.692 21.465  1.00 37.67  ? 280  ASN A OD1 1 
ATOM   2165  N  ND2 . ASN A 1 280 ? 105.573 68.520 20.263  1.00 36.97  ? 280  ASN A ND2 1 
ATOM   2166  N  N   . VAL A 1 281 ? 100.567 68.549 23.269  1.00 32.60  ? 281  VAL A N   1 
ATOM   2167  C  CA  . VAL A 1 281 ? 99.598  69.421 23.920  1.00 31.77  ? 281  VAL A CA  1 
ATOM   2168  C  C   . VAL A 1 281 ? 99.011  68.900 25.236  1.00 32.85  ? 281  VAL A C   1 
ATOM   2169  O  O   . VAL A 1 281 ? 98.279  69.623 25.914  1.00 31.12  ? 281  VAL A O   1 
ATOM   2170  C  CB  . VAL A 1 281 ? 98.433  69.795 22.961  1.00 31.03  ? 281  VAL A CB  1 
ATOM   2171  C  CG1 . VAL A 1 281 ? 98.995  70.336 21.652  1.00 27.81  ? 281  VAL A CG1 1 
ATOM   2172  C  CG2 . VAL A 1 281 ? 97.542  68.593 22.713  1.00 30.81  ? 281  VAL A CG2 1 
ATOM   2173  N  N   . LEU A 1 282 ? 99.322  67.661 25.610  1.00 33.29  ? 282  LEU A N   1 
ATOM   2174  C  CA  . LEU A 1 282 ? 98.806  67.133 26.875  1.00 34.95  ? 282  LEU A CA  1 
ATOM   2175  C  C   . LEU A 1 282 ? 99.366  67.989 28.015  1.00 36.54  ? 282  LEU A C   1 
ATOM   2176  O  O   . LEU A 1 282 ? 100.501 68.459 27.945  1.00 37.78  ? 282  LEU A O   1 
ATOM   2177  C  CB  . LEU A 1 282 ? 99.222  65.670 27.071  1.00 32.92  ? 282  LEU A CB  1 
ATOM   2178  C  CG  . LEU A 1 282 ? 98.515  64.599 26.233  1.00 32.92  ? 282  LEU A CG  1 
ATOM   2179  C  CD1 . LEU A 1 282 ? 99.205  63.266 26.443  1.00 32.21  ? 282  LEU A CD1 1 
ATOM   2180  C  CD2 . LEU A 1 282 ? 97.040  64.504 26.619  1.00 30.88  ? 282  LEU A CD2 1 
ATOM   2181  N  N   . PRO A 1 283 ? 98.577  68.204 29.077  1.00 37.96  ? 283  PRO A N   1 
ATOM   2182  C  CA  . PRO A 1 283 ? 99.042  69.017 30.207  1.00 39.77  ? 283  PRO A CA  1 
ATOM   2183  C  C   . PRO A 1 283 ? 100.038 68.354 31.174  1.00 41.52  ? 283  PRO A C   1 
ATOM   2184  O  O   . PRO A 1 283 ? 100.781 69.056 31.863  1.00 43.11  ? 283  PRO A O   1 
ATOM   2185  C  CB  . PRO A 1 283 ? 97.738  69.414 30.896  1.00 38.95  ? 283  PRO A CB  1 
ATOM   2186  C  CG  . PRO A 1 283 ? 96.884  68.205 30.683  1.00 36.26  ? 283  PRO A CG  1 
ATOM   2187  C  CD  . PRO A 1 283 ? 97.151  67.860 29.231  1.00 37.50  ? 283  PRO A CD  1 
ATOM   2188  N  N   . PHE A 1 284 ? 100.063 67.021 31.229  1.00 41.15  ? 284  PHE A N   1 
ATOM   2189  C  CA  . PHE A 1 284 ? 100.980 66.314 32.134  1.00 42.54  ? 284  PHE A CA  1 
ATOM   2190  C  C   . PHE A 1 284 ? 101.629 65.122 31.456  1.00 41.96  ? 284  PHE A C   1 
ATOM   2191  O  O   . PHE A 1 284 ? 101.239 64.737 30.362  1.00 44.55  ? 284  PHE A O   1 
ATOM   2192  C  CB  . PHE A 1 284 ? 100.237 65.749 33.353  1.00 44.89  ? 284  PHE A CB  1 
ATOM   2193  C  CG  . PHE A 1 284 ? 99.308  66.715 34.021  1.00 47.34  ? 284  PHE A CG  1 
ATOM   2194  C  CD1 . PHE A 1 284 ? 99.801  67.811 34.722  1.00 48.16  ? 284  PHE A CD1 1 
ATOM   2195  C  CD2 . PHE A 1 284 ? 97.930  66.512 33.968  1.00 48.12  ? 284  PHE A CD2 1 
ATOM   2196  C  CE1 . PHE A 1 284 ? 98.931  68.697 35.366  1.00 50.95  ? 284  PHE A CE1 1 
ATOM   2197  C  CE2 . PHE A 1 284 ? 97.051  67.387 34.605  1.00 50.00  ? 284  PHE A CE2 1 
ATOM   2198  C  CZ  . PHE A 1 284 ? 97.552  68.483 35.307  1.00 49.79  ? 284  PHE A CZ  1 
ATOM   2199  N  N   . ASP A 1 285 ? 102.620 64.536 32.118  1.00 41.91  ? 285  ASP A N   1 
ATOM   2200  C  CA  . ASP A 1 285 ? 103.254 63.323 31.612  1.00 40.39  ? 285  ASP A CA  1 
ATOM   2201  C  C   . ASP A 1 285 ? 102.233 62.302 32.100  1.00 38.86  ? 285  ASP A C   1 
ATOM   2202  O  O   . ASP A 1 285 ? 101.831 62.351 33.267  1.00 38.63  ? 285  ASP A O   1 
ATOM   2203  C  CB  . ASP A 1 285 ? 104.606 63.065 32.296  1.00 42.65  ? 285  ASP A CB  1 
ATOM   2204  C  CG  . ASP A 1 285 ? 105.674 64.082 31.906  1.00 45.07  ? 285  ASP A CG  1 
ATOM   2205  O  OD1 . ASP A 1 285 ? 105.964 64.223 30.698  1.00 46.32  ? 285  ASP A OD1 1 
ATOM   2206  O  OD2 . ASP A 1 285 ? 106.232 64.738 32.809  1.00 46.92  ? 285  ASP A OD2 1 
ATOM   2207  N  N   . SER A 1 286 ? 101.798 61.390 31.235  1.00 36.65  ? 286  SER A N   1 
ATOM   2208  C  CA  . SER A 1 286 ? 100.789 60.426 31.655  1.00 33.59  ? 286  SER A CA  1 
ATOM   2209  C  C   . SER A 1 286 ? 100.579 59.275 30.694  1.00 30.68  ? 286  SER A C   1 
ATOM   2210  O  O   . SER A 1 286 ? 101.245 59.175 29.676  1.00 33.66  ? 286  SER A O   1 
ATOM   2211  C  CB  . SER A 1 286 ? 99.451  61.141 31.834  1.00 33.78  ? 286  SER A CB  1 
ATOM   2212  O  OG  . SER A 1 286 ? 98.957  61.574 30.576  1.00 34.27  ? 286  SER A OG  1 
ATOM   2213  N  N   . ILE A 1 287 ? 99.645  58.397 31.046  1.00 29.36  ? 287  ILE A N   1 
ATOM   2214  C  CA  . ILE A 1 287 ? 99.283  57.259 30.209  1.00 27.48  ? 287  ILE A CA  1 
ATOM   2215  C  C   . ILE A 1 287 ? 97.765  57.174 30.172  1.00 26.72  ? 287  ILE A C   1 
ATOM   2216  O  O   . ILE A 1 287 ? 97.088  57.575 31.124  1.00 27.08  ? 287  ILE A O   1 
ATOM   2217  C  CB  . ILE A 1 287 ? 99.836  55.924 30.742  1.00 25.42  ? 287  ILE A CB  1 
ATOM   2218  C  CG1 . ILE A 1 287 ? 99.291  55.646 32.133  1.00 24.73  ? 287  ILE A CG1 1 
ATOM   2219  C  CG2 . ILE A 1 287 ? 101.351 55.955 30.748  1.00 27.03  ? 287  ILE A CG2 1 
ATOM   2220  C  CD1 . ILE A 1 287 ? 99.676  54.280 32.658  1.00 26.20  ? 287  ILE A CD1 1 
ATOM   2221  N  N   . PHE A 1 288 ? 97.236  56.659 29.067  1.00 26.03  ? 288  PHE A N   1 
ATOM   2222  C  CA  . PHE A 1 288 ? 95.799  56.521 28.881  1.00 25.65  ? 288  PHE A CA  1 
ATOM   2223  C  C   . PHE A 1 288 ? 95.157  57.914 28.870  1.00 26.81  ? 288  PHE A C   1 
ATOM   2224  O  O   . PHE A 1 288 ? 94.099  58.131 29.458  1.00 28.05  ? 288  PHE A O   1 
ATOM   2225  C  CB  . PHE A 1 288 ? 95.187  55.661 29.998  1.00 21.52  ? 288  PHE A CB  1 
ATOM   2226  C  CG  . PHE A 1 288 ? 94.097  54.725 29.525  1.00 21.25  ? 288  PHE A CG  1 
ATOM   2227  C  CD1 . PHE A 1 288 ? 93.060  55.187 28.720  1.00 20.46  ? 288  PHE A CD1 1 
ATOM   2228  C  CD2 . PHE A 1 288 ? 94.118  53.374 29.881  1.00 20.56  ? 288  PHE A CD2 1 
ATOM   2229  C  CE1 . PHE A 1 288 ? 92.059  54.327 28.269  1.00 21.40  ? 288  PHE A CE1 1 
ATOM   2230  C  CE2 . PHE A 1 288 ? 93.123  52.498 29.440  1.00 20.46  ? 288  PHE A CE2 1 
ATOM   2231  C  CZ  . PHE A 1 288 ? 92.088  52.976 28.628  1.00 22.86  ? 288  PHE A CZ  1 
ATOM   2232  N  N   . ARG A 1 289 ? 95.832  58.860 28.224  1.00 26.37  ? 289  ARG A N   1 
ATOM   2233  C  CA  . ARG A 1 289 ? 95.335  60.229 28.085  1.00 28.29  ? 289  ARG A CA  1 
ATOM   2234  C  C   . ARG A 1 289 ? 95.615  60.641 26.643  1.00 28.97  ? 289  ARG A C   1 
ATOM   2235  O  O   . ARG A 1 289 ? 96.716  60.434 26.131  1.00 28.54  ? 289  ARG A O   1 
ATOM   2236  C  CB  . ARG A 1 289 ? 96.033  61.176 29.072  1.00 28.90  ? 289  ARG A CB  1 
ATOM   2237  C  CG  . ARG A 1 289 ? 95.584  61.010 30.528  1.00 28.29  ? 289  ARG A CG  1 
ATOM   2238  C  CD  . ARG A 1 289 ? 94.112  61.377 30.732  1.00 29.76  ? 289  ARG A CD  1 
ATOM   2239  N  NE  . ARG A 1 289 ? 93.656  61.137 32.104  1.00 29.96  ? 289  ARG A NE  1 
ATOM   2240  C  CZ  . ARG A 1 289 ? 93.402  59.933 32.620  1.00 31.83  ? 289  ARG A CZ  1 
ATOM   2241  N  NH1 . ARG A 1 289 ? 93.548  58.836 31.885  1.00 29.45  ? 289  ARG A NH1 1 
ATOM   2242  N  NH2 . ARG A 1 289 ? 93.019  59.821 33.884  1.00 31.10  ? 289  ARG A NH2 1 
ATOM   2243  N  N   . PHE A 1 290 ? 94.619  61.218 25.982  1.00 29.64  ? 290  PHE A N   1 
ATOM   2244  C  CA  . PHE A 1 290 ? 94.773  61.596 24.579  1.00 28.03  ? 290  PHE A CA  1 
ATOM   2245  C  C   . PHE A 1 290 ? 94.482  63.072 24.337  1.00 27.54  ? 290  PHE A C   1 
ATOM   2246  O  O   . PHE A 1 290 ? 93.624  63.665 24.981  1.00 27.36  ? 290  PHE A O   1 
ATOM   2247  C  CB  . PHE A 1 290 ? 93.869  60.698 23.743  1.00 26.30  ? 290  PHE A CB  1 
ATOM   2248  C  CG  . PHE A 1 290 ? 93.846  59.278 24.229  1.00 26.51  ? 290  PHE A CG  1 
ATOM   2249  C  CD1 . PHE A 1 290 ? 94.988  58.486 24.156  1.00 28.78  ? 290  PHE A CD1 1 
ATOM   2250  C  CD2 . PHE A 1 290 ? 92.712  58.756 24.833  1.00 27.59  ? 290  PHE A CD2 1 
ATOM   2251  C  CE1 . PHE A 1 290 ? 95.003  57.193 24.683  1.00 27.87  ? 290  PHE A CE1 1 
ATOM   2252  C  CE2 . PHE A 1 290 ? 92.713  57.467 25.363  1.00 26.92  ? 290  PHE A CE2 1 
ATOM   2253  C  CZ  . PHE A 1 290 ? 93.860  56.684 25.289  1.00 28.26  ? 290  PHE A CZ  1 
ATOM   2254  N  N   . SER A 1 291 ? 95.209  63.655 23.395  1.00 27.63  ? 291  SER A N   1 
ATOM   2255  C  CA  . SER A 1 291 ? 95.087  65.069 23.090  1.00 28.28  ? 291  SER A CA  1 
ATOM   2256  C  C   . SER A 1 291 ? 93.729  65.597 22.647  1.00 28.47  ? 291  SER A C   1 
ATOM   2257  O  O   . SER A 1 291 ? 93.147  66.452 23.315  1.00 29.01  ? 291  SER A O   1 
ATOM   2258  C  CB  . SER A 1 291 ? 96.142  65.453 22.057  1.00 28.34  ? 291  SER A CB  1 
ATOM   2259  O  OG  . SER A 1 291 ? 97.436  65.289 22.603  1.00 31.18  ? 291  SER A OG  1 
ATOM   2260  N  N   . PHE A 1 292 ? 93.224  65.097 21.525  1.00 27.12  ? 292  PHE A N   1 
ATOM   2261  C  CA  . PHE A 1 292 ? 91.951  65.579 21.018  1.00 25.76  ? 292  PHE A CA  1 
ATOM   2262  C  C   . PHE A 1 292 ? 90.814  64.580 21.145  1.00 25.44  ? 292  PHE A C   1 
ATOM   2263  O  O   . PHE A 1 292 ? 90.727  63.592 20.417  1.00 24.39  ? 292  PHE A O   1 
ATOM   2264  C  CB  . PHE A 1 292 ? 92.153  66.049 19.580  1.00 26.24  ? 292  PHE A CB  1 
ATOM   2265  C  CG  . PHE A 1 292 ? 93.187  67.133 19.468  1.00 26.88  ? 292  PHE A CG  1 
ATOM   2266  C  CD1 . PHE A 1 292 ? 92.885  68.438 19.857  1.00 26.18  ? 292  PHE A CD1 1 
ATOM   2267  C  CD2 . PHE A 1 292 ? 94.493  66.831 19.092  1.00 25.61  ? 292  PHE A CD2 1 
ATOM   2268  C  CE1 . PHE A 1 292 ? 93.864  69.421 19.880  1.00 26.46  ? 292  PHE A CE1 1 
ATOM   2269  C  CE2 . PHE A 1 292 ? 95.486  67.810 19.112  1.00 25.92  ? 292  PHE A CE2 1 
ATOM   2270  C  CZ  . PHE A 1 292 ? 95.171  69.107 19.508  1.00 27.25  ? 292  PHE A CZ  1 
ATOM   2271  N  N   . VAL A 1 293 ? 89.942  64.865 22.104  1.00 25.56  ? 293  VAL A N   1 
ATOM   2272  C  CA  . VAL A 1 293 ? 88.800  64.024 22.403  1.00 24.91  ? 293  VAL A CA  1 
ATOM   2273  C  C   . VAL A 1 293 ? 87.536  64.881 22.419  1.00 24.60  ? 293  VAL A C   1 
ATOM   2274  O  O   . VAL A 1 293 ? 87.613  66.103 22.331  1.00 24.64  ? 293  VAL A O   1 
ATOM   2275  C  CB  . VAL A 1 293 ? 88.988  63.355 23.786  1.00 24.72  ? 293  VAL A CB  1 
ATOM   2276  C  CG1 . VAL A 1 293 ? 90.218  62.460 23.768  1.00 20.46  ? 293  VAL A CG1 1 
ATOM   2277  C  CG2 . VAL A 1 293 ? 89.139  64.425 24.851  1.00 22.13  ? 293  VAL A CG2 1 
ATOM   2278  N  N   . PRO A 1 294 ? 86.355  64.244 22.519  1.00 24.19  ? 294  PRO A N   1 
ATOM   2279  C  CA  . PRO A 1 294 ? 85.086  64.974 22.545  1.00 25.56  ? 294  PRO A CA  1 
ATOM   2280  C  C   . PRO A 1 294 ? 85.060  66.053 23.622  1.00 26.41  ? 294  PRO A C   1 
ATOM   2281  O  O   . PRO A 1 294 ? 85.712  65.919 24.654  1.00 27.03  ? 294  PRO A O   1 
ATOM   2282  C  CB  . PRO A 1 294 ? 84.069  63.868 22.805  1.00 21.97  ? 294  PRO A CB  1 
ATOM   2283  C  CG  . PRO A 1 294 ? 84.634  62.743 22.032  1.00 24.75  ? 294  PRO A CG  1 
ATOM   2284  C  CD  . PRO A 1 294 ? 86.111  62.794 22.396  1.00 24.94  ? 294  PRO A CD  1 
ATOM   2285  N  N   . VAL A 1 295 ? 84.303  67.118 23.383  1.00 26.18  ? 295  VAL A N   1 
ATOM   2286  C  CA  . VAL A 1 295 ? 84.205  68.195 24.356  1.00 28.89  ? 295  VAL A CA  1 
ATOM   2287  C  C   . VAL A 1 295 ? 82.773  68.469 24.806  1.00 29.11  ? 295  VAL A C   1 
ATOM   2288  O  O   . VAL A 1 295 ? 81.843  68.358 24.016  1.00 31.75  ? 295  VAL A O   1 
ATOM   2289  C  CB  . VAL A 1 295 ? 84.801  69.492 23.797  1.00 26.61  ? 295  VAL A CB  1 
ATOM   2290  C  CG1 . VAL A 1 295 ? 86.296  69.339 23.641  1.00 31.53  ? 295  VAL A CG1 1 
ATOM   2291  C  CG2 . VAL A 1 295 ? 84.158  69.832 22.468  1.00 26.96  ? 295  VAL A CG2 1 
ATOM   2292  N  N   . ILE A 1 296 ? 82.607  68.812 26.081  1.00 31.14  ? 296  ILE A N   1 
ATOM   2293  C  CA  . ILE A 1 296 ? 81.294  69.125 26.658  1.00 33.75  ? 296  ILE A CA  1 
ATOM   2294  C  C   . ILE A 1 296 ? 80.984  70.560 26.226  1.00 36.52  ? 296  ILE A C   1 
ATOM   2295  O  O   . ILE A 1 296 ? 81.344  71.527 26.909  1.00 34.65  ? 296  ILE A O   1 
ATOM   2296  C  CB  . ILE A 1 296 ? 81.334  69.032 28.212  1.00 33.65  ? 296  ILE A CB  1 
ATOM   2297  C  CG1 . ILE A 1 296 ? 81.850  67.654 28.640  1.00 34.26  ? 296  ILE A CG1 1 
ATOM   2298  C  CG2 . ILE A 1 296 ? 79.952  69.267 28.796  1.00 32.00  ? 296  ILE A CG2 1 
ATOM   2299  C  CD1 . ILE A 1 296 ? 81.073  66.468 28.051  1.00 33.38  ? 296  ILE A CD1 1 
ATOM   2300  N  N   . ASP A 1 297 ? 80.313  70.677 25.082  1.00 39.14  ? 297  ASP A N   1 
ATOM   2301  C  CA  . ASP A 1 297 ? 79.991  71.966 24.472  1.00 41.66  ? 297  ASP A CA  1 
ATOM   2302  C  C   . ASP A 1 297 ? 78.637  72.602 24.771  1.00 43.49  ? 297  ASP A C   1 
ATOM   2303  O  O   . ASP A 1 297 ? 78.435  73.781 24.486  1.00 45.91  ? 297  ASP A O   1 
ATOM   2304  C  CB  . ASP A 1 297 ? 80.145  71.839 22.957  1.00 40.25  ? 297  ASP A CB  1 
ATOM   2305  C  CG  . ASP A 1 297 ? 79.258  70.746 22.372  1.00 41.75  ? 297  ASP A CG  1 
ATOM   2306  O  OD1 . ASP A 1 297 ? 78.617  70.002 23.153  1.00 39.44  ? 297  ASP A OD1 1 
ATOM   2307  O  OD2 . ASP A 1 297 ? 79.206  70.625 21.127  1.00 41.78  ? 297  ASP A OD2 1 
ATOM   2308  N  N   . GLY A 1 298 ? 77.708  71.841 25.333  1.00 45.06  ? 298  GLY A N   1 
ATOM   2309  C  CA  . GLY A 1 298 ? 76.400  72.400 25.617  1.00 45.20  ? 298  GLY A CA  1 
ATOM   2310  C  C   . GLY A 1 298 ? 75.490  72.267 24.410  1.00 46.61  ? 298  GLY A C   1 
ATOM   2311  O  O   . GLY A 1 298 ? 74.327  72.678 24.444  1.00 47.95  ? 298  GLY A O   1 
ATOM   2312  N  N   . GLU A 1 299 ? 76.022  71.691 23.336  1.00 47.10  ? 299  GLU A N   1 
ATOM   2313  C  CA  . GLU A 1 299 ? 75.259  71.496 22.105  1.00 47.12  ? 299  GLU A CA  1 
ATOM   2314  C  C   . GLU A 1 299 ? 75.068  70.006 21.827  1.00 44.60  ? 299  GLU A C   1 
ATOM   2315  O  O   . GLU A 1 299 ? 73.946  69.508 21.880  1.00 45.50  ? 299  GLU A O   1 
ATOM   2316  C  CB  . GLU A 1 299 ? 75.971  72.171 20.929  1.00 51.46  ? 299  GLU A CB  1 
ATOM   2317  C  CG  . GLU A 1 299 ? 75.250  72.010 19.600  1.00 58.11  ? 299  GLU A CG  1 
ATOM   2318  C  CD  . GLU A 1 299 ? 75.910  72.788 18.476  1.00 62.13  ? 299  GLU A CD  1 
ATOM   2319  O  OE1 . GLU A 1 299 ? 77.152  72.702 18.331  1.00 63.88  ? 299  GLU A OE1 1 
ATOM   2320  O  OE2 . GLU A 1 299 ? 75.182  73.481 17.732  1.00 65.35  ? 299  GLU A OE2 1 
ATOM   2321  N  N   . PHE A 1 300 ? 76.149  69.294 21.516  1.00 42.05  ? 300  PHE A N   1 
ATOM   2322  C  CA  . PHE A 1 300 ? 76.038  67.853 21.283  1.00 38.77  ? 300  PHE A CA  1 
ATOM   2323  C  C   . PHE A 1 300 ? 75.666  67.260 22.642  1.00 37.63  ? 300  PHE A C   1 
ATOM   2324  O  O   . PHE A 1 300 ? 74.861  66.335 22.736  1.00 37.10  ? 300  PHE A O   1 
ATOM   2325  C  CB  . PHE A 1 300 ? 77.368  67.273 20.784  1.00 35.38  ? 300  PHE A CB  1 
ATOM   2326  C  CG  . PHE A 1 300 ? 77.310  65.800 20.458  1.00 30.66  ? 300  PHE A CG  1 
ATOM   2327  C  CD1 . PHE A 1 300 ? 77.424  64.844 21.465  1.00 28.12  ? 300  PHE A CD1 1 
ATOM   2328  C  CD2 . PHE A 1 300 ? 77.128  65.371 19.141  1.00 29.47  ? 300  PHE A CD2 1 
ATOM   2329  C  CE1 . PHE A 1 300 ? 77.357  63.476 21.168  1.00 27.18  ? 300  PHE A CE1 1 
ATOM   2330  C  CE2 . PHE A 1 300 ? 77.059  64.008 18.829  1.00 27.96  ? 300  PHE A CE2 1 
ATOM   2331  C  CZ  . PHE A 1 300 ? 77.174  63.056 19.849  1.00 27.74  ? 300  PHE A CZ  1 
ATOM   2332  N  N   . PHE A 1 301 ? 76.258  67.823 23.690  1.00 37.62  ? 301  PHE A N   1 
ATOM   2333  C  CA  . PHE A 1 301 ? 75.995  67.415 25.070  1.00 38.26  ? 301  PHE A CA  1 
ATOM   2334  C  C   . PHE A 1 301 ? 75.313  68.594 25.783  1.00 39.92  ? 301  PHE A C   1 
ATOM   2335  O  O   . PHE A 1 301 ? 75.949  69.605 26.065  1.00 38.27  ? 301  PHE A O   1 
ATOM   2336  C  CB  . PHE A 1 301 ? 77.306  67.081 25.794  1.00 35.60  ? 301  PHE A CB  1 
ATOM   2337  C  CG  . PHE A 1 301 ? 78.011  65.862 25.260  1.00 34.04  ? 301  PHE A CG  1 
ATOM   2338  C  CD1 . PHE A 1 301 ? 77.468  64.590 25.438  1.00 32.94  ? 301  PHE A CD1 1 
ATOM   2339  C  CD2 . PHE A 1 301 ? 79.225  65.985 24.590  1.00 31.73  ? 301  PHE A CD2 1 
ATOM   2340  C  CE1 . PHE A 1 301 ? 78.132  63.453 24.957  1.00 30.50  ? 301  PHE A CE1 1 
ATOM   2341  C  CE2 . PHE A 1 301 ? 79.893  64.858 24.107  1.00 31.30  ? 301  PHE A CE2 1 
ATOM   2342  C  CZ  . PHE A 1 301 ? 79.343  63.590 24.294  1.00 29.52  ? 301  PHE A CZ  1 
ATOM   2343  N  N   . PRO A 1 302 ? 74.008  68.475 26.080  1.00 41.55  ? 302  PRO A N   1 
ATOM   2344  C  CA  . PRO A 1 302 ? 73.232  69.522 26.757  1.00 42.53  ? 302  PRO A CA  1 
ATOM   2345  C  C   . PRO A 1 302 ? 73.922  70.103 27.988  1.00 42.83  ? 302  PRO A C   1 
ATOM   2346  O  O   . PRO A 1 302 ? 74.144  71.311 28.068  1.00 44.40  ? 302  PRO A O   1 
ATOM   2347  C  CB  . PRO A 1 302 ? 71.933  68.808 27.112  1.00 44.07  ? 302  PRO A CB  1 
ATOM   2348  C  CG  . PRO A 1 302 ? 71.770  67.858 25.962  1.00 44.91  ? 302  PRO A CG  1 
ATOM   2349  C  CD  . PRO A 1 302 ? 73.165  67.298 25.800  1.00 41.45  ? 302  PRO A CD  1 
ATOM   2350  N  N   . THR A 1 303 ? 74.242  69.240 28.949  1.00 41.47  ? 303  THR A N   1 
ATOM   2351  C  CA  . THR A 1 303 ? 74.917  69.653 30.176  1.00 40.28  ? 303  THR A CA  1 
ATOM   2352  C  C   . THR A 1 303 ? 75.980  68.615 30.506  1.00 40.15  ? 303  THR A C   1 
ATOM   2353  O  O   . THR A 1 303 ? 76.238  67.716 29.710  1.00 40.86  ? 303  THR A O   1 
ATOM   2354  C  CB  . THR A 1 303 ? 73.943  69.726 31.363  1.00 41.86  ? 303  THR A CB  1 
ATOM   2355  O  OG1 . THR A 1 303 ? 73.319  68.445 31.546  1.00 42.24  ? 303  THR A OG1 1 
ATOM   2356  C  CG2 . THR A 1 303 ? 72.877  70.788 31.120  1.00 41.27  ? 303  THR A CG2 1 
ATOM   2357  N  N   . SER A 1 304 ? 76.592  68.728 31.680  1.00 38.24  ? 304  SER A N   1 
ATOM   2358  C  CA  . SER A 1 304 ? 77.621  67.775 32.077  1.00 39.19  ? 304  SER A CA  1 
ATOM   2359  C  C   . SER A 1 304 ? 77.079  66.349 31.984  1.00 37.63  ? 304  SER A C   1 
ATOM   2360  O  O   . SER A 1 304 ? 75.888  66.115 32.190  1.00 37.12  ? 304  SER A O   1 
ATOM   2361  C  CB  . SER A 1 304 ? 78.074  68.054 33.510  1.00 39.45  ? 304  SER A CB  1 
ATOM   2362  O  OG  . SER A 1 304 ? 77.022  67.797 34.426  1.00 42.84  ? 304  SER A OG  1 
ATOM   2363  N  N   . LEU A 1 305 ? 77.955  65.401 31.674  1.00 36.65  ? 305  LEU A N   1 
ATOM   2364  C  CA  . LEU A 1 305 ? 77.550  64.002 31.562  1.00 37.58  ? 305  LEU A CA  1 
ATOM   2365  C  C   . LEU A 1 305 ? 76.918  63.506 32.861  1.00 37.53  ? 305  LEU A C   1 
ATOM   2366  O  O   . LEU A 1 305 ? 75.950  62.744 32.840  1.00 35.99  ? 305  LEU A O   1 
ATOM   2367  C  CB  . LEU A 1 305 ? 78.760  63.120 31.218  1.00 35.63  ? 305  LEU A CB  1 
ATOM   2368  C  CG  . LEU A 1 305 ? 79.472  63.412 29.892  1.00 37.05  ? 305  LEU A CG  1 
ATOM   2369  C  CD1 . LEU A 1 305 ? 80.721  62.542 29.778  1.00 36.37  ? 305  LEU A CD1 1 
ATOM   2370  C  CD2 . LEU A 1 305 ? 78.523  63.145 28.720  1.00 34.88  ? 305  LEU A CD2 1 
ATOM   2371  N  N   . GLU A 1 306 ? 77.468  63.947 33.989  1.00 38.00  ? 306  GLU A N   1 
ATOM   2372  C  CA  . GLU A 1 306 ? 76.965  63.530 35.288  1.00 40.48  ? 306  GLU A CA  1 
ATOM   2373  C  C   . GLU A 1 306 ? 75.544  64.009 35.553  1.00 40.48  ? 306  GLU A C   1 
ATOM   2374  O  O   . GLU A 1 306 ? 74.677  63.217 35.917  1.00 40.77  ? 306  GLU A O   1 
ATOM   2375  C  CB  . GLU A 1 306 ? 77.887  64.028 36.402  1.00 42.28  ? 306  GLU A CB  1 
ATOM   2376  C  CG  . GLU A 1 306 ? 77.586  63.404 37.759  1.00 46.95  ? 306  GLU A CG  1 
ATOM   2377  C  CD  . GLU A 1 306 ? 77.872  61.904 37.789  1.00 49.89  ? 306  GLU A CD  1 
ATOM   2378  O  OE1 . GLU A 1 306 ? 77.312  61.163 36.951  1.00 49.77  ? 306  GLU A OE1 1 
ATOM   2379  O  OE2 . GLU A 1 306 ? 78.662  61.463 38.653  1.00 54.92  ? 306  GLU A OE2 1 
ATOM   2380  N  N   . SER A 1 307 ? 75.298  65.303 35.373  1.00 41.08  ? 307  SER A N   1 
ATOM   2381  C  CA  . SER A 1 307 ? 73.961  65.835 35.606  1.00 41.34  ? 307  SER A CA  1 
ATOM   2382  C  C   . SER A 1 307 ? 72.967  65.151 34.670  1.00 40.45  ? 307  SER A C   1 
ATOM   2383  O  O   . SER A 1 307 ? 71.824  64.904 35.049  1.00 40.33  ? 307  SER A O   1 
ATOM   2384  C  CB  . SER A 1 307 ? 73.930  67.356 35.398  1.00 41.38  ? 307  SER A CB  1 
ATOM   2385  O  OG  . SER A 1 307 ? 74.009  67.699 34.026  1.00 44.53  ? 307  SER A OG  1 
ATOM   2386  N  N   . MET A 1 308 ? 73.403  64.840 33.451  1.00 40.53  ? 308  MET A N   1 
ATOM   2387  C  CA  . MET A 1 308 ? 72.534  64.162 32.491  1.00 40.78  ? 308  MET A CA  1 
ATOM   2388  C  C   . MET A 1 308 ? 72.211  62.760 32.990  1.00 39.84  ? 308  MET A C   1 
ATOM   2389  O  O   . MET A 1 308 ? 71.086  62.282 32.857  1.00 39.54  ? 308  MET A O   1 
ATOM   2390  C  CB  . MET A 1 308 ? 73.207  64.048 31.123  1.00 41.80  ? 308  MET A CB  1 
ATOM   2391  C  CG  . MET A 1 308 ? 73.269  65.331 30.336  1.00 42.58  ? 308  MET A CG  1 
ATOM   2392  S  SD  . MET A 1 308 ? 73.968  65.041 28.702  1.00 44.42  ? 308  MET A SD  1 
ATOM   2393  C  CE  . MET A 1 308 ? 72.495  64.549 27.798  1.00 44.01  ? 308  MET A CE  1 
ATOM   2394  N  N   . LEU A 1 309 ? 73.215  62.099 33.553  1.00 39.69  ? 309  LEU A N   1 
ATOM   2395  C  CA  . LEU A 1 309 ? 73.034  60.753 34.073  1.00 40.41  ? 309  LEU A CA  1 
ATOM   2396  C  C   . LEU A 1 309 ? 72.138  60.726 35.316  1.00 42.13  ? 309  LEU A C   1 
ATOM   2397  O  O   . LEU A 1 309 ? 71.335  59.805 35.481  1.00 42.43  ? 309  LEU A O   1 
ATOM   2398  C  CB  . LEU A 1 309 ? 74.394  60.118 34.387  1.00 37.45  ? 309  LEU A CB  1 
ATOM   2399  C  CG  . LEU A 1 309 ? 75.194  59.607 33.184  1.00 35.76  ? 309  LEU A CG  1 
ATOM   2400  C  CD1 . LEU A 1 309 ? 76.575  59.149 33.622  1.00 35.01  ? 309  LEU A CD1 1 
ATOM   2401  C  CD2 . LEU A 1 309 ? 74.447  58.459 32.532  1.00 34.10  ? 309  LEU A CD2 1 
ATOM   2402  N  N   . ASN A 1 310 ? 72.258  61.730 36.182  1.00 42.59  ? 310  ASN A N   1 
ATOM   2403  C  CA  . ASN A 1 310 ? 71.439  61.761 37.392  1.00 43.08  ? 310  ASN A CA  1 
ATOM   2404  C  C   . ASN A 1 310 ? 69.980  62.063 37.101  1.00 43.35  ? 310  ASN A C   1 
ATOM   2405  O  O   . ASN A 1 310 ? 69.087  61.447 37.678  1.00 44.17  ? 310  ASN A O   1 
ATOM   2406  C  CB  . ASN A 1 310 ? 71.963  62.795 38.397  1.00 44.17  ? 310  ASN A CB  1 
ATOM   2407  C  CG  . ASN A 1 310 ? 73.264  62.376 39.047  1.00 44.20  ? 310  ASN A CG  1 
ATOM   2408  O  OD1 . ASN A 1 310 ? 73.440  61.220 39.419  1.00 47.43  ? 310  ASN A OD1 1 
ATOM   2409  N  ND2 . ASN A 1 310 ? 74.180  63.323 39.204  1.00 47.69  ? 310  ASN A ND2 1 
ATOM   2410  N  N   . SER A 1 311 ? 69.740  63.016 36.207  1.00 44.12  ? 311  SER A N   1 
ATOM   2411  C  CA  . SER A 1 311 ? 68.378  63.408 35.857  1.00 43.35  ? 311  SER A CA  1 
ATOM   2412  C  C   . SER A 1 311 ? 67.680  62.428 34.913  1.00 42.73  ? 311  SER A C   1 
ATOM   2413  O  O   . SER A 1 311 ? 66.489  62.570 34.636  1.00 44.32  ? 311  SER A O   1 
ATOM   2414  C  CB  . SER A 1 311 ? 68.390  64.794 35.222  1.00 43.10  ? 311  SER A CB  1 
ATOM   2415  O  OG  . SER A 1 311 ? 69.130  64.779 34.014  1.00 46.17  ? 311  SER A OG  1 
ATOM   2416  N  N   . GLY A 1 312 ? 68.414  61.439 34.417  1.00 41.09  ? 312  GLY A N   1 
ATOM   2417  C  CA  . GLY A 1 312 ? 67.820  60.475 33.510  1.00 39.95  ? 312  GLY A CA  1 
ATOM   2418  C  C   . GLY A 1 312 ? 67.569  61.044 32.123  1.00 40.56  ? 312  GLY A C   1 
ATOM   2419  O  O   . GLY A 1 312 ? 66.733  60.533 31.378  1.00 41.14  ? 312  GLY A O   1 
ATOM   2420  N  N   . ASN A 1 313 ? 68.282  62.110 31.773  1.00 40.44  ? 313  ASN A N   1 
ATOM   2421  C  CA  . ASN A 1 313 ? 68.131  62.725 30.460  1.00 39.77  ? 313  ASN A CA  1 
ATOM   2422  C  C   . ASN A 1 313 ? 68.991  61.995 29.434  1.00 38.49  ? 313  ASN A C   1 
ATOM   2423  O  O   . ASN A 1 313 ? 70.128  62.381 29.164  1.00 37.62  ? 313  ASN A O   1 
ATOM   2424  C  CB  . ASN A 1 313 ? 68.517  64.207 30.519  1.00 41.72  ? 313  ASN A CB  1 
ATOM   2425  C  CG  . ASN A 1 313 ? 68.573  64.854 29.142  1.00 44.01  ? 313  ASN A CG  1 
ATOM   2426  O  OD1 . ASN A 1 313 ? 67.833  64.474 28.228  1.00 45.86  ? 313  ASN A OD1 1 
ATOM   2427  N  ND2 . ASN A 1 313 ? 69.445  65.845 28.992  1.00 44.00  ? 313  ASN A ND2 1 
ATOM   2428  N  N   . PHE A 1 314 ? 68.433  60.925 28.878  1.00 36.74  ? 314  PHE A N   1 
ATOM   2429  C  CA  . PHE A 1 314 ? 69.121  60.117 27.887  1.00 34.91  ? 314  PHE A CA  1 
ATOM   2430  C  C   . PHE A 1 314 ? 68.184  59.047 27.345  1.00 34.54  ? 314  PHE A C   1 
ATOM   2431  O  O   . PHE A 1 314 ? 67.118  58.803 27.910  1.00 35.97  ? 314  PHE A O   1 
ATOM   2432  C  CB  . PHE A 1 314 ? 70.377  59.475 28.500  1.00 34.33  ? 314  PHE A CB  1 
ATOM   2433  C  CG  . PHE A 1 314 ? 70.114  58.647 29.734  1.00 33.10  ? 314  PHE A CG  1 
ATOM   2434  C  CD1 . PHE A 1 314 ? 69.475  57.411 29.647  1.00 33.02  ? 314  PHE A CD1 1 
ATOM   2435  C  CD2 . PHE A 1 314 ? 70.519  59.099 30.985  1.00 32.33  ? 314  PHE A CD2 1 
ATOM   2436  C  CE1 . PHE A 1 314 ? 69.244  56.636 30.792  1.00 30.16  ? 314  PHE A CE1 1 
ATOM   2437  C  CE2 . PHE A 1 314 ? 70.294  58.331 32.131  1.00 32.94  ? 314  PHE A CE2 1 
ATOM   2438  C  CZ  . PHE A 1 314 ? 69.654  57.095 32.030  1.00 30.65  ? 314  PHE A CZ  1 
ATOM   2439  N  N   . LYS A 1 315 ? 68.583  58.418 26.245  1.00 33.19  ? 315  LYS A N   1 
ATOM   2440  C  CA  . LYS A 1 315 ? 67.784  57.373 25.616  1.00 32.42  ? 315  LYS A CA  1 
ATOM   2441  C  C   . LYS A 1 315 ? 67.587  56.201 26.574  1.00 33.24  ? 315  LYS A C   1 
ATOM   2442  O  O   . LYS A 1 315 ? 68.545  55.704 27.167  1.00 32.08  ? 315  LYS A O   1 
ATOM   2443  C  CB  . LYS A 1 315 ? 68.471  56.893 24.336  1.00 31.94  ? 315  LYS A CB  1 
ATOM   2444  C  CG  . LYS A 1 315 ? 67.651  55.926 23.492  1.00 31.59  ? 315  LYS A CG  1 
ATOM   2445  C  CD  . LYS A 1 315 ? 68.463  55.404 22.311  1.00 31.51  ? 315  LYS A CD  1 
ATOM   2446  C  CE  . LYS A 1 315 ? 67.706  54.349 21.523  1.00 28.46  ? 315  LYS A CE  1 
ATOM   2447  N  NZ  . LYS A 1 315 ? 66.490  54.907 20.863  1.00 32.95  ? 315  LYS A NZ  1 
ATOM   2448  N  N   . LYS A 1 316 ? 66.339  55.769 26.725  1.00 33.81  ? 316  LYS A N   1 
ATOM   2449  C  CA  . LYS A 1 316 ? 66.016  54.655 27.613  1.00 35.21  ? 316  LYS A CA  1 
ATOM   2450  C  C   . LYS A 1 316 ? 65.678  53.440 26.777  1.00 33.97  ? 316  LYS A C   1 
ATOM   2451  O  O   . LYS A 1 316 ? 64.641  53.401 26.114  1.00 35.78  ? 316  LYS A O   1 
ATOM   2452  C  CB  . LYS A 1 316 ? 64.847  55.041 28.518  1.00 36.75  ? 316  LYS A CB  1 
ATOM   2453  C  CG  . LYS A 1 316 ? 65.199  56.219 29.415  1.00 39.83  ? 316  LYS A CG  1 
ATOM   2454  C  CD  . LYS A 1 316 ? 64.007  56.766 30.166  1.00 42.03  ? 316  LYS A CD  1 
ATOM   2455  C  CE  . LYS A 1 316 ? 64.389  58.056 30.878  1.00 43.58  ? 316  LYS A CE  1 
ATOM   2456  N  NZ  . LYS A 1 316 ? 64.890  59.079 29.909  1.00 44.54  ? 316  LYS A NZ  1 
ATOM   2457  N  N   . THR A 1 317 ? 66.567  52.451 26.804  1.00 30.92  ? 317  THR A N   1 
ATOM   2458  C  CA  . THR A 1 317 ? 66.390  51.237 26.014  1.00 29.90  ? 317  THR A CA  1 
ATOM   2459  C  C   . THR A 1 317 ? 67.184  50.123 26.693  1.00 29.11  ? 317  THR A C   1 
ATOM   2460  O  O   . THR A 1 317 ? 67.445  50.200 27.891  1.00 29.26  ? 317  THR A O   1 
ATOM   2461  C  CB  . THR A 1 317 ? 66.911  51.476 24.560  1.00 30.61  ? 317  THR A CB  1 
ATOM   2462  O  OG1 . THR A 1 317 ? 66.719  50.301 23.762  1.00 32.48  ? 317  THR A OG1 1 
ATOM   2463  C  CG2 . THR A 1 317 ? 68.394  51.839 24.575  1.00 30.81  ? 317  THR A CG2 1 
ATOM   2464  N  N   . GLN A 1 318 ? 67.551  49.087 25.945  1.00 29.01  ? 318  GLN A N   1 
ATOM   2465  C  CA  . GLN A 1 318 ? 68.354  48.007 26.507  1.00 30.29  ? 318  GLN A CA  1 
ATOM   2466  C  C   . GLN A 1 318 ? 69.827  48.224 26.136  1.00 31.64  ? 318  GLN A C   1 
ATOM   2467  O  O   . GLN A 1 318 ? 70.142  48.705 25.042  1.00 31.34  ? 318  GLN A O   1 
ATOM   2468  C  CB  . GLN A 1 318 ? 67.927  46.635 25.963  1.00 31.15  ? 318  GLN A CB  1 
ATOM   2469  C  CG  . GLN A 1 318 ? 66.482  46.225 26.233  1.00 34.14  ? 318  GLN A CG  1 
ATOM   2470  C  CD  . GLN A 1 318 ? 65.500  46.895 25.283  1.00 36.84  ? 318  GLN A CD  1 
ATOM   2471  O  OE1 . GLN A 1 318 ? 65.676  46.856 24.066  1.00 35.43  ? 318  GLN A OE1 1 
ATOM   2472  N  NE2 . GLN A 1 318 ? 64.456  47.507 25.838  1.00 38.46  ? 318  GLN A NE2 1 
ATOM   2473  N  N   . ILE A 1 319 ? 70.724  47.886 27.056  1.00 29.74  ? 319  ILE A N   1 
ATOM   2474  C  CA  . ILE A 1 319 ? 72.150  47.988 26.794  1.00 28.33  ? 319  ILE A CA  1 
ATOM   2475  C  C   . ILE A 1 319 ? 72.819  46.716 27.282  1.00 28.79  ? 319  ILE A C   1 
ATOM   2476  O  O   . ILE A 1 319 ? 72.349  46.070 28.220  1.00 28.73  ? 319  ILE A O   1 
ATOM   2477  C  CB  . ILE A 1 319 ? 72.822  49.176 27.514  1.00 27.04  ? 319  ILE A CB  1 
ATOM   2478  C  CG1 . ILE A 1 319 ? 72.513  49.127 29.012  1.00 28.45  ? 319  ILE A CG1 1 
ATOM   2479  C  CG2 . ILE A 1 319 ? 72.389  50.481 26.883  1.00 26.54  ? 319  ILE A CG2 1 
ATOM   2480  C  CD1 . ILE A 1 319 ? 73.263  50.175 29.821  1.00 28.35  ? 319  ILE A CD1 1 
ATOM   2481  N  N   . LEU A 1 320 ? 73.909  46.356 26.620  1.00 28.59  ? 320  LEU A N   1 
ATOM   2482  C  CA  . LEU A 1 320 ? 74.688  45.186 26.971  1.00 28.10  ? 320  LEU A CA  1 
ATOM   2483  C  C   . LEU A 1 320 ? 76.122  45.691 26.948  1.00 28.58  ? 320  LEU A C   1 
ATOM   2484  O  O   . LEU A 1 320 ? 76.630  46.068 25.899  1.00 29.23  ? 320  LEU A O   1 
ATOM   2485  C  CB  . LEU A 1 320 ? 74.474  44.075 25.941  1.00 27.26  ? 320  LEU A CB  1 
ATOM   2486  C  CG  . LEU A 1 320 ? 75.205  42.758 26.200  1.00 27.07  ? 320  LEU A CG  1 
ATOM   2487  C  CD1 . LEU A 1 320 ? 74.418  41.603 25.614  1.00 26.45  ? 320  LEU A CD1 1 
ATOM   2488  C  CD2 . LEU A 1 320 ? 76.603  42.828 25.608  1.00 26.25  ? 320  LEU A CD2 1 
ATOM   2489  N  N   . LEU A 1 321 ? 76.755  45.722 28.118  1.00 28.61  ? 321  LEU A N   1 
ATOM   2490  C  CA  . LEU A 1 321 ? 78.119  46.207 28.246  1.00 27.48  ? 321  LEU A CA  1 
ATOM   2491  C  C   . LEU A 1 321 ? 78.989  45.318 29.133  1.00 29.96  ? 321  LEU A C   1 
ATOM   2492  O  O   . LEU A 1 321 ? 78.485  44.481 29.889  1.00 29.30  ? 321  LEU A O   1 
ATOM   2493  C  CB  . LEU A 1 321 ? 78.101  47.642 28.793  1.00 23.89  ? 321  LEU A CB  1 
ATOM   2494  C  CG  . LEU A 1 321 ? 77.544  47.967 30.187  1.00 24.39  ? 321  LEU A CG  1 
ATOM   2495  C  CD1 . LEU A 1 321 ? 77.416  49.495 30.336  1.00 21.99  ? 321  LEU A CD1 1 
ATOM   2496  C  CD2 . LEU A 1 321 ? 76.183  47.315 30.397  1.00 23.10  ? 321  LEU A CD2 1 
ATOM   2497  N  N   . GLY A 1 322 ? 80.302  45.506 29.037  1.00 30.55  ? 322  GLY A N   1 
ATOM   2498  C  CA  . GLY A 1 322 ? 81.220  44.717 29.839  1.00 32.20  ? 322  GLY A CA  1 
ATOM   2499  C  C   . GLY A 1 322 ? 82.665  45.152 29.691  1.00 32.09  ? 322  GLY A C   1 
ATOM   2500  O  O   . GLY A 1 322 ? 82.974  46.098 28.961  1.00 33.76  ? 322  GLY A O   1 
ATOM   2501  N  N   . VAL A 1 323 ? 83.556  44.455 30.387  1.00 30.32  ? 323  VAL A N   1 
ATOM   2502  C  CA  . VAL A 1 323 ? 84.973  44.763 30.341  1.00 29.39  ? 323  VAL A CA  1 
ATOM   2503  C  C   . VAL A 1 323 ? 85.811  43.492 30.319  1.00 29.39  ? 323  VAL A C   1 
ATOM   2504  O  O   . VAL A 1 323 ? 85.302  42.388 30.530  1.00 29.23  ? 323  VAL A O   1 
ATOM   2505  C  CB  . VAL A 1 323 ? 85.395  45.607 31.560  1.00 30.52  ? 323  VAL A CB  1 
ATOM   2506  C  CG1 . VAL A 1 323 ? 84.606  46.898 31.588  1.00 30.34  ? 323  VAL A CG1 1 
ATOM   2507  C  CG2 . VAL A 1 323 ? 85.165  44.830 32.846  1.00 29.57  ? 323  VAL A CG2 1 
ATOM   2508  N  N   . ASN A 1 324 ? 87.098  43.663 30.046  1.00 28.76  ? 324  ASN A N   1 
ATOM   2509  C  CA  . ASN A 1 324 ? 88.043  42.560 30.013  1.00 29.27  ? 324  ASN A CA  1 
ATOM   2510  C  C   . ASN A 1 324 ? 88.806  42.553 31.337  1.00 30.28  ? 324  ASN A C   1 
ATOM   2511  O  O   . ASN A 1 324 ? 88.892  43.576 32.021  1.00 27.94  ? 324  ASN A O   1 
ATOM   2512  C  CB  . ASN A 1 324 ? 89.014  42.730 28.844  1.00 31.18  ? 324  ASN A CB  1 
ATOM   2513  C  CG  . ASN A 1 324 ? 88.369  42.438 27.500  1.00 32.76  ? 324  ASN A CG  1 
ATOM   2514  O  OD1 . ASN A 1 324 ? 87.155  42.247 27.407  1.00 33.24  ? 324  ASN A OD1 1 
ATOM   2515  N  ND2 . ASN A 1 324 ? 89.180  42.405 26.451  1.00 31.38  ? 324  ASN A ND2 1 
ATOM   2516  N  N   . LYS A 1 325 ? 89.363  41.403 31.695  1.00 30.53  ? 325  LYS A N   1 
ATOM   2517  C  CA  . LYS A 1 325 ? 90.086  41.278 32.953  1.00 32.29  ? 325  LYS A CA  1 
ATOM   2518  C  C   . LYS A 1 325 ? 91.316  42.181 33.142  1.00 31.20  ? 325  LYS A C   1 
ATOM   2519  O  O   . LYS A 1 325 ? 91.578  42.633 34.259  1.00 29.46  ? 325  LYS A O   1 
ATOM   2520  C  CB  . LYS A 1 325 ? 90.493  39.820 33.170  1.00 33.75  ? 325  LYS A CB  1 
ATOM   2521  C  CG  . LYS A 1 325 ? 91.208  39.582 34.487  1.00 36.71  ? 325  LYS A CG  1 
ATOM   2522  C  CD  . LYS A 1 325 ? 91.721  38.155 34.578  1.00 43.39  ? 325  LYS A CD  1 
ATOM   2523  C  CE  . LYS A 1 325 ? 92.432  37.908 35.900  1.00 45.60  ? 325  LYS A CE  1 
ATOM   2524  N  NZ  . LYS A 1 325 ? 93.144  36.594 35.896  1.00 49.77  ? 325  LYS A NZ  1 
ATOM   2525  N  N   . ASP A 1 326 ? 92.065  42.452 32.075  1.00 30.30  ? 326  ASP A N   1 
ATOM   2526  C  CA  . ASP A 1 326 ? 93.269  43.282 32.199  1.00 32.69  ? 326  ASP A CA  1 
ATOM   2527  C  C   . ASP A 1 326 ? 93.318  44.465 31.234  1.00 33.49  ? 326  ASP A C   1 
ATOM   2528  O  O   . ASP A 1 326 ? 94.130  44.492 30.307  1.00 34.20  ? 326  ASP A O   1 
ATOM   2529  C  CB  . ASP A 1 326 ? 94.502  42.406 32.005  1.00 31.04  ? 326  ASP A CB  1 
ATOM   2530  C  CG  . ASP A 1 326 ? 94.508  41.214 32.939  1.00 34.06  ? 326  ASP A CG  1 
ATOM   2531  O  OD1 . ASP A 1 326 ? 94.709  41.423 34.156  1.00 36.70  ? 326  ASP A OD1 1 
ATOM   2532  O  OD2 . ASP A 1 326 ? 94.298  40.072 32.467  1.00 32.47  ? 326  ASP A OD2 1 
ATOM   2533  N  N   . GLU A 1 327 ? 92.463  45.451 31.483  1.00 32.94  ? 327  GLU A N   1 
ATOM   2534  C  CA  . GLU A 1 327 ? 92.358  46.638 30.642  1.00 33.14  ? 327  GLU A CA  1 
ATOM   2535  C  C   . GLU A 1 327 ? 93.578  47.553 30.623  1.00 33.86  ? 327  GLU A C   1 
ATOM   2536  O  O   . GLU A 1 327 ? 93.794  48.272 29.649  1.00 37.65  ? 327  GLU A O   1 
ATOM   2537  C  CB  . GLU A 1 327 ? 91.148  47.470 31.074  1.00 30.21  ? 327  GLU A CB  1 
ATOM   2538  C  CG  . GLU A 1 327 ? 89.807  46.742 31.047  1.00 31.33  ? 327  GLU A CG  1 
ATOM   2539  C  CD  . GLU A 1 327 ? 89.243  46.557 29.645  1.00 32.05  ? 327  GLU A CD  1 
ATOM   2540  O  OE1 . GLU A 1 327 ? 89.884  46.994 28.671  1.00 32.90  ? 327  GLU A OE1 1 
ATOM   2541  O  OE2 . GLU A 1 327 ? 88.146  45.976 29.514  1.00 33.60  ? 327  GLU A OE2 1 
ATOM   2542  N  N   . GLY A 1 328 ? 94.387  47.533 31.675  1.00 33.52  ? 328  GLY A N   1 
ATOM   2543  C  CA  . GLY A 1 328 ? 95.520  48.444 31.716  1.00 33.02  ? 328  GLY A CA  1 
ATOM   2544  C  C   . GLY A 1 328 ? 96.905  48.064 31.215  1.00 32.01  ? 328  GLY A C   1 
ATOM   2545  O  O   . GLY A 1 328 ? 97.706  48.956 30.925  1.00 31.32  ? 328  GLY A O   1 
ATOM   2546  N  N   . SER A 1 329 ? 97.197  46.771 31.096  1.00 29.80  ? 329  SER A N   1 
ATOM   2547  C  CA  . SER A 1 329 ? 98.524  46.332 30.681  1.00 28.93  ? 329  SER A CA  1 
ATOM   2548  C  C   . SER A 1 329 ? 99.071  46.946 29.392  1.00 29.03  ? 329  SER A C   1 
ATOM   2549  O  O   . SER A 1 329 ? 100.240 47.332 29.335  1.00 26.83  ? 329  SER A O   1 
ATOM   2550  C  CB  . SER A 1 329 ? 98.568  44.802 30.593  1.00 29.75  ? 329  SER A CB  1 
ATOM   2551  O  OG  . SER A 1 329 ? 97.552  44.297 29.750  1.00 31.03  ? 329  SER A OG  1 
ATOM   2552  N  N   . PHE A 1 330 ? 98.234  47.053 28.367  1.00 27.64  ? 330  PHE A N   1 
ATOM   2553  C  CA  . PHE A 1 330 ? 98.683  47.611 27.102  1.00 30.00  ? 330  PHE A CA  1 
ATOM   2554  C  C   . PHE A 1 330 ? 99.264  49.021 27.247  1.00 29.94  ? 330  PHE A C   1 
ATOM   2555  O  O   . PHE A 1 330 ? 100.292 49.339 26.644  1.00 29.15  ? 330  PHE A O   1 
ATOM   2556  C  CB  . PHE A 1 330 ? 97.527  47.612 26.098  1.00 35.86  ? 330  PHE A CB  1 
ATOM   2557  C  CG  . PHE A 1 330 ? 97.953  47.865 24.680  1.00 39.89  ? 330  PHE A CG  1 
ATOM   2558  C  CD1 . PHE A 1 330 ? 98.191  49.164 24.227  1.00 41.52  ? 330  PHE A CD1 1 
ATOM   2559  C  CD2 . PHE A 1 330 ? 98.133  46.801 23.799  1.00 40.97  ? 330  PHE A CD2 1 
ATOM   2560  C  CE1 . PHE A 1 330 ? 98.600  49.399 22.912  1.00 43.29  ? 330  PHE A CE1 1 
ATOM   2561  C  CE2 . PHE A 1 330 ? 98.541  47.021 22.485  1.00 42.60  ? 330  PHE A CE2 1 
ATOM   2562  C  CZ  . PHE A 1 330 ? 98.776  48.323 22.039  1.00 43.43  ? 330  PHE A CZ  1 
ATOM   2563  N  N   . PHE A 1 331 ? 98.624  49.863 28.054  1.00 28.07  ? 331  PHE A N   1 
ATOM   2564  C  CA  . PHE A 1 331 ? 99.113  51.222 28.235  1.00 29.73  ? 331  PHE A CA  1 
ATOM   2565  C  C   . PHE A 1 331 ? 100.311 51.336 29.174  1.00 30.28  ? 331  PHE A C   1 
ATOM   2566  O  O   . PHE A 1 331 ? 101.070 52.305 29.101  1.00 28.83  ? 331  PHE A O   1 
ATOM   2567  C  CB  . PHE A 1 331 ? 97.976  52.134 28.691  1.00 32.36  ? 331  PHE A CB  1 
ATOM   2568  C  CG  . PHE A 1 331 ? 96.859  52.235 27.690  1.00 35.38  ? 331  PHE A CG  1 
ATOM   2569  C  CD1 . PHE A 1 331 ? 95.767  51.378 27.756  1.00 36.16  ? 331  PHE A CD1 1 
ATOM   2570  C  CD2 . PHE A 1 331 ? 96.928  53.153 26.645  1.00 34.99  ? 331  PHE A CD2 1 
ATOM   2571  C  CE1 . PHE A 1 331 ? 94.754  51.432 26.790  1.00 38.67  ? 331  PHE A CE1 1 
ATOM   2572  C  CE2 . PHE A 1 331 ? 95.923  53.217 25.673  1.00 37.81  ? 331  PHE A CE2 1 
ATOM   2573  C  CZ  . PHE A 1 331 ? 94.834  52.355 25.746  1.00 37.61  ? 331  PHE A CZ  1 
ATOM   2574  N  N   . LEU A 1 332 ? 100.492 50.356 30.053  1.00 29.55  ? 332  LEU A N   1 
ATOM   2575  C  CA  . LEU A 1 332 ? 101.645 50.383 30.944  1.00 30.28  ? 332  LEU A CA  1 
ATOM   2576  C  C   . LEU A 1 332 ? 102.869 50.036 30.109  1.00 31.00  ? 332  LEU A C   1 
ATOM   2577  O  O   . LEU A 1 332 ? 103.938 50.634 30.262  1.00 33.44  ? 332  LEU A O   1 
ATOM   2578  C  CB  . LEU A 1 332 ? 101.487 49.366 32.076  1.00 29.56  ? 332  LEU A CB  1 
ATOM   2579  C  CG  . LEU A 1 332 ? 100.558 49.776 33.221  1.00 28.39  ? 332  LEU A CG  1 
ATOM   2580  C  CD1 . LEU A 1 332 ? 100.191 48.562 34.060  1.00 27.46  ? 332  LEU A CD1 1 
ATOM   2581  C  CD2 . LEU A 1 332 ? 101.241 50.837 34.062  1.00 25.70  ? 332  LEU A CD2 1 
ATOM   2582  N  N   . LEU A 1 333 ? 102.700 49.076 29.209  1.00 30.92  ? 333  LEU A N   1 
ATOM   2583  C  CA  . LEU A 1 333 ? 103.786 48.642 28.350  1.00 32.03  ? 333  LEU A CA  1 
ATOM   2584  C  C   . LEU A 1 333 ? 104.360 49.758 27.485  1.00 33.14  ? 333  LEU A C   1 
ATOM   2585  O  O   . LEU A 1 333 ? 105.571 49.814 27.272  1.00 33.76  ? 333  LEU A O   1 
ATOM   2586  C  CB  . LEU A 1 333 ? 103.325 47.499 27.449  1.00 30.24  ? 333  LEU A CB  1 
ATOM   2587  C  CG  . LEU A 1 333 ? 104.365 47.087 26.407  1.00 30.69  ? 333  LEU A CG  1 
ATOM   2588  C  CD1 . LEU A 1 333 ? 105.683 46.728 27.100  1.00 27.36  ? 333  LEU A CD1 1 
ATOM   2589  C  CD2 . LEU A 1 333 ? 103.830 45.917 25.598  1.00 30.77  ? 333  LEU A CD2 1 
ATOM   2590  N  N   . TYR A 1 334 ? 103.497 50.641 26.989  1.00 33.99  ? 334  TYR A N   1 
ATOM   2591  C  CA  . TYR A 1 334 ? 103.947 51.738 26.134  1.00 34.23  ? 334  TYR A CA  1 
ATOM   2592  C  C   . TYR A 1 334 ? 104.466 52.969 26.868  1.00 35.08  ? 334  TYR A C   1 
ATOM   2593  O  O   . TYR A 1 334 ? 105.345 53.659 26.364  1.00 36.87  ? 334  TYR A O   1 
ATOM   2594  C  CB  . TYR A 1 334 ? 102.827 52.177 25.180  1.00 33.67  ? 334  TYR A CB  1 
ATOM   2595  C  CG  . TYR A 1 334 ? 102.657 51.294 23.962  1.00 33.22  ? 334  TYR A CG  1 
ATOM   2596  C  CD1 . TYR A 1 334 ? 102.142 50.001 24.074  1.00 33.79  ? 334  TYR A CD1 1 
ATOM   2597  C  CD2 . TYR A 1 334 ? 103.037 51.741 22.698  1.00 31.60  ? 334  TYR A CD2 1 
ATOM   2598  C  CE1 . TYR A 1 334 ? 102.012 49.177 22.957  1.00 31.29  ? 334  TYR A CE1 1 
ATOM   2599  C  CE2 . TYR A 1 334 ? 102.913 50.927 21.581  1.00 30.12  ? 334  TYR A CE2 1 
ATOM   2600  C  CZ  . TYR A 1 334 ? 102.402 49.650 21.718  1.00 30.50  ? 334  TYR A CZ  1 
ATOM   2601  O  OH  . TYR A 1 334 ? 102.284 48.845 20.615  1.00 31.03  ? 334  TYR A OH  1 
ATOM   2602  N  N   . GLY A 1 335 ? 103.946 53.256 28.055  1.00 34.51  ? 335  GLY A N   1 
ATOM   2603  C  CA  . GLY A 1 335 ? 104.412 54.452 28.730  1.00 34.23  ? 335  GLY A CA  1 
ATOM   2604  C  C   . GLY A 1 335 ? 104.827 54.436 30.187  1.00 33.86  ? 335  GLY A C   1 
ATOM   2605  O  O   . GLY A 1 335 ? 105.001 55.511 30.761  1.00 35.26  ? 335  GLY A O   1 
ATOM   2606  N  N   . ALA A 1 336 ? 104.999 53.263 30.791  1.00 32.17  ? 336  ALA A N   1 
ATOM   2607  C  CA  . ALA A 1 336 ? 105.397 53.206 32.198  1.00 32.43  ? 336  ALA A CA  1 
ATOM   2608  C  C   . ALA A 1 336 ? 106.736 52.497 32.408  1.00 32.52  ? 336  ALA A C   1 
ATOM   2609  O  O   . ALA A 1 336 ? 106.975 51.423 31.866  1.00 34.47  ? 336  ALA A O   1 
ATOM   2610  C  CB  . ALA A 1 336 ? 104.312 52.518 33.021  1.00 32.13  ? 336  ALA A CB  1 
ATOM   2611  N  N   . PRO A 1 337 ? 107.623 53.088 33.216  1.00 32.33  ? 337  PRO A N   1 
ATOM   2612  C  CA  . PRO A 1 337 ? 108.933 52.480 33.474  1.00 31.78  ? 337  PRO A CA  1 
ATOM   2613  C  C   . PRO A 1 337 ? 108.886 51.090 34.104  1.00 31.80  ? 337  PRO A C   1 
ATOM   2614  O  O   . PRO A 1 337 ? 108.061 50.817 34.974  1.00 32.14  ? 337  PRO A O   1 
ATOM   2615  C  CB  . PRO A 1 337 ? 109.622 53.508 34.374  1.00 32.18  ? 337  PRO A CB  1 
ATOM   2616  C  CG  . PRO A 1 337 ? 108.465 54.188 35.075  1.00 33.06  ? 337  PRO A CG  1 
ATOM   2617  C  CD  . PRO A 1 337 ? 107.452 54.341 33.975  1.00 31.68  ? 337  PRO A CD  1 
ATOM   2618  N  N   . GLY A 1 338 ? 109.779 50.214 33.649  1.00 31.26  ? 338  GLY A N   1 
ATOM   2619  C  CA  . GLY A 1 338 ? 109.851 48.868 34.179  1.00 30.23  ? 338  GLY A CA  1 
ATOM   2620  C  C   . GLY A 1 338 ? 109.179 47.807 33.333  1.00 32.39  ? 338  GLY A C   1 
ATOM   2621  O  O   . GLY A 1 338 ? 109.465 46.616 33.482  1.00 32.87  ? 338  GLY A O   1 
ATOM   2622  N  N   . PHE A 1 339 ? 108.287 48.224 32.440  1.00 32.66  ? 339  PHE A N   1 
ATOM   2623  C  CA  . PHE A 1 339 ? 107.572 47.279 31.586  1.00 32.12  ? 339  PHE A CA  1 
ATOM   2624  C  C   . PHE A 1 339 ? 108.256 46.974 30.250  1.00 32.89  ? 339  PHE A C   1 
ATOM   2625  O  O   . PHE A 1 339 ? 108.862 47.845 29.625  1.00 31.33  ? 339  PHE A O   1 
ATOM   2626  C  CB  . PHE A 1 339 ? 106.152 47.786 31.348  1.00 28.62  ? 339  PHE A CB  1 
ATOM   2627  C  CG  . PHE A 1 339 ? 105.312 47.829 32.596  1.00 27.48  ? 339  PHE A CG  1 
ATOM   2628  C  CD1 . PHE A 1 339 ? 104.598 46.713 33.006  1.00 24.69  ? 339  PHE A CD1 1 
ATOM   2629  C  CD2 . PHE A 1 339 ? 105.257 48.983 33.374  1.00 26.24  ? 339  PHE A CD2 1 
ATOM   2630  C  CE1 . PHE A 1 339 ? 103.838 46.740 34.171  1.00 26.53  ? 339  PHE A CE1 1 
ATOM   2631  C  CE2 . PHE A 1 339 ? 104.501 49.022 34.543  1.00 26.11  ? 339  PHE A CE2 1 
ATOM   2632  C  CZ  . PHE A 1 339 ? 103.790 47.899 34.943  1.00 25.56  ? 339  PHE A CZ  1 
ATOM   2633  N  N   . SER A 1 340 ? 108.154 45.718 29.831  1.00 32.80  ? 340  SER A N   1 
ATOM   2634  C  CA  . SER A 1 340 ? 108.744 45.263 28.584  1.00 34.69  ? 340  SER A CA  1 
ATOM   2635  C  C   . SER A 1 340 ? 107.920 44.132 27.987  1.00 36.22  ? 340  SER A C   1 
ATOM   2636  O  O   . SER A 1 340 ? 107.269 43.371 28.706  1.00 36.27  ? 340  SER A O   1 
ATOM   2637  C  CB  . SER A 1 340 ? 110.175 44.773 28.812  1.00 36.37  ? 340  SER A CB  1 
ATOM   2638  O  OG  . SER A 1 340 ? 110.648 44.058 27.680  1.00 37.10  ? 340  SER A OG  1 
ATOM   2639  N  N   . LYS A 1 341 ? 107.964 44.025 26.664  1.00 38.27  ? 341  LYS A N   1 
ATOM   2640  C  CA  . LYS A 1 341 ? 107.229 43.002 25.939  1.00 39.66  ? 341  LYS A CA  1 
ATOM   2641  C  C   . LYS A 1 341 ? 107.954 41.673 26.037  1.00 41.70  ? 341  LYS A C   1 
ATOM   2642  O  O   . LYS A 1 341 ? 107.344 40.611 25.918  1.00 42.00  ? 341  LYS A O   1 
ATOM   2643  C  CB  . LYS A 1 341 ? 107.103 43.394 24.467  1.00 38.71  ? 341  LYS A CB  1 
ATOM   2644  C  CG  . LYS A 1 341 ? 106.190 42.490 23.665  1.00 41.55  ? 341  LYS A CG  1 
ATOM   2645  C  CD  . LYS A 1 341 ? 106.092 42.931 22.208  1.00 42.61  ? 341  LYS A CD  1 
ATOM   2646  C  CE  . LYS A 1 341 ? 107.399 42.709 21.462  1.00 42.55  ? 341  LYS A CE  1 
ATOM   2647  N  NZ  . LYS A 1 341 ? 107.767 41.265 21.434  1.00 43.34  ? 341  LYS A NZ  1 
ATOM   2648  N  N   . ASP A 1 342 ? 109.258 41.741 26.275  1.00 44.18  ? 342  ASP A N   1 
ATOM   2649  C  CA  . ASP A 1 342 ? 110.076 40.541 26.340  1.00 47.83  ? 342  ASP A CA  1 
ATOM   2650  C  C   . ASP A 1 342 ? 110.537 40.120 27.741  1.00 48.50  ? 342  ASP A C   1 
ATOM   2651  O  O   . ASP A 1 342 ? 111.673 39.678 27.912  1.00 48.02  ? 342  ASP A O   1 
ATOM   2652  C  CB  . ASP A 1 342 ? 111.289 40.724 25.417  1.00 48.87  ? 342  ASP A CB  1 
ATOM   2653  C  CG  . ASP A 1 342 ? 110.900 41.257 24.033  1.00 51.25  ? 342  ASP A CG  1 
ATOM   2654  O  OD1 . ASP A 1 342 ? 110.091 40.607 23.331  1.00 50.25  ? 342  ASP A OD1 1 
ATOM   2655  O  OD2 . ASP A 1 342 ? 111.405 42.335 23.645  1.00 52.19  ? 342  ASP A OD2 1 
ATOM   2656  N  N   . SER A 1 343 ? 109.658 40.243 28.734  1.00 50.06  ? 343  SER A N   1 
ATOM   2657  C  CA  . SER A 1 343 ? 109.991 39.853 30.109  1.00 50.53  ? 343  SER A CA  1 
ATOM   2658  C  C   . SER A 1 343 ? 108.776 39.876 31.035  1.00 50.27  ? 343  SER A C   1 
ATOM   2659  O  O   . SER A 1 343 ? 107.740 40.453 30.700  1.00 50.90  ? 343  SER A O   1 
ATOM   2660  C  CB  . SER A 1 343 ? 111.074 40.773 30.683  1.00 51.34  ? 343  SER A CB  1 
ATOM   2661  O  OG  . SER A 1 343 ? 110.580 42.087 30.895  1.00 53.32  ? 343  SER A OG  1 
ATOM   2662  N  N   . GLU A 1 344 ? 108.915 39.247 32.201  1.00 49.90  ? 344  GLU A N   1 
ATOM   2663  C  CA  . GLU A 1 344 ? 107.839 39.187 33.190  1.00 48.63  ? 344  GLU A CA  1 
ATOM   2664  C  C   . GLU A 1 344 ? 107.448 40.582 33.645  1.00 45.97  ? 344  GLU A C   1 
ATOM   2665  O  O   . GLU A 1 344 ? 106.326 40.803 34.095  1.00 47.76  ? 344  GLU A O   1 
ATOM   2666  C  CB  . GLU A 1 344 ? 108.275 38.401 34.425  1.00 51.47  ? 344  GLU A CB  1 
ATOM   2667  C  CG  . GLU A 1 344 ? 108.691 36.969 34.186  1.00 55.05  ? 344  GLU A CG  1 
ATOM   2668  C  CD  . GLU A 1 344 ? 108.978 36.254 35.493  1.00 58.84  ? 344  GLU A CD  1 
ATOM   2669  O  OE1 . GLU A 1 344 ? 108.013 35.952 36.231  1.00 59.87  ? 344  GLU A OE1 1 
ATOM   2670  O  OE2 . GLU A 1 344 ? 110.169 36.008 35.794  1.00 61.37  ? 344  GLU A OE2 1 
ATOM   2671  N  N   . SER A 1 345 ? 108.393 41.509 33.557  1.00 41.88  ? 345  SER A N   1 
ATOM   2672  C  CA  . SER A 1 345 ? 108.165 42.890 33.953  1.00 39.52  ? 345  SER A CA  1 
ATOM   2673  C  C   . SER A 1 345 ? 107.868 43.069 35.443  1.00 39.10  ? 345  SER A C   1 
ATOM   2674  O  O   . SER A 1 345 ? 106.829 43.618 35.813  1.00 37.92  ? 345  SER A O   1 
ATOM   2675  C  CB  . SER A 1 345 ? 107.026 43.499 33.121  1.00 38.59  ? 345  SER A CB  1 
ATOM   2676  O  OG  . SER A 1 345 ? 107.338 43.485 31.736  1.00 35.81  ? 345  SER A OG  1 
ATOM   2677  N  N   . LYS A 1 346 ? 108.781 42.603 36.293  1.00 38.43  ? 346  LYS A N   1 
ATOM   2678  C  CA  . LYS A 1 346 ? 108.632 42.755 37.735  1.00 36.86  ? 346  LYS A CA  1 
ATOM   2679  C  C   . LYS A 1 346 ? 108.908 44.224 37.996  1.00 37.19  ? 346  LYS A C   1 
ATOM   2680  O  O   . LYS A 1 346 ? 109.959 44.745 37.609  1.00 37.19  ? 346  LYS A O   1 
ATOM   2681  C  CB  . LYS A 1 346 ? 109.649 41.893 38.476  1.00 37.61  ? 346  LYS A CB  1 
ATOM   2682  C  CG  . LYS A 1 346 ? 109.453 40.397 38.281  1.00 40.36  ? 346  LYS A CG  1 
ATOM   2683  C  CD  . LYS A 1 346 ? 110.672 39.627 38.758  1.00 42.88  ? 346  LYS A CD  1 
ATOM   2684  C  CE  . LYS A 1 346 ? 110.500 38.127 38.583  1.00 45.67  ? 346  LYS A CE  1 
ATOM   2685  N  NZ  . LYS A 1 346 ? 109.408 37.590 39.438  1.00 46.73  ? 346  LYS A NZ  1 
ATOM   2686  N  N   . ILE A 1 347 ? 107.961 44.892 38.644  1.00 36.09  ? 347  ILE A N   1 
ATOM   2687  C  CA  . ILE A 1 347 ? 108.078 46.316 38.921  1.00 36.06  ? 347  ILE A CA  1 
ATOM   2688  C  C   . ILE A 1 347 ? 108.680 46.638 40.283  1.00 36.71  ? 347  ILE A C   1 
ATOM   2689  O  O   . ILE A 1 347 ? 108.150 46.239 41.322  1.00 38.44  ? 347  ILE A O   1 
ATOM   2690  C  CB  . ILE A 1 347 ? 106.693 46.983 38.795  1.00 36.97  ? 347  ILE A CB  1 
ATOM   2691  C  CG1 . ILE A 1 347 ? 106.110 46.666 37.416  1.00 38.95  ? 347  ILE A CG1 1 
ATOM   2692  C  CG2 . ILE A 1 347 ? 106.797 48.490 38.991  1.00 36.96  ? 347  ILE A CG2 1 
ATOM   2693  C  CD1 . ILE A 1 347 ? 107.020 47.048 36.254  1.00 38.11  ? 347  ILE A CD1 1 
ATOM   2694  N  N   . SER A 1 348 ? 109.792 47.363 40.277  1.00 36.00  ? 348  SER A N   1 
ATOM   2695  C  CA  . SER A 1 348 ? 110.442 47.739 41.523  1.00 36.97  ? 348  SER A CA  1 
ATOM   2696  C  C   . SER A 1 348 ? 109.483 48.666 42.247  1.00 38.87  ? 348  SER A C   1 
ATOM   2697  O  O   . SER A 1 348 ? 108.445 49.046 41.702  1.00 39.58  ? 348  SER A O   1 
ATOM   2698  C  CB  . SER A 1 348 ? 111.741 48.491 41.255  1.00 36.56  ? 348  SER A CB  1 
ATOM   2699  O  OG  . SER A 1 348 ? 111.467 49.834 40.889  1.00 37.89  ? 348  SER A OG  1 
ATOM   2700  N  N   . ARG A 1 349 ? 109.840 49.037 43.471  1.00 39.63  ? 349  ARG A N   1 
ATOM   2701  C  CA  . ARG A 1 349 ? 109.014 49.924 44.271  1.00 38.82  ? 349  ARG A CA  1 
ATOM   2702  C  C   . ARG A 1 349 ? 109.080 51.339 43.705  1.00 38.57  ? 349  ARG A C   1 
ATOM   2703  O  O   . ARG A 1 349 ? 108.065 52.038 43.653  1.00 38.05  ? 349  ARG A O   1 
ATOM   2704  C  CB  . ARG A 1 349 ? 109.493 49.917 45.729  1.00 40.87  ? 349  ARG A CB  1 
ATOM   2705  C  CG  . ARG A 1 349 ? 108.516 50.549 46.706  1.00 42.99  ? 349  ARG A CG  1 
ATOM   2706  C  CD  . ARG A 1 349 ? 107.236 49.730 46.806  1.00 43.97  ? 349  ARG A CD  1 
ATOM   2707  N  NE  . ARG A 1 349 ? 106.116 50.543 47.268  1.00 45.27  ? 349  ARG A NE  1 
ATOM   2708  C  CZ  . ARG A 1 349 ? 104.839 50.216 47.089  1.00 45.39  ? 349  ARG A CZ  1 
ATOM   2709  N  NH1 . ARG A 1 349 ? 104.526 49.091 46.463  1.00 44.88  ? 349  ARG A NH1 1 
ATOM   2710  N  NH2 . ARG A 1 349 ? 103.876 51.023 47.514  1.00 44.61  ? 349  ARG A NH2 1 
ATOM   2711  N  N   . GLU A 1 350 ? 110.269 51.765 43.280  1.00 38.25  ? 350  GLU A N   1 
ATOM   2712  C  CA  . GLU A 1 350 ? 110.412 53.105 42.720  1.00 38.41  ? 350  GLU A CA  1 
ATOM   2713  C  C   . GLU A 1 350 ? 109.579 53.249 41.447  1.00 35.89  ? 350  GLU A C   1 
ATOM   2714  O  O   . GLU A 1 350 ? 108.913 54.263 41.252  1.00 32.82  ? 350  GLU A O   1 
ATOM   2715  C  CB  . GLU A 1 350 ? 111.877 53.436 42.414  1.00 40.89  ? 350  GLU A CB  1 
ATOM   2716  C  CG  . GLU A 1 350 ? 112.028 54.742 41.618  1.00 47.38  ? 350  GLU A CG  1 
ATOM   2717  C  CD  . GLU A 1 350 ? 113.470 55.216 41.473  1.00 52.04  ? 350  GLU A CD  1 
ATOM   2718  O  OE1 . GLU A 1 350 ? 114.034 55.739 42.462  1.00 53.77  ? 350  GLU A OE1 1 
ATOM   2719  O  OE2 . GLU A 1 350 ? 114.042 55.065 40.368  1.00 53.49  ? 350  GLU A OE2 1 
ATOM   2720  N  N   . ASP A 1 351 ? 109.613 52.233 40.588  1.00 34.69  ? 351  ASP A N   1 
ATOM   2721  C  CA  . ASP A 1 351 ? 108.841 52.271 39.348  1.00 34.87  ? 351  ASP A CA  1 
ATOM   2722  C  C   . ASP A 1 351 ? 107.338 52.263 39.626  1.00 34.53  ? 351  ASP A C   1 
ATOM   2723  O  O   . ASP A 1 351 ? 106.561 52.860 38.879  1.00 31.87  ? 351  ASP A O   1 
ATOM   2724  C  CB  . ASP A 1 351 ? 109.216 51.096 38.436  1.00 33.07  ? 351  ASP A CB  1 
ATOM   2725  C  CG  . ASP A 1 351 ? 110.541 51.317 37.724  1.00 34.73  ? 351  ASP A CG  1 
ATOM   2726  O  OD1 . ASP A 1 351 ? 111.051 52.459 37.784  1.00 32.38  ? 351  ASP A OD1 1 
ATOM   2727  O  OD2 . ASP A 1 351 ? 111.067 50.362 37.096  1.00 32.42  ? 351  ASP A OD2 1 
ATOM   2728  N  N   . PHE A 1 352 ? 106.934 51.589 40.700  1.00 34.79  ? 352  PHE A N   1 
ATOM   2729  C  CA  . PHE A 1 352 ? 105.523 51.535 41.070  1.00 33.15  ? 352  PHE A CA  1 
ATOM   2730  C  C   . PHE A 1 352 ? 105.071 52.960 41.333  1.00 32.80  ? 352  PHE A C   1 
ATOM   2731  O  O   . PHE A 1 352 ? 104.063 53.415 40.794  1.00 32.72  ? 352  PHE A O   1 
ATOM   2732  C  CB  . PHE A 1 352 ? 105.321 50.705 42.339  1.00 30.88  ? 352  PHE A CB  1 
ATOM   2733  C  CG  . PHE A 1 352 ? 103.894 50.635 42.793  1.00 27.10  ? 352  PHE A CG  1 
ATOM   2734  C  CD1 . PHE A 1 352 ? 103.005 49.737 42.207  1.00 28.22  ? 352  PHE A CD1 1 
ATOM   2735  C  CD2 . PHE A 1 352 ? 103.426 51.488 43.776  1.00 25.86  ? 352  PHE A CD2 1 
ATOM   2736  C  CE1 . PHE A 1 352 ? 101.666 49.693 42.598  1.00 25.46  ? 352  PHE A CE1 1 
ATOM   2737  C  CE2 . PHE A 1 352 ? 102.089 51.455 44.175  1.00 26.62  ? 352  PHE A CE2 1 
ATOM   2738  C  CZ  . PHE A 1 352 ? 101.209 50.552 43.581  1.00 26.26  ? 352  PHE A CZ  1 
ATOM   2739  N  N   . MET A 1 353 ? 105.828 53.660 42.169  1.00 34.23  ? 353  MET A N   1 
ATOM   2740  C  CA  . MET A 1 353 ? 105.518 55.045 42.506  1.00 36.58  ? 353  MET A CA  1 
ATOM   2741  C  C   . MET A 1 353 ? 105.451 55.890 41.235  1.00 35.47  ? 353  MET A C   1 
ATOM   2742  O  O   . MET A 1 353 ? 104.529 56.683 41.058  1.00 36.53  ? 353  MET A O   1 
ATOM   2743  C  CB  . MET A 1 353 ? 106.577 55.603 43.460  1.00 40.67  ? 353  MET A CB  1 
ATOM   2744  C  CG  . MET A 1 353 ? 106.015 56.137 44.775  1.00 49.72  ? 353  MET A CG  1 
ATOM   2745  S  SD  . MET A 1 353 ? 105.113 54.889 45.746  1.00 56.12  ? 353  MET A SD  1 
ATOM   2746  C  CE  . MET A 1 353 ? 103.459 55.153 45.139  1.00 53.85  ? 353  MET A CE  1 
ATOM   2747  N  N   . SER A 1 354 ? 106.428 55.721 40.349  1.00 35.09  ? 354  SER A N   1 
ATOM   2748  C  CA  . SER A 1 354 ? 106.438 56.461 39.091  1.00 34.92  ? 354  SER A CA  1 
ATOM   2749  C  C   . SER A 1 354 ? 105.166 56.150 38.308  1.00 33.77  ? 354  SER A C   1 
ATOM   2750  O  O   . SER A 1 354 ? 104.543 57.039 37.733  1.00 34.81  ? 354  SER A O   1 
ATOM   2751  C  CB  . SER A 1 354 ? 107.652 56.071 38.247  1.00 33.67  ? 354  SER A CB  1 
ATOM   2752  O  OG  . SER A 1 354 ? 108.850 56.556 38.826  1.00 39.07  ? 354  SER A OG  1 
ATOM   2753  N  N   . GLY A 1 355 ? 104.787 54.876 38.299  1.00 32.32  ? 355  GLY A N   1 
ATOM   2754  C  CA  . GLY A 1 355 ? 103.602 54.453 37.581  1.00 30.78  ? 355  GLY A CA  1 
ATOM   2755  C  C   . GLY A 1 355 ? 102.289 55.087 38.006  1.00 29.88  ? 355  GLY A C   1 
ATOM   2756  O  O   . GLY A 1 355 ? 101.542 55.565 37.158  1.00 28.40  ? 355  GLY A O   1 
ATOM   2757  N  N   . VAL A 1 356 ? 102.000 55.099 39.304  1.00 30.20  ? 356  VAL A N   1 
ATOM   2758  C  CA  . VAL A 1 356 ? 100.741 55.663 39.778  1.00 31.61  ? 356  VAL A CA  1 
ATOM   2759  C  C   . VAL A 1 356 ? 100.643 57.142 39.435  1.00 31.04  ? 356  VAL A C   1 
ATOM   2760  O  O   . VAL A 1 356 ? 99.579  57.626 39.053  1.00 30.09  ? 356  VAL A O   1 
ATOM   2761  C  CB  . VAL A 1 356 ? 100.545 55.473 41.320  1.00 31.57  ? 356  VAL A CB  1 
ATOM   2762  C  CG1 . VAL A 1 356 ? 101.029 54.097 41.742  1.00 30.58  ? 356  VAL A CG1 1 
ATOM   2763  C  CG2 . VAL A 1 356 ? 101.254 56.557 42.087  1.00 32.07  ? 356  VAL A CG2 1 
ATOM   2764  N  N   . LYS A 1 357 ? 101.755 57.857 39.569  1.00 32.21  ? 357  LYS A N   1 
ATOM   2765  C  CA  . LYS A 1 357 ? 101.776 59.281 39.255  1.00 34.07  ? 357  LYS A CA  1 
ATOM   2766  C  C   . LYS A 1 357 ? 101.364 59.433 37.792  1.00 34.89  ? 357  LYS A C   1 
ATOM   2767  O  O   . LYS A 1 357 ? 100.546 60.280 37.440  1.00 36.68  ? 357  LYS A O   1 
ATOM   2768  C  CB  . LYS A 1 357 ? 103.180 59.836 39.476  1.00 35.40  ? 357  LYS A CB  1 
ATOM   2769  C  CG  . LYS A 1 357 ? 103.378 61.252 38.990  1.00 38.35  ? 357  LYS A CG  1 
ATOM   2770  C  CD  . LYS A 1 357 ? 102.536 62.233 39.771  1.00 40.36  ? 357  LYS A CD  1 
ATOM   2771  C  CE  . LYS A 1 357 ? 102.984 63.665 39.522  1.00 38.57  ? 357  LYS A CE  1 
ATOM   2772  N  NZ  . LYS A 1 357 ? 102.181 64.610 40.342  1.00 42.71  ? 357  LYS A NZ  1 
ATOM   2773  N  N   . LEU A 1 358 ? 101.930 58.582 36.948  1.00 34.37  ? 358  LEU A N   1 
ATOM   2774  C  CA  . LEU A 1 358 ? 101.628 58.581 35.523  1.00 34.36  ? 358  LEU A CA  1 
ATOM   2775  C  C   . LEU A 1 358 ? 100.155 58.230 35.264  1.00 34.13  ? 358  LEU A C   1 
ATOM   2776  O  O   . LEU A 1 358 ? 99.544  58.750 34.331  1.00 32.35  ? 358  LEU A O   1 
ATOM   2777  C  CB  . LEU A 1 358 ? 102.531 57.559 34.816  1.00 34.14  ? 358  LEU A CB  1 
ATOM   2778  C  CG  . LEU A 1 358 ? 103.723 58.004 33.954  1.00 34.56  ? 358  LEU A CG  1 
ATOM   2779  C  CD1 . LEU A 1 358 ? 104.314 59.321 34.433  1.00 33.87  ? 358  LEU A CD1 1 
ATOM   2780  C  CD2 . LEU A 1 358 ? 104.758 56.905 33.983  1.00 31.50  ? 358  LEU A CD2 1 
ATOM   2781  N  N   . SER A 1 359 ? 99.599  57.352 36.102  1.00 32.87  ? 359  SER A N   1 
ATOM   2782  C  CA  . SER A 1 359 ? 98.219  56.887 35.963  1.00 31.80  ? 359  SER A CA  1 
ATOM   2783  C  C   . SER A 1 359 ? 97.151  57.862 36.425  1.00 32.40  ? 359  SER A C   1 
ATOM   2784  O  O   . SER A 1 359 ? 96.025  57.830 35.934  1.00 34.15  ? 359  SER A O   1 
ATOM   2785  C  CB  . SER A 1 359 ? 98.034  55.566 36.717  1.00 29.24  ? 359  SER A CB  1 
ATOM   2786  O  OG  . SER A 1 359 ? 98.976  54.601 36.288  1.00 26.29  ? 359  SER A OG  1 
ATOM   2787  N  N   . VAL A 1 360 ? 97.496  58.719 37.374  1.00 31.60  ? 360  VAL A N   1 
ATOM   2788  C  CA  . VAL A 1 360 ? 96.544  59.688 37.900  1.00 33.32  ? 360  VAL A CA  1 
ATOM   2789  C  C   . VAL A 1 360 ? 97.228  61.054 37.936  1.00 34.55  ? 360  VAL A C   1 
ATOM   2790  O  O   . VAL A 1 360 ? 97.414  61.644 39.000  1.00 32.59  ? 360  VAL A O   1 
ATOM   2791  C  CB  . VAL A 1 360 ? 96.101  59.287 39.334  1.00 34.83  ? 360  VAL A CB  1 
ATOM   2792  C  CG1 . VAL A 1 360 ? 94.925  60.140 39.781  1.00 35.03  ? 360  VAL A CG1 1 
ATOM   2793  C  CG2 . VAL A 1 360 ? 95.742  57.798 39.372  1.00 32.73  ? 360  VAL A CG2 1 
ATOM   2794  N  N   . PRO A 1 361 ? 97.581  61.583 36.754  1.00 35.70  ? 361  PRO A N   1 
ATOM   2795  C  CA  . PRO A 1 361 ? 98.257  62.874 36.565  1.00 37.42  ? 361  PRO A CA  1 
ATOM   2796  C  C   . PRO A 1 361 ? 97.620  64.065 37.265  1.00 40.57  ? 361  PRO A C   1 
ATOM   2797  O  O   . PRO A 1 361 ? 98.306  65.008 37.654  1.00 40.67  ? 361  PRO A O   1 
ATOM   2798  C  CB  . PRO A 1 361 ? 98.255  63.039 35.051  1.00 36.93  ? 361  PRO A CB  1 
ATOM   2799  C  CG  . PRO A 1 361 ? 96.963  62.372 34.658  1.00 36.45  ? 361  PRO A CG  1 
ATOM   2800  C  CD  . PRO A 1 361 ? 97.025  61.101 35.475  1.00 35.09  ? 361  PRO A CD  1 
ATOM   2801  N  N   . HIS A 1 362 ? 96.306  64.015 37.430  1.00 43.80  ? 362  HIS A N   1 
ATOM   2802  C  CA  . HIS A 1 362 ? 95.571  65.104 38.056  1.00 47.19  ? 362  HIS A CA  1 
ATOM   2803  C  C   . HIS A 1 362 ? 95.543  65.096 39.587  1.00 48.08  ? 362  HIS A C   1 
ATOM   2804  O  O   . HIS A 1 362 ? 95.228  66.113 40.208  1.00 49.80  ? 362  HIS A O   1 
ATOM   2805  C  CB  . HIS A 1 362 ? 94.134  65.104 37.522  1.00 51.19  ? 362  HIS A CB  1 
ATOM   2806  C  CG  . HIS A 1 362 ? 93.458  63.767 37.606  1.00 54.17  ? 362  HIS A CG  1 
ATOM   2807  N  ND1 . HIS A 1 362 ? 93.892  62.667 36.897  1.00 54.21  ? 362  HIS A ND1 1 
ATOM   2808  C  CD2 . HIS A 1 362 ? 92.380  63.355 38.318  1.00 54.88  ? 362  HIS A CD2 1 
ATOM   2809  C  CE1 . HIS A 1 362 ? 93.111  61.635 37.166  1.00 55.05  ? 362  HIS A CE1 1 
ATOM   2810  N  NE2 . HIS A 1 362 ? 92.186  62.026 38.026  1.00 56.30  ? 362  HIS A NE2 1 
ATOM   2811  N  N   . ALA A 1 363 ? 95.868  63.961 40.198  1.00 47.76  ? 363  ALA A N   1 
ATOM   2812  C  CA  . ALA A 1 363 ? 95.835  63.856 41.655  1.00 46.79  ? 363  ALA A CA  1 
ATOM   2813  C  C   . ALA A 1 363 ? 97.015  64.518 42.332  1.00 45.93  ? 363  ALA A C   1 
ATOM   2814  O  O   . ALA A 1 363 ? 98.105  64.579 41.770  1.00 45.74  ? 363  ALA A O   1 
ATOM   2815  C  CB  . ALA A 1 363 ? 95.766  62.387 42.073  1.00 46.37  ? 363  ALA A CB  1 
ATOM   2816  N  N   . ASN A 1 364 ? 96.788  65.018 43.544  1.00 45.79  ? 364  ASN A N   1 
ATOM   2817  C  CA  . ASN A 1 364 ? 97.846  65.648 44.324  1.00 44.94  ? 364  ASN A CA  1 
ATOM   2818  C  C   . ASN A 1 364 ? 98.587  64.548 45.072  1.00 43.65  ? 364  ASN A C   1 
ATOM   2819  O  O   . ASN A 1 364 ? 98.324  63.367 44.861  1.00 42.43  ? 364  ASN A O   1 
ATOM   2820  C  CB  . ASN A 1 364 ? 97.271  66.664 45.322  1.00 45.88  ? 364  ASN A CB  1 
ATOM   2821  C  CG  . ASN A 1 364 ? 96.079  66.123 46.098  1.00 47.09  ? 364  ASN A CG  1 
ATOM   2822  O  OD1 . ASN A 1 364 ? 96.054  64.958 46.497  1.00 46.28  ? 364  ASN A OD1 1 
ATOM   2823  N  ND2 . ASN A 1 364 ? 95.087  66.981 46.329  1.00 47.60  ? 364  ASN A ND2 1 
ATOM   2824  N  N   . ASP A 1 365 ? 99.509  64.936 45.945  1.00 44.31  ? 365  ASP A N   1 
ATOM   2825  C  CA  . ASP A 1 365 ? 100.293 63.972 46.712  1.00 44.62  ? 365  ASP A CA  1 
ATOM   2826  C  C   . ASP A 1 365 ? 99.433  63.101 47.627  1.00 42.08  ? 365  ASP A C   1 
ATOM   2827  O  O   . ASP A 1 365 ? 99.692  61.907 47.782  1.00 39.41  ? 365  ASP A O   1 
ATOM   2828  C  CB  . ASP A 1 365 ? 101.340 64.708 47.545  1.00 48.98  ? 365  ASP A CB  1 
ATOM   2829  C  CG  . ASP A 1 365 ? 102.259 65.560 46.696  1.00 55.27  ? 365  ASP A CG  1 
ATOM   2830  O  OD1 . ASP A 1 365 ? 103.022 64.987 45.881  1.00 56.47  ? 365  ASP A OD1 1 
ATOM   2831  O  OD2 . ASP A 1 365 ? 102.215 66.804 46.841  1.00 59.52  ? 365  ASP A OD2 1 
ATOM   2832  N  N   . LEU A 1 366 ? 98.416  63.704 48.234  1.00 39.21  ? 366  LEU A N   1 
ATOM   2833  C  CA  . LEU A 1 366 ? 97.533  62.971 49.127  1.00 38.78  ? 366  LEU A CA  1 
ATOM   2834  C  C   . LEU A 1 366 ? 96.733  61.954 48.318  1.00 37.75  ? 366  LEU A C   1 
ATOM   2835  O  O   . LEU A 1 366 ? 96.489  60.836 48.771  1.00 37.47  ? 366  LEU A O   1 
ATOM   2836  C  CB  . LEU A 1 366 ? 96.586  63.935 49.846  1.00 38.19  ? 366  LEU A CB  1 
ATOM   2837  C  CG  . LEU A 1 366 ? 95.701  63.309 50.925  1.00 39.34  ? 366  LEU A CG  1 
ATOM   2838  C  CD1 . LEU A 1 366 ? 96.576  62.749 52.035  1.00 39.06  ? 366  LEU A CD1 1 
ATOM   2839  C  CD2 . LEU A 1 366 ? 94.739  64.349 51.474  1.00 40.15  ? 366  LEU A CD2 1 
ATOM   2840  N  N   . GLY A 1 367 ? 96.332  62.351 47.116  1.00 36.44  ? 367  GLY A N   1 
ATOM   2841  C  CA  . GLY A 1 367 ? 95.579  61.455 46.261  1.00 36.22  ? 367  GLY A CA  1 
ATOM   2842  C  C   . GLY A 1 367 ? 96.434  60.280 45.814  1.00 36.28  ? 367  GLY A C   1 
ATOM   2843  O  O   . GLY A 1 367 ? 95.952  59.145 45.722  1.00 36.32  ? 367  GLY A O   1 
ATOM   2844  N  N   . LEU A 1 368 ? 97.706  60.548 45.532  1.00 33.48  ? 368  LEU A N   1 
ATOM   2845  C  CA  . LEU A 1 368 ? 98.617  59.492 45.111  1.00 33.84  ? 368  LEU A CA  1 
ATOM   2846  C  C   . LEU A 1 368 ? 98.835  58.509 46.252  1.00 32.32  ? 368  LEU A C   1 
ATOM   2847  O  O   . LEU A 1 368 ? 98.855  57.298 46.041  1.00 32.59  ? 368  LEU A O   1 
ATOM   2848  C  CB  . LEU A 1 368 ? 99.959  60.083 44.670  1.00 34.38  ? 368  LEU A CB  1 
ATOM   2849  C  CG  . LEU A 1 368 ? 99.909  61.003 43.448  1.00 36.33  ? 368  LEU A CG  1 
ATOM   2850  C  CD1 . LEU A 1 368 ? 101.303 61.540 43.160  1.00 37.26  ? 368  LEU A CD1 1 
ATOM   2851  C  CD2 . LEU A 1 368 ? 99.365  60.238 42.248  1.00 34.88  ? 368  LEU A CD2 1 
ATOM   2852  N  N   . ASP A 1 369 ? 99.011  59.031 47.461  1.00 32.09  ? 369  ASP A N   1 
ATOM   2853  C  CA  . ASP A 1 369 ? 99.209  58.173 48.621  1.00 32.36  ? 369  ASP A CA  1 
ATOM   2854  C  C   . ASP A 1 369 ? 97.968  57.311 48.824  1.00 30.36  ? 369  ASP A C   1 
ATOM   2855  O  O   . ASP A 1 369 ? 98.066  56.159 49.235  1.00 28.88  ? 369  ASP A O   1 
ATOM   2856  C  CB  . ASP A 1 369 ? 99.473  59.003 49.882  1.00 35.75  ? 369  ASP A CB  1 
ATOM   2857  C  CG  . ASP A 1 369 ? 100.805 59.740 49.833  1.00 42.36  ? 369  ASP A CG  1 
ATOM   2858  O  OD1 . ASP A 1 369 ? 101.687 59.333 49.036  1.00 45.68  ? 369  ASP A OD1 1 
ATOM   2859  O  OD2 . ASP A 1 369 ? 100.977 60.719 50.598  1.00 42.09  ? 369  ASP A OD2 1 
ATOM   2860  N  N   . ALA A 1 370 ? 96.804  57.879 48.524  1.00 29.14  ? 370  ALA A N   1 
ATOM   2861  C  CA  . ALA A 1 370 ? 95.542  57.164 48.662  1.00 28.60  ? 370  ALA A CA  1 
ATOM   2862  C  C   . ALA A 1 370 ? 95.492  56.003 47.671  1.00 28.41  ? 370  ALA A C   1 
ATOM   2863  O  O   . ALA A 1 370 ? 95.114  54.889 48.024  1.00 27.41  ? 370  ALA A O   1 
ATOM   2864  C  CB  . ALA A 1 370 ? 94.374  58.115 48.425  1.00 29.69  ? 370  ALA A CB  1 
ATOM   2865  N  N   . VAL A 1 371 ? 95.880  56.263 46.427  1.00 27.66  ? 371  VAL A N   1 
ATOM   2866  C  CA  . VAL A 1 371 ? 95.885  55.218 45.418  1.00 27.44  ? 371  VAL A CA  1 
ATOM   2867  C  C   . VAL A 1 371 ? 96.919  54.166 45.816  1.00 28.02  ? 371  VAL A C   1 
ATOM   2868  O  O   . VAL A 1 371 ? 96.658  52.961 45.756  1.00 28.03  ? 371  VAL A O   1 
ATOM   2869  C  CB  . VAL A 1 371 ? 96.246  55.784 44.016  1.00 28.72  ? 371  VAL A CB  1 
ATOM   2870  C  CG1 . VAL A 1 371 ? 96.313  54.658 42.992  1.00 25.82  ? 371  VAL A CG1 1 
ATOM   2871  C  CG2 . VAL A 1 371 ? 95.226  56.820 43.592  1.00 25.56  ? 371  VAL A CG2 1 
ATOM   2872  N  N   . THR A 1 372 ? 98.090  54.630 46.236  1.00 27.23  ? 372  THR A N   1 
ATOM   2873  C  CA  . THR A 1 372 ? 99.167  53.729 46.637  1.00 28.90  ? 372  THR A CA  1 
ATOM   2874  C  C   . THR A 1 372 ? 98.786  52.789 47.772  1.00 28.91  ? 372  THR A C   1 
ATOM   2875  O  O   . THR A 1 372 ? 98.999  51.581 47.676  1.00 30.29  ? 372  THR A O   1 
ATOM   2876  C  CB  . THR A 1 372 ? 100.421 54.508 47.064  1.00 28.53  ? 372  THR A CB  1 
ATOM   2877  O  OG1 . THR A 1 372 ? 100.864 55.327 45.975  1.00 30.36  ? 372  THR A OG1 1 
ATOM   2878  C  CG2 . THR A 1 372 ? 101.526 53.548 47.452  1.00 27.55  ? 372  THR A CG2 1 
ATOM   2879  N  N   . LEU A 1 373 ? 98.229  53.338 48.846  1.00 27.89  ? 373  LEU A N   1 
ATOM   2880  C  CA  . LEU A 1 373 ? 97.828  52.519 49.983  1.00 28.89  ? 373  LEU A CA  1 
ATOM   2881  C  C   . LEU A 1 373 ? 96.745  51.532 49.590  1.00 28.76  ? 373  LEU A C   1 
ATOM   2882  O  O   . LEU A 1 373 ? 96.725  50.389 50.054  1.00 28.67  ? 373  LEU A O   1 
ATOM   2883  C  CB  . LEU A 1 373 ? 97.308  53.403 51.122  1.00 32.67  ? 373  LEU A CB  1 
ATOM   2884  C  CG  . LEU A 1 373 ? 96.735  52.693 52.356  1.00 33.27  ? 373  LEU A CG  1 
ATOM   2885  C  CD1 . LEU A 1 373 ? 97.741  51.686 52.899  1.00 34.10  ? 373  LEU A CD1 1 
ATOM   2886  C  CD2 . LEU A 1 373 ? 96.391  53.727 53.418  1.00 34.98  ? 373  LEU A CD2 1 
ATOM   2887  N  N   . GLN A 1 374 ? 95.848  51.978 48.719  1.00 26.84  ? 374  GLN A N   1 
ATOM   2888  C  CA  . GLN A 1 374 ? 94.744  51.152 48.278  1.00 27.95  ? 374  GLN A CA  1 
ATOM   2889  C  C   . GLN A 1 374 ? 95.173  49.933 47.455  1.00 29.64  ? 374  GLN A C   1 
ATOM   2890  O  O   . GLN A 1 374 ? 94.459  48.931 47.412  1.00 27.87  ? 374  GLN A O   1 
ATOM   2891  C  CB  . GLN A 1 374 ? 93.769  52.005 47.471  1.00 30.63  ? 374  GLN A CB  1 
ATOM   2892  C  CG  . GLN A 1 374 ? 92.529  51.274 47.005  1.00 33.02  ? 374  GLN A CG  1 
ATOM   2893  C  CD  . GLN A 1 374 ? 91.522  51.047 48.117  1.00 35.85  ? 374  GLN A CD  1 
ATOM   2894  O  OE1 . GLN A 1 374 ? 90.495  50.390 47.913  1.00 37.34  ? 374  GLN A OE1 1 
ATOM   2895  N  NE2 . GLN A 1 374 ? 91.800  51.601 49.296  1.00 33.93  ? 374  GLN A NE2 1 
ATOM   2896  N  N   . TYR A 1 375 ? 96.341  50.011 46.821  1.00 29.33  ? 375  TYR A N   1 
ATOM   2897  C  CA  . TYR A 1 375 ? 96.825  48.921 45.981  1.00 31.00  ? 375  TYR A CA  1 
ATOM   2898  C  C   . TYR A 1 375 ? 98.157  48.287 46.400  1.00 32.39  ? 375  TYR A C   1 
ATOM   2899  O  O   . TYR A 1 375 ? 98.760  47.532 45.633  1.00 33.80  ? 375  TYR A O   1 
ATOM   2900  C  CB  . TYR A 1 375 ? 96.930  49.420 44.539  1.00 29.44  ? 375  TYR A CB  1 
ATOM   2901  C  CG  . TYR A 1 375 ? 95.596  49.594 43.848  1.00 28.13  ? 375  TYR A CG  1 
ATOM   2902  C  CD1 . TYR A 1 375 ? 95.026  48.547 43.128  1.00 26.21  ? 375  TYR A CD1 1 
ATOM   2903  C  CD2 . TYR A 1 375 ? 94.905  50.807 43.908  1.00 25.08  ? 375  TYR A CD2 1 
ATOM   2904  C  CE1 . TYR A 1 375 ? 93.807  48.698 42.476  1.00 25.54  ? 375  TYR A CE1 1 
ATOM   2905  C  CE2 . TYR A 1 375 ? 93.684  50.968 43.263  1.00 25.86  ? 375  TYR A CE2 1 
ATOM   2906  C  CZ  . TYR A 1 375 ? 93.140  49.910 42.544  1.00 26.24  ? 375  TYR A CZ  1 
ATOM   2907  O  OH  . TYR A 1 375 ? 91.940  50.061 41.872  1.00 26.85  ? 375  TYR A OH  1 
ATOM   2908  N  N   . THR A 1 376 ? 98.617  48.580 47.610  1.00 32.94  ? 376  THR A N   1 
ATOM   2909  C  CA  . THR A 1 376 ? 99.877  48.024 48.081  1.00 33.02  ? 376  THR A CA  1 
ATOM   2910  C  C   . THR A 1 376 ? 99.692  47.070 49.250  1.00 34.17  ? 376  THR A C   1 
ATOM   2911  O  O   . THR A 1 376 ? 99.100  47.424 50.266  1.00 33.80  ? 376  THR A O   1 
ATOM   2912  C  CB  . THR A 1 376 ? 100.838 49.130 48.542  1.00 33.11  ? 376  THR A CB  1 
ATOM   2913  O  OG1 . THR A 1 376 ? 101.141 49.989 47.440  1.00 32.61  ? 376  THR A OG1 1 
ATOM   2914  C  CG2 . THR A 1 376 ? 102.135 48.525 49.089  1.00 32.80  ? 376  THR A CG2 1 
ATOM   2915  N  N   . ASP A 1 377 ? 100.194 45.851 49.101  1.00 35.00  ? 377  ASP A N   1 
ATOM   2916  C  CA  . ASP A 1 377 ? 100.115 44.881 50.180  1.00 35.01  ? 377  ASP A CA  1 
ATOM   2917  C  C   . ASP A 1 377 ? 101.380 45.114 51.003  1.00 35.14  ? 377  ASP A C   1 
ATOM   2918  O  O   . ASP A 1 377 ? 102.474 44.701 50.613  1.00 33.66  ? 377  ASP A O   1 
ATOM   2919  C  CB  . ASP A 1 377 ? 100.075 43.459 49.618  1.00 37.51  ? 377  ASP A CB  1 
ATOM   2920  C  CG  . ASP A 1 377 ? 100.474 42.412 50.646  1.00 38.52  ? 377  ASP A CG  1 
ATOM   2921  O  OD1 . ASP A 1 377 ? 100.255 42.650 51.854  1.00 36.78  ? 377  ASP A OD1 1 
ATOM   2922  O  OD2 . ASP A 1 377 ? 100.997 41.348 50.243  1.00 38.58  ? 377  ASP A OD2 1 
ATOM   2923  N  N   . TRP A 1 378 ? 101.221 45.800 52.133  1.00 34.67  ? 378  TRP A N   1 
ATOM   2924  C  CA  . TRP A 1 378 ? 102.346 46.127 52.996  1.00 35.76  ? 378  TRP A CA  1 
ATOM   2925  C  C   . TRP A 1 378 ? 102.999 44.988 53.762  1.00 36.30  ? 378  TRP A C   1 
ATOM   2926  O  O   . TRP A 1 378 ? 103.980 45.208 54.474  1.00 34.76  ? 378  TRP A O   1 
ATOM   2927  C  CB  . TRP A 1 378 ? 101.961 47.256 53.949  1.00 34.45  ? 378  TRP A CB  1 
ATOM   2928  C  CG  . TRP A 1 378 ? 101.986 48.570 53.251  1.00 35.75  ? 378  TRP A CG  1 
ATOM   2929  C  CD1 . TRP A 1 378 ? 100.915 49.331 52.887  1.00 37.00  ? 378  TRP A CD1 1 
ATOM   2930  C  CD2 . TRP A 1 378 ? 103.145 49.241 52.751  1.00 36.79  ? 378  TRP A CD2 1 
ATOM   2931  N  NE1 . TRP A 1 378 ? 101.336 50.435 52.185  1.00 36.92  ? 378  TRP A NE1 1 
ATOM   2932  C  CE2 . TRP A 1 378 ? 102.701 50.405 52.088  1.00 36.46  ? 378  TRP A CE2 1 
ATOM   2933  C  CE3 . TRP A 1 378 ? 104.519 48.970 52.798  1.00 38.71  ? 378  TRP A CE3 1 
ATOM   2934  C  CZ2 . TRP A 1 378 ? 103.581 51.299 51.472  1.00 39.80  ? 378  TRP A CZ2 1 
ATOM   2935  C  CZ3 . TRP A 1 378 ? 105.400 49.862 52.184  1.00 41.17  ? 378  TRP A CZ3 1 
ATOM   2936  C  CH2 . TRP A 1 378 ? 104.924 51.012 51.530  1.00 40.83  ? 378  TRP A CH2 1 
ATOM   2937  N  N   . MET A 1 379 ? 102.468 43.777 53.623  1.00 37.78  ? 379  MET A N   1 
ATOM   2938  C  CA  . MET A 1 379 ? 103.078 42.623 54.277  1.00 41.42  ? 379  MET A CA  1 
ATOM   2939  C  C   . MET A 1 379 ? 104.155 42.120 53.319  1.00 42.90  ? 379  MET A C   1 
ATOM   2940  O  O   . MET A 1 379 ? 104.860 41.150 53.618  1.00 42.67  ? 379  MET A O   1 
ATOM   2941  C  CB  . MET A 1 379 ? 102.074 41.483 54.472  1.00 44.29  ? 379  MET A CB  1 
ATOM   2942  C  CG  . MET A 1 379 ? 101.010 41.680 55.530  1.00 48.05  ? 379  MET A CG  1 
ATOM   2943  S  SD  . MET A 1 379 ? 99.979  40.177 55.657  1.00 52.16  ? 379  MET A SD  1 
ATOM   2944  C  CE  . MET A 1 379 ? 101.040 39.116 56.668  1.00 50.86  ? 379  MET A CE  1 
ATOM   2945  N  N   . ASP A 1 380 ? 104.286 42.790 52.175  1.00 44.14  ? 380  ASP A N   1 
ATOM   2946  C  CA  . ASP A 1 380 ? 105.231 42.354 51.148  1.00 45.13  ? 380  ASP A CA  1 
ATOM   2947  C  C   . ASP A 1 380 ? 105.306 43.355 49.983  1.00 45.30  ? 380  ASP A C   1 
ATOM   2948  O  O   . ASP A 1 380 ? 105.080 42.999 48.828  1.00 44.25  ? 380  ASP A O   1 
ATOM   2949  C  CB  . ASP A 1 380 ? 104.756 40.975 50.673  1.00 46.65  ? 380  ASP A CB  1 
ATOM   2950  C  CG  . ASP A 1 380 ? 105.575 40.415 49.544  1.00 48.84  ? 380  ASP A CG  1 
ATOM   2951  O  OD1 . ASP A 1 380 ? 106.812 40.602 49.538  1.00 50.41  ? 380  ASP A OD1 1 
ATOM   2952  O  OD2 . ASP A 1 380 ? 104.966 39.758 48.670  1.00 49.83  ? 380  ASP A OD2 1 
ATOM   2953  N  N   . ASP A 1 381 ? 105.648 44.603 50.296  1.00 46.43  ? 381  ASP A N   1 
ATOM   2954  C  CA  . ASP A 1 381 ? 105.718 45.673 49.298  1.00 48.21  ? 381  ASP A CA  1 
ATOM   2955  C  C   . ASP A 1 381 ? 106.817 45.595 48.240  1.00 48.97  ? 381  ASP A C   1 
ATOM   2956  O  O   . ASP A 1 381 ? 106.706 46.229 47.188  1.00 49.58  ? 381  ASP A O   1 
ATOM   2957  C  CB  . ASP A 1 381 ? 105.806 47.033 49.997  1.00 49.23  ? 381  ASP A CB  1 
ATOM   2958  C  CG  . ASP A 1 381 ? 107.007 47.139 50.916  1.00 52.12  ? 381  ASP A CG  1 
ATOM   2959  O  OD1 . ASP A 1 381 ? 107.128 46.301 51.839  1.00 52.58  ? 381  ASP A OD1 1 
ATOM   2960  O  OD2 . ASP A 1 381 ? 107.829 48.060 50.715  1.00 53.03  ? 381  ASP A OD2 1 
ATOM   2961  N  N   . ASN A 1 382 ? 107.879 44.842 48.505  1.00 47.91  ? 382  ASN A N   1 
ATOM   2962  C  CA  . ASN A 1 382 ? 108.958 44.733 47.530  1.00 46.65  ? 382  ASN A CA  1 
ATOM   2963  C  C   . ASN A 1 382 ? 108.799 43.536 46.596  1.00 44.94  ? 382  ASN A C   1 
ATOM   2964  O  O   . ASN A 1 382 ? 109.775 43.008 46.061  1.00 44.76  ? 382  ASN A O   1 
ATOM   2965  C  CB  . ASN A 1 382 ? 110.313 44.681 48.241  1.00 47.34  ? 382  ASN A CB  1 
ATOM   2966  C  CG  . ASN A 1 382 ? 110.744 46.044 48.761  1.00 49.01  ? 382  ASN A CG  1 
ATOM   2967  O  OD1 . ASN A 1 382 ? 110.803 47.021 48.007  1.00 46.40  ? 382  ASN A OD1 1 
ATOM   2968  N  ND2 . ASN A 1 382 ? 111.050 46.116 50.052  1.00 49.69  ? 382  ASN A ND2 1 
ATOM   2969  N  N   . ASN A 1 383 ? 107.559 43.108 46.408  1.00 41.69  ? 383  ASN A N   1 
ATOM   2970  C  CA  . ASN A 1 383 ? 107.273 41.995 45.519  1.00 39.85  ? 383  ASN A CA  1 
ATOM   2971  C  C   . ASN A 1 383 ? 106.994 42.584 44.135  1.00 37.78  ? 383  ASN A C   1 
ATOM   2972  O  O   . ASN A 1 383 ? 106.032 43.329 43.945  1.00 34.04  ? 383  ASN A O   1 
ATOM   2973  C  CB  . ASN A 1 383 ? 106.069 41.206 46.038  1.00 40.32  ? 383  ASN A CB  1 
ATOM   2974  C  CG  . ASN A 1 383 ? 105.724 40.027 45.159  1.00 43.27  ? 383  ASN A CG  1 
ATOM   2975  O  OD1 . ASN A 1 383 ? 105.137 39.045 45.620  1.00 45.19  ? 383  ASN A OD1 1 
ATOM   2976  N  ND2 . ASN A 1 383 ? 106.073 40.117 43.880  1.00 43.32  ? 383  ASN A ND2 1 
ATOM   2977  N  N   . GLY A 1 384 ? 107.858 42.255 43.181  1.00 37.52  ? 384  GLY A N   1 
ATOM   2978  C  CA  . GLY A 1 384 ? 107.726 42.768 41.828  1.00 37.98  ? 384  GLY A CA  1 
ATOM   2979  C  C   . GLY A 1 384 ? 106.486 42.330 41.066  1.00 38.41  ? 384  GLY A C   1 
ATOM   2980  O  O   . GLY A 1 384 ? 105.927 43.114 40.302  1.00 38.41  ? 384  GLY A O   1 
ATOM   2981  N  N   . ILE A 1 385 ? 106.058 41.084 41.247  1.00 36.54  ? 385  ILE A N   1 
ATOM   2982  C  CA  . ILE A 1 385 ? 104.873 40.609 40.553  1.00 35.88  ? 385  ILE A CA  1 
ATOM   2983  C  C   . ILE A 1 385 ? 103.636 41.330 41.075  1.00 35.50  ? 385  ILE A C   1 
ATOM   2984  O  O   . ILE A 1 385 ? 102.781 41.748 40.295  1.00 35.22  ? 385  ILE A O   1 
ATOM   2985  C  CB  . ILE A 1 385 ? 104.685 39.075 40.711  1.00 37.15  ? 385  ILE A CB  1 
ATOM   2986  C  CG1 . ILE A 1 385 ? 105.709 38.332 39.847  1.00 37.36  ? 385  ILE A CG1 1 
ATOM   2987  C  CG2 . ILE A 1 385 ? 103.281 38.668 40.288  1.00 36.89  ? 385  ILE A CG2 1 
ATOM   2988  C  CD1 . ILE A 1 385 ? 105.497 36.824 39.802  1.00 39.06  ? 385  ILE A CD1 1 
ATOM   2989  N  N   . LYS A 1 386 ? 103.543 41.486 42.391  1.00 35.25  ? 386  LYS A N   1 
ATOM   2990  C  CA  . LYS A 1 386 ? 102.399 42.171 42.986  1.00 34.82  ? 386  LYS A CA  1 
ATOM   2991  C  C   . LYS A 1 386 ? 102.357 43.641 42.604  1.00 34.29  ? 386  LYS A C   1 
ATOM   2992  O  O   . LYS A 1 386 ? 101.281 44.215 42.436  1.00 33.51  ? 386  LYS A O   1 
ATOM   2993  C  CB  . LYS A 1 386 ? 102.431 42.052 44.509  1.00 35.54  ? 386  LYS A CB  1 
ATOM   2994  C  CG  . LYS A 1 386 ? 101.963 40.709 45.043  1.00 38.80  ? 386  LYS A CG  1 
ATOM   2995  C  CD  . LYS A 1 386 ? 102.163 40.612 46.555  1.00 40.17  ? 386  LYS A CD  1 
ATOM   2996  C  CE  . LYS A 1 386 ? 101.587 39.311 47.108  1.00 40.42  ? 386  LYS A CE  1 
ATOM   2997  N  NZ  . LYS A 1 386 ? 102.018 39.085 48.521  1.00 43.13  ? 386  LYS A NZ  1 
ATOM   2998  N  N   . ASN A 1 387 ? 103.527 44.258 42.486  1.00 34.09  ? 387  ASN A N   1 
ATOM   2999  C  CA  . ASN A 1 387 ? 103.586 45.666 42.121  1.00 33.22  ? 387  ASN A CA  1 
ATOM   3000  C  C   . ASN A 1 387 ? 103.150 45.861 40.679  1.00 32.62  ? 387  ASN A C   1 
ATOM   3001  O  O   . ASN A 1 387 ? 102.565 46.889 40.334  1.00 31.70  ? 387  ASN A O   1 
ATOM   3002  C  CB  . ASN A 1 387 ? 104.998 46.224 42.317  1.00 33.77  ? 387  ASN A CB  1 
ATOM   3003  C  CG  . ASN A 1 387 ? 105.347 46.407 43.777  1.00 35.13  ? 387  ASN A CG  1 
ATOM   3004  O  OD1 . ASN A 1 387 ? 104.480 46.714 44.591  1.00 35.47  ? 387  ASN A OD1 1 
ATOM   3005  N  ND2 . ASN A 1 387 ? 106.621 46.234 44.115  1.00 34.67  ? 387  ASN A ND2 1 
ATOM   3006  N  N   . ARG A 1 388 ? 103.441 44.865 39.845  1.00 30.90  ? 388  ARG A N   1 
ATOM   3007  C  CA  . ARG A 1 388 ? 103.084 44.901 38.433  1.00 31.01  ? 388  ARG A CA  1 
ATOM   3008  C  C   . ARG A 1 388 ? 101.568 44.787 38.302  1.00 30.96  ? 388  ARG A C   1 
ATOM   3009  O  O   . ARG A 1 388 ? 100.920 45.600 37.642  1.00 30.25  ? 388  ARG A O   1 
ATOM   3010  C  CB  . ARG A 1 388 ? 103.757 43.734 37.708  1.00 31.92  ? 388  ARG A CB  1 
ATOM   3011  C  CG  . ARG A 1 388 ? 103.468 43.638 36.218  1.00 30.44  ? 388  ARG A CG  1 
ATOM   3012  C  CD  . ARG A 1 388 ? 103.921 42.280 35.702  1.00 30.30  ? 388  ARG A CD  1 
ATOM   3013  N  NE  . ARG A 1 388 ? 103.115 41.211 36.285  1.00 31.94  ? 388  ARG A NE  1 
ATOM   3014  C  CZ  . ARG A 1 388 ? 103.445 39.923 36.276  1.00 31.70  ? 388  ARG A CZ  1 
ATOM   3015  N  NH1 . ARG A 1 388 ? 102.633 39.039 36.832  1.00 32.22  ? 388  ARG A NH1 1 
ATOM   3016  N  NH2 . ARG A 1 388 ? 104.585 39.517 35.729  1.00 31.57  ? 388  ARG A NH2 1 
ATOM   3017  N  N   . ASP A 1 389 ? 101.015 43.765 38.945  1.00 30.64  ? 389  ASP A N   1 
ATOM   3018  C  CA  . ASP A 1 389 ? 99.583  43.513 38.929  1.00 30.76  ? 389  ASP A CA  1 
ATOM   3019  C  C   . ASP A 1 389 ? 98.800  44.661 39.567  1.00 29.90  ? 389  ASP A C   1 
ATOM   3020  O  O   . ASP A 1 389 ? 97.678  44.946 39.162  1.00 29.42  ? 389  ASP A O   1 
ATOM   3021  C  CB  . ASP A 1 389 ? 99.284  42.203 39.658  1.00 31.46  ? 389  ASP A CB  1 
ATOM   3022  C  CG  . ASP A 1 389 ? 99.848  40.988 38.933  1.00 36.55  ? 389  ASP A CG  1 
ATOM   3023  O  OD1 . ASP A 1 389 ? 100.625 41.157 37.959  1.00 39.28  ? 389  ASP A OD1 1 
ATOM   3024  O  OD2 . ASP A 1 389 ? 99.519  39.853 39.342  1.00 40.72  ? 389  ASP A OD2 1 
ATOM   3025  N  N   . GLY A 1 390 ? 99.394  45.313 40.562  1.00 28.31  ? 390  GLY A N   1 
ATOM   3026  C  CA  . GLY A 1 390 ? 98.732  46.427 41.216  1.00 28.67  ? 390  GLY A CA  1 
ATOM   3027  C  C   . GLY A 1 390 ? 98.586  47.624 40.288  1.00 30.81  ? 390  GLY A C   1 
ATOM   3028  O  O   . GLY A 1 390 ? 97.539  48.274 40.247  1.00 30.07  ? 390  GLY A O   1 
ATOM   3029  N  N   . LEU A 1 391 ? 99.646  47.916 39.539  1.00 30.14  ? 391  LEU A N   1 
ATOM   3030  C  CA  . LEU A 1 391 ? 99.642  49.029 38.598  1.00 29.68  ? 391  LEU A CA  1 
ATOM   3031  C  C   . LEU A 1 391 ? 98.674  48.701 37.457  1.00 30.36  ? 391  LEU A C   1 
ATOM   3032  O  O   . LEU A 1 391 ? 97.972  49.575 36.940  1.00 28.82  ? 391  LEU A O   1 
ATOM   3033  C  CB  . LEU A 1 391 ? 101.053 49.231 38.051  1.00 29.26  ? 391  LEU A CB  1 
ATOM   3034  C  CG  . LEU A 1 391 ? 101.630 50.640 38.060  1.00 30.04  ? 391  LEU A CG  1 
ATOM   3035  C  CD1 . LEU A 1 391 ? 101.276 51.367 39.350  1.00 31.95  ? 391  LEU A CD1 1 
ATOM   3036  C  CD2 . LEU A 1 391 ? 103.134 50.537 37.890  1.00 31.38  ? 391  LEU A CD2 1 
ATOM   3037  N  N   . ASP A 1 392 ? 98.647  47.429 37.080  1.00 28.95  ? 392  ASP A N   1 
ATOM   3038  C  CA  . ASP A 1 392 ? 97.774  46.948 36.023  1.00 30.46  ? 392  ASP A CA  1 
ATOM   3039  C  C   . ASP A 1 392 ? 96.329  47.202 36.443  1.00 30.31  ? 392  ASP A C   1 
ATOM   3040  O  O   . ASP A 1 392 ? 95.533  47.735 35.672  1.00 29.94  ? 392  ASP A O   1 
ATOM   3041  C  CB  . ASP A 1 392 ? 98.005  45.450 35.803  1.00 34.81  ? 392  ASP A CB  1 
ATOM   3042  C  CG  . ASP A 1 392 ? 97.159  44.883 34.676  1.00 42.04  ? 392  ASP A CG  1 
ATOM   3043  O  OD1 . ASP A 1 392 ? 97.370  45.287 33.515  1.00 45.57  ? 392  ASP A OD1 1 
ATOM   3044  O  OD2 . ASP A 1 392 ? 96.279  44.034 34.945  1.00 45.10  ? 392  ASP A OD2 1 
ATOM   3045  N  N   . ASP A 1 393 ? 95.996  46.827 37.677  1.00 29.13  ? 393  ASP A N   1 
ATOM   3046  C  CA  . ASP A 1 393 ? 94.646  47.032 38.181  1.00 26.29  ? 393  ASP A CA  1 
ATOM   3047  C  C   . ASP A 1 393 ? 94.347  48.514 38.346  1.00 23.40  ? 393  ASP A C   1 
ATOM   3048  O  O   . ASP A 1 393 ? 93.232  48.945 38.096  1.00 20.95  ? 393  ASP A O   1 
ATOM   3049  C  CB  . ASP A 1 393 ? 94.442  46.309 39.513  1.00 30.58  ? 393  ASP A CB  1 
ATOM   3050  C  CG  . ASP A 1 393 ? 94.310  44.806 39.345  1.00 34.63  ? 393  ASP A CG  1 
ATOM   3051  O  OD1 . ASP A 1 393 ? 93.566  44.363 38.442  1.00 35.81  ? 393  ASP A OD1 1 
ATOM   3052  O  OD2 . ASP A 1 393 ? 94.937  44.061 40.123  1.00 38.46  ? 393  ASP A OD2 1 
ATOM   3053  N  N   . ILE A 1 394 ? 95.342  49.292 38.761  1.00 21.13  ? 394  ILE A N   1 
ATOM   3054  C  CA  . ILE A 1 394 ? 95.144  50.725 38.925  1.00 20.97  ? 394  ILE A CA  1 
ATOM   3055  C  C   . ILE A 1 394 ? 94.714  51.365 37.608  1.00 21.81  ? 394  ILE A C   1 
ATOM   3056  O  O   . ILE A 1 394 ? 93.730  52.098 37.562  1.00 22.01  ? 394  ILE A O   1 
ATOM   3057  C  CB  . ILE A 1 394 ? 96.425  51.434 39.396  1.00 21.46  ? 394  ILE A CB  1 
ATOM   3058  C  CG1 . ILE A 1 394 ? 96.667  51.161 40.879  1.00 22.12  ? 394  ILE A CG1 1 
ATOM   3059  C  CG2 . ILE A 1 394 ? 96.316  52.930 39.143  1.00 20.46  ? 394  ILE A CG2 1 
ATOM   3060  C  CD1 . ILE A 1 394 ? 98.001  51.670 41.368  1.00 20.46  ? 394  ILE A CD1 1 
ATOM   3061  N  N   . VAL A 1 395 ? 95.448  51.077 36.537  1.00 22.16  ? 395  VAL A N   1 
ATOM   3062  C  CA  . VAL A 1 395 ? 95.138  51.660 35.240  1.00 21.72  ? 395  VAL A CA  1 
ATOM   3063  C  C   . VAL A 1 395 ? 93.792  51.196 34.698  1.00 20.90  ? 395  VAL A C   1 
ATOM   3064  O  O   . VAL A 1 395 ? 93.025  52.001 34.184  1.00 20.93  ? 395  VAL A O   1 
ATOM   3065  C  CB  . VAL A 1 395 ? 96.237  51.346 34.195  1.00 21.62  ? 395  VAL A CB  1 
ATOM   3066  C  CG1 . VAL A 1 395 ? 95.878  51.978 32.854  1.00 21.98  ? 395  VAL A CG1 1 
ATOM   3067  C  CG2 . VAL A 1 395 ? 97.569  51.876 34.673  1.00 22.58  ? 395  VAL A CG2 1 
ATOM   3068  N  N   . GLY A 1 396 ? 93.515  49.902 34.818  1.00 21.20  ? 396  GLY A N   1 
ATOM   3069  C  CA  . GLY A 1 396 ? 92.257  49.360 34.336  1.00 20.46  ? 396  GLY A CA  1 
ATOM   3070  C  C   . GLY A 1 396 ? 91.051  49.811 35.141  1.00 22.52  ? 396  GLY A C   1 
ATOM   3071  O  O   . GLY A 1 396 ? 90.014  50.156 34.574  1.00 22.88  ? 396  GLY A O   1 
ATOM   3072  N  N   . ASP A 1 397 ? 91.177  49.811 36.465  1.00 24.24  ? 397  ASP A N   1 
ATOM   3073  C  CA  . ASP A 1 397 ? 90.076  50.233 37.328  1.00 23.35  ? 397  ASP A CA  1 
ATOM   3074  C  C   . ASP A 1 397 ? 89.748  51.721 37.127  1.00 24.02  ? 397  ASP A C   1 
ATOM   3075  O  O   . ASP A 1 397 ? 88.600  52.090 36.901  1.00 24.20  ? 397  ASP A O   1 
ATOM   3076  C  CB  . ASP A 1 397 ? 90.407  49.976 38.810  1.00 23.24  ? 397  ASP A CB  1 
ATOM   3077  C  CG  . ASP A 1 397 ? 90.453  48.474 39.172  1.00 27.18  ? 397  ASP A CG  1 
ATOM   3078  O  OD1 . ASP A 1 397 ? 89.850  47.643 38.460  1.00 26.51  ? 397  ASP A OD1 1 
ATOM   3079  O  OD2 . ASP A 1 397 ? 91.085  48.124 40.193  1.00 28.32  ? 397  ASP A OD2 1 
ATOM   3080  N  N   . HIS A 1 398 ? 90.759  52.577 37.189  1.00 24.11  ? 398  HIS A N   1 
ATOM   3081  C  CA  . HIS A 1 398 ? 90.532  54.010 37.041  1.00 23.45  ? 398  HIS A CA  1 
ATOM   3082  C  C   . HIS A 1 398 ? 90.038  54.469 35.658  1.00 23.15  ? 398  HIS A C   1 
ATOM   3083  O  O   . HIS A 1 398 ? 89.151  55.313 35.564  1.00 22.27  ? 398  HIS A O   1 
ATOM   3084  C  CB  . HIS A 1 398 ? 91.803  54.775 37.412  1.00 23.41  ? 398  HIS A CB  1 
ATOM   3085  C  CG  . HIS A 1 398 ? 91.719  56.246 37.151  1.00 26.03  ? 398  HIS A CG  1 
ATOM   3086  N  ND1 . HIS A 1 398 ? 90.744  57.047 37.707  1.00 25.23  ? 398  HIS A ND1 1 
ATOM   3087  C  CD2 . HIS A 1 398 ? 92.489  57.063 36.392  1.00 26.46  ? 398  HIS A CD2 1 
ATOM   3088  C  CE1 . HIS A 1 398 ? 90.918  58.292 37.304  1.00 26.56  ? 398  HIS A CE1 1 
ATOM   3089  N  NE2 . HIS A 1 398 ? 91.970  58.330 36.506  1.00 26.23  ? 398  HIS A NE2 1 
ATOM   3090  N  N   . ASN A 1 399 ? 90.591  53.902 34.595  1.00 22.77  ? 399  ASN A N   1 
ATOM   3091  C  CA  . ASN A 1 399 ? 90.221  54.308 33.244  1.00 23.87  ? 399  ASN A CA  1 
ATOM   3092  C  C   . ASN A 1 399 ? 89.098  53.555 32.531  1.00 23.38  ? 399  ASN A C   1 
ATOM   3093  O  O   . ASN A 1 399 ? 88.458  54.114 31.644  1.00 22.33  ? 399  ASN A O   1 
ATOM   3094  C  CB  . ASN A 1 399 ? 91.466  54.286 32.356  1.00 24.94  ? 399  ASN A CB  1 
ATOM   3095  C  CG  . ASN A 1 399 ? 92.488  55.316 32.773  1.00 24.05  ? 399  ASN A CG  1 
ATOM   3096  O  OD1 . ASN A 1 399 ? 92.255  56.515 32.648  1.00 27.79  ? 399  ASN A OD1 1 
ATOM   3097  N  ND2 . ASN A 1 399 ? 93.623  54.856 33.285  1.00 23.79  ? 399  ASN A ND2 1 
ATOM   3098  N  N   . VAL A 1 400 ? 88.848  52.305 32.910  1.00 22.96  ? 400  VAL A N   1 
ATOM   3099  C  CA  . VAL A 1 400 ? 87.817  51.525 32.238  1.00 21.82  ? 400  VAL A CA  1 
ATOM   3100  C  C   . VAL A 1 400 ? 86.757  50.875 33.118  1.00 23.83  ? 400  VAL A C   1 
ATOM   3101  O  O   . VAL A 1 400 ? 85.584  51.202 33.020  1.00 26.17  ? 400  VAL A O   1 
ATOM   3102  C  CB  . VAL A 1 400 ? 88.447  50.411 31.377  1.00 21.81  ? 400  VAL A CB  1 
ATOM   3103  C  CG1 . VAL A 1 400 ? 87.361  49.659 30.629  1.00 20.46  ? 400  VAL A CG1 1 
ATOM   3104  C  CG2 . VAL A 1 400 ? 89.453  51.004 30.408  1.00 20.46  ? 400  VAL A CG2 1 
ATOM   3105  N  N   . ILE A 1 401 ? 87.160  49.946 33.972  1.00 25.98  ? 401  ILE A N   1 
ATOM   3106  C  CA  . ILE A 1 401 ? 86.199  49.242 34.810  1.00 25.65  ? 401  ILE A CA  1 
ATOM   3107  C  C   . ILE A 1 401 ? 85.299  50.074 35.727  1.00 25.70  ? 401  ILE A C   1 
ATOM   3108  O  O   . ILE A 1 401 ? 84.081  49.934 35.690  1.00 24.54  ? 401  ILE A O   1 
ATOM   3109  C  CB  . ILE A 1 401 ? 86.898  48.175 35.653  1.00 24.76  ? 401  ILE A CB  1 
ATOM   3110  C  CG1 . ILE A 1 401 ? 87.668  47.236 34.723  1.00 24.99  ? 401  ILE A CG1 1 
ATOM   3111  C  CG2 . ILE A 1 401 ? 85.872  47.399 36.470  1.00 21.53  ? 401  ILE A CG2 1 
ATOM   3112  C  CD1 . ILE A 1 401 ? 88.299  46.059 35.434  1.00 25.87  ? 401  ILE A CD1 1 
ATOM   3113  N  N   . CYS A 1 402 ? 85.876  50.928 36.555  1.00 25.36  ? 402  CYS A N   1 
ATOM   3114  C  CA  . CYS A 1 402 ? 85.041  51.712 37.453  1.00 27.65  ? 402  CYS A CA  1 
ATOM   3115  C  C   . CYS A 1 402 ? 84.202  52.801 36.762  1.00 29.08  ? 402  CYS A C   1 
ATOM   3116  O  O   . CYS A 1 402 ? 83.085  53.082 37.181  1.00 27.65  ? 402  CYS A O   1 
ATOM   3117  C  CB  . CYS A 1 402 ? 85.895  52.259 38.597  1.00 27.24  ? 402  CYS A CB  1 
ATOM   3118  S  SG  . CYS A 1 402 ? 86.503  50.892 39.651  1.00 31.94  ? 402  CYS A SG  1 
ATOM   3119  N  N   . PRO A 1 403 ? 84.730  53.438 35.701  1.00 28.89  ? 403  PRO A N   1 
ATOM   3120  C  CA  . PRO A 1 403 ? 83.885  54.454 35.058  1.00 27.83  ? 403  PRO A CA  1 
ATOM   3121  C  C   . PRO A 1 403 ? 82.674  53.745 34.422  1.00 27.35  ? 403  PRO A C   1 
ATOM   3122  O  O   . PRO A 1 403 ? 81.558  54.275 34.408  1.00 25.81  ? 403  PRO A O   1 
ATOM   3123  C  CB  . PRO A 1 403 ? 84.811  55.057 34.005  1.00 27.86  ? 403  PRO A CB  1 
ATOM   3124  C  CG  . PRO A 1 403 ? 86.163  54.919 34.633  1.00 27.98  ? 403  PRO A CG  1 
ATOM   3125  C  CD  . PRO A 1 403 ? 86.122  53.534 35.228  1.00 26.28  ? 403  PRO A CD  1 
ATOM   3126  N  N   . LEU A 1 404 ? 82.897  52.538 33.904  1.00 24.87  ? 404  LEU A N   1 
ATOM   3127  C  CA  . LEU A 1 404 ? 81.809  51.784 33.287  1.00 25.10  ? 404  LEU A CA  1 
ATOM   3128  C  C   . LEU A 1 404 ? 80.780  51.320 34.316  1.00 26.59  ? 404  LEU A C   1 
ATOM   3129  O  O   . LEU A 1 404 ? 79.579  51.310 34.038  1.00 25.81  ? 404  LEU A O   1 
ATOM   3130  C  CB  . LEU A 1 404 ? 82.350  50.583 32.498  1.00 25.06  ? 404  LEU A CB  1 
ATOM   3131  C  CG  . LEU A 1 404 ? 81.273  49.715 31.830  1.00 26.40  ? 404  LEU A CG  1 
ATOM   3132  C  CD1 . LEU A 1 404 ? 81.728  49.230 30.463  1.00 24.33  ? 404  LEU A CD1 1 
ATOM   3133  C  CD2 . LEU A 1 404 ? 80.945  48.553 32.754  1.00 24.31  ? 404  LEU A CD2 1 
ATOM   3134  N  N   . MET A 1 405 ? 81.245  50.941 35.505  1.00 26.92  ? 405  MET A N   1 
ATOM   3135  C  CA  . MET A 1 405 ? 80.336  50.506 36.554  1.00 26.79  ? 405  MET A CA  1 
ATOM   3136  C  C   . MET A 1 405 ? 79.506  51.694 37.044  1.00 27.95  ? 405  MET A C   1 
ATOM   3137  O  O   . MET A 1 405 ? 78.324  51.553 37.349  1.00 27.36  ? 405  MET A O   1 
ATOM   3138  C  CB  . MET A 1 405 ? 81.109  49.884 37.720  1.00 26.02  ? 405  MET A CB  1 
ATOM   3139  C  CG  . MET A 1 405 ? 81.760  48.545 37.396  1.00 23.33  ? 405  MET A CG  1 
ATOM   3140  S  SD  . MET A 1 405 ? 80.621  47.379 36.633  1.00 26.94  ? 405  MET A SD  1 
ATOM   3141  C  CE  . MET A 1 405 ? 79.382  47.201 37.937  1.00 26.29  ? 405  MET A CE  1 
ATOM   3142  N  N   . HIS A 1 406 ? 80.123  52.866 37.122  1.00 28.24  ? 406  HIS A N   1 
ATOM   3143  C  CA  . HIS A 1 406 ? 79.392  54.056 37.543  1.00 30.08  ? 406  HIS A CA  1 
ATOM   3144  C  C   . HIS A 1 406 ? 78.273  54.310 36.524  1.00 30.66  ? 406  HIS A C   1 
ATOM   3145  O  O   . HIS A 1 406 ? 77.148  54.673 36.879  1.00 30.42  ? 406  HIS A O   1 
ATOM   3146  C  CB  . HIS A 1 406 ? 80.318  55.266 37.579  1.00 30.52  ? 406  HIS A CB  1 
ATOM   3147  C  CG  . HIS A 1 406 ? 79.629  56.541 37.954  1.00 35.03  ? 406  HIS A CG  1 
ATOM   3148  N  ND1 . HIS A 1 406 ? 79.219  56.816 39.241  1.00 34.67  ? 406  HIS A ND1 1 
ATOM   3149  C  CD2 . HIS A 1 406 ? 79.276  57.616 37.208  1.00 34.94  ? 406  HIS A CD2 1 
ATOM   3150  C  CE1 . HIS A 1 406 ? 78.646  58.007 39.273  1.00 35.03  ? 406  HIS A CE1 1 
ATOM   3151  N  NE2 . HIS A 1 406 ? 78.668  58.514 38.053  1.00 35.73  ? 406  HIS A NE2 1 
ATOM   3152  N  N   . PHE A 1 407 ? 78.601  54.109 35.252  1.00 30.18  ? 407  PHE A N   1 
ATOM   3153  C  CA  . PHE A 1 407 ? 77.648  54.305 34.173  1.00 28.73  ? 407  PHE A CA  1 
ATOM   3154  C  C   . PHE A 1 407 ? 76.519  53.275 34.254  1.00 28.94  ? 407  PHE A C   1 
ATOM   3155  O  O   . PHE A 1 407 ? 75.344  53.632 34.181  1.00 27.36  ? 407  PHE A O   1 
ATOM   3156  C  CB  . PHE A 1 407 ? 78.348  54.191 32.810  1.00 25.68  ? 407  PHE A CB  1 
ATOM   3157  C  CG  . PHE A 1 407 ? 77.420  54.353 31.644  1.00 27.23  ? 407  PHE A CG  1 
ATOM   3158  C  CD1 . PHE A 1 407 ? 76.952  55.613 31.281  1.00 28.62  ? 407  PHE A CD1 1 
ATOM   3159  C  CD2 . PHE A 1 407 ? 76.965  53.247 30.943  1.00 26.66  ? 407  PHE A CD2 1 
ATOM   3160  C  CE1 . PHE A 1 407 ? 76.042  55.769 30.234  1.00 27.93  ? 407  PHE A CE1 1 
ATOM   3161  C  CE2 . PHE A 1 407 ? 76.053  53.389 29.893  1.00 28.96  ? 407  PHE A CE2 1 
ATOM   3162  C  CZ  . PHE A 1 407 ? 75.591  54.655 29.539  1.00 28.57  ? 407  PHE A CZ  1 
ATOM   3163  N  N   . VAL A 1 408 ? 76.877  52.004 34.414  1.00 28.10  ? 408  VAL A N   1 
ATOM   3164  C  CA  . VAL A 1 408 ? 75.880  50.942 34.482  1.00 30.17  ? 408  VAL A CA  1 
ATOM   3165  C  C   . VAL A 1 408 ? 74.882  51.130 35.629  1.00 30.53  ? 408  VAL A C   1 
ATOM   3166  O  O   . VAL A 1 408 ? 73.691  50.859 35.473  1.00 30.39  ? 408  VAL A O   1 
ATOM   3167  C  CB  . VAL A 1 408 ? 76.547  49.551 34.615  1.00 31.87  ? 408  VAL A CB  1 
ATOM   3168  C  CG1 . VAL A 1 408 ? 77.049  49.341 36.024  1.00 34.63  ? 408  VAL A CG1 1 
ATOM   3169  C  CG2 . VAL A 1 408 ? 75.562  48.461 34.240  1.00 35.84  ? 408  VAL A CG2 1 
ATOM   3170  N  N   . ASN A 1 409 ? 75.356  51.599 36.779  1.00 30.58  ? 409  ASN A N   1 
ATOM   3171  C  CA  . ASN A 1 409 ? 74.457  51.801 37.900  1.00 32.86  ? 409  ASN A CA  1 
ATOM   3172  C  C   . ASN A 1 409 ? 73.542  53.007 37.681  1.00 35.44  ? 409  ASN A C   1 
ATOM   3173  O  O   . ASN A 1 409 ? 72.365  52.970 38.041  1.00 37.08  ? 409  ASN A O   1 
ATOM   3174  C  CB  . ASN A 1 409 ? 75.246  51.939 39.209  1.00 32.76  ? 409  ASN A CB  1 
ATOM   3175  C  CG  . ASN A 1 409 ? 75.759  50.593 39.728  1.00 35.03  ? 409  ASN A CG  1 
ATOM   3176  O  OD1 . ASN A 1 409 ? 74.986  49.656 39.919  1.00 36.22  ? 409  ASN A OD1 1 
ATOM   3177  N  ND2 . ASN A 1 409 ? 77.065  50.498 39.958  1.00 35.88  ? 409  ASN A ND2 1 
ATOM   3178  N  N   . LYS A 1 410 ? 74.067  54.069 37.079  1.00 36.32  ? 410  LYS A N   1 
ATOM   3179  C  CA  . LYS A 1 410 ? 73.258  55.258 36.820  1.00 36.00  ? 410  LYS A CA  1 
ATOM   3180  C  C   . LYS A 1 410 ? 72.220  54.988 35.729  1.00 35.15  ? 410  LYS A C   1 
ATOM   3181  O  O   . LYS A 1 410 ? 71.068  55.423 35.823  1.00 34.66  ? 410  LYS A O   1 
ATOM   3182  C  CB  . LYS A 1 410 ? 74.145  56.424 36.385  1.00 38.50  ? 410  LYS A CB  1 
ATOM   3183  C  CG  . LYS A 1 410 ? 74.998  57.026 37.489  1.00 43.13  ? 410  LYS A CG  1 
ATOM   3184  C  CD  . LYS A 1 410 ? 74.136  57.732 38.527  1.00 46.65  ? 410  LYS A CD  1 
ATOM   3185  C  CE  . LYS A 1 410 ? 74.987  58.380 39.612  1.00 46.62  ? 410  LYS A CE  1 
ATOM   3186  N  NZ  . LYS A 1 410 ? 74.124  58.973 40.673  1.00 50.14  ? 410  LYS A NZ  1 
ATOM   3187  N  N   . TYR A 1 411 ? 72.626  54.267 34.692  1.00 32.76  ? 411  TYR A N   1 
ATOM   3188  C  CA  . TYR A 1 411 ? 71.722  53.974 33.592  1.00 31.74  ? 411  TYR A CA  1 
ATOM   3189  C  C   . TYR A 1 411 ? 70.576  53.040 33.972  1.00 31.47  ? 411  TYR A C   1 
ATOM   3190  O  O   . TYR A 1 411 ? 69.438  53.243 33.560  1.00 30.61  ? 411  TYR A O   1 
ATOM   3191  C  CB  . TYR A 1 411 ? 72.483  53.356 32.419  1.00 28.90  ? 411  TYR A CB  1 
ATOM   3192  C  CG  . TYR A 1 411 ? 71.647  53.254 31.163  1.00 28.43  ? 411  TYR A CG  1 
ATOM   3193  C  CD1 . TYR A 1 411 ? 71.522  54.341 30.299  1.00 26.63  ? 411  TYR A CD1 1 
ATOM   3194  C  CD2 . TYR A 1 411 ? 70.937  52.089 30.865  1.00 27.55  ? 411  TYR A CD2 1 
ATOM   3195  C  CE1 . TYR A 1 411 ? 70.710  54.278 29.170  1.00 28.41  ? 411  TYR A CE1 1 
ATOM   3196  C  CE2 . TYR A 1 411 ? 70.120  52.014 29.740  1.00 28.85  ? 411  TYR A CE2 1 
ATOM   3197  C  CZ  . TYR A 1 411 ? 70.010  53.114 28.897  1.00 29.43  ? 411  TYR A CZ  1 
ATOM   3198  O  OH  . TYR A 1 411 ? 69.188  53.060 27.793  1.00 30.97  ? 411  TYR A OH  1 
ATOM   3199  N  N   . THR A 1 412 ? 70.888  52.016 34.752  1.00 32.75  ? 412  THR A N   1 
ATOM   3200  C  CA  . THR A 1 412 ? 69.907  51.020 35.160  1.00 33.17  ? 412  THR A CA  1 
ATOM   3201  C  C   . THR A 1 412 ? 68.705  51.587 35.923  1.00 34.46  ? 412  THR A C   1 
ATOM   3202  O  O   . THR A 1 412 ? 67.617  51.004 35.908  1.00 32.19  ? 412  THR A O   1 
ATOM   3203  C  CB  . THR A 1 412 ? 70.608  49.914 35.977  1.00 34.01  ? 412  THR A CB  1 
ATOM   3204  O  OG1 . THR A 1 412 ? 71.649  49.346 35.173  1.00 33.87  ? 412  THR A OG1 1 
ATOM   3205  C  CG2 . THR A 1 412 ? 69.634  48.812 36.370  1.00 30.56  ? 412  THR A CG2 1 
ATOM   3206  N  N   . LYS A 1 413 ? 68.888  52.730 36.573  1.00 34.52  ? 413  LYS A N   1 
ATOM   3207  C  CA  . LYS A 1 413 ? 67.783  53.341 37.302  1.00 36.64  ? 413  LYS A CA  1 
ATOM   3208  C  C   . LYS A 1 413 ? 66.668  53.838 36.373  1.00 36.97  ? 413  LYS A C   1 
ATOM   3209  O  O   . LYS A 1 413 ? 65.515  53.953 36.793  1.00 37.63  ? 413  LYS A O   1 
ATOM   3210  C  CB  . LYS A 1 413 ? 68.289  54.502 38.157  1.00 38.86  ? 413  LYS A CB  1 
ATOM   3211  C  CG  . LYS A 1 413 ? 69.170  54.067 39.308  1.00 44.19  ? 413  LYS A CG  1 
ATOM   3212  C  CD  . LYS A 1 413 ? 69.683  55.263 40.095  1.00 48.14  ? 413  LYS A CD  1 
ATOM   3213  C  CE  . LYS A 1 413 ? 70.582  54.819 41.246  1.00 51.17  ? 413  LYS A CE  1 
ATOM   3214  N  NZ  . LYS A 1 413 ? 69.866  53.929 42.213  1.00 53.19  ? 413  LYS A NZ  1 
ATOM   3215  N  N   . PHE A 1 414 ? 67.010  54.115 35.115  1.00 35.59  ? 414  PHE A N   1 
ATOM   3216  C  CA  . PHE A 1 414 ? 66.045  54.620 34.137  1.00 35.93  ? 414  PHE A CA  1 
ATOM   3217  C  C   . PHE A 1 414 ? 65.922  53.735 32.897  1.00 36.34  ? 414  PHE A C   1 
ATOM   3218  O  O   . PHE A 1 414 ? 64.964  53.855 32.134  1.00 37.40  ? 414  PHE A O   1 
ATOM   3219  C  CB  . PHE A 1 414 ? 66.458  56.020 33.668  1.00 37.09  ? 414  PHE A CB  1 
ATOM   3220  C  CG  . PHE A 1 414 ? 66.421  57.069 34.742  1.00 37.74  ? 414  PHE A CG  1 
ATOM   3221  C  CD1 . PHE A 1 414 ? 65.221  57.671 35.102  1.00 37.84  ? 414  PHE A CD1 1 
ATOM   3222  C  CD2 . PHE A 1 414 ? 67.593  57.474 35.373  1.00 38.38  ? 414  PHE A CD2 1 
ATOM   3223  C  CE1 . PHE A 1 414 ? 65.185  58.671 36.076  1.00 39.03  ? 414  PHE A CE1 1 
ATOM   3224  C  CE2 . PHE A 1 414 ? 67.575  58.470 36.348  1.00 39.25  ? 414  PHE A CE2 1 
ATOM   3225  C  CZ  . PHE A 1 414 ? 66.365  59.073 36.701  1.00 39.63  ? 414  PHE A CZ  1 
ATOM   3226  N  N   . GLY A 1 415 ? 66.899  52.861 32.690  1.00 36.60  ? 415  GLY A N   1 
ATOM   3227  C  CA  . GLY A 1 415 ? 66.897  52.003 31.517  1.00 35.80  ? 415  GLY A CA  1 
ATOM   3228  C  C   . GLY A 1 415 ? 65.798  50.965 31.449  1.00 36.96  ? 415  GLY A C   1 
ATOM   3229  O  O   . GLY A 1 415 ? 65.006  50.817 32.379  1.00 38.30  ? 415  GLY A O   1 
ATOM   3230  N  N   . ASN A 1 416 ? 65.767  50.231 30.344  1.00 35.80  ? 416  ASN A N   1 
ATOM   3231  C  CA  . ASN A 1 416 ? 64.763  49.209 30.137  1.00 36.86  ? 416  ASN A CA  1 
ATOM   3232  C  C   . ASN A 1 416 ? 65.387  47.812 30.054  1.00 36.48  ? 416  ASN A C   1 
ATOM   3233  O  O   . ASN A 1 416 ? 64.807  46.905 29.459  1.00 36.25  ? 416  ASN A O   1 
ATOM   3234  C  CB  . ASN A 1 416 ? 63.988  49.509 28.849  1.00 40.29  ? 416  ASN A CB  1 
ATOM   3235  C  CG  . ASN A 1 416 ? 62.712  48.691 28.723  1.00 43.23  ? 416  ASN A CG  1 
ATOM   3236  O  OD1 . ASN A 1 416 ? 62.359  48.247 27.632  1.00 42.91  ? 416  ASN A OD1 1 
ATOM   3237  N  ND2 . ASN A 1 416 ? 62.012  48.508 29.839  1.00 48.41  ? 416  ASN A ND2 1 
ATOM   3238  N  N   . GLY A 1 417 ? 66.567  47.641 30.646  1.00 35.52  ? 417  GLY A N   1 
ATOM   3239  C  CA  . GLY A 1 417 ? 67.219  46.341 30.618  1.00 34.94  ? 417  GLY A CA  1 
ATOM   3240  C  C   . GLY A 1 417 ? 68.730  46.383 30.455  1.00 34.79  ? 417  GLY A C   1 
ATOM   3241  O  O   . GLY A 1 417 ? 69.232  46.784 29.410  1.00 35.95  ? 417  GLY A O   1 
ATOM   3242  N  N   . THR A 1 418 ? 69.458  45.954 31.483  1.00 33.71  ? 418  THR A N   1 
ATOM   3243  C  CA  . THR A 1 418 ? 70.918  45.945 31.446  1.00 31.46  ? 418  THR A CA  1 
ATOM   3244  C  C   . THR A 1 418 ? 71.511  44.545 31.575  1.00 31.38  ? 418  THR A C   1 
ATOM   3245  O  O   . THR A 1 418 ? 71.072  43.750 32.403  1.00 31.88  ? 418  THR A O   1 
ATOM   3246  C  CB  . THR A 1 418 ? 71.511  46.783 32.590  1.00 31.26  ? 418  THR A CB  1 
ATOM   3247  O  OG1 . THR A 1 418 ? 71.088  48.143 32.466  1.00 31.59  ? 418  THR A OG1 1 
ATOM   3248  C  CG2 . THR A 1 418 ? 73.029  46.721 32.560  1.00 30.41  ? 418  THR A CG2 1 
ATOM   3249  N  N   . TYR A 1 419 ? 72.509  44.250 30.749  1.00 31.07  ? 419  TYR A N   1 
ATOM   3250  C  CA  . TYR A 1 419 ? 73.205  42.969 30.802  1.00 31.35  ? 419  TYR A CA  1 
ATOM   3251  C  C   . TYR A 1 419 ? 74.693  43.287 30.891  1.00 31.54  ? 419  TYR A C   1 
ATOM   3252  O  O   . TYR A 1 419 ? 75.239  43.976 30.035  1.00 31.50  ? 419  TYR A O   1 
ATOM   3253  C  CB  . TYR A 1 419 ? 72.903  42.111 29.564  1.00 31.20  ? 419  TYR A CB  1 
ATOM   3254  C  CG  . TYR A 1 419 ? 71.445  41.726 29.458  1.00 32.09  ? 419  TYR A CG  1 
ATOM   3255  C  CD1 . TYR A 1 419 ? 70.544  42.517 28.743  1.00 31.03  ? 419  TYR A CD1 1 
ATOM   3256  C  CD2 . TYR A 1 419 ? 70.951  40.602 30.126  1.00 33.53  ? 419  TYR A CD2 1 
ATOM   3257  C  CE1 . TYR A 1 419 ? 69.187  42.204 28.696  1.00 31.39  ? 419  TYR A CE1 1 
ATOM   3258  C  CE2 . TYR A 1 419 ? 69.591  40.278 30.088  1.00 32.63  ? 419  TYR A CE2 1 
ATOM   3259  C  CZ  . TYR A 1 419 ? 68.718  41.087 29.373  1.00 32.94  ? 419  TYR A CZ  1 
ATOM   3260  O  OH  . TYR A 1 419 ? 67.375  40.791 29.353  1.00 34.74  ? 419  TYR A OH  1 
ATOM   3261  N  N   . LEU A 1 420 ? 75.328  42.789 31.947  1.00 31.54  ? 420  LEU A N   1 
ATOM   3262  C  CA  . LEU A 1 420 ? 76.738  43.030 32.214  1.00 29.99  ? 420  LEU A CA  1 
ATOM   3263  C  C   . LEU A 1 420 ? 77.591  41.778 32.099  1.00 30.54  ? 420  LEU A C   1 
ATOM   3264  O  O   . LEU A 1 420 ? 77.172  40.692 32.508  1.00 33.21  ? 420  LEU A O   1 
ATOM   3265  C  CB  . LEU A 1 420 ? 76.888  43.609 33.619  1.00 29.15  ? 420  LEU A CB  1 
ATOM   3266  C  CG  . LEU A 1 420 ? 78.299  43.896 34.128  1.00 29.42  ? 420  LEU A CG  1 
ATOM   3267  C  CD1 . LEU A 1 420 ? 78.955  44.945 33.247  1.00 28.12  ? 420  LEU A CD1 1 
ATOM   3268  C  CD2 . LEU A 1 420 ? 78.229  44.381 35.568  1.00 26.72  ? 420  LEU A CD2 1 
ATOM   3269  N  N   . TYR A 1 421 ? 78.795  41.937 31.557  1.00 28.39  ? 421  TYR A N   1 
ATOM   3270  C  CA  . TYR A 1 421 ? 79.711  40.817 31.403  1.00 26.80  ? 421  TYR A CA  1 
ATOM   3271  C  C   . TYR A 1 421 ? 81.140  41.167 31.819  1.00 27.37  ? 421  TYR A C   1 
ATOM   3272  O  O   . TYR A 1 421 ? 81.537  42.335 31.843  1.00 25.90  ? 421  TYR A O   1 
ATOM   3273  C  CB  . TYR A 1 421 ? 79.702  40.302 29.947  1.00 26.36  ? 421  TYR A CB  1 
ATOM   3274  C  CG  . TYR A 1 421 ? 80.441  41.166 28.940  1.00 27.86  ? 421  TYR A CG  1 
ATOM   3275  C  CD1 . TYR A 1 421 ? 81.837  41.160 28.874  1.00 27.59  ? 421  TYR A CD1 1 
ATOM   3276  C  CD2 . TYR A 1 421 ? 79.746  42.007 28.064  1.00 27.11  ? 421  TYR A CD2 1 
ATOM   3277  C  CE1 . TYR A 1 421 ? 82.523  41.971 27.966  1.00 27.40  ? 421  TYR A CE1 1 
ATOM   3278  C  CE2 . TYR A 1 421 ? 80.422  42.822 27.151  1.00 26.54  ? 421  TYR A CE2 1 
ATOM   3279  C  CZ  . TYR A 1 421 ? 81.810  42.798 27.109  1.00 27.97  ? 421  TYR A CZ  1 
ATOM   3280  O  OH  . TYR A 1 421 ? 82.488  43.598 26.215  1.00 25.97  ? 421  TYR A OH  1 
ATOM   3281  N  N   . PHE A 1 422 ? 81.899  40.131 32.152  1.00 26.98  ? 422  PHE A N   1 
ATOM   3282  C  CA  . PHE A 1 422 ? 83.293  40.264 32.535  1.00 28.18  ? 422  PHE A CA  1 
ATOM   3283  C  C   . PHE A 1 422 ? 84.038  39.252 31.670  1.00 29.73  ? 422  PHE A C   1 
ATOM   3284  O  O   . PHE A 1 422 ? 83.954  38.043 31.904  1.00 29.04  ? 422  PHE A O   1 
ATOM   3285  C  CB  . PHE A 1 422 ? 83.488  39.918 34.012  1.00 28.35  ? 422  PHE A CB  1 
ATOM   3286  C  CG  . PHE A 1 422 ? 84.883  40.165 34.517  1.00 27.23  ? 422  PHE A CG  1 
ATOM   3287  C  CD1 . PHE A 1 422 ? 85.323  41.459 34.783  1.00 28.82  ? 422  PHE A CD1 1 
ATOM   3288  C  CD2 . PHE A 1 422 ? 85.754  39.103 34.740  1.00 28.10  ? 422  PHE A CD2 1 
ATOM   3289  C  CE1 . PHE A 1 422 ? 86.618  41.695 35.271  1.00 28.73  ? 422  PHE A CE1 1 
ATOM   3290  C  CE2 . PHE A 1 422 ? 87.049  39.324 35.225  1.00 28.24  ? 422  PHE A CE2 1 
ATOM   3291  C  CZ  . PHE A 1 422 ? 87.480  40.623 35.491  1.00 26.97  ? 422  PHE A CZ  1 
ATOM   3292  N  N   . PHE A 1 423 ? 84.746  39.748 30.660  1.00 28.85  ? 423  PHE A N   1 
ATOM   3293  C  CA  . PHE A 1 423 ? 85.492  38.877 29.759  1.00 28.41  ? 423  PHE A CA  1 
ATOM   3294  C  C   . PHE A 1 423 ? 86.874  38.573 30.340  1.00 28.48  ? 423  PHE A C   1 
ATOM   3295  O  O   . PHE A 1 423 ? 87.707  39.473 30.483  1.00 26.25  ? 423  PHE A O   1 
ATOM   3296  C  CB  . PHE A 1 423 ? 85.654  39.542 28.391  1.00 25.66  ? 423  PHE A CB  1 
ATOM   3297  C  CG  . PHE A 1 423 ? 86.230  38.634 27.348  1.00 26.86  ? 423  PHE A CG  1 
ATOM   3298  C  CD1 . PHE A 1 423 ? 85.406  37.796 26.607  1.00 26.46  ? 423  PHE A CD1 1 
ATOM   3299  C  CD2 . PHE A 1 423 ? 87.601  38.601 27.118  1.00 26.11  ? 423  PHE A CD2 1 
ATOM   3300  C  CE1 . PHE A 1 423 ? 85.935  36.936 25.649  1.00 27.02  ? 423  PHE A CE1 1 
ATOM   3301  C  CE2 . PHE A 1 423 ? 88.143  37.745 26.164  1.00 26.79  ? 423  PHE A CE2 1 
ATOM   3302  C  CZ  . PHE A 1 423 ? 87.307  36.909 25.426  1.00 27.24  ? 423  PHE A CZ  1 
ATOM   3303  N  N   . ASN A 1 424 ? 87.122  37.305 30.653  1.00 27.31  ? 424  ASN A N   1 
ATOM   3304  C  CA  . ASN A 1 424 ? 88.403  36.926 31.228  1.00 30.64  ? 424  ASN A CA  1 
ATOM   3305  C  C   . ASN A 1 424 ? 89.027  35.663 30.649  1.00 33.83  ? 424  ASN A C   1 
ATOM   3306  O  O   . ASN A 1 424 ? 89.590  34.854 31.382  1.00 35.96  ? 424  ASN A O   1 
ATOM   3307  C  CB  . ASN A 1 424 ? 88.275  36.786 32.747  1.00 29.99  ? 424  ASN A CB  1 
ATOM   3308  C  CG  . ASN A 1 424 ? 87.306  35.693 33.157  1.00 29.93  ? 424  ASN A CG  1 
ATOM   3309  O  OD1 . ASN A 1 424 ? 86.567  35.159 32.335  1.00 30.25  ? 424  ASN A OD1 1 
ATOM   3310  N  ND2 . ASN A 1 424 ? 87.300  35.364 34.440  1.00 30.59  ? 424  ASN A ND2 1 
ATOM   3311  N  N   . HIS A 1 425 ? 88.929  35.490 29.336  1.00 35.83  ? 425  HIS A N   1 
ATOM   3312  C  CA  . HIS A 1 425 ? 89.537  34.334 28.695  1.00 36.66  ? 425  HIS A CA  1 
ATOM   3313  C  C   . HIS A 1 425 ? 90.793  34.778 27.977  1.00 38.45  ? 425  HIS A C   1 
ATOM   3314  O  O   . HIS A 1 425 ? 90.772  35.760 27.242  1.00 39.87  ? 425  HIS A O   1 
ATOM   3315  C  CB  . HIS A 1 425 ? 88.612  33.694 27.671  1.00 36.12  ? 425  HIS A CB  1 
ATOM   3316  C  CG  . HIS A 1 425 ? 89.282  32.633 26.853  1.00 37.16  ? 425  HIS A CG  1 
ATOM   3317  N  ND1 . HIS A 1 425 ? 89.745  31.455 27.399  1.00 36.97  ? 425  HIS A ND1 1 
ATOM   3318  C  CD2 . HIS A 1 425 ? 89.609  32.592 25.539  1.00 35.83  ? 425  HIS A CD2 1 
ATOM   3319  C  CE1 . HIS A 1 425 ? 90.326  30.734 26.458  1.00 35.85  ? 425  HIS A CE1 1 
ATOM   3320  N  NE2 . HIS A 1 425 ? 90.258  31.401 25.321  1.00 36.71  ? 425  HIS A NE2 1 
ATOM   3321  N  N   . ARG A 1 426 ? 91.881  34.050 28.194  1.00 39.87  ? 426  ARG A N   1 
ATOM   3322  C  CA  . ARG A 1 426 ? 93.162  34.344 27.562  1.00 41.54  ? 426  ARG A CA  1 
ATOM   3323  C  C   . ARG A 1 426 ? 93.300  33.518 26.281  1.00 41.71  ? 426  ARG A C   1 
ATOM   3324  O  O   . ARG A 1 426 ? 93.363  32.290 26.333  1.00 42.39  ? 426  ARG A O   1 
ATOM   3325  C  CB  . ARG A 1 426 ? 94.296  34.003 28.533  1.00 42.96  ? 426  ARG A CB  1 
ATOM   3326  C  CG  . ARG A 1 426 ? 95.662  33.853 27.895  1.00 44.85  ? 426  ARG A CG  1 
ATOM   3327  C  CD  . ARG A 1 426 ? 96.438  35.155 27.853  1.00 46.79  ? 426  ARG A CD  1 
ATOM   3328  N  NE  . ARG A 1 426 ? 97.750  34.948 27.244  1.00 46.57  ? 426  ARG A NE  1 
ATOM   3329  C  CZ  . ARG A 1 426 ? 98.697  35.876 27.154  1.00 47.10  ? 426  ARG A CZ  1 
ATOM   3330  N  NH1 . ARG A 1 426 ? 99.854  35.578 26.572  1.00 44.21  ? 426  ARG A NH1 1 
ATOM   3331  N  NH2 . ARG A 1 426 ? 98.493  37.095 27.649  1.00 46.76  ? 426  ARG A NH2 1 
ATOM   3332  N  N   . ALA A 1 427 ? 93.337  34.191 25.136  1.00 42.40  ? 427  ALA A N   1 
ATOM   3333  C  CA  . ALA A 1 427 ? 93.469  33.504 23.852  1.00 44.44  ? 427  ALA A CA  1 
ATOM   3334  C  C   . ALA A 1 427 ? 94.713  32.628 23.862  1.00 45.14  ? 427  ALA A C   1 
ATOM   3335  O  O   . ALA A 1 427 ? 95.756  33.037 24.366  1.00 45.68  ? 427  ALA A O   1 
ATOM   3336  C  CB  . ALA A 1 427 ? 93.552  34.517 22.716  1.00 43.87  ? 427  ALA A CB  1 
ATOM   3337  N  N   . SER A 1 428 ? 94.598  31.427 23.300  1.00 45.27  ? 428  SER A N   1 
ATOM   3338  C  CA  . SER A 1 428 ? 95.717  30.485 23.253  1.00 46.20  ? 428  SER A CA  1 
ATOM   3339  C  C   . SER A 1 428 ? 96.808  30.864 22.249  1.00 45.95  ? 428  SER A C   1 
ATOM   3340  O  O   . SER A 1 428 ? 97.964  30.488 22.420  1.00 48.34  ? 428  SER A O   1 
ATOM   3341  C  CB  . SER A 1 428 ? 95.200  29.078 22.935  1.00 45.97  ? 428  SER A CB  1 
ATOM   3342  O  OG  . SER A 1 428 ? 94.538  29.055 21.684  1.00 47.57  ? 428  SER A OG  1 
ATOM   3343  N  N   . ASN A 1 429 ? 96.445  31.604 21.207  1.00 46.01  ? 429  ASN A N   1 
ATOM   3344  C  CA  . ASN A 1 429 ? 97.408  32.024 20.189  1.00 45.18  ? 429  ASN A CA  1 
ATOM   3345  C  C   . ASN A 1 429 ? 97.835  33.485 20.336  1.00 44.33  ? 429  ASN A C   1 
ATOM   3346  O  O   . ASN A 1 429 ? 98.299  34.098 19.376  1.00 44.03  ? 429  ASN A O   1 
ATOM   3347  C  CB  . ASN A 1 429 ? 96.822  31.824 18.788  1.00 45.95  ? 429  ASN A CB  1 
ATOM   3348  C  CG  . ASN A 1 429 ? 95.463  32.489 18.623  1.00 47.37  ? 429  ASN A CG  1 
ATOM   3349  O  OD1 . ASN A 1 429 ? 95.166  33.504 19.264  1.00 47.30  ? 429  ASN A OD1 1 
ATOM   3350  N  ND2 . ASN A 1 429 ? 94.633  31.927 17.750  1.00 46.90  ? 429  ASN A ND2 1 
ATOM   3351  N  N   . LEU A 1 430 ? 97.677  34.042 21.531  1.00 43.50  ? 430  LEU A N   1 
ATOM   3352  C  CA  . LEU A 1 430 ? 98.047  35.431 21.781  1.00 42.10  ? 430  LEU A CA  1 
ATOM   3353  C  C   . LEU A 1 430 ? 99.559  35.610 21.627  1.00 41.25  ? 430  LEU A C   1 
ATOM   3354  O  O   . LEU A 1 430 ? 100.342 34.799 22.122  1.00 39.43  ? 430  LEU A O   1 
ATOM   3355  C  CB  . LEU A 1 430 ? 97.609  35.842 23.188  1.00 43.81  ? 430  LEU A CB  1 
ATOM   3356  C  CG  . LEU A 1 430 ? 97.044  37.257 23.335  1.00 46.31  ? 430  LEU A CG  1 
ATOM   3357  C  CD1 . LEU A 1 430 ? 98.090  38.279 22.935  1.00 48.08  ? 430  LEU A CD1 1 
ATOM   3358  C  CD2 . LEU A 1 430 ? 95.802  37.398 22.467  1.00 45.44  ? 430  LEU A CD2 1 
ATOM   3359  N  N   . VAL A 1 431 ? 99.961  36.680 20.944  1.00 38.95  ? 431  VAL A N   1 
ATOM   3360  C  CA  . VAL A 1 431 ? 101.371 36.950 20.702  1.00 37.02  ? 431  VAL A CA  1 
ATOM   3361  C  C   . VAL A 1 431 ? 102.018 37.877 21.729  1.00 36.07  ? 431  VAL A C   1 
ATOM   3362  O  O   . VAL A 1 431 ? 103.223 38.134 21.669  1.00 35.57  ? 431  VAL A O   1 
ATOM   3363  C  CB  . VAL A 1 431 ? 101.582 37.540 19.282  1.00 38.15  ? 431  VAL A CB  1 
ATOM   3364  C  CG1 . VAL A 1 431 ? 101.097 36.550 18.240  1.00 37.93  ? 431  VAL A CG1 1 
ATOM   3365  C  CG2 . VAL A 1 431 ? 100.835 38.855 19.140  1.00 36.83  ? 431  VAL A CG2 1 
ATOM   3366  N  N   . TRP A 1 432 ? 101.221 38.387 22.662  1.00 34.00  ? 432  TRP A N   1 
ATOM   3367  C  CA  . TRP A 1 432 ? 101.753 39.253 23.701  1.00 33.35  ? 432  TRP A CA  1 
ATOM   3368  C  C   . TRP A 1 432 ? 102.158 38.385 24.898  1.00 33.96  ? 432  TRP A C   1 
ATOM   3369  O  O   . TRP A 1 432 ? 101.654 37.271 25.067  1.00 32.58  ? 432  TRP A O   1 
ATOM   3370  C  CB  . TRP A 1 432 ? 100.711 40.282 24.143  1.00 32.55  ? 432  TRP A CB  1 
ATOM   3371  C  CG  . TRP A 1 432 ? 100.340 41.286 23.094  1.00 34.49  ? 432  TRP A CG  1 
ATOM   3372  C  CD1 . TRP A 1 432 ? 99.250  41.250 22.262  1.00 33.71  ? 432  TRP A CD1 1 
ATOM   3373  C  CD2 . TRP A 1 432 ? 101.026 42.509 22.801  1.00 32.62  ? 432  TRP A CD2 1 
ATOM   3374  N  NE1 . TRP A 1 432 ? 99.216  42.384 21.480  1.00 33.10  ? 432  TRP A NE1 1 
ATOM   3375  C  CE2 . TRP A 1 432 ? 100.293 43.171 21.791  1.00 32.76  ? 432  TRP A CE2 1 
ATOM   3376  C  CE3 . TRP A 1 432 ? 102.190 43.111 23.297  1.00 32.93  ? 432  TRP A CE3 1 
ATOM   3377  C  CZ2 . TRP A 1 432 ? 100.685 44.407 21.269  1.00 33.69  ? 432  TRP A CZ2 1 
ATOM   3378  C  CZ3 . TRP A 1 432 ? 102.580 44.338 22.778  1.00 31.71  ? 432  TRP A CZ3 1 
ATOM   3379  C  CH2 . TRP A 1 432 ? 101.827 44.973 21.772  1.00 32.41  ? 432  TRP A CH2 1 
ATOM   3380  N  N   . PRO A 1 433 ? 103.066 38.889 25.750  1.00 34.13  ? 433  PRO A N   1 
ATOM   3381  C  CA  . PRO A 1 433 ? 103.505 38.119 26.919  1.00 35.43  ? 433  PRO A CA  1 
ATOM   3382  C  C   . PRO A 1 433 ? 102.355 37.822 27.881  1.00 36.79  ? 433  PRO A C   1 
ATOM   3383  O  O   . PRO A 1 433 ? 101.329 38.505 27.869  1.00 37.29  ? 433  PRO A O   1 
ATOM   3384  C  CB  . PRO A 1 433 ? 104.571 39.019 27.537  1.00 33.50  ? 433  PRO A CB  1 
ATOM   3385  C  CG  . PRO A 1 433 ? 104.055 40.394 27.223  1.00 34.29  ? 433  PRO A CG  1 
ATOM   3386  C  CD  . PRO A 1 433 ? 103.622 40.255 25.781  1.00 34.30  ? 433  PRO A CD  1 
ATOM   3387  N  N   . GLU A 1 434 ? 102.538 36.804 28.715  1.00 38.10  ? 434  GLU A N   1 
ATOM   3388  C  CA  . GLU A 1 434 ? 101.520 36.397 29.676  1.00 39.12  ? 434  GLU A CA  1 
ATOM   3389  C  C   . GLU A 1 434 ? 101.198 37.407 30.771  1.00 35.88  ? 434  GLU A C   1 
ATOM   3390  O  O   . GLU A 1 434 ? 100.056 37.482 31.223  1.00 35.49  ? 434  GLU A O   1 
ATOM   3391  C  CB  . GLU A 1 434 ? 101.912 35.066 30.321  1.00 43.57  ? 434  GLU A CB  1 
ATOM   3392  C  CG  . GLU A 1 434 ? 101.554 33.860 29.480  1.00 52.04  ? 434  GLU A CG  1 
ATOM   3393  C  CD  . GLU A 1 434 ? 101.981 32.550 30.119  1.00 57.64  ? 434  GLU A CD  1 
ATOM   3394  O  OE1 . GLU A 1 434 ? 101.724 32.360 31.332  1.00 59.82  ? 434  GLU A OE1 1 
ATOM   3395  O  OE2 . GLU A 1 434 ? 102.565 31.706 29.403  1.00 61.31  ? 434  GLU A OE2 1 
ATOM   3396  N  N   . TRP A 1 435 ? 102.183 38.183 31.204  1.00 33.96  ? 435  TRP A N   1 
ATOM   3397  C  CA  . TRP A 1 435 ? 101.926 39.158 32.263  1.00 34.55  ? 435  TRP A CA  1 
ATOM   3398  C  C   . TRP A 1 435 ? 100.847 40.172 31.895  1.00 34.17  ? 435  TRP A C   1 
ATOM   3399  O  O   . TRP A 1 435 ? 100.255 40.798 32.772  1.00 35.83  ? 435  TRP A O   1 
ATOM   3400  C  CB  . TRP A 1 435 ? 103.202 39.917 32.655  1.00 33.55  ? 435  TRP A CB  1 
ATOM   3401  C  CG  . TRP A 1 435 ? 103.676 40.943 31.662  1.00 31.92  ? 435  TRP A CG  1 
ATOM   3402  C  CD1 . TRP A 1 435 ? 104.669 40.788 30.739  1.00 32.16  ? 435  TRP A CD1 1 
ATOM   3403  C  CD2 . TRP A 1 435 ? 103.218 42.297 31.534  1.00 31.95  ? 435  TRP A CD2 1 
ATOM   3404  N  NE1 . TRP A 1 435 ? 104.866 41.961 30.049  1.00 32.20  ? 435  TRP A NE1 1 
ATOM   3405  C  CE2 . TRP A 1 435 ? 103.989 42.905 30.515  1.00 32.56  ? 435  TRP A CE2 1 
ATOM   3406  C  CE3 . TRP A 1 435 ? 102.234 43.058 32.180  1.00 32.84  ? 435  TRP A CE3 1 
ATOM   3407  C  CZ2 . TRP A 1 435 ? 103.807 44.244 30.127  1.00 30.87  ? 435  TRP A CZ2 1 
ATOM   3408  C  CZ3 . TRP A 1 435 ? 102.052 44.395 31.793  1.00 33.10  ? 435  TRP A CZ3 1 
ATOM   3409  C  CH2 . TRP A 1 435 ? 102.838 44.969 30.775  1.00 31.11  ? 435  TRP A CH2 1 
ATOM   3410  N  N   . MET A 1 436 ? 100.591 40.339 30.603  1.00 32.30  ? 436  MET A N   1 
ATOM   3411  C  CA  . MET A 1 436 ? 99.583  41.294 30.165  1.00 30.23  ? 436  MET A CA  1 
ATOM   3412  C  C   . MET A 1 436 ? 98.161  40.748 30.291  1.00 29.74  ? 436  MET A C   1 
ATOM   3413  O  O   . MET A 1 436 ? 97.195  41.505 30.214  1.00 27.49  ? 436  MET A O   1 
ATOM   3414  C  CB  . MET A 1 436 ? 99.873  41.735 28.730  1.00 29.27  ? 436  MET A CB  1 
ATOM   3415  C  CG  . MET A 1 436 ? 101.133 42.589 28.613  1.00 28.87  ? 436  MET A CG  1 
ATOM   3416  S  SD  . MET A 1 436 ? 101.507 43.105 26.932  1.00 30.40  ? 436  MET A SD  1 
ATOM   3417  C  CE  . MET A 1 436 ? 100.210 44.284 26.655  1.00 27.40  ? 436  MET A CE  1 
ATOM   3418  N  N   . GLY A 1 437 ? 98.052  39.434 30.488  1.00 29.49  ? 437  GLY A N   1 
ATOM   3419  C  CA  . GLY A 1 437 ? 96.759  38.786 30.650  1.00 28.76  ? 437  GLY A CA  1 
ATOM   3420  C  C   . GLY A 1 437 ? 95.758  38.929 29.516  1.00 30.63  ? 437  GLY A C   1 
ATOM   3421  O  O   . GLY A 1 437 ? 96.104  38.842 28.330  1.00 29.64  ? 437  GLY A O   1 
ATOM   3422  N  N   . VAL A 1 438 ? 94.499  39.130 29.898  1.00 30.53  ? 438  VAL A N   1 
ATOM   3423  C  CA  . VAL A 1 438 ? 93.407  39.307 28.949  1.00 33.02  ? 438  VAL A CA  1 
ATOM   3424  C  C   . VAL A 1 438 ? 93.438  40.786 28.566  1.00 33.28  ? 438  VAL A C   1 
ATOM   3425  O  O   . VAL A 1 438 ? 92.901  41.646 29.265  1.00 34.85  ? 438  VAL A O   1 
ATOM   3426  C  CB  . VAL A 1 438 ? 92.049  38.934 29.599  1.00 32.87  ? 438  VAL A CB  1 
ATOM   3427  C  CG1 . VAL A 1 438 ? 90.949  38.964 28.562  1.00 33.34  ? 438  VAL A CG1 1 
ATOM   3428  C  CG2 . VAL A 1 438 ? 92.141  37.544 30.226  1.00 30.05  ? 438  VAL A CG2 1 
ATOM   3429  N  N   . ILE A 1 439 ? 94.078  41.064 27.440  1.00 33.14  ? 439  ILE A N   1 
ATOM   3430  C  CA  . ILE A 1 439 ? 94.263  42.423 26.960  1.00 32.81  ? 439  ILE A CA  1 
ATOM   3431  C  C   . ILE A 1 439 ? 93.049  43.178 26.423  1.00 32.43  ? 439  ILE A C   1 
ATOM   3432  O  O   . ILE A 1 439 ? 92.095  42.604 25.885  1.00 29.96  ? 439  ILE A O   1 
ATOM   3433  C  CB  . ILE A 1 439 ? 95.366  42.445 25.885  1.00 33.30  ? 439  ILE A CB  1 
ATOM   3434  C  CG1 . ILE A 1 439 ? 96.571  41.639 26.369  1.00 34.33  ? 439  ILE A CG1 1 
ATOM   3435  C  CG2 . ILE A 1 439 ? 95.811  43.873 25.609  1.00 34.20  ? 439  ILE A CG2 1 
ATOM   3436  C  CD1 . ILE A 1 439 ? 97.697  41.580 25.365  1.00 37.81  ? 439  ILE A CD1 1 
ATOM   3437  N  N   . HIS A 1 440 ? 93.124  44.491 26.592  1.00 32.77  ? 440  HIS A N   1 
ATOM   3438  C  CA  . HIS A 1 440 ? 92.118  45.448 26.132  1.00 34.99  ? 440  HIS A CA  1 
ATOM   3439  C  C   . HIS A 1 440 ? 91.958  45.240 24.621  1.00 34.34  ? 440  HIS A C   1 
ATOM   3440  O  O   . HIS A 1 440 ? 92.943  45.236 23.884  1.00 33.45  ? 440  HIS A O   1 
ATOM   3441  C  CB  . HIS A 1 440 ? 92.649  46.857 26.442  1.00 37.96  ? 440  HIS A CB  1 
ATOM   3442  C  CG  . HIS A 1 440 ? 91.825  47.980 25.893  1.00 43.65  ? 440  HIS A CG  1 
ATOM   3443  N  ND1 . HIS A 1 440 ? 90.600  48.338 26.418  1.00 45.71  ? 440  HIS A ND1 1 
ATOM   3444  C  CD2 . HIS A 1 440 ? 92.096  48.888 24.923  1.00 44.95  ? 440  HIS A CD2 1 
ATOM   3445  C  CE1 . HIS A 1 440 ? 90.157  49.420 25.801  1.00 46.71  ? 440  HIS A CE1 1 
ATOM   3446  N  NE2 . HIS A 1 440 ? 91.047  49.775 24.890  1.00 46.28  ? 440  HIS A NE2 1 
ATOM   3447  N  N   . GLY A 1 441 ? 90.729  45.026 24.165  1.00 33.00  ? 441  GLY A N   1 
ATOM   3448  C  CA  . GLY A 1 441 ? 90.508  44.846 22.741  1.00 32.66  ? 441  GLY A CA  1 
ATOM   3449  C  C   . GLY A 1 441 ? 90.604  43.433 22.183  1.00 33.59  ? 441  GLY A C   1 
ATOM   3450  O  O   . GLY A 1 441 ? 90.203  43.192 21.040  1.00 31.83  ? 441  GLY A O   1 
ATOM   3451  N  N   . TYR A 1 442 ? 91.120  42.481 22.950  1.00 32.53  ? 442  TYR A N   1 
ATOM   3452  C  CA  . TYR A 1 442 ? 91.206  41.141 22.399  1.00 31.86  ? 442  TYR A CA  1 
ATOM   3453  C  C   . TYR A 1 442 ? 89.942  40.294 22.524  1.00 31.14  ? 442  TYR A C   1 
ATOM   3454  O  O   . TYR A 1 442 ? 89.965  39.090 22.286  1.00 31.75  ? 442  TYR A O   1 
ATOM   3455  C  CB  . TYR A 1 442 ? 92.446  40.417 22.940  1.00 33.23  ? 442  TYR A CB  1 
ATOM   3456  C  CG  . TYR A 1 442 ? 93.691  40.872 22.204  1.00 34.65  ? 442  TYR A CG  1 
ATOM   3457  C  CD1 . TYR A 1 442 ? 94.233  42.139 22.432  1.00 33.77  ? 442  TYR A CD1 1 
ATOM   3458  C  CD2 . TYR A 1 442 ? 94.243  40.095 21.178  1.00 35.19  ? 442  TYR A CD2 1 
ATOM   3459  C  CE1 . TYR A 1 442 ? 95.281  42.628 21.652  1.00 33.48  ? 442  TYR A CE1 1 
ATOM   3460  C  CE2 . TYR A 1 442 ? 95.293  40.572 20.392  1.00 34.77  ? 442  TYR A CE2 1 
ATOM   3461  C  CZ  . TYR A 1 442 ? 95.804  41.843 20.634  1.00 35.44  ? 442  TYR A CZ  1 
ATOM   3462  O  OH  . TYR A 1 442 ? 96.828  42.336 19.851  1.00 35.17  ? 442  TYR A OH  1 
ATOM   3463  N  N   . GLU A 1 443 ? 88.831  40.926 22.886  1.00 30.23  ? 443  GLU A N   1 
ATOM   3464  C  CA  . GLU A 1 443 ? 87.572  40.197 22.955  1.00 29.09  ? 443  GLU A CA  1 
ATOM   3465  C  C   . GLU A 1 443 ? 86.898  40.477 21.611  1.00 28.07  ? 443  GLU A C   1 
ATOM   3466  O  O   . GLU A 1 443 ? 85.967  39.789 21.204  1.00 25.92  ? 443  GLU A O   1 
ATOM   3467  C  CB  . GLU A 1 443 ? 86.692  40.680 24.132  1.00 28.28  ? 443  GLU A CB  1 
ATOM   3468  C  CG  . GLU A 1 443 ? 85.786  41.898 23.874  1.00 29.35  ? 443  GLU A CG  1 
ATOM   3469  C  CD  . GLU A 1 443 ? 86.546  43.219 23.761  1.00 32.62  ? 443  GLU A CD  1 
ATOM   3470  O  OE1 . GLU A 1 443 ? 87.763  43.241 24.064  1.00 30.17  ? 443  GLU A OE1 1 
ATOM   3471  O  OE2 . GLU A 1 443 ? 85.914  44.241 23.381  1.00 31.25  ? 443  GLU A OE2 1 
ATOM   3472  N  N   . ILE A 1 444 ? 87.404  41.492 20.914  1.00 28.51  ? 444  ILE A N   1 
ATOM   3473  C  CA  . ILE A 1 444 ? 86.857  41.875 19.621  1.00 28.27  ? 444  ILE A CA  1 
ATOM   3474  C  C   . ILE A 1 444 ? 86.927  40.705 18.657  1.00 28.21  ? 444  ILE A C   1 
ATOM   3475  O  O   . ILE A 1 444 ? 85.941  40.376 17.990  1.00 28.54  ? 444  ILE A O   1 
ATOM   3476  C  CB  . ILE A 1 444 ? 87.620  43.079 19.008  1.00 25.80  ? 444  ILE A CB  1 
ATOM   3477  C  CG1 . ILE A 1 444 ? 87.404  44.326 19.866  1.00 26.33  ? 444  ILE A CG1 1 
ATOM   3478  C  CG2 . ILE A 1 444 ? 87.122  43.335 17.596  1.00 23.66  ? 444  ILE A CG2 1 
ATOM   3479  C  CD1 . ILE A 1 444 ? 88.223  45.540 19.426  1.00 24.43  ? 444  ILE A CD1 1 
ATOM   3480  N  N   . GLU A 1 445 ? 88.090  40.071 18.581  1.00 28.59  ? 445  GLU A N   1 
ATOM   3481  C  CA  . GLU A 1 445 ? 88.230  38.941 17.679  1.00 31.55  ? 445  GLU A CA  1 
ATOM   3482  C  C   . GLU A 1 445 ? 87.165  37.872 17.929  1.00 30.44  ? 445  GLU A C   1 
ATOM   3483  O  O   . GLU A 1 445 ? 86.745  37.187 17.000  1.00 31.31  ? 445  GLU A O   1 
ATOM   3484  C  CB  . GLU A 1 445 ? 89.646  38.351 17.767  1.00 31.62  ? 445  GLU A CB  1 
ATOM   3485  C  CG  . GLU A 1 445 ? 90.182  38.123 19.159  1.00 35.59  ? 445  GLU A CG  1 
ATOM   3486  C  CD  . GLU A 1 445 ? 91.674  37.813 19.137  1.00 38.14  ? 445  GLU A CD  1 
ATOM   3487  O  OE1 . GLU A 1 445 ? 92.448  38.683 18.680  1.00 36.93  ? 445  GLU A OE1 1 
ATOM   3488  O  OE2 . GLU A 1 445 ? 92.073  36.704 19.565  1.00 38.68  ? 445  GLU A OE2 1 
ATOM   3489  N  N   . PHE A 1 446 ? 86.707  37.748 19.171  1.00 29.92  ? 446  PHE A N   1 
ATOM   3490  C  CA  . PHE A 1 446 ? 85.676  36.764 19.492  1.00 30.00  ? 446  PHE A CA  1 
ATOM   3491  C  C   . PHE A 1 446 ? 84.293  37.252 19.076  1.00 29.46  ? 446  PHE A C   1 
ATOM   3492  O  O   . PHE A 1 446 ? 83.426  36.452 18.715  1.00 29.76  ? 446  PHE A O   1 
ATOM   3493  C  CB  . PHE A 1 446 ? 85.671  36.446 20.992  1.00 29.27  ? 446  PHE A CB  1 
ATOM   3494  C  CG  . PHE A 1 446 ? 86.756  35.499 21.410  1.00 29.59  ? 446  PHE A CG  1 
ATOM   3495  C  CD1 . PHE A 1 446 ? 88.040  35.962 21.670  1.00 28.28  ? 446  PHE A CD1 1 
ATOM   3496  C  CD2 . PHE A 1 446 ? 86.503  34.131 21.492  1.00 29.65  ? 446  PHE A CD2 1 
ATOM   3497  C  CE1 . PHE A 1 446 ? 89.058  35.082 22.002  1.00 30.70  ? 446  PHE A CE1 1 
ATOM   3498  C  CE2 . PHE A 1 446 ? 87.515  33.236 21.823  1.00 29.72  ? 446  PHE A CE2 1 
ATOM   3499  C  CZ  . PHE A 1 446 ? 88.798  33.710 22.079  1.00 31.36  ? 446  PHE A CZ  1 
ATOM   3500  N  N   . VAL A 1 447 ? 84.090  38.565 19.132  1.00 27.96  ? 447  VAL A N   1 
ATOM   3501  C  CA  . VAL A 1 447 ? 82.812  39.159 18.758  1.00 26.42  ? 447  VAL A CA  1 
ATOM   3502  C  C   . VAL A 1 447 ? 82.622  39.093 17.246  1.00 26.97  ? 447  VAL A C   1 
ATOM   3503  O  O   . VAL A 1 447 ? 81.497  38.997 16.765  1.00 27.60  ? 447  VAL A O   1 
ATOM   3504  C  CB  . VAL A 1 447 ? 82.725  40.639 19.234  1.00 26.56  ? 447  VAL A CB  1 
ATOM   3505  C  CG1 . VAL A 1 447 ? 81.536  41.341 18.589  1.00 28.67  ? 447  VAL A CG1 1 
ATOM   3506  C  CG2 . VAL A 1 447 ? 82.577  40.686 20.746  1.00 25.06  ? 447  VAL A CG2 1 
ATOM   3507  N  N   . PHE A 1 448 ? 83.723  39.130 16.500  1.00 27.60  ? 448  PHE A N   1 
ATOM   3508  C  CA  . PHE A 1 448 ? 83.647  39.076 15.045  1.00 30.11  ? 448  PHE A CA  1 
ATOM   3509  C  C   . PHE A 1 448 ? 83.822  37.683 14.441  1.00 31.60  ? 448  PHE A C   1 
ATOM   3510  O  O   . PHE A 1 448 ? 83.875  37.532 13.221  1.00 30.78  ? 448  PHE A O   1 
ATOM   3511  C  CB  . PHE A 1 448 ? 84.639  40.063 14.417  1.00 30.77  ? 448  PHE A CB  1 
ATOM   3512  C  CG  . PHE A 1 448 ? 84.132  41.483 14.393  1.00 31.85  ? 448  PHE A CG  1 
ATOM   3513  C  CD1 . PHE A 1 448 ? 84.115  42.253 15.554  1.00 30.03  ? 448  PHE A CD1 1 
ATOM   3514  C  CD2 . PHE A 1 448 ? 83.606  42.027 13.221  1.00 30.65  ? 448  PHE A CD2 1 
ATOM   3515  C  CE1 . PHE A 1 448 ? 83.578  43.542 15.553  1.00 28.75  ? 448  PHE A CE1 1 
ATOM   3516  C  CE2 . PHE A 1 448 ? 83.065  43.316 13.211  1.00 29.62  ? 448  PHE A CE2 1 
ATOM   3517  C  CZ  . PHE A 1 448 ? 83.052  44.073 14.380  1.00 29.06  ? 448  PHE A CZ  1 
ATOM   3518  N  N   . GLY A 1 449 ? 83.908  36.671 15.301  1.00 33.32  ? 449  GLY A N   1 
ATOM   3519  C  CA  . GLY A 1 449 ? 84.022  35.301 14.828  1.00 33.69  ? 449  GLY A CA  1 
ATOM   3520  C  C   . GLY A 1 449 ? 85.337  34.825 14.244  1.00 34.30  ? 449  GLY A C   1 
ATOM   3521  O  O   . GLY A 1 449 ? 85.360  33.796 13.578  1.00 33.81  ? 449  GLY A O   1 
ATOM   3522  N  N   . LEU A 1 450 ? 86.426  35.549 14.485  1.00 34.94  ? 450  LEU A N   1 
ATOM   3523  C  CA  . LEU A 1 450 ? 87.727  35.145 13.965  1.00 35.27  ? 450  LEU A CA  1 
ATOM   3524  C  C   . LEU A 1 450 ? 88.092  33.710 14.353  1.00 36.53  ? 450  LEU A C   1 
ATOM   3525  O  O   . LEU A 1 450 ? 88.745  33.005 13.589  1.00 35.50  ? 450  LEU A O   1 
ATOM   3526  C  CB  . LEU A 1 450 ? 88.825  36.095 14.448  1.00 36.20  ? 450  LEU A CB  1 
ATOM   3527  C  CG  . LEU A 1 450 ? 89.098  37.357 13.626  1.00 38.47  ? 450  LEU A CG  1 
ATOM   3528  C  CD1 . LEU A 1 450 ? 89.415  36.961 12.199  1.00 39.15  ? 450  LEU A CD1 1 
ATOM   3529  C  CD2 . LEU A 1 450 ? 87.899  38.289 13.660  1.00 39.32  ? 450  LEU A CD2 1 
ATOM   3530  N  N   . PRO A 1 451 ? 87.691  33.264 15.553  1.00 37.03  ? 451  PRO A N   1 
ATOM   3531  C  CA  . PRO A 1 451 ? 88.023  31.893 15.950  1.00 37.50  ? 451  PRO A CA  1 
ATOM   3532  C  C   . PRO A 1 451 ? 87.364  30.824 15.073  1.00 38.38  ? 451  PRO A C   1 
ATOM   3533  O  O   . PRO A 1 451 ? 87.743  29.658 15.126  1.00 38.89  ? 451  PRO A O   1 
ATOM   3534  C  CB  . PRO A 1 451 ? 87.539  31.833 17.396  1.00 36.64  ? 451  PRO A CB  1 
ATOM   3535  C  CG  . PRO A 1 451 ? 87.774  33.217 17.875  1.00 36.30  ? 451  PRO A CG  1 
ATOM   3536  C  CD  . PRO A 1 451 ? 87.233  34.037 16.721  1.00 37.76  ? 451  PRO A CD  1 
ATOM   3537  N  N   . LEU A 1 452 ? 86.384  31.225 14.268  1.00 39.56  ? 452  LEU A N   1 
ATOM   3538  C  CA  . LEU A 1 452 ? 85.670  30.295 13.393  1.00 40.30  ? 452  LEU A CA  1 
ATOM   3539  C  C   . LEU A 1 452 ? 86.459  29.865 12.161  1.00 41.44  ? 452  LEU A C   1 
ATOM   3540  O  O   . LEU A 1 452 ? 86.017  28.985 11.428  1.00 43.27  ? 452  LEU A O   1 
ATOM   3541  C  CB  . LEU A 1 452 ? 84.344  30.902 12.921  1.00 39.36  ? 452  LEU A CB  1 
ATOM   3542  C  CG  . LEU A 1 452 ? 83.246  31.277 13.919  1.00 40.59  ? 452  LEU A CG  1 
ATOM   3543  C  CD1 . LEU A 1 452 ? 81.960  30.584 13.495  1.00 38.88  ? 452  LEU A CD1 1 
ATOM   3544  C  CD2 . LEU A 1 452 ? 83.632  30.885 15.341  1.00 39.39  ? 452  LEU A CD2 1 
ATOM   3545  N  N   . VAL A 1 453 ? 87.607  30.486 11.917  1.00 41.92  ? 453  VAL A N   1 
ATOM   3546  C  CA  . VAL A 1 453 ? 88.410  30.131 10.757  1.00 43.53  ? 453  VAL A CA  1 
ATOM   3547  C  C   . VAL A 1 453 ? 89.684  29.391 11.146  1.00 46.78  ? 453  VAL A C   1 
ATOM   3548  O  O   . VAL A 1 453 ? 90.576  29.939 11.799  1.00 45.68  ? 453  VAL A O   1 
ATOM   3549  C  CB  . VAL A 1 453 ? 88.744  31.377 9.899   1.00 44.35  ? 453  VAL A CB  1 
ATOM   3550  C  CG1 . VAL A 1 453 ? 89.068  32.557 10.782  1.00 45.28  ? 453  VAL A CG1 1 
ATOM   3551  C  CG2 . VAL A 1 453 ? 89.907  31.074 8.976   1.00 46.13  ? 453  VAL A CG2 1 
ATOM   3552  N  N   . LYS A 1 454 ? 89.735  28.127 10.726  1.00 50.02  ? 454  LYS A N   1 
ATOM   3553  C  CA  . LYS A 1 454 ? 90.833  27.201 10.995  1.00 52.38  ? 454  LYS A CA  1 
ATOM   3554  C  C   . LYS A 1 454 ? 92.242  27.766 10.882  1.00 53.21  ? 454  LYS A C   1 
ATOM   3555  O  O   . LYS A 1 454 ? 93.049  27.600 11.794  1.00 54.49  ? 454  LYS A O   1 
ATOM   3556  C  CB  . LYS A 1 454 ? 90.739  25.996 10.060  1.00 54.25  ? 454  LYS A CB  1 
ATOM   3557  C  CG  . LYS A 1 454 ? 89.335  25.476 9.805   1.00 58.18  ? 454  LYS A CG  1 
ATOM   3558  C  CD  . LYS A 1 454 ? 88.620  25.044 11.079  1.00 61.55  ? 454  LYS A CD  1 
ATOM   3559  C  CE  . LYS A 1 454 ? 87.708  26.145 11.600  1.00 63.52  ? 454  LYS A CE  1 
ATOM   3560  N  NZ  . LYS A 1 454 ? 86.778  25.640 12.648  1.00 64.51  ? 454  LYS A NZ  1 
ATOM   3561  N  N   . GLU A 1 455 ? 92.544  28.412 9.761   1.00 53.94  ? 455  GLU A N   1 
ATOM   3562  C  CA  . GLU A 1 455 ? 93.879  28.962 9.538   1.00 54.51  ? 455  GLU A CA  1 
ATOM   3563  C  C   . GLU A 1 455 ? 94.383  29.880 10.654  1.00 53.79  ? 455  GLU A C   1 
ATOM   3564  O  O   . GLU A 1 455 ? 95.577  30.186 10.712  1.00 53.01  ? 455  GLU A O   1 
ATOM   3565  C  CB  . GLU A 1 455 ? 93.928  29.720 8.207   1.00 57.50  ? 455  GLU A CB  1 
ATOM   3566  C  CG  . GLU A 1 455 ? 93.284  28.994 7.040   1.00 61.04  ? 455  GLU A CG  1 
ATOM   3567  C  CD  . GLU A 1 455 ? 91.852  29.440 6.807   1.00 64.50  ? 455  GLU A CD  1 
ATOM   3568  O  OE1 . GLU A 1 455 ? 91.651  30.627 6.460   1.00 65.43  ? 455  GLU A OE1 1 
ATOM   3569  O  OE2 . GLU A 1 455 ? 90.930  28.611 6.975   1.00 65.14  ? 455  GLU A OE2 1 
ATOM   3570  N  N   . LEU A 1 456 ? 93.489  30.320 11.536  1.00 51.81  ? 456  LEU A N   1 
ATOM   3571  C  CA  . LEU A 1 456 ? 93.898  31.202 12.623  1.00 50.82  ? 456  LEU A CA  1 
ATOM   3572  C  C   . LEU A 1 456 ? 94.331  30.427 13.861  1.00 50.42  ? 456  LEU A C   1 
ATOM   3573  O  O   . LEU A 1 456 ? 94.741  31.012 14.859  1.00 50.41  ? 456  LEU A O   1 
ATOM   3574  C  CB  . LEU A 1 456 ? 92.775  32.181 12.966  1.00 50.47  ? 456  LEU A CB  1 
ATOM   3575  C  CG  . LEU A 1 456 ? 92.360  33.115 11.823  1.00 49.31  ? 456  LEU A CG  1 
ATOM   3576  C  CD1 . LEU A 1 456 ? 91.418  34.171 12.368  1.00 49.03  ? 456  LEU A CD1 1 
ATOM   3577  C  CD2 . LEU A 1 456 ? 93.590  33.773 11.199  1.00 47.34  ? 456  LEU A CD2 1 
ATOM   3578  N  N   . ASN A 1 457 ? 94.230  29.105 13.783  1.00 49.91  ? 457  ASN A N   1 
ATOM   3579  C  CA  . ASN A 1 457 ? 94.646  28.208 14.857  1.00 49.45  ? 457  ASN A CA  1 
ATOM   3580  C  C   . ASN A 1 457 ? 94.079  28.436 16.260  1.00 48.70  ? 457  ASN A C   1 
ATOM   3581  O  O   . ASN A 1 457 ? 94.830  28.457 17.238  1.00 48.89  ? 457  ASN A O   1 
ATOM   3582  C  CB  . ASN A 1 457 ? 96.179  28.185 14.949  1.00 50.70  ? 457  ASN A CB  1 
ATOM   3583  C  CG  . ASN A 1 457 ? 96.845  27.785 13.643  1.00 52.44  ? 457  ASN A CG  1 
ATOM   3584  O  OD1 . ASN A 1 457 ? 96.503  26.767 13.041  1.00 53.67  ? 457  ASN A OD1 1 
ATOM   3585  N  ND2 . ASN A 1 457 ? 97.812  28.583 13.207  1.00 53.60  ? 457  ASN A ND2 1 
ATOM   3586  N  N   . TYR A 1 458 ? 92.768  28.612 16.369  1.00 46.71  ? 458  TYR A N   1 
ATOM   3587  C  CA  . TYR A 1 458 ? 92.149  28.773 17.678  1.00 43.55  ? 458  TYR A CA  1 
ATOM   3588  C  C   . TYR A 1 458 ? 91.722  27.380 18.120  1.00 43.23  ? 458  TYR A C   1 
ATOM   3589  O  O   . TYR A 1 458 ? 91.670  26.454 17.307  1.00 41.92  ? 458  TYR A O   1 
ATOM   3590  C  CB  . TYR A 1 458 ? 90.912  29.670 17.614  1.00 41.82  ? 458  TYR A CB  1 
ATOM   3591  C  CG  . TYR A 1 458 ? 91.201  31.146 17.533  1.00 40.90  ? 458  TYR A CG  1 
ATOM   3592  C  CD1 . TYR A 1 458 ? 91.619  31.728 16.342  1.00 39.98  ? 458  TYR A CD1 1 
ATOM   3593  C  CD2 . TYR A 1 458 ? 91.045  31.966 18.652  1.00 39.95  ? 458  TYR A CD2 1 
ATOM   3594  C  CE1 . TYR A 1 458 ? 91.871  33.093 16.262  1.00 40.38  ? 458  TYR A CE1 1 
ATOM   3595  C  CE2 . TYR A 1 458 ? 91.297  33.331 18.584  1.00 39.58  ? 458  TYR A CE2 1 
ATOM   3596  C  CZ  . TYR A 1 458 ? 91.708  33.887 17.384  1.00 39.95  ? 458  TYR A CZ  1 
ATOM   3597  O  OH  . TYR A 1 458 ? 91.951  35.237 17.296  1.00 40.61  ? 458  TYR A OH  1 
ATOM   3598  N  N   . THR A 1 459 ? 91.413  27.233 19.403  1.00 41.88  ? 459  THR A N   1 
ATOM   3599  C  CA  . THR A 1 459 ? 90.987  25.946 19.936  1.00 40.99  ? 459  THR A CA  1 
ATOM   3600  C  C   . THR A 1 459 ? 89.496  25.752 19.723  1.00 42.29  ? 459  THR A C   1 
ATOM   3601  O  O   . THR A 1 459 ? 88.741  26.719 19.620  1.00 43.61  ? 459  THR A O   1 
ATOM   3602  C  CB  . THR A 1 459 ? 91.250  25.847 21.439  1.00 39.76  ? 459  THR A CB  1 
ATOM   3603  O  OG1 . THR A 1 459 ? 90.378  26.746 22.129  1.00 40.33  ? 459  THR A OG1 1 
ATOM   3604  C  CG2 . THR A 1 459 ? 92.689  26.206 21.755  1.00 39.63  ? 459  THR A CG2 1 
ATOM   3605  N  N   . ALA A 1 460 ? 89.073  24.496 19.666  1.00 41.57  ? 460  ALA A N   1 
ATOM   3606  C  CA  . ALA A 1 460 ? 87.669  24.181 19.476  1.00 41.18  ? 460  ALA A CA  1 
ATOM   3607  C  C   . ALA A 1 460 ? 86.842  24.820 20.589  1.00 41.15  ? 460  ALA A C   1 
ATOM   3608  O  O   . ALA A 1 460 ? 85.697  25.221 20.372  1.00 41.11  ? 460  ALA A O   1 
ATOM   3609  C  CB  . ALA A 1 460 ? 87.472  22.667 19.475  1.00 42.86  ? 460  ALA A CB  1 
ATOM   3610  N  N   . GLU A 1 461 ? 87.423  24.912 21.780  1.00 41.26  ? 461  GLU A N   1 
ATOM   3611  C  CA  . GLU A 1 461 ? 86.725  25.509 22.912  1.00 43.71  ? 461  GLU A CA  1 
ATOM   3612  C  C   . GLU A 1 461 ? 86.529  27.010 22.703  1.00 43.18  ? 461  GLU A C   1 
ATOM   3613  O  O   . GLU A 1 461 ? 85.518  27.575 23.123  1.00 41.96  ? 461  GLU A O   1 
ATOM   3614  C  CB  . GLU A 1 461 ? 87.496  25.262 24.215  1.00 47.08  ? 461  GLU A CB  1 
ATOM   3615  C  CG  . GLU A 1 461 ? 87.481  23.807 24.681  1.00 52.65  ? 461  GLU A CG  1 
ATOM   3616  C  CD  . GLU A 1 461 ? 88.264  22.879 23.761  1.00 56.24  ? 461  GLU A CD  1 
ATOM   3617  O  OE1 . GLU A 1 461 ? 87.733  21.797 23.415  1.00 57.88  ? 461  GLU A OE1 1 
ATOM   3618  O  OE2 . GLU A 1 461 ? 89.412  23.226 23.392  1.00 57.36  ? 461  GLU A OE2 1 
ATOM   3619  N  N   . GLU A 1 462 ? 87.498  27.647 22.049  1.00 41.87  ? 462  GLU A N   1 
ATOM   3620  C  CA  . GLU A 1 462 ? 87.415  29.077 21.784  1.00 41.64  ? 462  GLU A CA  1 
ATOM   3621  C  C   . GLU A 1 462 ? 86.419  29.350 20.663  1.00 41.48  ? 462  GLU A C   1 
ATOM   3622  O  O   . GLU A 1 462 ? 85.714  30.357 20.687  1.00 41.92  ? 462  GLU A O   1 
ATOM   3623  C  CB  . GLU A 1 462 ? 88.800  29.634 21.435  1.00 39.12  ? 462  GLU A CB  1 
ATOM   3624  C  CG  . GLU A 1 462 ? 89.763  29.594 22.612  1.00 37.73  ? 462  GLU A CG  1 
ATOM   3625  C  CD  . GLU A 1 462 ? 91.182  29.973 22.246  1.00 37.88  ? 462  GLU A CD  1 
ATOM   3626  O  OE1 . GLU A 1 462 ? 91.714  29.422 21.259  1.00 37.66  ? 462  GLU A OE1 1 
ATOM   3627  O  OE2 . GLU A 1 462 ? 91.774  30.811 22.958  1.00 38.75  ? 462  GLU A OE2 1 
ATOM   3628  N  N   . GLU A 1 463 ? 86.345  28.447 19.691  1.00 41.00  ? 463  GLU A N   1 
ATOM   3629  C  CA  . GLU A 1 463 ? 85.405  28.625 18.593  1.00 41.58  ? 463  GLU A CA  1 
ATOM   3630  C  C   . GLU A 1 463 ? 83.990  28.620 19.151  1.00 40.64  ? 463  GLU A C   1 
ATOM   3631  O  O   . GLU A 1 463 ? 83.145  29.424 18.747  1.00 41.62  ? 463  GLU A O   1 
ATOM   3632  C  CB  . GLU A 1 463 ? 85.537  27.508 17.556  1.00 42.94  ? 463  GLU A CB  1 
ATOM   3633  C  CG  . GLU A 1 463 ? 84.618  27.717 16.363  1.00 46.99  ? 463  GLU A CG  1 
ATOM   3634  C  CD  . GLU A 1 463 ? 84.629  26.560 15.388  1.00 50.30  ? 463  GLU A CD  1 
ATOM   3635  O  OE1 . GLU A 1 463 ? 85.722  26.196 14.905  1.00 53.62  ? 463  GLU A OE1 1 
ATOM   3636  O  OE2 . GLU A 1 463 ? 83.543  26.017 15.096  1.00 52.09  ? 463  GLU A OE2 1 
ATOM   3637  N  N   . ALA A 1 464 ? 83.739  27.710 20.086  1.00 38.57  ? 464  ALA A N   1 
ATOM   3638  C  CA  . ALA A 1 464 ? 82.426  27.601 20.703  1.00 35.91  ? 464  ALA A CA  1 
ATOM   3639  C  C   . ALA A 1 464 ? 82.128  28.875 21.481  1.00 34.53  ? 464  ALA A C   1 
ATOM   3640  O  O   . ALA A 1 464 ? 81.001  29.361 21.472  1.00 34.16  ? 464  ALA A O   1 
ATOM   3641  C  CB  . ALA A 1 464 ? 82.377  26.386 21.630  1.00 34.94  ? 464  ALA A CB  1 
ATOM   3642  N  N   . LEU A 1 465 ? 83.146  29.409 22.153  1.00 33.79  ? 465  LEU A N   1 
ATOM   3643  C  CA  . LEU A 1 465 ? 82.989  30.640 22.922  1.00 33.48  ? 465  LEU A CA  1 
ATOM   3644  C  C   . LEU A 1 465 ? 82.603  31.775 21.982  1.00 33.42  ? 465  LEU A C   1 
ATOM   3645  O  O   . LEU A 1 465 ? 81.692  32.554 22.267  1.00 32.25  ? 465  LEU A O   1 
ATOM   3646  C  CB  . LEU A 1 465 ? 84.292  31.004 23.636  1.00 31.42  ? 465  LEU A CB  1 
ATOM   3647  C  CG  . LEU A 1 465 ? 84.320  32.391 24.297  1.00 29.89  ? 465  LEU A CG  1 
ATOM   3648  C  CD1 . LEU A 1 465 ? 83.203  32.511 25.330  1.00 27.61  ? 465  LEU A CD1 1 
ATOM   3649  C  CD2 . LEU A 1 465 ? 85.678  32.617 24.948  1.00 29.09  ? 465  LEU A CD2 1 
ATOM   3650  N  N   . SER A 1 466 ? 83.309  31.860 20.860  1.00 33.80  ? 466  SER A N   1 
ATOM   3651  C  CA  . SER A 1 466 ? 83.035  32.892 19.875  1.00 34.94  ? 466  SER A CA  1 
ATOM   3652  C  C   . SER A 1 466 ? 81.608  32.751 19.354  1.00 36.19  ? 466  SER A C   1 
ATOM   3653  O  O   . SER A 1 466 ? 80.918  33.746 19.146  1.00 35.26  ? 466  SER A O   1 
ATOM   3654  C  CB  . SER A 1 466 ? 84.026  32.794 18.717  1.00 34.50  ? 466  SER A CB  1 
ATOM   3655  O  OG  . SER A 1 466 ? 83.757  33.778 17.739  1.00 34.00  ? 466  SER A OG  1 
ATOM   3656  N  N   . ARG A 1 467 ? 81.158  31.514 19.164  1.00 36.48  ? 467  ARG A N   1 
ATOM   3657  C  CA  . ARG A 1 467 ? 79.810  31.286 18.664  1.00 36.81  ? 467  ARG A CA  1 
ATOM   3658  C  C   . ARG A 1 467 ? 78.735  31.728 19.639  1.00 37.37  ? 467  ARG A C   1 
ATOM   3659  O  O   . ARG A 1 467 ? 77.715  32.277 19.223  1.00 36.97  ? 467  ARG A O   1 
ATOM   3660  C  CB  . ARG A 1 467 ? 79.602  29.814 18.300  1.00 37.76  ? 467  ARG A CB  1 
ATOM   3661  C  CG  . ARG A 1 467 ? 80.254  29.424 16.989  1.00 38.22  ? 467  ARG A CG  1 
ATOM   3662  C  CD  . ARG A 1 467 ? 80.060  27.949 16.686  1.00 38.68  ? 467  ARG A CD  1 
ATOM   3663  N  NE  . ARG A 1 467 ? 80.699  27.590 15.427  1.00 38.16  ? 467  ARG A NE  1 
ATOM   3664  C  CZ  . ARG A 1 467 ? 80.244  27.955 14.235  1.00 40.16  ? 467  ARG A CZ  1 
ATOM   3665  N  NH1 . ARG A 1 467 ? 79.136  28.682 14.138  1.00 37.71  ? 467  ARG A NH1 1 
ATOM   3666  N  NH2 . ARG A 1 467 ? 80.912  27.615 13.142  1.00 41.32  ? 467  ARG A NH2 1 
ATOM   3667  N  N   . ARG A 1 468 ? 78.940  31.491 20.932  1.00 37.41  ? 468  ARG A N   1 
ATOM   3668  C  CA  . ARG A 1 468 ? 77.930  31.909 21.890  1.00 38.03  ? 468  ARG A CA  1 
ATOM   3669  C  C   . ARG A 1 468 ? 77.990  33.412 22.128  1.00 36.10  ? 468  ARG A C   1 
ATOM   3670  O  O   . ARG A 1 468 ? 76.987  34.028 22.474  1.00 36.22  ? 468  ARG A O   1 
ATOM   3671  C  CB  . ARG A 1 468 ? 78.044  31.128 23.209  1.00 39.58  ? 468  ARG A CB  1 
ATOM   3672  C  CG  . ARG A 1 468 ? 79.422  31.035 23.816  1.00 44.26  ? 468  ARG A CG  1 
ATOM   3673  C  CD  . ARG A 1 468 ? 79.396  30.134 25.063  1.00 45.19  ? 468  ARG A CD  1 
ATOM   3674  N  NE  . ARG A 1 468 ? 78.719  30.754 26.199  1.00 45.84  ? 468  ARG A NE  1 
ATOM   3675  C  CZ  . ARG A 1 468 ? 79.333  31.149 27.314  1.00 47.04  ? 468  ARG A CZ  1 
ATOM   3676  N  NH1 . ARG A 1 468 ? 80.642  30.985 27.450  1.00 44.68  ? 468  ARG A NH1 1 
ATOM   3677  N  NH2 . ARG A 1 468 ? 78.637  31.718 28.292  1.00 46.68  ? 468  ARG A NH2 1 
ATOM   3678  N  N   . ILE A 1 469 ? 79.158  34.012 21.930  1.00 35.79  ? 469  ILE A N   1 
ATOM   3679  C  CA  . ILE A 1 469 ? 79.275  35.457 22.103  1.00 34.33  ? 469  ILE A CA  1 
ATOM   3680  C  C   . ILE A 1 469 ? 78.568  36.142 20.927  1.00 34.89  ? 469  ILE A C   1 
ATOM   3681  O  O   . ILE A 1 469 ? 77.833  37.112 21.120  1.00 35.64  ? 469  ILE A O   1 
ATOM   3682  C  CB  . ILE A 1 469 ? 80.752  35.907 22.171  1.00 31.73  ? 469  ILE A CB  1 
ATOM   3683  C  CG1 . ILE A 1 469 ? 81.346  35.508 23.523  1.00 31.03  ? 469  ILE A CG1 1 
ATOM   3684  C  CG2 . ILE A 1 469 ? 80.851  37.413 21.979  1.00 31.59  ? 469  ILE A CG2 1 
ATOM   3685  C  CD1 . ILE A 1 469 ? 82.813  35.822 23.667  1.00 29.09  ? 469  ILE A CD1 1 
ATOM   3686  N  N   . MET A 1 470 ? 78.778  35.626 19.717  1.00 34.36  ? 470  MET A N   1 
ATOM   3687  C  CA  . MET A 1 470 ? 78.136  36.192 18.531  1.00 34.80  ? 470  MET A CA  1 
ATOM   3688  C  C   . MET A 1 470 ? 76.626  36.025 18.632  1.00 35.09  ? 470  MET A C   1 
ATOM   3689  O  O   . MET A 1 470 ? 75.868  36.893 18.196  1.00 34.83  ? 470  MET A O   1 
ATOM   3690  C  CB  . MET A 1 470 ? 78.629  35.510 17.251  1.00 34.69  ? 470  MET A CB  1 
ATOM   3691  C  CG  . MET A 1 470 ? 80.041  35.879 16.830  1.00 34.65  ? 470  MET A CG  1 
ATOM   3692  S  SD  . MET A 1 470 ? 80.383  35.335 15.136  1.00 40.73  ? 470  MET A SD  1 
ATOM   3693  C  CE  . MET A 1 470 ? 80.593  33.578 15.370  1.00 36.28  ? 470  MET A CE  1 
ATOM   3694  N  N   . HIS A 1 471 ? 76.188  34.912 19.217  1.00 35.48  ? 471  HIS A N   1 
ATOM   3695  C  CA  . HIS A 1 471 ? 74.762  34.664 19.368  1.00 35.13  ? 471  HIS A CA  1 
ATOM   3696  C  C   . HIS A 1 471 ? 74.171  35.556 20.448  1.00 33.81  ? 471  HIS A C   1 
ATOM   3697  O  O   . HIS A 1 471 ? 73.027  35.975 20.333  1.00 35.18  ? 471  HIS A O   1 
ATOM   3698  C  CB  . HIS A 1 471 ? 74.483  33.197 19.691  1.00 36.86  ? 471  HIS A CB  1 
ATOM   3699  C  CG  . HIS A 1 471 ? 73.055  32.803 19.477  1.00 41.35  ? 471  HIS A CG  1 
ATOM   3700  N  ND1 . HIS A 1 471 ? 72.402  32.999 18.277  1.00 42.27  ? 471  HIS A ND1 1 
ATOM   3701  C  CD2 . HIS A 1 471 ? 72.143  32.254 20.314  1.00 42.43  ? 471  HIS A CD2 1 
ATOM   3702  C  CE1 . HIS A 1 471 ? 71.151  32.590 18.385  1.00 40.77  ? 471  HIS A CE1 1 
ATOM   3703  N  NE2 . HIS A 1 471 ? 70.967  32.134 19.612  1.00 42.65  ? 471  HIS A NE2 1 
ATOM   3704  N  N   . TYR A 1 472 ? 74.935  35.841 21.500  1.00 32.46  ? 472  TYR A N   1 
ATOM   3705  C  CA  . TYR A 1 472 ? 74.444  36.729 22.556  1.00 32.54  ? 472  TYR A CA  1 
ATOM   3706  C  C   . TYR A 1 472 ? 74.290  38.133 21.978  1.00 31.45  ? 472  TYR A C   1 
ATOM   3707  O  O   . TYR A 1 472 ? 73.274  38.790 22.184  1.00 31.02  ? 472  TYR A O   1 
ATOM   3708  C  CB  . TYR A 1 472 ? 75.420  36.829 23.735  1.00 34.73  ? 472  TYR A CB  1 
ATOM   3709  C  CG  . TYR A 1 472 ? 75.492  35.639 24.662  1.00 37.00  ? 472  TYR A CG  1 
ATOM   3710  C  CD1 . TYR A 1 472 ? 74.348  34.935 25.027  1.00 38.53  ? 472  TYR A CD1 1 
ATOM   3711  C  CD2 . TYR A 1 472 ? 76.706  35.261 25.235  1.00 38.14  ? 472  TYR A CD2 1 
ATOM   3712  C  CE1 . TYR A 1 472 ? 74.413  33.884 25.946  1.00 38.61  ? 472  TYR A CE1 1 
ATOM   3713  C  CE2 . TYR A 1 472 ? 76.779  34.220 26.150  1.00 38.40  ? 472  TYR A CE2 1 
ATOM   3714  C  CZ  . TYR A 1 472 ? 75.633  33.537 26.501  1.00 38.63  ? 472  TYR A CZ  1 
ATOM   3715  O  OH  . TYR A 1 472 ? 75.714  32.504 27.405  1.00 43.89  ? 472  TYR A OH  1 
ATOM   3716  N  N   . TRP A 1 473 ? 75.322  38.589 21.268  1.00 30.87  ? 473  TRP A N   1 
ATOM   3717  C  CA  . TRP A 1 473 ? 75.322  39.916 20.661  1.00 31.38  ? 473  TRP A CA  1 
ATOM   3718  C  C   . TRP A 1 473 ? 74.188  40.084 19.645  1.00 31.52  ? 473  TRP A C   1 
ATOM   3719  O  O   . TRP A 1 473 ? 73.437  41.056 19.697  1.00 31.43  ? 473  TRP A O   1 
ATOM   3720  C  CB  . TRP A 1 473 ? 76.675  40.192 19.978  1.00 30.11  ? 473  TRP A CB  1 
ATOM   3721  C  CG  . TRP A 1 473 ? 77.699  40.917 20.837  1.00 30.38  ? 473  TRP A CG  1 
ATOM   3722  C  CD1 . TRP A 1 473 ? 78.403  42.049 20.499  1.00 29.60  ? 473  TRP A CD1 1 
ATOM   3723  C  CD2 . TRP A 1 473 ? 78.151  40.550 22.151  1.00 28.46  ? 473  TRP A CD2 1 
ATOM   3724  N  NE1 . TRP A 1 473 ? 79.258  42.403 21.517  1.00 25.95  ? 473  TRP A NE1 1 
ATOM   3725  C  CE2 . TRP A 1 473 ? 79.125  41.504 22.542  1.00 27.49  ? 473  TRP A CE2 1 
ATOM   3726  C  CE3 . TRP A 1 473 ? 77.830  39.509 23.034  1.00 27.12  ? 473  TRP A CE3 1 
ATOM   3727  C  CZ2 . TRP A 1 473 ? 79.781  41.445 23.779  1.00 29.04  ? 473  TRP A CZ2 1 
ATOM   3728  C  CZ3 . TRP A 1 473 ? 78.483  39.449 24.266  1.00 30.52  ? 473  TRP A CZ3 1 
ATOM   3729  C  CH2 . TRP A 1 473 ? 79.450  40.414 24.626  1.00 29.37  ? 473  TRP A CH2 1 
ATOM   3730  N  N   . ALA A 1 474 ? 74.071  39.135 18.722  1.00 31.58  ? 474  ALA A N   1 
ATOM   3731  C  CA  . ALA A 1 474 ? 73.040  39.189 17.690  1.00 31.36  ? 474  ALA A CA  1 
ATOM   3732  C  C   . ALA A 1 474 ? 71.631  39.081 18.274  1.00 31.99  ? 474  ALA A C   1 
ATOM   3733  O  O   . ALA A 1 474 ? 70.765  39.912 17.992  1.00 30.86  ? 474  ALA A O   1 
ATOM   3734  C  CB  . ALA A 1 474 ? 73.272  38.084 16.671  1.00 29.89  ? 474  ALA A CB  1 
ATOM   3735  N  N   . THR A 1 475 ? 71.405  38.055 19.087  1.00 31.92  ? 475  THR A N   1 
ATOM   3736  C  CA  . THR A 1 475 ? 70.100  37.846 19.707  1.00 30.86  ? 475  THR A CA  1 
ATOM   3737  C  C   . THR A 1 475 ? 69.695  39.091 20.480  1.00 31.91  ? 475  THR A C   1 
ATOM   3738  O  O   . THR A 1 475 ? 68.529  39.507 20.457  1.00 31.64  ? 475  THR A O   1 
ATOM   3739  C  CB  . THR A 1 475 ? 70.133  36.650 20.661  1.00 28.16  ? 475  THR A CB  1 
ATOM   3740  O  OG1 . THR A 1 475 ? 70.480  35.472 19.920  1.00 30.88  ? 475  THR A OG1 1 
ATOM   3741  C  CG2 . THR A 1 475 ? 68.782  36.456 21.323  1.00 27.51  ? 475  THR A CG2 1 
ATOM   3742  N  N   . PHE A 1 476 ? 70.664  39.687 21.166  1.00 30.88  ? 476  PHE A N   1 
ATOM   3743  C  CA  . PHE A 1 476 ? 70.400  40.900 21.922  1.00 30.48  ? 476  PHE A CA  1 
ATOM   3744  C  C   . PHE A 1 476 ? 69.966  42.017 20.971  1.00 30.27  ? 476  PHE A C   1 
ATOM   3745  O  O   . PHE A 1 476 ? 68.920  42.640 21.167  1.00 30.64  ? 476  PHE A O   1 
ATOM   3746  C  CB  . PHE A 1 476 ? 71.650  41.349 22.682  1.00 29.05  ? 476  PHE A CB  1 
ATOM   3747  C  CG  . PHE A 1 476 ? 71.510  42.702 23.302  1.00 26.72  ? 476  PHE A CG  1 
ATOM   3748  C  CD1 . PHE A 1 476 ? 70.750  42.876 24.456  1.00 26.66  ? 476  PHE A CD1 1 
ATOM   3749  C  CD2 . PHE A 1 476 ? 72.077  43.817 22.695  1.00 22.86  ? 476  PHE A CD2 1 
ATOM   3750  C  CE1 . PHE A 1 476 ? 70.553  44.153 24.994  1.00 28.42  ? 476  PHE A CE1 1 
ATOM   3751  C  CE2 . PHE A 1 476 ? 71.890  45.089 23.216  1.00 24.28  ? 476  PHE A CE2 1 
ATOM   3752  C  CZ  . PHE A 1 476 ? 71.125  45.264 24.370  1.00 25.74  ? 476  PHE A CZ  1 
ATOM   3753  N  N   . ALA A 1 477 ? 70.774  42.263 19.943  1.00 29.29  ? 477  ALA A N   1 
ATOM   3754  C  CA  . ALA A 1 477 ? 70.478  43.313 18.969  1.00 30.18  ? 477  ALA A CA  1 
ATOM   3755  C  C   . ALA A 1 477 ? 69.065  43.207 18.390  1.00 32.01  ? 477  ALA A C   1 
ATOM   3756  O  O   . ALA A 1 477 ? 68.402  44.217 18.161  1.00 30.53  ? 477  ALA A O   1 
ATOM   3757  C  CB  . ALA A 1 477 ? 71.499  43.279 17.844  1.00 27.62  ? 477  ALA A CB  1 
ATOM   3758  N  N   . LYS A 1 478 ? 68.598  41.983 18.168  1.00 33.84  ? 478  LYS A N   1 
ATOM   3759  C  CA  . LYS A 1 478 ? 67.273  41.790 17.601  1.00 37.67  ? 478  LYS A CA  1 
ATOM   3760  C  C   . LYS A 1 478 ? 66.096  41.726 18.573  1.00 37.92  ? 478  LYS A C   1 
ATOM   3761  O  O   . LYS A 1 478 ? 64.953  41.872 18.154  1.00 39.49  ? 478  LYS A O   1 
ATOM   3762  C  CB  . LYS A 1 478 ? 67.270  40.546 16.716  1.00 40.91  ? 478  LYS A CB  1 
ATOM   3763  C  CG  . LYS A 1 478 ? 67.862  39.317 17.361  1.00 46.67  ? 478  LYS A CG  1 
ATOM   3764  C  CD  . LYS A 1 478 ? 68.076  38.208 16.332  1.00 49.41  ? 478  LYS A CD  1 
ATOM   3765  C  CE  . LYS A 1 478 ? 69.053  38.634 15.240  1.00 51.59  ? 478  LYS A CE  1 
ATOM   3766  N  NZ  . LYS A 1 478 ? 69.371  37.527 14.286  1.00 53.46  ? 478  LYS A NZ  1 
ATOM   3767  N  N   . THR A 1 479 ? 66.352  41.535 19.862  1.00 36.36  ? 479  THR A N   1 
ATOM   3768  C  CA  . THR A 1 479 ? 65.249  41.433 20.808  1.00 34.43  ? 479  THR A CA  1 
ATOM   3769  C  C   . THR A 1 479 ? 65.428  42.237 22.085  1.00 36.01  ? 479  THR A C   1 
ATOM   3770  O  O   . THR A 1 479 ? 64.449  42.570 22.755  1.00 36.78  ? 479  THR A O   1 
ATOM   3771  C  CB  . THR A 1 479 ? 65.002  39.957 21.209  1.00 34.58  ? 479  THR A CB  1 
ATOM   3772  O  OG1 . THR A 1 479 ? 66.078  39.502 22.039  1.00 34.20  ? 479  THR A OG1 1 
ATOM   3773  C  CG2 . THR A 1 479 ? 64.922  39.064 19.967  1.00 30.14  ? 479  THR A CG2 1 
ATOM   3774  N  N   . GLY A 1 480 ? 66.672  42.546 22.429  1.00 35.51  ? 480  GLY A N   1 
ATOM   3775  C  CA  . GLY A 1 480 ? 66.926  43.294 23.646  1.00 34.78  ? 480  GLY A CA  1 
ATOM   3776  C  C   . GLY A 1 480 ? 67.252  42.347 24.789  1.00 35.56  ? 480  GLY A C   1 
ATOM   3777  O  O   . GLY A 1 480 ? 67.306  42.753 25.949  1.00 35.30  ? 480  GLY A O   1 
ATOM   3778  N  N   . ASN A 1 481 ? 67.472  41.078 24.453  1.00 34.83  ? 481  ASN A N   1 
ATOM   3779  C  CA  . ASN A 1 481 ? 67.793  40.061 25.443  1.00 35.53  ? 481  ASN A CA  1 
ATOM   3780  C  C   . ASN A 1 481 ? 68.761  39.050 24.837  1.00 34.93  ? 481  ASN A C   1 
ATOM   3781  O  O   . ASN A 1 481 ? 68.437  38.381 23.862  1.00 35.31  ? 481  ASN A O   1 
ATOM   3782  C  CB  . ASN A 1 481 ? 66.516  39.343 25.888  1.00 38.77  ? 481  ASN A CB  1 
ATOM   3783  C  CG  . ASN A 1 481 ? 66.775  38.281 26.942  1.00 40.87  ? 481  ASN A CG  1 
ATOM   3784  O  OD1 . ASN A 1 481 ? 67.742  37.518 26.856  1.00 41.93  ? 481  ASN A OD1 1 
ATOM   3785  N  ND2 . ASN A 1 481 ? 65.899  38.215 27.938  1.00 42.40  ? 481  ASN A ND2 1 
ATOM   3786  N  N   . PRO A 1 482 ? 69.960  38.915 25.420  1.00 35.00  ? 482  PRO A N   1 
ATOM   3787  C  CA  . PRO A 1 482 ? 70.964  37.973 24.914  1.00 36.81  ? 482  PRO A CA  1 
ATOM   3788  C  C   . PRO A 1 482 ? 70.564  36.495 24.972  1.00 38.34  ? 482  PRO A C   1 
ATOM   3789  O  O   . PRO A 1 482 ? 71.214  35.652 24.355  1.00 38.72  ? 482  PRO A O   1 
ATOM   3790  C  CB  . PRO A 1 482 ? 72.186  38.272 25.786  1.00 36.67  ? 482  PRO A CB  1 
ATOM   3791  C  CG  . PRO A 1 482 ? 71.573  38.658 27.087  1.00 35.81  ? 482  PRO A CG  1 
ATOM   3792  C  CD  . PRO A 1 482 ? 70.435  39.572 26.652  1.00 35.05  ? 482  PRO A CD  1 
ATOM   3793  N  N   . ASN A 1 483 ? 69.499  36.186 25.704  1.00 39.21  ? 483  ASN A N   1 
ATOM   3794  C  CA  . ASN A 1 483 ? 69.043  34.806 25.846  1.00 42.27  ? 483  ASN A CA  1 
ATOM   3795  C  C   . ASN A 1 483 ? 67.908  34.465 24.883  1.00 45.82  ? 483  ASN A C   1 
ATOM   3796  O  O   . ASN A 1 483 ? 67.051  35.299 24.606  1.00 46.42  ? 483  ASN A O   1 
ATOM   3797  C  CB  . ASN A 1 483 ? 68.548  34.554 27.278  1.00 39.70  ? 483  ASN A CB  1 
ATOM   3798  C  CG  . ASN A 1 483 ? 69.585  34.887 28.336  1.00 36.41  ? 483  ASN A CG  1 
ATOM   3799  O  OD1 . ASN A 1 483 ? 70.632  34.255 28.415  1.00 36.56  ? 483  ASN A OD1 1 
ATOM   3800  N  ND2 . ASN A 1 483 ? 69.291  35.882 29.157  1.00 35.26  ? 483  ASN A ND2 1 
ATOM   3801  N  N   . GLU A 1 484 ? 67.903  33.237 24.375  1.00 50.51  ? 484  GLU A N   1 
ATOM   3802  C  CA  . GLU A 1 484 ? 66.837  32.796 23.482  1.00 54.57  ? 484  GLU A CA  1 
ATOM   3803  C  C   . GLU A 1 484 ? 65.736  32.170 24.332  1.00 56.81  ? 484  GLU A C   1 
ATOM   3804  O  O   . GLU A 1 484 ? 66.016  31.525 25.343  1.00 57.90  ? 484  GLU A O   1 
ATOM   3805  C  CB  . GLU A 1 484 ? 67.349  31.766 22.472  1.00 55.95  ? 484  GLU A CB  1 
ATOM   3806  C  CG  . GLU A 1 484 ? 68.162  32.354 21.336  1.00 60.21  ? 484  GLU A CG  1 
ATOM   3807  C  CD  . GLU A 1 484 ? 68.405  31.353 20.217  1.00 63.07  ? 484  GLU A CD  1 
ATOM   3808  O  OE1 . GLU A 1 484 ? 69.034  30.304 20.479  1.00 64.34  ? 484  GLU A OE1 1 
ATOM   3809  O  OE2 . GLU A 1 484 ? 67.966  31.613 19.075  1.00 63.52  ? 484  GLU A OE2 1 
ATOM   3810  N  N   . PRO A 1 485 ? 64.467  32.355 23.934  1.00 59.22  ? 485  PRO A N   1 
ATOM   3811  C  CA  . PRO A 1 485 ? 63.305  31.814 24.651  1.00 59.89  ? 485  PRO A CA  1 
ATOM   3812  C  C   . PRO A 1 485 ? 63.371  30.309 24.927  1.00 60.26  ? 485  PRO A C   1 
ATOM   3813  O  O   . PRO A 1 485 ? 64.369  29.649 24.634  1.00 60.08  ? 485  PRO A O   1 
ATOM   3814  C  CB  . PRO A 1 485 ? 62.142  32.179 23.735  1.00 60.94  ? 485  PRO A CB  1 
ATOM   3815  C  CG  . PRO A 1 485 ? 62.602  33.469 23.123  1.00 60.70  ? 485  PRO A CG  1 
ATOM   3816  C  CD  . PRO A 1 485 ? 64.036  33.159 22.776  1.00 59.46  ? 485  PRO A CD  1 
ATOM   3817  N  N   . SER A 1 490 ? 71.976  27.847 30.172  1.00 51.27  ? 490  SER A N   1 
ATOM   3818  C  CA  . SER A 1 490 ? 72.403  28.877 31.115  1.00 51.67  ? 490  SER A CA  1 
ATOM   3819  C  C   . SER A 1 490 ? 71.884  30.238 30.667  1.00 50.07  ? 490  SER A C   1 
ATOM   3820  O  O   . SER A 1 490 ? 72.084  30.639 29.521  1.00 50.94  ? 490  SER A O   1 
ATOM   3821  C  CB  . SER A 1 490 ? 73.932  28.918 31.200  1.00 53.00  ? 490  SER A CB  1 
ATOM   3822  O  OG  . SER A 1 490 ? 74.459  27.675 31.632  1.00 57.06  ? 490  SER A OG  1 
ATOM   3823  N  N   . LYS A 1 491 ? 71.221  30.953 31.566  1.00 47.61  ? 491  LYS A N   1 
ATOM   3824  C  CA  . LYS A 1 491 ? 70.694  32.256 31.205  1.00 46.07  ? 491  LYS A CA  1 
ATOM   3825  C  C   . LYS A 1 491 ? 71.430  33.435 31.818  1.00 43.38  ? 491  LYS A C   1 
ATOM   3826  O  O   . LYS A 1 491 ? 71.644  33.503 33.029  1.00 42.91  ? 491  LYS A O   1 
ATOM   3827  C  CB  . LYS A 1 491 ? 69.207  32.349 31.547  1.00 48.09  ? 491  LYS A CB  1 
ATOM   3828  C  CG  . LYS A 1 491 ? 68.334  31.492 30.650  1.00 51.90  ? 491  LYS A CG  1 
ATOM   3829  C  CD  . LYS A 1 491 ? 66.880  31.930 30.692  1.00 54.27  ? 491  LYS A CD  1 
ATOM   3830  C  CE  . LYS A 1 491 ? 66.044  31.080 29.748  1.00 56.15  ? 491  LYS A CE  1 
ATOM   3831  N  NZ  . LYS A 1 491 ? 66.614  31.052 28.370  1.00 56.82  ? 491  LYS A NZ  1 
ATOM   3832  N  N   . TRP A 1 492 ? 71.822  34.356 30.946  1.00 40.72  ? 492  TRP A N   1 
ATOM   3833  C  CA  . TRP A 1 492 ? 72.515  35.574 31.330  1.00 37.11  ? 492  TRP A CA  1 
ATOM   3834  C  C   . TRP A 1 492 ? 71.502  36.415 32.097  1.00 35.90  ? 492  TRP A C   1 
ATOM   3835  O  O   . TRP A 1 492 ? 70.582  36.984 31.507  1.00 38.02  ? 492  TRP A O   1 
ATOM   3836  C  CB  . TRP A 1 492 ? 72.946  36.318 30.073  1.00 35.12  ? 492  TRP A CB  1 
ATOM   3837  C  CG  . TRP A 1 492 ? 73.812  37.510 30.295  1.00 32.51  ? 492  TRP A CG  1 
ATOM   3838  C  CD1 . TRP A 1 492 ? 73.832  38.333 31.388  1.00 30.03  ? 492  TRP A CD1 1 
ATOM   3839  C  CD2 . TRP A 1 492 ? 74.747  38.055 29.363  1.00 30.50  ? 492  TRP A CD2 1 
ATOM   3840  N  NE1 . TRP A 1 492 ? 74.722  39.357 31.188  1.00 29.81  ? 492  TRP A NE1 1 
ATOM   3841  C  CE2 . TRP A 1 492 ? 75.297  39.210 29.952  1.00 30.01  ? 492  TRP A CE2 1 
ATOM   3842  C  CE3 . TRP A 1 492 ? 75.170  37.679 28.082  1.00 29.36  ? 492  TRP A CE3 1 
ATOM   3843  C  CZ2 . TRP A 1 492 ? 76.252  39.996 29.304  1.00 31.76  ? 492  TRP A CZ2 1 
ATOM   3844  C  CZ3 . TRP A 1 492 ? 76.116  38.458 27.437  1.00 30.02  ? 492  TRP A CZ3 1 
ATOM   3845  C  CH2 . TRP A 1 492 ? 76.647  39.604 28.048  1.00 32.07  ? 492  TRP A CH2 1 
ATOM   3846  N  N   . PRO A 1 493 ? 71.650  36.501 33.424  1.00 34.35  ? 493  PRO A N   1 
ATOM   3847  C  CA  . PRO A 1 493 ? 70.710  37.287 34.219  1.00 33.74  ? 493  PRO A CA  1 
ATOM   3848  C  C   . PRO A 1 493 ? 70.793  38.787 33.990  1.00 34.77  ? 493  PRO A C   1 
ATOM   3849  O  O   . PRO A 1 493 ? 71.850  39.333 33.674  1.00 32.89  ? 493  PRO A O   1 
ATOM   3850  C  CB  . PRO A 1 493 ? 71.066  36.898 35.648  1.00 33.84  ? 493  PRO A CB  1 
ATOM   3851  C  CG  . PRO A 1 493 ? 72.529  36.662 35.561  1.00 32.44  ? 493  PRO A CG  1 
ATOM   3852  C  CD  . PRO A 1 493 ? 72.648  35.857 34.292  1.00 33.63  ? 493  PRO A CD  1 
ATOM   3853  N  N   . LEU A 1 494 ? 69.651  39.434 34.166  1.00 34.55  ? 494  LEU A N   1 
ATOM   3854  C  CA  . LEU A 1 494 ? 69.514  40.865 34.005  1.00 34.84  ? 494  LEU A CA  1 
ATOM   3855  C  C   . LEU A 1 494 ? 70.193  41.557 35.187  1.00 36.50  ? 494  LEU A C   1 
ATOM   3856  O  O   . LEU A 1 494 ? 70.119  41.081 36.322  1.00 36.26  ? 494  LEU A O   1 
ATOM   3857  C  CB  . LEU A 1 494 ? 68.022  41.202 33.965  1.00 36.93  ? 494  LEU A CB  1 
ATOM   3858  C  CG  . LEU A 1 494 ? 67.449  42.510 33.423  1.00 37.56  ? 494  LEU A CG  1 
ATOM   3859  C  CD1 . LEU A 1 494 ? 67.965  42.792 32.025  1.00 35.30  ? 494  LEU A CD1 1 
ATOM   3860  C  CD2 . LEU A 1 494 ? 65.930  42.377 33.395  1.00 37.98  ? 494  LEU A CD2 1 
ATOM   3861  N  N   . PHE A 1 495 ? 70.868  42.671 34.914  1.00 34.50  ? 495  PHE A N   1 
ATOM   3862  C  CA  . PHE A 1 495 ? 71.544  43.436 35.953  1.00 33.03  ? 495  PHE A CA  1 
ATOM   3863  C  C   . PHE A 1 495 ? 70.538  44.394 36.581  1.00 34.05  ? 495  PHE A C   1 
ATOM   3864  O  O   . PHE A 1 495 ? 69.932  45.203 35.886  1.00 35.57  ? 495  PHE A O   1 
ATOM   3865  C  CB  . PHE A 1 495 ? 72.720  44.221 35.347  1.00 31.51  ? 495  PHE A CB  1 
ATOM   3866  C  CG  . PHE A 1 495 ? 73.408  45.151 36.317  1.00 27.50  ? 495  PHE A CG  1 
ATOM   3867  C  CD1 . PHE A 1 495 ? 72.871  46.406 36.602  1.00 25.96  ? 495  PHE A CD1 1 
ATOM   3868  C  CD2 . PHE A 1 495 ? 74.583  44.761 36.961  1.00 24.48  ? 495  PHE A CD2 1 
ATOM   3869  C  CE1 . PHE A 1 495 ? 73.494  47.258 37.517  1.00 28.06  ? 495  PHE A CE1 1 
ATOM   3870  C  CE2 . PHE A 1 495 ? 75.216  45.601 37.879  1.00 22.65  ? 495  PHE A CE2 1 
ATOM   3871  C  CZ  . PHE A 1 495 ? 74.674  46.852 38.161  1.00 26.25  ? 495  PHE A CZ  1 
ATOM   3872  N  N   . THR A 1 496 ? 70.358  44.306 37.894  1.00 35.20  ? 496  THR A N   1 
ATOM   3873  C  CA  . THR A 1 496 ? 69.408  45.178 38.584  1.00 37.02  ? 496  THR A CA  1 
ATOM   3874  C  C   . THR A 1 496 ? 70.098  46.012 39.652  1.00 37.26  ? 496  THR A C   1 
ATOM   3875  O  O   . THR A 1 496 ? 71.177  45.657 40.131  1.00 37.75  ? 496  THR A O   1 
ATOM   3876  C  CB  . THR A 1 496 ? 68.282  44.362 39.259  1.00 36.70  ? 496  THR A CB  1 
ATOM   3877  O  OG1 . THR A 1 496 ? 68.828  43.602 40.344  1.00 37.49  ? 496  THR A OG1 1 
ATOM   3878  C  CG2 . THR A 1 496 ? 67.643  43.414 38.260  1.00 35.06  ? 496  THR A CG2 1 
ATOM   3879  N  N   . THR A 1 497 ? 69.471  47.120 40.024  1.00 37.88  ? 497  THR A N   1 
ATOM   3880  C  CA  . THR A 1 497 ? 70.034  48.002 41.038  1.00 40.79  ? 497  THR A CA  1 
ATOM   3881  C  C   . THR A 1 497 ? 70.260  47.228 42.338  1.00 43.30  ? 497  THR A C   1 
ATOM   3882  O  O   . THR A 1 497 ? 71.257  47.426 43.034  1.00 43.05  ? 497  THR A O   1 
ATOM   3883  C  CB  . THR A 1 497 ? 69.092  49.191 41.315  1.00 40.20  ? 497  THR A CB  1 
ATOM   3884  O  OG1 . THR A 1 497 ? 68.822  49.880 40.090  1.00 39.94  ? 497  THR A OG1 1 
ATOM   3885  C  CG2 . THR A 1 497 ? 69.723  50.157 42.296  1.00 39.04  ? 497  THR A CG2 1 
ATOM   3886  N  N   . LYS A 1 498 ? 69.327  46.332 42.643  1.00 45.69  ? 498  LYS A N   1 
ATOM   3887  C  CA  . LYS A 1 498 ? 69.390  45.522 43.852  1.00 47.71  ? 498  LYS A CA  1 
ATOM   3888  C  C   . LYS A 1 498 ? 70.518  44.492 43.846  1.00 47.14  ? 498  LYS A C   1 
ATOM   3889  O  O   . LYS A 1 498 ? 71.520  44.669 44.532  1.00 49.99  ? 498  LYS A O   1 
ATOM   3890  C  CB  . LYS A 1 498 ? 68.044  44.810 44.075  1.00 50.21  ? 498  LYS A CB  1 
ATOM   3891  C  CG  . LYS A 1 498 ? 68.026  43.811 45.238  1.00 52.72  ? 498  LYS A CG  1 
ATOM   3892  C  CD  . LYS A 1 498 ? 68.101  44.508 46.596  1.00 55.08  ? 498  LYS A CD  1 
ATOM   3893  C  CE  . LYS A 1 498 ? 66.725  44.946 47.090  1.00 56.66  ? 498  LYS A CE  1 
ATOM   3894  N  NZ  . LYS A 1 498 ? 65.878  43.791 47.523  1.00 56.75  ? 498  LYS A NZ  1 
ATOM   3895  N  N   . GLU A 1 499 ? 70.351  43.425 43.067  1.00 45.73  ? 499  GLU A N   1 
ATOM   3896  C  CA  . GLU A 1 499 ? 71.331  42.341 43.002  1.00 44.32  ? 499  GLU A CA  1 
ATOM   3897  C  C   . GLU A 1 499 ? 72.587  42.562 42.156  1.00 42.74  ? 499  GLU A C   1 
ATOM   3898  O  O   . GLU A 1 499 ? 73.597  41.888 42.361  1.00 39.86  ? 499  GLU A O   1 
ATOM   3899  C  CB  . GLU A 1 499 ? 70.630  41.059 42.560  1.00 47.21  ? 499  GLU A CB  1 
ATOM   3900  C  CG  . GLU A 1 499 ? 69.677  40.518 43.610  1.00 52.65  ? 499  GLU A CG  1 
ATOM   3901  C  CD  . GLU A 1 499 ? 68.886  39.326 43.120  1.00 57.27  ? 499  GLU A CD  1 
ATOM   3902  O  OE1 . GLU A 1 499 ? 68.022  39.511 42.236  1.00 60.29  ? 499  GLU A OE1 1 
ATOM   3903  O  OE2 . GLU A 1 499 ? 69.130  38.203 43.614  1.00 59.69  ? 499  GLU A OE2 1 
ATOM   3904  N  N   . GLN A 1 500 ? 72.520  43.484 41.201  1.00 41.14  ? 500  GLN A N   1 
ATOM   3905  C  CA  . GLN A 1 500 ? 73.671  43.805 40.358  1.00 38.45  ? 500  GLN A CA  1 
ATOM   3906  C  C   . GLN A 1 500 ? 74.442  42.576 39.869  1.00 37.01  ? 500  GLN A C   1 
ATOM   3907  O  O   . GLN A 1 500 ? 75.642  42.461 40.104  1.00 35.23  ? 500  GLN A O   1 
ATOM   3908  C  CB  . GLN A 1 500 ? 74.607  44.720 41.146  1.00 38.37  ? 500  GLN A CB  1 
ATOM   3909  C  CG  . GLN A 1 500 ? 73.904  45.944 41.703  1.00 39.84  ? 500  GLN A CG  1 
ATOM   3910  C  CD  . GLN A 1 500 ? 74.733  46.678 42.733  1.00 41.92  ? 500  GLN A CD  1 
ATOM   3911  O  OE1 . GLN A 1 500 ? 75.868  47.066 42.470  1.00 41.71  ? 500  GLN A OE1 1 
ATOM   3912  N  NE2 . GLN A 1 500 ? 74.166  46.878 43.915  1.00 43.12  ? 500  GLN A NE2 1 
ATOM   3913  N  N   . LYS A 1 501 ? 73.760  41.669 39.179  1.00 35.35  ? 501  LYS A N   1 
ATOM   3914  C  CA  . LYS A 1 501 ? 74.403  40.453 38.686  1.00 34.95  ? 501  LYS A CA  1 
ATOM   3915  C  C   . LYS A 1 501 ? 75.086  40.627 37.333  1.00 33.75  ? 501  LYS A C   1 
ATOM   3916  O  O   . LYS A 1 501 ? 74.700  41.481 36.539  1.00 34.27  ? 501  LYS A O   1 
ATOM   3917  C  CB  . LYS A 1 501 ? 73.378  39.325 38.567  1.00 35.88  ? 501  LYS A CB  1 
ATOM   3918  C  CG  . LYS A 1 501 ? 72.729  38.902 39.870  1.00 38.36  ? 501  LYS A CG  1 
ATOM   3919  C  CD  . LYS A 1 501 ? 71.721  37.788 39.623  1.00 39.29  ? 501  LYS A CD  1 
ATOM   3920  C  CE  . LYS A 1 501 ? 71.130  37.262 40.921  1.00 42.43  ? 501  LYS A CE  1 
ATOM   3921  N  NZ  . LYS A 1 501 ? 70.153  36.163 40.683  1.00 43.67  ? 501  LYS A NZ  1 
ATOM   3922  N  N   . PHE A 1 502 ? 76.103  39.806 37.086  1.00 30.71  ? 502  PHE A N   1 
ATOM   3923  C  CA  . PHE A 1 502 ? 76.836  39.819 35.826  1.00 30.12  ? 502  PHE A CA  1 
ATOM   3924  C  C   . PHE A 1 502 ? 77.386  38.419 35.610  1.00 30.52  ? 502  PHE A C   1 
ATOM   3925  O  O   . PHE A 1 502 ? 77.395  37.605 36.533  1.00 29.54  ? 502  PHE A O   1 
ATOM   3926  C  CB  . PHE A 1 502 ? 77.972  40.852 35.853  1.00 28.66  ? 502  PHE A CB  1 
ATOM   3927  C  CG  . PHE A 1 502 ? 79.165  40.445 36.678  1.00 27.82  ? 502  PHE A CG  1 
ATOM   3928  C  CD1 . PHE A 1 502 ? 80.208  39.720 36.112  1.00 27.67  ? 502  PHE A CD1 1 
ATOM   3929  C  CD2 . PHE A 1 502 ? 79.264  40.819 38.012  1.00 27.25  ? 502  PHE A CD2 1 
ATOM   3930  C  CE1 . PHE A 1 502 ? 81.328  39.382 36.863  1.00 27.06  ? 502  PHE A CE1 1 
ATOM   3931  C  CE2 . PHE A 1 502 ? 80.381  40.486 38.773  1.00 25.75  ? 502  PHE A CE2 1 
ATOM   3932  C  CZ  . PHE A 1 502 ? 81.414  39.768 38.198  1.00 25.48  ? 502  PHE A CZ  1 
ATOM   3933  N  N   . ILE A 1 503 ? 77.841  38.131 34.396  1.00 31.15  ? 503  ILE A N   1 
ATOM   3934  C  CA  . ILE A 1 503 ? 78.373  36.807 34.103  1.00 32.47  ? 503  ILE A CA  1 
ATOM   3935  C  C   . ILE A 1 503 ? 79.804  36.841 33.584  1.00 33.81  ? 503  ILE A C   1 
ATOM   3936  O  O   . ILE A 1 503 ? 80.219  37.805 32.939  1.00 33.76  ? 503  ILE A O   1 
ATOM   3937  C  CB  . ILE A 1 503 ? 77.531  36.083 33.027  1.00 32.68  ? 503  ILE A CB  1 
ATOM   3938  C  CG1 . ILE A 1 503 ? 77.674  36.811 31.688  1.00 32.17  ? 503  ILE A CG1 1 
ATOM   3939  C  CG2 . ILE A 1 503 ? 76.069  36.022 33.447  1.00 34.61  ? 503  ILE A CG2 1 
ATOM   3940  C  CD1 . ILE A 1 503 ? 77.129  36.054 30.519  1.00 31.00  ? 503  ILE A CD1 1 
ATOM   3941  N  N   . ASP A 1 504 ? 80.556  35.783 33.871  1.00 35.73  ? 504  ASP A N   1 
ATOM   3942  C  CA  . ASP A 1 504 ? 81.914  35.675 33.370  1.00 38.29  ? 504  ASP A CA  1 
ATOM   3943  C  C   . ASP A 1 504 ? 81.741  35.194 31.943  1.00 38.34  ? 504  ASP A C   1 
ATOM   3944  O  O   . ASP A 1 504 ? 80.756  34.534 31.624  1.00 38.57  ? 504  ASP A O   1 
ATOM   3945  C  CB  . ASP A 1 504 ? 82.731  34.656 34.162  1.00 40.75  ? 504  ASP A CB  1 
ATOM   3946  C  CG  . ASP A 1 504 ? 83.197  35.199 35.496  1.00 46.25  ? 504  ASP A CG  1 
ATOM   3947  O  OD1 . ASP A 1 504 ? 83.575  36.388 35.545  1.00 49.90  ? 504  ASP A OD1 1 
ATOM   3948  O  OD2 . ASP A 1 504 ? 83.201  34.443 36.492  1.00 48.76  ? 504  ASP A OD2 1 
ATOM   3949  N  N   . LEU A 1 505 ? 82.684  35.537 31.081  1.00 39.22  ? 505  LEU A N   1 
ATOM   3950  C  CA  . LEU A 1 505 ? 82.601  35.139 29.686  1.00 37.96  ? 505  LEU A CA  1 
ATOM   3951  C  C   . LEU A 1 505 ? 83.885  34.402 29.342  1.00 37.41  ? 505  LEU A C   1 
ATOM   3952  O  O   . LEU A 1 505 ? 84.908  35.018 29.048  1.00 38.30  ? 505  LEU A O   1 
ATOM   3953  C  CB  . LEU A 1 505 ? 82.434  36.391 28.818  1.00 37.40  ? 505  LEU A CB  1 
ATOM   3954  C  CG  . LEU A 1 505 ? 81.468  36.394 27.628  1.00 37.95  ? 505  LEU A CG  1 
ATOM   3955  C  CD1 . LEU A 1 505 ? 80.169  35.686 27.981  1.00 33.60  ? 505  LEU A CD1 1 
ATOM   3956  C  CD2 . LEU A 1 505 ? 81.202  37.842 27.214  1.00 32.94  ? 505  LEU A CD2 1 
ATOM   3957  N  N   . ASN A 1 506 ? 83.837  33.079 29.401  1.00 36.30  ? 506  ASN A N   1 
ATOM   3958  C  CA  . ASN A 1 506 ? 85.010  32.273 29.098  1.00 38.27  ? 506  ASN A CA  1 
ATOM   3959  C  C   . ASN A 1 506 ? 84.608  30.925 28.517  1.00 39.59  ? 506  ASN A C   1 
ATOM   3960  O  O   . ASN A 1 506 ? 83.447  30.710 28.181  1.00 39.56  ? 506  ASN A O   1 
ATOM   3961  C  CB  . ASN A 1 506 ? 85.852  32.081 30.360  1.00 38.92  ? 506  ASN A CB  1 
ATOM   3962  C  CG  . ASN A 1 506 ? 85.032  31.570 31.531  1.00 41.58  ? 506  ASN A CG  1 
ATOM   3963  O  OD1 . ASN A 1 506 ? 84.389  30.524 31.438  1.00 42.47  ? 506  ASN A OD1 1 
ATOM   3964  N  ND2 . ASN A 1 506 ? 85.047  32.309 32.642  1.00 39.21  ? 506  ASN A ND2 1 
ATOM   3965  N  N   . THR A 1 507 ? 85.573  30.019 28.399  1.00 42.37  ? 507  THR A N   1 
ATOM   3966  C  CA  . THR A 1 507 ? 85.316  28.697 27.835  1.00 44.52  ? 507  THR A CA  1 
ATOM   3967  C  C   . THR A 1 507 ? 84.724  27.715 28.841  1.00 46.40  ? 507  THR A C   1 
ATOM   3968  O  O   . THR A 1 507 ? 84.515  26.546 28.518  1.00 47.80  ? 507  THR A O   1 
ATOM   3969  C  CB  . THR A 1 507 ? 86.601  28.079 27.257  1.00 43.61  ? 507  THR A CB  1 
ATOM   3970  O  OG1 . THR A 1 507 ? 87.550  27.882 28.311  1.00 43.16  ? 507  THR A OG1 1 
ATOM   3971  C  CG2 . THR A 1 507 ? 87.209  28.996 26.206  1.00 42.53  ? 507  THR A CG2 1 
ATOM   3972  N  N   . GLU A 1 508 ? 84.458  28.186 30.055  1.00 47.97  ? 508  GLU A N   1 
ATOM   3973  C  CA  . GLU A 1 508 ? 83.877  27.337 31.089  1.00 50.89  ? 508  GLU A CA  1 
ATOM   3974  C  C   . GLU A 1 508 ? 82.388  27.621 31.232  1.00 52.08  ? 508  GLU A C   1 
ATOM   3975  O  O   . GLU A 1 508 ? 81.914  28.687 30.844  1.00 51.45  ? 508  GLU A O   1 
ATOM   3976  C  CB  . GLU A 1 508 ? 84.539  27.590 32.443  1.00 52.54  ? 508  GLU A CB  1 
ATOM   3977  C  CG  . GLU A 1 508 ? 86.009  27.271 32.512  1.00 57.38  ? 508  GLU A CG  1 
ATOM   3978  C  CD  . GLU A 1 508 ? 86.496  27.205 33.943  1.00 61.42  ? 508  GLU A CD  1 
ATOM   3979  O  OE1 . GLU A 1 508 ? 86.307  28.197 34.682  1.00 62.50  ? 508  GLU A OE1 1 
ATOM   3980  O  OE2 . GLU A 1 508 ? 87.060  26.156 34.331  1.00 65.25  ? 508  GLU A OE2 1 
ATOM   3981  N  N   . PRO A 1 509 ? 81.631  26.665 31.794  1.00 53.30  ? 509  PRO A N   1 
ATOM   3982  C  CA  . PRO A 1 509 ? 80.190  26.855 31.978  1.00 54.29  ? 509  PRO A CA  1 
ATOM   3983  C  C   . PRO A 1 509 ? 79.913  28.182 32.677  1.00 54.69  ? 509  PRO A C   1 
ATOM   3984  O  O   . PRO A 1 509 ? 80.656  28.589 33.571  1.00 54.55  ? 509  PRO A O   1 
ATOM   3985  C  CB  . PRO A 1 509 ? 79.797  25.647 32.821  1.00 54.19  ? 509  PRO A CB  1 
ATOM   3986  C  CG  . PRO A 1 509 ? 80.708  24.583 32.284  1.00 54.02  ? 509  PRO A CG  1 
ATOM   3987  C  CD  . PRO A 1 509 ? 82.039  25.311 32.209  1.00 53.42  ? 509  PRO A CD  1 
ATOM   3988  N  N   . MET A 1 510 ? 78.844  28.850 32.263  1.00 55.34  ? 510  MET A N   1 
ATOM   3989  C  CA  . MET A 1 510 ? 78.476  30.146 32.822  1.00 56.13  ? 510  MET A CA  1 
ATOM   3990  C  C   . MET A 1 510 ? 78.410  30.206 34.343  1.00 55.82  ? 510  MET A C   1 
ATOM   3991  O  O   . MET A 1 510 ? 78.010  29.248 34.999  1.00 57.27  ? 510  MET A O   1 
ATOM   3992  C  CB  . MET A 1 510 ? 77.134  30.595 32.252  1.00 57.82  ? 510  MET A CB  1 
ATOM   3993  C  CG  . MET A 1 510 ? 76.648  31.914 32.812  1.00 59.47  ? 510  MET A CG  1 
ATOM   3994  S  SD  . MET A 1 510 ? 75.038  32.339 32.170  1.00 62.29  ? 510  MET A SD  1 
ATOM   3995  C  CE  . MET A 1 510 ? 75.515  33.191 30.674  1.00 63.23  ? 510  MET A CE  1 
ATOM   3996  N  N   . LYS A 1 511 ? 78.801  31.355 34.889  1.00 54.51  ? 511  LYS A N   1 
ATOM   3997  C  CA  . LYS A 1 511 ? 78.788  31.586 36.329  1.00 52.99  ? 511  LYS A CA  1 
ATOM   3998  C  C   . LYS A 1 511 ? 78.269  32.994 36.600  1.00 50.37  ? 511  LYS A C   1 
ATOM   3999  O  O   . LYS A 1 511 ? 78.743  33.961 36.004  1.00 51.67  ? 511  LYS A O   1 
ATOM   4000  C  CB  . LYS A 1 511 ? 80.199  31.439 36.905  1.00 54.84  ? 511  LYS A CB  1 
ATOM   4001  C  CG  . LYS A 1 511 ? 80.767  30.027 36.831  1.00 58.48  ? 511  LYS A CG  1 
ATOM   4002  C  CD  . LYS A 1 511 ? 80.027  29.073 37.763  1.00 60.98  ? 511  LYS A CD  1 
ATOM   4003  C  CE  . LYS A 1 511 ? 80.159  29.511 39.222  1.00 61.92  ? 511  LYS A CE  1 
ATOM   4004  N  NZ  . LYS A 1 511 ? 79.480  28.575 40.167  1.00 61.46  ? 511  LYS A NZ  1 
ATOM   4005  N  N   . VAL A 1 512 ? 77.295  33.103 37.498  1.00 46.04  ? 512  VAL A N   1 
ATOM   4006  C  CA  . VAL A 1 512 ? 76.711  34.391 37.856  1.00 42.90  ? 512  VAL A CA  1 
ATOM   4007  C  C   . VAL A 1 512 ? 77.378  34.967 39.100  1.00 42.34  ? 512  VAL A C   1 
ATOM   4008  O  O   . VAL A 1 512 ? 77.527  34.276 40.108  1.00 42.60  ? 512  VAL A O   1 
ATOM   4009  C  CB  . VAL A 1 512 ? 75.199  34.260 38.145  1.00 41.76  ? 512  VAL A CB  1 
ATOM   4010  C  CG1 . VAL A 1 512 ? 74.645  35.589 38.636  1.00 40.18  ? 512  VAL A CG1 1 
ATOM   4011  C  CG2 . VAL A 1 512 ? 74.466  33.801 36.895  1.00 42.72  ? 512  VAL A CG2 1 
ATOM   4012  N  N   . HIS A 1 513 ? 77.766  36.237 39.024  1.00 40.40  ? 513  HIS A N   1 
ATOM   4013  C  CA  . HIS A 1 513 ? 78.407  36.923 40.142  1.00 38.00  ? 513  HIS A CA  1 
ATOM   4014  C  C   . HIS A 1 513 ? 77.651  38.200 40.470  1.00 36.40  ? 513  HIS A C   1 
ATOM   4015  O  O   . HIS A 1 513 ? 76.671  38.539 39.811  1.00 36.34  ? 513  HIS A O   1 
ATOM   4016  C  CB  . HIS A 1 513 ? 79.847  37.291 39.793  1.00 37.53  ? 513  HIS A CB  1 
ATOM   4017  C  CG  . HIS A 1 513 ? 80.735  36.112 39.555  1.00 40.39  ? 513  HIS A CG  1 
ATOM   4018  N  ND1 . HIS A 1 513 ? 81.080  35.227 40.553  1.00 41.45  ? 513  HIS A ND1 1 
ATOM   4019  C  CD2 . HIS A 1 513 ? 81.366  35.684 38.437  1.00 41.05  ? 513  HIS A CD2 1 
ATOM   4020  C  CE1 . HIS A 1 513 ? 81.888  34.306 40.060  1.00 43.54  ? 513  HIS A CE1 1 
ATOM   4021  N  NE2 . HIS A 1 513 ? 82.078  34.561 38.778  1.00 43.50  ? 513  HIS A NE2 1 
ATOM   4022  N  N   . GLN A 1 514 ? 78.120  38.911 41.487  1.00 34.15  ? 514  GLN A N   1 
ATOM   4023  C  CA  . GLN A 1 514 ? 77.497  40.157 41.880  1.00 33.77  ? 514  GLN A CA  1 
ATOM   4024  C  C   . GLN A 1 514 ? 78.556  41.184 42.255  1.00 32.71  ? 514  GLN A C   1 
ATOM   4025  O  O   . GLN A 1 514 ? 79.656  40.835 42.679  1.00 30.30  ? 514  GLN A O   1 
ATOM   4026  C  CB  . GLN A 1 514 ? 76.541  39.932 43.054  1.00 35.74  ? 514  GLN A CB  1 
ATOM   4027  C  CG  . GLN A 1 514 ? 75.424  38.935 42.757  1.00 40.89  ? 514  GLN A CG  1 
ATOM   4028  C  CD  . GLN A 1 514 ? 74.381  38.845 43.867  1.00 44.81  ? 514  GLN A CD  1 
ATOM   4029  O  OE1 . GLN A 1 514 ? 73.603  37.894 43.919  1.00 49.15  ? 514  GLN A OE1 1 
ATOM   4030  N  NE2 . GLN A 1 514 ? 74.354  39.841 44.747  1.00 45.35  ? 514  GLN A NE2 1 
ATOM   4031  N  N   . ARG A 1 515 ? 78.208  42.452 42.068  1.00 32.87  ? 515  ARG A N   1 
ATOM   4032  C  CA  . ARG A 1 515 ? 79.077  43.582 42.382  1.00 33.88  ? 515  ARG A CA  1 
ATOM   4033  C  C   . ARG A 1 515 ? 80.502  43.473 41.836  1.00 31.87  ? 515  ARG A C   1 
ATOM   4034  O  O   . ARG A 1 515 ? 81.448  43.213 42.575  1.00 32.56  ? 515  ARG A O   1 
ATOM   4035  C  CB  . ARG A 1 515 ? 79.086  43.787 43.898  1.00 35.70  ? 515  ARG A CB  1 
ATOM   4036  C  CG  . ARG A 1 515 ? 77.677  43.901 44.455  1.00 39.94  ? 515  ARG A CG  1 
ATOM   4037  C  CD  . ARG A 1 515 ? 77.625  44.233 45.934  1.00 41.76  ? 515  ARG A CD  1 
ATOM   4038  N  NE  . ARG A 1 515 ? 76.245  44.488 46.345  1.00 45.73  ? 515  ARG A NE  1 
ATOM   4039  C  CZ  . ARG A 1 515 ? 75.885  44.982 47.527  1.00 48.88  ? 515  ARG A CZ  1 
ATOM   4040  N  NH1 . ARG A 1 515 ? 74.600  45.179 47.797  1.00 49.18  ? 515  ARG A NH1 1 
ATOM   4041  N  NH2 . ARG A 1 515 ? 76.805  45.279 48.442  1.00 48.73  ? 515  ARG A NH2 1 
ATOM   4042  N  N   . LEU A 1 516 ? 80.646  43.678 40.532  1.00 31.68  ? 516  LEU A N   1 
ATOM   4043  C  CA  . LEU A 1 516 ? 81.949  43.619 39.877  1.00 30.15  ? 516  LEU A CA  1 
ATOM   4044  C  C   . LEU A 1 516 ? 82.890  44.670 40.474  1.00 29.58  ? 516  LEU A C   1 
ATOM   4045  O  O   . LEU A 1 516 ? 82.611  45.869 40.417  1.00 28.23  ? 516  LEU A O   1 
ATOM   4046  C  CB  . LEU A 1 516 ? 81.772  43.844 38.370  1.00 32.87  ? 516  LEU A CB  1 
ATOM   4047  C  CG  . LEU A 1 516 ? 83.004  43.997 37.470  1.00 32.68  ? 516  LEU A CG  1 
ATOM   4048  C  CD1 . LEU A 1 516 ? 83.957  42.849 37.666  1.00 31.48  ? 516  LEU A CD1 1 
ATOM   4049  C  CD2 . LEU A 1 516 ? 82.539  44.062 36.017  1.00 34.23  ? 516  LEU A CD2 1 
ATOM   4050  N  N   . ARG A 1 517 ? 83.992  44.200 41.059  1.00 29.00  ? 517  ARG A N   1 
ATOM   4051  C  CA  . ARG A 1 517 ? 84.994  45.048 41.702  1.00 29.71  ? 517  ARG A CA  1 
ATOM   4052  C  C   . ARG A 1 517 ? 84.397  46.237 42.448  1.00 28.48  ? 517  ARG A C   1 
ATOM   4053  O  O   . ARG A 1 517 ? 84.875  47.366 42.325  1.00 27.20  ? 517  ARG A O   1 
ATOM   4054  C  CB  . ARG A 1 517 ? 86.026  45.529 40.668  1.00 33.29  ? 517  ARG A CB  1 
ATOM   4055  C  CG  . ARG A 1 517 ? 86.895  44.394 40.129  1.00 35.11  ? 517  ARG A CG  1 
ATOM   4056  C  CD  . ARG A 1 517 ? 87.949  44.871 39.153  1.00 35.78  ? 517  ARG A CD  1 
ATOM   4057  N  NE  . ARG A 1 517 ? 89.072  45.554 39.791  1.00 38.47  ? 517  ARG A NE  1 
ATOM   4058  C  CZ  . ARG A 1 517 ? 89.927  44.980 40.637  1.00 39.59  ? 517  ARG A CZ  1 
ATOM   4059  N  NH1 . ARG A 1 517 ? 89.789  43.701 40.968  1.00 39.00  ? 517  ARG A NH1 1 
ATOM   4060  N  NH2 . ARG A 1 517 ? 90.942  45.679 41.131  1.00 36.39  ? 517  ARG A NH2 1 
ATOM   4061  N  N   . VAL A 1 518 ? 83.358  45.969 43.238  1.00 27.66  ? 518  VAL A N   1 
ATOM   4062  C  CA  . VAL A 1 518 ? 82.681  47.010 44.001  1.00 25.49  ? 518  VAL A CA  1 
ATOM   4063  C  C   . VAL A 1 518 ? 83.601  47.724 44.984  1.00 26.45  ? 518  VAL A C   1 
ATOM   4064  O  O   . VAL A 1 518 ? 83.498  48.936 45.167  1.00 26.96  ? 518  VAL A O   1 
ATOM   4065  C  CB  . VAL A 1 518 ? 81.463  46.438 44.778  1.00 27.03  ? 518  VAL A CB  1 
ATOM   4066  C  CG1 . VAL A 1 518 ? 81.906  45.338 45.731  1.00 25.36  ? 518  VAL A CG1 1 
ATOM   4067  C  CG2 . VAL A 1 518 ? 80.770  47.558 45.551  1.00 25.17  ? 518  VAL A CG2 1 
ATOM   4068  N  N   . GLN A 1 519 ? 84.502  46.979 45.616  1.00 25.79  ? 519  GLN A N   1 
ATOM   4069  C  CA  . GLN A 1 519 ? 85.423  47.569 46.578  1.00 26.86  ? 519  GLN A CA  1 
ATOM   4070  C  C   . GLN A 1 519 ? 86.279  48.673 45.940  1.00 27.69  ? 519  GLN A C   1 
ATOM   4071  O  O   . GLN A 1 519 ? 86.311  49.808 46.421  1.00 26.83  ? 519  GLN A O   1 
ATOM   4072  C  CB  . GLN A 1 519 ? 86.326  46.481 47.167  1.00 28.12  ? 519  GLN A CB  1 
ATOM   4073  C  CG  . GLN A 1 519 ? 87.029  46.860 48.476  1.00 30.48  ? 519  GLN A CG  1 
ATOM   4074  C  CD  . GLN A 1 519 ? 86.060  47.008 49.647  1.00 33.07  ? 519  GLN A CD  1 
ATOM   4075  O  OE1 . GLN A 1 519 ? 85.190  46.157 49.863  1.00 33.28  ? 519  GLN A OE1 1 
ATOM   4076  N  NE2 . GLN A 1 519 ? 86.212  48.086 50.411  1.00 33.98  ? 519  GLN A NE2 1 
ATOM   4077  N  N   . MET A 1 520 ? 86.967  48.345 44.853  1.00 28.26  ? 520  MET A N   1 
ATOM   4078  C  CA  . MET A 1 520 ? 87.818  49.324 44.183  1.00 29.67  ? 520  MET A CA  1 
ATOM   4079  C  C   . MET A 1 520 ? 87.016  50.449 43.558  1.00 28.92  ? 520  MET A C   1 
ATOM   4080  O  O   . MET A 1 520 ? 87.449  51.598 43.548  1.00 28.23  ? 520  MET A O   1 
ATOM   4081  C  CB  . MET A 1 520 ? 88.666  48.651 43.104  1.00 31.14  ? 520  MET A CB  1 
ATOM   4082  C  CG  . MET A 1 520 ? 89.702  47.686 43.649  1.00 36.67  ? 520  MET A CG  1 
ATOM   4083  S  SD  . MET A 1 520 ? 90.789  48.463 44.865  1.00 42.34  ? 520  MET A SD  1 
ATOM   4084  C  CE  . MET A 1 520 ? 90.039  47.886 46.408  1.00 41.74  ? 520  MET A CE  1 
ATOM   4085  N  N   . CYS A 1 521 ? 85.840  50.128 43.036  1.00 27.96  ? 521  CYS A N   1 
ATOM   4086  C  CA  . CYS A 1 521 ? 85.049  51.165 42.413  1.00 31.30  ? 521  CYS A CA  1 
ATOM   4087  C  C   . CYS A 1 521 ? 84.430  52.126 43.424  1.00 29.87  ? 521  CYS A C   1 
ATOM   4088  O  O   . CYS A 1 521 ? 84.103  53.263 43.081  1.00 32.10  ? 521  CYS A O   1 
ATOM   4089  C  CB  . CYS A 1 521 ? 84.015  50.548 41.464  1.00 32.52  ? 521  CYS A CB  1 
ATOM   4090  S  SG  . CYS A 1 521 ? 84.815  49.787 39.990  1.00 39.45  ? 521  CYS A SG  1 
ATOM   4091  N  N   . VAL A 1 522 ? 84.286  51.698 44.673  1.00 27.39  ? 522  VAL A N   1 
ATOM   4092  C  CA  . VAL A 1 522 ? 83.771  52.621 45.671  1.00 26.72  ? 522  VAL A CA  1 
ATOM   4093  C  C   . VAL A 1 522 ? 84.885  53.649 45.877  1.00 26.51  ? 522  VAL A C   1 
ATOM   4094  O  O   . VAL A 1 522 ? 84.626  54.835 46.052  1.00 25.80  ? 522  VAL A O   1 
ATOM   4095  C  CB  . VAL A 1 522 ? 83.473  51.934 47.017  1.00 27.36  ? 522  VAL A CB  1 
ATOM   4096  C  CG1 . VAL A 1 522 ? 83.246  52.995 48.100  1.00 28.78  ? 522  VAL A CG1 1 
ATOM   4097  C  CG2 . VAL A 1 522 ? 82.232  51.070 46.895  1.00 25.58  ? 522  VAL A CG2 1 
ATOM   4098  N  N   . PHE A 1 523 ? 86.130  53.174 45.837  1.00 24.17  ? 523  PHE A N   1 
ATOM   4099  C  CA  . PHE A 1 523 ? 87.291  54.029 45.998  1.00 22.38  ? 523  PHE A CA  1 
ATOM   4100  C  C   . PHE A 1 523 ? 87.410  55.061 44.870  1.00 24.03  ? 523  PHE A C   1 
ATOM   4101  O  O   . PHE A 1 523 ? 87.584  56.253 45.131  1.00 23.51  ? 523  PHE A O   1 
ATOM   4102  C  CB  . PHE A 1 523 ? 88.570  53.182 46.034  1.00 23.37  ? 523  PHE A CB  1 
ATOM   4103  C  CG  . PHE A 1 523 ? 89.838  53.996 46.027  1.00 21.95  ? 523  PHE A CG  1 
ATOM   4104  C  CD1 . PHE A 1 523 ? 90.301  54.604 47.193  1.00 24.26  ? 523  PHE A CD1 1 
ATOM   4105  C  CD2 . PHE A 1 523 ? 90.544  54.194 44.842  1.00 22.53  ? 523  PHE A CD2 1 
ATOM   4106  C  CE1 . PHE A 1 523 ? 91.457  55.406 47.183  1.00 24.60  ? 523  PHE A CE1 1 
ATOM   4107  C  CE2 . PHE A 1 523 ? 91.696  54.992 44.812  1.00 25.38  ? 523  PHE A CE2 1 
ATOM   4108  C  CZ  . PHE A 1 523 ? 92.156  55.601 45.984  1.00 26.11  ? 523  PHE A CZ  1 
ATOM   4109  N  N   . TRP A 1 524 ? 87.327  54.595 43.624  1.00 22.53  ? 524  TRP A N   1 
ATOM   4110  C  CA  . TRP A 1 524 ? 87.458  55.472 42.461  1.00 25.79  ? 524  TRP A CA  1 
ATOM   4111  C  C   . TRP A 1 524 ? 86.238  56.320 42.118  1.00 27.09  ? 524  TRP A C   1 
ATOM   4112  O  O   . TRP A 1 524 ? 86.379  57.392 41.536  1.00 26.91  ? 524  TRP A O   1 
ATOM   4113  C  CB  . TRP A 1 524 ? 87.842  54.669 41.206  1.00 22.09  ? 524  TRP A CB  1 
ATOM   4114  C  CG  . TRP A 1 524 ? 89.205  54.021 41.253  1.00 23.16  ? 524  TRP A CG  1 
ATOM   4115  C  CD1 . TRP A 1 524 ? 89.476  52.695 41.441  1.00 20.46  ? 524  TRP A CD1 1 
ATOM   4116  C  CD2 . TRP A 1 524 ? 90.476  54.666 41.076  1.00 21.11  ? 524  TRP A CD2 1 
ATOM   4117  N  NE1 . TRP A 1 524 ? 90.827  52.476 41.386  1.00 21.75  ? 524  TRP A NE1 1 
ATOM   4118  C  CE2 . TRP A 1 524 ? 91.466  53.666 41.163  1.00 20.46  ? 524  TRP A CE2 1 
ATOM   4119  C  CE3 . TRP A 1 524 ? 90.871  55.992 40.852  1.00 20.92  ? 524  TRP A CE3 1 
ATOM   4120  C  CZ2 . TRP A 1 524 ? 92.833  53.947 41.033  1.00 22.22  ? 524  TRP A CZ2 1 
ATOM   4121  C  CZ3 . TRP A 1 524 ? 92.232  56.273 40.724  1.00 21.46  ? 524  TRP A CZ3 1 
ATOM   4122  C  CH2 . TRP A 1 524 ? 93.194  55.254 40.815  1.00 20.77  ? 524  TRP A CH2 1 
ATOM   4123  N  N   . ASN A 1 525 ? 85.044  55.846 42.459  1.00 29.69  ? 525  ASN A N   1 
ATOM   4124  C  CA  . ASN A 1 525 ? 83.837  56.596 42.128  1.00 30.60  ? 525  ASN A CA  1 
ATOM   4125  C  C   . ASN A 1 525 ? 83.344  57.509 43.235  1.00 32.89  ? 525  ASN A C   1 
ATOM   4126  O  O   . ASN A 1 525 ? 82.684  58.510 42.960  1.00 33.09  ? 525  ASN A O   1 
ATOM   4127  C  CB  . ASN A 1 525 ? 82.709  55.644 41.713  1.00 29.78  ? 525  ASN A CB  1 
ATOM   4128  C  CG  . ASN A 1 525 ? 83.015  54.909 40.420  1.00 29.52  ? 525  ASN A CG  1 
ATOM   4129  O  OD1 . ASN A 1 525 ? 83.729  55.427 39.565  1.00 31.52  ? 525  ASN A OD1 1 
ATOM   4130  N  ND2 . ASN A 1 525 ? 82.468  53.707 40.265  1.00 26.00  ? 525  ASN A ND2 1 
ATOM   4131  N  N   . GLN A 1 526 ? 83.662  57.175 44.482  1.00 33.45  ? 526  GLN A N   1 
ATOM   4132  C  CA  . GLN A 1 526 ? 83.218  57.992 45.601  1.00 34.48  ? 526  GLN A CA  1 
ATOM   4133  C  C   . GLN A 1 526 ? 84.320  58.619 46.454  1.00 35.11  ? 526  GLN A C   1 
ATOM   4134  O  O   . GLN A 1 526 ? 84.382  59.845 46.587  1.00 35.27  ? 526  GLN A O   1 
ATOM   4135  C  CB  . GLN A 1 526 ? 82.282  57.186 46.498  1.00 36.54  ? 526  GLN A CB  1 
ATOM   4136  C  CG  . GLN A 1 526 ? 80.930  56.905 45.882  1.00 42.76  ? 526  GLN A CG  1 
ATOM   4137  C  CD  . GLN A 1 526 ? 79.925  56.390 46.899  1.00 49.19  ? 526  GLN A CD  1 
ATOM   4138  O  OE1 . GLN A 1 526 ? 80.044  55.268 47.402  1.00 50.51  ? 526  GLN A OE1 1 
ATOM   4139  N  NE2 . GLN A 1 526 ? 78.930  57.216 47.216  1.00 50.88  ? 526  GLN A NE2 1 
ATOM   4140  N  N   . PHE A 1 527 ? 85.197  57.800 47.027  1.00 32.72  ? 527  PHE A N   1 
ATOM   4141  C  CA  . PHE A 1 527 ? 86.237  58.346 47.881  1.00 31.20  ? 527  PHE A CA  1 
ATOM   4142  C  C   . PHE A 1 527 ? 87.224  59.306 47.227  1.00 31.23  ? 527  PHE A C   1 
ATOM   4143  O  O   . PHE A 1 527 ? 87.291  60.472 47.609  1.00 31.24  ? 527  PHE A O   1 
ATOM   4144  C  CB  . PHE A 1 527 ? 87.020  57.233 48.576  1.00 29.48  ? 527  PHE A CB  1 
ATOM   4145  C  CG  . PHE A 1 527 ? 87.991  57.743 49.604  1.00 28.05  ? 527  PHE A CG  1 
ATOM   4146  C  CD1 . PHE A 1 527 ? 87.532  58.372 50.756  1.00 28.50  ? 527  PHE A CD1 1 
ATOM   4147  C  CD2 . PHE A 1 527 ? 89.361  57.622 49.409  1.00 28.09  ? 527  PHE A CD2 1 
ATOM   4148  C  CE1 . PHE A 1 527 ? 88.421  58.874 51.701  1.00 27.90  ? 527  PHE A CE1 1 
ATOM   4149  C  CE2 . PHE A 1 527 ? 90.262  58.120 50.346  1.00 28.39  ? 527  PHE A CE2 1 
ATOM   4150  C  CZ  . PHE A 1 527 ? 89.789  58.748 51.497  1.00 28.78  ? 527  PHE A CZ  1 
ATOM   4151  N  N   . LEU A 1 528 ? 87.993  58.830 46.252  1.00 31.54  ? 528  LEU A N   1 
ATOM   4152  C  CA  . LEU A 1 528 ? 88.984  59.689 45.610  1.00 33.23  ? 528  LEU A CA  1 
ATOM   4153  C  C   . LEU A 1 528 ? 88.381  60.991 45.097  1.00 34.06  ? 528  LEU A C   1 
ATOM   4154  O  O   . LEU A 1 528 ? 88.880  62.073 45.410  1.00 35.98  ? 528  LEU A O   1 
ATOM   4155  C  CB  . LEU A 1 528 ? 89.695  58.953 44.471  1.00 32.10  ? 528  LEU A CB  1 
ATOM   4156  C  CG  . LEU A 1 528 ? 90.928  59.668 43.904  1.00 32.87  ? 528  LEU A CG  1 
ATOM   4157  C  CD1 . LEU A 1 528 ? 91.979  59.833 44.993  1.00 35.93  ? 528  LEU A CD1 1 
ATOM   4158  C  CD2 . LEU A 1 528 ? 91.504  58.869 42.751  1.00 32.41  ? 528  LEU A CD2 1 
ATOM   4159  N  N   . PRO A 1 529 ? 87.303  60.912 44.302  1.00 34.14  ? 529  PRO A N   1 
ATOM   4160  C  CA  . PRO A 1 529 ? 86.690  62.142 43.789  1.00 35.24  ? 529  PRO A CA  1 
ATOM   4161  C  C   . PRO A 1 529 ? 86.457  63.151 44.909  1.00 36.55  ? 529  PRO A C   1 
ATOM   4162  O  O   . PRO A 1 529 ? 86.841  64.315 44.806  1.00 39.18  ? 529  PRO A O   1 
ATOM   4163  C  CB  . PRO A 1 529 ? 85.385  61.644 43.173  1.00 33.89  ? 529  PRO A CB  1 
ATOM   4164  C  CG  . PRO A 1 529 ? 85.771  60.303 42.646  1.00 33.36  ? 529  PRO A CG  1 
ATOM   4165  C  CD  . PRO A 1 529 ? 86.607  59.721 43.779  1.00 34.74  ? 529  PRO A CD  1 
ATOM   4166  N  N   . LYS A 1 530 ? 85.837  62.686 45.985  1.00 37.54  ? 530  LYS A N   1 
ATOM   4167  C  CA  . LYS A 1 530 ? 85.545  63.527 47.134  1.00 37.89  ? 530  LYS A CA  1 
ATOM   4168  C  C   . LYS A 1 530 ? 86.819  64.072 47.780  1.00 37.47  ? 530  LYS A C   1 
ATOM   4169  O  O   . LYS A 1 530 ? 86.854  65.218 48.224  1.00 37.71  ? 530  LYS A O   1 
ATOM   4170  C  CB  . LYS A 1 530 ? 84.733  62.723 48.151  1.00 39.61  ? 530  LYS A CB  1 
ATOM   4171  C  CG  . LYS A 1 530 ? 84.144  63.535 49.291  1.00 43.05  ? 530  LYS A CG  1 
ATOM   4172  C  CD  . LYS A 1 530 ? 82.934  62.814 49.877  1.00 45.91  ? 530  LYS A CD  1 
ATOM   4173  C  CE  . LYS A 1 530 ? 82.373  63.527 51.101  1.00 48.70  ? 530  LYS A CE  1 
ATOM   4174  N  NZ  . LYS A 1 530 ? 83.315  63.472 52.260  1.00 49.95  ? 530  LYS A NZ  1 
ATOM   4175  N  N   . LEU A 1 531 ? 87.867  63.255 47.819  1.00 36.86  ? 531  LEU A N   1 
ATOM   4176  C  CA  . LEU A 1 531 ? 89.131  63.670 48.418  1.00 37.08  ? 531  LEU A CA  1 
ATOM   4177  C  C   . LEU A 1 531 ? 89.841  64.757 47.617  1.00 38.80  ? 531  LEU A C   1 
ATOM   4178  O  O   . LEU A 1 531 ? 90.404  65.686 48.191  1.00 38.04  ? 531  LEU A O   1 
ATOM   4179  C  CB  . LEU A 1 531 ? 90.057  62.464 48.587  1.00 35.28  ? 531  LEU A CB  1 
ATOM   4180  C  CG  . LEU A 1 531 ? 91.457  62.725 49.144  1.00 33.57  ? 531  LEU A CG  1 
ATOM   4181  C  CD1 . LEU A 1 531 ? 91.966  61.489 49.856  1.00 34.97  ? 531  LEU A CD1 1 
ATOM   4182  C  CD2 . LEU A 1 531 ? 92.393  63.125 48.022  1.00 33.19  ? 531  LEU A CD2 1 
ATOM   4183  N  N   . LEU A 1 532 ? 89.820  64.637 46.293  1.00 40.23  ? 532  LEU A N   1 
ATOM   4184  C  CA  . LEU A 1 532 ? 90.465  65.627 45.436  1.00 42.89  ? 532  LEU A CA  1 
ATOM   4185  C  C   . LEU A 1 532 ? 89.684  66.945 45.434  1.00 44.53  ? 532  LEU A C   1 
ATOM   4186  O  O   . LEU A 1 532 ? 90.262  68.021 45.289  1.00 42.18  ? 532  LEU A O   1 
ATOM   4187  C  CB  . LEU A 1 532 ? 90.600  65.082 44.009  1.00 42.16  ? 532  LEU A CB  1 
ATOM   4188  C  CG  . LEU A 1 532 ? 91.529  63.875 43.822  1.00 42.23  ? 532  LEU A CG  1 
ATOM   4189  C  CD1 . LEU A 1 532 ? 91.434  63.368 42.388  1.00 41.16  ? 532  LEU A CD1 1 
ATOM   4190  C  CD2 . LEU A 1 532 ? 92.960  64.263 44.161  1.00 38.88  ? 532  LEU A CD2 1 
ATOM   4191  N  N   . ASN A 1 533 ? 88.368  66.857 45.599  1.00 47.96  ? 533  ASN A N   1 
ATOM   4192  C  CA  . ASN A 1 533 ? 87.532  68.049 45.632  1.00 50.85  ? 533  ASN A CA  1 
ATOM   4193  C  C   . ASN A 1 533 ? 87.720  68.784 46.954  1.00 52.32  ? 533  ASN A C   1 
ATOM   4194  O  O   . ASN A 1 533 ? 87.539  70.000 47.030  1.00 52.87  ? 533  ASN A O   1 
ATOM   4195  C  CB  . ASN A 1 533 ? 86.059  67.675 45.475  1.00 52.45  ? 533  ASN A CB  1 
ATOM   4196  C  CG  . ASN A 1 533 ? 85.147  68.887 45.513  1.00 55.43  ? 533  ASN A CG  1 
ATOM   4197  O  OD1 . ASN A 1 533 ? 85.219  69.761 44.649  1.00 57.60  ? 533  ASN A OD1 1 
ATOM   4198  N  ND2 . ASN A 1 533 ? 84.285  68.948 46.520  1.00 57.34  ? 533  ASN A ND2 1 
ATOM   4199  N  N   . ALA A 1 534 ? 88.091  68.040 47.992  1.00 53.22  ? 534  ALA A N   1 
ATOM   4200  C  CA  . ALA A 1 534 ? 88.291  68.616 49.317  1.00 53.71  ? 534  ALA A CA  1 
ATOM   4201  C  C   . ALA A 1 534 ? 89.713  69.111 49.547  1.00 53.84  ? 534  ALA A C   1 
ATOM   4202  O  O   . ALA A 1 534 ? 89.951  69.920 50.442  1.00 54.08  ? 534  ALA A O   1 
ATOM   4203  C  CB  . ALA A 1 534 ? 87.919  67.594 50.391  1.00 53.81  ? 534  ALA A CB  1 
ATOM   4204  N  N   . THR A 1 535 ? 90.658  68.627 48.747  1.00 54.66  ? 535  THR A N   1 
ATOM   4205  C  CA  . THR A 1 535 ? 92.053  69.037 48.892  1.00 55.71  ? 535  THR A CA  1 
ATOM   4206  C  C   . THR A 1 535 ? 92.677  69.411 47.550  1.00 56.42  ? 535  THR A C   1 
ATOM   4207  O  O   . THR A 1 535 ? 93.884  69.642 47.460  1.00 57.10  ? 535  THR A O   1 
ATOM   4208  C  CB  . THR A 1 535 ? 92.907  67.917 49.542  1.00 55.94  ? 535  THR A CB  1 
ATOM   4209  O  OG1 . THR A 1 535 ? 92.987  66.790 48.658  1.00 57.18  ? 535  THR A OG1 1 
ATOM   4210  C  CG2 . THR A 1 535 ? 92.287  67.471 50.855  1.00 55.32  ? 535  THR A CG2 1 
ATOM   4211  N  N   . SER B 1 4   ? 114.551 39.752 112.250 1.00 54.39  ? 4    SER B N   1 
ATOM   4212  C  CA  . SER B 1 4   ? 113.134 39.920 111.952 1.00 54.49  ? 4    SER B CA  1 
ATOM   4213  C  C   . SER B 1 4   ? 112.923 40.355 110.508 1.00 53.82  ? 4    SER B C   1 
ATOM   4214  O  O   . SER B 1 4   ? 113.186 41.503 110.150 1.00 53.69  ? 4    SER B O   1 
ATOM   4215  C  CB  . SER B 1 4   ? 112.514 40.959 112.892 1.00 55.93  ? 4    SER B CB  1 
ATOM   4216  O  OG  . SER B 1 4   ? 111.126 41.108 112.645 1.00 56.28  ? 4    SER B OG  1 
ATOM   4217  N  N   . GLU B 1 5   ? 112.448 39.428 109.682 1.00 52.77  ? 5    GLU B N   1 
ATOM   4218  C  CA  . GLU B 1 5   ? 112.193 39.711 108.275 1.00 51.49  ? 5    GLU B CA  1 
ATOM   4219  C  C   . GLU B 1 5   ? 111.138 40.790 108.103 1.00 48.94  ? 5    GLU B C   1 
ATOM   4220  O  O   . GLU B 1 5   ? 111.219 41.611 107.190 1.00 49.40  ? 5    GLU B O   1 
ATOM   4221  C  CB  . GLU B 1 5   ? 111.693 38.459 107.549 1.00 53.11  ? 5    GLU B CB  1 
ATOM   4222  C  CG  . GLU B 1 5   ? 112.752 37.454 107.164 1.00 55.93  ? 5    GLU B CG  1 
ATOM   4223  C  CD  . GLU B 1 5   ? 112.169 36.309 106.359 1.00 56.66  ? 5    GLU B CD  1 
ATOM   4224  O  OE1 . GLU B 1 5   ? 111.309 35.579 106.897 1.00 56.45  ? 5    GLU B OE1 1 
ATOM   4225  O  OE2 . GLU B 1 5   ? 112.563 36.144 105.186 1.00 58.20  ? 5    GLU B OE2 1 
ATOM   4226  N  N   . LEU B 1 6   ? 110.147 40.772 108.986 1.00 45.84  ? 6    LEU B N   1 
ATOM   4227  C  CA  . LEU B 1 6   ? 109.032 41.706 108.916 1.00 44.57  ? 6    LEU B CA  1 
ATOM   4228  C  C   . LEU B 1 6   ? 109.285 43.120 109.416 1.00 43.76  ? 6    LEU B C   1 
ATOM   4229  O  O   . LEU B 1 6   ? 108.540 44.037 109.074 1.00 43.26  ? 6    LEU B O   1 
ATOM   4230  C  CB  . LEU B 1 6   ? 107.835 41.112 109.654 1.00 42.47  ? 6    LEU B CB  1 
ATOM   4231  C  CG  . LEU B 1 6   ? 107.504 39.680 109.234 1.00 41.39  ? 6    LEU B CG  1 
ATOM   4232  C  CD1 . LEU B 1 6   ? 106.349 39.154 110.068 1.00 41.51  ? 6    LEU B CD1 1 
ATOM   4233  C  CD2 . LEU B 1 6   ? 107.161 39.648 107.754 1.00 41.73  ? 6    LEU B CD2 1 
ATOM   4234  N  N   . LEU B 1 7   ? 110.323 43.309 110.220 1.00 44.73  ? 7    LEU B N   1 
ATOM   4235  C  CA  . LEU B 1 7   ? 110.610 44.636 110.749 1.00 45.08  ? 7    LEU B CA  1 
ATOM   4236  C  C   . LEU B 1 7   ? 111.755 45.309 110.011 1.00 44.67  ? 7    LEU B C   1 
ATOM   4237  O  O   . LEU B 1 7   ? 112.926 45.068 110.300 1.00 45.39  ? 7    LEU B O   1 
ATOM   4238  C  CB  . LEU B 1 7   ? 110.922 44.555 112.243 1.00 45.79  ? 7    LEU B CB  1 
ATOM   4239  C  CG  . LEU B 1 7   ? 111.173 45.885 112.960 1.00 47.09  ? 7    LEU B CG  1 
ATOM   4240  C  CD1 . LEU B 1 7   ? 110.197 46.956 112.476 1.00 45.78  ? 7    LEU B CD1 1 
ATOM   4241  C  CD2 . LEU B 1 7   ? 111.035 45.664 114.463 1.00 47.20  ? 7    LEU B CD2 1 
ATOM   4242  N  N   . VAL B 1 8   ? 111.404 46.163 109.060 1.00 42.59  ? 8    VAL B N   1 
ATOM   4243  C  CA  . VAL B 1 8   ? 112.398 46.860 108.266 1.00 42.38  ? 8    VAL B CA  1 
ATOM   4244  C  C   . VAL B 1 8   ? 112.393 48.355 108.563 1.00 41.86  ? 8    VAL B C   1 
ATOM   4245  O  O   . VAL B 1 8   ? 111.343 48.960 108.752 1.00 42.52  ? 8    VAL B O   1 
ATOM   4246  C  CB  . VAL B 1 8   ? 112.139 46.631 106.754 1.00 42.08  ? 8    VAL B CB  1 
ATOM   4247  C  CG1 . VAL B 1 8   ? 113.176 47.363 105.927 1.00 41.63  ? 8    VAL B CG1 1 
ATOM   4248  C  CG2 . VAL B 1 8   ? 112.163 45.138 106.441 1.00 40.04  ? 8    VAL B CG2 1 
ATOM   4249  N  N   . ASN B 1 9   ? 113.577 48.948 108.608 1.00 43.13  ? 9    ASN B N   1 
ATOM   4250  C  CA  . ASN B 1 9   ? 113.696 50.374 108.872 1.00 44.11  ? 9    ASN B CA  1 
ATOM   4251  C  C   . ASN B 1 9   ? 114.094 51.097 107.597 1.00 42.25  ? 9    ASN B C   1 
ATOM   4252  O  O   . ASN B 1 9   ? 115.128 50.807 107.001 1.00 42.96  ? 9    ASN B O   1 
ATOM   4253  C  CB  . ASN B 1 9   ? 114.731 50.619 109.969 1.00 48.25  ? 9    ASN B CB  1 
ATOM   4254  C  CG  . ASN B 1 9   ? 116.002 49.823 109.756 1.00 53.03  ? 9    ASN B CG  1 
ATOM   4255  O  OD1 . ASN B 1 9   ? 116.760 50.075 108.810 1.00 55.50  ? 9    ASN B OD1 1 
ATOM   4256  N  ND2 . ASN B 1 9   ? 116.242 48.842 110.633 1.00 53.75  ? 9    ASN B ND2 1 
ATOM   4257  N  N   . THR B 1 10  ? 113.266 52.045 107.185 1.00 39.09  ? 10   THR B N   1 
ATOM   4258  C  CA  . THR B 1 10  ? 113.516 52.795 105.969 1.00 37.78  ? 10   THR B CA  1 
ATOM   4259  C  C   . THR B 1 10  ? 114.050 54.172 106.309 1.00 37.65  ? 10   THR B C   1 
ATOM   4260  O  O   . THR B 1 10  ? 114.240 54.495 107.475 1.00 38.61  ? 10   THR B O   1 
ATOM   4261  C  CB  . THR B 1 10  ? 112.222 52.955 105.158 1.00 36.54  ? 10   THR B CB  1 
ATOM   4262  O  OG1 . THR B 1 10  ? 111.438 54.014 105.715 1.00 34.23  ? 10   THR B OG1 1 
ATOM   4263  C  CG2 . THR B 1 10  ? 111.407 51.673 105.216 1.00 36.15  ? 10   THR B CG2 1 
ATOM   4264  N  N   . LYS B 1 11  ? 114.292 54.982 105.285 1.00 37.85  ? 11   LYS B N   1 
ATOM   4265  C  CA  . LYS B 1 11  ? 114.792 56.330 105.488 1.00 39.05  ? 11   LYS B CA  1 
ATOM   4266  C  C   . LYS B 1 11  ? 113.765 57.215 106.182 1.00 39.17  ? 11   LYS B C   1 
ATOM   4267  O  O   . LYS B 1 11  ? 114.120 58.226 106.784 1.00 41.59  ? 11   LYS B O   1 
ATOM   4268  C  CB  . LYS B 1 11  ? 115.166 56.973 104.156 1.00 40.27  ? 11   LYS B CB  1 
ATOM   4269  C  CG  . LYS B 1 11  ? 116.627 56.868 103.774 1.00 43.35  ? 11   LYS B CG  1 
ATOM   4270  C  CD  . LYS B 1 11  ? 116.929 55.589 103.036 1.00 46.65  ? 11   LYS B CD  1 
ATOM   4271  C  CE  . LYS B 1 11  ? 118.174 55.747 102.173 1.00 46.65  ? 11   LYS B CE  1 
ATOM   4272  N  NZ  . LYS B 1 11  ? 119.364 56.127 102.977 1.00 49.76  ? 11   LYS B NZ  1 
ATOM   4273  N  N   . SER B 1 12  ? 112.496 56.839 106.104 1.00 38.54  ? 12   SER B N   1 
ATOM   4274  C  CA  . SER B 1 12  ? 111.447 57.640 106.720 1.00 39.49  ? 12   SER B CA  1 
ATOM   4275  C  C   . SER B 1 12  ? 110.913 57.094 108.041 1.00 38.09  ? 12   SER B C   1 
ATOM   4276  O  O   . SER B 1 12  ? 110.109 57.750 108.703 1.00 38.51  ? 12   SER B O   1 
ATOM   4277  C  CB  . SER B 1 12  ? 110.290 57.824 105.736 1.00 41.86  ? 12   SER B CB  1 
ATOM   4278  O  OG  . SER B 1 12  ? 110.715 58.512 104.567 1.00 45.96  ? 12   SER B OG  1 
ATOM   4279  N  N   . GLY B 1 13  ? 111.362 55.904 108.427 1.00 36.44  ? 13   GLY B N   1 
ATOM   4280  C  CA  . GLY B 1 13  ? 110.902 55.309 109.669 1.00 34.91  ? 13   GLY B CA  1 
ATOM   4281  C  C   . GLY B 1 13  ? 110.783 53.806 109.545 1.00 34.40  ? 13   GLY B C   1 
ATOM   4282  O  O   . GLY B 1 13  ? 110.924 53.268 108.453 1.00 35.61  ? 13   GLY B O   1 
ATOM   4283  N  N   . LYS B 1 14  ? 110.521 53.121 110.652 1.00 35.20  ? 14   LYS B N   1 
ATOM   4284  C  CA  . LYS B 1 14  ? 110.395 51.669 110.620 1.00 36.09  ? 14   LYS B CA  1 
ATOM   4285  C  C   . LYS B 1 14  ? 109.025 51.227 110.101 1.00 36.95  ? 14   LYS B C   1 
ATOM   4286  O  O   . LYS B 1 14  ? 108.037 51.960 110.201 1.00 37.36  ? 14   LYS B O   1 
ATOM   4287  C  CB  . LYS B 1 14  ? 110.616 51.074 112.012 1.00 38.17  ? 14   LYS B CB  1 
ATOM   4288  C  CG  . LYS B 1 14  ? 111.895 51.505 112.705 1.00 42.52  ? 14   LYS B CG  1 
ATOM   4289  C  CD  . LYS B 1 14  ? 112.130 50.669 113.959 1.00 46.99  ? 14   LYS B CD  1 
ATOM   4290  C  CE  . LYS B 1 14  ? 113.277 51.205 114.810 1.00 48.24  ? 14   LYS B CE  1 
ATOM   4291  N  NZ  . LYS B 1 14  ? 112.887 52.437 115.558 1.00 51.30  ? 14   LYS B NZ  1 
ATOM   4292  N  N   . VAL B 1 15  ? 108.980 50.014 109.559 1.00 35.77  ? 15   VAL B N   1 
ATOM   4293  C  CA  . VAL B 1 15  ? 107.760 49.439 109.014 1.00 34.55  ? 15   VAL B CA  1 
ATOM   4294  C  C   . VAL B 1 15  ? 107.673 47.965 109.394 1.00 34.56  ? 15   VAL B C   1 
ATOM   4295  O  O   . VAL B 1 15  ? 108.684 47.269 109.430 1.00 35.30  ? 15   VAL B O   1 
ATOM   4296  C  CB  . VAL B 1 15  ? 107.733 49.576 107.473 1.00 33.45  ? 15   VAL B CB  1 
ATOM   4297  C  CG1 . VAL B 1 15  ? 106.723 48.623 106.881 1.00 34.30  ? 15   VAL B CG1 1 
ATOM   4298  C  CG2 . VAL B 1 15  ? 107.388 51.002 107.088 1.00 30.33  ? 15   VAL B CG2 1 
ATOM   4299  N  N   . MET B 1 16  ? 106.465 47.498 109.686 1.00 35.33  ? 16   MET B N   1 
ATOM   4300  C  CA  . MET B 1 16  ? 106.252 46.108 110.065 1.00 38.23  ? 16   MET B CA  1 
ATOM   4301  C  C   . MET B 1 16  ? 105.321 45.398 109.079 1.00 38.79  ? 16   MET B C   1 
ATOM   4302  O  O   . MET B 1 16  ? 104.135 45.725 108.973 1.00 37.42  ? 16   MET B O   1 
ATOM   4303  C  CB  . MET B 1 16  ? 105.669 46.036 111.481 1.00 41.61  ? 16   MET B CB  1 
ATOM   4304  C  CG  . MET B 1 16  ? 105.318 44.627 111.951 1.00 48.22  ? 16   MET B CG  1 
ATOM   4305  S  SD  . MET B 1 16  ? 106.758 43.558 112.205 1.00 56.83  ? 16   MET B SD  1 
ATOM   4306  C  CE  . MET B 1 16  ? 106.846 43.547 114.000 1.00 54.32  ? 16   MET B CE  1 
ATOM   4307  N  N   . GLY B 1 17  ? 105.869 44.418 108.365 1.00 39.11  ? 17   GLY B N   1 
ATOM   4308  C  CA  . GLY B 1 17  ? 105.087 43.676 107.398 1.00 40.07  ? 17   GLY B CA  1 
ATOM   4309  C  C   . GLY B 1 17  ? 104.333 42.508 108.000 1.00 42.46  ? 17   GLY B C   1 
ATOM   4310  O  O   . GLY B 1 17  ? 104.077 42.469 109.202 1.00 44.12  ? 17   GLY B O   1 
ATOM   4311  N  N   . THR B 1 18  ? 103.982 41.544 107.157 1.00 43.68  ? 18   THR B N   1 
ATOM   4312  C  CA  . THR B 1 18  ? 103.236 40.375 107.595 1.00 44.65  ? 18   THR B CA  1 
ATOM   4313  C  C   . THR B 1 18  ? 103.563 39.154 106.742 1.00 45.15  ? 18   THR B C   1 
ATOM   4314  O  O   . THR B 1 18  ? 103.821 39.269 105.549 1.00 45.18  ? 18   THR B O   1 
ATOM   4315  C  CB  . THR B 1 18  ? 101.716 40.637 107.518 1.00 46.28  ? 18   THR B CB  1 
ATOM   4316  O  OG1 . THR B 1 18  ? 101.003 39.428 107.805 1.00 47.62  ? 18   THR B OG1 1 
ATOM   4317  C  CG2 . THR B 1 18  ? 101.327 41.139 106.124 1.00 46.04  ? 18   THR B CG2 1 
ATOM   4318  N  N   . ARG B 1 19  ? 103.549 37.985 107.371 1.00 45.56  ? 19   ARG B N   1 
ATOM   4319  C  CA  . ARG B 1 19  ? 103.832 36.731 106.689 1.00 44.82  ? 19   ARG B CA  1 
ATOM   4320  C  C   . ARG B 1 19  ? 102.571 36.281 105.977 1.00 43.73  ? 19   ARG B C   1 
ATOM   4321  O  O   . ARG B 1 19  ? 101.558 36.031 106.619 1.00 44.48  ? 19   ARG B O   1 
ATOM   4322  C  CB  . ARG B 1 19  ? 104.241 35.675 107.711 1.00 47.50  ? 19   ARG B CB  1 
ATOM   4323  C  CG  . ARG B 1 19  ? 104.518 34.307 107.129 1.00 52.76  ? 19   ARG B CG  1 
ATOM   4324  C  CD  . ARG B 1 19  ? 105.984 33.935 107.260 1.00 57.29  ? 19   ARG B CD  1 
ATOM   4325  N  NE  . ARG B 1 19  ? 106.445 33.998 108.645 1.00 62.78  ? 19   ARG B NE  1 
ATOM   4326  C  CZ  . ARG B 1 19  ? 106.934 35.092 109.226 1.00 65.67  ? 19   ARG B CZ  1 
ATOM   4327  N  NH1 . ARG B 1 19  ? 107.321 35.055 110.496 1.00 66.23  ? 19   ARG B NH1 1 
ATOM   4328  N  NH2 . ARG B 1 19  ? 107.055 36.220 108.533 1.00 67.27  ? 19   ARG B NH2 1 
ATOM   4329  N  N   . VAL B 1 20  ? 102.626 36.177 104.654 1.00 42.33  ? 20   VAL B N   1 
ATOM   4330  C  CA  . VAL B 1 20  ? 101.455 35.751 103.900 1.00 41.81  ? 20   VAL B CA  1 
ATOM   4331  C  C   . VAL B 1 20  ? 101.648 34.405 103.216 1.00 41.37  ? 20   VAL B C   1 
ATOM   4332  O  O   . VAL B 1 20  ? 102.679 34.147 102.595 1.00 41.28  ? 20   VAL B O   1 
ATOM   4333  C  CB  . VAL B 1 20  ? 101.057 36.793 102.836 1.00 41.66  ? 20   VAL B CB  1 
ATOM   4334  C  CG1 . VAL B 1 20  ? 100.750 38.122 103.509 1.00 41.83  ? 20   VAL B CG1 1 
ATOM   4335  C  CG2 . VAL B 1 20  ? 102.161 36.949 101.818 1.00 40.01  ? 20   VAL B CG2 1 
ATOM   4336  N  N   . PRO B 1 21  ? 100.648 33.523 103.331 1.00 41.38  ? 21   PRO B N   1 
ATOM   4337  C  CA  . PRO B 1 21  ? 100.704 32.194 102.720 1.00 41.72  ? 21   PRO B CA  1 
ATOM   4338  C  C   . PRO B 1 21  ? 100.606 32.287 101.199 1.00 42.47  ? 21   PRO B C   1 
ATOM   4339  O  O   . PRO B 1 21  ? 99.988  33.214 100.664 1.00 42.93  ? 21   PRO B O   1 
ATOM   4340  C  CB  . PRO B 1 21  ? 99.506  31.486 103.340 1.00 41.58  ? 21   PRO B CB  1 
ATOM   4341  C  CG  . PRO B 1 21  ? 98.516  32.609 103.502 1.00 41.68  ? 21   PRO B CG  1 
ATOM   4342  C  CD  . PRO B 1 21  ? 99.378  33.720 104.054 1.00 41.59  ? 21   PRO B CD  1 
ATOM   4343  N  N   . VAL B 1 22  ? 101.219 31.332 100.506 1.00 42.06  ? 22   VAL B N   1 
ATOM   4344  C  CA  . VAL B 1 22  ? 101.194 31.319 99.051  1.00 42.87  ? 22   VAL B CA  1 
ATOM   4345  C  C   . VAL B 1 22  ? 101.664 29.985 98.472  1.00 45.12  ? 22   VAL B C   1 
ATOM   4346  O  O   . VAL B 1 22  ? 102.795 29.555 98.704  1.00 45.29  ? 22   VAL B O   1 
ATOM   4347  C  CB  . VAL B 1 22  ? 102.073 32.460 98.467  1.00 41.45  ? 22   VAL B CB  1 
ATOM   4348  C  CG1 . VAL B 1 22  ? 103.515 32.317 98.940  1.00 38.00  ? 22   VAL B CG1 1 
ATOM   4349  C  CG2 . VAL B 1 22  ? 102.006 32.443 96.949  1.00 40.56  ? 22   VAL B CG2 1 
ATOM   4350  N  N   . LEU B 1 23  ? 100.780 29.331 97.725  1.00 47.36  ? 23   LEU B N   1 
ATOM   4351  C  CA  . LEU B 1 23  ? 101.100 28.055 97.086  1.00 49.03  ? 23   LEU B CA  1 
ATOM   4352  C  C   . LEU B 1 23  ? 101.844 27.079 98.005  1.00 49.14  ? 23   LEU B C   1 
ATOM   4353  O  O   . LEU B 1 23  ? 102.932 26.603 97.667  1.00 49.89  ? 23   LEU B O   1 
ATOM   4354  C  CB  . LEU B 1 23  ? 101.943 28.308 95.829  1.00 49.27  ? 23   LEU B CB  1 
ATOM   4355  C  CG  . LEU B 1 23  ? 101.387 29.304 94.806  1.00 49.78  ? 23   LEU B CG  1 
ATOM   4356  C  CD1 . LEU B 1 23  ? 102.429 29.576 93.730  1.00 49.02  ? 23   LEU B CD1 1 
ATOM   4357  C  CD2 . LEU B 1 23  ? 100.108 28.750 94.197  1.00 50.16  ? 23   LEU B CD2 1 
ATOM   4358  N  N   . SER B 1 24  ? 101.260 26.786 99.163  1.00 49.05  ? 24   SER B N   1 
ATOM   4359  C  CA  . SER B 1 24  ? 101.863 25.858 100.119 1.00 49.63  ? 24   SER B CA  1 
ATOM   4360  C  C   . SER B 1 24  ? 103.117 26.402 100.800 1.00 49.07  ? 24   SER B C   1 
ATOM   4361  O  O   . SER B 1 24  ? 103.757 25.696 101.579 1.00 49.78  ? 24   SER B O   1 
ATOM   4362  C  CB  . SER B 1 24  ? 102.202 24.527 99.431  1.00 50.52  ? 24   SER B CB  1 
ATOM   4363  O  OG  . SER B 1 24  ? 101.046 23.907 98.902  1.00 51.19  ? 24   SER B OG  1 
ATOM   4364  N  N   . SER B 1 25  ? 103.473 27.648 100.506 1.00 47.63  ? 25   SER B N   1 
ATOM   4365  C  CA  . SER B 1 25  ? 104.649 28.255 101.116 1.00 44.93  ? 25   SER B CA  1 
ATOM   4366  C  C   . SER B 1 25  ? 104.271 29.606 101.706 1.00 43.84  ? 25   SER B C   1 
ATOM   4367  O  O   . SER B 1 25  ? 103.097 29.868 101.947 1.00 44.57  ? 25   SER B O   1 
ATOM   4368  C  CB  . SER B 1 25  ? 105.759 28.421 100.080 1.00 45.24  ? 25   SER B CB  1 
ATOM   4369  O  OG  . SER B 1 25  ? 106.961 28.873 100.688 1.00 45.87  ? 25   SER B OG  1 
ATOM   4370  N  N   . HIS B 1 26  ? 105.260 30.460 101.948 1.00 43.83  ? 26   HIS B N   1 
ATOM   4371  C  CA  . HIS B 1 26  ? 104.993 31.778 102.516 1.00 44.59  ? 26   HIS B CA  1 
ATOM   4372  C  C   . HIS B 1 26  ? 105.986 32.829 102.025 1.00 42.43  ? 26   HIS B C   1 
ATOM   4373  O  O   . HIS B 1 26  ? 107.080 32.499 101.578 1.00 42.05  ? 26   HIS B O   1 
ATOM   4374  C  CB  . HIS B 1 26  ? 105.058 31.727 104.052 1.00 48.01  ? 26   HIS B CB  1 
ATOM   4375  C  CG  . HIS B 1 26  ? 104.129 30.731 104.675 1.00 51.19  ? 26   HIS B CG  1 
ATOM   4376  N  ND1 . HIS B 1 26  ? 104.328 29.369 104.589 1.00 53.44  ? 26   HIS B ND1 1 
ATOM   4377  C  CD2 . HIS B 1 26  ? 102.993 30.899 105.393 1.00 52.32  ? 26   HIS B CD2 1 
ATOM   4378  C  CE1 . HIS B 1 26  ? 103.354 28.741 105.225 1.00 53.58  ? 26   HIS B CE1 1 
ATOM   4379  N  NE2 . HIS B 1 26  ? 102.531 29.647 105.722 1.00 53.48  ? 26   HIS B NE2 1 
ATOM   4380  N  N   . ILE B 1 27  ? 105.589 34.095 102.107 1.00 40.65  ? 27   ILE B N   1 
ATOM   4381  C  CA  . ILE B 1 27  ? 106.451 35.208 101.717 1.00 39.82  ? 27   ILE B CA  1 
ATOM   4382  C  C   . ILE B 1 27  ? 106.108 36.407 102.591 1.00 37.26  ? 27   ILE B C   1 
ATOM   4383  O  O   . ILE B 1 27  ? 105.087 36.408 103.273 1.00 36.89  ? 27   ILE B O   1 
ATOM   4384  C  CB  . ILE B 1 27  ? 106.258 35.631 100.247 1.00 40.65  ? 27   ILE B CB  1 
ATOM   4385  C  CG1 . ILE B 1 27  ? 104.830 36.124 100.034 1.00 42.65  ? 27   ILE B CG1 1 
ATOM   4386  C  CG2 . ILE B 1 27  ? 106.576 34.478 99.323  1.00 43.88  ? 27   ILE B CG2 1 
ATOM   4387  C  CD1 . ILE B 1 27  ? 104.618 36.769 98.697  1.00 44.61  ? 27   ILE B CD1 1 
ATOM   4388  N  N   . SER B 1 28  ? 106.962 37.423 102.567 1.00 35.54  ? 28   SER B N   1 
ATOM   4389  C  CA  . SER B 1 28  ? 106.731 38.621 103.361 1.00 35.59  ? 28   SER B CA  1 
ATOM   4390  C  C   . SER B 1 28  ? 105.982 39.643 102.529 1.00 35.61  ? 28   SER B C   1 
ATOM   4391  O  O   . SER B 1 28  ? 106.222 39.775 101.330 1.00 35.48  ? 28   SER B O   1 
ATOM   4392  C  CB  . SER B 1 28  ? 108.056 39.232 103.816 1.00 35.93  ? 28   SER B CB  1 
ATOM   4393  O  OG  . SER B 1 28  ? 108.828 38.304 104.553 1.00 37.63  ? 28   SER B OG  1 
ATOM   4394  N  N   . ALA B 1 29  ? 105.076 40.369 103.167 1.00 34.54  ? 29   ALA B N   1 
ATOM   4395  C  CA  . ALA B 1 29  ? 104.313 41.383 102.469 1.00 34.36  ? 29   ALA B CA  1 
ATOM   4396  C  C   . ALA B 1 29  ? 104.300 42.653 103.292 1.00 35.14  ? 29   ALA B C   1 
ATOM   4397  O  O   . ALA B 1 29  ? 104.128 42.608 104.506 1.00 38.50  ? 29   ALA B O   1 
ATOM   4398  C  CB  . ALA B 1 29  ? 102.894 40.901 102.229 1.00 32.74  ? 29   ALA B CB  1 
ATOM   4399  N  N   . PHE B 1 30  ? 104.510 43.781 102.627 1.00 33.66  ? 30   PHE B N   1 
ATOM   4400  C  CA  . PHE B 1 30  ? 104.493 45.080 103.277 1.00 33.30  ? 30   PHE B CA  1 
ATOM   4401  C  C   . PHE B 1 30  ? 103.442 45.881 102.525 1.00 33.04  ? 30   PHE B C   1 
ATOM   4402  O  O   . PHE B 1 30  ? 103.697 46.407 101.445 1.00 32.03  ? 30   PHE B O   1 
ATOM   4403  C  CB  . PHE B 1 30  ? 105.869 45.743 103.182 1.00 34.66  ? 30   PHE B CB  1 
ATOM   4404  C  CG  . PHE B 1 30  ? 106.964 44.935 103.815 1.00 36.36  ? 30   PHE B CG  1 
ATOM   4405  C  CD1 . PHE B 1 30  ? 107.449 43.791 103.192 1.00 35.74  ? 30   PHE B CD1 1 
ATOM   4406  C  CD2 . PHE B 1 30  ? 107.471 45.285 105.065 1.00 37.29  ? 30   PHE B CD2 1 
ATOM   4407  C  CE1 . PHE B 1 30  ? 108.419 43.004 103.803 1.00 37.14  ? 30   PHE B CE1 1 
ATOM   4408  C  CE2 . PHE B 1 30  ? 108.440 44.506 105.687 1.00 36.81  ? 30   PHE B CE2 1 
ATOM   4409  C  CZ  . PHE B 1 30  ? 108.916 43.362 105.055 1.00 38.77  ? 30   PHE B CZ  1 
ATOM   4410  N  N   . LEU B 1 31  ? 102.252 45.962 103.107 1.00 32.13  ? 31   LEU B N   1 
ATOM   4411  C  CA  . LEU B 1 31  ? 101.139 46.647 102.475 1.00 31.64  ? 31   LEU B CA  1 
ATOM   4412  C  C   . LEU B 1 31  ? 100.836 48.033 103.025 1.00 31.70  ? 31   LEU B C   1 
ATOM   4413  O  O   . LEU B 1 31  ? 100.861 48.256 104.231 1.00 34.23  ? 31   LEU B O   1 
ATOM   4414  C  CB  . LEU B 1 31  ? 99.896  45.761 102.584 1.00 31.01  ? 31   LEU B CB  1 
ATOM   4415  C  CG  . LEU B 1 31  ? 100.189 44.288 102.261 1.00 31.15  ? 31   LEU B CG  1 
ATOM   4416  C  CD1 . LEU B 1 31  ? 98.975  43.420 102.577 1.00 31.60  ? 31   LEU B CD1 1 
ATOM   4417  C  CD2 . LEU B 1 31  ? 100.592 44.157 100.800 1.00 30.64  ? 31   LEU B CD2 1 
ATOM   4418  N  N   . GLY B 1 32  ? 100.561 48.966 102.122 1.00 30.84  ? 32   GLY B N   1 
ATOM   4419  C  CA  . GLY B 1 32  ? 100.213 50.317 102.525 1.00 30.66  ? 32   GLY B CA  1 
ATOM   4420  C  C   . GLY B 1 32  ? 101.296 51.192 103.121 1.00 30.30  ? 32   GLY B C   1 
ATOM   4421  O  O   . GLY B 1 32  ? 101.054 51.888 104.102 1.00 30.41  ? 32   GLY B O   1 
ATOM   4422  N  N   . ILE B 1 33  ? 102.486 51.170 102.534 1.00 29.27  ? 33   ILE B N   1 
ATOM   4423  C  CA  . ILE B 1 33  ? 103.580 52.002 103.013 1.00 28.70  ? 33   ILE B CA  1 
ATOM   4424  C  C   . ILE B 1 33  ? 103.464 53.340 102.288 1.00 29.28  ? 33   ILE B C   1 
ATOM   4425  O  O   . ILE B 1 33  ? 103.391 53.377 101.064 1.00 28.55  ? 33   ILE B O   1 
ATOM   4426  C  CB  . ILE B 1 33  ? 104.939 51.365 102.698 1.00 28.96  ? 33   ILE B CB  1 
ATOM   4427  C  CG1 . ILE B 1 33  ? 105.053 50.019 103.423 1.00 28.97  ? 33   ILE B CG1 1 
ATOM   4428  C  CG2 . ILE B 1 33  ? 106.063 52.321 103.095 1.00 28.93  ? 33   ILE B CG2 1 
ATOM   4429  C  CD1 . ILE B 1 33  ? 106.320 49.265 103.130 1.00 29.52  ? 33   ILE B CD1 1 
ATOM   4430  N  N   . PRO B 1 34  ? 103.431 54.455 103.038 1.00 29.87  ? 34   PRO B N   1 
ATOM   4431  C  CA  . PRO B 1 34  ? 103.316 55.791 102.443 1.00 29.31  ? 34   PRO B CA  1 
ATOM   4432  C  C   . PRO B 1 34  ? 104.622 56.287 101.841 1.00 30.76  ? 34   PRO B C   1 
ATOM   4433  O  O   . PRO B 1 34  ? 105.690 56.051 102.403 1.00 33.62  ? 34   PRO B O   1 
ATOM   4434  C  CB  . PRO B 1 34  ? 102.860 56.643 103.619 1.00 30.38  ? 34   PRO B CB  1 
ATOM   4435  C  CG  . PRO B 1 34  ? 103.593 56.011 104.776 1.00 29.79  ? 34   PRO B CG  1 
ATOM   4436  C  CD  . PRO B 1 34  ? 103.393 54.528 104.511 1.00 29.48  ? 34   PRO B CD  1 
ATOM   4437  N  N   . PHE B 1 35  ? 104.537 56.965 100.698 1.00 30.07  ? 35   PHE B N   1 
ATOM   4438  C  CA  . PHE B 1 35  ? 105.724 57.489 100.032 1.00 30.09  ? 35   PHE B CA  1 
ATOM   4439  C  C   . PHE B 1 35  ? 105.589 58.981 99.772  1.00 31.77  ? 35   PHE B C   1 
ATOM   4440  O  O   . PHE B 1 35  ? 106.510 59.627 99.277  1.00 33.02  ? 35   PHE B O   1 
ATOM   4441  C  CB  . PHE B 1 35  ? 105.989 56.735 98.711  1.00 28.94  ? 35   PHE B CB  1 
ATOM   4442  C  CG  . PHE B 1 35  ? 104.904 56.894 97.676  1.00 28.48  ? 35   PHE B CG  1 
ATOM   4443  C  CD1 . PHE B 1 35  ? 104.783 58.071 96.941  1.00 26.14  ? 35   PHE B CD1 1 
ATOM   4444  C  CD2 . PHE B 1 35  ? 103.995 55.865 97.440  1.00 26.23  ? 35   PHE B CD2 1 
ATOM   4445  C  CE1 . PHE B 1 35  ? 103.774 58.217 95.988  1.00 26.32  ? 35   PHE B CE1 1 
ATOM   4446  C  CE2 . PHE B 1 35  ? 102.988 56.009 96.491  1.00 26.31  ? 35   PHE B CE2 1 
ATOM   4447  C  CZ  . PHE B 1 35  ? 102.878 57.184 95.766  1.00 24.33  ? 35   PHE B CZ  1 
ATOM   4448  N  N   . ALA B 1 36  ? 104.434 59.534 100.112 1.00 33.28  ? 36   ALA B N   1 
ATOM   4449  C  CA  . ALA B 1 36  ? 104.205 60.956 99.920  1.00 35.20  ? 36   ALA B CA  1 
ATOM   4450  C  C   . ALA B 1 36  ? 103.281 61.444 101.014 1.00 36.53  ? 36   ALA B C   1 
ATOM   4451  O  O   . ALA B 1 36  ? 102.684 60.638 101.729 1.00 36.21  ? 36   ALA B O   1 
ATOM   4452  C  CB  . ALA B 1 36  ? 103.575 61.206 98.556  1.00 35.39  ? 36   ALA B CB  1 
ATOM   4453  N  N   . GLU B 1 37  ? 103.174 62.761 101.153 1.00 38.10  ? 37   GLU B N   1 
ATOM   4454  C  CA  . GLU B 1 37  ? 102.283 63.345 102.148 1.00 40.92  ? 37   GLU B CA  1 
ATOM   4455  C  C   . GLU B 1 37  ? 100.875 63.290 101.562 1.00 42.23  ? 37   GLU B C   1 
ATOM   4456  O  O   . GLU B 1 37  ? 100.699 63.367 100.345 1.00 43.83  ? 37   GLU B O   1 
ATOM   4457  C  CB  . GLU B 1 37  ? 102.662 64.806 102.426 1.00 41.45  ? 37   GLU B CB  1 
ATOM   4458  C  CG  . GLU B 1 37  ? 103.946 64.988 103.238 1.00 42.91  ? 37   GLU B CG  1 
ATOM   4459  C  CD  . GLU B 1 37  ? 103.783 64.575 104.691 1.00 44.09  ? 37   GLU B CD  1 
ATOM   4460  O  OE1 . GLU B 1 37  ? 103.024 65.251 105.422 1.00 45.83  ? 37   GLU B OE1 1 
ATOM   4461  O  OE2 . GLU B 1 37  ? 104.408 63.572 105.103 1.00 45.27  ? 37   GLU B OE2 1 
ATOM   4462  N  N   . PRO B 1 38  ? 99.854  63.139 102.415 1.00 42.96  ? 38   PRO B N   1 
ATOM   4463  C  CA  . PRO B 1 38  ? 98.476  63.086 101.910 1.00 42.40  ? 38   PRO B CA  1 
ATOM   4464  C  C   . PRO B 1 38  ? 98.138  64.376 101.152 1.00 43.84  ? 38   PRO B C   1 
ATOM   4465  O  O   . PRO B 1 38  ? 98.094  65.455 101.746 1.00 45.19  ? 38   PRO B O   1 
ATOM   4466  C  CB  . PRO B 1 38  ? 97.655  62.938 103.184 1.00 42.16  ? 38   PRO B CB  1 
ATOM   4467  C  CG  . PRO B 1 38  ? 98.590  62.170 104.100 1.00 43.11  ? 38   PRO B CG  1 
ATOM   4468  C  CD  . PRO B 1 38  ? 99.904  62.869 103.864 1.00 42.81  ? 38   PRO B CD  1 
ATOM   4469  N  N   . PRO B 1 39  ? 97.908  64.283 99.830  1.00 43.04  ? 39   PRO B N   1 
ATOM   4470  C  CA  . PRO B 1 39  ? 97.578  65.460 99.016  1.00 43.14  ? 39   PRO B CA  1 
ATOM   4471  C  C   . PRO B 1 39  ? 96.141  65.926 99.222  1.00 44.41  ? 39   PRO B C   1 
ATOM   4472  O  O   . PRO B 1 39  ? 95.331  65.924 98.285  1.00 44.09  ? 39   PRO B O   1 
ATOM   4473  C  CB  . PRO B 1 39  ? 97.819  64.966 97.596  1.00 42.40  ? 39   PRO B CB  1 
ATOM   4474  C  CG  . PRO B 1 39  ? 97.364  63.545 97.686  1.00 43.31  ? 39   PRO B CG  1 
ATOM   4475  C  CD  . PRO B 1 39  ? 97.998  63.079 98.987  1.00 42.38  ? 39   PRO B CD  1 
ATOM   4476  N  N   . VAL B 1 40  ? 95.833  66.326 100.453 1.00 44.02  ? 40   VAL B N   1 
ATOM   4477  C  CA  . VAL B 1 40  ? 94.499  66.790 100.801 1.00 43.30  ? 40   VAL B CA  1 
ATOM   4478  C  C   . VAL B 1 40  ? 94.469  68.292 101.095 1.00 43.60  ? 40   VAL B C   1 
ATOM   4479  O  O   . VAL B 1 40  ? 95.512  68.931 101.232 1.00 43.07  ? 40   VAL B O   1 
ATOM   4480  C  CB  . VAL B 1 40  ? 93.968  66.028 102.031 1.00 43.51  ? 40   VAL B CB  1 
ATOM   4481  C  CG1 . VAL B 1 40  ? 93.889  64.543 101.726 1.00 44.51  ? 40   VAL B CG1 1 
ATOM   4482  C  CG2 . VAL B 1 40  ? 94.880  66.261 103.219 1.00 44.06  ? 40   VAL B CG2 1 
ATOM   4483  N  N   . GLY B 1 41  ? 93.264  68.846 101.186 1.00 44.32  ? 41   GLY B N   1 
ATOM   4484  C  CA  . GLY B 1 41  ? 93.104  70.260 101.473 1.00 44.70  ? 41   GLY B CA  1 
ATOM   4485  C  C   . GLY B 1 41  ? 93.732  71.184 100.449 1.00 45.29  ? 41   GLY B C   1 
ATOM   4486  O  O   . GLY B 1 41  ? 93.355  71.182 99.277  1.00 46.14  ? 41   GLY B O   1 
ATOM   4487  N  N   . ASN B 1 42  ? 94.690  71.985 100.893 1.00 45.53  ? 42   ASN B N   1 
ATOM   4488  C  CA  . ASN B 1 42  ? 95.371  72.917 100.005 1.00 46.98  ? 42   ASN B CA  1 
ATOM   4489  C  C   . ASN B 1 42  ? 96.407  72.186 99.149  1.00 46.08  ? 42   ASN B C   1 
ATOM   4490  O  O   . ASN B 1 42  ? 97.099  72.802 98.335  1.00 46.02  ? 42   ASN B O   1 
ATOM   4491  C  CB  . ASN B 1 42  ? 96.051  74.010 100.833 1.00 49.80  ? 42   ASN B CB  1 
ATOM   4492  C  CG  . ASN B 1 42  ? 97.128  73.460 101.757 1.00 51.76  ? 42   ASN B CG  1 
ATOM   4493  O  OD1 . ASN B 1 42  ? 98.276  73.276 101.353 1.00 54.54  ? 42   ASN B OD1 1 
ATOM   4494  N  ND2 . ASN B 1 42  ? 96.755  73.179 103.000 1.00 53.32  ? 42   ASN B ND2 1 
ATOM   4495  N  N   . MET B 1 43  ? 96.505  70.872 99.338  1.00 45.34  ? 43   MET B N   1 
ATOM   4496  C  CA  . MET B 1 43  ? 97.459  70.052 98.591  1.00 44.84  ? 43   MET B CA  1 
ATOM   4497  C  C   . MET B 1 43  ? 96.859  69.518 97.293  1.00 42.86  ? 43   MET B C   1 
ATOM   4498  O  O   . MET B 1 43  ? 97.582  69.082 96.398  1.00 42.96  ? 43   MET B O   1 
ATOM   4499  C  CB  . MET B 1 43  ? 97.917  68.868 99.444  1.00 47.77  ? 43   MET B CB  1 
ATOM   4500  C  CG  . MET B 1 43  ? 98.541  69.241 100.779 1.00 51.82  ? 43   MET B CG  1 
ATOM   4501  S  SD  . MET B 1 43  ? 100.189 69.946 100.626 1.00 56.41  ? 43   MET B SD  1 
ATOM   4502  C  CE  . MET B 1 43  ? 101.196 68.438 100.681 1.00 55.11  ? 43   MET B CE  1 
ATOM   4503  N  N   . ARG B 1 44  ? 95.535  69.550 97.194  1.00 40.43  ? 44   ARG B N   1 
ATOM   4504  C  CA  . ARG B 1 44  ? 94.850  69.051 96.010  1.00 38.94  ? 44   ARG B CA  1 
ATOM   4505  C  C   . ARG B 1 44  ? 95.305  69.754 94.734  1.00 38.46  ? 44   ARG B C   1 
ATOM   4506  O  O   . ARG B 1 44  ? 95.370  70.987 94.673  1.00 38.33  ? 44   ARG B O   1 
ATOM   4507  C  CB  . ARG B 1 44  ? 93.333  69.199 96.174  1.00 38.03  ? 44   ARG B CB  1 
ATOM   4508  C  CG  . ARG B 1 44  ? 92.539  68.618 95.021  1.00 37.49  ? 44   ARG B CG  1 
ATOM   4509  C  CD  . ARG B 1 44  ? 91.055  68.928 95.142  1.00 37.57  ? 44   ARG B CD  1 
ATOM   4510  N  NE  . ARG B 1 44  ? 90.382  68.161 96.186  1.00 34.83  ? 44   ARG B NE  1 
ATOM   4511  C  CZ  . ARG B 1 44  ? 89.143  68.410 96.602  1.00 34.01  ? 44   ARG B CZ  1 
ATOM   4512  N  NH1 . ARG B 1 44  ? 88.454  69.411 96.067  1.00 33.45  ? 44   ARG B NH1 1 
ATOM   4513  N  NH2 . ARG B 1 44  ? 88.584  67.649 97.532  1.00 31.03  ? 44   ARG B NH2 1 
ATOM   4514  N  N   . PHE B 1 45  ? 95.618  68.945 93.722  1.00 36.77  ? 45   PHE B N   1 
ATOM   4515  C  CA  . PHE B 1 45  ? 96.075  69.412 92.413  1.00 36.14  ? 45   PHE B CA  1 
ATOM   4516  C  C   . PHE B 1 45  ? 97.553  69.777 92.427  1.00 35.96  ? 45   PHE B C   1 
ATOM   4517  O  O   . PHE B 1 45  ? 98.164  69.962 91.379  1.00 35.76  ? 45   PHE B O   1 
ATOM   4518  C  CB  . PHE B 1 45  ? 95.265  70.629 91.948  1.00 33.46  ? 45   PHE B CB  1 
ATOM   4519  C  CG  . PHE B 1 45  ? 93.778  70.402 91.914  1.00 35.19  ? 45   PHE B CG  1 
ATOM   4520  C  CD1 . PHE B 1 45  ? 93.238  69.280 91.284  1.00 35.19  ? 45   PHE B CD1 1 
ATOM   4521  C  CD2 . PHE B 1 45  ? 92.911  71.321 92.491  1.00 35.65  ? 45   PHE B CD2 1 
ATOM   4522  C  CE1 . PHE B 1 45  ? 91.860  69.081 91.232  1.00 32.79  ? 45   PHE B CE1 1 
ATOM   4523  C  CE2 . PHE B 1 45  ? 91.533  71.130 92.443  1.00 36.26  ? 45   PHE B CE2 1 
ATOM   4524  C  CZ  . PHE B 1 45  ? 91.008  70.006 91.811  1.00 35.68  ? 45   PHE B CZ  1 
ATOM   4525  N  N   . ARG B 1 46  ? 98.126  69.860 93.621  1.00 37.26  ? 46   ARG B N   1 
ATOM   4526  C  CA  . ARG B 1 46  ? 99.526  70.236 93.781  1.00 39.33  ? 46   ARG B CA  1 
ATOM   4527  C  C   . ARG B 1 46  ? 100.502 69.062 93.667  1.00 37.67  ? 46   ARG B C   1 
ATOM   4528  O  O   . ARG B 1 46  ? 100.141 67.906 93.897  1.00 34.42  ? 46   ARG B O   1 
ATOM   4529  C  CB  . ARG B 1 46  ? 99.706  70.940 95.134  1.00 41.70  ? 46   ARG B CB  1 
ATOM   4530  C  CG  . ARG B 1 46  ? 100.957 71.799 95.240  1.00 50.29  ? 46   ARG B CG  1 
ATOM   4531  C  CD  . ARG B 1 46  ? 100.942 72.660 96.507  1.00 53.90  ? 46   ARG B CD  1 
ATOM   4532  N  NE  . ARG B 1 46  ? 99.752  73.506 96.591  1.00 58.00  ? 46   ARG B NE  1 
ATOM   4533  C  CZ  . ARG B 1 46  ? 99.483  74.332 97.602  1.00 60.61  ? 46   ARG B CZ  1 
ATOM   4534  N  NH1 . ARG B 1 46  ? 100.322 74.430 98.627  1.00 62.33  ? 46   ARG B NH1 1 
ATOM   4535  N  NH2 . ARG B 1 46  ? 98.370  75.057 97.595  1.00 59.35  ? 46   ARG B NH2 1 
ATOM   4536  N  N   . ARG B 1 47  ? 101.742 69.375 93.305  1.00 37.68  ? 47   ARG B N   1 
ATOM   4537  C  CA  . ARG B 1 47  ? 102.783 68.362 93.171  1.00 39.08  ? 47   ARG B CA  1 
ATOM   4538  C  C   . ARG B 1 47  ? 102.920 67.630 94.492  1.00 38.74  ? 47   ARG B C   1 
ATOM   4539  O  O   . ARG B 1 47  ? 102.760 68.226 95.557  1.00 40.00  ? 47   ARG B O   1 
ATOM   4540  C  CB  . ARG B 1 47  ? 104.128 69.001 92.819  1.00 39.90  ? 47   ARG B CB  1 
ATOM   4541  C  CG  . ARG B 1 47  ? 104.156 69.729 91.490  1.00 44.97  ? 47   ARG B CG  1 
ATOM   4542  C  CD  . ARG B 1 47  ? 105.584 70.051 91.060  1.00 47.12  ? 47   ARG B CD  1 
ATOM   4543  N  NE  . ARG B 1 47  ? 105.620 70.619 89.716  1.00 51.72  ? 47   ARG B NE  1 
ATOM   4544  C  CZ  . ARG B 1 47  ? 105.300 71.878 89.421  1.00 53.57  ? 47   ARG B CZ  1 
ATOM   4545  N  NH1 . ARG B 1 47  ? 105.355 72.300 88.162  1.00 52.38  ? 47   ARG B NH1 1 
ATOM   4546  N  NH2 . ARG B 1 47  ? 104.948 72.722 90.386  1.00 52.51  ? 47   ARG B NH2 1 
ATOM   4547  N  N   . PRO B 1 48  ? 103.228 66.327 94.446  1.00 38.41  ? 48   PRO B N   1 
ATOM   4548  C  CA  . PRO B 1 48  ? 103.375 65.563 95.686  1.00 37.70  ? 48   PRO B CA  1 
ATOM   4549  C  C   . PRO B 1 48  ? 104.594 66.012 96.486  1.00 38.41  ? 48   PRO B C   1 
ATOM   4550  O  O   . PRO B 1 48  ? 105.551 66.560 95.937  1.00 36.34  ? 48   PRO B O   1 
ATOM   4551  C  CB  . PRO B 1 48  ? 103.513 64.133 95.187  1.00 37.28  ? 48   PRO B CB  1 
ATOM   4552  C  CG  . PRO B 1 48  ? 104.286 64.317 93.915  1.00 37.67  ? 48   PRO B CG  1 
ATOM   4553  C  CD  . PRO B 1 48  ? 103.570 65.498 93.276  1.00 37.28  ? 48   PRO B CD  1 
ATOM   4554  N  N   . GLU B 1 49  ? 104.545 65.778 97.790  1.00 39.53  ? 49   GLU B N   1 
ATOM   4555  C  CA  . GLU B 1 49  ? 105.640 66.140 98.669  1.00 41.22  ? 49   GLU B CA  1 
ATOM   4556  C  C   . GLU B 1 49  ? 106.083 64.879 99.401  1.00 40.75  ? 49   GLU B C   1 
ATOM   4557  O  O   . GLU B 1 49  ? 105.254 64.046 99.784  1.00 40.12  ? 49   GLU B O   1 
ATOM   4558  C  CB  . GLU B 1 49  ? 105.184 67.194 99.678  1.00 43.91  ? 49   GLU B CB  1 
ATOM   4559  C  CG  . GLU B 1 49  ? 106.294 68.133 100.076 1.00 49.24  ? 49   GLU B CG  1 
ATOM   4560  C  CD  . GLU B 1 49  ? 106.697 69.058 98.939  1.00 52.20  ? 49   GLU B CD  1 
ATOM   4561  O  OE1 . GLU B 1 49  ? 107.896 69.412 98.856  1.00 53.67  ? 49   GLU B OE1 1 
ATOM   4562  O  OE2 . GLU B 1 49  ? 105.810 69.437 98.140  1.00 51.44  ? 49   GLU B OE2 1 
ATOM   4563  N  N   . PRO B 1 50  ? 107.398 64.718 99.604  1.00 40.04  ? 50   PRO B N   1 
ATOM   4564  C  CA  . PRO B 1 50  ? 107.910 63.534 100.296 1.00 39.88  ? 50   PRO B CA  1 
ATOM   4565  C  C   . PRO B 1 50  ? 107.274 63.342 101.666 1.00 39.76  ? 50   PRO B C   1 
ATOM   4566  O  O   . PRO B 1 50  ? 107.034 64.304 102.393 1.00 40.41  ? 50   PRO B O   1 
ATOM   4567  C  CB  . PRO B 1 50  ? 109.408 63.808 100.395 1.00 39.01  ? 50   PRO B CB  1 
ATOM   4568  C  CG  . PRO B 1 50  ? 109.675 64.677 99.206  1.00 41.51  ? 50   PRO B CG  1 
ATOM   4569  C  CD  . PRO B 1 50  ? 108.499 65.619 99.223  1.00 41.35  ? 50   PRO B CD  1 
ATOM   4570  N  N   . LYS B 1 51  ? 106.986 62.092 102.001 1.00 39.66  ? 51   LYS B N   1 
ATOM   4571  C  CA  . LYS B 1 51  ? 106.407 61.762 103.293 1.00 40.72  ? 51   LYS B CA  1 
ATOM   4572  C  C   . LYS B 1 51  ? 107.440 62.136 104.352 1.00 42.58  ? 51   LYS B C   1 
ATOM   4573  O  O   . LYS B 1 51  ? 108.615 61.788 104.217 1.00 42.04  ? 51   LYS B O   1 
ATOM   4574  C  CB  . LYS B 1 51  ? 106.122 60.260 103.364 1.00 38.87  ? 51   LYS B CB  1 
ATOM   4575  C  CG  . LYS B 1 51  ? 105.678 59.760 104.727 1.00 35.83  ? 51   LYS B CG  1 
ATOM   4576  C  CD  . LYS B 1 51  ? 104.373 60.400 105.149 1.00 35.40  ? 51   LYS B CD  1 
ATOM   4577  C  CE  . LYS B 1 51  ? 103.797 59.712 106.369 1.00 35.55  ? 51   LYS B CE  1 
ATOM   4578  N  NZ  . LYS B 1 51  ? 102.440 60.220 106.696 1.00 35.82  ? 51   LYS B NZ  1 
ATOM   4579  N  N   . LYS B 1 52  ? 107.021 62.851 105.392 1.00 43.44  ? 52   LYS B N   1 
ATOM   4580  C  CA  . LYS B 1 52  ? 107.961 63.222 106.437 1.00 45.82  ? 52   LYS B CA  1 
ATOM   4581  C  C   . LYS B 1 52  ? 108.107 62.073 107.415 1.00 45.88  ? 52   LYS B C   1 
ATOM   4582  O  O   . LYS B 1 52  ? 107.142 61.373 107.713 1.00 45.83  ? 52   LYS B O   1 
ATOM   4583  C  CB  . LYS B 1 52  ? 107.519 64.501 107.148 1.00 47.56  ? 52   LYS B CB  1 
ATOM   4584  C  CG  . LYS B 1 52  ? 106.036 64.615 107.403 1.00 51.38  ? 52   LYS B CG  1 
ATOM   4585  C  CD  . LYS B 1 52  ? 105.685 66.048 107.794 1.00 53.44  ? 52   LYS B CD  1 
ATOM   4586  C  CE  . LYS B 1 52  ? 106.109 67.040 106.711 1.00 54.48  ? 52   LYS B CE  1 
ATOM   4587  N  NZ  . LYS B 1 52  ? 105.721 68.443 107.049 1.00 55.42  ? 52   LYS B NZ  1 
ATOM   4588  N  N   . PRO B 1 53  ? 109.329 61.860 107.922 1.00 47.00  ? 53   PRO B N   1 
ATOM   4589  C  CA  . PRO B 1 53  ? 109.638 60.785 108.868 1.00 46.57  ? 53   PRO B CA  1 
ATOM   4590  C  C   . PRO B 1 53  ? 108.620 60.616 109.987 1.00 45.87  ? 53   PRO B C   1 
ATOM   4591  O  O   . PRO B 1 53  ? 108.057 61.587 110.491 1.00 46.51  ? 53   PRO B O   1 
ATOM   4592  C  CB  . PRO B 1 53  ? 111.017 61.174 109.383 1.00 47.42  ? 53   PRO B CB  1 
ATOM   4593  C  CG  . PRO B 1 53  ? 111.628 61.847 108.190 1.00 47.53  ? 53   PRO B CG  1 
ATOM   4594  C  CD  . PRO B 1 53  ? 110.502 62.730 107.725 1.00 46.19  ? 53   PRO B CD  1 
ATOM   4595  N  N   . TRP B 1 54  ? 108.383 59.368 110.367 1.00 44.83  ? 54   TRP B N   1 
ATOM   4596  C  CA  . TRP B 1 54  ? 107.441 59.065 111.430 1.00 44.12  ? 54   TRP B CA  1 
ATOM   4597  C  C   . TRP B 1 54  ? 108.169 58.289 112.515 1.00 45.18  ? 54   TRP B C   1 
ATOM   4598  O  O   . TRP B 1 54  ? 109.206 57.666 112.264 1.00 44.80  ? 54   TRP B O   1 
ATOM   4599  C  CB  . TRP B 1 54  ? 106.277 58.234 110.888 1.00 41.66  ? 54   TRP B CB  1 
ATOM   4600  C  CG  . TRP B 1 54  ? 106.671 56.854 110.424 1.00 40.73  ? 54   TRP B CG  1 
ATOM   4601  C  CD1 . TRP B 1 54  ? 106.859 55.743 111.203 1.00 39.23  ? 54   TRP B CD1 1 
ATOM   4602  C  CD2 . TRP B 1 54  ? 106.930 56.446 109.076 1.00 38.27  ? 54   TRP B CD2 1 
ATOM   4603  N  NE1 . TRP B 1 54  ? 107.217 54.670 110.421 1.00 38.35  ? 54   TRP B NE1 1 
ATOM   4604  C  CE2 . TRP B 1 54  ? 107.269 55.073 109.112 1.00 39.64  ? 54   TRP B CE2 1 
ATOM   4605  C  CE3 . TRP B 1 54  ? 106.909 57.106 107.840 1.00 38.81  ? 54   TRP B CE3 1 
ATOM   4606  C  CZ2 . TRP B 1 54  ? 107.585 54.347 107.954 1.00 38.93  ? 54   TRP B CZ2 1 
ATOM   4607  C  CZ3 . TRP B 1 54  ? 107.225 56.383 106.688 1.00 37.49  ? 54   TRP B CZ3 1 
ATOM   4608  C  CH2 . TRP B 1 54  ? 107.558 55.019 106.757 1.00 38.53  ? 54   TRP B CH2 1 
ATOM   4609  N  N   . SER B 1 55  ? 107.627 58.329 113.724 1.00 46.05  ? 55   SER B N   1 
ATOM   4610  C  CA  . SER B 1 55  ? 108.237 57.619 114.835 1.00 47.00  ? 55   SER B CA  1 
ATOM   4611  C  C   . SER B 1 55  ? 107.475 56.327 115.062 1.00 46.73  ? 55   SER B C   1 
ATOM   4612  O  O   . SER B 1 55  ? 106.351 56.170 114.585 1.00 47.70  ? 55   SER B O   1 
ATOM   4613  C  CB  . SER B 1 55  ? 108.204 58.492 116.088 1.00 48.69  ? 55   SER B CB  1 
ATOM   4614  O  OG  . SER B 1 55  ? 108.855 59.730 115.840 1.00 51.93  ? 55   SER B OG  1 
ATOM   4615  N  N   . GLY B 1 56  ? 108.086 55.396 115.780 1.00 45.44  ? 56   GLY B N   1 
ATOM   4616  C  CA  . GLY B 1 56  ? 107.415 54.141 116.035 1.00 45.26  ? 56   GLY B CA  1 
ATOM   4617  C  C   . GLY B 1 56  ? 107.385 53.251 114.808 1.00 45.54  ? 56   GLY B C   1 
ATOM   4618  O  O   . GLY B 1 56  ? 108.002 53.558 113.785 1.00 44.57  ? 56   GLY B O   1 
ATOM   4619  N  N   . VAL B 1 57  ? 106.654 52.148 114.919 1.00 45.03  ? 57   VAL B N   1 
ATOM   4620  C  CA  . VAL B 1 57  ? 106.532 51.171 113.847 1.00 44.42  ? 57   VAL B CA  1 
ATOM   4621  C  C   . VAL B 1 57  ? 105.240 51.337 113.048 1.00 44.55  ? 57   VAL B C   1 
ATOM   4622  O  O   . VAL B 1 57  ? 104.137 51.300 113.607 1.00 43.68  ? 57   VAL B O   1 
ATOM   4623  C  CB  . VAL B 1 57  ? 106.571 49.734 114.419 1.00 44.63  ? 57   VAL B CB  1 
ATOM   4624  C  CG1 . VAL B 1 57  ? 106.463 48.721 113.295 1.00 43.69  ? 57   VAL B CG1 1 
ATOM   4625  C  CG2 . VAL B 1 57  ? 107.850 49.526 115.218 1.00 44.21  ? 57   VAL B CG2 1 
ATOM   4626  N  N   . TRP B 1 58  ? 105.382 51.516 111.738 1.00 43.45  ? 58   TRP B N   1 
ATOM   4627  C  CA  . TRP B 1 58  ? 104.228 51.668 110.866 1.00 42.01  ? 58   TRP B CA  1 
ATOM   4628  C  C   . TRP B 1 58  ? 103.665 50.285 110.557 1.00 41.53  ? 58   TRP B C   1 
ATOM   4629  O  O   . TRP B 1 58  ? 104.371 49.428 110.031 1.00 41.94  ? 58   TRP B O   1 
ATOM   4630  C  CB  . TRP B 1 58  ? 104.626 52.363 109.561 1.00 40.31  ? 58   TRP B CB  1 
ATOM   4631  C  CG  . TRP B 1 58  ? 103.447 52.649 108.681 1.00 40.30  ? 58   TRP B CG  1 
ATOM   4632  C  CD1 . TRP B 1 58  ? 102.668 51.734 108.028 1.00 39.28  ? 58   TRP B CD1 1 
ATOM   4633  C  CD2 . TRP B 1 58  ? 102.865 53.930 108.420 1.00 38.95  ? 58   TRP B CD2 1 
ATOM   4634  N  NE1 . TRP B 1 58  ? 101.637 52.365 107.384 1.00 39.51  ? 58   TRP B NE1 1 
ATOM   4635  C  CE2 . TRP B 1 58  ? 101.730 53.714 107.606 1.00 39.13  ? 58   TRP B CE2 1 
ATOM   4636  C  CE3 . TRP B 1 58  ? 103.189 55.240 108.797 1.00 39.08  ? 58   TRP B CE3 1 
ATOM   4637  C  CZ2 . TRP B 1 58  ? 100.912 54.762 107.159 1.00 38.40  ? 58   TRP B CZ2 1 
ATOM   4638  C  CZ3 . TRP B 1 58  ? 102.374 56.287 108.353 1.00 40.89  ? 58   TRP B CZ3 1 
ATOM   4639  C  CH2 . TRP B 1 58  ? 101.248 56.037 107.541 1.00 38.53  ? 58   TRP B CH2 1 
ATOM   4640  N  N   . ASN B 1 59  ? 102.398 50.068 110.892 1.00 40.56  ? 59   ASN B N   1 
ATOM   4641  C  CA  . ASN B 1 59  ? 101.759 48.784 110.635 1.00 41.95  ? 59   ASN B CA  1 
ATOM   4642  C  C   . ASN B 1 59  ? 101.520 48.646 109.129 1.00 41.33  ? 59   ASN B C   1 
ATOM   4643  O  O   . ASN B 1 59  ? 100.719 49.380 108.552 1.00 40.77  ? 59   ASN B O   1 
ATOM   4644  C  CB  . ASN B 1 59  ? 100.423 48.698 111.377 1.00 43.69  ? 59   ASN B CB  1 
ATOM   4645  C  CG  . ASN B 1 59  ? 99.847  47.296 111.375 1.00 49.23  ? 59   ASN B CG  1 
ATOM   4646  O  OD1 . ASN B 1 59  ? 100.034 46.548 110.412 1.00 48.28  ? 59   ASN B OD1 1 
ATOM   4647  N  ND2 . ASN B 1 59  ? 99.136  46.938 112.443 1.00 52.98  ? 59   ASN B ND2 1 
ATOM   4648  N  N   . ALA B 1 60  ? 102.214 47.710 108.492 1.00 39.24  ? 60   ALA B N   1 
ATOM   4649  C  CA  . ALA B 1 60  ? 102.055 47.514 107.055 1.00 38.65  ? 60   ALA B CA  1 
ATOM   4650  C  C   . ALA B 1 60  ? 101.499 46.129 106.723 1.00 38.73  ? 60   ALA B C   1 
ATOM   4651  O  O   . ALA B 1 60  ? 102.025 45.431 105.855 1.00 36.93  ? 60   ALA B O   1 
ATOM   4652  C  CB  . ALA B 1 60  ? 103.395 47.727 106.352 1.00 36.86  ? 60   ALA B CB  1 
ATOM   4653  N  N   . SER B 1 61  ? 100.427 45.738 107.406 1.00 38.14  ? 61   SER B N   1 
ATOM   4654  C  CA  . SER B 1 61  ? 99.832  44.430 107.167 1.00 39.27  ? 61   SER B CA  1 
ATOM   4655  C  C   . SER B 1 61  ? 98.472  44.472 106.458 1.00 39.08  ? 61   SER B C   1 
ATOM   4656  O  O   . SER B 1 61  ? 97.887  43.420 106.168 1.00 39.04  ? 61   SER B O   1 
ATOM   4657  C  CB  . SER B 1 61  ? 99.703  43.665 108.485 1.00 38.85  ? 61   SER B CB  1 
ATOM   4658  O  OG  . SER B 1 61  ? 98.847  44.343 109.380 1.00 39.20  ? 61   SER B OG  1 
ATOM   4659  N  N   . THR B 1 62  ? 97.967  45.670 106.175 1.00 37.32  ? 62   THR B N   1 
ATOM   4660  C  CA  . THR B 1 62  ? 96.687  45.775 105.485 1.00 38.14  ? 62   THR B CA  1 
ATOM   4661  C  C   . THR B 1 62  ? 96.764  46.750 104.315 1.00 37.00  ? 62   THR B C   1 
ATOM   4662  O  O   . THR B 1 62  ? 97.507  47.734 104.356 1.00 37.46  ? 62   THR B O   1 
ATOM   4663  C  CB  . THR B 1 62  ? 95.555  46.241 106.427 1.00 39.70  ? 62   THR B CB  1 
ATOM   4664  O  OG1 . THR B 1 62  ? 95.658  47.653 106.640 1.00 43.03  ? 62   THR B OG1 1 
ATOM   4665  C  CG2 . THR B 1 62  ? 95.645  45.527 107.773 1.00 41.08  ? 62   THR B CG2 1 
ATOM   4666  N  N   . TYR B 1 63  ? 95.999  46.460 103.267 1.00 34.43  ? 63   TYR B N   1 
ATOM   4667  C  CA  . TYR B 1 63  ? 95.960  47.319 102.093 1.00 33.11  ? 63   TYR B CA  1 
ATOM   4668  C  C   . TYR B 1 63  ? 95.493  48.718 102.489 1.00 32.10  ? 63   TYR B C   1 
ATOM   4669  O  O   . TYR B 1 63  ? 94.748  48.883 103.453 1.00 31.84  ? 63   TYR B O   1 
ATOM   4670  C  CB  . TYR B 1 63  ? 95.006  46.748 101.046 1.00 31.65  ? 63   TYR B CB  1 
ATOM   4671  C  CG  . TYR B 1 63  ? 95.607  45.690 100.147 1.00 32.72  ? 63   TYR B CG  1 
ATOM   4672  C  CD1 . TYR B 1 63  ? 96.859  45.876 99.560  1.00 30.66  ? 63   TYR B CD1 1 
ATOM   4673  C  CD2 . TYR B 1 63  ? 94.885  44.544 99.806  1.00 32.17  ? 63   TYR B CD2 1 
ATOM   4674  C  CE1 . TYR B 1 63  ? 97.373  44.957 98.652  1.00 31.48  ? 63   TYR B CE1 1 
ATOM   4675  C  CE2 . TYR B 1 63  ? 95.394  43.615 98.892  1.00 32.04  ? 63   TYR B CE2 1 
ATOM   4676  C  CZ  . TYR B 1 63  ? 96.637  43.833 98.318  1.00 31.49  ? 63   TYR B CZ  1 
ATOM   4677  O  OH  . TYR B 1 63  ? 97.140  42.945 97.393  1.00 32.28  ? 63   TYR B OH  1 
ATOM   4678  N  N   . PRO B 1 64  ? 95.937  49.746 101.752 1.00 31.85  ? 64   PRO B N   1 
ATOM   4679  C  CA  . PRO B 1 64  ? 95.548  51.129 102.043 1.00 31.50  ? 64   PRO B CA  1 
ATOM   4680  C  C   . PRO B 1 64  ? 94.323  51.537 101.240 1.00 32.40  ? 64   PRO B C   1 
ATOM   4681  O  O   . PRO B 1 64  ? 93.807  50.755 100.436 1.00 32.77  ? 64   PRO B O   1 
ATOM   4682  C  CB  . PRO B 1 64  ? 96.766  51.913 101.596 1.00 30.29  ? 64   PRO B CB  1 
ATOM   4683  C  CG  . PRO B 1 64  ? 97.120  51.182 100.329 1.00 29.83  ? 64   PRO B CG  1 
ATOM   4684  C  CD  . PRO B 1 64  ? 97.033  49.717 100.765 1.00 29.74  ? 64   PRO B CD  1 
ATOM   4685  N  N   . ASN B 1 65  ? 93.887  52.778 101.440 1.00 32.03  ? 65   ASN B N   1 
ATOM   4686  C  CA  . ASN B 1 65  ? 92.747  53.319 100.717 1.00 31.80  ? 65   ASN B CA  1 
ATOM   4687  C  C   . ASN B 1 65  ? 93.071  53.448 99.235  1.00 29.79  ? 65   ASN B C   1 
ATOM   4688  O  O   . ASN B 1 65  ? 94.235  53.470 98.837  1.00 27.80  ? 65   ASN B O   1 
ATOM   4689  C  CB  . ASN B 1 65  ? 92.371  54.703 101.245 1.00 34.69  ? 65   ASN B CB  1 
ATOM   4690  C  CG  . ASN B 1 65  ? 91.976  54.686 102.699 1.00 37.40  ? 65   ASN B CG  1 
ATOM   4691  O  OD1 . ASN B 1 65  ? 91.180  53.852 103.126 1.00 37.90  ? 65   ASN B OD1 1 
ATOM   4692  N  ND2 . ASN B 1 65  ? 92.526  55.621 103.472 1.00 39.81  ? 65   ASN B ND2 1 
ATOM   4693  N  N   . ASN B 1 66  ? 92.021  53.538 98.431  1.00 28.01  ? 66   ASN B N   1 
ATOM   4694  C  CA  . ASN B 1 66  ? 92.141  53.689 96.991  1.00 28.26  ? 66   ASN B CA  1 
ATOM   4695  C  C   . ASN B 1 66  ? 91.835  55.161 96.734  1.00 28.74  ? 66   ASN B C   1 
ATOM   4696  O  O   . ASN B 1 66  ? 91.079  55.776 97.480  1.00 28.76  ? 66   ASN B O   1 
ATOM   4697  C  CB  . ASN B 1 66  ? 91.113  52.800 96.282  1.00 27.33  ? 66   ASN B CB  1 
ATOM   4698  C  CG  . ASN B 1 66  ? 91.334  51.314 96.545  1.00 26.85  ? 66   ASN B CG  1 
ATOM   4699  O  OD1 . ASN B 1 66  ? 90.391  50.529 96.532  1.00 29.27  ? 66   ASN B OD1 1 
ATOM   4700  N  ND2 . ASN B 1 66  ? 92.581  50.923 96.770  1.00 28.38  ? 66   ASN B ND2 1 
ATOM   4701  N  N   . CYS B 1 67  ? 92.433  55.733 95.699  1.00 28.18  ? 67   CYS B N   1 
ATOM   4702  C  CA  . CYS B 1 67  ? 92.198  57.134 95.398  1.00 29.89  ? 67   CYS B CA  1 
ATOM   4703  C  C   . CYS B 1 67  ? 90.745  57.371 94.977  1.00 30.62  ? 67   CYS B C   1 
ATOM   4704  O  O   . CYS B 1 67  ? 90.047  56.442 94.561  1.00 31.52  ? 67   CYS B O   1 
ATOM   4705  C  CB  . CYS B 1 67  ? 93.160  57.599 94.294  1.00 30.54  ? 67   CYS B CB  1 
ATOM   4706  S  SG  . CYS B 1 67  ? 94.940  57.505 94.732  1.00 37.93  ? 67   CYS B SG  1 
ATOM   4707  N  N   . GLN B 1 68  ? 90.292  58.617 95.110  1.00 30.68  ? 68   GLN B N   1 
ATOM   4708  C  CA  . GLN B 1 68  ? 88.939  59.000 94.720  1.00 30.21  ? 68   GLN B CA  1 
ATOM   4709  C  C   . GLN B 1 68  ? 88.815  58.799 93.213  1.00 28.98  ? 68   GLN B C   1 
ATOM   4710  O  O   . GLN B 1 68  ? 89.676  59.246 92.451  1.00 28.27  ? 68   GLN B O   1 
ATOM   4711  C  CB  . GLN B 1 68  ? 88.684  60.476 95.057  1.00 32.75  ? 68   GLN B CB  1 
ATOM   4712  C  CG  . GLN B 1 68  ? 88.628  60.788 96.541  1.00 34.67  ? 68   GLN B CG  1 
ATOM   4713  C  CD  . GLN B 1 68  ? 87.370  60.262 97.209  1.00 38.41  ? 68   GLN B CD  1 
ATOM   4714  O  OE1 . GLN B 1 68  ? 87.275  60.237 98.436  1.00 43.37  ? 68   GLN B OE1 1 
ATOM   4715  N  NE2 . GLN B 1 68  ? 86.395  59.851 96.409  1.00 37.63  ? 68   GLN B NE2 1 
ATOM   4716  N  N   . GLN B 1 69  ? 87.747  58.140 92.778  1.00 27.45  ? 69   GLN B N   1 
ATOM   4717  C  CA  . GLN B 1 69  ? 87.567  57.895 91.352  1.00 27.82  ? 69   GLN B CA  1 
ATOM   4718  C  C   . GLN B 1 69  ? 86.134  57.543 90.952  1.00 28.92  ? 69   GLN B C   1 
ATOM   4719  O  O   . GLN B 1 69  ? 85.287  57.225 91.792  1.00 28.56  ? 69   GLN B O   1 
ATOM   4720  C  CB  . GLN B 1 69  ? 88.503  56.762 90.904  1.00 25.42  ? 69   GLN B CB  1 
ATOM   4721  C  CG  . GLN B 1 69  ? 88.351  55.478 91.725  1.00 26.05  ? 69   GLN B CG  1 
ATOM   4722  C  CD  . GLN B 1 69  ? 89.421  54.437 91.414  1.00 27.96  ? 69   GLN B CD  1 
ATOM   4723  O  OE1 . GLN B 1 69  ? 89.326  53.705 90.434  1.00 25.07  ? 69   GLN B OE1 1 
ATOM   4724  N  NE2 . GLN B 1 69  ? 90.457  54.381 92.255  1.00 27.03  ? 69   GLN B NE2 1 
ATOM   4725  N  N   . TYR B 1 70  ? 85.879  57.611 89.651  1.00 29.26  ? 70   TYR B N   1 
ATOM   4726  C  CA  . TYR B 1 70  ? 84.587  57.247 89.094  1.00 31.40  ? 70   TYR B CA  1 
ATOM   4727  C  C   . TYR B 1 70  ? 84.478  55.730 89.263  1.00 31.38  ? 70   TYR B C   1 
ATOM   4728  O  O   . TYR B 1 70  ? 85.432  55.014 88.976  1.00 31.74  ? 70   TYR B O   1 
ATOM   4729  C  CB  . TYR B 1 70  ? 84.555  57.609 87.606  1.00 33.02  ? 70   TYR B CB  1 
ATOM   4730  C  CG  . TYR B 1 70  ? 83.403  57.002 86.842  1.00 34.89  ? 70   TYR B CG  1 
ATOM   4731  C  CD1 . TYR B 1 70  ? 82.162  57.641 86.780  1.00 36.05  ? 70   TYR B CD1 1 
ATOM   4732  C  CD2 . TYR B 1 70  ? 83.546  55.768 86.200  1.00 34.37  ? 70   TYR B CD2 1 
ATOM   4733  C  CE1 . TYR B 1 70  ? 81.087  57.060 86.095  1.00 37.46  ? 70   TYR B CE1 1 
ATOM   4734  C  CE2 . TYR B 1 70  ? 82.484  55.180 85.517  1.00 35.92  ? 70   TYR B CE2 1 
ATOM   4735  C  CZ  . TYR B 1 70  ? 81.260  55.830 85.468  1.00 37.08  ? 70   TYR B CZ  1 
ATOM   4736  O  OH  . TYR B 1 70  ? 80.216  55.253 84.783  1.00 38.76  ? 70   TYR B OH  1 
ATOM   4737  N  N   . VAL B 1 71  ? 83.339  55.243 89.745  1.00 31.63  ? 71   VAL B N   1 
ATOM   4738  C  CA  . VAL B 1 71  ? 83.148  53.809 89.921  1.00 32.25  ? 71   VAL B CA  1 
ATOM   4739  C  C   . VAL B 1 71  ? 82.148  53.284 88.888  1.00 33.61  ? 71   VAL B C   1 
ATOM   4740  O  O   . VAL B 1 71  ? 81.084  53.869 88.689  1.00 32.45  ? 71   VAL B O   1 
ATOM   4741  C  CB  . VAL B 1 71  ? 82.624  53.474 91.333  1.00 35.05  ? 71   VAL B CB  1 
ATOM   4742  C  CG1 . VAL B 1 71  ? 82.423  51.967 91.469  1.00 33.60  ? 71   VAL B CG1 1 
ATOM   4743  C  CG2 . VAL B 1 71  ? 83.602  53.972 92.389  1.00 33.31  ? 71   VAL B CG2 1 
ATOM   4744  N  N   . ASP B 1 72  ? 82.500  52.178 88.237  1.00 34.01  ? 72   ASP B N   1 
ATOM   4745  C  CA  . ASP B 1 72  ? 81.654  51.567 87.217  1.00 34.70  ? 72   ASP B CA  1 
ATOM   4746  C  C   . ASP B 1 72  ? 80.525  50.726 87.795  1.00 34.52  ? 72   ASP B C   1 
ATOM   4747  O  O   . ASP B 1 72  ? 80.769  49.720 88.458  1.00 33.97  ? 72   ASP B O   1 
ATOM   4748  C  CB  . ASP B 1 72  ? 82.500  50.702 86.274  1.00 34.60  ? 72   ASP B CB  1 
ATOM   4749  C  CG  . ASP B 1 72  ? 81.654  49.782 85.412  1.00 36.40  ? 72   ASP B CG  1 
ATOM   4750  O  OD1 . ASP B 1 72  ? 80.573  50.218 84.963  1.00 36.01  ? 72   ASP B OD1 1 
ATOM   4751  O  OD2 . ASP B 1 72  ? 82.066  48.626 85.173  1.00 36.92  ? 72   ASP B OD2 1 
ATOM   4752  N  N   . GLU B 1 73  ? 79.293  51.141 87.515  1.00 35.34  ? 73   GLU B N   1 
ATOM   4753  C  CA  . GLU B 1 73  ? 78.099  50.449 87.991  1.00 38.76  ? 73   GLU B CA  1 
ATOM   4754  C  C   . GLU B 1 73  ? 77.181  50.017 86.847  1.00 38.17  ? 73   GLU B C   1 
ATOM   4755  O  O   . GLU B 1 73  ? 75.973  49.904 87.027  1.00 39.17  ? 73   GLU B O   1 
ATOM   4756  C  CB  . GLU B 1 73  ? 77.317  51.351 88.952  1.00 41.25  ? 73   GLU B CB  1 
ATOM   4757  C  CG  . GLU B 1 73  ? 78.018  51.600 90.271  1.00 48.08  ? 73   GLU B CG  1 
ATOM   4758  C  CD  . GLU B 1 73  ? 77.442  52.784 91.030  1.00 53.82  ? 73   GLU B CD  1 
ATOM   4759  O  OE1 . GLU B 1 73  ? 77.889  53.024 92.174  1.00 57.72  ? 73   GLU B OE1 1 
ATOM   4760  O  OE2 . GLU B 1 73  ? 76.552  53.479 90.487  1.00 55.54  ? 73   GLU B OE2 1 
ATOM   4761  N  N   . GLN B 1 74  ? 77.751  49.779 85.673  1.00 37.36  ? 74   GLN B N   1 
ATOM   4762  C  CA  . GLN B 1 74  ? 76.963  49.346 84.529  1.00 38.03  ? 74   GLN B CA  1 
ATOM   4763  C  C   . GLN B 1 74  ? 76.334  47.991 84.793  1.00 36.47  ? 74   GLN B C   1 
ATOM   4764  O  O   . GLN B 1 74  ? 75.168  47.769 84.472  1.00 34.34  ? 74   GLN B O   1 
ATOM   4765  C  CB  . GLN B 1 74  ? 77.835  49.244 83.274  1.00 40.64  ? 74   GLN B CB  1 
ATOM   4766  C  CG  . GLN B 1 74  ? 77.792  50.470 82.383  1.00 47.78  ? 74   GLN B CG  1 
ATOM   4767  C  CD  . GLN B 1 74  ? 76.419  50.704 81.771  1.00 51.08  ? 74   GLN B CD  1 
ATOM   4768  O  OE1 . GLN B 1 74  ? 76.206  51.683 81.052  1.00 53.61  ? 74   GLN B OE1 1 
ATOM   4769  N  NE2 . GLN B 1 74  ? 75.480  49.799 82.047  1.00 52.60  ? 74   GLN B NE2 1 
ATOM   4770  N  N   . PHE B 1 75  ? 77.116  47.092 85.382  1.00 34.90  ? 75   PHE B N   1 
ATOM   4771  C  CA  . PHE B 1 75  ? 76.656  45.740 85.669  1.00 36.41  ? 75   PHE B CA  1 
ATOM   4772  C  C   . PHE B 1 75  ? 76.807  45.386 87.146  1.00 37.45  ? 75   PHE B C   1 
ATOM   4773  O  O   . PHE B 1 75  ? 77.801  44.776 87.552  1.00 37.62  ? 75   PHE B O   1 
ATOM   4774  C  CB  . PHE B 1 75  ? 77.451  44.743 84.831  1.00 35.66  ? 75   PHE B CB  1 
ATOM   4775  C  CG  . PHE B 1 75  ? 77.492  45.076 83.370  1.00 36.54  ? 75   PHE B CG  1 
ATOM   4776  C  CD1 . PHE B 1 75  ? 76.335  45.036 82.600  1.00 35.83  ? 75   PHE B CD1 1 
ATOM   4777  C  CD2 . PHE B 1 75  ? 78.698  45.399 82.754  1.00 35.04  ? 75   PHE B CD2 1 
ATOM   4778  C  CE1 . PHE B 1 75  ? 76.378  45.308 81.236  1.00 36.33  ? 75   PHE B CE1 1 
ATOM   4779  C  CE2 . PHE B 1 75  ? 78.753  45.672 81.393  1.00 35.71  ? 75   PHE B CE2 1 
ATOM   4780  C  CZ  . PHE B 1 75  ? 77.593  45.626 80.630  1.00 36.81  ? 75   PHE B CZ  1 
ATOM   4781  N  N   . PRO B 1 76  ? 75.813  45.750 87.968  1.00 38.90  ? 76   PRO B N   1 
ATOM   4782  C  CA  . PRO B 1 76  ? 75.862  45.460 89.402  1.00 39.85  ? 76   PRO B CA  1 
ATOM   4783  C  C   . PRO B 1 76  ? 75.945  43.961 89.681  1.00 41.21  ? 76   PRO B C   1 
ATOM   4784  O  O   . PRO B 1 76  ? 75.211  43.163 89.087  1.00 41.15  ? 76   PRO B O   1 
ATOM   4785  C  CB  . PRO B 1 76  ? 74.564  46.073 89.916  1.00 40.87  ? 76   PRO B CB  1 
ATOM   4786  C  CG  . PRO B 1 76  ? 74.312  47.201 88.946  1.00 39.77  ? 76   PRO B CG  1 
ATOM   4787  C  CD  . PRO B 1 76  ? 74.611  46.536 87.636  1.00 38.96  ? 76   PRO B CD  1 
ATOM   4788  N  N   . GLY B 1 77  ? 76.845  43.583 90.581  1.00 42.26  ? 77   GLY B N   1 
ATOM   4789  C  CA  . GLY B 1 77  ? 76.995  42.177 90.922  1.00 42.59  ? 77   GLY B CA  1 
ATOM   4790  C  C   . GLY B 1 77  ? 77.873  41.397 89.962  1.00 42.52  ? 77   GLY B C   1 
ATOM   4791  O  O   . GLY B 1 77  ? 78.395  40.343 90.319  1.00 44.11  ? 77   GLY B O   1 
ATOM   4792  N  N   . PHE B 1 78  ? 78.048  41.916 88.750  1.00 41.42  ? 78   PHE B N   1 
ATOM   4793  C  CA  . PHE B 1 78  ? 78.861  41.251 87.734  1.00 38.97  ? 78   PHE B CA  1 
ATOM   4794  C  C   . PHE B 1 78  ? 80.353  41.350 88.041  1.00 38.03  ? 78   PHE B C   1 
ATOM   4795  O  O   . PHE B 1 78  ? 80.930  42.442 88.088  1.00 39.04  ? 78   PHE B O   1 
ATOM   4796  C  CB  . PHE B 1 78  ? 78.565  41.858 86.364  1.00 38.69  ? 78   PHE B CB  1 
ATOM   4797  C  CG  . PHE B 1 78  ? 79.173  41.100 85.223  1.00 39.10  ? 78   PHE B CG  1 
ATOM   4798  C  CD1 . PHE B 1 78  ? 78.873  39.754 85.029  1.00 38.55  ? 78   PHE B CD1 1 
ATOM   4799  C  CD2 . PHE B 1 78  ? 80.036  41.734 84.334  1.00 37.62  ? 78   PHE B CD2 1 
ATOM   4800  C  CE1 . PHE B 1 78  ? 79.425  39.043 83.961  1.00 40.52  ? 78   PHE B CE1 1 
ATOM   4801  C  CE2 . PHE B 1 78  ? 80.594  41.035 83.263  1.00 41.30  ? 78   PHE B CE2 1 
ATOM   4802  C  CZ  . PHE B 1 78  ? 80.288  39.684 83.075  1.00 40.34  ? 78   PHE B CZ  1 
ATOM   4803  N  N   . SER B 1 79  ? 80.975  40.196 88.243  1.00 37.58  ? 79   SER B N   1 
ATOM   4804  C  CA  . SER B 1 79  ? 82.393  40.119 88.570  1.00 37.95  ? 79   SER B CA  1 
ATOM   4805  C  C   . SER B 1 79  ? 83.300  40.662 87.478  1.00 37.74  ? 79   SER B C   1 
ATOM   4806  O  O   . SER B 1 79  ? 84.326  41.281 87.763  1.00 36.57  ? 79   SER B O   1 
ATOM   4807  C  CB  . SER B 1 79  ? 82.777  38.669 88.841  1.00 38.91  ? 79   SER B CB  1 
ATOM   4808  O  OG  . SER B 1 79  ? 82.617  37.897 87.659  1.00 42.14  ? 79   SER B OG  1 
ATOM   4809  N  N   . GLY B 1 80  ? 82.924  40.410 86.227  1.00 37.07  ? 80   GLY B N   1 
ATOM   4810  C  CA  . GLY B 1 80  ? 83.725  40.851 85.101  1.00 35.02  ? 80   GLY B CA  1 
ATOM   4811  C  C   . GLY B 1 80  ? 84.085  42.321 85.113  1.00 34.92  ? 80   GLY B C   1 
ATOM   4812  O  O   . GLY B 1 80  ? 85.156  42.701 84.642  1.00 34.47  ? 80   GLY B O   1 
ATOM   4813  N  N   . SER B 1 81  ? 83.194  43.149 85.644  1.00 33.93  ? 81   SER B N   1 
ATOM   4814  C  CA  . SER B 1 81  ? 83.427  44.587 85.700  1.00 36.05  ? 81   SER B CA  1 
ATOM   4815  C  C   . SER B 1 81  ? 83.795  45.068 87.104  1.00 36.09  ? 81   SER B C   1 
ATOM   4816  O  O   . SER B 1 81  ? 84.623  45.955 87.262  1.00 35.39  ? 81   SER B O   1 
ATOM   4817  C  CB  . SER B 1 81  ? 82.183  45.340 85.219  1.00 34.93  ? 81   SER B CB  1 
ATOM   4818  O  OG  . SER B 1 81  ? 81.056  45.014 86.018  1.00 36.48  ? 81   SER B OG  1 
ATOM   4819  N  N   . GLU B 1 82  ? 83.189  44.473 88.121  1.00 37.44  ? 82   GLU B N   1 
ATOM   4820  C  CA  . GLU B 1 82  ? 83.460  44.893 89.491  1.00 40.24  ? 82   GLU B CA  1 
ATOM   4821  C  C   . GLU B 1 82  ? 84.853  44.531 90.003  1.00 38.90  ? 82   GLU B C   1 
ATOM   4822  O  O   . GLU B 1 82  ? 85.305  45.078 91.008  1.00 38.68  ? 82   GLU B O   1 
ATOM   4823  C  CB  . GLU B 1 82  ? 82.366  44.356 90.421  1.00 42.21  ? 82   GLU B CB  1 
ATOM   4824  C  CG  . GLU B 1 82  ? 80.989  44.869 90.004  1.00 48.14  ? 82   GLU B CG  1 
ATOM   4825  C  CD  . GLU B 1 82  ? 79.869  44.448 90.928  1.00 51.36  ? 82   GLU B CD  1 
ATOM   4826  O  OE1 . GLU B 1 82  ? 79.745  43.235 91.213  1.00 53.50  ? 82   GLU B OE1 1 
ATOM   4827  O  OE2 . GLU B 1 82  ? 79.098  45.336 91.355  1.00 53.79  ? 82   GLU B OE2 1 
ATOM   4828  N  N   . MET B 1 83  ? 85.537  43.631 89.300  1.00 36.39  ? 83   MET B N   1 
ATOM   4829  C  CA  . MET B 1 83  ? 86.885  43.234 89.686  1.00 34.29  ? 83   MET B CA  1 
ATOM   4830  C  C   . MET B 1 83  ? 87.864  44.367 89.384  1.00 33.37  ? 83   MET B C   1 
ATOM   4831  O  O   . MET B 1 83  ? 89.045  44.269 89.704  1.00 35.02  ? 83   MET B O   1 
ATOM   4832  C  CB  . MET B 1 83  ? 87.325  41.993 88.913  1.00 34.11  ? 83   MET B CB  1 
ATOM   4833  C  CG  . MET B 1 83  ? 87.504  42.246 87.423  1.00 36.14  ? 83   MET B CG  1 
ATOM   4834  S  SD  . MET B 1 83  ? 87.959  40.764 86.511  1.00 39.84  ? 83   MET B SD  1 
ATOM   4835  C  CE  . MET B 1 83  ? 89.761  40.880 86.554  1.00 41.40  ? 83   MET B CE  1 
ATOM   4836  N  N   . TRP B 1 84  ? 87.383  45.435 88.757  1.00 30.35  ? 84   TRP B N   1 
ATOM   4837  C  CA  . TRP B 1 84  ? 88.248  46.560 88.437  1.00 28.89  ? 84   TRP B CA  1 
ATOM   4838  C  C   . TRP B 1 84  ? 87.936  47.776 89.299  1.00 27.46  ? 84   TRP B C   1 
ATOM   4839  O  O   . TRP B 1 84  ? 88.635  48.781 89.220  1.00 26.61  ? 84   TRP B O   1 
ATOM   4840  C  CB  . TRP B 1 84  ? 88.132  46.939 86.950  1.00 29.37  ? 84   TRP B CB  1 
ATOM   4841  C  CG  . TRP B 1 84  ? 88.447  45.810 86.021  1.00 30.59  ? 84   TRP B CG  1 
ATOM   4842  C  CD1 . TRP B 1 84  ? 87.554  45.070 85.301  1.00 31.73  ? 84   TRP B CD1 1 
ATOM   4843  C  CD2 . TRP B 1 84  ? 89.738  45.239 85.765  1.00 31.39  ? 84   TRP B CD2 1 
ATOM   4844  N  NE1 . TRP B 1 84  ? 88.206  44.072 84.617  1.00 32.60  ? 84   TRP B NE1 1 
ATOM   4845  C  CE2 . TRP B 1 84  ? 89.547  44.150 84.885  1.00 31.09  ? 84   TRP B CE2 1 
ATOM   4846  C  CE3 . TRP B 1 84  ? 91.039  45.539 86.197  1.00 31.09  ? 84   TRP B CE3 1 
ATOM   4847  C  CZ2 . TRP B 1 84  ? 90.608  43.355 84.429  1.00 32.18  ? 84   TRP B CZ2 1 
ATOM   4848  C  CZ3 . TRP B 1 84  ? 92.096  44.749 85.744  1.00 31.42  ? 84   TRP B CZ3 1 
ATOM   4849  C  CH2 . TRP B 1 84  ? 91.872  43.667 84.868  1.00 31.28  ? 84   TRP B CH2 1 
ATOM   4850  N  N   . ASN B 1 85  ? 86.882  47.687 90.107  1.00 27.53  ? 85   ASN B N   1 
ATOM   4851  C  CA  . ASN B 1 85  ? 86.493  48.792 90.987  1.00 27.99  ? 85   ASN B CA  1 
ATOM   4852  C  C   . ASN B 1 85  ? 87.269  48.759 92.298  1.00 26.76  ? 85   ASN B C   1 
ATOM   4853  O  O   . ASN B 1 85  ? 87.846  47.737 92.661  1.00 25.92  ? 85   ASN B O   1 
ATOM   4854  C  CB  . ASN B 1 85  ? 85.005  48.729 91.336  1.00 30.32  ? 85   ASN B CB  1 
ATOM   4855  C  CG  . ASN B 1 85  ? 84.111  48.972 90.145  1.00 33.49  ? 85   ASN B CG  1 
ATOM   4856  O  OD1 . ASN B 1 85  ? 84.418  49.795 89.281  1.00 34.51  ? 85   ASN B OD1 1 
ATOM   4857  N  ND2 . ASN B 1 85  ? 82.984  48.268 90.102  1.00 32.66  ? 85   ASN B ND2 1 
ATOM   4858  N  N   . PRO B 1 86  ? 87.288  49.886 93.026  1.00 26.82  ? 86   PRO B N   1 
ATOM   4859  C  CA  . PRO B 1 86  ? 88.003  49.933 94.304  1.00 28.13  ? 86   PRO B CA  1 
ATOM   4860  C  C   . PRO B 1 86  ? 87.447  48.851 95.232  1.00 29.27  ? 86   PRO B C   1 
ATOM   4861  O  O   . PRO B 1 86  ? 86.234  48.658 95.309  1.00 29.27  ? 86   PRO B O   1 
ATOM   4862  C  CB  . PRO B 1 86  ? 87.696  51.337 94.821  1.00 27.57  ? 86   PRO B CB  1 
ATOM   4863  C  CG  . PRO B 1 86  ? 87.507  52.131 93.582  1.00 27.04  ? 86   PRO B CG  1 
ATOM   4864  C  CD  . PRO B 1 86  ? 86.706  51.200 92.699  1.00 25.99  ? 86   PRO B CD  1 
ATOM   4865  N  N   . ASN B 1 87  ? 88.331  48.142 95.924  1.00 29.18  ? 87   ASN B N   1 
ATOM   4866  C  CA  . ASN B 1 87  ? 87.906  47.092 96.839  1.00 30.30  ? 87   ASN B CA  1 
ATOM   4867  C  C   . ASN B 1 87  ? 88.192  47.546 98.258  1.00 32.32  ? 87   ASN B C   1 
ATOM   4868  O  O   . ASN B 1 87  ? 88.123  46.761 99.205  1.00 33.34  ? 87   ASN B O   1 
ATOM   4869  C  CB  . ASN B 1 87  ? 88.626  45.772 96.526  1.00 28.47  ? 87   ASN B CB  1 
ATOM   4870  C  CG  . ASN B 1 87  ? 90.133  45.910 96.524  1.00 29.63  ? 87   ASN B CG  1 
ATOM   4871  O  OD1 . ASN B 1 87  ? 90.676  46.932 96.107  1.00 32.25  ? 87   ASN B OD1 1 
ATOM   4872  N  ND2 . ASN B 1 87  ? 90.821  44.872 96.970  1.00 31.47  ? 87   ASN B ND2 1 
ATOM   4873  N  N   . ARG B 1 88  ? 88.501  48.834 98.382  1.00 33.36  ? 88   ARG B N   1 
ATOM   4874  C  CA  . ARG B 1 88  ? 88.791  49.474 99.658  1.00 35.71  ? 88   ARG B CA  1 
ATOM   4875  C  C   . ARG B 1 88  ? 88.156  50.868 99.624  1.00 36.95  ? 88   ARG B C   1 
ATOM   4876  O  O   . ARG B 1 88  ? 87.851  51.391 98.550  1.00 37.46  ? 88   ARG B O   1 
ATOM   4877  C  CB  . ARG B 1 88  ? 90.308  49.603 99.861  1.00 36.67  ? 88   ARG B CB  1 
ATOM   4878  C  CG  . ARG B 1 88  ? 91.054  48.296 100.102 1.00 39.72  ? 88   ARG B CG  1 
ATOM   4879  C  CD  . ARG B 1 88  ? 90.769  47.757 101.491 1.00 43.57  ? 88   ARG B CD  1 
ATOM   4880  N  NE  . ARG B 1 88  ? 91.417  46.472 101.732 1.00 47.67  ? 88   ARG B NE  1 
ATOM   4881  C  CZ  . ARG B 1 88  ? 91.113  45.343 101.096 1.00 51.21  ? 88   ARG B CZ  1 
ATOM   4882  N  NH1 . ARG B 1 88  ? 91.763  44.221 101.386 1.00 52.15  ? 88   ARG B NH1 1 
ATOM   4883  N  NH2 . ARG B 1 88  ? 90.158  45.331 100.173 1.00 51.92  ? 88   ARG B NH2 1 
ATOM   4884  N  N   . GLU B 1 89  ? 87.962  51.471 100.792 1.00 37.46  ? 89   GLU B N   1 
ATOM   4885  C  CA  . GLU B 1 89  ? 87.379  52.803 100.863 1.00 39.40  ? 89   GLU B CA  1 
ATOM   4886  C  C   . GLU B 1 89  ? 88.224  53.821 100.106 1.00 37.95  ? 89   GLU B C   1 
ATOM   4887  O  O   . GLU B 1 89  ? 89.447  53.834 100.212 1.00 38.72  ? 89   GLU B O   1 
ATOM   4888  C  CB  . GLU B 1 89  ? 87.248  53.263 102.319 1.00 42.74  ? 89   GLU B CB  1 
ATOM   4889  C  CG  . GLU B 1 89  ? 86.905  54.743 102.435 1.00 50.14  ? 89   GLU B CG  1 
ATOM   4890  C  CD  . GLU B 1 89  ? 86.672  55.209 103.861 1.00 54.45  ? 89   GLU B CD  1 
ATOM   4891  O  OE1 . GLU B 1 89  ? 87.617  55.145 104.681 1.00 57.03  ? 89   GLU B OE1 1 
ATOM   4892  O  OE2 . GLU B 1 89  ? 85.537  55.647 104.158 1.00 57.06  ? 89   GLU B OE2 1 
ATOM   4893  N  N   . MET B 1 90  ? 87.564  54.692 99.359  1.00 36.69  ? 90   MET B N   1 
ATOM   4894  C  CA  . MET B 1 90  ? 88.269  55.711 98.602  1.00 35.25  ? 90   MET B CA  1 
ATOM   4895  C  C   . MET B 1 90  ? 88.533  56.917 99.483  1.00 35.67  ? 90   MET B C   1 
ATOM   4896  O  O   . MET B 1 90  ? 87.758  57.218 100.390 1.00 36.66  ? 90   MET B O   1 
ATOM   4897  C  CB  . MET B 1 90  ? 87.454  56.131 97.380  1.00 33.91  ? 90   MET B CB  1 
ATOM   4898  C  CG  . MET B 1 90  ? 87.188  55.005 96.414  1.00 31.57  ? 90   MET B CG  1 
ATOM   4899  S  SD  . MET B 1 90  ? 86.303  55.588 94.981  1.00 36.06  ? 90   MET B SD  1 
ATOM   4900  C  CE  . MET B 1 90  ? 84.612  55.554 95.588  1.00 33.91  ? 90   MET B CE  1 
ATOM   4901  N  N   . SER B 1 91  ? 89.634  57.601 99.201  1.00 35.92  ? 91   SER B N   1 
ATOM   4902  C  CA  . SER B 1 91  ? 90.043  58.776 99.955  1.00 35.75  ? 91   SER B CA  1 
ATOM   4903  C  C   . SER B 1 91  ? 91.162  59.479 99.201  1.00 35.85  ? 91   SER B C   1 
ATOM   4904  O  O   . SER B 1 91  ? 91.949  58.832 98.505  1.00 35.76  ? 91   SER B O   1 
ATOM   4905  C  CB  . SER B 1 91  ? 90.543  58.358 101.343 1.00 36.47  ? 91   SER B CB  1 
ATOM   4906  O  OG  . SER B 1 91  ? 91.268  59.404 101.969 1.00 38.08  ? 91   SER B OG  1 
ATOM   4907  N  N   . GLU B 1 92  ? 91.228  60.800 99.335  1.00 34.59  ? 92   GLU B N   1 
ATOM   4908  C  CA  . GLU B 1 92  ? 92.269  61.576 98.679  1.00 34.18  ? 92   GLU B CA  1 
ATOM   4909  C  C   . GLU B 1 92  ? 93.634  61.204 99.244  1.00 33.72  ? 92   GLU B C   1 
ATOM   4910  O  O   . GLU B 1 92  ? 94.661  61.412 98.600  1.00 35.07  ? 92   GLU B O   1 
ATOM   4911  C  CB  . GLU B 1 92  ? 92.023  63.067 98.872  1.00 36.73  ? 92   GLU B CB  1 
ATOM   4912  C  CG  . GLU B 1 92  ? 91.187  63.704 97.782  1.00 39.60  ? 92   GLU B CG  1 
ATOM   4913  C  CD  . GLU B 1 92  ? 91.031  65.197 97.991  1.00 41.75  ? 92   GLU B CD  1 
ATOM   4914  O  OE1 . GLU B 1 92  ? 90.215  65.592 98.850  1.00 43.74  ? 92   GLU B OE1 1 
ATOM   4915  O  OE2 . GLU B 1 92  ? 91.735  65.972 97.308  1.00 40.71  ? 92   GLU B OE2 1 
ATOM   4916  N  N   . ASP B 1 93  ? 93.636  60.670 100.459 1.00 32.75  ? 93   ASP B N   1 
ATOM   4917  C  CA  . ASP B 1 93  ? 94.862  60.235 101.117 1.00 35.52  ? 93   ASP B CA  1 
ATOM   4918  C  C   . ASP B 1 93  ? 95.045  58.790 100.655 1.00 35.37  ? 93   ASP B C   1 
ATOM   4919  O  O   . ASP B 1 93  ? 94.604  57.856 101.319 1.00 36.12  ? 93   ASP B O   1 
ATOM   4920  C  CB  . ASP B 1 93  ? 94.678  60.320 102.636 1.00 37.00  ? 93   ASP B CB  1 
ATOM   4921  C  CG  . ASP B 1 93  ? 95.861  59.767 103.410 1.00 36.72  ? 93   ASP B CG  1 
ATOM   4922  O  OD1 . ASP B 1 93  ? 96.994  59.773 102.890 1.00 37.00  ? 93   ASP B OD1 1 
ATOM   4923  O  OD2 . ASP B 1 93  ? 95.652  59.338 104.559 1.00 40.18  ? 93   ASP B OD2 1 
ATOM   4924  N  N   . CYS B 1 94  ? 95.701  58.623 99.509  1.00 35.80  ? 94   CYS B N   1 
ATOM   4925  C  CA  . CYS B 1 94  ? 95.877  57.304 98.904  1.00 35.19  ? 94   CYS B CA  1 
ATOM   4926  C  C   . CYS B 1 94  ? 97.259  57.011 98.335  1.00 33.43  ? 94   CYS B C   1 
ATOM   4927  O  O   . CYS B 1 94  ? 97.441  55.986 97.679  1.00 33.50  ? 94   CYS B O   1 
ATOM   4928  C  CB  . CYS B 1 94  ? 94.863  57.157 97.775  1.00 35.21  ? 94   CYS B CB  1 
ATOM   4929  S  SG  . CYS B 1 94  ? 95.075  58.472 96.528  1.00 34.79  ? 94   CYS B SG  1 
ATOM   4930  N  N   . LEU B 1 95  ? 98.224  57.893 98.569  1.00 30.87  ? 95   LEU B N   1 
ATOM   4931  C  CA  . LEU B 1 95  ? 99.562  57.684 98.035  1.00 28.78  ? 95   LEU B CA  1 
ATOM   4932  C  C   . LEU B 1 95  ? 100.411 56.702 98.845  1.00 28.73  ? 95   LEU B C   1 
ATOM   4933  O  O   . LEU B 1 95  ? 101.259 57.096 99.643  1.00 28.57  ? 95   LEU B O   1 
ATOM   4934  C  CB  . LEU B 1 95  ? 100.281 59.026 97.891  1.00 26.91  ? 95   LEU B CB  1 
ATOM   4935  C  CG  . LEU B 1 95  ? 99.607  59.986 96.906  1.00 28.61  ? 95   LEU B CG  1 
ATOM   4936  C  CD1 . LEU B 1 95  ? 100.436 61.260 96.763  1.00 27.17  ? 95   LEU B CD1 1 
ATOM   4937  C  CD2 . LEU B 1 95  ? 99.450  59.295 95.551  1.00 28.04  ? 95   LEU B CD2 1 
ATOM   4938  N  N   . TYR B 1 96  ? 100.168 55.414 98.627  1.00 28.94  ? 96   TYR B N   1 
ATOM   4939  C  CA  . TYR B 1 96  ? 100.907 54.367 99.320  1.00 28.90  ? 96   TYR B CA  1 
ATOM   4940  C  C   . TYR B 1 96  ? 101.403 53.338 98.318  1.00 28.82  ? 96   TYR B C   1 
ATOM   4941  O  O   . TYR B 1 96  ? 101.026 53.368 97.147  1.00 28.81  ? 96   TYR B O   1 
ATOM   4942  C  CB  . TYR B 1 96  ? 100.019 53.674 100.360 1.00 29.83  ? 96   TYR B CB  1 
ATOM   4943  C  CG  . TYR B 1 96  ? 99.423  54.616 101.379 1.00 33.85  ? 96   TYR B CG  1 
ATOM   4944  C  CD1 . TYR B 1 96  ? 98.370  55.464 101.036 1.00 35.02  ? 96   TYR B CD1 1 
ATOM   4945  C  CD2 . TYR B 1 96  ? 99.932  54.687 102.674 1.00 35.20  ? 96   TYR B CD2 1 
ATOM   4946  C  CE1 . TYR B 1 96  ? 97.838  56.361 101.953 1.00 36.18  ? 96   TYR B CE1 1 
ATOM   4947  C  CE2 . TYR B 1 96  ? 99.408  55.582 103.606 1.00 35.88  ? 96   TYR B CE2 1 
ATOM   4948  C  CZ  . TYR B 1 96  ? 98.362  56.417 103.237 1.00 37.57  ? 96   TYR B CZ  1 
ATOM   4949  O  OH  . TYR B 1 96  ? 97.840  57.314 104.141 1.00 37.97  ? 96   TYR B OH  1 
ATOM   4950  N  N   . LEU B 1 97  ? 102.255 52.432 98.779  1.00 27.81  ? 97   LEU B N   1 
ATOM   4951  C  CA  . LEU B 1 97  ? 102.776 51.389 97.920  1.00 26.90  ? 97   LEU B CA  1 
ATOM   4952  C  C   . LEU B 1 97  ? 102.850 50.081 98.684  1.00 26.50  ? 97   LEU B C   1 
ATOM   4953  O  O   . LEU B 1 97  ? 102.913 50.070 99.910  1.00 26.30  ? 97   LEU B O   1 
ATOM   4954  C  CB  . LEU B 1 97  ? 104.141 51.795 97.350  1.00 26.28  ? 97   LEU B CB  1 
ATOM   4955  C  CG  . LEU B 1 97  ? 105.292 52.237 98.250  1.00 27.84  ? 97   LEU B CG  1 
ATOM   4956  C  CD1 . LEU B 1 97  ? 105.970 51.036 98.874  1.00 28.09  ? 97   LEU B CD1 1 
ATOM   4957  C  CD2 . LEU B 1 97  ? 106.295 53.012 97.410  1.00 26.93  ? 97   LEU B CD2 1 
ATOM   4958  N  N   . ASN B 1 98  ? 102.808 48.976 97.950  1.00 28.18  ? 98   ASN B N   1 
ATOM   4959  C  CA  . ASN B 1 98  ? 102.843 47.653 98.552  1.00 29.25  ? 98   ASN B CA  1 
ATOM   4960  C  C   . ASN B 1 98  ? 104.089 46.928 98.088  1.00 31.63  ? 98   ASN B C   1 
ATOM   4961  O  O   . ASN B 1 98  ? 104.636 47.247 97.035  1.00 34.85  ? 98   ASN B O   1 
ATOM   4962  C  CB  . ASN B 1 98  ? 101.605 46.867 98.139  1.00 29.94  ? 98   ASN B CB  1 
ATOM   4963  C  CG  . ASN B 1 98  ? 100.336 47.667 98.304  1.00 31.37  ? 98   ASN B CG  1 
ATOM   4964  O  OD1 . ASN B 1 98  ? 100.012 48.109 99.398  1.00 35.55  ? 98   ASN B OD1 1 
ATOM   4965  N  ND2 . ASN B 1 98  ? 99.609  47.863 97.210  1.00 33.73  ? 98   ASN B ND2 1 
ATOM   4966  N  N   . ILE B 1 99  ? 104.542 45.949 98.864  1.00 31.68  ? 99   ILE B N   1 
ATOM   4967  C  CA  . ILE B 1 99  ? 105.742 45.216 98.492  1.00 31.55  ? 99   ILE B CA  1 
ATOM   4968  C  C   . ILE B 1 99  ? 105.707 43.750 98.904  1.00 31.96  ? 99   ILE B C   1 
ATOM   4969  O  O   . ILE B 1 99  ? 105.296 43.418 100.010 1.00 31.07  ? 99   ILE B O   1 
ATOM   4970  C  CB  . ILE B 1 99  ? 107.002 45.866 99.112  1.00 31.67  ? 99   ILE B CB  1 
ATOM   4971  C  CG1 . ILE B 1 99  ? 106.986 47.381 98.875  1.00 30.28  ? 99   ILE B CG1 1 
ATOM   4972  C  CG2 . ILE B 1 99  ? 108.251 45.260 98.492  1.00 31.26  ? 99   ILE B CG2 1 
ATOM   4973  C  CD1 . ILE B 1 99  ? 108.198 48.101 99.420  1.00 32.83  ? 99   ILE B CD1 1 
ATOM   4974  N  N   . TRP B 1 100 ? 106.136 42.879 97.996  1.00 31.05  ? 100  TRP B N   1 
ATOM   4975  C  CA  . TRP B 1 100 ? 106.190 41.444 98.252  1.00 30.85  ? 100  TRP B CA  1 
ATOM   4976  C  C   . TRP B 1 100 ? 107.650 41.019 98.174  1.00 31.47  ? 100  TRP B C   1 
ATOM   4977  O  O   . TRP B 1 100 ? 108.328 41.263 97.171  1.00 30.89  ? 100  TRP B O   1 
ATOM   4978  C  CB  . TRP B 1 100 ? 105.343 40.683 97.224  1.00 29.55  ? 100  TRP B CB  1 
ATOM   4979  C  CG  . TRP B 1 100 ? 103.873 40.822 97.478  1.00 29.98  ? 100  TRP B CG  1 
ATOM   4980  C  CD1 . TRP B 1 100 ? 103.105 40.043 98.295  1.00 30.47  ? 100  TRP B CD1 1 
ATOM   4981  C  CD2 . TRP B 1 100 ? 103.011 41.852 96.978  1.00 29.45  ? 100  TRP B CD2 1 
ATOM   4982  N  NE1 . TRP B 1 100 ? 101.817 40.525 98.339  1.00 31.02  ? 100  TRP B NE1 1 
ATOM   4983  C  CE2 . TRP B 1 100 ? 101.732 41.636 97.540  1.00 30.46  ? 100  TRP B CE2 1 
ATOM   4984  C  CE3 . TRP B 1 100 ? 103.194 42.936 96.112  1.00 27.32  ? 100  TRP B CE3 1 
ATOM   4985  C  CZ2 . TRP B 1 100 ? 100.642 42.466 97.263  1.00 28.93  ? 100  TRP B CZ2 1 
ATOM   4986  C  CZ3 . TRP B 1 100 ? 102.111 43.760 95.838  1.00 28.14  ? 100  TRP B CZ3 1 
ATOM   4987  C  CH2 . TRP B 1 100 ? 100.850 43.519 96.414  1.00 27.97  ? 100  TRP B CH2 1 
ATOM   4988  N  N   . VAL B 1 101 ? 108.132 40.394 99.245  1.00 31.94  ? 101  VAL B N   1 
ATOM   4989  C  CA  . VAL B 1 101 ? 109.522 39.962 99.325  1.00 32.19  ? 101  VAL B CA  1 
ATOM   4990  C  C   . VAL B 1 101 ? 109.643 38.467 99.585  1.00 33.81  ? 101  VAL B C   1 
ATOM   4991  O  O   . VAL B 1 101 ? 109.004 37.928 100.491 1.00 34.98  ? 101  VAL B O   1 
ATOM   4992  C  CB  . VAL B 1 101 ? 110.256 40.712 100.458 1.00 32.53  ? 101  VAL B CB  1 
ATOM   4993  C  CG1 . VAL B 1 101 ? 111.714 40.251 100.545 1.00 32.78  ? 101  VAL B CG1 1 
ATOM   4994  C  CG2 . VAL B 1 101 ? 110.184 42.214 100.216 1.00 31.44  ? 101  VAL B CG2 1 
ATOM   4995  N  N   . PRO B 1 102 ? 110.458 37.772 98.780  1.00 33.95  ? 102  PRO B N   1 
ATOM   4996  C  CA  . PRO B 1 102 ? 110.652 36.330 98.952  1.00 35.23  ? 102  PRO B CA  1 
ATOM   4997  C  C   . PRO B 1 102 ? 111.184 36.048 100.355 1.00 38.06  ? 102  PRO B C   1 
ATOM   4998  O  O   . PRO B 1 102 ? 111.875 36.882 100.946 1.00 36.19  ? 102  PRO B O   1 
ATOM   4999  C  CB  . PRO B 1 102 ? 111.678 35.992 97.875  1.00 35.74  ? 102  PRO B CB  1 
ATOM   5000  C  CG  . PRO B 1 102 ? 111.353 36.962 96.792  1.00 33.57  ? 102  PRO B CG  1 
ATOM   5001  C  CD  . PRO B 1 102 ? 111.135 38.248 97.562  1.00 34.66  ? 102  PRO B CD  1 
ATOM   5002  N  N   . SER B 1 103 ? 110.861 34.878 100.887 1.00 40.53  ? 103  SER B N   1 
ATOM   5003  C  CA  . SER B 1 103 ? 111.319 34.514 102.219 1.00 44.27  ? 103  SER B CA  1 
ATOM   5004  C  C   . SER B 1 103 ? 111.996 33.150 102.195 1.00 45.37  ? 103  SER B C   1 
ATOM   5005  O  O   . SER B 1 103 ? 111.388 32.156 101.794 1.00 46.95  ? 103  SER B O   1 
ATOM   5006  C  CB  . SER B 1 103 ? 110.141 34.488 103.190 1.00 44.21  ? 103  SER B CB  1 
ATOM   5007  O  OG  . SER B 1 103 ? 110.595 34.246 104.509 1.00 48.91  ? 103  SER B OG  1 
ATOM   5008  N  N   . PRO B 1 104 ? 113.257 33.072 102.656 1.00 46.26  ? 104  PRO B N   1 
ATOM   5009  C  CA  . PRO B 1 104 ? 114.110 34.137 103.202 1.00 45.76  ? 104  PRO B CA  1 
ATOM   5010  C  C   . PRO B 1 104 ? 114.418 35.322 102.281 1.00 45.17  ? 104  PRO B C   1 
ATOM   5011  O  O   . PRO B 1 104 ? 114.501 35.179 101.062 1.00 46.36  ? 104  PRO B O   1 
ATOM   5012  C  CB  . PRO B 1 104 ? 115.372 33.380 103.616 1.00 45.80  ? 104  PRO B CB  1 
ATOM   5013  C  CG  . PRO B 1 104 ? 115.420 32.251 102.628 1.00 45.41  ? 104  PRO B CG  1 
ATOM   5014  C  CD  . PRO B 1 104 ? 113.993 31.795 102.618 1.00 45.51  ? 104  PRO B CD  1 
ATOM   5015  N  N   . ARG B 1 105 ? 114.606 36.490 102.889 1.00 44.22  ? 105  ARG B N   1 
ATOM   5016  C  CA  . ARG B 1 105 ? 114.894 37.717 102.159 1.00 44.15  ? 105  ARG B CA  1 
ATOM   5017  C  C   . ARG B 1 105 ? 116.122 37.660 101.257 1.00 46.12  ? 105  ARG B C   1 
ATOM   5018  O  O   . ARG B 1 105 ? 117.228 37.355 101.702 1.00 46.49  ? 105  ARG B O   1 
ATOM   5019  C  CB  . ARG B 1 105 ? 115.065 38.886 103.132 1.00 42.55  ? 105  ARG B CB  1 
ATOM   5020  C  CG  . ARG B 1 105 ? 115.360 40.212 102.436 1.00 43.53  ? 105  ARG B CG  1 
ATOM   5021  C  CD  . ARG B 1 105 ? 115.679 41.306 103.422 1.00 44.42  ? 105  ARG B CD  1 
ATOM   5022  N  NE  . ARG B 1 105 ? 114.669 41.398 104.472 1.00 47.76  ? 105  ARG B NE  1 
ATOM   5023  C  CZ  . ARG B 1 105 ? 114.717 42.267 105.479 1.00 48.77  ? 105  ARG B CZ  1 
ATOM   5024  N  NH1 . ARG B 1 105 ? 115.728 43.124 105.572 1.00 47.41  ? 105  ARG B NH1 1 
ATOM   5025  N  NH2 . ARG B 1 105 ? 113.758 42.277 106.395 1.00 49.10  ? 105  ARG B NH2 1 
ATOM   5026  N  N   . PRO B 1 106 ? 115.942 37.966 99.965  1.00 47.59  ? 106  PRO B N   1 
ATOM   5027  C  CA  . PRO B 1 106 ? 117.069 37.948 99.031  1.00 48.56  ? 106  PRO B CA  1 
ATOM   5028  C  C   . PRO B 1 106 ? 118.063 39.015 99.483  1.00 49.52  ? 106  PRO B C   1 
ATOM   5029  O  O   . PRO B 1 106 ? 117.737 39.841 100.339 1.00 48.85  ? 106  PRO B O   1 
ATOM   5030  C  CB  . PRO B 1 106 ? 116.418 38.309 97.699  1.00 49.11  ? 106  PRO B CB  1 
ATOM   5031  C  CG  . PRO B 1 106 ? 115.015 37.808 97.858  1.00 49.59  ? 106  PRO B CG  1 
ATOM   5032  C  CD  . PRO B 1 106 ? 114.677 38.225 99.261  1.00 47.47  ? 106  PRO B CD  1 
ATOM   5033  N  N   . LYS B 1 107 ? 119.264 39.006 98.916  1.00 50.58  ? 107  LYS B N   1 
ATOM   5034  C  CA  . LYS B 1 107 ? 120.266 39.996 99.290  1.00 52.97  ? 107  LYS B CA  1 
ATOM   5035  C  C   . LYS B 1 107 ? 120.130 41.277 98.478  1.00 53.25  ? 107  LYS B C   1 
ATOM   5036  O  O   . LYS B 1 107 ? 120.016 42.374 99.036  1.00 54.51  ? 107  LYS B O   1 
ATOM   5037  C  CB  . LYS B 1 107 ? 121.677 39.430 99.118  1.00 53.53  ? 107  LYS B CB  1 
ATOM   5038  C  CG  . LYS B 1 107 ? 122.191 38.678 100.334 1.00 54.94  ? 107  LYS B CG  1 
ATOM   5039  C  CD  . LYS B 1 107 ? 123.644 38.276 100.147 1.00 57.79  ? 107  LYS B CD  1 
ATOM   5040  C  CE  . LYS B 1 107 ? 124.207 37.604 101.388 1.00 58.17  ? 107  LYS B CE  1 
ATOM   5041  N  NZ  . LYS B 1 107 ? 124.196 38.513 102.568 1.00 59.77  ? 107  LYS B NZ  1 
ATOM   5042  N  N   . SER B 1 108 ? 120.145 41.124 97.159  1.00 51.52  ? 108  SER B N   1 
ATOM   5043  C  CA  . SER B 1 108 ? 120.032 42.243 96.235  1.00 49.24  ? 108  SER B CA  1 
ATOM   5044  C  C   . SER B 1 108 ? 119.488 41.672 94.925  1.00 47.03  ? 108  SER B C   1 
ATOM   5045  O  O   . SER B 1 108 ? 120.212 41.537 93.940  1.00 45.84  ? 108  SER B O   1 
ATOM   5046  C  CB  . SER B 1 108 ? 121.414 42.869 96.024  1.00 50.88  ? 108  SER B CB  1 
ATOM   5047  O  OG  . SER B 1 108 ? 121.367 43.966 95.126  1.00 55.16  ? 108  SER B OG  1 
ATOM   5048  N  N   . THR B 1 109 ? 118.204 41.333 94.922  1.00 43.53  ? 109  THR B N   1 
ATOM   5049  C  CA  . THR B 1 109 ? 117.594 40.743 93.745  1.00 42.15  ? 109  THR B CA  1 
ATOM   5050  C  C   . THR B 1 109 ? 116.826 41.729 92.863  1.00 38.82  ? 109  THR B C   1 
ATOM   5051  O  O   . THR B 1 109 ? 116.697 42.908 93.191  1.00 39.70  ? 109  THR B O   1 
ATOM   5052  C  CB  . THR B 1 109 ? 116.670 39.571 94.143  1.00 42.76  ? 109  THR B CB  1 
ATOM   5053  O  OG1 . THR B 1 109 ? 116.283 38.855 92.965  1.00 47.18  ? 109  THR B OG1 1 
ATOM   5054  C  CG2 . THR B 1 109 ? 115.423 40.080 94.860  1.00 44.34  ? 109  THR B CG2 1 
ATOM   5055  N  N   . THR B 1 110 ? 116.334 41.222 91.737  1.00 35.49  ? 110  THR B N   1 
ATOM   5056  C  CA  . THR B 1 110 ? 115.589 42.010 90.761  1.00 32.97  ? 110  THR B CA  1 
ATOM   5057  C  C   . THR B 1 110 ? 114.298 42.583 91.328  1.00 29.86  ? 110  THR B C   1 
ATOM   5058  O  O   . THR B 1 110 ? 113.582 41.922 92.076  1.00 26.92  ? 110  THR B O   1 
ATOM   5059  C  CB  . THR B 1 110 ? 115.235 41.156 89.522  1.00 36.61  ? 110  THR B CB  1 
ATOM   5060  O  OG1 . THR B 1 110 ? 116.411 40.479 89.057  1.00 39.92  ? 110  THR B OG1 1 
ATOM   5061  C  CG2 . THR B 1 110 ? 114.683 42.037 88.400  1.00 36.56  ? 110  THR B CG2 1 
ATOM   5062  N  N   . VAL B 1 111 ? 114.002 43.819 90.944  1.00 28.67  ? 111  VAL B N   1 
ATOM   5063  C  CA  . VAL B 1 111 ? 112.803 44.503 91.403  1.00 27.27  ? 111  VAL B CA  1 
ATOM   5064  C  C   . VAL B 1 111 ? 111.890 44.887 90.245  1.00 27.28  ? 111  VAL B C   1 
ATOM   5065  O  O   . VAL B 1 111 ? 112.343 45.432 89.236  1.00 27.94  ? 111  VAL B O   1 
ATOM   5066  C  CB  . VAL B 1 111 ? 113.180 45.779 92.175  1.00 27.66  ? 111  VAL B CB  1 
ATOM   5067  C  CG1 . VAL B 1 111 ? 111.932 46.482 92.694  1.00 24.29  ? 111  VAL B CG1 1 
ATOM   5068  C  CG2 . VAL B 1 111 ? 114.113 45.414 93.308  1.00 25.70  ? 111  VAL B CG2 1 
ATOM   5069  N  N   . MET B 1 112 ? 110.602 44.603 90.402  1.00 27.94  ? 112  MET B N   1 
ATOM   5070  C  CA  . MET B 1 112 ? 109.609 44.931 89.389  1.00 26.98  ? 112  MET B CA  1 
ATOM   5071  C  C   . MET B 1 112 ? 108.536 45.823 90.005  1.00 27.75  ? 112  MET B C   1 
ATOM   5072  O  O   . MET B 1 112 ? 107.923 45.472 91.014  1.00 29.94  ? 112  MET B O   1 
ATOM   5073  C  CB  . MET B 1 112 ? 108.982 43.654 88.840  1.00 25.84  ? 112  MET B CB  1 
ATOM   5074  C  CG  . MET B 1 112 ? 109.961 42.783 88.078  1.00 24.32  ? 112  MET B CG  1 
ATOM   5075  S  SD  . MET B 1 112 ? 109.239 41.218 87.580  1.00 26.74  ? 112  MET B SD  1 
ATOM   5076  C  CE  . MET B 1 112 ? 108.374 41.709 86.088  1.00 27.28  ? 112  MET B CE  1 
ATOM   5077  N  N   . VAL B 1 113 ? 108.320 46.986 89.406  1.00 25.80  ? 113  VAL B N   1 
ATOM   5078  C  CA  . VAL B 1 113 ? 107.327 47.917 89.917  1.00 24.19  ? 113  VAL B CA  1 
ATOM   5079  C  C   . VAL B 1 113 ? 106.121 47.988 88.993  1.00 22.42  ? 113  VAL B C   1 
ATOM   5080  O  O   . VAL B 1 113 ? 106.255 48.312 87.815  1.00 23.12  ? 113  VAL B O   1 
ATOM   5081  C  CB  . VAL B 1 113 ? 107.935 49.330 90.090  1.00 24.04  ? 113  VAL B CB  1 
ATOM   5082  C  CG1 . VAL B 1 113 ? 106.879 50.300 90.613  1.00 22.63  ? 113  VAL B CG1 1 
ATOM   5083  C  CG2 . VAL B 1 113 ? 109.107 49.259 91.052  1.00 23.49  ? 113  VAL B CG2 1 
ATOM   5084  N  N   . TRP B 1 114 ? 104.949 47.684 89.547  1.00 20.75  ? 114  TRP B N   1 
ATOM   5085  C  CA  . TRP B 1 114 ? 103.693 47.691 88.804  1.00 21.29  ? 114  TRP B CA  1 
ATOM   5086  C  C   . TRP B 1 114 ? 102.930 49.013 88.862  1.00 21.44  ? 114  TRP B C   1 
ATOM   5087  O  O   . TRP B 1 114 ? 102.721 49.575 89.935  1.00 20.46  ? 114  TRP B O   1 
ATOM   5088  C  CB  . TRP B 1 114 ? 102.777 46.575 89.320  1.00 20.46  ? 114  TRP B CB  1 
ATOM   5089  C  CG  . TRP B 1 114 ? 101.415 46.550 88.660  1.00 23.57  ? 114  TRP B CG  1 
ATOM   5090  C  CD1 . TRP B 1 114 ? 100.217 46.906 89.222  1.00 22.45  ? 114  TRP B CD1 1 
ATOM   5091  C  CD2 . TRP B 1 114 ? 101.122 46.153 87.316  1.00 22.11  ? 114  TRP B CD2 1 
ATOM   5092  N  NE1 . TRP B 1 114 ? 99.198  46.753 88.309  1.00 21.53  ? 114  TRP B NE1 1 
ATOM   5093  C  CE2 . TRP B 1 114 ? 99.728  46.293 87.131  1.00 23.74  ? 114  TRP B CE2 1 
ATOM   5094  C  CE3 . TRP B 1 114 ? 101.902 45.696 86.247  1.00 23.22  ? 114  TRP B CE3 1 
ATOM   5095  C  CZ2 . TRP B 1 114 ? 99.098  45.988 85.914  1.00 25.23  ? 114  TRP B CZ2 1 
ATOM   5096  C  CZ3 . TRP B 1 114 ? 101.276 45.397 85.040  1.00 20.57  ? 114  TRP B CZ3 1 
ATOM   5097  C  CH2 . TRP B 1 114 ? 99.889  45.544 84.886  1.00 21.61  ? 114  TRP B CH2 1 
ATOM   5098  N  N   . ILE B 1 115 ? 102.508 49.491 87.695  1.00 21.69  ? 115  ILE B N   1 
ATOM   5099  C  CA  . ILE B 1 115 ? 101.737 50.723 87.592  1.00 23.43  ? 115  ILE B CA  1 
ATOM   5100  C  C   . ILE B 1 115 ? 100.371 50.409 86.964  1.00 24.29  ? 115  ILE B C   1 
ATOM   5101  O  O   . ILE B 1 115 ? 100.271 50.256 85.748  1.00 23.75  ? 115  ILE B O   1 
ATOM   5102  C  CB  . ILE B 1 115 ? 102.452 51.764 86.704  1.00 22.39  ? 115  ILE B CB  1 
ATOM   5103  C  CG1 . ILE B 1 115 ? 103.841 52.054 87.261  1.00 22.17  ? 115  ILE B CG1 1 
ATOM   5104  C  CG2 . ILE B 1 115 ? 101.620 53.055 86.638  1.00 25.10  ? 115  ILE B CG2 1 
ATOM   5105  C  CD1 . ILE B 1 115 ? 104.695 52.919 86.362  1.00 22.65  ? 115  ILE B CD1 1 
ATOM   5106  N  N   . TYR B 1 116 ? 99.319  50.329 87.778  1.00 23.89  ? 116  TYR B N   1 
ATOM   5107  C  CA  . TYR B 1 116 ? 97.993  50.023 87.248  1.00 24.31  ? 116  TYR B CA  1 
ATOM   5108  C  C   . TYR B 1 116 ? 97.505  51.001 86.182  1.00 24.06  ? 116  TYR B C   1 
ATOM   5109  O  O   . TYR B 1 116 ? 97.954  52.140 86.101  1.00 21.87  ? 116  TYR B O   1 
ATOM   5110  C  CB  . TYR B 1 116 ? 96.954  49.935 88.384  1.00 25.58  ? 116  TYR B CB  1 
ATOM   5111  C  CG  . TYR B 1 116 ? 96.780  51.193 89.216  1.00 23.71  ? 116  TYR B CG  1 
ATOM   5112  C  CD1 . TYR B 1 116 ? 96.180  52.335 88.687  1.00 24.44  ? 116  TYR B CD1 1 
ATOM   5113  C  CD2 . TYR B 1 116 ? 97.203  51.230 90.540  1.00 24.06  ? 116  TYR B CD2 1 
ATOM   5114  C  CE1 . TYR B 1 116 ? 96.001  53.490 89.463  1.00 23.64  ? 116  TYR B CE1 1 
ATOM   5115  C  CE2 . TYR B 1 116 ? 97.031  52.373 91.325  1.00 25.02  ? 116  TYR B CE2 1 
ATOM   5116  C  CZ  . TYR B 1 116 ? 96.429  53.498 90.785  1.00 24.74  ? 116  TYR B CZ  1 
ATOM   5117  O  OH  . TYR B 1 116 ? 96.239  54.612 91.579  1.00 23.95  ? 116  TYR B OH  1 
ATOM   5118  N  N   . GLY B 1 117 ? 96.577  50.526 85.361  1.00 24.91  ? 117  GLY B N   1 
ATOM   5119  C  CA  . GLY B 1 117 ? 96.003  51.345 84.313  1.00 24.42  ? 117  GLY B CA  1 
ATOM   5120  C  C   . GLY B 1 117 ? 94.586  51.726 84.694  1.00 25.18  ? 117  GLY B C   1 
ATOM   5121  O  O   . GLY B 1 117 ? 94.198  51.587 85.852  1.00 26.83  ? 117  GLY B O   1 
ATOM   5122  N  N   . GLY B 1 118 ? 93.809  52.195 83.726  1.00 24.19  ? 118  GLY B N   1 
ATOM   5123  C  CA  . GLY B 1 118 ? 92.446  52.602 84.006  1.00 23.32  ? 118  GLY B CA  1 
ATOM   5124  C  C   . GLY B 1 118 ? 92.140  53.960 83.399  1.00 22.53  ? 118  GLY B C   1 
ATOM   5125  O  O   . GLY B 1 118 ? 91.450  54.776 84.001  1.00 22.62  ? 118  GLY B O   1 
ATOM   5126  N  N   . GLY B 1 119 ? 92.681  54.200 82.209  1.00 22.56  ? 119  GLY B N   1 
ATOM   5127  C  CA  . GLY B 1 119 ? 92.448  55.443 81.491  1.00 24.12  ? 119  GLY B CA  1 
ATOM   5128  C  C   . GLY B 1 119 ? 92.807  56.742 82.190  1.00 25.52  ? 119  GLY B C   1 
ATOM   5129  O  O   . GLY B 1 119 ? 92.365  57.804 81.763  1.00 23.83  ? 119  GLY B O   1 
ATOM   5130  N  N   . PHE B 1 120 ? 93.613  56.657 83.247  1.00 27.23  ? 120  PHE B N   1 
ATOM   5131  C  CA  . PHE B 1 120 ? 94.032  57.822 84.027  1.00 27.57  ? 120  PHE B CA  1 
ATOM   5132  C  C   . PHE B 1 120 ? 92.893  58.431 84.842  1.00 26.96  ? 120  PHE B C   1 
ATOM   5133  O  O   . PHE B 1 120 ? 93.043  59.512 85.408  1.00 27.35  ? 120  PHE B O   1 
ATOM   5134  C  CB  . PHE B 1 120 ? 94.644  58.902 83.119  1.00 26.02  ? 120  PHE B CB  1 
ATOM   5135  C  CG  . PHE B 1 120 ? 95.999  58.542 82.569  1.00 25.07  ? 120  PHE B CG  1 
ATOM   5136  C  CD1 . PHE B 1 120 ? 97.067  58.294 83.424  1.00 21.35  ? 120  PHE B CD1 1 
ATOM   5137  C  CD2 . PHE B 1 120 ? 96.206  58.450 81.193  1.00 24.03  ? 120  PHE B CD2 1 
ATOM   5138  C  CE1 . PHE B 1 120 ? 98.324  57.958 82.918  1.00 22.07  ? 120  PHE B CE1 1 
ATOM   5139  C  CE2 . PHE B 1 120 ? 97.460  58.116 80.678  1.00 22.11  ? 120  PHE B CE2 1 
ATOM   5140  C  CZ  . PHE B 1 120 ? 98.521  57.869 81.542  1.00 20.46  ? 120  PHE B CZ  1 
ATOM   5141  N  N   . TYR B 1 121 ? 91.757  57.741 84.902  1.00 25.46  ? 121  TYR B N   1 
ATOM   5142  C  CA  . TYR B 1 121 ? 90.613  58.235 85.669  1.00 25.23  ? 121  TYR B CA  1 
ATOM   5143  C  C   . TYR B 1 121 ? 90.208  57.238 86.757  1.00 24.57  ? 121  TYR B C   1 
ATOM   5144  O  O   . TYR B 1 121 ? 89.256  57.471 87.499  1.00 26.31  ? 121  TYR B O   1 
ATOM   5145  C  CB  . TYR B 1 121 ? 89.422  58.491 84.740  1.00 25.18  ? 121  TYR B CB  1 
ATOM   5146  C  CG  . TYR B 1 121 ? 88.774  57.229 84.203  1.00 26.63  ? 121  TYR B CG  1 
ATOM   5147  C  CD1 . TYR B 1 121 ? 87.770  56.573 84.920  1.00 25.24  ? 121  TYR B CD1 1 
ATOM   5148  C  CD2 . TYR B 1 121 ? 89.172  56.688 82.980  1.00 27.50  ? 121  TYR B CD2 1 
ATOM   5149  C  CE1 . TYR B 1 121 ? 87.176  55.411 84.430  1.00 26.58  ? 121  TYR B CE1 1 
ATOM   5150  C  CE2 . TYR B 1 121 ? 88.589  55.527 82.480  1.00 29.66  ? 121  TYR B CE2 1 
ATOM   5151  C  CZ  . TYR B 1 121 ? 87.590  54.895 83.210  1.00 31.22  ? 121  TYR B CZ  1 
ATOM   5152  O  OH  . TYR B 1 121 ? 87.002  53.755 82.703  1.00 33.40  ? 121  TYR B OH  1 
ATOM   5153  N  N   . SER B 1 122 ? 90.937  56.131 86.848  1.00 23.60  ? 122  SER B N   1 
ATOM   5154  C  CA  . SER B 1 122 ? 90.646  55.101 87.837  1.00 24.61  ? 122  SER B CA  1 
ATOM   5155  C  C   . SER B 1 122 ? 91.788  54.106 87.959  1.00 24.69  ? 122  SER B C   1 
ATOM   5156  O  O   . SER B 1 122 ? 92.787  54.205 87.251  1.00 24.33  ? 122  SER B O   1 
ATOM   5157  C  CB  . SER B 1 122 ? 89.365  54.353 87.461  1.00 26.17  ? 122  SER B CB  1 
ATOM   5158  O  OG  . SER B 1 122 ? 89.457  53.799 86.159  1.00 29.29  ? 122  SER B OG  1 
ATOM   5159  N  N   . GLY B 1 123 ? 91.629  53.145 88.865  1.00 26.13  ? 123  GLY B N   1 
ATOM   5160  C  CA  . GLY B 1 123 ? 92.654  52.137 89.074  1.00 26.54  ? 123  GLY B CA  1 
ATOM   5161  C  C   . GLY B 1 123 ? 93.051  52.033 90.532  1.00 26.39  ? 123  GLY B C   1 
ATOM   5162  O  O   . GLY B 1 123 ? 92.975  53.008 91.268  1.00 29.90  ? 123  GLY B O   1 
ATOM   5163  N  N   . SER B 1 124 ? 93.467  50.848 90.958  1.00 27.92  ? 124  SER B N   1 
ATOM   5164  C  CA  . SER B 1 124 ? 93.887  50.629 92.340  1.00 29.83  ? 124  SER B CA  1 
ATOM   5165  C  C   . SER B 1 124 ? 95.053  49.657 92.374  1.00 28.95  ? 124  SER B C   1 
ATOM   5166  O  O   . SER B 1 124 ? 95.225  48.853 91.462  1.00 30.00  ? 124  SER B O   1 
ATOM   5167  C  CB  . SER B 1 124 ? 92.749  50.044 93.178  1.00 30.10  ? 124  SER B CB  1 
ATOM   5168  O  OG  . SER B 1 124 ? 91.623  50.894 93.171  1.00 33.95  ? 124  SER B OG  1 
ATOM   5169  N  N   . SER B 1 125 ? 95.844  49.726 93.435  1.00 28.04  ? 125  SER B N   1 
ATOM   5170  C  CA  . SER B 1 125 ? 96.987  48.840 93.582  1.00 30.23  ? 125  SER B CA  1 
ATOM   5171  C  C   . SER B 1 125 ? 96.578  47.620 94.397  1.00 29.46  ? 125  SER B C   1 
ATOM   5172  O  O   . SER B 1 125 ? 97.331  46.665 94.512  1.00 30.34  ? 125  SER B O   1 
ATOM   5173  C  CB  . SER B 1 125 ? 98.114  49.569 94.314  1.00 29.46  ? 125  SER B CB  1 
ATOM   5174  O  OG  . SER B 1 125 ? 97.711  49.888 95.638  1.00 31.83  ? 125  SER B OG  1 
ATOM   5175  N  N   . THR B 1 126 ? 95.369  47.656 94.944  1.00 31.19  ? 126  THR B N   1 
ATOM   5176  C  CA  . THR B 1 126 ? 94.885  46.583 95.801  1.00 31.63  ? 126  THR B CA  1 
ATOM   5177  C  C   . THR B 1 126 ? 93.925  45.553 95.213  1.00 32.78  ? 126  THR B C   1 
ATOM   5178  O  O   . THR B 1 126 ? 93.429  44.696 95.941  1.00 35.02  ? 126  THR B O   1 
ATOM   5179  C  CB  . THR B 1 126 ? 94.238  47.181 97.048  1.00 29.95  ? 126  THR B CB  1 
ATOM   5180  O  OG1 . THR B 1 126 ? 93.121  47.984 96.657  1.00 30.62  ? 126  THR B OG1 1 
ATOM   5181  C  CG2 . THR B 1 126 ? 95.234  48.064 97.784  1.00 27.86  ? 126  THR B CG2 1 
ATOM   5182  N  N   . LEU B 1 127 ? 93.663  45.621 93.912  1.00 32.87  ? 127  LEU B N   1 
ATOM   5183  C  CA  . LEU B 1 127 ? 92.763  44.661 93.280  1.00 32.25  ? 127  LEU B CA  1 
ATOM   5184  C  C   . LEU B 1 127 ? 93.314  43.248 93.471  1.00 32.44  ? 127  LEU B C   1 
ATOM   5185  O  O   . LEU B 1 127 ? 94.522  43.067 93.606  1.00 33.52  ? 127  LEU B O   1 
ATOM   5186  C  CB  . LEU B 1 127 ? 92.633  44.961 91.783  1.00 32.12  ? 127  LEU B CB  1 
ATOM   5187  C  CG  . LEU B 1 127 ? 92.154  46.348 91.352  1.00 31.99  ? 127  LEU B CG  1 
ATOM   5188  C  CD1 . LEU B 1 127 ? 92.085  46.395 89.836  1.00 30.64  ? 127  LEU B CD1 1 
ATOM   5189  C  CD2 . LEU B 1 127 ? 90.792  46.645 91.949  1.00 29.13  ? 127  LEU B CD2 1 
ATOM   5190  N  N   . ASP B 1 128 ? 92.435  42.250 93.480  1.00 33.51  ? 128  ASP B N   1 
ATOM   5191  C  CA  . ASP B 1 128 ? 92.863  40.862 93.644  1.00 34.85  ? 128  ASP B CA  1 
ATOM   5192  C  C   . ASP B 1 128 ? 93.696  40.395 92.456  1.00 34.40  ? 128  ASP B C   1 
ATOM   5193  O  O   . ASP B 1 128 ? 94.575  39.544 92.599  1.00 33.64  ? 128  ASP B O   1 
ATOM   5194  C  CB  . ASP B 1 128 ? 91.662  39.924 93.780  1.00 38.63  ? 128  ASP B CB  1 
ATOM   5195  C  CG  . ASP B 1 128 ? 90.711  40.343 94.870  1.00 43.33  ? 128  ASP B CG  1 
ATOM   5196  O  OD1 . ASP B 1 128 ? 91.178  40.734 95.963  1.00 47.00  ? 128  ASP B OD1 1 
ATOM   5197  O  OD2 . ASP B 1 128 ? 89.487  40.262 94.637  1.00 47.63  ? 128  ASP B OD2 1 
ATOM   5198  N  N   . VAL B 1 129 ? 93.407  40.937 91.278  1.00 33.24  ? 129  VAL B N   1 
ATOM   5199  C  CA  . VAL B 1 129 ? 94.143  40.549 90.083  1.00 32.66  ? 129  VAL B CA  1 
ATOM   5200  C  C   . VAL B 1 129 ? 95.586  41.062 90.123  1.00 33.61  ? 129  VAL B C   1 
ATOM   5201  O  O   . VAL B 1 129 ? 96.425  40.613 89.345  1.00 35.91  ? 129  VAL B O   1 
ATOM   5202  C  CB  . VAL B 1 129 ? 93.430  41.059 88.801  1.00 31.52  ? 129  VAL B CB  1 
ATOM   5203  C  CG1 . VAL B 1 129 ? 93.497  42.567 88.723  1.00 29.59  ? 129  VAL B CG1 1 
ATOM   5204  C  CG2 . VAL B 1 129 ? 94.046  40.427 87.570  1.00 30.64  ? 129  VAL B CG2 1 
ATOM   5205  N  N   . TYR B 1 130 ? 95.874  41.995 91.031  1.00 32.70  ? 130  TYR B N   1 
ATOM   5206  C  CA  . TYR B 1 130 ? 97.224  42.547 91.164  1.00 32.70  ? 130  TYR B CA  1 
ATOM   5207  C  C   . TYR B 1 130 ? 97.969  41.997 92.389  1.00 33.20  ? 130  TYR B C   1 
ATOM   5208  O  O   . TYR B 1 130 ? 99.017  42.521 92.770  1.00 34.25  ? 130  TYR B O   1 
ATOM   5209  C  CB  . TYR B 1 130 ? 97.199  44.079 91.274  1.00 29.46  ? 130  TYR B CB  1 
ATOM   5210  C  CG  . TYR B 1 130 ? 96.573  44.816 90.113  1.00 29.17  ? 130  TYR B CG  1 
ATOM   5211  C  CD1 . TYR B 1 130 ? 96.494  44.241 88.842  1.00 26.76  ? 130  TYR B CD1 1 
ATOM   5212  C  CD2 . TYR B 1 130 ? 96.074  46.109 90.286  1.00 26.87  ? 130  TYR B CD2 1 
ATOM   5213  C  CE1 . TYR B 1 130 ? 95.928  44.936 87.775  1.00 27.48  ? 130  TYR B CE1 1 
ATOM   5214  C  CE2 . TYR B 1 130 ? 95.508  46.814 89.231  1.00 25.64  ? 130  TYR B CE2 1 
ATOM   5215  C  CZ  . TYR B 1 130 ? 95.431  46.228 87.980  1.00 27.47  ? 130  TYR B CZ  1 
ATOM   5216  O  OH  . TYR B 1 130 ? 94.832  46.920 86.950  1.00 22.95  ? 130  TYR B OH  1 
ATOM   5217  N  N   . ASN B 1 131 ? 97.425  40.958 93.011  1.00 33.10  ? 131  ASN B N   1 
ATOM   5218  C  CA  . ASN B 1 131 ? 98.061  40.354 94.179  1.00 33.29  ? 131  ASN B CA  1 
ATOM   5219  C  C   . ASN B 1 131 ? 99.454  39.913 93.733  1.00 33.22  ? 131  ASN B C   1 
ATOM   5220  O  O   . ASN B 1 131 ? 99.583  38.985 92.939  1.00 32.62  ? 131  ASN B O   1 
ATOM   5221  C  CB  . ASN B 1 131 ? 97.253  39.140 94.636  1.00 33.11  ? 131  ASN B CB  1 
ATOM   5222  C  CG  . ASN B 1 131 ? 97.627  38.682 96.027  1.00 36.51  ? 131  ASN B CG  1 
ATOM   5223  O  OD1 . ASN B 1 131 ? 98.790  38.767 96.435  1.00 38.83  ? 131  ASN B OD1 1 
ATOM   5224  N  ND2 . ASN B 1 131 ? 96.643  38.175 96.764  1.00 36.90  ? 131  ASN B ND2 1 
ATOM   5225  N  N   . GLY B 1 132 ? 100.494 40.566 94.248  1.00 32.03  ? 132  GLY B N   1 
ATOM   5226  C  CA  . GLY B 1 132 ? 101.848 40.231 93.832  1.00 30.01  ? 132  GLY B CA  1 
ATOM   5227  C  C   . GLY B 1 132 ? 102.534 39.018 94.440  1.00 31.36  ? 132  GLY B C   1 
ATOM   5228  O  O   . GLY B 1 132 ? 103.619 38.641 93.992  1.00 30.40  ? 132  GLY B O   1 
ATOM   5229  N  N   . LYS B 1 133 ? 101.916 38.390 95.433  1.00 30.86  ? 133  LYS B N   1 
ATOM   5230  C  CA  . LYS B 1 133 ? 102.539 37.250 96.089  1.00 32.14  ? 133  LYS B CA  1 
ATOM   5231  C  C   . LYS B 1 133 ? 102.895 36.071 95.177  1.00 32.80  ? 133  LYS B C   1 
ATOM   5232  O  O   . LYS B 1 133 ? 103.933 35.443 95.366  1.00 33.97  ? 133  LYS B O   1 
ATOM   5233  C  CB  . LYS B 1 133 ? 101.664 36.763 97.257  1.00 31.94  ? 133  LYS B CB  1 
ATOM   5234  C  CG  . LYS B 1 133 ? 100.408 36.012 96.867  1.00 29.95  ? 133  LYS B CG  1 
ATOM   5235  C  CD  . LYS B 1 133 ? 99.639  35.599 98.105  1.00 27.50  ? 133  LYS B CD  1 
ATOM   5236  C  CE  . LYS B 1 133 ? 98.414  34.781 97.752  1.00 26.78  ? 133  LYS B CE  1 
ATOM   5237  N  NZ  . LYS B 1 133 ? 97.670  34.333 98.966  1.00 27.51  ? 133  LYS B NZ  1 
ATOM   5238  N  N   . TYR B 1 134 ? 102.053 35.777 94.190  1.00 33.22  ? 134  TYR B N   1 
ATOM   5239  C  CA  . TYR B 1 134 ? 102.317 34.660 93.286  1.00 33.38  ? 134  TYR B CA  1 
ATOM   5240  C  C   . TYR B 1 134 ? 103.533 34.872 92.387  1.00 33.10  ? 134  TYR B C   1 
ATOM   5241  O  O   . TYR B 1 134 ? 104.354 33.972 92.219  1.00 34.36  ? 134  TYR B O   1 
ATOM   5242  C  CB  . TYR B 1 134 ? 101.087 34.372 92.418  1.00 33.30  ? 134  TYR B CB  1 
ATOM   5243  C  CG  . TYR B 1 134 ? 99.837  34.077 93.211  1.00 35.52  ? 134  TYR B CG  1 
ATOM   5244  C  CD1 . TYR B 1 134 ? 98.816  35.026 93.323  1.00 36.48  ? 134  TYR B CD1 1 
ATOM   5245  C  CD2 . TYR B 1 134 ? 99.677  32.855 93.869  1.00 35.37  ? 134  TYR B CD2 1 
ATOM   5246  C  CE1 . TYR B 1 134 ? 97.663  34.766 94.075  1.00 36.13  ? 134  TYR B CE1 1 
ATOM   5247  C  CE2 . TYR B 1 134 ? 98.532  32.586 94.625  1.00 35.08  ? 134  TYR B CE2 1 
ATOM   5248  C  CZ  . TYR B 1 134 ? 97.532  33.545 94.723  1.00 36.05  ? 134  TYR B CZ  1 
ATOM   5249  O  OH  . TYR B 1 134 ? 96.411  33.288 95.480  1.00 38.58  ? 134  TYR B OH  1 
ATOM   5250  N  N   . LEU B 1 135 ? 103.650 36.061 91.811  1.00 33.83  ? 135  LEU B N   1 
ATOM   5251  C  CA  . LEU B 1 135 ? 104.770 36.367 90.924  1.00 34.39  ? 135  LEU B CA  1 
ATOM   5252  C  C   . LEU B 1 135 ? 106.081 36.482 91.690  1.00 35.03  ? 135  LEU B C   1 
ATOM   5253  O  O   . LEU B 1 135 ? 107.092 35.890 91.305  1.00 34.42  ? 135  LEU B O   1 
ATOM   5254  C  CB  . LEU B 1 135 ? 104.494 37.668 90.159  1.00 31.28  ? 135  LEU B CB  1 
ATOM   5255  C  CG  . LEU B 1 135 ? 105.568 38.215 89.209  1.00 32.33  ? 135  LEU B CG  1 
ATOM   5256  C  CD1 . LEU B 1 135 ? 105.960 37.161 88.169  1.00 28.75  ? 135  LEU B CD1 1 
ATOM   5257  C  CD2 . LEU B 1 135 ? 105.032 39.469 88.520  1.00 30.89  ? 135  LEU B CD2 1 
ATOM   5258  N  N   . ALA B 1 136 ? 106.064 37.249 92.776  1.00 36.34  ? 136  ALA B N   1 
ATOM   5259  C  CA  . ALA B 1 136 ? 107.263 37.437 93.579  1.00 37.37  ? 136  ALA B CA  1 
ATOM   5260  C  C   . ALA B 1 136 ? 107.766 36.089 94.076  1.00 37.98  ? 136  ALA B C   1 
ATOM   5261  O  O   . ALA B 1 136 ? 108.970 35.832 94.104  1.00 38.43  ? 136  ALA B O   1 
ATOM   5262  C  CB  . ALA B 1 136 ? 106.970 38.359 94.757  1.00 36.36  ? 136  ALA B CB  1 
ATOM   5263  N  N   . TYR B 1 137 ? 106.837 35.219 94.450  1.00 38.46  ? 137  TYR B N   1 
ATOM   5264  C  CA  . TYR B 1 137 ? 107.204 33.903 94.948  1.00 39.56  ? 137  TYR B CA  1 
ATOM   5265  C  C   . TYR B 1 137 ? 107.774 32.962 93.885  1.00 40.51  ? 137  TYR B C   1 
ATOM   5266  O  O   . TYR B 1 137 ? 108.849 32.387 94.067  1.00 40.80  ? 137  TYR B O   1 
ATOM   5267  C  CB  . TYR B 1 137 ? 105.995 33.250 95.620  1.00 40.06  ? 137  TYR B CB  1 
ATOM   5268  C  CG  . TYR B 1 137 ? 106.221 31.807 96.003  1.00 42.62  ? 137  TYR B CG  1 
ATOM   5269  C  CD1 . TYR B 1 137 ? 105.869 30.774 95.136  1.00 42.97  ? 137  TYR B CD1 1 
ATOM   5270  C  CD2 . TYR B 1 137 ? 106.826 31.474 97.216  1.00 43.81  ? 137  TYR B CD2 1 
ATOM   5271  C  CE1 . TYR B 1 137 ? 106.112 29.447 95.463  1.00 44.75  ? 137  TYR B CE1 1 
ATOM   5272  C  CE2 . TYR B 1 137 ? 107.077 30.150 97.553  1.00 44.11  ? 137  TYR B CE2 1 
ATOM   5273  C  CZ  . TYR B 1 137 ? 106.718 29.143 96.672  1.00 44.48  ? 137  TYR B CZ  1 
ATOM   5274  O  OH  . TYR B 1 137 ? 106.970 27.831 96.993  1.00 46.81  ? 137  TYR B OH  1 
ATOM   5275  N  N   . THR B 1 138 ? 107.064 32.815 92.772  1.00 39.89  ? 138  THR B N   1 
ATOM   5276  C  CA  . THR B 1 138 ? 107.490 31.907 91.714  1.00 38.47  ? 138  THR B CA  1 
ATOM   5277  C  C   . THR B 1 138 ? 108.760 32.310 90.972  1.00 37.44  ? 138  THR B C   1 
ATOM   5278  O  O   . THR B 1 138 ? 109.535 31.453 90.557  1.00 37.73  ? 138  THR B O   1 
ATOM   5279  C  CB  . THR B 1 138 ? 106.356 31.704 90.687  1.00 39.70  ? 138  THR B CB  1 
ATOM   5280  O  OG1 . THR B 1 138 ? 105.182 31.237 91.365  1.00 39.94  ? 138  THR B OG1 1 
ATOM   5281  C  CG2 . THR B 1 138 ? 106.762 30.678 89.632  1.00 38.79  ? 138  THR B CG2 1 
ATOM   5282  N  N   . GLU B 1 139 ? 108.980 33.606 90.798  1.00 35.95  ? 139  GLU B N   1 
ATOM   5283  C  CA  . GLU B 1 139 ? 110.168 34.055 90.088  1.00 34.77  ? 139  GLU B CA  1 
ATOM   5284  C  C   . GLU B 1 139 ? 111.215 34.656 91.019  1.00 34.28  ? 139  GLU B C   1 
ATOM   5285  O  O   . GLU B 1 139 ? 112.266 35.108 90.573  1.00 33.48  ? 139  GLU B O   1 
ATOM   5286  C  CB  . GLU B 1 139 ? 109.774 35.060 89.003  1.00 34.30  ? 139  GLU B CB  1 
ATOM   5287  C  CG  . GLU B 1 139 ? 108.897 34.465 87.919  1.00 33.82  ? 139  GLU B CG  1 
ATOM   5288  C  CD  . GLU B 1 139 ? 109.563 33.300 87.209  1.00 36.74  ? 139  GLU B CD  1 
ATOM   5289  O  OE1 . GLU B 1 139 ? 110.694 33.472 86.705  1.00 37.57  ? 139  GLU B OE1 1 
ATOM   5290  O  OE2 . GLU B 1 139 ? 108.956 32.210 87.148  1.00 36.74  ? 139  GLU B OE2 1 
ATOM   5291  N  N   . GLU B 1 140 ? 110.920 34.658 92.314  1.00 35.96  ? 140  GLU B N   1 
ATOM   5292  C  CA  . GLU B 1 140 ? 111.838 35.181 93.318  1.00 37.85  ? 140  GLU B CA  1 
ATOM   5293  C  C   . GLU B 1 140 ? 112.290 36.611 93.057  1.00 37.05  ? 140  GLU B C   1 
ATOM   5294  O  O   . GLU B 1 140 ? 113.486 36.888 93.011  1.00 37.72  ? 140  GLU B O   1 
ATOM   5295  C  CB  . GLU B 1 140 ? 113.074 34.290 93.419  1.00 41.43  ? 140  GLU B CB  1 
ATOM   5296  C  CG  . GLU B 1 140 ? 112.795 32.858 93.833  1.00 49.37  ? 140  GLU B CG  1 
ATOM   5297  C  CD  . GLU B 1 140 ? 114.077 32.078 94.060  1.00 55.13  ? 140  GLU B CD  1 
ATOM   5298  O  OE1 . GLU B 1 140 ? 114.900 32.509 94.903  1.00 57.23  ? 140  GLU B OE1 1 
ATOM   5299  O  OE2 . GLU B 1 140 ? 114.264 31.036 93.392  1.00 58.20  ? 140  GLU B OE2 1 
ATOM   5300  N  N   . VAL B 1 141 ? 111.339 37.517 92.878  1.00 34.30  ? 141  VAL B N   1 
ATOM   5301  C  CA  . VAL B 1 141 ? 111.681 38.912 92.656  1.00 32.89  ? 141  VAL B CA  1 
ATOM   5302  C  C   . VAL B 1 141 ? 111.003 39.748 93.727  1.00 30.52  ? 141  VAL B C   1 
ATOM   5303  O  O   . VAL B 1 141 ? 110.074 39.281 94.386  1.00 30.18  ? 141  VAL B O   1 
ATOM   5304  C  CB  . VAL B 1 141 ? 111.213 39.414 91.258  1.00 33.08  ? 141  VAL B CB  1 
ATOM   5305  C  CG1 . VAL B 1 141 ? 111.857 38.577 90.165  1.00 32.96  ? 141  VAL B CG1 1 
ATOM   5306  C  CG2 . VAL B 1 141 ? 109.698 39.367 91.156  1.00 30.27  ? 141  VAL B CG2 1 
ATOM   5307  N  N   . VAL B 1 142 ? 111.496 40.965 93.923  1.00 28.87  ? 142  VAL B N   1 
ATOM   5308  C  CA  . VAL B 1 142 ? 110.898 41.876 94.886  1.00 29.78  ? 142  VAL B CA  1 
ATOM   5309  C  C   . VAL B 1 142 ? 109.881 42.640 94.053  1.00 29.72  ? 142  VAL B C   1 
ATOM   5310  O  O   . VAL B 1 142 ? 110.246 43.383 93.145  1.00 30.00  ? 142  VAL B O   1 
ATOM   5311  C  CB  . VAL B 1 142 ? 111.946 42.852 95.479  1.00 31.81  ? 142  VAL B CB  1 
ATOM   5312  C  CG1 . VAL B 1 142 ? 111.260 43.922 96.305  1.00 29.92  ? 142  VAL B CG1 1 
ATOM   5313  C  CG2 . VAL B 1 142 ? 112.928 42.083 96.355  1.00 31.65  ? 142  VAL B CG2 1 
ATOM   5314  N  N   . LEU B 1 143 ? 108.605 42.439 94.352  1.00 30.62  ? 143  LEU B N   1 
ATOM   5315  C  CA  . LEU B 1 143 ? 107.538 43.079 93.595  1.00 30.78  ? 143  LEU B CA  1 
ATOM   5316  C  C   . LEU B 1 143 ? 106.912 44.260 94.319  1.00 29.89  ? 143  LEU B C   1 
ATOM   5317  O  O   . LEU B 1 143 ? 106.438 44.130 95.447  1.00 29.86  ? 143  LEU B O   1 
ATOM   5318  C  CB  . LEU B 1 143 ? 106.469 42.032 93.257  1.00 33.68  ? 143  LEU B CB  1 
ATOM   5319  C  CG  . LEU B 1 143 ? 105.317 42.405 92.322  1.00 34.79  ? 143  LEU B CG  1 
ATOM   5320  C  CD1 . LEU B 1 143 ? 105.842 43.094 91.073  1.00 36.83  ? 143  LEU B CD1 1 
ATOM   5321  C  CD2 . LEU B 1 143 ? 104.567 41.141 91.954  1.00 35.89  ? 143  LEU B CD2 1 
ATOM   5322  N  N   . VAL B 1 144 ? 106.925 45.416 93.661  1.00 27.69  ? 144  VAL B N   1 
ATOM   5323  C  CA  . VAL B 1 144 ? 106.354 46.630 94.228  1.00 26.24  ? 144  VAL B CA  1 
ATOM   5324  C  C   . VAL B 1 144 ? 105.129 47.055 93.434  1.00 25.92  ? 144  VAL B C   1 
ATOM   5325  O  O   . VAL B 1 144 ? 105.113 46.988 92.211  1.00 27.37  ? 144  VAL B O   1 
ATOM   5326  C  CB  . VAL B 1 144 ? 107.355 47.806 94.217  1.00 26.28  ? 144  VAL B CB  1 
ATOM   5327  C  CG1 . VAL B 1 144 ? 106.668 49.087 94.705  1.00 22.27  ? 144  VAL B CG1 1 
ATOM   5328  C  CG2 . VAL B 1 144 ? 108.560 47.472 95.085  1.00 25.04  ? 144  VAL B CG2 1 
ATOM   5329  N  N   . SER B 1 145 ? 104.113 47.499 94.160  1.00 27.30  ? 145  SER B N   1 
ATOM   5330  C  CA  . SER B 1 145 ? 102.850 47.953 93.598  1.00 28.71  ? 145  SER B CA  1 
ATOM   5331  C  C   . SER B 1 145 ? 102.655 49.397 94.081  1.00 28.67  ? 145  SER B C   1 
ATOM   5332  O  O   . SER B 1 145 ? 102.497 49.625 95.276  1.00 28.68  ? 145  SER B O   1 
ATOM   5333  C  CB  . SER B 1 145 ? 101.734 47.046 94.135  1.00 29.61  ? 145  SER B CB  1 
ATOM   5334  O  OG  . SER B 1 145 ? 100.463 47.419 93.671  1.00 33.29  ? 145  SER B OG  1 
ATOM   5335  N  N   . LEU B 1 146 ? 102.680 50.370 93.171  1.00 28.76  ? 146  LEU B N   1 
ATOM   5336  C  CA  . LEU B 1 146 ? 102.493 51.770 93.574  1.00 27.81  ? 146  LEU B CA  1 
ATOM   5337  C  C   . LEU B 1 146 ? 101.106 52.313 93.246  1.00 27.75  ? 146  LEU B C   1 
ATOM   5338  O  O   . LEU B 1 146 ? 100.266 51.604 92.710  1.00 28.98  ? 146  LEU B O   1 
ATOM   5339  C  CB  . LEU B 1 146 ? 103.567 52.666 92.934  1.00 26.25  ? 146  LEU B CB  1 
ATOM   5340  C  CG  . LEU B 1 146 ? 103.830 52.680 91.424  1.00 26.59  ? 146  LEU B CG  1 
ATOM   5341  C  CD1 . LEU B 1 146 ? 102.696 53.358 90.666  1.00 27.40  ? 146  LEU B CD1 1 
ATOM   5342  C  CD2 . LEU B 1 146 ? 105.131 53.419 91.165  1.00 25.98  ? 146  LEU B CD2 1 
ATOM   5343  N  N   . SER B 1 147 ? 100.865 53.574 93.586  1.00 28.75  ? 147  SER B N   1 
ATOM   5344  C  CA  . SER B 1 147 ? 99.583  54.207 93.301  1.00 26.46  ? 147  SER B CA  1 
ATOM   5345  C  C   . SER B 1 147 ? 99.828  55.652 92.925  1.00 27.00  ? 147  SER B C   1 
ATOM   5346  O  O   . SER B 1 147 ? 100.911 56.181 93.170  1.00 27.52  ? 147  SER B O   1 
ATOM   5347  C  CB  . SER B 1 147 ? 98.660  54.138 94.515  1.00 28.28  ? 147  SER B CB  1 
ATOM   5348  O  OG  . SER B 1 147 ? 99.226  54.813 95.619  1.00 31.49  ? 147  SER B OG  1 
ATOM   5349  N  N   . TYR B 1 148 ? 98.825  56.278 92.317  1.00 24.28  ? 148  TYR B N   1 
ATOM   5350  C  CA  . TYR B 1 148 ? 98.914  57.667 91.888  1.00 24.38  ? 148  TYR B CA  1 
ATOM   5351  C  C   . TYR B 1 148 ? 97.515  58.238 91.705  1.00 23.65  ? 148  TYR B C   1 
ATOM   5352  O  O   . TYR B 1 148 ? 96.588  57.523 91.319  1.00 23.97  ? 148  TYR B O   1 
ATOM   5353  C  CB  . TYR B 1 148 ? 99.682  57.790 90.563  1.00 21.30  ? 148  TYR B CB  1 
ATOM   5354  C  CG  . TYR B 1 148 ? 99.069  57.003 89.416  1.00 23.40  ? 148  TYR B CG  1 
ATOM   5355  C  CD1 . TYR B 1 148 ? 99.250  55.622 89.323  1.00 20.46  ? 148  TYR B CD1 1 
ATOM   5356  C  CD2 . TYR B 1 148 ? 98.302  57.635 88.426  1.00 20.77  ? 148  TYR B CD2 1 
ATOM   5357  C  CE1 . TYR B 1 148 ? 98.693  54.890 88.284  1.00 20.46  ? 148  TYR B CE1 1 
ATOM   5358  C  CE2 . TYR B 1 148 ? 97.738  56.903 87.373  1.00 20.46  ? 148  TYR B CE2 1 
ATOM   5359  C  CZ  . TYR B 1 148 ? 97.945  55.523 87.315  1.00 20.46  ? 148  TYR B CZ  1 
ATOM   5360  O  OH  . TYR B 1 148 ? 97.434  54.764 86.293  1.00 20.46  ? 148  TYR B OH  1 
ATOM   5361  N  N   . ARG B 1 149 ? 97.374  59.532 91.969  1.00 24.19  ? 149  ARG B N   1 
ATOM   5362  C  CA  . ARG B 1 149 ? 96.088  60.206 91.837  1.00 26.28  ? 149  ARG B CA  1 
ATOM   5363  C  C   . ARG B 1 149 ? 95.563  60.164 90.408  1.00 26.93  ? 149  ARG B C   1 
ATOM   5364  O  O   . ARG B 1 149 ? 96.307  60.391 89.455  1.00 27.87  ? 149  ARG B O   1 
ATOM   5365  C  CB  . ARG B 1 149 ? 96.212  61.660 92.294  1.00 27.99  ? 149  ARG B CB  1 
ATOM   5366  C  CG  . ARG B 1 149 ? 96.438  61.822 93.785  1.00 25.81  ? 149  ARG B CG  1 
ATOM   5367  C  CD  . ARG B 1 149 ? 96.785  63.262 94.123  1.00 27.52  ? 149  ARG B CD  1 
ATOM   5368  N  NE  . ARG B 1 149 ? 98.172  63.585 93.803  1.00 27.67  ? 149  ARG B NE  1 
ATOM   5369  C  CZ  . ARG B 1 149 ? 98.692  64.809 93.862  1.00 30.61  ? 149  ARG B CZ  1 
ATOM   5370  N  NH1 . ARG B 1 149 ? 97.939  65.849 94.224  1.00 27.77  ? 149  ARG B NH1 1 
ATOM   5371  N  NH2 . ARG B 1 149 ? 99.976  64.992 93.573  1.00 29.46  ? 149  ARG B NH2 1 
ATOM   5372  N  N   . VAL B 1 150 ? 94.272  59.877 90.264  1.00 28.11  ? 150  VAL B N   1 
ATOM   5373  C  CA  . VAL B 1 150 ? 93.647  59.805 88.949  1.00 25.87  ? 150  VAL B CA  1 
ATOM   5374  C  C   . VAL B 1 150 ? 92.577  60.872 88.783  1.00 26.99  ? 150  VAL B C   1 
ATOM   5375  O  O   . VAL B 1 150 ? 92.214  61.552 89.740  1.00 27.40  ? 150  VAL B O   1 
ATOM   5376  C  CB  . VAL B 1 150 ? 92.996  58.430 88.713  1.00 24.89  ? 150  VAL B CB  1 
ATOM   5377  C  CG1 . VAL B 1 150 ? 94.064  57.338 88.732  1.00 22.50  ? 150  VAL B CG1 1 
ATOM   5378  C  CG2 . VAL B 1 150 ? 91.930  58.176 89.772  1.00 21.98  ? 150  VAL B CG2 1 
ATOM   5379  N  N   . GLY B 1 151 ? 92.073  61.005 87.560  1.00 27.07  ? 151  GLY B N   1 
ATOM   5380  C  CA  . GLY B 1 151 ? 91.046  61.988 87.288  1.00 27.44  ? 151  GLY B CA  1 
ATOM   5381  C  C   . GLY B 1 151 ? 91.542  63.407 87.484  1.00 28.18  ? 151  GLY B C   1 
ATOM   5382  O  O   . GLY B 1 151 ? 92.732  63.683 87.334  1.00 27.62  ? 151  GLY B O   1 
ATOM   5383  N  N   . ALA B 1 152 ? 90.622  64.307 87.817  1.00 27.92  ? 152  ALA B N   1 
ATOM   5384  C  CA  . ALA B 1 152 ? 90.954  65.708 88.039  1.00 29.15  ? 152  ALA B CA  1 
ATOM   5385  C  C   . ALA B 1 152 ? 92.026  65.884 89.113  1.00 29.65  ? 152  ALA B C   1 
ATOM   5386  O  O   . ALA B 1 152 ? 92.912  66.716 88.976  1.00 32.63  ? 152  ALA B O   1 
ATOM   5387  C  CB  . ALA B 1 152 ? 89.703  66.472 88.433  1.00 29.55  ? 152  ALA B CB  1 
ATOM   5388  N  N   . PHE B 1 153 ? 91.934  65.088 90.171  1.00 29.21  ? 153  PHE B N   1 
ATOM   5389  C  CA  . PHE B 1 153 ? 92.860  65.143 91.294  1.00 30.12  ? 153  PHE B CA  1 
ATOM   5390  C  C   . PHE B 1 153 ? 94.314  64.921 90.902  1.00 32.12  ? 153  PHE B C   1 
ATOM   5391  O  O   . PHE B 1 153 ? 95.222  65.461 91.541  1.00 32.52  ? 153  PHE B O   1 
ATOM   5392  C  CB  . PHE B 1 153 ? 92.456  64.103 92.341  1.00 29.83  ? 153  PHE B CB  1 
ATOM   5393  C  CG  . PHE B 1 153 ? 91.026  64.206 92.764  1.00 31.19  ? 153  PHE B CG  1 
ATOM   5394  C  CD1 . PHE B 1 153 ? 90.637  65.126 93.728  1.00 32.46  ? 153  PHE B CD1 1 
ATOM   5395  C  CD2 . PHE B 1 153 ? 90.054  63.419 92.158  1.00 32.79  ? 153  PHE B CD2 1 
ATOM   5396  C  CE1 . PHE B 1 153 ? 89.292  65.263 94.086  1.00 30.92  ? 153  PHE B CE1 1 
ATOM   5397  C  CE2 . PHE B 1 153 ? 88.707  63.548 92.504  1.00 33.15  ? 153  PHE B CE2 1 
ATOM   5398  C  CZ  . PHE B 1 153 ? 88.328  64.473 93.471  1.00 33.62  ? 153  PHE B CZ  1 
ATOM   5399  N  N   . GLY B 1 154 ? 94.543  64.124 89.861  1.00 31.48  ? 154  GLY B N   1 
ATOM   5400  C  CA  . GLY B 1 154 ? 95.911  63.866 89.452  1.00 28.56  ? 154  GLY B CA  1 
ATOM   5401  C  C   . GLY B 1 154 ? 96.320  64.470 88.126  1.00 26.54  ? 154  GLY B C   1 
ATOM   5402  O  O   . GLY B 1 154 ? 97.507  64.474 87.783  1.00 28.09  ? 154  GLY B O   1 
ATOM   5403  N  N   . PHE B 1 155 ? 95.361  65.004 87.379  1.00 24.47  ? 155  PHE B N   1 
ATOM   5404  C  CA  . PHE B 1 155 ? 95.695  65.543 86.072  1.00 25.25  ? 155  PHE B CA  1 
ATOM   5405  C  C   . PHE B 1 155 ? 95.037  66.851 85.656  1.00 25.54  ? 155  PHE B C   1 
ATOM   5406  O  O   . PHE B 1 155 ? 95.125  67.254 84.496  1.00 22.87  ? 155  PHE B O   1 
ATOM   5407  C  CB  . PHE B 1 155 ? 95.466  64.448 85.025  1.00 22.17  ? 155  PHE B CB  1 
ATOM   5408  C  CG  . PHE B 1 155 ? 96.347  63.248 85.231  1.00 22.21  ? 155  PHE B CG  1 
ATOM   5409  C  CD1 . PHE B 1 155 ? 97.679  63.274 84.836  1.00 22.97  ? 155  PHE B CD1 1 
ATOM   5410  C  CD2 . PHE B 1 155 ? 95.877  62.133 85.914  1.00 22.00  ? 155  PHE B CD2 1 
ATOM   5411  C  CE1 . PHE B 1 155 ? 98.538  62.207 85.126  1.00 25.82  ? 155  PHE B CE1 1 
ATOM   5412  C  CE2 . PHE B 1 155 ? 96.724  61.063 86.210  1.00 25.93  ? 155  PHE B CE2 1 
ATOM   5413  C  CZ  . PHE B 1 155 ? 98.060  61.100 85.816  1.00 23.95  ? 155  PHE B CZ  1 
ATOM   5414  N  N   . LEU B 1 156 ? 94.374  67.514 86.599  1.00 27.68  ? 156  LEU B N   1 
ATOM   5415  C  CA  . LEU B 1 156 ? 93.774  68.807 86.304  1.00 29.53  ? 156  LEU B CA  1 
ATOM   5416  C  C   . LEU B 1 156 ? 94.977  69.640 85.891  1.00 30.36  ? 156  LEU B C   1 
ATOM   5417  O  O   . LEU B 1 156 ? 96.009  69.605 86.555  1.00 30.66  ? 156  LEU B O   1 
ATOM   5418  C  CB  . LEU B 1 156 ? 93.147  69.420 87.554  1.00 30.82  ? 156  LEU B CB  1 
ATOM   5419  C  CG  . LEU B 1 156 ? 92.608  70.836 87.308  1.00 32.11  ? 156  LEU B CG  1 
ATOM   5420  C  CD1 . LEU B 1 156 ? 91.267  70.736 86.602  1.00 28.51  ? 156  LEU B CD1 1 
ATOM   5421  C  CD2 . LEU B 1 156 ? 92.464  71.583 88.631  1.00 30.15  ? 156  LEU B CD2 1 
ATOM   5422  N  N   . ALA B 1 157 ? 94.866  70.385 84.803  1.00 32.35  ? 157  ALA B N   1 
ATOM   5423  C  CA  . ALA B 1 157 ? 96.007  71.166 84.361  1.00 34.25  ? 157  ALA B CA  1 
ATOM   5424  C  C   . ALA B 1 157 ? 95.676  72.568 83.884  1.00 36.36  ? 157  ALA B C   1 
ATOM   5425  O  O   . ALA B 1 157 ? 94.864  72.763 82.976  1.00 35.67  ? 157  ALA B O   1 
ATOM   5426  C  CB  . ALA B 1 157 ? 96.758  70.409 83.272  1.00 33.02  ? 157  ALA B CB  1 
ATOM   5427  N  N   . LEU B 1 158 ? 96.329  73.535 84.519  1.00 37.89  ? 158  LEU B N   1 
ATOM   5428  C  CA  . LEU B 1 158 ? 96.185  74.949 84.206  1.00 38.95  ? 158  LEU B CA  1 
ATOM   5429  C  C   . LEU B 1 158 ? 97.602  75.476 84.076  1.00 42.10  ? 158  LEU B C   1 
ATOM   5430  O  O   . LEU B 1 158 ? 98.151  76.050 85.020  1.00 43.69  ? 158  LEU B O   1 
ATOM   5431  C  CB  . LEU B 1 158 ? 95.455  75.670 85.339  1.00 35.56  ? 158  LEU B CB  1 
ATOM   5432  C  CG  . LEU B 1 158 ? 93.958  75.379 85.436  1.00 33.44  ? 158  LEU B CG  1 
ATOM   5433  C  CD1 . LEU B 1 158 ? 93.364  76.048 86.666  1.00 33.08  ? 158  LEU B CD1 1 
ATOM   5434  C  CD2 . LEU B 1 158 ? 93.280  75.875 84.172  1.00 31.32  ? 158  LEU B CD2 1 
ATOM   5435  N  N   . HIS B 1 159 ? 98.193  75.258 82.904  1.00 44.81  ? 159  HIS B N   1 
ATOM   5436  C  CA  . HIS B 1 159 ? 99.563  75.676 82.627  1.00 47.06  ? 159  HIS B CA  1 
ATOM   5437  C  C   . HIS B 1 159 ? 99.803  77.121 83.043  1.00 48.36  ? 159  HIS B C   1 
ATOM   5438  O  O   . HIS B 1 159 ? 99.050  78.020 82.671  1.00 49.23  ? 159  HIS B O   1 
ATOM   5439  C  CB  . HIS B 1 159 ? 99.869  75.499 81.139  1.00 49.56  ? 159  HIS B CB  1 
ATOM   5440  C  CG  . HIS B 1 159 ? 101.331 75.495 80.817  1.00 51.67  ? 159  HIS B CG  1 
ATOM   5441  N  ND1 . HIS B 1 159 ? 102.215 74.604 81.387  1.00 53.04  ? 159  HIS B ND1 1 
ATOM   5442  C  CD2 . HIS B 1 159 ? 102.061 76.256 79.966  1.00 52.16  ? 159  HIS B CD2 1 
ATOM   5443  C  CE1 . HIS B 1 159 ? 103.426 74.815 80.901  1.00 53.27  ? 159  HIS B CE1 1 
ATOM   5444  N  NE2 . HIS B 1 159 ? 103.360 75.812 80.037  1.00 53.95  ? 159  HIS B NE2 1 
ATOM   5445  N  N   . GLY B 1 160 ? 100.864 77.333 83.816  1.00 49.08  ? 160  GLY B N   1 
ATOM   5446  C  CA  . GLY B 1 160 ? 101.190 78.664 84.292  1.00 50.07  ? 160  GLY B CA  1 
ATOM   5447  C  C   . GLY B 1 160 ? 101.153 78.691 85.808  1.00 50.42  ? 160  GLY B C   1 
ATOM   5448  O  O   . GLY B 1 160 ? 102.059 79.216 86.458  1.00 50.10  ? 160  GLY B O   1 
ATOM   5449  N  N   . SER B 1 161 ? 100.095 78.113 86.370  1.00 50.63  ? 161  SER B N   1 
ATOM   5450  C  CA  . SER B 1 161 ? 99.916  78.044 87.816  1.00 51.24  ? 161  SER B CA  1 
ATOM   5451  C  C   . SER B 1 161 ? 100.812 76.971 88.426  1.00 51.16  ? 161  SER B C   1 
ATOM   5452  O  O   . SER B 1 161 ? 101.190 76.013 87.755  1.00 51.52  ? 161  SER B O   1 
ATOM   5453  C  CB  . SER B 1 161 ? 98.456  77.720 88.148  1.00 50.88  ? 161  SER B CB  1 
ATOM   5454  O  OG  . SER B 1 161 ? 98.318  77.304 89.498  1.00 51.98  ? 161  SER B OG  1 
ATOM   5455  N  N   . GLN B 1 162 ? 101.147 77.138 89.700  1.00 50.97  ? 162  GLN B N   1 
ATOM   5456  C  CA  . GLN B 1 162 ? 101.978 76.169 90.400  1.00 50.84  ? 162  GLN B CA  1 
ATOM   5457  C  C   . GLN B 1 162 ? 101.102 75.456 91.426  1.00 49.46  ? 162  GLN B C   1 
ATOM   5458  O  O   . GLN B 1 162 ? 101.594 74.705 92.270  1.00 48.90  ? 162  GLN B O   1 
ATOM   5459  C  CB  . GLN B 1 162 ? 103.143 76.866 91.108  1.00 53.76  ? 162  GLN B CB  1 
ATOM   5460  C  CG  . GLN B 1 162 ? 104.040 77.706 90.198  1.00 56.91  ? 162  GLN B CG  1 
ATOM   5461  C  CD  . GLN B 1 162 ? 104.692 76.896 89.093  1.00 59.39  ? 162  GLN B CD  1 
ATOM   5462  O  OE1 . GLN B 1 162 ? 105.288 75.844 89.343  1.00 61.45  ? 162  GLN B OE1 1 
ATOM   5463  N  NE2 . GLN B 1 162 ? 104.593 77.388 87.861  1.00 59.85  ? 162  GLN B NE2 1 
ATOM   5464  N  N   . GLU B 1 163 ? 99.799  75.708 91.350  1.00 47.49  ? 163  GLU B N   1 
ATOM   5465  C  CA  . GLU B 1 163 ? 98.837  75.091 92.258  1.00 47.76  ? 163  GLU B CA  1 
ATOM   5466  C  C   . GLU B 1 163 ? 98.195  73.892 91.566  1.00 47.21  ? 163  GLU B C   1 
ATOM   5467  O  O   . GLU B 1 163 ? 97.842  72.900 92.207  1.00 47.13  ? 163  GLU B O   1 
ATOM   5468  C  CB  . GLU B 1 163 ? 97.763  76.106 92.654  1.00 48.99  ? 163  GLU B CB  1 
ATOM   5469  C  CG  . GLU B 1 163 ? 98.323  77.317 93.379  1.00 50.76  ? 163  GLU B CG  1 
ATOM   5470  C  CD  . GLU B 1 163 ? 98.988  76.946 94.693  1.00 51.76  ? 163  GLU B CD  1 
ATOM   5471  O  OE1 . GLU B 1 163 ? 99.696  77.800 95.266  1.00 52.86  ? 163  GLU B OE1 1 
ATOM   5472  O  OE2 . GLU B 1 163 ? 98.798  75.802 95.159  1.00 51.87  ? 163  GLU B OE2 1 
ATOM   5473  N  N   . ALA B 1 164 ? 98.047  74.004 90.250  1.00 44.97  ? 164  ALA B N   1 
ATOM   5474  C  CA  . ALA B 1 164 ? 97.474  72.947 89.427  1.00 42.21  ? 164  ALA B CA  1 
ATOM   5475  C  C   . ALA B 1 164 ? 98.257  72.942 88.113  1.00 39.83  ? 164  ALA B C   1 
ATOM   5476  O  O   . ALA B 1 164 ? 97.713  73.234 87.050  1.00 38.94  ? 164  ALA B O   1 
ATOM   5477  C  CB  . ALA B 1 164 ? 95.996  73.223 89.170  1.00 41.20  ? 164  ALA B CB  1 
ATOM   5478  N  N   . PRO B 1 165 ? 99.552  72.600 88.180  1.00 38.86  ? 165  PRO B N   1 
ATOM   5479  C  CA  . PRO B 1 165 ? 100.467 72.545 87.032  1.00 38.81  ? 165  PRO B CA  1 
ATOM   5480  C  C   . PRO B 1 165 ? 100.199 71.444 86.011  1.00 38.85  ? 165  PRO B C   1 
ATOM   5481  O  O   . PRO B 1 165 ? 100.554 71.578 84.839  1.00 40.33  ? 165  PRO B O   1 
ATOM   5482  C  CB  . PRO B 1 165 ? 101.831 72.389 87.696  1.00 37.75  ? 165  PRO B CB  1 
ATOM   5483  C  CG  . PRO B 1 165 ? 101.512 71.536 88.877  1.00 39.77  ? 165  PRO B CG  1 
ATOM   5484  C  CD  . PRO B 1 165 ? 100.239 72.169 89.413  1.00 39.15  ? 165  PRO B CD  1 
ATOM   5485  N  N   . GLY B 1 166 ? 99.579  70.358 86.456  1.00 37.60  ? 166  GLY B N   1 
ATOM   5486  C  CA  . GLY B 1 166 ? 99.304  69.256 85.556  1.00 36.03  ? 166  GLY B CA  1 
ATOM   5487  C  C   . GLY B 1 166 ? 100.331 68.151 85.736  1.00 34.56  ? 166  GLY B C   1 
ATOM   5488  O  O   . GLY B 1 166 ? 101.426 68.394 86.250  1.00 34.27  ? 166  GLY B O   1 
ATOM   5489  N  N   . ASN B 1 167 ? 99.969  66.940 85.322  1.00 32.02  ? 167  ASN B N   1 
ATOM   5490  C  CA  . ASN B 1 167 ? 100.839 65.770 85.420  1.00 30.15  ? 167  ASN B CA  1 
ATOM   5491  C  C   . ASN B 1 167 ? 101.252 65.379 86.837  1.00 28.99  ? 167  ASN B C   1 
ATOM   5492  O  O   . ASN B 1 167 ? 102.193 64.603 87.009  1.00 30.81  ? 167  ASN B O   1 
ATOM   5493  C  CB  . ASN B 1 167 ? 102.109 65.964 84.578  1.00 29.69  ? 167  ASN B CB  1 
ATOM   5494  C  CG  . ASN B 1 167 ? 101.822 66.060 83.094  1.00 31.28  ? 167  ASN B CG  1 
ATOM   5495  O  OD1 . ASN B 1 167 ? 100.956 65.354 82.567  1.00 32.49  ? 167  ASN B OD1 1 
ATOM   5496  N  ND2 . ASN B 1 167 ? 102.561 66.925 82.403  1.00 32.38  ? 167  ASN B ND2 1 
ATOM   5497  N  N   . VAL B 1 168 ? 100.567 65.885 87.855  1.00 28.47  ? 168  VAL B N   1 
ATOM   5498  C  CA  . VAL B 1 168 ? 100.958 65.529 89.215  1.00 28.12  ? 168  VAL B CA  1 
ATOM   5499  C  C   . VAL B 1 168 ? 100.810 64.038 89.471  1.00 27.96  ? 168  VAL B C   1 
ATOM   5500  O  O   . VAL B 1 168 ? 101.488 63.488 90.334  1.00 29.31  ? 168  VAL B O   1 
ATOM   5501  C  CB  . VAL B 1 168 ? 100.163 66.310 90.282  1.00 29.27  ? 168  VAL B CB  1 
ATOM   5502  C  CG1 . VAL B 1 168 ? 100.429 67.805 90.128  1.00 27.52  ? 168  VAL B CG1 1 
ATOM   5503  C  CG2 . VAL B 1 168 ? 98.687  65.989 90.178  1.00 29.71  ? 168  VAL B CG2 1 
ATOM   5504  N  N   . GLY B 1 169 ? 99.921  63.384 88.727  1.00 28.41  ? 169  GLY B N   1 
ATOM   5505  C  CA  . GLY B 1 169 ? 99.753  61.949 88.888  1.00 26.90  ? 169  GLY B CA  1 
ATOM   5506  C  C   . GLY B 1 169 ? 101.015 61.250 88.397  1.00 26.98  ? 169  GLY B C   1 
ATOM   5507  O  O   . GLY B 1 169 ? 101.439 60.234 88.946  1.00 26.44  ? 169  GLY B O   1 
ATOM   5508  N  N   . LEU B 1 170 ? 101.621 61.787 87.343  1.00 26.88  ? 170  LEU B N   1 
ATOM   5509  C  CA  . LEU B 1 170 ? 102.850 61.199 86.828  1.00 27.88  ? 170  LEU B CA  1 
ATOM   5510  C  C   . LEU B 1 170 ? 103.956 61.451 87.852  1.00 28.29  ? 170  LEU B C   1 
ATOM   5511  O  O   . LEU B 1 170 ? 104.827 60.607 88.055  1.00 28.79  ? 170  LEU B O   1 
ATOM   5512  C  CB  . LEU B 1 170 ? 103.208 61.801 85.467  1.00 25.21  ? 170  LEU B CB  1 
ATOM   5513  C  CG  . LEU B 1 170 ? 102.348 61.296 84.301  1.00 26.31  ? 170  LEU B CG  1 
ATOM   5514  C  CD1 . LEU B 1 170 ? 102.679 62.068 83.028  1.00 23.01  ? 170  LEU B CD1 1 
ATOM   5515  C  CD2 . LEU B 1 170 ? 102.585 59.794 84.103  1.00 23.89  ? 170  LEU B CD2 1 
ATOM   5516  N  N   . LEU B 1 171 ? 103.901 62.608 88.512  1.00 28.68  ? 171  LEU B N   1 
ATOM   5517  C  CA  . LEU B 1 171 ? 104.887 62.944 89.535  1.00 27.73  ? 171  LEU B CA  1 
ATOM   5518  C  C   . LEU B 1 171 ? 104.696 62.071 90.778  1.00 28.25  ? 171  LEU B C   1 
ATOM   5519  O  O   . LEU B 1 171 ? 105.663 61.793 91.485  1.00 27.64  ? 171  LEU B O   1 
ATOM   5520  C  CB  . LEU B 1 171 ? 104.799 64.424 89.906  1.00 26.84  ? 171  LEU B CB  1 
ATOM   5521  C  CG  . LEU B 1 171 ? 105.234 65.381 88.797  1.00 27.79  ? 171  LEU B CG  1 
ATOM   5522  C  CD1 . LEU B 1 171 ? 104.978 66.820 89.230  1.00 29.37  ? 171  LEU B CD1 1 
ATOM   5523  C  CD2 . LEU B 1 171 ? 106.712 65.167 88.487  1.00 26.21  ? 171  LEU B CD2 1 
ATOM   5524  N  N   . ASP B 1 172 ? 103.460 61.641 91.046  1.00 28.14  ? 172  ASP B N   1 
ATOM   5525  C  CA  . ASP B 1 172 ? 103.205 60.763 92.191  1.00 28.18  ? 172  ASP B CA  1 
ATOM   5526  C  C   . ASP B 1 172 ? 103.938 59.447 91.913  1.00 27.43  ? 172  ASP B C   1 
ATOM   5527  O  O   . ASP B 1 172 ? 104.546 58.856 92.805  1.00 26.51  ? 172  ASP B O   1 
ATOM   5528  C  CB  . ASP B 1 172 ? 101.703 60.454 92.370  1.00 30.13  ? 172  ASP B CB  1 
ATOM   5529  C  CG  . ASP B 1 172 ? 100.877 61.678 92.783  1.00 33.88  ? 172  ASP B CG  1 
ATOM   5530  O  OD1 . ASP B 1 172 ? 101.429 62.588 93.445  1.00 34.92  ? 172  ASP B OD1 1 
ATOM   5531  O  OD2 . ASP B 1 172 ? 99.662  61.716 92.462  1.00 31.51  ? 172  ASP B OD2 1 
ATOM   5532  N  N   . GLN B 1 173 ? 103.863 58.993 90.665  1.00 25.58  ? 173  GLN B N   1 
ATOM   5533  C  CA  . GLN B 1 173 ? 104.520 57.755 90.255  1.00 26.32  ? 173  GLN B CA  1 
ATOM   5534  C  C   . GLN B 1 173 ? 106.035 57.886 90.413  1.00 26.63  ? 173  GLN B C   1 
ATOM   5535  O  O   . GLN B 1 173 ? 106.696 56.999 90.946  1.00 27.09  ? 173  GLN B O   1 
ATOM   5536  C  CB  . GLN B 1 173 ? 104.191 57.437 88.795  1.00 25.42  ? 173  GLN B CB  1 
ATOM   5537  C  CG  . GLN B 1 173 ? 102.769 56.997 88.553  1.00 25.83  ? 173  GLN B CG  1 
ATOM   5538  C  CD  . GLN B 1 173 ? 102.455 56.856 87.079  1.00 27.75  ? 173  GLN B CD  1 
ATOM   5539  O  OE1 . GLN B 1 173 ? 103.358 56.827 86.241  1.00 29.57  ? 173  GLN B OE1 1 
ATOM   5540  N  NE2 . GLN B 1 173 ? 101.172 56.758 86.753  1.00 25.00  ? 173  GLN B NE2 1 
ATOM   5541  N  N   . ARG B 1 174 ? 106.576 59.002 89.940  1.00 26.66  ? 174  ARG B N   1 
ATOM   5542  C  CA  . ARG B 1 174 ? 108.005 59.252 90.026  1.00 29.40  ? 174  ARG B CA  1 
ATOM   5543  C  C   . ARG B 1 174 ? 108.484 59.204 91.474  1.00 29.16  ? 174  ARG B C   1 
ATOM   5544  O  O   . ARG B 1 174 ? 109.509 58.594 91.775  1.00 30.68  ? 174  ARG B O   1 
ATOM   5545  C  CB  . ARG B 1 174 ? 108.334 60.613 89.406  1.00 27.99  ? 174  ARG B CB  1 
ATOM   5546  C  CG  . ARG B 1 174 ? 109.800 60.977 89.453  1.00 28.01  ? 174  ARG B CG  1 
ATOM   5547  C  CD  . ARG B 1 174 ? 110.039 62.357 88.847  1.00 26.16  ? 174  ARG B CD  1 
ATOM   5548  N  NE  . ARG B 1 174 ? 109.873 62.337 87.399  1.00 27.28  ? 174  ARG B NE  1 
ATOM   5549  C  CZ  . ARG B 1 174 ? 109.918 63.412 86.619  1.00 29.24  ? 174  ARG B CZ  1 
ATOM   5550  N  NH1 . ARG B 1 174 ? 110.124 64.619 87.145  1.00 30.88  ? 174  ARG B NH1 1 
ATOM   5551  N  NH2 . ARG B 1 174 ? 109.756 63.279 85.311  1.00 28.07  ? 174  ARG B NH2 1 
ATOM   5552  N  N   . MET B 1 175 ? 107.723 59.819 92.370  1.00 30.14  ? 175  MET B N   1 
ATOM   5553  C  CA  . MET B 1 175 ? 108.087 59.847 93.778  1.00 30.17  ? 175  MET B CA  1 
ATOM   5554  C  C   . MET B 1 175 ? 108.055 58.453 94.401  1.00 29.70  ? 175  MET B C   1 
ATOM   5555  O  O   . MET B 1 175 ? 108.794 58.166 95.350  1.00 29.19  ? 175  MET B O   1 
ATOM   5556  C  CB  . MET B 1 175 ? 107.172 60.803 94.539  1.00 31.50  ? 175  MET B CB  1 
ATOM   5557  C  CG  . MET B 1 175 ? 107.677 61.135 95.938  1.00 36.29  ? 175  MET B CG  1 
ATOM   5558  S  SD  . MET B 1 175 ? 107.405 62.868 96.361  1.00 40.98  ? 175  MET B SD  1 
ATOM   5559  C  CE  . MET B 1 175 ? 105.831 62.748 97.092  1.00 39.87  ? 175  MET B CE  1 
ATOM   5560  N  N   . ALA B 1 176 ? 107.208 57.577 93.874  1.00 27.91  ? 176  ALA B N   1 
ATOM   5561  C  CA  . ALA B 1 176 ? 107.163 56.219 94.393  1.00 27.33  ? 176  ALA B CA  1 
ATOM   5562  C  C   . ALA B 1 176 ? 108.434 55.509 93.903  1.00 28.06  ? 176  ALA B C   1 
ATOM   5563  O  O   . ALA B 1 176 ? 109.049 54.736 94.642  1.00 27.39  ? 176  ALA B O   1 
ATOM   5564  C  CB  . ALA B 1 176 ? 105.916 55.496 93.896  1.00 25.99  ? 176  ALA B CB  1 
ATOM   5565  N  N   . LEU B 1 177 ? 108.837 55.783 92.663  1.00 27.50  ? 177  LEU B N   1 
ATOM   5566  C  CA  . LEU B 1 177 ? 110.045 55.155 92.119  1.00 29.45  ? 177  LEU B CA  1 
ATOM   5567  C  C   . LEU B 1 177 ? 111.287 55.691 92.854  1.00 28.62  ? 177  LEU B C   1 
ATOM   5568  O  O   . LEU B 1 177 ? 112.248 54.965 93.080  1.00 25.45  ? 177  LEU B O   1 
ATOM   5569  C  CB  . LEU B 1 177 ? 110.159 55.409 90.603  1.00 27.54  ? 177  LEU B CB  1 
ATOM   5570  C  CG  . LEU B 1 177 ? 109.074 54.820 89.686  1.00 27.34  ? 177  LEU B CG  1 
ATOM   5571  C  CD1 . LEU B 1 177 ? 109.285 55.308 88.267  1.00 26.56  ? 177  LEU B CD1 1 
ATOM   5572  C  CD2 . LEU B 1 177 ? 109.100 53.300 89.736  1.00 26.02  ? 177  LEU B CD2 1 
ATOM   5573  N  N   . GLN B 1 178 ? 111.250 56.965 93.233  1.00 30.20  ? 178  GLN B N   1 
ATOM   5574  C  CA  . GLN B 1 178 ? 112.355 57.571 93.969  1.00 29.06  ? 178  GLN B CA  1 
ATOM   5575  C  C   . GLN B 1 178 ? 112.468 56.897 95.342  1.00 27.66  ? 178  GLN B C   1 
ATOM   5576  O  O   . GLN B 1 178 ? 113.563 56.733 95.872  1.00 28.08  ? 178  GLN B O   1 
ATOM   5577  C  CB  . GLN B 1 178 ? 112.119 59.077 94.135  1.00 29.18  ? 178  GLN B CB  1 
ATOM   5578  C  CG  . GLN B 1 178 ? 113.193 59.788 94.961  1.00 30.04  ? 178  GLN B CG  1 
ATOM   5579  C  CD  . GLN B 1 178 ? 114.561 59.782 94.298  1.00 29.52  ? 178  GLN B CD  1 
ATOM   5580  O  OE1 . GLN B 1 178 ? 114.735 60.315 93.204  1.00 31.61  ? 178  GLN B OE1 1 
ATOM   5581  N  NE2 . GLN B 1 178 ? 115.540 59.180 94.962  1.00 28.87  ? 178  GLN B NE2 1 
ATOM   5582  N  N   . TRP B 1 179 ? 111.330 56.500 95.904  1.00 27.46  ? 179  TRP B N   1 
ATOM   5583  C  CA  . TRP B 1 179 ? 111.304 55.832 97.206  1.00 27.89  ? 179  TRP B CA  1 
ATOM   5584  C  C   . TRP B 1 179 ? 111.903 54.427 97.079  1.00 27.83  ? 179  TRP B C   1 
ATOM   5585  O  O   . TRP B 1 179 ? 112.609 53.962 97.970  1.00 27.00  ? 179  TRP B O   1 
ATOM   5586  C  CB  . TRP B 1 179 ? 109.861 55.728 97.732  1.00 26.53  ? 179  TRP B CB  1 
ATOM   5587  C  CG  . TRP B 1 179 ? 109.739 55.131 99.120  1.00 28.67  ? 179  TRP B CG  1 
ATOM   5588  C  CD1 . TRP B 1 179 ? 109.634 55.814 100.306 1.00 29.17  ? 179  TRP B CD1 1 
ATOM   5589  C  CD2 . TRP B 1 179 ? 109.745 53.735 99.468  1.00 26.39  ? 179  TRP B CD2 1 
ATOM   5590  N  NE1 . TRP B 1 179 ? 109.578 54.932 101.359 1.00 27.44  ? 179  TRP B NE1 1 
ATOM   5591  C  CE2 . TRP B 1 179 ? 109.644 53.652 100.874 1.00 26.87  ? 179  TRP B CE2 1 
ATOM   5592  C  CE3 . TRP B 1 179 ? 109.827 52.551 98.727  1.00 27.67  ? 179  TRP B CE3 1 
ATOM   5593  C  CZ2 . TRP B 1 179 ? 109.621 52.428 101.557 1.00 27.70  ? 179  TRP B CZ2 1 
ATOM   5594  C  CZ3 . TRP B 1 179 ? 109.804 51.323 99.411  1.00 28.25  ? 179  TRP B CZ3 1 
ATOM   5595  C  CH2 . TRP B 1 179 ? 109.701 51.278 100.811 1.00 27.47  ? 179  TRP B CH2 1 
ATOM   5596  N  N   . VAL B 1 180 ? 111.600 53.745 95.978  1.00 28.91  ? 180  VAL B N   1 
ATOM   5597  C  CA  . VAL B 1 180 ? 112.126 52.401 95.754  1.00 28.56  ? 180  VAL B CA  1 
ATOM   5598  C  C   . VAL B 1 180 ? 113.638 52.509 95.572  1.00 29.48  ? 180  VAL B C   1 
ATOM   5599  O  O   . VAL B 1 180 ? 114.403 51.668 96.044  1.00 28.32  ? 180  VAL B O   1 
ATOM   5600  C  CB  . VAL B 1 180 ? 111.501 51.759 94.487  1.00 29.31  ? 180  VAL B CB  1 
ATOM   5601  C  CG1 . VAL B 1 180 ? 112.200 50.447 94.158  1.00 30.02  ? 180  VAL B CG1 1 
ATOM   5602  C  CG2 . VAL B 1 180 ? 110.014 51.515 94.707  1.00 26.97  ? 180  VAL B CG2 1 
ATOM   5603  N  N   . HIS B 1 181 ? 114.053 53.571 94.894  1.00 30.50  ? 181  HIS B N   1 
ATOM   5604  C  CA  . HIS B 1 181 ? 115.459 53.824 94.627  1.00 31.99  ? 181  HIS B CA  1 
ATOM   5605  C  C   . HIS B 1 181 ? 116.250 54.032 95.914  1.00 32.35  ? 181  HIS B C   1 
ATOM   5606  O  O   . HIS B 1 181 ? 117.398 53.604 96.014  1.00 31.25  ? 181  HIS B O   1 
ATOM   5607  C  CB  . HIS B 1 181 ? 115.595 55.052 93.715  1.00 32.14  ? 181  HIS B CB  1 
ATOM   5608  C  CG  . HIS B 1 181 ? 117.012 55.431 93.404  1.00 33.56  ? 181  HIS B CG  1 
ATOM   5609  N  ND1 . HIS B 1 181 ? 117.721 56.347 94.154  1.00 33.64  ? 181  HIS B ND1 1 
ATOM   5610  C  CD2 . HIS B 1 181 ? 117.846 55.027 92.416  1.00 31.76  ? 181  HIS B CD2 1 
ATOM   5611  C  CE1 . HIS B 1 181 ? 118.929 56.493 93.639  1.00 32.26  ? 181  HIS B CE1 1 
ATOM   5612  N  NE2 . HIS B 1 181 ? 119.030 55.704 92.584  1.00 32.82  ? 181  HIS B NE2 1 
ATOM   5613  N  N   . ASP B 1 182 ? 115.628 54.672 96.900  1.00 32.97  ? 182  ASP B N   1 
ATOM   5614  C  CA  . ASP B 1 182 ? 116.301 54.943 98.165  1.00 34.26  ? 182  ASP B CA  1 
ATOM   5615  C  C   . ASP B 1 182 ? 116.079 53.921 99.274  1.00 34.44  ? 182  ASP B C   1 
ATOM   5616  O  O   . ASP B 1 182 ? 116.869 53.862 100.218 1.00 36.53  ? 182  ASP B O   1 
ATOM   5617  C  CB  . ASP B 1 182 ? 115.886 56.312 98.711  1.00 34.41  ? 182  ASP B CB  1 
ATOM   5618  C  CG  . ASP B 1 182 ? 116.177 57.442 97.747  1.00 37.62  ? 182  ASP B CG  1 
ATOM   5619  O  OD1 . ASP B 1 182 ? 117.133 57.326 96.950  1.00 37.45  ? 182  ASP B OD1 1 
ATOM   5620  O  OD2 . ASP B 1 182 ? 115.452 58.461 97.802  1.00 39.41  ? 182  ASP B OD2 1 
ATOM   5621  N  N   . ASN B 1 183 ? 115.035 53.104 99.159  1.00 31.95  ? 183  ASN B N   1 
ATOM   5622  C  CA  . ASN B 1 183 ? 114.712 52.158 100.219 1.00 31.02  ? 183  ASN B CA  1 
ATOM   5623  C  C   . ASN B 1 183 ? 114.607 50.677 99.882  1.00 31.65  ? 183  ASN B C   1 
ATOM   5624  O  O   . ASN B 1 183 ? 114.640 49.844 100.786 1.00 31.92  ? 183  ASN B O   1 
ATOM   5625  C  CB  . ASN B 1 183 ? 113.386 52.576 100.860 1.00 31.10  ? 183  ASN B CB  1 
ATOM   5626  C  CG  . ASN B 1 183 ? 113.443 53.958 101.479 1.00 32.71  ? 183  ASN B CG  1 
ATOM   5627  O  OD1 . ASN B 1 183 ? 114.051 54.149 102.529 1.00 35.48  ? 183  ASN B OD1 1 
ATOM   5628  N  ND2 . ASN B 1 183 ? 112.816 54.932 100.827 1.00 30.92  ? 183  ASN B ND2 1 
ATOM   5629  N  N   . ILE B 1 184 ? 114.467 50.335 98.606  1.00 31.83  ? 184  ILE B N   1 
ATOM   5630  C  CA  . ILE B 1 184 ? 114.284 48.932 98.255  1.00 29.54  ? 184  ILE B CA  1 
ATOM   5631  C  C   . ILE B 1 184 ? 115.431 48.040 98.706  1.00 29.48  ? 184  ILE B C   1 
ATOM   5632  O  O   . ILE B 1 184 ? 115.230 46.856 98.992  1.00 27.62  ? 184  ILE B O   1 
ATOM   5633  C  CB  . ILE B 1 184 ? 114.019 48.759 96.735  1.00 27.29  ? 184  ILE B CB  1 
ATOM   5634  C  CG1 . ILE B 1 184 ? 113.296 47.436 96.493  1.00 26.29  ? 184  ILE B CG1 1 
ATOM   5635  C  CG2 . ILE B 1 184 ? 115.310 48.839 95.950  1.00 26.76  ? 184  ILE B CG2 1 
ATOM   5636  C  CD1 . ILE B 1 184 ? 111.898 47.394 97.092  1.00 25.57  ? 184  ILE B CD1 1 
ATOM   5637  N  N   . GLN B 1 185 ? 116.628 48.608 98.795  1.00 30.89  ? 185  GLN B N   1 
ATOM   5638  C  CA  . GLN B 1 185 ? 117.783 47.831 99.238  1.00 33.60  ? 185  GLN B CA  1 
ATOM   5639  C  C   . GLN B 1 185 ? 117.524 47.235 100.618 1.00 33.07  ? 185  GLN B C   1 
ATOM   5640  O  O   . GLN B 1 185 ? 118.024 46.158 100.925 1.00 33.03  ? 185  GLN B O   1 
ATOM   5641  C  CB  . GLN B 1 185 ? 119.039 48.702 99.289  1.00 34.91  ? 185  GLN B CB  1 
ATOM   5642  C  CG  . GLN B 1 185 ? 118.992 49.815 100.320 1.00 38.05  ? 185  GLN B CG  1 
ATOM   5643  C  CD  . GLN B 1 185 ? 120.116 50.814 100.137 1.00 41.42  ? 185  GLN B CD  1 
ATOM   5644  O  OE1 . GLN B 1 185 ? 120.178 51.515 99.124  1.00 42.34  ? 185  GLN B OE1 1 
ATOM   5645  N  NE2 . GLN B 1 185 ? 121.018 50.879 101.111 1.00 42.23  ? 185  GLN B NE2 1 
ATOM   5646  N  N   . PHE B 1 186 ? 116.735 47.931 101.439 1.00 33.08  ? 186  PHE B N   1 
ATOM   5647  C  CA  . PHE B 1 186 ? 116.425 47.452 102.789 1.00 35.16  ? 186  PHE B CA  1 
ATOM   5648  C  C   . PHE B 1 186 ? 115.455 46.278 102.772 1.00 35.59  ? 186  PHE B C   1 
ATOM   5649  O  O   . PHE B 1 186 ? 115.241 45.632 103.792 1.00 36.58  ? 186  PHE B O   1 
ATOM   5650  C  CB  . PHE B 1 186 ? 115.842 48.586 103.646 1.00 34.47  ? 186  PHE B CB  1 
ATOM   5651  C  CG  . PHE B 1 186 ? 116.685 49.825 103.656 1.00 35.69  ? 186  PHE B CG  1 
ATOM   5652  C  CD1 . PHE B 1 186 ? 118.040 49.757 103.982 1.00 36.24  ? 186  PHE B CD1 1 
ATOM   5653  C  CD2 . PHE B 1 186 ? 116.141 51.056 103.302 1.00 36.24  ? 186  PHE B CD2 1 
ATOM   5654  C  CE1 . PHE B 1 186 ? 118.845 50.902 103.947 1.00 36.23  ? 186  PHE B CE1 1 
ATOM   5655  C  CE2 . PHE B 1 186 ? 116.933 52.209 103.265 1.00 36.91  ? 186  PHE B CE2 1 
ATOM   5656  C  CZ  . PHE B 1 186 ? 118.290 52.132 103.586 1.00 35.85  ? 186  PHE B CZ  1 
ATOM   5657  N  N   . PHE B 1 187 ? 114.861 46.007 101.615 1.00 37.14  ? 187  PHE B N   1 
ATOM   5658  C  CA  . PHE B 1 187 ? 113.927 44.893 101.497 1.00 36.88  ? 187  PHE B CA  1 
ATOM   5659  C  C   . PHE B 1 187 ? 114.545 43.755 100.692 1.00 38.37  ? 187  PHE B C   1 
ATOM   5660  O  O   . PHE B 1 187 ? 113.861 42.783 100.352 1.00 39.70  ? 187  PHE B O   1 
ATOM   5661  C  CB  . PHE B 1 187 ? 112.619 45.349 100.838 1.00 33.40  ? 187  PHE B CB  1 
ATOM   5662  C  CG  . PHE B 1 187 ? 111.863 46.369 101.638 1.00 31.33  ? 187  PHE B CG  1 
ATOM   5663  C  CD1 . PHE B 1 187 ? 112.222 47.710 101.598 1.00 29.35  ? 187  PHE B CD1 1 
ATOM   5664  C  CD2 . PHE B 1 187 ? 110.811 45.981 102.462 1.00 29.36  ? 187  PHE B CD2 1 
ATOM   5665  C  CE1 . PHE B 1 187 ? 111.544 48.651 102.369 1.00 30.68  ? 187  PHE B CE1 1 
ATOM   5666  C  CE2 . PHE B 1 187 ? 110.126 46.913 103.238 1.00 30.02  ? 187  PHE B CE2 1 
ATOM   5667  C  CZ  . PHE B 1 187 ? 110.491 48.249 103.194 1.00 29.65  ? 187  PHE B CZ  1 
ATOM   5668  N  N   . GLY B 1 188 ? 115.837 43.886 100.387 1.00 38.33  ? 188  GLY B N   1 
ATOM   5669  C  CA  . GLY B 1 188 ? 116.538 42.858 99.634  1.00 38.09  ? 188  GLY B CA  1 
ATOM   5670  C  C   . GLY B 1 188 ? 116.602 43.052 98.122  1.00 39.26  ? 188  GLY B C   1 
ATOM   5671  O  O   . GLY B 1 188 ? 117.013 42.141 97.394  1.00 38.30  ? 188  GLY B O   1 
ATOM   5672  N  N   . GLY B 1 189 ? 116.214 44.227 97.636  1.00 37.77  ? 189  GLY B N   1 
ATOM   5673  C  CA  . GLY B 1 189 ? 116.248 44.458 96.205  1.00 37.68  ? 189  GLY B CA  1 
ATOM   5674  C  C   . GLY B 1 189 ? 117.393 45.330 95.723  1.00 38.52  ? 189  GLY B C   1 
ATOM   5675  O  O   . GLY B 1 189 ? 117.887 46.184 96.458  1.00 38.94  ? 189  GLY B O   1 
ATOM   5676  N  N   . ASP B 1 190 ? 117.816 45.113 94.480  1.00 38.00  ? 190  ASP B N   1 
ATOM   5677  C  CA  . ASP B 1 190 ? 118.887 45.903 93.889  1.00 38.32  ? 190  ASP B CA  1 
ATOM   5678  C  C   . ASP B 1 190 ? 118.281 47.103 93.170  1.00 37.53  ? 190  ASP B C   1 
ATOM   5679  O  O   . ASP B 1 190 ? 117.643 46.960 92.130  1.00 37.38  ? 190  ASP B O   1 
ATOM   5680  C  CB  . ASP B 1 190 ? 119.699 45.060 92.896  1.00 39.29  ? 190  ASP B CB  1 
ATOM   5681  C  CG  . ASP B 1 190 ? 120.673 45.904 92.073  1.00 43.94  ? 190  ASP B CG  1 
ATOM   5682  O  OD1 . ASP B 1 190 ? 121.046 47.010 92.530  1.00 44.83  ? 190  ASP B OD1 1 
ATOM   5683  O  OD2 . ASP B 1 190 ? 121.077 45.464 90.973  1.00 44.31  ? 190  ASP B OD2 1 
ATOM   5684  N  N   . PRO B 1 191 ? 118.458 48.309 93.726  1.00 37.40  ? 191  PRO B N   1 
ATOM   5685  C  CA  . PRO B 1 191 ? 117.889 49.488 93.066  1.00 36.50  ? 191  PRO B CA  1 
ATOM   5686  C  C   . PRO B 1 191 ? 118.536 49.816 91.725  1.00 37.43  ? 191  PRO B C   1 
ATOM   5687  O  O   . PRO B 1 191 ? 118.096 50.719 91.020  1.00 36.94  ? 191  PRO B O   1 
ATOM   5688  C  CB  . PRO B 1 191 ? 118.082 50.588 94.107  1.00 36.68  ? 191  PRO B CB  1 
ATOM   5689  C  CG  . PRO B 1 191 ? 119.318 50.150 94.842  1.00 35.56  ? 191  PRO B CG  1 
ATOM   5690  C  CD  . PRO B 1 191 ? 119.099 48.670 95.003  1.00 36.14  ? 191  PRO B CD  1 
ATOM   5691  N  N   . LYS B 1 192 ? 119.586 49.087 91.365  1.00 39.28  ? 192  LYS B N   1 
ATOM   5692  C  CA  . LYS B 1 192 ? 120.248 49.342 90.088  1.00 40.41  ? 192  LYS B CA  1 
ATOM   5693  C  C   . LYS B 1 192 ? 119.570 48.504 89.011  1.00 40.42  ? 192  LYS B C   1 
ATOM   5694  O  O   . LYS B 1 192 ? 119.818 48.692 87.815  1.00 41.03  ? 192  LYS B O   1 
ATOM   5695  C  CB  . LYS B 1 192 ? 121.737 48.981 90.157  1.00 41.17  ? 192  LYS B CB  1 
ATOM   5696  C  CG  . LYS B 1 192 ? 122.533 49.753 91.199  1.00 43.38  ? 192  LYS B CG  1 
ATOM   5697  C  CD  . LYS B 1 192 ? 123.979 49.249 91.304  1.00 46.46  ? 192  LYS B CD  1 
ATOM   5698  C  CE  . LYS B 1 192 ? 124.873 49.757 90.169  1.00 48.37  ? 192  LYS B CE  1 
ATOM   5699  N  NZ  . LYS B 1 192 ? 124.390 49.407 88.800  1.00 51.32  ? 192  LYS B NZ  1 
ATOM   5700  N  N   . THR B 1 193 ? 118.704 47.590 89.446  1.00 38.88  ? 193  THR B N   1 
ATOM   5701  C  CA  . THR B 1 193 ? 117.993 46.707 88.532  1.00 38.36  ? 193  THR B CA  1 
ATOM   5702  C  C   . THR B 1 193 ? 116.484 46.666 88.797  1.00 36.58  ? 193  THR B C   1 
ATOM   5703  O  O   . THR B 1 193 ? 115.949 45.654 89.260  1.00 35.18  ? 193  THR B O   1 
ATOM   5704  C  CB  . THR B 1 193 ? 118.549 45.273 88.630  1.00 40.35  ? 193  THR B CB  1 
ATOM   5705  O  OG1 . THR B 1 193 ? 119.982 45.318 88.605  1.00 41.92  ? 193  THR B OG1 1 
ATOM   5706  C  CG2 . THR B 1 193 ? 118.070 44.434 87.454  1.00 38.97  ? 193  THR B CG2 1 
ATOM   5707  N  N   . VAL B 1 194 ? 115.806 47.773 88.519  1.00 33.82  ? 194  VAL B N   1 
ATOM   5708  C  CA  . VAL B 1 194 ? 114.365 47.831 88.706  1.00 32.74  ? 194  VAL B CA  1 
ATOM   5709  C  C   . VAL B 1 194 ? 113.675 47.915 87.362  1.00 30.58  ? 194  VAL B C   1 
ATOM   5710  O  O   . VAL B 1 194 ? 114.052 48.709 86.499  1.00 29.48  ? 194  VAL B O   1 
ATOM   5711  C  CB  . VAL B 1 194 ? 113.917 49.063 89.535  1.00 35.11  ? 194  VAL B CB  1 
ATOM   5712  C  CG1 . VAL B 1 194 ? 114.549 50.313 88.984  1.00 37.52  ? 194  VAL B CG1 1 
ATOM   5713  C  CG2 . VAL B 1 194 ? 112.393 49.211 89.475  1.00 33.20  ? 194  VAL B CG2 1 
ATOM   5714  N  N   . THR B 1 195 ? 112.663 47.081 87.186  1.00 28.88  ? 195  THR B N   1 
ATOM   5715  C  CA  . THR B 1 195 ? 111.891 47.088 85.958  1.00 27.95  ? 195  THR B CA  1 
ATOM   5716  C  C   . THR B 1 195 ? 110.522 47.692 86.260  1.00 27.63  ? 195  THR B C   1 
ATOM   5717  O  O   . THR B 1 195 ? 109.877 47.325 87.243  1.00 27.44  ? 195  THR B O   1 
ATOM   5718  C  CB  . THR B 1 195 ? 111.704 45.663 85.426  1.00 28.85  ? 195  THR B CB  1 
ATOM   5719  O  OG1 . THR B 1 195 ? 112.957 45.186 84.924  1.00 31.84  ? 195  THR B OG1 1 
ATOM   5720  C  CG2 . THR B 1 195 ? 110.654 45.622 84.312  1.00 27.60  ? 195  THR B CG2 1 
ATOM   5721  N  N   . ILE B 1 196 ? 110.089 48.642 85.442  1.00 25.94  ? 196  ILE B N   1 
ATOM   5722  C  CA  . ILE B 1 196 ? 108.769 49.214 85.647  1.00 26.58  ? 196  ILE B CA  1 
ATOM   5723  C  C   . ILE B 1 196 ? 107.841 48.647 84.574  1.00 26.98  ? 196  ILE B C   1 
ATOM   5724  O  O   . ILE B 1 196 ? 108.165 48.690 83.378  1.00 28.89  ? 196  ILE B O   1 
ATOM   5725  C  CB  . ILE B 1 196 ? 108.775 50.770 85.566  1.00 24.49  ? 196  ILE B CB  1 
ATOM   5726  C  CG1 . ILE B 1 196 ? 109.323 51.244 84.224  1.00 24.56  ? 196  ILE B CG1 1 
ATOM   5727  C  CG2 . ILE B 1 196 ? 109.605 51.338 86.694  1.00 25.21  ? 196  ILE B CG2 1 
ATOM   5728  C  CD1 . ILE B 1 196 ? 109.127 52.745 83.979  1.00 24.80  ? 196  ILE B CD1 1 
ATOM   5729  N  N   . PHE B 1 197 ? 106.709 48.085 84.993  1.00 25.30  ? 197  PHE B N   1 
ATOM   5730  C  CA  . PHE B 1 197 ? 105.759 47.540 84.034  1.00 25.50  ? 197  PHE B CA  1 
ATOM   5731  C  C   . PHE B 1 197 ? 104.326 47.925 84.351  1.00 27.50  ? 197  PHE B C   1 
ATOM   5732  O  O   . PHE B 1 197 ? 103.928 48.001 85.514  1.00 26.75  ? 197  PHE B O   1 
ATOM   5733  C  CB  . PHE B 1 197 ? 105.898 46.011 83.919  1.00 26.00  ? 197  PHE B CB  1 
ATOM   5734  C  CG  . PHE B 1 197 ? 105.471 45.237 85.145  1.00 24.70  ? 197  PHE B CG  1 
ATOM   5735  C  CD1 . PHE B 1 197 ? 105.933 45.577 86.410  1.00 23.30  ? 197  PHE B CD1 1 
ATOM   5736  C  CD2 . PHE B 1 197 ? 104.668 44.109 85.013  1.00 25.85  ? 197  PHE B CD2 1 
ATOM   5737  C  CE1 . PHE B 1 197 ? 105.609 44.809 87.520  1.00 21.11  ? 197  PHE B CE1 1 
ATOM   5738  C  CE2 . PHE B 1 197 ? 104.336 43.327 86.127  1.00 26.81  ? 197  PHE B CE2 1 
ATOM   5739  C  CZ  . PHE B 1 197 ? 104.808 43.677 87.380  1.00 23.69  ? 197  PHE B CZ  1 
ATOM   5740  N  N   . GLY B 1 198 ? 103.559 48.184 83.296  1.00 27.12  ? 198  GLY B N   1 
ATOM   5741  C  CA  . GLY B 1 198 ? 102.177 48.577 83.461  1.00 26.99  ? 198  GLY B CA  1 
ATOM   5742  C  C   . GLY B 1 198 ? 101.313 48.278 82.255  1.00 29.21  ? 198  GLY B C   1 
ATOM   5743  O  O   . GLY B 1 198 ? 101.818 48.057 81.147  1.00 28.83  ? 198  GLY B O   1 
ATOM   5744  N  N   . GLU B 1 199 ? 100.001 48.291 82.468  1.00 28.32  ? 199  GLU B N   1 
ATOM   5745  C  CA  . GLU B 1 199 ? 99.056  47.995 81.404  1.00 29.14  ? 199  GLU B CA  1 
ATOM   5746  C  C   . GLU B 1 199 ? 98.131  49.178 81.124  1.00 28.82  ? 199  GLU B C   1 
ATOM   5747  O  O   . GLU B 1 199 ? 97.739  49.895 82.041  1.00 28.93  ? 199  GLU B O   1 
ATOM   5748  C  CB  . GLU B 1 199 ? 98.250  46.750 81.796  1.00 29.57  ? 199  GLU B CB  1 
ATOM   5749  C  CG  . GLU B 1 199 ? 97.343  46.178 80.714  1.00 32.84  ? 199  GLU B CG  1 
ATOM   5750  C  CD  . GLU B 1 199 ? 95.947  46.754 80.769  1.00 34.76  ? 199  GLU B CD  1 
ATOM   5751  O  OE1 . GLU B 1 199 ? 95.503  47.115 81.880  1.00 37.90  ? 199  GLU B OE1 1 
ATOM   5752  O  OE2 . GLU B 1 199 ? 95.282  46.833 79.714  1.00 37.62  ? 199  GLU B OE2 1 
ATOM   5753  N  N   . SER B 1 200 ? 97.808  49.380 79.847  1.00 29.61  ? 200  SER B N   1 
ATOM   5754  C  CA  . SER B 1 200 ? 96.920  50.456 79.398  1.00 30.91  ? 200  SER B CA  1 
ATOM   5755  C  C   . SER B 1 200 ? 97.461  51.828 79.823  1.00 29.48  ? 200  SER B C   1 
ATOM   5756  O  O   . SER B 1 200 ? 98.518  52.248 79.354  1.00 28.22  ? 200  SER B O   1 
ATOM   5757  C  CB  . SER B 1 200 ? 95.503  50.229 79.959  1.00 33.81  ? 200  SER B CB  1 
ATOM   5758  O  OG  . SER B 1 200 ? 94.524  50.924 79.196  1.00 38.82  ? 200  SER B OG  1 
ATOM   5759  N  N   . ALA B 1 201 ? 96.738  52.531 80.691  1.00 28.19  ? 201  ALA B N   1 
ATOM   5760  C  CA  . ALA B 1 201 ? 97.198  53.834 81.170  1.00 28.24  ? 201  ALA B CA  1 
ATOM   5761  C  C   . ALA B 1 201 ? 98.511  53.593 81.904  1.00 27.40  ? 201  ALA B C   1 
ATOM   5762  O  O   . ALA B 1 201 ? 99.327  54.499 82.044  1.00 26.49  ? 201  ALA B O   1 
ATOM   5763  C  CB  . ALA B 1 201 ? 96.175  54.463 82.116  1.00 24.30  ? 201  ALA B CB  1 
ATOM   5764  N  N   . GLY B 1 202 ? 98.698  52.359 82.370  1.00 25.33  ? 202  GLY B N   1 
ATOM   5765  C  CA  . GLY B 1 202 ? 99.921  52.003 83.064  1.00 26.24  ? 202  GLY B CA  1 
ATOM   5766  C  C   . GLY B 1 202 ? 101.037 51.925 82.042  1.00 27.30  ? 202  GLY B C   1 
ATOM   5767  O  O   . GLY B 1 202 ? 102.128 52.484 82.228  1.00 28.12  ? 202  GLY B O   1 
ATOM   5768  N  N   . GLY B 1 203 ? 100.754 51.232 80.945  1.00 25.63  ? 203  GLY B N   1 
ATOM   5769  C  CA  . GLY B 1 203 ? 101.725 51.106 79.879  1.00 24.97  ? 203  GLY B CA  1 
ATOM   5770  C  C   . GLY B 1 203 ? 102.073 52.458 79.277  1.00 24.57  ? 203  GLY B C   1 
ATOM   5771  O  O   . GLY B 1 203 ? 103.216 52.687 78.883  1.00 26.00  ? 203  GLY B O   1 
ATOM   5772  N  N   . ALA B 1 204 ? 101.096 53.354 79.185  1.00 22.93  ? 204  ALA B N   1 
ATOM   5773  C  CA  . ALA B 1 204 ? 101.369 54.673 78.634  1.00 24.29  ? 204  ALA B CA  1 
ATOM   5774  C  C   . ALA B 1 204 ? 102.272 55.422 79.610  1.00 24.89  ? 204  ALA B C   1 
ATOM   5775  O  O   . ALA B 1 204 ? 103.145 56.190 79.192  1.00 26.58  ? 204  ALA B O   1 
ATOM   5776  C  CB  . ALA B 1 204 ? 100.078 55.445 78.416  1.00 23.87  ? 204  ALA B CB  1 
ATOM   5777  N  N   . SER B 1 205 ? 102.061 55.186 80.904  1.00 22.01  ? 205  SER B N   1 
ATOM   5778  C  CA  . SER B 1 205 ? 102.860 55.829 81.945  1.00 23.14  ? 205  SER B CA  1 
ATOM   5779  C  C   . SER B 1 205 ? 104.317 55.389 81.859  1.00 22.23  ? 205  SER B C   1 
ATOM   5780  O  O   . SER B 1 205 ? 105.223 56.220 81.844  1.00 22.02  ? 205  SER B O   1 
ATOM   5781  C  CB  . SER B 1 205 ? 102.309 55.489 83.332  1.00 21.03  ? 205  SER B CB  1 
ATOM   5782  O  OG  . SER B 1 205 ? 101.065 56.115 83.544  1.00 24.17  ? 205  SER B OG  1 
ATOM   5783  N  N   . VAL B 1 206 ? 104.531 54.075 81.811  1.00 22.23  ? 206  VAL B N   1 
ATOM   5784  C  CA  . VAL B 1 206 ? 105.870 53.527 81.710  1.00 20.94  ? 206  VAL B CA  1 
ATOM   5785  C  C   . VAL B 1 206 ? 106.570 54.185 80.533  1.00 23.10  ? 206  VAL B C   1 
ATOM   5786  O  O   . VAL B 1 206 ? 107.734 54.579 80.627  1.00 24.16  ? 206  VAL B O   1 
ATOM   5787  C  CB  . VAL B 1 206 ? 105.838 52.019 81.481  1.00 20.75  ? 206  VAL B CB  1 
ATOM   5788  C  CG1 . VAL B 1 206 ? 107.192 51.551 81.024  1.00 20.79  ? 206  VAL B CG1 1 
ATOM   5789  C  CG2 . VAL B 1 206 ? 105.455 51.303 82.764  1.00 20.46  ? 206  VAL B CG2 1 
ATOM   5790  N  N   . GLY B 1 207 ? 105.849 54.308 79.423  1.00 24.19  ? 207  GLY B N   1 
ATOM   5791  C  CA  . GLY B 1 207 ? 106.416 54.928 78.243  1.00 24.85  ? 207  GLY B CA  1 
ATOM   5792  C  C   . GLY B 1 207 ? 106.735 56.397 78.449  1.00 27.10  ? 207  GLY B C   1 
ATOM   5793  O  O   . GLY B 1 207 ? 107.662 56.927 77.839  1.00 25.60  ? 207  GLY B O   1 
ATOM   5794  N  N   . MET B 1 208 ? 105.962 57.065 79.303  1.00 28.27  ? 208  MET B N   1 
ATOM   5795  C  CA  . MET B 1 208 ? 106.180 58.487 79.564  1.00 27.51  ? 208  MET B CA  1 
ATOM   5796  C  C   . MET B 1 208 ? 107.404 58.716 80.444  1.00 27.22  ? 208  MET B C   1 
ATOM   5797  O  O   . MET B 1 208 ? 108.070 59.742 80.327  1.00 25.22  ? 208  MET B O   1 
ATOM   5798  C  CB  . MET B 1 208 ? 104.928 59.104 80.188  1.00 25.86  ? 208  MET B CB  1 
ATOM   5799  C  CG  . MET B 1 208 ? 103.758 59.101 79.224  1.00 26.41  ? 208  MET B CG  1 
ATOM   5800  S  SD  . MET B 1 208 ? 102.185 59.659 79.916  1.00 30.38  ? 208  MET B SD  1 
ATOM   5801  C  CE  . MET B 1 208 ? 101.309 60.129 78.417  1.00 25.63  ? 208  MET B CE  1 
ATOM   5802  N  N   . HIS B 1 209 ? 107.709 57.755 81.310  1.00 25.68  ? 209  HIS B N   1 
ATOM   5803  C  CA  . HIS B 1 209 ? 108.886 57.871 82.164  1.00 28.44  ? 209  HIS B CA  1 
ATOM   5804  C  C   . HIS B 1 209 ? 110.126 57.651 81.309  1.00 30.41  ? 209  HIS B C   1 
ATOM   5805  O  O   . HIS B 1 209 ? 111.194 58.187 81.594  1.00 31.13  ? 209  HIS B O   1 
ATOM   5806  C  CB  . HIS B 1 209 ? 108.846 56.842 83.290  1.00 28.29  ? 209  HIS B CB  1 
ATOM   5807  C  CG  . HIS B 1 209 ? 107.807 57.132 84.322  1.00 31.70  ? 209  HIS B CG  1 
ATOM   5808  N  ND1 . HIS B 1 209 ? 107.892 58.209 85.177  1.00 32.96  ? 209  HIS B ND1 1 
ATOM   5809  C  CD2 . HIS B 1 209 ? 106.633 56.520 84.603  1.00 31.16  ? 209  HIS B CD2 1 
ATOM   5810  C  CE1 . HIS B 1 209 ? 106.814 58.251 85.939  1.00 32.97  ? 209  HIS B CE1 1 
ATOM   5811  N  NE2 . HIS B 1 209 ? 106.033 57.237 85.610  1.00 33.17  ? 209  HIS B NE2 1 
ATOM   5812  N  N   . ILE B 1 210 ? 109.974 56.858 80.254  1.00 31.65  ? 210  ILE B N   1 
ATOM   5813  C  CA  . ILE B 1 210 ? 111.081 56.593 79.353  1.00 32.17  ? 210  ILE B CA  1 
ATOM   5814  C  C   . ILE B 1 210 ? 111.443 57.875 78.604  1.00 33.08  ? 210  ILE B C   1 
ATOM   5815  O  O   . ILE B 1 210 ? 112.611 58.139 78.337  1.00 34.07  ? 210  ILE B O   1 
ATOM   5816  C  CB  . ILE B 1 210 ? 110.723 55.477 78.342  1.00 31.05  ? 210  ILE B CB  1 
ATOM   5817  C  CG1 . ILE B 1 210 ? 110.693 54.128 79.061  1.00 32.32  ? 210  ILE B CG1 1 
ATOM   5818  C  CG2 . ILE B 1 210 ? 111.726 55.450 77.196  1.00 30.18  ? 210  ILE B CG2 1 
ATOM   5819  C  CD1 . ILE B 1 210 ? 110.487 52.940 78.147  1.00 31.60  ? 210  ILE B CD1 1 
ATOM   5820  N  N   . LEU B 1 211 ? 110.435 58.679 78.290  1.00 33.57  ? 211  LEU B N   1 
ATOM   5821  C  CA  . LEU B 1 211 ? 110.647 59.926 77.566  1.00 34.83  ? 211  LEU B CA  1 
ATOM   5822  C  C   . LEU B 1 211 ? 111.070 61.085 78.460  1.00 35.22  ? 211  LEU B C   1 
ATOM   5823  O  O   . LEU B 1 211 ? 111.908 61.893 78.083  1.00 38.65  ? 211  LEU B O   1 
ATOM   5824  C  CB  . LEU B 1 211 ? 109.372 60.320 76.817  1.00 34.74  ? 211  LEU B CB  1 
ATOM   5825  C  CG  . LEU B 1 211 ? 108.862 59.364 75.742  1.00 36.26  ? 211  LEU B CG  1 
ATOM   5826  C  CD1 . LEU B 1 211 ? 107.554 59.886 75.165  1.00 36.23  ? 211  LEU B CD1 1 
ATOM   5827  C  CD2 . LEU B 1 211 ? 109.907 59.226 74.657  1.00 36.24  ? 211  LEU B CD2 1 
ATOM   5828  N  N   . SER B 1 212 ? 110.489 61.164 79.647  1.00 35.97  ? 212  SER B N   1 
ATOM   5829  C  CA  . SER B 1 212 ? 110.792 62.250 80.572  1.00 36.58  ? 212  SER B CA  1 
ATOM   5830  C  C   . SER B 1 212 ? 112.169 62.171 81.232  1.00 36.07  ? 212  SER B C   1 
ATOM   5831  O  O   . SER B 1 212 ? 112.489 61.200 81.928  1.00 35.83  ? 212  SER B O   1 
ATOM   5832  C  CB  . SER B 1 212 ? 109.713 62.317 81.652  1.00 35.63  ? 212  SER B CB  1 
ATOM   5833  O  OG  . SER B 1 212 ? 110.120 63.142 82.725  1.00 37.67  ? 212  SER B OG  1 
ATOM   5834  N  N   . PRO B 1 213 ? 113.001 63.207 81.025  1.00 34.65  ? 213  PRO B N   1 
ATOM   5835  C  CA  . PRO B 1 213 ? 114.353 63.287 81.589  1.00 35.04  ? 213  PRO B CA  1 
ATOM   5836  C  C   . PRO B 1 213 ? 114.384 63.103 83.106  1.00 34.34  ? 213  PRO B C   1 
ATOM   5837  O  O   . PRO B 1 213 ? 115.348 62.576 83.650  1.00 35.82  ? 213  PRO B O   1 
ATOM   5838  C  CB  . PRO B 1 213 ? 114.816 64.682 81.172  1.00 35.70  ? 213  PRO B CB  1 
ATOM   5839  C  CG  . PRO B 1 213 ? 114.149 64.865 79.853  1.00 34.59  ? 213  PRO B CG  1 
ATOM   5840  C  CD  . PRO B 1 213 ? 112.745 64.346 80.126  1.00 34.35  ? 213  PRO B CD  1 
ATOM   5841  N  N   . GLY B 1 214 ? 113.321 63.531 83.783  1.00 34.49  ? 214  GLY B N   1 
ATOM   5842  C  CA  . GLY B 1 214 ? 113.265 63.407 85.233  1.00 32.96  ? 214  GLY B CA  1 
ATOM   5843  C  C   . GLY B 1 214 ? 112.993 62.018 85.786  1.00 32.34  ? 214  GLY B C   1 
ATOM   5844  O  O   . GLY B 1 214 ? 113.154 61.785 86.983  1.00 32.67  ? 214  GLY B O   1 
ATOM   5845  N  N   . SER B 1 215 ? 112.585 61.084 84.937  1.00 31.59  ? 215  SER B N   1 
ATOM   5846  C  CA  . SER B 1 215 ? 112.305 59.730 85.417  1.00 32.38  ? 215  SER B CA  1 
ATOM   5847  C  C   . SER B 1 215 ? 113.361 58.711 85.009  1.00 33.56  ? 215  SER B C   1 
ATOM   5848  O  O   . SER B 1 215 ? 113.528 57.684 85.664  1.00 34.36  ? 215  SER B O   1 
ATOM   5849  C  CB  . SER B 1 215 ? 110.948 59.250 84.893  1.00 31.38  ? 215  SER B CB  1 
ATOM   5850  O  OG  . SER B 1 215 ? 109.883 60.068 85.336  1.00 30.14  ? 215  SER B OG  1 
ATOM   5851  N  N   . ARG B 1 216 ? 114.077 59.014 83.932  1.00 35.35  ? 216  ARG B N   1 
ATOM   5852  C  CA  . ARG B 1 216 ? 115.085 58.121 83.362  1.00 37.81  ? 216  ARG B CA  1 
ATOM   5853  C  C   . ARG B 1 216 ? 116.028 57.348 84.284  1.00 37.61  ? 216  ARG B C   1 
ATOM   5854  O  O   . ARG B 1 216 ? 116.217 56.144 84.109  1.00 36.35  ? 216  ARG B O   1 
ATOM   5855  C  CB  . ARG B 1 216 ? 115.900 58.888 82.315  1.00 39.62  ? 216  ARG B CB  1 
ATOM   5856  C  CG  . ARG B 1 216 ? 115.032 59.424 81.181  1.00 42.31  ? 216  ARG B CG  1 
ATOM   5857  C  CD  . ARG B 1 216 ? 115.854 60.001 80.045  1.00 45.93  ? 216  ARG B CD  1 
ATOM   5858  N  NE  . ARG B 1 216 ? 115.005 60.686 79.073  1.00 47.87  ? 216  ARG B NE  1 
ATOM   5859  C  CZ  . ARG B 1 216 ? 115.461 61.331 78.005  1.00 48.06  ? 216  ARG B CZ  1 
ATOM   5860  N  NH1 . ARG B 1 216 ? 114.616 61.930 77.177  1.00 48.79  ? 216  ARG B NH1 1 
ATOM   5861  N  NH2 . ARG B 1 216 ? 116.762 61.372 77.764  1.00 50.15  ? 216  ARG B NH2 1 
ATOM   5862  N  N   . ASP B 1 217 ? 116.615 58.018 85.265  1.00 38.09  ? 217  ASP B N   1 
ATOM   5863  C  CA  . ASP B 1 217 ? 117.551 57.341 86.154  1.00 38.82  ? 217  ASP B CA  1 
ATOM   5864  C  C   . ASP B 1 217 ? 116.899 56.585 87.307  1.00 36.81  ? 217  ASP B C   1 
ATOM   5865  O  O   . ASP B 1 217 ? 117.588 56.075 88.186  1.00 36.14  ? 217  ASP B O   1 
ATOM   5866  C  CB  . ASP B 1 217 ? 118.561 58.356 86.691  1.00 42.32  ? 217  ASP B CB  1 
ATOM   5867  C  CG  . ASP B 1 217 ? 119.283 59.095 85.576  1.00 47.11  ? 217  ASP B CG  1 
ATOM   5868  O  OD1 . ASP B 1 217 ? 119.944 58.421 84.750  1.00 49.24  ? 217  ASP B OD1 1 
ATOM   5869  O  OD2 . ASP B 1 217 ? 119.186 60.344 85.521  1.00 47.87  ? 217  ASP B OD2 1 
ATOM   5870  N  N   . LEU B 1 218 ? 115.574 56.487 87.292  1.00 35.21  ? 218  LEU B N   1 
ATOM   5871  C  CA  . LEU B 1 218 ? 114.867 55.795 88.363  1.00 32.99  ? 218  LEU B CA  1 
ATOM   5872  C  C   . LEU B 1 218 ? 114.505 54.333 88.098  1.00 32.27  ? 218  LEU B C   1 
ATOM   5873  O  O   . LEU B 1 218 ? 113.870 53.688 88.938  1.00 32.07  ? 218  LEU B O   1 
ATOM   5874  C  CB  . LEU B 1 218 ? 113.610 56.580 88.744  1.00 33.27  ? 218  LEU B CB  1 
ATOM   5875  C  CG  . LEU B 1 218 ? 113.907 57.946 89.364  1.00 31.22  ? 218  LEU B CG  1 
ATOM   5876  C  CD1 . LEU B 1 218 ? 112.612 58.650 89.718  1.00 33.36  ? 218  LEU B CD1 1 
ATOM   5877  C  CD2 . LEU B 1 218 ? 114.751 57.760 90.601  1.00 34.09  ? 218  LEU B CD2 1 
ATOM   5878  N  N   . PHE B 1 219 ? 114.890 53.811 86.937  1.00 29.09  ? 219  PHE B N   1 
ATOM   5879  C  CA  . PHE B 1 219 ? 114.621 52.406 86.617  1.00 27.61  ? 219  PHE B CA  1 
ATOM   5880  C  C   . PHE B 1 219 ? 115.586 51.953 85.549  1.00 27.47  ? 219  PHE B C   1 
ATOM   5881  O  O   . PHE B 1 219 ? 116.151 52.774 84.839  1.00 25.70  ? 219  PHE B O   1 
ATOM   5882  C  CB  . PHE B 1 219 ? 113.178 52.183 86.138  1.00 24.69  ? 219  PHE B CB  1 
ATOM   5883  C  CG  . PHE B 1 219 ? 112.832 52.936 84.896  1.00 23.61  ? 219  PHE B CG  1 
ATOM   5884  C  CD1 . PHE B 1 219 ? 112.572 54.302 84.947  1.00 22.66  ? 219  PHE B CD1 1 
ATOM   5885  C  CD2 . PHE B 1 219 ? 112.795 52.291 83.669  1.00 21.98  ? 219  PHE B CD2 1 
ATOM   5886  C  CE1 . PHE B 1 219 ? 112.280 55.017 83.791  1.00 24.55  ? 219  PHE B CE1 1 
ATOM   5887  C  CE2 . PHE B 1 219 ? 112.503 52.998 82.507  1.00 25.25  ? 219  PHE B CE2 1 
ATOM   5888  C  CZ  . PHE B 1 219 ? 112.245 54.365 82.568  1.00 22.19  ? 219  PHE B CZ  1 
ATOM   5889  N  N   . ARG B 1 220 ? 115.758 50.640 85.448  1.00 28.42  ? 220  ARG B N   1 
ATOM   5890  C  CA  . ARG B 1 220 ? 116.682 50.032 84.500  1.00 29.82  ? 220  ARG B CA  1 
ATOM   5891  C  C   . ARG B 1 220 ? 116.055 49.635 83.156  1.00 31.68  ? 220  ARG B C   1 
ATOM   5892  O  O   . ARG B 1 220 ? 116.602 49.940 82.092  1.00 32.00  ? 220  ARG B O   1 
ATOM   5893  C  CB  . ARG B 1 220 ? 117.322 48.805 85.159  1.00 32.14  ? 220  ARG B CB  1 
ATOM   5894  C  CG  . ARG B 1 220 ? 118.305 48.042 84.294  1.00 35.87  ? 220  ARG B CG  1 
ATOM   5895  C  CD  . ARG B 1 220 ? 119.485 48.910 83.921  1.00 37.62  ? 220  ARG B CD  1 
ATOM   5896  N  NE  . ARG B 1 220 ? 120.524 48.141 83.245  1.00 43.10  ? 220  ARG B NE  1 
ATOM   5897  C  CZ  . ARG B 1 220 ? 121.188 47.132 83.803  1.00 45.26  ? 220  ARG B CZ  1 
ATOM   5898  N  NH1 . ARG B 1 220 ? 120.917 46.769 85.054  1.00 45.14  ? 220  ARG B NH1 1 
ATOM   5899  N  NH2 . ARG B 1 220 ? 122.129 46.491 83.114  1.00 44.80  ? 220  ARG B NH2 1 
ATOM   5900  N  N   . ARG B 1 221 ? 114.913 48.954 83.214  1.00 30.25  ? 221  ARG B N   1 
ATOM   5901  C  CA  . ARG B 1 221 ? 114.214 48.489 82.023  1.00 30.66  ? 221  ARG B CA  1 
ATOM   5902  C  C   . ARG B 1 221 ? 112.714 48.726 82.144  1.00 30.59  ? 221  ARG B C   1 
ATOM   5903  O  O   . ARG B 1 221 ? 112.231 49.084 83.219  1.00 31.72  ? 221  ARG B O   1 
ATOM   5904  C  CB  . ARG B 1 221 ? 114.479 47.002 81.819  1.00 32.08  ? 221  ARG B CB  1 
ATOM   5905  C  CG  . ARG B 1 221 ? 115.879 46.693 81.370  1.00 35.88  ? 221  ARG B CG  1 
ATOM   5906  C  CD  . ARG B 1 221 ? 116.024 45.219 81.117  1.00 35.83  ? 221  ARG B CD  1 
ATOM   5907  N  NE  . ARG B 1 221 ? 116.495 44.512 82.296  1.00 37.12  ? 221  ARG B NE  1 
ATOM   5908  C  CZ  . ARG B 1 221 ? 117.756 44.522 82.711  1.00 35.44  ? 221  ARG B CZ  1 
ATOM   5909  N  NH1 . ARG B 1 221 ? 118.671 45.204 82.038  1.00 34.89  ? 221  ARG B NH1 1 
ATOM   5910  N  NH2 . ARG B 1 221 ? 118.097 43.841 83.791  1.00 34.57  ? 221  ARG B NH2 1 
ATOM   5911  N  N   . ALA B 1 222 ? 111.977 48.494 81.057  1.00 27.06  ? 222  ALA B N   1 
ATOM   5912  C  CA  . ALA B 1 222 ? 110.535 48.734 81.061  1.00 25.51  ? 222  ALA B CA  1 
ATOM   5913  C  C   . ALA B 1 222 ? 109.679 47.791 80.212  1.00 26.47  ? 222  ALA B C   1 
ATOM   5914  O  O   . ALA B 1 222 ? 110.046 47.426 79.087  1.00 25.58  ? 222  ALA B O   1 
ATOM   5915  C  CB  . ALA B 1 222 ? 110.273 50.160 80.633  1.00 21.17  ? 222  ALA B CB  1 
ATOM   5916  N  N   . ILE B 1 223 ? 108.525 47.419 80.763  1.00 24.95  ? 223  ILE B N   1 
ATOM   5917  C  CA  . ILE B 1 223 ? 107.570 46.557 80.080  1.00 25.70  ? 223  ILE B CA  1 
ATOM   5918  C  C   . ILE B 1 223 ? 106.251 47.327 79.901  1.00 25.96  ? 223  ILE B C   1 
ATOM   5919  O  O   . ILE B 1 223 ? 105.710 47.861 80.870  1.00 25.49  ? 223  ILE B O   1 
ATOM   5920  C  CB  . ILE B 1 223 ? 107.292 45.276 80.895  1.00 26.39  ? 223  ILE B CB  1 
ATOM   5921  C  CG1 . ILE B 1 223 ? 108.593 44.490 81.089  1.00 23.15  ? 223  ILE B CG1 1 
ATOM   5922  C  CG2 . ILE B 1 223 ? 106.215 44.436 80.190  1.00 24.50  ? 223  ILE B CG2 1 
ATOM   5923  C  CD1 . ILE B 1 223 ? 108.421 43.185 81.842  1.00 20.46  ? 223  ILE B CD1 1 
ATOM   5924  N  N   . LEU B 1 224 ? 105.762 47.401 78.662  1.00 25.74  ? 224  LEU B N   1 
ATOM   5925  C  CA  . LEU B 1 224 ? 104.518 48.101 78.345  1.00 25.47  ? 224  LEU B CA  1 
ATOM   5926  C  C   . LEU B 1 224 ? 103.480 47.144 77.759  1.00 25.87  ? 224  LEU B C   1 
ATOM   5927  O  O   . LEU B 1 224 ? 103.672 46.598 76.676  1.00 24.47  ? 224  LEU B O   1 
ATOM   5928  C  CB  . LEU B 1 224 ? 104.761 49.226 77.331  1.00 25.16  ? 224  LEU B CB  1 
ATOM   5929  C  CG  . LEU B 1 224 ? 105.807 50.306 77.608  1.00 26.31  ? 224  LEU B CG  1 
ATOM   5930  C  CD1 . LEU B 1 224 ? 107.180 49.782 77.234  1.00 26.41  ? 224  LEU B CD1 1 
ATOM   5931  C  CD2 . LEU B 1 224 ? 105.492 51.555 76.787  1.00 21.72  ? 224  LEU B CD2 1 
ATOM   5932  N  N   . GLN B 1 225 ? 102.370 46.970 78.469  1.00 26.86  ? 225  GLN B N   1 
ATOM   5933  C  CA  . GLN B 1 225 ? 101.302 46.073 78.039  1.00 24.91  ? 225  GLN B CA  1 
ATOM   5934  C  C   . GLN B 1 225 ? 100.072 46.841 77.562  1.00 26.39  ? 225  GLN B C   1 
ATOM   5935  O  O   . GLN B 1 225 ? 99.459  47.581 78.334  1.00 28.61  ? 225  GLN B O   1 
ATOM   5936  C  CB  . GLN B 1 225 ? 100.904 45.158 79.200  1.00 24.85  ? 225  GLN B CB  1 
ATOM   5937  C  CG  . GLN B 1 225 ? 102.089 44.505 79.913  1.00 24.16  ? 225  GLN B CG  1 
ATOM   5938  C  CD  . GLN B 1 225 ? 101.687 43.637 81.097  1.00 24.47  ? 225  GLN B CD  1 
ATOM   5939  O  OE1 . GLN B 1 225 ? 102.532 43.243 81.895  1.00 23.83  ? 225  GLN B OE1 1 
ATOM   5940  N  NE2 . GLN B 1 225 ? 100.395 43.331 81.214  1.00 25.82  ? 225  GLN B NE2 1 
ATOM   5941  N  N   . SER B 1 226 ? 99.711  46.660 76.293  1.00 25.79  ? 226  SER B N   1 
ATOM   5942  C  CA  . SER B 1 226 ? 98.539  47.310 75.706  1.00 25.93  ? 226  SER B CA  1 
ATOM   5943  C  C   . SER B 1 226 ? 98.435  48.801 76.012  1.00 26.78  ? 226  SER B C   1 
ATOM   5944  O  O   . SER B 1 226 ? 97.375  49.282 76.403  1.00 28.11  ? 226  SER B O   1 
ATOM   5945  C  CB  . SER B 1 226 ? 97.254  46.621 76.180  1.00 26.85  ? 226  SER B CB  1 
ATOM   5946  O  OG  . SER B 1 226 ? 97.255  45.230 75.880  1.00 28.41  ? 226  SER B OG  1 
ATOM   5947  N  N   . GLY B 1 227 ? 99.528  49.532 75.825  1.00 26.25  ? 227  GLY B N   1 
ATOM   5948  C  CA  . GLY B 1 227 ? 99.518  50.961 76.093  1.00 25.70  ? 227  GLY B CA  1 
ATOM   5949  C  C   . GLY B 1 227 ? 100.872 51.585 75.793  1.00 25.77  ? 227  GLY B C   1 
ATOM   5950  O  O   . GLY B 1 227 ? 101.910 50.969 76.031  1.00 24.86  ? 227  GLY B O   1 
ATOM   5951  N  N   . SER B 1 228 ? 100.865 52.797 75.250  1.00 23.87  ? 228  SER B N   1 
ATOM   5952  C  CA  . SER B 1 228 ? 102.098 53.489 74.920  1.00 26.81  ? 228  SER B CA  1 
ATOM   5953  C  C   . SER B 1 228 ? 101.876 54.991 75.083  1.00 26.06  ? 228  SER B C   1 
ATOM   5954  O  O   . SER B 1 228 ? 100.748 55.466 75.042  1.00 25.31  ? 228  SER B O   1 
ATOM   5955  C  CB  . SER B 1 228 ? 102.545 53.145 73.490  1.00 28.37  ? 228  SER B CB  1 
ATOM   5956  O  OG  . SER B 1 228 ? 101.547 53.461 72.536  1.00 31.32  ? 228  SER B OG  1 
ATOM   5957  N  N   . PRO B 1 229 ? 102.959 55.759 75.250  1.00 26.09  ? 229  PRO B N   1 
ATOM   5958  C  CA  . PRO B 1 229 ? 102.867 57.209 75.438  1.00 28.45  ? 229  PRO B CA  1 
ATOM   5959  C  C   . PRO B 1 229 ? 102.194 58.031 74.352  1.00 29.22  ? 229  PRO B C   1 
ATOM   5960  O  O   . PRO B 1 229 ? 101.530 59.018 74.647  1.00 31.33  ? 229  PRO B O   1 
ATOM   5961  C  CB  . PRO B 1 229 ? 104.324 57.615 75.670  1.00 28.70  ? 229  PRO B CB  1 
ATOM   5962  C  CG  . PRO B 1 229 ? 105.079 56.643 74.838  1.00 27.96  ? 229  PRO B CG  1 
ATOM   5963  C  CD  . PRO B 1 229 ? 104.365 55.335 75.126  1.00 27.36  ? 229  PRO B CD  1 
ATOM   5964  N  N   . ASN B 1 230 ? 102.349 57.618 73.102  1.00 29.64  ? 230  ASN B N   1 
ATOM   5965  C  CA  . ASN B 1 230 ? 101.776 58.351 71.982  1.00 27.97  ? 230  ASN B CA  1 
ATOM   5966  C  C   . ASN B 1 230 ? 100.310 58.048 71.643  1.00 27.93  ? 230  ASN B C   1 
ATOM   5967  O  O   . ASN B 1 230 ? 99.813  58.539 70.638  1.00 29.11  ? 230  ASN B O   1 
ATOM   5968  C  CB  . ASN B 1 230 ? 102.648 58.125 70.741  1.00 25.78  ? 230  ASN B CB  1 
ATOM   5969  C  CG  . ASN B 1 230 ? 102.804 56.651 70.405  1.00 25.95  ? 230  ASN B CG  1 
ATOM   5970  O  OD1 . ASN B 1 230 ? 103.137 55.847 71.271  1.00 25.68  ? 230  ASN B OD1 1 
ATOM   5971  N  ND2 . ASN B 1 230 ? 102.559 56.292 69.149  1.00 20.46  ? 230  ASN B ND2 1 
ATOM   5972  N  N   . CYS B 1 231 ? 99.614  57.255 72.456  1.00 27.22  ? 231  CYS B N   1 
ATOM   5973  C  CA  . CYS B 1 231 ? 98.206  56.954 72.167  1.00 27.85  ? 231  CYS B CA  1 
ATOM   5974  C  C   . CYS B 1 231 ? 97.378  58.230 72.067  1.00 27.77  ? 231  CYS B C   1 
ATOM   5975  O  O   . CYS B 1 231 ? 97.646  59.202 72.758  1.00 29.56  ? 231  CYS B O   1 
ATOM   5976  C  CB  . CYS B 1 231 ? 97.597  56.060 73.247  1.00 25.36  ? 231  CYS B CB  1 
ATOM   5977  S  SG  . CYS B 1 231 ? 98.226  54.378 73.261  1.00 28.98  ? 231  CYS B SG  1 
ATOM   5978  N  N   . PRO B 1 232 ? 96.343  58.231 71.215  1.00 28.86  ? 232  PRO B N   1 
ATOM   5979  C  CA  . PRO B 1 232 ? 95.493  59.416 71.052  1.00 28.69  ? 232  PRO B CA  1 
ATOM   5980  C  C   . PRO B 1 232 ? 94.759  59.867 72.321  1.00 29.34  ? 232  PRO B C   1 
ATOM   5981  O  O   . PRO B 1 232 ? 94.398  61.038 72.457  1.00 30.36  ? 232  PRO B O   1 
ATOM   5982  C  CB  . PRO B 1 232 ? 94.534  58.996 69.932  1.00 27.90  ? 232  PRO B CB  1 
ATOM   5983  C  CG  . PRO B 1 232 ? 94.405  57.521 70.147  1.00 28.14  ? 232  PRO B CG  1 
ATOM   5984  C  CD  . PRO B 1 232 ? 95.837  57.108 70.406  1.00 26.30  ? 232  PRO B CD  1 
ATOM   5985  N  N   . TRP B 1 233 ? 94.552  58.943 73.252  1.00 28.05  ? 233  TRP B N   1 
ATOM   5986  C  CA  . TRP B 1 233 ? 93.848  59.253 74.489  1.00 26.83  ? 233  TRP B CA  1 
ATOM   5987  C  C   . TRP B 1 233 ? 94.759  59.519 75.685  1.00 28.25  ? 233  TRP B C   1 
ATOM   5988  O  O   . TRP B 1 233 ? 94.308  60.035 76.704  1.00 29.75  ? 233  TRP B O   1 
ATOM   5989  C  CB  . TRP B 1 233 ? 92.929  58.094 74.849  1.00 25.85  ? 233  TRP B CB  1 
ATOM   5990  C  CG  . TRP B 1 233 ? 93.649  56.796 74.794  1.00 24.59  ? 233  TRP B CG  1 
ATOM   5991  C  CD1 . TRP B 1 233 ? 93.740  55.956 73.723  1.00 24.97  ? 233  TRP B CD1 1 
ATOM   5992  C  CD2 . TRP B 1 233 ? 94.449  56.214 75.831  1.00 25.11  ? 233  TRP B CD2 1 
ATOM   5993  N  NE1 . TRP B 1 233 ? 94.548  54.885 74.027  1.00 26.15  ? 233  TRP B NE1 1 
ATOM   5994  C  CE2 . TRP B 1 233 ? 94.997  55.018 75.314  1.00 23.71  ? 233  TRP B CE2 1 
ATOM   5995  C  CE3 . TRP B 1 233 ? 94.758  56.591 77.148  1.00 25.08  ? 233  TRP B CE3 1 
ATOM   5996  C  CZ2 . TRP B 1 233 ? 95.838  54.191 76.063  1.00 24.91  ? 233  TRP B CZ2 1 
ATOM   5997  C  CZ3 . TRP B 1 233 ? 95.597  55.769 77.898  1.00 28.25  ? 233  TRP B CZ3 1 
ATOM   5998  C  CH2 . TRP B 1 233 ? 96.130  54.578 77.349  1.00 28.94  ? 233  TRP B CH2 1 
ATOM   5999  N  N   . ALA B 1 234 ? 96.037  59.178 75.563  1.00 28.19  ? 234  ALA B N   1 
ATOM   6000  C  CA  . ALA B 1 234 ? 96.973  59.333 76.675  1.00 27.76  ? 234  ALA B CA  1 
ATOM   6001  C  C   . ALA B 1 234 ? 97.463  60.740 77.038  1.00 27.50  ? 234  ALA B C   1 
ATOM   6002  O  O   . ALA B 1 234 ? 98.146  60.904 78.044  1.00 25.88  ? 234  ALA B O   1 
ATOM   6003  C  CB  . ALA B 1 234 ? 98.174  58.410 76.454  1.00 27.74  ? 234  ALA B CB  1 
ATOM   6004  N  N   . SER B 1 235 ? 97.132  61.752 76.242  1.00 27.35  ? 235  SER B N   1 
ATOM   6005  C  CA  . SER B 1 235 ? 97.584  63.106 76.567  1.00 28.27  ? 235  SER B CA  1 
ATOM   6006  C  C   . SER B 1 235 ? 96.841  64.192 75.807  1.00 28.65  ? 235  SER B C   1 
ATOM   6007  O  O   . SER B 1 235 ? 96.158  63.919 74.830  1.00 29.91  ? 235  SER B O   1 
ATOM   6008  C  CB  . SER B 1 235 ? 99.084  63.252 76.289  1.00 28.29  ? 235  SER B CB  1 
ATOM   6009  O  OG  . SER B 1 235 ? 99.348  63.294 74.895  1.00 26.49  ? 235  SER B OG  1 
ATOM   6010  N  N   . VAL B 1 236 ? 96.976  65.426 76.275  1.00 28.03  ? 236  VAL B N   1 
ATOM   6011  C  CA  . VAL B 1 236 ? 96.345  66.566 75.630  1.00 28.95  ? 236  VAL B CA  1 
ATOM   6012  C  C   . VAL B 1 236 ? 97.287  67.768 75.691  1.00 29.27  ? 236  VAL B C   1 
ATOM   6013  O  O   . VAL B 1 236 ? 98.241  67.780 76.466  1.00 27.64  ? 236  VAL B O   1 
ATOM   6014  C  CB  . VAL B 1 236 ? 95.006  66.954 76.314  1.00 29.70  ? 236  VAL B CB  1 
ATOM   6015  C  CG1 . VAL B 1 236 ? 94.034  65.792 76.255  1.00 31.31  ? 236  VAL B CG1 1 
ATOM   6016  C  CG2 . VAL B 1 236 ? 95.257  67.374 77.750  1.00 28.52  ? 236  VAL B CG2 1 
ATOM   6017  N  N   . SER B 1 237 ? 97.017  68.773 74.864  1.00 32.06  ? 237  SER B N   1 
ATOM   6018  C  CA  . SER B 1 237 ? 97.835  69.984 74.837  1.00 33.99  ? 237  SER B CA  1 
ATOM   6019  C  C   . SER B 1 237 ? 97.496  70.825 76.062  1.00 33.75  ? 237  SER B C   1 
ATOM   6020  O  O   . SER B 1 237 ? 96.499  70.561 76.738  1.00 32.72  ? 237  SER B O   1 
ATOM   6021  C  CB  . SER B 1 237 ? 97.540  70.784 73.571  1.00 33.74  ? 237  SER B CB  1 
ATOM   6022  O  OG  . SER B 1 237 ? 96.177  71.168 73.532  1.00 37.18  ? 237  SER B OG  1 
ATOM   6023  N  N   . VAL B 1 238 ? 98.321  71.828 76.351  1.00 35.32  ? 238  VAL B N   1 
ATOM   6024  C  CA  . VAL B 1 238 ? 98.067  72.693 77.502  1.00 37.30  ? 238  VAL B CA  1 
ATOM   6025  C  C   . VAL B 1 238 ? 96.752  73.431 77.285  1.00 37.73  ? 238  VAL B C   1 
ATOM   6026  O  O   . VAL B 1 238 ? 95.970  73.609 78.217  1.00 40.23  ? 238  VAL B O   1 
ATOM   6027  C  CB  . VAL B 1 238 ? 99.217  73.735 77.729  1.00 39.16  ? 238  VAL B CB  1 
ATOM   6028  C  CG1 . VAL B 1 238 ? 100.519 73.018 78.071  1.00 38.31  ? 238  VAL B CG1 1 
ATOM   6029  C  CG2 . VAL B 1 238 ? 99.409  74.599 76.495  1.00 38.94  ? 238  VAL B CG2 1 
ATOM   6030  N  N   . ALA B 1 239 ? 96.501  73.831 76.043  1.00 38.09  ? 239  ALA B N   1 
ATOM   6031  C  CA  . ALA B 1 239 ? 95.277  74.549 75.689  1.00 38.49  ? 239  ALA B CA  1 
ATOM   6032  C  C   . ALA B 1 239 ? 94.023  73.727 75.980  1.00 38.23  ? 239  ALA B C   1 
ATOM   6033  O  O   . ALA B 1 239 ? 93.083  74.224 76.600  1.00 38.13  ? 239  ALA B O   1 
ATOM   6034  C  CB  . ALA B 1 239 ? 95.311  74.942 74.215  1.00 36.16  ? 239  ALA B CB  1 
ATOM   6035  N  N   . GLU B 1 240 ? 94.005  72.478 75.519  1.00 38.52  ? 240  GLU B N   1 
ATOM   6036  C  CA  . GLU B 1 240 ? 92.864  71.594 75.745  1.00 37.79  ? 240  GLU B CA  1 
ATOM   6037  C  C   . GLU B 1 240 ? 92.729  71.284 77.240  1.00 37.00  ? 240  GLU B C   1 
ATOM   6038  O  O   . GLU B 1 240 ? 91.623  71.104 77.749  1.00 37.40  ? 240  GLU B O   1 
ATOM   6039  C  CB  . GLU B 1 240 ? 93.040  70.294 74.945  1.00 38.39  ? 240  GLU B CB  1 
ATOM   6040  C  CG  . GLU B 1 240 ? 91.981  69.210 75.196  1.00 36.12  ? 240  GLU B CG  1 
ATOM   6041  C  CD  . GLU B 1 240 ? 90.566  69.653 74.854  1.00 38.90  ? 240  GLU B CD  1 
ATOM   6042  O  OE1 . GLU B 1 240 ? 90.404  70.732 74.239  1.00 38.87  ? 240  GLU B OE1 1 
ATOM   6043  O  OE2 . GLU B 1 240 ? 89.611  68.918 75.196  1.00 34.98  ? 240  GLU B OE2 1 
ATOM   6044  N  N   . GLY B 1 241 ? 93.860  71.222 77.937  1.00 36.40  ? 241  GLY B N   1 
ATOM   6045  C  CA  . GLY B 1 241 ? 93.836  70.948 79.362  1.00 36.37  ? 241  GLY B CA  1 
ATOM   6046  C  C   . GLY B 1 241 ? 93.194  72.096 80.123  1.00 36.37  ? 241  GLY B C   1 
ATOM   6047  O  O   . GLY B 1 241 ? 92.459  71.881 81.082  1.00 34.67  ? 241  GLY B O   1 
ATOM   6048  N  N   . ARG B 1 242 ? 93.482  73.322 79.695  1.00 36.84  ? 242  ARG B N   1 
ATOM   6049  C  CA  . ARG B 1 242 ? 92.912  74.503 80.329  1.00 36.50  ? 242  ARG B CA  1 
ATOM   6050  C  C   . ARG B 1 242 ? 91.420  74.566 80.014  1.00 36.41  ? 242  ARG B C   1 
ATOM   6051  O  O   . ARG B 1 242 ? 90.600  74.815 80.898  1.00 36.34  ? 242  ARG B O   1 
ATOM   6052  C  CB  . ARG B 1 242 ? 93.611  75.773 79.826  1.00 37.83  ? 242  ARG B CB  1 
ATOM   6053  C  CG  . ARG B 1 242 ? 92.904  77.075 80.219  1.00 38.93  ? 242  ARG B CG  1 
ATOM   6054  C  CD  . ARG B 1 242 ? 93.738  78.305 79.868  1.00 39.88  ? 242  ARG B CD  1 
ATOM   6055  N  NE  . ARG B 1 242 ? 94.950  78.405 80.684  1.00 39.73  ? 242  ARG B NE  1 
ATOM   6056  C  CZ  . ARG B 1 242 ? 94.960  78.704 81.980  1.00 38.95  ? 242  ARG B CZ  1 
ATOM   6057  N  NH1 . ARG B 1 242 ? 96.110  78.765 82.639  1.00 38.75  ? 242  ARG B NH1 1 
ATOM   6058  N  NH2 . ARG B 1 242 ? 93.824  78.952 82.619  1.00 40.06  ? 242  ARG B NH2 1 
ATOM   6059  N  N   . ARG B 1 243 ? 91.073  74.331 78.753  1.00 36.45  ? 243  ARG B N   1 
ATOM   6060  C  CA  . ARG B 1 243 ? 89.676  74.352 78.337  1.00 36.89  ? 243  ARG B CA  1 
ATOM   6061  C  C   . ARG B 1 243 ? 88.868  73.427 79.247  1.00 36.23  ? 243  ARG B C   1 
ATOM   6062  O  O   . ARG B 1 243 ? 87.843  73.829 79.801  1.00 35.22  ? 243  ARG B O   1 
ATOM   6063  C  CB  . ARG B 1 243 ? 89.540  73.878 76.885  1.00 40.51  ? 243  ARG B CB  1 
ATOM   6064  C  CG  . ARG B 1 243 ? 88.584  74.714 76.043  1.00 43.76  ? 243  ARG B CG  1 
ATOM   6065  C  CD  . ARG B 1 243 ? 87.778  73.864 75.071  1.00 47.84  ? 243  ARG B CD  1 
ATOM   6066  N  NE  . ARG B 1 243 ? 86.841  72.995 75.783  1.00 51.39  ? 243  ARG B NE  1 
ATOM   6067  C  CZ  . ARG B 1 243 ? 87.001  71.685 75.940  1.00 49.95  ? 243  ARG B CZ  1 
ATOM   6068  N  NH1 . ARG B 1 243 ? 88.061  71.081 75.427  1.00 51.48  ? 243  ARG B NH1 1 
ATOM   6069  N  NH2 . ARG B 1 243 ? 86.109  70.985 76.626  1.00 49.59  ? 243  ARG B NH2 1 
ATOM   6070  N  N   . ARG B 1 244 ? 89.339  72.191 79.405  1.00 34.58  ? 244  ARG B N   1 
ATOM   6071  C  CA  . ARG B 1 244 ? 88.657  71.215 80.253  1.00 35.28  ? 244  ARG B CA  1 
ATOM   6072  C  C   . ARG B 1 244 ? 88.668  71.634 81.723  1.00 36.01  ? 244  ARG B C   1 
ATOM   6073  O  O   . ARG B 1 244 ? 87.699  71.411 82.454  1.00 36.12  ? 244  ARG B O   1 
ATOM   6074  C  CB  . ARG B 1 244 ? 89.303  69.833 80.104  1.00 33.72  ? 244  ARG B CB  1 
ATOM   6075  C  CG  . ARG B 1 244 ? 89.208  69.255 78.700  1.00 32.97  ? 244  ARG B CG  1 
ATOM   6076  C  CD  . ARG B 1 244 ? 89.777  67.840 78.617  1.00 31.99  ? 244  ARG B CD  1 
ATOM   6077  N  NE  . ARG B 1 244 ? 89.841  67.381 77.230  1.00 31.09  ? 244  ARG B NE  1 
ATOM   6078  C  CZ  . ARG B 1 244 ? 90.170  66.149 76.852  1.00 29.29  ? 244  ARG B CZ  1 
ATOM   6079  N  NH1 . ARG B 1 244 ? 90.470  65.223 77.756  1.00 24.96  ? 244  ARG B NH1 1 
ATOM   6080  N  NH2 . ARG B 1 244 ? 90.204  65.849 75.563  1.00 26.57  ? 244  ARG B NH2 1 
ATOM   6081  N  N   . ALA B 1 245 ? 89.764  72.244 82.157  1.00 36.53  ? 245  ALA B N   1 
ATOM   6082  C  CA  . ALA B 1 245 ? 89.871  72.692 83.538  1.00 38.14  ? 245  ALA B CA  1 
ATOM   6083  C  C   . ALA B 1 245 ? 88.856  73.811 83.789  1.00 39.29  ? 245  ALA B C   1 
ATOM   6084  O  O   . ALA B 1 245 ? 88.198  73.846 84.831  1.00 38.90  ? 245  ALA B O   1 
ATOM   6085  C  CB  . ALA B 1 245 ? 91.282  73.176 83.821  1.00 35.95  ? 245  ALA B CB  1 
ATOM   6086  N  N   . VAL B 1 246 ? 88.728  74.715 82.823  1.00 39.63  ? 246  VAL B N   1 
ATOM   6087  C  CA  . VAL B 1 246 ? 87.792  75.822 82.945  1.00 40.62  ? 246  VAL B CA  1 
ATOM   6088  C  C   . VAL B 1 246 ? 86.359  75.327 82.762  1.00 42.13  ? 246  VAL B C   1 
ATOM   6089  O  O   . VAL B 1 246 ? 85.421  75.905 83.310  1.00 42.65  ? 246  VAL B O   1 
ATOM   6090  C  CB  . VAL B 1 246 ? 88.090  76.927 81.900  1.00 39.39  ? 246  VAL B CB  1 
ATOM   6091  C  CG1 . VAL B 1 246 ? 87.002  77.983 81.932  1.00 39.33  ? 246  VAL B CG1 1 
ATOM   6092  C  CG2 . VAL B 1 246 ? 89.437  77.561 82.187  1.00 36.76  ? 246  VAL B CG2 1 
ATOM   6093  N  N   . GLU B 1 247 ? 86.192  74.256 81.992  1.00 42.99  ? 247  GLU B N   1 
ATOM   6094  C  CA  . GLU B 1 247 ? 84.866  73.700 81.754  1.00 42.64  ? 247  GLU B CA  1 
ATOM   6095  C  C   . GLU B 1 247 ? 84.359  72.992 83.006  1.00 42.09  ? 247  GLU B C   1 
ATOM   6096  O  O   . GLU B 1 247 ? 83.150  72.917 83.246  1.00 40.41  ? 247  GLU B O   1 
ATOM   6097  C  CB  . GLU B 1 247 ? 84.903  72.717 80.583  1.00 45.68  ? 247  GLU B CB  1 
ATOM   6098  C  CG  . GLU B 1 247 ? 83.529  72.251 80.142  1.00 50.32  ? 247  GLU B CG  1 
ATOM   6099  C  CD  . GLU B 1 247 ? 82.653  73.400 79.655  1.00 53.91  ? 247  GLU B CD  1 
ATOM   6100  O  OE1 . GLU B 1 247 ? 81.437  73.179 79.463  1.00 55.74  ? 247  GLU B OE1 1 
ATOM   6101  O  OE2 . GLU B 1 247 ? 83.177  74.520 79.458  1.00 53.17  ? 247  GLU B OE2 1 
ATOM   6102  N  N   . LEU B 1 248 ? 85.287  72.468 83.800  1.00 41.12  ? 248  LEU B N   1 
ATOM   6103  C  CA  . LEU B 1 248 ? 84.922  71.780 85.034  1.00 41.95  ? 248  LEU B CA  1 
ATOM   6104  C  C   . LEU B 1 248 ? 84.400  72.808 86.030  1.00 43.27  ? 248  LEU B C   1 
ATOM   6105  O  O   . LEU B 1 248 ? 83.409  72.569 86.725  1.00 42.99  ? 248  LEU B O   1 
ATOM   6106  C  CB  . LEU B 1 248 ? 86.131  71.062 85.634  1.00 41.06  ? 248  LEU B CB  1 
ATOM   6107  C  CG  . LEU B 1 248 ? 85.866  70.325 86.949  1.00 41.33  ? 248  LEU B CG  1 
ATOM   6108  C  CD1 . LEU B 1 248 ? 84.826  69.244 86.713  1.00 42.51  ? 248  LEU B CD1 1 
ATOM   6109  C  CD2 . LEU B 1 248 ? 87.158  69.712 87.483  1.00 39.87  ? 248  LEU B CD2 1 
ATOM   6110  N  N   . GLY B 1 249 ? 85.072  73.954 86.096  1.00 42.69  ? 249  GLY B N   1 
ATOM   6111  C  CA  . GLY B 1 249 ? 84.638  74.993 87.007  1.00 43.96  ? 249  GLY B CA  1 
ATOM   6112  C  C   . GLY B 1 249 ? 83.249  75.481 86.643  1.00 44.77  ? 249  GLY B C   1 
ATOM   6113  O  O   . GLY B 1 249 ? 82.401  75.689 87.512  1.00 45.04  ? 249  GLY B O   1 
ATOM   6114  N  N   . ARG B 1 250 ? 83.011  75.647 85.347  1.00 45.68  ? 250  ARG B N   1 
ATOM   6115  C  CA  . ARG B 1 250 ? 81.729  76.132 84.858  1.00 47.40  ? 250  ARG B CA  1 
ATOM   6116  C  C   . ARG B 1 250 ? 80.585  75.189 85.224  1.00 47.57  ? 250  ARG B C   1 
ATOM   6117  O  O   . ARG B 1 250 ? 79.462  75.634 85.467  1.00 45.90  ? 250  ARG B O   1 
ATOM   6118  C  CB  . ARG B 1 250 ? 81.788  76.327 83.339  1.00 49.06  ? 250  ARG B CB  1 
ATOM   6119  C  CG  . ARG B 1 250 ? 80.660  77.189 82.791  1.00 54.29  ? 250  ARG B CG  1 
ATOM   6120  C  CD  . ARG B 1 250 ? 80.736  77.338 81.277  1.00 57.33  ? 250  ARG B CD  1 
ATOM   6121  N  NE  . ARG B 1 250 ? 80.473  76.084 80.575  1.00 61.55  ? 250  ARG B NE  1 
ATOM   6122  C  CZ  . ARG B 1 250 ? 79.322  75.418 80.635  1.00 63.21  ? 250  ARG B CZ  1 
ATOM   6123  N  NH1 . ARG B 1 250 ? 79.172  74.283 79.961  1.00 63.27  ? 250  ARG B NH1 1 
ATOM   6124  N  NH2 . ARG B 1 250 ? 78.320  75.885 81.370  1.00 64.52  ? 250  ARG B NH2 1 
ATOM   6125  N  N   . ASN B 1 251 ? 80.878  73.890 85.261  1.00 48.63  ? 251  ASN B N   1 
ATOM   6126  C  CA  . ASN B 1 251 ? 79.886  72.871 85.605  1.00 49.56  ? 251  ASN B CA  1 
ATOM   6127  C  C   . ASN B 1 251 ? 79.537  72.890 87.092  1.00 50.65  ? 251  ASN B C   1 
ATOM   6128  O  O   . ASN B 1 251 ? 78.547  72.296 87.511  1.00 52.40  ? 251  ASN B O   1 
ATOM   6129  C  CB  . ASN B 1 251 ? 80.409  71.480 85.237  1.00 50.16  ? 251  ASN B CB  1 
ATOM   6130  C  CG  . ASN B 1 251 ? 80.040  71.067 83.826  1.00 50.16  ? 251  ASN B CG  1 
ATOM   6131  O  OD1 . ASN B 1 251 ? 78.952  70.544 83.588  1.00 51.68  ? 251  ASN B OD1 1 
ATOM   6132  N  ND2 . ASN B 1 251 ? 80.941  71.308 82.882  1.00 50.61  ? 251  ASN B ND2 1 
ATOM   6133  N  N   . LEU B 1 252 ? 80.356  73.567 87.887  1.00 51.86  ? 252  LEU B N   1 
ATOM   6134  C  CA  . LEU B 1 252 ? 80.131  73.648 89.326  1.00 53.22  ? 252  LEU B CA  1 
ATOM   6135  C  C   . LEU B 1 252 ? 79.974  75.105 89.770  1.00 54.22  ? 252  LEU B C   1 
ATOM   6136  O  O   . LEU B 1 252 ? 80.292  75.459 90.905  1.00 54.33  ? 252  LEU B O   1 
ATOM   6137  C  CB  . LEU B 1 252 ? 81.309  73.010 90.061  1.00 51.70  ? 252  LEU B CB  1 
ATOM   6138  C  CG  . LEU B 1 252 ? 81.720  71.636 89.534  1.00 51.76  ? 252  LEU B CG  1 
ATOM   6139  C  CD1 . LEU B 1 252 ? 83.155  71.356 89.935  1.00 50.90  ? 252  LEU B CD1 1 
ATOM   6140  C  CD2 . LEU B 1 252 ? 80.765  70.565 90.051  1.00 51.16  ? 252  LEU B CD2 1 
ATOM   6141  N  N   . ASN B 1 253 ? 79.486  75.943 88.861  1.00 55.64  ? 253  ASN B N   1 
ATOM   6142  C  CA  . ASN B 1 253 ? 79.283  77.359 89.137  1.00 56.63  ? 253  ASN B CA  1 
ATOM   6143  C  C   . ASN B 1 253 ? 80.463  77.971 89.876  1.00 55.78  ? 253  ASN B C   1 
ATOM   6144  O  O   . ASN B 1 253 ? 80.291  78.608 90.911  1.00 55.53  ? 253  ASN B O   1 
ATOM   6145  C  CB  . ASN B 1 253 ? 78.012  77.559 89.959  1.00 58.00  ? 253  ASN B CB  1 
ATOM   6146  C  CG  . ASN B 1 253 ? 76.781  77.036 89.255  1.00 60.22  ? 253  ASN B CG  1 
ATOM   6147  O  OD1 . ASN B 1 253 ? 76.485  77.428 88.124  1.00 60.80  ? 253  ASN B OD1 1 
ATOM   6148  N  ND2 . ASN B 1 253 ? 76.052  76.144 89.921  1.00 60.59  ? 253  ASN B ND2 1 
ATOM   6149  N  N   . CYS B 1 254 ? 81.662  77.771 89.345  1.00 55.51  ? 254  CYS B N   1 
ATOM   6150  C  CA  . CYS B 1 254 ? 82.862  78.317 89.962  1.00 55.23  ? 254  CYS B CA  1 
ATOM   6151  C  C   . CYS B 1 254 ? 83.202  79.693 89.403  1.00 54.73  ? 254  CYS B C   1 
ATOM   6152  O  O   . CYS B 1 254 ? 82.772  80.057 88.308  1.00 54.37  ? 254  CYS B O   1 
ATOM   6153  C  CB  . CYS B 1 254 ? 84.053  77.381 89.737  1.00 56.66  ? 254  CYS B CB  1 
ATOM   6154  S  SG  . CYS B 1 254 ? 84.272  76.074 90.992  1.00 58.83  ? 254  CYS B SG  1 
ATOM   6155  N  N   . ASN B 1 255 ? 83.970  80.459 90.171  1.00 54.65  ? 255  ASN B N   1 
ATOM   6156  C  CA  . ASN B 1 255 ? 84.403  81.781 89.744  1.00 54.03  ? 255  ASN B CA  1 
ATOM   6157  C  C   . ASN B 1 255 ? 85.494  81.534 88.705  1.00 53.93  ? 255  ASN B C   1 
ATOM   6158  O  O   . ASN B 1 255 ? 86.551  80.994 89.029  1.00 53.20  ? 255  ASN B O   1 
ATOM   6159  C  CB  . ASN B 1 255 ? 84.974  82.550 90.934  1.00 54.96  ? 255  ASN B CB  1 
ATOM   6160  C  CG  . ASN B 1 255 ? 85.462  83.934 90.555  1.00 57.24  ? 255  ASN B CG  1 
ATOM   6161  O  OD1 . ASN B 1 255 ? 86.290  84.093 89.650  1.00 57.03  ? 255  ASN B OD1 1 
ATOM   6162  N  ND2 . ASN B 1 255 ? 84.953  84.947 91.249  1.00 56.88  ? 255  ASN B ND2 1 
ATOM   6163  N  N   . LEU B 1 256 ? 85.240  81.926 87.460  1.00 53.74  ? 256  LEU B N   1 
ATOM   6164  C  CA  . LEU B 1 256 ? 86.201  81.701 86.383  1.00 54.63  ? 256  LEU B CA  1 
ATOM   6165  C  C   . LEU B 1 256 ? 87.068  82.910 86.034  1.00 56.31  ? 256  LEU B C   1 
ATOM   6166  O  O   . LEU B 1 256 ? 87.729  82.926 84.995  1.00 57.05  ? 256  LEU B O   1 
ATOM   6167  C  CB  . LEU B 1 256 ? 85.459  81.243 85.123  1.00 52.42  ? 256  LEU B CB  1 
ATOM   6168  C  CG  . LEU B 1 256 ? 84.472  80.081 85.273  1.00 52.50  ? 256  LEU B CG  1 
ATOM   6169  C  CD1 . LEU B 1 256 ? 83.734  79.885 83.959  1.00 52.29  ? 256  LEU B CD1 1 
ATOM   6170  C  CD2 . LEU B 1 256 ? 85.198  78.808 85.680  1.00 49.80  ? 256  LEU B CD2 1 
ATOM   6171  N  N   . ASN B 1 257 ? 87.084  83.916 86.899  1.00 58.11  ? 257  ASN B N   1 
ATOM   6172  C  CA  . ASN B 1 257 ? 87.861  85.116 86.626  1.00 59.27  ? 257  ASN B CA  1 
ATOM   6173  C  C   . ASN B 1 257 ? 89.377  84.943 86.682  1.00 59.44  ? 257  ASN B C   1 
ATOM   6174  O  O   . ASN B 1 257 ? 90.111  85.778 86.151  1.00 61.15  ? 257  ASN B O   1 
ATOM   6175  C  CB  . ASN B 1 257 ? 87.424  86.237 87.572  1.00 60.95  ? 257  ASN B CB  1 
ATOM   6176  C  CG  . ASN B 1 257 ? 85.952  86.583 87.417  1.00 62.52  ? 257  ASN B CG  1 
ATOM   6177  O  OD1 . ASN B 1 257 ? 85.504  86.953 86.330  1.00 62.32  ? 257  ASN B OD1 1 
ATOM   6178  N  ND2 . ASN B 1 257 ? 85.192  86.460 88.504  1.00 63.64  ? 257  ASN B ND2 1 
ATOM   6179  N  N   . SER B 1 258 ? 89.852  83.872 87.312  1.00 58.67  ? 258  SER B N   1 
ATOM   6180  C  CA  . SER B 1 258 ? 91.294  83.639 87.408  1.00 58.13  ? 258  SER B CA  1 
ATOM   6181  C  C   . SER B 1 258 ? 91.623  82.222 87.864  1.00 57.84  ? 258  SER B C   1 
ATOM   6182  O  O   . SER B 1 258 ? 90.798  81.556 88.488  1.00 57.66  ? 258  SER B O   1 
ATOM   6183  C  CB  . SER B 1 258 ? 91.926  84.630 88.390  1.00 57.86  ? 258  SER B CB  1 
ATOM   6184  O  OG  . SER B 1 258 ? 91.551  84.332 89.726  1.00 57.30  ? 258  SER B OG  1 
ATOM   6185  N  N   . ASP B 1 259 ? 92.838  81.769 87.563  1.00 57.44  ? 259  ASP B N   1 
ATOM   6186  C  CA  . ASP B 1 259 ? 93.256  80.429 87.957  1.00 58.14  ? 259  ASP B CA  1 
ATOM   6187  C  C   . ASP B 1 259 ? 93.167  80.264 89.469  1.00 58.28  ? 259  ASP B C   1 
ATOM   6188  O  O   . ASP B 1 259 ? 92.672  79.250 89.966  1.00 58.20  ? 259  ASP B O   1 
ATOM   6189  C  CB  . ASP B 1 259 ? 94.694  80.144 87.506  1.00 58.87  ? 259  ASP B CB  1 
ATOM   6190  C  CG  . ASP B 1 259 ? 94.853  80.159 85.998  1.00 59.24  ? 259  ASP B CG  1 
ATOM   6191  O  OD1 . ASP B 1 259 ? 93.891  79.788 85.293  1.00 59.32  ? 259  ASP B OD1 1 
ATOM   6192  O  OD2 . ASP B 1 259 ? 95.949  80.526 85.519  1.00 60.08  ? 259  ASP B OD2 1 
ATOM   6193  N  N   . GLU B 1 260 ? 93.649  81.269 90.195  1.00 58.82  ? 260  GLU B N   1 
ATOM   6194  C  CA  . GLU B 1 260 ? 93.639  81.247 91.655  1.00 59.06  ? 260  GLU B CA  1 
ATOM   6195  C  C   . GLU B 1 260 ? 92.245  81.015 92.230  1.00 57.69  ? 260  GLU B C   1 
ATOM   6196  O  O   . GLU B 1 260 ? 92.048  80.131 93.063  1.00 57.40  ? 260  GLU B O   1 
ATOM   6197  C  CB  . GLU B 1 260 ? 94.200  82.560 92.215  1.00 61.24  ? 260  GLU B CB  1 
ATOM   6198  C  CG  . GLU B 1 260 ? 95.671  82.816 91.896  1.00 63.62  ? 260  GLU B CG  1 
ATOM   6199  C  CD  . GLU B 1 260 ? 95.909  83.287 90.465  1.00 65.85  ? 260  GLU B CD  1 
ATOM   6200  O  OE1 . GLU B 1 260 ? 97.091  83.439 90.083  1.00 66.30  ? 260  GLU B OE1 1 
ATOM   6201  O  OE2 . GLU B 1 260 ? 94.926  83.514 89.724  1.00 67.06  ? 260  GLU B OE2 1 
ATOM   6202  N  N   . GLU B 1 261 ? 91.285  81.818 91.782  1.00 56.63  ? 261  GLU B N   1 
ATOM   6203  C  CA  . GLU B 1 261 ? 89.908  81.719 92.257  1.00 55.59  ? 261  GLU B CA  1 
ATOM   6204  C  C   . GLU B 1 261 ? 89.256  80.419 91.813  1.00 53.23  ? 261  GLU B C   1 
ATOM   6205  O  O   . GLU B 1 261 ? 88.510  79.797 92.573  1.00 52.49  ? 261  GLU B O   1 
ATOM   6206  C  CB  . GLU B 1 261 ? 89.098  82.913 91.746  1.00 57.51  ? 261  GLU B CB  1 
ATOM   6207  C  CG  . GLU B 1 261 ? 89.693  84.255 92.137  1.00 61.02  ? 261  GLU B CG  1 
ATOM   6208  C  CD  . GLU B 1 261 ? 89.013  85.418 91.447  1.00 63.26  ? 261  GLU B CD  1 
ATOM   6209  O  OE1 . GLU B 1 261 ? 87.809  85.638 91.697  1.00 64.29  ? 261  GLU B OE1 1 
ATOM   6210  O  OE2 . GLU B 1 261 ? 89.685  86.110 90.650  1.00 64.34  ? 261  GLU B OE2 1 
ATOM   6211  N  N   . LEU B 1 262 ? 89.537  80.018 90.577  1.00 51.06  ? 262  LEU B N   1 
ATOM   6212  C  CA  . LEU B 1 262 ? 88.994  78.781 90.028  1.00 49.48  ? 262  LEU B CA  1 
ATOM   6213  C  C   . LEU B 1 262 ? 89.482  77.599 90.857  1.00 48.04  ? 262  LEU B C   1 
ATOM   6214  O  O   . LEU B 1 262 ? 88.691  76.775 91.319  1.00 46.08  ? 262  LEU B O   1 
ATOM   6215  C  CB  . LEU B 1 262 ? 89.440  78.605 88.570  1.00 49.04  ? 262  LEU B CB  1 
ATOM   6216  C  CG  . LEU B 1 262 ? 89.180  77.229 87.944  1.00 48.14  ? 262  LEU B CG  1 
ATOM   6217  C  CD1 . LEU B 1 262 ? 87.702  76.870 88.054  1.00 47.64  ? 262  LEU B CD1 1 
ATOM   6218  C  CD2 . LEU B 1 262 ? 89.625  77.242 86.497  1.00 47.36  ? 262  LEU B CD2 1 
ATOM   6219  N  N   . ILE B 1 263 ? 90.795  77.534 91.043  1.00 46.95  ? 263  ILE B N   1 
ATOM   6220  C  CA  . ILE B 1 263 ? 91.406  76.465 91.809  1.00 47.39  ? 263  ILE B CA  1 
ATOM   6221  C  C   . ILE B 1 263 ? 90.932  76.504 93.253  1.00 48.48  ? 263  ILE B C   1 
ATOM   6222  O  O   . ILE B 1 263 ? 90.701  75.456 93.862  1.00 49.75  ? 263  ILE B O   1 
ATOM   6223  C  CB  . ILE B 1 263 ? 92.948  76.566 91.763  1.00 46.97  ? 263  ILE B CB  1 
ATOM   6224  C  CG1 . ILE B 1 263 ? 93.431  76.367 90.322  1.00 46.76  ? 263  ILE B CG1 1 
ATOM   6225  C  CG2 . ILE B 1 263 ? 93.569  75.530 92.688  1.00 46.13  ? 263  ILE B CG2 1 
ATOM   6226  C  CD1 . ILE B 1 263 ? 94.905  76.635 90.122  1.00 47.95  ? 263  ILE B CD1 1 
ATOM   6227  N  N   . HIS B 1 264 ? 90.784  77.703 93.810  1.00 48.51  ? 264  HIS B N   1 
ATOM   6228  C  CA  . HIS B 1 264 ? 90.323  77.808 95.188  1.00 48.78  ? 264  HIS B CA  1 
ATOM   6229  C  C   . HIS B 1 264 ? 88.910  77.259 95.264  1.00 48.07  ? 264  HIS B C   1 
ATOM   6230  O  O   . HIS B 1 264 ? 88.537  76.587 96.225  1.00 47.77  ? 264  HIS B O   1 
ATOM   6231  C  CB  . HIS B 1 264 ? 90.334  79.259 95.678  1.00 49.91  ? 264  HIS B CB  1 
ATOM   6232  C  CG  . HIS B 1 264 ? 89.735  79.430 97.042  1.00 51.80  ? 264  HIS B CG  1 
ATOM   6233  N  ND1 . HIS B 1 264 ? 88.378  79.337 97.275  1.00 51.80  ? 264  HIS B ND1 1 
ATOM   6234  C  CD2 . HIS B 1 264 ? 90.312  79.605 98.254  1.00 52.02  ? 264  HIS B CD2 1 
ATOM   6235  C  CE1 . HIS B 1 264 ? 88.146  79.445 98.571  1.00 51.25  ? 264  HIS B CE1 1 
ATOM   6236  N  NE2 . HIS B 1 264 ? 89.302  79.607 99.188  1.00 52.35  ? 264  HIS B NE2 1 
ATOM   6237  N  N   . CYS B 1 265 ? 88.124  77.549 94.238  1.00 47.91  ? 265  CYS B N   1 
ATOM   6238  C  CA  . CYS B 1 265 ? 86.752  77.075 94.184  1.00 50.03  ? 265  CYS B CA  1 
ATOM   6239  C  C   . CYS B 1 265 ? 86.726  75.551 94.154  1.00 48.28  ? 265  CYS B C   1 
ATOM   6240  O  O   . CYS B 1 265 ? 86.003  74.915 94.922  1.00 48.11  ? 265  CYS B O   1 
ATOM   6241  C  CB  . CYS B 1 265 ? 86.068  77.623 92.932  1.00 54.31  ? 265  CYS B CB  1 
ATOM   6242  S  SG  . CYS B 1 265 ? 84.323  77.130 92.733  1.00 62.19  ? 265  CYS B SG  1 
ATOM   6243  N  N   . LEU B 1 266 ? 87.532  74.975 93.266  1.00 46.56  ? 266  LEU B N   1 
ATOM   6244  C  CA  . LEU B 1 266 ? 87.603  73.527 93.101  1.00 44.36  ? 266  LEU B CA  1 
ATOM   6245  C  C   . LEU B 1 266 ? 88.159  72.801 94.315  1.00 43.58  ? 266  LEU B C   1 
ATOM   6246  O  O   . LEU B 1 266 ? 87.930  71.601 94.486  1.00 43.31  ? 266  LEU B O   1 
ATOM   6247  C  CB  . LEU B 1 266 ? 88.431  73.186 91.862  1.00 42.63  ? 266  LEU B CB  1 
ATOM   6248  C  CG  . LEU B 1 266 ? 87.835  73.716 90.555  1.00 42.00  ? 266  LEU B CG  1 
ATOM   6249  C  CD1 . LEU B 1 266 ? 88.784  73.449 89.396  1.00 40.57  ? 266  LEU B CD1 1 
ATOM   6250  C  CD2 . LEU B 1 266 ? 86.481  73.056 90.315  1.00 41.11  ? 266  LEU B CD2 1 
ATOM   6251  N  N   . ARG B 1 267 ? 88.888  73.519 95.162  1.00 43.28  ? 267  ARG B N   1 
ATOM   6252  C  CA  . ARG B 1 267 ? 89.451  72.909 96.358  1.00 42.98  ? 267  ARG B CA  1 
ATOM   6253  C  C   . ARG B 1 267 ? 88.424  72.841 97.485  1.00 43.72  ? 267  ARG B C   1 
ATOM   6254  O  O   . ARG B 1 267 ? 88.541  72.017 98.392  1.00 42.83  ? 267  ARG B O   1 
ATOM   6255  C  CB  . ARG B 1 267 ? 90.688  73.683 96.814  1.00 42.12  ? 267  ARG B CB  1 
ATOM   6256  C  CG  . ARG B 1 267 ? 91.891  73.494 95.903  1.00 43.64  ? 267  ARG B CG  1 
ATOM   6257  C  CD  . ARG B 1 267 ? 93.108  74.248 96.408  1.00 43.75  ? 267  ARG B CD  1 
ATOM   6258  N  NE  . ARG B 1 267 ? 94.300  73.964 95.615  1.00 45.82  ? 267  ARG B NE  1 
ATOM   6259  C  CZ  . ARG B 1 267 ? 95.437  74.647 95.706  1.00 46.08  ? 267  ARG B CZ  1 
ATOM   6260  N  NH1 . ARG B 1 267 ? 95.536  75.657 96.557  1.00 47.55  ? 267  ARG B NH1 1 
ATOM   6261  N  NH2 . ARG B 1 267 ? 96.473  74.327 94.944  1.00 44.67  ? 267  ARG B NH2 1 
ATOM   6262  N  N   . GLU B 1 268 ? 87.410  73.697 97.421  1.00 45.73  ? 268  GLU B N   1 
ATOM   6263  C  CA  . GLU B 1 268 ? 86.372  73.710 98.449  1.00 49.17  ? 268  GLU B CA  1 
ATOM   6264  C  C   . GLU B 1 268 ? 85.359  72.598 98.210  1.00 48.72  ? 268  GLU B C   1 
ATOM   6265  O  O   . GLU B 1 268 ? 84.604  72.229 99.108  1.00 48.14  ? 268  GLU B O   1 
ATOM   6266  C  CB  . GLU B 1 268 ? 85.639  75.061 98.469  1.00 52.11  ? 268  GLU B CB  1 
ATOM   6267  C  CG  . GLU B 1 268 ? 86.487  76.253 98.917  1.00 58.55  ? 268  GLU B CG  1 
ATOM   6268  C  CD  . GLU B 1 268 ? 86.880  76.201 100.391 1.00 63.83  ? 268  GLU B CD  1 
ATOM   6269  O  OE1 . GLU B 1 268 ? 87.531  77.164 100.862 1.00 65.16  ? 268  GLU B OE1 1 
ATOM   6270  O  OE2 . GLU B 1 268 ? 86.543  75.207 101.079 1.00 66.34  ? 268  GLU B OE2 1 
ATOM   6271  N  N   . LYS B 1 269 ? 85.356  72.057 96.997  1.00 48.18  ? 269  LYS B N   1 
ATOM   6272  C  CA  . LYS B 1 269 ? 84.420  71.002 96.635  1.00 47.07  ? 269  LYS B CA  1 
ATOM   6273  C  C   . LYS B 1 269 ? 84.758  69.630 97.208  1.00 46.43  ? 269  LYS B C   1 
ATOM   6274  O  O   . LYS B 1 269 ? 85.918  69.319 97.479  1.00 45.56  ? 269  LYS B O   1 
ATOM   6275  C  CB  . LYS B 1 269 ? 84.328  70.902 95.114  1.00 47.58  ? 269  LYS B CB  1 
ATOM   6276  C  CG  . LYS B 1 269 ? 83.974  72.209 94.428  1.00 49.66  ? 269  LYS B CG  1 
ATOM   6277  C  CD  . LYS B 1 269 ? 82.579  72.675 94.810  1.00 50.15  ? 269  LYS B CD  1 
ATOM   6278  C  CE  . LYS B 1 269 ? 82.246  73.995 94.142  1.00 50.84  ? 269  LYS B CE  1 
ATOM   6279  N  NZ  . LYS B 1 269 ? 80.829  74.379 94.378  1.00 54.43  ? 269  LYS B NZ  1 
ATOM   6280  N  N   . LYS B 1 270 ? 83.725  68.814 97.398  1.00 46.66  ? 270  LYS B N   1 
ATOM   6281  C  CA  . LYS B 1 270 ? 83.904  67.462 97.901  1.00 47.90  ? 270  LYS B CA  1 
ATOM   6282  C  C   . LYS B 1 270 ? 84.338  66.579 96.736  1.00 47.76  ? 270  LYS B C   1 
ATOM   6283  O  O   . LYS B 1 270 ? 83.917  66.791 95.597  1.00 46.74  ? 270  LYS B O   1 
ATOM   6284  C  CB  . LYS B 1 270 ? 82.601  66.924 98.491  1.00 50.16  ? 270  LYS B CB  1 
ATOM   6285  C  CG  . LYS B 1 270 ? 82.237  67.505 99.841  1.00 53.16  ? 270  LYS B CG  1 
ATOM   6286  C  CD  . LYS B 1 270 ? 81.076  66.742 100.446 1.00 55.98  ? 270  LYS B CD  1 
ATOM   6287  C  CE  . LYS B 1 270 ? 80.898  67.069 101.921 1.00 59.16  ? 270  LYS B CE  1 
ATOM   6288  N  NZ  . LYS B 1 270 ? 79.914  66.144 102.569 1.00 61.52  ? 270  LYS B NZ  1 
ATOM   6289  N  N   . PRO B 1 271 ? 85.183  65.570 97.010  1.00 47.33  ? 271  PRO B N   1 
ATOM   6290  C  CA  . PRO B 1 271 ? 85.692  64.643 95.994  1.00 46.82  ? 271  PRO B CA  1 
ATOM   6291  C  C   . PRO B 1 271 ? 84.632  64.170 94.999  1.00 46.06  ? 271  PRO B C   1 
ATOM   6292  O  O   . PRO B 1 271 ? 84.809  64.282 93.787  1.00 45.26  ? 271  PRO B O   1 
ATOM   6293  C  CB  . PRO B 1 271 ? 86.244  63.492 96.832  1.00 47.78  ? 271  PRO B CB  1 
ATOM   6294  C  CG  . PRO B 1 271 ? 86.720  64.185 98.062  1.00 47.51  ? 271  PRO B CG  1 
ATOM   6295  C  CD  . PRO B 1 271 ? 85.588  65.135 98.358  1.00 46.55  ? 271  PRO B CD  1 
ATOM   6296  N  N   . GLN B 1 272 ? 83.526  63.654 95.525  1.00 45.14  ? 272  GLN B N   1 
ATOM   6297  C  CA  . GLN B 1 272 ? 82.449  63.141 94.693  1.00 44.63  ? 272  GLN B CA  1 
ATOM   6298  C  C   . GLN B 1 272 ? 81.759  64.189 93.823  1.00 43.55  ? 272  GLN B C   1 
ATOM   6299  O  O   . GLN B 1 272 ? 81.050  63.839 92.877  1.00 42.78  ? 272  GLN B O   1 
ATOM   6300  C  CB  . GLN B 1 272 ? 81.415  62.425 95.568  1.00 46.01  ? 272  GLN B CB  1 
ATOM   6301  C  CG  . GLN B 1 272 ? 80.514  61.457 94.803  1.00 47.78  ? 272  GLN B CG  1 
ATOM   6302  C  CD  . GLN B 1 272 ? 81.313  60.413 94.034  1.00 48.71  ? 272  GLN B CD  1 
ATOM   6303  O  OE1 . GLN B 1 272 ? 82.200  59.761 94.591  1.00 48.34  ? 272  GLN B OE1 1 
ATOM   6304  N  NE2 . GLN B 1 272 ? 81.001  60.250 92.750  1.00 46.12  ? 272  GLN B NE2 1 
ATOM   6305  N  N   . GLU B 1 273 ? 81.958  65.468 94.127  1.00 43.91  ? 273  GLU B N   1 
ATOM   6306  C  CA  . GLU B 1 273 ? 81.333  66.521 93.325  1.00 44.07  ? 273  GLU B CA  1 
ATOM   6307  C  C   . GLU B 1 273 ? 82.079  66.712 92.014  1.00 42.97  ? 273  GLU B C   1 
ATOM   6308  O  O   . GLU B 1 273 ? 81.463  66.966 90.977  1.00 43.15  ? 273  GLU B O   1 
ATOM   6309  C  CB  . GLU B 1 273 ? 81.290  67.845 94.089  1.00 47.25  ? 273  GLU B CB  1 
ATOM   6310  C  CG  . GLU B 1 273 ? 80.371  67.834 95.302  1.00 53.01  ? 273  GLU B CG  1 
ATOM   6311  C  CD  . GLU B 1 273 ? 80.192  69.216 95.907  1.00 56.50  ? 273  GLU B CD  1 
ATOM   6312  O  OE1 . GLU B 1 273 ? 79.530  70.067 95.267  1.00 56.98  ? 273  GLU B OE1 1 
ATOM   6313  O  OE2 . GLU B 1 273 ? 80.719  69.451 97.020  1.00 59.19  ? 273  GLU B OE2 1 
ATOM   6314  N  N   . LEU B 1 274 ? 83.406  66.609 92.065  1.00 41.30  ? 274  LEU B N   1 
ATOM   6315  C  CA  . LEU B 1 274 ? 84.228  66.746 90.867  1.00 39.56  ? 274  LEU B CA  1 
ATOM   6316  C  C   . LEU B 1 274 ? 83.984  65.539 89.975  1.00 37.52  ? 274  LEU B C   1 
ATOM   6317  O  O   . LEU B 1 274 ? 83.766  65.668 88.768  1.00 35.98  ? 274  LEU B O   1 
ATOM   6318  C  CB  . LEU B 1 274 ? 85.713  66.803 91.234  1.00 40.28  ? 274  LEU B CB  1 
ATOM   6319  C  CG  . LEU B 1 274 ? 86.332  68.146 91.641  1.00 41.22  ? 274  LEU B CG  1 
ATOM   6320  C  CD1 . LEU B 1 274 ? 85.529  68.802 92.745  1.00 41.01  ? 274  LEU B CD1 1 
ATOM   6321  C  CD2 . LEU B 1 274 ? 87.754  67.900 92.101  1.00 41.05  ? 274  LEU B CD2 1 
ATOM   6322  N  N   . ILE B 1 275 ? 84.011  64.365 90.596  1.00 36.47  ? 275  ILE B N   1 
ATOM   6323  C  CA  . ILE B 1 275 ? 83.806  63.100 89.902  1.00 35.80  ? 275  ILE B CA  1 
ATOM   6324  C  C   . ILE B 1 275 ? 82.497  63.049 89.122  1.00 36.90  ? 275  ILE B C   1 
ATOM   6325  O  O   . ILE B 1 275 ? 82.483  62.643 87.964  1.00 37.65  ? 275  ILE B O   1 
ATOM   6326  C  CB  . ILE B 1 275 ? 83.841  61.928 90.901  1.00 35.17  ? 275  ILE B CB  1 
ATOM   6327  C  CG1 . ILE B 1 275 ? 85.171  61.953 91.659  1.00 32.72  ? 275  ILE B CG1 1 
ATOM   6328  C  CG2 . ILE B 1 275 ? 83.629  60.601 90.173  1.00 33.60  ? 275  ILE B CG2 1 
ATOM   6329  C  CD1 . ILE B 1 275 ? 85.315  60.860 92.700  1.00 34.87  ? 275  ILE B CD1 1 
ATOM   6330  N  N   . ASP B 1 276 ? 81.402  63.468 89.749  1.00 38.02  ? 276  ASP B N   1 
ATOM   6331  C  CA  . ASP B 1 276 ? 80.092  63.451 89.094  1.00 39.60  ? 276  ASP B CA  1 
ATOM   6332  C  C   . ASP B 1 276 ? 79.993  64.215 87.772  1.00 38.67  ? 276  ASP B C   1 
ATOM   6333  O  O   . ASP B 1 276 ? 79.180  63.865 86.921  1.00 38.01  ? 276  ASP B O   1 
ATOM   6334  C  CB  . ASP B 1 276 ? 79.002  63.964 90.046  1.00 41.43  ? 276  ASP B CB  1 
ATOM   6335  C  CG  . ASP B 1 276 ? 78.522  62.896 91.017  1.00 46.32  ? 276  ASP B CG  1 
ATOM   6336  O  OD1 . ASP B 1 276 ? 78.456  61.713 90.612  1.00 48.20  ? 276  ASP B OD1 1 
ATOM   6337  O  OD2 . ASP B 1 276 ? 78.190  63.234 92.175  1.00 47.10  ? 276  ASP B OD2 1 
ATOM   6338  N  N   . VAL B 1 277 ? 80.803  65.250 87.585  1.00 37.62  ? 277  VAL B N   1 
ATOM   6339  C  CA  . VAL B 1 277 ? 80.732  66.015 86.340  1.00 38.44  ? 277  VAL B CA  1 
ATOM   6340  C  C   . VAL B 1 277 ? 81.938  65.791 85.429  1.00 39.15  ? 277  VAL B C   1 
ATOM   6341  O  O   . VAL B 1 277 ? 82.022  66.368 84.343  1.00 39.85  ? 277  VAL B O   1 
ATOM   6342  C  CB  . VAL B 1 277 ? 80.610  67.537 86.615  1.00 37.08  ? 277  VAL B CB  1 
ATOM   6343  C  CG1 . VAL B 1 277 ? 79.257  67.851 87.253  1.00 35.61  ? 277  VAL B CG1 1 
ATOM   6344  C  CG2 . VAL B 1 277 ? 81.743  67.991 87.523  1.00 34.70  ? 277  VAL B CG2 1 
ATOM   6345  N  N   . GLU B 1 278 ? 82.856  64.942 85.880  1.00 39.41  ? 278  GLU B N   1 
ATOM   6346  C  CA  . GLU B 1 278 ? 84.084  64.636 85.151  1.00 40.03  ? 278  GLU B CA  1 
ATOM   6347  C  C   . GLU B 1 278 ? 83.937  64.440 83.643  1.00 38.51  ? 278  GLU B C   1 
ATOM   6348  O  O   . GLU B 1 278 ? 84.674  65.037 82.858  1.00 38.47  ? 278  GLU B O   1 
ATOM   6349  C  CB  . GLU B 1 278 ? 84.744  63.391 85.755  1.00 41.36  ? 278  GLU B CB  1 
ATOM   6350  C  CG  . GLU B 1 278 ? 86.121  63.111 85.196  1.00 45.33  ? 278  GLU B CG  1 
ATOM   6351  C  CD  . GLU B 1 278 ? 86.694  61.783 85.661  1.00 47.12  ? 278  GLU B CD  1 
ATOM   6352  O  OE1 . GLU B 1 278 ? 86.794  61.568 86.888  1.00 45.19  ? 278  GLU B OE1 1 
ATOM   6353  O  OE2 . GLU B 1 278 ? 87.051  60.956 84.789  1.00 49.50  ? 278  GLU B OE2 1 
ATOM   6354  N  N   . TRP B 1 279 ? 82.987  63.612 83.234  1.00 38.50  ? 279  TRP B N   1 
ATOM   6355  C  CA  . TRP B 1 279 ? 82.790  63.332 81.817  1.00 38.44  ? 279  TRP B CA  1 
ATOM   6356  C  C   . TRP B 1 279 ? 82.133  64.438 80.992  1.00 39.25  ? 279  TRP B C   1 
ATOM   6357  O  O   . TRP B 1 279 ? 82.122  64.370 79.758  1.00 40.09  ? 279  TRP B O   1 
ATOM   6358  C  CB  . TRP B 1 279 ? 81.991  62.042 81.665  1.00 38.52  ? 279  TRP B CB  1 
ATOM   6359  C  CG  . TRP B 1 279 ? 82.568  60.921 82.469  1.00 40.61  ? 279  TRP B CG  1 
ATOM   6360  C  CD1 . TRP B 1 279 ? 82.303  60.623 83.778  1.00 40.05  ? 279  TRP B CD1 1 
ATOM   6361  C  CD2 . TRP B 1 279 ? 83.553  59.979 82.036  1.00 39.81  ? 279  TRP B CD2 1 
ATOM   6362  N  NE1 . TRP B 1 279 ? 83.065  59.553 84.184  1.00 40.85  ? 279  TRP B NE1 1 
ATOM   6363  C  CE2 . TRP B 1 279 ? 83.841  59.139 83.133  1.00 41.33  ? 279  TRP B CE2 1 
ATOM   6364  C  CE3 . TRP B 1 279 ? 84.223  59.764 80.826  1.00 39.93  ? 279  TRP B CE3 1 
ATOM   6365  C  CZ2 . TRP B 1 279 ? 84.772  58.098 83.056  1.00 43.30  ? 279  TRP B CZ2 1 
ATOM   6366  C  CZ3 . TRP B 1 279 ? 85.150  58.728 80.749  1.00 41.32  ? 279  TRP B CZ3 1 
ATOM   6367  C  CH2 . TRP B 1 279 ? 85.414  57.909 81.859  1.00 41.73  ? 279  TRP B CH2 1 
ATOM   6368  N  N   . ASN B 1 280 ? 81.598  65.458 81.655  1.00 38.26  ? 280  ASN B N   1 
ATOM   6369  C  CA  . ASN B 1 280 ? 80.938  66.552 80.941  1.00 38.41  ? 280  ASN B CA  1 
ATOM   6370  C  C   . ASN B 1 280 ? 81.903  67.489 80.224  1.00 37.23  ? 280  ASN B C   1 
ATOM   6371  O  O   . ASN B 1 280 ? 81.489  68.251 79.357  1.00 36.91  ? 280  ASN B O   1 
ATOM   6372  C  CB  . ASN B 1 280 ? 80.061  67.389 81.893  1.00 38.37  ? 280  ASN B CB  1 
ATOM   6373  C  CG  . ASN B 1 280 ? 78.933  66.583 82.522  1.00 38.74  ? 280  ASN B CG  1 
ATOM   6374  O  OD1 . ASN B 1 280 ? 78.538  65.534 82.007  1.00 40.86  ? 280  ASN B OD1 1 
ATOM   6375  N  ND2 . ASN B 1 280 ? 78.400  67.080 83.636  1.00 39.43  ? 280  ASN B ND2 1 
ATOM   6376  N  N   . VAL B 1 281 ? 83.183  67.434 80.578  1.00 36.90  ? 281  VAL B N   1 
ATOM   6377  C  CA  . VAL B 1 281 ? 84.170  68.317 79.967  1.00 35.81  ? 281  VAL B CA  1 
ATOM   6378  C  C   . VAL B 1 281 ? 84.774  67.811 78.652  1.00 38.40  ? 281  VAL B C   1 
ATOM   6379  O  O   . VAL B 1 281 ? 85.577  68.509 78.032  1.00 37.88  ? 281  VAL B O   1 
ATOM   6380  C  CB  . VAL B 1 281 ? 85.320  68.624 80.958  1.00 36.01  ? 281  VAL B CB  1 
ATOM   6381  C  CG1 . VAL B 1 281 ? 84.744  69.098 82.288  1.00 33.40  ? 281  VAL B CG1 1 
ATOM   6382  C  CG2 . VAL B 1 281 ? 86.193  67.385 81.160  1.00 35.86  ? 281  VAL B CG2 1 
ATOM   6383  N  N   . LEU B 1 282 ? 84.397  66.609 78.222  1.00 37.99  ? 282  LEU B N   1 
ATOM   6384  C  CA  . LEU B 1 282 ? 84.930  66.066 76.975  1.00 39.02  ? 282  LEU B CA  1 
ATOM   6385  C  C   . LEU B 1 282 ? 84.492  66.867 75.749  1.00 41.13  ? 282  LEU B C   1 
ATOM   6386  O  O   . LEU B 1 282 ? 83.387  67.407 75.710  1.00 42.39  ? 282  LEU B O   1 
ATOM   6387  C  CB  . LEU B 1 282 ? 84.520  64.603 76.805  1.00 36.95  ? 282  LEU B CB  1 
ATOM   6388  C  CG  . LEU B 1 282 ? 85.286  63.577 77.650  1.00 36.61  ? 282  LEU B CG  1 
ATOM   6389  C  CD1 . LEU B 1 282 ? 84.788  62.181 77.335  1.00 35.23  ? 282  LEU B CD1 1 
ATOM   6390  C  CD2 . LEU B 1 282 ? 86.776  63.679 77.358  1.00 34.54  ? 282  LEU B CD2 1 
ATOM   6391  N  N   . PRO B 1 283 ? 85.371  66.961 74.733  1.00 42.97  ? 283  PRO B N   1 
ATOM   6392  C  CA  . PRO B 1 283 ? 85.135  67.683 73.477  1.00 44.29  ? 283  PRO B CA  1 
ATOM   6393  C  C   . PRO B 1 283 ? 83.921  67.208 72.675  1.00 45.31  ? 283  PRO B C   1 
ATOM   6394  O  O   . PRO B 1 283 ? 83.107  68.022 72.245  1.00 46.30  ? 283  PRO B O   1 
ATOM   6395  C  CB  . PRO B 1 283 ? 86.437  67.467 72.708  1.00 42.70  ? 283  PRO B CB  1 
ATOM   6396  C  CG  . PRO B 1 283 ? 87.443  67.402 73.780  1.00 42.79  ? 283  PRO B CG  1 
ATOM   6397  C  CD  . PRO B 1 283 ? 86.775  66.518 74.808  1.00 42.33  ? 283  PRO B CD  1 
ATOM   6398  N  N   . PHE B 1 284 ? 83.808  65.900 72.458  1.00 45.91  ? 284  PHE B N   1 
ATOM   6399  C  CA  . PHE B 1 284 ? 82.687  65.358 71.687  1.00 47.85  ? 284  PHE B CA  1 
ATOM   6400  C  C   . PHE B 1 284 ? 82.141  64.102 72.344  1.00 48.07  ? 284  PHE B C   1 
ATOM   6401  O  O   . PHE B 1 284 ? 82.665  63.636 73.357  1.00 48.00  ? 284  PHE B O   1 
ATOM   6402  C  CB  . PHE B 1 284 ? 83.133  64.954 70.275  1.00 49.65  ? 284  PHE B CB  1 
ATOM   6403  C  CG  . PHE B 1 284 ? 84.190  65.839 69.676  1.00 52.28  ? 284  PHE B CG  1 
ATOM   6404  C  CD1 . PHE B 1 284 ? 83.845  67.010 69.007  1.00 53.57  ? 284  PHE B CD1 1 
ATOM   6405  C  CD2 . PHE B 1 284 ? 85.535  65.489 69.766  1.00 53.63  ? 284  PHE B CD2 1 
ATOM   6406  C  CE1 . PHE B 1 284 ? 84.828  67.820 68.434  1.00 55.71  ? 284  PHE B CE1 1 
ATOM   6407  C  CE2 . PHE B 1 284 ? 86.526  66.291 69.198  1.00 55.31  ? 284  PHE B CE2 1 
ATOM   6408  C  CZ  . PHE B 1 284 ? 86.172  67.458 68.530  1.00 55.96  ? 284  PHE B CZ  1 
ATOM   6409  N  N   . ASP B 1 285 ? 81.073  63.563 71.762  1.00 48.24  ? 285  ASP B N   1 
ATOM   6410  C  CA  . ASP B 1 285 ? 80.521  62.304 72.242  1.00 47.59  ? 285  ASP B CA  1 
ATOM   6411  C  C   . ASP B 1 285 ? 81.623  61.373 71.758  1.00 45.17  ? 285  ASP B C   1 
ATOM   6412  O  O   . ASP B 1 285 ? 82.098  61.522 70.630  1.00 43.52  ? 285  ASP B O   1 
ATOM   6413  C  CB  . ASP B 1 285 ? 79.208  61.963 71.527  1.00 50.94  ? 285  ASP B CB  1 
ATOM   6414  C  CG  . ASP B 1 285 ? 78.039  62.799 72.013  1.00 53.94  ? 285  ASP B CG  1 
ATOM   6415  O  OD1 . ASP B 1 285 ? 76.953  62.710 71.401  1.00 55.89  ? 285  ASP B OD1 1 
ATOM   6416  O  OD2 . ASP B 1 285 ? 78.202  63.538 73.009  1.00 56.07  ? 285  ASP B OD2 1 
ATOM   6417  N  N   . SER B 1 286 ? 82.052  60.432 72.588  1.00 43.35  ? 286  SER B N   1 
ATOM   6418  C  CA  . SER B 1 286 ? 83.124  59.553 72.154  1.00 40.70  ? 286  SER B CA  1 
ATOM   6419  C  C   . SER B 1 286 ? 83.286  58.315 72.998  1.00 38.26  ? 286  SER B C   1 
ATOM   6420  O  O   . SER B 1 286 ? 82.582  58.114 73.986  1.00 38.59  ? 286  SER B O   1 
ATOM   6421  C  CB  . SER B 1 286 ? 84.445  60.311 72.179  1.00 41.66  ? 286  SER B CB  1 
ATOM   6422  O  OG  . SER B 1 286 ? 84.756  60.685 73.514  1.00 43.55  ? 286  SER B OG  1 
ATOM   6423  N  N   . ILE B 1 287 ? 84.225  57.480 72.574  1.00 35.57  ? 287  ILE B N   1 
ATOM   6424  C  CA  . ILE B 1 287 ? 84.570  56.268 73.286  1.00 33.15  ? 287  ILE B CA  1 
ATOM   6425  C  C   . ILE B 1 287 ? 86.090  56.212 73.287  1.00 31.09  ? 287  ILE B C   1 
ATOM   6426  O  O   . ILE B 1 287 ? 86.739  56.685 72.351  1.00 30.18  ? 287  ILE B O   1 
ATOM   6427  C  CB  . ILE B 1 287 ? 83.981  54.993 72.629  1.00 33.90  ? 287  ILE B CB  1 
ATOM   6428  C  CG1 . ILE B 1 287 ? 84.431  54.869 71.184  1.00 32.72  ? 287  ILE B CG1 1 
ATOM   6429  C  CG2 . ILE B 1 287 ? 82.460  55.013 72.743  1.00 33.77  ? 287  ILE B CG2 1 
ATOM   6430  C  CD1 . ILE B 1 287 ? 84.003  53.548 70.548  1.00 36.92  ? 287  ILE B CD1 1 
ATOM   6431  N  N   . PHE B 1 288 ? 86.644  55.658 74.359  1.00 28.75  ? 288  PHE B N   1 
ATOM   6432  C  CA  . PHE B 1 288 ? 88.082  55.550 74.550  1.00 27.83  ? 288  PHE B CA  1 
ATOM   6433  C  C   . PHE B 1 288 ? 88.716  56.939 74.661  1.00 27.83  ? 288  PHE B C   1 
ATOM   6434  O  O   . PHE B 1 288 ? 89.813  57.179 74.161  1.00 28.08  ? 288  PHE B O   1 
ATOM   6435  C  CB  . PHE B 1 288 ? 88.727  54.759 73.410  1.00 25.36  ? 288  PHE B CB  1 
ATOM   6436  C  CG  . PHE B 1 288 ? 89.793  53.799 73.872  1.00 23.65  ? 288  PHE B CG  1 
ATOM   6437  C  CD1 . PHE B 1 288 ? 90.816  54.229 74.718  1.00 22.73  ? 288  PHE B CD1 1 
ATOM   6438  C  CD2 . PHE B 1 288 ? 89.766  52.462 73.477  1.00 23.48  ? 288  PHE B CD2 1 
ATOM   6439  C  CE1 . PHE B 1 288 ? 91.795  53.341 75.168  1.00 22.95  ? 288  PHE B CE1 1 
ATOM   6440  C  CE2 . PHE B 1 288 ? 90.744  51.562 73.922  1.00 22.99  ? 288  PHE B CE2 1 
ATOM   6441  C  CZ  . PHE B 1 288 ? 91.758  52.006 74.771  1.00 23.06  ? 288  PHE B CZ  1 
ATOM   6442  N  N   . ARG B 1 289 ? 87.994  57.856 75.299  1.00 27.59  ? 289  ARG B N   1 
ATOM   6443  C  CA  . ARG B 1 289 ? 88.478  59.212 75.527  1.00 28.49  ? 289  ARG B CA  1 
ATOM   6444  C  C   . ARG B 1 289 ? 88.226  59.550 76.995  1.00 29.31  ? 289  ARG B C   1 
ATOM   6445  O  O   . ARG B 1 289 ? 87.141  59.323 77.526  1.00 28.42  ? 289  ARG B O   1 
ATOM   6446  C  CB  . ARG B 1 289 ? 87.776  60.209 74.604  1.00 27.65  ? 289  ARG B CB  1 
ATOM   6447  C  CG  . ARG B 1 289 ? 88.231  60.111 73.148  1.00 27.51  ? 289  ARG B CG  1 
ATOM   6448  C  CD  . ARG B 1 289 ? 89.711  60.468 72.991  1.00 28.77  ? 289  ARG B CD  1 
ATOM   6449  N  NE  . ARG B 1 289 ? 90.183  60.287 71.617  1.00 29.77  ? 289  ARG B NE  1 
ATOM   6450  C  CZ  . ARG B 1 289 ? 90.404  59.105 71.045  1.00 30.09  ? 289  ARG B CZ  1 
ATOM   6451  N  NH1 . ARG B 1 289 ? 90.204  57.982 71.722  1.00 31.61  ? 289  ARG B NH1 1 
ATOM   6452  N  NH2 . ARG B 1 289 ? 90.816  59.042 69.789  1.00 30.69  ? 289  ARG B NH2 1 
ATOM   6453  N  N   . PHE B 1 290 ? 89.242  60.094 77.648  1.00 30.05  ? 290  PHE B N   1 
ATOM   6454  C  CA  . PHE B 1 290 ? 89.146  60.410 79.062  1.00 28.58  ? 290  PHE B CA  1 
ATOM   6455  C  C   . PHE B 1 290 ? 89.400  61.894 79.333  1.00 29.17  ? 290  PHE B C   1 
ATOM   6456  O  O   . PHE B 1 290 ? 90.264  62.514 78.720  1.00 31.10  ? 290  PHE B O   1 
ATOM   6457  C  CB  . PHE B 1 290 ? 90.125  59.500 79.798  1.00 26.91  ? 290  PHE B CB  1 
ATOM   6458  C  CG  . PHE B 1 290 ? 90.104  58.075 79.286  1.00 26.99  ? 290  PHE B CG  1 
ATOM   6459  C  CD1 . PHE B 1 290 ? 88.948  57.309 79.378  1.00 26.44  ? 290  PHE B CD1 1 
ATOM   6460  C  CD2 . PHE B 1 290 ? 91.214  57.525 78.654  1.00 25.28  ? 290  PHE B CD2 1 
ATOM   6461  C  CE1 . PHE B 1 290 ? 88.893  56.018 78.847  1.00 27.64  ? 290  PHE B CE1 1 
ATOM   6462  C  CE2 . PHE B 1 290 ? 91.171  56.238 78.120  1.00 25.96  ? 290  PHE B CE2 1 
ATOM   6463  C  CZ  . PHE B 1 290 ? 90.008  55.481 78.215  1.00 26.72  ? 290  PHE B CZ  1 
ATOM   6464  N  N   . SER B 1 291 ? 88.631  62.455 80.256  1.00 30.09  ? 291  SER B N   1 
ATOM   6465  C  CA  . SER B 1 291 ? 88.713  63.872 80.586  1.00 30.56  ? 291  SER B CA  1 
ATOM   6466  C  C   . SER B 1 291 ? 90.049  64.442 81.050  1.00 30.49  ? 291  SER B C   1 
ATOM   6467  O  O   . SER B 1 291 ? 90.536  65.409 80.471  1.00 32.37  ? 291  SER B O   1 
ATOM   6468  C  CB  . SER B 1 291 ? 87.641  64.213 81.618  1.00 30.95  ? 291  SER B CB  1 
ATOM   6469  O  OG  . SER B 1 291 ? 86.350  64.053 81.062  1.00 31.26  ? 291  SER B OG  1 
ATOM   6470  N  N   . PHE B 1 292 ? 90.634  63.859 82.088  1.00 29.52  ? 292  PHE B N   1 
ATOM   6471  C  CA  . PHE B 1 292 ? 91.898  64.357 82.629  1.00 27.52  ? 292  PHE B CA  1 
ATOM   6472  C  C   . PHE B 1 292 ? 93.067  63.386 82.482  1.00 27.31  ? 292  PHE B C   1 
ATOM   6473  O  O   . PHE B 1 292 ? 93.139  62.358 83.154  1.00 25.57  ? 292  PHE B O   1 
ATOM   6474  C  CB  . PHE B 1 292 ? 91.684  64.744 84.094  1.00 27.19  ? 292  PHE B CB  1 
ATOM   6475  C  CG  . PHE B 1 292 ? 90.621  65.786 84.276  1.00 27.37  ? 292  PHE B CG  1 
ATOM   6476  C  CD1 . PHE B 1 292 ? 90.887  67.123 83.987  1.00 26.05  ? 292  PHE B CD1 1 
ATOM   6477  C  CD2 . PHE B 1 292 ? 89.327  65.421 84.637  1.00 27.55  ? 292  PHE B CD2 1 
ATOM   6478  C  CE1 . PHE B 1 292 ? 89.884  68.082 84.044  1.00 28.18  ? 292  PHE B CE1 1 
ATOM   6479  C  CE2 . PHE B 1 292 ? 88.311  66.372 84.699  1.00 30.07  ? 292  PHE B CE2 1 
ATOM   6480  C  CZ  . PHE B 1 292 ? 88.590  67.709 84.399  1.00 29.90  ? 292  PHE B CZ  1 
ATOM   6481  N  N   . VAL B 1 293 ? 93.987  63.740 81.594  1.00 27.02  ? 293  VAL B N   1 
ATOM   6482  C  CA  . VAL B 1 293 ? 95.157  62.919 81.306  1.00 27.24  ? 293  VAL B CA  1 
ATOM   6483  C  C   . VAL B 1 293 ? 96.428  63.777 81.264  1.00 28.10  ? 293  VAL B C   1 
ATOM   6484  O  O   . VAL B 1 293 ? 96.366  65.006 81.354  1.00 27.20  ? 293  VAL B O   1 
ATOM   6485  C  CB  . VAL B 1 293 ? 94.979  62.201 79.938  1.00 28.16  ? 293  VAL B CB  1 
ATOM   6486  C  CG1 . VAL B 1 293 ? 93.751  61.294 79.973  1.00 28.62  ? 293  VAL B CG1 1 
ATOM   6487  C  CG2 . VAL B 1 293 ? 94.824  63.222 78.832  1.00 26.36  ? 293  VAL B CG2 1 
ATOM   6488  N  N   . PRO B 1 294 ? 97.602  63.138 81.135  1.00 27.29  ? 294  PRO B N   1 
ATOM   6489  C  CA  . PRO B 1 294 ? 98.848  63.905 81.085  1.00 27.31  ? 294  PRO B CA  1 
ATOM   6490  C  C   . PRO B 1 294 ? 98.796  64.994 80.018  1.00 29.37  ? 294  PRO B C   1 
ATOM   6491  O  O   . PRO B 1 294 ? 98.116  64.844 79.000  1.00 31.57  ? 294  PRO B O   1 
ATOM   6492  C  CB  . PRO B 1 294 ? 99.888  62.834 80.761  1.00 27.21  ? 294  PRO B CB  1 
ATOM   6493  C  CG  . PRO B 1 294 ? 99.357  61.636 81.458  1.00 25.58  ? 294  PRO B CG  1 
ATOM   6494  C  CD  . PRO B 1 294 ? 97.880  61.689 81.117  1.00 28.13  ? 294  PRO B CD  1 
ATOM   6495  N  N   . VAL B 1 295 ? 99.506  66.090 80.252  1.00 30.00  ? 295  VAL B N   1 
ATOM   6496  C  CA  . VAL B 1 295 ? 99.553  67.183 79.286  1.00 30.92  ? 295  VAL B CA  1 
ATOM   6497  C  C   . VAL B 1 295 ? 100.988 67.416 78.831  1.00 29.76  ? 295  VAL B C   1 
ATOM   6498  O  O   . VAL B 1 295 ? 101.913 67.314 79.628  1.00 31.15  ? 295  VAL B O   1 
ATOM   6499  C  CB  . VAL B 1 295 ? 99.008  68.505 79.883  1.00 31.48  ? 295  VAL B CB  1 
ATOM   6500  C  CG1 . VAL B 1 295 ? 97.514  68.402 80.075  1.00 35.46  ? 295  VAL B CG1 1 
ATOM   6501  C  CG2 . VAL B 1 295 ? 99.687  68.800 81.215  1.00 32.48  ? 295  VAL B CG2 1 
ATOM   6502  N  N   . ILE B 1 296 ? 101.171 67.711 77.549  1.00 32.32  ? 296  ILE B N   1 
ATOM   6503  C  CA  . ILE B 1 296 ? 102.504 67.975 76.998  1.00 35.27  ? 296  ILE B CA  1 
ATOM   6504  C  C   . ILE B 1 296 ? 102.813 69.423 77.384  1.00 38.30  ? 296  ILE B C   1 
ATOM   6505  O  O   . ILE B 1 296 ? 102.473 70.367 76.666  1.00 37.43  ? 296  ILE B O   1 
ATOM   6506  C  CB  . ILE B 1 296 ? 102.503 67.797 75.463  1.00 34.29  ? 296  ILE B CB  1 
ATOM   6507  C  CG1 . ILE B 1 296 ? 102.046 66.374 75.114  1.00 35.19  ? 296  ILE B CG1 1 
ATOM   6508  C  CG2 . ILE B 1 296 ? 103.885 68.057 74.896  1.00 32.88  ? 296  ILE B CG2 1 
ATOM   6509  C  CD1 . ILE B 1 296 ? 102.909 65.266 75.727  1.00 32.60  ? 296  ILE B CD1 1 
ATOM   6510  N  N   . ASP B 1 297 ? 103.466 69.565 78.535  1.00 40.82  ? 297  ASP B N   1 
ATOM   6511  C  CA  . ASP B 1 297 ? 103.784 70.854 79.144  1.00 43.99  ? 297  ASP B CA  1 
ATOM   6512  C  C   . ASP B 1 297 ? 105.118 71.529 78.848  1.00 45.79  ? 297  ASP B C   1 
ATOM   6513  O  O   . ASP B 1 297 ? 105.236 72.739 79.022  1.00 48.33  ? 297  ASP B O   1 
ATOM   6514  C  CB  . ASP B 1 297 ? 103.652 70.719 80.664  1.00 43.68  ? 297  ASP B CB  1 
ATOM   6515  C  CG  . ASP B 1 297 ? 104.574 69.640 81.238  1.00 44.67  ? 297  ASP B CG  1 
ATOM   6516  O  OD1 . ASP B 1 297 ? 105.317 69.003 80.453  1.00 41.84  ? 297  ASP B OD1 1 
ATOM   6517  O  OD2 . ASP B 1 297 ? 104.555 69.426 82.472  1.00 43.92  ? 297  ASP B OD2 1 
ATOM   6518  N  N   . GLY B 1 298 ? 106.123 70.769 78.428  1.00 46.65  ? 298  GLY B N   1 
ATOM   6519  C  CA  . GLY B 1 298 ? 107.417 71.375 78.166  1.00 47.34  ? 298  GLY B CA  1 
ATOM   6520  C  C   . GLY B 1 298 ? 108.317 71.240 79.385  1.00 48.01  ? 298  GLY B C   1 
ATOM   6521  O  O   . GLY B 1 298 ? 109.479 71.655 79.370  1.00 49.12  ? 298  GLY B O   1 
ATOM   6522  N  N   . GLU B 1 299 ? 107.767 70.662 80.449  1.00 47.47  ? 299  GLU B N   1 
ATOM   6523  C  CA  . GLU B 1 299 ? 108.500 70.441 81.689  1.00 46.56  ? 299  GLU B CA  1 
ATOM   6524  C  C   . GLU B 1 299 ? 108.709 68.934 81.878  1.00 44.49  ? 299  GLU B C   1 
ATOM   6525  O  O   . GLU B 1 299 ? 109.800 68.419 81.633  1.00 44.32  ? 299  GLU B O   1 
ATOM   6526  C  CB  . GLU B 1 299 ? 107.722 71.020 82.871  1.00 48.78  ? 299  GLU B CB  1 
ATOM   6527  C  CG  . GLU B 1 299 ? 108.374 70.761 84.219  1.00 54.21  ? 299  GLU B CG  1 
ATOM   6528  C  CD  . GLU B 1 299 ? 107.637 71.434 85.366  1.00 58.00  ? 299  GLU B CD  1 
ATOM   6529  O  OE1 . GLU B 1 299 ? 106.399 71.270 85.461  1.00 59.80  ? 299  GLU B OE1 1 
ATOM   6530  O  OE2 . GLU B 1 299 ? 108.300 72.120 86.176  1.00 59.95  ? 299  GLU B OE2 1 
ATOM   6531  N  N   . PHE B 1 300 ? 107.670 68.230 82.317  1.00 41.62  ? 300  PHE B N   1 
ATOM   6532  C  CA  . PHE B 1 300 ? 107.775 66.787 82.489  1.00 39.32  ? 300  PHE B CA  1 
ATOM   6533  C  C   . PHE B 1 300 ? 108.145 66.229 81.121  1.00 39.02  ? 300  PHE B C   1 
ATOM   6534  O  O   . PHE B 1 300 ? 108.922 65.283 81.011  1.00 37.53  ? 300  PHE B O   1 
ATOM   6535  C  CB  . PHE B 1 300 ? 106.438 66.196 82.958  1.00 36.40  ? 300  PHE B CB  1 
ATOM   6536  C  CG  . PHE B 1 300 ? 106.501 64.724 83.267  1.00 31.79  ? 300  PHE B CG  1 
ATOM   6537  C  CD1 . PHE B 1 300 ? 106.458 63.780 82.245  1.00 28.30  ? 300  PHE B CD1 1 
ATOM   6538  C  CD2 . PHE B 1 300 ? 106.614 64.284 84.583  1.00 30.18  ? 300  PHE B CD2 1 
ATOM   6539  C  CE1 . PHE B 1 300 ? 106.526 62.424 82.526  1.00 26.95  ? 300  PHE B CE1 1 
ATOM   6540  C  CE2 . PHE B 1 300 ? 106.684 62.932 84.877  1.00 27.96  ? 300  PHE B CE2 1 
ATOM   6541  C  CZ  . PHE B 1 300 ? 106.640 61.996 83.843  1.00 28.98  ? 300  PHE B CZ  1 
ATOM   6542  N  N   . PHE B 1 301 ? 107.582 66.850 80.086  1.00 40.02  ? 301  PHE B N   1 
ATOM   6543  C  CA  . PHE B 1 301 ? 107.826 66.484 78.692  1.00 41.33  ? 301  PHE B CA  1 
ATOM   6544  C  C   . PHE B 1 301 ? 108.502 67.651 77.970  1.00 42.08  ? 301  PHE B C   1 
ATOM   6545  O  O   . PHE B 1 301 ? 107.857 68.650 77.669  1.00 41.78  ? 301  PHE B O   1 
ATOM   6546  C  CB  . PHE B 1 301 ? 106.505 66.179 77.973  1.00 39.35  ? 301  PHE B CB  1 
ATOM   6547  C  CG  . PHE B 1 301 ? 105.820 64.943 78.458  1.00 37.68  ? 301  PHE B CG  1 
ATOM   6548  C  CD1 . PHE B 1 301 ? 106.354 63.686 78.187  1.00 38.52  ? 301  PHE B CD1 1 
ATOM   6549  C  CD2 . PHE B 1 301 ? 104.635 65.031 79.176  1.00 36.70  ? 301  PHE B CD2 1 
ATOM   6550  C  CE1 . PHE B 1 301 ? 105.713 62.526 78.625  1.00 36.87  ? 301  PHE B CE1 1 
ATOM   6551  C  CE2 . PHE B 1 301 ? 103.983 63.880 79.620  1.00 37.05  ? 301  PHE B CE2 1 
ATOM   6552  C  CZ  . PHE B 1 301 ? 104.523 62.623 79.343  1.00 38.03  ? 301  PHE B CZ  1 
ATOM   6553  N  N   . PRO B 1 302 ? 109.806 67.530 77.672  1.00 43.31  ? 302  PRO B N   1 
ATOM   6554  C  CA  . PRO B 1 302 ? 110.594 68.558 76.982  1.00 43.92  ? 302  PRO B CA  1 
ATOM   6555  C  C   . PRO B 1 302 ? 109.927 69.190 75.758  1.00 44.20  ? 302  PRO B C   1 
ATOM   6556  O  O   . PRO B 1 302 ? 109.793 70.412 75.690  1.00 45.79  ? 302  PRO B O   1 
ATOM   6557  C  CB  . PRO B 1 302 ? 111.873 67.814 76.630  1.00 45.09  ? 302  PRO B CB  1 
ATOM   6558  C  CG  . PRO B 1 302 ? 112.061 66.948 77.844  1.00 46.09  ? 302  PRO B CG  1 
ATOM   6559  C  CD  . PRO B 1 302 ? 110.662 66.399 78.075  1.00 43.50  ? 302  PRO B CD  1 
ATOM   6560  N  N   . THR B 1 303 ? 109.538 68.364 74.787  1.00 42.66  ? 303  THR B N   1 
ATOM   6561  C  CA  . THR B 1 303 ? 108.871 68.839 73.574  1.00 41.53  ? 303  THR B CA  1 
ATOM   6562  C  C   . THR B 1 303 ? 107.816 67.810 73.164  1.00 41.71  ? 303  THR B C   1 
ATOM   6563  O  O   . THR B 1 303 ? 107.580 66.840 73.888  1.00 41.15  ? 303  THR B O   1 
ATOM   6564  C  CB  . THR B 1 303 ? 109.852 68.997 72.398  1.00 42.95  ? 303  THR B CB  1 
ATOM   6565  O  OG1 . THR B 1 303 ? 110.251 67.702 71.933  1.00 44.97  ? 303  THR B OG1 1 
ATOM   6566  C  CG2 . THR B 1 303 ? 111.086 69.767 72.830  1.00 43.27  ? 303  THR B CG2 1 
ATOM   6567  N  N   . SER B 1 304 ? 107.192 68.010 72.003  1.00 39.80  ? 304  SER B N   1 
ATOM   6568  C  CA  . SER B 1 304 ? 106.172 67.077 71.521  1.00 38.69  ? 304  SER B CA  1 
ATOM   6569  C  C   . SER B 1 304 ? 106.700 65.643 71.571  1.00 37.64  ? 304  SER B C   1 
ATOM   6570  O  O   . SER B 1 304 ? 107.867 65.390 71.269  1.00 35.94  ? 304  SER B O   1 
ATOM   6571  C  CB  . SER B 1 304 ? 105.786 67.406 70.081  1.00 39.80  ? 304  SER B CB  1 
ATOM   6572  O  OG  . SER B 1 304 ? 106.843 67.075 69.193  1.00 41.72  ? 304  SER B OG  1 
ATOM   6573  N  N   . LEU B 1 305 ? 105.837 64.705 71.947  1.00 37.22  ? 305  LEU B N   1 
ATOM   6574  C  CA  . LEU B 1 305 ? 106.239 63.305 72.035  1.00 36.93  ? 305  LEU B CA  1 
ATOM   6575  C  C   . LEU B 1 305 ? 106.828 62.825 70.714  1.00 37.94  ? 305  LEU B C   1 
ATOM   6576  O  O   . LEU B 1 305 ? 107.783 62.050 70.694  1.00 37.87  ? 305  LEU B O   1 
ATOM   6577  C  CB  . LEU B 1 305 ? 105.038 62.420 72.402  1.00 36.23  ? 305  LEU B CB  1 
ATOM   6578  C  CG  . LEU B 1 305 ? 104.292 62.710 73.711  1.00 36.23  ? 305  LEU B CG  1 
ATOM   6579  C  CD1 . LEU B 1 305 ? 103.148 61.714 73.874  1.00 36.71  ? 305  LEU B CD1 1 
ATOM   6580  C  CD2 . LEU B 1 305 ? 105.248 62.618 74.896  1.00 35.80  ? 305  LEU B CD2 1 
ATOM   6581  N  N   . GLU B 1 306 ? 106.261 63.297 69.609  1.00 38.92  ? 306  GLU B N   1 
ATOM   6582  C  CA  . GLU B 1 306 ? 106.730 62.879 68.295  1.00 41.22  ? 306  GLU B CA  1 
ATOM   6583  C  C   . GLU B 1 306 ? 108.163 63.299 67.989  1.00 40.71  ? 306  GLU B C   1 
ATOM   6584  O  O   . GLU B 1 306 ? 108.969 62.478 67.544  1.00 39.67  ? 306  GLU B O   1 
ATOM   6585  C  CB  . GLU B 1 306 ? 105.787 63.398 67.207  1.00 43.20  ? 306  GLU B CB  1 
ATOM   6586  C  CG  . GLU B 1 306 ? 106.069 62.833 65.815  1.00 46.20  ? 306  GLU B CG  1 
ATOM   6587  C  CD  . GLU B 1 306 ? 106.158 61.310 65.795  1.00 48.60  ? 306  GLU B CD  1 
ATOM   6588  O  OE1 . GLU B 1 306 ? 105.363 60.644 66.494  1.00 50.01  ? 306  GLU B OE1 1 
ATOM   6589  O  OE2 . GLU B 1 306 ? 107.018 60.774 65.066  1.00 51.78  ? 306  GLU B OE2 1 
ATOM   6590  N  N   . SER B 1 307 ? 108.488 64.568 68.227  1.00 40.32  ? 307  SER B N   1 
ATOM   6591  C  CA  . SER B 1 307 ? 109.843 65.040 67.959  1.00 39.92  ? 307  SER B CA  1 
ATOM   6592  C  C   . SER B 1 307 ? 110.850 64.342 68.869  1.00 39.10  ? 307  SER B C   1 
ATOM   6593  O  O   . SER B 1 307 ? 112.002 64.142 68.482  1.00 39.41  ? 307  SER B O   1 
ATOM   6594  C  CB  . SER B 1 307 ? 109.942 66.563 68.137  1.00 39.93  ? 307  SER B CB  1 
ATOM   6595  O  OG  . SER B 1 307 ? 109.751 66.946 69.487  1.00 41.38  ? 307  SER B OG  1 
ATOM   6596  N  N   . MET B 1 308 ? 110.416 63.971 70.073  1.00 38.46  ? 308  MET B N   1 
ATOM   6597  C  CA  . MET B 1 308 ? 111.290 63.282 71.021  1.00 38.04  ? 308  MET B CA  1 
ATOM   6598  C  C   . MET B 1 308 ? 111.630 61.881 70.526  1.00 37.81  ? 308  MET B C   1 
ATOM   6599  O  O   . MET B 1 308 ? 112.753 61.417 70.698  1.00 37.50  ? 308  MET B O   1 
ATOM   6600  C  CB  . MET B 1 308 ? 110.629 63.170 72.401  1.00 39.41  ? 308  MET B CB  1 
ATOM   6601  C  CG  . MET B 1 308 ? 110.577 64.461 73.208  1.00 40.74  ? 308  MET B CG  1 
ATOM   6602  S  SD  . MET B 1 308 ? 109.877 64.198 74.859  1.00 42.22  ? 308  MET B SD  1 
ATOM   6603  C  CE  . MET B 1 308 ? 111.335 63.629 75.743  1.00 41.06  ? 308  MET B CE  1 
ATOM   6604  N  N   . LEU B 1 309 ? 110.652 61.203 69.928  1.00 38.50  ? 309  LEU B N   1 
ATOM   6605  C  CA  . LEU B 1 309 ? 110.866 59.858 69.398  1.00 39.02  ? 309  LEU B CA  1 
ATOM   6606  C  C   . LEU B 1 309 ? 111.747 59.895 68.146  1.00 40.96  ? 309  LEU B C   1 
ATOM   6607  O  O   . LEU B 1 309 ? 112.633 59.054 67.980  1.00 40.44  ? 309  LEU B O   1 
ATOM   6608  C  CB  . LEU B 1 309 ? 109.526 59.189 69.075  1.00 36.94  ? 309  LEU B CB  1 
ATOM   6609  C  CG  . LEU B 1 309 ? 108.659 58.816 70.282  1.00 37.04  ? 309  LEU B CG  1 
ATOM   6610  C  CD1 . LEU B 1 309 ? 107.267 58.410 69.828  1.00 36.02  ? 309  LEU B CD1 1 
ATOM   6611  C  CD2 . LEU B 1 309 ? 109.325 57.686 71.052  1.00 36.86  ? 309  LEU B CD2 1 
ATOM   6612  N  N   . ASN B 1 310 ? 111.516 60.877 67.275  1.00 42.15  ? 310  ASN B N   1 
ATOM   6613  C  CA  . ASN B 1 310 ? 112.303 61.004 66.051  1.00 43.22  ? 310  ASN B CA  1 
ATOM   6614  C  C   . ASN B 1 310 ? 113.756 61.370 66.316  1.00 42.23  ? 310  ASN B C   1 
ATOM   6615  O  O   . ASN B 1 310 ? 114.638 60.995 65.547  1.00 42.99  ? 310  ASN B O   1 
ATOM   6616  C  CB  . ASN B 1 310 ? 111.716 62.066 65.115  1.00 44.42  ? 310  ASN B CB  1 
ATOM   6617  C  CG  . ASN B 1 310 ? 110.340 61.711 64.616  1.00 47.28  ? 310  ASN B CG  1 
ATOM   6618  O  OD1 . ASN B 1 310 ? 110.020 60.537 64.425  1.00 48.72  ? 310  ASN B OD1 1 
ATOM   6619  N  ND2 . ASN B 1 310 ? 109.515 62.730 64.378  1.00 49.25  ? 310  ASN B ND2 1 
ATOM   6620  N  N   . SER B 1 311 ? 114.007 62.109 67.392  1.00 41.99  ? 311  SER B N   1 
ATOM   6621  C  CA  . SER B 1 311 ? 115.369 62.532 67.711  1.00 41.34  ? 311  SER B CA  1 
ATOM   6622  C  C   . SER B 1 311 ? 116.115 61.600 68.667  1.00 40.56  ? 311  SER B C   1 
ATOM   6623  O  O   . SER B 1 311 ? 117.298 61.806 68.943  1.00 40.02  ? 311  SER B O   1 
ATOM   6624  C  CB  . SER B 1 311 ? 115.355 63.959 68.282  1.00 42.15  ? 311  SER B CB  1 
ATOM   6625  O  OG  . SER B 1 311 ? 114.644 64.031 69.505  1.00 42.61  ? 311  SER B OG  1 
ATOM   6626  N  N   . GLY B 1 312 ? 115.427 60.578 69.167  1.00 39.48  ? 312  GLY B N   1 
ATOM   6627  C  CA  . GLY B 1 312 ? 116.060 59.639 70.078  1.00 38.29  ? 312  GLY B CA  1 
ATOM   6628  C  C   . GLY B 1 312 ? 116.258 60.194 71.476  1.00 38.73  ? 312  GLY B C   1 
ATOM   6629  O  O   . GLY B 1 312 ? 117.045 59.665 72.263  1.00 39.09  ? 312  GLY B O   1 
ATOM   6630  N  N   . ASN B 1 313 ? 115.543 61.268 71.790  1.00 39.13  ? 313  ASN B N   1 
ATOM   6631  C  CA  . ASN B 1 313 ? 115.642 61.894 73.100  1.00 39.10  ? 313  ASN B CA  1 
ATOM   6632  C  C   . ASN B 1 313 ? 114.809 61.140 74.136  1.00 37.41  ? 313  ASN B C   1 
ATOM   6633  O  O   . ASN B 1 313 ? 113.690 61.529 74.474  1.00 37.21  ? 313  ASN B O   1 
ATOM   6634  C  CB  . ASN B 1 313 ? 115.202 63.356 73.002  1.00 41.50  ? 313  ASN B CB  1 
ATOM   6635  C  CG  . ASN B 1 313 ? 115.057 64.013 74.355  1.00 43.26  ? 313  ASN B CG  1 
ATOM   6636  O  OD1 . ASN B 1 313 ? 115.840 63.761 75.275  1.00 43.44  ? 313  ASN B OD1 1 
ATOM   6637  N  ND2 . ASN B 1 313 ? 114.054 64.871 74.482  1.00 46.39  ? 313  ASN B ND2 1 
ATOM   6638  N  N   . PHE B 1 314 ? 115.375 60.049 74.638  1.00 35.24  ? 314  PHE B N   1 
ATOM   6639  C  CA  . PHE B 1 314 ? 114.701 59.218 75.621  1.00 33.31  ? 314  PHE B CA  1 
ATOM   6640  C  C   . PHE B 1 314 ? 115.660 58.162 76.150  1.00 32.65  ? 314  PHE B C   1 
ATOM   6641  O  O   . PHE B 1 314 ? 116.710 57.914 75.565  1.00 35.37  ? 314  PHE B O   1 
ATOM   6642  C  CB  . PHE B 1 314 ? 113.464 58.559 74.990  1.00 30.95  ? 314  PHE B CB  1 
ATOM   6643  C  CG  . PHE B 1 314 ? 113.750 57.812 73.716  1.00 28.49  ? 314  PHE B CG  1 
ATOM   6644  C  CD1 . PHE B 1 314 ? 114.376 56.570 73.741  1.00 29.14  ? 314  PHE B CD1 1 
ATOM   6645  C  CD2 . PHE B 1 314 ? 113.381 58.349 72.488  1.00 29.61  ? 314  PHE B CD2 1 
ATOM   6646  C  CE1 . PHE B 1 314 ? 114.630 55.869 72.560  1.00 26.68  ? 314  PHE B CE1 1 
ATOM   6647  C  CE2 . PHE B 1 314 ? 113.628 57.660 71.298  1.00 29.63  ? 314  PHE B CE2 1 
ATOM   6648  C  CZ  . PHE B 1 314 ? 114.256 56.413 71.338  1.00 29.84  ? 314  PHE B CZ  1 
ATOM   6649  N  N   . LYS B 1 315 ? 115.302 57.544 77.261  1.00 30.93  ? 315  LYS B N   1 
ATOM   6650  C  CA  . LYS B 1 315 ? 116.154 56.528 77.852  1.00 32.03  ? 315  LYS B CA  1 
ATOM   6651  C  C   . LYS B 1 315 ? 116.368 55.375 76.861  1.00 33.64  ? 315  LYS B C   1 
ATOM   6652  O  O   . LYS B 1 315 ? 115.403 54.812 76.334  1.00 32.79  ? 315  LYS B O   1 
ATOM   6653  C  CB  . LYS B 1 315 ? 115.502 56.014 79.138  1.00 30.15  ? 315  LYS B CB  1 
ATOM   6654  C  CG  . LYS B 1 315 ? 116.412 55.232 80.063  1.00 29.31  ? 315  LYS B CG  1 
ATOM   6655  C  CD  . LYS B 1 315 ? 115.615 54.589 81.195  1.00 28.66  ? 315  LYS B CD  1 
ATOM   6656  C  CE  . LYS B 1 315 ? 116.435 53.539 81.927  1.00 25.97  ? 315  LYS B CE  1 
ATOM   6657  N  NZ  . LYS B 1 315 ? 117.662 54.137 82.524  1.00 27.30  ? 315  LYS B NZ  1 
ATOM   6658  N  N   . LYS B 1 316 ? 117.628 55.041 76.590  1.00 33.63  ? 316  LYS B N   1 
ATOM   6659  C  CA  . LYS B 1 316 ? 117.944 53.934 75.686  1.00 34.10  ? 316  LYS B CA  1 
ATOM   6660  C  C   . LYS B 1 316 ? 118.233 52.682 76.503  1.00 32.38  ? 316  LYS B C   1 
ATOM   6661  O  O   . LYS B 1 316 ? 119.257 52.600 77.179  1.00 32.31  ? 316  LYS B O   1 
ATOM   6662  C  CB  . LYS B 1 316 ? 119.162 54.255 74.819  1.00 35.51  ? 316  LYS B CB  1 
ATOM   6663  C  CG  . LYS B 1 316 ? 118.893 55.210 73.675  1.00 38.94  ? 316  LYS B CG  1 
ATOM   6664  C  CD  . LYS B 1 316 ? 119.204 56.632 74.060  1.00 42.42  ? 316  LYS B CD  1 
ATOM   6665  C  CE  . LYS B 1 316 ? 119.165 57.541 72.845  1.00 43.35  ? 316  LYS B CE  1 
ATOM   6666  N  NZ  . LYS B 1 316 ? 119.377 58.965 73.241  1.00 45.43  ? 316  LYS B NZ  1 
ATOM   6667  N  N   . THR B 1 317 ? 117.327 51.709 76.441  1.00 31.18  ? 317  THR B N   1 
ATOM   6668  C  CA  . THR B 1 317 ? 117.478 50.466 77.198  1.00 28.55  ? 317  THR B CA  1 
ATOM   6669  C  C   . THR B 1 317 ? 116.729 49.341 76.481  1.00 28.66  ? 317  THR B C   1 
ATOM   6670  O  O   . THR B 1 317 ? 116.489 49.424 75.282  1.00 28.22  ? 317  THR B O   1 
ATOM   6671  C  CB  . THR B 1 317 ? 116.925 50.634 78.643  1.00 25.61  ? 317  THR B CB  1 
ATOM   6672  O  OG1 . THR B 1 317 ? 117.345 49.535 79.455  1.00 30.18  ? 317  THR B OG1 1 
ATOM   6673  C  CG2 . THR B 1 317 ? 115.407 50.676 78.643  1.00 26.58  ? 317  THR B CG2 1 
ATOM   6674  N  N   . GLN B 1 318 ? 116.378 48.287 77.213  1.00 29.07  ? 318  GLN B N   1 
ATOM   6675  C  CA  . GLN B 1 318 ? 115.639 47.175 76.644  1.00 29.41  ? 318  GLN B CA  1 
ATOM   6676  C  C   . GLN B 1 318 ? 114.165 47.296 77.046  1.00 29.96  ? 318  GLN B C   1 
ATOM   6677  O  O   . GLN B 1 318 ? 113.860 47.625 78.193  1.00 28.76  ? 318  GLN B O   1 
ATOM   6678  C  CB  . GLN B 1 318 ? 116.173 45.836 77.170  1.00 33.61  ? 318  GLN B CB  1 
ATOM   6679  C  CG  . GLN B 1 318 ? 117.669 45.587 76.986  1.00 36.98  ? 318  GLN B CG  1 
ATOM   6680  C  CD  . GLN B 1 318 ? 118.488 46.065 78.176  1.00 39.51  ? 318  GLN B CD  1 
ATOM   6681  O  OE1 . GLN B 1 318 ? 118.216 45.703 79.321  1.00 39.70  ? 318  GLN B OE1 1 
ATOM   6682  N  NE2 . GLN B 1 318 ? 119.501 46.876 77.906  1.00 42.34  ? 318  GLN B NE2 1 
ATOM   6683  N  N   . ILE B 1 319 ? 113.258 47.047 76.102  1.00 27.14  ? 319  ILE B N   1 
ATOM   6684  C  CA  . ILE B 1 319 ? 111.829 47.076 76.387  1.00 25.59  ? 319  ILE B CA  1 
ATOM   6685  C  C   . ILE B 1 319 ? 111.158 45.827 75.816  1.00 26.83  ? 319  ILE B C   1 
ATOM   6686  O  O   . ILE B 1 319 ? 111.588 45.272 74.804  1.00 27.74  ? 319  ILE B O   1 
ATOM   6687  C  CB  . ILE B 1 319 ? 111.123 48.302 75.787  1.00 23.92  ? 319  ILE B CB  1 
ATOM   6688  C  CG1 . ILE B 1 319 ? 111.311 48.318 74.276  1.00 25.07  ? 319  ILE B CG1 1 
ATOM   6689  C  CG2 . ILE B 1 319 ? 111.645 49.583 76.429  1.00 26.18  ? 319  ILE B CG2 1 
ATOM   6690  C  CD1 . ILE B 1 319 ? 110.476 49.362 73.591  1.00 26.35  ? 319  ILE B CD1 1 
ATOM   6691  N  N   . LEU B 1 320 ? 110.105 45.391 76.490  1.00 26.28  ? 320  LEU B N   1 
ATOM   6692  C  CA  . LEU B 1 320 ? 109.322 44.235 76.094  1.00 25.39  ? 320  LEU B CA  1 
ATOM   6693  C  C   . LEU B 1 320 ? 107.897 44.757 76.139  1.00 24.77  ? 320  LEU B C   1 
ATOM   6694  O  O   . LEU B 1 320 ? 107.457 45.264 77.172  1.00 23.65  ? 320  LEU B O   1 
ATOM   6695  C  CB  . LEU B 1 320 ? 109.525 43.093 77.096  1.00 23.51  ? 320  LEU B CB  1 
ATOM   6696  C  CG  . LEU B 1 320 ? 108.756 41.786 76.886  1.00 22.97  ? 320  LEU B CG  1 
ATOM   6697  C  CD1 . LEU B 1 320 ? 109.482 40.642 77.582  1.00 21.54  ? 320  LEU B CD1 1 
ATOM   6698  C  CD2 . LEU B 1 320 ? 107.332 41.929 77.412  1.00 21.70  ? 320  LEU B CD2 1 
ATOM   6699  N  N   . LEU B 1 321 ? 107.190 44.660 75.015  1.00 24.62  ? 321  LEU B N   1 
ATOM   6700  C  CA  . LEU B 1 321 ? 105.821 45.161 74.929  1.00 23.16  ? 321  LEU B CA  1 
ATOM   6701  C  C   . LEU B 1 321 ? 104.970 44.383 73.941  1.00 24.17  ? 321  LEU B C   1 
ATOM   6702  O  O   . LEU B 1 321 ? 105.475 43.619 73.123  1.00 23.87  ? 321  LEU B O   1 
ATOM   6703  C  CB  . LEU B 1 321 ? 105.830 46.636 74.516  1.00 21.28  ? 321  LEU B CB  1 
ATOM   6704  C  CG  . LEU B 1 321 ? 106.215 46.968 73.072  1.00 25.15  ? 321  LEU B CG  1 
ATOM   6705  C  CD1 . LEU B 1 321 ? 106.241 48.503 72.873  1.00 22.92  ? 321  LEU B CD1 1 
ATOM   6706  C  CD2 . LEU B 1 321 ? 107.585 46.363 72.750  1.00 24.40  ? 321  LEU B CD2 1 
ATOM   6707  N  N   . GLY B 1 322 ? 103.665 44.600 74.016  1.00 24.10  ? 322  GLY B N   1 
ATOM   6708  C  CA  . GLY B 1 322 ? 102.756 43.920 73.120  1.00 26.56  ? 322  GLY B CA  1 
ATOM   6709  C  C   . GLY B 1 322 ? 101.320 44.347 73.339  1.00 26.87  ? 322  GLY B C   1 
ATOM   6710  O  O   . GLY B 1 322 ? 101.046 45.273 74.111  1.00 29.23  ? 322  GLY B O   1 
ATOM   6711  N  N   . VAL B 1 323 ? 100.404 43.666 72.659  1.00 25.25  ? 323  VAL B N   1 
ATOM   6712  C  CA  . VAL B 1 323 ? 98.984  43.963 72.757  1.00 23.26  ? 323  VAL B CA  1 
ATOM   6713  C  C   . VAL B 1 323 ? 98.156  42.676 72.761  1.00 24.90  ? 323  VAL B C   1 
ATOM   6714  O  O   . VAL B 1 323 ? 98.681  41.573 72.571  1.00 24.65  ? 323  VAL B O   1 
ATOM   6715  C  CB  . VAL B 1 323 ? 98.528  44.862 71.583  1.00 24.42  ? 323  VAL B CB  1 
ATOM   6716  C  CG1 . VAL B 1 323 ? 99.295  46.173 71.612  1.00 23.93  ? 323  VAL B CG1 1 
ATOM   6717  C  CG2 . VAL B 1 323 ? 98.770  44.160 70.249  1.00 20.46  ? 323  VAL B CG2 1 
ATOM   6718  N  N   . ASN B 1 324 ? 96.860  42.833 73.002  1.00 24.62  ? 324  ASN B N   1 
ATOM   6719  C  CA  . ASN B 1 324 ? 95.924  41.723 73.034  1.00 23.32  ? 324  ASN B CA  1 
ATOM   6720  C  C   . ASN B 1 324 ? 95.122  41.747 71.738  1.00 25.47  ? 324  ASN B C   1 
ATOM   6721  O  O   . ASN B 1 324 ? 94.921  42.805 71.142  1.00 23.43  ? 324  ASN B O   1 
ATOM   6722  C  CB  . ASN B 1 324 ? 95.009  41.858 74.248  1.00 24.31  ? 324  ASN B CB  1 
ATOM   6723  C  CG  . ASN B 1 324 ? 95.740  41.608 75.558  1.00 27.45  ? 324  ASN B CG  1 
ATOM   6724  O  OD1 . ASN B 1 324 ? 96.962  41.470 75.577  1.00 32.77  ? 324  ASN B OD1 1 
ATOM   6725  N  ND2 . ASN B 1 324 ? 94.999  41.551 76.657  1.00 28.24  ? 324  ASN B ND2 1 
ATOM   6726  N  N   . LYS B 1 325 ? 94.665  40.577 71.304  1.00 28.06  ? 325  LYS B N   1 
ATOM   6727  C  CA  . LYS B 1 325 ? 93.920  40.463 70.055  1.00 29.97  ? 325  LYS B CA  1 
ATOM   6728  C  C   . LYS B 1 325 ? 92.694  41.358 69.886  1.00 31.31  ? 325  LYS B C   1 
ATOM   6729  O  O   . LYS B 1 325 ? 92.454  41.862 68.784  1.00 32.65  ? 325  LYS B O   1 
ATOM   6730  C  CB  . LYS B 1 325 ? 93.528  39.002 69.817  1.00 31.77  ? 325  LYS B CB  1 
ATOM   6731  C  CG  . LYS B 1 325 ? 92.648  38.779 68.600  1.00 33.87  ? 325  LYS B CG  1 
ATOM   6732  C  CD  . LYS B 1 325 ? 92.554  37.294 68.264  1.00 38.12  ? 325  LYS B CD  1 
ATOM   6733  C  CE  . LYS B 1 325 ? 91.227  36.941 67.609  1.00 40.29  ? 325  LYS B CE  1 
ATOM   6734  N  NZ  . LYS B 1 325 ? 90.110  36.896 68.609  1.00 42.03  ? 325  LYS B NZ  1 
ATOM   6735  N  N   . ASP B 1 326 ? 91.921  41.568 70.951  1.00 30.79  ? 326  ASP B N   1 
ATOM   6736  C  CA  . ASP B 1 326 ? 90.723  42.407 70.855  1.00 31.75  ? 326  ASP B CA  1 
ATOM   6737  C  C   . ASP B 1 326 ? 90.729  43.569 71.850  1.00 32.29  ? 326  ASP B C   1 
ATOM   6738  O  O   . ASP B 1 326 ? 89.959  43.584 72.814  1.00 33.39  ? 326  ASP B O   1 
ATOM   6739  C  CB  . ASP B 1 326 ? 89.474  41.550 71.070  1.00 32.61  ? 326  ASP B CB  1 
ATOM   6740  C  CG  . ASP B 1 326 ? 89.355  40.423 70.051  1.00 36.34  ? 326  ASP B CG  1 
ATOM   6741  O  OD1 . ASP B 1 326 ? 88.923  40.695 68.908  1.00 38.30  ? 326  ASP B OD1 1 
ATOM   6742  O  OD2 . ASP B 1 326 ? 89.703  39.265 70.389  1.00 34.06  ? 326  ASP B OD2 1 
ATOM   6743  N  N   . GLU B 1 327 ? 91.584  44.552 71.597  1.00 31.45  ? 327  GLU B N   1 
ATOM   6744  C  CA  . GLU B 1 327 ? 91.708  45.715 72.468  1.00 32.51  ? 327  GLU B CA  1 
ATOM   6745  C  C   . GLU B 1 327 ? 90.468  46.610 72.572  1.00 33.00  ? 327  GLU B C   1 
ATOM   6746  O  O   . GLU B 1 327 ? 90.236  47.223 73.608  1.00 35.85  ? 327  GLU B O   1 
ATOM   6747  C  CB  . GLU B 1 327 ? 92.886  46.580 72.016  1.00 32.11  ? 327  GLU B CB  1 
ATOM   6748  C  CG  . GLU B 1 327 ? 94.271  45.940 72.141  1.00 32.07  ? 327  GLU B CG  1 
ATOM   6749  C  CD  . GLU B 1 327 ? 94.702  45.728 73.583  1.00 33.57  ? 327  GLU B CD  1 
ATOM   6750  O  OE1 . GLU B 1 327 ? 94.111  46.345 74.487  1.00 35.18  ? 327  GLU B OE1 1 
ATOM   6751  O  OE2 . GLU B 1 327 ? 95.649  44.955 73.817  1.00 34.07  ? 327  GLU B OE2 1 
ATOM   6752  N  N   . GLY B 1 328 ? 89.665  46.688 71.517  1.00 31.82  ? 328  GLY B N   1 
ATOM   6753  C  CA  . GLY B 1 328 ? 88.515  47.573 71.567  1.00 31.37  ? 328  GLY B CA  1 
ATOM   6754  C  C   . GLY B 1 328 ? 87.131  47.115 72.009  1.00 30.94  ? 328  GLY B C   1 
ATOM   6755  O  O   . GLY B 1 328 ? 86.276  47.964 72.245  1.00 31.65  ? 328  GLY B O   1 
ATOM   6756  N  N   . SER B 1 329 ? 86.892  45.814 72.143  1.00 30.16  ? 329  SER B N   1 
ATOM   6757  C  CA  . SER B 1 329 ? 85.563  45.328 72.514  1.00 30.18  ? 329  SER B CA  1 
ATOM   6758  C  C   . SER B 1 329 ? 84.989  45.890 73.816  1.00 30.71  ? 329  SER B C   1 
ATOM   6759  O  O   . SER B 1 329 ? 83.818  46.258 73.878  1.00 28.79  ? 329  SER B O   1 
ATOM   6760  C  CB  . SER B 1 329 ? 85.558  43.799 72.564  1.00 30.13  ? 329  SER B CB  1 
ATOM   6761  O  OG  . SER B 1 329 ? 86.421  43.321 73.574  1.00 31.87  ? 329  SER B OG  1 
ATOM   6762  N  N   . PHE B 1 330 ? 85.807  45.960 74.858  1.00 30.84  ? 330  PHE B N   1 
ATOM   6763  C  CA  . PHE B 1 330 ? 85.336  46.480 76.133  1.00 31.51  ? 330  PHE B CA  1 
ATOM   6764  C  C   . PHE B 1 330 ? 84.754  47.893 76.027  1.00 31.02  ? 330  PHE B C   1 
ATOM   6765  O  O   . PHE B 1 330 ? 83.729  48.203 76.645  1.00 30.87  ? 330  PHE B O   1 
ATOM   6766  C  CB  . PHE B 1 330 ? 86.474  46.453 77.156  1.00 33.99  ? 330  PHE B CB  1 
ATOM   6767  C  CG  . PHE B 1 330 ? 86.103  47.029 78.493  1.00 37.40  ? 330  PHE B CG  1 
ATOM   6768  C  CD1 . PHE B 1 330 ? 86.208  48.405 78.728  1.00 38.22  ? 330  PHE B CD1 1 
ATOM   6769  C  CD2 . PHE B 1 330 ? 85.652  46.200 79.521  1.00 39.22  ? 330  PHE B CD2 1 
ATOM   6770  C  CE1 . PHE B 1 330 ? 85.873  48.951 79.975  1.00 40.88  ? 330  PHE B CE1 1 
ATOM   6771  C  CE2 . PHE B 1 330 ? 85.314  46.728 80.774  1.00 40.98  ? 330  PHE B CE2 1 
ATOM   6772  C  CZ  . PHE B 1 330 ? 85.426  48.110 81.003  1.00 42.55  ? 330  PHE B CZ  1 
ATOM   6773  N  N   . PHE B 1 331 ? 85.397  48.748 75.245  1.00 29.54  ? 331  PHE B N   1 
ATOM   6774  C  CA  . PHE B 1 331 ? 84.922  50.113 75.090  1.00 30.10  ? 331  PHE B CA  1 
ATOM   6775  C  C   . PHE B 1 331 ? 83.729  50.253 74.146  1.00 30.68  ? 331  PHE B C   1 
ATOM   6776  O  O   . PHE B 1 331 ? 83.009  51.247 74.202  1.00 31.93  ? 331  PHE B O   1 
ATOM   6777  C  CB  . PHE B 1 331 ? 86.069  51.009 74.627  1.00 32.85  ? 331  PHE B CB  1 
ATOM   6778  C  CG  . PHE B 1 331 ? 87.232  51.027 75.576  1.00 35.07  ? 331  PHE B CG  1 
ATOM   6779  C  CD1 . PHE B 1 331 ? 88.236  50.064 75.487  1.00 35.48  ? 331  PHE B CD1 1 
ATOM   6780  C  CD2 . PHE B 1 331 ? 87.299  51.973 76.592  1.00 35.46  ? 331  PHE B CD2 1 
ATOM   6781  C  CE1 . PHE B 1 331 ? 89.289  50.042 76.398  1.00 36.74  ? 331  PHE B CE1 1 
ATOM   6782  C  CE2 . PHE B 1 331 ? 88.350  51.962 77.515  1.00 38.57  ? 331  PHE B CE2 1 
ATOM   6783  C  CZ  . PHE B 1 331 ? 89.345  50.995 77.417  1.00 38.25  ? 331  PHE B CZ  1 
ATOM   6784  N  N   . LEU B 1 332 ? 83.510  49.272 73.276  1.00 29.58  ? 332  LEU B N   1 
ATOM   6785  C  CA  . LEU B 1 332 ? 82.375  49.341 72.365  1.00 29.28  ? 332  LEU B CA  1 
ATOM   6786  C  C   . LEU B 1 332 ? 81.124  48.983 73.160  1.00 30.32  ? 332  LEU B C   1 
ATOM   6787  O  O   . LEU B 1 332 ? 80.060  49.587 73.004  1.00 28.17  ? 332  LEU B O   1 
ATOM   6788  C  CB  . LEU B 1 332 ? 82.568  48.369 71.195  1.00 28.38  ? 332  LEU B CB  1 
ATOM   6789  C  CG  . LEU B 1 332 ? 83.614  48.787 70.158  1.00 26.57  ? 332  LEU B CG  1 
ATOM   6790  C  CD1 . LEU B 1 332 ? 83.869  47.662 69.165  1.00 22.98  ? 332  LEU B CD1 1 
ATOM   6791  C  CD2 . LEU B 1 332 ? 83.120  50.031 69.444  1.00 23.54  ? 332  LEU B CD2 1 
ATOM   6792  N  N   . LEU B 1 333 ? 81.275  48.000 74.036  1.00 32.10  ? 333  LEU B N   1 
ATOM   6793  C  CA  . LEU B 1 333 ? 80.182  47.546 74.886  1.00 33.63  ? 333  LEU B CA  1 
ATOM   6794  C  C   . LEU B 1 333 ? 79.584  48.670 75.734  1.00 34.72  ? 333  LEU B C   1 
ATOM   6795  O  O   . LEU B 1 333 ? 78.367  48.754 75.899  1.00 36.91  ? 333  LEU B O   1 
ATOM   6796  C  CB  . LEU B 1 333 ? 80.676  46.439 75.813  1.00 31.40  ? 333  LEU B CB  1 
ATOM   6797  C  CG  . LEU B 1 333 ? 79.733  46.055 76.951  1.00 31.66  ? 333  LEU B CG  1 
ATOM   6798  C  CD1 . LEU B 1 333 ? 78.431  45.480 76.393  1.00 31.20  ? 333  LEU B CD1 1 
ATOM   6799  C  CD2 . LEU B 1 333 ? 80.430  45.049 77.842  1.00 32.68  ? 333  LEU B CD2 1 
ATOM   6800  N  N   . TYR B 1 334 ? 80.438  49.537 76.262  1.00 34.09  ? 334  TYR B N   1 
ATOM   6801  C  CA  . TYR B 1 334 ? 79.975  50.611 77.120  1.00 33.89  ? 334  TYR B CA  1 
ATOM   6802  C  C   . TYR B 1 334 ? 79.421  51.844 76.432  1.00 35.19  ? 334  TYR B C   1 
ATOM   6803  O  O   . TYR B 1 334 ? 78.473  52.450 76.934  1.00 36.28  ? 334  TYR B O   1 
ATOM   6804  C  CB  . TYR B 1 334 ? 81.092  51.040 78.081  1.00 33.93  ? 334  TYR B CB  1 
ATOM   6805  C  CG  . TYR B 1 334 ? 81.282  50.106 79.254  1.00 34.08  ? 334  TYR B CG  1 
ATOM   6806  C  CD1 . TYR B 1 334 ? 81.768  48.811 79.072  1.00 32.19  ? 334  TYR B CD1 1 
ATOM   6807  C  CD2 . TYR B 1 334 ? 80.952  50.509 80.552  1.00 35.10  ? 334  TYR B CD2 1 
ATOM   6808  C  CE1 . TYR B 1 334 ? 81.920  47.940 80.153  1.00 32.36  ? 334  TYR B CE1 1 
ATOM   6809  C  CE2 . TYR B 1 334 ? 81.101  49.642 81.638  1.00 32.10  ? 334  TYR B CE2 1 
ATOM   6810  C  CZ  . TYR B 1 334 ? 81.584  48.362 81.425  1.00 31.02  ? 334  TYR B CZ  1 
ATOM   6811  O  OH  . TYR B 1 334 ? 81.729  47.503 82.483  1.00 30.88  ? 334  TYR B OH  1 
ATOM   6812  N  N   . GLY B 1 335 ? 79.990  52.227 75.293  1.00 35.26  ? 335  GLY B N   1 
ATOM   6813  C  CA  . GLY B 1 335 ? 79.505  53.431 74.642  1.00 35.10  ? 335  GLY B CA  1 
ATOM   6814  C  C   . GLY B 1 335 ? 79.093  53.432 73.183  1.00 34.29  ? 335  GLY B C   1 
ATOM   6815  O  O   . GLY B 1 335 ? 78.974  54.510 72.604  1.00 37.11  ? 335  GLY B O   1 
ATOM   6816  N  N   . ALA B 1 336 ? 78.868  52.272 72.575  1.00 31.53  ? 336  ALA B N   1 
ATOM   6817  C  CA  . ALA B 1 336 ? 78.468  52.251 71.167  1.00 31.37  ? 336  ALA B CA  1 
ATOM   6818  C  C   . ALA B 1 336 ? 77.137  51.530 70.973  1.00 31.64  ? 336  ALA B C   1 
ATOM   6819  O  O   . ALA B 1 336 ? 76.874  50.501 71.594  1.00 34.42  ? 336  ALA B O   1 
ATOM   6820  C  CB  . ALA B 1 336 ? 79.548  51.594 70.320  1.00 28.71  ? 336  ALA B CB  1 
ATOM   6821  N  N   . PRO B 1 337 ? 76.274  52.066 70.105  1.00 30.89  ? 337  PRO B N   1 
ATOM   6822  C  CA  . PRO B 1 337 ? 74.970  51.446 69.854  1.00 30.84  ? 337  PRO B CA  1 
ATOM   6823  C  C   . PRO B 1 337 ? 75.042  50.063 69.202  1.00 31.53  ? 337  PRO B C   1 
ATOM   6824  O  O   . PRO B 1 337 ? 75.868  49.830 68.315  1.00 32.53  ? 337  PRO B O   1 
ATOM   6825  C  CB  . PRO B 1 337 ? 74.272  52.472 68.969  1.00 29.83  ? 337  PRO B CB  1 
ATOM   6826  C  CG  . PRO B 1 337 ? 75.412  53.083 68.217  1.00 31.83  ? 337  PRO B CG  1 
ATOM   6827  C  CD  . PRO B 1 337 ? 76.456  53.274 69.284  1.00 30.21  ? 337  PRO B CD  1 
ATOM   6828  N  N   . GLY B 1 338 ? 74.176  49.155 69.653  1.00 30.88  ? 338  GLY B N   1 
ATOM   6829  C  CA  . GLY B 1 338 ? 74.128  47.812 69.097  1.00 31.14  ? 338  GLY B CA  1 
ATOM   6830  C  C   . GLY B 1 338 ? 74.886  46.766 69.890  1.00 32.54  ? 338  GLY B C   1 
ATOM   6831  O  O   . GLY B 1 338 ? 74.684  45.562 69.705  1.00 33.52  ? 338  GLY B O   1 
ATOM   6832  N  N   . PHE B 1 339 ? 75.770  47.216 70.770  1.00 32.60  ? 339  PHE B N   1 
ATOM   6833  C  CA  . PHE B 1 339 ? 76.558  46.296 71.584  1.00 32.58  ? 339  PHE B CA  1 
ATOM   6834  C  C   . PHE B 1 339 ? 75.869  45.957 72.896  1.00 32.87  ? 339  PHE B C   1 
ATOM   6835  O  O   . PHE B 1 339 ? 75.253  46.808 73.535  1.00 31.86  ? 339  PHE B O   1 
ATOM   6836  C  CB  . PHE B 1 339 ? 77.939  46.895 71.849  1.00 31.29  ? 339  PHE B CB  1 
ATOM   6837  C  CG  . PHE B 1 339 ? 78.781  47.018 70.613  1.00 28.77  ? 339  PHE B CG  1 
ATOM   6838  C  CD1 . PHE B 1 339 ? 79.495  45.923 70.134  1.00 25.41  ? 339  PHE B CD1 1 
ATOM   6839  C  CD2 . PHE B 1 339 ? 78.797  48.208 69.883  1.00 28.42  ? 339  PHE B CD2 1 
ATOM   6840  C  CE1 . PHE B 1 339 ? 80.213  46.003 68.938  1.00 26.68  ? 339  PHE B CE1 1 
ATOM   6841  C  CE2 . PHE B 1 339 ? 79.512  48.301 68.684  1.00 29.33  ? 339  PHE B CE2 1 
ATOM   6842  C  CZ  . PHE B 1 339 ? 80.221  47.191 68.211  1.00 25.92  ? 339  PHE B CZ  1 
ATOM   6843  N  N   . SER B 1 340 ? 75.975  44.697 73.289  1.00 32.76  ? 340  SER B N   1 
ATOM   6844  C  CA  . SER B 1 340 ? 75.369  44.235 74.520  1.00 33.73  ? 340  SER B CA  1 
ATOM   6845  C  C   . SER B 1 340 ? 76.120  43.032 75.072  1.00 35.32  ? 340  SER B C   1 
ATOM   6846  O  O   . SER B 1 340 ? 76.632  42.203 74.321  1.00 33.97  ? 340  SER B O   1 
ATOM   6847  C  CB  . SER B 1 340 ? 73.912  43.864 74.279  1.00 34.59  ? 340  SER B CB  1 
ATOM   6848  O  OG  . SER B 1 340 ? 73.415  43.104 75.362  1.00 40.92  ? 340  SER B OG  1 
ATOM   6849  N  N   . LYS B 1 341 ? 76.183  42.946 76.395  1.00 36.72  ? 341  LYS B N   1 
ATOM   6850  C  CA  . LYS B 1 341 ? 76.871  41.859 77.062  1.00 39.08  ? 341  LYS B CA  1 
ATOM   6851  C  C   . LYS B 1 341 ? 76.094  40.557 76.933  1.00 42.43  ? 341  LYS B C   1 
ATOM   6852  O  O   . LYS B 1 341 ? 76.675  39.470 76.902  1.00 42.99  ? 341  LYS B O   1 
ATOM   6853  C  CB  . LYS B 1 341 ? 77.056  42.202 78.542  1.00 37.98  ? 341  LYS B CB  1 
ATOM   6854  C  CG  . LYS B 1 341 ? 77.804  41.156 79.343  1.00 38.61  ? 341  LYS B CG  1 
ATOM   6855  C  CD  . LYS B 1 341 ? 78.169  41.676 80.731  1.00 39.35  ? 341  LYS B CD  1 
ATOM   6856  C  CE  . LYS B 1 341 ? 76.961  41.770 81.651  1.00 38.25  ? 341  LYS B CE  1 
ATOM   6857  N  NZ  . LYS B 1 341 ? 76.487  40.420 82.048  1.00 36.54  ? 341  LYS B NZ  1 
ATOM   6858  N  N   . ASP B 1 342 ? 74.776  40.673 76.836  1.00 44.97  ? 342  ASP B N   1 
ATOM   6859  C  CA  . ASP B 1 342 ? 73.925  39.493 76.761  1.00 48.16  ? 342  ASP B CA  1 
ATOM   6860  C  C   . ASP B 1 342 ? 73.393  39.177 75.371  1.00 48.67  ? 342  ASP B C   1 
ATOM   6861  O  O   . ASP B 1 342 ? 72.238  38.780 75.216  1.00 50.58  ? 342  ASP B O   1 
ATOM   6862  C  CB  . ASP B 1 342 ? 72.771  39.662 77.749  1.00 48.56  ? 342  ASP B CB  1 
ATOM   6863  C  CG  . ASP B 1 342 ? 73.256  40.104 79.122  1.00 49.91  ? 342  ASP B CG  1 
ATOM   6864  O  OD1 . ASP B 1 342 ? 74.099  39.392 79.711  1.00 49.46  ? 342  ASP B OD1 1 
ATOM   6865  O  OD2 . ASP B 1 342 ? 72.807  41.166 79.608  1.00 51.62  ? 342  ASP B OD2 1 
ATOM   6866  N  N   . SER B 1 343 ? 74.245  39.336 74.364  1.00 48.63  ? 343  SER B N   1 
ATOM   6867  C  CA  . SER B 1 343 ? 73.855  39.071 72.986  1.00 48.17  ? 343  SER B CA  1 
ATOM   6868  C  C   . SER B 1 343 ? 75.066  38.949 72.061  1.00 47.95  ? 343  SER B C   1 
ATOM   6869  O  O   . SER B 1 343 ? 76.189  39.298 72.433  1.00 48.44  ? 343  SER B O   1 
ATOM   6870  C  CB  . SER B 1 343 ? 72.920  40.181 72.491  1.00 48.36  ? 343  SER B CB  1 
ATOM   6871  O  OG  . SER B 1 343 ? 72.791  40.156 71.080  1.00 51.68  ? 343  SER B OG  1 
ATOM   6872  N  N   . GLU B 1 344 ? 74.821  38.451 70.853  1.00 46.41  ? 344  GLU B N   1 
ATOM   6873  C  CA  . GLU B 1 344 ? 75.864  38.258 69.854  1.00 44.94  ? 344  GLU B CA  1 
ATOM   6874  C  C   . GLU B 1 344 ? 76.348  39.614 69.331  1.00 42.54  ? 344  GLU B C   1 
ATOM   6875  O  O   . GLU B 1 344 ? 77.424  39.721 68.733  1.00 40.58  ? 344  GLU B O   1 
ATOM   6876  C  CB  . GLU B 1 344 ? 75.310  37.406 68.713  1.00 47.46  ? 344  GLU B CB  1 
ATOM   6877  C  CG  . GLU B 1 344 ? 76.349  36.682 67.889  1.00 53.62  ? 344  GLU B CG  1 
ATOM   6878  C  CD  . GLU B 1 344 ? 75.715  35.751 66.859  1.00 57.74  ? 344  GLU B CD  1 
ATOM   6879  O  OE1 . GLU B 1 344 ? 76.462  35.035 66.154  1.00 57.79  ? 344  GLU B OE1 1 
ATOM   6880  O  OE2 . GLU B 1 344 ? 74.465  35.740 66.757  1.00 58.39  ? 344  GLU B OE2 1 
ATOM   6881  N  N   . SER B 1 345 ? 75.537  40.641 69.553  1.00 38.21  ? 345  SER B N   1 
ATOM   6882  C  CA  . SER B 1 345 ? 75.873  41.995 69.140  1.00 38.12  ? 345  SER B CA  1 
ATOM   6883  C  C   . SER B 1 345 ? 76.139  42.208 67.646  1.00 37.68  ? 345  SER B C   1 
ATOM   6884  O  O   . SER B 1 345 ? 77.167  42.780 67.273  1.00 35.84  ? 345  SER B O   1 
ATOM   6885  C  CB  . SER B 1 345 ? 77.087  42.490 69.936  1.00 39.33  ? 345  SER B CB  1 
ATOM   6886  O  OG  . SER B 1 345 ? 76.804  42.566 71.321  1.00 38.31  ? 345  SER B OG  1 
ATOM   6887  N  N   . LYS B 1 346 ? 75.222  41.763 66.792  1.00 36.90  ? 346  LYS B N   1 
ATOM   6888  C  CA  . LYS B 1 346 ? 75.384  41.963 65.356  1.00 36.24  ? 346  LYS B CA  1 
ATOM   6889  C  C   . LYS B 1 346 ? 75.063  43.427 65.081  1.00 36.29  ? 346  LYS B C   1 
ATOM   6890  O  O   . LYS B 1 346 ? 73.985  43.909 65.414  1.00 37.03  ? 346  LYS B O   1 
ATOM   6891  C  CB  . LYS B 1 346 ? 74.447  41.041 64.584  1.00 37.75  ? 346  LYS B CB  1 
ATOM   6892  C  CG  . LYS B 1 346 ? 74.779  39.568 64.776  1.00 40.40  ? 346  LYS B CG  1 
ATOM   6893  C  CD  . LYS B 1 346 ? 73.786  38.673 64.076  1.00 43.87  ? 346  LYS B CD  1 
ATOM   6894  C  CE  . LYS B 1 346 ? 74.202  37.213 64.185  1.00 47.64  ? 346  LYS B CE  1 
ATOM   6895  N  NZ  . LYS B 1 346 ? 73.197  36.296 63.569  1.00 50.38  ? 346  LYS B NZ  1 
ATOM   6896  N  N   . ILE B 1 347 ? 76.013  44.137 64.489  1.00 34.41  ? 347  ILE B N   1 
ATOM   6897  C  CA  . ILE B 1 347 ? 75.847  45.554 64.213  1.00 34.22  ? 347  ILE B CA  1 
ATOM   6898  C  C   . ILE B 1 347 ? 75.286  45.839 62.827  1.00 35.15  ? 347  ILE B C   1 
ATOM   6899  O  O   . ILE B 1 347 ? 75.828  45.390 61.815  1.00 35.69  ? 347  ILE B O   1 
ATOM   6900  C  CB  . ILE B 1 347 ? 77.199  46.296 64.360  1.00 33.89  ? 347  ILE B CB  1 
ATOM   6901  C  CG1 . ILE B 1 347 ? 77.808  46.000 65.736  1.00 36.41  ? 347  ILE B CG1 1 
ATOM   6902  C  CG2 . ILE B 1 347 ? 77.004  47.787 64.180  1.00 33.80  ? 347  ILE B CG2 1 
ATOM   6903  C  CD1 . ILE B 1 347 ? 76.929  46.405 66.915  1.00 35.67  ? 347  ILE B CD1 1 
ATOM   6904  N  N   . SER B 1 348 ? 74.197  46.596 62.789  1.00 35.85  ? 348  SER B N   1 
ATOM   6905  C  CA  . SER B 1 348 ? 73.573  46.962 61.529  1.00 36.09  ? 348  SER B CA  1 
ATOM   6906  C  C   . SER B 1 348 ? 74.510  47.961 60.870  1.00 36.42  ? 348  SER B C   1 
ATOM   6907  O  O   . SER B 1 348 ? 75.501  48.370 61.464  1.00 36.32  ? 348  SER B O   1 
ATOM   6908  C  CB  . SER B 1 348 ? 72.222  47.628 61.780  1.00 35.72  ? 348  SER B CB  1 
ATOM   6909  O  OG  . SER B 1 348 ? 72.398  48.936 62.300  1.00 35.36  ? 348  SER B OG  1 
ATOM   6910  N  N   . ARG B 1 349 ? 74.187  48.359 59.647  1.00 36.60  ? 349  ARG B N   1 
ATOM   6911  C  CA  . ARG B 1 349 ? 75.005  49.315 58.921  1.00 36.67  ? 349  ARG B CA  1 
ATOM   6912  C  C   . ARG B 1 349 ? 74.862  50.692 59.561  1.00 37.64  ? 349  ARG B C   1 
ATOM   6913  O  O   . ARG B 1 349 ? 75.820  51.458 59.644  1.00 36.87  ? 349  ARG B O   1 
ATOM   6914  C  CB  . ARG B 1 349 ? 74.567  49.369 57.455  1.00 37.90  ? 349  ARG B CB  1 
ATOM   6915  C  CG  . ARG B 1 349 ? 75.597  49.997 56.529  1.00 39.77  ? 349  ARG B CG  1 
ATOM   6916  C  CD  . ARG B 1 349 ? 76.879  49.177 56.519  1.00 39.56  ? 349  ARG B CD  1 
ATOM   6917  N  NE  . ARG B 1 349 ? 77.993  49.936 55.970  1.00 39.08  ? 349  ARG B NE  1 
ATOM   6918  C  CZ  . ARG B 1 349 ? 79.269  49.636 56.170  1.00 37.76  ? 349  ARG B CZ  1 
ATOM   6919  N  NH1 . ARG B 1 349 ? 79.599  48.585 56.906  1.00 39.13  ? 349  ARG B NH1 1 
ATOM   6920  N  NH2 . ARG B 1 349 ? 80.217  50.397 55.644  1.00 38.65  ? 349  ARG B NH2 1 
ATOM   6921  N  N   . GLU B 1 350 ? 73.658  50.999 60.026  1.00 39.37  ? 350  GLU B N   1 
ATOM   6922  C  CA  . GLU B 1 350 ? 73.398  52.285 60.656  1.00 40.49  ? 350  GLU B CA  1 
ATOM   6923  C  C   . GLU B 1 350 ? 74.243  52.440 61.928  1.00 39.46  ? 350  GLU B C   1 
ATOM   6924  O  O   . GLU B 1 350 ? 74.877  53.478 62.137  1.00 37.38  ? 350  GLU B O   1 
ATOM   6925  C  CB  . GLU B 1 350 ? 71.905  52.412 60.994  1.00 44.10  ? 350  GLU B CB  1 
ATOM   6926  C  CG  . GLU B 1 350 ? 71.464  53.829 61.353  1.00 48.05  ? 350  GLU B CG  1 
ATOM   6927  C  CD  . GLU B 1 350 ? 70.016  53.903 61.833  1.00 51.07  ? 350  GLU B CD  1 
ATOM   6928  O  OE1 . GLU B 1 350 ? 69.104  53.487 61.085  1.00 51.89  ? 350  GLU B OE1 1 
ATOM   6929  O  OE2 . GLU B 1 350 ? 69.788  54.387 62.963  1.00 53.13  ? 350  GLU B OE2 1 
ATOM   6930  N  N   . ASP B 1 351 ? 74.256  51.410 62.773  1.00 36.39  ? 351  ASP B N   1 
ATOM   6931  C  CA  . ASP B 1 351 ? 75.029  51.467 64.010  1.00 35.56  ? 351  ASP B CA  1 
ATOM   6932  C  C   . ASP B 1 351 ? 76.526  51.483 63.741  1.00 35.05  ? 351  ASP B C   1 
ATOM   6933  O  O   . ASP B 1 351 ? 77.299  52.045 64.524  1.00 33.48  ? 351  ASP B O   1 
ATOM   6934  C  CB  . ASP B 1 351 ? 74.685  50.292 64.930  1.00 35.60  ? 351  ASP B CB  1 
ATOM   6935  C  CG  . ASP B 1 351 ? 73.313  50.435 65.572  1.00 39.24  ? 351  ASP B CG  1 
ATOM   6936  O  OD1 . ASP B 1 351 ? 72.787  51.576 65.621  1.00 37.13  ? 351  ASP B OD1 1 
ATOM   6937  O  OD2 . ASP B 1 351 ? 72.766  49.409 66.043  1.00 39.69  ? 351  ASP B OD2 1 
ATOM   6938  N  N   . PHE B 1 352 ? 76.931  50.867 62.632  1.00 33.13  ? 352  PHE B N   1 
ATOM   6939  C  CA  . PHE B 1 352 ? 78.338  50.826 62.251  1.00 30.95  ? 352  PHE B CA  1 
ATOM   6940  C  C   . PHE B 1 352 ? 78.794  52.256 62.018  1.00 31.15  ? 352  PHE B C   1 
ATOM   6941  O  O   . PHE B 1 352 ? 79.797  52.698 62.575  1.00 30.89  ? 352  PHE B O   1 
ATOM   6942  C  CB  . PHE B 1 352 ? 78.519  50.015 60.971  1.00 30.29  ? 352  PHE B CB  1 
ATOM   6943  C  CG  . PHE B 1 352 ? 79.945  49.903 60.524  1.00 29.21  ? 352  PHE B CG  1 
ATOM   6944  C  CD1 . PHE B 1 352 ? 80.815  49.024 61.153  1.00 28.11  ? 352  PHE B CD1 1 
ATOM   6945  C  CD2 . PHE B 1 352 ? 80.428  50.702 59.496  1.00 27.89  ? 352  PHE B CD2 1 
ATOM   6946  C  CE1 . PHE B 1 352 ? 82.140  48.943 60.770  1.00 26.09  ? 352  PHE B CE1 1 
ATOM   6947  C  CE2 . PHE B 1 352 ? 81.755  50.628 59.104  1.00 28.43  ? 352  PHE B CE2 1 
ATOM   6948  C  CZ  . PHE B 1 352 ? 82.615  49.746 59.744  1.00 27.86  ? 352  PHE B CZ  1 
ATOM   6949  N  N   . MET B 1 353 ? 78.044  52.978 61.192  1.00 32.48  ? 353  MET B N   1 
ATOM   6950  C  CA  . MET B 1 353 ? 78.361  54.369 60.890  1.00 35.37  ? 353  MET B CA  1 
ATOM   6951  C  C   . MET B 1 353 ? 78.472  55.175 62.184  1.00 33.79  ? 353  MET B C   1 
ATOM   6952  O  O   . MET B 1 353 ? 79.454  55.877 62.397  1.00 33.51  ? 353  MET B O   1 
ATOM   6953  C  CB  . MET B 1 353 ? 77.284  54.967 59.974  1.00 39.87  ? 353  MET B CB  1 
ATOM   6954  C  CG  . MET B 1 353 ? 77.143  54.248 58.633  1.00 45.76  ? 353  MET B CG  1 
ATOM   6955  S  SD  . MET B 1 353 ? 78.468  54.623 57.452  1.00 54.08  ? 353  MET B SD  1 
ATOM   6956  C  CE  . MET B 1 353 ? 79.816  53.593 58.051  1.00 51.40  ? 353  MET B CE  1 
ATOM   6957  N  N   . SER B 1 354 ? 77.466  55.063 63.046  1.00 32.93  ? 354  SER B N   1 
ATOM   6958  C  CA  . SER B 1 354 ? 77.469  55.761 64.330  1.00 34.60  ? 354  SER B CA  1 
ATOM   6959  C  C   . SER B 1 354 ? 78.726  55.426 65.132  1.00 34.10  ? 354  SER B C   1 
ATOM   6960  O  O   . SER B 1 354 ? 79.342  56.300 65.736  1.00 34.17  ? 354  SER B O   1 
ATOM   6961  C  CB  . SER B 1 354 ? 76.246  55.361 65.152  1.00 33.14  ? 354  SER B CB  1 
ATOM   6962  O  OG  . SER B 1 354 ? 75.058  55.680 64.462  1.00 35.76  ? 354  SER B OG  1 
ATOM   6963  N  N   . GLY B 1 355 ? 79.096  54.149 65.136  1.00 34.96  ? 355  GLY B N   1 
ATOM   6964  C  CA  . GLY B 1 355 ? 80.276  53.721 65.866  1.00 33.11  ? 355  GLY B CA  1 
ATOM   6965  C  C   . GLY B 1 355 ? 81.560  54.373 65.389  1.00 33.71  ? 355  GLY B C   1 
ATOM   6966  O  O   . GLY B 1 355 ? 82.375  54.810 66.200  1.00 33.59  ? 355  GLY B O   1 
ATOM   6967  N  N   . VAL B 1 356 ? 81.760  54.443 64.077  1.00 32.44  ? 356  VAL B N   1 
ATOM   6968  C  CA  . VAL B 1 356 ? 82.983  55.039 63.562  1.00 32.20  ? 356  VAL B CA  1 
ATOM   6969  C  C   . VAL B 1 356 ? 83.058  56.510 63.959  1.00 31.55  ? 356  VAL B C   1 
ATOM   6970  O  O   . VAL B 1 356 ? 84.123  57.016 64.305  1.00 29.78  ? 356  VAL B O   1 
ATOM   6971  C  CB  . VAL B 1 356 ? 83.079  54.896 62.024  1.00 32.72  ? 356  VAL B CB  1 
ATOM   6972  C  CG1 . VAL B 1 356 ? 82.899  53.439 61.627  1.00 31.65  ? 356  VAL B CG1 1 
ATOM   6973  C  CG2 . VAL B 1 356 ? 82.042  55.763 61.350  1.00 37.83  ? 356  VAL B CG2 1 
ATOM   6974  N  N   . LYS B 1 357 ? 81.925  57.198 63.900  1.00 32.28  ? 357  LYS B N   1 
ATOM   6975  C  CA  . LYS B 1 357 ? 81.872  58.602 64.290  1.00 33.62  ? 357  LYS B CA  1 
ATOM   6976  C  C   . LYS B 1 357 ? 82.302  58.652 65.762  1.00 34.33  ? 357  LYS B C   1 
ATOM   6977  O  O   . LYS B 1 357 ? 83.127  59.468 66.168  1.00 34.55  ? 357  LYS B O   1 
ATOM   6978  C  CB  . LYS B 1 357 ? 80.438  59.114 64.132  1.00 36.67  ? 357  LYS B CB  1 
ATOM   6979  C  CG  . LYS B 1 357 ? 80.190  60.538 64.598  1.00 38.14  ? 357  LYS B CG  1 
ATOM   6980  C  CD  . LYS B 1 357 ? 80.903  61.540 63.724  1.00 40.57  ? 357  LYS B CD  1 
ATOM   6981  C  CE  . LYS B 1 357 ? 80.477  62.959 64.070  1.00 41.63  ? 357  LYS B CE  1 
ATOM   6982  N  NZ  . LYS B 1 357 ? 81.307  63.963 63.346  1.00 42.92  ? 357  LYS B NZ  1 
ATOM   6983  N  N   . LEU B 1 358 ? 81.736  57.748 66.551  1.00 34.38  ? 358  LEU B N   1 
ATOM   6984  C  CA  . LEU B 1 358 ? 82.038  57.653 67.971  1.00 34.75  ? 358  LEU B CA  1 
ATOM   6985  C  C   . LEU B 1 358 ? 83.515  57.341 68.245  1.00 35.09  ? 358  LEU B C   1 
ATOM   6986  O  O   . LEU B 1 358 ? 84.117  57.901 69.164  1.00 33.94  ? 358  LEU B O   1 
ATOM   6987  C  CB  . LEU B 1 358 ? 81.168  56.560 68.599  1.00 34.43  ? 358  LEU B CB  1 
ATOM   6988  C  CG  . LEU B 1 358 ? 79.910  56.901 69.406  1.00 35.58  ? 358  LEU B CG  1 
ATOM   6989  C  CD1 . LEU B 1 358 ? 78.973  57.801 68.629  1.00 35.77  ? 358  LEU B CD1 1 
ATOM   6990  C  CD2 . LEU B 1 358 ? 79.219  55.590 69.770  1.00 34.58  ? 358  LEU B CD2 1 
ATOM   6991  N  N   . SER B 1 359 ? 84.096  56.454 67.444  1.00 33.96  ? 359  SER B N   1 
ATOM   6992  C  CA  . SER B 1 359 ? 85.483  56.043 67.628  1.00 34.71  ? 359  SER B CA  1 
ATOM   6993  C  C   . SER B 1 359 ? 86.546  57.043 67.195  1.00 35.74  ? 359  SER B C   1 
ATOM   6994  O  O   . SER B 1 359 ? 87.619  57.106 67.791  1.00 36.34  ? 359  SER B O   1 
ATOM   6995  C  CB  . SER B 1 359 ? 85.714  54.717 66.909  1.00 34.78  ? 359  SER B CB  1 
ATOM   6996  O  OG  . SER B 1 359 ? 84.774  53.754 67.357  1.00 37.39  ? 359  SER B OG  1 
ATOM   6997  N  N   . VAL B 1 360 ? 86.259  57.821 66.159  1.00 35.71  ? 360  VAL B N   1 
ATOM   6998  C  CA  . VAL B 1 360 ? 87.221  58.796 65.667  1.00 36.59  ? 360  VAL B CA  1 
ATOM   6999  C  C   . VAL B 1 360 ? 86.555  60.167 65.680  1.00 38.40  ? 360  VAL B C   1 
ATOM   7000  O  O   . VAL B 1 360 ? 86.318  60.768 64.633  1.00 36.78  ? 360  VAL B O   1 
ATOM   7001  C  CB  . VAL B 1 360 ? 87.668  58.431 64.238  1.00 35.32  ? 360  VAL B CB  1 
ATOM   7002  C  CG1 . VAL B 1 360 ? 88.893  59.232 63.848  1.00 35.27  ? 360  VAL B CG1 1 
ATOM   7003  C  CG2 . VAL B 1 360 ? 87.960  56.938 64.163  1.00 36.88  ? 360  VAL B CG2 1 
ATOM   7004  N  N   . PRO B 1 361 ? 86.273  60.688 66.888  1.00 41.30  ? 361  PRO B N   1 
ATOM   7005  C  CA  . PRO B 1 361 ? 85.623  61.982 67.138  1.00 43.27  ? 361  PRO B CA  1 
ATOM   7006  C  C   . PRO B 1 361 ? 86.304  63.210 66.554  1.00 44.23  ? 361  PRO B C   1 
ATOM   7007  O  O   . PRO B 1 361 ? 85.638  64.175 66.185  1.00 46.59  ? 361  PRO B O   1 
ATOM   7008  C  CB  . PRO B 1 361 ? 85.558  62.038 68.657  1.00 43.17  ? 361  PRO B CB  1 
ATOM   7009  C  CG  . PRO B 1 361 ? 86.836  61.357 69.047  1.00 43.95  ? 361  PRO B CG  1 
ATOM   7010  C  CD  . PRO B 1 361 ? 86.826  60.143 68.143  1.00 41.90  ? 361  PRO B CD  1 
ATOM   7011  N  N   . HIS B 1 362 ? 87.626  63.180 66.474  1.00 45.70  ? 362  HIS B N   1 
ATOM   7012  C  CA  . HIS B 1 362 ? 88.369  64.316 65.949  1.00 48.38  ? 362  HIS B CA  1 
ATOM   7013  C  C   . HIS B 1 362 ? 88.370  64.397 64.426  1.00 48.22  ? 362  HIS B C   1 
ATOM   7014  O  O   . HIS B 1 362 ? 88.749  65.422 63.858  1.00 49.67  ? 362  HIS B O   1 
ATOM   7015  C  CB  . HIS B 1 362 ? 89.816  64.276 66.461  1.00 49.80  ? 362  HIS B CB  1 
ATOM   7016  C  CG  . HIS B 1 362 ? 90.515  62.973 66.210  1.00 53.34  ? 362  HIS B CG  1 
ATOM   7017  N  ND1 . HIS B 1 362 ? 90.115  61.788 66.791  1.00 53.30  ? 362  HIS B ND1 1 
ATOM   7018  C  CD2 . HIS B 1 362 ? 91.593  62.672 65.445  1.00 54.40  ? 362  HIS B CD2 1 
ATOM   7019  C  CE1 . HIS B 1 362 ? 90.917  60.814 66.397  1.00 54.86  ? 362  HIS B CE1 1 
ATOM   7020  N  NE2 . HIS B 1 362 ? 91.823  61.323 65.580  1.00 55.24  ? 362  HIS B NE2 1 
ATOM   7021  N  N   . ALA B 1 363 ? 87.931  63.331 63.766  1.00 46.77  ? 363  ALA B N   1 
ATOM   7022  C  CA  . ALA B 1 363 ? 87.924  63.286 62.307  1.00 45.90  ? 363  ALA B CA  1 
ATOM   7023  C  C   . ALA B 1 363 ? 86.833  64.103 61.634  1.00 45.15  ? 363  ALA B C   1 
ATOM   7024  O  O   . ALA B 1 363 ? 85.752  64.287 62.189  1.00 45.40  ? 363  ALA B O   1 
ATOM   7025  C  CB  . ALA B 1 363 ? 87.834  61.836 61.836  1.00 43.56  ? 363  ALA B CB  1 
ATOM   7026  N  N   . ASN B 1 364 ? 87.135  64.594 60.433  1.00 45.19  ? 364  ASN B N   1 
ATOM   7027  C  CA  . ASN B 1 364 ? 86.174  65.352 59.638  1.00 44.46  ? 364  ASN B CA  1 
ATOM   7028  C  C   . ASN B 1 364 ? 85.439  64.344 58.758  1.00 44.06  ? 364  ASN B C   1 
ATOM   7029  O  O   . ASN B 1 364 ? 85.794  63.163 58.722  1.00 42.75  ? 364  ASN B O   1 
ATOM   7030  C  CB  . ASN B 1 364 ? 86.870  66.399 58.755  1.00 44.27  ? 364  ASN B CB  1 
ATOM   7031  C  CG  . ASN B 1 364 ? 87.943  65.799 57.857  1.00 45.40  ? 364  ASN B CG  1 
ATOM   7032  O  OD1 . ASN B 1 364 ? 87.839  64.651 57.421  1.00 45.71  ? 364  ASN B OD1 1 
ATOM   7033  N  ND2 . ASN B 1 364 ? 88.975  66.584 57.565  1.00 43.13  ? 364  ASN B ND2 1 
ATOM   7034  N  N   . ASP B 1 365 ? 84.423  64.810 58.044  1.00 45.01  ? 365  ASP B N   1 
ATOM   7035  C  CA  . ASP B 1 365 ? 83.634  63.933 57.189  1.00 45.17  ? 365  ASP B CA  1 
ATOM   7036  C  C   . ASP B 1 365 ? 84.489  63.105 56.227  1.00 43.15  ? 365  ASP B C   1 
ATOM   7037  O  O   . ASP B 1 365 ? 84.171  61.947 55.949  1.00 41.96  ? 365  ASP B O   1 
ATOM   7038  C  CB  . ASP B 1 365 ? 82.611  64.757 56.408  1.00 49.46  ? 365  ASP B CB  1 
ATOM   7039  C  CG  . ASP B 1 365 ? 81.536  63.895 55.775  1.00 55.13  ? 365  ASP B CG  1 
ATOM   7040  O  OD1 . ASP B 1 365 ? 80.860  63.149 56.521  1.00 58.20  ? 365  ASP B OD1 1 
ATOM   7041  O  OD2 . ASP B 1 365 ? 81.366  63.965 54.536  1.00 58.79  ? 365  ASP B OD2 1 
ATOM   7042  N  N   . LEU B 1 366 ? 85.571  63.697 55.726  1.00 39.40  ? 366  LEU B N   1 
ATOM   7043  C  CA  . LEU B 1 366 ? 86.464  63.005 54.802  1.00 37.26  ? 366  LEU B CA  1 
ATOM   7044  C  C   . LEU B 1 366 ? 87.242  61.902 55.506  1.00 36.18  ? 366  LEU B C   1 
ATOM   7045  O  O   . LEU B 1 366 ? 87.425  60.813 54.959  1.00 35.23  ? 366  LEU B O   1 
ATOM   7046  C  CB  . LEU B 1 366 ? 87.455  63.982 54.175  1.00 36.97  ? 366  LEU B CB  1 
ATOM   7047  C  CG  . LEU B 1 366 ? 88.307  63.366 53.066  1.00 36.21  ? 366  LEU B CG  1 
ATOM   7048  C  CD1 . LEU B 1 366 ? 87.414  63.077 51.871  1.00 34.96  ? 366  LEU B CD1 1 
ATOM   7049  C  CD2 . LEU B 1 366 ? 89.440  64.307 52.679  1.00 36.51  ? 366  LEU B CD2 1 
ATOM   7050  N  N   . GLY B 1 367 ? 87.717  62.200 56.712  1.00 34.29  ? 367  GLY B N   1 
ATOM   7051  C  CA  . GLY B 1 367 ? 88.455  61.217 57.478  1.00 32.61  ? 367  GLY B CA  1 
ATOM   7052  C  C   . GLY B 1 367 ? 87.541  60.067 57.858  1.00 32.91  ? 367  GLY B C   1 
ATOM   7053  O  O   . GLY B 1 367 ? 87.984  58.924 57.984  1.00 31.04  ? 367  GLY B O   1 
ATOM   7054  N  N   . LEU B 1 368 ? 86.259  60.369 58.037  1.00 31.44  ? 368  LEU B N   1 
ATOM   7055  C  CA  . LEU B 1 368 ? 85.282  59.347 58.395  1.00 31.67  ? 368  LEU B CA  1 
ATOM   7056  C  C   . LEU B 1 368 ? 85.048  58.393 57.228  1.00 30.94  ? 368  LEU B C   1 
ATOM   7057  O  O   . LEU B 1 368 ? 85.007  57.171 57.414  1.00 30.65  ? 368  LEU B O   1 
ATOM   7058  C  CB  . LEU B 1 368 ? 83.954  59.993 58.816  1.00 32.42  ? 368  LEU B CB  1 
ATOM   7059  C  CG  . LEU B 1 368 ? 83.948  60.782 60.133  1.00 35.85  ? 368  LEU B CG  1 
ATOM   7060  C  CD1 . LEU B 1 368 ? 82.589  61.433 60.319  1.00 36.09  ? 368  LEU B CD1 1 
ATOM   7061  C  CD2 . LEU B 1 368 ? 84.266  59.848 61.315  1.00 33.77  ? 368  LEU B CD2 1 
ATOM   7062  N  N   . ASP B 1 369 ? 84.893  58.944 56.028  1.00 29.78  ? 369  ASP B N   1 
ATOM   7063  C  CA  . ASP B 1 369 ? 84.677  58.108 54.854  1.00 30.72  ? 369  ASP B CA  1 
ATOM   7064  C  C   . ASP B 1 369 ? 85.889  57.205 54.644  1.00 29.50  ? 369  ASP B C   1 
ATOM   7065  O  O   . ASP B 1 369 ? 85.752  56.044 54.252  1.00 28.87  ? 369  ASP B O   1 
ATOM   7066  C  CB  . ASP B 1 369 ? 84.441  58.963 53.603  1.00 32.93  ? 369  ASP B CB  1 
ATOM   7067  C  CG  . ASP B 1 369 ? 83.156  59.787 53.681  1.00 38.36  ? 369  ASP B CG  1 
ATOM   7068  O  OD1 . ASP B 1 369 ? 82.219  59.393 54.410  1.00 41.51  ? 369  ASP B OD1 1 
ATOM   7069  O  OD2 . ASP B 1 369 ? 83.074  60.831 52.994  1.00 42.33  ? 369  ASP B OD2 1 
ATOM   7070  N  N   . ALA B 1 370 ? 87.073  57.744 54.920  1.00 27.21  ? 370  ALA B N   1 
ATOM   7071  C  CA  . ALA B 1 370 ? 88.314  57.000 54.775  1.00 26.12  ? 370  ALA B CA  1 
ATOM   7072  C  C   . ALA B 1 370 ? 88.343  55.799 55.710  1.00 26.60  ? 370  ALA B C   1 
ATOM   7073  O  O   . ALA B 1 370 ? 88.709  54.697 55.304  1.00 24.51  ? 370  ALA B O   1 
ATOM   7074  C  CB  . ALA B 1 370 ? 89.506  57.909 55.056  1.00 25.83  ? 370  ALA B CB  1 
ATOM   7075  N  N   . VAL B 1 371 ? 87.956  56.017 56.964  1.00 27.40  ? 371  VAL B N   1 
ATOM   7076  C  CA  . VAL B 1 371 ? 87.940  54.947 57.962  1.00 29.09  ? 371  VAL B CA  1 
ATOM   7077  C  C   . VAL B 1 371 ? 86.926  53.884 57.551  1.00 29.83  ? 371  VAL B C   1 
ATOM   7078  O  O   . VAL B 1 371 ? 87.220  52.684 57.542  1.00 29.41  ? 371  VAL B O   1 
ATOM   7079  C  CB  . VAL B 1 371 ? 87.551  55.489 59.365  1.00 28.10  ? 371  VAL B CB  1 
ATOM   7080  C  CG1 . VAL B 1 371 ? 87.454  54.343 60.364  1.00 28.25  ? 371  VAL B CG1 1 
ATOM   7081  C  CG2 . VAL B 1 371 ? 88.570  56.507 59.827  1.00 25.72  ? 371  VAL B CG2 1 
ATOM   7082  N  N   . THR B 1 372 ? 85.730  54.349 57.210  1.00 29.60  ? 372  THR B N   1 
ATOM   7083  C  CA  . THR B 1 372 ? 84.646  53.474 56.794  1.00 30.48  ? 372  THR B CA  1 
ATOM   7084  C  C   . THR B 1 372 ? 85.060  52.577 55.635  1.00 30.35  ? 372  THR B C   1 
ATOM   7085  O  O   . THR B 1 372 ? 84.887  51.358 55.692  1.00 29.58  ? 372  THR B O   1 
ATOM   7086  C  CB  . THR B 1 372 ? 83.402  54.303 56.379  1.00 30.96  ? 372  THR B CB  1 
ATOM   7087  O  OG1 . THR B 1 372 ? 82.928  55.047 57.510  1.00 31.78  ? 372  THR B OG1 1 
ATOM   7088  C  CG2 . THR B 1 372 ? 82.296  53.394 55.874  1.00 29.08  ? 372  THR B CG2 1 
ATOM   7089  N  N   . LEU B 1 373 ? 85.619  53.183 54.591  1.00 28.76  ? 373  LEU B N   1 
ATOM   7090  C  CA  . LEU B 1 373 ? 86.043  52.433 53.414  1.00 27.88  ? 373  LEU B CA  1 
ATOM   7091  C  C   . LEU B 1 373 ? 87.145  51.430 53.731  1.00 27.19  ? 373  LEU B C   1 
ATOM   7092  O  O   . LEU B 1 373 ? 87.184  50.330 53.173  1.00 25.82  ? 373  LEU B O   1 
ATOM   7093  C  CB  . LEU B 1 373 ? 86.528  53.394 52.324  1.00 29.75  ? 373  LEU B CB  1 
ATOM   7094  C  CG  . LEU B 1 373 ? 87.034  52.769 51.017  1.00 31.79  ? 373  LEU B CG  1 
ATOM   7095  C  CD1 . LEU B 1 373 ? 85.935  51.908 50.411  1.00 31.05  ? 373  LEU B CD1 1 
ATOM   7096  C  CD2 . LEU B 1 373 ? 87.463  53.865 50.038  1.00 30.14  ? 373  LEU B CD2 1 
ATOM   7097  N  N   . GLN B 1 374 ? 88.035  51.815 54.634  1.00 25.37  ? 374  GLN B N   1 
ATOM   7098  C  CA  . GLN B 1 374 ? 89.148  50.970 55.018  1.00 26.48  ? 374  GLN B CA  1 
ATOM   7099  C  C   . GLN B 1 374 ? 88.729  49.714 55.793  1.00 28.64  ? 374  GLN B C   1 
ATOM   7100  O  O   . GLN B 1 374 ? 89.437  48.710 55.777  1.00 30.26  ? 374  GLN B O   1 
ATOM   7101  C  CB  . GLN B 1 374 ? 90.128  51.791 55.848  1.00 26.61  ? 374  GLN B CB  1 
ATOM   7102  C  CG  . GLN B 1 374 ? 91.439  51.108 56.139  1.00 31.15  ? 374  GLN B CG  1 
ATOM   7103  C  CD  . GLN B 1 374 ? 92.388  51.077 54.941  1.00 32.44  ? 374  GLN B CD  1 
ATOM   7104  O  OE1 . GLN B 1 374 ? 93.521  50.601 55.052  1.00 34.87  ? 374  GLN B OE1 1 
ATOM   7105  N  NE2 . GLN B 1 374 ? 91.931  51.580 53.799  1.00 29.02  ? 374  GLN B NE2 1 
ATOM   7106  N  N   . TYR B 1 375 ? 87.579  49.760 56.461  1.00 29.18  ? 375  TYR B N   1 
ATOM   7107  C  CA  . TYR B 1 375 ? 87.116  48.617 57.247  1.00 28.91  ? 375  TYR B CA  1 
ATOM   7108  C  C   . TYR B 1 375 ? 85.784  48.014 56.807  1.00 30.18  ? 375  TYR B C   1 
ATOM   7109  O  O   . TYR B 1 375 ? 85.170  47.257 57.559  1.00 30.71  ? 375  TYR B O   1 
ATOM   7110  C  CB  . TYR B 1 375 ? 87.008  49.016 58.719  1.00 27.54  ? 375  TYR B CB  1 
ATOM   7111  C  CG  . TYR B 1 375 ? 88.337  49.187 59.417  1.00 24.93  ? 375  TYR B CG  1 
ATOM   7112  C  CD1 . TYR B 1 375 ? 88.912  48.132 60.132  1.00 24.73  ? 375  TYR B CD1 1 
ATOM   7113  C  CD2 . TYR B 1 375 ? 89.016  50.405 59.374  1.00 21.35  ? 375  TYR B CD2 1 
ATOM   7114  C  CE1 . TYR B 1 375 ? 90.131  48.290 60.796  1.00 24.85  ? 375  TYR B CE1 1 
ATOM   7115  C  CE2 . TYR B 1 375 ? 90.232  50.575 60.028  1.00 23.53  ? 375  TYR B CE2 1 
ATOM   7116  C  CZ  . TYR B 1 375 ? 90.783  49.515 60.742  1.00 23.08  ? 375  TYR B CZ  1 
ATOM   7117  O  OH  . TYR B 1 375 ? 91.959  49.689 61.426  1.00 20.63  ? 375  TYR B OH  1 
ATOM   7118  N  N   . THR B 1 376 ? 85.344  48.336 55.595  1.00 30.40  ? 376  THR B N   1 
ATOM   7119  C  CA  . THR B 1 376 ? 84.078  47.820 55.082  1.00 29.81  ? 376  THR B CA  1 
ATOM   7120  C  C   . THR B 1 376 ? 84.259  46.875 53.898  1.00 31.76  ? 376  THR B C   1 
ATOM   7121  O  O   . THR B 1 376 ? 84.927  47.212 52.921  1.00 30.01  ? 376  THR B O   1 
ATOM   7122  C  CB  . THR B 1 376 ? 83.152  48.970 54.622  1.00 29.49  ? 376  THR B CB  1 
ATOM   7123  O  OG1 . THR B 1 376 ? 82.830  49.805 55.737  1.00 28.37  ? 376  THR B OG1 1 
ATOM   7124  C  CG2 . THR B 1 376 ? 81.870  48.419 54.017  1.00 28.82  ? 376  THR B CG2 1 
ATOM   7125  N  N   . ASP B 1 377 ? 83.663  45.690 53.996  1.00 33.21  ? 377  ASP B N   1 
ATOM   7126  C  CA  . ASP B 1 377 ? 83.709  44.699 52.918  1.00 33.91  ? 377  ASP B CA  1 
ATOM   7127  C  C   . ASP B 1 377 ? 82.468  45.004 52.077  1.00 34.05  ? 377  ASP B C   1 
ATOM   7128  O  O   . ASP B 1 377 ? 81.367  44.577 52.413  1.00 31.06  ? 377  ASP B O   1 
ATOM   7129  C  CB  . ASP B 1 377 ? 83.607  43.286 53.497  1.00 36.59  ? 377  ASP B CB  1 
ATOM   7130  C  CG  . ASP B 1 377 ? 83.671  42.198 52.429  1.00 40.00  ? 377  ASP B CG  1 
ATOM   7131  O  OD1 . ASP B 1 377 ? 83.587  42.516 51.220  1.00 42.32  ? 377  ASP B OD1 1 
ATOM   7132  O  OD2 . ASP B 1 377 ? 83.795  41.010 52.808  1.00 41.97  ? 377  ASP B OD2 1 
ATOM   7133  N  N   . TRP B 1 378 ? 82.639  45.746 50.989  1.00 34.31  ? 378  TRP B N   1 
ATOM   7134  C  CA  . TRP B 1 378 ? 81.495  46.107 50.166  1.00 35.53  ? 378  TRP B CA  1 
ATOM   7135  C  C   . TRP B 1 378 ? 80.799  44.986 49.403  1.00 35.55  ? 378  TRP B C   1 
ATOM   7136  O  O   . TRP B 1 378 ? 79.766  45.207 48.777  1.00 34.67  ? 378  TRP B O   1 
ATOM   7137  C  CB  . TRP B 1 378 ? 81.866  47.255 49.234  1.00 34.94  ? 378  TRP B CB  1 
ATOM   7138  C  CG  . TRP B 1 378 ? 81.898  48.545 49.975  1.00 35.30  ? 378  TRP B CG  1 
ATOM   7139  C  CD1 . TRP B 1 378 ? 82.996  49.299 50.270  1.00 34.92  ? 378  TRP B CD1 1 
ATOM   7140  C  CD2 . TRP B 1 378 ? 80.784  49.198 50.592  1.00 35.67  ? 378  TRP B CD2 1 
ATOM   7141  N  NE1 . TRP B 1 378 ? 82.635  50.379 51.037  1.00 36.21  ? 378  TRP B NE1 1 
ATOM   7142  C  CE2 . TRP B 1 378 ? 81.282  50.342 51.250  1.00 35.91  ? 378  TRP B CE2 1 
ATOM   7143  C  CE3 . TRP B 1 378 ? 79.411  48.924 50.655  1.00 38.55  ? 378  TRP B CE3 1 
ATOM   7144  C  CZ2 . TRP B 1 378 ? 80.456  51.217 51.967  1.00 37.18  ? 378  TRP B CZ2 1 
ATOM   7145  C  CZ3 . TRP B 1 378 ? 78.584  49.798 51.370  1.00 39.07  ? 378  TRP B CZ3 1 
ATOM   7146  C  CH2 . TRP B 1 378 ? 79.114  50.929 52.016  1.00 37.09  ? 378  TRP B CH2 1 
ATOM   7147  N  N   . MET B 1 379 ? 81.349  43.783 49.457  1.00 38.23  ? 379  MET B N   1 
ATOM   7148  C  CA  . MET B 1 379 ? 80.701  42.656 48.801  1.00 42.62  ? 379  MET B CA  1 
ATOM   7149  C  C   . MET B 1 379 ? 79.651  42.102 49.763  1.00 43.19  ? 379  MET B C   1 
ATOM   7150  O  O   . MET B 1 379 ? 78.881  41.211 49.407  1.00 43.39  ? 379  MET B O   1 
ATOM   7151  C  CB  . MET B 1 379 ? 81.698  41.541 48.500  1.00 44.94  ? 379  MET B CB  1 
ATOM   7152  C  CG  . MET B 1 379 ? 82.624  41.798 47.340  1.00 51.21  ? 379  MET B CG  1 
ATOM   7153  S  SD  . MET B 1 379 ? 83.659  40.339 47.049  1.00 57.07  ? 379  MET B SD  1 
ATOM   7154  C  CE  . MET B 1 379 ? 85.087  40.741 48.091  1.00 54.09  ? 379  MET B CE  1 
ATOM   7155  N  N   . ASP B 1 380 ? 79.623  42.643 50.979  1.00 43.33  ? 380  ASP B N   1 
ATOM   7156  C  CA  . ASP B 1 380 ? 78.703  42.158 52.001  1.00 43.50  ? 380  ASP B CA  1 
ATOM   7157  C  C   . ASP B 1 380 ? 78.650  43.119 53.201  1.00 42.81  ? 380  ASP B C   1 
ATOM   7158  O  O   . ASP B 1 380 ? 79.008  42.755 54.320  1.00 42.54  ? 380  ASP B O   1 
ATOM   7159  C  CB  . ASP B 1 380 ? 79.191  40.769 52.423  1.00 45.28  ? 380  ASP B CB  1 
ATOM   7160  C  CG  . ASP B 1 380 ? 78.254  40.078 53.367  1.00 45.96  ? 380  ASP B CG  1 
ATOM   7161  O  OD1 . ASP B 1 380 ? 77.022  40.247 53.228  1.00 47.13  ? 380  ASP B OD1 1 
ATOM   7162  O  OD2 . ASP B 1 380 ? 78.762  39.349 54.239  1.00 46.67  ? 380  ASP B OD2 1 
ATOM   7163  N  N   . ASP B 1 381 ? 78.180  44.339 52.947  1.00 41.97  ? 381  ASP B N   1 
ATOM   7164  C  CA  . ASP B 1 381 ? 78.103  45.402 53.951  1.00 42.11  ? 381  ASP B CA  1 
ATOM   7165  C  C   . ASP B 1 381 ? 77.042  45.310 55.051  1.00 42.81  ? 381  ASP B C   1 
ATOM   7166  O  O   . ASP B 1 381 ? 77.131  46.024 56.054  1.00 42.09  ? 381  ASP B O   1 
ATOM   7167  C  CB  . ASP B 1 381 ? 77.955  46.753 53.246  1.00 42.93  ? 381  ASP B CB  1 
ATOM   7168  C  CG  . ASP B 1 381 ? 76.803  46.773 52.259  1.00 43.70  ? 381  ASP B CG  1 
ATOM   7169  O  OD1 . ASP B 1 381 ? 76.856  46.017 51.265  1.00 42.93  ? 381  ASP B OD1 1 
ATOM   7170  O  OD2 . ASP B 1 381 ? 75.843  47.543 52.478  1.00 45.63  ? 381  ASP B OD2 1 
ATOM   7171  N  N   . ASN B 1 382 ? 76.038  44.459 54.868  1.00 42.60  ? 382  ASN B N   1 
ATOM   7172  C  CA  . ASN B 1 382 ? 74.988  44.313 55.871  1.00 41.93  ? 382  ASN B CA  1 
ATOM   7173  C  C   . ASN B 1 382 ? 75.199  43.081 56.738  1.00 41.49  ? 382  ASN B C   1 
ATOM   7174  O  O   . ASN B 1 382 ? 74.272  42.620 57.412  1.00 43.66  ? 382  ASN B O   1 
ATOM   7175  C  CB  . ASN B 1 382 ? 73.613  44.243 55.204  1.00 42.66  ? 382  ASN B CB  1 
ATOM   7176  C  CG  . ASN B 1 382 ? 73.190  45.569 54.606  1.00 43.37  ? 382  ASN B CG  1 
ATOM   7177  O  OD1 . ASN B 1 382 ? 72.977  46.546 55.320  1.00 42.85  ? 382  ASN B OD1 1 
ATOM   7178  N  ND2 . ASN B 1 382 ? 73.072  45.609 53.287  1.00 45.53  ? 382  ASN B ND2 1 
ATOM   7179  N  N   . ASN B 1 383 ? 76.414  42.542 56.709  1.00 39.26  ? 383  ASN B N   1 
ATOM   7180  C  CA  . ASN B 1 383 ? 76.744  41.370 57.511  1.00 37.55  ? 383  ASN B CA  1 
ATOM   7181  C  C   . ASN B 1 383 ? 77.013  41.844 58.940  1.00 35.61  ? 383  ASN B C   1 
ATOM   7182  O  O   . ASN B 1 383 ? 78.049  42.441 59.228  1.00 34.40  ? 383  ASN B O   1 
ATOM   7183  C  CB  . ASN B 1 383 ? 77.978  40.669 56.945  1.00 37.86  ? 383  ASN B CB  1 
ATOM   7184  C  CG  . ASN B 1 383 ? 78.318  39.396 57.695  1.00 40.16  ? 383  ASN B CG  1 
ATOM   7185  O  OD1 . ASN B 1 383 ? 78.403  39.392 58.922  1.00 39.40  ? 383  ASN B OD1 1 
ATOM   7186  N  ND2 . ASN B 1 383 ? 78.519  38.308 56.958  1.00 41.58  ? 383  ASN B ND2 1 
ATOM   7187  N  N   . GLY B 1 384 ? 76.063  41.581 59.826  1.00 34.31  ? 384  GLY B N   1 
ATOM   7188  C  CA  . GLY B 1 384 ? 76.190  42.005 61.206  1.00 33.97  ? 384  GLY B CA  1 
ATOM   7189  C  C   . GLY B 1 384 ? 77.493  41.650 61.894  1.00 33.52  ? 384  GLY B C   1 
ATOM   7190  O  O   . GLY B 1 384 ? 78.056  42.472 62.622  1.00 33.61  ? 384  GLY B O   1 
ATOM   7191  N  N   . ILE B 1 385 ? 77.970  40.429 61.673  1.00 32.90  ? 385  ILE B N   1 
ATOM   7192  C  CA  . ILE B 1 385 ? 79.203  39.977 62.289  1.00 32.63  ? 385  ILE B CA  1 
ATOM   7193  C  C   . ILE B 1 385 ? 80.436  40.730 61.798  1.00 33.05  ? 385  ILE B C   1 
ATOM   7194  O  O   . ILE B 1 385 ? 81.281  41.116 62.608  1.00 32.90  ? 385  ILE B O   1 
ATOM   7195  C  CB  . ILE B 1 385 ? 79.374  38.456 62.098  1.00 33.84  ? 385  ILE B CB  1 
ATOM   7196  C  CG1 . ILE B 1 385 ? 78.358  37.734 62.987  1.00 34.96  ? 385  ILE B CG1 1 
ATOM   7197  C  CG2 . ILE B 1 385 ? 80.788  38.017 62.466  1.00 33.72  ? 385  ILE B CG2 1 
ATOM   7198  C  CD1 . ILE B 1 385 ? 78.367  36.233 62.842  1.00 37.63  ? 385  ILE B CD1 1 
ATOM   7199  N  N   . LYS B 1 386 ? 80.540  40.956 60.491  1.00 31.67  ? 386  LYS B N   1 
ATOM   7200  C  CA  . LYS B 1 386 ? 81.690  41.682 59.953  1.00 33.10  ? 386  LYS B CA  1 
ATOM   7201  C  C   . LYS B 1 386 ? 81.679  43.142 60.418  1.00 31.45  ? 386  LYS B C   1 
ATOM   7202  O  O   . LYS B 1 386 ? 82.731  43.745 60.620  1.00 30.89  ? 386  LYS B O   1 
ATOM   7203  C  CB  . LYS B 1 386 ? 81.702  41.629 58.420  1.00 32.42  ? 386  LYS B CB  1 
ATOM   7204  C  CG  . LYS B 1 386 ? 82.047  40.269 57.860  1.00 37.63  ? 386  LYS B CG  1 
ATOM   7205  C  CD  . LYS B 1 386 ? 82.077  40.260 56.333  1.00 38.65  ? 386  LYS B CD  1 
ATOM   7206  C  CE  . LYS B 1 386 ? 82.504  38.890 55.810  1.00 40.97  ? 386  LYS B CE  1 
ATOM   7207  N  NZ  . LYS B 1 386 ? 82.399  38.788 54.317  1.00 44.90  ? 386  LYS B NZ  1 
ATOM   7208  N  N   . ASN B 1 387 ? 80.488  43.703 60.582  1.00 28.90  ? 387  ASN B N   1 
ATOM   7209  C  CA  . ASN B 1 387 ? 80.371  45.080 61.031  1.00 30.81  ? 387  ASN B CA  1 
ATOM   7210  C  C   . ASN B 1 387 ? 80.797  45.217 62.489  1.00 31.04  ? 387  ASN B C   1 
ATOM   7211  O  O   . ASN B 1 387 ? 81.370  46.236 62.879  1.00 30.54  ? 387  ASN B O   1 
ATOM   7212  C  CB  . ASN B 1 387 ? 78.938  45.577 60.868  1.00 29.90  ? 387  ASN B CB  1 
ATOM   7213  C  CG  . ASN B 1 387 ? 78.521  45.657 59.422  1.00 32.93  ? 387  ASN B CG  1 
ATOM   7214  O  OD1 . ASN B 1 387 ? 79.312  46.050 58.562  1.00 33.71  ? 387  ASN B OD1 1 
ATOM   7215  N  ND2 . ASN B 1 387 ? 77.273  45.299 59.140  1.00 32.22  ? 387  ASN B ND2 1 
ATOM   7216  N  N   . ARG B 1 388 ? 80.520  44.184 63.283  1.00 29.96  ? 388  ARG B N   1 
ATOM   7217  C  CA  . ARG B 1 388 ? 80.871  44.190 64.693  1.00 30.31  ? 388  ARG B CA  1 
ATOM   7218  C  C   . ARG B 1 388 ? 82.382  44.066 64.828  1.00 30.14  ? 388  ARG B C   1 
ATOM   7219  O  O   . ARG B 1 388 ? 83.038  44.930 65.417  1.00 29.84  ? 388  ARG B O   1 
ATOM   7220  C  CB  . ARG B 1 388 ? 80.187  43.025 65.418  1.00 30.70  ? 388  ARG B CB  1 
ATOM   7221  C  CG  . ARG B 1 388 ? 80.575  42.886 66.886  1.00 29.61  ? 388  ARG B CG  1 
ATOM   7222  C  CD  . ARG B 1 388 ? 80.158  41.537 67.436  1.00 28.39  ? 388  ARG B CD  1 
ATOM   7223  N  NE  . ARG B 1 388 ? 80.915  40.445 66.838  1.00 29.63  ? 388  ARG B NE  1 
ATOM   7224  C  CZ  . ARG B 1 388 ? 80.500  39.180 66.803  1.00 31.40  ? 388  ARG B CZ  1 
ATOM   7225  N  NH1 . ARG B 1 388 ? 81.253  38.247 66.238  1.00 29.84  ? 388  ARG B NH1 1 
ATOM   7226  N  NH2 . ARG B 1 388 ? 79.327  38.848 67.324  1.00 31.02  ? 388  ARG B NH2 1 
ATOM   7227  N  N   . ASP B 1 389 ? 82.923  42.984 64.281  1.00 28.67  ? 389  ASP B N   1 
ATOM   7228  C  CA  . ASP B 1 389 ? 84.354  42.743 64.325  1.00 29.57  ? 389  ASP B CA  1 
ATOM   7229  C  C   . ASP B 1 389 ? 85.107  43.906 63.676  1.00 27.87  ? 389  ASP B C   1 
ATOM   7230  O  O   . ASP B 1 389 ? 86.233  44.224 64.057  1.00 25.32  ? 389  ASP B O   1 
ATOM   7231  C  CB  . ASP B 1 389 ? 84.690  41.429 63.617  1.00 28.08  ? 389  ASP B CB  1 
ATOM   7232  C  CG  . ASP B 1 389 ? 84.080  40.208 64.318  1.00 34.91  ? 389  ASP B CG  1 
ATOM   7233  O  OD1 . ASP B 1 389 ? 83.798  40.282 65.540  1.00 34.15  ? 389  ASP B OD1 1 
ATOM   7234  O  OD2 . ASP B 1 389 ? 83.893  39.165 63.648  1.00 37.40  ? 389  ASP B OD2 1 
ATOM   7235  N  N   . GLY B 1 390 ? 84.471  44.538 62.697  1.00 26.85  ? 390  GLY B N   1 
ATOM   7236  C  CA  . GLY B 1 390 ? 85.089  45.664 62.026  1.00 29.46  ? 390  GLY B CA  1 
ATOM   7237  C  C   . GLY B 1 390 ? 85.308  46.806 63.001  1.00 28.89  ? 390  GLY B C   1 
ATOM   7238  O  O   . GLY B 1 390 ? 86.405  47.362 63.076  1.00 29.79  ? 390  GLY B O   1 
ATOM   7239  N  N   . LEU B 1 391 ? 84.261  47.154 63.746  1.00 28.67  ? 391  LEU B N   1 
ATOM   7240  C  CA  . LEU B 1 391 ? 84.328  48.228 64.734  1.00 29.49  ? 391  LEU B CA  1 
ATOM   7241  C  C   . LEU B 1 391 ? 85.335  47.882 65.831  1.00 28.82  ? 391  LEU B C   1 
ATOM   7242  O  O   . LEU B 1 391 ? 86.052  48.746 66.331  1.00 26.72  ? 391  LEU B O   1 
ATOM   7243  C  CB  . LEU B 1 391 ? 82.942  48.466 65.342  1.00 30.37  ? 391  LEU B CB  1 
ATOM   7244  C  CG  . LEU B 1 391 ? 82.425  49.897 65.198  1.00 34.21  ? 391  LEU B CG  1 
ATOM   7245  C  CD1 . LEU B 1 391 ? 82.595  50.341 63.759  1.00 35.20  ? 391  LEU B CD1 1 
ATOM   7246  C  CD2 . LEU B 1 391 ? 80.963  49.988 65.619  1.00 34.00  ? 391  LEU B CD2 1 
ATOM   7247  N  N   . ASP B 1 392 ? 85.385  46.609 66.197  1.00 30.01  ? 392  ASP B N   1 
ATOM   7248  C  CA  . ASP B 1 392 ? 86.321  46.155 67.213  1.00 32.02  ? 392  ASP B CA  1 
ATOM   7249  C  C   . ASP B 1 392 ? 87.739  46.451 66.737  1.00 31.29  ? 392  ASP B C   1 
ATOM   7250  O  O   . ASP B 1 392 ? 88.553  46.998 67.486  1.00 31.31  ? 392  ASP B O   1 
ATOM   7251  C  CB  . ASP B 1 392 ? 86.140  44.655 67.465  1.00 37.28  ? 392  ASP B CB  1 
ATOM   7252  C  CG  . ASP B 1 392 ? 87.203  44.083 68.388  1.00 45.05  ? 392  ASP B CG  1 
ATOM   7253  O  OD1 . ASP B 1 392 ? 87.372  44.611 69.509  1.00 49.70  ? 392  ASP B OD1 1 
ATOM   7254  O  OD2 . ASP B 1 392 ? 87.872  43.102 67.992  1.00 48.61  ? 392  ASP B OD2 1 
ATOM   7255  N  N   . ASP B 1 393 ? 88.030  46.112 65.482  1.00 29.56  ? 393  ASP B N   1 
ATOM   7256  C  CA  . ASP B 1 393 ? 89.355  46.359 64.932  1.00 27.30  ? 393  ASP B CA  1 
ATOM   7257  C  C   . ASP B 1 393 ? 89.645  47.858 64.846  1.00 25.06  ? 393  ASP B C   1 
ATOM   7258  O  O   . ASP B 1 393 ? 90.754  48.292 65.144  1.00 24.46  ? 393  ASP B O   1 
ATOM   7259  C  CB  . ASP B 1 393 ? 89.507  45.710 63.548  1.00 28.23  ? 393  ASP B CB  1 
ATOM   7260  C  CG  . ASP B 1 393 ? 89.665  44.191 63.621  1.00 31.37  ? 393  ASP B CG  1 
ATOM   7261  O  OD1 . ASP B 1 393 ? 90.427  43.703 64.480  1.00 35.72  ? 393  ASP B OD1 1 
ATOM   7262  O  OD2 . ASP B 1 393 ? 89.043  43.477 62.809  1.00 33.28  ? 393  ASP B OD2 1 
ATOM   7263  N  N   . ILE B 1 394 ? 88.654  48.649 64.448  1.00 22.83  ? 394  ILE B N   1 
ATOM   7264  C  CA  . ILE B 1 394 ? 88.846  50.093 64.346  1.00 23.01  ? 394  ILE B CA  1 
ATOM   7265  C  C   . ILE B 1 394 ? 89.286  50.682 65.683  1.00 22.83  ? 394  ILE B C   1 
ATOM   7266  O  O   . ILE B 1 394 ? 90.304  51.374 65.772  1.00 23.81  ? 394  ILE B O   1 
ATOM   7267  C  CB  . ILE B 1 394 ? 87.546  50.815 63.907  1.00 23.60  ? 394  ILE B CB  1 
ATOM   7268  C  CG1 . ILE B 1 394 ? 87.254  50.527 62.431  1.00 24.73  ? 394  ILE B CG1 1 
ATOM   7269  C  CG2 . ILE B 1 394 ? 87.669  52.315 64.156  1.00 22.45  ? 394  ILE B CG2 1 
ATOM   7270  C  CD1 . ILE B 1 394 ? 86.054  51.272 61.877  1.00 22.73  ? 394  ILE B CD1 1 
ATOM   7271  N  N   . VAL B 1 395 ? 88.502  50.400 66.716  1.00 22.10  ? 395  VAL B N   1 
ATOM   7272  C  CA  . VAL B 1 395 ? 88.766  50.892 68.052  1.00 22.97  ? 395  VAL B CA  1 
ATOM   7273  C  C   . VAL B 1 395 ? 90.108  50.432 68.607  1.00 23.77  ? 395  VAL B C   1 
ATOM   7274  O  O   . VAL B 1 395 ? 90.834  51.221 69.218  1.00 23.84  ? 395  VAL B O   1 
ATOM   7275  C  CB  . VAL B 1 395 ? 87.631  50.472 69.013  1.00 22.68  ? 395  VAL B CB  1 
ATOM   7276  C  CG1 . VAL B 1 395 ? 87.998  50.800 70.441  1.00 21.10  ? 395  VAL B CG1 1 
ATOM   7277  C  CG2 . VAL B 1 395 ? 86.346  51.188 68.622  1.00 22.21  ? 395  VAL B CG2 1 
ATOM   7278  N  N   . GLY B 1 396 ? 90.438  49.162 68.391  1.00 24.95  ? 396  GLY B N   1 
ATOM   7279  C  CA  . GLY B 1 396 ? 91.693  48.632 68.884  1.00 23.31  ? 396  GLY B CA  1 
ATOM   7280  C  C   . GLY B 1 396 ? 92.909  49.142 68.136  1.00 24.25  ? 396  GLY B C   1 
ATOM   7281  O  O   . GLY B 1 396 ? 93.932  49.451 68.749  1.00 24.58  ? 396  GLY B O   1 
ATOM   7282  N  N   . ASP B 1 397 ? 92.810  49.227 66.811  1.00 24.63  ? 397  ASP B N   1 
ATOM   7283  C  CA  . ASP B 1 397 ? 93.930  49.689 65.992  1.00 23.26  ? 397  ASP B CA  1 
ATOM   7284  C  C   . ASP B 1 397 ? 94.241  51.162 66.241  1.00 23.03  ? 397  ASP B C   1 
ATOM   7285  O  O   . ASP B 1 397 ? 95.390  51.536 66.455  1.00 22.31  ? 397  ASP B O   1 
ATOM   7286  C  CB  . ASP B 1 397 ? 93.642  49.488 64.492  1.00 24.27  ? 397  ASP B CB  1 
ATOM   7287  C  CG  . ASP B 1 397 ? 93.562  48.011 64.082  1.00 27.86  ? 397  ASP B CG  1 
ATOM   7288  O  OD1 . ASP B 1 397 ? 94.099  47.141 64.806  1.00 29.17  ? 397  ASP B OD1 1 
ATOM   7289  O  OD2 . ASP B 1 397 ? 92.973  47.723 63.016  1.00 25.21  ? 397  ASP B OD2 1 
ATOM   7290  N  N   . HIS B 1 398 ? 93.208  51.996 66.209  1.00 23.18  ? 398  HIS B N   1 
ATOM   7291  C  CA  . HIS B 1 398 ? 93.370  53.429 66.408  1.00 22.14  ? 398  HIS B CA  1 
ATOM   7292  C  C   . HIS B 1 398 ? 93.871  53.809 67.790  1.00 22.59  ? 398  HIS B C   1 
ATOM   7293  O  O   . HIS B 1 398 ? 94.776  54.620 67.928  1.00 23.07  ? 398  HIS B O   1 
ATOM   7294  C  CB  . HIS B 1 398 ? 92.038  54.142 66.147  1.00 23.61  ? 398  HIS B CB  1 
ATOM   7295  C  CG  . HIS B 1 398 ? 92.059  55.611 66.450  1.00 24.55  ? 398  HIS B CG  1 
ATOM   7296  N  ND1 . HIS B 1 398 ? 93.007  56.469 65.930  1.00 25.93  ? 398  HIS B ND1 1 
ATOM   7297  C  CD2 . HIS B 1 398 ? 91.221  56.382 67.184  1.00 24.91  ? 398  HIS B CD2 1 
ATOM   7298  C  CE1 . HIS B 1 398 ? 92.749  57.703 66.326  1.00 23.73  ? 398  HIS B CE1 1 
ATOM   7299  N  NE2 . HIS B 1 398 ? 91.669  57.679 67.087  1.00 25.41  ? 398  HIS B NE2 1 
ATOM   7300  N  N   . ASN B 1 399 ? 93.285  53.208 68.813  1.00 22.57  ? 399  ASN B N   1 
ATOM   7301  C  CA  . ASN B 1 399 ? 93.628  53.541 70.183  1.00 22.16  ? 399  ASN B CA  1 
ATOM   7302  C  C   . ASN B 1 399 ? 94.797  52.819 70.830  1.00 23.98  ? 399  ASN B C   1 
ATOM   7303  O  O   . ASN B 1 399 ? 95.485  53.394 71.672  1.00 24.51  ? 399  ASN B O   1 
ATOM   7304  C  CB  . ASN B 1 399 ? 92.392  53.357 71.058  1.00 20.46  ? 399  ASN B CB  1 
ATOM   7305  C  CG  . ASN B 1 399 ? 91.291  54.306 70.697  1.00 21.49  ? 399  ASN B CG  1 
ATOM   7306  O  OD1 . ASN B 1 399 ? 91.394  55.503 70.949  1.00 25.96  ? 399  ASN B OD1 1 
ATOM   7307  N  ND2 . ASN B 1 399 ? 90.228  53.789 70.086  1.00 23.43  ? 399  ASN B ND2 1 
ATOM   7308  N  N   . VAL B 1 400 ? 95.031  51.570 70.446  1.00 24.25  ? 400  VAL B N   1 
ATOM   7309  C  CA  . VAL B 1 400 ? 96.095  50.812 71.080  1.00 24.28  ? 400  VAL B CA  1 
ATOM   7310  C  C   . VAL B 1 400 ? 97.170  50.190 70.189  1.00 24.16  ? 400  VAL B C   1 
ATOM   7311  O  O   . VAL B 1 400 ? 98.334  50.563 70.280  1.00 23.23  ? 400  VAL B O   1 
ATOM   7312  C  CB  . VAL B 1 400 ? 95.480  49.702 71.969  1.00 26.82  ? 400  VAL B CB  1 
ATOM   7313  C  CG1 . VAL B 1 400 ? 96.579  48.930 72.698  1.00 26.27  ? 400  VAL B CG1 1 
ATOM   7314  C  CG2 . VAL B 1 400 ? 94.500  50.324 72.958  1.00 25.11  ? 400  VAL B CG2 1 
ATOM   7315  N  N   . ILE B 1 401 ? 96.780  49.250 69.331  1.00 24.28  ? 401  ILE B N   1 
ATOM   7316  C  CA  . ILE B 1 401 ? 97.741  48.554 68.479  1.00 24.65  ? 401  ILE B CA  1 
ATOM   7317  C  C   . ILE B 1 401 ? 98.623  49.404 67.577  1.00 24.62  ? 401  ILE B C   1 
ATOM   7318  O  O   . ILE B 1 401 ? 99.840  49.292 67.626  1.00 24.26  ? 401  ILE B O   1 
ATOM   7319  C  CB  . ILE B 1 401 ? 97.055  47.482 67.595  1.00 25.00  ? 401  ILE B CB  1 
ATOM   7320  C  CG1 . ILE B 1 401 ? 96.360  46.445 68.479  1.00 23.18  ? 401  ILE B CG1 1 
ATOM   7321  C  CG2 . ILE B 1 401 ? 98.093  46.781 66.716  1.00 22.95  ? 401  ILE B CG2 1 
ATOM   7322  C  CD1 . ILE B 1 401 ? 95.575  45.415 67.690  1.00 26.16  ? 401  ILE B CD1 1 
ATOM   7323  N  N   . CYS B 1 402 ? 98.027  50.250 66.753  1.00 24.36  ? 402  CYS B N   1 
ATOM   7324  C  CA  . CYS B 1 402 ? 98.843  51.045 65.856  1.00 27.00  ? 402  CYS B CA  1 
ATOM   7325  C  C   . CYS B 1 402 ? 99.701  52.095 66.560  1.00 28.25  ? 402  CYS B C   1 
ATOM   7326  O  O   . CYS B 1 402 ? 100.848 52.328 66.170  1.00 27.53  ? 402  CYS B O   1 
ATOM   7327  C  CB  . CYS B 1 402 ? 97.969  51.649 64.761  1.00 29.72  ? 402  CYS B CB  1 
ATOM   7328  S  SG  . CYS B 1 402 ? 97.412  50.362 63.594  1.00 33.80  ? 402  CYS B SG  1 
ATOM   7329  N  N   . PRO B 1 403 ? 99.172  52.739 67.611  1.00 27.36  ? 403  PRO B N   1 
ATOM   7330  C  CA  . PRO B 1 403 ? 100.034 53.728 68.269  1.00 27.13  ? 403  PRO B CA  1 
ATOM   7331  C  C   . PRO B 1 403 ? 101.243 53.009 68.885  1.00 27.02  ? 403  PRO B C   1 
ATOM   7332  O  O   . PRO B 1 403 ? 102.358 53.544 68.922  1.00 27.98  ? 403  PRO B O   1 
ATOM   7333  C  CB  . PRO B 1 403 ? 99.116  54.331 69.330  1.00 27.09  ? 403  PRO B CB  1 
ATOM   7334  C  CG  . PRO B 1 403 ? 97.764  54.232 68.690  1.00 24.78  ? 403  PRO B CG  1 
ATOM   7335  C  CD  . PRO B 1 403 ? 97.791  52.836 68.105  1.00 26.11  ? 403  PRO B CD  1 
ATOM   7336  N  N   . LEU B 1 404 ? 101.025 51.786 69.358  1.00 25.05  ? 404  LEU B N   1 
ATOM   7337  C  CA  . LEU B 1 404 ? 102.110 51.033 69.961  1.00 25.38  ? 404  LEU B CA  1 
ATOM   7338  C  C   . LEU B 1 404 ? 103.152 50.604 68.925  1.00 26.41  ? 404  LEU B C   1 
ATOM   7339  O  O   . LEU B 1 404 ? 104.340 50.566 69.229  1.00 26.67  ? 404  LEU B O   1 
ATOM   7340  C  CB  . LEU B 1 404 ? 101.569 49.819 70.719  1.00 26.09  ? 404  LEU B CB  1 
ATOM   7341  C  CG  . LEU B 1 404 ? 102.632 48.995 71.457  1.00 27.05  ? 404  LEU B CG  1 
ATOM   7342  C  CD1 . LEU B 1 404 ? 102.057 48.441 72.739  1.00 25.67  ? 404  LEU B CD1 1 
ATOM   7343  C  CD2 . LEU B 1 404 ? 103.146 47.876 70.557  1.00 25.47  ? 404  LEU B CD2 1 
ATOM   7344  N  N   . MET B 1 405 ? 102.715 50.289 67.708  1.00 26.19  ? 405  MET B N   1 
ATOM   7345  C  CA  . MET B 1 405 ? 103.642 49.894 66.655  1.00 25.82  ? 405  MET B CA  1 
ATOM   7346  C  C   . MET B 1 405 ? 104.470 51.108 66.262  1.00 26.71  ? 405  MET B C   1 
ATOM   7347  O  O   . MET B 1 405 ? 105.671 51.005 66.023  1.00 26.84  ? 405  MET B O   1 
ATOM   7348  C  CB  . MET B 1 405 ? 102.895 49.361 65.427  1.00 23.93  ? 405  MET B CB  1 
ATOM   7349  C  CG  . MET B 1 405 ? 102.237 48.010 65.639  1.00 25.77  ? 405  MET B CG  1 
ATOM   7350  S  SD  . MET B 1 405 ? 103.291 46.836 66.520  1.00 27.28  ? 405  MET B SD  1 
ATOM   7351  C  CE  . MET B 1 405 ? 104.693 46.684 65.388  1.00 27.39  ? 405  MET B CE  1 
ATOM   7352  N  N   . HIS B 1 406 ? 103.819 52.262 66.196  1.00 27.10  ? 406  HIS B N   1 
ATOM   7353  C  CA  . HIS B 1 406 ? 104.510 53.488 65.863  1.00 27.01  ? 406  HIS B CA  1 
ATOM   7354  C  C   . HIS B 1 406 ? 105.647 53.645 66.858  1.00 26.88  ? 406  HIS B C   1 
ATOM   7355  O  O   . HIS B 1 406 ? 106.799 53.857 66.481  1.00 27.44  ? 406  HIS B O   1 
ATOM   7356  C  CB  . HIS B 1 406 ? 103.569 54.676 65.991  1.00 29.29  ? 406  HIS B CB  1 
ATOM   7357  C  CG  . HIS B 1 406 ? 104.185 55.972 65.569  1.00 33.53  ? 406  HIS B CG  1 
ATOM   7358  N  ND1 . HIS B 1 406 ? 104.507 56.248 64.258  1.00 34.15  ? 406  HIS B ND1 1 
ATOM   7359  C  CD2 . HIS B 1 406 ? 104.543 57.065 66.283  1.00 34.72  ? 406  HIS B CD2 1 
ATOM   7360  C  CE1 . HIS B 1 406 ? 105.033 57.458 64.181  1.00 35.26  ? 406  HIS B CE1 1 
ATOM   7361  N  NE2 . HIS B 1 406 ? 105.067 57.975 65.397  1.00 36.80  ? 406  HIS B NE2 1 
ATOM   7362  N  N   . PHE B 1 407 ? 105.305 53.519 68.136  1.00 26.40  ? 407  PHE B N   1 
ATOM   7363  C  CA  . PHE B 1 407 ? 106.268 53.643 69.224  1.00 24.44  ? 407  PHE B CA  1 
ATOM   7364  C  C   . PHE B 1 407 ? 107.401 52.621 69.130  1.00 25.68  ? 407  PHE B C   1 
ATOM   7365  O  O   . PHE B 1 407 ? 108.571 52.983 69.232  1.00 26.47  ? 407  PHE B O   1 
ATOM   7366  C  CB  . PHE B 1 407 ? 105.556 53.494 70.584  1.00 22.23  ? 407  PHE B CB  1 
ATOM   7367  C  CG  . PHE B 1 407 ? 106.490 53.517 71.764  1.00 22.76  ? 407  PHE B CG  1 
ATOM   7368  C  CD1 . PHE B 1 407 ? 107.107 54.699 72.160  1.00 23.60  ? 407  PHE B CD1 1 
ATOM   7369  C  CD2 . PHE B 1 407 ? 106.801 52.344 72.443  1.00 20.54  ? 407  PHE B CD2 1 
ATOM   7370  C  CE1 . PHE B 1 407 ? 108.028 54.712 73.216  1.00 25.33  ? 407  PHE B CE1 1 
ATOM   7371  C  CE2 . PHE B 1 407 ? 107.717 52.344 73.497  1.00 21.73  ? 407  PHE B CE2 1 
ATOM   7372  C  CZ  . PHE B 1 407 ? 108.334 53.529 73.885  1.00 23.27  ? 407  PHE B CZ  1 
ATOM   7373  N  N   . VAL B 1 408 ? 107.060 51.351 68.936  1.00 25.72  ? 408  VAL B N   1 
ATOM   7374  C  CA  . VAL B 1 408 ? 108.076 50.308 68.871  1.00 28.57  ? 408  VAL B CA  1 
ATOM   7375  C  C   . VAL B 1 408 ? 109.050 50.489 67.707  1.00 29.69  ? 408  VAL B C   1 
ATOM   7376  O  O   . VAL B 1 408 ? 110.235 50.183 67.832  1.00 30.91  ? 408  VAL B O   1 
ATOM   7377  C  CB  . VAL B 1 408 ? 107.435 48.902 68.794  1.00 29.62  ? 408  VAL B CB  1 
ATOM   7378  C  CG1 . VAL B 1 408 ? 106.787 48.685 67.450  1.00 30.87  ? 408  VAL B CG1 1 
ATOM   7379  C  CG2 . VAL B 1 408 ? 108.482 47.844 69.049  1.00 34.47  ? 408  VAL B CG2 1 
ATOM   7380  N  N   . ASN B 1 409 ? 108.558 50.992 66.580  1.00 30.84  ? 409  ASN B N   1 
ATOM   7381  C  CA  . ASN B 1 409 ? 109.411 51.211 65.415  1.00 31.29  ? 409  ASN B CA  1 
ATOM   7382  C  C   . ASN B 1 409 ? 110.314 52.419 65.625  1.00 31.67  ? 409  ASN B C   1 
ATOM   7383  O  O   . ASN B 1 409 ? 111.478 52.409 65.230  1.00 32.26  ? 409  ASN B O   1 
ATOM   7384  C  CB  . ASN B 1 409 ? 108.565 51.403 64.150  1.00 30.73  ? 409  ASN B CB  1 
ATOM   7385  C  CG  . ASN B 1 409 ? 108.121 50.082 63.541  1.00 31.86  ? 409  ASN B CG  1 
ATOM   7386  O  OD1 . ASN B 1 409 ? 108.940 49.315 63.038  1.00 32.69  ? 409  ASN B OD1 1 
ATOM   7387  N  ND2 . ASN B 1 409 ? 106.826 49.810 63.590  1.00 29.44  ? 409  ASN B ND2 1 
ATOM   7388  N  N   . LYS B 1 410 ? 109.781 53.462 66.249  1.00 31.22  ? 410  LYS B N   1 
ATOM   7389  C  CA  . LYS B 1 410 ? 110.576 54.656 66.501  1.00 31.75  ? 410  LYS B CA  1 
ATOM   7390  C  C   . LYS B 1 410 ? 111.632 54.369 67.566  1.00 31.26  ? 410  LYS B C   1 
ATOM   7391  O  O   . LYS B 1 410 ? 112.798 54.748 67.426  1.00 31.33  ? 410  LYS B O   1 
ATOM   7392  C  CB  . LYS B 1 410 ? 109.675 55.802 66.964  1.00 33.66  ? 410  LYS B CB  1 
ATOM   7393  C  CG  . LYS B 1 410 ? 108.789 56.379 65.867  1.00 36.05  ? 410  LYS B CG  1 
ATOM   7394  C  CD  . LYS B 1 410 ? 109.621 57.137 64.840  1.00 37.69  ? 410  LYS B CD  1 
ATOM   7395  C  CE  . LYS B 1 410 ? 108.742 57.791 63.786  1.00 38.78  ? 410  LYS B CE  1 
ATOM   7396  N  NZ  . LYS B 1 410 ? 109.556 58.611 62.835  1.00 43.13  ? 410  LYS B NZ  1 
ATOM   7397  N  N   . TYR B 1 411 ? 111.220 53.674 68.619  1.00 29.91  ? 411  TYR B N   1 
ATOM   7398  C  CA  . TYR B 1 411 ? 112.112 53.354 69.725  1.00 29.21  ? 411  TYR B CA  1 
ATOM   7399  C  C   . TYR B 1 411 ? 113.299 52.496 69.305  1.00 29.62  ? 411  TYR B C   1 
ATOM   7400  O  O   . TYR B 1 411 ? 114.445 52.815 69.612  1.00 30.16  ? 411  TYR B O   1 
ATOM   7401  C  CB  . TYR B 1 411 ? 111.343 52.629 70.836  1.00 26.41  ? 411  TYR B CB  1 
ATOM   7402  C  CG  . TYR B 1 411 ? 112.150 52.456 72.105  1.00 25.43  ? 411  TYR B CG  1 
ATOM   7403  C  CD1 . TYR B 1 411 ? 112.291 53.509 73.009  1.00 23.69  ? 411  TYR B CD1 1 
ATOM   7404  C  CD2 . TYR B 1 411 ? 112.840 51.266 72.360  1.00 24.71  ? 411  TYR B CD2 1 
ATOM   7405  C  CE1 . TYR B 1 411 ? 113.108 53.390 74.136  1.00 26.03  ? 411  TYR B CE1 1 
ATOM   7406  C  CE2 . TYR B 1 411 ? 113.660 51.134 73.480  1.00 26.39  ? 411  TYR B CE2 1 
ATOM   7407  C  CZ  . TYR B 1 411 ? 113.794 52.205 74.363  1.00 28.04  ? 411  TYR B CZ  1 
ATOM   7408  O  OH  . TYR B 1 411 ? 114.644 52.107 75.444  1.00 29.08  ? 411  TYR B OH  1 
ATOM   7409  N  N   . THR B 1 412 ? 113.006 51.409 68.600  1.00 30.83  ? 412  THR B N   1 
ATOM   7410  C  CA  . THR B 1 412 ? 114.010 50.459 68.151  1.00 30.16  ? 412  THR B CA  1 
ATOM   7411  C  C   . THR B 1 412 ? 115.165 51.049 67.342  1.00 32.24  ? 412  THR B C   1 
ATOM   7412  O  O   . THR B 1 412 ? 116.223 50.433 67.247  1.00 31.31  ? 412  THR B O   1 
ATOM   7413  C  CB  . THR B 1 412 ? 113.330 49.312 67.360  1.00 30.64  ? 412  THR B CB  1 
ATOM   7414  O  OG1 . THR B 1 412 ? 112.388 48.652 68.214  1.00 28.78  ? 412  THR B OG1 1 
ATOM   7415  C  CG2 . THR B 1 412 ? 114.346 48.288 66.875  1.00 28.61  ? 412  THR B CG2 1 
ATOM   7416  N  N   . LYS B 1 413 ? 114.978 52.234 66.767  1.00 34.47  ? 413  LYS B N   1 
ATOM   7417  C  CA  . LYS B 1 413 ? 116.047 52.865 65.994  1.00 37.77  ? 413  LYS B CA  1 
ATOM   7418  C  C   . LYS B 1 413 ? 117.172 53.346 66.920  1.00 37.67  ? 413  LYS B C   1 
ATOM   7419  O  O   . LYS B 1 413 ? 118.302 53.564 66.470  1.00 38.86  ? 413  LYS B O   1 
ATOM   7420  C  CB  . LYS B 1 413 ? 115.517 54.067 65.190  1.00 41.75  ? 413  LYS B CB  1 
ATOM   7421  C  CG  . LYS B 1 413 ? 114.390 53.757 64.194  1.00 47.47  ? 413  LYS B CG  1 
ATOM   7422  C  CD  . LYS B 1 413 ? 114.838 52.847 63.048  1.00 51.23  ? 413  LYS B CD  1 
ATOM   7423  C  CE  . LYS B 1 413 ? 115.803 53.558 62.110  1.00 54.59  ? 413  LYS B CE  1 
ATOM   7424  N  NZ  . LYS B 1 413 ? 116.285 52.676 61.008  1.00 55.02  ? 413  LYS B NZ  1 
ATOM   7425  N  N   . PHE B 1 414 ? 116.861 53.498 68.208  1.00 35.70  ? 414  PHE B N   1 
ATOM   7426  C  CA  . PHE B 1 414 ? 117.831 53.972 69.200  1.00 34.99  ? 414  PHE B CA  1 
ATOM   7427  C  C   . PHE B 1 414 ? 117.995 53.052 70.406  1.00 34.10  ? 414  PHE B C   1 
ATOM   7428  O  O   . PHE B 1 414 ? 119.020 53.097 71.086  1.00 34.96  ? 414  PHE B O   1 
ATOM   7429  C  CB  . PHE B 1 414 ? 117.422 55.351 69.724  1.00 34.80  ? 414  PHE B CB  1 
ATOM   7430  C  CG  . PHE B 1 414 ? 117.513 56.446 68.709  1.00 36.48  ? 414  PHE B CG  1 
ATOM   7431  C  CD1 . PHE B 1 414 ? 118.732 57.057 68.435  1.00 38.91  ? 414  PHE B CD1 1 
ATOM   7432  C  CD2 . PHE B 1 414 ? 116.377 56.886 68.043  1.00 38.27  ? 414  PHE B CD2 1 
ATOM   7433  C  CE1 . PHE B 1 414 ? 118.818 58.098 67.509  1.00 40.66  ? 414  PHE B CE1 1 
ATOM   7434  C  CE2 . PHE B 1 414 ? 116.449 57.926 67.114  1.00 40.82  ? 414  PHE B CE2 1 
ATOM   7435  C  CZ  . PHE B 1 414 ? 117.673 58.534 66.847  1.00 42.16  ? 414  PHE B CZ  1 
ATOM   7436  N  N   . GLY B 1 415 ? 116.980 52.238 70.687  1.00 33.65  ? 415  GLY B N   1 
ATOM   7437  C  CA  . GLY B 1 415 ? 117.034 51.345 71.837  1.00 31.69  ? 415  GLY B CA  1 
ATOM   7438  C  C   . GLY B 1 415 ? 118.128 50.294 71.807  1.00 31.09  ? 415  GLY B C   1 
ATOM   7439  O  O   . GLY B 1 415 ? 118.877 50.187 70.834  1.00 29.54  ? 415  GLY B O   1 
ATOM   7440  N  N   . ASN B 1 416 ? 118.204 49.501 72.870  1.00 30.61  ? 416  ASN B N   1 
ATOM   7441  C  CA  . ASN B 1 416 ? 119.215 48.462 72.979  1.00 32.02  ? 416  ASN B CA  1 
ATOM   7442  C  C   . ASN B 1 416 ? 118.621 47.051 73.085  1.00 32.55  ? 416  ASN B C   1 
ATOM   7443  O  O   . ASN B 1 416 ? 119.246 46.134 73.627  1.00 31.70  ? 416  ASN B O   1 
ATOM   7444  C  CB  . ASN B 1 416 ? 120.114 48.763 74.188  1.00 34.58  ? 416  ASN B CB  1 
ATOM   7445  C  CG  . ASN B 1 416 ? 121.282 47.797 74.309  1.00 37.26  ? 416  ASN B CG  1 
ATOM   7446  O  OD1 . ASN B 1 416 ? 121.319 46.974 75.225  1.00 37.68  ? 416  ASN B OD1 1 
ATOM   7447  N  ND2 . ASN B 1 416 ? 122.232 47.893 73.383  1.00 39.90  ? 416  ASN B ND2 1 
ATOM   7448  N  N   . GLY B 1 417 ? 117.412 46.875 72.562  1.00 32.99  ? 417  GLY B N   1 
ATOM   7449  C  CA  . GLY B 1 417 ? 116.781 45.565 72.600  1.00 32.79  ? 417  GLY B CA  1 
ATOM   7450  C  C   . GLY B 1 417 ? 115.273 45.593 72.763  1.00 31.76  ? 417  GLY B C   1 
ATOM   7451  O  O   . GLY B 1 417 ? 114.777 45.832 73.856  1.00 34.64  ? 417  GLY B O   1 
ATOM   7452  N  N   . THR B 1 418 ? 114.541 45.337 71.685  1.00 30.12  ? 418  THR B N   1 
ATOM   7453  C  CA  . THR B 1 418 ? 113.083 45.337 71.730  1.00 27.89  ? 418  THR B CA  1 
ATOM   7454  C  C   . THR B 1 418 ? 112.476 43.942 71.532  1.00 27.80  ? 418  THR B C   1 
ATOM   7455  O  O   . THR B 1 418 ? 112.916 43.187 70.668  1.00 25.98  ? 418  THR B O   1 
ATOM   7456  C  CB  . THR B 1 418 ? 112.497 46.267 70.638  1.00 27.85  ? 418  THR B CB  1 
ATOM   7457  O  OG1 . THR B 1 418 ? 112.964 47.607 70.840  1.00 29.26  ? 418  THR B OG1 1 
ATOM   7458  C  CG2 . THR B 1 418 ? 110.965 46.257 70.686  1.00 27.93  ? 418  THR B CG2 1 
ATOM   7459  N  N   . TYR B 1 419 ? 111.473 43.604 72.342  1.00 26.91  ? 419  TYR B N   1 
ATOM   7460  C  CA  . TYR B 1 419 ? 110.768 42.325 72.216  1.00 30.17  ? 419  TYR B CA  1 
ATOM   7461  C  C   . TYR B 1 419 ? 109.264 42.611 72.140  1.00 30.73  ? 419  TYR B C   1 
ATOM   7462  O  O   . TYR B 1 419 ? 108.692 43.187 73.065  1.00 32.44  ? 419  TYR B O   1 
ATOM   7463  C  CB  . TYR B 1 419 ? 111.068 41.395 73.399  1.00 29.53  ? 419  TYR B CB  1 
ATOM   7464  C  CG  . TYR B 1 419 ? 112.518 40.975 73.480  1.00 30.62  ? 419  TYR B CG  1 
ATOM   7465  C  CD1 . TYR B 1 419 ? 113.457 41.766 74.145  1.00 27.68  ? 419  TYR B CD1 1 
ATOM   7466  C  CD2 . TYR B 1 419 ? 112.961 39.805 72.858  1.00 30.29  ? 419  TYR B CD2 1 
ATOM   7467  C  CE1 . TYR B 1 419 ? 114.793 41.407 74.191  1.00 27.82  ? 419  TYR B CE1 1 
ATOM   7468  C  CE2 . TYR B 1 419 ? 114.307 39.435 72.894  1.00 28.56  ? 419  TYR B CE2 1 
ATOM   7469  C  CZ  . TYR B 1 419 ? 115.216 40.242 73.565  1.00 29.42  ? 419  TYR B CZ  1 
ATOM   7470  O  OH  . TYR B 1 419 ? 116.548 39.894 73.612  1.00 28.84  ? 419  TYR B OH  1 
ATOM   7471  N  N   . LEU B 1 420 ? 108.636 42.224 71.033  1.00 28.25  ? 420  LEU B N   1 
ATOM   7472  C  CA  . LEU B 1 420 ? 107.210 42.466 70.822  1.00 27.37  ? 420  LEU B CA  1 
ATOM   7473  C  C   . LEU B 1 420 ? 106.383 41.187 70.934  1.00 27.58  ? 420  LEU B C   1 
ATOM   7474  O  O   . LEU B 1 420 ? 106.806 40.131 70.463  1.00 29.21  ? 420  LEU B O   1 
ATOM   7475  C  CB  . LEU B 1 420 ? 106.999 43.099 69.440  1.00 26.36  ? 420  LEU B CB  1 
ATOM   7476  C  CG  . LEU B 1 420 ? 105.590 43.516 69.007  1.00 26.62  ? 420  LEU B CG  1 
ATOM   7477  C  CD1 . LEU B 1 420 ? 105.028 44.519 70.004  1.00 24.68  ? 420  LEU B CD1 1 
ATOM   7478  C  CD2 . LEU B 1 420 ? 105.631 44.125 67.609  1.00 22.80  ? 420  LEU B CD2 1 
ATOM   7479  N  N   . TYR B 1 421 ? 105.211 41.283 71.563  1.00 26.00  ? 421  TYR B N   1 
ATOM   7480  C  CA  . TYR B 1 421 ? 104.328 40.131 71.725  1.00 25.65  ? 421  TYR B CA  1 
ATOM   7481  C  C   . TYR B 1 421 ? 102.888 40.443 71.293  1.00 26.77  ? 421  TYR B C   1 
ATOM   7482  O  O   . TYR B 1 421 ? 102.467 41.604 71.263  1.00 25.02  ? 421  TYR B O   1 
ATOM   7483  C  CB  . TYR B 1 421 ? 104.346 39.630 73.184  1.00 25.17  ? 421  TYR B CB  1 
ATOM   7484  C  CG  . TYR B 1 421 ? 103.566 40.483 74.175  1.00 27.70  ? 421  TYR B CG  1 
ATOM   7485  C  CD1 . TYR B 1 421 ? 102.168 40.501 74.167  1.00 28.60  ? 421  TYR B CD1 1 
ATOM   7486  C  CD2 . TYR B 1 421 ? 104.225 41.297 75.099  1.00 26.09  ? 421  TYR B CD2 1 
ATOM   7487  C  CE1 . TYR B 1 421 ? 101.446 41.312 75.049  1.00 28.04  ? 421  TYR B CE1 1 
ATOM   7488  C  CE2 . TYR B 1 421 ? 103.519 42.109 75.981  1.00 26.41  ? 421  TYR B CE2 1 
ATOM   7489  C  CZ  . TYR B 1 421 ? 102.127 42.113 75.950  1.00 28.58  ? 421  TYR B CZ  1 
ATOM   7490  O  OH  . TYR B 1 421 ? 101.418 42.918 76.813  1.00 25.78  ? 421  TYR B OH  1 
ATOM   7491  N  N   . PHE B 1 422 ? 102.150 39.390 70.949  1.00 26.81  ? 422  PHE B N   1 
ATOM   7492  C  CA  . PHE B 1 422 ? 100.748 39.492 70.542  1.00 27.54  ? 422  PHE B CA  1 
ATOM   7493  C  C   . PHE B 1 422 ? 99.995  38.461 71.375  1.00 27.54  ? 422  PHE B C   1 
ATOM   7494  O  O   . PHE B 1 422 ? 100.074 37.258 71.109  1.00 28.48  ? 422  PHE B O   1 
ATOM   7495  C  CB  . PHE B 1 422 ? 100.576 39.156 69.055  1.00 27.37  ? 422  PHE B CB  1 
ATOM   7496  C  CG  . PHE B 1 422 ? 99.181  39.402 68.529  1.00 28.06  ? 422  PHE B CG  1 
ATOM   7497  C  CD1 . PHE B 1 422 ? 98.681  40.699 68.424  1.00 26.61  ? 422  PHE B CD1 1 
ATOM   7498  C  CD2 . PHE B 1 422 ? 98.378  38.340 68.115  1.00 30.01  ? 422  PHE B CD2 1 
ATOM   7499  C  CE1 . PHE B 1 422 ? 97.409  40.941 67.912  1.00 26.57  ? 422  PHE B CE1 1 
ATOM   7500  C  CE2 . PHE B 1 422 ? 97.092  38.568 67.598  1.00 30.12  ? 422  PHE B CE2 1 
ATOM   7501  C  CZ  . PHE B 1 422 ? 96.609  39.876 67.496  1.00 28.48  ? 422  PHE B CZ  1 
ATOM   7502  N  N   . PHE B 1 423 ? 99.280  38.931 72.390  1.00 27.24  ? 423  PHE B N   1 
ATOM   7503  C  CA  . PHE B 1 423 ? 98.528  38.042 73.264  1.00 27.95  ? 423  PHE B CA  1 
ATOM   7504  C  C   . PHE B 1 423 ? 97.161  37.756 72.668  1.00 27.56  ? 423  PHE B C   1 
ATOM   7505  O  O   . PHE B 1 423 ? 96.344  38.667 72.523  1.00 28.08  ? 423  PHE B O   1 
ATOM   7506  C  CB  . PHE B 1 423 ? 98.351  38.679 74.640  1.00 27.43  ? 423  PHE B CB  1 
ATOM   7507  C  CG  . PHE B 1 423 ? 97.728  37.767 75.641  1.00 29.91  ? 423  PHE B CG  1 
ATOM   7508  C  CD1 . PHE B 1 423 ? 98.488  36.788 76.270  1.00 28.00  ? 423  PHE B CD1 1 
ATOM   7509  C  CD2 . PHE B 1 423 ? 96.367  37.858 75.932  1.00 27.39  ? 423  PHE B CD2 1 
ATOM   7510  C  CE1 . PHE B 1 423 ? 97.904  35.911 77.176  1.00 29.46  ? 423  PHE B CE1 1 
ATOM   7511  C  CE2 . PHE B 1 423 ? 95.773  36.985 76.835  1.00 27.63  ? 423  PHE B CE2 1 
ATOM   7512  C  CZ  . PHE B 1 423 ? 96.539  36.009 77.459  1.00 28.98  ? 423  PHE B CZ  1 
ATOM   7513  N  N   . ASN B 1 424 ? 96.910  36.497 72.323  1.00 26.98  ? 424  ASN B N   1 
ATOM   7514  C  CA  . ASN B 1 424 ? 95.628  36.137 71.734  1.00 31.32  ? 424  ASN B CA  1 
ATOM   7515  C  C   . ASN B 1 424 ? 94.977  34.884 72.317  1.00 31.99  ? 424  ASN B C   1 
ATOM   7516  O  O   . ASN B 1 424 ? 94.414  34.069 71.588  1.00 32.89  ? 424  ASN B O   1 
ATOM   7517  C  CB  . ASN B 1 424 ? 95.770  35.999 70.215  1.00 30.70  ? 424  ASN B CB  1 
ATOM   7518  C  CG  . ASN B 1 424 ? 96.792  34.964 69.815  1.00 31.60  ? 424  ASN B CG  1 
ATOM   7519  O  OD1 . ASN B 1 424 ? 97.568  34.488 70.637  1.00 31.46  ? 424  ASN B OD1 1 
ATOM   7520  N  ND2 . ASN B 1 424 ? 96.809  34.618 68.534  1.00 33.51  ? 424  ASN B ND2 1 
ATOM   7521  N  N   . HIS B 1 425 ? 95.057  34.736 73.636  1.00 33.06  ? 425  HIS B N   1 
ATOM   7522  C  CA  . HIS B 1 425 ? 94.451  33.591 74.299  1.00 33.58  ? 425  HIS B CA  1 
ATOM   7523  C  C   . HIS B 1 425 ? 93.219  34.000 75.078  1.00 35.37  ? 425  HIS B C   1 
ATOM   7524  O  O   . HIS B 1 425 ? 93.274  34.896 75.926  1.00 35.95  ? 425  HIS B O   1 
ATOM   7525  C  CB  . HIS B 1 425 ? 95.414  32.927 75.270  1.00 32.86  ? 425  HIS B CB  1 
ATOM   7526  C  CG  . HIS B 1 425 ? 94.790  31.810 76.045  1.00 33.74  ? 425  HIS B CG  1 
ATOM   7527  N  ND1 . HIS B 1 425 ? 94.466  30.599 75.473  1.00 34.30  ? 425  HIS B ND1 1 
ATOM   7528  C  CD2 . HIS B 1 425 ? 94.394  31.734 77.337  1.00 33.45  ? 425  HIS B CD2 1 
ATOM   7529  C  CE1 . HIS B 1 425 ? 93.898  29.823 76.379  1.00 35.02  ? 425  HIS B CE1 1 
ATOM   7530  N  NE2 . HIS B 1 425 ? 93.841  30.489 77.518  1.00 36.35  ? 425  HIS B NE2 1 
ATOM   7531  N  N   . ARG B 1 426 ? 92.113  33.327 74.785  1.00 37.25  ? 426  ARG B N   1 
ATOM   7532  C  CA  . ARG B 1 426 ? 90.834  33.569 75.441  1.00 39.08  ? 426  ARG B CA  1 
ATOM   7533  C  C   . ARG B 1 426 ? 90.718  32.604 76.616  1.00 38.42  ? 426  ARG B C   1 
ATOM   7534  O  O   . ARG B 1 426 ? 90.564  31.401 76.419  1.00 39.87  ? 426  ARG B O   1 
ATOM   7535  C  CB  . ARG B 1 426 ? 89.704  33.331 74.433  1.00 41.11  ? 426  ARG B CB  1 
ATOM   7536  C  CG  . ARG B 1 426 ? 88.339  33.062 75.031  1.00 42.39  ? 426  ARG B CG  1 
ATOM   7537  C  CD  . ARG B 1 426 ? 87.499  34.310 75.160  1.00 44.18  ? 426  ARG B CD  1 
ATOM   7538  N  NE  . ARG B 1 426 ? 86.161  33.976 75.645  1.00 44.92  ? 426  ARG B NE  1 
ATOM   7539  C  CZ  . ARG B 1 426 ? 85.168  34.847 75.791  1.00 45.66  ? 426  ARG B CZ  1 
ATOM   7540  N  NH1 . ARG B 1 426 ? 83.992  34.426 76.243  1.00 46.81  ? 426  ARG B NH1 1 
ATOM   7541  N  NH2 . ARG B 1 426 ? 85.343  36.131 75.485  1.00 42.97  ? 426  ARG B NH2 1 
ATOM   7542  N  N   . ALA B 1 427 ? 90.802  33.126 77.836  1.00 38.93  ? 427  ALA B N   1 
ATOM   7543  C  CA  . ALA B 1 427 ? 90.712  32.286 79.027  1.00 40.81  ? 427  ALA B CA  1 
ATOM   7544  C  C   . ALA B 1 427 ? 89.446  31.434 78.990  1.00 41.99  ? 427  ALA B C   1 
ATOM   7545  O  O   . ALA B 1 427 ? 88.374  31.905 78.609  1.00 42.05  ? 427  ALA B O   1 
ATOM   7546  C  CB  . ALA B 1 427 ? 90.735  33.147 80.287  1.00 41.41  ? 427  ALA B CB  1 
ATOM   7547  N  N   . SER B 1 428 ? 89.578  30.176 79.391  1.00 42.67  ? 428  SER B N   1 
ATOM   7548  C  CA  . SER B 1 428 ? 88.455  29.246 79.385  1.00 43.97  ? 428  SER B CA  1 
ATOM   7549  C  C   . SER B 1 428 ? 87.359  29.592 80.391  1.00 44.10  ? 428  SER B C   1 
ATOM   7550  O  O   . SER B 1 428 ? 86.233  29.107 80.279  1.00 45.01  ? 428  SER B O   1 
ATOM   7551  C  CB  . SER B 1 428 ? 88.960  27.829 79.660  1.00 44.82  ? 428  SER B CB  1 
ATOM   7552  O  OG  . SER B 1 428 ? 89.591  27.758 80.928  1.00 45.56  ? 428  SER B OG  1 
ATOM   7553  N  N   . ASN B 1 429 ? 87.684  30.427 81.371  1.00 43.73  ? 429  ASN B N   1 
ATOM   7554  C  CA  . ASN B 1 429 ? 86.714  30.807 82.392  1.00 42.64  ? 429  ASN B CA  1 
ATOM   7555  C  C   . ASN B 1 429 ? 86.306  32.284 82.331  1.00 42.21  ? 429  ASN B C   1 
ATOM   7556  O  O   . ASN B 1 429 ? 85.949  32.874 83.354  1.00 40.90  ? 429  ASN B O   1 
ATOM   7557  C  CB  . ASN B 1 429 ? 87.278  30.501 83.782  1.00 42.54  ? 429  ASN B CB  1 
ATOM   7558  C  CG  . ASN B 1 429 ? 88.593  31.219 84.048  1.00 41.94  ? 429  ASN B CG  1 
ATOM   7559  O  OD1 . ASN B 1 429 ? 88.916  32.218 83.394  1.00 39.03  ? 429  ASN B OD1 1 
ATOM   7560  N  ND2 . ASN B 1 429 ? 89.352  30.720 85.016  1.00 41.09  ? 429  ASN B ND2 1 
ATOM   7561  N  N   . LEU B 1 430 ? 86.358  32.879 81.143  1.00 42.01  ? 430  LEU B N   1 
ATOM   7562  C  CA  . LEU B 1 430 ? 85.982  34.284 80.989  1.00 42.01  ? 430  LEU B CA  1 
ATOM   7563  C  C   . LEU B 1 430 ? 84.471  34.438 81.182  1.00 41.72  ? 430  LEU B C   1 
ATOM   7564  O  O   . LEU B 1 430 ? 83.679  33.660 80.638  1.00 41.74  ? 430  LEU B O   1 
ATOM   7565  C  CB  . LEU B 1 430 ? 86.386  34.805 79.604  1.00 42.82  ? 430  LEU B CB  1 
ATOM   7566  C  CG  . LEU B 1 430 ? 86.721  36.302 79.578  1.00 42.35  ? 430  LEU B CG  1 
ATOM   7567  C  CD1 . LEU B 1 430 ? 87.999  36.523 80.373  1.00 43.04  ? 430  LEU B CD1 1 
ATOM   7568  C  CD2 . LEU B 1 430 ? 86.908  36.791 78.153  1.00 41.94  ? 430  LEU B CD2 1 
ATOM   7569  N  N   . VAL B 1 431 ? 84.077  35.440 81.961  1.00 39.48  ? 431  VAL B N   1 
ATOM   7570  C  CA  . VAL B 1 431 ? 82.670  35.679 82.239  1.00 38.40  ? 431  VAL B CA  1 
ATOM   7571  C  C   . VAL B 1 431 ? 82.047  36.615 81.221  1.00 37.09  ? 431  VAL B C   1 
ATOM   7572  O  O   . VAL B 1 431 ? 80.830  36.807 81.203  1.00 37.56  ? 431  VAL B O   1 
ATOM   7573  C  CB  . VAL B 1 431 ? 82.476  36.274 83.651  1.00 40.84  ? 431  VAL B CB  1 
ATOM   7574  C  CG1 . VAL B 1 431 ? 82.898  35.256 84.699  1.00 40.01  ? 431  VAL B CG1 1 
ATOM   7575  C  CG2 . VAL B 1 431 ? 83.288  37.564 83.792  1.00 39.64  ? 431  VAL B CG2 1 
ATOM   7576  N  N   . TRP B 1 432 ? 82.888  37.207 80.382  1.00 35.56  ? 432  TRP B N   1 
ATOM   7577  C  CA  . TRP B 1 432 ? 82.419  38.115 79.344  1.00 33.63  ? 432  TRP B CA  1 
ATOM   7578  C  C   . TRP B 1 432 ? 82.011  37.322 78.107  1.00 33.98  ? 432  TRP B C   1 
ATOM   7579  O  O   . TRP B 1 432 ? 82.518  36.221 77.865  1.00 31.99  ? 432  TRP B O   1 
ATOM   7580  C  CB  . TRP B 1 432 ? 83.515  39.108 78.964  1.00 32.73  ? 432  TRP B CB  1 
ATOM   7581  C  CG  . TRP B 1 432 ? 83.800  40.130 80.016  1.00 33.13  ? 432  TRP B CG  1 
ATOM   7582  C  CD1 . TRP B 1 432 ? 84.841  40.136 80.897  1.00 32.33  ? 432  TRP B CD1 1 
ATOM   7583  C  CD2 . TRP B 1 432 ? 83.033  41.307 80.291  1.00 30.27  ? 432  TRP B CD2 1 
ATOM   7584  N  NE1 . TRP B 1 432 ? 84.771  41.248 81.702  1.00 30.82  ? 432  TRP B NE1 1 
ATOM   7585  C  CE2 . TRP B 1 432 ? 83.671  41.983 81.351  1.00 30.97  ? 432  TRP B CE2 1 
ATOM   7586  C  CE3 . TRP B 1 432 ? 81.870  41.855 79.743  1.00 31.07  ? 432  TRP B CE3 1 
ATOM   7587  C  CZ2 . TRP B 1 432 ? 83.185  43.183 81.877  1.00 32.62  ? 432  TRP B CZ2 1 
ATOM   7588  C  CZ3 . TRP B 1 432 ? 81.382  43.050 80.267  1.00 32.12  ? 432  TRP B CZ3 1 
ATOM   7589  C  CH2 . TRP B 1 432 ? 82.042  43.701 81.324  1.00 31.86  ? 432  TRP B CH2 1 
ATOM   7590  N  N   . PRO B 1 433 ? 81.098  37.880 77.296  1.00 33.90  ? 433  PRO B N   1 
ATOM   7591  C  CA  . PRO B 1 433 ? 80.638  37.197 76.083  1.00 34.14  ? 433  PRO B CA  1 
ATOM   7592  C  C   . PRO B 1 433 ? 81.744  36.851 75.086  1.00 35.67  ? 433  PRO B C   1 
ATOM   7593  O  O   . PRO B 1 433 ? 82.772  37.527 75.005  1.00 35.84  ? 433  PRO B O   1 
ATOM   7594  C  CB  . PRO B 1 433 ? 79.601  38.165 75.516  1.00 32.35  ? 433  PRO B CB  1 
ATOM   7595  C  CG  . PRO B 1 433 ? 80.078  39.495 75.994  1.00 33.16  ? 433  PRO B CG  1 
ATOM   7596  C  CD  . PRO B 1 433 ? 80.489  39.215 77.411  1.00 31.61  ? 433  PRO B CD  1 
ATOM   7597  N  N   . GLU B 1 434 ? 81.506  35.785 74.330  1.00 37.09  ? 434  GLU B N   1 
ATOM   7598  C  CA  . GLU B 1 434 ? 82.433  35.272 73.326  1.00 37.78  ? 434  GLU B CA  1 
ATOM   7599  C  C   . GLU B 1 434 ? 82.786  36.287 72.238  1.00 36.15  ? 434  GLU B C   1 
ATOM   7600  O  O   . GLU B 1 434 ? 83.912  36.303 71.741  1.00 33.87  ? 434  GLU B O   1 
ATOM   7601  C  CB  . GLU B 1 434 ? 81.820  34.032 72.670  1.00 42.44  ? 434  GLU B CB  1 
ATOM   7602  C  CG  . GLU B 1 434 ? 82.731  33.267 71.725  1.00 49.83  ? 434  GLU B CG  1 
ATOM   7603  C  CD  . GLU B 1 434 ? 83.717  32.378 72.464  1.00 54.58  ? 434  GLU B CD  1 
ATOM   7604  O  OE1 . GLU B 1 434 ? 83.298  31.742 73.458  1.00 57.86  ? 434  GLU B OE1 1 
ATOM   7605  O  OE2 . GLU B 1 434 ? 84.898  32.303 72.047  1.00 54.76  ? 434  GLU B OE2 1 
ATOM   7606  N  N   . TRP B 1 435 ? 81.834  37.132 71.860  1.00 34.09  ? 435  TRP B N   1 
ATOM   7607  C  CA  . TRP B 1 435 ? 82.105  38.104 70.807  1.00 34.01  ? 435  TRP B CA  1 
ATOM   7608  C  C   . TRP B 1 435 ? 83.165  39.130 71.187  1.00 32.71  ? 435  TRP B C   1 
ATOM   7609  O  O   . TRP B 1 435 ? 83.766  39.751 70.317  1.00 34.79  ? 435  TRP B O   1 
ATOM   7610  C  CB  . TRP B 1 435 ? 80.823  38.835 70.369  1.00 31.51  ? 435  TRP B CB  1 
ATOM   7611  C  CG  . TRP B 1 435 ? 80.267  39.802 71.376  1.00 31.64  ? 435  TRP B CG  1 
ATOM   7612  C  CD1 . TRP B 1 435 ? 79.292  39.554 72.298  1.00 32.45  ? 435  TRP B CD1 1 
ATOM   7613  C  CD2 . TRP B 1 435 ? 80.669  41.165 71.576  1.00 30.07  ? 435  TRP B CD2 1 
ATOM   7614  N  NE1 . TRP B 1 435 ? 79.062  40.673 73.061  1.00 31.04  ? 435  TRP B NE1 1 
ATOM   7615  C  CE2 . TRP B 1 435 ? 79.892  41.677 72.641  1.00 30.13  ? 435  TRP B CE2 1 
ATOM   7616  C  CE3 . TRP B 1 435 ? 81.611  42.000 70.963  1.00 28.68  ? 435  TRP B CE3 1 
ATOM   7617  C  CZ2 . TRP B 1 435 ? 80.027  42.990 73.109  1.00 29.36  ? 435  TRP B CZ2 1 
ATOM   7618  C  CZ3 . TRP B 1 435 ? 81.750  43.303 71.426  1.00 30.11  ? 435  TRP B CZ3 1 
ATOM   7619  C  CH2 . TRP B 1 435 ? 80.959  43.786 72.492  1.00 30.88  ? 435  TRP B CH2 1 
ATOM   7620  N  N   . MET B 1 436 ? 83.404  39.308 72.479  1.00 31.26  ? 436  MET B N   1 
ATOM   7621  C  CA  . MET B 1 436 ? 84.392  40.285 72.916  1.00 29.50  ? 436  MET B CA  1 
ATOM   7622  C  C   . MET B 1 436 ? 85.830  39.811 72.727  1.00 28.36  ? 436  MET B C   1 
ATOM   7623  O  O   . MET B 1 436 ? 86.759  40.618 72.747  1.00 27.31  ? 436  MET B O   1 
ATOM   7624  C  CB  . MET B 1 436 ? 84.127  40.676 74.369  1.00 29.08  ? 436  MET B CB  1 
ATOM   7625  C  CG  . MET B 1 436 ? 82.777  41.354 74.544  1.00 29.33  ? 436  MET B CG  1 
ATOM   7626  S  SD  . MET B 1 436 ? 82.405  41.836 76.227  1.00 29.10  ? 436  MET B SD  1 
ATOM   7627  C  CE  . MET B 1 436 ? 83.223  43.417 76.301  1.00 27.52  ? 436  MET B CE  1 
ATOM   7628  N  N   . GLY B 1 437 ? 86.004  38.504 72.546  1.00 27.60  ? 437  GLY B N   1 
ATOM   7629  C  CA  . GLY B 1 437 ? 87.324  37.935 72.308  1.00 26.85  ? 437  GLY B CA  1 
ATOM   7630  C  C   . GLY B 1 437 ? 88.365  38.047 73.406  1.00 26.72  ? 437  GLY B C   1 
ATOM   7631  O  O   . GLY B 1 437 ? 88.064  37.864 74.586  1.00 26.71  ? 437  GLY B O   1 
ATOM   7632  N  N   . VAL B 1 438 ? 89.607  38.318 73.011  1.00 25.39  ? 438  VAL B N   1 
ATOM   7633  C  CA  . VAL B 1 438 ? 90.697  38.466 73.972  1.00 26.81  ? 438  VAL B CA  1 
ATOM   7634  C  C   . VAL B 1 438 ? 90.671  39.928 74.427  1.00 26.92  ? 438  VAL B C   1 
ATOM   7635  O  O   . VAL B 1 438 ? 91.256  40.809 73.794  1.00 27.39  ? 438  VAL B O   1 
ATOM   7636  C  CB  . VAL B 1 438 ? 92.044  38.122 73.322  1.00 27.01  ? 438  VAL B CB  1 
ATOM   7637  C  CG1 . VAL B 1 438 ? 93.122  38.009 74.382  1.00 26.58  ? 438  VAL B CG1 1 
ATOM   7638  C  CG2 . VAL B 1 438 ? 91.925  36.810 72.568  1.00 26.69  ? 438  VAL B CG2 1 
ATOM   7639  N  N   . ILE B 1 439 ? 89.976  40.154 75.537  1.00 27.10  ? 439  ILE B N   1 
ATOM   7640  C  CA  . ILE B 1 439 ? 89.754  41.473 76.118  1.00 27.52  ? 439  ILE B CA  1 
ATOM   7641  C  C   . ILE B 1 439 ? 90.924  42.282 76.668  1.00 28.45  ? 439  ILE B C   1 
ATOM   7642  O  O   . ILE B 1 439 ? 91.900  41.750 77.214  1.00 25.27  ? 439  ILE B O   1 
ATOM   7643  C  CB  . ILE B 1 439 ? 88.698  41.374 77.234  1.00 28.79  ? 439  ILE B CB  1 
ATOM   7644  C  CG1 . ILE B 1 439 ? 87.472  40.621 76.716  1.00 28.91  ? 439  ILE B CG1 1 
ATOM   7645  C  CG2 . ILE B 1 439 ? 88.273  42.769 77.692  1.00 28.07  ? 439  ILE B CG2 1 
ATOM   7646  C  CD1 . ILE B 1 439 ? 86.474  40.305 77.805  1.00 30.85  ? 439  ILE B CD1 1 
ATOM   7647  N  N   . HIS B 1 440 ? 90.783  43.594 76.521  1.00 30.25  ? 440  HIS B N   1 
ATOM   7648  C  CA  . HIS B 1 440 ? 91.754  44.569 76.996  1.00 32.49  ? 440  HIS B CA  1 
ATOM   7649  C  C   . HIS B 1 440 ? 91.948  44.349 78.500  1.00 32.60  ? 440  HIS B C   1 
ATOM   7650  O  O   . HIS B 1 440 ? 91.006  44.494 79.276  1.00 30.73  ? 440  HIS B O   1 
ATOM   7651  C  CB  . HIS B 1 440 ? 91.201  45.972 76.726  1.00 35.85  ? 440  HIS B CB  1 
ATOM   7652  C  CG  . HIS B 1 440 ? 92.065  47.089 77.225  1.00 43.00  ? 440  HIS B CG  1 
ATOM   7653  N  ND1 . HIS B 1 440 ? 93.324  47.344 76.722  1.00 46.75  ? 440  HIS B ND1 1 
ATOM   7654  C  CD2 . HIS B 1 440 ? 91.827  48.057 78.143  1.00 45.56  ? 440  HIS B CD2 1 
ATOM   7655  C  CE1 . HIS B 1 440 ? 93.822  48.421 77.305  1.00 47.47  ? 440  HIS B CE1 1 
ATOM   7656  N  NE2 . HIS B 1 440 ? 92.933  48.873 78.172  1.00 47.75  ? 440  HIS B NE2 1 
ATOM   7657  N  N   . GLY B 1 441 ? 93.159  43.962 78.897  1.00 32.38  ? 441  GLY B N   1 
ATOM   7658  C  CA  . GLY B 1 441 ? 93.450  43.757 80.308  1.00 32.23  ? 441  GLY B CA  1 
ATOM   7659  C  C   . GLY B 1 441 ? 93.418  42.342 80.865  1.00 32.38  ? 441  GLY B C   1 
ATOM   7660  O  O   . GLY B 1 441 ? 93.872  42.112 81.984  1.00 32.27  ? 441  GLY B O   1 
ATOM   7661  N  N   . TYR B 1 442 ? 92.902  41.383 80.107  1.00 32.14  ? 442  TYR B N   1 
ATOM   7662  C  CA  . TYR B 1 442 ? 92.831  40.029 80.624  1.00 31.41  ? 442  TYR B CA  1 
ATOM   7663  C  C   . TYR B 1 442 ? 94.094  39.189 80.492  1.00 31.70  ? 442  TYR B C   1 
ATOM   7664  O  O   . TYR B 1 442 ? 94.070  37.983 80.725  1.00 32.20  ? 442  TYR B O   1 
ATOM   7665  C  CB  . TYR B 1 442 ? 91.598  39.314 80.055  1.00 32.04  ? 442  TYR B CB  1 
ATOM   7666  C  CG  . TYR B 1 442 ? 90.342  39.785 80.763  1.00 33.54  ? 442  TYR B CG  1 
ATOM   7667  C  CD1 . TYR B 1 442 ? 89.854  41.082 80.571  1.00 35.14  ? 442  TYR B CD1 1 
ATOM   7668  C  CD2 . TYR B 1 442 ? 89.741  39.002 81.744  1.00 34.13  ? 442  TYR B CD2 1 
ATOM   7669  C  CE1 . TYR B 1 442 ? 88.812  41.589 81.354  1.00 35.32  ? 442  TYR B CE1 1 
ATOM   7670  C  CE2 . TYR B 1 442 ? 88.704  39.495 82.530  1.00 36.03  ? 442  TYR B CE2 1 
ATOM   7671  C  CZ  . TYR B 1 442 ? 88.248  40.790 82.336  1.00 37.13  ? 442  TYR B CZ  1 
ATOM   7672  O  OH  . TYR B 1 442 ? 87.265  41.295 83.162  1.00 38.53  ? 442  TYR B OH  1 
ATOM   7673  N  N   . GLU B 1 443 ? 95.205  39.829 80.135  1.00 31.01  ? 443  GLU B N   1 
ATOM   7674  C  CA  . GLU B 1 443 ? 96.470  39.115 80.061  1.00 30.76  ? 443  GLU B CA  1 
ATOM   7675  C  C   . GLU B 1 443 ? 97.140  39.303 81.422  1.00 30.51  ? 443  GLU B C   1 
ATOM   7676  O  O   . GLU B 1 443 ? 98.065  38.577 81.784  1.00 29.64  ? 443  GLU B O   1 
ATOM   7677  C  CB  . GLU B 1 443 ? 97.376  39.668 78.948  1.00 30.20  ? 443  GLU B CB  1 
ATOM   7678  C  CG  . GLU B 1 443 ? 98.204  40.911 79.291  1.00 31.11  ? 443  GLU B CG  1 
ATOM   7679  C  CD  . GLU B 1 443 ? 97.381  42.190 79.382  1.00 34.53  ? 443  GLU B CD  1 
ATOM   7680  O  OE1 . GLU B 1 443 ? 96.165  42.151 79.064  1.00 33.11  ? 443  GLU B OE1 1 
ATOM   7681  O  OE2 . GLU B 1 443 ? 97.960  43.243 79.771  1.00 35.80  ? 443  GLU B OE2 1 
ATOM   7682  N  N   . ILE B 1 444 ? 96.646  40.280 82.181  1.00 30.73  ? 444  ILE B N   1 
ATOM   7683  C  CA  . ILE B 1 444 ? 97.198  40.587 83.498  1.00 30.61  ? 444  ILE B CA  1 
ATOM   7684  C  C   . ILE B 1 444 ? 97.122  39.404 84.460  1.00 30.65  ? 444  ILE B C   1 
ATOM   7685  O  O   . ILE B 1 444 ? 98.068  39.143 85.206  1.00 31.61  ? 444  ILE B O   1 
ATOM   7686  C  CB  . ILE B 1 444 ? 96.481  41.807 84.145  1.00 28.17  ? 444  ILE B CB  1 
ATOM   7687  C  CG1 . ILE B 1 444 ? 96.669  43.048 83.271  1.00 28.28  ? 444  ILE B CG1 1 
ATOM   7688  C  CG2 . ILE B 1 444 ? 97.055  42.079 85.518  1.00 26.59  ? 444  ILE B CG2 1 
ATOM   7689  C  CD1 . ILE B 1 444 ? 95.969  44.294 83.797  1.00 25.23  ? 444  ILE B CD1 1 
ATOM   7690  N  N   . GLU B 1 445 ? 96.005  38.684 84.446  1.00 31.62  ? 445  GLU B N   1 
ATOM   7691  C  CA  . GLU B 1 445 ? 95.861  37.540 85.337  1.00 33.10  ? 445  GLU B CA  1 
ATOM   7692  C  C   . GLU B 1 445 ? 96.917  36.472 85.065  1.00 31.64  ? 445  GLU B C   1 
ATOM   7693  O  O   . GLU B 1 445 ? 97.307  35.741 85.976  1.00 31.41  ? 445  GLU B O   1 
ATOM   7694  C  CB  . GLU B 1 445 ? 94.442  36.954 85.248  1.00 36.37  ? 445  GLU B CB  1 
ATOM   7695  C  CG  . GLU B 1 445 ? 93.906  36.753 83.847  1.00 39.75  ? 445  GLU B CG  1 
ATOM   7696  C  CD  . GLU B 1 445 ? 92.393  36.702 83.833  1.00 42.18  ? 445  GLU B CD  1 
ATOM   7697  O  OE1 . GLU B 1 445 ? 91.782  37.691 84.305  1.00 39.98  ? 445  GLU B OE1 1 
ATOM   7698  O  OE2 . GLU B 1 445 ? 91.819  35.686 83.363  1.00 41.57  ? 445  GLU B OE2 1 
ATOM   7699  N  N   . PHE B 1 446 ? 97.391  36.384 83.823  1.00 29.41  ? 446  PHE B N   1 
ATOM   7700  C  CA  . PHE B 1 446 ? 98.435  35.414 83.501  1.00 27.62  ? 446  PHE B CA  1 
ATOM   7701  C  C   . PHE B 1 446 ? 99.801  35.937 83.941  1.00 27.42  ? 446  PHE B C   1 
ATOM   7702  O  O   . PHE B 1 446 ? 100.667 35.153 84.345  1.00 25.29  ? 446  PHE B O   1 
ATOM   7703  C  CB  . PHE B 1 446 ? 98.454  35.096 82.002  1.00 28.76  ? 446  PHE B CB  1 
ATOM   7704  C  CG  . PHE B 1 446 ? 97.329  34.206 81.567  1.00 27.58  ? 446  PHE B CG  1 
ATOM   7705  C  CD1 . PHE B 1 446 ? 96.059  34.728 81.342  1.00 26.68  ? 446  PHE B CD1 1 
ATOM   7706  C  CD2 . PHE B 1 446 ? 97.528  32.831 81.433  1.00 28.85  ? 446  PHE B CD2 1 
ATOM   7707  C  CE1 . PHE B 1 446 ? 94.998  33.899 80.992  1.00 27.51  ? 446  PHE B CE1 1 
ATOM   7708  C  CE2 . PHE B 1 446 ? 96.477  31.988 81.084  1.00 28.61  ? 446  PHE B CE2 1 
ATOM   7709  C  CZ  . PHE B 1 446 ? 95.204  32.525 80.863  1.00 29.87  ? 446  PHE B CZ  1 
ATOM   7710  N  N   . VAL B 1 447 ? 99.984  37.259 83.873  1.00 25.21  ? 447  VAL B N   1 
ATOM   7711  C  CA  . VAL B 1 447 ? 101.235 37.883 84.287  1.00 25.30  ? 447  VAL B CA  1 
ATOM   7712  C  C   . VAL B 1 447 ? 101.429 37.751 85.799  1.00 26.58  ? 447  VAL B C   1 
ATOM   7713  O  O   . VAL B 1 447 ? 102.551 37.566 86.269  1.00 27.81  ? 447  VAL B O   1 
ATOM   7714  C  CB  . VAL B 1 447 ? 101.273 39.395 83.921  1.00 27.63  ? 447  VAL B CB  1 
ATOM   7715  C  CG1 . VAL B 1 447 ? 102.487 40.064 84.566  1.00 27.07  ? 447  VAL B CG1 1 
ATOM   7716  C  CG2 . VAL B 1 447 ? 101.330 39.572 82.397  1.00 28.49  ? 447  VAL B CG2 1 
ATOM   7717  N  N   . PHE B 1 448 ? 100.340 37.844 86.560  1.00 27.06  ? 448  PHE B N   1 
ATOM   7718  C  CA  . PHE B 1 448 ? 100.429 37.744 88.014  1.00 28.33  ? 448  PHE B CA  1 
ATOM   7719  C  C   . PHE B 1 448 ? 100.225 36.334 88.572  1.00 30.30  ? 448  PHE B C   1 
ATOM   7720  O  O   . PHE B 1 448 ? 100.126 36.146 89.786  1.00 29.56  ? 448  PHE B O   1 
ATOM   7721  C  CB  . PHE B 1 448 ? 99.465  38.736 88.682  1.00 27.71  ? 448  PHE B CB  1 
ATOM   7722  C  CG  . PHE B 1 448 ? 99.974  40.161 88.690  1.00 31.25  ? 448  PHE B CG  1 
ATOM   7723  C  CD1 . PHE B 1 448 ? 99.922  40.949 87.540  1.00 30.56  ? 448  PHE B CD1 1 
ATOM   7724  C  CD2 . PHE B 1 448 ? 100.539 40.706 89.842  1.00 33.14  ? 448  PHE B CD2 1 
ATOM   7725  C  CE1 . PHE B 1 448 ? 100.426 42.259 87.535  1.00 30.17  ? 448  PHE B CE1 1 
ATOM   7726  C  CE2 . PHE B 1 448 ? 101.047 42.019 89.841  1.00 32.68  ? 448  PHE B CE2 1 
ATOM   7727  C  CZ  . PHE B 1 448 ? 100.987 42.790 88.683  1.00 30.12  ? 448  PHE B CZ  1 
ATOM   7728  N  N   . GLY B 1 449 ? 100.162 35.350 87.677  1.00 30.21  ? 449  GLY B N   1 
ATOM   7729  C  CA  . GLY B 1 449 ? 100.030 33.964 88.089  1.00 31.30  ? 449  GLY B CA  1 
ATOM   7730  C  C   . GLY B 1 449 ? 98.720  33.468 88.666  1.00 32.76  ? 449  GLY B C   1 
ATOM   7731  O  O   . GLY B 1 449 ? 98.706  32.443 89.348  1.00 33.56  ? 449  GLY B O   1 
ATOM   7732  N  N   . LEU B 1 450 ? 97.621  34.168 88.407  1.00 31.84  ? 450  LEU B N   1 
ATOM   7733  C  CA  . LEU B 1 450 ? 96.330  33.728 88.920  1.00 32.53  ? 450  LEU B CA  1 
ATOM   7734  C  C   . LEU B 1 450 ? 96.033  32.273 88.515  1.00 34.44  ? 450  LEU B C   1 
ATOM   7735  O  O   . LEU B 1 450 ? 95.429  31.523 89.277  1.00 32.85  ? 450  LEU B O   1 
ATOM   7736  C  CB  . LEU B 1 450 ? 95.219  34.654 88.419  1.00 33.24  ? 450  LEU B CB  1 
ATOM   7737  C  CG  . LEU B 1 450 ? 95.036  36.015 89.110  1.00 36.19  ? 450  LEU B CG  1 
ATOM   7738  C  CD1 . LEU B 1 450 ? 94.318  35.815 90.428  1.00 37.39  ? 450  LEU B CD1 1 
ATOM   7739  C  CD2 . LEU B 1 450 ? 96.382  36.699 89.331  1.00 34.18  ? 450  LEU B CD2 1 
ATOM   7740  N  N   . PRO B 1 451 ? 96.456  31.857 87.308  1.00 35.33  ? 451  PRO B N   1 
ATOM   7741  C  CA  . PRO B 1 451 ? 96.195  30.479 86.884  1.00 37.24  ? 451  PRO B CA  1 
ATOM   7742  C  C   . PRO B 1 451 ? 96.857  29.409 87.764  1.00 39.57  ? 451  PRO B C   1 
ATOM   7743  O  O   . PRO B 1 451 ? 96.511  28.230 87.679  1.00 39.21  ? 451  PRO B O   1 
ATOM   7744  C  CB  . PRO B 1 451 ? 96.730  30.456 85.455  1.00 36.08  ? 451  PRO B CB  1 
ATOM   7745  C  CG  . PRO B 1 451 ? 96.504  31.853 84.994  1.00 35.84  ? 451  PRO B CG  1 
ATOM   7746  C  CD  . PRO B 1 451 ? 96.977  32.651 86.180  1.00 34.73  ? 451  PRO B CD  1 
ATOM   7747  N  N   . LEU B 1 452 ? 97.806  29.816 88.605  1.00 40.97  ? 452  LEU B N   1 
ATOM   7748  C  CA  . LEU B 1 452 ? 98.502  28.867 89.473  1.00 40.90  ? 452  LEU B CA  1 
ATOM   7749  C  C   . LEU B 1 452 ? 97.694  28.428 90.683  1.00 41.43  ? 452  LEU B C   1 
ATOM   7750  O  O   . LEU B 1 452 ? 98.092  27.508 91.391  1.00 43.46  ? 452  LEU B O   1 
ATOM   7751  C  CB  . LEU B 1 452 ? 99.844  29.440 89.941  1.00 40.28  ? 452  LEU B CB  1 
ATOM   7752  C  CG  . LEU B 1 452 ? 100.985 29.410 88.915  1.00 40.91  ? 452  LEU B CG  1 
ATOM   7753  C  CD1 . LEU B 1 452 ? 100.646 30.288 87.720  1.00 40.90  ? 452  LEU B CD1 1 
ATOM   7754  C  CD2 . LEU B 1 452 ? 102.269 29.883 89.573  1.00 41.75  ? 452  LEU B CD2 1 
ATOM   7755  N  N   . VAL B 1 453 ? 96.563  29.079 90.930  1.00 42.09  ? 453  VAL B N   1 
ATOM   7756  C  CA  . VAL B 1 453 ? 95.728  28.697 92.058  1.00 43.97  ? 453  VAL B CA  1 
ATOM   7757  C  C   . VAL B 1 453 ? 94.543  27.854 91.588  1.00 46.51  ? 453  VAL B C   1 
ATOM   7758  O  O   . VAL B 1 453 ? 93.698  28.304 90.812  1.00 46.81  ? 453  VAL B O   1 
ATOM   7759  C  CB  . VAL B 1 453 ? 95.251  29.940 92.858  1.00 43.21  ? 453  VAL B CB  1 
ATOM   7760  C  CG1 . VAL B 1 453 ? 95.304  31.172 91.992  1.00 43.67  ? 453  VAL B CG1 1 
ATOM   7761  C  CG2 . VAL B 1 453 ? 93.847  29.724 93.388  1.00 42.76  ? 453  VAL B CG2 1 
ATOM   7762  N  N   . LYS B 1 454 ? 94.509  26.615 92.069  1.00 49.61  ? 454  LYS B N   1 
ATOM   7763  C  CA  . LYS B 1 454 ? 93.475  25.648 91.721  1.00 51.75  ? 454  LYS B CA  1 
ATOM   7764  C  C   . LYS B 1 454 ? 92.023  26.110 91.765  1.00 52.17  ? 454  LYS B C   1 
ATOM   7765  O  O   . LYS B 1 454 ? 91.314  26.004 90.764  1.00 52.54  ? 454  LYS B O   1 
ATOM   7766  C  CB  . LYS B 1 454 ? 93.624  24.394 92.592  1.00 54.13  ? 454  LYS B CB  1 
ATOM   7767  C  CG  . LYS B 1 454 ? 94.557  23.341 92.009  1.00 58.21  ? 454  LYS B CG  1 
ATOM   7768  C  CD  . LYS B 1 454 ? 94.004  22.795 90.691  1.00 61.50  ? 454  LYS B CD  1 
ATOM   7769  C  CE  . LYS B 1 454 ? 94.907  21.722 90.093  1.00 63.54  ? 454  LYS B CE  1 
ATOM   7770  N  NZ  . LYS B 1 454 ? 94.347  21.173 88.822  1.00 63.28  ? 454  LYS B NZ  1 
ATOM   7771  N  N   . GLU B 1 455 ? 91.571  26.616 92.909  1.00 51.76  ? 455  GLU B N   1 
ATOM   7772  C  CA  . GLU B 1 455 ? 90.179  27.039 93.020  1.00 52.70  ? 455  GLU B CA  1 
ATOM   7773  C  C   . GLU B 1 455 ? 89.726  28.096 92.018  1.00 51.92  ? 455  GLU B C   1 
ATOM   7774  O  O   . GLU B 1 455 ? 88.531  28.384 91.926  1.00 50.85  ? 455  GLU B O   1 
ATOM   7775  C  CB  . GLU B 1 455 ? 89.850  27.504 94.447  1.00 55.16  ? 455  GLU B CB  1 
ATOM   7776  C  CG  . GLU B 1 455 ? 90.721  28.611 95.015  1.00 59.41  ? 455  GLU B CG  1 
ATOM   7777  C  CD  . GLU B 1 455 ? 92.015  28.095 95.612  1.00 62.85  ? 455  GLU B CD  1 
ATOM   7778  O  OE1 . GLU B 1 455 ? 92.674  28.867 96.345  1.00 66.32  ? 455  GLU B OE1 1 
ATOM   7779  O  OE2 . GLU B 1 455 ? 92.376  26.927 95.348  1.00 63.48  ? 455  GLU B OE2 1 
ATOM   7780  N  N   . LEU B 1 456 ? 90.663  28.673 91.268  1.00 50.79  ? 456  LEU B N   1 
ATOM   7781  C  CA  . LEU B 1 456 ? 90.303  29.681 90.276  1.00 49.17  ? 456  LEU B CA  1 
ATOM   7782  C  C   . LEU B 1 456 ? 89.833  29.014 88.987  1.00 48.67  ? 456  LEU B C   1 
ATOM   7783  O  O   . LEU B 1 456 ? 89.302  29.665 88.086  1.00 48.72  ? 456  LEU B O   1 
ATOM   7784  C  CB  . LEU B 1 456 ? 91.480  30.613 90.003  1.00 48.14  ? 456  LEU B CB  1 
ATOM   7785  C  CG  . LEU B 1 456 ? 91.834  31.547 91.163  1.00 47.75  ? 456  LEU B CG  1 
ATOM   7786  C  CD1 . LEU B 1 456 ? 92.714  32.673 90.649  1.00 45.92  ? 456  LEU B CD1 1 
ATOM   7787  C  CD2 . LEU B 1 456 ? 90.563  32.124 91.771  1.00 47.29  ? 456  LEU B CD2 1 
ATOM   7788  N  N   . ASN B 1 457 ? 90.047  27.706 88.914  1.00 47.86  ? 457  ASN B N   1 
ATOM   7789  C  CA  . ASN B 1 457 ? 89.624  26.891 87.781  1.00 47.49  ? 457  ASN B CA  1 
ATOM   7790  C  C   . ASN B 1 457 ? 90.168  27.196 86.384  1.00 45.77  ? 457  ASN B C   1 
ATOM   7791  O  O   . ASN B 1 457 ? 89.408  27.247 85.419  1.00 47.89  ? 457  ASN B O   1 
ATOM   7792  C  CB  . ASN B 1 457 ? 88.089  26.849 87.733  1.00 49.21  ? 457  ASN B CB  1 
ATOM   7793  C  CG  . ASN B 1 457 ? 87.486  26.036 88.874  1.00 50.50  ? 457  ASN B CG  1 
ATOM   7794  O  OD1 . ASN B 1 457 ? 86.275  26.058 89.094  1.00 52.86  ? 457  ASN B OD1 1 
ATOM   7795  N  ND2 . ASN B 1 457 ? 88.330  25.306 89.597  1.00 50.81  ? 457  ASN B ND2 1 
ATOM   7796  N  N   . TYR B 1 458 ? 91.472  27.404 86.266  1.00 42.44  ? 458  TYR B N   1 
ATOM   7797  C  CA  . TYR B 1 458 ? 92.062  27.618 84.953  1.00 40.32  ? 458  TYR B CA  1 
ATOM   7798  C  C   . TYR B 1 458 ? 92.491  26.225 84.495  1.00 40.93  ? 458  TYR B C   1 
ATOM   7799  O  O   . TYR B 1 458 ? 92.685  25.331 85.322  1.00 40.19  ? 458  TYR B O   1 
ATOM   7800  C  CB  . TYR B 1 458 ? 93.290  28.528 85.025  1.00 38.83  ? 458  TYR B CB  1 
ATOM   7801  C  CG  . TYR B 1 458 ? 92.973  29.995 85.179  1.00 37.80  ? 458  TYR B CG  1 
ATOM   7802  C  CD1 . TYR B 1 458 ? 92.672  30.540 86.426  1.00 37.59  ? 458  TYR B CD1 1 
ATOM   7803  C  CD2 . TYR B 1 458 ? 92.981  30.844 84.075  1.00 36.65  ? 458  TYR B CD2 1 
ATOM   7804  C  CE1 . TYR B 1 458 ? 92.393  31.899 86.569  1.00 37.14  ? 458  TYR B CE1 1 
ATOM   7805  C  CE2 . TYR B 1 458 ? 92.701  32.202 84.208  1.00 37.25  ? 458  TYR B CE2 1 
ATOM   7806  C  CZ  . TYR B 1 458 ? 92.412  32.721 85.456  1.00 36.28  ? 458  TYR B CZ  1 
ATOM   7807  O  OH  . TYR B 1 458 ? 92.157  34.064 85.589  1.00 37.66  ? 458  TYR B OH  1 
ATOM   7808  N  N   . THR B 1 459 ? 92.634  26.030 83.190  1.00 40.33  ? 459  THR B N   1 
ATOM   7809  C  CA  . THR B 1 459 ? 93.040  24.727 82.681  1.00 40.95  ? 459  THR B CA  1 
ATOM   7810  C  C   . THR B 1 459 ? 94.530  24.546 82.929  1.00 42.34  ? 459  THR B C   1 
ATOM   7811  O  O   . THR B 1 459 ? 95.245  25.519 83.194  1.00 43.05  ? 459  THR B O   1 
ATOM   7812  C  CB  . THR B 1 459 ? 92.792  24.605 81.166  1.00 41.32  ? 459  THR B CB  1 
ATOM   7813  O  OG1 . THR B 1 459 ? 93.595  25.571 80.482  1.00 42.35  ? 459  THR B OG1 1 
ATOM   7814  C  CG2 . THR B 1 459 ? 91.323  24.844 80.830  1.00 40.12  ? 459  THR B CG2 1 
ATOM   7815  N  N   . ALA B 1 460 ? 94.998  23.304 82.843  1.00 40.28  ? 460  ALA B N   1 
ATOM   7816  C  CA  . ALA B 1 460 ? 96.410  23.011 83.044  1.00 38.67  ? 460  ALA B CA  1 
ATOM   7817  C  C   . ALA B 1 460 ? 97.253  23.773 82.026  1.00 38.57  ? 460  ALA B C   1 
ATOM   7818  O  O   . ALA B 1 460 ? 98.337  24.260 82.343  1.00 40.76  ? 460  ALA B O   1 
ATOM   7819  C  CB  . ALA B 1 460 ? 96.663  21.513 82.911  1.00 38.93  ? 460  ALA B CB  1 
ATOM   7820  N  N   . GLU B 1 461 ? 96.760  23.872 80.798  1.00 37.74  ? 461  GLU B N   1 
ATOM   7821  C  CA  . GLU B 1 461 ? 97.491  24.581 79.760  1.00 38.03  ? 461  GLU B CA  1 
ATOM   7822  C  C   . GLU B 1 461 ? 97.575  26.080 80.046  1.00 37.04  ? 461  GLU B C   1 
ATOM   7823  O  O   . GLU B 1 461 ? 98.525  26.744 79.630  1.00 35.45  ? 461  GLU B O   1 
ATOM   7824  C  CB  . GLU B 1 461 ? 96.856  24.336 78.386  1.00 41.77  ? 461  GLU B CB  1 
ATOM   7825  C  CG  . GLU B 1 461 ? 95.414  23.835 78.411  1.00 48.93  ? 461  GLU B CG  1 
ATOM   7826  C  CD  . GLU B 1 461 ? 95.295  22.388 78.880  1.00 52.15  ? 461  GLU B CD  1 
ATOM   7827  O  OE1 . GLU B 1 461 ? 95.974  21.517 78.295  1.00 55.00  ? 461  GLU B OE1 1 
ATOM   7828  O  OE2 . GLU B 1 461 ? 94.521  22.119 79.826  1.00 51.96  ? 461  GLU B OE2 1 
ATOM   7829  N  N   . GLU B 1 462 ? 96.587  26.617 80.758  1.00 34.88  ? 462  GLU B N   1 
ATOM   7830  C  CA  . GLU B 1 462 ? 96.605  28.034 81.086  1.00 35.37  ? 462  GLU B CA  1 
ATOM   7831  C  C   . GLU B 1 462 ? 97.596  28.281 82.217  1.00 35.22  ? 462  GLU B C   1 
ATOM   7832  O  O   . GLU B 1 462 ? 98.185  29.354 82.312  1.00 35.45  ? 462  GLU B O   1 
ATOM   7833  C  CB  . GLU B 1 462 ? 95.198  28.517 81.455  1.00 33.61  ? 462  GLU B CB  1 
ATOM   7834  C  CG  . GLU B 1 462 ? 94.263  28.499 80.258  1.00 35.27  ? 462  GLU B CG  1 
ATOM   7835  C  CD  . GLU B 1 462 ? 92.817  28.797 80.601  1.00 37.20  ? 462  GLU B CD  1 
ATOM   7836  O  OE1 . GLU B 1 462 ? 92.285  28.175 81.547  1.00 35.01  ? 462  GLU B OE1 1 
ATOM   7837  O  OE2 . GLU B 1 462 ? 92.206  29.643 79.905  1.00 40.03  ? 462  GLU B OE2 1 
ATOM   7838  N  N   . GLU B 1 463 ? 97.798  27.274 83.061  1.00 35.21  ? 463  GLU B N   1 
ATOM   7839  C  CA  . GLU B 1 463 ? 98.749  27.394 84.158  1.00 35.49  ? 463  GLU B CA  1 
ATOM   7840  C  C   . GLU B 1 463 ? 100.160 27.397 83.575  1.00 34.57  ? 463  GLU B C   1 
ATOM   7841  O  O   . GLU B 1 463 ? 101.016 28.172 83.997  1.00 34.34  ? 463  GLU B O   1 
ATOM   7842  C  CB  . GLU B 1 463 ? 98.614  26.222 85.137  1.00 37.81  ? 463  GLU B CB  1 
ATOM   7843  C  CG  . GLU B 1 463 ? 99.397  26.436 86.427  1.00 42.74  ? 463  GLU B CG  1 
ATOM   7844  C  CD  . GLU B 1 463 ? 99.492  25.195 87.302  1.00 43.70  ? 463  GLU B CD  1 
ATOM   7845  O  OE1 . GLU B 1 463 ? 98.457  24.524 87.515  1.00 44.78  ? 463  GLU B OE1 1 
ATOM   7846  O  OE2 . GLU B 1 463 ? 100.606 24.905 87.791  1.00 42.94  ? 463  GLU B OE2 1 
ATOM   7847  N  N   . ALA B 1 464 ? 100.399 26.526 82.599  1.00 33.26  ? 464  ALA B N   1 
ATOM   7848  C  CA  . ALA B 1 464 ? 101.712 26.450 81.972  1.00 32.24  ? 464  ALA B CA  1 
ATOM   7849  C  C   . ALA B 1 464 ? 101.983 27.747 81.226  1.00 30.84  ? 464  ALA B C   1 
ATOM   7850  O  O   . ALA B 1 464 ? 103.115 28.220 81.190  1.00 31.10  ? 464  ALA B O   1 
ATOM   7851  C  CB  . ALA B 1 464 ? 101.785 25.261 81.010  1.00 30.57  ? 464  ALA B CB  1 
ATOM   7852  N  N   . LEU B 1 465 ? 100.944 28.320 80.626  1.00 29.47  ? 465  LEU B N   1 
ATOM   7853  C  CA  . LEU B 1 465 ? 101.107 29.572 79.898  1.00 30.14  ? 465  LEU B CA  1 
ATOM   7854  C  C   . LEU B 1 465 ? 101.477 30.674 80.885  1.00 30.09  ? 465  LEU B C   1 
ATOM   7855  O  O   . LEU B 1 465 ? 102.390 31.464 80.643  1.00 30.05  ? 465  LEU B O   1 
ATOM   7856  C  CB  . LEU B 1 465 ? 99.819  29.949 79.159  1.00 27.21  ? 465  LEU B CB  1 
ATOM   7857  C  CG  . LEU B 1 465 ? 99.823  31.321 78.475  1.00 25.87  ? 465  LEU B CG  1 
ATOM   7858  C  CD1 . LEU B 1 465 ? 100.914 31.381 77.420  1.00 23.57  ? 465  LEU B CD1 1 
ATOM   7859  C  CD2 . LEU B 1 465 ? 98.465  31.583 77.850  1.00 25.56  ? 465  LEU B CD2 1 
ATOM   7860  N  N   . SER B 1 466 ? 100.763 30.717 82.003  1.00 31.64  ? 466  SER B N   1 
ATOM   7861  C  CA  . SER B 1 466 ? 101.024 31.721 83.022  1.00 31.81  ? 466  SER B CA  1 
ATOM   7862  C  C   . SER B 1 466 ? 102.466 31.611 83.498  1.00 32.21  ? 466  SER B C   1 
ATOM   7863  O  O   . SER B 1 466 ? 103.171 32.615 83.594  1.00 28.86  ? 466  SER B O   1 
ATOM   7864  C  CB  . SER B 1 466 ? 100.074 31.538 84.202  1.00 32.92  ? 466  SER B CB  1 
ATOM   7865  O  OG  . SER B 1 466 ? 100.330 32.504 85.204  1.00 33.09  ? 466  SER B OG  1 
ATOM   7866  N  N   . ARG B 1 467 ? 102.900 30.383 83.780  1.00 33.14  ? 467  ARG B N   1 
ATOM   7867  C  CA  . ARG B 1 467 ? 104.259 30.138 84.252  1.00 33.60  ? 467  ARG B CA  1 
ATOM   7868  C  C   . ARG B 1 467 ? 105.329 30.597 83.278  1.00 33.42  ? 467  ARG B C   1 
ATOM   7869  O  O   . ARG B 1 467 ? 106.356 31.123 83.700  1.00 33.70  ? 467  ARG B O   1 
ATOM   7870  C  CB  . ARG B 1 467 ? 104.469 28.653 84.569  1.00 34.88  ? 467  ARG B CB  1 
ATOM   7871  C  CG  . ARG B 1 467 ? 103.798 28.202 85.857  1.00 36.97  ? 467  ARG B CG  1 
ATOM   7872  C  CD  . ARG B 1 467 ? 104.067 26.739 86.166  1.00 34.70  ? 467  ARG B CD  1 
ATOM   7873  N  NE  . ARG B 1 467 ? 103.463 26.343 87.436  1.00 36.47  ? 467  ARG B NE  1 
ATOM   7874  C  CZ  . ARG B 1 467 ? 103.901 26.728 88.633  1.00 37.76  ? 467  ARG B CZ  1 
ATOM   7875  N  NH1 . ARG B 1 467 ? 104.960 27.523 88.739  1.00 36.52  ? 467  ARG B NH1 1 
ATOM   7876  N  NH2 . ARG B 1 467 ? 103.271 26.323 89.730  1.00 37.27  ? 467  ARG B NH2 1 
ATOM   7877  N  N   . ARG B 1 468 ? 105.110 30.405 81.979  1.00 32.93  ? 468  ARG B N   1 
ATOM   7878  C  CA  . ARG B 1 468 ? 106.121 30.832 81.026  1.00 33.12  ? 468  ARG B CA  1 
ATOM   7879  C  C   . ARG B 1 468 ? 106.067 32.327 80.753  1.00 31.89  ? 468  ARG B C   1 
ATOM   7880  O  O   . ARG B 1 468 ? 107.074 32.919 80.366  1.00 31.99  ? 468  ARG B O   1 
ATOM   7881  C  CB  . ARG B 1 468 ? 106.052 30.025 79.716  1.00 34.40  ? 468  ARG B CB  1 
ATOM   7882  C  CG  . ARG B 1 468 ? 104.723 29.981 79.004  1.00 38.76  ? 468  ARG B CG  1 
ATOM   7883  C  CD  . ARG B 1 468 ? 104.817 29.048 77.787  1.00 41.21  ? 468  ARG B CD  1 
ATOM   7884  N  NE  . ARG B 1 468 ? 105.601 29.627 76.699  1.00 41.29  ? 468  ARG B NE  1 
ATOM   7885  C  CZ  . ARG B 1 468 ? 105.070 30.187 75.616  1.00 40.44  ? 468  ARG B CZ  1 
ATOM   7886  N  NH1 . ARG B 1 468 ? 103.751 30.236 75.470  1.00 38.40  ? 468  ARG B NH1 1 
ATOM   7887  N  NH2 . ARG B 1 468 ? 105.857 30.716 74.690  1.00 39.03  ? 468  ARG B NH2 1 
ATOM   7888  N  N   . ILE B 1 469 ? 104.908 32.944 80.968  1.00 29.75  ? 469  ILE B N   1 
ATOM   7889  C  CA  . ILE B 1 469 ? 104.797 34.383 80.766  1.00 28.43  ? 469  ILE B CA  1 
ATOM   7890  C  C   . ILE B 1 469 ? 105.505 35.087 81.924  1.00 27.79  ? 469  ILE B C   1 
ATOM   7891  O  O   . ILE B 1 469 ? 106.264 36.035 81.714  1.00 26.43  ? 469  ILE B O   1 
ATOM   7892  C  CB  . ILE B 1 469 ? 103.315 34.839 80.666  1.00 28.83  ? 469  ILE B CB  1 
ATOM   7893  C  CG1 . ILE B 1 469 ? 102.740 34.423 79.298  1.00 27.46  ? 469  ILE B CG1 1 
ATOM   7894  C  CG2 . ILE B 1 469 ? 103.220 36.348 80.840  1.00 26.72  ? 469  ILE B CG2 1 
ATOM   7895  C  CD1 . ILE B 1 469 ? 101.270 34.776 79.076  1.00 23.62  ? 469  ILE B CD1 1 
ATOM   7896  N  N   . MET B 1 470 ? 105.274 34.603 83.144  1.00 28.39  ? 470  MET B N   1 
ATOM   7897  C  CA  . MET B 1 470 ? 105.920 35.176 84.323  1.00 29.30  ? 470  MET B CA  1 
ATOM   7898  C  C   . MET B 1 470 ? 107.433 34.987 84.212  1.00 30.30  ? 470  MET B C   1 
ATOM   7899  O  O   . MET B 1 470 ? 108.207 35.860 84.618  1.00 28.08  ? 470  MET B O   1 
ATOM   7900  C  CB  . MET B 1 470 ? 105.431 34.502 85.608  1.00 28.28  ? 470  MET B CB  1 
ATOM   7901  C  CG  . MET B 1 470 ? 103.999 34.803 85.989  1.00 30.77  ? 470  MET B CG  1 
ATOM   7902  S  SD  . MET B 1 470 ? 103.646 34.249 87.680  1.00 38.24  ? 470  MET B SD  1 
ATOM   7903  C  CE  . MET B 1 470 ? 103.643 32.436 87.455  1.00 35.70  ? 470  MET B CE  1 
ATOM   7904  N  N   . HIS B 1 471 ? 107.852 33.845 83.663  1.00 28.50  ? 471  HIS B N   1 
ATOM   7905  C  CA  . HIS B 1 471 ? 109.273 33.573 83.505  1.00 29.32  ? 471  HIS B CA  1 
ATOM   7906  C  C   . HIS B 1 471 ? 109.880 34.496 82.454  1.00 28.46  ? 471  HIS B C   1 
ATOM   7907  O  O   . HIS B 1 471 ? 111.027 34.915 82.586  1.00 28.13  ? 471  HIS B O   1 
ATOM   7908  C  CB  . HIS B 1 471 ? 109.524 32.114 83.119  1.00 31.39  ? 471  HIS B CB  1 
ATOM   7909  C  CG  . HIS B 1 471 ? 110.946 31.689 83.305  1.00 34.68  ? 471  HIS B CG  1 
ATOM   7910  N  ND1 . HIS B 1 471 ? 111.573 31.713 84.534  1.00 37.86  ? 471  HIS B ND1 1 
ATOM   7911  C  CD2 . HIS B 1 471 ? 111.879 31.271 82.418  1.00 36.72  ? 471  HIS B CD2 1 
ATOM   7912  C  CE1 . HIS B 1 471 ? 112.830 31.331 84.395  1.00 36.38  ? 471  HIS B CE1 1 
ATOM   7913  N  NE2 . HIS B 1 471 ? 113.042 31.058 83.120  1.00 37.07  ? 471  HIS B NE2 1 
ATOM   7914  N  N   . TYR B 1 472 ? 109.117 34.797 81.408  1.00 28.08  ? 472  TYR B N   1 
ATOM   7915  C  CA  . TYR B 1 472 ? 109.583 35.705 80.362  1.00 27.82  ? 472  TYR B CA  1 
ATOM   7916  C  C   . TYR B 1 472 ? 109.757 37.097 80.968  1.00 27.92  ? 472  TYR B C   1 
ATOM   7917  O  O   . TYR B 1 472 ? 110.784 37.744 80.770  1.00 28.36  ? 472  TYR B O   1 
ATOM   7918  C  CB  . TYR B 1 472 ? 108.568 35.824 79.220  1.00 28.69  ? 472  TYR B CB  1 
ATOM   7919  C  CG  . TYR B 1 472 ? 108.519 34.681 78.235  1.00 29.27  ? 472  TYR B CG  1 
ATOM   7920  C  CD1 . TYR B 1 472 ? 109.672 33.985 77.873  1.00 31.82  ? 472  TYR B CD1 1 
ATOM   7921  C  CD2 . TYR B 1 472 ? 107.326 34.361 77.586  1.00 30.31  ? 472  TYR B CD2 1 
ATOM   7922  C  CE1 . TYR B 1 472 ? 109.636 33.003 76.883  1.00 31.52  ? 472  TYR B CE1 1 
ATOM   7923  C  CE2 . TYR B 1 472 ? 107.278 33.387 76.595  1.00 30.13  ? 472  TYR B CE2 1 
ATOM   7924  C  CZ  . TYR B 1 472 ? 108.433 32.715 76.247  1.00 32.18  ? 472  TYR B CZ  1 
ATOM   7925  O  OH  . TYR B 1 472 ? 108.383 31.765 75.250  1.00 35.09  ? 472  TYR B OH  1 
ATOM   7926  N  N   . TRP B 1 473 ? 108.735 37.548 81.696  1.00 28.04  ? 473  TRP B N   1 
ATOM   7927  C  CA  . TRP B 1 473 ? 108.740 38.862 82.337  1.00 26.96  ? 473  TRP B CA  1 
ATOM   7928  C  C   . TRP B 1 473 ? 109.882 39.036 83.341  1.00 27.84  ? 473  TRP B C   1 
ATOM   7929  O  O   . TRP B 1 473 ? 110.631 40.010 83.276  1.00 27.30  ? 473  TRP B O   1 
ATOM   7930  C  CB  . TRP B 1 473 ? 107.409 39.107 83.058  1.00 26.06  ? 473  TRP B CB  1 
ATOM   7931  C  CG  . TRP B 1 473 ? 106.365 39.864 82.273  1.00 26.61  ? 473  TRP B CG  1 
ATOM   7932  C  CD1 . TRP B 1 473 ? 105.610 40.912 82.724  1.00 28.96  ? 473  TRP B CD1 1 
ATOM   7933  C  CD2 . TRP B 1 473 ? 105.907 39.593 80.938  1.00 26.77  ? 473  TRP B CD2 1 
ATOM   7934  N  NE1 . TRP B 1 473 ? 104.711 41.306 81.758  1.00 28.14  ? 473  TRP B NE1 1 
ATOM   7935  C  CE2 . TRP B 1 473 ? 104.871 40.513 80.654  1.00 25.95  ? 473  TRP B CE2 1 
ATOM   7936  C  CE3 . TRP B 1 473 ? 106.268 38.660 79.957  1.00 25.79  ? 473  TRP B CE3 1 
ATOM   7937  C  CZ2 . TRP B 1 473 ? 104.192 40.526 79.432  1.00 27.44  ? 473  TRP B CZ2 1 
ATOM   7938  C  CZ3 . TRP B 1 473 ? 105.593 38.675 78.742  1.00 25.46  ? 473  TRP B CZ3 1 
ATOM   7939  C  CH2 . TRP B 1 473 ? 104.565 39.601 78.491  1.00 25.83  ? 473  TRP B CH2 1 
ATOM   7940  N  N   . ALA B 1 474 ? 110.008 38.091 84.269  1.00 28.13  ? 474  ALA B N   1 
ATOM   7941  C  CA  . ALA B 1 474 ? 111.044 38.152 85.300  1.00 28.09  ? 474  ALA B CA  1 
ATOM   7942  C  C   . ALA B 1 474 ? 112.449 38.051 84.724  1.00 28.88  ? 474  ALA B C   1 
ATOM   7943  O  O   . ALA B 1 474 ? 113.323 38.844 85.073  1.00 30.49  ? 474  ALA B O   1 
ATOM   7944  C  CB  . ALA B 1 474 ? 110.825 37.052 86.336  1.00 26.57  ? 474  ALA B CB  1 
ATOM   7945  N  N   . THR B 1 475 ? 112.667 37.073 83.851  1.00 27.79  ? 475  THR B N   1 
ATOM   7946  C  CA  . THR B 1 475 ? 113.972 36.887 83.225  1.00 27.05  ? 475  THR B CA  1 
ATOM   7947  C  C   . THR B 1 475 ? 114.340 38.159 82.474  1.00 27.77  ? 475  THR B C   1 
ATOM   7948  O  O   . THR B 1 475 ? 115.487 38.600 82.503  1.00 28.86  ? 475  THR B O   1 
ATOM   7949  C  CB  . THR B 1 475 ? 113.953 35.695 82.250  1.00 27.94  ? 475  THR B CB  1 
ATOM   7950  O  OG1 . THR B 1 475 ? 113.547 34.518 82.959  1.00 27.23  ? 475  THR B OG1 1 
ATOM   7951  C  CG2 . THR B 1 475 ? 115.340 35.471 81.633  1.00 25.26  ? 475  THR B CG2 1 
ATOM   7952  N  N   . PHE B 1 476 ? 113.362 38.753 81.798  1.00 28.41  ? 476  PHE B N   1 
ATOM   7953  C  CA  . PHE B 1 476 ? 113.614 39.992 81.077  1.00 27.87  ? 476  PHE B CA  1 
ATOM   7954  C  C   . PHE B 1 476 ? 113.979 41.064 82.102  1.00 27.87  ? 476  PHE B C   1 
ATOM   7955  O  O   . PHE B 1 476 ? 114.875 41.879 81.879  1.00 26.43  ? 476  PHE B O   1 
ATOM   7956  C  CB  . PHE B 1 476 ? 112.372 40.446 80.307  1.00 25.95  ? 476  PHE B CB  1 
ATOM   7957  C  CG  . PHE B 1 476 ? 112.482 41.845 79.785  1.00 24.75  ? 476  PHE B CG  1 
ATOM   7958  C  CD1 . PHE B 1 476 ? 113.257 42.121 78.666  1.00 24.87  ? 476  PHE B CD1 1 
ATOM   7959  C  CD2 . PHE B 1 476 ? 111.877 42.899 80.459  1.00 20.46  ? 476  PHE B CD2 1 
ATOM   7960  C  CE1 . PHE B 1 476 ? 113.431 43.436 78.225  1.00 25.00  ? 476  PHE B CE1 1 
ATOM   7961  C  CE2 . PHE B 1 476 ? 112.042 44.208 80.033  1.00 22.75  ? 476  PHE B CE2 1 
ATOM   7962  C  CZ  . PHE B 1 476 ? 112.823 44.482 78.910  1.00 22.65  ? 476  PHE B CZ  1 
ATOM   7963  N  N   . ALA B 1 477 ? 113.268 41.066 83.225  1.00 27.50  ? 477  ALA B N   1 
ATOM   7964  C  CA  . ALA B 1 477 ? 113.538 42.038 84.277  1.00 28.58  ? 477  ALA B CA  1 
ATOM   7965  C  C   . ALA B 1 477 ? 114.975 41.885 84.785  1.00 28.74  ? 477  ALA B C   1 
ATOM   7966  O  O   . ALA B 1 477 ? 115.682 42.873 84.977  1.00 28.30  ? 477  ALA B O   1 
ATOM   7967  C  CB  . ALA B 1 477 ? 112.548 41.858 85.428  1.00 24.36  ? 477  ALA B CB  1 
ATOM   7968  N  N   . LYS B 1 478 ? 115.412 40.642 84.975  1.00 30.75  ? 478  LYS B N   1 
ATOM   7969  C  CA  . LYS B 1 478 ? 116.757 40.379 85.480  1.00 33.60  ? 478  LYS B CA  1 
ATOM   7970  C  C   . LYS B 1 478 ? 117.889 40.627 84.496  1.00 33.25  ? 478  LYS B C   1 
ATOM   7971  O  O   . LYS B 1 478 ? 118.912 41.199 84.859  1.00 33.94  ? 478  LYS B O   1 
ATOM   7972  C  CB  . LYS B 1 478 ? 116.878 38.937 85.970  1.00 35.82  ? 478  LYS B CB  1 
ATOM   7973  C  CG  . LYS B 1 478 ? 115.805 38.499 86.953  1.00 42.32  ? 478  LYS B CG  1 
ATOM   7974  C  CD  . LYS B 1 478 ? 116.239 37.230 87.676  1.00 44.65  ? 478  LYS B CD  1 
ATOM   7975  C  CE  . LYS B 1 478 ? 115.113 36.616 88.501  1.00 45.01  ? 478  LYS B CE  1 
ATOM   7976  N  NZ  . LYS B 1 478 ? 114.089 35.980 87.629  1.00 47.41  ? 478  LYS B NZ  1 
ATOM   7977  N  N   . THR B 1 479 ? 117.701 40.215 83.248  1.00 33.14  ? 479  THR B N   1 
ATOM   7978  C  CA  . THR B 1 479 ? 118.757 40.325 82.250  1.00 31.70  ? 479  THR B CA  1 
ATOM   7979  C  C   . THR B 1 479 ? 118.548 41.233 81.053  1.00 31.93  ? 479  THR B C   1 
ATOM   7980  O  O   . THR B 1 479 ? 119.517 41.612 80.399  1.00 31.73  ? 479  THR B O   1 
ATOM   7981  C  CB  . THR B 1 479 ? 119.086 38.941 81.688  1.00 31.06  ? 479  THR B CB  1 
ATOM   7982  O  OG1 . THR B 1 479 ? 117.973 38.475 80.912  1.00 30.61  ? 479  THR B OG1 1 
ATOM   7983  C  CG2 . THR B 1 479 ? 119.352 37.955 82.822  1.00 28.34  ? 479  THR B CG2 1 
ATOM   7984  N  N   . GLY B 1 480 ? 117.301 41.566 80.744  1.00 32.18  ? 480  GLY B N   1 
ATOM   7985  C  CA  . GLY B 1 480 ? 117.036 42.411 79.590  1.00 29.47  ? 480  GLY B CA  1 
ATOM   7986  C  C   . GLY B 1 480 ? 116.739 41.549 78.374  1.00 29.33  ? 480  GLY B C   1 
ATOM   7987  O  O   . GLY B 1 480 ? 116.673 42.035 77.248  1.00 27.89  ? 480  GLY B O   1 
ATOM   7988  N  N   . ASN B 1 481 ? 116.557 40.255 78.616  1.00 29.71  ? 481  ASN B N   1 
ATOM   7989  C  CA  . ASN B 1 481 ? 116.271 39.288 77.562  1.00 29.89  ? 481  ASN B CA  1 
ATOM   7990  C  C   . ASN B 1 481 ? 115.314 38.266 78.162  1.00 29.74  ? 481  ASN B C   1 
ATOM   7991  O  O   . ASN B 1 481 ? 115.638 37.603 79.141  1.00 30.10  ? 481  ASN B O   1 
ATOM   7992  C  CB  . ASN B 1 481 ? 117.564 38.592 77.129  1.00 31.73  ? 481  ASN B CB  1 
ATOM   7993  C  CG  . ASN B 1 481 ? 117.369 37.655 75.952  1.00 33.70  ? 481  ASN B CG  1 
ATOM   7994  O  OD1 . ASN B 1 481 ? 116.293 37.077 75.756  1.00 35.70  ? 481  ASN B OD1 1 
ATOM   7995  N  ND2 . ASN B 1 481 ? 118.423 37.481 75.171  1.00 34.11  ? 481  ASN B ND2 1 
ATOM   7996  N  N   . PRO B 1 482 ? 114.119 38.124 77.582  1.00 29.79  ? 482  PRO B N   1 
ATOM   7997  C  CA  . PRO B 1 482 ? 113.148 37.162 78.113  1.00 30.90  ? 482  PRO B CA  1 
ATOM   7998  C  C   . PRO B 1 482 ? 113.586 35.706 77.987  1.00 33.02  ? 482  PRO B C   1 
ATOM   7999  O  O   . PRO B 1 482 ? 112.997 34.820 78.607  1.00 32.11  ? 482  PRO B O   1 
ATOM   8000  C  CB  . PRO B 1 482 ? 111.898 37.458 77.294  1.00 28.81  ? 482  PRO B CB  1 
ATOM   8001  C  CG  . PRO B 1 482 ? 112.478 37.844 75.961  1.00 29.87  ? 482  PRO B CG  1 
ATOM   8002  C  CD  . PRO B 1 482 ? 113.602 38.780 76.370  1.00 28.98  ? 482  PRO B CD  1 
ATOM   8003  N  N   . ASN B 1 483 ? 114.619 35.466 77.188  1.00 34.83  ? 483  ASN B N   1 
ATOM   8004  C  CA  . ASN B 1 483 ? 115.107 34.110 76.971  1.00 39.80  ? 483  ASN B CA  1 
ATOM   8005  C  C   . ASN B 1 483 ? 116.241 33.751 77.914  1.00 43.46  ? 483  ASN B C   1 
ATOM   8006  O  O   . ASN B 1 483 ? 117.003 34.614 78.339  1.00 43.61  ? 483  ASN B O   1 
ATOM   8007  C  CB  . ASN B 1 483 ? 115.602 33.945 75.527  1.00 38.70  ? 483  ASN B CB  1 
ATOM   8008  C  CG  . ASN B 1 483 ? 114.520 34.215 74.494  1.00 37.70  ? 483  ASN B CG  1 
ATOM   8009  O  OD1 . ASN B 1 483 ? 113.473 33.577 74.497  1.00 38.05  ? 483  ASN B OD1 1 
ATOM   8010  N  ND2 . ASN B 1 483 ? 114.775 35.163 73.602  1.00 37.47  ? 483  ASN B ND2 1 
ATOM   8011  N  N   . GLU B 1 484 ? 116.345 32.470 78.246  1.00 48.65  ? 484  GLU B N   1 
ATOM   8012  C  CA  . GLU B 1 484 ? 117.423 32.004 79.104  1.00 54.63  ? 484  GLU B CA  1 
ATOM   8013  C  C   . GLU B 1 484 ? 118.468 31.385 78.191  1.00 57.78  ? 484  GLU B C   1 
ATOM   8014  O  O   . GLU B 1 484 ? 118.169 30.464 77.430  1.00 56.44  ? 484  GLU B O   1 
ATOM   8015  C  CB  . GLU B 1 484 ? 116.931 30.951 80.097  1.00 56.88  ? 484  GLU B CB  1 
ATOM   8016  C  CG  . GLU B 1 484 ? 115.882 31.453 81.063  1.00 61.41  ? 484  GLU B CG  1 
ATOM   8017  C  CD  . GLU B 1 484 ? 115.713 30.535 82.255  1.00 63.86  ? 484  GLU B CD  1 
ATOM   8018  O  OE1 . GLU B 1 484 ? 115.473 29.323 82.045  1.00 65.39  ? 484  GLU B OE1 1 
ATOM   8019  O  OE2 . GLU B 1 484 ? 115.819 31.029 83.402  1.00 63.91  ? 484  GLU B OE2 1 
ATOM   8020  N  N   . PRO B 1 485 ? 119.708 31.891 78.246  1.00 61.37  ? 485  PRO B N   1 
ATOM   8021  C  CA  . PRO B 1 485 ? 120.783 31.358 77.403  1.00 63.86  ? 485  PRO B CA  1 
ATOM   8022  C  C   . PRO B 1 485 ? 120.878 29.834 77.446  1.00 65.83  ? 485  PRO B C   1 
ATOM   8023  O  O   . PRO B 1 485 ? 120.408 29.197 78.388  1.00 64.92  ? 485  PRO B O   1 
ATOM   8024  C  CB  . PRO B 1 485 ? 122.034 32.050 77.954  1.00 64.61  ? 485  PRO B CB  1 
ATOM   8025  C  CG  . PRO B 1 485 ? 121.659 32.378 79.381  1.00 64.08  ? 485  PRO B CG  1 
ATOM   8026  C  CD  . PRO B 1 485 ? 120.238 32.849 79.230  1.00 62.60  ? 485  PRO B CD  1 
ATOM   8027  N  N   . HIS B 1 486 ? 121.490 29.266 76.412  1.00 69.13  ? 486  HIS B N   1 
ATOM   8028  C  CA  . HIS B 1 486 ? 121.652 27.821 76.279  1.00 72.32  ? 486  HIS B CA  1 
ATOM   8029  C  C   . HIS B 1 486 ? 120.528 26.995 76.907  1.00 72.51  ? 486  HIS B C   1 
ATOM   8030  O  O   . HIS B 1 486 ? 120.773 26.093 77.708  1.00 73.27  ? 486  HIS B O   1 
ATOM   8031  C  CB  . HIS B 1 486 ? 123.019 27.373 76.828  1.00 74.39  ? 486  HIS B CB  1 
ATOM   8032  C  CG  . HIS B 1 486 ? 123.285 27.798 78.239  1.00 76.95  ? 486  HIS B CG  1 
ATOM   8033  N  ND1 . HIS B 1 486 ? 122.550 27.335 79.310  1.00 78.56  ? 486  HIS B ND1 1 
ATOM   8034  C  CD2 . HIS B 1 486 ? 124.212 28.640 78.754  1.00 77.88  ? 486  HIS B CD2 1 
ATOM   8035  C  CE1 . HIS B 1 486 ? 123.013 27.874 80.424  1.00 79.35  ? 486  HIS B CE1 1 
ATOM   8036  N  NE2 . HIS B 1 486 ? 124.022 28.670 80.115  1.00 79.37  ? 486  HIS B NE2 1 
ATOM   8037  N  N   . SER B 1 487 ? 119.294 27.321 76.535  1.00 72.42  ? 487  SER B N   1 
ATOM   8038  C  CA  . SER B 1 487 ? 118.121 26.598 77.014  1.00 72.36  ? 487  SER B CA  1 
ATOM   8039  C  C   . SER B 1 487 ? 117.543 25.919 75.779  1.00 72.41  ? 487  SER B C   1 
ATOM   8040  O  O   . SER B 1 487 ? 117.790 26.359 74.655  1.00 72.75  ? 487  SER B O   1 
ATOM   8041  C  CB  . SER B 1 487 ? 117.088 27.558 77.606  1.00 72.58  ? 487  SER B CB  1 
ATOM   8042  O  OG  . SER B 1 487 ? 116.479 28.338 76.592  1.00 73.18  ? 487  SER B OG  1 
ATOM   8043  N  N   . GLN B 1 488 ? 116.770 24.860 75.978  1.00 71.80  ? 488  GLN B N   1 
ATOM   8044  C  CA  . GLN B 1 488 ? 116.202 24.134 74.850  1.00 71.84  ? 488  GLN B CA  1 
ATOM   8045  C  C   . GLN B 1 488 ? 114.910 24.714 74.272  1.00 70.05  ? 488  GLN B C   1 
ATOM   8046  O  O   . GLN B 1 488 ? 114.594 24.477 73.105  1.00 70.17  ? 488  GLN B O   1 
ATOM   8047  C  CB  . GLN B 1 488 ? 115.976 22.667 75.236  1.00 75.06  ? 488  GLN B CB  1 
ATOM   8048  C  CG  . GLN B 1 488 ? 117.258 21.869 75.478  1.00 78.50  ? 488  GLN B CG  1 
ATOM   8049  C  CD  . GLN B 1 488 ? 118.080 22.405 76.640  1.00 81.23  ? 488  GLN B CD  1 
ATOM   8050  O  OE1 . GLN B 1 488 ? 117.637 22.392 77.792  1.00 82.12  ? 488  GLN B OE1 1 
ATOM   8051  N  NE2 . GLN B 1 488 ? 119.285 22.883 76.340  1.00 82.17  ? 488  GLN B NE2 1 
ATOM   8052  N  N   . GLU B 1 489 ? 114.169 25.475 75.072  1.00 67.46  ? 489  GLU B N   1 
ATOM   8053  C  CA  . GLU B 1 489 ? 112.905 26.051 74.612  1.00 64.90  ? 489  GLU B CA  1 
ATOM   8054  C  C   . GLU B 1 489 ? 113.035 27.065 73.479  1.00 61.01  ? 489  GLU B C   1 
ATOM   8055  O  O   . GLU B 1 489 ? 114.036 27.777 73.378  1.00 60.39  ? 489  GLU B O   1 
ATOM   8056  C  CB  . GLU B 1 489 ? 112.159 26.682 75.789  1.00 67.41  ? 489  GLU B CB  1 
ATOM   8057  C  CG  . GLU B 1 489 ? 111.722 25.667 76.837  1.00 71.09  ? 489  GLU B CG  1 
ATOM   8058  C  CD  . GLU B 1 489 ? 112.325 25.937 78.200  1.00 73.78  ? 489  GLU B CD  1 
ATOM   8059  O  OE1 . GLU B 1 489 ? 113.562 26.103 78.281  1.00 74.94  ? 489  GLU B OE1 1 
ATOM   8060  O  OE2 . GLU B 1 489 ? 111.562 25.978 79.190  1.00 75.43  ? 489  GLU B OE2 1 
ATOM   8061  N  N   . SER B 1 490 ? 112.012 27.120 72.627  1.00 56.54  ? 490  SER B N   1 
ATOM   8062  C  CA  . SER B 1 490 ? 111.993 28.043 71.492  1.00 52.42  ? 490  SER B CA  1 
ATOM   8063  C  C   . SER B 1 490 ? 112.351 29.457 71.944  1.00 48.35  ? 490  SER B C   1 
ATOM   8064  O  O   . SER B 1 490 ? 111.949 29.899 73.020  1.00 48.15  ? 490  SER B O   1 
ATOM   8065  C  CB  . SER B 1 490 ? 110.617 28.028 70.820  1.00 51.49  ? 490  SER B CB  1 
ATOM   8066  O  OG  . SER B 1 490 ? 109.594 28.345 71.743  1.00 53.82  ? 490  SER B OG  1 
ATOM   8067  N  N   . LYS B 1 491 ? 113.106 30.165 71.113  1.00 44.35  ? 491  LYS B N   1 
ATOM   8068  C  CA  . LYS B 1 491 ? 113.556 31.506 71.454  1.00 41.44  ? 491  LYS B CA  1 
ATOM   8069  C  C   . LYS B 1 491 ? 112.683 32.652 70.965  1.00 39.76  ? 491  LYS B C   1 
ATOM   8070  O  O   . LYS B 1 491 ? 112.277 32.690 69.806  1.00 40.32  ? 491  LYS B O   1 
ATOM   8071  C  CB  . LYS B 1 491 ? 114.983 31.716 70.936  1.00 41.62  ? 491  LYS B CB  1 
ATOM   8072  C  CG  . LYS B 1 491 ? 116.035 30.808 71.567  1.00 40.52  ? 491  LYS B CG  1 
ATOM   8073  C  CD  . LYS B 1 491 ? 116.253 31.138 73.040  1.00 42.22  ? 491  LYS B CD  1 
ATOM   8074  C  CE  . LYS B 1 491 ? 117.373 30.296 73.635  1.00 42.36  ? 491  LYS B CE  1 
ATOM   8075  N  NZ  . LYS B 1 491 ? 117.074 28.840 73.567  1.00 42.73  ? 491  LYS B NZ  1 
ATOM   8076  N  N   . TRP B 1 492 ? 112.398 33.586 71.869  1.00 37.50  ? 492  TRP B N   1 
ATOM   8077  C  CA  . TRP B 1 492 ? 111.617 34.772 71.544  1.00 32.99  ? 492  TRP B CA  1 
ATOM   8078  C  C   . TRP B 1 492 ? 112.650 35.654 70.848  1.00 31.74  ? 492  TRP B C   1 
ATOM   8079  O  O   . TRP B 1 492 ? 113.596 36.118 71.479  1.00 32.36  ? 492  TRP B O   1 
ATOM   8080  C  CB  . TRP B 1 492 ? 111.132 35.443 72.828  1.00 30.65  ? 492  TRP B CB  1 
ATOM   8081  C  CG  . TRP B 1 492 ? 110.283 36.678 72.626  1.00 29.37  ? 492  TRP B CG  1 
ATOM   8082  C  CD1 . TRP B 1 492 ? 110.313 37.534 71.563  1.00 29.12  ? 492  TRP B CD1 1 
ATOM   8083  C  CD2 . TRP B 1 492 ? 109.328 37.220 73.548  1.00 27.16  ? 492  TRP B CD2 1 
ATOM   8084  N  NE1 . TRP B 1 492 ? 109.439 38.574 71.762  1.00 27.45  ? 492  TRP B NE1 1 
ATOM   8085  C  CE2 . TRP B 1 492 ? 108.822 38.407 72.974  1.00 27.95  ? 492  TRP B CE2 1 
ATOM   8086  C  CE3 . TRP B 1 492 ? 108.855 36.820 74.805  1.00 27.20  ? 492  TRP B CE3 1 
ATOM   8087  C  CZ2 . TRP B 1 492 ? 107.864 39.201 73.616  1.00 27.47  ? 492  TRP B CZ2 1 
ATOM   8088  C  CZ3 . TRP B 1 492 ? 107.904 37.608 75.445  1.00 27.93  ? 492  TRP B CZ3 1 
ATOM   8089  C  CH2 . TRP B 1 492 ? 107.419 38.788 74.847  1.00 28.53  ? 492  TRP B CH2 1 
ATOM   8090  N  N   . PRO B 1 493 ? 112.497 35.879 69.536  1.00 29.97  ? 493  PRO B N   1 
ATOM   8091  C  CA  . PRO B 1 493 ? 113.463 36.712 68.816  1.00 28.82  ? 493  PRO B CA  1 
ATOM   8092  C  C   . PRO B 1 493 ? 113.316 38.208 69.033  1.00 29.73  ? 493  PRO B C   1 
ATOM   8093  O  O   . PRO B 1 493 ? 112.235 38.703 69.346  1.00 28.28  ? 493  PRO B O   1 
ATOM   8094  C  CB  . PRO B 1 493 ? 113.224 36.327 67.363  1.00 27.53  ? 493  PRO B CB  1 
ATOM   8095  C  CG  . PRO B 1 493 ? 111.747 36.107 67.342  1.00 28.95  ? 493  PRO B CG  1 
ATOM   8096  C  CD  . PRO B 1 493 ? 111.513 35.297 68.607  1.00 27.45  ? 493  PRO B CD  1 
ATOM   8097  N  N   . LEU B 1 494 ? 114.429 38.911 68.859  1.00 30.20  ? 494  LEU B N   1 
ATOM   8098  C  CA  . LEU B 1 494 ? 114.480 40.357 68.992  1.00 30.73  ? 494  LEU B CA  1 
ATOM   8099  C  C   . LEU B 1 494 ? 113.710 41.007 67.857  1.00 31.98  ? 494  LEU B C   1 
ATOM   8100  O  O   . LEU B 1 494 ? 113.688 40.501 66.732  1.00 31.93  ? 494  LEU B O   1 
ATOM   8101  C  CB  . LEU B 1 494 ? 115.928 40.851 68.919  1.00 30.36  ? 494  LEU B CB  1 
ATOM   8102  C  CG  . LEU B 1 494 ? 116.777 40.934 70.185  1.00 34.28  ? 494  LEU B CG  1 
ATOM   8103  C  CD1 . LEU B 1 494 ? 118.247 41.115 69.802  1.00 34.90  ? 494  LEU B CD1 1 
ATOM   8104  C  CD2 . LEU B 1 494 ? 116.299 42.097 71.047  1.00 32.26  ? 494  LEU B CD2 1 
ATOM   8105  N  N   . PHE B 1 495 ? 113.095 42.144 68.151  1.00 30.53  ? 495  PHE B N   1 
ATOM   8106  C  CA  . PHE B 1 495 ? 112.367 42.883 67.144  1.00 28.95  ? 495  PHE B CA  1 
ATOM   8107  C  C   . PHE B 1 495 ? 113.383 43.822 66.515  1.00 30.21  ? 495  PHE B C   1 
ATOM   8108  O  O   . PHE B 1 495 ? 114.010 44.615 67.214  1.00 31.86  ? 495  PHE B O   1 
ATOM   8109  C  CB  . PHE B 1 495 ? 111.230 43.676 67.793  1.00 26.49  ? 495  PHE B CB  1 
ATOM   8110  C  CG  . PHE B 1 495 ? 110.517 44.593 66.846  1.00 24.18  ? 495  PHE B CG  1 
ATOM   8111  C  CD1 . PHE B 1 495 ? 111.011 45.868 66.589  1.00 23.12  ? 495  PHE B CD1 1 
ATOM   8112  C  CD2 . PHE B 1 495 ? 109.360 44.177 66.201  1.00 23.22  ? 495  PHE B CD2 1 
ATOM   8113  C  CE1 . PHE B 1 495 ? 110.362 46.717 65.703  1.00 24.84  ? 495  PHE B CE1 1 
ATOM   8114  C  CE2 . PHE B 1 495 ? 108.699 45.018 65.310  1.00 24.82  ? 495  PHE B CE2 1 
ATOM   8115  C  CZ  . PHE B 1 495 ? 109.200 46.292 65.060  1.00 25.81  ? 495  PHE B CZ  1 
ATOM   8116  N  N   . THR B 1 496 ? 113.562 43.731 65.203  1.00 30.78  ? 496  THR B N   1 
ATOM   8117  C  CA  . THR B 1 496 ? 114.524 44.593 64.527  1.00 32.34  ? 496  THR B CA  1 
ATOM   8118  C  C   . THR B 1 496 ? 113.819 45.474 63.519  1.00 32.83  ? 496  THR B C   1 
ATOM   8119  O  O   . THR B 1 496 ? 112.777 45.111 62.990  1.00 31.14  ? 496  THR B O   1 
ATOM   8120  C  CB  . THR B 1 496 ? 115.604 43.776 63.780  1.00 33.10  ? 496  THR B CB  1 
ATOM   8121  O  OG1 . THR B 1 496 ? 114.988 43.028 62.722  1.00 33.20  ? 496  THR B OG1 1 
ATOM   8122  C  CG2 . THR B 1 496 ? 116.319 42.820 64.740  1.00 31.71  ? 496  THR B CG2 1 
ATOM   8123  N  N   . THR B 1 497 ? 114.391 46.639 63.255  1.00 35.94  ? 497  THR B N   1 
ATOM   8124  C  CA  . THR B 1 497 ? 113.798 47.558 62.296  1.00 40.16  ? 497  THR B CA  1 
ATOM   8125  C  C   . THR B 1 497 ? 113.583 46.869 60.943  1.00 41.72  ? 497  THR B C   1 
ATOM   8126  O  O   . THR B 1 497 ? 112.601 47.133 60.245  1.00 41.19  ? 497  THR B O   1 
ATOM   8127  C  CB  . THR B 1 497 ? 114.695 48.785 62.092  1.00 40.37  ? 497  THR B CB  1 
ATOM   8128  O  OG1 . THR B 1 497 ? 114.237 49.530 60.960  1.00 43.00  ? 497  THR B OG1 1 
ATOM   8129  C  CG2 . THR B 1 497 ? 116.129 48.352 61.851  1.00 44.60  ? 497  THR B CG2 1 
ATOM   8130  N  N   . LYS B 1 498 ? 114.495 45.967 60.591  1.00 43.08  ? 498  LYS B N   1 
ATOM   8131  C  CA  . LYS B 1 498 ? 114.416 45.256 59.321  1.00 43.20  ? 498  LYS B CA  1 
ATOM   8132  C  C   . LYS B 1 498 ? 113.379 44.140 59.247  1.00 41.43  ? 498  LYS B C   1 
ATOM   8133  O  O   . LYS B 1 498 ? 112.492 44.178 58.403  1.00 42.66  ? 498  LYS B O   1 
ATOM   8134  C  CB  . LYS B 1 498 ? 115.785 44.678 58.951  1.00 45.86  ? 498  LYS B CB  1 
ATOM   8135  C  CG  . LYS B 1 498 ? 115.789 43.965 57.601  1.00 50.38  ? 498  LYS B CG  1 
ATOM   8136  C  CD  . LYS B 1 498 ? 117.134 43.320 57.291  1.00 54.11  ? 498  LYS B CD  1 
ATOM   8137  C  CE  . LYS B 1 498 ? 117.118 42.637 55.923  1.00 54.90  ? 498  LYS B CE  1 
ATOM   8138  N  NZ  . LYS B 1 498 ? 116.819 43.605 54.829  1.00 55.16  ? 498  LYS B NZ  1 
ATOM   8139  N  N   . GLU B 1 499 ? 113.491 43.145 60.121  1.00 40.10  ? 499  GLU B N   1 
ATOM   8140  C  CA  . GLU B 1 499 ? 112.573 42.008 60.096  1.00 39.27  ? 499  GLU B CA  1 
ATOM   8141  C  C   . GLU B 1 499 ? 111.309 42.167 60.928  1.00 36.84  ? 499  GLU B C   1 
ATOM   8142  O  O   . GLU B 1 499 ? 110.325 41.464 60.707  1.00 36.77  ? 499  GLU B O   1 
ATOM   8143  C  CB  . GLU B 1 499 ? 113.323 40.741 60.502  1.00 42.01  ? 499  GLU B CB  1 
ATOM   8144  C  CG  . GLU B 1 499 ? 114.313 40.282 59.443  1.00 48.46  ? 499  GLU B CG  1 
ATOM   8145  C  CD  . GLU B 1 499 ? 115.516 39.570 60.030  1.00 54.71  ? 499  GLU B CD  1 
ATOM   8146  O  OE1 . GLU B 1 499 ? 115.330 38.563 60.757  1.00 57.22  ? 499  GLU B OE1 1 
ATOM   8147  O  OE2 . GLU B 1 499 ? 116.653 40.021 59.762  1.00 56.74  ? 499  GLU B OE2 1 
ATOM   8148  N  N   . GLN B 1 500 ? 111.346 43.079 61.891  1.00 33.84  ? 500  GLN B N   1 
ATOM   8149  C  CA  . GLN B 1 500 ? 110.188 43.362 62.731  1.00 31.34  ? 500  GLN B CA  1 
ATOM   8150  C  C   . GLN B 1 500 ? 109.454 42.125 63.240  1.00 29.39  ? 500  GLN B C   1 
ATOM   8151  O  O   . GLN B 1 500 ? 108.243 42.043 63.108  1.00 28.24  ? 500  GLN B O   1 
ATOM   8152  C  CB  . GLN B 1 500 ? 109.217 44.235 61.939  1.00 31.88  ? 500  GLN B CB  1 
ATOM   8153  C  CG  . GLN B 1 500 ? 109.828 45.550 61.493  1.00 33.55  ? 500  GLN B CG  1 
ATOM   8154  C  CD  . GLN B 1 500 ? 109.074 46.194 60.351  1.00 33.59  ? 500  GLN B CD  1 
ATOM   8155  O  OE1 . GLN B 1 500 ? 107.871 46.415 60.438  1.00 33.69  ? 500  GLN B OE1 1 
ATOM   8156  N  NE2 . GLN B 1 500 ? 109.786 46.506 59.269  1.00 34.79  ? 500  GLN B NE2 1 
ATOM   8157  N  N   . LYS B 1 501 ? 110.176 41.178 63.829  1.00 28.61  ? 501  LYS B N   1 
ATOM   8158  C  CA  . LYS B 1 501 ? 109.553 39.953 64.331  1.00 28.95  ? 501  LYS B CA  1 
ATOM   8159  C  C   . LYS B 1 501 ? 108.836 40.109 65.671  1.00 29.17  ? 501  LYS B C   1 
ATOM   8160  O  O   . LYS B 1 501 ? 109.119 41.033 66.440  1.00 28.99  ? 501  LYS B O   1 
ATOM   8161  C  CB  . LYS B 1 501 ? 110.592 38.843 64.453  1.00 30.90  ? 501  LYS B CB  1 
ATOM   8162  C  CG  . LYS B 1 501 ? 111.250 38.455 63.142  1.00 34.41  ? 501  LYS B CG  1 
ATOM   8163  C  CD  . LYS B 1 501 ? 112.303 37.386 63.359  1.00 36.22  ? 501  LYS B CD  1 
ATOM   8164  C  CE  . LYS B 1 501 ? 112.899 36.919 62.046  1.00 38.61  ? 501  LYS B CE  1 
ATOM   8165  N  NZ  . LYS B 1 501 ? 113.977 35.908 62.258  1.00 43.66  ? 501  LYS B NZ  1 
ATOM   8166  N  N   . PHE B 1 502 ? 107.902 39.196 65.930  1.00 27.39  ? 502  PHE B N   1 
ATOM   8167  C  CA  . PHE B 1 502 ? 107.133 39.177 67.169  1.00 26.33  ? 502  PHE B CA  1 
ATOM   8168  C  C   . PHE B 1 502 ? 106.519 37.788 67.320  1.00 27.77  ? 502  PHE B C   1 
ATOM   8169  O  O   . PHE B 1 502 ? 106.382 37.071 66.333  1.00 28.29  ? 502  PHE B O   1 
ATOM   8170  C  CB  . PHE B 1 502 ? 106.037 40.260 67.138  1.00 24.68  ? 502  PHE B CB  1 
ATOM   8171  C  CG  . PHE B 1 502 ? 104.819 39.905 66.304  1.00 24.87  ? 502  PHE B CG  1 
ATOM   8172  C  CD1 . PHE B 1 502 ? 103.731 39.251 66.871  1.00 23.34  ? 502  PHE B CD1 1 
ATOM   8173  C  CD2 . PHE B 1 502 ? 104.746 40.257 64.961  1.00 23.57  ? 502  PHE B CD2 1 
ATOM   8174  C  CE1 . PHE B 1 502 ? 102.592 38.960 66.115  1.00 23.38  ? 502  PHE B CE1 1 
ATOM   8175  C  CE2 . PHE B 1 502 ? 103.613 39.969 64.196  1.00 23.51  ? 502  PHE B CE2 1 
ATOM   8176  C  CZ  . PHE B 1 502 ? 102.534 39.320 64.777  1.00 21.73  ? 502  PHE B CZ  1 
ATOM   8177  N  N   . ILE B 1 503 ? 106.168 37.396 68.545  1.00 28.64  ? 503  ILE B N   1 
ATOM   8178  C  CA  . ILE B 1 503 ? 105.558 36.086 68.774  1.00 30.78  ? 503  ILE B CA  1 
ATOM   8179  C  C   . ILE B 1 503 ? 104.133 36.184 69.292  1.00 31.78  ? 503  ILE B C   1 
ATOM   8180  O  O   . ILE B 1 503 ? 103.737 37.192 69.870  1.00 30.47  ? 503  ILE B O   1 
ATOM   8181  C  CB  . ILE B 1 503 ? 106.312 35.232 69.830  1.00 31.10  ? 503  ILE B CB  1 
ATOM   8182  C  CG1 . ILE B 1 503 ? 106.326 35.961 71.171  1.00 30.49  ? 503  ILE B CG1 1 
ATOM   8183  C  CG2 . ILE B 1 503 ? 107.703 34.874 69.340  1.00 31.19  ? 503  ILE B CG2 1 
ATOM   8184  C  CD1 . ILE B 1 503 ? 106.710 35.083 72.337  1.00 30.94  ? 503  ILE B CD1 1 
ATOM   8185  N  N   . ASP B 1 504 ? 103.356 35.127 69.074  1.00 34.10  ? 504  ASP B N   1 
ATOM   8186  C  CA  . ASP B 1 504 ? 102.005 35.094 69.602  1.00 36.33  ? 504  ASP B CA  1 
ATOM   8187  C  C   . ASP B 1 504 ? 102.203 34.491 70.977  1.00 36.03  ? 504  ASP B C   1 
ATOM   8188  O  O   . ASP B 1 504 ? 103.083 33.658 71.170  1.00 37.57  ? 504  ASP B O   1 
ATOM   8189  C  CB  . ASP B 1 504 ? 101.082 34.185 68.785  1.00 39.64  ? 504  ASP B CB  1 
ATOM   8190  C  CG  . ASP B 1 504 ? 100.775 34.744 67.413  1.00 43.03  ? 504  ASP B CG  1 
ATOM   8191  O  OD1 . ASP B 1 504 ? 100.793 35.984 67.249  1.00 44.90  ? 504  ASP B OD1 1 
ATOM   8192  O  OD2 . ASP B 1 504 ? 100.501 33.941 66.497  1.00 46.38  ? 504  ASP B OD2 1 
ATOM   8193  N  N   . LEU B 1 505 ? 101.402 34.922 71.937  1.00 35.19  ? 505  LEU B N   1 
ATOM   8194  C  CA  . LEU B 1 505 ? 101.510 34.397 73.284  1.00 33.02  ? 505  LEU B CA  1 
ATOM   8195  C  C   . LEU B 1 505 ? 100.219 33.627 73.540  1.00 33.48  ? 505  LEU B C   1 
ATOM   8196  O  O   . LEU B 1 505 ? 99.148  34.228 73.655  1.00 32.67  ? 505  LEU B O   1 
ATOM   8197  C  CB  . LEU B 1 505 ? 101.667 35.562 74.271  1.00 32.88  ? 505  LEU B CB  1 
ATOM   8198  C  CG  . LEU B 1 505 ? 102.736 35.567 75.374  1.00 33.13  ? 505  LEU B CG  1 
ATOM   8199  C  CD1 . LEU B 1 505 ? 103.973 34.786 74.965  1.00 30.46  ? 505  LEU B CD1 1 
ATOM   8200  C  CD2 . LEU B 1 505 ? 103.102 37.021 75.678  1.00 29.35  ? 505  LEU B CD2 1 
ATOM   8201  N  N   . ASN B 1 506 ? 100.323 32.298 73.572  1.00 32.77  ? 506  ASN B N   1 
ATOM   8202  C  CA  . ASN B 1 506 ? 99.187  31.419 73.839  1.00 33.63  ? 506  ASN B CA  1 
ATOM   8203  C  C   . ASN B 1 506 ? 99.651  30.040 74.314  1.00 35.66  ? 506  ASN B C   1 
ATOM   8204  O  O   . ASN B 1 506 ? 100.833 29.842 74.600  1.00 36.77  ? 506  ASN B O   1 
ATOM   8205  C  CB  . ASN B 1 506 ? 98.275  31.282 72.608  1.00 33.10  ? 506  ASN B CB  1 
ATOM   8206  C  CG  . ASN B 1 506 ? 99.019  30.873 71.356  1.00 33.67  ? 506  ASN B CG  1 
ATOM   8207  O  OD1 . ASN B 1 506 ? 99.787  29.914 71.356  1.00 34.51  ? 506  ASN B OD1 1 
ATOM   8208  N  ND2 . ASN B 1 506 ? 98.780  31.595 70.273  1.00 34.41  ? 506  ASN B ND2 1 
ATOM   8209  N  N   . THR B 1 507 ? 98.723  29.092 74.402  1.00 37.34  ? 507  THR B N   1 
ATOM   8210  C  CA  . THR B 1 507 ? 99.039  27.747 74.877  1.00 40.30  ? 507  THR B CA  1 
ATOM   8211  C  C   . THR B 1 507 ? 99.571  26.804 73.816  1.00 41.51  ? 507  THR B C   1 
ATOM   8212  O  O   . THR B 1 507 ? 99.842  25.639 74.105  1.00 43.72  ? 507  THR B O   1 
ATOM   8213  C  CB  . THR B 1 507 ? 97.822  27.067 75.520  1.00 40.42  ? 507  THR B CB  1 
ATOM   8214  O  OG1 . THR B 1 507 ? 96.726  27.085 74.598  1.00 42.69  ? 507  THR B OG1 1 
ATOM   8215  C  CG2 . THR B 1 507 ? 97.428  27.776 76.799  1.00 39.42  ? 507  THR B CG2 1 
ATOM   8216  N  N   . GLU B 1 508 ? 99.707  27.294 72.590  1.00 42.35  ? 508  GLU B N   1 
ATOM   8217  C  CA  . GLU B 1 508 ? 100.240 26.473 71.508  1.00 42.36  ? 508  GLU B CA  1 
ATOM   8218  C  C   . GLU B 1 508 ? 101.730 26.753 71.376  1.00 42.28  ? 508  GLU B C   1 
ATOM   8219  O  O   . GLU B 1 508 ? 102.233 27.737 71.918  1.00 41.64  ? 508  GLU B O   1 
ATOM   8220  C  CB  . GLU B 1 508 ? 99.569  26.817 70.184  1.00 43.51  ? 508  GLU B CB  1 
ATOM   8221  C  CG  . GLU B 1 508 ? 98.084  26.619 70.155  1.00 48.20  ? 508  GLU B CG  1 
ATOM   8222  C  CD  . GLU B 1 508 ? 97.514  26.954 68.800  1.00 51.63  ? 508  GLU B CD  1 
ATOM   8223  O  OE1 . GLU B 1 508 ? 97.801  28.064 68.300  1.00 53.23  ? 508  GLU B OE1 1 
ATOM   8224  O  OE2 . GLU B 1 508 ? 96.784  26.113 68.233  1.00 54.60  ? 508  GLU B OE2 1 
ATOM   8225  N  N   . PRO B 1 509 ? 102.462 25.883 70.662  1.00 42.90  ? 509  PRO B N   1 
ATOM   8226  C  CA  . PRO B 1 509 ? 103.900 26.107 70.492  1.00 42.70  ? 509  PRO B CA  1 
ATOM   8227  C  C   . PRO B 1 509 ? 104.130 27.514 69.940  1.00 42.29  ? 509  PRO B C   1 
ATOM   8228  O  O   . PRO B 1 509 ? 103.276 28.060 69.245  1.00 40.02  ? 509  PRO B O   1 
ATOM   8229  C  CB  . PRO B 1 509 ? 104.295 25.022 69.499  1.00 43.05  ? 509  PRO B CB  1 
ATOM   8230  C  CG  . PRO B 1 509 ? 103.399 23.890 69.902  1.00 44.62  ? 509  PRO B CG  1 
ATOM   8231  C  CD  . PRO B 1 509 ? 102.062 24.581 70.095  1.00 43.13  ? 509  PRO B CD  1 
ATOM   8232  N  N   . MET B 1 510 ? 105.280 28.095 70.255  1.00 42.13  ? 510  MET B N   1 
ATOM   8233  C  CA  . MET B 1 510 ? 105.604 29.437 69.799  1.00 43.26  ? 510  MET B CA  1 
ATOM   8234  C  C   . MET B 1 510 ? 105.578 29.563 68.285  1.00 42.95  ? 510  MET B C   1 
ATOM   8235  O  O   . MET B 1 510 ? 105.918 28.629 67.562  1.00 44.49  ? 510  MET B O   1 
ATOM   8236  C  CB  . MET B 1 510 ? 106.987 29.848 70.307  1.00 45.47  ? 510  MET B CB  1 
ATOM   8237  C  CG  . MET B 1 510 ? 107.408 31.263 69.921  1.00 46.23  ? 510  MET B CG  1 
ATOM   8238  S  SD  . MET B 1 510 ? 109.050 31.682 70.543  1.00 48.87  ? 510  MET B SD  1 
ATOM   8239  C  CE  . MET B 1 510 ? 108.745 31.696 72.291  1.00 50.16  ? 510  MET B CE  1 
ATOM   8240  N  N   . LYS B 1 511 ? 105.154 30.728 67.816  1.00 42.35  ? 511  LYS B N   1 
ATOM   8241  C  CA  . LYS B 1 511 ? 105.108 31.026 66.394  1.00 42.05  ? 511  LYS B CA  1 
ATOM   8242  C  C   . LYS B 1 511 ? 105.717 32.409 66.230  1.00 40.87  ? 511  LYS B C   1 
ATOM   8243  O  O   . LYS B 1 511 ? 105.443 33.314 67.023  1.00 43.38  ? 511  LYS B O   1 
ATOM   8244  C  CB  . LYS B 1 511 ? 103.668 31.046 65.878  1.00 43.98  ? 511  LYS B CB  1 
ATOM   8245  C  CG  . LYS B 1 511 ? 102.946 29.711 65.904  1.00 46.49  ? 511  LYS B CG  1 
ATOM   8246  C  CD  . LYS B 1 511 ? 101.587 29.845 65.219  1.00 50.35  ? 511  LYS B CD  1 
ATOM   8247  C  CE  . LYS B 1 511 ? 100.843 28.513 65.109  1.00 51.22  ? 511  LYS B CE  1 
ATOM   8248  N  NZ  . LYS B 1 511 ? 100.338 27.998 66.419  1.00 52.75  ? 511  LYS B NZ  1 
ATOM   8249  N  N   . VAL B 1 512 ? 106.556 32.573 65.218  1.00 38.70  ? 512  VAL B N   1 
ATOM   8250  C  CA  . VAL B 1 512 ? 107.179 33.862 64.962  1.00 37.23  ? 512  VAL B CA  1 
ATOM   8251  C  C   . VAL B 1 512 ? 106.497 34.486 63.753  1.00 37.33  ? 512  VAL B C   1 
ATOM   8252  O  O   . VAL B 1 512 ? 106.340 33.842 62.718  1.00 39.01  ? 512  VAL B O   1 
ATOM   8253  C  CB  . VAL B 1 512 ? 108.693 33.712 64.674  1.00 37.56  ? 512  VAL B CB  1 
ATOM   8254  C  CG1 . VAL B 1 512 ? 109.300 35.067 64.343  1.00 35.25  ? 512  VAL B CG1 1 
ATOM   8255  C  CG2 . VAL B 1 512 ? 109.392 33.087 65.876  1.00 35.02  ? 512  VAL B CG2 1 
ATOM   8256  N  N   . HIS B 1 513 ? 106.074 35.732 63.894  1.00 35.67  ? 513  HIS B N   1 
ATOM   8257  C  CA  . HIS B 1 513 ? 105.416 36.436 62.811  1.00 35.09  ? 513  HIS B CA  1 
ATOM   8258  C  C   . HIS B 1 513 ? 106.214 37.688 62.499  1.00 34.34  ? 513  HIS B C   1 
ATOM   8259  O  O   . HIS B 1 513 ? 107.241 37.941 63.122  1.00 34.80  ? 513  HIS B O   1 
ATOM   8260  C  CB  . HIS B 1 513 ? 103.998 36.824 63.219  1.00 35.94  ? 513  HIS B CB  1 
ATOM   8261  C  CG  . HIS B 1 513 ? 103.115 35.657 63.523  1.00 39.15  ? 513  HIS B CG  1 
ATOM   8262  N  ND1 . HIS B 1 513 ? 102.804 34.695 62.586  1.00 40.23  ? 513  HIS B ND1 1 
ATOM   8263  C  CD2 . HIS B 1 513 ? 102.461 35.306 64.655  1.00 40.36  ? 513  HIS B CD2 1 
ATOM   8264  C  CE1 . HIS B 1 513 ? 101.993 33.804 63.127  1.00 41.09  ? 513  HIS B CE1 1 
ATOM   8265  N  NE2 . HIS B 1 513 ? 101.769 34.152 64.382  1.00 40.14  ? 513  HIS B NE2 1 
ATOM   8266  N  N   . GLN B 1 514 ? 105.740 38.469 61.534  1.00 33.48  ? 514  GLN B N   1 
ATOM   8267  C  CA  . GLN B 1 514 ? 106.414 39.700 61.154  1.00 33.33  ? 514  GLN B CA  1 
ATOM   8268  C  C   . GLN B 1 514 ? 105.425 40.794 60.793  1.00 31.66  ? 514  GLN B C   1 
ATOM   8269  O  O   . GLN B 1 514 ? 104.329 40.520 60.305  1.00 30.26  ? 514  GLN B O   1 
ATOM   8270  C  CB  . GLN B 1 514 ? 107.366 39.453 59.975  1.00 35.09  ? 514  GLN B CB  1 
ATOM   8271  C  CG  . GLN B 1 514 ? 108.529 38.524 60.314  1.00 40.14  ? 514  GLN B CG  1 
ATOM   8272  C  CD  . GLN B 1 514 ? 109.580 38.438 59.213  1.00 43.59  ? 514  GLN B CD  1 
ATOM   8273  O  OE1 . GLN B 1 514 ? 110.367 37.487 59.171  1.00 46.94  ? 514  GLN B OE1 1 
ATOM   8274  N  NE2 . GLN B 1 514 ? 109.609 39.434 58.329  1.00 41.27  ? 514  GLN B NE2 1 
ATOM   8275  N  N   . ARG B 1 515 ? 105.819 42.035 61.060  1.00 30.43  ? 515  ARG B N   1 
ATOM   8276  C  CA  . ARG B 1 515 ? 105.004 43.206 60.749  1.00 29.22  ? 515  ARG B CA  1 
ATOM   8277  C  C   . ARG B 1 515 ? 103.573 43.172 61.283  1.00 27.66  ? 515  ARG B C   1 
ATOM   8278  O  O   . ARG B 1 515 ? 102.620 43.113 60.507  1.00 29.31  ? 515  ARG B O   1 
ATOM   8279  C  CB  . ARG B 1 515 ? 104.974 43.405 59.238  1.00 27.50  ? 515  ARG B CB  1 
ATOM   8280  C  CG  . ARG B 1 515 ? 106.346 43.550 58.626  1.00 35.54  ? 515  ARG B CG  1 
ATOM   8281  C  CD  . ARG B 1 515 ? 106.292 44.238 57.274  1.00 37.80  ? 515  ARG B CD  1 
ATOM   8282  N  NE  . ARG B 1 515 ? 107.608 44.321 56.650  1.00 42.56  ? 515  ARG B NE  1 
ATOM   8283  C  CZ  . ARG B 1 515 ? 107.861 45.000 55.535  1.00 45.71  ? 515  ARG B CZ  1 
ATOM   8284  N  NH1 . ARG B 1 515 ? 106.883 45.662 54.924  1.00 47.53  ? 515  ARG B NH1 1 
ATOM   8285  N  NH2 . ARG B 1 515 ? 109.086 45.012 55.024  1.00 44.95  ? 515  ARG B NH2 1 
ATOM   8286  N  N   . LEU B 1 516 ? 103.424 43.220 62.603  1.00 28.16  ? 516  LEU B N   1 
ATOM   8287  C  CA  . LEU B 1 516 ? 102.107 43.201 63.237  1.00 27.59  ? 516  LEU B CA  1 
ATOM   8288  C  C   . LEU B 1 516 ? 101.164 44.266 62.662  1.00 27.44  ? 516  LEU B C   1 
ATOM   8289  O  O   . LEU B 1 516 ? 101.387 45.479 62.801  1.00 24.46  ? 516  LEU B O   1 
ATOM   8290  C  CB  . LEU B 1 516 ? 102.262 43.373 64.756  1.00 29.65  ? 516  LEU B CB  1 
ATOM   8291  C  CG  . LEU B 1 516 ? 101.044 43.585 65.670  1.00 29.38  ? 516  LEU B CG  1 
ATOM   8292  C  CD1 . LEU B 1 516 ? 99.918  42.645 65.315  1.00 33.05  ? 516  LEU B CD1 1 
ATOM   8293  C  CD2 . LEU B 1 516 ? 101.478 43.358 67.109  1.00 31.12  ? 516  LEU B CD2 1 
ATOM   8294  N  N   . ARG B 1 517 ? 100.117 43.785 61.994  1.00 28.31  ? 517  ARG B N   1 
ATOM   8295  C  CA  . ARG B 1 517 ? 99.099  44.628 61.369  1.00 28.81  ? 517  ARG B CA  1 
ATOM   8296  C  C   . ARG B 1 517 ? 99.621  45.848 60.600  1.00 26.94  ? 517  ARG B C   1 
ATOM   8297  O  O   . ARG B 1 517 ? 99.076  46.942 60.724  1.00 24.44  ? 517  ARG B O   1 
ATOM   8298  C  CB  . ARG B 1 517 ? 98.072  45.064 62.428  1.00 31.19  ? 517  ARG B CB  1 
ATOM   8299  C  CG  . ARG B 1 517 ? 97.300  43.881 63.031  1.00 36.72  ? 517  ARG B CG  1 
ATOM   8300  C  CD  . ARG B 1 517 ? 96.178  44.311 63.968  1.00 38.63  ? 517  ARG B CD  1 
ATOM   8301  N  NE  . ARG B 1 517 ? 95.093  45.014 63.283  1.00 39.48  ? 517  ARG B NE  1 
ATOM   8302  C  CZ  . ARG B 1 517 ? 94.168  44.422 62.530  1.00 40.25  ? 517  ARG B CZ  1 
ATOM   8303  N  NH1 . ARG B 1 517 ? 94.190  43.099 62.358  1.00 39.53  ? 517  ARG B NH1 1 
ATOM   8304  N  NH2 . ARG B 1 517 ? 93.212  45.152 61.957  1.00 32.90  ? 517  ARG B NH2 1 
ATOM   8305  N  N   . VAL B 1 518 ? 100.658 45.648 59.786  1.00 25.70  ? 518  VAL B N   1 
ATOM   8306  C  CA  . VAL B 1 518 ? 101.244 46.741 59.007  1.00 25.17  ? 518  VAL B CA  1 
ATOM   8307  C  C   . VAL B 1 518 ? 100.260 47.493 58.119  1.00 25.70  ? 518  VAL B C   1 
ATOM   8308  O  O   . VAL B 1 518 ? 100.291 48.726 58.050  1.00 25.92  ? 518  VAL B O   1 
ATOM   8309  C  CB  . VAL B 1 518 ? 102.386 46.254 58.078  1.00 25.46  ? 518  VAL B CB  1 
ATOM   8310  C  CG1 . VAL B 1 518 ? 103.659 46.130 58.846  1.00 30.04  ? 518  VAL B CG1 1 
ATOM   8311  C  CG2 . VAL B 1 518 ? 102.015 44.927 57.444  1.00 26.05  ? 518  VAL B CG2 1 
ATOM   8312  N  N   . GLN B 1 519 ? 99.401  46.752 57.425  1.00 25.86  ? 519  GLN B N   1 
ATOM   8313  C  CA  . GLN B 1 519 ? 98.439  47.370 56.523  1.00 27.72  ? 519  GLN B CA  1 
ATOM   8314  C  C   . GLN B 1 519 ? 97.635  48.448 57.230  1.00 27.56  ? 519  GLN B C   1 
ATOM   8315  O  O   . GLN B 1 519 ? 97.624  49.606 56.806  1.00 29.17  ? 519  GLN B O   1 
ATOM   8316  C  CB  . GLN B 1 519 ? 97.494  46.316 55.941  1.00 28.71  ? 519  GLN B CB  1 
ATOM   8317  C  CG  . GLN B 1 519 ? 96.790  46.745 54.658  1.00 28.68  ? 519  GLN B CG  1 
ATOM   8318  C  CD  . GLN B 1 519 ? 97.761  47.036 53.517  1.00 31.89  ? 519  GLN B CD  1 
ATOM   8319  O  OE1 . GLN B 1 519 ? 98.785  46.369 53.370  1.00 32.47  ? 519  GLN B OE1 1 
ATOM   8320  N  NE2 . GLN B 1 519 ? 97.430  48.025 52.691  1.00 31.31  ? 519  GLN B NE2 1 
ATOM   8321  N  N   . MET B 1 520 ? 96.977  48.074 58.322  1.00 28.13  ? 520  MET B N   1 
ATOM   8322  C  CA  . MET B 1 520 ? 96.166  49.023 59.065  1.00 29.21  ? 520  MET B CA  1 
ATOM   8323  C  C   . MET B 1 520 ? 96.983  50.127 59.727  1.00 28.86  ? 520  MET B C   1 
ATOM   8324  O  O   . MET B 1 520 ? 96.598  51.295 59.714  1.00 26.93  ? 520  MET B O   1 
ATOM   8325  C  CB  . MET B 1 520 ? 95.330  48.288 60.110  1.00 31.16  ? 520  MET B CB  1 
ATOM   8326  C  CG  . MET B 1 520 ? 94.288  47.370 59.501  1.00 36.87  ? 520  MET B CG  1 
ATOM   8327  S  SD  . MET B 1 520 ? 93.127  48.273 58.439  1.00 42.54  ? 520  MET B SD  1 
ATOM   8328  C  CE  . MET B 1 520 ? 93.922  48.114 56.835  1.00 43.15  ? 520  MET B CE  1 
ATOM   8329  N  N   . CYS B 1 521 ? 98.121  49.776 60.300  1.00 28.98  ? 521  CYS B N   1 
ATOM   8330  C  CA  . CYS B 1 521 ? 98.902  50.806 60.951  1.00 33.13  ? 521  CYS B CA  1 
ATOM   8331  C  C   . CYS B 1 521 ? 99.484  51.828 59.981  1.00 32.09  ? 521  CYS B C   1 
ATOM   8332  O  O   . CYS B 1 521 ? 99.750  52.965 60.374  1.00 33.08  ? 521  CYS B O   1 
ATOM   8333  C  CB  . CYS B 1 521 ? 99.956  50.168 61.852  1.00 33.17  ? 521  CYS B CB  1 
ATOM   8334  S  SG  . CYS B 1 521 ? 99.128  49.301 63.233  1.00 41.81  ? 521  CYS B SG  1 
ATOM   8335  N  N   . VAL B 1 522 ? 99.665  51.451 58.716  1.00 30.25  ? 522  VAL B N   1 
ATOM   8336  C  CA  . VAL B 1 522 ? 100.144 52.432 57.738  1.00 28.49  ? 522  VAL B CA  1 
ATOM   8337  C  C   . VAL B 1 522 ? 99.013  53.458 57.572  1.00 27.80  ? 522  VAL B C   1 
ATOM   8338  O  O   . VAL B 1 522 ? 99.254  54.665 57.492  1.00 26.68  ? 522  VAL B O   1 
ATOM   8339  C  CB  . VAL B 1 522 ? 100.426 51.806 56.357  1.00 29.80  ? 522  VAL B CB  1 
ATOM   8340  C  CG1 . VAL B 1 522 ? 100.614 52.904 55.324  1.00 29.37  ? 522  VAL B CG1 1 
ATOM   8341  C  CG2 . VAL B 1 522 ? 101.673 50.936 56.414  1.00 31.13  ? 522  VAL B CG2 1 
ATOM   8342  N  N   . PHE B 1 523 ? 97.775  52.962 57.525  1.00 25.81  ? 523  PHE B N   1 
ATOM   8343  C  CA  . PHE B 1 523 ? 96.601  53.819 57.384  1.00 25.42  ? 523  PHE B CA  1 
ATOM   8344  C  C   . PHE B 1 523 ? 96.474  54.785 58.561  1.00 26.87  ? 523  PHE B C   1 
ATOM   8345  O  O   . PHE B 1 523 ? 96.285  55.991 58.375  1.00 26.73  ? 523  PHE B O   1 
ATOM   8346  C  CB  . PHE B 1 523 ? 95.334  52.965 57.312  1.00 24.23  ? 523  PHE B CB  1 
ATOM   8347  C  CG  . PHE B 1 523 ? 94.055  53.762 57.330  1.00 23.82  ? 523  PHE B CG  1 
ATOM   8348  C  CD1 . PHE B 1 523 ? 93.533  54.298 56.160  1.00 24.68  ? 523  PHE B CD1 1 
ATOM   8349  C  CD2 . PHE B 1 523 ? 93.369  53.970 58.520  1.00 23.72  ? 523  PHE B CD2 1 
ATOM   8350  C  CE1 . PHE B 1 523 ? 92.342  55.026 56.175  1.00 25.19  ? 523  PHE B CE1 1 
ATOM   8351  C  CE2 . PHE B 1 523 ? 92.182  54.697 58.545  1.00 26.05  ? 523  PHE B CE2 1 
ATOM   8352  C  CZ  . PHE B 1 523 ? 91.666  55.225 57.368  1.00 25.51  ? 523  PHE B CZ  1 
ATOM   8353  N  N   . TRP B 1 524 ? 96.564  54.238 59.773  1.00 26.57  ? 524  TRP B N   1 
ATOM   8354  C  CA  . TRP B 1 524 ? 96.447  55.029 60.992  1.00 28.62  ? 524  TRP B CA  1 
ATOM   8355  C  C   . TRP B 1 524 ? 97.647  55.925 61.308  1.00 29.76  ? 524  TRP B C   1 
ATOM   8356  O  O   . TRP B 1 524 ? 97.470  57.068 61.745  1.00 29.75  ? 524  TRP B O   1 
ATOM   8357  C  CB  . TRP B 1 524 ? 96.179  54.117 62.194  1.00 26.04  ? 524  TRP B CB  1 
ATOM   8358  C  CG  . TRP B 1 524 ? 94.831  53.460 62.174  1.00 25.40  ? 524  TRP B CG  1 
ATOM   8359  C  CD1 . TRP B 1 524 ? 94.562  52.137 61.955  1.00 22.67  ? 524  TRP B CD1 1 
ATOM   8360  C  CD2 . TRP B 1 524 ? 93.563  54.099 62.369  1.00 24.14  ? 524  TRP B CD2 1 
ATOM   8361  N  NE1 . TRP B 1 524 ? 93.209  51.915 62.002  1.00 22.22  ? 524  TRP B NE1 1 
ATOM   8362  C  CE2 . TRP B 1 524 ? 92.571  53.101 62.254  1.00 23.92  ? 524  TRP B CE2 1 
ATOM   8363  C  CE3 . TRP B 1 524 ? 93.169  55.421 62.628  1.00 23.39  ? 524  TRP B CE3 1 
ATOM   8364  C  CZ2 . TRP B 1 524 ? 91.207  53.382 62.390  1.00 23.09  ? 524  TRP B CZ2 1 
ATOM   8365  C  CZ3 . TRP B 1 524 ? 91.808  55.700 62.763  1.00 23.02  ? 524  TRP B CZ3 1 
ATOM   8366  C  CH2 . TRP B 1 524 ? 90.846  54.685 62.643  1.00 22.12  ? 524  TRP B CH2 1 
ATOM   8367  N  N   . ASN B 1 525 ? 98.856  55.422 61.077  1.00 29.09  ? 525  ASN B N   1 
ATOM   8368  C  CA  . ASN B 1 525 ? 100.052 56.193 61.389  1.00 31.27  ? 525  ASN B CA  1 
ATOM   8369  C  C   . ASN B 1 525 ? 100.543 57.146 60.306  1.00 34.01  ? 525  ASN B C   1 
ATOM   8370  O  O   . ASN B 1 525 ? 101.149 58.171 60.616  1.00 33.36  ? 525  ASN B O   1 
ATOM   8371  C  CB  . ASN B 1 525 ? 101.195 55.256 61.801  1.00 29.52  ? 525  ASN B CB  1 
ATOM   8372  C  CG  . ASN B 1 525 ? 100.848 54.423 63.020  1.00 28.47  ? 525  ASN B CG  1 
ATOM   8373  O  OD1 . ASN B 1 525 ? 100.248 54.918 63.968  1.00 30.92  ? 525  ASN B OD1 1 
ATOM   8374  N  ND2 . ASN B 1 525 ? 101.229 53.160 63.004  1.00 26.88  ? 525  ASN B ND2 1 
ATOM   8375  N  N   . GLN B 1 526 ? 100.275 56.833 59.043  1.00 34.97  ? 526  GLN B N   1 
ATOM   8376  C  CA  . GLN B 1 526 ? 100.741 57.696 57.972  1.00 36.21  ? 526  GLN B CA  1 
ATOM   8377  C  C   . GLN B 1 526 ? 99.665  58.382 57.146  1.00 36.02  ? 526  GLN B C   1 
ATOM   8378  O  O   . GLN B 1 526 ? 99.662  59.605 57.025  1.00 36.52  ? 526  GLN B O   1 
ATOM   8379  C  CB  . GLN B 1 526 ? 101.654 56.910 57.035  1.00 39.68  ? 526  GLN B CB  1 
ATOM   8380  C  CG  . GLN B 1 526 ? 102.904 56.369 57.695  1.00 46.42  ? 526  GLN B CG  1 
ATOM   8381  C  CD  . GLN B 1 526 ? 103.715 55.488 56.762  1.00 52.15  ? 526  GLN B CD  1 
ATOM   8382  O  OE1 . GLN B 1 526 ? 104.047 55.887 55.638  1.00 54.22  ? 526  GLN B OE1 1 
ATOM   8383  N  NE2 . GLN B 1 526 ? 104.042 54.283 57.223  1.00 54.40  ? 526  GLN B NE2 1 
ATOM   8384  N  N   . PHE B 1 527 ? 98.747  57.606 56.583  1.00 34.36  ? 527  PHE B N   1 
ATOM   8385  C  CA  . PHE B 1 527 ? 97.721  58.178 55.728  1.00 32.74  ? 527  PHE B CA  1 
ATOM   8386  C  C   . PHE B 1 527 ? 96.662  59.060 56.369  1.00 32.89  ? 527  PHE B C   1 
ATOM   8387  O  O   . PHE B 1 527 ? 96.462  60.195 55.934  1.00 32.38  ? 527  PHE B O   1 
ATOM   8388  C  CB  . PHE B 1 527 ? 97.017  57.083 54.922  1.00 31.64  ? 527  PHE B CB  1 
ATOM   8389  C  CG  . PHE B 1 527 ? 95.996  57.619 53.959  1.00 32.39  ? 527  PHE B CG  1 
ATOM   8390  C  CD1 . PHE B 1 527 ? 96.390  58.379 52.861  1.00 33.17  ? 527  PHE B CD1 1 
ATOM   8391  C  CD2 . PHE B 1 527 ? 94.640  57.418 54.179  1.00 33.00  ? 527  PHE B CD2 1 
ATOM   8392  C  CE1 . PHE B 1 527 ? 95.447  58.936 51.998  1.00 32.24  ? 527  PHE B CE1 1 
ATOM   8393  C  CE2 . PHE B 1 527 ? 93.689  57.970 53.324  1.00 32.78  ? 527  PHE B CE2 1 
ATOM   8394  C  CZ  . PHE B 1 527 ? 94.095  58.733 52.230  1.00 31.40  ? 527  PHE B CZ  1 
ATOM   8395  N  N   . LEU B 1 528 ? 95.973  58.559 57.387  1.00 32.70  ? 528  LEU B N   1 
ATOM   8396  C  CA  . LEU B 1 528 ? 94.917  59.362 57.986  1.00 35.15  ? 528  LEU B CA  1 
ATOM   8397  C  C   . LEU B 1 528 ? 95.384  60.725 58.502  1.00 36.82  ? 528  LEU B C   1 
ATOM   8398  O  O   . LEU B 1 528 ? 94.741  61.740 58.233  1.00 37.19  ? 528  LEU B O   1 
ATOM   8399  C  CB  . LEU B 1 528 ? 94.192  58.592 59.097  1.00 33.88  ? 528  LEU B CB  1 
ATOM   8400  C  CG  . LEU B 1 528 ? 92.900  59.287 59.556  1.00 33.41  ? 528  LEU B CG  1 
ATOM   8401  C  CD1 . LEU B 1 528 ? 91.980  59.493 58.357  1.00 33.75  ? 528  LEU B CD1 1 
ATOM   8402  C  CD2 . LEU B 1 528 ? 92.197  58.460 60.622  1.00 33.08  ? 528  LEU B CD2 1 
ATOM   8403  N  N   . PRO B 1 529 ? 96.502  60.771 59.245  1.00 38.15  ? 529  PRO B N   1 
ATOM   8404  C  CA  . PRO B 1 529 ? 96.975  62.067 59.750  1.00 39.25  ? 529  PRO B CA  1 
ATOM   8405  C  C   . PRO B 1 529 ? 97.183  63.095 58.628  1.00 39.38  ? 529  PRO B C   1 
ATOM   8406  O  O   . PRO B 1 529 ? 96.784  64.254 58.764  1.00 38.16  ? 529  PRO B O   1 
ATOM   8407  C  CB  . PRO B 1 529 ? 98.270  61.703 60.471  1.00 38.80  ? 529  PRO B CB  1 
ATOM   8408  C  CG  . PRO B 1 529 ? 97.977  60.308 60.978  1.00 38.93  ? 529  PRO B CG  1 
ATOM   8409  C  CD  . PRO B 1 529 ? 97.323  59.668 59.775  1.00 38.92  ? 529  PRO B CD  1 
ATOM   8410  N  N   . LYS B 1 530 ? 97.796  62.666 57.525  1.00 39.93  ? 530  LYS B N   1 
ATOM   8411  C  CA  . LYS B 1 530 ? 98.026  63.558 56.388  1.00 41.80  ? 530  LYS B CA  1 
ATOM   8412  C  C   . LYS B 1 530 ? 96.706  64.066 55.838  1.00 42.35  ? 530  LYS B C   1 
ATOM   8413  O  O   . LYS B 1 530 ? 96.605  65.207 55.406  1.00 43.40  ? 530  LYS B O   1 
ATOM   8414  C  CB  . LYS B 1 530 ? 98.775  62.846 55.261  1.00 41.79  ? 530  LYS B CB  1 
ATOM   8415  C  CG  . LYS B 1 530 ? 100.250 62.635 55.517  1.00 45.99  ? 530  LYS B CG  1 
ATOM   8416  C  CD  . LYS B 1 530 ? 100.982 62.283 54.227  1.00 48.17  ? 530  LYS B CD  1 
ATOM   8417  C  CE  . LYS B 1 530 ? 100.852 63.405 53.200  1.00 49.74  ? 530  LYS B CE  1 
ATOM   8418  N  NZ  . LYS B 1 530 ? 101.571 63.127 51.917  1.00 49.13  ? 530  LYS B NZ  1 
ATOM   8419  N  N   . LEU B 1 531 ? 95.695  63.208 55.856  1.00 44.67  ? 531  LEU B N   1 
ATOM   8420  C  CA  . LEU B 1 531 ? 94.374  63.565 55.354  1.00 46.61  ? 531  LEU B CA  1 
ATOM   8421  C  C   . LEU B 1 531 ? 93.671  64.596 56.240  1.00 48.31  ? 531  LEU B C   1 
ATOM   8422  O  O   . LEU B 1 531 ? 93.116  65.577 55.742  1.00 49.12  ? 531  LEU B O   1 
ATOM   8423  C  CB  . LEU B 1 531 ? 93.518  62.300 55.227  1.00 45.91  ? 531  LEU B CB  1 
ATOM   8424  C  CG  . LEU B 1 531 ? 92.137  62.434 54.586  1.00 45.69  ? 531  LEU B CG  1 
ATOM   8425  C  CD1 . LEU B 1 531 ? 91.639  61.067 54.157  1.00 44.87  ? 531  LEU B CD1 1 
ATOM   8426  C  CD2 . LEU B 1 531 ? 91.175  63.080 55.570  1.00 46.52  ? 531  LEU B CD2 1 
ATOM   8427  N  N   . LEU B 1 532 ? 93.682  64.368 57.549  1.00 49.73  ? 532  LEU B N   1 
ATOM   8428  C  CA  . LEU B 1 532 ? 93.043  65.290 58.484  1.00 52.23  ? 532  LEU B CA  1 
ATOM   8429  C  C   . LEU B 1 532 ? 93.807  66.613 58.543  1.00 54.58  ? 532  LEU B C   1 
ATOM   8430  O  O   . LEU B 1 532 ? 93.244  67.651 58.890  1.00 53.54  ? 532  LEU B O   1 
ATOM   8431  C  CB  . LEU B 1 532 ? 92.983  64.667 59.884  1.00 51.54  ? 532  LEU B CB  1 
ATOM   8432  C  CG  . LEU B 1 532 ? 92.163  63.381 60.049  1.00 50.65  ? 532  LEU B CG  1 
ATOM   8433  C  CD1 . LEU B 1 532 ? 92.345  62.822 61.454  1.00 46.90  ? 532  LEU B CD1 1 
ATOM   8434  C  CD2 . LEU B 1 532 ? 90.694  63.677 59.771  1.00 50.21  ? 532  LEU B CD2 1 
ATOM   8435  N  N   . ASN B 1 533 ? 95.089  66.568 58.197  1.00 57.84  ? 533  ASN B N   1 
ATOM   8436  C  CA  . ASN B 1 533 ? 95.935  67.757 58.219  1.00 61.44  ? 533  ASN B CA  1 
ATOM   8437  C  C   . ASN B 1 533 ? 95.751  68.620 56.974  1.00 63.08  ? 533  ASN B C   1 
ATOM   8438  O  O   . ASN B 1 533 ? 96.372  69.673 56.842  1.00 62.84  ? 533  ASN B O   1 
ATOM   8439  C  CB  . ASN B 1 533 ? 97.405  67.350 58.351  1.00 62.68  ? 533  ASN B CB  1 
ATOM   8440  C  CG  . ASN B 1 533 ? 98.344  68.539 58.308  1.00 65.00  ? 533  ASN B CG  1 
ATOM   8441  O  OD1 . ASN B 1 533 ? 98.232  69.463 59.114  1.00 66.47  ? 533  ASN B OD1 1 
ATOM   8442  N  ND2 . ASN B 1 533 ? 99.275  68.523 57.360  1.00 65.92  ? 533  ASN B ND2 1 
ATOM   8443  N  N   . ALA B 1 534 ? 94.892  68.174 56.066  1.00 65.29  ? 534  ALA B N   1 
ATOM   8444  C  CA  . ALA B 1 534 ? 94.636  68.910 54.836  1.00 67.70  ? 534  ALA B CA  1 
ATOM   8445  C  C   . ALA B 1 534 ? 93.385  69.776 54.952  1.00 69.40  ? 534  ALA B C   1 
ATOM   8446  O  O   . ALA B 1 534 ? 92.559  69.579 55.844  1.00 70.11  ? 534  ALA B O   1 
ATOM   8447  C  CB  . ALA B 1 534 ? 94.493  67.935 53.671  1.00 66.38  ? 534  ALA B CB  1 
ATOM   8448  N  N   . THR B 1 535 ? 93.257  70.739 54.044  1.00 71.49  ? 535  THR B N   1 
ATOM   8449  C  CA  . THR B 1 535 ? 92.107  71.638 54.019  1.00 73.58  ? 535  THR B CA  1 
ATOM   8450  C  C   . THR B 1 535 ? 92.244  72.652 52.885  1.00 73.70  ? 535  THR B C   1 
ATOM   8451  O  O   . THR B 1 535 ? 92.413  72.279 51.725  1.00 74.14  ? 535  THR B O   1 
ATOM   8452  C  CB  . THR B 1 535 ? 91.950  72.408 55.353  1.00 74.76  ? 535  THR B CB  1 
ATOM   8453  O  OG1 . THR B 1 535 ? 90.770  73.219 55.295  1.00 75.61  ? 535  THR B OG1 1 
ATOM   8454  C  CG2 . THR B 1 535 ? 93.160  73.299 55.609  1.00 74.94  ? 535  THR B CG2 1 
HETATM 8455  C  C1  . NAG C 2 .   ? 86.029  48.140 -9.082  1.00 60.45  ? 1536 NAG A C1  1 
HETATM 8456  C  C2  . NAG C 2 .   ? 86.051  47.578 -10.501 1.00 62.70  ? 1536 NAG A C2  1 
HETATM 8457  C  C3  . NAG C 2 .   ? 86.903  46.305 -10.549 1.00 64.41  ? 1536 NAG A C3  1 
HETATM 8458  C  C4  . NAG C 2 .   ? 88.284  46.541 -9.924  1.00 63.47  ? 1536 NAG A C4  1 
HETATM 8459  C  C5  . NAG C 2 .   ? 88.136  47.171 -8.538  1.00 62.32  ? 1536 NAG A C5  1 
HETATM 8460  C  C6  . NAG C 2 .   ? 89.468  47.518 -7.900  1.00 62.12  ? 1536 NAG A C6  1 
HETATM 8461  C  C7  . NAG C 2 .   ? 84.397  47.240 -12.214 1.00 65.19  ? 1536 NAG A C7  1 
HETATM 8462  C  C8  . NAG C 2 .   ? 84.302  45.866 -12.860 1.00 65.99  ? 1536 NAG A C8  1 
HETATM 8463  N  N2  . NAG C 2 .   ? 84.697  47.281 -10.922 1.00 64.77  ? 1536 NAG A N2  1 
HETATM 8464  O  O3  . NAG C 2 .   ? 87.063  45.892 -11.899 1.00 66.42  ? 1536 NAG A O3  1 
HETATM 8465  O  O4  . NAG C 2 .   ? 88.970  45.304 -9.815  1.00 63.69  ? 1536 NAG A O4  1 
HETATM 8466  O  O5  . NAG C 2 .   ? 87.366  48.389 -8.632  1.00 61.19  ? 1536 NAG A O5  1 
HETATM 8467  O  O6  . NAG C 2 .   ? 89.992  48.728 -8.423  1.00 62.71  ? 1536 NAG A O6  1 
HETATM 8468  O  O7  . NAG C 2 .   ? 84.204  48.253 -12.885 1.00 66.27  ? 1536 NAG A O7  1 
HETATM 8469  C  C1  . NAG D 2 .   ? 60.761  47.771 29.810  1.00 54.23  ? 1537 NAG A C1  1 
HETATM 8470  C  C2  . NAG D 2 .   ? 60.560  47.049 31.156  1.00 55.97  ? 1537 NAG A C2  1 
HETATM 8471  C  C3  . NAG D 2 .   ? 59.176  46.383 31.243  1.00 57.70  ? 1537 NAG A C3  1 
HETATM 8472  C  C4  . NAG D 2 .   ? 58.079  47.378 30.854  1.00 58.87  ? 1537 NAG A C4  1 
HETATM 8473  C  C5  . NAG D 2 .   ? 58.396  47.963 29.478  1.00 58.92  ? 1537 NAG A C5  1 
HETATM 8474  C  C6  . NAG D 2 .   ? 57.351  48.954 28.990  1.00 60.79  ? 1537 NAG A C6  1 
HETATM 8475  C  C7  . NAG D 2 .   ? 62.587  46.258 32.186  1.00 52.99  ? 1537 NAG A C7  1 
HETATM 8476  C  C8  . NAG D 2 .   ? 63.499  45.083 32.506  1.00 52.31  ? 1537 NAG A C8  1 
HETATM 8477  N  N2  . NAG D 2 .   ? 61.596  46.046 31.326  1.00 54.55  ? 1537 NAG A N2  1 
HETATM 8478  O  O3  . NAG D 2 .   ? 58.951  45.924 32.570  1.00 57.21  ? 1537 NAG A O3  1 
HETATM 8479  O  O4  . NAG D 2 .   ? 56.819  46.727 30.828  1.00 59.20  ? 1537 NAG A O4  1 
HETATM 8480  O  O5  . NAG D 2 .   ? 59.661  48.655 29.532  1.00 56.41  ? 1537 NAG A O5  1 
HETATM 8481  O  O6  . NAG D 2 .   ? 57.350  50.139 29.774  1.00 61.94  ? 1537 NAG A O6  1 
HETATM 8482  O  O7  . NAG D 2 .   ? 62.780  47.349 32.723  1.00 51.58  ? 1537 NAG A O7  1 
HETATM 8483  CL CL  . CL  E 3 .   ? 87.686  32.888 4.889   1.00 66.65  ? 1538 CL  A CL  1 
HETATM 8484  CL CL  . CL  F 3 .   ? 99.344  50.032 3.394   1.00 85.12  ? 1539 CL  A CL  1 
HETATM 8485  CL CL  . CL  G 3 .   ? 66.157  47.566 38.629  1.00 70.82  ? 1540 CL  A CL  1 
HETATM 8486  O  O7  . CCD H 4 .   ? 89.756  53.620 22.378  1.00 38.58  ? 1541 CCD A O7  1 
HETATM 8487  C  C5  . CCD H 4 .   ? 90.413  52.893 23.422  1.00 42.52  ? 1541 CCD A C5  1 
HETATM 8488  C  C6  . CCD H 4 .   ? 91.172  53.832 24.365  1.00 41.38  ? 1541 CCD A C6  1 
HETATM 8489  C  C4  . CCD H 4 .   ? 91.735  52.147 23.185  1.00 45.09  ? 1541 CCD A C4  1 
HETATM 8490  C  C3  . CCD H 4 .   ? 91.603  51.167 22.017  1.00 46.29  ? 1541 CCD A C3  1 
HETATM 8491  C  C2  . CCD H 4 .   ? 92.924  50.464 21.667  1.00 49.80  ? 1541 CCD A C2  1 
HETATM 8492  N  N1  . CCD H 4 .   ? 92.995  49.400 20.635  1.00 51.66  ? 1541 CCD A N1  1 
HETATM 8493  C  C9  . CCD H 4 .   ? 92.612  49.817 19.273  1.00 49.90  ? 1541 CCD A C9  1 
HETATM 8494  C  C10 . CCD H 4 .   ? 94.412  49.001 20.528  1.00 52.15  ? 1541 CCD A C10 1 
HETATM 8495  C  C8  . CCD H 4 .   ? 92.261  48.170 20.996  1.00 50.64  ? 1541 CCD A C8  1 
HETATM 8496  O  O7  . CCD I 4 .   ? 100.621 53.819 21.316  1.00 88.61  ? 1542 CCD A O7  1 
HETATM 8497  C  C5  . CCD I 4 .   ? 100.001 54.138 22.588  1.00 88.60  ? 1542 CCD A C5  1 
HETATM 8498  C  C6  . CCD I 4 .   ? 99.206  53.038 23.330  1.00 88.15  ? 1542 CCD A C6  1 
HETATM 8499  C  C4  . CCD I 4 .   ? 100.415 55.420 23.355  1.00 88.37  ? 1542 CCD A C4  1 
HETATM 8500  C  C3  . CCD I 4 .   ? 100.945 56.541 22.439  1.00 88.88  ? 1542 CCD A C3  1 
HETATM 8501  C  C2  . CCD I 4 .   ? 102.535 56.624 22.531  1.00 89.09  ? 1542 CCD A C2  1 
HETATM 8502  N  N1  . CCD I 4 .   ? 103.242 57.974 22.309  1.00 88.94  ? 1542 CCD A N1  1 
HETATM 8503  C  C9  . CCD I 4 .   ? 103.026 58.555 20.961  1.00 89.14  ? 1542 CCD A C9  1 
HETATM 8504  C  C10 . CCD I 4 .   ? 102.901 59.003 23.318  1.00 89.15  ? 1542 CCD A C10 1 
HETATM 8505  C  C8  . CCD I 4 .   ? 104.690 57.766 22.435  1.00 89.27  ? 1542 CCD A C8  1 
HETATM 8506  C  C1  . PGE J 5 .   ? 80.146  72.445 32.912  1.00 88.28  ? 1543 PGE A C1  1 
HETATM 8507  O  O1  . PGE J 5 .   ? 79.838  71.982 34.245  1.00 88.37  ? 1543 PGE A O1  1 
HETATM 8508  C  C2  . PGE J 5 .   ? 78.853  72.456 32.095  1.00 88.62  ? 1543 PGE A C2  1 
HETATM 8509  O  O2  . PGE J 5 .   ? 79.048  72.905 30.730  1.00 88.97  ? 1543 PGE A O2  1 
HETATM 8510  C  C3  . PGE J 5 .   ? 77.755  72.859 30.111  1.00 88.81  ? 1543 PGE A C3  1 
HETATM 8511  C  C4  . PGE J 5 .   ? 77.754  73.308 28.630  1.00 88.98  ? 1543 PGE A C4  1 
HETATM 8512  O  O4  . PGE J 5 .   ? 81.153  76.904 28.359  1.00 88.35  ? 1543 PGE A O4  1 
HETATM 8513  C  C6  . PGE J 5 .   ? 79.811  76.504 28.060  1.00 88.62  ? 1543 PGE A C6  1 
HETATM 8514  C  C5  . PGE J 5 .   ? 79.576  75.076 28.555  1.00 88.68  ? 1543 PGE A C5  1 
HETATM 8515  O  O3  . PGE J 5 .   ? 78.196  74.690 28.234  1.00 89.48  ? 1543 PGE A O3  1 
HETATM 8516  C  C1  . PGE K 5 .   ? 79.509  17.899 4.739   1.00 88.70  ? 1544 PGE A C1  1 
HETATM 8517  O  O1  . PGE K 5 .   ? 79.173  17.233 5.956   1.00 89.92  ? 1544 PGE A O1  1 
HETATM 8518  C  C2  . PGE K 5 .   ? 78.605  17.400 3.613   1.00 88.69  ? 1544 PGE A C2  1 
HETATM 8519  O  O2  . PGE K 5 .   ? 78.983  18.100 2.435   1.00 88.62  ? 1544 PGE A O2  1 
HETATM 8520  C  C3  . PGE K 5 .   ? 78.191  17.709 1.301   1.00 88.97  ? 1544 PGE A C3  1 
HETATM 8521  C  C4  . PGE K 5 .   ? 78.721  18.544 0.159   1.00 89.84  ? 1544 PGE A C4  1 
HETATM 8522  O  O4  . PGE K 5 .   ? 81.316  21.287 0.322   1.00 90.51  ? 1544 PGE A O4  1 
HETATM 8523  C  C6  . PGE K 5 .   ? 80.518  21.044 -0.853  1.00 90.56  ? 1544 PGE A C6  1 
HETATM 8524  C  C5  . PGE K 5 .   ? 78.994  21.006 -0.460  1.00 90.69  ? 1544 PGE A C5  1 
HETATM 8525  O  O3  . PGE K 5 .   ? 78.530  19.972 0.530   1.00 90.70  ? 1544 PGE A O3  1 
HETATM 8526  C  C1  . NAG L 2 .   ? 98.608  45.588 112.535 1.00 56.89  ? 1536 NAG B C1  1 
HETATM 8527  C  C2  . NAG L 2 .   ? 98.523  45.124 113.990 1.00 58.33  ? 1536 NAG B C2  1 
HETATM 8528  C  C3  . NAG L 2 .   ? 98.098  43.655 113.997 1.00 58.49  ? 1536 NAG B C3  1 
HETATM 8529  C  C4  . NAG L 2 .   ? 96.766  43.496 113.248 1.00 58.68  ? 1536 NAG B C4  1 
HETATM 8530  C  C5  . NAG L 2 .   ? 96.863  44.107 111.840 1.00 57.87  ? 1536 NAG B C5  1 
HETATM 8531  C  C6  . NAG L 2 .   ? 95.533  44.117 111.112 1.00 58.21  ? 1536 NAG B C6  1 
HETATM 8532  C  C7  . NAG L 2 .   ? 99.938  46.194 115.616 1.00 63.08  ? 1536 NAG B C7  1 
HETATM 8533  C  C8  . NAG L 2 .   ? 100.342 45.688 116.990 1.00 63.32  ? 1536 NAG B C8  1 
HETATM 8534  N  N2  . NAG L 2 .   ? 99.804  45.293 114.648 1.00 61.09  ? 1536 NAG B N2  1 
HETATM 8535  O  O3  . NAG L 2 .   ? 97.959  43.201 115.335 1.00 58.02  ? 1536 NAG B O3  1 
HETATM 8536  O  O4  . NAG L 2 .   ? 96.430  42.118 113.148 1.00 59.53  ? 1536 NAG B O4  1 
HETATM 8537  O  O5  . NAG L 2 .   ? 97.318  45.479 111.915 1.00 57.33  ? 1536 NAG B O5  1 
HETATM 8538  O  O6  . NAG L 2 .   ? 94.543  44.809 111.858 1.00 59.31  ? 1536 NAG B O6  1 
HETATM 8539  O  O7  . NAG L 2 .   ? 99.742  47.398 115.440 1.00 66.71  ? 1536 NAG B O7  1 
HETATM 8540  C  C1  . NAG M 2 .   ? 123.415 47.053 73.462  1.00 44.76  ? 1537 NAG B C1  1 
HETATM 8541  C  C2  . NAG M 2 .   ? 123.578 46.260 72.154  1.00 45.93  ? 1537 NAG B C2  1 
HETATM 8542  C  C3  . NAG M 2 .   ? 124.892 45.468 72.140  1.00 47.62  ? 1537 NAG B C3  1 
HETATM 8543  C  C4  . NAG M 2 .   ? 126.074 46.363 72.522  1.00 50.41  ? 1537 NAG B C4  1 
HETATM 8544  C  C5  . NAG M 2 .   ? 125.777 47.052 73.850  1.00 49.99  ? 1537 NAG B C5  1 
HETATM 8545  C  C6  . NAG M 2 .   ? 126.902 47.970 74.287  1.00 51.59  ? 1537 NAG B C6  1 
HETATM 8546  C  C7  . NAG M 2 .   ? 121.533 45.563 71.081  1.00 43.17  ? 1537 NAG B C7  1 
HETATM 8547  C  C8  . NAG M 2 .   ? 120.635 44.395 70.706  1.00 41.60  ? 1537 NAG B C8  1 
HETATM 8548  N  N2  . NAG M 2 .   ? 122.465 45.341 72.002  1.00 45.41  ? 1537 NAG B N2  1 
HETATM 8549  O  O3  . NAG M 2 .   ? 125.106 44.938 70.841  1.00 47.73  ? 1537 NAG B O3  1 
HETATM 8550  O  O4  . NAG M 2 .   ? 127.257 45.587 72.635  1.00 51.23  ? 1537 NAG B O4  1 
HETATM 8551  O  O5  . NAG M 2 .   ? 124.581 47.851 73.722  1.00 46.55  ? 1537 NAG B O5  1 
HETATM 8552  O  O6  . NAG M 2 .   ? 126.703 49.295 73.814  1.00 56.05  ? 1537 NAG B O6  1 
HETATM 8553  O  O7  . NAG M 2 .   ? 121.380 46.656 70.536  1.00 40.90  ? 1537 NAG B O7  1 
HETATM 8554  O  O7  . CCD N 4 .   ? 94.274  52.305 81.111  1.00 38.57  ? 1539 CCD B O7  1 
HETATM 8555  C  C5  . CCD N 4 .   ? 93.614  51.666 80.017  1.00 40.99  ? 1539 CCD B C5  1 
HETATM 8556  C  C6  . CCD N 4 .   ? 92.850  52.679 79.158  1.00 35.95  ? 1539 CCD B C6  1 
HETATM 8557  C  C4  . CCD N 4 .   ? 92.367  50.837 80.362  1.00 45.00  ? 1539 CCD B C4  1 
HETATM 8558  C  C3  . CCD N 4 .   ? 92.570  49.831 81.502  1.00 45.33  ? 1539 CCD B C3  1 
HETATM 8559  C  C2  . CCD N 4 .   ? 91.213  49.319 82.024  1.00 47.71  ? 1539 CCD B C2  1 
HETATM 8560  N  N1  . CCD N 4 .   ? 91.069  48.006 82.700  1.00 48.35  ? 1539 CCD B N1  1 
HETATM 8561  C  C9  . CCD N 4 .   ? 91.545  48.104 84.089  1.00 46.72  ? 1539 CCD B C9  1 
HETATM 8562  C  C10 . CCD N 4 .   ? 89.638  47.654 82.768  1.00 47.27  ? 1539 CCD B C10 1 
HETATM 8563  C  C8  . CCD N 4 .   ? 91.691  46.845 82.031  1.00 47.24  ? 1539 CCD B C8  1 
HETATM 8564  O  O7  . CCD O 4 .   ? 83.111  52.976 80.592  1.00 86.28  ? 1540 CCD B O7  1 
HETATM 8565  C  C5  . CCD O 4 .   ? 83.962  54.097 80.405  1.00 86.26  ? 1540 CCD B C5  1 
HETATM 8566  C  C6  . CCD O 4 .   ? 85.272  53.890 79.650  1.00 86.78  ? 1540 CCD B C6  1 
HETATM 8567  C  C4  . CCD O 4 .   ? 83.373  55.517 80.469  1.00 86.82  ? 1540 CCD B C4  1 
HETATM 8568  C  C3  . CCD O 4 .   ? 82.473  55.762 81.695  1.00 86.31  ? 1540 CCD B C3  1 
HETATM 8569  C  C2  . CCD O 4 .   ? 80.973  56.018 81.236  1.00 86.22  ? 1540 CCD B C2  1 
HETATM 8570  N  N1  . CCD O 4 .   ? 80.472  57.456 81.060  1.00 85.93  ? 1540 CCD B N1  1 
HETATM 8571  C  C9  . CCD O 4 .   ? 81.223  58.258 80.062  1.00 86.33  ? 1540 CCD B C9  1 
HETATM 8572  C  C10 . CCD O 4 .   ? 79.106  57.404 80.543  1.00 86.45  ? 1540 CCD B C10 1 
HETATM 8573  C  C8  . CCD O 4 .   ? 80.387  58.197 82.337  1.00 86.17  ? 1540 CCD B C8  1 
HETATM 8574  C  C1  . PGE P 5 .   ? 103.860 52.543 116.510 1.00 92.00  ? 1541 PGE B C1  1 
HETATM 8575  O  O1  . PGE P 5 .   ? 104.464 51.335 117.002 1.00 91.76  ? 1541 PGE B O1  1 
HETATM 8576  C  C2  . PGE P 5 .   ? 102.337 52.339 116.197 1.00 91.53  ? 1541 PGE B C2  1 
HETATM 8577  O  O2  . PGE P 5 .   ? 101.604 53.566 115.679 1.00 90.63  ? 1541 PGE B O2  1 
HETATM 8578  C  C3  . PGE P 5 .   ? 101.941 54.296 114.409 1.00 88.74  ? 1541 PGE B C3  1 
HETATM 8579  C  C4  . PGE P 5 .   ? 103.375 54.863 114.331 1.00 87.24  ? 1541 PGE B C4  1 
HETATM 8580  O  O4  . PGE P 5 .   ? 101.250 58.291 112.200 1.00 84.84  ? 1541 PGE B O4  1 
HETATM 8581  C  C6  . PGE P 5 .   ? 101.575 56.939 112.477 1.00 85.67  ? 1541 PGE B C6  1 
HETATM 8582  C  C5  . PGE P 5 .   ? 103.076 56.904 112.780 1.00 85.83  ? 1541 PGE B C5  1 
HETATM 8583  O  O3  . PGE P 5 .   ? 103.804 55.615 113.134 1.00 86.62  ? 1541 PGE B O3  1 
HETATM 8584  CL CL  . CL  Q 3 .   ? 103.556 51.321 61.655  1.00 64.30  ? 1542 CL  B CL  1 
HETATM 8585  O  O   . HOH R 6 .   ? 73.300  39.094 -9.227  1.00 80.72  ? 2001 HOH A O   1 
HETATM 8586  O  O   . HOH R 6 .   ? 68.877  45.083 -5.849  1.00 57.77  ? 2002 HOH A O   1 
HETATM 8587  O  O   . HOH R 6 .   ? 75.195  41.683 -12.701 1.00 59.75  ? 2003 HOH A O   1 
HETATM 8588  O  O   . HOH R 6 .   ? 73.597  35.339 -5.896  1.00 69.17  ? 2004 HOH A O   1 
HETATM 8589  O  O   . HOH R 6 .   ? 72.363  42.202 -1.182  1.00 45.17  ? 2005 HOH A O   1 
HETATM 8590  O  O   . HOH R 6 .   ? 72.469  43.801 -13.264 1.00 59.64  ? 2006 HOH A O   1 
HETATM 8591  O  O   . HOH R 6 .   ? 69.412  46.615 -13.691 1.00 65.06  ? 2007 HOH A O   1 
HETATM 8592  O  O   . HOH R 6 .   ? 73.203  28.184 -5.000  1.00 60.88  ? 2008 HOH A O   1 
HETATM 8593  O  O   . HOH R 6 .   ? 67.880  48.273 -6.182  1.00 58.20  ? 2009 HOH A O   1 
HETATM 8594  O  O   . HOH R 6 .   ? 65.683  54.016 -3.717  1.00 44.85  ? 2010 HOH A O   1 
HETATM 8595  O  O   . HOH R 6 .   ? 67.236  49.639 -3.882  1.00 60.92  ? 2011 HOH A O   1 
HETATM 8596  O  O   . HOH R 6 .   ? 65.338  51.158 -4.479  1.00 68.61  ? 2012 HOH A O   1 
HETATM 8597  O  O   . HOH R 6 .   ? 73.434  55.590 -14.815 1.00 62.25  ? 2013 HOH A O   1 
HETATM 8598  O  O   . HOH R 6 .   ? 70.239  49.367 -13.138 1.00 55.76  ? 2014 HOH A O   1 
HETATM 8599  O  O   . HOH R 6 .   ? 74.306  52.532 -14.856 1.00 46.20  ? 2015 HOH A O   1 
HETATM 8600  O  O   . HOH R 6 .   ? 66.746  56.316 -5.331  1.00 57.95  ? 2016 HOH A O   1 
HETATM 8601  O  O   . HOH R 6 .   ? 75.648  29.282 -6.665  1.00 70.03  ? 2017 HOH A O   1 
HETATM 8602  O  O   . HOH R 6 .   ? 78.712  37.852 -8.304  1.00 49.46  ? 2018 HOH A O   1 
HETATM 8603  O  O   . HOH R 6 .   ? 75.059  34.216 -9.904  1.00 66.48  ? 2019 HOH A O   1 
HETATM 8604  O  O   . HOH R 6 .   ? 63.704  58.270 -1.775  1.00 42.51  ? 2020 HOH A O   1 
HETATM 8605  O  O   . HOH R 6 .   ? 63.698  59.461 0.456   1.00 51.05  ? 2021 HOH A O   1 
HETATM 8606  O  O   . HOH R 6 .   ? 62.245  56.268 1.949   1.00 43.64  ? 2022 HOH A O   1 
HETATM 8607  O  O   . HOH R 6 .   ? 64.074  55.777 -2.445  1.00 59.00  ? 2023 HOH A O   1 
HETATM 8608  O  O   . HOH R 6 .   ? 95.167  42.094 -12.259 1.00 63.77  ? 2024 HOH A O   1 
HETATM 8609  O  O   . HOH R 6 .   ? 71.544  67.961 2.672   1.00 54.79  ? 2025 HOH A O   1 
HETATM 8610  O  O   . HOH R 6 .   ? 62.260  49.119 41.208  1.00 56.07  ? 2026 HOH A O   1 
HETATM 8611  O  O   . HOH R 6 .   ? 75.210  60.520 0.733   1.00 58.79  ? 2027 HOH A O   1 
HETATM 8612  O  O   . HOH R 6 .   ? 74.411  28.569 -2.893  1.00 66.02  ? 2028 HOH A O   1 
HETATM 8613  O  O   . HOH R 6 .   ? 74.135  26.575 -0.531  1.00 74.43  ? 2029 HOH A O   1 
HETATM 8614  O  O   . HOH R 6 .   ? 72.398  64.252 -9.646  1.00 53.32  ? 2030 HOH A O   1 
HETATM 8615  O  O   . HOH R 6 .   ? 82.507  60.963 -11.533 1.00 75.82  ? 2031 HOH A O   1 
HETATM 8616  O  O   . HOH R 6 .   ? 69.899  64.205 -7.826  1.00 53.71  ? 2032 HOH A O   1 
HETATM 8617  O  O   . HOH R 6 .   ? 88.865  55.759 -6.747  1.00 61.31  ? 2033 HOH A O   1 
HETATM 8618  O  O   . HOH R 6 .   ? 71.734  55.647 -12.687 1.00 52.81  ? 2034 HOH A O   1 
HETATM 8619  O  O   . HOH R 6 .   ? 72.695  50.638 -13.787 1.00 75.08  ? 2035 HOH A O   1 
HETATM 8620  O  O   . HOH R 6 .   ? 82.019  45.806 -6.996  1.00 84.48  ? 2036 HOH A O   1 
HETATM 8621  O  O   . HOH R 6 .   ? 79.980  42.152 -8.706  1.00 73.78  ? 2037 HOH A O   1 
HETATM 8622  O  O   . HOH R 6 .   ? 83.609  70.861 -2.836  1.00 63.14  ? 2038 HOH A O   1 
HETATM 8623  O  O   . HOH R 6 .   ? 86.187  68.186 -1.613  1.00 58.75  ? 2039 HOH A O   1 
HETATM 8624  O  O   . HOH R 6 .   ? 92.629  69.340 -1.011  1.00 47.89  ? 2040 HOH A O   1 
HETATM 8625  O  O   . HOH R 6 .   ? 81.161  34.327 -7.171  1.00 65.79  ? 2041 HOH A O   1 
HETATM 8626  O  O   . HOH R 6 .   ? 76.941  29.567 -4.206  1.00 61.44  ? 2042 HOH A O   1 
HETATM 8627  O  O   . HOH R 6 .   ? 81.629  39.770 -7.274  1.00 51.94  ? 2043 HOH A O   1 
HETATM 8628  O  O   . HOH R 6 .   ? 79.023  30.385 -5.315  1.00 69.01  ? 2044 HOH A O   1 
HETATM 8629  O  O   . HOH R 6 .   ? 75.989  33.041 -7.337  1.00 64.78  ? 2045 HOH A O   1 
HETATM 8630  O  O   . HOH R 6 .   ? 82.622  34.930 -3.845  1.00 75.59  ? 2046 HOH A O   1 
HETATM 8631  O  O   . HOH R 6 .   ? 75.093  32.910 -2.277  1.00 60.10  ? 2047 HOH A O   1 
HETATM 8632  O  O   . HOH R 6 .   ? 85.950  73.249 -0.352  1.00 58.66  ? 2048 HOH A O   1 
HETATM 8633  O  O   . HOH R 6 .   ? 88.437  71.065 -1.444  1.00 71.69  ? 2049 HOH A O   1 
HETATM 8634  O  O   . HOH R 6 .   ? 73.687  71.072 11.989  1.00 67.22  ? 2050 HOH A O   1 
HETATM 8635  O  O   . HOH R 6 .   ? 72.087  69.328 4.872   1.00 63.78  ? 2051 HOH A O   1 
HETATM 8636  O  O   . HOH R 6 .   ? 92.748  43.296 -11.363 1.00 66.67  ? 2052 HOH A O   1 
HETATM 8637  O  O   . HOH R 6 .   ? 74.523  68.950 1.722   1.00 63.34  ? 2053 HOH A O   1 
HETATM 8638  O  O   . HOH R 6 .   ? 87.783  42.535 -6.957  1.00 81.11  ? 2054 HOH A O   1 
HETATM 8639  O  O   . HOH R 6 .   ? 64.467  49.922 37.887  1.00 56.35  ? 2055 HOH A O   1 
HETATM 8640  O  O   . HOH R 6 .   ? 71.197  63.502 2.421   1.00 56.12  ? 2056 HOH A O   1 
HETATM 8641  O  O   . HOH R 6 .   ? 72.695  65.658 -0.373  1.00 58.87  ? 2057 HOH A O   1 
HETATM 8642  O  O   . HOH R 6 .   ? 58.762  53.348 31.966  1.00 76.45  ? 2058 HOH A O   1 
HETATM 8643  O  O   . HOH R 6 .   ? 62.181  42.495 34.772  1.00 49.28  ? 2059 HOH A O   1 
HETATM 8644  O  O   . HOH R 6 .   ? 63.672  45.424 38.295  1.00 72.76  ? 2060 HOH A O   1 
HETATM 8645  O  O   . HOH R 6 .   ? 61.032  46.550 37.408  1.00 64.68  ? 2061 HOH A O   1 
HETATM 8646  O  O   . HOH R 6 .   ? 85.609  31.921 5.830   1.00 47.94  ? 2062 HOH A O   1 
HETATM 8647  O  O   . HOH R 6 .   ? 78.610  25.731 0.071   1.00 74.41  ? 2063 HOH A O   1 
HETATM 8648  O  O   . HOH R 6 .   ? 71.253  62.278 -10.921 1.00 64.07  ? 2064 HOH A O   1 
HETATM 8649  O  O   . HOH R 6 .   ? 76.583  27.519 0.297   1.00 84.42  ? 2065 HOH A O   1 
HETATM 8650  O  O   . HOH R 6 .   ? 78.207  80.489 25.293  1.00 65.03  ? 2066 HOH A O   1 
HETATM 8651  O  O   . HOH R 6 .   ? 80.781  80.062 25.996  1.00 82.69  ? 2067 HOH A O   1 
HETATM 8652  O  O   . HOH R 6 .   ? 81.278  58.544 -9.307  1.00 49.11  ? 2068 HOH A O   1 
HETATM 8653  O  O   . HOH R 6 .   ? 77.014  52.563 -15.271 1.00 44.43  ? 2069 HOH A O   1 
HETATM 8654  O  O   . HOH R 6 .   ? 81.172  20.360 4.783   1.00 78.10  ? 2070 HOH A O   1 
HETATM 8655  O  O   . HOH R 6 .   ? 77.022  29.418 -1.423  1.00 72.48  ? 2071 HOH A O   1 
HETATM 8656  O  O   . HOH R 6 .   ? 84.917  32.054 -4.558  1.00 65.38  ? 2072 HOH A O   1 
HETATM 8657  O  O   . HOH R 6 .   ? 89.572  54.303 -1.874  1.00 54.86  ? 2073 HOH A O   1 
HETATM 8658  O  O   . HOH R 6 .   ? 90.722  55.434 -4.122  1.00 71.68  ? 2074 HOH A O   1 
HETATM 8659  O  O   . HOH R 6 .   ? 72.907  39.428 -0.287  1.00 39.00  ? 2075 HOH A O   1 
HETATM 8660  O  O   . HOH R 6 .   ? 102.747 57.584 9.132   1.00 49.08  ? 2076 HOH A O   1 
HETATM 8661  O  O   . HOH R 6 .   ? 107.631 56.399 18.772  1.00 79.71  ? 2077 HOH A O   1 
HETATM 8662  O  O   . HOH R 6 .   ? 85.686  54.300 -1.746  1.00 48.30  ? 2078 HOH A O   1 
HETATM 8663  O  O   . HOH R 6 .   ? 107.511 39.906 16.143  1.00 58.37  ? 2079 HOH A O   1 
HETATM 8664  O  O   . HOH R 6 .   ? 74.908  61.277 3.509   1.00 44.96  ? 2080 HOH A O   1 
HETATM 8665  O  O   . HOH R 6 .   ? 98.151  50.878 19.480  1.00 82.51  ? 2081 HOH A O   1 
HETATM 8666  O  O   . HOH R 6 .   ? 65.091  68.023 16.141  1.00 73.05  ? 2082 HOH A O   1 
HETATM 8667  O  O   . HOH R 6 .   ? 64.897  71.136 20.207  1.00 63.40  ? 2083 HOH A O   1 
HETATM 8668  O  O   . HOH R 6 .   ? 66.266  68.035 21.761  1.00 63.36  ? 2084 HOH A O   1 
HETATM 8669  O  O   . HOH R 6 .   ? 83.150  60.700 1.815   1.00 32.27  ? 2085 HOH A O   1 
HETATM 8670  O  O   . HOH R 6 .   ? 82.130  69.117 -0.931  1.00 62.46  ? 2086 HOH A O   1 
HETATM 8671  O  O   . HOH R 6 .   ? 81.911  66.999 5.015   1.00 36.27  ? 2087 HOH A O   1 
HETATM 8672  O  O   . HOH R 6 .   ? 81.142  64.716 -3.492  1.00 42.09  ? 2088 HOH A O   1 
HETATM 8673  O  O   . HOH R 6 .   ? 80.434  67.078 -4.856  1.00 62.93  ? 2089 HOH A O   1 
HETATM 8674  O  O   . HOH R 6 .   ? 91.674  43.756 -1.998  1.00 59.04  ? 2090 HOH A O   1 
HETATM 8675  O  O   . HOH R 6 .   ? 92.391  43.770 3.268   1.00 62.27  ? 2091 HOH A O   1 
HETATM 8676  O  O   . HOH R 6 .   ? 98.558  45.716 5.814   1.00 68.62  ? 2092 HOH A O   1 
HETATM 8677  O  O   . HOH R 6 .   ? 99.716  48.054 5.321   1.00 61.95  ? 2093 HOH A O   1 
HETATM 8678  O  O   . HOH R 6 .   ? 101.199 47.604 9.545   1.00 67.67  ? 2094 HOH A O   1 
HETATM 8679  O  O   . HOH R 6 .   ? 104.453 51.591 9.969   1.00 67.05  ? 2095 HOH A O   1 
HETATM 8680  O  O   . HOH R 6 .   ? 100.804 53.364 7.832   1.00 41.84  ? 2096 HOH A O   1 
HETATM 8681  O  O   . HOH R 6 .   ? 99.980  46.875 1.290   1.00 64.68  ? 2097 HOH A O   1 
HETATM 8682  O  O   . HOH R 6 .   ? 84.462  68.754 0.043   1.00 50.86  ? 2098 HOH A O   1 
HETATM 8683  O  O   . HOH R 6 .   ? 100.247 51.207 0.722   1.00 71.06  ? 2099 HOH A O   1 
HETATM 8684  O  O   . HOH R 6 .   ? 97.098  49.880 -0.653  1.00 62.10  ? 2100 HOH A O   1 
HETATM 8685  O  O   . HOH R 6 .   ? 95.720  57.619 -1.061  1.00 69.31  ? 2101 HOH A O   1 
HETATM 8686  O  O   . HOH R 6 .   ? 89.409  69.561 5.353   1.00 111.37 ? 2102 HOH A O   1 
HETATM 8687  O  O   . HOH R 6 .   ? 93.814  66.261 -0.232  1.00 60.33  ? 2103 HOH A O   1 
HETATM 8688  O  O   . HOH R 6 .   ? 96.862  68.796 2.318   1.00 58.83  ? 2104 HOH A O   1 
HETATM 8689  O  O   . HOH R 6 .   ? 93.114  64.189 8.348   1.00 89.91  ? 2105 HOH A O   1 
HETATM 8690  O  O   . HOH R 6 .   ? 86.416  70.968 0.618   1.00 50.31  ? 2106 HOH A O   1 
HETATM 8691  O  O   . HOH R 6 .   ? 91.379  64.532 -1.217  1.00 57.14  ? 2107 HOH A O   1 
HETATM 8692  O  O   . HOH R 6 .   ? 87.337  66.033 -2.409  1.00 58.22  ? 2108 HOH A O   1 
HETATM 8693  O  O   . HOH R 6 .   ? 83.717  85.821 15.514  1.00 74.60  ? 2109 HOH A O   1 
HETATM 8694  O  O   . HOH R 6 .   ? 84.173  84.380 12.708  1.00 83.83  ? 2110 HOH A O   1 
HETATM 8695  O  O   . HOH R 6 .   ? 92.972  69.856 3.863   1.00 45.30  ? 2111 HOH A O   1 
HETATM 8696  O  O   . HOH R 6 .   ? 92.917  72.148 5.254   1.00 43.08  ? 2112 HOH A O   1 
HETATM 8697  O  O   . HOH R 6 .   ? 88.453  73.691 0.082   1.00 40.03  ? 2113 HOH A O   1 
HETATM 8698  O  O   . HOH R 6 .   ? 85.982  77.419 1.889   1.00 57.45  ? 2114 HOH A O   1 
HETATM 8699  O  O   . HOH R 6 .   ? 92.293  76.817 3.591   1.00 64.08  ? 2115 HOH A O   1 
HETATM 8700  O  O   . HOH R 6 .   ? 92.445  74.790 2.082   1.00 49.22  ? 2116 HOH A O   1 
HETATM 8701  O  O   . HOH R 6 .   ? 92.977  77.467 1.190   1.00 60.60  ? 2117 HOH A O   1 
HETATM 8702  O  O   . HOH R 6 .   ? 72.773  30.770 -5.473  1.00 62.78  ? 2118 HOH A O   1 
HETATM 8703  O  O   . HOH R 6 .   ? 73.487  32.950 -6.664  1.00 63.37  ? 2119 HOH A O   1 
HETATM 8704  O  O   . HOH R 6 .   ? 73.924  30.035 3.565   1.00 66.54  ? 2120 HOH A O   1 
HETATM 8705  O  O   . HOH R 6 .   ? 88.571  67.709 9.575   1.00 21.07  ? 2121 HOH A O   1 
HETATM 8706  O  O   . HOH R 6 .   ? 68.872  74.856 16.445  1.00 70.60  ? 2122 HOH A O   1 
HETATM 8707  O  O   . HOH R 6 .   ? 85.202  74.463 2.425   1.00 74.42  ? 2123 HOH A O   1 
HETATM 8708  O  O   . HOH R 6 .   ? 82.585  72.982 4.257   1.00 71.54  ? 2124 HOH A O   1 
HETATM 8709  O  O   . HOH R 6 .   ? 66.136  66.553 31.658  1.00 60.88  ? 2125 HOH A O   1 
HETATM 8710  O  O   . HOH R 6 .   ? 76.069  71.064 15.862  1.00 63.74  ? 2126 HOH A O   1 
HETATM 8711  O  O   . HOH R 6 .   ? 80.439  71.990 7.658   1.00 54.06  ? 2127 HOH A O   1 
HETATM 8712  O  O   . HOH R 6 .   ? 83.372  69.375 6.359   1.00 50.80  ? 2128 HOH A O   1 
HETATM 8713  O  O   . HOH R 6 .   ? 76.491  73.211 11.290  1.00 90.82  ? 2129 HOH A O   1 
HETATM 8714  O  O   . HOH R 6 .   ? 66.490  71.866 22.929  1.00 67.34  ? 2130 HOH A O   1 
HETATM 8715  O  O   . HOH R 6 .   ? 96.305  51.404 22.942  1.00 86.70  ? 2131 HOH A O   1 
HETATM 8716  O  O   . HOH R 6 .   ? 80.507  73.548 5.449   1.00 62.53  ? 2132 HOH A O   1 
HETATM 8717  O  O   . HOH R 6 .   ? 76.642  71.978 8.949   1.00 48.40  ? 2133 HOH A O   1 
HETATM 8718  O  O   . HOH R 6 .   ? 74.664  70.663 3.557   1.00 68.29  ? 2134 HOH A O   1 
HETATM 8719  O  O   . HOH R 6 .   ? 76.805  69.069 0.578   1.00 53.19  ? 2135 HOH A O   1 
HETATM 8720  O  O   . HOH R 6 .   ? 72.295  63.071 -0.428  1.00 82.43  ? 2136 HOH A O   1 
HETATM 8721  O  O   . HOH R 6 .   ? 95.021  43.635 2.975   1.00 67.87  ? 2137 HOH A O   1 
HETATM 8722  O  O   . HOH R 6 .   ? 92.213  37.873 8.625   1.00 82.20  ? 2138 HOH A O   1 
HETATM 8723  O  O   . HOH R 6 .   ? 115.570 47.988 42.449  1.00 52.00  ? 2139 HOH A O   1 
HETATM 8724  O  O   . HOH R 6 .   ? 86.575  41.360 2.446   1.00 53.35  ? 2140 HOH A O   1 
HETATM 8725  O  O   . HOH R 6 .   ? 89.129  41.929 2.416   1.00 76.92  ? 2141 HOH A O   1 
HETATM 8726  O  O   . HOH R 6 .   ? 90.802  37.886 4.772   1.00 51.78  ? 2142 HOH A O   1 
HETATM 8727  O  O   . HOH R 6 .   ? 90.499  39.650 1.495   1.00 55.59  ? 2143 HOH A O   1 
HETATM 8728  O  O   . HOH R 6 .   ? 92.368  39.836 4.875   1.00 72.51  ? 2144 HOH A O   1 
HETATM 8729  O  O   . HOH R 6 .   ? 71.346  60.069 -8.022  1.00 45.19  ? 2145 HOH A O   1 
HETATM 8730  O  O   . HOH R 6 .   ? 76.172  29.284 11.128  1.00 52.85  ? 2146 HOH A O   1 
HETATM 8731  O  O   . HOH R 6 .   ? 71.348  31.160 4.401   1.00 71.26  ? 2147 HOH A O   1 
HETATM 8732  O  O   . HOH R 6 .   ? 72.790  28.657 7.430   1.00 70.70  ? 2148 HOH A O   1 
HETATM 8733  O  O   . HOH R 6 .   ? 74.924  29.100 8.911   1.00 59.83  ? 2149 HOH A O   1 
HETATM 8734  O  O   . HOH R 6 .   ? 73.987  56.931 -9.604  1.00 38.77  ? 2150 HOH A O   1 
HETATM 8735  O  O   . HOH R 6 .   ? 81.103  56.478 -10.532 1.00 42.37  ? 2151 HOH A O   1 
HETATM 8736  O  O   . HOH R 6 .   ? 79.379  53.822 -13.785 1.00 54.36  ? 2152 HOH A O   1 
HETATM 8737  O  O   . HOH R 6 .   ? 83.466  54.358 -8.344  1.00 40.30  ? 2153 HOH A O   1 
HETATM 8738  O  O   . HOH R 6 .   ? 85.659  50.562 -11.554 1.00 60.92  ? 2154 HOH A O   1 
HETATM 8739  O  O   . HOH R 6 .   ? 82.086  48.023 -8.002  1.00 78.24  ? 2155 HOH A O   1 
HETATM 8740  O  O   . HOH R 6 .   ? 84.748  50.564 -2.948  1.00 63.38  ? 2156 HOH A O   1 
HETATM 8741  O  O   . HOH R 6 .   ? 66.955  57.902 40.131  1.00 49.14  ? 2157 HOH A O   1 
HETATM 8742  O  O   . HOH R 6 .   ? 87.730  42.739 -1.739  1.00 60.10  ? 2158 HOH A O   1 
HETATM 8743  O  O   . HOH R 6 .   ? 89.091  43.742 -3.852  1.00 91.19  ? 2159 HOH A O   1 
HETATM 8744  O  O   . HOH R 6 .   ? 85.765  42.577 -3.424  1.00 75.58  ? 2160 HOH A O   1 
HETATM 8745  O  O   . HOH R 6 .   ? 87.021  51.546 -2.884  1.00 53.21  ? 2161 HOH A O   1 
HETATM 8746  O  O   . HOH R 6 .   ? 75.864  77.809 21.199  1.00 61.46  ? 2162 HOH A O   1 
HETATM 8747  O  O   . HOH R 6 .   ? 76.177  80.720 16.223  1.00 54.10  ? 2163 HOH A O   1 
HETATM 8748  O  O   . HOH R 6 .   ? 79.486  82.311 14.290  1.00 62.22  ? 2164 HOH A O   1 
HETATM 8749  O  O   . HOH R 6 .   ? 89.301  45.479 -0.297  1.00 56.16  ? 2165 HOH A O   1 
HETATM 8750  O  O   . HOH R 6 .   ? 91.270  51.946 -1.014  1.00 41.97  ? 2166 HOH A O   1 
HETATM 8751  O  O   . HOH R 6 .   ? 88.854  42.673 6.193   1.00 60.08  ? 2167 HOH A O   1 
HETATM 8752  O  O   . HOH R 6 .   ? 87.366  45.440 8.096   1.00 61.14  ? 2168 HOH A O   1 
HETATM 8753  O  O   . HOH R 6 .   ? 80.214  74.843 7.933   1.00 59.64  ? 2169 HOH A O   1 
HETATM 8754  O  O   . HOH R 6 .   ? 78.406  73.778 9.647   1.00 61.73  ? 2170 HOH A O   1 
HETATM 8755  O  O   . HOH R 6 .   ? 92.967  38.161 10.989  1.00 53.10  ? 2171 HOH A O   1 
HETATM 8756  O  O   . HOH R 6 .   ? 90.723  58.560 -3.133  1.00 58.96  ? 2172 HOH A O   1 
HETATM 8757  O  O   . HOH R 6 .   ? 88.080  55.940 -0.303  1.00 61.84  ? 2173 HOH A O   1 
HETATM 8758  O  O   . HOH R 6 .   ? 87.503  54.996 5.836   1.00 28.58  ? 2174 HOH A O   1 
HETATM 8759  O  O   . HOH R 6 .   ? 93.159  52.732 0.134   1.00 50.00  ? 2175 HOH A O   1 
HETATM 8760  O  O   . HOH R 6 .   ? 73.334  63.769 10.097  1.00 40.47  ? 2176 HOH A O   1 
HETATM 8761  O  O   . HOH R 6 .   ? 91.089  19.003 16.013  1.00 78.80  ? 2177 HOH A O   1 
HETATM 8762  O  O   . HOH R 6 .   ? 72.396  26.215 21.234  1.00 54.60  ? 2178 HOH A O   1 
HETATM 8763  O  O   . HOH R 6 .   ? 89.989  55.560 9.429   1.00 31.47  ? 2179 HOH A O   1 
HETATM 8764  O  O   . HOH R 6 .   ? 71.580  69.465 15.842  1.00 67.25  ? 2180 HOH A O   1 
HETATM 8765  O  O   . HOH R 6 .   ? 73.268  63.140 6.137   1.00 58.69  ? 2181 HOH A O   1 
HETATM 8766  O  O   . HOH R 6 .   ? 95.579  63.517 2.977   1.00 36.68  ? 2182 HOH A O   1 
HETATM 8767  O  O   . HOH R 6 .   ? 94.832  62.500 13.688  1.00 21.66  ? 2183 HOH A O   1 
HETATM 8768  O  O   . HOH R 6 .   ? 91.640  62.267 8.559   1.00 36.20  ? 2184 HOH A O   1 
HETATM 8769  O  O   . HOH R 6 .   ? 91.505  61.831 11.142  1.00 22.23  ? 2185 HOH A O   1 
HETATM 8770  O  O   . HOH R 6 .   ? 101.226 58.942 10.624  1.00 39.42  ? 2186 HOH A O   1 
HETATM 8771  O  O   . HOH R 6 .   ? 93.947  52.476 12.608  1.00 23.54  ? 2187 HOH A O   1 
HETATM 8772  O  O   . HOH R 6 .   ? 91.385  57.144 11.146  1.00 91.52  ? 2188 HOH A O   1 
HETATM 8773  O  O   . HOH R 6 .   ? 68.136  64.644 8.035   1.00 59.45  ? 2189 HOH A O   1 
HETATM 8774  O  O   . HOH R 6 .   ? 68.811  60.878 1.792   1.00 53.36  ? 2190 HOH A O   1 
HETATM 8775  O  O   . HOH R 6 .   ? 64.523  30.050 33.566  1.00 78.45  ? 2191 HOH A O   1 
HETATM 8776  O  O   . HOH R 6 .   ? 65.896  22.759 26.967  1.00 61.31  ? 2192 HOH A O   1 
HETATM 8777  O  O   . HOH R 6 .   ? 69.707  25.653 34.100  1.00 64.15  ? 2193 HOH A O   1 
HETATM 8778  O  O   . HOH R 6 .   ? 60.756  33.358 31.509  1.00 55.50  ? 2194 HOH A O   1 
HETATM 8779  O  O   . HOH R 6 .   ? 103.464 54.179 19.488  1.00 50.87  ? 2195 HOH A O   1 
HETATM 8780  O  O   . HOH R 6 .   ? 97.332  54.026 14.085  1.00 38.96  ? 2196 HOH A O   1 
HETATM 8781  O  O   . HOH R 6 .   ? 105.544 55.317 17.674  1.00 47.62  ? 2197 HOH A O   1 
HETATM 8782  O  O   . HOH R 6 .   ? 60.187  49.173 8.487   1.00 52.88  ? 2198 HOH A O   1 
HETATM 8783  O  O   . HOH R 6 .   ? 102.665 58.441 12.717  1.00 36.43  ? 2199 HOH A O   1 
HETATM 8784  O  O   . HOH R 6 .   ? 105.656 55.302 15.357  1.00 87.09  ? 2200 HOH A O   1 
HETATM 8785  O  O   . HOH R 6 .   ? 108.316 56.942 11.101  1.00 50.04  ? 2201 HOH A O   1 
HETATM 8786  O  O   . HOH R 6 .   ? 110.021 55.694 13.065  1.00 98.21  ? 2202 HOH A O   1 
HETATM 8787  O  O   . HOH R 6 .   ? 108.333 54.561 17.245  1.00 37.98  ? 2203 HOH A O   1 
HETATM 8788  O  O   . HOH R 6 .   ? 74.141  54.566 41.028  1.00 77.95  ? 2204 HOH A O   1 
HETATM 8789  O  O   . HOH R 6 .   ? 111.203 47.909 19.798  1.00 50.38  ? 2205 HOH A O   1 
HETATM 8790  O  O   . HOH R 6 .   ? 106.467 54.689 21.465  1.00 58.93  ? 2206 HOH A O   1 
HETATM 8791  O  O   . HOH R 6 .   ? 110.096 50.875 23.634  1.00 64.72  ? 2207 HOH A O   1 
HETATM 8792  O  O   . HOH R 6 .   ? 109.638 44.949 16.099  1.00 66.49  ? 2208 HOH A O   1 
HETATM 8793  O  O   . HOH R 6 .   ? 108.314 42.065 14.710  1.00 70.66  ? 2209 HOH A O   1 
HETATM 8794  O  O   . HOH R 6 .   ? 102.795 42.015 11.342  1.00 52.88  ? 2210 HOH A O   1 
HETATM 8795  O  O   . HOH R 6 .   ? 103.742 38.582 12.088  1.00 57.10  ? 2211 HOH A O   1 
HETATM 8796  O  O   . HOH R 6 .   ? 104.023 38.753 14.915  1.00 55.92  ? 2212 HOH A O   1 
HETATM 8797  O  O   . HOH R 6 .   ? 99.104  38.507 16.199  1.00 69.71  ? 2213 HOH A O   1 
HETATM 8798  O  O   . HOH R 6 .   ? 99.375  49.340 17.731  1.00 31.16  ? 2214 HOH A O   1 
HETATM 8799  O  O   . HOH R 6 .   ? 104.203 48.565 16.427  1.00 39.77  ? 2215 HOH A O   1 
HETATM 8800  O  O   . HOH R 6 .   ? 66.680  70.114 18.766  1.00 59.25  ? 2216 HOH A O   1 
HETATM 8801  O  O   . HOH R 6 .   ? 65.483  64.826 22.501  1.00 64.15  ? 2217 HOH A O   1 
HETATM 8802  O  O   . HOH R 6 .   ? 106.500 47.839 9.804   1.00 52.91  ? 2218 HOH A O   1 
HETATM 8803  O  O   . HOH R 6 .   ? 104.692 48.707 13.941  1.00 59.09  ? 2219 HOH A O   1 
HETATM 8804  O  O   . HOH R 6 .   ? 71.624  52.158 11.460  1.00 75.19  ? 2220 HOH A O   1 
HETATM 8805  O  O   . HOH R 6 .   ? 63.494  66.384 17.961  1.00 74.26  ? 2221 HOH A O   1 
HETATM 8806  O  O   . HOH R 6 .   ? 66.434  65.727 16.104  1.00 76.84  ? 2222 HOH A O   1 
HETATM 8807  O  O   . HOH R 6 .   ? 62.064  58.475 15.018  1.00 69.07  ? 2223 HOH A O   1 
HETATM 8808  O  O   . HOH R 6 .   ? 67.235  64.483 14.104  1.00 78.15  ? 2224 HOH A O   1 
HETATM 8809  O  O   . HOH R 6 .   ? 93.646  44.567 15.360  1.00 100.57 ? 2225 HOH A O   1 
HETATM 8810  O  O   . HOH R 6 .   ? 93.506  43.586 12.516  1.00 37.27  ? 2226 HOH A O   1 
HETATM 8811  O  O   . HOH R 6 .   ? 93.176  50.877 15.926  1.00 29.67  ? 2227 HOH A O   1 
HETATM 8812  O  O   . HOH R 6 .   ? 102.762 49.200 10.746  1.00 61.75  ? 2228 HOH A O   1 
HETATM 8813  O  O   . HOH R 6 .   ? 96.492  46.661 10.141  1.00 28.76  ? 2229 HOH A O   1 
HETATM 8814  O  O   . HOH R 6 .   ? 97.669  51.876 16.202  1.00 60.35  ? 2230 HOH A O   1 
HETATM 8815  O  O   . HOH R 6 .   ? 98.862  47.183 8.188   1.00 43.79  ? 2231 HOH A O   1 
HETATM 8816  O  O   . HOH R 6 .   ? 100.263 51.101 9.243   1.00 32.15  ? 2232 HOH A O   1 
HETATM 8817  O  O   . HOH R 6 .   ? 99.144  51.595 5.421   1.00 70.37  ? 2233 HOH A O   1 
HETATM 8818  O  O   . HOH R 6 .   ? 97.114  48.788 2.053   1.00 79.81  ? 2234 HOH A O   1 
HETATM 8819  O  O   . HOH R 6 .   ? 90.976  66.770 31.551  1.00 37.78  ? 2235 HOH A O   1 
HETATM 8820  O  O   . HOH R 6 .   ? 85.016  63.313 33.109  1.00 47.93  ? 2236 HOH A O   1 
HETATM 8821  O  O   . HOH R 6 .   ? 84.801  65.951 34.525  1.00 49.11  ? 2237 HOH A O   1 
HETATM 8822  O  O   . HOH R 6 .   ? 86.967  67.890 32.422  1.00 44.60  ? 2238 HOH A O   1 
HETATM 8823  O  O   . HOH R 6 .   ? 91.629  46.195 -1.311  1.00 40.75  ? 2239 HOH A O   1 
HETATM 8824  O  O   . HOH R 6 .   ? 94.268  46.248 2.970   1.00 50.09  ? 2240 HOH A O   1 
HETATM 8825  O  O   . HOH R 6 .   ? 99.016  54.123 5.746   1.00 49.22  ? 2241 HOH A O   1 
HETATM 8826  O  O   . HOH R 6 .   ? 96.536  46.699 0.404   1.00 52.46  ? 2242 HOH A O   1 
HETATM 8827  O  O   . HOH R 6 .   ? 91.473  48.830 -0.872  1.00 50.07  ? 2243 HOH A O   1 
HETATM 8828  O  O   . HOH R 6 .   ? 85.068  78.027 29.221  1.00 46.13  ? 2244 HOH A O   1 
HETATM 8829  O  O   . HOH R 6 .   ? 95.546  51.653 0.518   1.00 53.15  ? 2245 HOH A O   1 
HETATM 8830  O  O   . HOH R 6 .   ? 99.723  56.226 3.965   1.00 35.67  ? 2246 HOH A O   1 
HETATM 8831  O  O   . HOH R 6 .   ? 97.879  51.376 1.471   1.00 83.79  ? 2247 HOH A O   1 
HETATM 8832  O  O   . HOH R 6 .   ? 93.323  53.317 3.874   1.00 86.96  ? 2248 HOH A O   1 
HETATM 8833  O  O   . HOH R 6 .   ? 97.390  56.383 -2.590  1.00 78.33  ? 2249 HOH A O   1 
HETATM 8834  O  O   . HOH R 6 .   ? 100.054 52.682 2.795   1.00 65.39  ? 2250 HOH A O   1 
HETATM 8835  O  O   . HOH R 6 .   ? 93.178  82.148 20.828  1.00 42.40  ? 2251 HOH A O   1 
HETATM 8836  O  O   . HOH R 6 .   ? 92.518  80.711 25.579  1.00 76.12  ? 2252 HOH A O   1 
HETATM 8837  O  O   . HOH R 6 .   ? 86.578  78.637 27.154  1.00 47.09  ? 2253 HOH A O   1 
HETATM 8838  O  O   . HOH R 6 .   ? 99.374  73.074 30.456  1.00 62.15  ? 2254 HOH A O   1 
HETATM 8839  O  O   . HOH R 6 .   ? 88.420  64.729 3.315   1.00 95.12  ? 2255 HOH A O   1 
HETATM 8840  O  O   . HOH R 6 .   ? 89.701  63.836 7.412   1.00 27.41  ? 2256 HOH A O   1 
HETATM 8841  O  O   . HOH R 6 .   ? 89.928  66.814 7.574   1.00 30.97  ? 2257 HOH A O   1 
HETATM 8842  O  O   . HOH R 6 .   ? 95.116  66.391 2.762   1.00 35.56  ? 2258 HOH A O   1 
HETATM 8843  O  O   . HOH R 6 .   ? 107.711 76.664 20.333  1.00 53.84  ? 2259 HOH A O   1 
HETATM 8844  O  O   . HOH R 6 .   ? 110.618 78.621 17.409  1.00 67.29  ? 2260 HOH A O   1 
HETATM 8845  O  O   . HOH R 6 .   ? 106.262 80.396 20.552  1.00 49.43  ? 2261 HOH A O   1 
HETATM 8846  O  O   . HOH R 6 .   ? 103.994 81.223 19.969  1.00 64.32  ? 2262 HOH A O   1 
HETATM 8847  O  O   . HOH R 6 .   ? 103.501 84.153 15.392  1.00 46.58  ? 2263 HOH A O   1 
HETATM 8848  O  O   . HOH R 6 .   ? 90.301  61.367 -2.681  1.00 51.47  ? 2264 HOH A O   1 
HETATM 8849  O  O   . HOH R 6 .   ? 85.560  61.689 -2.944  1.00 43.48  ? 2265 HOH A O   1 
HETATM 8850  O  O   . HOH R 6 .   ? 88.982  63.950 -2.084  1.00 70.92  ? 2266 HOH A O   1 
HETATM 8851  O  O   . HOH R 6 .   ? 85.533  61.585 2.733   1.00 29.55  ? 2267 HOH A O   1 
HETATM 8852  O  O   . HOH R 6 .   ? 102.244 83.705 11.614  1.00 56.13  ? 2268 HOH A O   1 
HETATM 8853  O  O   . HOH R 6 .   ? 85.511  83.177 14.685  1.00 64.01  ? 2269 HOH A O   1 
HETATM 8854  O  O   . HOH R 6 .   ? 83.527  60.750 -1.415  1.00 36.65  ? 2270 HOH A O   1 
HETATM 8855  O  O   . HOH R 6 .   ? 87.453  57.317 -2.819  1.00 74.23  ? 2271 HOH A O   1 
HETATM 8856  O  O   . HOH R 6 .   ? 93.148  84.558 7.888   1.00 60.56  ? 2272 HOH A O   1 
HETATM 8857  O  O   . HOH R 6 .   ? 89.549  83.535 3.791   1.00 68.04  ? 2273 HOH A O   1 
HETATM 8858  O  O   . HOH R 6 .   ? 86.572  49.127 6.366   1.00 74.10  ? 2274 HOH A O   1 
HETATM 8859  O  O   . HOH R 6 .   ? 84.399  51.820 4.731   1.00 91.76  ? 2275 HOH A O   1 
HETATM 8860  O  O   . HOH R 6 .   ? 95.091  81.637 6.141   1.00 44.84  ? 2276 HOH A O   1 
HETATM 8861  O  O   . HOH R 6 .   ? 91.346  81.290 1.950   1.00 61.98  ? 2277 HOH A O   1 
HETATM 8862  O  O   . HOH R 6 .   ? 100.725 59.199 5.440   1.00 60.27  ? 2278 HOH A O   1 
HETATM 8863  O  O   . HOH R 6 .   ? 84.300  40.741 3.255   1.00 56.52  ? 2279 HOH A O   1 
HETATM 8864  O  O   . HOH R 6 .   ? 72.862  32.877 -3.756  1.00 61.27  ? 2280 HOH A O   1 
HETATM 8865  O  O   . HOH R 6 .   ? 74.767  31.926 1.721   1.00 74.27  ? 2281 HOH A O   1 
HETATM 8866  O  O   . HOH R 6 .   ? 105.601 62.093 21.939  1.00 45.04  ? 2282 HOH A O   1 
HETATM 8867  O  O   . HOH R 6 .   ? 65.899  44.627 -0.737  1.00 69.43  ? 2283 HOH A O   1 
HETATM 8868  O  O   . HOH R 6 .   ? 66.985  46.914 -2.991  1.00 49.83  ? 2284 HOH A O   1 
HETATM 8869  O  O   . HOH R 6 .   ? 67.789  41.288 -4.358  1.00 54.86  ? 2285 HOH A O   1 
HETATM 8870  O  O   . HOH R 6 .   ? 97.705  55.483 24.564  1.00 99.05  ? 2286 HOH A O   1 
HETATM 8871  O  O   . HOH R 6 .   ? 102.304 56.149 25.756  1.00 65.95  ? 2287 HOH A O   1 
HETATM 8872  O  O   . HOH R 6 .   ? 102.560 60.985 25.672  1.00 57.73  ? 2288 HOH A O   1 
HETATM 8873  O  O   . HOH R 6 .   ? 105.027 61.600 26.127  1.00 67.36  ? 2289 HOH A O   1 
HETATM 8874  O  O   . HOH R 6 .   ? 60.748  36.607 1.400   1.00 87.04  ? 2290 HOH A O   1 
HETATM 8875  O  O   . HOH R 6 .   ? 57.277  42.059 1.607   1.00 53.70  ? 2291 HOH A O   1 
HETATM 8876  O  O   . HOH R 6 .   ? 61.136  42.585 9.909   1.00 67.23  ? 2292 HOH A O   1 
HETATM 8877  O  O   . HOH R 6 .   ? 67.633  37.528 9.843   1.00 69.10  ? 2293 HOH A O   1 
HETATM 8878  O  O   . HOH R 6 .   ? 71.073  74.513 14.349  1.00 79.55  ? 2294 HOH A O   1 
HETATM 8879  O  O   . HOH R 6 .   ? 77.129  75.555 20.852  1.00 55.20  ? 2295 HOH A O   1 
HETATM 8880  O  O   . HOH R 6 .   ? 64.967  42.951 14.008  1.00 80.52  ? 2296 HOH A O   1 
HETATM 8881  O  O   . HOH R 6 .   ? 81.276  68.899 32.448  1.00 35.94  ? 2297 HOH A O   1 
HETATM 8882  O  O   . HOH R 6 .   ? 80.960  66.933 36.774  1.00 61.77  ? 2298 HOH A O   1 
HETATM 8883  O  O   . HOH R 6 .   ? 82.273  59.279 38.962  1.00 41.56  ? 2299 HOH A O   1 
HETATM 8884  O  O   . HOH R 6 .   ? 64.961  64.404 31.524  1.00 54.26  ? 2300 HOH A O   1 
HETATM 8885  O  O   . HOH R 6 .   ? 68.719  69.873 24.037  1.00 58.84  ? 2301 HOH A O   1 
HETATM 8886  O  O   . HOH R 6 .   ? 65.310  59.763 23.700  1.00 70.44  ? 2302 HOH A O   1 
HETATM 8887  O  O   . HOH R 6 .   ? 60.368  58.109 28.394  1.00 57.74  ? 2303 HOH A O   1 
HETATM 8888  O  O   . HOH R 6 .   ? 61.423  62.229 30.510  1.00 63.38  ? 2304 HOH A O   1 
HETATM 8889  O  O   . HOH R 6 .   ? 88.058  49.136 18.852  1.00 29.45  ? 2305 HOH A O   1 
HETATM 8890  O  O   . HOH R 6 .   ? 93.654  54.132 22.409  1.00 88.03  ? 2306 HOH A O   1 
HETATM 8891  O  O   . HOH R 6 .   ? 92.666  61.477 20.845  1.00 29.22  ? 2307 HOH A O   1 
HETATM 8892  O  O   . HOH R 6 .   ? 78.531  47.720 34.035  1.00 92.99  ? 2308 HOH A O   1 
HETATM 8893  O  O   . HOH R 6 .   ? 95.295  35.881 31.750  1.00 37.69  ? 2309 HOH A O   1 
HETATM 8894  O  O   . HOH R 6 .   ? 98.132  37.771 34.422  1.00 59.04  ? 2310 HOH A O   1 
HETATM 8895  O  O   . HOH R 6 .   ? 98.543  53.505 19.513  1.00 47.38  ? 2311 HOH A O   1 
HETATM 8896  O  O   . HOH R 6 .   ? 94.904  52.429 20.858  1.00 46.12  ? 2312 HOH A O   1 
HETATM 8897  O  O   . HOH R 6 .   ? 94.647  52.033 17.820  1.00 30.49  ? 2313 HOH A O   1 
HETATM 8898  O  O   . HOH R 6 .   ? 89.250  56.103 18.118  1.00 20.46  ? 2314 HOH A O   1 
HETATM 8899  O  O   . HOH R 6 .   ? 85.392  53.524 6.368   1.00 29.50  ? 2315 HOH A O   1 
HETATM 8900  O  O   . HOH R 6 .   ? 84.667  46.752 9.437   1.00 43.79  ? 2316 HOH A O   1 
HETATM 8901  O  O   . HOH R 6 .   ? 88.646  53.696 8.333   1.00 31.09  ? 2317 HOH A O   1 
HETATM 8902  O  O   . HOH R 6 .   ? 103.097 52.330 35.655  1.00 105.77 ? 2318 HOH A O   1 
HETATM 8903  O  O   . HOH R 6 .   ? 108.511 57.522 33.416  1.00 68.05  ? 2319 HOH A O   1 
HETATM 8904  O  O   . HOH R 6 .   ? 108.937 36.368 21.779  1.00 85.01  ? 2320 HOH A O   1 
HETATM 8905  O  O   . HOH R 6 .   ? 105.965 35.995 24.692  1.00 49.80  ? 2321 HOH A O   1 
HETATM 8906  O  O   . HOH R 6 .   ? 95.038  43.983 6.590   1.00 53.50  ? 2322 HOH A O   1 
HETATM 8907  O  O   . HOH R 6 .   ? 89.503  38.680 8.523   1.00 64.17  ? 2323 HOH A O   1 
HETATM 8908  O  O   . HOH R 6 .   ? 91.199  43.343 6.150   1.00 37.40  ? 2324 HOH A O   1 
HETATM 8909  O  O   . HOH R 6 .   ? 104.318 54.767 49.872  1.00 48.96  ? 2325 HOH A O   1 
HETATM 8910  O  O   . HOH R 6 .   ? 114.957 50.673 42.126  1.00 51.50  ? 2326 HOH A O   1 
HETATM 8911  O  O   . HOH R 6 .   ? 110.294 55.025 45.938  1.00 68.94  ? 2327 HOH A O   1 
HETATM 8912  O  O   . HOH R 6 .   ? 111.670 51.587 47.151  1.00 65.58  ? 2328 HOH A O   1 
HETATM 8913  O  O   . HOH R 6 .   ? 90.462  50.630 16.049  1.00 23.49  ? 2329 HOH A O   1 
HETATM 8914  O  O   . HOH R 6 .   ? 105.422 60.647 42.560  1.00 62.41  ? 2330 HOH A O   1 
HETATM 8915  O  O   . HOH R 6 .   ? 87.641  38.932 3.371   1.00 53.69  ? 2331 HOH A O   1 
HETATM 8916  O  O   . HOH R 6 .   ? 90.207  40.054 6.321   1.00 54.28  ? 2332 HOH A O   1 
HETATM 8917  O  O   . HOH R 6 .   ? 108.107 58.927 35.673  1.00 54.86  ? 2333 HOH A O   1 
HETATM 8918  O  O   . HOH R 6 .   ? 93.796  67.731 35.162  1.00 62.38  ? 2334 HOH A O   1 
HETATM 8919  O  O   . HOH R 6 .   ? 100.372 56.892 53.168  1.00 41.01  ? 2335 HOH A O   1 
HETATM 8920  O  O   . HOH R 6 .   ? 78.967  30.009 11.104  1.00 49.77  ? 2336 HOH A O   1 
HETATM 8921  O  O   . HOH R 6 .   ? 95.165  44.557 48.061  1.00 54.50  ? 2337 HOH A O   1 
HETATM 8922  O  O   . HOH R 6 .   ? 96.466  44.805 49.991  1.00 46.54  ? 2338 HOH A O   1 
HETATM 8923  O  O   . HOH R 6 .   ? 77.283  31.925 16.512  1.00 33.60  ? 2339 HOH A O   1 
HETATM 8924  O  O   . HOH R 6 .   ? 70.981  35.729 15.579  1.00 47.57  ? 2340 HOH A O   1 
HETATM 8925  O  O   . HOH R 6 .   ? 96.487  42.576 51.574  1.00 67.89  ? 2341 HOH A O   1 
HETATM 8926  O  O   . HOH R 6 .   ? 70.196  30.106 6.698   1.00 57.41  ? 2342 HOH A O   1 
HETATM 8927  O  O   . HOH R 6 .   ? 72.822  30.945 9.269   1.00 64.27  ? 2343 HOH A O   1 
HETATM 8928  O  O   . HOH R 6 .   ? 100.748 36.787 42.518  1.00 49.17  ? 2344 HOH A O   1 
HETATM 8929  O  O   . HOH R 6 .   ? 112.456 44.717 41.958  1.00 68.52  ? 2345 HOH A O   1 
HETATM 8930  O  O   . HOH R 6 .   ? 83.995  51.296 12.713  1.00 20.46  ? 2346 HOH A O   1 
HETATM 8931  O  O   . HOH R 6 .   ? 83.755  50.731 10.461  1.00 91.41  ? 2347 HOH A O   1 
HETATM 8932  O  O   . HOH R 6 .   ? 79.434  51.212 11.631  1.00 92.35  ? 2348 HOH A O   1 
HETATM 8933  O  O   . HOH R 6 .   ? 82.956  59.789 9.709   1.00 107.22 ? 2349 HOH A O   1 
HETATM 8934  O  O   . HOH R 6 .   ? 87.422  57.207 19.089  1.00 108.68 ? 2350 HOH A O   1 
HETATM 8935  O  O   . HOH R 6 .   ? 70.214  58.416 39.724  1.00 53.37  ? 2351 HOH A O   1 
HETATM 8936  O  O   . HOH R 6 .   ? 62.066  50.835 35.073  1.00 54.34  ? 2352 HOH A O   1 
HETATM 8937  O  O   . HOH R 6 .   ? 86.151  67.872 20.186  1.00 25.10  ? 2353 HOH A O   1 
HETATM 8938  O  O   . HOH R 6 .   ? 63.500  39.316 30.525  1.00 69.28  ? 2354 HOH A O   1 
HETATM 8939  O  O   . HOH R 6 .   ? 87.046  74.473 22.954  1.00 26.45  ? 2355 HOH A O   1 
HETATM 8940  O  O   . HOH R 6 .   ? 79.985  80.117 23.232  1.00 60.01  ? 2356 HOH A O   1 
HETATM 8941  O  O   . HOH R 6 .   ? 78.699  78.852 21.214  1.00 58.33  ? 2357 HOH A O   1 
HETATM 8942  O  O   . HOH R 6 .   ? 78.323  77.730 25.337  1.00 59.98  ? 2358 HOH A O   1 
HETATM 8943  O  O   . HOH R 6 .   ? 78.570  80.391 16.830  1.00 72.09  ? 2359 HOH A O   1 
HETATM 8944  O  O   . HOH R 6 .   ? 85.699  80.859 13.670  1.00 44.32  ? 2360 HOH A O   1 
HETATM 8945  O  O   . HOH R 6 .   ? 81.332  76.608 18.467  1.00 44.97  ? 2361 HOH A O   1 
HETATM 8946  O  O   . HOH R 6 .   ? 78.275  77.693 18.991  1.00 68.94  ? 2362 HOH A O   1 
HETATM 8947  O  O   . HOH R 6 .   ? 81.034  73.346 11.142  1.00 35.90  ? 2363 HOH A O   1 
HETATM 8948  O  O   . HOH R 6 .   ? 107.148 36.761 29.191  1.00 56.36  ? 2364 HOH A O   1 
HETATM 8949  O  O   . HOH R 6 .   ? 104.620 35.992 33.218  1.00 46.36  ? 2365 HOH A O   1 
HETATM 8950  O  O   . HOH R 6 .   ? 81.229  77.019 9.047   1.00 61.62  ? 2366 HOH A O   1 
HETATM 8951  O  O   . HOH R 6 .   ? 94.951  49.424 24.704  1.00 63.31  ? 2367 HOH A O   1 
HETATM 8952  O  O   . HOH R 6 .   ? 81.399  74.448 19.868  1.00 68.60  ? 2368 HOH A O   1 
HETATM 8953  O  O   . HOH R 6 .   ? 93.778  39.893 12.928  1.00 59.52  ? 2369 HOH A O   1 
HETATM 8954  O  O   . HOH R 6 .   ? 93.663  37.147 13.029  1.00 59.47  ? 2370 HOH A O   1 
HETATM 8955  O  O   . HOH R 6 .   ? 83.206  70.448 15.628  1.00 79.88  ? 2371 HOH A O   1 
HETATM 8956  O  O   . HOH R 6 .   ? 80.061  70.519 17.257  1.00 37.68  ? 2372 HOH A O   1 
HETATM 8957  O  O   . HOH R 6 .   ? 85.808  71.042 15.276  1.00 34.02  ? 2373 HOH A O   1 
HETATM 8958  O  O   . HOH R 6 .   ? 99.157  21.823 13.802  1.00 62.15  ? 2374 HOH A O   1 
HETATM 8959  O  O   . HOH R 6 .   ? 100.284 23.451 12.198  1.00 57.70  ? 2375 HOH A O   1 
HETATM 8960  O  O   . HOH R 6 .   ? 88.945  22.912 15.415  1.00 60.67  ? 2376 HOH A O   1 
HETATM 8961  O  O   . HOH R 6 .   ? 91.547  21.724 17.990  1.00 79.87  ? 2377 HOH A O   1 
HETATM 8962  O  O   . HOH R 6 .   ? 75.957  64.603 11.755  1.00 31.93  ? 2378 HOH A O   1 
HETATM 8963  O  O   . HOH R 6 .   ? 83.369  59.402 17.712  1.00 57.53  ? 2379 HOH A O   1 
HETATM 8964  O  O   . HOH R 6 .   ? 74.952  29.816 21.375  1.00 51.59  ? 2380 HOH A O   1 
HETATM 8965  O  O   . HOH R 6 .   ? 73.765  27.977 17.794  1.00 60.19  ? 2381 HOH A O   1 
HETATM 8966  O  O   . HOH R 6 .   ? 73.805  68.282 18.088  1.00 52.99  ? 2382 HOH A O   1 
HETATM 8967  O  O   . HOH R 6 .   ? 73.441  66.754 13.421  1.00 49.50  ? 2383 HOH A O   1 
HETATM 8968  O  O   . HOH R 6 .   ? 73.612  60.774 5.517   1.00 41.69  ? 2384 HOH A O   1 
HETATM 8969  O  O   . HOH R 6 .   ? 66.159  33.795 14.233  1.00 62.61  ? 2385 HOH A O   1 
HETATM 8970  O  O   . HOH R 6 .   ? 61.935  38.927 13.003  1.00 64.89  ? 2386 HOH A O   1 
HETATM 8971  O  O   . HOH R 6 .   ? 71.070  63.558 11.862  1.00 36.63  ? 2387 HOH A O   1 
HETATM 8972  O  O   . HOH R 6 .   ? 69.932  64.967 9.735   1.00 56.12  ? 2388 HOH A O   1 
HETATM 8973  O  O   . HOH R 6 .   ? 66.996  61.753 12.269  1.00 49.11  ? 2389 HOH A O   1 
HETATM 8974  O  O   . HOH R 6 .   ? 63.207  35.996 30.653  1.00 64.35  ? 2390 HOH A O   1 
HETATM 8975  O  O   . HOH R 6 .   ? 67.534  35.042 35.007  1.00 61.62  ? 2391 HOH A O   1 
HETATM 8976  O  O   . HOH R 6 .   ? 75.024  58.016 -0.006  1.00 65.70  ? 2392 HOH A O   1 
HETATM 8977  O  O   . HOH R 6 .   ? 63.861  54.959 8.120   1.00 36.32  ? 2393 HOH A O   1 
HETATM 8978  O  O   . HOH R 6 .   ? 65.970  54.094 10.149  1.00 75.47  ? 2394 HOH A O   1 
HETATM 8979  O  O   . HOH R 6 .   ? 69.609  25.164 28.232  1.00 53.66  ? 2395 HOH A O   1 
HETATM 8980  O  O   . HOH R 6 .   ? 63.526  30.364 30.822  1.00 80.58  ? 2396 HOH A O   1 
HETATM 8981  O  O   . HOH R 6 .   ? 67.190  25.938 27.268  1.00 48.10  ? 2397 HOH A O   1 
HETATM 8982  O  O   . HOH R 6 .   ? 67.116  26.265 32.540  1.00 67.87  ? 2398 HOH A O   1 
HETATM 8983  O  O   . HOH R 6 .   ? 66.802  28.822 31.649  1.00 63.26  ? 2399 HOH A O   1 
HETATM 8984  O  O   . HOH R 6 .   ? 65.023  60.372 5.991   1.00 56.65  ? 2400 HOH A O   1 
HETATM 8985  O  O   . HOH R 6 .   ? 64.567  55.751 3.750   1.00 56.23  ? 2401 HOH A O   1 
HETATM 8986  O  O   . HOH R 6 .   ? 68.259  62.317 5.603   1.00 54.39  ? 2402 HOH A O   1 
HETATM 8987  O  O   . HOH R 6 .   ? 71.133  60.232 5.028   1.00 45.15  ? 2403 HOH A O   1 
HETATM 8988  O  O   . HOH R 6 .   ? 65.302  59.146 3.279   1.00 69.99  ? 2404 HOH A O   1 
HETATM 8989  O  O   . HOH R 6 .   ? 71.305  59.044 1.449   1.00 46.14  ? 2405 HOH A O   1 
HETATM 8990  O  O   . HOH R 6 .   ? 71.811  32.084 38.487  1.00 76.73  ? 2406 HOH A O   1 
HETATM 8991  O  O   . HOH R 6 .   ? 72.520  31.656 40.965  1.00 68.40  ? 2407 HOH A O   1 
HETATM 8992  O  O   . HOH R 6 .   ? 61.970  49.292 1.377   1.00 55.57  ? 2408 HOH A O   1 
HETATM 8993  O  O   . HOH R 6 .   ? 61.314  51.395 5.901   1.00 70.23  ? 2409 HOH A O   1 
HETATM 8994  O  O   . HOH R 6 .   ? 61.115  52.239 0.287   1.00 72.52  ? 2410 HOH A O   1 
HETATM 8995  O  O   . HOH R 6 .   ? 66.421  52.550 5.433   1.00 31.88  ? 2411 HOH A O   1 
HETATM 8996  O  O   . HOH R 6 .   ? 83.957  37.400 41.314  1.00 71.38  ? 2412 HOH A O   1 
HETATM 8997  O  O   . HOH R 6 .   ? 85.331  39.765 38.623  1.00 52.34  ? 2413 HOH A O   1 
HETATM 8998  O  O   . HOH R 6 .   ? 85.633  35.681 40.292  1.00 65.22  ? 2414 HOH A O   1 
HETATM 8999  O  O   . HOH R 6 .   ? 86.889  37.203 38.622  1.00 72.29  ? 2415 HOH A O   1 
HETATM 9000  O  O   . HOH R 6 .   ? 74.830  28.800 40.489  1.00 62.65  ? 2416 HOH A O   1 
HETATM 9001  O  O   . HOH R 6 .   ? 63.222  47.311 5.493   1.00 53.57  ? 2417 HOH A O   1 
HETATM 9002  O  O   . HOH R 6 .   ? 70.382  46.277 5.085   1.00 108.78 ? 2418 HOH A O   1 
HETATM 9003  O  O   . HOH R 6 .   ? 77.443  35.950 44.828  1.00 59.79  ? 2419 HOH A O   1 
HETATM 9004  O  O   . HOH R 6 .   ? 61.805  43.777 12.293  1.00 63.81  ? 2420 HOH A O   1 
HETATM 9005  O  O   . HOH R 6 .   ? 61.517  49.158 10.319  1.00 78.23  ? 2421 HOH A O   1 
HETATM 9006  O  O   . HOH R 6 .   ? 60.807  47.339 12.052  1.00 90.61  ? 2422 HOH A O   1 
HETATM 9007  O  O   . HOH R 6 .   ? 89.984  38.740 38.124  1.00 56.78  ? 2423 HOH A O   1 
HETATM 9008  O  O   . HOH R 6 .   ? 90.321  41.473 38.059  1.00 60.28  ? 2424 HOH A O   1 
HETATM 9009  O  O   . HOH R 6 .   ? 67.657  53.897 12.070  1.00 34.95  ? 2425 HOH A O   1 
HETATM 9010  O  O   . HOH R 6 .   ? 66.680  51.563 14.835  1.00 25.46  ? 2426 HOH A O   1 
HETATM 9011  O  O   . HOH R 6 .   ? 64.147  53.779 12.889  1.00 59.44  ? 2427 HOH A O   1 
HETATM 9012  O  O   . HOH R 6 .   ? 58.248  52.050 16.686  1.00 70.91  ? 2428 HOH A O   1 
HETATM 9013  O  O   . HOH R 6 .   ? 62.491  51.211 16.322  1.00 62.12  ? 2429 HOH A O   1 
HETATM 9014  O  O   . HOH R 6 .   ? 64.845  52.774 16.537  1.00 40.20  ? 2430 HOH A O   1 
HETATM 9015  O  O   . HOH R 6 .   ? 62.967  43.550 15.873  1.00 55.74  ? 2431 HOH A O   1 
HETATM 9016  O  O   . HOH R 6 .   ? 68.965  46.345 16.500  1.00 35.90  ? 2432 HOH A O   1 
HETATM 9017  O  O   . HOH R 6 .   ? 62.517  46.199 16.350  1.00 84.73  ? 2433 HOH A O   1 
HETATM 9018  O  O   . HOH R 6 .   ? 76.549  55.724 41.844  1.00 66.83  ? 2434 HOH A O   1 
HETATM 9019  O  O   . HOH R 6 .   ? 75.756  52.504 49.799  1.00 67.82  ? 2435 HOH A O   1 
HETATM 9020  O  O   . HOH R 6 .   ? 72.992  48.584 13.864  1.00 107.81 ? 2436 HOH A O   1 
HETATM 9021  O  O   . HOH R 6 .   ? 90.088  49.979 20.064  1.00 66.23  ? 2437 HOH A O   1 
HETATM 9022  O  O   . HOH R 6 .   ? 66.960  65.946 18.779  1.00 52.95  ? 2438 HOH A O   1 
HETATM 9023  O  O   . HOH R 6 .   ? 67.555  61.956 17.634  1.00 49.73  ? 2439 HOH A O   1 
HETATM 9024  O  O   . HOH R 6 .   ? 71.703  66.950 19.864  1.00 58.52  ? 2440 HOH A O   1 
HETATM 9025  O  O   . HOH R 6 .   ? 70.085  64.453 14.034  1.00 50.24  ? 2441 HOH A O   1 
HETATM 9026  O  O   . HOH R 6 .   ? 69.412  67.853 18.251  1.00 60.38  ? 2442 HOH A O   1 
HETATM 9027  O  O   . HOH R 6 .   ? 65.590  62.390 22.904  1.00 50.91  ? 2443 HOH A O   1 
HETATM 9028  O  O   . HOH R 6 .   ? 64.875  63.844 16.667  1.00 60.55  ? 2444 HOH A O   1 
HETATM 9029  O  O   . HOH R 6 .   ? 64.230  61.577 20.950  1.00 71.87  ? 2445 HOH A O   1 
HETATM 9030  O  O   . HOH R 6 .   ? 62.530  63.145 18.341  1.00 66.40  ? 2446 HOH A O   1 
HETATM 9031  O  O   . HOH R 6 .   ? 60.799  59.324 17.217  1.00 72.60  ? 2447 HOH A O   1 
HETATM 9032  O  O   . HOH R 6 .   ? 63.104  57.544 17.787  1.00 62.61  ? 2448 HOH A O   1 
HETATM 9033  O  O   . HOH R 6 .   ? 70.765  54.337 12.396  1.00 34.79  ? 2449 HOH A O   1 
HETATM 9034  O  O   . HOH R 6 .   ? 68.671  51.469 15.740  1.00 96.52  ? 2450 HOH A O   1 
HETATM 9035  O  O   . HOH R 6 .   ? 62.417  46.152 23.226  1.00 53.83  ? 2451 HOH A O   1 
HETATM 9036  O  O   . HOH R 6 .   ? 62.651  44.278 18.784  1.00 63.49  ? 2452 HOH A O   1 
HETATM 9037  O  O   . HOH R 6 .   ? 67.898  47.178 18.584  1.00 93.17  ? 2453 HOH A O   1 
HETATM 9038  O  O   . HOH R 6 .   ? 85.278  44.245 26.663  1.00 29.91  ? 2454 HOH A O   1 
HETATM 9039  O  O   . HOH R 6 .   ? 88.694  49.425 28.088  1.00 94.16  ? 2455 HOH A O   1 
HETATM 9040  O  O   . HOH R 6 .   ? 80.433  51.602 29.445  1.00 75.62  ? 2456 HOH A O   1 
HETATM 9041  O  O   . HOH R 6 .   ? 84.065  61.723 29.657  1.00 35.06  ? 2457 HOH A O   1 
HETATM 9042  O  O   . HOH R 6 .   ? 78.720  59.985 31.275  1.00 109.31 ? 2458 HOH A O   1 
HETATM 9043  O  O   . HOH R 6 .   ? 82.526  58.431 36.369  1.00 49.99  ? 2459 HOH A O   1 
HETATM 9044  O  O   . HOH R 6 .   ? 92.114  62.004 26.957  1.00 23.06  ? 2460 HOH A O   1 
HETATM 9045  O  O   . HOH R 6 .   ? 90.209  64.372 29.832  1.00 33.91  ? 2461 HOH A O   1 
HETATM 9046  O  O   . HOH R 6 .   ? 87.161  64.590 32.242  1.00 48.59  ? 2462 HOH A O   1 
HETATM 9047  O  O   . HOH R 6 .   ? 89.288  63.450 27.747  1.00 80.25  ? 2463 HOH A O   1 
HETATM 9048  O  O   . HOH R 6 .   ? 83.184  65.069 30.879  1.00 43.40  ? 2464 HOH A O   1 
HETATM 9049  O  O   . HOH R 6 .   ? 84.111  68.631 31.112  1.00 65.72  ? 2465 HOH A O   1 
HETATM 9050  O  O   . HOH R 6 .   ? 89.159  68.753 30.832  1.00 38.34  ? 2466 HOH A O   1 
HETATM 9051  O  O   . HOH R 6 .   ? 84.771  71.953 24.519  1.00 70.56  ? 2467 HOH A O   1 
HETATM 9052  O  O   . HOH R 6 .   ? 85.285  75.434 30.209  1.00 35.65  ? 2468 HOH A O   1 
HETATM 9053  O  O   . HOH R 6 .   ? 91.174  77.773 27.658  1.00 48.23  ? 2469 HOH A O   1 
HETATM 9054  O  O   . HOH R 6 .   ? 93.887  73.038 28.962  1.00 56.01  ? 2470 HOH A O   1 
HETATM 9055  O  O   . HOH R 6 .   ? 92.289  74.180 30.809  1.00 40.91  ? 2471 HOH A O   1 
HETATM 9056  O  O   . HOH R 6 .   ? 90.979  71.173 20.855  1.00 28.74  ? 2472 HOH A O   1 
HETATM 9057  O  O   . HOH R 6 .   ? 86.243  78.161 24.710  1.00 60.74  ? 2473 HOH A O   1 
HETATM 9058  O  O   . HOH R 6 .   ? 92.149  81.390 23.068  1.00 49.44  ? 2474 HOH A O   1 
HETATM 9059  O  O   . HOH R 6 .   ? 97.035  77.382 25.420  1.00 45.21  ? 2475 HOH A O   1 
HETATM 9060  O  O   . HOH R 6 .   ? 100.659 71.751 27.338  1.00 59.58  ? 2476 HOH A O   1 
HETATM 9061  O  O   . HOH R 6 .   ? 95.042  64.864 30.731  1.00 52.67  ? 2477 HOH A O   1 
HETATM 9062  O  O   . HOH R 6 .   ? 92.878  64.416 28.670  1.00 32.71  ? 2478 HOH A O   1 
HETATM 9063  O  O   . HOH R 6 .   ? 93.265  67.985 30.751  1.00 53.48  ? 2479 HOH A O   1 
HETATM 9064  O  O   . HOH R 6 .   ? 103.524 72.019 24.059  1.00 39.95  ? 2480 HOH A O   1 
HETATM 9065  O  O   . HOH R 6 .   ? 104.987 75.522 23.505  1.00 53.50  ? 2481 HOH A O   1 
HETATM 9066  O  O   . HOH R 6 .   ? 98.523  82.820 23.681  1.00 46.54  ? 2482 HOH A O   1 
HETATM 9067  O  O   . HOH R 6 .   ? 101.868 82.778 22.499  1.00 52.61  ? 2483 HOH A O   1 
HETATM 9068  O  O   . HOH R 6 .   ? 107.789 75.292 18.150  1.00 65.86  ? 2484 HOH A O   1 
HETATM 9069  O  O   . HOH R 6 .   ? 101.990 77.162 12.280  1.00 68.86  ? 2485 HOH A O   1 
HETATM 9070  O  O   . HOH R 6 .   ? 105.289 79.886 18.164  1.00 55.82  ? 2486 HOH A O   1 
HETATM 9071  O  O   . HOH R 6 .   ? 105.433 81.723 15.188  1.00 55.54  ? 2487 HOH A O   1 
HETATM 9072  O  O   . HOH R 6 .   ? 103.441 78.786 10.543  1.00 69.20  ? 2488 HOH A O   1 
HETATM 9073  O  O   . HOH R 6 .   ? 110.814 77.174 15.320  1.00 69.74  ? 2489 HOH A O   1 
HETATM 9074  O  O   . HOH R 6 .   ? 107.142 81.157 13.383  1.00 67.54  ? 2490 HOH A O   1 
HETATM 9075  O  O   . HOH R 6 .   ? 108.094 77.912 18.005  1.00 77.56  ? 2491 HOH A O   1 
HETATM 9076  O  O   . HOH R 6 .   ? 102.889 80.514 17.622  1.00 37.95  ? 2492 HOH A O   1 
HETATM 9077  O  O   . HOH R 6 .   ? 99.905  81.914 11.457  1.00 59.51  ? 2493 HOH A O   1 
HETATM 9078  O  O   . HOH R 6 .   ? 101.242 86.272 10.353  1.00 58.63  ? 2494 HOH A O   1 
HETATM 9079  O  O   . HOH R 6 .   ? 95.384  81.727 19.519  1.00 92.19  ? 2495 HOH A O   1 
HETATM 9080  O  O   . HOH R 6 .   ? 99.145  89.767 20.377  1.00 70.19  ? 2496 HOH A O   1 
HETATM 9081  O  O   . HOH R 6 .   ? 98.544  86.471 19.951  1.00 60.93  ? 2497 HOH A O   1 
HETATM 9082  O  O   . HOH R 6 .   ? 89.211  84.475 18.016  1.00 50.55  ? 2498 HOH A O   1 
HETATM 9083  O  O   . HOH R 6 .   ? 87.819  84.372 15.824  1.00 46.30  ? 2499 HOH A O   1 
HETATM 9084  O  O   . HOH R 6 .   ? 88.019  85.485 13.655  1.00 83.90  ? 2500 HOH A O   1 
HETATM 9085  O  O   . HOH R 6 .   ? 97.371  81.828 10.194  1.00 71.22  ? 2501 HOH A O   1 
HETATM 9086  O  O   . HOH R 6 .   ? 95.308  90.346 11.753  1.00 79.64  ? 2502 HOH A O   1 
HETATM 9087  O  O   . HOH R 6 .   ? 95.495  85.115 10.103  1.00 73.66  ? 2503 HOH A O   1 
HETATM 9088  O  O   . HOH R 6 .   ? 93.025  82.970 5.728   1.00 94.27  ? 2504 HOH A O   1 
HETATM 9089  O  O   . HOH R 6 .   ? 90.463  80.763 4.656   1.00 66.09  ? 2505 HOH A O   1 
HETATM 9090  O  O   . HOH R 6 .   ? 89.945  78.337 6.127   1.00 78.74  ? 2506 HOH A O   1 
HETATM 9091  O  O   . HOH R 6 .   ? 96.581  74.317 0.997   1.00 60.43  ? 2507 HOH A O   1 
HETATM 9092  O  O   . HOH R 6 .   ? 93.911  80.916 4.261   1.00 62.77  ? 2508 HOH A O   1 
HETATM 9093  O  O   . HOH R 6 .   ? 92.407  78.823 5.171   1.00 57.70  ? 2509 HOH A O   1 
HETATM 9094  O  O   . HOH R 6 .   ? 102.861 76.374 6.104   1.00 70.89  ? 2510 HOH A O   1 
HETATM 9095  O  O   . HOH R 6 .   ? 97.004  71.014 3.422   1.00 58.17  ? 2511 HOH A O   1 
HETATM 9096  O  O   . HOH R 6 .   ? 105.179 67.557 -1.057  1.00 73.74  ? 2512 HOH A O   1 
HETATM 9097  O  O   . HOH R 6 .   ? 106.462 68.334 5.550   1.00 66.63  ? 2513 HOH A O   1 
HETATM 9098  O  O   . HOH R 6 .   ? 103.634 60.709 13.827  1.00 37.09  ? 2514 HOH A O   1 
HETATM 9099  O  O   . HOH R 6 .   ? 100.186 61.225 7.129   1.00 50.46  ? 2515 HOH A O   1 
HETATM 9100  O  O   . HOH R 6 .   ? 101.335 64.211 5.283   1.00 52.97  ? 2516 HOH A O   1 
HETATM 9101  O  O   . HOH R 6 .   ? 105.095 65.864 6.610   1.00 64.91  ? 2517 HOH A O   1 
HETATM 9102  O  O   . HOH R 6 .   ? 105.044 69.309 12.500  1.00 32.47  ? 2518 HOH A O   1 
HETATM 9103  O  O   . HOH R 6 .   ? 103.145 73.663 5.471   1.00 51.15  ? 2519 HOH A O   1 
HETATM 9104  O  O   . HOH R 6 .   ? 105.849 71.427 10.631  1.00 48.81  ? 2520 HOH A O   1 
HETATM 9105  O  O   . HOH R 6 .   ? 100.619 61.589 16.269  1.00 64.14  ? 2521 HOH A O   1 
HETATM 9106  O  O   . HOH R 6 .   ? 103.395 61.402 16.483  1.00 55.42  ? 2522 HOH A O   1 
HETATM 9107  O  O   . HOH R 6 .   ? 106.692 61.458 13.714  1.00 52.74  ? 2523 HOH A O   1 
HETATM 9108  O  O   . HOH R 6 .   ? 103.800 64.678 19.295  1.00 47.08  ? 2524 HOH A O   1 
HETATM 9109  O  O   . HOH R 6 .   ? 94.444  63.173 19.648  1.00 25.11  ? 2525 HOH A O   1 
HETATM 9110  O  O   . HOH R 6 .   ? 96.475  60.875 15.557  1.00 23.05  ? 2526 HOH A O   1 
HETATM 9111  O  O   . HOH R 6 .   ? 96.307  61.819 21.280  1.00 53.34  ? 2527 HOH A O   1 
HETATM 9112  O  O   . HOH R 6 .   ? 95.837  64.780 15.264  1.00 34.93  ? 2528 HOH A O   1 
HETATM 9113  O  O   . HOH R 6 .   ? 103.045 63.708 25.519  1.00 71.52  ? 2529 HOH A O   1 
HETATM 9114  O  O   . HOH R 6 .   ? 103.093 70.464 26.734  1.00 85.52  ? 2530 HOH A O   1 
HETATM 9115  O  O   . HOH R 6 .   ? 105.676 64.520 22.637  1.00 73.47  ? 2531 HOH A O   1 
HETATM 9116  O  O   . HOH R 6 .   ? 102.635 66.853 27.139  1.00 58.15  ? 2532 HOH A O   1 
HETATM 9117  O  O   . HOH R 6 .   ? 101.755 62.816 36.163  1.00 42.97  ? 2533 HOH A O   1 
HETATM 9118  O  O   . HOH R 6 .   ? 106.694 67.475 31.217  1.00 76.92  ? 2534 HOH A O   1 
HETATM 9119  O  O   . HOH R 6 .   ? 97.847  64.555 30.658  1.00 36.07  ? 2535 HOH A O   1 
HETATM 9120  O  O   . HOH R 6 .   ? 100.581 62.672 29.087  1.00 70.16  ? 2536 HOH A O   1 
HETATM 9121  O  O   . HOH R 6 .   ? 102.550 61.706 28.107  1.00 41.19  ? 2537 HOH A O   1 
HETATM 9122  O  O   . HOH R 6 .   ? 101.790 59.207 27.207  1.00 68.86  ? 2538 HOH A O   1 
HETATM 9123  O  O   . HOH R 6 .   ? 102.959 56.878 28.194  1.00 82.31  ? 2539 HOH A O   1 
HETATM 9124  O  O   . HOH R 6 .   ? 98.841  59.809 28.128  1.00 34.31  ? 2540 HOH A O   1 
HETATM 9125  O  O   . HOH R 6 .   ? 98.929  55.818 26.998  1.00 31.72  ? 2541 HOH A O   1 
HETATM 9126  O  O   . HOH R 6 .   ? 99.276  58.026 25.572  1.00 59.90  ? 2542 HOH A O   1 
HETATM 9127  O  O   . HOH R 6 .   ? 93.978  63.208 33.781  1.00 58.91  ? 2543 HOH A O   1 
HETATM 9128  O  O   . HOH R 6 .   ? 96.410  66.936 24.936  1.00 103.97 ? 2544 HOH A O   1 
HETATM 9129  O  O   . HOH R 6 .   ? 91.291  69.031 22.974  1.00 34.89  ? 2545 HOH A O   1 
HETATM 9130  O  O   . HOH R 6 .   ? 88.963  68.279 22.070  1.00 29.54  ? 2546 HOH A O   1 
HETATM 9131  O  O   . HOH R 6 .   ? 82.760  72.307 29.165  1.00 34.62  ? 2547 HOH A O   1 
HETATM 9132  O  O   . HOH R 6 .   ? 83.860  66.645 26.804  1.00 97.44  ? 2548 HOH A O   1 
HETATM 9133  O  O   . HOH R 6 .   ? 80.387  74.809 25.539  1.00 72.34  ? 2549 HOH A O   1 
HETATM 9134  O  O   . HOH R 6 .   ? 76.675  75.850 25.298  1.00 69.99  ? 2550 HOH A O   1 
HETATM 9135  O  O   . HOH R 6 .   ? 80.264  72.302 19.210  1.00 64.87  ? 2551 HOH A O   1 
HETATM 9136  O  O   . HOH R 6 .   ? 79.065  73.803 20.915  1.00 90.36  ? 2552 HOH A O   1 
HETATM 9137  O  O   . HOH R 6 .   ? 75.370  75.231 22.877  1.00 76.11  ? 2553 HOH A O   1 
HETATM 9138  O  O   . HOH R 6 .   ? 73.768  75.399 26.090  1.00 58.64  ? 2554 HOH A O   1 
HETATM 9139  O  O   . HOH R 6 .   ? 72.609  72.244 15.735  1.00 64.37  ? 2555 HOH A O   1 
HETATM 9140  O  O   . HOH R 6 .   ? 75.115  75.389 15.796  1.00 62.37  ? 2556 HOH A O   1 
HETATM 9141  O  O   . HOH R 6 .   ? 72.550  74.158 17.565  1.00 72.57  ? 2557 HOH A O   1 
HETATM 9142  O  O   . HOH R 6 .   ? 74.907  73.209 29.805  1.00 75.77  ? 2558 HOH A O   1 
HETATM 9143  O  O   . HOH R 6 .   ? 70.943  67.713 30.673  1.00 77.17  ? 2559 HOH A O   1 
HETATM 9144  O  O   . HOH R 6 .   ? 76.338  71.221 33.819  1.00 58.44  ? 2560 HOH A O   1 
HETATM 9145  O  O   . HOH R 6 .   ? 77.823  66.915 37.590  1.00 92.31  ? 2561 HOH A O   1 
HETATM 9146  O  O   . HOH R 6 .   ? 81.185  66.248 31.920  1.00 32.96  ? 2562 HOH A O   1 
HETATM 9147  O  O   . HOH R 6 .   ? 80.199  61.454 40.678  1.00 65.95  ? 2563 HOH A O   1 
HETATM 9148  O  O   . HOH R 6 .   ? 80.349  65.275 34.231  1.00 38.17  ? 2564 HOH A O   1 
HETATM 9149  O  O   . HOH R 6 .   ? 73.060  65.664 38.960  1.00 60.25  ? 2565 HOH A O   1 
HETATM 9150  O  O   . HOH R 6 .   ? 69.824  67.001 32.738  1.00 52.61  ? 2566 HOH A O   1 
HETATM 9151  O  O   . HOH R 6 .   ? 64.225  60.408 33.112  1.00 67.26  ? 2567 HOH A O   1 
HETATM 9152  O  O   . HOH R 6 .   ? 64.049  62.098 31.126  1.00 66.03  ? 2568 HOH A O   1 
HETATM 9153  O  O   . HOH R 6 .   ? 68.421  68.086 26.425  1.00 51.33  ? 2569 HOH A O   1 
HETATM 9154  O  O   . HOH R 6 .   ? 65.356  63.724 27.628  1.00 58.24  ? 2570 HOH A O   1 
HETATM 9155  O  O   . HOH R 6 .   ? 66.754  65.697 25.760  1.00 46.38  ? 2571 HOH A O   1 
HETATM 9156  O  O   . HOH R 6 .   ? 64.668  53.941 19.074  1.00 51.94  ? 2572 HOH A O   1 
HETATM 9157  O  O   . HOH R 6 .   ? 64.077  55.075 22.047  1.00 59.40  ? 2573 HOH A O   1 
HETATM 9158  O  O   . HOH R 6 .   ? 64.490  57.535 21.435  1.00 68.18  ? 2574 HOH A O   1 
HETATM 9159  O  O   . HOH R 6 .   ? 63.004  58.784 27.157  1.00 66.94  ? 2575 HOH A O   1 
HETATM 9160  O  O   . HOH R 6 .   ? 64.314  57.610 25.142  1.00 39.31  ? 2576 HOH A O   1 
HETATM 9161  O  O   . HOH R 6 .   ? 64.644  60.972 27.914  1.00 56.67  ? 2577 HOH A O   1 
HETATM 9162  O  O   . HOH R 6 .   ? 61.824  60.216 29.009  1.00 85.34  ? 2578 HOH A O   1 
HETATM 9163  O  O   . HOH R 6 .   ? 77.126  43.248 28.313  1.00 81.69  ? 2579 HOH A O   1 
HETATM 9164  O  O   . HOH R 6 .   ? 79.923  46.823 31.097  1.00 97.66  ? 2580 HOH A O   1 
HETATM 9165  O  O   . HOH R 6 .   ? 91.938  34.685 34.178  1.00 65.13  ? 2581 HOH A O   1 
HETATM 9166  O  O   . HOH R 6 .   ? 89.895  43.247 36.223  1.00 49.42  ? 2582 HOH A O   1 
HETATM 9167  O  O   . HOH R 6 .   ? 90.165  44.643 33.926  1.00 82.45  ? 2583 HOH A O   1 
HETATM 9168  O  O   . HOH R 6 .   ? 94.969  37.444 33.809  1.00 48.44  ? 2584 HOH A O   1 
HETATM 9169  O  O   . HOH R 6 .   ? 97.745  40.179 35.533  1.00 53.64  ? 2585 HOH A O   1 
HETATM 9170  O  O   . HOH R 6 .   ? 94.569  39.631 36.472  1.00 47.18  ? 2586 HOH A O   1 
HETATM 9171  O  O   . HOH R 6 .   ? 91.792  46.439 33.761  1.00 89.85  ? 2587 HOH A O   1 
HETATM 9172  O  O   . HOH R 6 .   ? 95.502  46.022 28.227  1.00 38.27  ? 2588 HOH A O   1 
HETATM 9173  O  O   . HOH R 6 .   ? 100.822 54.371 27.053  1.00 34.47  ? 2589 HOH A O   1 
HETATM 9174  O  O   . HOH R 6 .   ? 107.078 51.423 28.827  1.00 63.35  ? 2590 HOH A O   1 
HETATM 9175  O  O   . HOH R 6 .   ? 107.904 54.067 28.216  1.00 39.25  ? 2591 HOH A O   1 
HETATM 9176  O  O   . HOH R 6 .   ? 104.927 56.256 26.040  1.00 45.40  ? 2592 HOH A O   1 
HETATM 9177  O  O   . HOH R 6 .   ? 104.512 58.364 29.523  1.00 64.40  ? 2593 HOH A O   1 
HETATM 9178  O  O   . HOH R 6 .   ? 105.885 51.800 36.097  1.00 33.49  ? 2594 HOH A O   1 
HETATM 9179  O  O   . HOH R 6 .   ? 108.610 55.625 30.952  1.00 62.40  ? 2595 HOH A O   1 
HETATM 9180  O  O   . HOH R 6 .   ? 111.872 50.625 31.635  1.00 44.87  ? 2596 HOH A O   1 
HETATM 9181  O  O   . HOH R 6 .   ? 109.555 50.268 29.534  1.00 49.35  ? 2597 HOH A O   1 
HETATM 9182  O  O   . HOH R 6 .   ? 107.139 38.199 21.250  1.00 56.88  ? 2598 HOH A O   1 
HETATM 9183  O  O   . HOH R 6 .   ? 107.051 38.599 24.382  1.00 58.45  ? 2599 HOH A O   1 
HETATM 9184  O  O   . HOH R 6 .   ? 108.785 41.309 18.063  1.00 57.55  ? 2600 HOH A O   1 
HETATM 9185  O  O   . HOH R 6 .   ? 109.206 45.521 25.175  1.00 62.65  ? 2601 HOH A O   1 
HETATM 9186  O  O   . HOH R 6 .   ? 109.532 38.191 23.601  1.00 50.83  ? 2602 HOH A O   1 
HETATM 9187  O  O   . HOH R 6 .   ? 111.465 45.829 24.111  1.00 56.80  ? 2603 HOH A O   1 
HETATM 9188  O  O   . HOH R 6 .   ? 111.605 45.110 21.592  1.00 69.04  ? 2604 HOH A O   1 
HETATM 9189  O  O   . HOH R 6 .   ? 108.867 37.845 27.723  1.00 73.08  ? 2605 HOH A O   1 
HETATM 9190  O  O   . HOH R 6 .   ? 105.028 36.497 36.345  1.00 59.07  ? 2606 HOH A O   1 
HETATM 9191  O  O   . HOH R 6 .   ? 111.730 34.965 37.989  1.00 61.50  ? 2607 HOH A O   1 
HETATM 9192  O  O   . HOH R 6 .   ? 108.844 36.961 31.024  1.00 88.94  ? 2608 HOH A O   1 
HETATM 9193  O  O   . HOH R 6 .   ? 111.462 37.459 32.814  1.00 64.51  ? 2609 HOH A O   1 
HETATM 9194  O  O   . HOH R 6 .   ? 107.757 38.297 37.285  1.00 88.53  ? 2610 HOH A O   1 
HETATM 9195  O  O   . HOH R 6 .   ? 111.609 37.783 42.159  1.00 76.19  ? 2611 HOH A O   1 
HETATM 9196  O  O   . HOH R 6 .   ? 108.964 34.641 38.878  1.00 60.14  ? 2612 HOH A O   1 
HETATM 9197  O  O   . HOH R 6 .   ? 111.264 45.961 35.506  1.00 41.41  ? 2613 HOH A O   1 
HETATM 9198  O  O   . HOH R 6 .   ? 114.094 50.339 39.499  1.00 45.44  ? 2614 HOH A O   1 
HETATM 9199  O  O   . HOH R 6 .   ? 105.434 53.100 48.379  1.00 51.40  ? 2615 HOH A O   1 
HETATM 9200  O  O   . HOH R 6 .   ? 102.554 48.090 45.461  1.00 46.46  ? 2616 HOH A O   1 
HETATM 9201  O  O   . HOH R 6 .   ? 107.819 54.607 46.129  1.00 47.51  ? 2617 HOH A O   1 
HETATM 9202  O  O   . HOH R 6 .   ? 111.605 47.684 45.119  1.00 33.21  ? 2618 HOH A O   1 
HETATM 9203  O  O   . HOH R 6 .   ? 114.911 53.137 42.439  1.00 53.23  ? 2619 HOH A O   1 
HETATM 9204  O  O   . HOH R 6 .   ? 112.755 50.627 44.019  1.00 59.93  ? 2620 HOH A O   1 
HETATM 9205  O  O   . HOH R 6 .   ? 109.095 56.494 42.074  1.00 47.96  ? 2621 HOH A O   1 
HETATM 9206  O  O   . HOH R 6 .   ? 112.706 58.700 42.230  1.00 76.70  ? 2622 HOH A O   1 
HETATM 9207  O  O   . HOH R 6 .   ? 112.110 57.067 39.395  1.00 71.32  ? 2623 HOH A O   1 
HETATM 9208  O  O   . HOH R 6 .   ? 116.382 55.234 42.943  1.00 71.41  ? 2624 HOH A O   1 
HETATM 9209  O  O   . HOH R 6 .   ? 111.092 47.974 37.629  1.00 27.68  ? 2625 HOH A O   1 
HETATM 9210  O  O   . HOH R 6 .   ? 113.430 49.239 34.695  1.00 67.34  ? 2626 HOH A O   1 
HETATM 9211  O  O   . HOH R 6 .   ? 112.856 51.621 35.347  1.00 39.83  ? 2627 HOH A O   1 
HETATM 9212  O  O   . HOH R 6 .   ? 113.454 52.898 38.742  1.00 52.54  ? 2628 HOH A O   1 
HETATM 9213  O  O   . HOH R 6 .   ? 103.807 58.701 43.087  1.00 62.50  ? 2629 HOH A O   1 
HETATM 9214  O  O   . HOH R 6 .   ? 107.470 58.723 41.770  1.00 61.23  ? 2630 HOH A O   1 
HETATM 9215  O  O   . HOH R 6 .   ? 110.783 55.121 37.992  1.00 36.45  ? 2631 HOH A O   1 
HETATM 9216  O  O   . HOH R 6 .   ? 105.873 59.657 37.117  1.00 38.39  ? 2632 HOH A O   1 
HETATM 9217  O  O   . HOH R 6 .   ? 99.850  63.268 40.045  1.00 46.87  ? 2633 HOH A O   1 
HETATM 9218  O  O   . HOH R 6 .   ? 94.861  67.544 42.604  1.00 64.16  ? 2634 HOH A O   1 
HETATM 9219  O  O   . HOH R 6 .   ? 90.471  61.302 39.806  1.00 53.59  ? 2635 HOH A O   1 
HETATM 9220  O  O   . HOH R 6 .   ? 95.161  67.910 37.455  1.00 79.27  ? 2636 HOH A O   1 
HETATM 9221  O  O   . HOH R 6 .   ? 91.970  67.180 40.853  1.00 52.61  ? 2637 HOH A O   1 
HETATM 9222  O  O   . HOH R 6 .   ? 100.511 67.933 45.145  1.00 58.35  ? 2638 HOH A O   1 
HETATM 9223  O  O   . HOH R 6 .   ? 103.322 64.340 43.131  1.00 62.14  ? 2639 HOH A O   1 
HETATM 9224  O  O   . HOH R 6 .   ? 98.515  66.967 48.817  1.00 50.20  ? 2640 HOH A O   1 
HETATM 9225  O  O   . HOH R 6 .   ? 100.503 59.411 53.180  1.00 49.75  ? 2641 HOH A O   1 
HETATM 9226  O  O   . HOH R 6 .   ? 100.460 55.660 50.837  1.00 38.46  ? 2642 HOH A O   1 
HETATM 9227  O  O   . HOH R 6 .   ? 102.664 56.526 49.165  1.00 46.11  ? 2643 HOH A O   1 
HETATM 9228  O  O   . HOH R 6 .   ? 93.006  54.035 50.483  1.00 54.49  ? 2644 HOH A O   1 
HETATM 9229  O  O   . HOH R 6 .   ? 99.345  44.103 45.998  1.00 54.46  ? 2645 HOH A O   1 
HETATM 9230  O  O   . HOH R 6 .   ? 97.435  45.644 47.552  1.00 79.76  ? 2646 HOH A O   1 
HETATM 9231  O  O   . HOH R 6 .   ? 99.054  43.775 53.775  1.00 32.90  ? 2647 HOH A O   1 
HETATM 9232  O  O   . HOH R 6 .   ? 101.919 45.311 46.493  1.00 40.41  ? 2648 HOH A O   1 
HETATM 9233  O  O   . HOH R 6 .   ? 99.943  39.943 52.801  1.00 52.59  ? 2649 HOH A O   1 
HETATM 9234  O  O   . HOH R 6 .   ? 97.745  40.681 50.688  1.00 68.31  ? 2650 HOH A O   1 
HETATM 9235  O  O   . HOH R 6 .   ? 100.957 53.012 51.184  1.00 46.93  ? 2651 HOH A O   1 
HETATM 9236  O  O   . HOH R 6 .   ? 105.963 41.098 56.347  1.00 43.56  ? 2652 HOH A O   1 
HETATM 9237  O  O   . HOH R 6 .   ? 108.503 42.233 49.419  1.00 44.18  ? 2653 HOH A O   1 
HETATM 9238  O  O   . HOH R 6 .   ? 104.449 44.311 46.295  1.00 49.83  ? 2654 HOH A O   1 
HETATM 9239  O  O   . HOH R 6 .   ? 107.493 38.160 48.083  1.00 48.95  ? 2655 HOH A O   1 
HETATM 9240  O  O   . HOH R 6 .   ? 102.637 43.501 48.121  1.00 93.49  ? 2656 HOH A O   1 
HETATM 9241  O  O   . HOH R 6 .   ? 108.851 44.138 52.047  1.00 71.58  ? 2657 HOH A O   1 
HETATM 9242  O  O   . HOH R 6 .   ? 109.766 40.094 47.456  1.00 55.85  ? 2658 HOH A O   1 
HETATM 9243  O  O   . HOH R 6 .   ? 111.387 49.261 49.002  1.00 49.28  ? 2659 HOH A O   1 
HETATM 9244  O  O   . HOH R 6 .   ? 112.221 43.751 50.970  1.00 59.61  ? 2660 HOH A O   1 
HETATM 9245  O  O   . HOH R 6 .   ? 108.431 38.672 43.063  1.00 55.47  ? 2661 HOH A O   1 
HETATM 9246  O  O   . HOH R 6 .   ? 103.631 36.936 44.130  1.00 59.35  ? 2662 HOH A O   1 
HETATM 9247  O  O   . HOH R 6 .   ? 110.510 40.159 43.124  1.00 38.86  ? 2663 HOH A O   1 
HETATM 9248  O  O   . HOH R 6 .   ? 110.869 42.990 42.651  1.00 54.88  ? 2664 HOH A O   1 
HETATM 9249  O  O   . HOH R 6 .   ? 100.456 36.599 48.959  1.00 56.06  ? 2665 HOH A O   1 
HETATM 9250  O  O   . HOH R 6 .   ? 99.079  43.865 43.609  1.00 40.99  ? 2666 HOH A O   1 
HETATM 9251  O  O   . HOH R 6 .   ? 101.952 39.101 42.729  1.00 89.34  ? 2667 HOH A O   1 
HETATM 9252  O  O   . HOH R 6 .   ? 99.592  41.455 43.057  1.00 89.74  ? 2668 HOH A O   1 
HETATM 9253  O  O   . HOH R 6 .   ? 102.606 36.307 36.898  1.00 47.19  ? 2669 HOH A O   1 
HETATM 9254  O  O   . HOH R 6 .   ? 99.776  42.664 35.323  1.00 48.92  ? 2670 HOH A O   1 
HETATM 9255  O  O   . HOH R 6 .   ? 99.637  39.203 41.952  1.00 57.15  ? 2671 HOH A O   1 
HETATM 9256  O  O   . HOH R 6 .   ? 100.324 37.581 38.339  1.00 52.34  ? 2672 HOH A O   1 
HETATM 9257  O  O   . HOH R 6 .   ? 96.369  42.556 37.443  1.00 70.83  ? 2673 HOH A O   1 
HETATM 9258  O  O   . HOH R 6 .   ? 98.534  43.096 33.089  1.00 57.58  ? 2674 HOH A O   1 
HETATM 9259  O  O   . HOH R 6 .   ? 94.118  46.198 34.438  1.00 53.60  ? 2675 HOH A O   1 
HETATM 9260  O  O   . HOH R 6 .   ? 94.013  43.609 36.099  1.00 54.85  ? 2676 HOH A O   1 
HETATM 9261  O  O   . HOH R 6 .   ? 95.272  40.679 38.766  1.00 59.27  ? 2677 HOH A O   1 
HETATM 9262  O  O   . HOH R 6 .   ? 95.965  41.552 41.095  1.00 47.55  ? 2678 HOH A O   1 
HETATM 9263  O  O   . HOH R 6 .   ? 91.324  45.324 37.221  1.00 29.81  ? 2679 HOH A O   1 
HETATM 9264  O  O   . HOH R 6 .   ? 91.780  47.259 36.140  1.00 77.54  ? 2680 HOH A O   1 
HETATM 9265  O  O   . HOH R 6 .   ? 87.921  56.836 37.701  1.00 37.61  ? 2681 HOH A O   1 
HETATM 9266  O  O   . HOH R 6 .   ? 95.853  56.444 33.468  1.00 31.59  ? 2682 HOH A O   1 
HETATM 9267  O  O   . HOH R 6 .   ? 84.812  52.573 30.535  1.00 39.62  ? 2683 HOH A O   1 
HETATM 9268  O  O   . HOH R 6 .   ? 78.952  54.709 41.502  1.00 38.79  ? 2684 HOH A O   1 
HETATM 9269  O  O   . HOH R 6 .   ? 72.728  50.060 41.691  1.00 52.09  ? 2685 HOH A O   1 
HETATM 9270  O  O   . HOH R 6 .   ? 79.816  49.720 41.476  1.00 42.04  ? 2686 HOH A O   1 
HETATM 9271  O  O   . HOH R 6 .   ? 70.600  57.731 36.874  1.00 38.67  ? 2687 HOH A O   1 
HETATM 9272  O  O   . HOH R 6 .   ? 67.219  48.890 34.351  1.00 33.39  ? 2688 HOH A O   1 
HETATM 9273  O  O   . HOH R 6 .   ? 62.254  55.570 37.396  1.00 49.22  ? 2689 HOH A O   1 
HETATM 9274  O  O   . HOH R 6 .   ? 66.315  55.249 41.325  1.00 73.38  ? 2690 HOH A O   1 
HETATM 9275  O  O   . HOH R 6 .   ? 62.656  52.774 30.876  1.00 43.20  ? 2691 HOH A O   1 
HETATM 9276  O  O   . HOH R 6 .   ? 62.068  49.924 32.030  1.00 45.50  ? 2692 HOH A O   1 
HETATM 9277  O  O   . HOH R 6 .   ? 64.065  44.479 28.959  1.00 39.57  ? 2693 HOH A O   1 
HETATM 9278  O  O   . HOH R 6 .   ? 60.467  51.229 26.737  1.00 66.61  ? 2694 HOH A O   1 
HETATM 9279  O  O   . HOH R 6 .   ? 68.535  49.292 32.201  1.00 31.27  ? 2695 HOH A O   1 
HETATM 9280  O  O   . HOH R 6 .   ? 65.533  42.456 28.334  1.00 38.22  ? 2696 HOH A O   1 
HETATM 9281  O  O   . HOH R 6 .   ? 66.262  38.519 30.956  1.00 39.79  ? 2697 HOH A O   1 
HETATM 9282  O  O   . HOH R 6 .   ? 88.931  36.324 36.849  1.00 38.92  ? 2698 HOH A O   1 
HETATM 9283  O  O   . HOH R 6 .   ? 89.880  30.945 30.978  1.00 64.51  ? 2699 HOH A O   1 
HETATM 9284  O  O   . HOH R 6 .   ? 90.795  35.952 24.274  1.00 52.83  ? 2700 HOH A O   1 
HETATM 9285  O  O   . HOH R 6 .   ? 98.032  32.864 25.703  1.00 46.94  ? 2701 HOH A O   1 
HETATM 9286  O  O   . HOH R 6 .   ? 92.765  32.159 30.239  1.00 55.70  ? 2702 HOH A O   1 
HETATM 9287  O  O   . HOH R 6 .   ? 95.191  36.597 25.584  1.00 95.51  ? 2703 HOH A O   1 
HETATM 9288  O  O   . HOH R 6 .   ? 92.533  37.653 24.678  1.00 75.41  ? 2704 HOH A O   1 
HETATM 9289  O  O   . HOH R 6 .   ? 99.837  33.017 24.019  1.00 51.74  ? 2705 HOH A O   1 
HETATM 9290  O  O   . HOH R 6 .   ? 105.358 39.406 22.649  1.00 34.23  ? 2706 HOH A O   1 
HETATM 9291  O  O   . HOH R 6 .   ? 101.151 29.362 31.912  1.00 72.35  ? 2707 HOH A O   1 
HETATM 9292  O  O   . HOH R 6 .   ? 104.685 35.290 28.037  1.00 68.08  ? 2708 HOH A O   1 
HETATM 9293  O  O   . HOH R 6 .   ? 103.853 29.282 31.768  1.00 68.05  ? 2709 HOH A O   1 
HETATM 9294  O  O   . HOH R 6 .   ? 104.972 37.364 30.941  1.00 44.21  ? 2710 HOH A O   1 
HETATM 9295  O  O   . HOH R 6 .   ? 94.789  39.187 25.922  1.00 38.41  ? 2711 HOH A O   1 
HETATM 9296  O  O   . HOH R 6 .   ? 94.507  46.928 24.324  1.00 62.97  ? 2712 HOH A O   1 
HETATM 9297  O  O   . HOH R 6 .   ? 90.497  41.415 18.933  1.00 49.90  ? 2713 HOH A O   1 
HETATM 9298  O  O   . HOH R 6 .   ? 97.787  40.387 18.234  1.00 77.51  ? 2714 HOH A O   1 
HETATM 9299  O  O   . HOH R 6 .   ? 88.078  45.551 25.229  1.00 37.33  ? 2715 HOH A O   1 
HETATM 9300  O  O   . HOH R 6 .   ? 94.732  36.321 19.401  1.00 38.19  ? 2716 HOH A O   1 
HETATM 9301  O  O   . HOH R 6 .   ? 91.931  36.944 22.120  1.00 56.55  ? 2717 HOH A O   1 
HETATM 9302  O  O   . HOH R 6 .   ? 94.705  39.166 17.105  1.00 46.86  ? 2718 HOH A O   1 
HETATM 9303  O  O   . HOH R 6 .   ? 93.063  38.069 15.452  1.00 62.54  ? 2719 HOH A O   1 
HETATM 9304  O  O   . HOH R 6 .   ? 82.691  38.864 11.310  1.00 31.71  ? 2720 HOH A O   1 
HETATM 9305  O  O   . HOH R 6 .   ? 90.377  28.646 14.706  1.00 48.29  ? 2721 HOH A O   1 
HETATM 9306  O  O   . HOH R 6 .   ? 88.214  27.305 14.193  1.00 87.28  ? 2722 HOH A O   1 
HETATM 9307  O  O   . HOH R 6 .   ? 84.057  27.166 11.351  1.00 56.15  ? 2723 HOH A O   1 
HETATM 9308  O  O   . HOH R 6 .   ? 88.108  22.578 12.791  1.00 72.55  ? 2724 HOH A O   1 
HETATM 9309  O  O   . HOH R 6 .   ? 91.400  24.798 12.742  1.00 81.48  ? 2725 HOH A O   1 
HETATM 9310  O  O   . HOH R 6 .   ? 86.471  25.280 8.664   1.00 67.01  ? 2726 HOH A O   1 
HETATM 9311  O  O   . HOH R 6 .   ? 89.063  30.189 5.695   1.00 66.08  ? 2727 HOH A O   1 
HETATM 9312  O  O   . HOH R 6 .   ? 97.665  24.331 11.746  1.00 78.69  ? 2728 HOH A O   1 
HETATM 9313  O  O   . HOH R 6 .   ? 95.329  24.529 15.619  1.00 89.24  ? 2729 HOH A O   1 
HETATM 9314  O  O   . HOH R 6 .   ? 98.931  26.740 11.912  1.00 54.34  ? 2730 HOH A O   1 
HETATM 9315  O  O   . HOH R 6 .   ? 96.332  28.354 19.507  1.00 56.18  ? 2731 HOH A O   1 
HETATM 9316  O  O   . HOH R 6 .   ? 99.220  29.314 11.238  1.00 64.29  ? 2732 HOH A O   1 
HETATM 9317  O  O   . HOH R 6 .   ? 93.095  23.379 16.762  1.00 65.42  ? 2733 HOH A O   1 
HETATM 9318  O  O   . HOH R 6 .   ? 94.228  25.409 17.955  1.00 70.40  ? 2734 HOH A O   1 
HETATM 9319  O  O   . HOH R 6 .   ? 89.509  25.678 15.671  1.00 60.10  ? 2735 HOH A O   1 
HETATM 9320  O  O   . HOH R 6 .   ? 93.018  25.518 14.766  1.00 83.10  ? 2736 HOH A O   1 
HETATM 9321  O  O   . HOH R 6 .   ? 84.179  24.164 18.623  1.00 57.77  ? 2737 HOH A O   1 
HETATM 9322  O  O   . HOH R 6 .   ? 83.873  27.586 25.220  1.00 31.40  ? 2738 HOH A O   1 
HETATM 9323  O  O   . HOH R 6 .   ? 88.388  19.917 21.658  1.00 68.92  ? 2739 HOH A O   1 
HETATM 9324  O  O   . HOH R 6 .   ? 88.361  29.418 18.677  1.00 106.71 ? 2740 HOH A O   1 
HETATM 9325  O  O   . HOH R 6 .   ? 80.491  27.481 24.561  1.00 44.69  ? 2741 HOH A O   1 
HETATM 9326  O  O   . HOH R 6 .   ? 76.811  29.498 15.548  1.00 34.02  ? 2742 HOH A O   1 
HETATM 9327  O  O   . HOH R 6 .   ? 77.202  25.861 12.213  1.00 71.87  ? 2743 HOH A O   1 
HETATM 9328  O  O   . HOH R 6 .   ? 81.779  28.944 26.051  1.00 49.84  ? 2744 HOH A O   1 
HETATM 9329  O  O   . HOH R 6 .   ? 74.816  32.324 22.743  1.00 35.01  ? 2745 HOH A O   1 
HETATM 9330  O  O   . HOH R 6 .   ? 76.896  28.994 19.937  1.00 42.31  ? 2746 HOH A O   1 
HETATM 9331  O  O   . HOH R 6 .   ? 77.529  28.609 28.868  1.00 46.82  ? 2747 HOH A O   1 
HETATM 9332  O  O   . HOH R 6 .   ? 68.617  34.371 15.454  1.00 62.54  ? 2748 HOH A O   1 
HETATM 9333  O  O   . HOH R 6 .   ? 63.520  41.117 15.463  1.00 65.20  ? 2749 HOH A O   1 
HETATM 9334  O  O   . HOH R 6 .   ? 68.631  35.212 13.091  1.00 65.04  ? 2750 HOH A O   1 
HETATM 9335  O  O   . HOH R 6 .   ? 65.726  35.348 29.871  1.00 39.29  ? 2751 HOH A O   1 
HETATM 9336  O  O   . HOH R 6 .   ? 62.608  39.658 26.563  1.00 59.99  ? 2752 HOH A O   1 
HETATM 9337  O  O   . HOH R 6 .   ? 71.873  33.187 23.066  1.00 53.43  ? 2753 HOH A O   1 
HETATM 9338  O  O   . HOH R 6 .   ? 71.212  32.169 26.809  1.00 50.64  ? 2754 HOH A O   1 
HETATM 9339  O  O   . HOH R 6 .   ? 65.340  36.555 23.092  1.00 51.04  ? 2755 HOH A O   1 
HETATM 9340  O  O   . HOH R 6 .   ? 68.006  35.013 32.051  1.00 87.78  ? 2756 HOH A O   1 
HETATM 9341  O  O   . HOH R 6 .   ? 67.078  29.121 18.197  1.00 68.46  ? 2757 HOH A O   1 
HETATM 9342  O  O   . HOH R 6 .   ? 68.218  31.316 16.481  1.00 72.28  ? 2758 HOH A O   1 
HETATM 9343  O  O   . HOH R 6 .   ? 67.450  29.008 26.223  1.00 75.64  ? 2759 HOH A O   1 
HETATM 9344  O  O   . HOH R 6 .   ? 63.886  27.211 24.092  1.00 78.76  ? 2760 HOH A O   1 
HETATM 9345  O  O   . HOH R 6 .   ? 63.957  30.004 22.225  1.00 63.11  ? 2761 HOH A O   1 
HETATM 9346  O  O   . HOH R 6 .   ? 64.134  28.184 26.666  1.00 68.30  ? 2762 HOH A O   1 
HETATM 9347  O  O   . HOH R 6 .   ? 63.829  34.306 25.965  1.00 64.15  ? 2763 HOH A O   1 
HETATM 9348  O  O   . HOH R 6 .   ? 66.050  27.116 25.356  1.00 59.19  ? 2764 HOH A O   1 
HETATM 9349  O  O   . HOH R 6 .   ? 70.075  27.625 28.520  1.00 62.05  ? 2765 HOH A O   1 
HETATM 9350  O  O   . HOH R 6 .   ? 72.331  27.280 27.565  1.00 50.32  ? 2766 HOH A O   1 
HETATM 9351  O  O   . HOH R 6 .   ? 69.367  28.065 30.960  1.00 77.59  ? 2767 HOH A O   1 
HETATM 9352  O  O   . HOH R 6 .   ? 63.363  31.269 27.523  1.00 58.14  ? 2768 HOH A O   1 
HETATM 9353  O  O   . HOH R 6 .   ? 70.442  29.246 34.017  1.00 67.29  ? 2769 HOH A O   1 
HETATM 9354  O  O   . HOH R 6 .   ? 70.862  32.728 35.920  1.00 58.08  ? 2770 HOH A O   1 
HETATM 9355  O  O   . HOH R 6 .   ? 65.298  33.936 27.927  1.00 88.23  ? 2771 HOH A O   1 
HETATM 9356  O  O   . HOH R 6 .   ? 69.646  38.778 37.065  1.00 70.59  ? 2772 HOH A O   1 
HETATM 9357  O  O   . HOH R 6 .   ? 68.089  46.164 34.134  1.00 31.63  ? 2773 HOH A O   1 
HETATM 9358  O  O   . HOH R 6 .   ? 70.657  41.789 38.985  1.00 42.30  ? 2774 HOH A O   1 
HETATM 9359  O  O   . HOH R 6 .   ? 68.187  41.260 40.266  1.00 81.36  ? 2775 HOH A O   1 
HETATM 9360  O  O   . HOH R 6 .   ? 71.297  50.811 39.518  1.00 43.64  ? 2776 HOH A O   1 
HETATM 9361  O  O   . HOH R 6 .   ? 66.551  45.970 41.633  1.00 52.03  ? 2777 HOH A O   1 
HETATM 9362  O  O   . HOH R 6 .   ? 67.798  47.923 48.627  1.00 65.70  ? 2778 HOH A O   1 
HETATM 9363  O  O   . HOH R 6 .   ? 68.845  35.472 43.648  1.00 58.10  ? 2779 HOH A O   1 
HETATM 9364  O  O   . HOH R 6 .   ? 68.743  38.881 39.723  1.00 49.03  ? 2780 HOH A O   1 
HETATM 9365  O  O   . HOH R 6 .   ? 68.952  41.087 46.295  1.00 83.98  ? 2781 HOH A O   1 
HETATM 9366  O  O   . HOH R 6 .   ? 77.858  42.257 39.701  1.00 100.82 ? 2782 HOH A O   1 
HETATM 9367  O  O   . HOH R 6 .   ? 77.612  47.007 40.598  1.00 25.04  ? 2783 HOH A O   1 
HETATM 9368  O  O   . HOH R 6 .   ? 77.673  44.595 39.253  1.00 29.38  ? 2784 HOH A O   1 
HETATM 9369  O  O   . HOH R 6 .   ? 71.975  34.177 40.909  1.00 49.87  ? 2785 HOH A O   1 
HETATM 9370  O  O   . HOH R 6 .   ? 70.619  34.463 38.825  1.00 47.18  ? 2786 HOH A O   1 
HETATM 9371  O  O   . HOH R 6 .   ? 68.445  36.646 38.535  1.00 43.84  ? 2787 HOH A O   1 
HETATM 9372  O  O   . HOH R 6 .   ? 74.116  41.126 33.838  1.00 32.47  ? 2788 HOH A O   1 
HETATM 9373  O  O   . HOH R 6 .   ? 79.109  32.335 31.112  1.00 76.46  ? 2789 HOH A O   1 
HETATM 9374  O  O   . HOH R 6 .   ? 84.443  36.585 38.064  1.00 51.75  ? 2790 HOH A O   1 
HETATM 9375  O  O   . HOH R 6 .   ? 83.091  31.848 35.480  1.00 51.67  ? 2791 HOH A O   1 
HETATM 9376  O  O   . HOH R 6 .   ? 81.675  31.608 30.393  1.00 51.57  ? 2792 HOH A O   1 
HETATM 9377  O  O   . HOH R 6 .   ? 82.352  24.088 29.595  1.00 87.42  ? 2793 HOH A O   1 
HETATM 9378  O  O   . HOH R 6 .   ? 81.488  25.548 27.739  1.00 47.84  ? 2794 HOH A O   1 
HETATM 9379  O  O   . HOH R 6 .   ? 87.988  30.356 29.169  1.00 38.44  ? 2795 HOH A O   1 
HETATM 9380  O  O   . HOH R 6 .   ? 87.479  24.663 29.307  1.00 65.72  ? 2796 HOH A O   1 
HETATM 9381  O  O   . HOH R 6 .   ? 81.536  28.235 28.416  1.00 74.13  ? 2797 HOH A O   1 
HETATM 9382  O  O   . HOH R 6 .   ? 86.157  27.193 37.711  1.00 77.82  ? 2798 HOH A O   1 
HETATM 9383  O  O   . HOH R 6 .   ? 79.555  26.634 29.060  1.00 97.71  ? 2799 HOH A O   1 
HETATM 9384  O  O   . HOH R 6 .   ? 81.557  31.755 33.479  1.00 53.00  ? 2800 HOH A O   1 
HETATM 9385  O  O   . HOH R 6 .   ? 77.222  29.181 41.310  1.00 73.72  ? 2801 HOH A O   1 
HETATM 9386  O  O   . HOH R 6 .   ? 76.722  30.627 38.241  1.00 85.29  ? 2802 HOH A O   1 
HETATM 9387  O  O   . HOH R 6 .   ? 74.707  33.579 41.940  1.00 63.78  ? 2803 HOH A O   1 
HETATM 9388  O  O   . HOH R 6 .   ? 77.600  31.899 41.063  1.00 71.60  ? 2804 HOH A O   1 
HETATM 9389  O  O   . HOH R 6 .   ? 79.973  34.671 43.015  1.00 63.77  ? 2805 HOH A O   1 
HETATM 9390  O  O   . HOH R 6 .   ? 82.067  40.248 42.111  1.00 51.91  ? 2806 HOH A O   1 
HETATM 9391  O  O   . HOH R 6 .   ? 73.192  35.658 42.561  1.00 75.97  ? 2807 HOH A O   1 
HETATM 9392  O  O   . HOH R 6 .   ? 71.203  36.172 44.280  1.00 56.96  ? 2808 HOH A O   1 
HETATM 9393  O  O   . HOH R 6 .   ? 80.957  40.373 45.541  1.00 71.04  ? 2809 HOH A O   1 
HETATM 9394  O  O   . HOH R 6 .   ? 77.073  38.339 45.593  1.00 81.90  ? 2810 HOH A O   1 
HETATM 9395  O  O   . HOH R 6 .   ? 79.282  37.202 43.719  1.00 46.18  ? 2811 HOH A O   1 
HETATM 9396  O  O   . HOH R 6 .   ? 75.739  35.677 42.921  1.00 71.26  ? 2812 HOH A O   1 
HETATM 9397  O  O   . HOH R 6 .   ? 83.663  42.223 44.193  1.00 47.65  ? 2813 HOH A O   1 
HETATM 9398  O  O   . HOH R 6 .   ? 73.887  43.066 45.514  1.00 47.42  ? 2814 HOH A O   1 
HETATM 9399  O  O   . HOH R 6 .   ? 72.026  46.238 47.288  1.00 52.25  ? 2815 HOH A O   1 
HETATM 9400  O  O   . HOH R 6 .   ? 80.400  47.163 41.473  1.00 36.92  ? 2816 HOH A O   1 
HETATM 9401  O  O   . HOH R 6 .   ? 89.551  44.626 44.492  1.00 44.34  ? 2817 HOH A O   1 
HETATM 9402  O  O   . HOH R 6 .   ? 88.601  41.480 39.959  1.00 57.60  ? 2818 HOH A O   1 
HETATM 9403  O  O   . HOH R 6 .   ? 92.584  44.576 42.969  1.00 56.30  ? 2819 HOH A O   1 
HETATM 9404  O  O   . HOH R 6 .   ? 84.661  41.244 41.202  1.00 42.69  ? 2820 HOH A O   1 
HETATM 9405  O  O   . HOH R 6 .   ? 85.071  43.726 48.885  1.00 52.34  ? 2821 HOH A O   1 
HETATM 9406  O  O   . HOH R 6 .   ? 85.394  44.153 45.425  1.00 38.24  ? 2822 HOH A O   1 
HETATM 9407  O  O   . HOH R 6 .   ? 87.687  49.804 49.043  1.00 84.07  ? 2823 HOH A O   1 
HETATM 9408  O  O   . HOH R 6 .   ? 87.297  45.668 43.954  1.00 28.74  ? 2824 HOH A O   1 
HETATM 9409  O  O   . HOH R 6 .   ? 88.367  58.654 39.882  1.00 51.79  ? 2825 HOH A O   1 
HETATM 9410  O  O   . HOH R 6 .   ? 79.782  52.244 41.235  1.00 37.91  ? 2826 HOH A O   1 
HETATM 9411  O  O   . HOH R 6 .   ? 85.102  56.527 37.693  1.00 35.86  ? 2827 HOH A O   1 
HETATM 9412  O  O   . HOH R 6 .   ? 79.528  57.113 42.922  1.00 67.36  ? 2828 HOH A O   1 
HETATM 9413  O  O   . HOH R 6 .   ? 80.703  58.875 41.132  1.00 90.20  ? 2829 HOH A O   1 
HETATM 9414  O  O   . HOH R 6 .   ? 80.847  55.948 49.908  1.00 50.08  ? 2830 HOH A O   1 
HETATM 9415  O  O   . HOH R 6 .   ? 78.726  52.735 48.692  1.00 49.75  ? 2831 HOH A O   1 
HETATM 9416  O  O   . HOH R 6 .   ? 78.387  57.604 50.547  1.00 65.75  ? 2832 HOH A O   1 
HETATM 9417  O  O   . HOH R 6 .   ? 80.790  59.813 48.841  1.00 84.32  ? 2833 HOH A O   1 
HETATM 9418  O  O   . HOH R 6 .   ? 78.108  59.820 47.745  1.00 72.18  ? 2834 HOH A O   1 
HETATM 9419  O  O   . HOH R 6 .   ? 86.844  65.600 42.410  1.00 42.49  ? 2835 HOH A O   1 
HETATM 9420  O  O   . HOH R 6 .   ? 82.643  70.336 44.149  1.00 54.99  ? 2836 HOH A O   1 
HETATM 9421  O  O   . HOH R 6 .   ? 92.096  72.332 47.643  1.00 76.53  ? 2837 HOH A O   1 
HETATM 9422  O  O   . HOH R 6 .   ? 92.253  71.169 45.113  1.00 50.15  ? 2838 HOH A O   1 
HETATM 9423  O  O   . HOH R 6 .   ? 91.432  47.972 -10.362 1.00 73.72  ? 2839 HOH A O   1 
HETATM 9424  O  O   . HOH R 6 .   ? 91.456  49.990 -6.972  1.00 66.82  ? 2840 HOH A O   1 
HETATM 9425  O  O   . HOH R 6 .   ? 82.922  45.331 -10.280 1.00 73.01  ? 2841 HOH A O   1 
HETATM 9426  O  O   . HOH R 6 .   ? 88.568  50.856 -10.139 1.00 66.72  ? 2842 HOH A O   1 
HETATM 9427  O  O   . HOH R 6 .   ? 91.436  45.270 -10.188 1.00 62.12  ? 2843 HOH A O   1 
HETATM 9428  O  O   . HOH R 6 .   ? 90.478  44.057 -12.423 1.00 69.82  ? 2844 HOH A O   1 
HETATM 9429  O  O   . HOH R 6 .   ? 91.395  45.224 -7.455  1.00 84.53  ? 2845 HOH A O   1 
HETATM 9430  O  O   . HOH R 6 .   ? 92.019  50.260 -9.386  1.00 62.75  ? 2846 HOH A O   1 
HETATM 9431  O  O   . HOH R 6 .   ? 88.174  48.440 -12.255 1.00 91.32  ? 2847 HOH A O   1 
HETATM 9432  O  O   . HOH R 6 .   ? 89.695  42.806 -9.704  1.00 74.40  ? 2848 HOH A O   1 
HETATM 9433  O  O   . HOH R 6 .   ? 81.361  48.612 -10.664 1.00 46.26  ? 2849 HOH A O   1 
HETATM 9434  O  O   . HOH R 6 .   ? 55.443  51.255 31.196  1.00 71.74  ? 2850 HOH A O   1 
HETATM 9435  O  O   . HOH R 6 .   ? 56.262  44.564 31.675  1.00 51.19  ? 2851 HOH A O   1 
HETATM 9436  O  O   . HOH R 6 .   ? 54.472  44.805 29.781  1.00 70.47  ? 2852 HOH A O   1 
HETATM 9437  O  O   . HOH R 6 .   ? 57.540  53.028 29.783  1.00 57.01  ? 2853 HOH A O   1 
HETATM 9438  O  O   . HOH R 6 .   ? 54.462  47.325 31.535  1.00 68.12  ? 2854 HOH A O   1 
HETATM 9439  O  O   . HOH R 6 .   ? 64.450  48.192 34.705  1.00 50.16  ? 2855 HOH A O   1 
HETATM 9440  O  O   . HOH R 6 .   ? 61.821  45.275 35.248  1.00 62.89  ? 2856 HOH A O   1 
HETATM 9441  O  O   . HOH R 6 .   ? 81.050  77.413 30.917  1.00 77.25  ? 2857 HOH A O   1 
HETATM 9442  O  O   . HOH R 6 .   ? 79.654  79.456 28.162  1.00 66.18  ? 2858 HOH A O   1 
HETATM 9443  O  O   . HOH R 6 .   ? 82.920  79.129 27.361  1.00 65.07  ? 2859 HOH A O   1 
HETATM 9444  O  O   . HOH R 6 .   ? 81.987  74.994 30.277  1.00 72.81  ? 2860 HOH A O   1 
HETATM 9445  O  O   . HOH R 6 .   ? 82.132  19.779 2.280   1.00 50.50  ? 2861 HOH A O   1 
HETATM 9446  O  O   . HOH R 6 .   ? 76.500  16.648 5.632   1.00 54.64  ? 2862 HOH A O   1 
HETATM 9447  O  O   . HOH S 6 .   ? 111.264 37.954 113.356 1.00 79.53  ? 2001 HOH B O   1 
HETATM 9448  O  O   . HOH S 6 .   ? 108.973 40.823 115.513 1.00 67.52  ? 2002 HOH B O   1 
HETATM 9449  O  O   . HOH S 6 .   ? 115.137 38.898 114.693 1.00 66.37  ? 2003 HOH B O   1 
HETATM 9450  O  O   . HOH S 6 .   ? 109.448 38.114 111.395 1.00 54.99  ? 2004 HOH B O   1 
HETATM 9451  O  O   . HOH S 6 .   ? 109.264 40.541 106.010 1.00 91.00  ? 2005 HOH B O   1 
HETATM 9452  O  O   . HOH S 6 .   ? 111.626 35.838 111.134 1.00 65.32  ? 2006 HOH B O   1 
HETATM 9453  O  O   . HOH S 6 .   ? 114.552 35.630 109.799 1.00 58.20  ? 2007 HOH B O   1 
HETATM 9454  O  O   . HOH S 6 .   ? 114.516 43.941 108.935 1.00 59.11  ? 2008 HOH B O   1 
HETATM 9455  O  O   . HOH S 6 .   ? 114.792 44.169 111.985 1.00 59.59  ? 2009 HOH B O   1 
HETATM 9456  O  O   . HOH S 6 .   ? 109.507 47.865 106.375 1.00 81.26  ? 2010 HOH B O   1 
HETATM 9457  O  O   . HOH S 6 .   ? 114.364 55.035 112.576 1.00 67.61  ? 2011 HOH B O   1 
HETATM 9458  O  O   . HOH S 6 .   ? 118.567 52.334 107.347 1.00 40.78  ? 2012 HOH B O   1 
HETATM 9459  O  O   . HOH S 6 .   ? 116.205 47.112 108.572 1.00 46.16  ? 2013 HOH B O   1 
HETATM 9460  O  O   . HOH S 6 .   ? 118.751 50.346 111.109 1.00 42.13  ? 2014 HOH B O   1 
HETATM 9461  O  O   . HOH S 6 .   ? 116.397 52.765 110.777 1.00 68.42  ? 2015 HOH B O   1 
HETATM 9462  O  O   . HOH S 6 .   ? 110.244 50.023 117.567 1.00 77.91  ? 2016 HOH B O   1 
HETATM 9463  O  O   . HOH S 6 .   ? 117.208 54.387 108.737 1.00 76.30  ? 2017 HOH B O   1 
HETATM 9464  O  O   . HOH S 6 .   ? 91.920  66.783 107.367 1.00 65.87  ? 2018 HOH B O   1 
HETATM 9465  O  O   . HOH S 6 .   ? 112.837 60.127 105.631 1.00 83.49  ? 2019 HOH B O   1 
HETATM 9466  O  O   . HOH S 6 .   ? 121.709 55.660 101.552 1.00 56.70  ? 2020 HOH B O   1 
HETATM 9467  O  O   . HOH S 6 .   ? 120.198 54.192 105.792 1.00 49.24  ? 2021 HOH B O   1 
HETATM 9468  O  O   . HOH S 6 .   ? 114.246 59.343 109.696 1.00 77.34  ? 2022 HOH B O   1 
HETATM 9469  O  O   . HOH S 6 .   ? 117.716 54.513 106.117 1.00 73.00  ? 2023 HOH B O   1 
HETATM 9470  O  O   . HOH S 6 .   ? 113.680 57.019 110.903 1.00 61.18  ? 2024 HOH B O   1 
HETATM 9471  O  O   . HOH S 6 .   ? 110.862 52.592 117.493 1.00 58.87  ? 2025 HOH B O   1 
HETATM 9472  O  O   . HOH S 6 .   ? 112.717 54.888 114.567 1.00 61.49  ? 2026 HOH B O   1 
HETATM 9473  O  O   . HOH S 6 .   ? 111.570 55.213 116.772 1.00 67.34  ? 2027 HOH B O   1 
HETATM 9474  O  O   . HOH S 6 .   ? 104.146 40.439 111.764 1.00 68.11  ? 2028 HOH B O   1 
HETATM 9475  O  O   . HOH S 6 .   ? 101.671 41.385 110.965 1.00 67.68  ? 2029 HOH B O   1 
HETATM 9476  O  O   . HOH S 6 .   ? 103.794 68.797 102.341 1.00 75.56  ? 2030 HOH B O   1 
HETATM 9477  O  O   . HOH S 6 .   ? 89.443  69.044 104.512 1.00 80.13  ? 2031 HOH B O   1 
HETATM 9478  O  O   . HOH S 6 .   ? 106.303 31.296 107.680 1.00 50.35  ? 2032 HOH B O   1 
HETATM 9479  O  O   . HOH S 6 .   ? 109.486 36.927 108.779 1.00 74.21  ? 2033 HOH B O   1 
HETATM 9480  O  O   . HOH S 6 .   ? 103.411 74.163 95.495  1.00 45.68  ? 2034 HOH B O   1 
HETATM 9481  O  O   . HOH S 6 .   ? 110.060 63.149 95.440  1.00 82.73  ? 2035 HOH B O   1 
HETATM 9482  O  O   . HOH S 6 .   ? 111.269 65.131 96.566  1.00 44.43  ? 2036 HOH B O   1 
HETATM 9483  O  O   . HOH S 6 .   ? 125.933 53.992 74.229  1.00 50.15  ? 2037 HOH B O   1 
HETATM 9484  O  O   . HOH S 6 .   ? 93.154  37.341 114.927 1.00 64.86  ? 2038 HOH B O   1 
HETATM 9485  O  O   . HOH S 6 .   ? 128.495 45.136 68.184  1.00 60.25  ? 2039 HOH B O   1 
HETATM 9486  O  O   . HOH S 6 .   ? 130.319 44.836 70.714  1.00 56.76  ? 2040 HOH B O   1 
HETATM 9487  O  O   . HOH S 6 .   ? 104.436 44.759 115.094 1.00 68.98  ? 2041 HOH B O   1 
HETATM 9488  O  O   . HOH S 6 .   ? 90.922  36.493 91.526  1.00 57.12  ? 2042 HOH B O   1 
HETATM 9489  O  O   . HOH S 6 .   ? 98.585  25.204 97.758  1.00 55.58  ? 2043 HOH B O   1 
HETATM 9490  O  O   . HOH S 6 .   ? 105.035 24.162 100.058 1.00 76.18  ? 2044 HOH B O   1 
HETATM 9491  O  O   . HOH S 6 .   ? 103.995 59.240 114.528 1.00 62.28  ? 2045 HOH B O   1 
HETATM 9492  O  O   . HOH S 6 .   ? 107.174 49.719 118.873 1.00 46.14  ? 2046 HOH B O   1 
HETATM 9493  O  O   . HOH S 6 .   ? 103.850 47.290 116.419 1.00 82.22  ? 2047 HOH B O   1 
HETATM 9494  O  O   . HOH S 6 .   ? 114.223 61.918 111.052 1.00 54.99  ? 2048 HOH B O   1 
HETATM 9495  O  O   . HOH S 6 .   ? 112.281 62.065 114.049 1.00 65.97  ? 2049 HOH B O   1 
HETATM 9496  O  O   . HOH S 6 .   ? 109.677 28.285 94.412  1.00 57.21  ? 2050 HOH B O   1 
HETATM 9497  O  O   . HOH S 6 .   ? 103.905 31.448 108.488 1.00 65.56  ? 2051 HOH B O   1 
HETATM 9498  O  O   . HOH S 6 .   ? 109.065 32.848 99.216  1.00 62.99  ? 2052 HOH B O   1 
HETATM 9499  O  O   . HOH S 6 .   ? 111.222 37.851 103.646 1.00 39.60  ? 2053 HOH B O   1 
HETATM 9500  O  O   . HOH S 6 .   ? 93.648  60.321 94.970  1.00 86.94  ? 2054 HOH B O   1 
HETATM 9501  O  O   . HOH S 6 .   ? 75.834  58.492 82.607  1.00 74.35  ? 2055 HOH B O   1 
HETATM 9502  O  O   . HOH S 6 .   ? 71.962  41.126 88.192  1.00 62.20  ? 2056 HOH B O   1 
HETATM 9503  O  O   . HOH S 6 .   ? 106.171 54.312 100.348 1.00 83.48  ? 2057 HOH B O   1 
HETATM 9504  O  O   . HOH S 6 .   ? 108.878 58.267 98.944  1.00 80.95  ? 2058 HOH B O   1 
HETATM 9505  O  O   . HOH S 6 .   ? 109.162 60.689 99.919  1.00 55.79  ? 2059 HOH B O   1 
HETATM 9506  O  O   . HOH S 6 .   ? 100.577 58.855 101.957 1.00 36.81  ? 2060 HOH B O   1 
HETATM 9507  O  O   . HOH S 6 .   ? 102.901 66.786 107.899 1.00 77.76  ? 2061 HOH B O   1 
HETATM 9508  O  O   . HOH S 6 .   ? 103.655 67.798 104.786 1.00 88.55  ? 2062 HOH B O   1 
HETATM 9509  O  O   . HOH S 6 .   ? 100.965 67.630 104.601 1.00 46.96  ? 2063 HOH B O   1 
HETATM 9510  O  O   . HOH S 6 .   ? 84.196  46.487 97.529  1.00 67.44  ? 2064 HOH B O   1 
HETATM 9511  O  O   . HOH S 6 .   ? 84.512  49.060 99.048  1.00 54.49  ? 2065 HOH B O   1 
HETATM 9512  O  O   . HOH S 6 .   ? 96.998  63.534 71.238  1.00 54.39  ? 2066 HOH B O   1 
HETATM 9513  O  O   . HOH S 6 .   ? 97.309  61.854 69.097  1.00 57.59  ? 2067 HOH B O   1 
HETATM 9514  O  O   . HOH S 6 .   ? 98.527  67.019 104.111 1.00 59.03  ? 2068 HOH B O   1 
HETATM 9515  O  O   . HOH S 6 .   ? 97.245  81.008 75.493  1.00 63.07  ? 2069 HOH B O   1 
HETATM 9516  O  O   . HOH S 6 .   ? 87.255  67.177 101.262 1.00 46.33  ? 2070 HOH B O   1 
HETATM 9517  O  O   . HOH S 6 .   ? 87.918  69.614 101.489 1.00 67.29  ? 2071 HOH B O   1 
HETATM 9518  O  O   . HOH S 6 .   ? 97.136  69.635 103.520 1.00 43.98  ? 2072 HOH B O   1 
HETATM 9519  O  O   . HOH S 6 .   ? 90.798  70.194 98.700  1.00 36.08  ? 2073 HOH B O   1 
HETATM 9520  O  O   . HOH S 6 .   ? 91.809  68.032 104.705 1.00 47.23  ? 2074 HOH B O   1 
HETATM 9521  O  O   . HOH S 6 .   ? 95.042  66.290 94.159  1.00 24.94  ? 2075 HOH B O   1 
HETATM 9522  O  O   . HOH S 6 .   ? 99.384  70.634 70.236  1.00 62.68  ? 2076 HOH B O   1 
HETATM 9523  O  O   . HOH S 6 .   ? 99.771  71.844 98.915  1.00 69.01  ? 2077 HOH B O   1 
HETATM 9524  O  O   . HOH S 6 .   ? 102.123 74.592 100.790 1.00 67.71  ? 2078 HOH B O   1 
HETATM 9525  O  O   . HOH S 6 .   ? 100.694 67.342 97.625  1.00 63.52  ? 2079 HOH B O   1 
HETATM 9526  O  O   . HOH S 6 .   ? 102.765 72.050 92.791  1.00 49.05  ? 2080 HOH B O   1 
HETATM 9527  O  O   . HOH S 6 .   ? 108.376 65.795 95.706  1.00 86.81  ? 2081 HOH B O   1 
HETATM 9528  O  O   . HOH S 6 .   ? 108.441 69.370 101.552 1.00 57.19  ? 2082 HOH B O   1 
HETATM 9529  O  O   . HOH S 6 .   ? 102.027 65.416 98.775  1.00 36.20  ? 2083 HOH B O   1 
HETATM 9530  O  O   . HOH S 6 .   ? 107.568 67.156 102.709 1.00 45.94  ? 2084 HOH B O   1 
HETATM 9531  O  O   . HOH S 6 .   ? 100.426 59.231 104.894 1.00 37.59  ? 2085 HOH B O   1 
HETATM 9532  O  O   . HOH S 6 .   ? 102.538 62.758 107.134 1.00 45.47  ? 2086 HOH B O   1 
HETATM 9533  O  O   . HOH S 6 .   ? 91.449  36.172 93.827  1.00 65.47  ? 2087 HOH B O   1 
HETATM 9534  O  O   . HOH S 6 .   ? 72.685  55.780 54.640  1.00 61.85  ? 2088 HOH B O   1 
HETATM 9535  O  O   . HOH S 6 .   ? 76.238  56.660 54.204  1.00 53.17  ? 2089 HOH B O   1 
HETATM 9536  O  O   . HOH S 6 .   ? 76.239  56.542 56.958  1.00 60.16  ? 2090 HOH B O   1 
HETATM 9537  O  O   . HOH S 6 .   ? 97.229  39.637 100.807 1.00 44.23  ? 2091 HOH B O   1 
HETATM 9538  O  O   . HOH S 6 .   ? 111.484 59.645 113.585 1.00 70.97  ? 2092 HOH B O   1 
HETATM 9539  O  O   . HOH S 6 .   ? 112.305 59.023 111.312 1.00 41.75  ? 2093 HOH B O   1 
HETATM 9540  O  O   . HOH S 6 .   ? 107.809 27.979 92.049  1.00 60.53  ? 2094 HOH B O   1 
HETATM 9541  O  O   . HOH S 6 .   ? 106.171 60.412 114.276 1.00 55.17  ? 2095 HOH B O   1 
HETATM 9542  O  O   . HOH S 6 .   ? 116.883 34.524 90.361  1.00 52.43  ? 2096 HOH B O   1 
HETATM 9543  O  O   . HOH S 6 .   ? 87.921  45.597 54.337  1.00 42.31  ? 2097 HOH B O   1 
HETATM 9544  O  O   . HOH S 6 .   ? 110.040 55.085 112.822 1.00 40.66  ? 2098 HOH B O   1 
HETATM 9545  O  O   . HOH S 6 .   ? 103.121 47.976 114.007 1.00 46.93  ? 2099 HOH B O   1 
HETATM 9546  O  O   . HOH S 6 .   ? 100.154 53.180 111.230 1.00 44.84  ? 2100 HOH B O   1 
HETATM 9547  O  O   . HOH S 6 .   ? 96.249  41.252 104.715 1.00 51.09  ? 2101 HOH B O   1 
HETATM 9548  O  O   . HOH S 6 .   ? 95.309  43.251 106.230 1.00 72.15  ? 2102 HOH B O   1 
HETATM 9549  O  O   . HOH S 6 .   ? 106.935 77.525 76.954  1.00 77.62  ? 2103 HOH B O   1 
HETATM 9550  O  O   . HOH S 6 .   ? 105.845 80.690 77.890  1.00 78.71  ? 2104 HOH B O   1 
HETATM 9551  O  O   . HOH S 6 .   ? 106.765 78.641 80.147  1.00 63.29  ? 2105 HOH B O   1 
HETATM 9552  O  O   . HOH S 6 .   ? 99.172  80.906 80.219  1.00 55.34  ? 2106 HOH B O   1 
HETATM 9553  O  O   . HOH S 6 .   ? 94.342  44.277 103.246 1.00 55.24  ? 2107 HOH B O   1 
HETATM 9554  O  O   . HOH S 6 .   ? 93.068  50.638 104.688 1.00 73.44  ? 2108 HOH B O   1 
HETATM 9555  O  O   . HOH S 6 .   ? 90.229  51.826 105.691 1.00 57.22  ? 2109 HOH B O   1 
HETATM 9556  O  O   . HOH S 6 .   ? 90.999  51.062 103.302 1.00 54.49  ? 2110 HOH B O   1 
HETATM 9557  O  O   . HOH S 6 .   ? 95.443  54.053 103.558 1.00 46.03  ? 2111 HOH B O   1 
HETATM 9558  O  O   . HOH S 6 .   ? 96.420  53.482 97.483  1.00 27.66  ? 2112 HOH B O   1 
HETATM 9559  O  O   . HOH S 6 .   ? 90.365  52.106 99.003  1.00 99.87  ? 2113 HOH B O   1 
HETATM 9560  O  O   . HOH S 6 .   ? 106.872 66.475 92.264  1.00 50.77  ? 2114 HOH B O   1 
HETATM 9561  O  O   . HOH S 6 .   ? 110.512 62.436 93.085  1.00 38.28  ? 2115 HOH B O   1 
HETATM 9562  O  O   . HOH S 6 .   ? 89.841  38.656 90.254  1.00 51.85  ? 2116 HOH B O   1 
HETATM 9563  O  O   . HOH S 6 .   ? 94.170  54.249 93.764  1.00 30.54  ? 2117 HOH B O   1 
HETATM 9564  O  O   . HOH S 6 .   ? 111.517 61.752 96.933  1.00 51.47  ? 2118 HOH B O   1 
HETATM 9565  O  O   . HOH S 6 .   ? 92.308  60.350 92.562  1.00 28.24  ? 2119 HOH B O   1 
HETATM 9566  O  O   . HOH S 6 .   ? 88.402  61.748 100.853 1.00 43.77  ? 2120 HOH B O   1 
HETATM 9567  O  O   . HOH S 6 .   ? 84.835  58.422 94.623  1.00 94.85  ? 2121 HOH B O   1 
HETATM 9568  O  O   . HOH S 6 .   ? 91.617  61.369 95.501  1.00 60.72  ? 2122 HOH B O   1 
HETATM 9569  O  O   . HOH S 6 .   ? 87.248  60.649 90.722  1.00 72.67  ? 2123 HOH B O   1 
HETATM 9570  O  O   . HOH S 6 .   ? 89.872  51.130 90.632  1.00 26.61  ? 2124 HOH B O   1 
HETATM 9571  O  O   . HOH S 6 .   ? 82.804  57.575 92.754  1.00 31.38  ? 2125 HOH B O   1 
HETATM 9572  O  O   . HOH S 6 .   ? 85.149  53.410 86.446  1.00 81.21  ? 2126 HOH B O   1 
HETATM 9573  O  O   . HOH S 6 .   ? 86.742  52.685 89.118  1.00 41.67  ? 2127 HOH B O   1 
HETATM 9574  O  O   . HOH S 6 .   ? 76.862  55.991 84.207  1.00 61.32  ? 2128 HOH B O   1 
HETATM 9575  O  O   . HOH S 6 .   ? 87.388  59.431 88.438  1.00 31.56  ? 2129 HOH B O   1 
HETATM 9576  O  O   . HOH S 6 .   ? 80.268  52.880 84.009  1.00 41.70  ? 2130 HOH B O   1 
HETATM 9577  O  O   . HOH S 6 .   ? 124.975 48.651 101.672 1.00 82.74  ? 2131 HOH B O   1 
HETATM 9578  O  O   . HOH S 6 .   ? 122.379 46.217 101.202 1.00 49.44  ? 2132 HOH B O   1 
HETATM 9579  O  O   . HOH S 6 .   ? 81.326  57.287 90.387  1.00 38.86  ? 2133 HOH B O   1 
HETATM 9580  O  O   . HOH S 6 .   ? 78.577  47.803 89.361  1.00 69.97  ? 2134 HOH B O   1 
HETATM 9581  O  O   . HOH S 6 .   ? 124.505 46.455 95.253  1.00 97.42  ? 2135 HOH B O   1 
HETATM 9582  O  O   . HOH S 6 .   ? 75.692  53.339 85.898  1.00 40.60  ? 2136 HOH B O   1 
HETATM 9583  O  O   . HOH S 6 .   ? 78.483  53.390 86.204  1.00 34.70  ? 2137 HOH B O   1 
HETATM 9584  O  O   . HOH S 6 .   ? 75.318  53.684 93.078  1.00 79.42  ? 2138 HOH B O   1 
HETATM 9585  O  O   . HOH S 6 .   ? 77.062  48.431 80.393  1.00 88.58  ? 2139 HOH B O   1 
HETATM 9586  O  O   . HOH S 6 .   ? 77.933  53.377 81.938  1.00 68.94  ? 2140 HOH B O   1 
HETATM 9587  O  O   . HOH S 6 .   ? 75.359  40.316 88.070  1.00 83.66  ? 2141 HOH B O   1 
HETATM 9588  O  O   . HOH S 6 .   ? 81.075  40.565 91.628  1.00 48.59  ? 2142 HOH B O   1 
HETATM 9589  O  O   . HOH S 6 .   ? 79.706  37.941 90.722  1.00 74.94  ? 2143 HOH B O   1 
HETATM 9590  O  O   . HOH S 6 .   ? 79.778  37.710 87.932  1.00 50.94  ? 2144 HOH B O   1 
HETATM 9591  O  O   . HOH S 6 .   ? 81.799  35.738 88.942  1.00 57.98  ? 2145 HOH B O   1 
HETATM 9592  O  O   . HOH S 6 .   ? 85.471  37.753 86.168  1.00 74.36  ? 2146 HOH B O   1 
HETATM 9593  O  O   . HOH S 6 .   ? 85.073  46.374 83.915  1.00 85.04  ? 2147 HOH B O   1 
HETATM 9594  O  O   . HOH S 6 .   ? 84.739  48.141 85.714  1.00 23.95  ? 2148 HOH B O   1 
HETATM 9595  O  O   . HOH S 6 .   ? 79.782  47.088 87.098  1.00 44.53  ? 2149 HOH B O   1 
HETATM 9596  O  O   . HOH S 6 .   ? 77.569  45.766 93.610  1.00 61.39  ? 2150 HOH B O   1 
HETATM 9597  O  O   . HOH S 6 .   ? 119.356 60.350 80.360  1.00 60.99  ? 2151 HOH B O   1 
HETATM 9598  O  O   . HOH S 6 .   ? 118.594 62.895 80.728  1.00 74.59  ? 2152 HOH B O   1 
HETATM 9599  O  O   . HOH S 6 .   ? 90.478  42.290 90.877  1.00 25.77  ? 2153 HOH B O   1 
HETATM 9600  O  O   . HOH S 6 .   ? 90.934  49.512 87.417  1.00 26.58  ? 2154 HOH B O   1 
HETATM 9601  O  O   . HOH S 6 .   ? 87.431  45.148 92.971  1.00 35.97  ? 2155 HOH B O   1 
HETATM 9602  O  O   . HOH S 6 .   ? 81.682  47.984 93.081  1.00 55.87  ? 2156 HOH B O   1 
HETATM 9603  O  O   . HOH S 6 .   ? 86.326  50.593 86.785  1.00 48.84  ? 2157 HOH B O   1 
HETATM 9604  O  O   . HOH S 6 .   ? 100.135 62.425 71.054  1.00 51.01  ? 2158 HOH B O   1 
HETATM 9605  O  O   . HOH S 6 .   ? 84.938  46.218 94.559  1.00 61.60  ? 2159 HOH B O   1 
HETATM 9606  O  O   . HOH S 6 .   ? 83.421  49.850 94.419  1.00 49.63  ? 2160 HOH B O   1 
HETATM 9607  O  O   . HOH S 6 .   ? 86.354  48.025 102.863 1.00 62.32  ? 2161 HOH B O   1 
HETATM 9608  O  O   . HOH S 6 .   ? 91.831  42.197 99.550  1.00 47.98  ? 2162 HOH B O   1 
HETATM 9609  O  O   . HOH S 6 .   ? 84.912  52.138 97.612  1.00 43.19  ? 2163 HOH B O   1 
HETATM 9610  O  O   . HOH S 6 .   ? 92.320  46.967 103.990 1.00 50.89  ? 2164 HOH B O   1 
HETATM 9611  O  O   . HOH S 6 .   ? 93.420  65.538 72.481  1.00 47.18  ? 2165 HOH B O   1 
HETATM 9612  O  O   . HOH S 6 .   ? 90.756  76.014 73.664  1.00 49.31  ? 2166 HOH B O   1 
HETATM 9613  O  O   . HOH S 6 .   ? 83.779  57.786 103.663 1.00 66.38  ? 2167 HOH B O   1 
HETATM 9614  O  O   . HOH S 6 .   ? 84.324  53.171 102.950 1.00 57.15  ? 2168 HOH B O   1 
HETATM 9615  O  O   . HOH S 6 .   ? 97.274  80.632 78.202  1.00 60.56  ? 2169 HOH B O   1 
HETATM 9616  O  O   . HOH S 6 .   ? 84.901  72.243 72.341  1.00 49.63  ? 2170 HOH B O   1 
HETATM 9617  O  O   . HOH S 6 .   ? 84.615  54.292 99.390  1.00 38.63  ? 2171 HOH B O   1 
HETATM 9618  O  O   . HOH S 6 .   ? 93.970  64.995 96.041  1.00 30.71  ? 2172 HOH B O   1 
HETATM 9619  O  O   . HOH S 6 .   ? 96.754  60.396 97.538  1.00 81.99  ? 2173 HOH B O   1 
HETATM 9620  O  O   . HOH S 6 .   ? 94.129  62.503 96.205  1.00 33.04  ? 2174 HOH B O   1 
HETATM 9621  O  O   . HOH S 6 .   ? 88.684  64.517 100.746 1.00 33.60  ? 2175 HOH B O   1 
HETATM 9622  O  O   . HOH S 6 .   ? 90.831  68.049 99.982  1.00 46.84  ? 2176 HOH B O   1 
HETATM 9623  O  O   . HOH S 6 .   ? 73.470  70.220 90.985  1.00 61.23  ? 2177 HOH B O   1 
HETATM 9624  O  O   . HOH S 6 .   ? 93.488  57.748 106.387 1.00 45.63  ? 2178 HOH B O   1 
HETATM 9625  O  O   . HOH S 6 .   ? 98.155  59.655 106.630 1.00 43.07  ? 2179 HOH B O   1 
HETATM 9626  O  O   . HOH S 6 .   ? 98.383  59.753 100.939 1.00 20.46  ? 2180 HOH B O   1 
HETATM 9627  O  O   . HOH S 6 .   ? 90.927  82.478 97.030  1.00 66.12  ? 2181 HOH B O   1 
HETATM 9628  O  O   . HOH S 6 .   ? 77.839  66.703 99.048  1.00 72.35  ? 2182 HOH B O   1 
HETATM 9629  O  O   . HOH S 6 .   ? 81.141  53.823 95.475  1.00 49.72  ? 2183 HOH B O   1 
HETATM 9630  O  O   . HOH S 6 .   ? 99.217  39.302 99.504  1.00 35.70  ? 2184 HOH B O   1 
HETATM 9631  O  O   . HOH S 6 .   ? 75.921  70.440 94.333  1.00 60.58  ? 2185 HOH B O   1 
HETATM 9632  O  O   . HOH S 6 .   ? 108.041 32.223 105.947 1.00 50.46  ? 2186 HOH B O   1 
HETATM 9633  O  O   . HOH S 6 .   ? 112.105 31.893 105.316 1.00 67.75  ? 2187 HOH B O   1 
HETATM 9634  O  O   . HOH S 6 .   ? 113.400 32.715 98.864  1.00 64.88  ? 2188 HOH B O   1 
HETATM 9635  O  O   . HOH S 6 .   ? 111.746 40.782 104.238 1.00 31.21  ? 2189 HOH B O   1 
HETATM 9636  O  O   . HOH S 6 .   ? 117.661 36.088 104.739 1.00 57.44  ? 2190 HOH B O   1 
HETATM 9637  O  O   . HOH S 6 .   ? 83.886  56.815 77.744  1.00 71.58  ? 2191 HOH B O   1 
HETATM 9638  O  O   . HOH S 6 .   ? 88.801  63.865 72.677  1.00 45.47  ? 2192 HOH B O   1 
HETATM 9639  O  O   . HOH S 6 .   ? 119.597 41.595 102.148 1.00 49.31  ? 2193 HOH B O   1 
HETATM 9640  O  O   . HOH S 6 .   ? 125.720 40.564 104.983 1.00 54.15  ? 2194 HOH B O   1 
HETATM 9641  O  O   . HOH S 6 .   ? 119.048 44.453 98.093  1.00 74.44  ? 2195 HOH B O   1 
HETATM 9642  O  O   . HOH S 6 .   ? 119.844 36.261 96.993  1.00 59.11  ? 2196 HOH B O   1 
HETATM 9643  O  O   . HOH S 6 .   ? 125.267 38.115 105.537 1.00 49.14  ? 2197 HOH B O   1 
HETATM 9644  O  O   . HOH S 6 .   ? 122.711 41.016 94.220  1.00 66.89  ? 2198 HOH B O   1 
HETATM 9645  O  O   . HOH S 6 .   ? 120.249 38.910 95.941  1.00 58.66  ? 2199 HOH B O   1 
HETATM 9646  O  O   . HOH S 6 .   ? 121.060 45.789 97.252  1.00 64.86  ? 2200 HOH B O   1 
HETATM 9647  O  O   . HOH S 6 .   ? 101.163 70.485 72.310  1.00 46.75  ? 2201 HOH B O   1 
HETATM 9648  O  O   . HOH S 6 .   ? 118.887 40.291 89.734  1.00 58.36  ? 2202 HOH B O   1 
HETATM 9649  O  O   . HOH S 6 .   ? 102.455 68.577 71.445  1.00 48.51  ? 2203 HOH B O   1 
HETATM 9650  O  O   . HOH S 6 .   ? 103.074 67.835 68.456  1.00 64.16  ? 2204 HOH B O   1 
HETATM 9651  O  O   . HOH S 6 .   ? 102.299 61.691 69.831  1.00 57.18  ? 2205 HOH B O   1 
HETATM 9652  O  O   . HOH S 6 .   ? 100.309 50.065 90.540  1.00 21.44  ? 2206 HOH B O   1 
HETATM 9653  O  O   . HOH S 6 .   ? 100.829 48.199 85.568  1.00 73.33  ? 2207 HOH B O   1 
HETATM 9654  O  O   . HOH S 6 .   ? 118.009 67.241 74.785  1.00 53.26  ? 2208 HOH B O   1 
HETATM 9655  O  O   . HOH S 6 .   ? 99.882  52.529 88.813  1.00 97.52  ? 2209 HOH B O   1 
HETATM 9656  O  O   . HOH S 6 .   ? 119.075 57.676 80.328  1.00 45.49  ? 2210 HOH B O   1 
HETATM 9657  O  O   . HOH S 6 .   ? 122.600 56.864 76.252  1.00 46.22  ? 2211 HOH B O   1 
HETATM 9658  O  O   . HOH S 6 .   ? 119.072 63.043 72.717  1.00 70.70  ? 2212 HOH B O   1 
HETATM 9659  O  O   . HOH S 6 .   ? 123.286 60.081 77.347  1.00 68.95  ? 2213 HOH B O   1 
HETATM 9660  O  O   . HOH S 6 .   ? 93.646  40.066 64.949  1.00 40.27  ? 2214 HOH B O   1 
HETATM 9661  O  O   . HOH S 6 .   ? 85.571  51.644 84.245  1.00 42.72  ? 2215 HOH B O   1 
HETATM 9662  O  O   . HOH S 6 .   ? 89.334  50.689 85.530  1.00 28.68  ? 2216 HOH B O   1 
HETATM 9663  O  O   . HOH S 6 .   ? 95.312  52.202 95.201  1.00 34.88  ? 2217 HOH B O   1 
HETATM 9664  O  O   . HOH S 6 .   ? 98.543  51.917 96.959  1.00 37.47  ? 2218 HOH B O   1 
HETATM 9665  O  O   . HOH S 6 .   ? 79.965  33.871 65.100  1.00 72.92  ? 2219 HOH B O   1 
HETATM 9666  O  O   . HOH S 6 .   ? 79.673  35.091 69.419  1.00 55.36  ? 2220 HOH B O   1 
HETATM 9667  O  O   . HOH S 6 .   ? 79.487  31.668 68.429  1.00 77.51  ? 2221 HOH B O   1 
HETATM 9668  O  O   . HOH S 6 .   ? 94.299  37.393 94.382  1.00 48.38  ? 2222 HOH B O   1 
HETATM 9669  O  O   . HOH S 6 .   ? 88.972  42.672 96.142  1.00 68.20  ? 2223 HOH B O   1 
HETATM 9670  O  O   . HOH S 6 .   ? 89.626  43.075 93.456  1.00 40.06  ? 2224 HOH B O   1 
HETATM 9671  O  O   . HOH S 6 .   ? 69.097  49.778 60.894  1.00 47.54  ? 2225 HOH B O   1 
HETATM 9672  O  O   . HOH S 6 .   ? 69.332  47.421 65.152  1.00 54.75  ? 2226 HOH B O   1 
HETATM 9673  O  O   . HOH S 6 .   ? 70.522  40.387 64.908  1.00 79.40  ? 2227 HOH B O   1 
HETATM 9674  O  O   . HOH S 6 .   ? 69.460  42.493 65.790  1.00 53.98  ? 2228 HOH B O   1 
HETATM 9675  O  O   . HOH S 6 .   ? 74.510  53.929 54.401  1.00 66.27  ? 2229 HOH B O   1 
HETATM 9676  O  O   . HOH S 6 .   ? 79.756  54.100 53.486  1.00 49.15  ? 2230 HOH B O   1 
HETATM 9677  O  O   . HOH S 6 .   ? 71.704  58.828 62.049  1.00 64.63  ? 2231 HOH B O   1 
HETATM 9678  O  O   . HOH S 6 .   ? 93.525  49.110 87.522  1.00 29.03  ? 2232 HOH B O   1 
HETATM 9679  O  O   . HOH S 6 .   ? 72.462  55.341 67.666  1.00 52.17  ? 2233 HOH B O   1 
HETATM 9680  O  O   . HOH S 6 .   ? 101.380 37.738 91.705  1.00 30.46  ? 2234 HOH B O   1 
HETATM 9681  O  O   . HOH S 6 .   ? 78.752  61.150 67.485  1.00 54.25  ? 2235 HOH B O   1 
HETATM 9682  O  O   . HOH S 6 .   ? 75.731  58.214 68.342  1.00 52.15  ? 2236 HOH B O   1 
HETATM 9683  O  O   . HOH S 6 .   ? 97.236  37.247 99.639  1.00 62.93  ? 2237 HOH B O   1 
HETATM 9684  O  O   . HOH S 6 .   ? 96.885  31.226 97.376  1.00 37.27  ? 2238 HOH B O   1 
HETATM 9685  O  O   . HOH S 6 .   ? 94.285  34.751 94.661  1.00 56.90  ? 2239 HOH B O   1 
HETATM 9686  O  O   . HOH S 6 .   ? 83.346  57.098 50.222  1.00 32.79  ? 2240 HOH B O   1 
HETATM 9687  O  O   . HOH S 6 .   ? 80.951  58.156 51.112  1.00 54.88  ? 2241 HOH B O   1 
HETATM 9688  O  O   . HOH S 6 .   ? 78.069  59.252 54.901  1.00 67.85  ? 2242 HOH B O   1 
HETATM 9689  O  O   . HOH S 6 .   ? 106.916 36.641 97.068  1.00 79.53  ? 2243 HOH B O   1 
HETATM 9690  O  O   . HOH S 6 .   ? 110.487 32.659 96.409  1.00 46.17  ? 2244 HOH B O   1 
HETATM 9691  O  O   . HOH S 6 .   ? 105.392 28.477 91.723  1.00 34.31  ? 2245 HOH B O   1 
HETATM 9692  O  O   . HOH S 6 .   ? 106.949 30.746 86.303  1.00 29.79  ? 2246 HOH B O   1 
HETATM 9693  O  O   . HOH S 6 .   ? 87.822  44.037 52.425  1.00 54.48  ? 2247 HOH B O   1 
HETATM 9694  O  O   . HOH S 6 .   ? 87.509  42.709 55.149  1.00 63.07  ? 2248 HOH B O   1 
HETATM 9695  O  O   . HOH S 6 .   ? 115.651 32.319 91.065  1.00 67.14  ? 2249 HOH B O   1 
HETATM 9696  O  O   . HOH S 6 .   ? 115.586 35.643 94.578  1.00 86.36  ? 2250 HOH B O   1 
HETATM 9697  O  O   . HOH S 6 .   ? 115.344 36.080 91.464  1.00 82.73  ? 2251 HOH B O   1 
HETATM 9698  O  O   . HOH S 6 .   ? 113.315 33.734 96.545  1.00 62.74  ? 2252 HOH B O   1 
HETATM 9699  O  O   . HOH S 6 .   ? 75.613  33.877 60.505  1.00 53.01  ? 2253 HOH B O   1 
HETATM 9700  O  O   . HOH S 6 .   ? 71.894  37.657 53.033  1.00 62.82  ? 2254 HOH B O   1 
HETATM 9701  O  O   . HOH S 6 .   ? 70.788  38.265 59.261  1.00 72.46  ? 2255 HOH B O   1 
HETATM 9702  O  O   . HOH S 6 .   ? 104.173 44.539 93.744  1.00 80.90  ? 2256 HOH B O   1 
HETATM 9703  O  O   . HOH S 6 .   ? 82.840  36.972 59.655  1.00 42.17  ? 2257 HOH B O   1 
HETATM 9704  O  O   . HOH S 6 .   ? 99.351  45.052 93.761  1.00 30.00  ? 2258 HOH B O   1 
HETATM 9705  O  O   . HOH S 6 .   ? 94.855  54.831 85.473  1.00 20.46  ? 2259 HOH B O   1 
HETATM 9706  O  O   . HOH S 6 .   ? 107.737 54.928 62.047  1.00 58.29  ? 2260 HOH B O   1 
HETATM 9707  O  O   . HOH S 6 .   ? 89.275  61.054 89.755  1.00 34.57  ? 2261 HOH B O   1 
HETATM 9708  O  O   . HOH S 6 .   ? 120.142 48.729 65.958  1.00 54.38  ? 2262 HOH B O   1 
HETATM 9709  O  O   . HOH S 6 .   ? 122.149 50.456 67.038  1.00 55.61  ? 2263 HOH B O   1 
HETATM 9710  O  O   . HOH S 6 .   ? 98.039  66.953 87.599  1.00 69.69  ? 2264 HOH B O   1 
HETATM 9711  O  O   . HOH S 6 .   ? 97.544  66.706 83.359  1.00 28.75  ? 2265 HOH B O   1 
HETATM 9712  O  O   . HOH S 6 .   ? 94.295  37.691 65.097  1.00 56.55  ? 2266 HOH B O   1 
HETATM 9713  O  O   . HOH S 6 .   ? 98.283  77.583 79.806  1.00 66.07  ? 2267 HOH B O   1 
HETATM 9714  O  O   . HOH S 6 .   ? 104.964 77.624 78.426  1.00 56.38  ? 2268 HOH B O   1 
HETATM 9715  O  O   . HOH S 6 .   ? 85.385  28.890 76.177  1.00 55.51  ? 2269 HOH B O   1 
HETATM 9716  O  O   . HOH S 6 .   ? 102.485 75.405 85.556  1.00 60.92  ? 2270 HOH B O   1 
HETATM 9717  O  O   . HOH S 6 .   ? 76.021  34.208 72.533  1.00 50.80  ? 2271 HOH B O   1 
HETATM 9718  O  O   . HOH S 6 .   ? 77.656  34.707 78.126  1.00 58.53  ? 2272 HOH B O   1 
HETATM 9719  O  O   . HOH S 6 .   ? 102.592 72.884 83.785  1.00 61.03  ? 2273 HOH B O   1 
HETATM 9720  O  O   . HOH S 6 .   ? 97.972  69.851 88.450  1.00 44.61  ? 2274 HOH B O   1 
HETATM 9721  O  O   . HOH S 6 .   ? 103.818 69.347 86.064  1.00 48.08  ? 2275 HOH B O   1 
HETATM 9722  O  O   . HOH S 6 .   ? 83.026  24.355 91.423  1.00 52.11  ? 2276 HOH B O   1 
HETATM 9723  O  O   . HOH S 6 .   ? 89.929  36.364 88.103  1.00 73.20  ? 2277 HOH B O   1 
HETATM 9724  O  O   . HOH S 6 .   ? 108.049 63.548 91.853  1.00 35.56  ? 2278 HOH B O   1 
HETATM 9725  O  O   . HOH S 6 .   ? 94.056  18.894 83.228  1.00 72.12  ? 2279 HOH B O   1 
HETATM 9726  O  O   . HOH S 6 .   ? 89.967  26.864 76.839  1.00 66.46  ? 2280 HOH B O   1 
HETATM 9727  O  O   . HOH S 6 .   ? 100.850 59.199 86.381  1.00 111.72 ? 2281 HOH B O   1 
HETATM 9728  O  O   . HOH S 6 .   ? 108.178 27.207 85.206  1.00 49.37  ? 2282 HOH B O   1 
HETATM 9729  O  O   . HOH S 6 .   ? 110.218 65.292 89.737  1.00 45.36  ? 2283 HOH B O   1 
HETATM 9730  O  O   . HOH S 6 .   ? 109.682 66.965 86.127  1.00 43.93  ? 2284 HOH B O   1 
HETATM 9731  O  O   . HOH S 6 .   ? 108.409 27.392 75.672  1.00 68.62  ? 2285 HOH B O   1 
HETATM 9732  O  O   . HOH S 6 .   ? 110.136 29.375 77.812  1.00 73.67  ? 2286 HOH B O   1 
HETATM 9733  O  O   . HOH S 6 .   ? 110.477 59.336 97.352  1.00 46.52  ? 2287 HOH B O   1 
HETATM 9734  O  O   . HOH S 6 .   ? 115.951 31.481 87.212  1.00 68.86  ? 2288 HOH B O   1 
HETATM 9735  O  O   . HOH S 6 .   ? 113.318 30.549 88.000  1.00 65.96  ? 2289 HOH B O   1 
HETATM 9736  O  O   . HOH S 6 .   ? 117.000 60.535 91.534  1.00 43.54  ? 2290 HOH B O   1 
HETATM 9737  O  O   . HOH S 6 .   ? 112.845 61.948 91.894  1.00 40.54  ? 2291 HOH B O   1 
HETATM 9738  O  O   . HOH S 6 .   ? 120.992 37.103 78.470  1.00 46.82  ? 2292 HOH B O   1 
HETATM 9739  O  O   . HOH S 6 .   ? 109.333 56.185 103.612 1.00 60.68  ? 2293 HOH B O   1 
HETATM 9740  O  O   . HOH S 6 .   ? 123.971 22.538 72.742  1.00 62.64  ? 2294 HOH B O   1 
HETATM 9741  O  O   . HOH S 6 .   ? 119.991 53.739 95.003  1.00 47.39  ? 2295 HOH B O   1 
HETATM 9742  O  O   . HOH S 6 .   ? 107.064 24.699 78.133  1.00 65.28  ? 2296 HOH B O   1 
HETATM 9743  O  O   . HOH S 6 .   ? 110.837 24.233 82.681  1.00 55.90  ? 2297 HOH B O   1 
HETATM 9744  O  O   . HOH S 6 .   ? 112.639 58.402 98.697  1.00 43.95  ? 2298 HOH B O   1 
HETATM 9745  O  O   . HOH S 6 .   ? 115.485 61.078 97.981  1.00 40.24  ? 2299 HOH B O   1 
HETATM 9746  O  O   . HOH S 6 .   ? 115.279 59.507 101.227 1.00 53.47  ? 2300 HOH B O   1 
HETATM 9747  O  O   . HOH S 6 .   ? 118.877 59.007 98.050  1.00 66.17  ? 2301 HOH B O   1 
HETATM 9748  O  O   . HOH S 6 .   ? 112.854 57.690 101.342 1.00 47.13  ? 2302 HOH B O   1 
HETATM 9749  O  O   . HOH S 6 .   ? 108.039 50.624 58.891  1.00 62.58  ? 2303 HOH B O   1 
HETATM 9750  O  O   . HOH S 6 .   ? 111.459 33.102 61.841  1.00 58.73  ? 2304 HOH B O   1 
HETATM 9751  O  O   . HOH S 6 .   ? 121.888 48.513 102.147 1.00 52.51  ? 2305 HOH B O   1 
HETATM 9752  O  O   . HOH S 6 .   ? 120.379 45.529 99.884  1.00 68.82  ? 2306 HOH B O   1 
HETATM 9753  O  O   . HOH S 6 .   ? 118.472 44.061 103.406 1.00 47.46  ? 2307 HOH B O   1 
HETATM 9754  O  O   . HOH S 6 .   ? 122.721 50.752 103.245 1.00 67.84  ? 2308 HOH B O   1 
HETATM 9755  O  O   . HOH S 6 .   ? 119.659 54.086 99.420  1.00 49.17  ? 2309 HOH B O   1 
HETATM 9756  O  O   . HOH S 6 .   ? 117.471 50.889 97.868  1.00 34.98  ? 2310 HOH B O   1 
HETATM 9757  O  O   . HOH S 6 .   ? 106.450 23.615 72.120  1.00 55.93  ? 2311 HOH B O   1 
HETATM 9758  O  O   . HOH S 6 .   ? 115.027 40.787 98.071  1.00 94.52  ? 2312 HOH B O   1 
HETATM 9759  O  O   . HOH S 6 .   ? 102.433 31.063 61.142  1.00 61.52  ? 2313 HOH B O   1 
HETATM 9760  O  O   . HOH S 6 .   ? 123.415 48.712 94.190  1.00 69.66  ? 2314 HOH B O   1 
HETATM 9761  O  O   . HOH S 6 .   ? 116.000 47.032 94.116  1.00 100.28 ? 2315 HOH B O   1 
HETATM 9762  O  O   . HOH S 6 .   ? 116.445 52.818 91.278  1.00 35.41  ? 2316 HOH B O   1 
HETATM 9763  O  O   . HOH S 6 .   ? 115.080 50.089 91.794  1.00 77.58  ? 2317 HOH B O   1 
HETATM 9764  O  O   . HOH S 6 .   ? 119.811 53.227 90.866  1.00 43.23  ? 2318 HOH B O   1 
HETATM 9765  O  O   . HOH S 6 .   ? 94.228  44.416 58.315  1.00 38.92  ? 2319 HOH B O   1 
HETATM 9766  O  O   . HOH S 6 .   ? 106.498 57.983 60.900  1.00 78.72  ? 2320 HOH B O   1 
HETATM 9767  O  O   . HOH S 6 .   ? 117.191 50.294 88.313  1.00 20.46  ? 2321 HOH B O   1 
HETATM 9768  O  O   . HOH S 6 .   ? 115.054 45.161 86.495  1.00 37.96  ? 2322 HOH B O   1 
HETATM 9769  O  O   . HOH S 6 .   ? 101.787 66.584 50.559  1.00 75.03  ? 2323 HOH B O   1 
HETATM 9770  O  O   . HOH S 6 .   ? 102.328 71.035 56.707  1.00 55.44  ? 2324 HOH B O   1 
HETATM 9771  O  O   . HOH S 6 .   ? 105.081 50.206 85.499  1.00 90.36  ? 2325 HOH B O   1 
HETATM 9772  O  O   . HOH S 6 .   ? 89.765  69.714 59.620  1.00 58.63  ? 2326 HOH B O   1 
HETATM 9773  O  O   . HOH S 6 .   ? 88.866  73.587 49.283  1.00 78.37  ? 2327 HOH B O   1 
HETATM 9774  O  O   . HOH S 6 .   ? 95.865  47.982 84.409  1.00 31.07  ? 2328 HOH B O   1 
HETATM 9775  O  O   . HOH S 6 .   ? 102.972 51.144 84.073  1.00 96.80  ? 2329 HOH B O   1 
HETATM 9776  O  O   . HOH S 6 .   ? 107.791 52.433 78.400  1.00 96.78  ? 2330 HOH B O   1 
HETATM 9777  O  O   . HOH S 6 .   ? 111.872 66.281 83.134  1.00 42.97  ? 2331 HOH B O   1 
HETATM 9778  O  O   . HOH S 6 .   ? 114.072 63.037 89.649  1.00 46.34  ? 2332 HOH B O   1 
HETATM 9779  O  O   . HOH S 6 .   ? 119.003 59.699 77.974  1.00 72.63  ? 2333 HOH B O   1 
HETATM 9780  O  O   . HOH S 6 .   ? 120.537 55.948 88.497  1.00 75.91  ? 2334 HOH B O   1 
HETATM 9781  O  O   . HOH S 6 .   ? 121.690 60.797 83.016  1.00 65.13  ? 2335 HOH B O   1 
HETATM 9782  O  O   . HOH S 6 .   ? 118.789 61.389 83.166  1.00 73.39  ? 2336 HOH B O   1 
HETATM 9783  O  O   . HOH S 6 .   ? 118.524 62.816 87.418  1.00 60.93  ? 2337 HOH B O   1 
HETATM 9784  O  O   . HOH S 6 .   ? 116.274 61.097 86.216  1.00 43.69  ? 2338 HOH B O   1 
HETATM 9785  O  O   . HOH S 6 .   ? 113.348 52.831 91.125  1.00 38.83  ? 2339 HOH B O   1 
HETATM 9786  O  O   . HOH S 6 .   ? 118.928 52.333 86.389  1.00 35.81  ? 2340 HOH B O   1 
HETATM 9787  O  O   . HOH S 6 .   ? 119.658 51.262 81.501  1.00 54.12  ? 2341 HOH B O   1 
HETATM 9788  O  O   . HOH S 6 .   ? 121.568 46.747 80.338  1.00 49.62  ? 2342 HOH B O   1 
HETATM 9789  O  O   . HOH S 6 .   ? 120.609 43.436 84.390  1.00 48.48  ? 2343 HOH B O   1 
HETATM 9790  O  O   . HOH S 6 .   ? 107.588 49.386 79.770  1.00 90.70  ? 2344 HOH B O   1 
HETATM 9791  O  O   . HOH S 6 .   ? 95.759  44.693 78.084  1.00 28.83  ? 2345 HOH B O   1 
HETATM 9792  O  O   . HOH S 6 .   ? 99.409  51.767 72.997  1.00 38.14  ? 2346 HOH B O   1 
HETATM 9793  O  O   . HOH S 6 .   ? 99.749  60.712 73.770  1.00 26.60  ? 2347 HOH B O   1 
HETATM 9794  O  O   . HOH S 6 .   ? 101.355 58.049 67.339  1.00 34.00  ? 2348 HOH B O   1 
HETATM 9795  O  O   . HOH S 6 .   ? 91.763  61.098 76.643  1.00 26.69  ? 2349 HOH B O   1 
HETATM 9796  O  O   . HOH S 6 .   ? 100.401 64.849 72.611  1.00 43.91  ? 2350 HOH B O   1 
HETATM 9797  O  O   . HOH S 6 .   ? 93.715  63.331 73.860  1.00 41.49  ? 2351 HOH B O   1 
HETATM 9798  O  O   . HOH S 6 .   ? 94.728  68.216 72.553  1.00 32.08  ? 2352 HOH B O   1 
HETATM 9799  O  O   . HOH S 6 .   ? 95.796  72.747 71.003  1.00 49.31  ? 2353 HOH B O   1 
HETATM 9800  O  O   . HOH S 6 .   ? 99.341  67.457 72.627  1.00 39.88  ? 2354 HOH B O   1 
HETATM 9801  O  O   . HOH S 6 .   ? 96.973  73.407 80.864  1.00 39.93  ? 2355 HOH B O   1 
HETATM 9802  O  O   . HOH S 6 .   ? 98.621  74.441 73.581  1.00 46.51  ? 2356 HOH B O   1 
HETATM 9803  O  O   . HOH S 6 .   ? 92.233  76.615 75.777  1.00 50.74  ? 2357 HOH B O   1 
HETATM 9804  O  O   . HOH S 6 .   ? 91.107  73.240 73.257  1.00 41.45  ? 2358 HOH B O   1 
HETATM 9805  O  O   . HOH S 6 .   ? 92.793  69.942 82.827  1.00 39.76  ? 2359 HOH B O   1 
HETATM 9806  O  O   . HOH S 6 .   ? 91.361  80.444 80.946  1.00 51.46  ? 2360 HOH B O   1 
HETATM 9807  O  O   . HOH S 6 .   ? 96.844  77.928 77.721  1.00 44.27  ? 2361 HOH B O   1 
HETATM 9808  O  O   . HOH S 6 .   ? 86.580  70.291 73.187  1.00 95.09  ? 2362 HOH B O   1 
HETATM 9809  O  O   . HOH S 6 .   ? 83.653  71.227 75.944  1.00 84.38  ? 2363 HOH B O   1 
HETATM 9810  O  O   . HOH S 6 .   ? 86.744  76.781 78.753  1.00 73.66  ? 2364 HOH B O   1 
HETATM 9811  O  O   . HOH S 6 .   ? 84.839  74.710 76.628  1.00 52.57  ? 2365 HOH B O   1 
HETATM 9812  O  O   . HOH S 6 .   ? 90.221  66.391 72.866  1.00 57.68  ? 2366 HOH B O   1 
HETATM 9813  O  O   . HOH S 6 .   ? 88.748  63.754 75.144  1.00 97.46  ? 2367 HOH B O   1 
HETATM 9814  O  O   . HOH S 6 .   ? 88.769  70.583 84.640  1.00 97.48  ? 2368 HOH B O   1 
HETATM 9815  O  O   . HOH S 6 .   ? 91.312  63.181 75.139  1.00 32.81  ? 2369 HOH B O   1 
HETATM 9816  O  O   . HOH S 6 .   ? 83.987  76.963 79.385  1.00 49.05  ? 2370 HOH B O   1 
HETATM 9817  O  O   . HOH S 6 .   ? 80.338  70.742 79.516  1.00 52.69  ? 2371 HOH B O   1 
HETATM 9818  O  O   . HOH S 6 .   ? 78.361  78.417 85.457  1.00 47.53  ? 2372 HOH B O   1 
HETATM 9819  O  O   . HOH S 6 .   ? 82.775  78.907 80.412  1.00 44.25  ? 2373 HOH B O   1 
HETATM 9820  O  O   . HOH S 6 .   ? 77.362  70.128 85.643  1.00 77.98  ? 2374 HOH B O   1 
HETATM 9821  O  O   . HOH S 6 .   ? 76.245  71.158 89.256  1.00 72.23  ? 2375 HOH B O   1 
HETATM 9822  O  O   . HOH S 6 .   ? 75.964  71.837 83.206  1.00 59.36  ? 2376 HOH B O   1 
HETATM 9823  O  O   . HOH S 6 .   ? 73.238  75.835 88.862  1.00 74.77  ? 2377 HOH B O   1 
HETATM 9824  O  O   . HOH S 6 .   ? 75.169  73.716 89.925  1.00 77.15  ? 2378 HOH B O   1 
HETATM 9825  O  O   . HOH S 6 .   ? 84.477  80.045 92.881  1.00 52.02  ? 2379 HOH B O   1 
HETATM 9826  O  O   . HOH S 6 .   ? 82.854  83.375 86.517  1.00 51.32  ? 2380 HOH B O   1 
HETATM 9827  O  O   . HOH S 6 .   ? 88.612  80.669 83.247  1.00 55.34  ? 2381 HOH B O   1 
HETATM 9828  O  O   . HOH S 6 .   ? 91.005  81.022 84.138  1.00 53.24  ? 2382 HOH B O   1 
HETATM 9829  O  O   . HOH S 6 .   ? 88.415  82.429 97.759  1.00 79.98  ? 2383 HOH B O   1 
HETATM 9830  O  O   . HOH S 6 .   ? 78.830  69.089 101.155 1.00 72.19  ? 2384 HOH B O   1 
HETATM 9831  O  O   . HOH S 6 .   ? 81.154  56.273 94.611  1.00 47.97  ? 2385 HOH B O   1 
HETATM 9832  O  O   . HOH S 6 .   ? 82.937  62.993 98.528  1.00 37.90  ? 2386 HOH B O   1 
HETATM 9833  O  O   . HOH S 6 .   ? 83.674  59.881 96.591  1.00 45.24  ? 2387 HOH B O   1 
HETATM 9834  O  O   . HOH S 6 .   ? 80.733  70.491 92.970  1.00 88.76  ? 2388 HOH B O   1 
HETATM 9835  O  O   . HOH S 6 .   ? 81.181  72.662 98.179  1.00 56.72  ? 2389 HOH B O   1 
HETATM 9836  O  O   . HOH S 6 .   ? 78.233  70.123 92.891  1.00 47.68  ? 2390 HOH B O   1 
HETATM 9837  O  O   . HOH S 6 .   ? 78.499  67.961 91.349  1.00 37.66  ? 2391 HOH B O   1 
HETATM 9838  O  O   . HOH S 6 .   ? 83.025  69.212 91.575  1.00 97.32  ? 2392 HOH B O   1 
HETATM 9839  O  O   . HOH S 6 .   ? 80.444  60.753 86.612  1.00 48.25  ? 2393 HOH B O   1 
HETATM 9840  O  O   . HOH S 6 .   ? 78.281  64.223 94.953  1.00 61.75  ? 2394 HOH B O   1 
HETATM 9841  O  O   . HOH S 6 .   ? 77.418  59.438 91.252  1.00 72.72  ? 2395 HOH B O   1 
HETATM 9842  O  O   . HOH S 6 .   ? 77.549  66.065 93.052  1.00 72.87  ? 2396 HOH B O   1 
HETATM 9843  O  O   . HOH S 6 .   ? 79.862  63.504 84.038  1.00 46.51  ? 2397 HOH B O   1 
HETATM 9844  O  O   . HOH S 6 .   ? 80.192  59.471 88.985  1.00 47.06  ? 2398 HOH B O   1 
HETATM 9845  O  O   . HOH S 6 .   ? 89.328  61.852 83.922  1.00 34.93  ? 2399 HOH B O   1 
HETATM 9846  O  O   . HOH S 6 .   ? 87.814  63.329 88.480  1.00 35.67  ? 2400 HOH B O   1 
HETATM 9847  O  O   . HOH S 6 .   ? 87.221  60.648 82.254  1.00 36.95  ? 2401 HOH B O   1 
HETATM 9848  O  O   . HOH S 6 .   ? 84.103  60.454 86.821  1.00 71.21  ? 2402 HOH B O   1 
HETATM 9849  O  O   . HOH S 6 .   ? 80.369  65.984 74.742  1.00 58.06  ? 2403 HOH B O   1 
HETATM 9850  O  O   . HOH S 6 .   ? 86.214  63.797 73.249  1.00 39.66  ? 2404 HOH B O   1 
HETATM 9851  O  O   . HOH S 6 .   ? 80.586  59.805 69.485  1.00 84.46  ? 2405 HOH B O   1 
HETATM 9852  O  O   . HOH S 6 .   ? 81.890  61.470 67.899  1.00 58.88  ? 2406 HOH B O   1 
HETATM 9853  O  O   . HOH S 6 .   ? 78.702  60.166 73.943  1.00 52.58  ? 2407 HOH B O   1 
HETATM 9854  O  O   . HOH S 6 .   ? 80.302  58.598 75.287  1.00 71.90  ? 2408 HOH B O   1 
HETATM 9855  O  O   . HOH S 6 .   ? 81.547  61.075 75.393  1.00 41.49  ? 2409 HOH B O   1 
HETATM 9856  O  O   . HOH S 6 .   ? 82.477  59.030 77.068  1.00 56.48  ? 2410 HOH B O   1 
HETATM 9857  O  O   . HOH S 6 .   ? 82.531  57.032 70.859  1.00 87.16  ? 2411 HOH B O   1 
HETATM 9858  O  O   . HOH S 6 .   ? 85.255  54.925 76.790  1.00 33.77  ? 2412 HOH B O   1 
HETATM 9859  O  O   . HOH S 6 .   ? 89.780  62.958 70.050  1.00 52.35  ? 2413 HOH B O   1 
HETATM 9860  O  O   . HOH S 6 .   ? 85.129  58.651 75.697  1.00 43.27  ? 2414 HOH B O   1 
HETATM 9861  O  O   . HOH S 6 .   ? 92.309  67.677 81.060  1.00 37.65  ? 2415 HOH B O   1 
HETATM 9862  O  O   . HOH S 6 .   ? 91.327  60.297 82.848  1.00 27.58  ? 2416 HOH B O   1 
HETATM 9863  O  O   . HOH S 6 .   ? 94.707  66.975 81.591  1.00 34.21  ? 2417 HOH B O   1 
HETATM 9864  O  O   . HOH S 6 .   ? 100.920 71.289 74.807  1.00 37.64  ? 2418 HOH B O   1 
HETATM 9865  O  O   . HOH S 6 .   ? 106.361 75.418 78.720  1.00 67.87  ? 2419 HOH B O   1 
HETATM 9866  O  O   . HOH S 6 .   ? 110.427 68.348 84.212  1.00 96.18  ? 2420 HOH B O   1 
HETATM 9867  O  O   . HOH S 6 .   ? 105.098 72.388 83.467  1.00 72.53  ? 2421 HOH B O   1 
HETATM 9868  O  O   . HOH S 6 .   ? 108.204 68.739 87.343  1.00 46.45  ? 2422 HOH B O   1 
HETATM 9869  O  O   . HOH S 6 .   ? 107.148 68.073 85.186  1.00 63.81  ? 2423 HOH B O   1 
HETATM 9870  O  O   . HOH S 6 .   ? 113.079 66.556 71.945  1.00 63.81  ? 2424 HOH B O   1 
HETATM 9871  O  O   . HOH S 6 .   ? 105.170 67.642 66.595  1.00 74.74  ? 2425 HOH B O   1 
HETATM 9872  O  O   . HOH S 6 .   ? 102.821 65.703 71.639  1.00 34.91  ? 2426 HOH B O   1 
HETATM 9873  O  O   . HOH S 6 .   ? 103.565 60.201 68.258  1.00 49.75  ? 2427 HOH B O   1 
HETATM 9874  O  O   . HOH S 6 .   ? 103.209 64.126 69.161  1.00 53.68  ? 2428 HOH B O   1 
HETATM 9875  O  O   . HOH S 6 .   ? 103.478 62.636 64.216  1.00 64.61  ? 2429 HOH B O   1 
HETATM 9876  O  O   . HOH S 6 .   ? 113.189 65.083 66.372  1.00 78.03  ? 2430 HOH B O   1 
HETATM 9877  O  O   . HOH S 6 .   ? 113.152 57.191 66.314  1.00 33.18  ? 2431 HOH B O   1 
HETATM 9878  O  O   . HOH S 6 .   ? 117.555 64.843 70.995  1.00 61.85  ? 2432 HOH B O   1 
HETATM 9879  O  O   . HOH S 6 .   ? 118.620 63.077 76.054  1.00 65.50  ? 2433 HOH B O   1 
HETATM 9880  O  O   . HOH S 6 .   ? 114.876 66.801 76.510  1.00 75.76  ? 2434 HOH B O   1 
HETATM 9881  O  O   . HOH S 6 .   ? 117.157 65.886 77.585  1.00 65.37  ? 2435 HOH B O   1 
HETATM 9882  O  O   . HOH S 6 .   ? 119.429 56.207 82.216  1.00 66.87  ? 2436 HOH B O   1 
HETATM 9883  O  O   . HOH S 6 .   ? 119.813 53.810 80.594  1.00 54.81  ? 2437 HOH B O   1 
HETATM 9884  O  O   . HOH S 6 .   ? 116.100 53.235 78.344  1.00 73.10  ? 2438 HOH B O   1 
HETATM 9885  O  O   . HOH S 6 .   ? 119.558 52.752 83.691  1.00 48.56  ? 2439 HOH B O   1 
HETATM 9886  O  O   . HOH S 6 .   ? 121.007 58.958 76.148  1.00 68.17  ? 2440 HOH B O   1 
HETATM 9887  O  O   . HOH S 6 .   ? 119.981 60.490 70.486  1.00 60.86  ? 2441 HOH B O   1 
HETATM 9888  O  O   . HOH S 6 .   ? 119.216 60.545 75.569  1.00 62.09  ? 2442 HOH B O   1 
HETATM 9889  O  O   . HOH S 6 .   ? 119.704 56.385 77.993  1.00 38.03  ? 2443 HOH B O   1 
HETATM 9890  O  O   . HOH S 6 .   ? 119.848 48.841 80.360  1.00 50.28  ? 2444 HOH B O   1 
HETATM 9891  O  O   . HOH S 6 .   ? 94.007  42.438 66.460  1.00 37.47  ? 2445 HOH B O   1 
HETATM 9892  O  O   . HOH S 6 .   ? 89.883  39.363 66.151  1.00 60.20  ? 2446 HOH B O   1 
HETATM 9893  O  O   . HOH S 6 .   ? 85.994  43.061 76.097  1.00 102.87 ? 2447 HOH B O   1 
HETATM 9894  O  O   . HOH S 6 .   ? 88.669  45.128 75.058  1.00 36.88  ? 2448 HOH B O   1 
HETATM 9895  O  O   . HOH S 6 .   ? 84.825  53.400 74.732  1.00 75.90  ? 2449 HOH B O   1 
HETATM 9896  O  O   . HOH S 6 .   ? 83.003  53.295 76.376  1.00 33.57  ? 2450 HOH B O   1 
HETATM 9897  O  O   . HOH S 6 .   ? 81.680  52.203 72.335  1.00 94.03  ? 2451 HOH B O   1 
HETATM 9898  O  O   . HOH S 6 .   ? 76.169  48.736 78.005  1.00 38.31  ? 2452 HOH B O   1 
HETATM 9899  O  O   . HOH S 6 .   ? 75.860  52.803 75.469  1.00 45.77  ? 2453 HOH B O   1 
HETATM 9900  O  O   . HOH S 6 .   ? 78.844  55.410 78.071  1.00 63.43  ? 2454 HOH B O   1 
HETATM 9901  O  O   . HOH S 6 .   ? 79.170  56.768 73.939  1.00 43.74  ? 2455 HOH B O   1 
HETATM 9902  O  O   . HOH S 6 .   ? 76.673  50.092 74.256  1.00 35.49  ? 2456 HOH B O   1 
HETATM 9903  O  O   . HOH S 6 .   ? 72.640  49.188 71.934  1.00 29.22  ? 2457 HOH B O   1 
HETATM 9904  O  O   . HOH S 6 .   ? 70.681  41.937 74.230  1.00 58.89  ? 2458 HOH B O   1 
HETATM 9905  O  O   . HOH S 6 .   ? 74.150  43.259 78.160  1.00 73.72  ? 2459 HOH B O   1 
HETATM 9906  O  O   . HOH S 6 .   ? 74.900  40.024 84.542  1.00 51.56  ? 2460 HOH B O   1 
HETATM 9907  O  O   . HOH S 6 .   ? 76.746  37.498 78.686  1.00 61.84  ? 2461 HOH B O   1 
HETATM 9908  O  O   . HOH S 6 .   ? 75.207  45.816 77.919  1.00 50.59  ? 2462 HOH B O   1 
HETATM 9909  O  O   . HOH S 6 .   ? 76.737  37.725 81.930  1.00 76.85  ? 2463 HOH B O   1 
HETATM 9910  O  O   . HOH S 6 .   ? 79.651  42.439 77.187  1.00 78.27  ? 2464 HOH B O   1 
HETATM 9911  O  O   . HOH S 6 .   ? 74.147  35.930 79.128  1.00 66.05  ? 2465 HOH B O   1 
HETATM 9912  O  O   . HOH S 6 .   ? 76.591  36.644 72.170  1.00 92.41  ? 2466 HOH B O   1 
HETATM 9913  O  O   . HOH S 6 .   ? 71.905  42.723 70.022  1.00 69.44  ? 2467 HOH B O   1 
HETATM 9914  O  O   . HOH S 6 .   ? 72.233  38.814 67.753  1.00 57.29  ? 2468 HOH B O   1 
HETATM 9915  O  O   . HOH S 6 .   ? 75.948  36.385 74.469  1.00 39.34  ? 2469 HOH B O   1 
HETATM 9916  O  O   . HOH S 6 .   ? 78.103  32.903 66.606  1.00 88.02  ? 2470 HOH B O   1 
HETATM 9917  O  O   . HOH S 6 .   ? 78.949  35.854 66.627  1.00 43.96  ? 2471 HOH B O   1 
HETATM 9918  O  O   . HOH S 6 .   ? 72.018  35.782 67.854  1.00 75.94  ? 2472 HOH B O   1 
HETATM 9919  O  O   . HOH S 6 .   ? 76.542  32.944 64.559  1.00 47.61  ? 2473 HOH B O   1 
HETATM 9920  O  O   . HOH S 6 .   ? 75.571  32.091 67.115  1.00 65.99  ? 2474 HOH B O   1 
HETATM 9921  O  O   . HOH S 6 .   ? 76.217  34.185 69.529  1.00 67.12  ? 2475 HOH B O   1 
HETATM 9922  O  O   . HOH S 6 .   ? 75.053  41.791 72.639  1.00 89.65  ? 2476 HOH B O   1 
HETATM 9923  O  O   . HOH S 6 .   ? 75.094  34.403 62.912  1.00 74.42  ? 2477 HOH B O   1 
HETATM 9924  O  O   . HOH S 6 .   ? 72.805  44.802 67.738  1.00 45.90  ? 2478 HOH B O   1 
HETATM 9925  O  O   . HOH S 6 .   ? 71.629  43.531 64.042  1.00 46.97  ? 2479 HOH B O   1 
HETATM 9926  O  O   . HOH S 6 .   ? 70.894  37.745 65.760  1.00 68.38  ? 2480 HOH B O   1 
HETATM 9927  O  O   . HOH S 6 .   ? 71.575  34.975 65.382  1.00 63.62  ? 2481 HOH B O   1 
HETATM 9928  O  O   . HOH S 6 .   ? 72.610  41.330 68.025  1.00 38.18  ? 2482 HOH B O   1 
HETATM 9929  O  O   . HOH S 6 .   ? 69.831  49.440 63.496  1.00 40.35  ? 2483 HOH B O   1 
HETATM 9930  O  O   . HOH S 6 .   ? 72.130  47.325 58.064  1.00 32.64  ? 2484 HOH B O   1 
HETATM 9931  O  O   . HOH S 6 .   ? 76.897  52.513 54.988  1.00 65.41  ? 2485 HOH B O   1 
HETATM 9932  O  O   . HOH S 6 .   ? 71.261  49.779 58.756  1.00 42.88  ? 2486 HOH B O   1 
HETATM 9933  O  O   . HOH S 6 .   ? 74.934  56.075 61.563  1.00 44.14  ? 2487 HOH B O   1 
HETATM 9934  O  O   . HOH S 6 .   ? 70.967  56.203 64.243  1.00 61.68  ? 2488 HOH B O   1 
HETATM 9935  O  O   . HOH S 6 .   ? 70.702  50.045 67.875  1.00 33.11  ? 2489 HOH B O   1 
HETATM 9936  O  O   . HOH S 6 .   ? 78.072  51.089 67.030  1.00 30.67  ? 2490 HOH B O   1 
HETATM 9937  O  O   . HOH S 6 .   ? 72.688  46.938 65.418  1.00 34.48  ? 2491 HOH B O   1 
HETATM 9938  O  O   . HOH S 6 .   ? 70.555  52.013 64.629  1.00 49.02  ? 2492 HOH B O   1 
HETATM 9939  O  O   . HOH S 6 .   ? 72.731  54.099 65.191  1.00 41.71  ? 2493 HOH B O   1 
HETATM 9940  O  O   . HOH S 6 .   ? 72.527  56.348 62.353  1.00 75.84  ? 2494 HOH B O   1 
HETATM 9941  O  O   . HOH S 6 .   ? 76.724  58.363 62.188  1.00 47.20  ? 2495 HOH B O   1 
HETATM 9942  O  O   . HOH S 6 .   ? 75.183  58.672 64.373  1.00 52.97  ? 2496 HOH B O   1 
HETATM 9943  O  O   . HOH S 6 .   ? 77.635  58.356 66.066  1.00 43.85  ? 2497 HOH B O   1 
HETATM 9944  O  O   . HOH S 6 .   ? 84.879  56.688 61.091  1.00 64.26  ? 2498 HOH B O   1 
HETATM 9945  O  O   . HOH S 6 .   ? 83.783  62.756 63.690  1.00 49.88  ? 2499 HOH B O   1 
HETATM 9946  O  O   . HOH S 6 .   ? 81.686  66.209 60.933  1.00 81.24  ? 2500 HOH B O   1 
HETATM 9947  O  O   . HOH S 6 .   ? 81.288  66.621 64.154  1.00 74.50  ? 2501 HOH B O   1 
HETATM 9948  O  O   . HOH S 6 .   ? 81.586  58.667 61.206  1.00 99.07  ? 2502 HOH B O   1 
HETATM 9949  O  O   . HOH S 6 .   ? 83.117  64.368 61.598  1.00 71.34  ? 2503 HOH B O   1 
HETATM 9950  O  O   . HOH S 6 .   ? 83.610  52.580 65.293  1.00 96.37  ? 2504 HOH B O   1 
HETATM 9951  O  O   . HOH S 6 .   ? 87.917  55.682 69.996  1.00 37.70  ? 2505 HOH B O   1 
HETATM 9952  O  O   . HOH S 6 .   ? 82.568  64.135 66.447  1.00 43.09  ? 2506 HOH B O   1 
HETATM 9953  O  O   . HOH S 6 .   ? 92.438  61.773 68.637  1.00 67.85  ? 2507 HOH B O   1 
HETATM 9954  O  O   . HOH S 6 .   ? 94.342  61.097 66.876  1.00 59.22  ? 2508 HOH B O   1 
HETATM 9955  O  O   . HOH S 6 .   ? 86.292  66.331 64.157  1.00 69.15  ? 2509 HOH B O   1 
HETATM 9956  O  O   . HOH S 6 .   ? 94.144  60.837 63.925  1.00 48.54  ? 2510 HOH B O   1 
HETATM 9957  O  O   . HOH S 6 .   ? 89.767  66.698 60.518  1.00 62.88  ? 2511 HOH B O   1 
HETATM 9958  O  O   . HOH S 6 .   ? 80.250  60.457 57.362  1.00 74.13  ? 2512 HOH B O   1 
HETATM 9959  O  O   . HOH S 6 .   ? 78.828  61.698 54.992  1.00 66.54  ? 2513 HOH B O   1 
HETATM 9960  O  O   . HOH S 6 .   ? 83.335  67.800 57.843  1.00 59.93  ? 2514 HOH B O   1 
HETATM 9961  O  O   . HOH S 6 .   ? 81.112  64.232 59.298  1.00 71.44  ? 2515 HOH B O   1 
HETATM 9962  O  O   . HOH S 6 .   ? 85.611  66.790 55.099  1.00 53.27  ? 2516 HOH B O   1 
HETATM 9963  O  O   . HOH S 6 .   ? 87.103  58.880 61.282  1.00 96.34  ? 2517 HOH B O   1 
HETATM 9964  O  O   . HOH S 6 .   ? 81.092  56.591 53.989  1.00 51.69  ? 2518 HOH B O   1 
HETATM 9965  O  O   . HOH S 6 .   ? 85.218  56.475 51.764  1.00 101.34 ? 2519 HOH B O   1 
HETATM 9966  O  O   . HOH S 6 .   ? 80.663  61.947 52.856  1.00 76.98  ? 2520 HOH B O   1 
HETATM 9967  O  O   . HOH S 6 .   ? 79.837  59.453 53.020  1.00 67.90  ? 2521 HOH B O   1 
HETATM 9968  O  O   . HOH S 6 .   ? 83.492  59.535 49.935  1.00 36.85  ? 2522 HOH B O   1 
HETATM 9969  O  O   . HOH S 6 .   ? 83.167  55.309 52.711  1.00 36.04  ? 2523 HOH B O   1 
HETATM 9970  O  O   . HOH S 6 .   ? 80.360  56.623 58.503  1.00 70.37  ? 2524 HOH B O   1 
HETATM 9971  O  O   . HOH S 6 .   ? 89.079  49.337 51.175  1.00 42.71  ? 2525 HOH B O   1 
HETATM 9972  O  O   . HOH S 6 .   ? 90.626  54.068 52.668  1.00 50.44  ? 2526 HOH B O   1 
HETATM 9973  O  O   . HOH S 6 .   ? 82.320  44.811 56.447  1.00 43.01  ? 2527 HOH B O   1 
HETATM 9974  O  O   . HOH S 6 .   ? 84.680  43.710 56.703  1.00 53.71  ? 2528 HOH B O   1 
HETATM 9975  O  O   . HOH S 6 .   ? 85.072  40.756 55.504  1.00 67.71  ? 2529 HOH B O   1 
HETATM 9976  O  O   . HOH S 6 .   ? 86.585  41.466 51.690  1.00 59.89  ? 2530 HOH B O   1 
HETATM 9977  O  O   . HOH S 6 .   ? 82.946  39.097 51.030  1.00 49.29  ? 2531 HOH B O   1 
HETATM 9978  O  O   . HOH S 6 .   ? 82.915  52.714 52.175  1.00 44.32  ? 2532 HOH B O   1 
HETATM 9979  O  O   . HOH S 6 .   ? 77.084  41.191 46.590  1.00 73.79  ? 2533 HOH B O   1 
HETATM 9980  O  O   . HOH S 6 .   ? 77.396  37.791 49.769  1.00 47.53  ? 2534 HOH B O   1 
HETATM 9981  O  O   . HOH S 6 .   ? 78.796  36.409 54.023  1.00 64.32  ? 2535 HOH B O   1 
HETATM 9982  O  O   . HOH S 6 .   ? 76.025  38.167 54.888  1.00 39.57  ? 2536 HOH B O   1 
HETATM 9983  O  O   . HOH S 6 .   ? 75.400  42.250 53.238  1.00 44.56  ? 2537 HOH B O   1 
HETATM 9984  O  O   . HOH S 6 .   ? 74.888  43.445 50.956  1.00 58.62  ? 2538 HOH B O   1 
HETATM 9985  O  O   . HOH S 6 .   ? 73.097  44.817 59.127  1.00 77.98  ? 2539 HOH B O   1 
HETATM 9986  O  O   . HOH S 6 .   ? 72.636  49.585 54.416  1.00 51.61  ? 2540 HOH B O   1 
HETATM 9987  O  O   . HOH S 6 .   ? 71.133  41.317 58.296  1.00 69.64  ? 2541 HOH B O   1 
HETATM 9988  O  O   . HOH S 6 .   ? 75.840  37.169 59.967  1.00 53.89  ? 2542 HOH B O   1 
HETATM 9989  O  O   . HOH S 6 .   ? 74.007  39.954 59.381  1.00 42.24  ? 2543 HOH B O   1 
HETATM 9990  O  O   . HOH S 6 .   ? 77.798  40.606 64.730  1.00 99.76  ? 2544 HOH B O   1 
HETATM 9991  O  O   . HOH S 6 .   ? 72.942  42.398 61.380  1.00 57.02  ? 2545 HOH B O   1 
HETATM 9992  O  O   . HOH S 6 .   ? 75.258  38.981 61.474  1.00 88.82  ? 2546 HOH B O   1 
HETATM 9993  O  O   . HOH S 6 .   ? 85.440  42.625 59.357  1.00 47.34  ? 2547 HOH B O   1 
HETATM 9994  O  O   . HOH S 6 .   ? 81.939  35.168 54.326  1.00 65.44  ? 2548 HOH B O   1 
HETATM 9995  O  O   . HOH S 6 .   ? 79.975  44.048 56.771  1.00 38.84  ? 2549 HOH B O   1 
HETATM 9996  O  O   . HOH S 6 .   ? 81.759  35.659 65.556  1.00 46.16  ? 2550 HOH B O   1 
HETATM 9997  O  O   . HOH S 6 .   ? 83.586  39.694 60.950  1.00 74.77  ? 2551 HOH B O   1 
HETATM 9998  O  O   . HOH S 6 .   ? 83.872  36.288 64.150  1.00 61.00  ? 2552 HOH B O   1 
HETATM 9999  O  O   . HOH S 6 .   ? 85.008  41.457 67.637  1.00 62.39  ? 2553 HOH B O   1 
HETATM 10000 O  O   . HOH S 6 .   ? 84.603  49.056 62.007  1.00 83.07  ? 2554 HOH B O   1 
HETATM 10001 O  O   . HOH S 6 .   ? 87.869  41.854 65.283  1.00 56.22  ? 2555 HOH B O   1 
HETATM 10002 O  O   . HOH S 6 .   ? 89.790  45.468 69.176  1.00 85.90  ? 2556 HOH B O   1 
HETATM 10003 O  O   . HOH S 6 .   ? 89.965  42.065 66.919  1.00 73.38  ? 2557 HOH B O   1 
HETATM 10004 O  O   . HOH S 6 .   ? 92.568  44.929 65.996  1.00 24.94  ? 2558 HOH B O   1 
HETATM 10005 O  O   . HOH S 6 .   ? 91.090  41.169 63.742  1.00 58.46  ? 2559 HOH B O   1 
HETATM 10006 O  O   . HOH S 6 .   ? 88.952  39.918 62.809  1.00 58.71  ? 2560 HOH B O   1 
HETATM 10007 O  O   . HOH S 6 .   ? 96.100  56.003 65.824  1.00 39.04  ? 2561 HOH B O   1 
HETATM 10008 O  O   . HOH S 6 .   ? 106.825 56.240 67.808  1.00 95.19  ? 2562 HOH B O   1 
HETATM 10009 O  O   . HOH S 6 .   ? 105.032 54.376 61.779  1.00 38.86  ? 2563 HOH B O   1 
HETATM 10010 O  O   . HOH S 6 .   ? 101.856 57.778 64.673  1.00 42.57  ? 2564 HOH B O   1 
HETATM 10011 O  O   . HOH S 6 .   ? 112.739 50.697 63.683  1.00 44.70  ? 2565 HOH B O   1 
HETATM 10012 O  O   . HOH S 6 .   ? 104.416 48.697 61.460  1.00 54.89  ? 2566 HOH B O   1 
HETATM 10013 O  O   . HOH S 6 .   ? 106.018 52.147 62.548  1.00 58.06  ? 2567 HOH B O   1 
HETATM 10014 O  O   . HOH S 6 .   ? 116.606 48.365 68.833  1.00 28.31  ? 2568 HOH B O   1 
HETATM 10015 O  O   . HOH S 6 .   ? 119.750 51.157 67.694  1.00 61.25  ? 2569 HOH B O   1 
HETATM 10016 O  O   . HOH S 6 .   ? 117.732 50.549 63.173  1.00 60.69  ? 2570 HOH B O   1 
HETATM 10017 O  O   . HOH S 6 .   ? 121.204 52.262 72.411  1.00 47.29  ? 2571 HOH B O   1 
HETATM 10018 O  O   . HOH S 6 .   ? 119.925 43.777 74.340  1.00 46.10  ? 2572 HOH B O   1 
HETATM 10019 O  O   . HOH S 6 .   ? 122.168 49.927 71.358  1.00 39.75  ? 2573 HOH B O   1 
HETATM 10020 O  O   . HOH S 6 .   ? 113.902 44.551 75.809  1.00 93.94  ? 2574 HOH B O   1 
HETATM 10021 O  O   . HOH S 6 .   ? 115.553 48.551 71.070  1.00 27.10  ? 2575 HOH B O   1 
HETATM 10022 O  O   . HOH S 6 .   ? 107.166 41.978 74.506  1.00 91.73  ? 2576 HOH B O   1 
HETATM 10023 O  O   . HOH S 6 .   ? 117.751 38.315 72.026  1.00 47.32  ? 2577 HOH B O   1 
HETATM 10024 O  O   . HOH S 6 .   ? 118.414 41.477 74.787  1.00 33.23  ? 2578 HOH B O   1 
HETATM 10025 O  O   . HOH S 6 .   ? 98.954  43.345 76.450  1.00 22.44  ? 2579 HOH B O   1 
HETATM 10026 O  O   . HOH S 6 .   ? 95.531  35.800 66.239  1.00 37.57  ? 2580 HOH B O   1 
HETATM 10027 O  O   . HOH S 6 .   ? 94.256  31.391 69.923  1.00 55.38  ? 2581 HOH B O   1 
HETATM 10028 O  O   . HOH S 6 .   ? 91.777  31.131 72.519  1.00 50.04  ? 2582 HOH B O   1 
HETATM 10029 O  O   . HOH S 6 .   ? 85.980  31.682 77.099  1.00 48.24  ? 2583 HOH B O   1 
HETATM 10030 O  O   . HOH S 6 .   ? 91.642  35.754 78.027  1.00 43.96  ? 2584 HOH B O   1 
HETATM 10031 O  O   . HOH S 6 .   ? 85.531  27.093 83.195  1.00 50.70  ? 2585 HOH B O   1 
HETATM 10032 O  O   . HOH S 6 .   ? 85.975  34.602 86.058  1.00 62.05  ? 2586 HOH B O   1 
HETATM 10033 O  O   . HOH S 6 .   ? 89.022  34.811 83.174  1.00 34.62  ? 2587 HOH B O   1 
HETATM 10034 O  O   . HOH S 6 .   ? 84.405  31.358 79.214  1.00 65.64  ? 2588 HOH B O   1 
HETATM 10035 O  O   . HOH S 6 .   ? 79.795  34.129 79.509  1.00 67.19  ? 2589 HOH B O   1 
HETATM 10036 O  O   . HOH S 6 .   ? 78.528  38.366 80.261  1.00 43.58  ? 2590 HOH B O   1 
HETATM 10037 O  O   . HOH S 6 .   ? 86.699  36.422 83.707  1.00 42.93  ? 2591 HOH B O   1 
HETATM 10038 O  O   . HOH S 6 .   ? 85.928  34.681 71.577  1.00 48.88  ? 2592 HOH B O   1 
HETATM 10039 O  O   . HOH S 6 .   ? 78.660  34.459 74.931  1.00 53.00  ? 2593 HOH B O   1 
HETATM 10040 O  O   . HOH S 6 .   ? 79.076  36.783 71.788  1.00 33.94  ? 2594 HOH B O   1 
HETATM 10041 O  O   . HOH S 6 .   ? 89.637  37.708 77.022  1.00 46.18  ? 2595 HOH B O   1 
HETATM 10042 O  O   . HOH S 6 .   ? 93.112  40.335 75.770  1.00 87.68  ? 2596 HOH B O   1 
HETATM 10043 O  O   . HOH S 6 .   ? 89.213  47.512 79.012  1.00 65.67  ? 2597 HOH B O   1 
HETATM 10044 O  O   . HOH S 6 .   ? 93.384  40.081 83.927  1.00 31.90  ? 2598 HOH B O   1 
HETATM 10045 O  O   . HOH S 6 .   ? 92.469  35.755 80.512  1.00 53.06  ? 2599 HOH B O   1 
HETATM 10046 O  O   . HOH S 6 .   ? 89.626  37.619 85.928  1.00 52.30  ? 2600 HOH B O   1 
HETATM 10047 O  O   . HOH S 6 .   ? 100.226 25.904 91.194  1.00 55.17  ? 2601 HOH B O   1 
HETATM 10048 O  O   . HOH S 6 .   ? 94.202  21.064 86.026  1.00 73.82  ? 2602 HOH B O   1 
HETATM 10049 O  O   . HOH S 6 .   ? 91.223  24.438 88.641  1.00 82.12  ? 2603 HOH B O   1 
HETATM 10050 O  O   . HOH S 6 .   ? 92.470  24.539 96.536  1.00 74.86  ? 2604 HOH B O   1 
HETATM 10051 O  O   . HOH S 6 .   ? 84.209  26.725 91.099  1.00 52.07  ? 2605 HOH B O   1 
HETATM 10052 O  O   . HOH S 6 .   ? 86.947  23.378 87.818  1.00 76.46  ? 2606 HOH B O   1 
HETATM 10053 O  O   . HOH S 6 .   ? 88.269  22.616 91.190  1.00 66.66  ? 2607 HOH B O   1 
HETATM 10054 O  O   . HOH S 6 .   ? 88.157  27.046 83.225  1.00 60.05  ? 2608 HOH B O   1 
HETATM 10055 O  O   . HOH S 6 .   ? 85.055  23.779 89.553  1.00 43.13  ? 2609 HOH B O   1 
HETATM 10056 O  O   . HOH S 6 .   ? 93.639  24.500 87.443  1.00 70.86  ? 2610 HOH B O   1 
HETATM 10057 O  O   . HOH S 6 .   ? 88.946  34.071 87.264  1.00 57.25  ? 2611 HOH B O   1 
HETATM 10058 O  O   . HOH S 6 .   ? 93.506  27.545 87.982  1.00 37.28  ? 2612 HOH B O   1 
HETATM 10059 O  O   . HOH S 6 .   ? 92.804  25.474 77.990  1.00 53.44  ? 2613 HOH B O   1 
HETATM 10060 O  O   . HOH S 6 .   ? 93.029  21.489 82.916  1.00 64.46  ? 2614 HOH B O   1 
HETATM 10061 O  O   . HOH S 6 .   ? 100.103 23.150 83.778  1.00 37.04  ? 2615 HOH B O   1 
HETATM 10062 O  O   . HOH S 6 .   ? 96.855  22.926 75.971  1.00 89.86  ? 2616 HOH B O   1 
HETATM 10063 O  O   . HOH S 6 .   ? 93.205  20.577 76.651  1.00 72.56  ? 2617 HOH B O   1 
HETATM 10064 O  O   . HOH S 6 .   ? 100.326 26.367 77.578  1.00 34.54  ? 2618 HOH B O   1 
HETATM 10065 O  O   . HOH S 6 .   ? 91.705  27.880 78.135  1.00 95.00  ? 2619 HOH B O   1 
HETATM 10066 O  O   . HOH S 6 .   ? 96.319  25.411 88.976  1.00 55.74  ? 2620 HOH B O   1 
HETATM 10067 O  O   . HOH S 6 .   ? 95.928  23.414 87.062  1.00 57.11  ? 2621 HOH B O   1 
HETATM 10068 O  O   . HOH S 6 .   ? 102.418 24.289 84.240  1.00 47.81  ? 2622 HOH B O   1 
HETATM 10069 O  O   . HOH S 6 .   ? 104.009 26.300 78.589  1.00 72.79  ? 2623 HOH B O   1 
HETATM 10070 O  O   . HOH S 6 .   ? 105.375 26.764 81.294  1.00 35.04  ? 2624 HOH B O   1 
HETATM 10071 O  O   . HOH S 6 .   ? 103.512 26.358 93.261  1.00 73.42  ? 2625 HOH B O   1 
HETATM 10072 O  O   . HOH S 6 .   ? 103.345 23.035 86.864  1.00 59.57  ? 2626 HOH B O   1 
HETATM 10073 O  O   . HOH S 6 .   ? 106.970 28.268 87.291  1.00 31.36  ? 2627 HOH B O   1 
HETATM 10074 O  O   . HOH S 6 .   ? 105.868 27.536 73.800  1.00 40.02  ? 2628 HOH B O   1 
HETATM 10075 O  O   . HOH S 6 .   ? 107.544 28.012 82.477  1.00 46.63  ? 2629 HOH B O   1 
HETATM 10076 O  O   . HOH S 6 .   ? 109.836 31.701 79.933  1.00 48.41  ? 2630 HOH B O   1 
HETATM 10077 O  O   . HOH S 6 .   ? 102.440 27.618 77.031  1.00 38.66  ? 2631 HOH B O   1 
HETATM 10078 O  O   . HOH S 6 .   ? 105.722 31.693 72.234  1.00 79.51  ? 2632 HOH B O   1 
HETATM 10079 O  O   . HOH S 6 .   ? 110.325 29.873 75.290  1.00 55.53  ? 2633 HOH B O   1 
HETATM 10080 O  O   . HOH S 6 .   ? 115.106 33.457 84.802  1.00 66.77  ? 2634 HOH B O   1 
HETATM 10081 O  O   . HOH S 6 .   ? 112.986 33.832 87.716  1.00 71.63  ? 2635 HOH B O   1 
HETATM 10082 O  O   . HOH S 6 .   ? 120.620 41.600 87.644  1.00 62.02  ? 2636 HOH B O   1 
HETATM 10083 O  O   . HOH S 6 .   ? 112.648 32.471 79.913  1.00 50.61  ? 2637 HOH B O   1 
HETATM 10084 O  O   . HOH S 6 .   ? 113.286 31.420 75.771  1.00 42.56  ? 2638 HOH B O   1 
HETATM 10085 O  O   . HOH S 6 .   ? 118.628 35.879 79.984  1.00 42.36  ? 2639 HOH B O   1 
HETATM 10086 O  O   . HOH S 6 .   ? 116.744 27.773 84.507  1.00 78.23  ? 2640 HOH B O   1 
HETATM 10087 O  O   . HOH S 6 .   ? 113.018 28.078 82.000  1.00 65.85  ? 2641 HOH B O   1 
HETATM 10088 O  O   . HOH S 6 .   ? 112.808 29.559 79.621  1.00 66.70  ? 2642 HOH B O   1 
HETATM 10089 O  O   . HOH S 6 .   ? 114.091 31.110 78.174  1.00 80.42  ? 2643 HOH B O   1 
HETATM 10090 O  O   . HOH S 6 .   ? 120.722 34.060 76.229  1.00 74.34  ? 2644 HOH B O   1 
HETATM 10091 O  O   . HOH S 6 .   ? 121.914 25.021 80.822  1.00 63.20  ? 2645 HOH B O   1 
HETATM 10092 O  O   . HOH S 6 .   ? 120.227 30.698 74.632  1.00 88.19  ? 2646 HOH B O   1 
HETATM 10093 O  O   . HOH S 6 .   ? 122.760 24.875 75.076  1.00 64.59  ? 2647 HOH B O   1 
HETATM 10094 O  O   . HOH S 6 .   ? 123.941 30.166 75.904  1.00 70.52  ? 2648 HOH B O   1 
HETATM 10095 O  O   . HOH S 6 .   ? 121.744 23.231 76.993  1.00 67.52  ? 2649 HOH B O   1 
HETATM 10096 O  O   . HOH S 6 .   ? 114.211 21.919 77.662  1.00 83.27  ? 2650 HOH B O   1 
HETATM 10097 O  O   . HOH S 6 .   ? 109.010 24.718 80.937  1.00 62.42  ? 2651 HOH B O   1 
HETATM 10098 O  O   . HOH S 6 .   ? 109.838 26.137 73.726  1.00 70.54  ? 2652 HOH B O   1 
HETATM 10099 O  O   . HOH S 6 .   ? 110.033 40.452 69.125  1.00 30.32  ? 2653 HOH B O   1 
HETATM 10100 O  O   . HOH S 6 .   ? 116.061 38.860 65.772  1.00 37.59  ? 2654 HOH B O   1 
HETATM 10101 O  O   . HOH S 6 .   ? 117.012 37.811 68.668  1.00 46.42  ? 2655 HOH B O   1 
HETATM 10102 O  O   . HOH S 6 .   ? 113.162 41.085 64.000  1.00 31.46  ? 2656 HOH B O   1 
HETATM 10103 O  O   . HOH S 6 .   ? 115.957 45.390 69.002  1.00 38.58  ? 2657 HOH B O   1 
HETATM 10104 O  O   . HOH S 6 .   ? 109.992 43.784 58.136  1.00 32.86  ? 2658 HOH B O   1 
HETATM 10105 O  O   . HOH S 6 .   ? 114.835 36.302 59.273  1.00 56.50  ? 2659 HOH B O   1 
HETATM 10106 O  O   . HOH S 6 .   ? 106.218 46.243 62.395  1.00 21.36  ? 2660 HOH B O   1 
HETATM 10107 O  O   . HOH S 6 .   ? 106.643 42.370 65.179  1.00 89.84  ? 2661 HOH B O   1 
HETATM 10108 O  O   . HOH S 6 .   ? 107.002 40.217 63.703  1.00 89.22  ? 2662 HOH B O   1 
HETATM 10109 O  O   . HOH S 6 .   ? 106.576 48.542 58.963  1.00 61.96  ? 2663 HOH B O   1 
HETATM 10110 O  O   . HOH S 6 .   ? 115.794 36.577 64.057  1.00 63.86  ? 2664 HOH B O   1 
HETATM 10111 O  O   . HOH S 6 .   ? 112.969 33.929 63.809  1.00 58.86  ? 2665 HOH B O   1 
HETATM 10112 O  O   . HOH S 6 .   ? 108.341 35.736 66.867  1.00 97.85  ? 2666 HOH B O   1 
HETATM 10113 O  O   . HOH S 6 .   ? 108.592 37.343 69.557  1.00 79.24  ? 2667 HOH B O   1 
HETATM 10114 O  O   . HOH S 6 .   ? 104.740 39.297 69.307  1.00 102.40 ? 2668 HOH B O   1 
HETATM 10115 O  O   . HOH S 6 .   ? 98.958  36.767 64.561  1.00 57.32  ? 2669 HOH B O   1 
HETATM 10116 O  O   . HOH S 6 .   ? 97.127  33.670 72.873  1.00 99.99  ? 2670 HOH B O   1 
HETATM 10117 O  O   . HOH S 6 .   ? 101.538 30.230 69.346  1.00 41.28  ? 2671 HOH B O   1 
HETATM 10118 O  O   . HOH S 6 .   ? 102.634 31.001 72.385  1.00 60.05  ? 2672 HOH B O   1 
HETATM 10119 O  O   . HOH S 6 .   ? 99.884  31.032 67.553  1.00 61.85  ? 2673 HOH B O   1 
HETATM 10120 O  O   . HOH S 6 .   ? 97.075  30.366 75.656  1.00 93.18  ? 2674 HOH B O   1 
HETATM 10121 O  O   . HOH S 6 .   ? 95.847  27.085 72.060  1.00 99.45  ? 2675 HOH B O   1 
HETATM 10122 O  O   . HOH S 6 .   ? 102.131 23.933 74.205  1.00 60.68  ? 2676 HOH B O   1 
HETATM 10123 O  O   . HOH S 6 .   ? 96.039  29.405 73.649  1.00 35.17  ? 2677 HOH B O   1 
HETATM 10124 O  O   . HOH S 6 .   ? 93.758  25.579 75.747  1.00 49.08  ? 2678 HOH B O   1 
HETATM 10125 O  O   . HOH S 6 .   ? 103.489 26.138 74.193  1.00 65.31  ? 2679 HOH B O   1 
HETATM 10126 O  O   . HOH S 6 .   ? 107.059 26.231 71.405  1.00 49.81  ? 2680 HOH B O   1 
HETATM 10127 O  O   . HOH S 6 .   ? 101.906 26.323 67.747  1.00 65.23  ? 2681 HOH B O   1 
HETATM 10128 O  O   . HOH S 6 .   ? 104.292 32.719 61.397  1.00 89.53  ? 2682 HOH B O   1 
HETATM 10129 O  O   . HOH S 6 .   ? 103.889 34.206 59.338  1.00 59.32  ? 2683 HOH B O   1 
HETATM 10130 O  O   . HOH S 6 .   ? 101.480 38.516 60.678  1.00 45.92  ? 2684 HOH B O   1 
HETATM 10131 O  O   . HOH S 6 .   ? 109.330 41.716 56.875  1.00 54.29  ? 2685 HOH B O   1 
HETATM 10132 O  O   . HOH S 6 .   ? 104.309 37.058 59.275  1.00 50.53  ? 2686 HOH B O   1 
HETATM 10133 O  O   . HOH S 6 .   ? 102.633 41.204 57.938  1.00 68.91  ? 2687 HOH B O   1 
HETATM 10134 O  O   . HOH S 6 .   ? 108.780 41.785 54.282  1.00 66.35  ? 2688 HOH B O   1 
HETATM 10135 O  O   . HOH S 6 .   ? 101.811 40.907 61.395  1.00 65.20  ? 2689 HOH B O   1 
HETATM 10136 O  O   . HOH S 6 .   ? 100.180 41.879 58.693  1.00 41.87  ? 2690 HOH B O   1 
HETATM 10137 O  O   . HOH S 6 .   ? 106.076 44.030 63.639  1.00 28.97  ? 2691 HOH B O   1 
HETATM 10138 O  O   . HOH S 6 .   ? 103.537 46.359 61.787  1.00 33.59  ? 2692 HOH B O   1 
HETATM 10139 O  O   . HOH S 6 .   ? 99.229  41.256 61.700  1.00 38.08  ? 2693 HOH B O   1 
HETATM 10140 O  O   . HOH S 6 .   ? 101.883 50.005 59.708  1.00 90.69  ? 2694 HOH B O   1 
HETATM 10141 O  O   . HOH S 6 .   ? 95.033  49.321 52.610  1.00 49.41  ? 2695 HOH B O   1 
HETATM 10142 O  O   . HOH S 6 .   ? 98.549  43.872 57.864  1.00 34.07  ? 2696 HOH B O   1 
HETATM 10143 O  O   . HOH S 6 .   ? 96.515  45.476 59.046  1.00 39.23  ? 2697 HOH B O   1 
HETATM 10144 O  O   . HOH S 6 .   ? 95.742  57.786 63.741  1.00 42.70  ? 2698 HOH B O   1 
HETATM 10145 O  O   . HOH S 6 .   ? 97.796  54.471 64.543  1.00 95.79  ? 2699 HOH B O   1 
HETATM 10146 O  O   . HOH S 6 .   ? 99.113  55.938 65.955  1.00 47.40  ? 2700 HOH B O   1 
HETATM 10147 O  O   . HOH S 6 .   ? 103.068 55.350 53.358  1.00 58.84  ? 2701 HOH B O   1 
HETATM 10148 O  O   . HOH S 6 .   ? 103.183 53.247 59.468  1.00 54.18  ? 2702 HOH B O   1 
HETATM 10149 O  O   . HOH S 6 .   ? 104.683 56.025 59.922  1.00 53.83  ? 2703 HOH B O   1 
HETATM 10150 O  O   . HOH S 6 .   ? 107.502 55.406 56.450  1.00 59.90  ? 2704 HOH B O   1 
HETATM 10151 O  O   . HOH S 6 .   ? 105.436 52.712 54.972  1.00 48.03  ? 2705 HOH B O   1 
HETATM 10152 O  O   . HOH S 6 .   ? 96.746  64.851 61.446  1.00 49.85  ? 2706 HOH B O   1 
HETATM 10153 O  O   . HOH S 6 .   ? 99.588  64.785 51.141  1.00 69.99  ? 2707 HOH B O   1 
HETATM 10154 O  O   . HOH S 6 .   ? 101.897 68.390 57.299  1.00 78.97  ? 2708 HOH B O   1 
HETATM 10155 O  O   . HOH S 6 .   ? 96.835  68.291 61.077  1.00 79.95  ? 2709 HOH B O   1 
HETATM 10156 O  O   . HOH S 6 .   ? 99.244  66.851 55.107  1.00 53.14  ? 2710 HOH B O   1 
HETATM 10157 O  O   . HOH S 6 .   ? 100.629 70.353 58.660  1.00 50.81  ? 2711 HOH B O   1 
HETATM 10158 O  O   . HOH S 6 .   ? 101.870 67.964 59.734  1.00 56.76  ? 2712 HOH B O   1 
HETATM 10159 O  O   . HOH S 6 .   ? 89.518  69.878 56.489  1.00 77.44  ? 2713 HOH B O   1 
HETATM 10160 O  O   . HOH S 6 .   ? 90.563  67.383 55.011  1.00 64.15  ? 2714 HOH B O   1 
HETATM 10161 O  O   . HOH S 6 .   ? 91.794  74.114 50.052  1.00 61.41  ? 2715 HOH B O   1 
HETATM 10162 O  O   . HOH S 6 .   ? 93.509  47.156 111.233 1.00 60.79  ? 2716 HOH B O   1 
HETATM 10163 O  O   . HOH S 6 .   ? 102.358 45.762 113.116 1.00 70.73  ? 2717 HOH B O   1 
HETATM 10164 O  O   . HOH S 6 .   ? 101.754 43.427 114.485 1.00 92.78  ? 2718 HOH B O   1 
HETATM 10165 O  O   . HOH S 6 .   ? 92.436  45.063 110.421 1.00 82.97  ? 2719 HOH B O   1 
HETATM 10166 O  O   . HOH S 6 .   ? 92.224  42.673 113.422 1.00 91.68  ? 2720 HOH B O   1 
HETATM 10167 O  O   . HOH S 6 .   ? 92.210  45.276 112.899 1.00 44.63  ? 2721 HOH B O   1 
HETATM 10168 O  O   . HOH S 6 .   ? 94.816  40.720 116.065 1.00 52.10  ? 2722 HOH B O   1 
HETATM 10169 O  O   . HOH S 6 .   ? 94.639  40.187 113.645 1.00 64.07  ? 2723 HOH B O   1 
HETATM 10170 O  O   . HOH S 6 .   ? 95.923  40.289 111.068 1.00 75.70  ? 2724 HOH B O   1 
HETATM 10171 O  O   . HOH S 6 .   ? 99.144  50.140 114.722 1.00 48.57  ? 2725 HOH B O   1 
HETATM 10172 O  O   . HOH S 6 .   ? 127.313 49.505 76.620  1.00 61.65  ? 2726 HOH B O   1 
HETATM 10173 O  O   . HOH S 6 .   ? 127.587 43.819 70.709  1.00 64.04  ? 2727 HOH B O   1 
HETATM 10174 O  O   . HOH S 6 .   ? 121.886 42.392 72.548  1.00 66.54  ? 2728 HOH B O   1 
HETATM 10175 O  O   . HOH S 6 .   ? 129.374 50.391 73.887  1.00 73.69  ? 2729 HOH B O   1 
HETATM 10176 O  O   . HOH S 6 .   ? 129.264 48.152 72.498  1.00 70.72  ? 2730 HOH B O   1 
HETATM 10177 O  O   . HOH S 6 .   ? 128.193 46.334 70.495  1.00 61.39  ? 2731 HOH B O   1 
HETATM 10178 O  O   . HOH S 6 .   ? 126.888 51.626 75.057  1.00 58.13  ? 2732 HOH B O   1 
HETATM 10179 O  O   . HOH S 6 .   ? 123.831 50.205 75.710  1.00 43.43  ? 2733 HOH B O   1 
HETATM 10180 O  O   . HOH S 6 .   ? 127.759 51.745 72.235  1.00 45.30  ? 2734 HOH B O   1 
HETATM 10181 O  O   . HOH S 6 .   ? 82.611  52.653 83.078  1.00 73.42  ? 2735 HOH B O   1 
HETATM 10182 O  O   . HOH S 6 .   ? 84.363  50.784 81.806  1.00 62.68  ? 2736 HOH B O   1 
HETATM 10183 O  O   . HOH S 6 .   ? 101.327 50.362 118.465 1.00 68.23  ? 2737 HOH B O   1 
HETATM 10184 O  O   . HOH S 6 .   ? 103.774 49.132 117.925 1.00 54.61  ? 2738 HOH B O   1 
HETATM 10185 O  O   . HOH S 6 .   ? 106.766 52.313 118.930 1.00 71.14  ? 2739 HOH B O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'CCD A 1542 HAS WRONG CHIRALITY AT ATOM C5' 
2 'CCD B 1540 HAS WRONG CHIRALITY AT ATOM C5' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
B 1 1   ASP 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   ?   ?   ?   B . n 
B 1 3   HIS 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ASN 9   9   9   ASN ASN B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  LYS 14  14  14  LYS LYS B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  MET 16  16  16  MET MET B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  SER 24  24  24  SER SER B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  ILE 27  27  27  ILE ILE B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  PRO 38  38  38  PRO PRO B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ASN 42  42  42  ASN ASN B . n 
B 1 43  MET 43  43  43  MET MET B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  PHE 45  45  45  PHE PHE B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  ARG 47  47  47  ARG ARG B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  TRP 54  54  54  TRP TRP B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  TRP 58  58  58  TRP TRP B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  THR 62  62  62  THR THR B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  CYS 67  67  67  CYS CYS B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  VAL 71  71  71  VAL VAL B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  PHE 78  78  78  PHE PHE B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  TRP 84  84  84  TRP TRP B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  ARG 88  88  88  ARG ARG B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  MET 90  90  90  MET MET B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  CYS 94  94  94  CYS CYS B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 TRP 100 100 100 TRP TRP B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 MET 112 112 112 MET MET B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 TRP 114 114 114 TRP TRP B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 TYR 116 116 116 TYR TYR B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 TYR 121 121 121 TYR TYR B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 THR 126 126 126 THR THR B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 TYR 148 148 148 TYR TYR B . n 
B 1 149 ARG 149 149 149 ARG ARG B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 PHE 155 155 155 PHE PHE B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 GLN 162 162 162 GLN GLN B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 MET 175 175 175 MET MET B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 TRP 179 179 179 TRP TRP B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 HIS 181 181 181 HIS HIS B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 THR 195 195 195 THR THR B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 GLY 198 198 198 GLY GLY B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 ALA 201 201 201 ALA ALA B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 MET 208 208 208 MET MET B . n 
B 1 209 HIS 209 209 209 HIS HIS B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 SER 212 212 212 SER SER B . n 
B 1 213 PRO 213 213 213 PRO PRO B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 ASP 217 217 217 ASP ASP B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 PHE 219 219 219 PHE PHE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 GLN 225 225 225 GLN GLN B . n 
B 1 226 SER 226 226 226 SER SER B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 SER 228 228 228 SER SER B . n 
B 1 229 PRO 229 229 229 PRO PRO B . n 
B 1 230 ASN 230 230 230 ASN ASN B . n 
B 1 231 CYS 231 231 231 CYS CYS B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 TRP 233 233 233 TRP TRP B . n 
B 1 234 ALA 234 234 234 ALA ALA B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 GLU 240 240 240 GLU GLU B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 ARG 242 242 242 ARG ARG B . n 
B 1 243 ARG 243 243 243 ARG ARG B . n 
B 1 244 ARG 244 244 244 ARG ARG B . n 
B 1 245 ALA 245 245 245 ALA ALA B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 ARG 250 250 250 ARG ARG B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 ASN 253 253 253 ASN ASN B . n 
B 1 254 CYS 254 254 254 CYS CYS B . n 
B 1 255 ASN 255 255 255 ASN ASN B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 ASN 257 257 257 ASN ASN B . n 
B 1 258 SER 258 258 258 SER SER B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 GLU 260 260 260 GLU GLU B . n 
B 1 261 GLU 261 261 261 GLU GLU B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ILE 263 263 263 ILE ILE B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 ARG 267 267 267 ARG ARG B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LYS 269 269 269 LYS LYS B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 ASP 276 276 276 ASP ASP B . n 
B 1 277 VAL 277 277 277 VAL VAL B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 TRP 279 279 279 TRP TRP B . n 
B 1 280 ASN 280 280 280 ASN ASN B . n 
B 1 281 VAL 281 281 281 VAL VAL B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 PHE 284 284 284 PHE PHE B . n 
B 1 285 ASP 285 285 285 ASP ASP B . n 
B 1 286 SER 286 286 286 SER SER B . n 
B 1 287 ILE 287 287 287 ILE ILE B . n 
B 1 288 PHE 288 288 288 PHE PHE B . n 
B 1 289 ARG 289 289 289 ARG ARG B . n 
B 1 290 PHE 290 290 290 PHE PHE B . n 
B 1 291 SER 291 291 291 SER SER B . n 
B 1 292 PHE 292 292 292 PHE PHE B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 VAL 295 295 295 VAL VAL B . n 
B 1 296 ILE 296 296 296 ILE ILE B . n 
B 1 297 ASP 297 297 297 ASP ASP B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 GLU 299 299 299 GLU GLU B . n 
B 1 300 PHE 300 300 300 PHE PHE B . n 
B 1 301 PHE 301 301 301 PHE PHE B . n 
B 1 302 PRO 302 302 302 PRO PRO B . n 
B 1 303 THR 303 303 303 THR THR B . n 
B 1 304 SER 304 304 304 SER SER B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 MET 308 308 308 MET MET B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 ASN 310 310 310 ASN ASN B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 ASN 313 313 313 ASN ASN B . n 
B 1 314 PHE 314 314 314 PHE PHE B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 LYS 316 316 316 LYS LYS B . n 
B 1 317 THR 317 317 317 THR THR B . n 
B 1 318 GLN 318 318 318 GLN GLN B . n 
B 1 319 ILE 319 319 319 ILE ILE B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 GLY 322 322 322 GLY GLY B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 ASN 324 324 324 ASN ASN B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 ASP 326 326 326 ASP ASP B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 GLY 328 328 328 GLY GLY B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 PHE 331 331 331 PHE PHE B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 LEU 333 333 333 LEU LEU B . n 
B 1 334 TYR 334 334 334 TYR TYR B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PHE 339 339 339 PHE PHE B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 LYS 341 341 341 LYS LYS B . n 
B 1 342 ASP 342 342 342 ASP ASP B . n 
B 1 343 SER 343 343 343 SER SER B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 ILE 347 347 347 ILE ILE B . n 
B 1 348 SER 348 348 348 SER SER B . n 
B 1 349 ARG 349 349 349 ARG ARG B . n 
B 1 350 GLU 350 350 350 GLU GLU B . n 
B 1 351 ASP 351 351 351 ASP ASP B . n 
B 1 352 PHE 352 352 352 PHE PHE B . n 
B 1 353 MET 353 353 353 MET MET B . n 
B 1 354 SER 354 354 354 SER SER B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 VAL 356 356 356 VAL VAL B . n 
B 1 357 LYS 357 357 357 LYS LYS B . n 
B 1 358 LEU 358 358 358 LEU LEU B . n 
B 1 359 SER 359 359 359 SER SER B . n 
B 1 360 VAL 360 360 360 VAL VAL B . n 
B 1 361 PRO 361 361 361 PRO PRO B . n 
B 1 362 HIS 362 362 362 HIS HIS B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 ASP 365 365 365 ASP ASP B . n 
B 1 366 LEU 366 366 366 LEU LEU B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 LEU 368 368 368 LEU LEU B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 THR 372 372 372 THR THR B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 GLN 374 374 374 GLN GLN B . n 
B 1 375 TYR 375 375 375 TYR TYR B . n 
B 1 376 THR 376 376 376 THR THR B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 TRP 378 378 378 TRP TRP B . n 
B 1 379 MET 379 379 379 MET MET B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 ASP 381 381 381 ASP ASP B . n 
B 1 382 ASN 382 382 382 ASN ASN B . n 
B 1 383 ASN 383 383 383 ASN ASN B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 ILE 385 385 385 ILE ILE B . n 
B 1 386 LYS 386 386 386 LYS LYS B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 ARG 388 388 388 ARG ARG B . n 
B 1 389 ASP 389 389 389 ASP ASP B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 LEU 391 391 391 LEU LEU B . n 
B 1 392 ASP 392 392 392 ASP ASP B . n 
B 1 393 ASP 393 393 393 ASP ASP B . n 
B 1 394 ILE 394 394 394 ILE ILE B . n 
B 1 395 VAL 395 395 395 VAL VAL B . n 
B 1 396 GLY 396 396 396 GLY GLY B . n 
B 1 397 ASP 397 397 397 ASP ASP B . n 
B 1 398 HIS 398 398 398 HIS HIS B . n 
B 1 399 ASN 399 399 399 ASN ASN B . n 
B 1 400 VAL 400 400 400 VAL VAL B . n 
B 1 401 ILE 401 401 401 ILE ILE B . n 
B 1 402 CYS 402 402 402 CYS CYS B . n 
B 1 403 PRO 403 403 403 PRO PRO B . n 
B 1 404 LEU 404 404 404 LEU LEU B . n 
B 1 405 MET 405 405 405 MET MET B . n 
B 1 406 HIS 406 406 406 HIS HIS B . n 
B 1 407 PHE 407 407 407 PHE PHE B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 ASN 409 409 409 ASN ASN B . n 
B 1 410 LYS 410 410 410 LYS LYS B . n 
B 1 411 TYR 411 411 411 TYR TYR B . n 
B 1 412 THR 412 412 412 THR THR B . n 
B 1 413 LYS 413 413 413 LYS LYS B . n 
B 1 414 PHE 414 414 414 PHE PHE B . n 
B 1 415 GLY 415 415 415 GLY GLY B . n 
B 1 416 ASN 416 416 416 ASN ASN B . n 
B 1 417 GLY 417 417 417 GLY GLY B . n 
B 1 418 THR 418 418 418 THR THR B . n 
B 1 419 TYR 419 419 419 TYR TYR B . n 
B 1 420 LEU 420 420 420 LEU LEU B . n 
B 1 421 TYR 421 421 421 TYR TYR B . n 
B 1 422 PHE 422 422 422 PHE PHE B . n 
B 1 423 PHE 423 423 423 PHE PHE B . n 
B 1 424 ASN 424 424 424 ASN ASN B . n 
B 1 425 HIS 425 425 425 HIS HIS B . n 
B 1 426 ARG 426 426 426 ARG ARG B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 SER 428 428 428 SER SER B . n 
B 1 429 ASN 429 429 429 ASN ASN B . n 
B 1 430 LEU 430 430 430 LEU LEU B . n 
B 1 431 VAL 431 431 431 VAL VAL B . n 
B 1 432 TRP 432 432 432 TRP TRP B . n 
B 1 433 PRO 433 433 433 PRO PRO B . n 
B 1 434 GLU 434 434 434 GLU GLU B . n 
B 1 435 TRP 435 435 435 TRP TRP B . n 
B 1 436 MET 436 436 436 MET MET B . n 
B 1 437 GLY 437 437 437 GLY GLY B . n 
B 1 438 VAL 438 438 438 VAL VAL B . n 
B 1 439 ILE 439 439 439 ILE ILE B . n 
B 1 440 HIS 440 440 440 HIS HIS B . n 
B 1 441 GLY 441 441 441 GLY GLY B . n 
B 1 442 TYR 442 442 442 TYR TYR B . n 
B 1 443 GLU 443 443 443 GLU GLU B . n 
B 1 444 ILE 444 444 444 ILE ILE B . n 
B 1 445 GLU 445 445 445 GLU GLU B . n 
B 1 446 PHE 446 446 446 PHE PHE B . n 
B 1 447 VAL 447 447 447 VAL VAL B . n 
B 1 448 PHE 448 448 448 PHE PHE B . n 
B 1 449 GLY 449 449 449 GLY GLY B . n 
B 1 450 LEU 450 450 450 LEU LEU B . n 
B 1 451 PRO 451 451 451 PRO PRO B . n 
B 1 452 LEU 452 452 452 LEU LEU B . n 
B 1 453 VAL 453 453 453 VAL VAL B . n 
B 1 454 LYS 454 454 454 LYS LYS B . n 
B 1 455 GLU 455 455 455 GLU GLU B . n 
B 1 456 LEU 456 456 456 LEU LEU B . n 
B 1 457 ASN 457 457 457 ASN ASN B . n 
B 1 458 TYR 458 458 458 TYR TYR B . n 
B 1 459 THR 459 459 459 THR THR B . n 
B 1 460 ALA 460 460 460 ALA ALA B . n 
B 1 461 GLU 461 461 461 GLU GLU B . n 
B 1 462 GLU 462 462 462 GLU GLU B . n 
B 1 463 GLU 463 463 463 GLU GLU B . n 
B 1 464 ALA 464 464 464 ALA ALA B . n 
B 1 465 LEU 465 465 465 LEU LEU B . n 
B 1 466 SER 466 466 466 SER SER B . n 
B 1 467 ARG 467 467 467 ARG ARG B . n 
B 1 468 ARG 468 468 468 ARG ARG B . n 
B 1 469 ILE 469 469 469 ILE ILE B . n 
B 1 470 MET 470 470 470 MET MET B . n 
B 1 471 HIS 471 471 471 HIS HIS B . n 
B 1 472 TYR 472 472 472 TYR TYR B . n 
B 1 473 TRP 473 473 473 TRP TRP B . n 
B 1 474 ALA 474 474 474 ALA ALA B . n 
B 1 475 THR 475 475 475 THR THR B . n 
B 1 476 PHE 476 476 476 PHE PHE B . n 
B 1 477 ALA 477 477 477 ALA ALA B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 THR 479 479 479 THR THR B . n 
B 1 480 GLY 480 480 480 GLY GLY B . n 
B 1 481 ASN 481 481 481 ASN ASN B . n 
B 1 482 PRO 482 482 482 PRO PRO B . n 
B 1 483 ASN 483 483 483 ASN ASN B . n 
B 1 484 GLU 484 484 484 GLU GLU B . n 
B 1 485 PRO 485 485 485 PRO PRO B . n 
B 1 486 HIS 486 486 486 HIS HIS B . n 
B 1 487 SER 487 487 487 SER SER B . n 
B 1 488 GLN 488 488 488 GLN GLN B . n 
B 1 489 GLU 489 489 489 GLU GLU B . n 
B 1 490 SER 490 490 490 SER SER B . n 
B 1 491 LYS 491 491 491 LYS LYS B . n 
B 1 492 TRP 492 492 492 TRP TRP B . n 
B 1 493 PRO 493 493 493 PRO PRO B . n 
B 1 494 LEU 494 494 494 LEU LEU B . n 
B 1 495 PHE 495 495 495 PHE PHE B . n 
B 1 496 THR 496 496 496 THR THR B . n 
B 1 497 THR 497 497 497 THR THR B . n 
B 1 498 LYS 498 498 498 LYS LYS B . n 
B 1 499 GLU 499 499 499 GLU GLU B . n 
B 1 500 GLN 500 500 500 GLN GLN B . n 
B 1 501 LYS 501 501 501 LYS LYS B . n 
B 1 502 PHE 502 502 502 PHE PHE B . n 
B 1 503 ILE 503 503 503 ILE ILE B . n 
B 1 504 ASP 504 504 504 ASP ASP B . n 
B 1 505 LEU 505 505 505 LEU LEU B . n 
B 1 506 ASN 506 506 506 ASN ASN B . n 
B 1 507 THR 507 507 507 THR THR B . n 
B 1 508 GLU 508 508 508 GLU GLU B . n 
B 1 509 PRO 509 509 509 PRO PRO B . n 
B 1 510 MET 510 510 510 MET MET B . n 
B 1 511 LYS 511 511 511 LYS LYS B . n 
B 1 512 VAL 512 512 512 VAL VAL B . n 
B 1 513 HIS 513 513 513 HIS HIS B . n 
B 1 514 GLN 514 514 514 GLN GLN B . n 
B 1 515 ARG 515 515 515 ARG ARG B . n 
B 1 516 LEU 516 516 516 LEU LEU B . n 
B 1 517 ARG 517 517 517 ARG ARG B . n 
B 1 518 VAL 518 518 518 VAL VAL B . n 
B 1 519 GLN 519 519 519 GLN GLN B . n 
B 1 520 MET 520 520 520 MET MET B . n 
B 1 521 CYS 521 521 521 CYS CYS B . n 
B 1 522 VAL 522 522 522 VAL VAL B . n 
B 1 523 PHE 523 523 523 PHE PHE B . n 
B 1 524 TRP 524 524 524 TRP TRP B . n 
B 1 525 ASN 525 525 525 ASN ASN B . n 
B 1 526 GLN 526 526 526 GLN GLN B . n 
B 1 527 PHE 527 527 527 PHE PHE B . n 
B 1 528 LEU 528 528 528 LEU LEU B . n 
B 1 529 PRO 529 529 529 PRO PRO B . n 
B 1 530 LYS 530 530 530 LYS LYS B . n 
B 1 531 LEU 531 531 531 LEU LEU B . n 
B 1 532 LEU 532 532 532 LEU LEU B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ALA 534 534 534 ALA ALA B . n 
B 1 535 THR 535 535 535 THR THR B . n 
B 1 536 ALA 536 536 ?   ?   ?   B . n 
B 1 537 CYS 537 537 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   1536 1536 NAG NAG A . 
D 2 NAG 1   1537 1537 NAG NAG A . 
E 3 CL  1   1538 1538 CL  CL  A . 
F 3 CL  1   1539 1539 CL  CL  A . 
G 3 CL  1   1540 1540 CL  CL  A . 
H 4 CCD 1   1541 1541 CCD CCD A . 
I 4 CCD 1   1542 1542 CCD CCD A . 
J 5 PGE 1   1543 1543 PGE PGE A . 
K 5 PGE 1   1544 1544 PGE PGE A . 
L 2 NAG 1   1536 1536 NAG NAG B . 
M 2 NAG 1   1537 1537 NAG NAG B . 
N 4 CCD 1   1539 1539 CCD CCD B . 
O 4 CCD 1   1540 1540 CCD CCD B . 
P 5 PGE 1   1541 1541 PGE PGE B . 
Q 3 CL  1   1542 1542 CL  CL  B . 
R 6 HOH 1   2001 2001 HOH HOH A . 
R 6 HOH 2   2002 2002 HOH HOH A . 
R 6 HOH 3   2003 2003 HOH HOH A . 
R 6 HOH 4   2004 2004 HOH HOH A . 
R 6 HOH 5   2005 2005 HOH HOH A . 
R 6 HOH 6   2006 2006 HOH HOH A . 
R 6 HOH 7   2007 2007 HOH HOH A . 
R 6 HOH 8   2008 2008 HOH HOH A . 
R 6 HOH 9   2009 2009 HOH HOH A . 
R 6 HOH 10  2010 2010 HOH HOH A . 
R 6 HOH 11  2011 2011 HOH HOH A . 
R 6 HOH 12  2012 2012 HOH HOH A . 
R 6 HOH 13  2013 2013 HOH HOH A . 
R 6 HOH 14  2014 2014 HOH HOH A . 
R 6 HOH 15  2015 2015 HOH HOH A . 
R 6 HOH 16  2016 2016 HOH HOH A . 
R 6 HOH 17  2017 2017 HOH HOH A . 
R 6 HOH 18  2018 2018 HOH HOH A . 
R 6 HOH 19  2019 2019 HOH HOH A . 
R 6 HOH 20  2020 2020 HOH HOH A . 
R 6 HOH 21  2021 2021 HOH HOH A . 
R 6 HOH 22  2022 2022 HOH HOH A . 
R 6 HOH 23  2023 2023 HOH HOH A . 
R 6 HOH 24  2024 2024 HOH HOH A . 
R 6 HOH 25  2025 2025 HOH HOH A . 
R 6 HOH 26  2026 2026 HOH HOH A . 
R 6 HOH 27  2027 2027 HOH HOH A . 
R 6 HOH 28  2028 2028 HOH HOH A . 
R 6 HOH 29  2029 2029 HOH HOH A . 
R 6 HOH 30  2030 2030 HOH HOH A . 
R 6 HOH 31  2031 2031 HOH HOH A . 
R 6 HOH 32  2032 2032 HOH HOH A . 
R 6 HOH 33  2033 2033 HOH HOH A . 
R 6 HOH 34  2034 2034 HOH HOH A . 
R 6 HOH 35  2035 2035 HOH HOH A . 
R 6 HOH 36  2036 2036 HOH HOH A . 
R 6 HOH 37  2037 2037 HOH HOH A . 
R 6 HOH 38  2038 2038 HOH HOH A . 
R 6 HOH 39  2039 2039 HOH HOH A . 
R 6 HOH 40  2040 2040 HOH HOH A . 
R 6 HOH 41  2041 2041 HOH HOH A . 
R 6 HOH 42  2042 2042 HOH HOH A . 
R 6 HOH 43  2043 2043 HOH HOH A . 
R 6 HOH 44  2044 2044 HOH HOH A . 
R 6 HOH 45  2045 2045 HOH HOH A . 
R 6 HOH 46  2046 2046 HOH HOH A . 
R 6 HOH 47  2047 2047 HOH HOH A . 
R 6 HOH 48  2048 2048 HOH HOH A . 
R 6 HOH 49  2049 2049 HOH HOH A . 
R 6 HOH 50  2050 2050 HOH HOH A . 
R 6 HOH 51  2051 2051 HOH HOH A . 
R 6 HOH 52  2052 2052 HOH HOH A . 
R 6 HOH 53  2053 2053 HOH HOH A . 
R 6 HOH 54  2054 2054 HOH HOH A . 
R 6 HOH 55  2055 2055 HOH HOH A . 
R 6 HOH 56  2056 2056 HOH HOH A . 
R 6 HOH 57  2057 2057 HOH HOH A . 
R 6 HOH 58  2058 2058 HOH HOH A . 
R 6 HOH 59  2059 2059 HOH HOH A . 
R 6 HOH 60  2060 2060 HOH HOH A . 
R 6 HOH 61  2061 2061 HOH HOH A . 
R 6 HOH 62  2062 2062 HOH HOH A . 
R 6 HOH 63  2063 2063 HOH HOH A . 
R 6 HOH 64  2064 2064 HOH HOH A . 
R 6 HOH 65  2065 2065 HOH HOH A . 
R 6 HOH 66  2066 2066 HOH HOH A . 
R 6 HOH 67  2067 2067 HOH HOH A . 
R 6 HOH 68  2068 2068 HOH HOH A . 
R 6 HOH 69  2069 2069 HOH HOH A . 
R 6 HOH 70  2070 2070 HOH HOH A . 
R 6 HOH 71  2071 2071 HOH HOH A . 
R 6 HOH 72  2072 2072 HOH HOH A . 
R 6 HOH 73  2073 2073 HOH HOH A . 
R 6 HOH 74  2074 2074 HOH HOH A . 
R 6 HOH 75  2075 2075 HOH HOH A . 
R 6 HOH 76  2076 2076 HOH HOH A . 
R 6 HOH 77  2077 2077 HOH HOH A . 
R 6 HOH 78  2078 2078 HOH HOH A . 
R 6 HOH 79  2079 2079 HOH HOH A . 
R 6 HOH 80  2080 2080 HOH HOH A . 
R 6 HOH 81  2081 2081 HOH HOH A . 
R 6 HOH 82  2082 2082 HOH HOH A . 
R 6 HOH 83  2083 2083 HOH HOH A . 
R 6 HOH 84  2084 2084 HOH HOH A . 
R 6 HOH 85  2085 2085 HOH HOH A . 
R 6 HOH 86  2086 2086 HOH HOH A . 
R 6 HOH 87  2087 2087 HOH HOH A . 
R 6 HOH 88  2088 2088 HOH HOH A . 
R 6 HOH 89  2089 2089 HOH HOH A . 
R 6 HOH 90  2090 2090 HOH HOH A . 
R 6 HOH 91  2091 2091 HOH HOH A . 
R 6 HOH 92  2092 2092 HOH HOH A . 
R 6 HOH 93  2093 2093 HOH HOH A . 
R 6 HOH 94  2094 2094 HOH HOH A . 
R 6 HOH 95  2095 2095 HOH HOH A . 
R 6 HOH 96  2096 2096 HOH HOH A . 
R 6 HOH 97  2097 2097 HOH HOH A . 
R 6 HOH 98  2098 2098 HOH HOH A . 
R 6 HOH 99  2099 2099 HOH HOH A . 
R 6 HOH 100 2100 2100 HOH HOH A . 
R 6 HOH 101 2101 2101 HOH HOH A . 
R 6 HOH 102 2102 2102 HOH HOH A . 
R 6 HOH 103 2103 2103 HOH HOH A . 
R 6 HOH 104 2104 2104 HOH HOH A . 
R 6 HOH 105 2105 2105 HOH HOH A . 
R 6 HOH 106 2106 2106 HOH HOH A . 
R 6 HOH 107 2107 2107 HOH HOH A . 
R 6 HOH 108 2108 2108 HOH HOH A . 
R 6 HOH 109 2109 2109 HOH HOH A . 
R 6 HOH 110 2110 2110 HOH HOH A . 
R 6 HOH 111 2111 2111 HOH HOH A . 
R 6 HOH 112 2112 2112 HOH HOH A . 
R 6 HOH 113 2113 2113 HOH HOH A . 
R 6 HOH 114 2114 2114 HOH HOH A . 
R 6 HOH 115 2115 2115 HOH HOH A . 
R 6 HOH 116 2116 2116 HOH HOH A . 
R 6 HOH 117 2117 2117 HOH HOH A . 
R 6 HOH 118 2118 2118 HOH HOH A . 
R 6 HOH 119 2119 2119 HOH HOH A . 
R 6 HOH 120 2120 2120 HOH HOH A . 
R 6 HOH 121 2121 2121 HOH HOH A . 
R 6 HOH 122 2122 2122 HOH HOH A . 
R 6 HOH 123 2123 2123 HOH HOH A . 
R 6 HOH 124 2124 2124 HOH HOH A . 
R 6 HOH 125 2125 2125 HOH HOH A . 
R 6 HOH 126 2126 2126 HOH HOH A . 
R 6 HOH 127 2127 2127 HOH HOH A . 
R 6 HOH 128 2128 2128 HOH HOH A . 
R 6 HOH 129 2129 2129 HOH HOH A . 
R 6 HOH 130 2130 2130 HOH HOH A . 
R 6 HOH 131 2131 2131 HOH HOH A . 
R 6 HOH 132 2132 2132 HOH HOH A . 
R 6 HOH 133 2133 2133 HOH HOH A . 
R 6 HOH 134 2134 2134 HOH HOH A . 
R 6 HOH 135 2135 2135 HOH HOH A . 
R 6 HOH 136 2136 2136 HOH HOH A . 
R 6 HOH 137 2137 2137 HOH HOH A . 
R 6 HOH 138 2138 2138 HOH HOH A . 
R 6 HOH 139 2139 2139 HOH HOH A . 
R 6 HOH 140 2140 2140 HOH HOH A . 
R 6 HOH 141 2141 2141 HOH HOH A . 
R 6 HOH 142 2142 2142 HOH HOH A . 
R 6 HOH 143 2143 2143 HOH HOH A . 
R 6 HOH 144 2144 2144 HOH HOH A . 
R 6 HOH 145 2145 2145 HOH HOH A . 
R 6 HOH 146 2146 2146 HOH HOH A . 
R 6 HOH 147 2147 2147 HOH HOH A . 
R 6 HOH 148 2148 2148 HOH HOH A . 
R 6 HOH 149 2149 2149 HOH HOH A . 
R 6 HOH 150 2150 2150 HOH HOH A . 
R 6 HOH 151 2151 2151 HOH HOH A . 
R 6 HOH 152 2152 2152 HOH HOH A . 
R 6 HOH 153 2153 2153 HOH HOH A . 
R 6 HOH 154 2154 2154 HOH HOH A . 
R 6 HOH 155 2155 2155 HOH HOH A . 
R 6 HOH 156 2156 2156 HOH HOH A . 
R 6 HOH 157 2157 2157 HOH HOH A . 
R 6 HOH 158 2158 2158 HOH HOH A . 
R 6 HOH 159 2159 2159 HOH HOH A . 
R 6 HOH 160 2160 2160 HOH HOH A . 
R 6 HOH 161 2161 2161 HOH HOH A . 
R 6 HOH 162 2162 2162 HOH HOH A . 
R 6 HOH 163 2163 2163 HOH HOH A . 
R 6 HOH 164 2164 2164 HOH HOH A . 
R 6 HOH 165 2165 2165 HOH HOH A . 
R 6 HOH 166 2166 2166 HOH HOH A . 
R 6 HOH 167 2167 2167 HOH HOH A . 
R 6 HOH 168 2168 2168 HOH HOH A . 
R 6 HOH 169 2169 2169 HOH HOH A . 
R 6 HOH 170 2170 2170 HOH HOH A . 
R 6 HOH 171 2171 2171 HOH HOH A . 
R 6 HOH 172 2172 2172 HOH HOH A . 
R 6 HOH 173 2173 2173 HOH HOH A . 
R 6 HOH 174 2174 2174 HOH HOH A . 
R 6 HOH 175 2175 2175 HOH HOH A . 
R 6 HOH 176 2176 2176 HOH HOH A . 
R 6 HOH 177 2177 2177 HOH HOH A . 
R 6 HOH 178 2178 2178 HOH HOH A . 
R 6 HOH 179 2179 2179 HOH HOH A . 
R 6 HOH 180 2180 2180 HOH HOH A . 
R 6 HOH 181 2181 2181 HOH HOH A . 
R 6 HOH 182 2182 2182 HOH HOH A . 
R 6 HOH 183 2183 2183 HOH HOH A . 
R 6 HOH 184 2184 2184 HOH HOH A . 
R 6 HOH 185 2185 2185 HOH HOH A . 
R 6 HOH 186 2186 2186 HOH HOH A . 
R 6 HOH 187 2187 2187 HOH HOH A . 
R 6 HOH 188 2188 2188 HOH HOH A . 
R 6 HOH 189 2189 2189 HOH HOH A . 
R 6 HOH 190 2190 2190 HOH HOH A . 
R 6 HOH 191 2191 2191 HOH HOH A . 
R 6 HOH 192 2192 2192 HOH HOH A . 
R 6 HOH 193 2193 2193 HOH HOH A . 
R 6 HOH 194 2194 2194 HOH HOH A . 
R 6 HOH 195 2195 2195 HOH HOH A . 
R 6 HOH 196 2196 2196 HOH HOH A . 
R 6 HOH 197 2197 2197 HOH HOH A . 
R 6 HOH 198 2198 2198 HOH HOH A . 
R 6 HOH 199 2199 2199 HOH HOH A . 
R 6 HOH 200 2200 2200 HOH HOH A . 
R 6 HOH 201 2201 2201 HOH HOH A . 
R 6 HOH 202 2202 2202 HOH HOH A . 
R 6 HOH 203 2203 2203 HOH HOH A . 
R 6 HOH 204 2204 2204 HOH HOH A . 
R 6 HOH 205 2205 2205 HOH HOH A . 
R 6 HOH 206 2206 2206 HOH HOH A . 
R 6 HOH 207 2207 2207 HOH HOH A . 
R 6 HOH 208 2208 2208 HOH HOH A . 
R 6 HOH 209 2209 2209 HOH HOH A . 
R 6 HOH 210 2210 2210 HOH HOH A . 
R 6 HOH 211 2211 2211 HOH HOH A . 
R 6 HOH 212 2212 2212 HOH HOH A . 
R 6 HOH 213 2213 2213 HOH HOH A . 
R 6 HOH 214 2214 2214 HOH HOH A . 
R 6 HOH 215 2215 2215 HOH HOH A . 
R 6 HOH 216 2216 2216 HOH HOH A . 
R 6 HOH 217 2217 2217 HOH HOH A . 
R 6 HOH 218 2218 2218 HOH HOH A . 
R 6 HOH 219 2219 2219 HOH HOH A . 
R 6 HOH 220 2220 2220 HOH HOH A . 
R 6 HOH 221 2221 2221 HOH HOH A . 
R 6 HOH 222 2222 2222 HOH HOH A . 
R 6 HOH 223 2223 2223 HOH HOH A . 
R 6 HOH 224 2224 2224 HOH HOH A . 
R 6 HOH 225 2225 2225 HOH HOH A . 
R 6 HOH 226 2226 2226 HOH HOH A . 
R 6 HOH 227 2227 2227 HOH HOH A . 
R 6 HOH 228 2228 2228 HOH HOH A . 
R 6 HOH 229 2229 2229 HOH HOH A . 
R 6 HOH 230 2230 2230 HOH HOH A . 
R 6 HOH 231 2231 2231 HOH HOH A . 
R 6 HOH 232 2232 2232 HOH HOH A . 
R 6 HOH 233 2233 2233 HOH HOH A . 
R 6 HOH 234 2234 2234 HOH HOH A . 
R 6 HOH 235 2235 2235 HOH HOH A . 
R 6 HOH 236 2236 2236 HOH HOH A . 
R 6 HOH 237 2237 2237 HOH HOH A . 
R 6 HOH 238 2238 2238 HOH HOH A . 
R 6 HOH 239 2239 2239 HOH HOH A . 
R 6 HOH 240 2240 2240 HOH HOH A . 
R 6 HOH 241 2241 2241 HOH HOH A . 
R 6 HOH 242 2242 2242 HOH HOH A . 
R 6 HOH 243 2243 2243 HOH HOH A . 
R 6 HOH 244 2244 2244 HOH HOH A . 
R 6 HOH 245 2245 2245 HOH HOH A . 
R 6 HOH 246 2246 2246 HOH HOH A . 
R 6 HOH 247 2247 2247 HOH HOH A . 
R 6 HOH 248 2248 2248 HOH HOH A . 
R 6 HOH 249 2249 2249 HOH HOH A . 
R 6 HOH 250 2250 2250 HOH HOH A . 
R 6 HOH 251 2251 2251 HOH HOH A . 
R 6 HOH 252 2252 2252 HOH HOH A . 
R 6 HOH 253 2253 2253 HOH HOH A . 
R 6 HOH 254 2254 2254 HOH HOH A . 
R 6 HOH 255 2255 2255 HOH HOH A . 
R 6 HOH 256 2256 2256 HOH HOH A . 
R 6 HOH 257 2257 2257 HOH HOH A . 
R 6 HOH 258 2258 2258 HOH HOH A . 
R 6 HOH 259 2259 2259 HOH HOH A . 
R 6 HOH 260 2260 2260 HOH HOH A . 
R 6 HOH 261 2261 2261 HOH HOH A . 
R 6 HOH 262 2262 2262 HOH HOH A . 
R 6 HOH 263 2263 2263 HOH HOH A . 
R 6 HOH 264 2264 2264 HOH HOH A . 
R 6 HOH 265 2265 2265 HOH HOH A . 
R 6 HOH 266 2266 2266 HOH HOH A . 
R 6 HOH 267 2267 2267 HOH HOH A . 
R 6 HOH 268 2268 2268 HOH HOH A . 
R 6 HOH 269 2269 2269 HOH HOH A . 
R 6 HOH 270 2270 2270 HOH HOH A . 
R 6 HOH 271 2271 2271 HOH HOH A . 
R 6 HOH 272 2272 2272 HOH HOH A . 
R 6 HOH 273 2273 2273 HOH HOH A . 
R 6 HOH 274 2274 2274 HOH HOH A . 
R 6 HOH 275 2275 2275 HOH HOH A . 
R 6 HOH 276 2276 2276 HOH HOH A . 
R 6 HOH 277 2277 2277 HOH HOH A . 
R 6 HOH 278 2278 2278 HOH HOH A . 
R 6 HOH 279 2279 2279 HOH HOH A . 
R 6 HOH 280 2280 2280 HOH HOH A . 
R 6 HOH 281 2281 2281 HOH HOH A . 
R 6 HOH 282 2282 2282 HOH HOH A . 
R 6 HOH 283 2283 2283 HOH HOH A . 
R 6 HOH 284 2284 2284 HOH HOH A . 
R 6 HOH 285 2285 2285 HOH HOH A . 
R 6 HOH 286 2286 2286 HOH HOH A . 
R 6 HOH 287 2287 2287 HOH HOH A . 
R 6 HOH 288 2288 2288 HOH HOH A . 
R 6 HOH 289 2289 2289 HOH HOH A . 
R 6 HOH 290 2290 2290 HOH HOH A . 
R 6 HOH 291 2291 2291 HOH HOH A . 
R 6 HOH 292 2292 2292 HOH HOH A . 
R 6 HOH 293 2293 2293 HOH HOH A . 
R 6 HOH 294 2294 2294 HOH HOH A . 
R 6 HOH 295 2295 2295 HOH HOH A . 
R 6 HOH 296 2296 2296 HOH HOH A . 
R 6 HOH 297 2297 2297 HOH HOH A . 
R 6 HOH 298 2298 2298 HOH HOH A . 
R 6 HOH 299 2299 2299 HOH HOH A . 
R 6 HOH 300 2300 2300 HOH HOH A . 
R 6 HOH 301 2301 2301 HOH HOH A . 
R 6 HOH 302 2302 2302 HOH HOH A . 
R 6 HOH 303 2303 2303 HOH HOH A . 
R 6 HOH 304 2304 2304 HOH HOH A . 
R 6 HOH 305 2305 2305 HOH HOH A . 
R 6 HOH 306 2306 2306 HOH HOH A . 
R 6 HOH 307 2307 2307 HOH HOH A . 
R 6 HOH 308 2308 2308 HOH HOH A . 
R 6 HOH 309 2309 2309 HOH HOH A . 
R 6 HOH 310 2310 2310 HOH HOH A . 
R 6 HOH 311 2311 2311 HOH HOH A . 
R 6 HOH 312 2312 2312 HOH HOH A . 
R 6 HOH 313 2313 2313 HOH HOH A . 
R 6 HOH 314 2314 2314 HOH HOH A . 
R 6 HOH 315 2315 2315 HOH HOH A . 
R 6 HOH 316 2316 2316 HOH HOH A . 
R 6 HOH 317 2317 2317 HOH HOH A . 
R 6 HOH 318 2318 2318 HOH HOH A . 
R 6 HOH 319 2319 2319 HOH HOH A . 
R 6 HOH 320 2320 2320 HOH HOH A . 
R 6 HOH 321 2321 2321 HOH HOH A . 
R 6 HOH 322 2322 2322 HOH HOH A . 
R 6 HOH 323 2323 2323 HOH HOH A . 
R 6 HOH 324 2324 2324 HOH HOH A . 
R 6 HOH 325 2325 2325 HOH HOH A . 
R 6 HOH 326 2326 2326 HOH HOH A . 
R 6 HOH 327 2327 2327 HOH HOH A . 
R 6 HOH 328 2328 2328 HOH HOH A . 
R 6 HOH 329 2329 2329 HOH HOH A . 
R 6 HOH 330 2330 2330 HOH HOH A . 
R 6 HOH 331 2331 2331 HOH HOH A . 
R 6 HOH 332 2332 2332 HOH HOH A . 
R 6 HOH 333 2333 2333 HOH HOH A . 
R 6 HOH 334 2334 2334 HOH HOH A . 
R 6 HOH 335 2335 2335 HOH HOH A . 
R 6 HOH 336 2336 2336 HOH HOH A . 
R 6 HOH 337 2337 2337 HOH HOH A . 
R 6 HOH 338 2338 2338 HOH HOH A . 
R 6 HOH 339 2339 2339 HOH HOH A . 
R 6 HOH 340 2340 2340 HOH HOH A . 
R 6 HOH 341 2341 2341 HOH HOH A . 
R 6 HOH 342 2342 2342 HOH HOH A . 
R 6 HOH 343 2343 2343 HOH HOH A . 
R 6 HOH 344 2344 2344 HOH HOH A . 
R 6 HOH 345 2345 2345 HOH HOH A . 
R 6 HOH 346 2346 2346 HOH HOH A . 
R 6 HOH 347 2347 2347 HOH HOH A . 
R 6 HOH 348 2348 2348 HOH HOH A . 
R 6 HOH 349 2349 2349 HOH HOH A . 
R 6 HOH 350 2350 2350 HOH HOH A . 
R 6 HOH 351 2351 2351 HOH HOH A . 
R 6 HOH 352 2352 2352 HOH HOH A . 
R 6 HOH 353 2353 2353 HOH HOH A . 
R 6 HOH 354 2354 2354 HOH HOH A . 
R 6 HOH 355 2355 2355 HOH HOH A . 
R 6 HOH 356 2356 2356 HOH HOH A . 
R 6 HOH 357 2357 2357 HOH HOH A . 
R 6 HOH 358 2358 2358 HOH HOH A . 
R 6 HOH 359 2359 2359 HOH HOH A . 
R 6 HOH 360 2360 2360 HOH HOH A . 
R 6 HOH 361 2361 2361 HOH HOH A . 
R 6 HOH 362 2362 2362 HOH HOH A . 
R 6 HOH 363 2363 2363 HOH HOH A . 
R 6 HOH 364 2364 2364 HOH HOH A . 
R 6 HOH 365 2365 2365 HOH HOH A . 
R 6 HOH 366 2366 2366 HOH HOH A . 
R 6 HOH 367 2367 2367 HOH HOH A . 
R 6 HOH 368 2368 2368 HOH HOH A . 
R 6 HOH 369 2369 2369 HOH HOH A . 
R 6 HOH 370 2370 2370 HOH HOH A . 
R 6 HOH 371 2371 2371 HOH HOH A . 
R 6 HOH 372 2372 2372 HOH HOH A . 
R 6 HOH 373 2373 2373 HOH HOH A . 
R 6 HOH 374 2374 2374 HOH HOH A . 
R 6 HOH 375 2375 2375 HOH HOH A . 
R 6 HOH 376 2376 2376 HOH HOH A . 
R 6 HOH 377 2377 2377 HOH HOH A . 
R 6 HOH 378 2378 2378 HOH HOH A . 
R 6 HOH 379 2379 2379 HOH HOH A . 
R 6 HOH 380 2380 2380 HOH HOH A . 
R 6 HOH 381 2381 2381 HOH HOH A . 
R 6 HOH 382 2382 2382 HOH HOH A . 
R 6 HOH 383 2383 2383 HOH HOH A . 
R 6 HOH 384 2384 2384 HOH HOH A . 
R 6 HOH 385 2385 2385 HOH HOH A . 
R 6 HOH 386 2386 2386 HOH HOH A . 
R 6 HOH 387 2387 2387 HOH HOH A . 
R 6 HOH 388 2388 2388 HOH HOH A . 
R 6 HOH 389 2389 2389 HOH HOH A . 
R 6 HOH 390 2390 2390 HOH HOH A . 
R 6 HOH 391 2391 2391 HOH HOH A . 
R 6 HOH 392 2392 2392 HOH HOH A . 
R 6 HOH 393 2393 2393 HOH HOH A . 
R 6 HOH 394 2394 2394 HOH HOH A . 
R 6 HOH 395 2395 2395 HOH HOH A . 
R 6 HOH 396 2396 2396 HOH HOH A . 
R 6 HOH 397 2397 2397 HOH HOH A . 
R 6 HOH 398 2398 2398 HOH HOH A . 
R 6 HOH 399 2399 2399 HOH HOH A . 
R 6 HOH 400 2400 2400 HOH HOH A . 
R 6 HOH 401 2401 2401 HOH HOH A . 
R 6 HOH 402 2402 2402 HOH HOH A . 
R 6 HOH 403 2403 2403 HOH HOH A . 
R 6 HOH 404 2404 2404 HOH HOH A . 
R 6 HOH 405 2405 2405 HOH HOH A . 
R 6 HOH 406 2406 2406 HOH HOH A . 
R 6 HOH 407 2407 2407 HOH HOH A . 
R 6 HOH 408 2408 2408 HOH HOH A . 
R 6 HOH 409 2409 2409 HOH HOH A . 
R 6 HOH 410 2410 2410 HOH HOH A . 
R 6 HOH 411 2411 2411 HOH HOH A . 
R 6 HOH 412 2412 2412 HOH HOH A . 
R 6 HOH 413 2413 2413 HOH HOH A . 
R 6 HOH 414 2414 2414 HOH HOH A . 
R 6 HOH 415 2415 2415 HOH HOH A . 
R 6 HOH 416 2416 2416 HOH HOH A . 
R 6 HOH 417 2417 2417 HOH HOH A . 
R 6 HOH 418 2418 2418 HOH HOH A . 
R 6 HOH 419 2419 2419 HOH HOH A . 
R 6 HOH 420 2420 2420 HOH HOH A . 
R 6 HOH 421 2421 2421 HOH HOH A . 
R 6 HOH 422 2422 2422 HOH HOH A . 
R 6 HOH 423 2423 2423 HOH HOH A . 
R 6 HOH 424 2424 2424 HOH HOH A . 
R 6 HOH 425 2425 2425 HOH HOH A . 
R 6 HOH 426 2426 2426 HOH HOH A . 
R 6 HOH 427 2427 2427 HOH HOH A . 
R 6 HOH 428 2428 2428 HOH HOH A . 
R 6 HOH 429 2429 2429 HOH HOH A . 
R 6 HOH 430 2430 2430 HOH HOH A . 
R 6 HOH 431 2431 2431 HOH HOH A . 
R 6 HOH 432 2432 2432 HOH HOH A . 
R 6 HOH 433 2433 2433 HOH HOH A . 
R 6 HOH 434 2434 2434 HOH HOH A . 
R 6 HOH 435 2435 2435 HOH HOH A . 
R 6 HOH 436 2436 2436 HOH HOH A . 
R 6 HOH 437 2437 2437 HOH HOH A . 
R 6 HOH 438 2438 2438 HOH HOH A . 
R 6 HOH 439 2439 2439 HOH HOH A . 
R 6 HOH 440 2440 2440 HOH HOH A . 
R 6 HOH 441 2441 2441 HOH HOH A . 
R 6 HOH 442 2442 2442 HOH HOH A . 
R 6 HOH 443 2443 2443 HOH HOH A . 
R 6 HOH 444 2444 2444 HOH HOH A . 
R 6 HOH 445 2445 2445 HOH HOH A . 
R 6 HOH 446 2446 2446 HOH HOH A . 
R 6 HOH 447 2447 2447 HOH HOH A . 
R 6 HOH 448 2448 2448 HOH HOH A . 
R 6 HOH 449 2449 2449 HOH HOH A . 
R 6 HOH 450 2450 2450 HOH HOH A . 
R 6 HOH 451 2451 2451 HOH HOH A . 
R 6 HOH 452 2452 2452 HOH HOH A . 
R 6 HOH 453 2453 2453 HOH HOH A . 
R 6 HOH 454 2454 2454 HOH HOH A . 
R 6 HOH 455 2455 2455 HOH HOH A . 
R 6 HOH 456 2456 2456 HOH HOH A . 
R 6 HOH 457 2457 2457 HOH HOH A . 
R 6 HOH 458 2458 2458 HOH HOH A . 
R 6 HOH 459 2459 2459 HOH HOH A . 
R 6 HOH 460 2460 2460 HOH HOH A . 
R 6 HOH 461 2461 2461 HOH HOH A . 
R 6 HOH 462 2462 2462 HOH HOH A . 
R 6 HOH 463 2463 2463 HOH HOH A . 
R 6 HOH 464 2464 2464 HOH HOH A . 
R 6 HOH 465 2465 2465 HOH HOH A . 
R 6 HOH 466 2466 2466 HOH HOH A . 
R 6 HOH 467 2467 2467 HOH HOH A . 
R 6 HOH 468 2468 2468 HOH HOH A . 
R 6 HOH 469 2469 2469 HOH HOH A . 
R 6 HOH 470 2470 2470 HOH HOH A . 
R 6 HOH 471 2471 2471 HOH HOH A . 
R 6 HOH 472 2472 2472 HOH HOH A . 
R 6 HOH 473 2473 2473 HOH HOH A . 
R 6 HOH 474 2474 2474 HOH HOH A . 
R 6 HOH 475 2475 2475 HOH HOH A . 
R 6 HOH 476 2476 2476 HOH HOH A . 
R 6 HOH 477 2477 2477 HOH HOH A . 
R 6 HOH 478 2478 2478 HOH HOH A . 
R 6 HOH 479 2479 2479 HOH HOH A . 
R 6 HOH 480 2480 2480 HOH HOH A . 
R 6 HOH 481 2481 2481 HOH HOH A . 
R 6 HOH 482 2482 2482 HOH HOH A . 
R 6 HOH 483 2483 2483 HOH HOH A . 
R 6 HOH 484 2484 2484 HOH HOH A . 
R 6 HOH 485 2485 2485 HOH HOH A . 
R 6 HOH 486 2486 2486 HOH HOH A . 
R 6 HOH 487 2487 2487 HOH HOH A . 
R 6 HOH 488 2488 2488 HOH HOH A . 
R 6 HOH 489 2489 2489 HOH HOH A . 
R 6 HOH 490 2490 2490 HOH HOH A . 
R 6 HOH 491 2491 2491 HOH HOH A . 
R 6 HOH 492 2492 2492 HOH HOH A . 
R 6 HOH 493 2493 2493 HOH HOH A . 
R 6 HOH 494 2494 2494 HOH HOH A . 
R 6 HOH 495 2495 2495 HOH HOH A . 
R 6 HOH 496 2496 2496 HOH HOH A . 
R 6 HOH 497 2497 2497 HOH HOH A . 
R 6 HOH 498 2498 2498 HOH HOH A . 
R 6 HOH 499 2499 2499 HOH HOH A . 
R 6 HOH 500 2500 2500 HOH HOH A . 
R 6 HOH 501 2501 2501 HOH HOH A . 
R 6 HOH 502 2502 2502 HOH HOH A . 
R 6 HOH 503 2503 2503 HOH HOH A . 
R 6 HOH 504 2504 2504 HOH HOH A . 
R 6 HOH 505 2505 2505 HOH HOH A . 
R 6 HOH 506 2506 2506 HOH HOH A . 
R 6 HOH 507 2507 2507 HOH HOH A . 
R 6 HOH 508 2508 2508 HOH HOH A . 
R 6 HOH 509 2509 2509 HOH HOH A . 
R 6 HOH 510 2510 2510 HOH HOH A . 
R 6 HOH 511 2511 2511 HOH HOH A . 
R 6 HOH 512 2512 2512 HOH HOH A . 
R 6 HOH 513 2513 2513 HOH HOH A . 
R 6 HOH 514 2514 2514 HOH HOH A . 
R 6 HOH 515 2515 2515 HOH HOH A . 
R 6 HOH 516 2516 2516 HOH HOH A . 
R 6 HOH 517 2517 2517 HOH HOH A . 
R 6 HOH 518 2518 2518 HOH HOH A . 
R 6 HOH 519 2519 2519 HOH HOH A . 
R 6 HOH 520 2520 2520 HOH HOH A . 
R 6 HOH 521 2521 2521 HOH HOH A . 
R 6 HOH 522 2522 2522 HOH HOH A . 
R 6 HOH 523 2523 2523 HOH HOH A . 
R 6 HOH 524 2524 2524 HOH HOH A . 
R 6 HOH 525 2525 2525 HOH HOH A . 
R 6 HOH 526 2526 2526 HOH HOH A . 
R 6 HOH 527 2527 2527 HOH HOH A . 
R 6 HOH 528 2528 2528 HOH HOH A . 
R 6 HOH 529 2529 2529 HOH HOH A . 
R 6 HOH 530 2530 2530 HOH HOH A . 
R 6 HOH 531 2531 2531 HOH HOH A . 
R 6 HOH 532 2532 2532 HOH HOH A . 
R 6 HOH 533 2533 2533 HOH HOH A . 
R 6 HOH 534 2534 2534 HOH HOH A . 
R 6 HOH 535 2535 2535 HOH HOH A . 
R 6 HOH 536 2536 2536 HOH HOH A . 
R 6 HOH 537 2537 2537 HOH HOH A . 
R 6 HOH 538 2538 2538 HOH HOH A . 
R 6 HOH 539 2539 2539 HOH HOH A . 
R 6 HOH 540 2540 2540 HOH HOH A . 
R 6 HOH 541 2541 2541 HOH HOH A . 
R 6 HOH 542 2542 2542 HOH HOH A . 
R 6 HOH 543 2543 2543 HOH HOH A . 
R 6 HOH 544 2544 2544 HOH HOH A . 
R 6 HOH 545 2545 2545 HOH HOH A . 
R 6 HOH 546 2546 2546 HOH HOH A . 
R 6 HOH 547 2547 2547 HOH HOH A . 
R 6 HOH 548 2548 2548 HOH HOH A . 
R 6 HOH 549 2549 2549 HOH HOH A . 
R 6 HOH 550 2550 2550 HOH HOH A . 
R 6 HOH 551 2551 2551 HOH HOH A . 
R 6 HOH 552 2552 2552 HOH HOH A . 
R 6 HOH 553 2553 2553 HOH HOH A . 
R 6 HOH 554 2554 2554 HOH HOH A . 
R 6 HOH 555 2555 2555 HOH HOH A . 
R 6 HOH 556 2556 2556 HOH HOH A . 
R 6 HOH 557 2557 2557 HOH HOH A . 
R 6 HOH 558 2558 2558 HOH HOH A . 
R 6 HOH 559 2559 2559 HOH HOH A . 
R 6 HOH 560 2560 2560 HOH HOH A . 
R 6 HOH 561 2561 2561 HOH HOH A . 
R 6 HOH 562 2562 2562 HOH HOH A . 
R 6 HOH 563 2563 2563 HOH HOH A . 
R 6 HOH 564 2564 2564 HOH HOH A . 
R 6 HOH 565 2565 2565 HOH HOH A . 
R 6 HOH 566 2566 2566 HOH HOH A . 
R 6 HOH 567 2567 2567 HOH HOH A . 
R 6 HOH 568 2568 2568 HOH HOH A . 
R 6 HOH 569 2569 2569 HOH HOH A . 
R 6 HOH 570 2570 2570 HOH HOH A . 
R 6 HOH 571 2571 2571 HOH HOH A . 
R 6 HOH 572 2572 2572 HOH HOH A . 
R 6 HOH 573 2573 2573 HOH HOH A . 
R 6 HOH 574 2574 2574 HOH HOH A . 
R 6 HOH 575 2575 2575 HOH HOH A . 
R 6 HOH 576 2576 2576 HOH HOH A . 
R 6 HOH 577 2577 2577 HOH HOH A . 
R 6 HOH 578 2578 2578 HOH HOH A . 
R 6 HOH 579 2579 2579 HOH HOH A . 
R 6 HOH 580 2580 2580 HOH HOH A . 
R 6 HOH 581 2581 2581 HOH HOH A . 
R 6 HOH 582 2582 2582 HOH HOH A . 
R 6 HOH 583 2583 2583 HOH HOH A . 
R 6 HOH 584 2584 2584 HOH HOH A . 
R 6 HOH 585 2585 2585 HOH HOH A . 
R 6 HOH 586 2586 2586 HOH HOH A . 
R 6 HOH 587 2587 2587 HOH HOH A . 
R 6 HOH 588 2588 2588 HOH HOH A . 
R 6 HOH 589 2589 2589 HOH HOH A . 
R 6 HOH 590 2590 2590 HOH HOH A . 
R 6 HOH 591 2591 2591 HOH HOH A . 
R 6 HOH 592 2592 2592 HOH HOH A . 
R 6 HOH 593 2593 2593 HOH HOH A . 
R 6 HOH 594 2594 2594 HOH HOH A . 
R 6 HOH 595 2595 2595 HOH HOH A . 
R 6 HOH 596 2596 2596 HOH HOH A . 
R 6 HOH 597 2597 2597 HOH HOH A . 
R 6 HOH 598 2598 2598 HOH HOH A . 
R 6 HOH 599 2599 2599 HOH HOH A . 
R 6 HOH 600 2600 2600 HOH HOH A . 
R 6 HOH 601 2601 2601 HOH HOH A . 
R 6 HOH 602 2602 2602 HOH HOH A . 
R 6 HOH 603 2603 2603 HOH HOH A . 
R 6 HOH 604 2604 2604 HOH HOH A . 
R 6 HOH 605 2605 2605 HOH HOH A . 
R 6 HOH 606 2606 2606 HOH HOH A . 
R 6 HOH 607 2607 2607 HOH HOH A . 
R 6 HOH 608 2608 2608 HOH HOH A . 
R 6 HOH 609 2609 2609 HOH HOH A . 
R 6 HOH 610 2610 2610 HOH HOH A . 
R 6 HOH 611 2611 2611 HOH HOH A . 
R 6 HOH 612 2612 2612 HOH HOH A . 
R 6 HOH 613 2613 2613 HOH HOH A . 
R 6 HOH 614 2614 2614 HOH HOH A . 
R 6 HOH 615 2615 2615 HOH HOH A . 
R 6 HOH 616 2616 2616 HOH HOH A . 
R 6 HOH 617 2617 2617 HOH HOH A . 
R 6 HOH 618 2618 2618 HOH HOH A . 
R 6 HOH 619 2619 2619 HOH HOH A . 
R 6 HOH 620 2620 2620 HOH HOH A . 
R 6 HOH 621 2621 2621 HOH HOH A . 
R 6 HOH 622 2622 2622 HOH HOH A . 
R 6 HOH 623 2623 2623 HOH HOH A . 
R 6 HOH 624 2624 2624 HOH HOH A . 
R 6 HOH 625 2625 2625 HOH HOH A . 
R 6 HOH 626 2626 2626 HOH HOH A . 
R 6 HOH 627 2627 2627 HOH HOH A . 
R 6 HOH 628 2628 2628 HOH HOH A . 
R 6 HOH 629 2629 2629 HOH HOH A . 
R 6 HOH 630 2630 2630 HOH HOH A . 
R 6 HOH 631 2631 2631 HOH HOH A . 
R 6 HOH 632 2632 2632 HOH HOH A . 
R 6 HOH 633 2633 2633 HOH HOH A . 
R 6 HOH 634 2634 2634 HOH HOH A . 
R 6 HOH 635 2635 2635 HOH HOH A . 
R 6 HOH 636 2636 2636 HOH HOH A . 
R 6 HOH 637 2637 2637 HOH HOH A . 
R 6 HOH 638 2638 2638 HOH HOH A . 
R 6 HOH 639 2639 2639 HOH HOH A . 
R 6 HOH 640 2640 2640 HOH HOH A . 
R 6 HOH 641 2641 2641 HOH HOH A . 
R 6 HOH 642 2642 2642 HOH HOH A . 
R 6 HOH 643 2643 2643 HOH HOH A . 
R 6 HOH 644 2644 2644 HOH HOH A . 
R 6 HOH 645 2645 2645 HOH HOH A . 
R 6 HOH 646 2646 2646 HOH HOH A . 
R 6 HOH 647 2647 2647 HOH HOH A . 
R 6 HOH 648 2648 2648 HOH HOH A . 
R 6 HOH 649 2649 2649 HOH HOH A . 
R 6 HOH 650 2650 2650 HOH HOH A . 
R 6 HOH 651 2651 2651 HOH HOH A . 
R 6 HOH 652 2652 2652 HOH HOH A . 
R 6 HOH 653 2653 2653 HOH HOH A . 
R 6 HOH 654 2654 2654 HOH HOH A . 
R 6 HOH 655 2655 2655 HOH HOH A . 
R 6 HOH 656 2656 2656 HOH HOH A . 
R 6 HOH 657 2657 2657 HOH HOH A . 
R 6 HOH 658 2658 2658 HOH HOH A . 
R 6 HOH 659 2659 2659 HOH HOH A . 
R 6 HOH 660 2660 2660 HOH HOH A . 
R 6 HOH 661 2661 2661 HOH HOH A . 
R 6 HOH 662 2662 2662 HOH HOH A . 
R 6 HOH 663 2663 2663 HOH HOH A . 
R 6 HOH 664 2664 2664 HOH HOH A . 
R 6 HOH 665 2665 2665 HOH HOH A . 
R 6 HOH 666 2666 2666 HOH HOH A . 
R 6 HOH 667 2667 2667 HOH HOH A . 
R 6 HOH 668 2668 2668 HOH HOH A . 
R 6 HOH 669 2669 2669 HOH HOH A . 
R 6 HOH 670 2670 2670 HOH HOH A . 
R 6 HOH 671 2671 2671 HOH HOH A . 
R 6 HOH 672 2672 2672 HOH HOH A . 
R 6 HOH 673 2673 2673 HOH HOH A . 
R 6 HOH 674 2674 2674 HOH HOH A . 
R 6 HOH 675 2675 2675 HOH HOH A . 
R 6 HOH 676 2676 2676 HOH HOH A . 
R 6 HOH 677 2677 2677 HOH HOH A . 
R 6 HOH 678 2678 2678 HOH HOH A . 
R 6 HOH 679 2679 2679 HOH HOH A . 
R 6 HOH 680 2680 2680 HOH HOH A . 
R 6 HOH 681 2681 2681 HOH HOH A . 
R 6 HOH 682 2682 2682 HOH HOH A . 
R 6 HOH 683 2683 2683 HOH HOH A . 
R 6 HOH 684 2684 2684 HOH HOH A . 
R 6 HOH 685 2685 2685 HOH HOH A . 
R 6 HOH 686 2686 2686 HOH HOH A . 
R 6 HOH 687 2687 2687 HOH HOH A . 
R 6 HOH 688 2688 2688 HOH HOH A . 
R 6 HOH 689 2689 2689 HOH HOH A . 
R 6 HOH 690 2690 2690 HOH HOH A . 
R 6 HOH 691 2691 2691 HOH HOH A . 
R 6 HOH 692 2692 2692 HOH HOH A . 
R 6 HOH 693 2693 2693 HOH HOH A . 
R 6 HOH 694 2694 2694 HOH HOH A . 
R 6 HOH 695 2695 2695 HOH HOH A . 
R 6 HOH 696 2696 2696 HOH HOH A . 
R 6 HOH 697 2697 2697 HOH HOH A . 
R 6 HOH 698 2698 2698 HOH HOH A . 
R 6 HOH 699 2699 2699 HOH HOH A . 
R 6 HOH 700 2700 2700 HOH HOH A . 
R 6 HOH 701 2701 2701 HOH HOH A . 
R 6 HOH 702 2702 2702 HOH HOH A . 
R 6 HOH 703 2703 2703 HOH HOH A . 
R 6 HOH 704 2704 2704 HOH HOH A . 
R 6 HOH 705 2705 2705 HOH HOH A . 
R 6 HOH 706 2706 2706 HOH HOH A . 
R 6 HOH 707 2707 2707 HOH HOH A . 
R 6 HOH 708 270