data_2VKX
# 
_entry.id   2VKX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2VKX         
PDBE  EBI-34913    
WWPDB D_1290034913 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2VKW 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'HUMAN NCAM, FN3 DOMAINS 1 AND 2' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2VKX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Carafoli, F.'   1 
'Saffell, J.L.'  2 
'Hohenester, E.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Tandem Fibronectin Type 3 Domains of Neural Cell Adhesion Molecule' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            377 
_citation.page_first                524 
_citation.page_last                 ? 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18261743 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2008.01.030 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Carafoli, F.'   1 
primary 'Saffell, J.L.'  2 
primary 'Hohenester, E.' 3 
# 
_cell.entry_id           2VKX 
_cell.length_a           92.419 
_cell.length_b           107.573 
_cell.length_c           161.124 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2VKX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NEURAL CELL ADHESION MOLECULE' 23127.775 6  ? YES 'FN3 DOMAINS, RESIDUES 496-598,601-692' ? 
2 non-polymer syn 'SULFATE ION'                   96.063    11 ? ?   ?                                       ? 
3 water       nat water                           18.015    31 ? ?   ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'N-CAM 140, NCAM-140, CD56 ANTIGEN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APLAQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETT
YAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQRGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRL
PSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAAAHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APLAQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETT
YAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQRGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRL
PSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAAAHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   LEU n 
1 4   ALA n 
1 5   GLN n 
1 6   ALA n 
1 7   ASP n 
1 8   THR n 
1 9   PRO n 
1 10  SER n 
1 11  SER n 
1 12  PRO n 
1 13  SER n 
1 14  ILE n 
1 15  ASP n 
1 16  GLN n 
1 17  VAL n 
1 18  GLU n 
1 19  PRO n 
1 20  TYR n 
1 21  SER n 
1 22  SER n 
1 23  THR n 
1 24  ALA n 
1 25  GLN n 
1 26  VAL n 
1 27  GLN n 
1 28  PHE n 
1 29  ASP n 
1 30  GLU n 
1 31  PRO n 
1 32  GLU n 
1 33  ALA n 
1 34  THR n 
1 35  GLY n 
1 36  GLY n 
1 37  VAL n 
1 38  PRO n 
1 39  ILE n 
1 40  LEU n 
1 41  LYS n 
1 42  TYR n 
1 43  LYS n 
1 44  ALA n 
1 45  GLU n 
1 46  TRP n 
1 47  ARG n 
1 48  ALA n 
1 49  VAL n 
1 50  GLY n 
1 51  GLU n 
1 52  GLU n 
1 53  VAL n 
1 54  TRP n 
1 55  HIS n 
1 56  SER n 
1 57  LYS n 
1 58  TRP n 
1 59  TYR n 
1 60  ASP n 
1 61  ALA n 
1 62  LYS n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  MET n 
1 67  GLU n 
1 68  GLY n 
1 69  ILE n 
1 70  VAL n 
1 71  THR n 
1 72  ILE n 
1 73  VAL n 
1 74  GLY n 
1 75  LEU n 
1 76  LYS n 
1 77  PRO n 
1 78  GLU n 
1 79  THR n 
1 80  THR n 
1 81  TYR n 
1 82  ALA n 
1 83  VAL n 
1 84  ARG n 
1 85  LEU n 
1 86  ALA n 
1 87  ALA n 
1 88  LEU n 
1 89  ASN n 
1 90  GLY n 
1 91  LYS n 
1 92  GLY n 
1 93  LEU n 
1 94  GLY n 
1 95  GLU n 
1 96  ILE n 
1 97  SER n 
1 98  ALA n 
1 99  ALA n 
1 100 SER n 
1 101 GLU n 
1 102 PHE n 
1 103 LYS n 
1 104 THR n 
1 105 GLN n 
1 106 PRO n 
1 107 VAL n 
1 108 ARG n 
1 109 GLU n 
1 110 PRO n 
1 111 SER n 
1 112 ALA n 
1 113 PRO n 
1 114 LYS n 
1 115 LEU n 
1 116 GLU n 
1 117 GLY n 
1 118 GLN n 
1 119 ARG n 
1 120 GLY n 
1 121 GLU n 
1 122 ASP n 
1 123 GLY n 
1 124 ASN n 
1 125 SER n 
1 126 ILE n 
1 127 LYS n 
1 128 VAL n 
1 129 ASN n 
1 130 LEU n 
1 131 ILE n 
1 132 LYS n 
1 133 GLN n 
1 134 ASP n 
1 135 ASP n 
1 136 GLY n 
1 137 GLY n 
1 138 SER n 
1 139 PRO n 
1 140 ILE n 
1 141 ARG n 
1 142 HIS n 
1 143 TYR n 
1 144 LEU n 
1 145 VAL n 
1 146 ARG n 
1 147 TYR n 
1 148 ARG n 
1 149 ALA n 
1 150 LEU n 
1 151 SER n 
1 152 SER n 
1 153 GLU n 
1 154 TRP n 
1 155 LYS n 
1 156 PRO n 
1 157 GLU n 
1 158 ILE n 
1 159 ARG n 
1 160 LEU n 
1 161 PRO n 
1 162 SER n 
1 163 GLY n 
1 164 SER n 
1 165 ASP n 
1 166 HIS n 
1 167 VAL n 
1 168 MET n 
1 169 LEU n 
1 170 LYS n 
1 171 SER n 
1 172 LEU n 
1 173 ASP n 
1 174 TRP n 
1 175 ASN n 
1 176 ALA n 
1 177 GLU n 
1 178 TYR n 
1 179 GLU n 
1 180 VAL n 
1 181 TYR n 
1 182 VAL n 
1 183 VAL n 
1 184 ALA n 
1 185 GLU n 
1 186 ASN n 
1 187 GLN n 
1 188 GLN n 
1 189 GLY n 
1 190 LYS n 
1 191 SER n 
1 192 LYS n 
1 193 ALA n 
1 194 ALA n 
1 195 HIS n 
1 196 PHE n 
1 197 VAL n 
1 198 PHE n 
1 199 ARG n 
1 200 THR n 
1 201 ALA n 
1 202 ALA n 
1 203 ALA n 
1 204 HIS n 
1 205 HIS n 
1 206 HIS n 
1 207 HIS n 
1 208 HIS n 
1 209 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            293-EBNA 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PCEP-PU 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2VKX        1 ? ? 2VKX   ? 
2 UNP NCA11_HUMAN 1 ? ? P13591 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2VKX A 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
2  2 2VKX A 5   ? 107 ? P13591 496 ? 598 ? 496 598 
3  1 2VKX A 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
4  2 2VKX A 109 ? 200 ? P13591 601 ? 692 ? 600 691 
5  1 2VKX A 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
6  1 2VKX B 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
7  2 2VKX B 5   ? 107 ? P13591 496 ? 598 ? 496 598 
8  1 2VKX B 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
9  2 2VKX B 109 ? 200 ? P13591 601 ? 692 ? 600 691 
10 1 2VKX B 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
11 1 2VKX C 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
12 2 2VKX C 5   ? 107 ? P13591 496 ? 598 ? 496 598 
13 1 2VKX C 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
14 2 2VKX C 109 ? 200 ? P13591 601 ? 692 ? 600 691 
15 1 2VKX C 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
16 1 2VKX D 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
17 2 2VKX D 5   ? 107 ? P13591 496 ? 598 ? 496 598 
18 1 2VKX D 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
19 2 2VKX D 109 ? 200 ? P13591 601 ? 692 ? 600 691 
20 1 2VKX D 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
21 1 2VKX E 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
22 2 2VKX E 5   ? 107 ? P13591 496 ? 598 ? 496 598 
23 1 2VKX E 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
24 2 2VKX E 109 ? 200 ? P13591 601 ? 692 ? 600 691 
25 1 2VKX E 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
26 1 2VKX F 1   ? 4   ? 2VKX   492 ? 495 ? 492 495 
27 2 2VKX F 5   ? 107 ? P13591 496 ? 598 ? 496 598 
28 1 2VKX F 108 ? 108 ? 2VKX   599 ? 599 ? 599 599 
29 2 2VKX F 109 ? 200 ? P13591 601 ? 692 ? 600 691 
30 1 2VKX F 201 ? 209 ? 2VKX   692 ? 700 ? 692 700 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2VKX ARG A 119 ? UNP P13591 MET 611 'engineered mutation' 610 1 
6  2VKX ARG B 119 ? UNP P13591 MET 611 'engineered mutation' 610 2 
11 2VKX ARG C 119 ? UNP P13591 MET 611 'engineered mutation' 610 3 
16 2VKX ARG D 119 ? UNP P13591 MET 611 'engineered mutation' 610 4 
21 2VKX ARG E 119 ? UNP P13591 MET 611 'engineered mutation' 610 5 
26 2VKX ARG F 119 ? UNP P13591 MET 611 'engineered mutation' 610 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2VKX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.06 
_exptl_crystal.density_percent_sol   59.48 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-06-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.12 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX10.1' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX10.1 
_diffrn_source.pdbx_wavelength             1.12 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2VKX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   44403 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.30 
_reflns_shell.pdbx_redundancy        5.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2VKX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     44347 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.2233 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2233 
_refine.ls_R_factor_R_free                       0.2676 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2227 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.854 
_refine.aniso_B[2][2]                            -7.932 
_refine.aniso_B[3][3]                            12.785 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 37.8006 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'NCAM FN3 DOMAIN PAIR, WILD-TYPE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9264 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               9350 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.37  1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.00  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.38  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.09  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.544460 0.540950  -0.641040 0.544230  -0.353710 -0.760720 -0.638260 -0.763060 -0.101820 35.99210  86.42128 98.64619  
2 given ? 0.208850  0.817790  0.536290  -0.389880 -0.433290 0.812560  0.896870  -0.378790 0.228350  -50.07765 22.99000 40.46176  
3 given ? -0.039220 -0.578840 -0.814490 -0.553680 -0.665960 0.499940  -0.831810 0.470580  -0.294370 81.79694  51.25030 60.17155  
4 given ? 0.219690  -0.473010 0.853230  0.764450  -0.459900 -0.451790 0.606100  0.751500  0.260550  -12.58587 70.74368 -2.45363  
5 given ? -0.925150 -0.363640 0.108910  -0.372260 0.925270  -0.072820 -0.074290 -0.107910 -0.991380 39.77160  12.85621 108.87283 
# 
_struct.entry_id                  2VKX 
_struct.title                     'Human NCAM, FN3 domains 1 and 2, M610R mutant' 
_struct.pdbx_descriptor           'NEURAL CELL ADHESION MOLECULE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2VKX 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'ADHESION RECEPTOR, CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 61 ? MET A 66 ? ALA A 552 MET A 557 1 ? 6 
HELX_P HELX_P2 2 ALA B 61 ? GLY B 68 ? ALA B 552 GLY B 559 1 ? 8 
HELX_P HELX_P3 3 ALA C 61 ? MET C 66 ? ALA C 552 MET C 557 1 ? 6 
HELX_P HELX_P4 4 ASP D 60 ? GLY D 68 ? ASP D 551 GLY D 559 1 ? 9 
HELX_P HELX_P5 5 ALA E 61 ? GLY E 68 ? ALA E 552 GLY E 559 1 ? 8 
HELX_P HELX_P6 6 ALA F 61 ? GLY F 68 ? ALA F 552 GLY F 559 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 4  ? 
AC ? 4  ? 
AD ? 7  ? 
AE ? 4  ? 
AF ? 4  ? 
BA ? 3  ? 
BB ? 4  ? 
BC ? 4  ? 
BD ? 3  ? 
BE ? 7  ? 
CA ? 3  ? 
CB ? 4  ? 
CC ? 12 ? 
CD ? 12 ? 
DA ? 3  ? 
DB ? 3  ? 
EA ? 3  ? 
EB ? 7  ? 
FA ? 3  ? 
FB ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
AC 3  4  ? anti-parallel 
AD 1  2  ? anti-parallel 
AD 2  3  ? anti-parallel 
AD 3  4  ? parallel      
AD 4  5  ? anti-parallel 
AD 5  6  ? anti-parallel 
AD 6  7  ? anti-parallel 
AE 1  2  ? anti-parallel 
AE 2  3  ? anti-parallel 
AE 3  4  ? anti-parallel 
AF 1  2  ? anti-parallel 
AF 2  3  ? anti-parallel 
AF 3  4  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BD 1  2  ? anti-parallel 
BD 2  3  ? anti-parallel 
BE 1  2  ? anti-parallel 
BE 2  3  ? anti-parallel 
BE 3  4  ? anti-parallel 
BE 4  5  ? parallel      
BE 5  6  ? anti-parallel 
BE 6  7  ? anti-parallel 
CA 1  2  ? anti-parallel 
CA 2  3  ? anti-parallel 
CB 1  2  ? anti-parallel 
CB 2  3  ? anti-parallel 
CB 3  4  ? anti-parallel 
CC 1  2  ? anti-parallel 
CC 3  4  ? anti-parallel 
CC 4  5  ? anti-parallel 
CC 5  6  ? anti-parallel 
CC 6  7  ? anti-parallel 
CC 8  9  ? anti-parallel 
CC 9  10 ? anti-parallel 
CC 10 11 ? anti-parallel 
CC 11 12 ? anti-parallel 
CD 1  2  ? anti-parallel 
CD 2  3  ? anti-parallel 
CD 3  4  ? anti-parallel 
CD 4  5  ? anti-parallel 
CD 6  7  ? anti-parallel 
CD 7  8  ? anti-parallel 
CD 8  9  ? anti-parallel 
CD 9  10 ? anti-parallel 
CD 11 12 ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 2  3  ? anti-parallel 
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
EA 1  2  ? anti-parallel 
EA 2  3  ? anti-parallel 
EB 1  2  ? anti-parallel 
EB 2  3  ? anti-parallel 
EB 3  4  ? anti-parallel 
EB 4  5  ? anti-parallel 
EB 5  6  ? anti-parallel 
EB 6  7  ? anti-parallel 
FA 1  2  ? anti-parallel 
FA 2  3  ? anti-parallel 
FB 1  2  ? anti-parallel 
FB 2  3  ? anti-parallel 
FB 3  4  ? anti-parallel 
FB 4  5  ? anti-parallel 
FB 5  6  ? anti-parallel 
FB 6  7  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  SER A 13  ? PRO A 19  ? SER A 504 PRO A 510 
AA 2  ALA A 24  ? ASP A 29  ? ALA A 515 ASP A 520 
AA 3  ILE A 69  ? ILE A 72  ? ILE A 560 ILE A 563 
AB 1  HIS A 55  ? ASP A 60  ? HIS A 546 ASP A 551 
AB 2  ILE A 39  ? ALA A 48  ? ILE A 530 ALA A 539 
AB 3  THR A 80  ? ASN A 89  ? THR A 571 ASN A 580 
AB 4  SER A 100 ? LYS A 103 ? SER A 591 LYS A 594 
AC 1  HIS A 55  ? ASP A 60  ? HIS A 546 ASP A 551 
AC 2  ILE A 39  ? ALA A 48  ? ILE A 530 ALA A 539 
AC 3  THR A 80  ? ASN A 89  ? THR A 571 ASN A 580 
AC 4  GLY A 92  ? LEU A 93  ? GLY A 583 LEU A 584 
AD 1  HIS A 166 ? LEU A 169 ? HIS A 657 LEU A 660 
AD 2  ILE A 126 ? ILE A 131 ? ILE A 617 ILE A 622 
AD 3  LYS A 114 ? ARG A 119 ? LYS A 605 ARG A 610 
AD 4  ALA D 194 ? ARG D 199 ? ALA D 685 ARG D 690 
AD 5  GLU D 177 ? ASN D 186 ? GLU D 668 ASN D 677 
AD 6  ILE D 140 ? ALA D 149 ? ILE D 631 ALA D 640 
AD 7  ILE D 158 ? PRO D 161 ? ILE D 649 PRO D 652 
AE 1  ILE A 158 ? PRO A 161 ? ILE A 649 PRO A 652 
AE 2  ILE A 140 ? ALA A 149 ? ILE A 631 ALA A 640 
AE 3  GLU A 177 ? ASN A 186 ? GLU A 668 ASN A 677 
AE 4  ALA A 194 ? ARG A 199 ? ALA A 685 ARG A 690 
AF 1  ILE A 158 ? PRO A 161 ? ILE A 649 PRO A 652 
AF 2  ILE A 140 ? ALA A 149 ? ILE A 631 ALA A 640 
AF 3  GLU A 177 ? ASN A 186 ? GLU A 668 ASN A 677 
AF 4  GLY A 189 ? LYS A 190 ? GLY A 680 LYS A 681 
BA 1  SER B 13  ? PRO B 19  ? SER B 504 PRO B 510 
BA 2  ALA B 24  ? ASP B 29  ? ALA B 515 ASP B 520 
BA 3  VAL B 70  ? ILE B 72  ? VAL B 561 ILE B 563 
BB 1  HIS B 55  ? ASP B 60  ? HIS B 546 ASP B 551 
BB 2  ILE B 39  ? ALA B 48  ? ILE B 530 ALA B 539 
BB 3  THR B 80  ? ASN B 89  ? THR B 571 ASN B 580 
BB 4  SER B 100 ? LYS B 103 ? SER B 591 LYS B 594 
BC 1  HIS B 55  ? ASP B 60  ? HIS B 546 ASP B 551 
BC 2  ILE B 39  ? ALA B 48  ? ILE B 530 ALA B 539 
BC 3  THR B 80  ? ASN B 89  ? THR B 571 ASN B 580 
BC 4  GLY B 92  ? LEU B 93  ? GLY B 583 LEU B 584 
BD 1  LYS B 114 ? ARG B 119 ? LYS B 605 ARG B 610 
BD 2  ILE B 126 ? ILE B 131 ? ILE B 617 ILE B 622 
BD 3  HIS B 166 ? LEU B 169 ? HIS B 657 LEU B 660 
BE 1  ILE B 158 ? PRO B 161 ? ILE B 649 PRO B 652 
BE 2  ILE B 140 ? ALA B 149 ? ILE B 631 ALA B 640 
BE 3  GLU B 177 ? ASN B 186 ? GLU B 668 ASN B 677 
BE 4  ALA B 194 ? ARG B 199 ? ALA B 685 ARG B 690 
BE 5  LYS E 114 ? ARG E 119 ? LYS E 605 ARG E 610 
BE 6  ILE E 126 ? ILE E 131 ? ILE E 617 ILE E 622 
BE 7  HIS E 166 ? LEU E 169 ? HIS E 657 LEU E 660 
CA 1  SER C 13  ? PRO C 19  ? SER C 504 PRO C 510 
CA 2  THR C 23  ? ASP C 29  ? THR C 514 ASP C 520 
CA 3  VAL C 70  ? VAL C 73  ? VAL C 561 VAL C 564 
CB 1  HIS C 55  ? ASP C 60  ? HIS C 546 ASP C 551 
CB 2  ILE C 39  ? ALA C 48  ? ILE C 530 ALA C 539 
CB 3  THR C 80  ? ASN C 89  ? THR C 571 ASN C 580 
CB 4  SER C 100 ? LYS C 103 ? SER C 591 LYS C 594 
CC 1  HIS C 166 ? LEU C 169 ? HIS C 657 LEU C 660 
CC 2  ILE C 126 ? LYS C 132 ? ILE C 617 LYS C 623 
CC 3  HIS D 55  ? TYR D 59  ? HIS D 546 TYR D 550 
CC 4  TYR D 42  ? ALA D 48  ? TYR D 533 ALA D 539 
CC 5  THR D 80  ? ASN D 89  ? THR D 571 ASN D 580 
CC 6  GLY D 92  ? ILE D 96  ? GLY D 583 ILE D 587 
CC 7  THR D 80  ? ASN D 89  ? THR D 571 ASN D 580 
CC 8  ILE F 158 ? LEU F 160 ? ILE F 649 LEU F 651 
CC 9  ILE F 140 ? ALA F 149 ? ILE F 631 ALA F 640 
CC 10 GLU F 177 ? ASN F 186 ? GLU F 668 ASN F 677 
CC 11 GLY F 189 ? LYS F 190 ? GLY F 680 LYS F 681 
CC 12 GLU F 177 ? ASN F 186 ? GLU F 668 ASN F 677 
CD 1  ILE C 158 ? LEU C 160 ? ILE C 649 LEU C 651 
CD 2  ILE C 140 ? ALA C 149 ? ILE C 631 ALA C 640 
CD 3  GLU C 177 ? ASN C 186 ? GLU C 668 ASN C 677 
CD 4  GLY C 189 ? LYS C 190 ? GLY C 680 LYS C 681 
CD 5  GLU C 177 ? ASN C 186 ? GLU C 668 ASN C 677 
CD 6  HIS E 55  ? ASP E 60  ? HIS E 546 ASP E 551 
CD 7  LYS E 41  ? ALA E 48  ? LYS E 532 ALA E 539 
CD 8  THR E 80  ? ASN E 89  ? THR E 571 ASN E 580 
CD 9  GLY E 92  ? LEU E 93  ? GLY E 583 LEU E 584 
CD 10 THR E 80  ? ASN E 89  ? THR E 571 ASN E 580 
CD 11 HIS F 166 ? LEU F 169 ? HIS F 657 LEU F 660 
CD 12 ILE F 126 ? LYS F 132 ? ILE F 617 LYS F 623 
DA 1  SER D 13  ? PRO D 19  ? SER D 504 PRO D 510 
DA 2  ALA D 24  ? ASP D 29  ? ALA D 515 ASP D 520 
DA 3  ILE D 69  ? ILE D 72  ? ILE D 560 ILE D 563 
DB 1  LYS D 114 ? ARG D 119 ? LYS D 605 ARG D 610 
DB 2  ILE D 126 ? ILE D 131 ? ILE D 617 ILE D 622 
DB 3  HIS D 166 ? LEU D 169 ? HIS D 657 LEU D 660 
EA 1  SER E 13  ? PRO E 19  ? SER E 504 PRO E 510 
EA 2  ALA E 24  ? ASP E 29  ? ALA E 515 ASP E 520 
EA 3  ILE E 69  ? ILE E 72  ? ILE E 560 ILE E 563 
EB 1  ILE E 158 ? PRO E 161 ? ILE E 649 PRO E 652 
EB 2  ILE E 140 ? ALA E 149 ? ILE E 631 ALA E 640 
EB 3  GLU E 177 ? ASN E 186 ? GLU E 668 ASN E 677 
EB 4  GLY E 189 ? LYS E 190 ? GLY E 680 LYS E 681 
EB 5  GLU E 177 ? ASN E 186 ? GLU E 668 ASN E 677 
EB 6  ALA E 194 ? ARG E 199 ? ALA E 685 ARG E 690 
EB 7  GLU E 177 ? ASN E 186 ? GLU E 668 ASN E 677 
FA 1  SER F 13  ? PRO F 19  ? SER F 504 PRO F 510 
FA 2  ALA F 24  ? ASP F 29  ? ALA F 515 ASP F 520 
FA 3  ILE F 69  ? ILE F 72  ? ILE F 560 ILE F 563 
FB 1  HIS F 55  ? ASP F 60  ? HIS F 546 ASP F 551 
FB 2  LYS F 41  ? ALA F 48  ? LYS F 532 ALA F 539 
FB 3  THR F 80  ? LEU F 88  ? THR F 571 LEU F 579 
FB 4  LEU F 93  ? ILE F 96  ? LEU F 584 ILE F 587 
FB 5  THR F 80  ? LEU F 88  ? THR F 571 LEU F 579 
FB 6  SER F 100 ? LYS F 103 ? SER F 591 LYS F 594 
FB 7  THR F 80  ? LEU F 88  ? THR F 571 LEU F 579 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N GLU A 18  ? N GLU A 509 O GLN A 25  ? O GLN A 516 
AA 2  3  N VAL A 26  ? N VAL A 517 O VAL A 70  ? O VAL A 561 
AB 1  2  N TYR A 59  ? N TYR A 550 O TYR A 42  ? O TYR A 533 
AB 2  3  N ARG A 47  ? N ARG A 538 O ALA A 82  ? O ALA A 573 
AB 3  4  N VAL A 83  ? N VAL A 574 O SER A 100 ? O SER A 591 
AC 1  2  N TYR A 59  ? N TYR A 550 O TYR A 42  ? O TYR A 533 
AC 2  3  N ARG A 47  ? N ARG A 538 O ALA A 82  ? O ALA A 573 
AC 3  4  N ASN A 89  ? N ASN A 580 O GLY A 92  ? O GLY A 583 
AD 1  2  N LEU A 169 ? N LEU A 660 O ILE A 126 ? O ILE A 617 
AD 2  3  N ILE A 131 ? N ILE A 622 O LYS A 114 ? O LYS A 605 
AD 3  4  N GLY A 117 ? N GLY A 608 O VAL D 197 ? O VAL D 688 
AD 4  5  N PHE D 198 ? N PHE D 689 O TYR D 178 ? O TYR D 669 
AD 5  6  O GLU D 185 ? O GLU D 676 N ARG D 141 ? N ARG D 632 
AD 6  7  N VAL D 145 ? N VAL D 636 O ILE D 158 ? O ILE D 649 
AE 1  2  N LEU A 160 ? N LEU A 651 O TYR A 143 ? O TYR A 634 
AE 2  3  N ARG A 148 ? N ARG A 639 O GLU A 179 ? O GLU A 670 
AE 3  4  N VAL A 182 ? N VAL A 673 O ALA A 194 ? O ALA A 685 
AF 1  2  N LEU A 160 ? N LEU A 651 O TYR A 143 ? O TYR A 634 
AF 2  3  N ARG A 148 ? N ARG A 639 O GLU A 179 ? O GLU A 670 
AF 3  4  N ASN A 186 ? N ASN A 677 O GLY A 189 ? O GLY A 680 
BA 1  2  N GLU B 18  ? N GLU B 509 O GLN B 25  ? O GLN B 516 
BA 2  3  N VAL B 26  ? N VAL B 517 O VAL B 70  ? O VAL B 561 
BB 1  2  N TYR B 59  ? N TYR B 550 O TYR B 42  ? O TYR B 533 
BB 2  3  N ARG B 47  ? N ARG B 538 O ALA B 82  ? O ALA B 573 
BB 3  4  N VAL B 83  ? N VAL B 574 O SER B 100 ? O SER B 591 
BC 1  2  N TYR B 59  ? N TYR B 550 O TYR B 42  ? O TYR B 533 
BC 2  3  N ARG B 47  ? N ARG B 538 O ALA B 82  ? O ALA B 573 
BC 3  4  N ASN B 89  ? N ASN B 580 O GLY B 92  ? O GLY B 583 
BD 1  2  N GLN B 118 ? N GLN B 609 O LYS B 127 ? O LYS B 618 
BD 2  3  N VAL B 128 ? N VAL B 619 O VAL B 167 ? O VAL B 658 
BE 1  2  N LEU B 160 ? N LEU B 651 O TYR B 143 ? O TYR B 634 
BE 2  3  N ARG B 148 ? N ARG B 639 O GLU B 179 ? O GLU B 670 
BE 3  4  N VAL B 182 ? N VAL B 673 O ALA B 194 ? O ALA B 685 
BE 4  5  N VAL B 197 ? N VAL B 688 O LEU E 115 ? O LEU E 606 
BE 5  6  N GLN E 118 ? N GLN E 609 O LYS E 127 ? O LYS E 618 
BE 6  7  N VAL E 128 ? N VAL E 619 O VAL E 167 ? O VAL E 658 
CA 1  2  N GLU C 18  ? N GLU C 509 O GLN C 25  ? O GLN C 516 
CA 2  3  N VAL C 26  ? N VAL C 517 O VAL C 70  ? O VAL C 561 
CB 1  2  N TYR C 59  ? N TYR C 550 O TYR C 42  ? O TYR C 533 
CB 2  3  N ARG C 47  ? N ARG C 538 O ALA C 82  ? O ALA C 573 
CB 3  4  N VAL C 83  ? N VAL C 574 O SER C 100 ? O SER C 591 
CC 1  2  N LEU C 169 ? N LEU C 660 O ILE C 126 ? O ILE C 617 
CC 3  4  N TYR D 59  ? N TYR D 550 O TYR D 42  ? O TYR D 533 
CC 4  5  N ARG D 47  ? N ARG D 538 O ALA D 82  ? O ALA D 573 
CC 5  6  N ASN D 89  ? N ASN D 580 O GLY D 92  ? O GLY D 583 
CC 6  7  N GLY D 94  ? N GLY D 585 O ALA D 87  ? O ALA D 578 
CC 8  9  N LEU F 160 ? N LEU F 651 O TYR F 143 ? O TYR F 634 
CC 9  10 N ARG F 148 ? N ARG F 639 O GLU F 179 ? O GLU F 670 
CC 10 11 N ASN F 186 ? N ASN F 677 O GLY F 189 ? O GLY F 680 
CC 11 12 N GLY F 189 ? N GLY F 680 O ASN F 186 ? O ASN F 677 
CD 1  2  N LEU C 160 ? N LEU C 651 O TYR C 143 ? O TYR C 634 
CD 2  3  N ARG C 148 ? N ARG C 639 O GLU C 179 ? O GLU C 670 
CD 3  4  N ASN C 186 ? N ASN C 677 O GLY C 189 ? O GLY C 680 
CD 4  5  N GLY C 189 ? N GLY C 680 O ASN C 186 ? O ASN C 677 
CD 6  7  N TYR E 59  ? N TYR E 550 O TYR E 42  ? O TYR E 533 
CD 7  8  N ARG E 47  ? N ARG E 538 O ALA E 82  ? O ALA E 573 
CD 8  9  N ASN E 89  ? N ASN E 580 O GLY E 92  ? O GLY E 583 
CD 9  10 N GLY E 92  ? N GLY E 583 O ASN E 89  ? O ASN E 580 
CD 11 12 N LEU F 169 ? N LEU F 660 O ILE F 126 ? O ILE F 617 
DA 1  2  N GLU D 18  ? N GLU D 509 O GLN D 25  ? O GLN D 516 
DA 2  3  N VAL D 26  ? N VAL D 517 O VAL D 70  ? O VAL D 561 
DB 1  2  N GLN D 118 ? N GLN D 609 O LYS D 127 ? O LYS D 618 
DB 2  3  N VAL D 128 ? N VAL D 619 O VAL D 167 ? O VAL D 658 
EA 1  2  N GLU E 18  ? N GLU E 509 O GLN E 25  ? O GLN E 516 
EA 2  3  N VAL E 26  ? N VAL E 517 O VAL E 70  ? O VAL E 561 
EB 1  2  N LEU E 160 ? N LEU E 651 O TYR E 143 ? O TYR E 634 
EB 2  3  N ARG E 148 ? N ARG E 639 O GLU E 179 ? O GLU E 670 
EB 3  4  N ASN E 186 ? N ASN E 677 O GLY E 189 ? O GLY E 680 
EB 4  5  N GLY E 189 ? N GLY E 680 O ASN E 186 ? O ASN E 677 
EB 5  6  N VAL E 182 ? N VAL E 673 O ALA E 194 ? O ALA E 685 
EB 6  7  N PHE E 198 ? N PHE E 689 O TYR E 178 ? O TYR E 669 
FA 1  2  N GLU F 18  ? N GLU F 509 O GLN F 25  ? O GLN F 516 
FA 2  3  N VAL F 26  ? N VAL F 517 O VAL F 70  ? O VAL F 561 
FB 1  2  N TYR F 59  ? N TYR F 550 O TYR F 42  ? O TYR F 533 
FB 2  3  N ARG F 47  ? N ARG F 538 O ALA F 82  ? O ALA F 573 
FB 3  4  O ALA F 87  ? O ALA F 578 N GLY F 94  ? N GLY F 585 
FB 4  5  N GLY F 94  ? N GLY F 585 O ALA F 87  ? O ALA F 578 
FB 5  6  N VAL F 83  ? N VAL F 574 O SER F 100 ? O SER F 591 
FB 6  7  N PHE F 102 ? N PHE F 593 O TYR F 81  ? O TYR F 572 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A1696' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 C1696' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 C1697' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 F1696' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 F1697' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A1697' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 F1698' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 E1695' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 D1696' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 F1699' 
BC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 F1700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 55  ? HIS A 546 . ? 1_555 ? 
2  AC1 4 SER A 56  ? SER A 547 . ? 1_555 ? 
3  AC1 4 LYS A 155 ? LYS A 646 . ? 1_555 ? 
4  AC1 4 ASP A 173 ? ASP A 664 . ? 1_555 ? 
5  AC2 4 ALA C 48  ? ALA C 539 . ? 1_555 ? 
6  AC2 4 HIS C 55  ? HIS C 546 . ? 1_555 ? 
7  AC2 4 LYS C 76  ? LYS C 567 . ? 1_555 ? 
8  AC2 4 TYR C 81  ? TYR C 572 . ? 1_555 ? 
9  AC3 5 ARG C 148 ? ARG C 639 . ? 1_555 ? 
10 AC3 5 LEU C 150 ? LEU C 641 . ? 1_555 ? 
11 AC3 5 SER C 151 ? SER C 642 . ? 1_555 ? 
12 AC3 5 GLU E 78  ? GLU E 569 . ? 1_555 ? 
13 AC3 5 THR E 80  ? THR E 571 . ? 1_555 ? 
14 AC4 7 GLU D 78  ? GLU D 569 . ? 1_555 ? 
15 AC4 7 THR D 79  ? THR D 570 . ? 1_555 ? 
16 AC4 7 THR D 80  ? THR D 571 . ? 1_555 ? 
17 AC4 7 LYS D 103 ? LYS D 594 . ? 1_555 ? 
18 AC4 7 ARG F 148 ? ARG F 639 . ? 1_555 ? 
19 AC4 7 LEU F 150 ? LEU F 641 . ? 1_555 ? 
20 AC4 7 SER F 151 ? SER F 642 . ? 1_555 ? 
21 AC5 2 ALA F 201 ? ALA F 692 . ? 1_555 ? 
22 AC5 2 ALA F 202 ? ALA F 693 . ? 1_555 ? 
23 AC6 2 ALA A 201 ? ALA A 692 . ? 1_555 ? 
24 AC6 2 ALA A 202 ? ALA A 693 . ? 1_555 ? 
25 AC7 6 ARG D 159 ? ARG D 650 . ? 1_555 ? 
26 AC7 6 ARG F 47  ? ARG F 538 . ? 1_555 ? 
27 AC7 6 ALA F 48  ? ALA F 539 . ? 1_555 ? 
28 AC7 6 GLU F 51  ? GLU F 542 . ? 1_555 ? 
29 AC7 6 HIS F 55  ? HIS F 546 . ? 1_555 ? 
30 AC7 6 TYR F 81  ? TYR F 572 . ? 1_555 ? 
31 AC8 3 ARG A 47  ? ARG A 538 . ? 1_555 ? 
32 AC8 3 ASN E 175 ? ASN E 666 . ? 1_555 ? 
33 AC8 3 ARG E 199 ? ARG E 690 . ? 1_555 ? 
34 AC9 2 ALA D 201 ? ALA D 692 . ? 1_555 ? 
35 AC9 2 ALA D 202 ? ALA D 693 . ? 1_555 ? 
36 BC1 3 PRO B 161 ? PRO B 652 . ? 1_555 ? 
37 BC1 3 SER F 152 ? SER F 643 . ? 1_555 ? 
38 BC1 3 LYS F 155 ? LYS F 646 . ? 1_555 ? 
39 BC2 3 ARG F 141 ? ARG F 632 . ? 1_555 ? 
40 BC2 3 HIS F 142 ? HIS F 633 . ? 1_555 ? 
41 BC2 3 ARG F 159 ? ARG F 650 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2VKX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2VKX 
_atom_sites.fract_transf_matrix[1][1]   0.010820 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009296 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006206 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 6   ? 27.911  87.262  11.413 1.00 63.58  ? 497  ALA A N   1 
ATOM   2    C CA  . ALA A 1 6   ? 28.043  88.649  11.957 1.00 63.59  ? 497  ALA A CA  1 
ATOM   3    C C   . ALA A 1 6   ? 27.561  88.719  13.408 1.00 62.52  ? 497  ALA A C   1 
ATOM   4    O O   . ALA A 1 6   ? 27.882  89.659  14.139 1.00 62.82  ? 497  ALA A O   1 
ATOM   5    C CB  . ALA A 1 6   ? 27.241  89.631  11.087 1.00 63.33  ? 497  ALA A CB  1 
ATOM   6    N N   . ASP A 1 7   ? 26.803  87.711  13.824 1.00 60.59  ? 498  ASP A N   1 
ATOM   7    C CA  . ASP A 1 7   ? 26.266  87.665  15.177 1.00 57.84  ? 498  ASP A CA  1 
ATOM   8    C C   . ASP A 1 7   ? 26.868  86.531  16.004 1.00 55.30  ? 498  ASP A C   1 
ATOM   9    O O   . ASP A 1 7   ? 27.517  85.633  15.469 1.00 54.37  ? 498  ASP A O   1 
ATOM   10   C CB  . ASP A 1 7   ? 24.754  87.469  15.110 1.00 59.18  ? 498  ASP A CB  1 
ATOM   11   C CG  . ASP A 1 7   ? 24.003  88.442  15.981 1.00 60.51  ? 498  ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 7   ? 24.460  88.690  17.118 1.00 61.54  ? 498  ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 7   ? 22.952  88.949  15.525 1.00 61.00  ? 498  ASP A OD2 1 
ATOM   14   N N   . THR A 1 8   ? 26.645  86.585  17.315 1.00 52.70  ? 499  THR A N   1 
ATOM   15   C CA  . THR A 1 8   ? 27.111  85.541  18.224 1.00 50.42  ? 499  THR A CA  1 
ATOM   16   C C   . THR A 1 8   ? 26.037  84.442  18.245 1.00 48.04  ? 499  THR A C   1 
ATOM   17   O O   . THR A 1 8   ? 24.861  84.699  17.971 1.00 48.18  ? 499  THR A O   1 
ATOM   18   C CB  . THR A 1 8   ? 27.304  86.074  19.651 1.00 51.49  ? 499  THR A CB  1 
ATOM   19   O OG1 . THR A 1 8   ? 26.073  86.634  20.124 1.00 52.78  ? 499  THR A OG1 1 
ATOM   20   C CG2 . THR A 1 8   ? 28.392  87.135  19.679 1.00 52.38  ? 499  THR A CG2 1 
ATOM   21   N N   . PRO A 1 9   ? 26.424  83.203  18.576 1.00 44.92  ? 500  PRO A N   1 
ATOM   22   C CA  . PRO A 1 9   ? 25.460  82.097  18.610 1.00 41.80  ? 500  PRO A CA  1 
ATOM   23   C C   . PRO A 1 9   ? 24.359  82.214  19.657 1.00 39.13  ? 500  PRO A C   1 
ATOM   24   O O   . PRO A 1 9   ? 24.526  82.885  20.676 1.00 38.53  ? 500  PRO A O   1 
ATOM   25   C CB  . PRO A 1 9   ? 26.344  80.879  18.866 1.00 41.92  ? 500  PRO A CB  1 
ATOM   26   C CG  . PRO A 1 9   ? 27.686  81.298  18.350 1.00 42.76  ? 500  PRO A CG  1 
ATOM   27   C CD  . PRO A 1 9   ? 27.790  82.713  18.821 1.00 43.09  ? 500  PRO A CD  1 
ATOM   28   N N   . SER A 1 10  ? 23.226  81.564  19.392 1.00 37.62  ? 501  SER A N   1 
ATOM   29   C CA  . SER A 1 10  ? 22.125  81.543  20.348 1.00 35.39  ? 501  SER A CA  1 
ATOM   30   C C   . SER A 1 10  ? 22.516  80.439  21.325 1.00 34.00  ? 501  SER A C   1 
ATOM   31   O O   . SER A 1 10  ? 23.425  79.672  21.044 1.00 33.53  ? 501  SER A O   1 
ATOM   32   C CB  . SER A 1 10  ? 20.786  81.237  19.654 1.00 35.71  ? 501  SER A CB  1 
ATOM   33   O OG  . SER A 1 10  ? 20.817  80.034  18.908 1.00 37.50  ? 501  SER A OG  1 
ATOM   34   N N   . SER A 1 11  ? 21.848  80.346  22.465 1.00 34.50  ? 502  SER A N   1 
ATOM   35   C CA  . SER A 1 11  ? 22.218  79.341  23.464 1.00 35.25  ? 502  SER A CA  1 
ATOM   36   C C   . SER A 1 11  ? 22.087  77.881  23.070 1.00 34.33  ? 502  SER A C   1 
ATOM   37   O O   . SER A 1 11  ? 21.190  77.496  22.330 1.00 34.04  ? 502  SER A O   1 
ATOM   38   C CB  . SER A 1 11  ? 21.420  79.550  24.749 1.00 37.07  ? 502  SER A CB  1 
ATOM   39   O OG  . SER A 1 11  ? 20.055  79.227  24.550 1.00 40.93  ? 502  SER A OG  1 
ATOM   40   N N   . PRO A 1 12  ? 23.021  77.048  23.534 1.00 34.51  ? 503  PRO A N   1 
ATOM   41   C CA  . PRO A 1 12  ? 22.914  75.632  23.191 1.00 35.29  ? 503  PRO A CA  1 
ATOM   42   C C   . PRO A 1 12  ? 21.814  75.151  24.127 1.00 36.05  ? 503  PRO A C   1 
ATOM   43   O O   . PRO A 1 12  ? 21.514  75.831  25.108 1.00 36.72  ? 503  PRO A O   1 
ATOM   44   C CB  . PRO A 1 12  ? 24.279  75.070  23.591 1.00 33.49  ? 503  PRO A CB  1 
ATOM   45   C CG  . PRO A 1 12  ? 25.189  76.252  23.491 1.00 33.48  ? 503  PRO A CG  1 
ATOM   46   C CD  . PRO A 1 12  ? 24.356  77.357  24.072 1.00 34.74  ? 503  PRO A CD  1 
ATOM   47   N N   . SER A 1 13  ? 21.203  74.009  23.836 1.00 36.46  ? 504  SER A N   1 
ATOM   48   C CA  . SER A 1 13  ? 20.161  73.492  24.713 1.00 35.90  ? 504  SER A CA  1 
ATOM   49   C C   . SER A 1 13  ? 20.601  72.202  25.353 1.00 34.72  ? 504  SER A C   1 
ATOM   50   O O   . SER A 1 13  ? 21.083  71.306  24.674 1.00 35.54  ? 504  SER A O   1 
ATOM   51   C CB  . SER A 1 13  ? 18.881  73.247  23.941 1.00 36.06  ? 504  SER A CB  1 
ATOM   52   O OG  . SER A 1 13  ? 18.230  74.477  23.711 1.00 42.47  ? 504  SER A OG  1 
ATOM   53   N N   . ILE A 1 14  ? 20.448  72.107  26.664 1.00 32.35  ? 505  ILE A N   1 
ATOM   54   C CA  . ILE A 1 14  ? 20.840  70.884  27.337 1.00 31.15  ? 505  ILE A CA  1 
ATOM   55   C C   . ILE A 1 14  ? 19.689  69.885  27.293 1.00 30.23  ? 505  ILE A C   1 
ATOM   56   O O   . ILE A 1 14  ? 18.559  70.214  27.637 1.00 30.80  ? 505  ILE A O   1 
ATOM   57   C CB  . ILE A 1 14  ? 21.258  71.164  28.792 1.00 29.92  ? 505  ILE A CB  1 
ATOM   58   C CG1 . ILE A 1 14  ? 22.497  72.066  28.794 1.00 28.40  ? 505  ILE A CG1 1 
ATOM   59   C CG2 . ILE A 1 14  ? 21.524  69.854  29.524 1.00 28.42  ? 505  ILE A CG2 1 
ATOM   60   C CD1 . ILE A 1 14  ? 23.046  72.393  30.162 1.00 27.57  ? 505  ILE A CD1 1 
ATOM   61   N N   . ASP A 1 15  ? 19.978  68.671  26.833 1.00 30.68  ? 506  ASP A N   1 
ATOM   62   C CA  . ASP A 1 15  ? 18.959  67.627  26.751 1.00 32.30  ? 506  ASP A CA  1 
ATOM   63   C C   . ASP A 1 15  ? 19.149  66.593  27.848 1.00 31.49  ? 506  ASP A C   1 
ATOM   64   O O   . ASP A 1 15  ? 18.186  66.133  28.457 1.00 29.31  ? 506  ASP A O   1 
ATOM   65   C CB  . ASP A 1 15  ? 18.998  66.922  25.390 1.00 32.86  ? 506  ASP A CB  1 
ATOM   66   C CG  . ASP A 1 15  ? 18.634  67.851  24.237 1.00 37.93  ? 506  ASP A CG  1 
ATOM   67   O OD1 . ASP A 1 15  ? 17.881  68.834  24.458 1.00 41.47  ? 506  ASP A OD1 1 
ATOM   68   O OD2 . ASP A 1 15  ? 19.089  67.592  23.103 1.00 36.82  ? 506  ASP A OD2 1 
ATOM   69   N N   . GLN A 1 16  ? 20.404  66.248  28.107 1.00 30.46  ? 507  GLN A N   1 
ATOM   70   C CA  . GLN A 1 16  ? 20.715  65.251  29.113 1.00 30.19  ? 507  GLN A CA  1 
ATOM   71   C C   . GLN A 1 16  ? 21.898  65.623  29.968 1.00 29.66  ? 507  GLN A C   1 
ATOM   72   O O   . GLN A 1 16  ? 22.787  66.354  29.546 1.00 29.06  ? 507  GLN A O   1 
ATOM   73   C CB  . GLN A 1 16  ? 21.042  63.906  28.449 1.00 28.68  ? 507  GLN A CB  1 
ATOM   74   C CG  . GLN A 1 16  ? 19.946  63.321  27.607 1.00 28.54  ? 507  GLN A CG  1 
ATOM   75   C CD  . GLN A 1 16  ? 18.774  62.853  28.436 1.00 29.70  ? 507  GLN A CD  1 
ATOM   76   O OE1 . GLN A 1 16  ? 17.708  62.562  27.906 1.00 29.88  ? 507  GLN A OE1 1 
ATOM   77   N NE2 . GLN A 1 16  ? 18.967  62.771  29.746 1.00 32.97  ? 507  GLN A NE2 1 
ATOM   78   N N   . VAL A 1 17  ? 21.893  65.098  31.183 1.00 30.78  ? 508  VAL A N   1 
ATOM   79   C CA  . VAL A 1 17  ? 23.005  65.271  32.097 1.00 31.40  ? 508  VAL A CA  1 
ATOM   80   C C   . VAL A 1 17  ? 23.070  63.984  32.894 1.00 30.43  ? 508  VAL A C   1 
ATOM   81   O O   . VAL A 1 17  ? 22.355  63.817  33.873 1.00 31.22  ? 508  VAL A O   1 
ATOM   82   C CB  . VAL A 1 17  ? 22.828  66.453  33.070 1.00 32.40  ? 508  VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 17  ? 24.030  66.494  34.017 1.00 31.24  ? 508  VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 17  ? 22.733  67.771  32.302 1.00 31.67  ? 508  VAL A CG2 1 
ATOM   85   N N   . GLU A 1 18  ? 23.892  63.047  32.439 1.00 30.56  ? 509  GLU A N   1 
ATOM   86   C CA  . GLU A 1 18  ? 24.044  61.785  33.150 1.00 29.53  ? 509  GLU A CA  1 
ATOM   87   C C   . GLU A 1 18  ? 25.194  61.933  34.119 1.00 29.02  ? 509  GLU A C   1 
ATOM   88   O O   . GLU A 1 18  ? 26.346  61.968  33.712 1.00 27.90  ? 509  GLU A O   1 
ATOM   89   C CB  . GLU A 1 18  ? 24.358  60.628  32.201 1.00 28.25  ? 509  GLU A CB  1 
ATOM   90   C CG  . GLU A 1 18  ? 24.857  59.392  32.941 1.00 28.66  ? 509  GLU A CG  1 
ATOM   91   C CD  . GLU A 1 18  ? 23.810  58.763  33.864 1.00 30.27  ? 509  GLU A CD  1 
ATOM   92   O OE1 . GLU A 1 18  ? 22.902  59.475  34.357 1.00 32.08  ? 509  GLU A OE1 1 
ATOM   93   O OE2 . GLU A 1 18  ? 23.907  57.546  34.113 1.00 28.90  ? 509  GLU A OE2 1 
ATOM   94   N N   . PRO A 1 19  ? 24.892  62.030  35.420 1.00 29.82  ? 510  PRO A N   1 
ATOM   95   C CA  . PRO A 1 19  ? 25.943  62.177  36.427 1.00 29.76  ? 510  PRO A CA  1 
ATOM   96   C C   . PRO A 1 19  ? 26.529  60.854  36.890 1.00 30.10  ? 510  PRO A C   1 
ATOM   97   O O   . PRO A 1 19  ? 25.828  59.855  37.021 1.00 30.90  ? 510  PRO A O   1 
ATOM   98   C CB  . PRO A 1 19  ? 25.233  62.903  37.551 1.00 28.95  ? 510  PRO A CB  1 
ATOM   99   C CG  . PRO A 1 19  ? 23.892  62.267  37.510 1.00 30.54  ? 510  PRO A CG  1 
ATOM   100  C CD  . PRO A 1 19  ? 23.562  62.204  36.029 1.00 29.11  ? 510  PRO A CD  1 
ATOM   101  N N   . TYR A 1 20  ? 27.833  60.870  37.118 1.00 30.63  ? 511  TYR A N   1 
ATOM   102  C CA  . TYR A 1 20  ? 28.566  59.721  37.606 1.00 30.15  ? 511  TYR A CA  1 
ATOM   103  C C   . TYR A 1 20  ? 29.286  60.237  38.841 1.00 31.81  ? 511  TYR A C   1 
ATOM   104  O O   . TYR A 1 20  ? 28.974  61.319  39.340 1.00 32.86  ? 511  TYR A O   1 
ATOM   105  C CB  . TYR A 1 20  ? 29.548  59.231  36.549 1.00 28.50  ? 511  TYR A CB  1 
ATOM   106  C CG  . TYR A 1 20  ? 28.856  58.561  35.384 1.00 31.95  ? 511  TYR A CG  1 
ATOM   107  C CD1 . TYR A 1 20  ? 29.232  58.833  34.071 1.00 32.59  ? 511  TYR A CD1 1 
ATOM   108  C CD2 . TYR A 1 20  ? 27.797  57.672  35.591 1.00 32.77  ? 511  TYR A CD2 1 
ATOM   109  C CE1 . TYR A 1 20  ? 28.568  58.246  32.993 1.00 33.17  ? 511  TYR A CE1 1 
ATOM   110  C CE2 . TYR A 1 20  ? 27.131  57.081  34.520 1.00 32.80  ? 511  TYR A CE2 1 
ATOM   111  C CZ  . TYR A 1 20  ? 27.518  57.375  33.224 1.00 33.02  ? 511  TYR A CZ  1 
ATOM   112  O OH  . TYR A 1 20  ? 26.844  56.824  32.154 1.00 33.38  ? 511  TYR A OH  1 
ATOM   113  N N   . SER A 1 21  ? 30.253  59.486  39.335 1.00 31.94  ? 512  SER A N   1 
ATOM   114  C CA  . SER A 1 21  ? 30.945  59.894  40.542 1.00 31.65  ? 512  SER A CA  1 
ATOM   115  C C   . SER A 1 21  ? 31.809  61.143  40.392 1.00 29.45  ? 512  SER A C   1 
ATOM   116  O O   . SER A 1 21  ? 31.654  62.100  41.151 1.00 29.64  ? 512  SER A O   1 
ATOM   117  C CB  . SER A 1 21  ? 31.780  58.726  41.061 1.00 33.33  ? 512  SER A CB  1 
ATOM   118  O OG  . SER A 1 21  ? 32.662  58.280  40.038 1.00 42.12  ? 512  SER A OG  1 
ATOM   119  N N   . SER A 1 22  ? 32.713  61.143  39.416 1.00 26.99  ? 513  SER A N   1 
ATOM   120  C CA  . SER A 1 22  ? 33.600  62.286  39.227 1.00 24.55  ? 513  SER A CA  1 
ATOM   121  C C   . SER A 1 22  ? 33.470  62.944  37.858 1.00 25.06  ? 513  SER A C   1 
ATOM   122  O O   . SER A 1 22  ? 34.105  63.965  37.587 1.00 25.68  ? 513  SER A O   1 
ATOM   123  C CB  . SER A 1 22  ? 35.045  61.867  39.467 1.00 21.06  ? 513  SER A CB  1 
ATOM   124  O OG  . SER A 1 22  ? 35.450  60.909  38.511 1.00 22.67  ? 513  SER A OG  1 
ATOM   125  N N   . THR A 1 23  ? 32.651  62.352  36.994 1.00 24.39  ? 514  THR A N   1 
ATOM   126  C CA  . THR A 1 23  ? 32.414  62.905  35.669 1.00 24.24  ? 514  THR A CA  1 
ATOM   127  C C   . THR A 1 23  ? 30.918  63.025  35.442 1.00 25.73  ? 514  THR A C   1 
ATOM   128  O O   . THR A 1 23  ? 30.119  62.461  36.184 1.00 25.18  ? 514  THR A O   1 
ATOM   129  C CB  . THR A 1 23  ? 32.977  62.026  34.565 1.00 22.58  ? 514  THR A CB  1 
ATOM   130  O OG1 . THR A 1 23  ? 32.289  60.772  34.562 1.00 24.21  ? 514  THR A OG1 1 
ATOM   131  C CG2 . THR A 1 23  ? 34.452  61.799  34.776 1.00 22.51  ? 514  THR A CG2 1 
ATOM   132  N N   . ALA A 1 24  ? 30.549  63.776  34.417 1.00 26.52  ? 515  ALA A N   1 
ATOM   133  C CA  . ALA A 1 24  ? 29.151  63.979  34.077 1.00 28.59  ? 515  ALA A CA  1 
ATOM   134  C C   . ALA A 1 24  ? 29.079  64.153  32.569 1.00 28.73  ? 515  ALA A C   1 
ATOM   135  O O   . ALA A 1 24  ? 29.843  64.916  31.993 1.00 30.93  ? 515  ALA A O   1 
ATOM   136  C CB  . ALA A 1 24  ? 28.606  65.230  34.785 1.00 27.78  ? 515  ALA A CB  1 
ATOM   137  N N   . GLN A 1 25  ? 28.178  63.434  31.923 1.00 27.95  ? 516  GLN A N   1 
ATOM   138  C CA  . GLN A 1 25  ? 28.058  63.560  30.487 1.00 28.63  ? 516  GLN A CA  1 
ATOM   139  C C   . GLN A 1 25  ? 26.913  64.493  30.155 1.00 28.99  ? 516  GLN A C   1 
ATOM   140  O O   . GLN A 1 25  ? 25.781  64.303  30.617 1.00 28.10  ? 516  GLN A O   1 
ATOM   141  C CB  . GLN A 1 25  ? 27.821  62.197  29.849 1.00 28.98  ? 516  GLN A CB  1 
ATOM   142  C CG  . GLN A 1 25  ? 28.882  61.186  30.190 1.00 29.34  ? 516  GLN A CG  1 
ATOM   143  C CD  . GLN A 1 25  ? 28.697  59.904  29.433 1.00 30.37  ? 516  GLN A CD  1 
ATOM   144  O OE1 . GLN A 1 25  ? 27.568  59.474  29.201 1.00 32.35  ? 516  GLN A OE1 1 
ATOM   145  N NE2 . GLN A 1 25  ? 29.801  59.273  29.054 1.00 28.65  ? 516  GLN A NE2 1 
ATOM   146  N N   . VAL A 1 26  ? 27.216  65.513  29.362 1.00 28.51  ? 517  VAL A N   1 
ATOM   147  C CA  . VAL A 1 26  ? 26.199  66.468  28.982 1.00 29.26  ? 517  VAL A CA  1 
ATOM   148  C C   . VAL A 1 26  ? 25.839  66.315  27.518 1.00 29.98  ? 517  VAL A C   1 
ATOM   149  O O   . VAL A 1 26  ? 26.689  66.441  26.638 1.00 29.65  ? 517  VAL A O   1 
ATOM   150  C CB  . VAL A 1 26  ? 26.654  67.898  29.273 1.00 28.43  ? 517  VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 26  ? 25.616  68.884  28.789 1.00 28.71  ? 517  VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 26  ? 26.861  68.066  30.769 1.00 29.24  ? 517  VAL A CG2 1 
ATOM   153  N N   . GLN A 1 27  ? 24.567  66.018  27.284 1.00 30.38  ? 518  GLN A N   1 
ATOM   154  C CA  . GLN A 1 27  ? 24.027  65.830  25.950 1.00 32.05  ? 518  GLN A CA  1 
ATOM   155  C C   . GLN A 1 27  ? 23.324  67.128  25.607 1.00 33.04  ? 518  GLN A C   1 
ATOM   156  O O   . GLN A 1 27  ? 22.514  67.612  26.390 1.00 32.92  ? 518  GLN A O   1 
ATOM   157  C CB  . GLN A 1 27  ? 23.014  64.694  25.963 1.00 32.31  ? 518  GLN A CB  1 
ATOM   158  C CG  . GLN A 1 27  ? 23.097  63.749  24.790 1.00 33.44  ? 518  GLN A CG  1 
ATOM   159  C CD  . GLN A 1 27  ? 21.917  62.810  24.749 1.00 34.60  ? 518  GLN A CD  1 
ATOM   160  O OE1 . GLN A 1 27  ? 20.811  63.209  24.381 1.00 34.82  ? 518  GLN A OE1 1 
ATOM   161  N NE2 . GLN A 1 27  ? 22.135  61.556  25.147 1.00 35.19  ? 518  GLN A NE2 1 
ATOM   162  N N   . PHE A 1 28  ? 23.619  67.685  24.438 1.00 34.45  ? 519  PHE A N   1 
ATOM   163  C CA  . PHE A 1 28  ? 23.012  68.956  24.052 1.00 35.45  ? 519  PHE A CA  1 
ATOM   164  C C   . PHE A 1 28  ? 22.717  69.077  22.559 1.00 35.14  ? 519  PHE A C   1 
ATOM   165  O O   . PHE A 1 28  ? 23.187  68.281  21.742 1.00 33.46  ? 519  PHE A O   1 
ATOM   166  C CB  . PHE A 1 28  ? 23.943  70.107  24.451 1.00 35.60  ? 519  PHE A CB  1 
ATOM   167  C CG  . PHE A 1 28  ? 25.193  70.165  23.624 1.00 37.25  ? 519  PHE A CG  1 
ATOM   168  C CD1 . PHE A 1 28  ? 25.321  71.095  22.595 1.00 37.89  ? 519  PHE A CD1 1 
ATOM   169  C CD2 . PHE A 1 28  ? 26.201  69.216  23.800 1.00 38.33  ? 519  PHE A CD2 1 
ATOM   170  C CE1 . PHE A 1 28  ? 26.429  71.075  21.745 1.00 38.03  ? 519  PHE A CE1 1 
ATOM   171  C CE2 . PHE A 1 28  ? 27.313  69.186  22.955 1.00 38.40  ? 519  PHE A CE2 1 
ATOM   172  C CZ  . PHE A 1 28  ? 27.424  70.117  21.924 1.00 38.97  ? 519  PHE A CZ  1 
ATOM   173  N N   . ASP A 1 29  ? 21.936  70.100  22.232 1.00 35.69  ? 520  ASP A N   1 
ATOM   174  C CA  . ASP A 1 29  ? 21.580  70.412  20.866 1.00 38.03  ? 520  ASP A CA  1 
ATOM   175  C C   . ASP A 1 29  ? 22.340  71.666  20.456 1.00 39.33  ? 520  ASP A C   1 
ATOM   176  O O   . ASP A 1 29  ? 22.598  72.545  21.284 1.00 40.38  ? 520  ASP A O   1 
ATOM   177  C CB  . ASP A 1 29  ? 20.086  70.690  20.753 1.00 40.56  ? 520  ASP A CB  1 
ATOM   178  C CG  . ASP A 1 29  ? 19.246  69.473  21.042 1.00 43.94  ? 520  ASP A CG  1 
ATOM   179  O OD1 . ASP A 1 29  ? 19.635  68.365  20.600 1.00 44.91  ? 520  ASP A OD1 1 
ATOM   180  O OD2 . ASP A 1 29  ? 18.192  69.629  21.698 1.00 43.82  ? 520  ASP A OD2 1 
ATOM   181  N N   . GLU A 1 30  ? 22.700  71.750  19.182 1.00 38.78  ? 521  GLU A N   1 
ATOM   182  C CA  . GLU A 1 30  ? 23.395  72.921  18.677 1.00 39.34  ? 521  GLU A CA  1 
ATOM   183  C C   . GLU A 1 30  ? 22.456  74.114  18.819 1.00 37.71  ? 521  GLU A C   1 
ATOM   184  O O   . GLU A 1 30  ? 21.240  73.955  18.930 1.00 36.31  ? 521  GLU A O   1 
ATOM   185  C CB  . GLU A 1 30  ? 23.727  72.750  17.198 1.00 41.99  ? 521  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 30  ? 24.695  71.640  16.876 1.00 48.35  ? 521  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 30  ? 24.498  71.122  15.464 1.00 52.74  ? 521  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 30  ? 24.038  71.913  14.607 1.00 53.92  ? 521  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 30  ? 24.803  69.931  15.209 1.00 54.25  ? 521  GLU A OE2 1 
ATOM   190  N N   . PRO A 1 31  ? 23.009  75.328  18.831 1.00 36.28  ? 522  PRO A N   1 
ATOM   191  C CA  . PRO A 1 31  ? 22.161  76.513  18.952 1.00 36.59  ? 522  PRO A CA  1 
ATOM   192  C C   . PRO A 1 31  ? 21.234  76.625  17.731 1.00 36.94  ? 522  PRO A C   1 
ATOM   193  O O   . PRO A 1 31  ? 21.545  76.096  16.662 1.00 36.78  ? 522  PRO A O   1 
ATOM   194  C CB  . PRO A 1 31  ? 23.178  77.646  19.010 1.00 36.86  ? 522  PRO A CB  1 
ATOM   195  C CG  . PRO A 1 31  ? 24.349  76.998  19.702 1.00 37.05  ? 522  PRO A CG  1 
ATOM   196  C CD  . PRO A 1 31  ? 24.430  75.673  19.002 1.00 35.83  ? 522  PRO A CD  1 
ATOM   197  N N   . GLU A 1 32  ? 20.096  77.299  17.880 1.00 37.83  ? 523  GLU A N   1 
ATOM   198  C CA  . GLU A 1 32  ? 19.181  77.457  16.753 1.00 38.01  ? 523  GLU A CA  1 
ATOM   199  C C   . GLU A 1 32  ? 19.838  78.364  15.719 1.00 39.03  ? 523  GLU A C   1 
ATOM   200  O O   . GLU A 1 32  ? 19.734  78.131  14.515 1.00 39.12  ? 523  GLU A O   1 
ATOM   201  C CB  . GLU A 1 32  ? 17.860  78.074  17.198 1.00 36.40  ? 523  GLU A CB  1 
ATOM   202  C CG  . GLU A 1 32  ? 16.759  78.043  16.137 1.00 38.04  ? 523  GLU A CG  1 
ATOM   203  C CD  . GLU A 1 32  ? 16.993  78.992  14.954 1.00 39.72  ? 523  GLU A CD  1 
ATOM   204  O OE1 . GLU A 1 32  ? 17.010  80.229  15.146 1.00 39.12  ? 523  GLU A OE1 1 
ATOM   205  O OE2 . GLU A 1 32  ? 17.153  78.492  13.819 1.00 40.41  ? 523  GLU A OE2 1 
ATOM   206  N N   . ALA A 1 33  ? 20.520  79.396  16.198 1.00 39.30  ? 524  ALA A N   1 
ATOM   207  C CA  . ALA A 1 33  ? 21.192  80.333  15.314 1.00 40.61  ? 524  ALA A CA  1 
ATOM   208  C C   . ALA A 1 33  ? 22.692  80.344  15.582 1.00 41.64  ? 524  ALA A C   1 
ATOM   209  O O   . ALA A 1 33  ? 23.128  80.467  16.728 1.00 41.26  ? 524  ALA A O   1 
ATOM   210  C CB  . ALA A 1 33  ? 20.614  81.722  15.504 1.00 40.21  ? 524  ALA A CB  1 
ATOM   211  N N   . THR A 1 34  ? 23.477  80.216  14.516 1.00 43.90  ? 525  THR A N   1 
ATOM   212  C CA  . THR A 1 34  ? 24.934  80.201  14.627 1.00 45.56  ? 525  THR A CA  1 
ATOM   213  C C   . THR A 1 34  ? 25.512  81.612  14.621 1.00 46.99  ? 525  THR A C   1 
ATOM   214  O O   . THR A 1 34  ? 26.698  81.803  14.903 1.00 48.35  ? 525  THR A O   1 
ATOM   215  C CB  . THR A 1 34  ? 25.584  79.423  13.468 1.00 44.53  ? 525  THR A CB  1 
ATOM   216  O OG1 . THR A 1 34  ? 25.670  80.271  12.320 1.00 45.87  ? 525  THR A OG1 1 
ATOM   217  C CG2 . THR A 1 34  ? 24.754  78.197  13.113 1.00 43.42  ? 525  THR A CG2 1 
ATOM   218  N N   . GLY A 1 35  ? 24.675  82.594  14.292 1.00 47.10  ? 526  GLY A N   1 
ATOM   219  C CA  . GLY A 1 35  ? 25.130  83.970  14.262 1.00 48.01  ? 526  GLY A CA  1 
ATOM   220  C C   . GLY A 1 35  ? 25.641  84.417  12.904 1.00 50.10  ? 526  GLY A C   1 
ATOM   221  O O   . GLY A 1 35  ? 25.751  85.619  12.642 1.00 50.44  ? 526  GLY A O   1 
ATOM   222  N N   . GLY A 1 36  ? 25.952  83.459  12.035 1.00 50.34  ? 527  GLY A N   1 
ATOM   223  C CA  . GLY A 1 36  ? 26.452  83.795  10.714 1.00 52.19  ? 527  GLY A CA  1 
ATOM   224  C C   . GLY A 1 36  ? 27.800  83.157  10.446 1.00 54.29  ? 527  GLY A C   1 
ATOM   225  O O   . GLY A 1 36  ? 28.252  83.072  9.306  1.00 55.13  ? 527  GLY A O   1 
ATOM   226  N N   . VAL A 1 37  ? 28.446  82.706  11.513 1.00 55.42  ? 528  VAL A N   1 
ATOM   227  C CA  . VAL A 1 37  ? 29.743  82.057  11.419 1.00 56.01  ? 528  VAL A CA  1 
ATOM   228  C C   . VAL A 1 37  ? 29.642  80.672  12.058 1.00 56.87  ? 528  VAL A C   1 
ATOM   229  O O   . VAL A 1 37  ? 29.010  80.505  13.105 1.00 57.75  ? 528  VAL A O   1 
ATOM   230  C CB  . VAL A 1 37  ? 30.820  82.871  12.169 1.00 56.09  ? 528  VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 37  ? 32.154  82.132  12.132 1.00 56.91  ? 528  VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 37  ? 30.951  84.251  11.551 1.00 55.14  ? 528  VAL A CG2 1 
ATOM   233  N N   . PRO A 1 38  ? 30.259  79.658  11.433 1.00 56.62  ? 529  PRO A N   1 
ATOM   234  C CA  . PRO A 1 38  ? 30.221  78.293  11.971 1.00 55.14  ? 529  PRO A CA  1 
ATOM   235  C C   . PRO A 1 38  ? 30.693  78.243  13.424 1.00 53.26  ? 529  PRO A C   1 
ATOM   236  O O   . PRO A 1 38  ? 31.565  79.010  13.828 1.00 53.53  ? 529  PRO A O   1 
ATOM   237  C CB  . PRO A 1 38  ? 31.161  77.532  11.039 1.00 55.61  ? 529  PRO A CB  1 
ATOM   238  C CG  . PRO A 1 38  ? 30.963  78.235  9.731  1.00 56.51  ? 529  PRO A CG  1 
ATOM   239  C CD  . PRO A 1 38  ? 30.977  79.693  10.146 1.00 56.77  ? 529  PRO A CD  1 
ATOM   240  N N   . ILE A 1 39  ? 30.112  77.337  14.202 1.00 51.33  ? 530  ILE A N   1 
ATOM   241  C CA  . ILE A 1 39  ? 30.478  77.175  15.607 1.00 49.08  ? 530  ILE A CA  1 
ATOM   242  C C   . ILE A 1 39  ? 31.811  76.430  15.714 1.00 47.97  ? 530  ILE A C   1 
ATOM   243  O O   . ILE A 1 39  ? 31.979  75.341  15.162 1.00 47.50  ? 530  ILE A O   1 
ATOM   244  C CB  . ILE A 1 39  ? 29.374  76.413  16.356 1.00 48.42  ? 530  ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 39  ? 28.048  77.149  16.170 1.00 49.39  ? 530  ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 39  ? 29.702  76.324  17.832 1.00 47.59  ? 530  ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 39  ? 26.852  76.359  16.593 1.00 51.21  ? 530  ILE A CD1 1 
ATOM   248  N N   . LEU A 1 40  ? 32.755  77.032  16.428 1.00 46.42  ? 531  LEU A N   1 
ATOM   249  C CA  . LEU A 1 40  ? 34.087  76.466  16.591 1.00 46.15  ? 531  LEU A CA  1 
ATOM   250  C C   . LEU A 1 40  ? 34.287  75.645  17.862 1.00 46.40  ? 531  LEU A C   1 
ATOM   251  O O   . LEU A 1 40  ? 34.802  74.525  17.812 1.00 46.12  ? 531  LEU A O   1 
ATOM   252  C CB  . LEU A 1 40  ? 35.124  77.588  16.576 1.00 45.47  ? 531  LEU A CB  1 
ATOM   253  C CG  . LEU A 1 40  ? 35.085  78.550  15.391 1.00 45.69  ? 531  LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 40  ? 36.017  79.717  15.685 1.00 46.17  ? 531  LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 40  ? 35.474  77.830  14.105 1.00 43.20  ? 531  LEU A CD2 1 
ATOM   256  N N   . LYS A 1 41  ? 33.900  76.218  18.999 1.00 45.00  ? 532  LYS A N   1 
ATOM   257  C CA  . LYS A 1 41  ? 34.057  75.545  20.282 1.00 43.45  ? 532  LYS A CA  1 
ATOM   258  C C   . LYS A 1 41  ? 32.837  75.689  21.183 1.00 40.43  ? 532  LYS A C   1 
ATOM   259  O O   . LYS A 1 41  ? 31.913  76.457  20.904 1.00 39.03  ? 532  LYS A O   1 
ATOM   260  C CB  . LYS A 1 41  ? 35.287  76.097  21.014 1.00 45.99  ? 532  LYS A CB  1 
ATOM   261  C CG  . LYS A 1 41  ? 36.550  76.107  20.169 1.00 51.05  ? 532  LYS A CG  1 
ATOM   262  C CD  . LYS A 1 41  ? 36.873  74.701  19.639 1.00 55.60  ? 532  LYS A CD  1 
ATOM   263  C CE  . LYS A 1 41  ? 37.987  74.707  18.587 1.00 56.60  ? 532  LYS A CE  1 
ATOM   264  N NZ  . LYS A 1 41  ? 38.306  73.330  18.112 1.00 55.29  ? 532  LYS A NZ  1 
ATOM   265  N N   . TYR A 1 42  ? 32.843  74.927  22.268 1.00 37.16  ? 533  TYR A N   1 
ATOM   266  C CA  . TYR A 1 42  ? 31.769  74.974  23.242 1.00 34.67  ? 533  TYR A CA  1 
ATOM   267  C C   . TYR A 1 42  ? 32.427  75.212  24.583 1.00 33.67  ? 533  TYR A C   1 
ATOM   268  O O   . TYR A 1 42  ? 33.390  74.533  24.925 1.00 33.61  ? 533  TYR A O   1 
ATOM   269  C CB  . TYR A 1 42  ? 30.993  73.656  23.252 1.00 31.41  ? 533  TYR A CB  1 
ATOM   270  C CG  . TYR A 1 42  ? 30.001  73.538  22.112 1.00 31.16  ? 533  TYR A CG  1 
ATOM   271  C CD1 . TYR A 1 42  ? 28.812  74.273  22.118 1.00 30.58  ? 533  TYR A CD1 1 
ATOM   272  C CD2 . TYR A 1 42  ? 30.270  72.729  21.007 1.00 28.66  ? 533  TYR A CD2 1 
ATOM   273  C CE1 . TYR A 1 42  ? 27.919  74.205  21.050 1.00 31.30  ? 533  TYR A CE1 1 
ATOM   274  C CE2 . TYR A 1 42  ? 29.389  72.656  19.937 1.00 29.36  ? 533  TYR A CE2 1 
ATOM   275  C CZ  . TYR A 1 42  ? 28.212  73.394  19.958 1.00 32.38  ? 533  TYR A CZ  1 
ATOM   276  O OH  . TYR A 1 42  ? 27.324  73.311  18.897 1.00 32.04  ? 533  TYR A OH  1 
ATOM   277  N N   . LYS A 1 43  ? 31.936  76.203  25.321 1.00 32.25  ? 534  LYS A N   1 
ATOM   278  C CA  . LYS A 1 43  ? 32.484  76.505  26.634 1.00 32.77  ? 534  LYS A CA  1 
ATOM   279  C C   . LYS A 1 43  ? 31.570  75.894  27.688 1.00 33.83  ? 534  LYS A C   1 
ATOM   280  O O   . LYS A 1 43  ? 30.405  76.277  27.815 1.00 35.28  ? 534  LYS A O   1 
ATOM   281  C CB  . LYS A 1 43  ? 32.569  78.013  26.828 1.00 32.32  ? 534  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 43  ? 33.287  78.497  28.086 1.00 32.42  ? 534  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 43  ? 33.389  80.029  28.018 1.00 35.79  ? 534  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 43  ? 33.617  80.700  29.365 1.00 35.91  ? 534  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 43  ? 34.970  80.437  29.940 1.00 39.62  ? 534  LYS A NZ  1 
ATOM   286  N N   . ALA A 1 44  ? 32.080  74.920  28.425 1.00 32.19  ? 535  ALA A N   1 
ATOM   287  C CA  . ALA A 1 44  ? 31.280  74.309  29.461 1.00 32.38  ? 535  ALA A CA  1 
ATOM   288  C C   . ALA A 1 44  ? 31.603  75.016  30.767 1.00 33.32  ? 535  ALA A C   1 
ATOM   289  O O   . ALA A 1 44  ? 32.761  75.321  31.047 1.00 32.82  ? 535  ALA A O   1 
ATOM   290  C CB  . ALA A 1 44  ? 31.597  72.839  29.574 1.00 31.44  ? 535  ALA A CB  1 
ATOM   291  N N   . GLU A 1 45  ? 30.568  75.292  31.551 1.00 34.66  ? 536  GLU A N   1 
ATOM   292  C CA  . GLU A 1 45  ? 30.726  75.943  32.841 1.00 34.51  ? 536  GLU A CA  1 
ATOM   293  C C   . GLU A 1 45  ? 29.943  75.159  33.881 1.00 34.88  ? 536  GLU A C   1 
ATOM   294  O O   . GLU A 1 45  ? 28.763  74.860  33.686 1.00 33.95  ? 536  GLU A O   1 
ATOM   295  C CB  . GLU A 1 45  ? 30.182  77.367  32.804 1.00 34.30  ? 536  GLU A CB  1 
ATOM   296  C CG  . GLU A 1 45  ? 30.889  78.283  31.857 1.00 40.54  ? 536  GLU A CG  1 
ATOM   297  C CD  . GLU A 1 45  ? 30.324  79.688  31.894 1.00 43.89  ? 536  GLU A CD  1 
ATOM   298  O OE1 . GLU A 1 45  ? 30.781  80.538  31.097 1.00 46.14  ? 536  GLU A OE1 1 
ATOM   299  O OE2 . GLU A 1 45  ? 29.422  79.937  32.723 1.00 43.43  ? 536  GLU A OE2 1 
ATOM   300  N N   . TRP A 1 46  ? 30.602  74.814  34.980 1.00 34.08  ? 537  TRP A N   1 
ATOM   301  C CA  . TRP A 1 46  ? 29.927  74.100  36.045 1.00 33.06  ? 537  TRP A CA  1 
ATOM   302  C C   . TRP A 1 46  ? 30.337  74.717  37.360 1.00 33.54  ? 537  TRP A C   1 
ATOM   303  O O   . TRP A 1 46  ? 31.410  75.301  37.473 1.00 33.01  ? 537  TRP A O   1 
ATOM   304  C CB  . TRP A 1 46  ? 30.245  72.600  36.002 1.00 31.47  ? 537  TRP A CB  1 
ATOM   305  C CG  . TRP A 1 46  ? 31.673  72.249  36.203 1.00 31.41  ? 537  TRP A CG  1 
ATOM   306  C CD1 . TRP A 1 46  ? 32.252  71.794  37.351 1.00 29.52  ? 537  TRP A CD1 1 
ATOM   307  C CD2 . TRP A 1 46  ? 32.715  72.318  35.225 1.00 32.88  ? 537  TRP A CD2 1 
ATOM   308  N NE1 . TRP A 1 46  ? 33.588  71.574  37.151 1.00 30.98  ? 537  TRP A NE1 1 
ATOM   309  C CE2 . TRP A 1 46  ? 33.903  71.888  35.854 1.00 32.06  ? 537  TRP A CE2 1 
ATOM   310  C CE3 . TRP A 1 46  ? 32.762  72.705  33.875 1.00 32.50  ? 537  TRP A CE3 1 
ATOM   311  C CZ2 . TRP A 1 46  ? 35.125  71.834  35.182 1.00 30.03  ? 537  TRP A CZ2 1 
ATOM   312  C CZ3 . TRP A 1 46  ? 33.980  72.652  33.205 1.00 30.34  ? 537  TRP A CZ3 1 
ATOM   313  C CH2 . TRP A 1 46  ? 35.143  72.220  33.860 1.00 32.00  ? 537  TRP A CH2 1 
ATOM   314  N N   . ARG A 1 47  ? 29.461  74.601  38.351 1.00 34.82  ? 538  ARG A N   1 
ATOM   315  C CA  . ARG A 1 47  ? 29.716  75.176  39.659 1.00 34.37  ? 538  ARG A CA  1 
ATOM   316  C C   . ARG A 1 47  ? 29.108  74.312  40.755 1.00 34.00  ? 538  ARG A C   1 
ATOM   317  O O   . ARG A 1 47  ? 27.992  73.811  40.624 1.00 32.88  ? 538  ARG A O   1 
ATOM   318  C CB  . ARG A 1 47  ? 29.121  76.586  39.706 1.00 34.80  ? 538  ARG A CB  1 
ATOM   319  C CG  . ARG A 1 47  ? 29.463  77.384  40.938 1.00 36.91  ? 538  ARG A CG  1 
ATOM   320  C CD  . ARG A 1 47  ? 28.775  78.744  40.899 1.00 40.45  ? 538  ARG A CD  1 
ATOM   321  N NE  . ARG A 1 47  ? 27.317  78.613  40.876 1.00 44.75  ? 538  ARG A NE  1 
ATOM   322  C CZ  . ARG A 1 47  ? 26.466  79.633  40.797 1.00 43.78  ? 538  ARG A CZ  1 
ATOM   323  N NH1 . ARG A 1 47  ? 26.918  80.878  40.732 1.00 43.80  ? 538  ARG A NH1 1 
ATOM   324  N NH2 . ARG A 1 47  ? 25.159  79.402  40.776 1.00 43.30  ? 538  ARG A NH2 1 
ATOM   325  N N   . ALA A 1 48  ? 29.859  74.125  41.829 1.00 34.30  ? 539  ALA A N   1 
ATOM   326  C CA  . ALA A 1 48  ? 29.374  73.353  42.957 1.00 35.20  ? 539  ALA A CA  1 
ATOM   327  C C   . ALA A 1 48  ? 28.370  74.256  43.665 1.00 36.41  ? 539  ALA A C   1 
ATOM   328  O O   . ALA A 1 48  ? 28.651  75.424  43.909 1.00 37.22  ? 539  ALA A O   1 
ATOM   329  C CB  . ALA A 1 48  ? 30.522  73.014  43.878 1.00 33.00  ? 539  ALA A CB  1 
ATOM   330  N N   . VAL A 1 49  ? 27.191  73.735  43.973 1.00 38.43  ? 540  VAL A N   1 
ATOM   331  C CA  . VAL A 1 49  ? 26.179  74.542  44.644 1.00 40.87  ? 540  VAL A CA  1 
ATOM   332  C C   . VAL A 1 49  ? 26.744  75.111  45.939 1.00 43.01  ? 540  VAL A C   1 
ATOM   333  O O   . VAL A 1 49  ? 27.001  74.382  46.899 1.00 43.48  ? 540  VAL A O   1 
ATOM   334  C CB  . VAL A 1 49  ? 24.900  73.715  44.926 1.00 40.53  ? 540  VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 49  ? 24.102  74.332  46.064 1.00 37.54  ? 540  VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 49  ? 24.052  73.663  43.658 1.00 39.27  ? 540  VAL A CG2 1 
ATOM   337  N N   . GLY A 1 50  ? 26.941  76.424  45.950 1.00 44.21  ? 541  GLY A N   1 
ATOM   338  C CA  . GLY A 1 50  ? 27.502  77.066  47.117 1.00 44.55  ? 541  GLY A CA  1 
ATOM   339  C C   . GLY A 1 50  ? 28.783  77.786  46.758 1.00 45.99  ? 541  GLY A C   1 
ATOM   340  O O   . GLY A 1 50  ? 29.323  78.521  47.571 1.00 46.14  ? 541  GLY A O   1 
ATOM   341  N N   . GLU A 1 51  ? 29.289  77.568  45.548 1.00 47.47  ? 542  GLU A N   1 
ATOM   342  C CA  . GLU A 1 51  ? 30.505  78.250  45.126 1.00 49.81  ? 542  GLU A CA  1 
ATOM   343  C C   . GLU A 1 51  ? 30.058  79.500  44.404 1.00 50.54  ? 542  GLU A C   1 
ATOM   344  O O   . GLU A 1 51  ? 28.883  79.637  44.069 1.00 50.50  ? 542  GLU A O   1 
ATOM   345  C CB  . GLU A 1 51  ? 31.338  77.395  44.166 1.00 51.67  ? 542  GLU A CB  1 
ATOM   346  C CG  . GLU A 1 51  ? 31.824  76.055  44.705 1.00 55.92  ? 542  GLU A CG  1 
ATOM   347  C CD  . GLU A 1 51  ? 32.574  76.170  46.021 1.00 57.98  ? 542  GLU A CD  1 
ATOM   348  O OE1 . GLU A 1 51  ? 33.340  75.237  46.350 1.00 58.55  ? 542  GLU A OE1 1 
ATOM   349  O OE2 . GLU A 1 51  ? 32.389  77.181  46.733 1.00 59.79  ? 542  GLU A OE2 1 
ATOM   350  N N   . GLU A 1 52  ? 30.993  80.407  44.154 1.00 52.00  ? 543  GLU A N   1 
ATOM   351  C CA  . GLU A 1 52  ? 30.670  81.641  43.457 1.00 53.30  ? 543  GLU A CA  1 
ATOM   352  C C   . GLU A 1 52  ? 31.184  81.549  42.041 1.00 51.50  ? 543  GLU A C   1 
ATOM   353  O O   . GLU A 1 52  ? 30.457  81.775  41.077 1.00 52.01  ? 543  GLU A O   1 
ATOM   354  C CB  . GLU A 1 52  ? 31.339  82.822  44.141 1.00 57.96  ? 543  GLU A CB  1 
ATOM   355  C CG  . GLU A 1 52  ? 31.119  82.862  45.632 1.00 64.94  ? 543  GLU A CG  1 
ATOM   356  C CD  . GLU A 1 52  ? 31.854  84.010  46.294 1.00 69.15  ? 543  GLU A CD  1 
ATOM   357  O OE1 . GLU A 1 52  ? 31.812  84.084  47.543 1.00 71.68  ? 543  GLU A OE1 1 
ATOM   358  O OE2 . GLU A 1 52  ? 32.468  84.835  45.571 1.00 69.67  ? 543  GLU A OE2 1 
ATOM   359  N N   . VAL A 1 53  ? 32.454  81.200  41.931 1.00 50.36  ? 544  VAL A N   1 
ATOM   360  C CA  . VAL A 1 53  ? 33.110  81.095  40.642 1.00 48.18  ? 544  VAL A CA  1 
ATOM   361  C C   . VAL A 1 53  ? 32.687  79.856  39.880 1.00 46.29  ? 544  VAL A C   1 
ATOM   362  O O   . VAL A 1 53  ? 32.354  78.833  40.468 1.00 46.01  ? 544  VAL A O   1 
ATOM   363  C CB  . VAL A 1 53  ? 34.635  81.074  40.813 1.00 47.56  ? 544  VAL A CB  1 
ATOM   364  C CG1 . VAL A 1 53  ? 35.309  81.616  39.561 1.00 49.06  ? 544  VAL A CG1 1 
ATOM   365  C CG2 . VAL A 1 53  ? 35.021  81.896  42.018 1.00 47.99  ? 544  VAL A CG2 1 
ATOM   366  N N   . TRP A 1 54  ? 32.703  79.968  38.559 1.00 44.95  ? 545  TRP A N   1 
ATOM   367  C CA  . TRP A 1 54  ? 32.341  78.869  37.682 1.00 43.64  ? 545  TRP A CA  1 
ATOM   368  C C   . TRP A 1 54  ? 33.584  78.294  37.045 1.00 42.69  ? 545  TRP A C   1 
ATOM   369  O O   . TRP A 1 54  ? 34.433  79.037  36.560 1.00 41.97  ? 545  TRP A O   1 
ATOM   370  C CB  . TRP A 1 54  ? 31.426  79.340  36.555 1.00 43.04  ? 545  TRP A CB  1 
ATOM   371  C CG  . TRP A 1 54  ? 30.073  79.731  36.974 1.00 43.25  ? 545  TRP A CG  1 
ATOM   372  C CD1 . TRP A 1 54  ? 29.699  80.901  37.565 1.00 43.37  ? 545  TRP A CD1 1 
ATOM   373  C CD2 . TRP A 1 54  ? 28.885  78.960  36.815 1.00 44.23  ? 545  TRP A CD2 1 
ATOM   374  N NE1 . TRP A 1 54  ? 28.345  80.911  37.780 1.00 43.11  ? 545  TRP A NE1 1 
ATOM   375  C CE2 . TRP A 1 54  ? 27.817  79.729  37.329 1.00 45.20  ? 545  TRP A CE2 1 
ATOM   376  C CE3 . TRP A 1 54  ? 28.615  77.692  36.289 1.00 43.84  ? 545  TRP A CE3 1 
ATOM   377  C CZ2 . TRP A 1 54  ? 26.495  79.269  37.330 1.00 45.69  ? 545  TRP A CZ2 1 
ATOM   378  C CZ3 . TRP A 1 54  ? 27.301  77.232  36.292 1.00 44.77  ? 545  TRP A CZ3 1 
ATOM   379  C CH2 . TRP A 1 54  ? 26.257  78.021  36.809 1.00 44.47  ? 545  TRP A CH2 1 
ATOM   380  N N   . HIS A 1 55  ? 33.680  76.970  37.044 1.00 42.73  ? 546  HIS A N   1 
ATOM   381  C CA  . HIS A 1 55  ? 34.800  76.274  36.426 1.00 42.27  ? 546  HIS A CA  1 
ATOM   382  C C   . HIS A 1 55  ? 34.464  76.176  34.943 1.00 42.36  ? 546  HIS A C   1 
ATOM   383  O O   . HIS A 1 55  ? 33.290  76.068  34.577 1.00 43.73  ? 546  HIS A O   1 
ATOM   384  C CB  . HIS A 1 55  ? 34.946  74.881  37.031 1.00 42.93  ? 546  HIS A CB  1 
ATOM   385  C CG  . HIS A 1 55  ? 35.357  74.895  38.468 1.00 46.11  ? 546  HIS A CG  1 
ATOM   386  N ND1 . HIS A 1 55  ? 36.623  75.255  38.876 1.00 48.01  ? 546  HIS A ND1 1 
ATOM   387  C CD2 . HIS A 1 55  ? 34.658  74.640  39.598 1.00 48.83  ? 546  HIS A CD2 1 
ATOM   388  C CE1 . HIS A 1 55  ? 36.686  75.223  40.194 1.00 48.79  ? 546  HIS A CE1 1 
ATOM   389  N NE2 . HIS A 1 55  ? 35.506  74.853  40.658 1.00 49.70  ? 546  HIS A NE2 1 
ATOM   390  N N   . SER A 1 56  ? 35.475  76.224  34.083 1.00 40.48  ? 547  SER A N   1 
ATOM   391  C CA  . SER A 1 56  ? 35.212  76.148  32.655 1.00 38.42  ? 547  SER A CA  1 
ATOM   392  C C   . SER A 1 56  ? 36.167  75.229  31.918 1.00 37.28  ? 547  SER A C   1 
ATOM   393  O O   . SER A 1 56  ? 37.148  74.749  32.480 1.00 38.60  ? 547  SER A O   1 
ATOM   394  C CB  . SER A 1 56  ? 35.261  77.548  32.040 1.00 38.76  ? 547  SER A CB  1 
ATOM   395  O OG  . SER A 1 56  ? 36.506  78.174  32.298 1.00 39.37  ? 547  SER A OG  1 
ATOM   396  N N   . LYS A 1 57  ? 35.850  74.983  30.652 1.00 36.23  ? 548  LYS A N   1 
ATOM   397  C CA  . LYS A 1 57  ? 36.647  74.134  29.777 1.00 34.81  ? 548  LYS A CA  1 
ATOM   398  C C   . LYS A 1 57  ? 36.111  74.289  28.359 1.00 34.83  ? 548  LYS A C   1 
ATOM   399  O O   . LYS A 1 57  ? 34.897  74.384  28.162 1.00 34.22  ? 548  LYS A O   1 
ATOM   400  C CB  . LYS A 1 57  ? 36.532  72.667  30.195 1.00 34.13  ? 548  LYS A CB  1 
ATOM   401  C CG  . LYS A 1 57  ? 37.494  71.741  29.468 1.00 35.15  ? 548  LYS A CG  1 
ATOM   402  C CD  . LYS A 1 57  ? 38.942  72.023  29.897 1.00 39.29  ? 548  LYS A CD  1 
ATOM   403  C CE  . LYS A 1 57  ? 39.969  71.490  28.896 1.00 39.72  ? 548  LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 57  ? 39.821  72.109  27.538 1.00 39.53  ? 548  LYS A NZ  1 
ATOM   405  N N   . TRP A 1 58  ? 37.014  74.334  27.380 1.00 34.57  ? 549  TRP A N   1 
ATOM   406  C CA  . TRP A 1 58  ? 36.622  74.438  25.974 1.00 33.48  ? 549  TRP A CA  1 
ATOM   407  C C   . TRP A 1 58  ? 36.550  73.043  25.341 1.00 31.46  ? 549  TRP A C   1 
ATOM   408  O O   . TRP A 1 58  ? 37.330  72.154  25.672 1.00 30.97  ? 549  TRP A O   1 
ATOM   409  C CB  . TRP A 1 58  ? 37.620  75.289  25.169 1.00 34.83  ? 549  TRP A CB  1 
ATOM   410  C CG  . TRP A 1 58  ? 37.638  76.738  25.515 1.00 35.62  ? 549  TRP A CG  1 
ATOM   411  C CD1 . TRP A 1 58  ? 38.548  77.380  26.302 1.00 36.91  ? 549  TRP A CD1 1 
ATOM   412  C CD2 . TRP A 1 58  ? 36.682  77.726  25.120 1.00 37.42  ? 549  TRP A CD2 1 
ATOM   413  N NE1 . TRP A 1 58  ? 38.219  78.709  26.425 1.00 38.05  ? 549  TRP A NE1 1 
ATOM   414  C CE2 . TRP A 1 58  ? 37.076  78.950  25.710 1.00 38.27  ? 549  TRP A CE2 1 
ATOM   415  C CE3 . TRP A 1 58  ? 35.527  77.700  24.324 1.00 37.51  ? 549  TRP A CE3 1 
ATOM   416  C CZ2 . TRP A 1 58  ? 36.355  80.135  25.533 1.00 38.53  ? 549  TRP A CZ2 1 
ATOM   417  C CZ3 . TRP A 1 58  ? 34.808  78.881  24.146 1.00 35.76  ? 549  TRP A CZ3 1 
ATOM   418  C CH2 . TRP A 1 58  ? 35.225  80.080  24.749 1.00 38.19  ? 549  TRP A CH2 1 
ATOM   419  N N   . TYR A 1 59  ? 35.606  72.869  24.426 1.00 31.62  ? 550  TYR A N   1 
ATOM   420  C CA  . TYR A 1 59  ? 35.415  71.603  23.726 1.00 33.21  ? 550  TYR A CA  1 
ATOM   421  C C   . TYR A 1 59  ? 35.347  71.891  22.222 1.00 34.67  ? 550  TYR A C   1 
ATOM   422  O O   . TYR A 1 59  ? 34.692  72.846  21.803 1.00 35.33  ? 550  TYR A O   1 
ATOM   423  C CB  . TYR A 1 59  ? 34.107  70.940  24.195 1.00 31.92  ? 550  TYR A CB  1 
ATOM   424  C CG  . TYR A 1 59  ? 34.136  70.440  25.624 1.00 30.61  ? 550  TYR A CG  1 
ATOM   425  C CD1 . TYR A 1 59  ? 34.653  69.187  25.925 1.00 30.42  ? 550  TYR A CD1 1 
ATOM   426  C CD2 . TYR A 1 59  ? 33.684  71.238  26.680 1.00 29.02  ? 550  TYR A CD2 1 
ATOM   427  C CE1 . TYR A 1 59  ? 34.728  68.735  27.240 1.00 31.79  ? 550  TYR A CE1 1 
ATOM   428  C CE2 . TYR A 1 59  ? 33.751  70.800  27.995 1.00 28.83  ? 550  TYR A CE2 1 
ATOM   429  C CZ  . TYR A 1 59  ? 34.274  69.542  28.271 1.00 32.63  ? 550  TYR A CZ  1 
ATOM   430  O OH  . TYR A 1 59  ? 34.333  69.065  29.566 1.00 33.75  ? 550  TYR A OH  1 
ATOM   431  N N   . ASP A 1 60  ? 36.035  71.089  21.415 1.00 35.66  ? 551  ASP A N   1 
ATOM   432  C CA  . ASP A 1 60  ? 36.010  71.285  19.970 1.00 38.24  ? 551  ASP A CA  1 
ATOM   433  C C   . ASP A 1 60  ? 34.610  70.979  19.449 1.00 39.48  ? 551  ASP A C   1 
ATOM   434  O O   . ASP A 1 60  ? 34.062  69.910  19.709 1.00 41.36  ? 551  ASP A O   1 
ATOM   435  C CB  . ASP A 1 60  ? 37.031  70.372  19.281 1.00 40.81  ? 551  ASP A CB  1 
ATOM   436  C CG  . ASP A 1 60  ? 36.893  70.377  17.761 1.00 44.48  ? 551  ASP A CG  1 
ATOM   437  O OD1 . ASP A 1 60  ? 36.980  71.461  17.145 1.00 45.44  ? 551  ASP A OD1 1 
ATOM   438  O OD2 . ASP A 1 60  ? 36.697  69.290  17.175 1.00 46.15  ? 551  ASP A OD2 1 
ATOM   439  N N   . ALA A 1 61  ? 34.033  71.918  18.708 1.00 40.04  ? 552  ALA A N   1 
ATOM   440  C CA  . ALA A 1 61  ? 32.688  71.743  18.168 1.00 39.12  ? 552  ALA A CA  1 
ATOM   441  C C   . ALA A 1 61  ? 32.542  70.504  17.287 1.00 38.56  ? 552  ALA A C   1 
ATOM   442  O O   . ALA A 1 61  ? 31.554  69.774  17.393 1.00 36.91  ? 552  ALA A O   1 
ATOM   443  C CB  . ALA A 1 61  ? 32.267  72.991  17.389 1.00 37.24  ? 552  ALA A CB  1 
ATOM   444  N N   . LYS A 1 62  ? 33.516  70.265  16.418 1.00 38.77  ? 553  LYS A N   1 
ATOM   445  C CA  . LYS A 1 62  ? 33.439  69.110  15.533 1.00 39.83  ? 553  LYS A CA  1 
ATOM   446  C C   . LYS A 1 62  ? 33.416  67.791  16.296 1.00 39.91  ? 553  LYS A C   1 
ATOM   447  O O   . LYS A 1 62  ? 32.650  66.890  15.943 1.00 39.26  ? 553  LYS A O   1 
ATOM   448  C CB  . LYS A 1 62  ? 34.598  69.121  14.537 1.00 41.33  ? 553  LYS A CB  1 
ATOM   449  C CG  . LYS A 1 62  ? 34.191  69.513  13.138 1.00 43.85  ? 553  LYS A CG  1 
ATOM   450  C CD  . LYS A 1 62  ? 35.400  69.936  12.297 1.00 47.73  ? 553  LYS A CD  1 
ATOM   451  C CE  . LYS A 1 62  ? 34.976  70.474  10.915 1.00 47.86  ? 553  LYS A CE  1 
ATOM   452  N NZ  . LYS A 1 62  ? 33.962  71.572  11.002 1.00 46.78  ? 553  LYS A NZ  1 
ATOM   453  N N   . GLU A 1 63  ? 34.242  67.670  17.336 1.00 38.82  ? 554  GLU A N   1 
ATOM   454  C CA  . GLU A 1 63  ? 34.273  66.434  18.111 1.00 38.62  ? 554  GLU A CA  1 
ATOM   455  C C   . GLU A 1 63  ? 33.020  66.324  18.967 1.00 38.99  ? 554  GLU A C   1 
ATOM   456  O O   . GLU A 1 63  ? 32.412  65.256  19.061 1.00 39.44  ? 554  GLU A O   1 
ATOM   457  C CB  . GLU A 1 63  ? 35.509  66.370  19.010 1.00 38.35  ? 554  GLU A CB  1 
ATOM   458  C CG  . GLU A 1 63  ? 35.925  64.936  19.347 1.00 40.30  ? 554  GLU A CG  1 
ATOM   459  C CD  . GLU A 1 63  ? 37.216  64.855  20.162 1.00 42.41  ? 554  GLU A CD  1 
ATOM   460  O OE1 . GLU A 1 63  ? 37.164  65.056  21.399 1.00 38.45  ? 554  GLU A OE1 1 
ATOM   461  O OE2 . GLU A 1 63  ? 38.284  64.594  19.555 1.00 42.71  ? 554  GLU A OE2 1 
ATOM   462  N N   . ALA A 1 64  ? 32.636  67.436  19.583 1.00 38.18  ? 555  ALA A N   1 
ATOM   463  C CA  . ALA A 1 64  ? 31.457  67.475  20.432 1.00 39.38  ? 555  ALA A CA  1 
ATOM   464  C C   . ALA A 1 64  ? 30.210  67.000  19.697 1.00 40.89  ? 555  ALA A C   1 
ATOM   465  O O   . ALA A 1 64  ? 29.426  66.214  20.223 1.00 40.84  ? 555  ALA A O   1 
ATOM   466  C CB  . ALA A 1 64  ? 31.243  68.889  20.956 1.00 38.86  ? 555  ALA A CB  1 
ATOM   467  N N   . SER A 1 65  ? 30.037  67.471  18.471 1.00 42.93  ? 556  SER A N   1 
ATOM   468  C CA  . SER A 1 65  ? 28.876  67.104  17.680 1.00 45.31  ? 556  SER A CA  1 
ATOM   469  C C   . SER A 1 65  ? 28.917  65.684  17.143 1.00 46.59  ? 556  SER A C   1 
ATOM   470  O O   . SER A 1 65  ? 27.874  65.095  16.895 1.00 47.16  ? 556  SER A O   1 
ATOM   471  C CB  . SER A 1 65  ? 28.703  68.096  16.531 1.00 46.23  ? 556  SER A CB  1 
ATOM   472  O OG  . SER A 1 65  ? 28.512  69.407  17.042 1.00 49.05  ? 556  SER A OG  1 
ATOM   473  N N   . MET A 1 66  ? 30.111  65.133  16.952 1.00 48.95  ? 557  MET A N   1 
ATOM   474  C CA  . MET A 1 66  ? 30.235  63.767  16.454 1.00 51.69  ? 557  MET A CA  1 
ATOM   475  C C   . MET A 1 66  ? 30.081  62.780  17.592 1.00 51.88  ? 557  MET A C   1 
ATOM   476  O O   . MET A 1 66  ? 30.127  61.569  17.391 1.00 53.27  ? 557  MET A O   1 
ATOM   477  C CB  . MET A 1 66  ? 31.588  63.546  15.798 1.00 54.83  ? 557  MET A CB  1 
ATOM   478  C CG  . MET A 1 66  ? 31.546  63.585  14.294 1.00 59.71  ? 557  MET A CG  1 
ATOM   479  S SD  . MET A 1 66  ? 33.148  63.137  13.608 1.00 68.30  ? 557  MET A SD  1 
ATOM   480  C CE  . MET A 1 66  ? 32.962  61.317  13.400 1.00 66.56  ? 557  MET A CE  1 
ATOM   481  N N   . GLU A 1 67  ? 29.914  63.308  18.794 1.00 50.87  ? 558  GLU A N   1 
ATOM   482  C CA  . GLU A 1 67  ? 29.747  62.485  19.975 1.00 49.99  ? 558  GLU A CA  1 
ATOM   483  C C   . GLU A 1 67  ? 28.344  62.704  20.532 1.00 48.09  ? 558  GLU A C   1 
ATOM   484  O O   . GLU A 1 67  ? 27.721  61.785  21.063 1.00 47.69  ? 558  GLU A O   1 
ATOM   485  C CB  . GLU A 1 67  ? 30.789  62.877  21.018 1.00 52.70  ? 558  GLU A CB  1 
ATOM   486  C CG  . GLU A 1 67  ? 32.200  62.476  20.655 1.00 56.38  ? 558  GLU A CG  1 
ATOM   487  C CD  . GLU A 1 67  ? 32.530  61.067  21.111 1.00 59.74  ? 558  GLU A CD  1 
ATOM   488  O OE1 . GLU A 1 67  ? 32.502  60.834  22.347 1.00 59.78  ? 558  GLU A OE1 1 
ATOM   489  O OE2 . GLU A 1 67  ? 32.814  60.204  20.241 1.00 58.59  ? 558  GLU A OE2 1 
ATOM   490  N N   . GLY A 1 68  ? 27.850  63.930  20.389 1.00 45.62  ? 559  GLY A N   1 
ATOM   491  C CA  . GLY A 1 68  ? 26.532  64.264  20.895 1.00 41.83  ? 559  GLY A CA  1 
ATOM   492  C C   . GLY A 1 68  ? 26.662  64.704  22.338 1.00 39.63  ? 559  GLY A C   1 
ATOM   493  O O   . GLY A 1 68  ? 25.746  65.307  22.910 1.00 38.72  ? 559  GLY A O   1 
ATOM   494  N N   . ILE A 1 69  ? 27.829  64.420  22.914 1.00 36.02  ? 560  ILE A N   1 
ATOM   495  C CA  . ILE A 1 69  ? 28.098  64.768  24.293 1.00 34.53  ? 560  ILE A CA  1 
ATOM   496  C C   . ILE A 1 69  ? 29.429  65.467  24.531 1.00 34.44  ? 560  ILE A C   1 
ATOM   497  O O   . ILE A 1 69  ? 30.287  65.546  23.650 1.00 35.03  ? 560  ILE A O   1 
ATOM   498  C CB  . ILE A 1 69  ? 28.089  63.512  25.190 1.00 34.29  ? 560  ILE A CB  1 
ATOM   499  C CG1 . ILE A 1 69  ? 29.041  62.462  24.598 1.00 33.46  ? 560  ILE A CG1 1 
ATOM   500  C CG2 . ILE A 1 69  ? 26.663  62.990  25.352 1.00 31.06  ? 560  ILE A CG2 1 
ATOM   501  C CD1 . ILE A 1 69  ? 29.369  61.303  25.527 1.00 31.59  ? 560  ILE A CD1 1 
ATOM   502  N N   . VAL A 1 70  ? 29.573  65.975  25.749 1.00 32.26  ? 561  VAL A N   1 
ATOM   503  C CA  . VAL A 1 70  ? 30.785  66.621  26.211 1.00 31.16  ? 561  VAL A CA  1 
ATOM   504  C C   . VAL A 1 70  ? 30.843  66.171  27.663 1.00 31.75  ? 561  VAL A C   1 
ATOM   505  O O   . VAL A 1 70  ? 29.852  66.295  28.390 1.00 34.10  ? 561  VAL A O   1 
ATOM   506  C CB  . VAL A 1 70  ? 30.701  68.159  26.144 1.00 30.49  ? 561  VAL A CB  1 
ATOM   507  C CG1 . VAL A 1 70  ? 30.586  68.601  24.713 1.00 27.77  ? 561  VAL A CG1 1 
ATOM   508  C CG2 . VAL A 1 70  ? 29.526  68.657  26.957 1.00 30.89  ? 561  VAL A CG2 1 
ATOM   509  N N   . THR A 1 71  ? 31.983  65.627  28.077 1.00 29.94  ? 562  THR A N   1 
ATOM   510  C CA  . THR A 1 71  ? 32.142  65.137  29.440 1.00 27.61  ? 562  THR A CA  1 
ATOM   511  C C   . THR A 1 71  ? 32.992  66.029  30.328 1.00 29.78  ? 562  THR A C   1 
ATOM   512  O O   . THR A 1 71  ? 34.175  66.254  30.067 1.00 30.99  ? 562  THR A O   1 
ATOM   513  C CB  . THR A 1 71  ? 32.778  63.727  29.465 1.00 25.10  ? 562  THR A CB  1 
ATOM   514  O OG1 . THR A 1 71  ? 31.935  62.803  28.778 1.00 21.90  ? 562  THR A OG1 1 
ATOM   515  C CG2 . THR A 1 71  ? 32.968  63.249  30.894 1.00 23.37  ? 562  THR A CG2 1 
ATOM   516  N N   . ILE A 1 72  ? 32.384  66.547  31.381 1.00 30.89  ? 563  ILE A N   1 
ATOM   517  C CA  . ILE A 1 72  ? 33.131  67.352  32.315 1.00 34.19  ? 563  ILE A CA  1 
ATOM   518  C C   . ILE A 1 72  ? 33.694  66.315  33.287 1.00 34.70  ? 563  ILE A C   1 
ATOM   519  O O   . ILE A 1 72  ? 33.025  65.339  33.630 1.00 36.04  ? 563  ILE A O   1 
ATOM   520  C CB  . ILE A 1 72  ? 32.223  68.377  33.037 1.00 36.24  ? 563  ILE A CB  1 
ATOM   521  C CG1 . ILE A 1 72  ? 31.099  67.664  33.775 1.00 37.92  ? 563  ILE A CG1 1 
ATOM   522  C CG2 . ILE A 1 72  ? 31.599  69.333  32.015 1.00 37.27  ? 563  ILE A CG2 1 
ATOM   523  C CD1 . ILE A 1 72  ? 30.093  68.624  34.383 1.00 40.83  ? 563  ILE A CD1 1 
ATOM   524  N N   . VAL A 1 73  ? 34.934  66.512  33.710 1.00 34.78  ? 564  VAL A N   1 
ATOM   525  C CA  . VAL A 1 73  ? 35.589  65.575  34.601 1.00 32.55  ? 564  VAL A CA  1 
ATOM   526  C C   . VAL A 1 73  ? 36.084  66.232  35.879 1.00 33.02  ? 564  VAL A C   1 
ATOM   527  O O   . VAL A 1 73  ? 35.855  67.418  36.113 1.00 32.05  ? 564  VAL A O   1 
ATOM   528  C CB  . VAL A 1 73  ? 36.789  64.932  33.886 1.00 32.61  ? 564  VAL A CB  1 
ATOM   529  C CG1 . VAL A 1 73  ? 36.313  64.206  32.634 1.00 31.48  ? 564  VAL A CG1 1 
ATOM   530  C CG2 . VAL A 1 73  ? 37.804  66.005  33.507 1.00 28.48  ? 564  VAL A CG2 1 
ATOM   531  N N   . GLY A 1 74  ? 36.753  65.441  36.711 1.00 33.74  ? 565  GLY A N   1 
ATOM   532  C CA  . GLY A 1 74  ? 37.312  65.960  37.947 1.00 33.93  ? 565  GLY A CA  1 
ATOM   533  C C   . GLY A 1 74  ? 36.342  66.524  38.963 1.00 35.30  ? 565  GLY A C   1 
ATOM   534  O O   . GLY A 1 74  ? 36.690  67.435  39.712 1.00 36.96  ? 565  GLY A O   1 
ATOM   535  N N   . LEU A 1 75  ? 35.131  65.984  39.007 1.00 34.74  ? 566  LEU A N   1 
ATOM   536  C CA  . LEU A 1 75  ? 34.133  66.446  39.958 1.00 34.61  ? 566  LEU A CA  1 
ATOM   537  C C   . LEU A 1 75  ? 34.256  65.633  41.240 1.00 35.57  ? 566  LEU A C   1 
ATOM   538  O O   . LEU A 1 75  ? 34.843  64.554  41.235 1.00 35.99  ? 566  LEU A O   1 
ATOM   539  C CB  . LEU A 1 75  ? 32.734  66.256  39.369 1.00 33.45  ? 566  LEU A CB  1 
ATOM   540  C CG  . LEU A 1 75  ? 32.468  66.901  38.007 1.00 30.84  ? 566  LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 75  ? 31.140  66.414  37.466 1.00 29.83  ? 566  LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 75  ? 32.486  68.412  38.139 1.00 30.00  ? 566  LEU A CD2 1 
ATOM   543  N N   . LYS A 1 76  ? 33.713  66.156  42.338 1.00 37.51  ? 567  LYS A N   1 
ATOM   544  C CA  . LYS A 1 76  ? 33.727  65.454  43.626 1.00 38.13  ? 567  LYS A CA  1 
ATOM   545  C C   . LYS A 1 76  ? 32.481  64.579  43.724 1.00 36.35  ? 567  LYS A C   1 
ATOM   546  O O   . LYS A 1 76  ? 31.394  64.978  43.313 1.00 35.31  ? 567  LYS A O   1 
ATOM   547  C CB  . LYS A 1 76  ? 33.697  66.431  44.807 1.00 40.59  ? 567  LYS A CB  1 
ATOM   548  C CG  . LYS A 1 76  ? 34.947  67.253  45.047 1.00 45.44  ? 567  LYS A CG  1 
ATOM   549  C CD  . LYS A 1 76  ? 34.783  68.061  46.348 1.00 49.32  ? 567  LYS A CD  1 
ATOM   550  C CE  . LYS A 1 76  ? 35.847  69.160  46.508 1.00 52.14  ? 567  LYS A CE  1 
ATOM   551  N NZ  . LYS A 1 76  ? 37.244  68.638  46.627 1.00 54.36  ? 567  LYS A NZ  1 
ATOM   552  N N   . PRO A 1 77  ? 32.621  63.368  44.269 1.00 35.60  ? 568  PRO A N   1 
ATOM   553  C CA  . PRO A 1 77  ? 31.442  62.507  44.384 1.00 34.66  ? 568  PRO A CA  1 
ATOM   554  C C   . PRO A 1 77  ? 30.416  63.091  45.352 1.00 34.40  ? 568  PRO A C   1 
ATOM   555  O O   . PRO A 1 77  ? 30.782  63.743  46.325 1.00 35.21  ? 568  PRO A O   1 
ATOM   556  C CB  . PRO A 1 77  ? 32.026  61.197  44.896 1.00 32.90  ? 568  PRO A CB  1 
ATOM   557  C CG  . PRO A 1 77  ? 33.394  61.190  44.291 1.00 34.61  ? 568  PRO A CG  1 
ATOM   558  C CD  . PRO A 1 77  ? 33.857  62.605  44.502 1.00 34.18  ? 568  PRO A CD  1 
ATOM   559  N N   . GLU A 1 78  ? 29.135  62.868  45.074 1.00 33.26  ? 569  GLU A N   1 
ATOM   560  C CA  . GLU A 1 78  ? 28.069  63.335  45.947 1.00 33.21  ? 569  GLU A CA  1 
ATOM   561  C C   . GLU A 1 78  ? 28.031  64.820  46.183 1.00 33.53  ? 569  GLU A C   1 
ATOM   562  O O   . GLU A 1 78  ? 27.923  65.269  47.323 1.00 33.61  ? 569  GLU A O   1 
ATOM   563  C CB  . GLU A 1 78  ? 28.165  62.661  47.300 1.00 33.86  ? 569  GLU A CB  1 
ATOM   564  C CG  . GLU A 1 78  ? 27.957  61.187  47.254 1.00 39.91  ? 569  GLU A CG  1 
ATOM   565  C CD  . GLU A 1 78  ? 27.835  60.607  48.631 1.00 42.91  ? 569  GLU A CD  1 
ATOM   566  O OE1 . GLU A 1 78  ? 28.794  60.767  49.424 1.00 44.07  ? 569  GLU A OE1 1 
ATOM   567  O OE2 . GLU A 1 78  ? 26.777  60.002  48.912 1.00 43.48  ? 569  GLU A OE2 1 
ATOM   568  N N   . THR A 1 79  ? 28.105  65.586  45.111 1.00 32.60  ? 570  THR A N   1 
ATOM   569  C CA  . THR A 1 79  ? 28.069  67.020  45.234 1.00 30.17  ? 570  THR A CA  1 
ATOM   570  C C   . THR A 1 79  ? 27.016  67.540  44.278 1.00 30.76  ? 570  THR A C   1 
ATOM   571  O O   . THR A 1 79  ? 26.785  66.981  43.206 1.00 29.78  ? 570  THR A O   1 
ATOM   572  C CB  . THR A 1 79  ? 29.431  67.609  44.894 1.00 31.37  ? 570  THR A CB  1 
ATOM   573  O OG1 . THR A 1 79  ? 30.429  66.953  45.683 1.00 32.16  ? 570  THR A OG1 1 
ATOM   574  C CG2 . THR A 1 79  ? 29.463  69.096  45.182 1.00 31.67  ? 570  THR A CG2 1 
ATOM   575  N N   . THR A 1 80  ? 26.345  68.601  44.681 1.00 31.49  ? 571  THR A N   1 
ATOM   576  C CA  . THR A 1 80  ? 25.337  69.167  43.826 1.00 31.31  ? 571  THR A CA  1 
ATOM   577  C C   . THR A 1 80  ? 26.065  70.178  42.973 1.00 31.68  ? 571  THR A C   1 
ATOM   578  O O   . THR A 1 80  ? 26.882  70.950  43.477 1.00 30.43  ? 571  THR A O   1 
ATOM   579  C CB  . THR A 1 80  ? 24.240  69.835  44.641 1.00 31.63  ? 571  THR A CB  1 
ATOM   580  O OG1 . THR A 1 80  ? 23.688  68.870  45.548 1.00 33.52  ? 571  THR A OG1 1 
ATOM   581  C CG2 . THR A 1 80  ? 23.136  70.352  43.721 1.00 30.46  ? 571  THR A CG2 1 
ATOM   582  N N   . TYR A 1 81  ? 25.784  70.138  41.673 1.00 32.48  ? 572  TYR A N   1 
ATOM   583  C CA  . TYR A 1 81  ? 26.412  71.024  40.706 1.00 32.11  ? 572  TYR A CA  1 
ATOM   584  C C   . TYR A 1 81  ? 25.383  71.691  39.804 1.00 32.40  ? 572  TYR A C   1 
ATOM   585  O O   . TYR A 1 81  ? 24.236  71.256  39.693 1.00 32.56  ? 572  TYR A O   1 
ATOM   586  C CB  . TYR A 1 81  ? 27.397  70.231  39.822 1.00 32.01  ? 572  TYR A CB  1 
ATOM   587  C CG  . TYR A 1 81  ? 28.730  69.874  40.459 1.00 30.43  ? 572  TYR A CG  1 
ATOM   588  C CD1 . TYR A 1 81  ? 29.787  70.787  40.471 1.00 31.14  ? 572  TYR A CD1 1 
ATOM   589  C CD2 . TYR A 1 81  ? 28.939  68.617  41.025 1.00 29.45  ? 572  TYR A CD2 1 
ATOM   590  C CE1 . TYR A 1 81  ? 31.016  70.458  41.027 1.00 30.21  ? 572  TYR A CE1 1 
ATOM   591  C CE2 . TYR A 1 81  ? 30.159  68.277  41.582 1.00 30.76  ? 572  TYR A CE2 1 
ATOM   592  C CZ  . TYR A 1 81  ? 31.195  69.202  41.581 1.00 32.21  ? 572  TYR A CZ  1 
ATOM   593  O OH  . TYR A 1 81  ? 32.405  68.874  42.153 1.00 32.97  ? 572  TYR A OH  1 
ATOM   594  N N   . ALA A 1 82  ? 25.819  72.764  39.163 1.00 31.98  ? 573  ALA A N   1 
ATOM   595  C CA  . ALA A 1 82  ? 24.997  73.494  38.221 1.00 30.55  ? 573  ALA A CA  1 
ATOM   596  C C   . ALA A 1 82  ? 25.905  73.479  37.003 1.00 31.31  ? 573  ALA A C   1 
ATOM   597  O O   . ALA A 1 82  ? 27.116  73.604  37.152 1.00 32.99  ? 573  ALA A O   1 
ATOM   598  C CB  . ALA A 1 82  ? 24.776  74.912  38.705 1.00 28.14  ? 573  ALA A CB  1 
ATOM   599  N N   . VAL A 1 83  ? 25.343  73.293  35.815 1.00 30.19  ? 574  VAL A N   1 
ATOM   600  C CA  . VAL A 1 83  ? 26.149  73.271  34.605 1.00 30.37  ? 574  VAL A CA  1 
ATOM   601  C C   . VAL A 1 83  ? 25.431  73.973  33.443 1.00 32.19  ? 574  VAL A C   1 
ATOM   602  O O   . VAL A 1 83  ? 24.211  73.881  33.306 1.00 32.05  ? 574  VAL A O   1 
ATOM   603  C CB  . VAL A 1 83  ? 26.514  71.810  34.209 1.00 28.61  ? 574  VAL A CB  1 
ATOM   604  C CG1 . VAL A 1 83  ? 25.263  70.993  34.014 1.00 27.51  ? 574  VAL A CG1 1 
ATOM   605  C CG2 . VAL A 1 83  ? 27.349  71.799  32.940 1.00 27.39  ? 574  VAL A CG2 1 
ATOM   606  N N   . ARG A 1 84  ? 26.192  74.689  32.619 1.00 32.97  ? 575  ARG A N   1 
ATOM   607  C CA  . ARG A 1 84  ? 25.622  75.401  31.481 1.00 33.15  ? 575  ARG A CA  1 
ATOM   608  C C   . ARG A 1 84  ? 26.622  75.503  30.327 1.00 34.45  ? 575  ARG A C   1 
ATOM   609  O O   . ARG A 1 84  ? 27.833  75.377  30.523 1.00 34.38  ? 575  ARG A O   1 
ATOM   610  C CB  . ARG A 1 84  ? 25.166  76.792  31.911 1.00 31.11  ? 575  ARG A CB  1 
ATOM   611  C CG  . ARG A 1 84  ? 26.287  77.665  32.355 1.00 28.25  ? 575  ARG A CG  1 
ATOM   612  C CD  . ARG A 1 84  ? 25.756  78.847  33.128 1.00 31.18  ? 575  ARG A CD  1 
ATOM   613  N NE  . ARG A 1 84  ? 26.819  79.782  33.493 1.00 32.22  ? 575  ARG A NE  1 
ATOM   614  C CZ  . ARG A 1 84  ? 26.639  80.892  34.198 1.00 30.64  ? 575  ARG A CZ  1 
ATOM   615  N NH1 . ARG A 1 84  ? 25.433  81.225  34.636 1.00 29.17  ? 575  ARG A NH1 1 
ATOM   616  N NH2 . ARG A 1 84  ? 27.673  81.678  34.444 1.00 32.21  ? 575  ARG A NH2 1 
ATOM   617  N N   . LEU A 1 85  ? 26.094  75.731  29.125 1.00 34.66  ? 576  LEU A N   1 
ATOM   618  C CA  . LEU A 1 85  ? 26.902  75.817  27.916 1.00 34.46  ? 576  LEU A CA  1 
ATOM   619  C C   . LEU A 1 85  ? 26.735  77.108  27.130 1.00 35.13  ? 576  LEU A C   1 
ATOM   620  O O   . LEU A 1 85  ? 25.747  77.829  27.285 1.00 34.58  ? 576  LEU A O   1 
ATOM   621  C CB  . LEU A 1 85  ? 26.559  74.664  26.982 1.00 33.74  ? 576  LEU A CB  1 
ATOM   622  C CG  . LEU A 1 85  ? 26.967  73.250  27.345 1.00 35.33  ? 576  LEU A CG  1 
ATOM   623  C CD1 . LEU A 1 85  ? 26.163  72.276  26.500 1.00 35.21  ? 576  LEU A CD1 1 
ATOM   624  C CD2 . LEU A 1 85  ? 28.458  73.073  27.119 1.00 35.24  ? 576  LEU A CD2 1 
ATOM   625  N N   . ALA A 1 86  ? 27.720  77.363  26.270 1.00 34.35  ? 577  ALA A N   1 
ATOM   626  C CA  . ALA A 1 86  ? 27.742  78.518  25.386 1.00 32.95  ? 577  ALA A CA  1 
ATOM   627  C C   . ALA A 1 86  ? 28.503  78.108  24.116 1.00 33.05  ? 577  ALA A C   1 
ATOM   628  O O   . ALA A 1 86  ? 29.371  77.235  24.158 1.00 34.30  ? 577  ALA A O   1 
ATOM   629  C CB  . ALA A 1 86  ? 28.415  79.685  26.070 1.00 30.23  ? 577  ALA A CB  1 
ATOM   630  N N   . ALA A 1 87  ? 28.159  78.716  22.986 1.00 33.10  ? 578  ALA A N   1 
ATOM   631  C CA  . ALA A 1 87  ? 28.807  78.405  21.719 1.00 33.27  ? 578  ALA A CA  1 
ATOM   632  C C   . ALA A 1 87  ? 29.668  79.574  21.275 1.00 35.36  ? 578  ALA A C   1 
ATOM   633  O O   . ALA A 1 87  ? 29.260  80.729  21.375 1.00 36.56  ? 578  ALA A O   1 
ATOM   634  C CB  . ALA A 1 87  ? 27.766  78.107  20.672 1.00 32.53  ? 578  ALA A CB  1 
ATOM   635  N N   . LEU A 1 88  ? 30.863  79.277  20.780 1.00 36.55  ? 579  LEU A N   1 
ATOM   636  C CA  . LEU A 1 88  ? 31.773  80.323  20.333 1.00 37.57  ? 579  LEU A CA  1 
ATOM   637  C C   . LEU A 1 88  ? 32.019  80.254  18.833 1.00 39.64  ? 579  LEU A C   1 
ATOM   638  O O   . LEU A 1 88  ? 32.386  79.202  18.302 1.00 41.30  ? 579  LEU A O   1 
ATOM   639  C CB  . LEU A 1 88  ? 33.114  80.193  21.049 1.00 36.80  ? 579  LEU A CB  1 
ATOM   640  C CG  . LEU A 1 88  ? 34.182  81.221  20.648 1.00 37.70  ? 579  LEU A CG  1 
ATOM   641  C CD1 . LEU A 1 88  ? 34.111  82.410  21.601 1.00 35.36  ? 579  LEU A CD1 1 
ATOM   642  C CD2 . LEU A 1 88  ? 35.568  80.592  20.692 1.00 34.04  ? 579  LEU A CD2 1 
ATOM   643  N N   . ASN A 1 89  ? 31.818  81.368  18.140 1.00 39.95  ? 580  ASN A N   1 
ATOM   644  C CA  . ASN A 1 89  ? 32.076  81.384  16.707 1.00 41.16  ? 580  ASN A CA  1 
ATOM   645  C C   . ASN A 1 89  ? 33.055  82.513  16.437 1.00 40.52  ? 580  ASN A C   1 
ATOM   646  O O   . ASN A 1 89  ? 33.437  83.225  17.361 1.00 39.96  ? 580  ASN A O   1 
ATOM   647  C CB  . ASN A 1 89  ? 30.771  81.559  15.908 1.00 41.94  ? 580  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 89  ? 30.132  82.927  16.092 1.00 42.56  ? 580  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 89  ? 30.395  83.631  17.066 1.00 41.81  ? 580  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 89  ? 29.265  83.297  15.155 1.00 42.31  ? 580  ASN A ND2 1 
ATOM   651  N N   . GLY A 1 90  ? 33.478  82.659  15.186 1.00 40.82  ? 581  GLY A N   1 
ATOM   652  C CA  . GLY A 1 90  ? 34.420  83.708  14.834 1.00 40.53  ? 581  GLY A CA  1 
ATOM   653  C C   . GLY A 1 90  ? 34.123  85.069  15.437 1.00 41.59  ? 581  GLY A C   1 
ATOM   654  O O   . GLY A 1 90  ? 35.038  85.761  15.884 1.00 40.89  ? 581  GLY A O   1 
ATOM   655  N N   . LYS A 1 91  ? 32.848  85.452  15.458 1.00 42.84  ? 582  LYS A N   1 
ATOM   656  C CA  . LYS A 1 91  ? 32.433  86.743  16.005 1.00 43.86  ? 582  LYS A CA  1 
ATOM   657  C C   . LYS A 1 91  ? 32.605  86.832  17.518 1.00 43.48  ? 582  LYS A C   1 
ATOM   658  O O   . LYS A 1 91  ? 32.981  87.875  18.043 1.00 44.41  ? 582  LYS A O   1 
ATOM   659  C CB  . LYS A 1 91  ? 30.967  87.027  15.656 1.00 47.13  ? 582  LYS A CB  1 
ATOM   660  C CG  . LYS A 1 91  ? 30.662  87.113  14.167 1.00 49.99  ? 582  LYS A CG  1 
ATOM   661  C CD  . LYS A 1 91  ? 31.396  88.272  13.507 1.00 53.01  ? 582  LYS A CD  1 
ATOM   662  C CE  . LYS A 1 91  ? 31.044  89.602  14.159 1.00 53.74  ? 582  LYS A CE  1 
ATOM   663  N NZ  . LYS A 1 91  ? 31.704  90.736  13.455 1.00 54.70  ? 582  LYS A NZ  1 
ATOM   664  N N   . GLY A 1 92  ? 32.315  85.749  18.227 1.00 42.83  ? 583  GLY A N   1 
ATOM   665  C CA  . GLY A 1 92  ? 32.461  85.784  19.670 1.00 43.17  ? 583  GLY A CA  1 
ATOM   666  C C   . GLY A 1 92  ? 31.705  84.698  20.413 1.00 43.85  ? 583  GLY A C   1 
ATOM   667  O O   . GLY A 1 92  ? 31.297  83.690  19.830 1.00 44.55  ? 583  GLY A O   1 
ATOM   668  N N   . LEU A 1 93  ? 31.519  84.904  21.713 1.00 43.19  ? 584  LEU A N   1 
ATOM   669  C CA  . LEU A 1 93  ? 30.823  83.931  22.533 1.00 42.40  ? 584  LEU A CA  1 
ATOM   670  C C   . LEU A 1 93  ? 29.328  84.228  22.563 1.00 42.41  ? 584  LEU A C   1 
ATOM   671  O O   . LEU A 1 93  ? 28.916  85.383  22.675 1.00 42.55  ? 584  LEU A O   1 
ATOM   672  C CB  . LEU A 1 93  ? 31.398  83.934  23.950 1.00 41.11  ? 584  LEU A CB  1 
ATOM   673  C CG  . LEU A 1 93  ? 31.108  82.674  24.767 1.00 42.89  ? 584  LEU A CG  1 
ATOM   674  C CD1 . LEU A 1 93  ? 31.589  81.442  24.000 1.00 42.83  ? 584  LEU A CD1 1 
ATOM   675  C CD2 . LEU A 1 93  ? 31.794  82.760  26.115 1.00 43.07  ? 584  LEU A CD2 1 
ATOM   676  N N   . GLY A 1 94  ? 28.520  83.176  22.457 1.00 41.62  ? 585  GLY A N   1 
ATOM   677  C CA  . GLY A 1 94  ? 27.081  83.343  22.464 1.00 41.16  ? 585  GLY A CA  1 
ATOM   678  C C   . GLY A 1 94  ? 26.440  83.309  23.837 1.00 41.09  ? 585  GLY A C   1 
ATOM   679  O O   . GLY A 1 94  ? 27.131  83.186  24.851 1.00 38.31  ? 585  GLY A O   1 
ATOM   680  N N   . GLU A 1 95  ? 25.110  83.422  23.860 1.00 42.00  ? 586  GLU A N   1 
ATOM   681  C CA  . GLU A 1 95  ? 24.351  83.407  25.107 1.00 41.86  ? 586  GLU A CA  1 
ATOM   682  C C   . GLU A 1 95  ? 24.450  82.038  25.761 1.00 39.07  ? 586  GLU A C   1 
ATOM   683  O O   . GLU A 1 95  ? 24.439  81.017  25.080 1.00 38.56  ? 586  GLU A O   1 
ATOM   684  C CB  . GLU A 1 95  ? 22.874  83.769  24.853 1.00 45.90  ? 586  GLU A CB  1 
ATOM   685  C CG  . GLU A 1 95  ? 22.634  85.237  24.444 1.00 51.50  ? 586  GLU A CG  1 
ATOM   686  C CD  . GLU A 1 95  ? 21.205  85.744  24.739 1.00 55.75  ? 586  GLU A CD  1 
ATOM   687  O OE1 . GLU A 1 95  ? 20.878  86.008  25.922 1.00 54.36  ? 586  GLU A OE1 1 
ATOM   688  O OE2 . GLU A 1 95  ? 20.405  85.885  23.783 1.00 58.35  ? 586  GLU A OE2 1 
ATOM   689  N N   . ILE A 1 96  ? 24.565  82.016  27.083 1.00 37.82  ? 587  ILE A N   1 
ATOM   690  C CA  . ILE A 1 96  ? 24.666  80.745  27.799 1.00 36.79  ? 587  ILE A CA  1 
ATOM   691  C C   . ILE A 1 96  ? 23.315  80.092  28.053 1.00 33.99  ? 587  ILE A C   1 
ATOM   692  O O   . ILE A 1 96  ? 22.301  80.759  28.241 1.00 34.55  ? 587  ILE A O   1 
ATOM   693  C CB  . ILE A 1 96  ? 25.397  80.899  29.158 1.00 36.96  ? 587  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 96  ? 24.837  82.104  29.911 1.00 38.07  ? 587  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 96  ? 26.897  81.007  28.936 1.00 35.60  ? 587  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 96  ? 25.582  82.432  31.187 1.00 41.13  ? 587  ILE A CD1 1 
ATOM   697  N N   . SER A 1 97  ? 23.319  78.769  28.055 1.00 31.79  ? 588  SER A N   1 
ATOM   698  C CA  . SER A 1 97  ? 22.111  77.989  28.285 1.00 28.59  ? 588  SER A CA  1 
ATOM   699  C C   . SER A 1 97  ? 21.578  78.174  29.707 1.00 26.57  ? 588  SER A C   1 
ATOM   700  O O   . SER A 1 97  ? 22.218  78.793  30.560 1.00 26.36  ? 588  SER A O   1 
ATOM   701  C CB  . SER A 1 97  ? 22.414  76.502  28.067 1.00 27.15  ? 588  SER A CB  1 
ATOM   702  O OG  . SER A 1 97  ? 23.236  76.011  29.113 1.00 22.70  ? 588  SER A OG  1 
ATOM   703  N N   . ALA A 1 98  ? 20.390  77.635  29.948 1.00 25.15  ? 589  ALA A N   1 
ATOM   704  C CA  . ALA A 1 98  ? 19.797  77.675  31.270 1.00 23.55  ? 589  ALA A CA  1 
ATOM   705  C C   . ALA A 1 98  ? 20.645  76.681  32.058 1.00 24.94  ? 589  ALA A C   1 
ATOM   706  O O   . ALA A 1 98  ? 21.078  75.652  31.518 1.00 23.51  ? 589  ALA A O   1 
ATOM   707  C CB  . ALA A 1 98  ? 18.361  77.225  31.214 1.00 19.60  ? 589  ALA A CB  1 
ATOM   708  N N   . ALA A 1 99  ? 20.887  76.992  33.327 1.00 26.32  ? 590  ALA A N   1 
ATOM   709  C CA  . ALA A 1 99  ? 21.715  76.155  34.185 1.00 28.78  ? 590  ALA A CA  1 
ATOM   710  C C   . ALA A 1 99  ? 21.070  74.872  34.706 1.00 30.40  ? 590  ALA A C   1 
ATOM   711  O O   . ALA A 1 99  ? 20.265  74.892  35.631 1.00 33.86  ? 590  ALA A O   1 
ATOM   712  C CB  . ALA A 1 99  ? 22.215  76.979  35.352 1.00 28.59  ? 590  ALA A CB  1 
ATOM   713  N N   . SER A 1 100 ? 21.454  73.750  34.120 1.00 31.37  ? 591  SER A N   1 
ATOM   714  C CA  . SER A 1 100 ? 20.943  72.450  34.526 1.00 31.58  ? 591  SER A CA  1 
ATOM   715  C C   . SER A 1 100 ? 21.602  72.072  35.860 1.00 31.08  ? 591  SER A C   1 
ATOM   716  O O   . SER A 1 100 ? 22.764  72.392  36.092 1.00 31.93  ? 591  SER A O   1 
ATOM   717  C CB  . SER A 1 100 ? 21.277  71.433  33.440 1.00 31.10  ? 591  SER A CB  1 
ATOM   718  O OG  . SER A 1 100 ? 20.748  70.173  33.747 1.00 35.44  ? 591  SER A OG  1 
ATOM   719  N N   . GLU A 1 101 ? 20.862  71.405  36.739 1.00 30.88  ? 592  GLU A N   1 
ATOM   720  C CA  . GLU A 1 101 ? 21.396  71.029  38.041 1.00 29.85  ? 592  GLU A CA  1 
ATOM   721  C C   . GLU A 1 101 ? 21.405  69.525  38.269 1.00 30.13  ? 592  GLU A C   1 
ATOM   722  O O   . GLU A 1 101 ? 20.448  68.829  37.935 1.00 30.60  ? 592  GLU A O   1 
ATOM   723  C CB  . GLU A 1 101 ? 20.605  71.728  39.141 1.00 30.17  ? 592  GLU A CB  1 
ATOM   724  C CG  . GLU A 1 101 ? 21.107  71.459  40.553 1.00 32.31  ? 592  GLU A CG  1 
ATOM   725  C CD  . GLU A 1 101 ? 20.693  72.541  41.549 1.00 31.66  ? 592  GLU A CD  1 
ATOM   726  O OE1 . GLU A 1 101 ? 19.548  73.030  41.475 1.00 31.34  ? 592  GLU A OE1 1 
ATOM   727  O OE2 . GLU A 1 101 ? 21.514  72.894  42.417 1.00 32.71  ? 592  GLU A OE2 1 
ATOM   728  N N   . PHE A 1 102 ? 22.496  69.033  38.855 1.00 29.63  ? 593  PHE A N   1 
ATOM   729  C CA  . PHE A 1 102 ? 22.657  67.606  39.099 1.00 29.21  ? 593  PHE A CA  1 
ATOM   730  C C   . PHE A 1 102 ? 23.493  67.309  40.335 1.00 29.62  ? 593  PHE A C   1 
ATOM   731  O O   . PHE A 1 102 ? 24.138  68.198  40.881 1.00 30.73  ? 593  PHE A O   1 
ATOM   732  C CB  . PHE A 1 102 ? 23.320  66.962  37.884 1.00 27.69  ? 593  PHE A CB  1 
ATOM   733  C CG  . PHE A 1 102 ? 24.747  67.427  37.644 1.00 27.99  ? 593  PHE A CG  1 
ATOM   734  C CD1 . PHE A 1 102 ? 25.811  66.859  38.345 1.00 25.98  ? 593  PHE A CD1 1 
ATOM   735  C CD2 . PHE A 1 102 ? 25.023  68.427  36.706 1.00 26.54  ? 593  PHE A CD2 1 
ATOM   736  C CE1 . PHE A 1 102 ? 27.114  67.277  38.113 1.00 27.17  ? 593  PHE A CE1 1 
ATOM   737  C CE2 . PHE A 1 102 ? 26.327  68.850  36.470 1.00 24.36  ? 593  PHE A CE2 1 
ATOM   738  C CZ  . PHE A 1 102 ? 27.372  68.277  37.171 1.00 25.19  ? 593  PHE A CZ  1 
ATOM   739  N N   . LYS A 1 103 ? 23.486  66.050  40.763 1.00 29.78  ? 594  LYS A N   1 
ATOM   740  C CA  . LYS A 1 103 ? 24.268  65.625  41.923 1.00 29.89  ? 594  LYS A CA  1 
ATOM   741  C C   . LYS A 1 103 ? 25.046  64.387  41.510 1.00 28.66  ? 594  LYS A C   1 
ATOM   742  O O   . LYS A 1 103 ? 24.468  63.450  40.967 1.00 29.01  ? 594  LYS A O   1 
ATOM   743  C CB  . LYS A 1 103 ? 23.355  65.286  43.105 1.00 31.20  ? 594  LYS A CB  1 
ATOM   744  C CG  . LYS A 1 103 ? 24.099  65.108  44.436 1.00 33.64  ? 594  LYS A CG  1 
ATOM   745  C CD  . LYS A 1 103 ? 23.160  64.659  45.545 1.00 34.20  ? 594  LYS A CD  1 
ATOM   746  C CE  . LYS A 1 103 ? 23.889  64.419  46.859 1.00 34.15  ? 594  LYS A CE  1 
ATOM   747  N NZ  . LYS A 1 103 ? 22.940  63.862  47.869 1.00 33.56  ? 594  LYS A NZ  1 
ATOM   748  N N   . THR A 1 104 ? 26.350  64.382  41.764 1.00 27.25  ? 595  THR A N   1 
ATOM   749  C CA  . THR A 1 104 ? 27.191  63.252  41.383 1.00 27.98  ? 595  THR A CA  1 
ATOM   750  C C   . THR A 1 104 ? 26.986  62.042  42.276 1.00 27.90  ? 595  THR A C   1 
ATOM   751  O O   . THR A 1 104 ? 26.630  62.178  43.447 1.00 29.10  ? 595  THR A O   1 
ATOM   752  C CB  . THR A 1 104 ? 28.681  63.626  41.424 1.00 28.72  ? 595  THR A CB  1 
ATOM   753  O OG1 . THR A 1 104 ? 29.034  64.047  42.749 1.00 30.57  ? 595  THR A OG1 1 
ATOM   754  C CG2 . THR A 1 104 ? 28.969  64.732  40.451 1.00 26.89  ? 595  THR A CG2 1 
ATOM   755  N N   . GLN A 1 105 ? 27.230  60.859  41.724 1.00 26.91  ? 596  GLN A N   1 
ATOM   756  C CA  . GLN A 1 105 ? 27.064  59.623  42.476 1.00 26.82  ? 596  GLN A CA  1 
ATOM   757  C C   . GLN A 1 105 ? 28.198  59.389  43.456 1.00 27.39  ? 596  GLN A C   1 
ATOM   758  O O   . GLN A 1 105 ? 29.262  59.999  43.348 1.00 29.50  ? 596  GLN A O   1 
ATOM   759  C CB  . GLN A 1 105 ? 26.979  58.437  41.532 1.00 24.82  ? 596  GLN A CB  1 
ATOM   760  C CG  . GLN A 1 105 ? 25.861  58.540  40.540 1.00 25.86  ? 596  GLN A CG  1 
ATOM   761  C CD  . GLN A 1 105 ? 25.699  57.272  39.755 1.00 27.42  ? 596  GLN A CD  1 
ATOM   762  O OE1 . GLN A 1 105 ? 25.892  56.178  40.285 1.00 27.09  ? 596  GLN A OE1 1 
ATOM   763  N NE2 . GLN A 1 105 ? 25.336  57.401  38.485 1.00 28.29  ? 596  GLN A NE2 1 
ATOM   764  N N   . PRO A 1 106 ? 27.977  58.512  44.445 1.00 27.04  ? 597  PRO A N   1 
ATOM   765  C CA  . PRO A 1 106 ? 29.025  58.234  45.421 1.00 26.13  ? 597  PRO A CA  1 
ATOM   766  C C   . PRO A 1 106 ? 29.956  57.165  44.871 1.00 27.62  ? 597  PRO A C   1 
ATOM   767  O O   . PRO A 1 106 ? 29.569  56.388  43.998 1.00 27.53  ? 597  PRO A O   1 
ATOM   768  C CB  . PRO A 1 106 ? 28.232  57.748  46.628 1.00 24.49  ? 597  PRO A CB  1 
ATOM   769  C CG  . PRO A 1 106 ? 27.130  56.992  46.003 1.00 22.31  ? 597  PRO A CG  1 
ATOM   770  C CD  . PRO A 1 106 ? 26.703  57.893  44.863 1.00 25.30  ? 597  PRO A CD  1 
ATOM   771  N N   . VAL A 1 107 ? 31.188  57.130  45.363 1.00 29.58  ? 598  VAL A N   1 
ATOM   772  C CA  . VAL A 1 107 ? 32.118  56.111  44.905 1.00 32.58  ? 598  VAL A CA  1 
ATOM   773  C C   . VAL A 1 107 ? 31.787  54.820  45.654 1.00 34.96  ? 598  VAL A C   1 
ATOM   774  O O   . VAL A 1 107 ? 31.622  54.822  46.878 1.00 35.24  ? 598  VAL A O   1 
ATOM   775  C CB  . VAL A 1 107 ? 33.590  56.524  45.152 1.00 31.59  ? 598  VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 107 ? 33.983  57.613  44.175 1.00 29.70  ? 598  VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 107 ? 33.766  57.035  46.571 1.00 33.47  ? 598  VAL A CG2 1 
ATOM   778  N N   . ARG A 1 108 ? 31.642  53.733  44.901 1.00 36.48  ? 599  ARG A N   1 
ATOM   779  C CA  . ARG A 1 108 ? 31.327  52.423  45.459 1.00 37.19  ? 599  ARG A CA  1 
ATOM   780  C C   . ARG A 1 108 ? 32.470  51.462  45.117 1.00 37.80  ? 599  ARG A C   1 
ATOM   781  O O   . ARG A 1 108 ? 33.306  51.763  44.264 1.00 38.49  ? 599  ARG A O   1 
ATOM   782  C CB  . ARG A 1 108 ? 30.001  51.933  44.870 1.00 38.29  ? 599  ARG A CB  1 
ATOM   783  C CG  . ARG A 1 108 ? 29.751  50.432  44.990 1.00 45.66  ? 599  ARG A CG  1 
ATOM   784  C CD  . ARG A 1 108 ? 29.387  49.974  46.411 1.00 49.51  ? 599  ARG A CD  1 
ATOM   785  N NE  . ARG A 1 108 ? 30.366  50.407  47.406 1.00 52.50  ? 599  ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 108 ? 30.314  50.096  48.695 1.00 52.08  ? 599  ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 108 ? 29.329  49.339  49.154 1.00 52.96  ? 599  ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 108 ? 31.241  50.557  49.525 1.00 52.02  ? 599  ARG A NH2 1 
ATOM   789  N N   . GLU A 1 109 ? 32.530  50.319  45.787 1.00 38.46  ? 600  GLU A N   1 
ATOM   790  C CA  . GLU A 1 109 ? 33.588  49.356  45.505 1.00 38.33  ? 600  GLU A CA  1 
ATOM   791  C C   . GLU A 1 109 ? 33.377  48.885  44.076 1.00 35.71  ? 600  GLU A C   1 
ATOM   792  O O   . GLU A 1 109 ? 32.277  48.979  43.541 1.00 33.71  ? 600  GLU A O   1 
ATOM   793  C CB  . GLU A 1 109 ? 33.527  48.163  46.466 1.00 42.30  ? 600  GLU A CB  1 
ATOM   794  C CG  . GLU A 1 109 ? 33.320  48.554  47.926 1.00 48.56  ? 600  GLU A CG  1 
ATOM   795  C CD  . GLU A 1 109 ? 33.759  47.474  48.909 1.00 51.58  ? 600  GLU A CD  1 
ATOM   796  O OE1 . GLU A 1 109 ? 34.982  47.322  49.113 1.00 53.55  ? 600  GLU A OE1 1 
ATOM   797  O OE2 . GLU A 1 109 ? 32.887  46.776  49.476 1.00 53.02  ? 600  GLU A OE2 1 
ATOM   798  N N   . PRO A 1 110 ? 34.434  48.373  43.438 1.00 34.25  ? 601  PRO A N   1 
ATOM   799  C CA  . PRO A 1 110 ? 34.346  47.897  42.061 1.00 33.90  ? 601  PRO A CA  1 
ATOM   800  C C   . PRO A 1 110 ? 33.518  46.634  41.966 1.00 34.18  ? 601  PRO A C   1 
ATOM   801  O O   . PRO A 1 110 ? 33.401  45.896  42.937 1.00 34.85  ? 601  PRO A O   1 
ATOM   802  C CB  . PRO A 1 110 ? 35.802  47.623  41.698 1.00 32.91  ? 601  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 110 ? 36.572  48.408  42.673 1.00 32.75  ? 601  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 110 ? 35.808  48.245  43.930 1.00 33.04  ? 601  PRO A CD  1 
ATOM   805  N N   . SER A 1 111 ? 32.927  46.385  40.807 1.00 34.56  ? 602  SER A N   1 
ATOM   806  C CA  . SER A 1 111 ? 32.177  45.155  40.644 1.00 35.15  ? 602  SER A CA  1 
ATOM   807  C C   . SER A 1 111 ? 33.251  44.158  40.207 1.00 35.47  ? 602  SER A C   1 
ATOM   808  O O   . SER A 1 111 ? 34.355  44.561  39.835 1.00 34.82  ? 602  SER A O   1 
ATOM   809  C CB  . SER A 1 111 ? 31.068  45.316  39.598 1.00 35.73  ? 602  SER A CB  1 
ATOM   810  O OG  . SER A 1 111 ? 31.572  45.772  38.361 1.00 40.95  ? 602  SER A OG  1 
ATOM   811  N N   . ALA A 1 112 ? 32.952  42.866  40.284 1.00 36.19  ? 603  ALA A N   1 
ATOM   812  C CA  . ALA A 1 112 ? 33.925  41.844  39.926 1.00 34.72  ? 603  ALA A CA  1 
ATOM   813  C C   . ALA A 1 112 ? 34.149  41.753  38.429 1.00 34.85  ? 603  ALA A C   1 
ATOM   814  O O   . ALA A 1 112 ? 33.251  42.024  37.635 1.00 35.72  ? 603  ALA A O   1 
ATOM   815  C CB  . ALA A 1 112 ? 33.482  40.501  40.459 1.00 32.90  ? 603  ALA A CB  1 
ATOM   816  N N   . PRO A 1 113 ? 35.367  41.388  38.019 1.00 34.31  ? 604  PRO A N   1 
ATOM   817  C CA  . PRO A 1 113 ? 35.663  41.268  36.593 1.00 33.37  ? 604  PRO A CA  1 
ATOM   818  C C   . PRO A 1 113 ? 35.193  39.908  36.091 1.00 32.42  ? 604  PRO A C   1 
ATOM   819  O O   . PRO A 1 113 ? 35.057  38.982  36.880 1.00 33.36  ? 604  PRO A O   1 
ATOM   820  C CB  . PRO A 1 113 ? 37.182  41.392  36.558 1.00 34.07  ? 604  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 113 ? 37.584  40.705  37.822 1.00 32.52  ? 604  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 113 ? 36.599  41.270  38.821 1.00 33.77  ? 604  PRO A CD  1 
ATOM   823  N N   . LYS A 1 114 ? 34.924  39.795  34.795 1.00 32.28  ? 605  LYS A N   1 
ATOM   824  C CA  . LYS A 1 114 ? 34.518  38.520  34.214 1.00 31.85  ? 605  LYS A CA  1 
ATOM   825  C C   . LYS A 1 114 ? 35.835  37.848  33.852 1.00 31.10  ? 605  LYS A C   1 
ATOM   826  O O   . LYS A 1 114 ? 36.791  38.527  33.474 1.00 32.17  ? 605  LYS A O   1 
ATOM   827  C CB  . LYS A 1 114 ? 33.670  38.722  32.943 1.00 34.63  ? 605  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 114 ? 32.165  38.930  33.179 1.00 37.53  ? 605  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 114 ? 31.366  38.950  31.856 1.00 42.64  ? 605  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 114 ? 31.392  37.589  31.105 1.00 45.40  ? 605  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 114 ? 30.765  37.603  29.730 1.00 43.88  ? 605  LYS A NZ  1 
ATOM   832  N N   . LEU A 1 115 ? 35.899  36.529  33.982 1.00 29.31  ? 606  LEU A N   1 
ATOM   833  C CA  . LEU A 1 115 ? 37.117  35.800  33.662 1.00 26.89  ? 606  LEU A CA  1 
ATOM   834  C C   . LEU A 1 115 ? 36.898  34.860  32.485 1.00 27.65  ? 606  LEU A C   1 
ATOM   835  O O   . LEU A 1 115 ? 35.818  34.294  32.323 1.00 29.56  ? 606  LEU A O   1 
ATOM   836  C CB  . LEU A 1 115 ? 37.593  34.988  34.866 1.00 24.71  ? 606  LEU A CB  1 
ATOM   837  C CG  . LEU A 1 115 ? 37.845  35.700  36.200 1.00 24.04  ? 606  LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 115 ? 38.288  34.663  37.221 1.00 20.27  ? 606  LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 115 ? 38.900  36.791  36.052 1.00 24.34  ? 606  LEU A CD2 1 
ATOM   840  N N   . GLU A 1 116 ? 37.936  34.692  31.669 1.00 26.91  ? 607  GLU A N   1 
ATOM   841  C CA  . GLU A 1 116 ? 37.882  33.820  30.503 1.00 24.89  ? 607  GLU A CA  1 
ATOM   842  C C   . GLU A 1 116 ? 39.159  32.996  30.416 1.00 25.14  ? 607  GLU A C   1 
ATOM   843  O O   . GLU A 1 116 ? 40.255  33.542  30.341 1.00 27.32  ? 607  GLU A O   1 
ATOM   844  C CB  . GLU A 1 116 ? 37.713  34.662  29.244 1.00 24.67  ? 607  GLU A CB  1 
ATOM   845  C CG  . GLU A 1 116 ? 37.955  33.934  27.952 1.00 23.59  ? 607  GLU A CG  1 
ATOM   846  C CD  . GLU A 1 116 ? 37.933  34.877  26.764 1.00 26.19  ? 607  GLU A CD  1 
ATOM   847  O OE1 . GLU A 1 116 ? 36.836  35.291  26.330 1.00 26.02  ? 607  GLU A OE1 1 
ATOM   848  O OE2 . GLU A 1 116 ? 39.024  35.218  26.267 1.00 28.51  ? 607  GLU A OE2 1 
ATOM   849  N N   . GLY A 1 117 ? 39.011  31.678  30.425 1.00 24.23  ? 608  GLY A N   1 
ATOM   850  C CA  . GLY A 1 117 ? 40.156  30.804  30.348 1.00 22.69  ? 608  GLY A CA  1 
ATOM   851  C C   . GLY A 1 117 ? 40.572  30.576  28.914 1.00 24.88  ? 608  GLY A C   1 
ATOM   852  O O   . GLY A 1 117 ? 39.737  30.551  28.008 1.00 24.07  ? 608  GLY A O   1 
ATOM   853  N N   . GLN A 1 118 ? 41.879  30.416  28.720 1.00 26.85  ? 609  GLN A N   1 
ATOM   854  C CA  . GLN A 1 118 ? 42.476  30.177  27.414 1.00 28.05  ? 609  GLN A CA  1 
ATOM   855  C C   . GLN A 1 118 ? 43.692  29.293  27.640 1.00 30.28  ? 609  GLN A C   1 
ATOM   856  O O   . GLN A 1 118 ? 44.244  29.267  28.744 1.00 30.10  ? 609  GLN A O   1 
ATOM   857  C CB  . GLN A 1 118 ? 42.927  31.491  26.778 1.00 26.65  ? 609  GLN A CB  1 
ATOM   858  C CG  . GLN A 1 118 ? 43.427  31.334  25.358 1.00 29.67  ? 609  GLN A CG  1 
ATOM   859  C CD  . GLN A 1 118 ? 43.968  32.628  24.751 1.00 31.18  ? 609  GLN A CD  1 
ATOM   860  O OE1 . GLN A 1 118 ? 43.311  33.666  24.770 1.00 31.67  ? 609  GLN A OE1 1 
ATOM   861  N NE2 . GLN A 1 118 ? 45.167  32.557  24.193 1.00 31.89  ? 609  GLN A NE2 1 
ATOM   862  N N   . ARG A 1 119 ? 44.101  28.568  26.601 1.00 32.16  ? 610  ARG A N   1 
ATOM   863  C CA  . ARG A 1 119 ? 45.270  27.696  26.678 1.00 34.79  ? 610  ARG A CA  1 
ATOM   864  C C   . ARG A 1 119 ? 46.547  28.509  26.853 1.00 36.09  ? 610  ARG A C   1 
ATOM   865  O O   . ARG A 1 119 ? 46.660  29.637  26.361 1.00 35.54  ? 610  ARG A O   1 
ATOM   866  C CB  . ARG A 1 119 ? 45.422  26.869  25.397 1.00 37.42  ? 610  ARG A CB  1 
ATOM   867  C CG  . ARG A 1 119 ? 44.535  25.643  25.266 1.00 40.11  ? 610  ARG A CG  1 
ATOM   868  C CD  . ARG A 1 119 ? 44.858  24.899  23.968 1.00 41.44  ? 610  ARG A CD  1 
ATOM   869  N NE  . ARG A 1 119 ? 44.859  23.452  24.153 1.00 44.39  ? 610  ARG A NE  1 
ATOM   870  C CZ  . ARG A 1 119 ? 45.333  22.587  23.266 1.00 45.44  ? 610  ARG A CZ  1 
ATOM   871  N NH1 . ARG A 1 119 ? 45.843  23.028  22.127 1.00 47.70  ? 610  ARG A NH1 1 
ATOM   872  N NH2 . ARG A 1 119 ? 45.314  21.284  23.521 1.00 46.34  ? 610  ARG A NH2 1 
ATOM   873  N N   . GLY A 1 120 ? 47.510  27.924  27.555 1.00 38.55  ? 611  GLY A N   1 
ATOM   874  C CA  . GLY A 1 120 ? 48.788  28.580  27.757 1.00 41.49  ? 611  GLY A CA  1 
ATOM   875  C C   . GLY A 1 120 ? 49.795  27.890  26.853 1.00 43.49  ? 611  GLY A C   1 
ATOM   876  O O   . GLY A 1 120 ? 49.396  27.119  25.982 1.00 42.87  ? 611  GLY A O   1 
ATOM   877  N N   . GLU A 1 121 ? 51.087  28.137  27.045 1.00 47.02  ? 612  GLU A N   1 
ATOM   878  C CA  . GLU A 1 121 ? 52.087  27.489  26.198 1.00 51.76  ? 612  GLU A CA  1 
ATOM   879  C C   . GLU A 1 121 ? 52.097  25.966  26.349 1.00 51.54  ? 612  GLU A C   1 
ATOM   880  O O   . GLU A 1 121 ? 52.321  25.241  25.376 1.00 50.76  ? 612  GLU A O   1 
ATOM   881  C CB  . GLU A 1 121 ? 53.494  28.045  26.482 1.00 55.84  ? 612  GLU A CB  1 
ATOM   882  C CG  . GLU A 1 121 ? 53.884  28.119  27.972 1.00 63.13  ? 612  GLU A CG  1 
ATOM   883  C CD  . GLU A 1 121 ? 55.333  28.618  28.189 1.00 66.38  ? 612  GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 121 ? 56.286  27.822  27.971 1.00 66.22  ? 612  GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 121 ? 55.511  29.811  28.568 1.00 67.61  ? 612  GLU A OE2 1 
ATOM   886  N N   . ASP A 1 122 ? 51.831  25.482  27.560 1.00 51.73  ? 613  ASP A N   1 
ATOM   887  C CA  . ASP A 1 122 ? 51.855  24.049  27.810 1.00 50.43  ? 613  ASP A CA  1 
ATOM   888  C C   . ASP A 1 122 ? 50.673  23.557  28.628 1.00 49.15  ? 613  ASP A C   1 
ATOM   889  O O   . ASP A 1 122 ? 49.889  24.352  29.147 1.00 47.94  ? 613  ASP A O   1 
ATOM   890  C CB  . ASP A 1 122 ? 53.168  23.703  28.499 1.00 51.47  ? 613  ASP A CB  1 
ATOM   891  C CG  . ASP A 1 122 ? 54.368  24.272  27.753 1.00 53.22  ? 613  ASP A CG  1 
ATOM   892  O OD1 . ASP A 1 122 ? 54.743  23.699  26.703 1.00 53.93  ? 613  ASP A OD1 1 
ATOM   893  O OD2 . ASP A 1 122 ? 54.918  25.306  28.197 1.00 52.46  ? 613  ASP A OD2 1 
ATOM   894  N N   . GLY A 1 123 ? 50.557  22.237  28.734 1.00 48.28  ? 614  GLY A N   1 
ATOM   895  C CA  . GLY A 1 123 ? 49.460  21.628  29.470 1.00 46.65  ? 614  GLY A CA  1 
ATOM   896  C C   . GLY A 1 123 ? 49.418  21.915  30.960 1.00 44.88  ? 614  GLY A C   1 
ATOM   897  O O   . GLY A 1 123 ? 48.366  21.781  31.589 1.00 44.77  ? 614  GLY A O   1 
ATOM   898  N N   . ASN A 1 124 ? 50.553  22.307  31.530 1.00 43.35  ? 615  ASN A N   1 
ATOM   899  C CA  . ASN A 1 124 ? 50.612  22.601  32.954 1.00 41.81  ? 615  ASN A CA  1 
ATOM   900  C C   . ASN A 1 124 ? 50.502  24.097  33.234 1.00 40.73  ? 615  ASN A C   1 
ATOM   901  O O   . ASN A 1 124 ? 50.952  24.575  34.275 1.00 40.88  ? 615  ASN A O   1 
ATOM   902  C CB  . ASN A 1 124 ? 51.903  22.039  33.575 1.00 42.17  ? 615  ASN A CB  1 
ATOM   903  C CG  . ASN A 1 124 ? 53.135  22.878  33.259 1.00 43.57  ? 615  ASN A CG  1 
ATOM   904  O OD1 . ASN A 1 124 ? 54.184  22.709  33.880 1.00 43.69  ? 615  ASN A OD1 1 
ATOM   905  N ND2 . ASN A 1 124 ? 53.017  23.781  32.293 1.00 43.75  ? 615  ASN A ND2 1 
ATOM   906  N N   . SER A 1 125 ? 49.889  24.830  32.308 1.00 39.28  ? 616  SER A N   1 
ATOM   907  C CA  . SER A 1 125 ? 49.717  26.273  32.466 1.00 38.24  ? 616  SER A CA  1 
ATOM   908  C C   . SER A 1 125 ? 48.421  26.762  31.839 1.00 36.84  ? 616  SER A C   1 
ATOM   909  O O   . SER A 1 125 ? 47.950  26.198  30.852 1.00 38.66  ? 616  SER A O   1 
ATOM   910  C CB  . SER A 1 125 ? 50.865  27.026  31.796 1.00 38.66  ? 616  SER A CB  1 
ATOM   911  O OG  . SER A 1 125 ? 50.711  27.021  30.381 1.00 38.49  ? 616  SER A OG  1 
ATOM   912  N N   . ILE A 1 126 ? 47.852  27.823  32.401 1.00 34.61  ? 617  ILE A N   1 
ATOM   913  C CA  . ILE A 1 126 ? 46.631  28.399  31.845 1.00 32.74  ? 617  ILE A CA  1 
ATOM   914  C C   . ILE A 1 126 ? 46.702  29.919  31.813 1.00 31.13  ? 617  ILE A C   1 
ATOM   915  O O   . ILE A 1 126 ? 47.359  30.544  32.646 1.00 29.48  ? 617  ILE A O   1 
ATOM   916  C CB  . ILE A 1 126 ? 45.364  27.990  32.640 1.00 33.08  ? 617  ILE A CB  1 
ATOM   917  C CG1 . ILE A 1 126 ? 44.125  28.492  31.896 1.00 31.19  ? 617  ILE A CG1 1 
ATOM   918  C CG2 . ILE A 1 126 ? 45.416  28.557  34.062 1.00 32.01  ? 617  ILE A CG2 1 
ATOM   919  C CD1 . ILE A 1 126 ? 42.851  28.344  32.655 1.00 30.90  ? 617  ILE A CD1 1 
ATOM   920  N N   . LYS A 1 127 ? 46.027  30.509  30.834 1.00 31.12  ? 618  LYS A N   1 
ATOM   921  C CA  . LYS A 1 127 ? 45.998  31.957  30.696 1.00 30.26  ? 618  LYS A CA  1 
ATOM   922  C C   . LYS A 1 127 ? 44.583  32.434  31.011 1.00 29.64  ? 618  LYS A C   1 
ATOM   923  O O   . LYS A 1 127 ? 43.614  31.964  30.421 1.00 28.13  ? 618  LYS A O   1 
ATOM   924  C CB  . LYS A 1 127 ? 46.392  32.361  29.276 1.00 30.68  ? 618  LYS A CB  1 
ATOM   925  C CG  . LYS A 1 127 ? 46.352  33.862  29.028 1.00 31.04  ? 618  LYS A CG  1 
ATOM   926  C CD  . LYS A 1 127 ? 46.670  34.185  27.584 1.00 30.82  ? 618  LYS A CD  1 
ATOM   927  C CE  . LYS A 1 127 ? 46.536  35.667  27.322 1.00 30.62  ? 618  LYS A CE  1 
ATOM   928  N NZ  . LYS A 1 127 ? 46.573  35.946  25.870 1.00 29.85  ? 618  LYS A NZ  1 
ATOM   929  N N   . VAL A 1 128 ? 44.476  33.356  31.960 1.00 28.83  ? 619  VAL A N   1 
ATOM   930  C CA  . VAL A 1 128 ? 43.190  33.896  32.374 1.00 27.04  ? 619  VAL A CA  1 
ATOM   931  C C   . VAL A 1 128 ? 43.032  35.321  31.838 1.00 25.94  ? 619  VAL A C   1 
ATOM   932  O O   . VAL A 1 128 ? 43.671  36.254  32.316 1.00 24.98  ? 619  VAL A O   1 
ATOM   933  C CB  . VAL A 1 128 ? 43.081  33.896  33.920 1.00 27.08  ? 619  VAL A CB  1 
ATOM   934  C CG1 . VAL A 1 128 ? 41.644  34.166  34.346 1.00 29.05  ? 619  VAL A CG1 1 
ATOM   935  C CG2 . VAL A 1 128 ? 43.551  32.566  34.468 1.00 25.96  ? 619  VAL A CG2 1 
ATOM   936  N N   . ASN A 1 129 ? 42.182  35.478  30.833 1.00 26.08  ? 620  ASN A N   1 
ATOM   937  C CA  . ASN A 1 129 ? 41.949  36.779  30.220 1.00 27.40  ? 620  ASN A CA  1 
ATOM   938  C C   . ASN A 1 129 ? 40.943  37.554  31.055 1.00 28.57  ? 620  ASN A C   1 
ATOM   939  O O   . ASN A 1 129 ? 39.960  36.988  31.529 1.00 30.27  ? 620  ASN A O   1 
ATOM   940  C CB  . ASN A 1 129 ? 41.412  36.593  28.804 1.00 28.14  ? 620  ASN A CB  1 
ATOM   941  C CG  . ASN A 1 129 ? 42.336  35.758  27.935 1.00 32.70  ? 620  ASN A CG  1 
ATOM   942  O OD1 . ASN A 1 129 ? 41.887  35.043  27.033 1.00 33.25  ? 620  ASN A OD1 1 
ATOM   943  N ND2 . ASN A 1 129 ? 43.637  35.852  28.193 1.00 34.23  ? 620  ASN A ND2 1 
ATOM   944  N N   . LEU A 1 130 ? 41.179  38.847  31.234 1.00 26.89  ? 621  LEU A N   1 
ATOM   945  C CA  . LEU A 1 130 ? 40.271  39.654  32.028 1.00 27.32  ? 621  LEU A CA  1 
ATOM   946  C C   . LEU A 1 130 ? 39.291  40.462  31.194 1.00 27.56  ? 621  LEU A C   1 
ATOM   947  O O   . LEU A 1 130 ? 39.667  41.076  30.202 1.00 30.27  ? 621  LEU A O   1 
ATOM   948  C CB  . LEU A 1 130 ? 41.058  40.619  32.912 1.00 27.28  ? 621  LEU A CB  1 
ATOM   949  C CG  . LEU A 1 130 ? 42.107  40.048  33.863 1.00 27.71  ? 621  LEU A CG  1 
ATOM   950  C CD1 . LEU A 1 130 ? 42.741  41.209  34.615 1.00 27.11  ? 621  LEU A CD1 1 
ATOM   951  C CD2 . LEU A 1 130 ? 41.476  39.050  34.829 1.00 26.59  ? 621  LEU A CD2 1 
ATOM   952  N N   . ILE A 1 131 ? 38.029  40.456  31.594 1.00 26.26  ? 622  ILE A N   1 
ATOM   953  C CA  . ILE A 1 131 ? 37.030  41.250  30.903 1.00 26.86  ? 622  ILE A CA  1 
ATOM   954  C C   . ILE A 1 131 ? 36.621  42.302  31.943 1.00 29.55  ? 622  ILE A C   1 
ATOM   955  O O   . ILE A 1 131 ? 35.977  41.977  32.948 1.00 29.55  ? 622  ILE A O   1 
ATOM   956  C CB  . ILE A 1 131 ? 35.825  40.401  30.496 1.00 26.27  ? 622  ILE A CB  1 
ATOM   957  C CG1 . ILE A 1 131 ? 36.285  39.266  29.564 1.00 25.69  ? 622  ILE A CG1 1 
ATOM   958  C CG2 . ILE A 1 131 ? 34.783  41.287  29.831 1.00 24.16  ? 622  ILE A CG2 1 
ATOM   959  C CD1 . ILE A 1 131 ? 35.204  38.265  29.168 1.00 22.23  ? 622  ILE A CD1 1 
ATOM   960  N N   . LYS A 1 132 ? 37.023  43.553  31.712 1.00 28.97  ? 623  LYS A N   1 
ATOM   961  C CA  . LYS A 1 132 ? 36.741  44.633  32.651 1.00 28.82  ? 623  LYS A CA  1 
ATOM   962  C C   . LYS A 1 132 ? 35.259  44.941  32.883 1.00 27.00  ? 623  LYS A C   1 
ATOM   963  O O   . LYS A 1 132 ? 34.429  44.808  31.995 1.00 25.80  ? 623  LYS A O   1 
ATOM   964  C CB  . LYS A 1 132 ? 37.480  45.912  32.229 1.00 30.28  ? 623  LYS A CB  1 
ATOM   965  C CG  . LYS A 1 132 ? 38.982  45.917  32.488 1.00 30.99  ? 623  LYS A CG  1 
ATOM   966  C CD  . LYS A 1 132 ? 39.741  45.115  31.454 1.00 36.60  ? 623  LYS A CD  1 
ATOM   967  C CE  . LYS A 1 132 ? 41.256  45.198  31.668 1.00 39.15  ? 623  LYS A CE  1 
ATOM   968  N NZ  . LYS A 1 132 ? 41.788  46.573  31.468 1.00 39.35  ? 623  LYS A NZ  1 
ATOM   969  N N   . GLN A 1 133 ? 34.958  45.357  34.107 1.00 27.12  ? 624  GLN A N   1 
ATOM   970  C CA  . GLN A 1 133 ? 33.609  45.700  34.543 1.00 26.82  ? 624  GLN A CA  1 
ATOM   971  C C   . GLN A 1 133 ? 33.580  47.042  35.290 1.00 25.01  ? 624  GLN A C   1 
ATOM   972  O O   . GLN A 1 133 ? 34.608  47.635  35.608 1.00 24.31  ? 624  GLN A O   1 
ATOM   973  C CB  . GLN A 1 133 ? 33.066  44.621  35.490 1.00 27.75  ? 624  GLN A CB  1 
ATOM   974  C CG  . GLN A 1 133 ? 32.813  43.245  34.880 1.00 30.20  ? 624  GLN A CG  1 
ATOM   975  C CD  . GLN A 1 133 ? 31.688  43.249  33.868 1.00 30.05  ? 624  GLN A CD  1 
ATOM   976  O OE1 . GLN A 1 133 ? 31.844  43.759  32.761 1.00 33.68  ? 624  GLN A OE1 1 
ATOM   977  N NE2 . GLN A 1 133 ? 30.546  42.688  34.245 1.00 28.02  ? 624  GLN A NE2 1 
ATOM   978  N N   . ASP A 1 134 ? 32.372  47.495  35.578 1.00 24.55  ? 625  ASP A N   1 
ATOM   979  C CA  . ASP A 1 134 ? 32.133  48.737  36.293 1.00 24.81  ? 625  ASP A CA  1 
ATOM   980  C C   . ASP A 1 134 ? 33.109  48.833  37.468 1.00 24.38  ? 625  ASP A C   1 
ATOM   981  O O   . ASP A 1 134 ? 33.191  47.902  38.262 1.00 24.60  ? 625  ASP A O   1 
ATOM   982  C CB  . ASP A 1 134 ? 30.685  48.711  36.779 1.00 26.02  ? 625  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 134 ? 30.278  49.968  37.487 1.00 28.97  ? 625  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 134 ? 31.134  50.856  37.684 1.00 32.56  ? 625  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 134 ? 29.088  50.061  37.856 1.00 30.95  ? 625  ASP A OD2 1 
ATOM   986  N N   . ASP A 1 135 ? 33.848  49.941  37.585 1.00 23.91  ? 626  ASP A N   1 
ATOM   987  C CA  . ASP A 1 135 ? 34.808  50.085  38.688 1.00 24.48  ? 626  ASP A CA  1 
ATOM   988  C C   . ASP A 1 135 ? 34.313  50.781  39.948 1.00 24.23  ? 626  ASP A C   1 
ATOM   989  O O   . ASP A 1 135 ? 35.087  50.981  40.879 1.00 22.83  ? 626  ASP A O   1 
ATOM   990  C CB  . ASP A 1 135 ? 36.113  50.766  38.231 1.00 25.97  ? 626  ASP A CB  1 
ATOM   991  C CG  . ASP A 1 135 ? 35.907  52.178  37.663 1.00 28.04  ? 626  ASP A CG  1 
ATOM   992  O OD1 . ASP A 1 135 ? 34.956  52.898  38.067 1.00 29.01  ? 626  ASP A OD1 1 
ATOM   993  O OD2 . ASP A 1 135 ? 36.737  52.575  36.813 1.00 26.50  ? 626  ASP A OD2 1 
ATOM   994  N N   . GLY A 1 136 ? 33.039  51.163  39.978 1.00 24.58  ? 627  GLY A N   1 
ATOM   995  C CA  . GLY A 1 136 ? 32.498  51.794  41.170 1.00 28.25  ? 627  GLY A CA  1 
ATOM   996  C C   . GLY A 1 136 ? 32.506  53.312  41.210 1.00 31.62  ? 627  GLY A C   1 
ATOM   997  O O   . GLY A 1 136 ? 31.992  53.916  42.167 1.00 32.53  ? 627  GLY A O   1 
ATOM   998  N N   . GLY A 1 137 ? 33.088  53.931  40.184 1.00 31.25  ? 628  GLY A N   1 
ATOM   999  C CA  . GLY A 1 137 ? 33.135  55.378  40.131 1.00 30.04  ? 628  GLY A CA  1 
ATOM   1000 C C   . GLY A 1 137 ? 34.512  55.927  40.424 1.00 30.71  ? 628  GLY A C   1 
ATOM   1001 O O   . GLY A 1 137 ? 34.708  57.150  40.476 1.00 29.11  ? 628  GLY A O   1 
ATOM   1002 N N   . SER A 1 138 ? 35.466  55.021  40.616 1.00 29.88  ? 629  SER A N   1 
ATOM   1003 C CA  . SER A 1 138 ? 36.841  55.399  40.904 1.00 30.63  ? 629  SER A CA  1 
ATOM   1004 C C   . SER A 1 138 ? 37.820  54.457  40.205 1.00 31.13  ? 629  SER A C   1 
ATOM   1005 O O   . SER A 1 138 ? 37.615  53.244  40.162 1.00 30.48  ? 629  SER A O   1 
ATOM   1006 C CB  . SER A 1 138 ? 37.075  55.382  42.414 1.00 30.77  ? 629  SER A CB  1 
ATOM   1007 O OG  . SER A 1 138 ? 38.456  55.473  42.709 1.00 36.23  ? 629  SER A OG  1 
ATOM   1008 N N   . PRO A 1 139 ? 38.906  55.007  39.647 1.00 32.54  ? 630  PRO A N   1 
ATOM   1009 C CA  . PRO A 1 139 ? 39.913  54.197  38.948 1.00 34.42  ? 630  PRO A CA  1 
ATOM   1010 C C   . PRO A 1 139 ? 40.272  52.928  39.718 1.00 36.08  ? 630  PRO A C   1 
ATOM   1011 O O   . PRO A 1 139 ? 40.198  52.899  40.951 1.00 38.16  ? 630  PRO A O   1 
ATOM   1012 C CB  . PRO A 1 139 ? 41.102  55.150  38.837 1.00 31.67  ? 630  PRO A CB  1 
ATOM   1013 C CG  . PRO A 1 139 ? 40.443  56.469  38.721 1.00 31.23  ? 630  PRO A CG  1 
ATOM   1014 C CD  . PRO A 1 139 ? 39.355  56.403  39.762 1.00 31.08  ? 630  PRO A CD  1 
ATOM   1015 N N   . ILE A 1 140 ? 40.655  51.881  38.997 1.00 35.85  ? 631  ILE A N   1 
ATOM   1016 C CA  . ILE A 1 140 ? 41.035  50.643  39.647 1.00 35.31  ? 631  ILE A CA  1 
ATOM   1017 C C   . ILE A 1 140 ? 42.514  50.688  39.975 1.00 37.36  ? 631  ILE A C   1 
ATOM   1018 O O   . ILE A 1 140 ? 43.346  50.958  39.113 1.00 36.45  ? 631  ILE A O   1 
ATOM   1019 C CB  . ILE A 1 140 ? 40.689  49.426  38.769 1.00 32.88  ? 631  ILE A CB  1 
ATOM   1020 C CG1 . ILE A 1 140 ? 39.192  49.148  38.910 1.00 31.70  ? 631  ILE A CG1 1 
ATOM   1021 C CG2 . ILE A 1 140 ? 41.521  48.201  39.175 1.00 29.66  ? 631  ILE A CG2 1 
ATOM   1022 C CD1 . ILE A 1 140 ? 38.704  47.960  38.150 1.00 34.01  ? 631  ILE A CD1 1 
ATOM   1023 N N   . ARG A 1 141 ? 42.828  50.443  41.242 1.00 40.08  ? 632  ARG A N   1 
ATOM   1024 C CA  . ARG A 1 141 ? 44.201  50.475  41.714 1.00 41.57  ? 632  ARG A CA  1 
ATOM   1025 C C   . ARG A 1 141 ? 44.963  49.223  41.306 1.00 40.33  ? 632  ARG A C   1 
ATOM   1026 O O   . ARG A 1 141 ? 46.005  49.316  40.665 1.00 39.99  ? 632  ARG A O   1 
ATOM   1027 C CB  . ARG A 1 141 ? 44.218  50.637  43.240 1.00 46.38  ? 632  ARG A CB  1 
ATOM   1028 C CG  . ARG A 1 141 ? 45.623  50.795  43.853 1.00 55.51  ? 632  ARG A CG  1 
ATOM   1029 C CD  . ARG A 1 141 ? 45.613  50.670  45.399 1.00 59.53  ? 632  ARG A CD  1 
ATOM   1030 N NE  . ARG A 1 141 ? 46.956  50.562  45.978 1.00 59.88  ? 632  ARG A NE  1 
ATOM   1031 C CZ  . ARG A 1 141 ? 47.200  50.158  47.223 1.00 59.23  ? 632  ARG A CZ  1 
ATOM   1032 N NH1 . ARG A 1 141 ? 46.195  49.824  48.019 1.00 57.91  ? 632  ARG A NH1 1 
ATOM   1033 N NH2 . ARG A 1 141 ? 48.447  50.078  47.670 1.00 58.79  ? 632  ARG A NH2 1 
ATOM   1034 N N   . HIS A 1 142 ? 44.431  48.056  41.672 1.00 39.92  ? 633  HIS A N   1 
ATOM   1035 C CA  . HIS A 1 142 ? 45.058  46.770  41.365 1.00 38.19  ? 633  HIS A CA  1 
ATOM   1036 C C   . HIS A 1 142 ? 44.018  45.687  41.148 1.00 36.75  ? 633  HIS A C   1 
ATOM   1037 O O   . HIS A 1 142 ? 42.822  45.900  41.341 1.00 36.58  ? 633  HIS A O   1 
ATOM   1038 C CB  . HIS A 1 142 ? 45.913  46.271  42.533 1.00 39.96  ? 633  HIS A CB  1 
ATOM   1039 C CG  . HIS A 1 142 ? 46.949  47.238  43.002 1.00 42.79  ? 633  HIS A CG  1 
ATOM   1040 N ND1 . HIS A 1 142 ? 48.127  47.461  42.320 1.00 43.28  ? 633  HIS A ND1 1 
ATOM   1041 C CD2 . HIS A 1 142 ? 46.990  48.029  44.100 1.00 42.85  ? 633  HIS A CD2 1 
ATOM   1042 C CE1 . HIS A 1 142 ? 48.849  48.350  42.979 1.00 44.97  ? 633  HIS A CE1 1 
ATOM   1043 N NE2 . HIS A 1 142 ? 48.182  48.712  44.062 1.00 44.75  ? 633  HIS A NE2 1 
ATOM   1044 N N   . TYR A 1 143 ? 44.522  44.515  40.763 1.00 34.27  ? 634  TYR A N   1 
ATOM   1045 C CA  . TYR A 1 143 ? 43.741  43.298  40.575 1.00 31.72  ? 634  TYR A CA  1 
ATOM   1046 C C   . TYR A 1 143 ? 44.534  42.340  41.443 1.00 32.38  ? 634  TYR A C   1 
ATOM   1047 O O   . TYR A 1 143 ? 45.753  42.235  41.296 1.00 32.57  ? 634  TYR A O   1 
ATOM   1048 C CB  . TYR A 1 143 ? 43.772  42.809  39.127 1.00 29.40  ? 634  TYR A CB  1 
ATOM   1049 C CG  . TYR A 1 143 ? 42.766  43.479  38.222 1.00 27.80  ? 634  TYR A CG  1 
ATOM   1050 C CD1 . TYR A 1 143 ? 41.410  43.176  38.312 1.00 24.93  ? 634  TYR A CD1 1 
ATOM   1051 C CD2 . TYR A 1 143 ? 43.168  44.458  37.306 1.00 26.95  ? 634  TYR A CD2 1 
ATOM   1052 C CE1 . TYR A 1 143 ? 40.484  43.829  37.521 1.00 23.38  ? 634  TYR A CE1 1 
ATOM   1053 C CE2 . TYR A 1 143 ? 42.252  45.116  36.518 1.00 24.71  ? 634  TYR A CE2 1 
ATOM   1054 C CZ  . TYR A 1 143 ? 40.913  44.799  36.631 1.00 24.97  ? 634  TYR A CZ  1 
ATOM   1055 O OH  . TYR A 1 143 ? 40.006  45.477  35.864 1.00 26.28  ? 634  TYR A OH  1 
ATOM   1056 N N   . LEU A 1 144 ? 43.859  41.664  42.361 1.00 32.11  ? 635  LEU A N   1 
ATOM   1057 C CA  . LEU A 1 144 ? 44.542  40.736  43.249 1.00 32.62  ? 635  LEU A CA  1 
ATOM   1058 C C   . LEU A 1 144 ? 44.199  39.325  42.852 1.00 32.76  ? 635  LEU A C   1 
ATOM   1059 O O   . LEU A 1 144 ? 43.044  38.929  42.929 1.00 34.57  ? 635  LEU A O   1 
ATOM   1060 C CB  . LEU A 1 144 ? 44.116  40.983  44.693 1.00 32.79  ? 635  LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 144 ? 44.243  42.444  45.141 1.00 35.20  ? 635  LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 144 ? 43.790  42.571  46.593 1.00 36.10  ? 635  LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 144 ? 45.688  42.923  44.968 1.00 32.88  ? 635  LEU A CD2 1 
ATOM   1064 N N   . VAL A 1 145 ? 45.206  38.568  42.432 1.00 32.82  ? 636  VAL A N   1 
ATOM   1065 C CA  . VAL A 1 145 ? 45.003  37.187  42.012 1.00 33.28  ? 636  VAL A CA  1 
ATOM   1066 C C   . VAL A 1 145 ? 45.520  36.159  43.026 1.00 34.48  ? 636  VAL A C   1 
ATOM   1067 O O   . VAL A 1 145 ? 46.636  36.269  43.543 1.00 34.66  ? 636  VAL A O   1 
ATOM   1068 C CB  . VAL A 1 145 ? 45.672  36.951  40.652 1.00 32.16  ? 636  VAL A CB  1 
ATOM   1069 C CG1 . VAL A 1 145 ? 45.411  35.532  40.165 1.00 31.36  ? 636  VAL A CG1 1 
ATOM   1070 C CG2 . VAL A 1 145 ? 45.139  37.961  39.662 1.00 32.33  ? 636  VAL A CG2 1 
ATOM   1071 N N   . ARG A 1 146 ? 44.686  35.172  43.317 1.00 35.20  ? 637  ARG A N   1 
ATOM   1072 C CA  . ARG A 1 146 ? 45.027  34.108  44.253 1.00 38.00  ? 637  ARG A CA  1 
ATOM   1073 C C   . ARG A 1 146 ? 44.635  32.796  43.617 1.00 38.31  ? 637  ARG A C   1 
ATOM   1074 O O   . ARG A 1 146 ? 43.582  32.697  42.987 1.00 39.48  ? 637  ARG A O   1 
ATOM   1075 C CB  . ARG A 1 146 ? 44.242  34.251  45.552 1.00 40.90  ? 637  ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 146 ? 44.647  35.409  46.417 1.00 47.62  ? 637  ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 146 ? 45.335  34.912  47.676 1.00 53.32  ? 637  ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 146 ? 44.948  35.706  48.838 1.00 58.84  ? 637  ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 146 ? 43.685  35.904  49.210 1.00 62.15  ? 637  ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 146 ? 42.695  35.365  48.504 1.00 63.55  ? 637  ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 146 ? 43.406  36.639  50.284 1.00 63.87  ? 637  ARG A NH2 1 
ATOM   1082 N N   . TYR A 1 147 ? 45.468  31.783  43.782 1.00 37.50  ? 638  TYR A N   1 
ATOM   1083 C CA  . TYR A 1 147 ? 45.144  30.493  43.212 1.00 37.23  ? 638  TYR A CA  1 
ATOM   1084 C C   . TYR A 1 147 ? 45.762  29.358  44.013 1.00 37.45  ? 638  TYR A C   1 
ATOM   1085 O O   . TYR A 1 147 ? 46.652  29.571  44.848 1.00 35.75  ? 638  TYR A O   1 
ATOM   1086 C CB  . TYR A 1 147 ? 45.610  30.444  41.759 1.00 37.62  ? 638  TYR A CB  1 
ATOM   1087 C CG  . TYR A 1 147 ? 47.101  30.445  41.593 1.00 38.73  ? 638  TYR A CG  1 
ATOM   1088 C CD1 . TYR A 1 147 ? 47.830  29.264  41.677 1.00 38.46  ? 638  TYR A CD1 1 
ATOM   1089 C CD2 . TYR A 1 147 ? 47.788  31.627  41.345 1.00 40.45  ? 638  TYR A CD2 1 
ATOM   1090 C CE1 . TYR A 1 147 ? 49.202  29.259  41.516 1.00 39.64  ? 638  TYR A CE1 1 
ATOM   1091 C CE2 . TYR A 1 147 ? 49.171  31.634  41.182 1.00 41.07  ? 638  TYR A CE2 1 
ATOM   1092 C CZ  . TYR A 1 147 ? 49.867  30.446  41.269 1.00 40.83  ? 638  TYR A CZ  1 
ATOM   1093 O OH  . TYR A 1 147 ? 51.230  30.447  41.112 1.00 44.43  ? 638  TYR A OH  1 
ATOM   1094 N N   . ARG A 1 148 ? 45.278  28.149  43.766 1.00 36.91  ? 639  ARG A N   1 
ATOM   1095 C CA  . ARG A 1 148 ? 45.793  26.994  44.465 1.00 37.44  ? 639  ARG A CA  1 
ATOM   1096 C C   . ARG A 1 148 ? 45.272  25.699  43.899 1.00 38.15  ? 639  ARG A C   1 
ATOM   1097 O O   . ARG A 1 148 ? 44.305  25.665  43.143 1.00 39.77  ? 639  ARG A O   1 
ATOM   1098 C CB  . ARG A 1 148 ? 45.407  27.054  45.929 1.00 38.31  ? 639  ARG A CB  1 
ATOM   1099 C CG  . ARG A 1 148 ? 43.932  26.963  46.144 1.00 39.39  ? 639  ARG A CG  1 
ATOM   1100 C CD  . ARG A 1 148 ? 43.631  26.809  47.597 1.00 43.57  ? 639  ARG A CD  1 
ATOM   1101 N NE  . ARG A 1 148 ? 42.224  27.063  47.873 1.00 49.10  ? 639  ARG A NE  1 
ATOM   1102 C CZ  . ARG A 1 148 ? 41.710  27.133  49.094 1.00 52.05  ? 639  ARG A CZ  1 
ATOM   1103 N NH1 . ARG A 1 148 ? 42.489  26.963  50.156 1.00 52.58  ? 639  ARG A NH1 1 
ATOM   1104 N NH2 . ARG A 1 148 ? 40.420  27.392  49.253 1.00 55.62  ? 639  ARG A NH2 1 
ATOM   1105 N N   . ALA A 1 149 ? 45.934  24.622  44.276 1.00 38.38  ? 640  ALA A N   1 
ATOM   1106 C CA  . ALA A 1 149 ? 45.520  23.310  43.848 1.00 38.92  ? 640  ALA A CA  1 
ATOM   1107 C C   . ALA A 1 149 ? 44.570  22.917  44.966 1.00 39.13  ? 640  ALA A C   1 
ATOM   1108 O O   . ALA A 1 149 ? 44.983  22.864  46.122 1.00 40.48  ? 640  ALA A O   1 
ATOM   1109 C CB  . ALA A 1 149 ? 46.724  22.381  43.806 1.00 38.44  ? 640  ALA A CB  1 
ATOM   1110 N N   . LEU A 1 150 ? 43.307  22.665  44.634 1.00 38.44  ? 641  LEU A N   1 
ATOM   1111 C CA  . LEU A 1 150 ? 42.314  22.299  45.640 1.00 39.01  ? 641  LEU A CA  1 
ATOM   1112 C C   . LEU A 1 150 ? 42.887  21.490  46.813 1.00 41.44  ? 641  LEU A C   1 
ATOM   1113 O O   . LEU A 1 150 ? 43.835  20.704  46.651 1.00 40.07  ? 641  LEU A O   1 
ATOM   1114 C CB  . LEU A 1 150 ? 41.160  21.531  44.988 1.00 37.23  ? 641  LEU A CB  1 
ATOM   1115 C CG  . LEU A 1 150 ? 40.495  22.211  43.780 1.00 38.19  ? 641  LEU A CG  1 
ATOM   1116 C CD1 . LEU A 1 150 ? 39.230  21.443  43.373 1.00 35.04  ? 641  LEU A CD1 1 
ATOM   1117 C CD2 . LEU A 1 150 ? 40.148  23.660  44.119 1.00 36.77  ? 641  LEU A CD2 1 
ATOM   1118 N N   . SER A 1 151 ? 42.313  21.715  47.996 1.00 43.90  ? 642  SER A N   1 
ATOM   1119 C CA  . SER A 1 151 ? 42.721  21.042  49.230 1.00 47.59  ? 642  SER A CA  1 
ATOM   1120 C C   . SER A 1 151 ? 44.199  21.242  49.556 1.00 49.89  ? 642  SER A C   1 
ATOM   1121 O O   . SER A 1 151 ? 44.787  20.452  50.302 1.00 49.98  ? 642  SER A O   1 
ATOM   1122 C CB  . SER A 1 151 ? 42.411  19.530  49.163 1.00 48.94  ? 642  SER A CB  1 
ATOM   1123 O OG  . SER A 1 151 ? 43.313  18.820  48.328 1.00 45.26  ? 642  SER A OG  1 
ATOM   1124 N N   . SER A 1 152 ? 44.795  22.295  48.999 1.00 50.95  ? 643  SER A N   1 
ATOM   1125 C CA  . SER A 1 152 ? 46.204  22.596  49.240 1.00 51.53  ? 643  SER A CA  1 
ATOM   1126 C C   . SER A 1 152 ? 46.341  24.082  49.565 1.00 51.90  ? 643  SER A C   1 
ATOM   1127 O O   . SER A 1 152 ? 45.372  24.830  49.432 1.00 52.71  ? 643  SER A O   1 
ATOM   1128 C CB  . SER A 1 152 ? 47.039  22.231  48.012 1.00 50.70  ? 643  SER A CB  1 
ATOM   1129 O OG  . SER A 1 152 ? 48.420  22.287  48.310 1.00 50.24  ? 643  SER A OG  1 
ATOM   1130 N N   . GLU A 1 153 ? 47.531  24.507  49.994 1.00 52.00  ? 644  GLU A N   1 
ATOM   1131 C CA  . GLU A 1 153 ? 47.771  25.911  50.365 1.00 51.75  ? 644  GLU A CA  1 
ATOM   1132 C C   . GLU A 1 153 ? 47.824  26.889  49.198 1.00 50.69  ? 644  GLU A C   1 
ATOM   1133 O O   . GLU A 1 153 ? 48.183  26.527  48.075 1.00 49.83  ? 644  GLU A O   1 
ATOM   1134 C CB  . GLU A 1 153 ? 49.073  26.040  51.170 1.00 52.86  ? 644  GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 153 ? 49.030  25.377  52.537 1.00 56.45  ? 644  GLU A CG  1 
ATOM   1136 C CD  . GLU A 1 153 ? 47.991  25.997  53.463 1.00 58.58  ? 644  GLU A CD  1 
ATOM   1137 O OE1 . GLU A 1 153 ? 47.527  25.292  54.385 1.00 58.82  ? 644  GLU A OE1 1 
ATOM   1138 O OE2 . GLU A 1 153 ? 47.645  27.187  53.275 1.00 58.72  ? 644  GLU A OE2 1 
ATOM   1139 N N   . TRP A 1 154 ? 47.470  28.139  49.483 1.00 49.28  ? 645  TRP A N   1 
ATOM   1140 C CA  . TRP A 1 154 ? 47.485  29.193  48.476 1.00 48.70  ? 645  TRP A CA  1 
ATOM   1141 C C   . TRP A 1 154 ? 48.892  29.624  48.114 1.00 47.06  ? 645  TRP A C   1 
ATOM   1142 O O   . TRP A 1 154 ? 49.713  29.858  48.993 1.00 46.28  ? 645  TRP A O   1 
ATOM   1143 C CB  . TRP A 1 154 ? 46.761  30.434  48.978 1.00 49.40  ? 645  TRP A CB  1 
ATOM   1144 C CG  . TRP A 1 154 ? 45.358  30.218  49.273 1.00 52.05  ? 645  TRP A CG  1 
ATOM   1145 C CD1 . TRP A 1 154 ? 44.825  29.792  50.448 1.00 52.57  ? 645  TRP A CD1 1 
ATOM   1146 C CD2 . TRP A 1 154 ? 44.267  30.409  48.374 1.00 54.36  ? 645  TRP A CD2 1 
ATOM   1147 N NE1 . TRP A 1 154 ? 43.459  29.707  50.343 1.00 55.18  ? 645  TRP A NE1 1 
ATOM   1148 C CE2 . TRP A 1 154 ? 43.088  30.081  49.077 1.00 55.33  ? 645  TRP A CE2 1 
ATOM   1149 C CE3 . TRP A 1 154 ? 44.169  30.823  47.039 1.00 54.77  ? 645  TRP A CE3 1 
ATOM   1150 C CZ2 . TRP A 1 154 ? 41.820  30.155  48.489 1.00 55.91  ? 645  TRP A CZ2 1 
ATOM   1151 C CZ3 . TRP A 1 154 ? 42.909  30.895  46.453 1.00 55.67  ? 645  TRP A CZ3 1 
ATOM   1152 C CH2 . TRP A 1 154 ? 41.751  30.561  47.181 1.00 56.36  ? 645  TRP A CH2 1 
ATOM   1153 N N   . LYS A 1 155 ? 49.174  29.738  46.823 1.00 46.03  ? 646  LYS A N   1 
ATOM   1154 C CA  . LYS A 1 155 ? 50.486  30.207  46.410 1.00 46.60  ? 646  LYS A CA  1 
ATOM   1155 C C   . LYS A 1 155 ? 50.520  31.686  46.819 1.00 46.37  ? 646  LYS A C   1 
ATOM   1156 O O   . LYS A 1 155 ? 49.504  32.247  47.236 1.00 46.16  ? 646  LYS A O   1 
ATOM   1157 C CB  . LYS A 1 155 ? 50.651  30.069  44.893 1.00 47.35  ? 646  LYS A CB  1 
ATOM   1158 C CG  . LYS A 1 155 ? 50.720  28.630  44.391 1.00 49.42  ? 646  LYS A CG  1 
ATOM   1159 C CD  . LYS A 1 155 ? 51.970  27.936  44.900 1.00 52.57  ? 646  LYS A CD  1 
ATOM   1160 C CE  . LYS A 1 155 ? 52.162  26.569  44.269 1.00 54.35  ? 646  LYS A CE  1 
ATOM   1161 N NZ  . LYS A 1 155 ? 51.015  25.662  44.511 1.00 56.64  ? 646  LYS A NZ  1 
ATOM   1162 N N   . PRO A 1 156 ? 51.690  32.333  46.737 1.00 46.60  ? 647  PRO A N   1 
ATOM   1163 C CA  . PRO A 1 156 ? 51.727  33.750  47.124 1.00 45.38  ? 647  PRO A CA  1 
ATOM   1164 C C   . PRO A 1 156 ? 50.803  34.588  46.227 1.00 44.52  ? 647  PRO A C   1 
ATOM   1165 O O   . PRO A 1 156 ? 50.760  34.388  45.010 1.00 43.07  ? 647  PRO A O   1 
ATOM   1166 C CB  . PRO A 1 156 ? 53.202  34.115  46.950 1.00 46.41  ? 647  PRO A CB  1 
ATOM   1167 C CG  . PRO A 1 156 ? 53.910  32.806  47.239 1.00 47.19  ? 647  PRO A CG  1 
ATOM   1168 C CD  . PRO A 1 156 ? 53.048  31.808  46.497 1.00 46.51  ? 647  PRO A CD  1 
ATOM   1169 N N   . GLU A 1 157 ? 50.073  35.522  46.833 1.00 43.54  ? 648  GLU A N   1 
ATOM   1170 C CA  . GLU A 1 157 ? 49.141  36.384  46.106 1.00 43.20  ? 648  GLU A CA  1 
ATOM   1171 C C   . GLU A 1 157 ? 49.817  37.287  45.064 1.00 42.04  ? 648  GLU A C   1 
ATOM   1172 O O   . GLU A 1 157 ? 50.885  37.834  45.315 1.00 41.49  ? 648  GLU A O   1 
ATOM   1173 C CB  . GLU A 1 157 ? 48.361  37.241  47.102 1.00 44.39  ? 648  GLU A CB  1 
ATOM   1174 C CG  . GLU A 1 157 ? 47.361  38.184  46.459 1.00 48.54  ? 648  GLU A CG  1 
ATOM   1175 C CD  . GLU A 1 157 ? 46.746  39.147  47.460 1.00 50.92  ? 648  GLU A CD  1 
ATOM   1176 O OE1 . GLU A 1 157 ? 47.508  39.914  48.086 1.00 51.80  ? 648  GLU A OE1 1 
ATOM   1177 O OE2 . GLU A 1 157 ? 45.506  39.140  47.623 1.00 52.43  ? 648  GLU A OE2 1 
ATOM   1178 N N   . ILE A 1 158 ? 49.179  37.444  43.902 1.00 41.11  ? 649  ILE A N   1 
ATOM   1179 C CA  . ILE A 1 158 ? 49.707  38.276  42.811 1.00 39.25  ? 649  ILE A CA  1 
ATOM   1180 C C   . ILE A 1 158 ? 48.986  39.622  42.655 1.00 39.66  ? 649  ILE A C   1 
ATOM   1181 O O   . ILE A 1 158 ? 47.756  39.676  42.606 1.00 39.63  ? 649  ILE A O   1 
ATOM   1182 C CB  . ILE A 1 158 ? 49.614  37.544  41.456 1.00 37.38  ? 649  ILE A CB  1 
ATOM   1183 C CG1 . ILE A 1 158 ? 50.468  36.279  41.483 1.00 37.16  ? 649  ILE A CG1 1 
ATOM   1184 C CG2 . ILE A 1 158 ? 50.061  38.461  40.339 1.00 35.70  ? 649  ILE A CG2 1 
ATOM   1185 C CD1 . ILE A 1 158 ? 50.378  35.450  40.213 1.00 36.76  ? 649  ILE A CD1 1 
ATOM   1186 N N   . ARG A 1 159 ? 49.761  40.702  42.567 1.00 39.82  ? 650  ARG A N   1 
ATOM   1187 C CA  . ARG A 1 159 ? 49.209  42.047  42.403 1.00 39.84  ? 650  ARG A CA  1 
ATOM   1188 C C   . ARG A 1 159 ? 49.360  42.463  40.943 1.00 38.47  ? 650  ARG A C   1 
ATOM   1189 O O   . ARG A 1 159 ? 50.443  42.359  40.380 1.00 38.02  ? 650  ARG A O   1 
ATOM   1190 C CB  . ARG A 1 159 ? 49.946  43.038  43.314 1.00 43.23  ? 650  ARG A CB  1 
ATOM   1191 C CG  . ARG A 1 159 ? 49.359  44.450  43.309 1.00 49.09  ? 650  ARG A CG  1 
ATOM   1192 C CD  . ARG A 1 159 ? 49.723  45.252  44.565 1.00 53.47  ? 650  ARG A CD  1 
ATOM   1193 N NE  . ARG A 1 159 ? 51.043  45.881  44.492 1.00 59.01  ? 650  ARG A NE  1 
ATOM   1194 C CZ  . ARG A 1 159 ? 51.517  46.730  45.404 1.00 60.44  ? 650  ARG A CZ  1 
ATOM   1195 N NH1 . ARG A 1 159 ? 50.778  47.048  46.463 1.00 60.54  ? 650  ARG A NH1 1 
ATOM   1196 N NH2 . ARG A 1 159 ? 52.722  47.269  45.254 1.00 59.62  ? 650  ARG A NH2 1 
ATOM   1197 N N   . LEU A 1 160 ? 48.277  42.928  40.329 1.00 36.98  ? 651  LEU A N   1 
ATOM   1198 C CA  . LEU A 1 160 ? 48.326  43.324  38.926 1.00 35.13  ? 651  LEU A CA  1 
ATOM   1199 C C   . LEU A 1 160 ? 47.874  44.752  38.687 1.00 34.35  ? 651  LEU A C   1 
ATOM   1200 O O   . LEU A 1 160 ? 46.969  45.242  39.357 1.00 35.36  ? 651  LEU A O   1 
ATOM   1201 C CB  . LEU A 1 160 ? 47.473  42.373  38.085 1.00 34.88  ? 651  LEU A CB  1 
ATOM   1202 C CG  . LEU A 1 160 ? 47.914  40.906  38.111 1.00 33.80  ? 651  LEU A CG  1 
ATOM   1203 C CD1 . LEU A 1 160 ? 46.926  40.061  37.320 1.00 33.37  ? 651  LEU A CD1 1 
ATOM   1204 C CD2 . LEU A 1 160 ? 49.314  40.786  37.540 1.00 28.87  ? 651  LEU A CD2 1 
ATOM   1205 N N   . PRO A 1 161 ? 48.502  45.439  37.715 1.00 33.37  ? 652  PRO A N   1 
ATOM   1206 C CA  . PRO A 1 161 ? 48.180  46.827  37.364 1.00 31.14  ? 652  PRO A CA  1 
ATOM   1207 C C   . PRO A 1 161 ? 46.794  46.902  36.728 1.00 29.40  ? 652  PRO A C   1 
ATOM   1208 O O   . PRO A 1 161 ? 46.380  45.973  36.041 1.00 27.81  ? 652  PRO A O   1 
ATOM   1209 C CB  . PRO A 1 161 ? 49.277  47.198  36.359 1.00 30.83  ? 652  PRO A CB  1 
ATOM   1210 C CG  . PRO A 1 161 ? 50.355  46.213  36.612 1.00 32.13  ? 652  PRO A CG  1 
ATOM   1211 C CD  . PRO A 1 161 ? 49.603  44.947  36.875 1.00 31.71  ? 652  PRO A CD  1 
ATOM   1212 N N   . SER A 1 162 ? 46.091  48.009  36.943 1.00 27.92  ? 653  SER A N   1 
ATOM   1213 C CA  . SER A 1 162 ? 44.759  48.175  36.383 1.00 28.10  ? 653  SER A CA  1 
ATOM   1214 C C   . SER A 1 162 ? 44.698  47.901  34.884 1.00 28.34  ? 653  SER A C   1 
ATOM   1215 O O   . SER A 1 162 ? 43.695  47.384  34.389 1.00 29.63  ? 653  SER A O   1 
ATOM   1216 C CB  . SER A 1 162 ? 44.233  49.579  36.668 1.00 28.82  ? 653  SER A CB  1 
ATOM   1217 O OG  . SER A 1 162 ? 45.026  50.572  36.049 1.00 34.13  ? 653  SER A OG  1 
ATOM   1218 N N   . GLY A 1 163 ? 45.775  48.226  34.172 1.00 27.90  ? 654  GLY A N   1 
ATOM   1219 C CA  . GLY A 1 163 ? 45.822  48.017  32.736 1.00 27.62  ? 654  GLY A CA  1 
ATOM   1220 C C   . GLY A 1 163 ? 46.036  46.586  32.262 1.00 29.13  ? 654  GLY A C   1 
ATOM   1221 O O   . GLY A 1 163 ? 45.935  46.317  31.054 1.00 28.97  ? 654  GLY A O   1 
ATOM   1222 N N   . SER A 1 164 ? 46.337  45.675  33.192 1.00 28.58  ? 655  SER A N   1 
ATOM   1223 C CA  . SER A 1 164 ? 46.540  44.261  32.872 1.00 28.93  ? 655  SER A CA  1 
ATOM   1224 C C   . SER A 1 164 ? 45.334  43.720  32.122 1.00 30.67  ? 655  SER A C   1 
ATOM   1225 O O   . SER A 1 164 ? 44.183  44.042  32.452 1.00 31.29  ? 655  SER A O   1 
ATOM   1226 C CB  . SER A 1 164 ? 46.719  43.435  34.144 1.00 30.48  ? 655  SER A CB  1 
ATOM   1227 O OG  . SER A 1 164 ? 47.805  43.895  34.925 1.00 35.95  ? 655  SER A OG  1 
ATOM   1228 N N   . ASP A 1 165 ? 45.591  42.888  31.120 1.00 31.73  ? 656  ASP A N   1 
ATOM   1229 C CA  . ASP A 1 165 ? 44.509  42.318  30.335 1.00 32.16  ? 656  ASP A CA  1 
ATOM   1230 C C   . ASP A 1 165 ? 44.355  40.832  30.589 1.00 32.00  ? 656  ASP A C   1 
ATOM   1231 O O   . ASP A 1 165 ? 43.305  40.252  30.335 1.00 30.20  ? 656  ASP A O   1 
ATOM   1232 C CB  . ASP A 1 165 ? 44.741  42.591  28.850 1.00 34.14  ? 656  ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 165 ? 44.646  44.082  28.513 1.00 39.03  ? 656  ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 165 ? 43.837  44.790  29.166 1.00 40.78  ? 656  ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 165 ? 45.366  44.545  27.597 1.00 37.94  ? 656  ASP A OD2 1 
ATOM   1236 N N   . HIS A 1 166 ? 45.406  40.223  31.119 1.00 33.80  ? 657  HIS A N   1 
ATOM   1237 C CA  . HIS A 1 166 ? 45.384  38.802  31.408 1.00 35.35  ? 657  HIS A CA  1 
ATOM   1238 C C   . HIS A 1 166 ? 46.371  38.496  32.518 1.00 35.90  ? 657  HIS A C   1 
ATOM   1239 O O   . HIS A 1 166 ? 47.109  39.365  32.969 1.00 36.01  ? 657  HIS A O   1 
ATOM   1240 C CB  . HIS A 1 166 ? 45.782  37.999  30.168 1.00 38.00  ? 657  HIS A CB  1 
ATOM   1241 C CG  . HIS A 1 166 ? 47.236  38.102  29.832 1.00 41.36  ? 657  HIS A CG  1 
ATOM   1242 N ND1 . HIS A 1 166 ? 47.751  39.119  29.059 1.00 44.01  ? 657  HIS A ND1 1 
ATOM   1243 C CD2 . HIS A 1 166 ? 48.296  37.360  30.233 1.00 43.67  ? 657  HIS A CD2 1 
ATOM   1244 C CE1 . HIS A 1 166 ? 49.067  39.002  29.001 1.00 44.86  ? 657  HIS A CE1 1 
ATOM   1245 N NE2 . HIS A 1 166 ? 49.423  37.944  29.707 1.00 44.90  ? 657  HIS A NE2 1 
ATOM   1246 N N   . VAL A 1 167 ? 46.365  37.247  32.958 1.00 36.11  ? 658  VAL A N   1 
ATOM   1247 C CA  . VAL A 1 167 ? 47.281  36.778  33.981 1.00 36.22  ? 658  VAL A CA  1 
ATOM   1248 C C   . VAL A 1 167 ? 47.613  35.363  33.566 1.00 36.43  ? 658  VAL A C   1 
ATOM   1249 O O   . VAL A 1 167 ? 46.722  34.574  33.257 1.00 35.42  ? 658  VAL A O   1 
ATOM   1250 C CB  . VAL A 1 167 ? 46.648  36.771  35.394 1.00 35.96  ? 658  VAL A CB  1 
ATOM   1251 C CG1 . VAL A 1 167 ? 45.317  36.052  35.378 1.00 37.59  ? 658  VAL A CG1 1 
ATOM   1252 C CG2 . VAL A 1 167 ? 47.586  36.095  36.367 1.00 34.76  ? 658  VAL A CG2 1 
ATOM   1253 N N   . MET A 1 168 ? 48.901  35.055  33.532 1.00 38.20  ? 659  MET A N   1 
ATOM   1254 C CA  . MET A 1 168 ? 49.360  33.732  33.138 1.00 39.01  ? 659  MET A CA  1 
ATOM   1255 C C   . MET A 1 168 ? 49.775  32.938  34.369 1.00 38.35  ? 659  MET A C   1 
ATOM   1256 O O   . MET A 1 168 ? 50.439  33.459  35.261 1.00 37.15  ? 659  MET A O   1 
ATOM   1257 C CB  . MET A 1 168 ? 50.545  33.861  32.178 1.00 41.30  ? 659  MET A CB  1 
ATOM   1258 C CG  . MET A 1 168 ? 51.034  32.552  31.569 1.00 45.50  ? 659  MET A CG  1 
ATOM   1259 S SD  . MET A 1 168 ? 49.950  31.944  30.252 1.00 52.73  ? 659  MET A SD  1 
ATOM   1260 C CE  . MET A 1 168 ? 49.983  33.394  29.126 1.00 49.97  ? 659  MET A CE  1 
ATOM   1261 N N   . LEU A 1 169 ? 49.360  31.677  34.416 1.00 38.82  ? 660  LEU A N   1 
ATOM   1262 C CA  . LEU A 1 169 ? 49.703  30.787  35.519 1.00 38.03  ? 660  LEU A CA  1 
ATOM   1263 C C   . LEU A 1 169 ? 50.452  29.606  34.916 1.00 38.72  ? 660  LEU A C   1 
ATOM   1264 O O   . LEU A 1 169 ? 49.838  28.629  34.497 1.00 39.04  ? 660  LEU A O   1 
ATOM   1265 C CB  . LEU A 1 169 ? 48.441  30.294  36.231 1.00 36.49  ? 660  LEU A CB  1 
ATOM   1266 C CG  . LEU A 1 169 ? 47.529  31.334  36.883 1.00 35.84  ? 660  LEU A CG  1 
ATOM   1267 C CD1 . LEU A 1 169 ? 46.337  30.633  37.504 1.00 35.45  ? 660  LEU A CD1 1 
ATOM   1268 C CD2 . LEU A 1 169 ? 48.288  32.116  37.933 1.00 34.92  ? 660  LEU A CD2 1 
ATOM   1269 N N   . LYS A 1 170 ? 51.779  29.715  34.872 1.00 40.06  ? 661  LYS A N   1 
ATOM   1270 C CA  . LYS A 1 170 ? 52.654  28.685  34.305 1.00 41.22  ? 661  LYS A CA  1 
ATOM   1271 C C   . LYS A 1 170 ? 53.192  27.737  35.366 1.00 40.93  ? 661  LYS A C   1 
ATOM   1272 O O   . LYS A 1 170 ? 52.844  27.837  36.543 1.00 40.22  ? 661  LYS A O   1 
ATOM   1273 C CB  . LYS A 1 170 ? 53.861  29.333  33.617 1.00 42.77  ? 661  LYS A CB  1 
ATOM   1274 C CG  . LYS A 1 170 ? 53.549  30.541  32.768 1.00 45.03  ? 661  LYS A CG  1 
ATOM   1275 C CD  . LYS A 1 170 ? 54.817  31.282  32.375 1.00 46.29  ? 661  LYS A CD  1 
ATOM   1276 C CE  . LYS A 1 170 ? 54.480  32.495  31.529 1.00 49.10  ? 661  LYS A CE  1 
ATOM   1277 N NZ  . LYS A 1 170 ? 55.675  33.334  31.242 1.00 54.06  ? 661  LYS A NZ  1 
ATOM   1278 N N   . SER A 1 171 ? 54.068  26.836  34.921 1.00 40.84  ? 662  SER A N   1 
ATOM   1279 C CA  . SER A 1 171 ? 54.729  25.847  35.774 1.00 40.87  ? 662  SER A CA  1 
ATOM   1280 C C   . SER A 1 171 ? 53.869  25.275  36.893 1.00 39.93  ? 662  SER A C   1 
ATOM   1281 O O   . SER A 1 171 ? 54.281  25.304  38.051 1.00 39.41  ? 662  SER A O   1 
ATOM   1282 C CB  . SER A 1 171 ? 55.988  26.453  36.400 1.00 42.02  ? 662  SER A CB  1 
ATOM   1283 O OG  . SER A 1 171 ? 56.892  26.930  35.419 1.00 46.21  ? 662  SER A OG  1 
ATOM   1284 N N   . LEU A 1 172 ? 52.693  24.751  36.550 1.00 38.17  ? 663  LEU A N   1 
ATOM   1285 C CA  . LEU A 1 172 ? 51.781  24.173  37.533 1.00 37.01  ? 663  LEU A CA  1 
ATOM   1286 C C   . LEU A 1 172 ? 52.015  22.668  37.646 1.00 37.10  ? 663  LEU A C   1 
ATOM   1287 O O   . LEU A 1 172 ? 52.801  22.109  36.893 1.00 37.18  ? 663  LEU A O   1 
ATOM   1288 C CB  . LEU A 1 172 ? 50.332  24.434  37.110 1.00 35.21  ? 663  LEU A CB  1 
ATOM   1289 C CG  . LEU A 1 172 ? 49.882  25.896  37.017 1.00 34.42  ? 663  LEU A CG  1 
ATOM   1290 C CD1 . LEU A 1 172 ? 48.561  25.989  36.277 1.00 30.72  ? 663  LEU A CD1 1 
ATOM   1291 C CD2 . LEU A 1 172 ? 49.763  26.485  38.415 1.00 32.48  ? 663  LEU A CD2 1 
ATOM   1292 N N   . ASP A 1 173 ? 51.348  22.015  38.592 1.00 37.59  ? 664  ASP A N   1 
ATOM   1293 C CA  . ASP A 1 173 ? 51.488  20.572  38.730 1.00 38.47  ? 664  ASP A CA  1 
ATOM   1294 C C   . ASP A 1 173 ? 50.651  19.922  37.639 1.00 38.72  ? 664  ASP A C   1 
ATOM   1295 O O   . ASP A 1 173 ? 49.625  20.473  37.235 1.00 38.96  ? 664  ASP A O   1 
ATOM   1296 C CB  . ASP A 1 173 ? 50.979  20.090  40.088 1.00 40.02  ? 664  ASP A CB  1 
ATOM   1297 C CG  . ASP A 1 173 ? 51.749  20.684  41.248 1.00 41.85  ? 664  ASP A CG  1 
ATOM   1298 O OD1 . ASP A 1 173 ? 52.887  21.152  41.033 1.00 41.91  ? 664  ASP A OD1 1 
ATOM   1299 O OD2 . ASP A 1 173 ? 51.216  20.667  42.380 1.00 43.21  ? 664  ASP A OD2 1 
ATOM   1300 N N   . TRP A 1 174 ? 51.082  18.755  37.166 1.00 38.59  ? 665  TRP A N   1 
ATOM   1301 C CA  . TRP A 1 174 ? 50.351  18.039  36.119 1.00 37.38  ? 665  TRP A CA  1 
ATOM   1302 C C   . TRP A 1 174 ? 49.210  17.209  36.701 1.00 34.85  ? 665  TRP A C   1 
ATOM   1303 O O   . TRP A 1 174 ? 49.289  16.730  37.831 1.00 32.95  ? 665  TRP A O   1 
ATOM   1304 C CB  . TRP A 1 174 ? 51.281  17.101  35.328 1.00 38.88  ? 665  TRP A CB  1 
ATOM   1305 C CG  . TRP A 1 174 ? 52.385  17.780  34.592 1.00 39.95  ? 665  TRP A CG  1 
ATOM   1306 C CD1 . TRP A 1 174 ? 53.611  18.134  35.087 1.00 41.21  ? 665  TRP A CD1 1 
ATOM   1307 C CD2 . TRP A 1 174 ? 52.354  18.231  33.237 1.00 41.11  ? 665  TRP A CD2 1 
ATOM   1308 N NE1 . TRP A 1 174 ? 54.346  18.782  34.119 1.00 40.65  ? 665  TRP A NE1 1 
ATOM   1309 C CE2 . TRP A 1 174 ? 53.597  18.856  32.974 1.00 41.96  ? 665  TRP A CE2 1 
ATOM   1310 C CE3 . TRP A 1 174 ? 51.396  18.171  32.214 1.00 41.81  ? 665  TRP A CE3 1 
ATOM   1311 C CZ2 . TRP A 1 174 ? 53.905  19.418  31.727 1.00 42.13  ? 665  TRP A CZ2 1 
ATOM   1312 C CZ3 . TRP A 1 174 ? 51.704  18.732  30.971 1.00 41.91  ? 665  TRP A CZ3 1 
ATOM   1313 C CH2 . TRP A 1 174 ? 52.948  19.346  30.742 1.00 41.94  ? 665  TRP A CH2 1 
ATOM   1314 N N   . ASN A 1 175 ? 48.157  17.036  35.910 1.00 34.14  ? 666  ASN A N   1 
ATOM   1315 C CA  . ASN A 1 175 ? 46.987  16.256  36.319 1.00 33.24  ? 666  ASN A CA  1 
ATOM   1316 C C   . ASN A 1 175 ? 46.437  16.734  37.664 1.00 32.42  ? 666  ASN A C   1 
ATOM   1317 O O   . ASN A 1 175 ? 46.019  15.925  38.490 1.00 31.68  ? 666  ASN A O   1 
ATOM   1318 C CB  . ASN A 1 175 ? 47.364  14.775  36.406 1.00 30.21  ? 666  ASN A CB  1 
ATOM   1319 C CG  . ASN A 1 175 ? 46.168  13.884  36.624 1.00 29.78  ? 666  ASN A CG  1 
ATOM   1320 O OD1 . ASN A 1 175 ? 45.137  14.039  35.967 1.00 29.96  ? 666  ASN A OD1 1 
ATOM   1321 N ND2 . ASN A 1 175 ? 46.298  12.935  37.540 1.00 26.56  ? 666  ASN A ND2 1 
ATOM   1322 N N   . ALA A 1 176 ? 46.428  18.054  37.856 1.00 31.13  ? 667  ALA A N   1 
ATOM   1323 C CA  . ALA A 1 176 ? 45.978  18.670  39.095 1.00 28.89  ? 667  ALA A CA  1 
ATOM   1324 C C   . ALA A 1 176 ? 44.899  19.725  38.860 1.00 29.83  ? 667  ALA A C   1 
ATOM   1325 O O   . ALA A 1 176 ? 44.893  20.410  37.828 1.00 27.40  ? 667  ALA A O   1 
ATOM   1326 C CB  . ALA A 1 176 ? 47.176  19.290  39.818 1.00 26.08  ? 667  ALA A CB  1 
ATOM   1327 N N   . GLU A 1 177 ? 44.000  19.850  39.840 1.00 30.87  ? 668  GLU A N   1 
ATOM   1328 C CA  . GLU A 1 177 ? 42.884  20.793  39.783 1.00 31.06  ? 668  GLU A CA  1 
ATOM   1329 C C   . GLU A 1 177 ? 43.143  22.047  40.588 1.00 30.67  ? 668  GLU A C   1 
ATOM   1330 O O   . GLU A 1 177 ? 43.496  21.980  41.765 1.00 30.46  ? 668  GLU A O   1 
ATOM   1331 C CB  . GLU A 1 177 ? 41.606  20.128  40.288 1.00 32.11  ? 668  GLU A CB  1 
ATOM   1332 C CG  . GLU A 1 177 ? 41.072  19.053  39.368 1.00 35.80  ? 668  GLU A CG  1 
ATOM   1333 C CD  . GLU A 1 177 ? 39.906  18.321  39.973 1.00 37.86  ? 668  GLU A CD  1 
ATOM   1334 O OE1 . GLU A 1 177 ? 38.829  18.930  40.117 1.00 40.03  ? 668  GLU A OE1 1 
ATOM   1335 O OE2 . GLU A 1 177 ? 40.070  17.137  40.319 1.00 40.83  ? 668  GLU A OE2 1 
ATOM   1336 N N   . TYR A 1 178 ? 42.937  23.194  39.947 1.00 30.34  ? 669  TYR A N   1 
ATOM   1337 C CA  . TYR A 1 178 ? 43.175  24.482  40.584 1.00 30.38  ? 669  TYR A CA  1 
ATOM   1338 C C   . TYR A 1 178 ? 41.960  25.403  40.592 1.00 30.33  ? 669  TYR A C   1 
ATOM   1339 O O   . TYR A 1 178 ? 41.022  25.217  39.813 1.00 30.87  ? 669  TYR A O   1 
ATOM   1340 C CB  . TYR A 1 178 ? 44.307  25.220  39.863 1.00 28.58  ? 669  TYR A CB  1 
ATOM   1341 C CG  . TYR A 1 178 ? 45.670  24.612  40.007 1.00 29.55  ? 669  TYR A CG  1 
ATOM   1342 C CD1 . TYR A 1 178 ? 46.077  23.538  39.206 1.00 30.29  ? 669  TYR A CD1 1 
ATOM   1343 C CD2 . TYR A 1 178 ? 46.573  25.121  40.937 1.00 29.93  ? 669  TYR A CD2 1 
ATOM   1344 C CE1 . TYR A 1 178 ? 47.359  22.992  39.332 1.00 28.44  ? 669  TYR A CE1 1 
ATOM   1345 C CE2 . TYR A 1 178 ? 47.849  24.585  41.070 1.00 28.88  ? 669  TYR A CE2 1 
ATOM   1346 C CZ  . TYR A 1 178 ? 48.235  23.527  40.267 1.00 29.04  ? 669  TYR A CZ  1 
ATOM   1347 O OH  . TYR A 1 178 ? 49.508  23.029  40.408 1.00 31.85  ? 669  TYR A OH  1 
ATOM   1348 N N   . GLU A 1 179 ? 41.996  26.396  41.478 1.00 29.03  ? 670  GLU A N   1 
ATOM   1349 C CA  . GLU A 1 179 ? 40.949  27.412  41.551 1.00 31.62  ? 670  GLU A CA  1 
ATOM   1350 C C   . GLU A 1 179 ? 41.645  28.769  41.631 1.00 31.73  ? 670  GLU A C   1 
ATOM   1351 O O   . GLU A 1 179 ? 42.587  28.955  42.406 1.00 31.93  ? 670  GLU A O   1 
ATOM   1352 C CB  . GLU A 1 179 ? 40.028  27.223  42.767 1.00 32.90  ? 670  GLU A CB  1 
ATOM   1353 C CG  . GLU A 1 179 ? 40.693  27.382  44.130 1.00 36.11  ? 670  GLU A CG  1 
ATOM   1354 C CD  . GLU A 1 179 ? 39.691  27.270  45.274 1.00 38.27  ? 670  GLU A CD  1 
ATOM   1355 O OE1 . GLU A 1 179 ? 40.102  27.380  46.455 1.00 37.63  ? 670  GLU A OE1 1 
ATOM   1356 O OE2 . GLU A 1 179 ? 38.490  27.072  44.982 1.00 37.40  ? 670  GLU A OE2 1 
ATOM   1357 N N   . VAL A 1 180 ? 41.192  29.704  40.803 1.00 30.42  ? 671  VAL A N   1 
ATOM   1358 C CA  . VAL A 1 180 ? 41.750  31.038  40.765 1.00 29.25  ? 671  VAL A CA  1 
ATOM   1359 C C   . VAL A 1 180 ? 40.727  32.044  41.252 1.00 30.11  ? 671  VAL A C   1 
ATOM   1360 O O   . VAL A 1 180 ? 39.557  31.979  40.871 1.00 29.27  ? 671  VAL A O   1 
ATOM   1361 C CB  . VAL A 1 180 ? 42.131  31.449  39.337 1.00 29.20  ? 671  VAL A CB  1 
ATOM   1362 C CG1 . VAL A 1 180 ? 42.575  32.888  39.322 1.00 29.74  ? 671  VAL A CG1 1 
ATOM   1363 C CG2 . VAL A 1 180 ? 43.233  30.572  38.818 1.00 31.82  ? 671  VAL A CG2 1 
ATOM   1364 N N   . TYR A 1 181 ? 41.172  32.971  42.094 1.00 30.37  ? 672  TYR A N   1 
ATOM   1365 C CA  . TYR A 1 181 ? 40.311  34.036  42.588 1.00 31.47  ? 672  TYR A CA  1 
ATOM   1366 C C   . TYR A 1 181 ? 40.868  35.387  42.136 1.00 31.40  ? 672  TYR A C   1 
ATOM   1367 O O   . TYR A 1 181 ? 42.047  35.693  42.329 1.00 31.37  ? 672  TYR A O   1 
ATOM   1368 C CB  . TYR A 1 181 ? 40.202  33.996  44.113 1.00 33.53  ? 672  TYR A CB  1 
ATOM   1369 C CG  . TYR A 1 181 ? 39.259  32.928  44.625 1.00 36.68  ? 672  TYR A CG  1 
ATOM   1370 C CD1 . TYR A 1 181 ? 39.708  31.631  44.877 1.00 37.81  ? 672  TYR A CD1 1 
ATOM   1371 C CD2 . TYR A 1 181 ? 37.916  33.219  44.867 1.00 38.20  ? 672  TYR A CD2 1 
ATOM   1372 C CE1 . TYR A 1 181 ? 38.846  30.652  45.366 1.00 39.13  ? 672  TYR A CE1 1 
ATOM   1373 C CE2 . TYR A 1 181 ? 37.043  32.249  45.352 1.00 39.17  ? 672  TYR A CE2 1 
ATOM   1374 C CZ  . TYR A 1 181 ? 37.514  30.968  45.604 1.00 39.69  ? 672  TYR A CZ  1 
ATOM   1375 O OH  . TYR A 1 181 ? 36.665  30.020  46.124 1.00 38.17  ? 672  TYR A OH  1 
ATOM   1376 N N   . VAL A 1 182 ? 40.022  36.190  41.507 1.00 30.54  ? 673  VAL A N   1 
ATOM   1377 C CA  . VAL A 1 182 ? 40.451  37.496  41.046 1.00 28.70  ? 673  VAL A CA  1 
ATOM   1378 C C   . VAL A 1 182 ? 39.559  38.570  41.640 1.00 28.75  ? 673  VAL A C   1 
ATOM   1379 O O   . VAL A 1 182 ? 38.336  38.495  41.547 1.00 28.49  ? 673  VAL A O   1 
ATOM   1380 C CB  . VAL A 1 182 ? 40.402  37.590  39.515 1.00 29.50  ? 673  VAL A CB  1 
ATOM   1381 C CG1 . VAL A 1 182 ? 40.892  38.962  39.063 1.00 27.49  ? 673  VAL A CG1 1 
ATOM   1382 C CG2 . VAL A 1 182 ? 41.260  36.487  38.905 1.00 29.17  ? 673  VAL A CG2 1 
ATOM   1383 N N   . VAL A 1 183 ? 40.179  39.563  42.267 1.00 28.90  ? 674  VAL A N   1 
ATOM   1384 C CA  . VAL A 1 183 ? 39.444  40.663  42.876 1.00 28.61  ? 674  VAL A CA  1 
ATOM   1385 C C   . VAL A 1 183 ? 39.905  41.993  42.294 1.00 28.48  ? 674  VAL A C   1 
ATOM   1386 O O   . VAL A 1 183 ? 41.084  42.174  41.991 1.00 29.60  ? 674  VAL A O   1 
ATOM   1387 C CB  . VAL A 1 183 ? 39.651  40.680  44.399 1.00 28.70  ? 674  VAL A CB  1 
ATOM   1388 C CG1 . VAL A 1 183 ? 39.008  41.914  45.003 1.00 31.76  ? 674  VAL A CG1 1 
ATOM   1389 C CG2 . VAL A 1 183 ? 39.046  39.434  45.009 1.00 28.96  ? 674  VAL A CG2 1 
ATOM   1390 N N   . ALA A 1 184 ? 38.965  42.910  42.115 1.00 26.99  ? 675  ALA A N   1 
ATOM   1391 C CA  . ALA A 1 184 ? 39.276  44.230  41.588 1.00 28.87  ? 675  ALA A CA  1 
ATOM   1392 C C   . ALA A 1 184 ? 39.280  45.170  42.788 1.00 31.10  ? 675  ALA A C   1 
ATOM   1393 O O   . ALA A 1 184 ? 38.421  45.065  43.672 1.00 32.87  ? 675  ALA A O   1 
ATOM   1394 C CB  . ALA A 1 184 ? 38.214  44.658  40.565 1.00 25.19  ? 675  ALA A CB  1 
ATOM   1395 N N   . GLU A 1 185 ? 40.233  46.091  42.829 1.00 32.62  ? 676  GLU A N   1 
ATOM   1396 C CA  . GLU A 1 185 ? 40.318  47.003  43.958 1.00 34.64  ? 676  GLU A CA  1 
ATOM   1397 C C   . GLU A 1 185 ? 40.599  48.452  43.606 1.00 36.00  ? 676  GLU A C   1 
ATOM   1398 O O   . GLU A 1 185 ? 41.456  48.742  42.765 1.00 36.42  ? 676  GLU A O   1 
ATOM   1399 C CB  . GLU A 1 185 ? 41.392  46.515  44.924 1.00 35.92  ? 676  GLU A CB  1 
ATOM   1400 C CG  . GLU A 1 185 ? 41.708  47.485  46.028 1.00 40.94  ? 676  GLU A CG  1 
ATOM   1401 C CD  . GLU A 1 185 ? 42.875  47.026  46.868 1.00 45.10  ? 676  GLU A CD  1 
ATOM   1402 O OE1 . GLU A 1 185 ? 43.973  46.832  46.294 1.00 45.93  ? 676  GLU A OE1 1 
ATOM   1403 O OE2 . GLU A 1 185 ? 42.691  46.857  48.098 1.00 47.14  ? 676  GLU A OE2 1 
ATOM   1404 N N   . ASN A 1 186 ? 39.870  49.355  44.264 1.00 36.00  ? 677  ASN A N   1 
ATOM   1405 C CA  . ASN A 1 186 ? 40.053  50.787  44.074 1.00 35.82  ? 677  ASN A CA  1 
ATOM   1406 C C   . ASN A 1 186 ? 40.270  51.502  45.421 1.00 36.68  ? 677  ASN A C   1 
ATOM   1407 O O   . ASN A 1 186 ? 40.389  50.863  46.468 1.00 37.01  ? 677  ASN A O   1 
ATOM   1408 C CB  . ASN A 1 186 ? 38.872  51.406  43.298 1.00 35.51  ? 677  ASN A CB  1 
ATOM   1409 C CG  . ASN A 1 186 ? 37.542  51.238  43.999 1.00 35.16  ? 677  ASN A CG  1 
ATOM   1410 O OD1 . ASN A 1 186 ? 37.486  50.854  45.159 1.00 36.17  ? 677  ASN A OD1 1 
ATOM   1411 N ND2 . ASN A 1 186 ? 36.458  51.541  43.292 1.00 33.79  ? 677  ASN A ND2 1 
ATOM   1412 N N   . GLN A 1 187 ? 40.332  52.828  45.386 1.00 37.22  ? 678  GLN A N   1 
ATOM   1413 C CA  . GLN A 1 187 ? 40.571  53.615  46.585 1.00 38.32  ? 678  GLN A CA  1 
ATOM   1414 C C   . GLN A 1 187 ? 39.484  53.408  47.636 1.00 37.90  ? 678  GLN A C   1 
ATOM   1415 O O   . GLN A 1 187 ? 39.654  53.779  48.788 1.00 38.95  ? 678  GLN A O   1 
ATOM   1416 C CB  . GLN A 1 187 ? 40.666  55.111  46.224 1.00 41.41  ? 678  GLN A CB  1 
ATOM   1417 C CG  . GLN A 1 187 ? 40.875  55.433  44.710 1.00 47.08  ? 678  GLN A CG  1 
ATOM   1418 C CD  . GLN A 1 187 ? 42.259  56.035  44.361 1.00 48.83  ? 678  GLN A CD  1 
ATOM   1419 O OE1 . GLN A 1 187 ? 42.464  56.548  43.250 1.00 45.48  ? 678  GLN A OE1 1 
ATOM   1420 N NE2 . GLN A 1 187 ? 43.205  55.961  45.304 1.00 47.43  ? 678  GLN A NE2 1 
ATOM   1421 N N   . GLN A 1 188 ? 38.375  52.799  47.238 1.00 37.65  ? 679  GLN A N   1 
ATOM   1422 C CA  . GLN A 1 188 ? 37.239  52.572  48.127 1.00 36.09  ? 679  GLN A CA  1 
ATOM   1423 C C   . GLN A 1 188 ? 37.212  51.169  48.756 1.00 35.18  ? 679  GLN A C   1 
ATOM   1424 O O   . GLN A 1 188 ? 36.572  50.954  49.787 1.00 33.35  ? 679  GLN A O   1 
ATOM   1425 C CB  . GLN A 1 188 ? 35.950  52.819  47.334 1.00 37.79  ? 679  GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 188 ? 34.640  52.659  48.102 1.00 43.66  ? 679  GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 188 ? 34.336  53.839  49.018 1.00 47.30  ? 679  GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 188 ? 34.448  55.000  48.611 1.00 48.39  ? 679  GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 188 ? 33.936  53.546  50.258 1.00 47.47  ? 679  GLN A NE2 1 
ATOM   1430 N N   . GLY A 1 189 ? 37.897  50.214  48.133 1.00 33.62  ? 680  GLY A N   1 
ATOM   1431 C CA  . GLY A 1 189 ? 37.905  48.862  48.661 1.00 32.60  ? 680  GLY A CA  1 
ATOM   1432 C C   . GLY A 1 189 ? 37.928  47.760  47.615 1.00 32.25  ? 680  GLY A C   1 
ATOM   1433 O O   . GLY A 1 189 ? 38.151  48.013  46.433 1.00 31.67  ? 680  GLY A O   1 
ATOM   1434 N N   . LYS A 1 190 ? 37.691  46.529  48.063 1.00 31.81  ? 681  LYS A N   1 
ATOM   1435 C CA  . LYS A 1 190 ? 37.695  45.360  47.191 1.00 31.66  ? 681  LYS A CA  1 
ATOM   1436 C C   . LYS A 1 190 ? 36.316  44.882  46.721 1.00 31.85  ? 681  LYS A C   1 
ATOM   1437 O O   . LYS A 1 190 ? 35.300  45.038  47.399 1.00 30.88  ? 681  LYS A O   1 
ATOM   1438 C CB  . LYS A 1 190 ? 38.396  44.198  47.885 1.00 31.49  ? 681  LYS A CB  1 
ATOM   1439 C CG  . LYS A 1 190 ? 39.836  44.468  48.257 1.00 33.57  ? 681  LYS A CG  1 
ATOM   1440 C CD  . LYS A 1 190 ? 40.324  43.423  49.262 1.00 34.32  ? 681  LYS A CD  1 
ATOM   1441 C CE  . LYS A 1 190 ? 41.754  43.685  49.706 1.00 35.18  ? 681  LYS A CE  1 
ATOM   1442 N NZ  . LYS A 1 190 ? 42.114  42.844  50.883 1.00 34.70  ? 681  LYS A NZ  1 
ATOM   1443 N N   . SER A 1 191 ? 36.310  44.273  45.545 1.00 31.53  ? 682  SER A N   1 
ATOM   1444 C CA  . SER A 1 191 ? 35.096  43.749  44.944 1.00 29.52  ? 682  SER A CA  1 
ATOM   1445 C C   . SER A 1 191 ? 34.867  42.316  45.392 1.00 29.37  ? 682  SER A C   1 
ATOM   1446 O O   . SER A 1 191 ? 35.676  41.735  46.115 1.00 28.59  ? 682  SER A O   1 
ATOM   1447 C CB  . SER A 1 191 ? 35.252  43.727  43.432 1.00 28.83  ? 682  SER A CB  1 
ATOM   1448 O OG  . SER A 1 191 ? 36.181  42.719  43.077 1.00 23.90  ? 682  SER A OG  1 
ATOM   1449 N N   . LYS A 1 192 ? 33.756  41.746  44.948 1.00 29.05  ? 683  LYS A N   1 
ATOM   1450 C CA  . LYS A 1 192 ? 33.481  40.358  45.239 1.00 29.80  ? 683  LYS A CA  1 
ATOM   1451 C C   . LYS A 1 192 ? 34.516  39.615  44.390 1.00 29.77  ? 683  LYS A C   1 
ATOM   1452 O O   . LYS A 1 192 ? 34.953  40.124  43.357 1.00 32.07  ? 683  LYS A O   1 
ATOM   1453 C CB  . LYS A 1 192 ? 32.059  40.011  44.806 1.00 30.57  ? 683  LYS A CB  1 
ATOM   1454 C CG  . LYS A 1 192 ? 31.029  40.356  45.858 1.00 36.10  ? 683  LYS A CG  1 
ATOM   1455 C CD  . LYS A 1 192 ? 29.797  41.027  45.278 1.00 40.84  ? 683  LYS A CD  1 
ATOM   1456 C CE  . LYS A 1 192 ? 28.982  40.099  44.395 1.00 42.73  ? 683  LYS A CE  1 
ATOM   1457 N NZ  . LYS A 1 192 ? 27.703  40.771  43.980 1.00 45.80  ? 683  LYS A NZ  1 
ATOM   1458 N N   . ALA A 1 193 ? 34.944  38.438  44.813 1.00 28.35  ? 684  ALA A N   1 
ATOM   1459 C CA  . ALA A 1 193 ? 35.924  37.723  44.013 1.00 28.89  ? 684  ALA A CA  1 
ATOM   1460 C C   . ALA A 1 193 ? 35.264  36.925  42.902 1.00 28.73  ? 684  ALA A C   1 
ATOM   1461 O O   . ALA A 1 193 ? 34.190  36.346  43.079 1.00 29.46  ? 684  ALA A O   1 
ATOM   1462 C CB  . ALA A 1 193 ? 36.766  36.790  44.884 1.00 27.94  ? 684  ALA A CB  1 
ATOM   1463 N N   . ALA A 1 194 ? 35.912  36.927  41.746 1.00 27.56  ? 685  ALA A N   1 
ATOM   1464 C CA  . ALA A 1 194 ? 35.450  36.170  40.606 1.00 27.62  ? 685  ALA A CA  1 
ATOM   1465 C C   . ALA A 1 194 ? 36.292  34.906  40.670 1.00 29.11  ? 685  ALA A C   1 
ATOM   1466 O O   . ALA A 1 194 ? 37.511  34.991  40.721 1.00 29.56  ? 685  ALA A O   1 
ATOM   1467 C CB  . ALA A 1 194 ? 35.736  36.928  39.317 1.00 26.00  ? 685  ALA A CB  1 
ATOM   1468 N N   . HIS A 1 195 ? 35.656  33.741  40.717 1.00 32.40  ? 686  HIS A N   1 
ATOM   1469 C CA  . HIS A 1 195 ? 36.415  32.501  40.760 1.00 35.50  ? 686  HIS A CA  1 
ATOM   1470 C C   . HIS A 1 195 ? 36.380  31.762  39.429 1.00 34.96  ? 686  HIS A C   1 
ATOM   1471 O O   . HIS A 1 195 ? 35.477  31.940  38.614 1.00 34.19  ? 686  HIS A O   1 
ATOM   1472 C CB  . HIS A 1 195 ? 35.962  31.580  41.917 1.00 39.54  ? 686  HIS A CB  1 
ATOM   1473 C CG  . HIS A 1 195 ? 34.480  31.515  42.121 1.00 44.56  ? 686  HIS A CG  1 
ATOM   1474 N ND1 . HIS A 1 195 ? 33.777  32.494  42.793 1.00 47.20  ? 686  HIS A ND1 1 
ATOM   1475 C CD2 . HIS A 1 195 ? 33.571  30.574  41.768 1.00 45.97  ? 686  HIS A CD2 1 
ATOM   1476 C CE1 . HIS A 1 195 ? 32.499  32.156  42.846 1.00 48.18  ? 686  HIS A CE1 1 
ATOM   1477 N NE2 . HIS A 1 195 ? 32.347  30.996  42.231 1.00 46.87  ? 686  HIS A NE2 1 
ATOM   1478 N N   . PHE A 1 196 ? 37.394  30.939  39.213 1.00 34.95  ? 687  PHE A N   1 
ATOM   1479 C CA  . PHE A 1 196 ? 37.530  30.181  37.980 1.00 33.85  ? 687  PHE A CA  1 
ATOM   1480 C C   . PHE A 1 196 ? 38.239  28.873  38.327 1.00 33.47  ? 687  PHE A C   1 
ATOM   1481 O O   . PHE A 1 196 ? 39.261  28.876  39.011 1.00 32.37  ? 687  PHE A O   1 
ATOM   1482 C CB  . PHE A 1 196 ? 38.370  30.996  36.990 1.00 33.82  ? 687  PHE A CB  1 
ATOM   1483 C CG  . PHE A 1 196 ? 38.526  30.352  35.666 1.00 34.70  ? 687  PHE A CG  1 
ATOM   1484 C CD1 . PHE A 1 196 ? 37.510  30.439  34.715 1.00 36.10  ? 687  PHE A CD1 1 
ATOM   1485 C CD2 . PHE A 1 196 ? 39.668  29.620  35.375 1.00 33.92  ? 687  PHE A CD2 1 
ATOM   1486 C CE1 . PHE A 1 196 ? 37.624  29.800  33.485 1.00 35.17  ? 687  PHE A CE1 1 
ATOM   1487 C CE2 . PHE A 1 196 ? 39.803  28.976  34.155 1.00 34.85  ? 687  PHE A CE2 1 
ATOM   1488 C CZ  . PHE A 1 196 ? 38.777  29.062  33.202 1.00 37.20  ? 687  PHE A CZ  1 
ATOM   1489 N N   . VAL A 1 197 ? 37.697  27.755  37.866 1.00 33.33  ? 688  VAL A N   1 
ATOM   1490 C CA  . VAL A 1 197 ? 38.305  26.461  38.161 1.00 31.56  ? 688  VAL A CA  1 
ATOM   1491 C C   . VAL A 1 197 ? 38.743  25.718  36.908 1.00 29.86  ? 688  VAL A C   1 
ATOM   1492 O O   . VAL A 1 197 ? 37.998  25.631  35.936 1.00 29.08  ? 688  VAL A O   1 
ATOM   1493 C CB  . VAL A 1 197 ? 37.341  25.565  38.965 1.00 30.81  ? 688  VAL A CB  1 
ATOM   1494 C CG1 . VAL A 1 197 ? 37.997  24.237  39.281 1.00 30.78  ? 688  VAL A CG1 1 
ATOM   1495 C CG2 . VAL A 1 197 ? 36.965  26.256  40.240 1.00 31.35  ? 688  VAL A CG2 1 
ATOM   1496 N N   . PHE A 1 198 ? 39.960  25.182  36.941 1.00 28.03  ? 689  PHE A N   1 
ATOM   1497 C CA  . PHE A 1 198 ? 40.488  24.448  35.804 1.00 26.15  ? 689  PHE A CA  1 
ATOM   1498 C C   . PHE A 1 198 ? 41.346  23.256  36.230 1.00 27.10  ? 689  PHE A C   1 
ATOM   1499 O O   . PHE A 1 198 ? 41.652  23.066  37.411 1.00 24.36  ? 689  PHE A O   1 
ATOM   1500 C CB  . PHE A 1 198 ? 41.304  25.384  34.914 1.00 22.58  ? 689  PHE A CB  1 
ATOM   1501 C CG  . PHE A 1 198 ? 42.552  25.865  35.553 1.00 20.68  ? 689  PHE A CG  1 
ATOM   1502 C CD1 . PHE A 1 198 ? 43.742  25.172  35.382 1.00 20.02  ? 689  PHE A CD1 1 
ATOM   1503 C CD2 . PHE A 1 198 ? 42.530  26.974  36.388 1.00 20.12  ? 689  PHE A CD2 1 
ATOM   1504 C CE1 . PHE A 1 198 ? 44.898  25.574  36.038 1.00 20.23  ? 689  PHE A CE1 1 
ATOM   1505 C CE2 . PHE A 1 198 ? 43.672  27.387  37.049 1.00 21.10  ? 689  PHE A CE2 1 
ATOM   1506 C CZ  . PHE A 1 198 ? 44.864  26.683  36.876 1.00 22.84  ? 689  PHE A CZ  1 
ATOM   1507 N N   . ARG A 1 199 ? 41.742  22.470  35.236 1.00 28.67  ? 690  ARG A N   1 
ATOM   1508 C CA  . ARG A 1 199 ? 42.527  21.277  35.457 1.00 30.33  ? 690  ARG A CA  1 
ATOM   1509 C C   . ARG A 1 199 ? 43.599  21.081  34.390 1.00 32.51  ? 690  ARG A C   1 
ATOM   1510 O O   . ARG A 1 199 ? 43.303  21.002  33.194 1.00 35.21  ? 690  ARG A O   1 
ATOM   1511 C CB  . ARG A 1 199 ? 41.596  20.069  35.496 1.00 28.53  ? 690  ARG A CB  1 
ATOM   1512 C CG  . ARG A 1 199 ? 42.313  18.757  35.521 1.00 28.48  ? 690  ARG A CG  1 
ATOM   1513 C CD  . ARG A 1 199 ? 41.433  17.657  36.038 1.00 29.17  ? 690  ARG A CD  1 
ATOM   1514 N NE  . ARG A 1 199 ? 42.107  16.369  35.899 1.00 31.61  ? 690  ARG A NE  1 
ATOM   1515 C CZ  . ARG A 1 199 ? 41.786  15.273  36.578 1.00 29.15  ? 690  ARG A CZ  1 
ATOM   1516 N NH1 . ARG A 1 199 ? 40.791  15.304  37.458 1.00 27.36  ? 690  ARG A NH1 1 
ATOM   1517 N NH2 . ARG A 1 199 ? 42.465  14.153  36.373 1.00 24.65  ? 690  ARG A NH2 1 
ATOM   1518 N N   . THR A 1 200 ? 44.848  20.992  34.832 1.00 32.77  ? 691  THR A N   1 
ATOM   1519 C CA  . THR A 1 200 ? 45.962  20.805  33.920 1.00 33.58  ? 691  THR A CA  1 
ATOM   1520 C C   . THR A 1 200 ? 45.907  19.420  33.290 1.00 34.39  ? 691  THR A C   1 
ATOM   1521 O O   . THR A 1 200 ? 45.185  18.537  33.762 1.00 32.64  ? 691  THR A O   1 
ATOM   1522 C CB  . THR A 1 200 ? 47.303  20.982  34.647 1.00 33.72  ? 691  THR A CB  1 
ATOM   1523 O OG1 . THR A 1 200 ? 47.382  20.064  35.749 1.00 34.52  ? 691  THR A OG1 1 
ATOM   1524 C CG2 . THR A 1 200 ? 47.427  22.397  35.164 1.00 31.40  ? 691  THR A CG2 1 
ATOM   1525 N N   . ALA A 1 201 ? 46.669  19.246  32.216 1.00 35.59  ? 692  ALA A N   1 
ATOM   1526 C CA  . ALA A 1 201 ? 46.721  17.977  31.508 1.00 37.41  ? 692  ALA A CA  1 
ATOM   1527 C C   . ALA A 1 201 ? 47.486  16.921  32.311 1.00 39.26  ? 692  ALA A C   1 
ATOM   1528 O O   . ALA A 1 201 ? 48.099  17.223  33.338 1.00 36.91  ? 692  ALA A O   1 
ATOM   1529 C CB  . ALA A 1 201 ? 47.361  18.173  30.146 1.00 36.69  ? 692  ALA A CB  1 
ATOM   1530 N N   . ALA A 1 202 ? 47.436  15.680  31.834 1.00 42.77  ? 693  ALA A N   1 
ATOM   1531 C CA  . ALA A 1 202 ? 48.106  14.561  32.491 1.00 45.19  ? 693  ALA A CA  1 
ATOM   1532 C C   . ALA A 1 202 ? 49.620  14.577  32.297 1.00 47.02  ? 693  ALA A C   1 
ATOM   1533 O O   . ALA A 1 202 ? 50.369  14.185  33.194 1.00 47.72  ? 693  ALA A O   1 
ATOM   1534 C CB  . ALA A 1 202 ? 47.539  13.251  31.976 1.00 43.91  ? 693  ALA A CB  1 
ATOM   1535 N N   . ALA A 1 203 ? 50.072  15.025  31.127 1.00 47.76  ? 694  ALA A N   1 
ATOM   1536 C CA  . ALA A 1 203 ? 51.511  15.072  30.838 1.00 49.53  ? 694  ALA A CA  1 
ATOM   1537 C C   . ALA A 1 203 ? 51.791  15.825  29.522 1.00 50.17  ? 694  ALA A C   1 
ATOM   1538 O O   . ALA A 1 203 ? 52.911  16.389  29.371 1.00 49.16  ? 694  ALA A O   1 
ATOM   1539 C CB  . ALA A 1 203 ? 52.083  13.636  30.767 1.00 47.98  ? 694  ALA A CB  1 
ATOM   1540 N N   . HIS A 1 204 ? 50.882  15.829  28.657 1.00 52.48  ? 695  HIS A N   1 
ATOM   1541 N N   . ALA B 1 6   ? 63.507  59.645  14.010 1.00 66.79  ? 497  ALA B N   1 
ATOM   1542 C CA  . ALA B 1 6   ? 62.419  60.242  13.181 1.00 66.32  ? 497  ALA B CA  1 
ATOM   1543 C C   . ALA B 1 6   ? 61.459  59.153  12.714 1.00 65.42  ? 497  ALA B C   1 
ATOM   1544 O O   . ALA B 1 6   ? 61.766  58.410  11.780 1.00 65.62  ? 497  ALA B O   1 
ATOM   1545 C CB  . ALA B 1 6   ? 63.024  60.969  11.974 1.00 67.56  ? 497  ALA B CB  1 
ATOM   1546 N N   . ASP B 1 7   ? 60.296  59.065  13.359 1.00 63.46  ? 498  ASP B N   1 
ATOM   1547 C CA  . ASP B 1 7   ? 59.311  58.049  13.007 1.00 61.10  ? 498  ASP B CA  1 
ATOM   1548 C C   . ASP B 1 7   ? 57.982  58.218  13.743 1.00 58.38  ? 498  ASP B C   1 
ATOM   1549 O O   . ASP B 1 7   ? 57.718  59.261  14.347 1.00 57.32  ? 498  ASP B O   1 
ATOM   1550 C CB  . ASP B 1 7   ? 59.899  56.656  13.285 1.00 64.60  ? 498  ASP B CB  1 
ATOM   1551 C CG  . ASP B 1 7   ? 60.476  56.520  14.704 1.00 67.67  ? 498  ASP B CG  1 
ATOM   1552 O OD1 . ASP B 1 7   ? 61.099  57.491  15.204 1.00 67.30  ? 498  ASP B OD1 1 
ATOM   1553 O OD2 . ASP B 1 7   ? 60.319  55.429  15.308 1.00 68.38  ? 498  ASP B OD2 1 
ATOM   1554 N N   . THR B 1 8   ? 57.142  57.186  13.675 1.00 54.87  ? 499  THR B N   1 
ATOM   1555 C CA  . THR B 1 8   ? 55.841  57.200  14.339 1.00 50.67  ? 499  THR B CA  1 
ATOM   1556 C C   . THR B 1 8   ? 56.023  56.857  15.817 1.00 48.16  ? 499  THR B C   1 
ATOM   1557 O O   . THR B 1 8   ? 57.055  56.310  16.209 1.00 48.48  ? 499  THR B O   1 
ATOM   1558 C CB  . THR B 1 8   ? 54.865  56.197  13.686 1.00 50.08  ? 499  THR B CB  1 
ATOM   1559 O OG1 . THR B 1 8   ? 55.456  54.894  13.651 1.00 49.86  ? 499  THR B OG1 1 
ATOM   1560 C CG2 . THR B 1 8   ? 54.528  56.633  12.277 1.00 49.38  ? 499  THR B CG2 1 
ATOM   1561 N N   . PRO B 1 9   ? 55.022  57.169  16.657 1.00 45.17  ? 500  PRO B N   1 
ATOM   1562 C CA  . PRO B 1 9   ? 55.143  56.876  18.082 1.00 43.00  ? 500  PRO B CA  1 
ATOM   1563 C C   . PRO B 1 9   ? 54.753  55.459  18.417 1.00 42.13  ? 500  PRO B C   1 
ATOM   1564 O O   . PRO B 1 9   ? 54.110  54.776  17.621 1.00 43.30  ? 500  PRO B O   1 
ATOM   1565 C CB  . PRO B 1 9   ? 54.183  57.875  18.734 1.00 42.31  ? 500  PRO B CB  1 
ATOM   1566 C CG  . PRO B 1 9   ? 53.498  58.606  17.567 1.00 42.67  ? 500  PRO B CG  1 
ATOM   1567 C CD  . PRO B 1 9   ? 53.701  57.741  16.374 1.00 43.77  ? 500  PRO B CD  1 
ATOM   1568 N N   . SER B 1 10  ? 55.154  55.024  19.605 1.00 41.04  ? 501  SER B N   1 
ATOM   1569 C CA  . SER B 1 10  ? 54.801  53.704  20.084 1.00 38.95  ? 501  SER B CA  1 
ATOM   1570 C C   . SER B 1 10  ? 53.310  53.749  20.396 1.00 39.42  ? 501  SER B C   1 
ATOM   1571 O O   . SER B 1 10  ? 52.640  54.764  20.185 1.00 39.21  ? 501  SER B O   1 
ATOM   1572 C CB  . SER B 1 10  ? 55.569  53.366  21.350 1.00 38.15  ? 501  SER B CB  1 
ATOM   1573 O OG  . SER B 1 10  ? 56.953  53.356  21.103 1.00 40.53  ? 501  SER B OG  1 
ATOM   1574 N N   . SER B 1 11  ? 52.793  52.646  20.912 1.00 38.46  ? 502  SER B N   1 
ATOM   1575 C CA  . SER B 1 11  ? 51.384  52.558  21.222 1.00 36.74  ? 502  SER B CA  1 
ATOM   1576 C C   . SER B 1 11  ? 51.083  53.143  22.587 1.00 34.46  ? 502  SER B C   1 
ATOM   1577 O O   . SER B 1 11  ? 51.931  53.126  23.483 1.00 35.77  ? 502  SER B O   1 
ATOM   1578 C CB  . SER B 1 11  ? 50.948  51.097  21.214 1.00 39.01  ? 502  SER B CB  1 
ATOM   1579 O OG  . SER B 1 11  ? 51.569  50.404  22.287 1.00 39.84  ? 502  SER B OG  1 
ATOM   1580 N N   . PRO B 1 12  ? 49.869  53.687  22.757 1.00 30.72  ? 503  PRO B N   1 
ATOM   1581 C CA  . PRO B 1 12  ? 49.482  54.260  24.047 1.00 28.91  ? 503  PRO B CA  1 
ATOM   1582 C C   . PRO B 1 12  ? 49.288  53.037  24.956 1.00 28.32  ? 503  PRO B C   1 
ATOM   1583 O O   . PRO B 1 12  ? 49.478  51.912  24.519 1.00 27.84  ? 503  PRO B O   1 
ATOM   1584 C CB  . PRO B 1 12  ? 48.153  54.955  23.735 1.00 27.64  ? 503  PRO B CB  1 
ATOM   1585 C CG  . PRO B 1 12  ? 48.192  55.170  22.238 1.00 28.08  ? 503  PRO B CG  1 
ATOM   1586 C CD  . PRO B 1 12  ? 48.835  53.926  21.734 1.00 29.52  ? 503  PRO B CD  1 
ATOM   1587 N N   . SER B 1 13  ? 48.922  53.243  26.211 1.00 28.35  ? 504  SER B N   1 
ATOM   1588 C CA  . SER B 1 13  ? 48.699  52.114  27.114 1.00 27.28  ? 504  SER B CA  1 
ATOM   1589 C C   . SER B 1 13  ? 47.390  52.338  27.853 1.00 27.91  ? 504  SER B C   1 
ATOM   1590 O O   . SER B 1 13  ? 47.199  53.364  28.505 1.00 28.94  ? 504  SER B O   1 
ATOM   1591 C CB  . SER B 1 13  ? 49.836  51.990  28.127 1.00 27.86  ? 504  SER B CB  1 
ATOM   1592 O OG  . SER B 1 13  ? 51.061  51.672  27.498 1.00 28.85  ? 504  SER B OG  1 
ATOM   1593 N N   . ILE B 1 14  ? 46.474  51.389  27.741 1.00 26.83  ? 505  ILE B N   1 
ATOM   1594 C CA  . ILE B 1 14  ? 45.200  51.527  28.412 1.00 25.88  ? 505  ILE B CA  1 
ATOM   1595 C C   . ILE B 1 14  ? 45.349  51.118  29.881 1.00 26.13  ? 505  ILE B C   1 
ATOM   1596 O O   . ILE B 1 14  ? 45.802  50.011  30.196 1.00 23.90  ? 505  ILE B O   1 
ATOM   1597 C CB  . ILE B 1 14  ? 44.132  50.691  27.696 1.00 24.89  ? 505  ILE B CB  1 
ATOM   1598 C CG1 . ILE B 1 14  ? 44.131  51.058  26.208 1.00 22.82  ? 505  ILE B CG1 1 
ATOM   1599 C CG2 . ILE B 1 14  ? 42.755  50.958  28.302 1.00 26.16  ? 505  ILE B CG2 1 
ATOM   1600 C CD1 . ILE B 1 14  ? 43.055  50.384  25.406 1.00 21.75  ? 505  ILE B CD1 1 
ATOM   1601 N N   . ASP B 1 15  ? 45.001  52.047  30.768 1.00 25.38  ? 506  ASP B N   1 
ATOM   1602 C CA  . ASP B 1 15  ? 45.096  51.828  32.201 1.00 26.46  ? 506  ASP B CA  1 
ATOM   1603 C C   . ASP B 1 15  ? 43.720  51.559  32.785 1.00 26.26  ? 506  ASP B C   1 
ATOM   1604 O O   . ASP B 1 15  ? 43.588  50.856  33.789 1.00 26.18  ? 506  ASP B O   1 
ATOM   1605 C CB  . ASP B 1 15  ? 45.682  53.058  32.904 1.00 28.57  ? 506  ASP B CB  1 
ATOM   1606 C CG  . ASP B 1 15  ? 46.994  53.506  32.305 1.00 32.64  ? 506  ASP B CG  1 
ATOM   1607 O OD1 . ASP B 1 15  ? 47.882  52.646  32.105 1.00 34.68  ? 506  ASP B OD1 1 
ATOM   1608 O OD2 . ASP B 1 15  ? 47.141  54.723  32.044 1.00 33.31  ? 506  ASP B OD2 1 
ATOM   1609 N N   . GLN B 1 16  ? 42.698  52.130  32.162 1.00 23.96  ? 507  GLN B N   1 
ATOM   1610 C CA  . GLN B 1 16  ? 41.344  51.959  32.651 1.00 23.30  ? 507  GLN B CA  1 
ATOM   1611 C C   . GLN B 1 16  ? 40.316  52.000  31.543 1.00 22.19  ? 507  GLN B C   1 
ATOM   1612 O O   . GLN B 1 16  ? 40.503  52.666  30.523 1.00 21.51  ? 507  GLN B O   1 
ATOM   1613 C CB  . GLN B 1 16  ? 40.988  53.073  33.637 1.00 24.76  ? 507  GLN B CB  1 
ATOM   1614 C CG  . GLN B 1 16  ? 41.960  53.284  34.760 1.00 26.69  ? 507  GLN B CG  1 
ATOM   1615 C CD  . GLN B 1 16  ? 41.683  52.403  35.944 1.00 28.89  ? 507  GLN B CD  1 
ATOM   1616 O OE1 . GLN B 1 16  ? 42.478  52.354  36.881 1.00 29.61  ? 507  GLN B OE1 1 
ATOM   1617 N NE2 . GLN B 1 16  ? 40.550  51.700  35.919 1.00 29.74  ? 507  GLN B NE2 1 
ATOM   1618 N N   . VAL B 1 17  ? 39.226  51.278  31.763 1.00 21.09  ? 508  VAL B N   1 
ATOM   1619 C CA  . VAL B 1 17  ? 38.099  51.268  30.848 1.00 22.13  ? 508  VAL B CA  1 
ATOM   1620 C C   . VAL B 1 17  ? 36.865  51.125  31.737 1.00 22.53  ? 508  VAL B C   1 
ATOM   1621 O O   . VAL B 1 17  ? 36.617  50.062  32.308 1.00 22.97  ? 508  VAL B O   1 
ATOM   1622 C CB  . VAL B 1 17  ? 38.160  50.103  29.824 1.00 22.50  ? 508  VAL B CB  1 
ATOM   1623 C CG1 . VAL B 1 17  ? 36.979  50.198  28.875 1.00 19.45  ? 508  VAL B CG1 1 
ATOM   1624 C CG2 . VAL B 1 17  ? 39.453  50.160  29.031 1.00 19.16  ? 508  VAL B CG2 1 
ATOM   1625 N N   . GLU B 1 18  ? 36.123  52.218  31.891 1.00 22.87  ? 509  GLU B N   1 
ATOM   1626 C CA  . GLU B 1 18  ? 34.908  52.215  32.704 1.00 23.63  ? 509  GLU B CA  1 
ATOM   1627 C C   . GLU B 1 18  ? 33.716  52.018  31.786 1.00 22.74  ? 509  GLU B C   1 
ATOM   1628 O O   . GLU B 1 18  ? 33.362  52.901  31.019 1.00 25.39  ? 509  GLU B O   1 
ATOM   1629 C CB  . GLU B 1 18  ? 34.764  53.533  33.474 1.00 22.80  ? 509  GLU B CB  1 
ATOM   1630 C CG  . GLU B 1 18  ? 33.475  53.665  34.263 1.00 24.79  ? 509  GLU B CG  1 
ATOM   1631 C CD  . GLU B 1 18  ? 33.199  52.469  35.178 1.00 26.41  ? 509  GLU B CD  1 
ATOM   1632 O OE1 . GLU B 1 18  ? 34.021  51.531  35.223 1.00 26.25  ? 509  GLU B OE1 1 
ATOM   1633 O OE2 . GLU B 1 18  ? 32.149  52.462  35.855 1.00 26.13  ? 509  GLU B OE2 1 
ATOM   1634 N N   . PRO B 1 19  ? 33.069  50.853  31.857 1.00 22.30  ? 510  PRO B N   1 
ATOM   1635 C CA  . PRO B 1 19  ? 31.932  50.679  30.957 1.00 21.47  ? 510  PRO B CA  1 
ATOM   1636 C C   . PRO B 1 19  ? 30.569  51.065  31.516 1.00 20.29  ? 510  PRO B C   1 
ATOM   1637 O O   . PRO B 1 19  ? 30.228  50.758  32.662 1.00 19.13  ? 510  PRO B O   1 
ATOM   1638 C CB  . PRO B 1 19  ? 32.009  49.193  30.610 1.00 20.55  ? 510  PRO B CB  1 
ATOM   1639 C CG  . PRO B 1 19  ? 32.398  48.588  31.931 1.00 20.98  ? 510  PRO B CG  1 
ATOM   1640 C CD  . PRO B 1 19  ? 33.437  49.578  32.504 1.00 21.69  ? 510  PRO B CD  1 
ATOM   1641 N N   . TYR B 1 20  ? 29.795  51.736  30.676 1.00 19.91  ? 511  TYR B N   1 
ATOM   1642 C CA  . TYR B 1 20  ? 28.443  52.126  31.010 1.00 21.52  ? 511  TYR B CA  1 
ATOM   1643 C C   . TYR B 1 20  ? 27.527  51.304  30.096 1.00 23.79  ? 511  TYR B C   1 
ATOM   1644 O O   . TYR B 1 20  ? 27.877  50.179  29.735 1.00 25.07  ? 511  TYR B O   1 
ATOM   1645 C CB  . TYR B 1 20  ? 28.278  53.626  30.800 1.00 22.82  ? 511  TYR B CB  1 
ATOM   1646 C CG  . TYR B 1 20  ? 29.092  54.416  31.795 1.00 24.77  ? 511  TYR B CG  1 
ATOM   1647 C CD1 . TYR B 1 20  ? 30.082  55.307  31.380 1.00 24.56  ? 511  TYR B CD1 1 
ATOM   1648 C CD2 . TYR B 1 20  ? 28.909  54.230  33.164 1.00 25.17  ? 511  TYR B CD2 1 
ATOM   1649 C CE1 . TYR B 1 20  ? 30.866  55.985  32.304 1.00 23.90  ? 511  TYR B CE1 1 
ATOM   1650 C CE2 . TYR B 1 20  ? 29.685  54.902  34.087 1.00 26.38  ? 511  TYR B CE2 1 
ATOM   1651 C CZ  . TYR B 1 20  ? 30.659  55.773  33.651 1.00 25.96  ? 511  TYR B CZ  1 
ATOM   1652 O OH  . TYR B 1 20  ? 31.419  56.425  34.581 1.00 30.10  ? 511  TYR B OH  1 
ATOM   1653 N N   . SER B 1 21  ? 26.375  51.838  29.705 1.00 25.49  ? 512  SER B N   1 
ATOM   1654 C CA  . SER B 1 21  ? 25.467  51.077  28.852 1.00 26.03  ? 512  SER B CA  1 
ATOM   1655 C C   . SER B 1 21  ? 25.735  51.240  27.370 1.00 26.71  ? 512  SER B C   1 
ATOM   1656 O O   . SER B 1 21  ? 25.742  50.261  26.636 1.00 29.73  ? 512  SER B O   1 
ATOM   1657 C CB  . SER B 1 21  ? 24.019  51.448  29.153 1.00 27.03  ? 512  SER B CB  1 
ATOM   1658 O OG  . SER B 1 21  ? 23.686  51.087  30.480 1.00 29.39  ? 512  SER B OG  1 
ATOM   1659 N N   . SER B 1 22  ? 25.955  52.471  26.928 1.00 26.43  ? 513  SER B N   1 
ATOM   1660 C CA  . SER B 1 22  ? 26.227  52.737  25.520 1.00 25.29  ? 513  SER B CA  1 
ATOM   1661 C C   . SER B 1 22  ? 27.521  53.541  25.330 1.00 25.70  ? 513  SER B C   1 
ATOM   1662 O O   . SER B 1 22  ? 27.860  53.934  24.215 1.00 26.49  ? 513  SER B O   1 
ATOM   1663 C CB  . SER B 1 22  ? 25.066  53.499  24.910 1.00 25.76  ? 513  SER B CB  1 
ATOM   1664 O OG  . SER B 1 22  ? 24.877  54.725  25.600 1.00 29.28  ? 513  SER B OG  1 
ATOM   1665 N N   . THR B 1 23  ? 28.223  53.809  26.423 1.00 24.21  ? 514  THR B N   1 
ATOM   1666 C CA  . THR B 1 23  ? 29.481  54.531  26.355 1.00 24.90  ? 514  THR B CA  1 
ATOM   1667 C C   . THR B 1 23  ? 30.462  53.842  27.282 1.00 26.01  ? 514  THR B C   1 
ATOM   1668 O O   . THR B 1 23  ? 30.077  53.007  28.100 1.00 26.08  ? 514  THR B O   1 
ATOM   1669 C CB  . THR B 1 23  ? 29.359  56.014  26.793 1.00 24.98  ? 514  THR B CB  1 
ATOM   1670 O OG1 . THR B 1 23  ? 29.075  56.092  28.196 1.00 23.91  ? 514  THR B OG1 1 
ATOM   1671 C CG2 . THR B 1 23  ? 28.268  56.706  26.015 1.00 24.78  ? 514  THR B CG2 1 
ATOM   1672 N N   . ALA B 1 24  ? 31.736  54.188  27.133 1.00 26.87  ? 515  ALA B N   1 
ATOM   1673 C CA  . ALA B 1 24  ? 32.805  53.631  27.953 1.00 25.44  ? 515  ALA B CA  1 
ATOM   1674 C C   . ALA B 1 24  ? 33.888  54.694  28.058 1.00 25.23  ? 515  ALA B C   1 
ATOM   1675 O O   . ALA B 1 24  ? 34.230  55.340  27.065 1.00 26.87  ? 515  ALA B O   1 
ATOM   1676 C CB  . ALA B 1 24  ? 33.366  52.363  27.295 1.00 23.63  ? 515  ALA B CB  1 
ATOM   1677 N N   . GLN B 1 25  ? 34.408  54.901  29.258 1.00 24.90  ? 516  GLN B N   1 
ATOM   1678 C CA  . GLN B 1 25  ? 35.467  55.881  29.445 1.00 25.35  ? 516  GLN B CA  1 
ATOM   1679 C C   . GLN B 1 25  ? 36.786  55.153  29.465 1.00 26.20  ? 516  GLN B C   1 
ATOM   1680 O O   . GLN B 1 25  ? 37.008  54.311  30.330 1.00 25.78  ? 516  GLN B O   1 
ATOM   1681 C CB  . GLN B 1 25  ? 35.294  56.649  30.755 1.00 23.69  ? 516  GLN B CB  1 
ATOM   1682 C CG  . GLN B 1 25  ? 34.002  57.436  30.814 1.00 25.37  ? 516  GLN B CG  1 
ATOM   1683 C CD  . GLN B 1 25  ? 33.936  58.354  32.006 1.00 25.88  ? 516  GLN B CD  1 
ATOM   1684 O OE1 . GLN B 1 25  ? 34.523  58.077  33.056 1.00 26.74  ? 516  GLN B OE1 1 
ATOM   1685 N NE2 . GLN B 1 25  ? 33.207  59.453  31.860 1.00 23.36  ? 516  GLN B NE2 1 
ATOM   1686 N N   . VAL B 1 26  ? 37.650  55.473  28.504 1.00 26.69  ? 517  VAL B N   1 
ATOM   1687 C CA  . VAL B 1 26  ? 38.963  54.851  28.420 1.00 28.41  ? 517  VAL B CA  1 
ATOM   1688 C C   . VAL B 1 26  ? 40.013  55.807  28.978 1.00 30.32  ? 517  VAL B C   1 
ATOM   1689 O O   . VAL B 1 26  ? 40.040  56.990  28.623 1.00 30.35  ? 517  VAL B O   1 
ATOM   1690 C CB  . VAL B 1 26  ? 39.352  54.502  26.942 1.00 28.79  ? 517  VAL B CB  1 
ATOM   1691 C CG1 . VAL B 1 26  ? 40.750  53.906  26.893 1.00 27.91  ? 517  VAL B CG1 1 
ATOM   1692 C CG2 . VAL B 1 26  ? 38.361  53.524  26.338 1.00 27.14  ? 517  VAL B CG2 1 
ATOM   1693 N N   . GLN B 1 27  ? 40.863  55.284  29.861 1.00 31.51  ? 518  GLN B N   1 
ATOM   1694 C CA  . GLN B 1 27  ? 41.955  56.049  30.459 1.00 31.91  ? 518  GLN B CA  1 
ATOM   1695 C C   . GLN B 1 27  ? 43.247  55.423  29.919 1.00 32.98  ? 518  GLN B C   1 
ATOM   1696 O O   . GLN B 1 27  ? 43.290  54.220  29.663 1.00 33.13  ? 518  GLN B O   1 
ATOM   1697 C CB  . GLN B 1 27  ? 41.923  55.927  31.974 1.00 32.34  ? 518  GLN B CB  1 
ATOM   1698 C CG  . GLN B 1 27  ? 42.009  57.244  32.701 1.00 35.86  ? 518  GLN B CG  1 
ATOM   1699 C CD  . GLN B 1 27  ? 42.290  57.060  34.177 1.00 38.42  ? 518  GLN B CD  1 
ATOM   1700 O OE1 . GLN B 1 27  ? 43.391  56.662  34.561 1.00 38.18  ? 518  GLN B OE1 1 
ATOM   1701 N NE2 . GLN B 1 27  ? 41.292  57.337  35.016 1.00 39.64  ? 518  GLN B NE2 1 
ATOM   1702 N N   . PHE B 1 28  ? 44.304  56.215  29.761 1.00 33.35  ? 519  PHE B N   1 
ATOM   1703 C CA  . PHE B 1 28  ? 45.539  55.673  29.210 1.00 33.34  ? 519  PHE B CA  1 
ATOM   1704 C C   . PHE B 1 28  ? 46.766  56.541  29.422 1.00 33.50  ? 519  PHE B C   1 
ATOM   1705 O O   . PHE B 1 28  ? 46.684  57.662  29.900 1.00 33.17  ? 519  PHE B O   1 
ATOM   1706 C CB  . PHE B 1 28  ? 45.364  55.454  27.705 1.00 32.59  ? 519  PHE B CB  1 
ATOM   1707 C CG  . PHE B 1 28  ? 45.085  56.726  26.938 1.00 32.99  ? 519  PHE B CG  1 
ATOM   1708 C CD1 . PHE B 1 28  ? 46.118  57.423  26.313 1.00 32.79  ? 519  PHE B CD1 1 
ATOM   1709 C CD2 . PHE B 1 28  ? 43.793  57.249  26.876 1.00 33.85  ? 519  PHE B CD2 1 
ATOM   1710 C CE1 . PHE B 1 28  ? 45.875  58.622  25.639 1.00 33.28  ? 519  PHE B CE1 1 
ATOM   1711 C CE2 . PHE B 1 28  ? 43.533  58.455  26.200 1.00 34.48  ? 519  PHE B CE2 1 
ATOM   1712 C CZ  . PHE B 1 28  ? 44.580  59.142  25.582 1.00 34.76  ? 519  PHE B CZ  1 
ATOM   1713 N N   . ASP B 1 29  ? 47.913  55.987  29.060 1.00 34.98  ? 520  ASP B N   1 
ATOM   1714 C CA  . ASP B 1 29  ? 49.171  56.697  29.136 1.00 37.19  ? 520  ASP B CA  1 
ATOM   1715 C C   . ASP B 1 29  ? 49.555  56.962  27.682 1.00 37.46  ? 520  ASP B C   1 
ATOM   1716 O O   . ASP B 1 29  ? 49.421  56.078  26.831 1.00 36.48  ? 520  ASP B O   1 
ATOM   1717 C CB  . ASP B 1 29  ? 50.254  55.842  29.802 1.00 39.32  ? 520  ASP B CB  1 
ATOM   1718 C CG  . ASP B 1 29  ? 50.120  55.795  31.301 1.00 41.89  ? 520  ASP B CG  1 
ATOM   1719 O OD1 . ASP B 1 29  ? 49.749  56.827  31.888 1.00 44.22  ? 520  ASP B OD1 1 
ATOM   1720 O OD2 . ASP B 1 29  ? 50.406  54.736  31.899 1.00 44.92  ? 520  ASP B OD2 1 
ATOM   1721 N N   . GLU B 1 30  ? 50.006  58.178  27.396 1.00 37.58  ? 521  GLU B N   1 
ATOM   1722 C CA  . GLU B 1 30  ? 50.421  58.537  26.050 1.00 37.95  ? 521  GLU B CA  1 
ATOM   1723 C C   . GLU B 1 30  ? 51.813  57.987  25.817 1.00 37.38  ? 521  GLU B C   1 
ATOM   1724 O O   . GLU B 1 30  ? 52.551  57.716  26.765 1.00 35.18  ? 521  GLU B O   1 
ATOM   1725 C CB  . GLU B 1 30  ? 50.507  60.047  25.879 1.00 40.08  ? 521  GLU B CB  1 
ATOM   1726 C CG  . GLU B 1 30  ? 49.239  60.811  26.076 1.00 45.52  ? 521  GLU B CG  1 
ATOM   1727 C CD  . GLU B 1 30  ? 49.478  62.298  25.955 1.00 48.82  ? 521  GLU B CD  1 
ATOM   1728 O OE1 . GLU B 1 30  ? 49.875  62.758  24.859 1.00 51.18  ? 521  GLU B OE1 1 
ATOM   1729 O OE2 . GLU B 1 30  ? 49.281  63.006  26.963 1.00 52.55  ? 521  GLU B OE2 1 
ATOM   1730 N N   . PRO B 1 31  ? 52.195  57.825  24.541 1.00 37.51  ? 522  PRO B N   1 
ATOM   1731 C CA  . PRO B 1 31  ? 53.525  57.312  24.216 1.00 37.50  ? 522  PRO B CA  1 
ATOM   1732 C C   . PRO B 1 31  ? 54.503  58.482  24.275 1.00 37.97  ? 522  PRO B C   1 
ATOM   1733 O O   . PRO B 1 31  ? 54.106  59.636  24.482 1.00 37.83  ? 522  PRO B O   1 
ATOM   1734 C CB  . PRO B 1 31  ? 53.371  56.796  22.780 1.00 35.99  ? 522  PRO B CB  1 
ATOM   1735 C CG  . PRO B 1 31  ? 51.891  56.834  22.503 1.00 37.48  ? 522  PRO B CG  1 
ATOM   1736 C CD  . PRO B 1 31  ? 51.384  57.966  23.325 1.00 36.71  ? 522  PRO B CD  1 
ATOM   1737 N N   . GLU B 1 32  ? 55.780  58.181  24.087 1.00 38.41  ? 523  GLU B N   1 
ATOM   1738 C CA  . GLU B 1 32  ? 56.797  59.214  24.076 1.00 39.83  ? 523  GLU B CA  1 
ATOM   1739 C C   . GLU B 1 32  ? 56.616  59.939  22.738 1.00 39.44  ? 523  GLU B C   1 
ATOM   1740 O O   . GLU B 1 32  ? 56.276  59.313  21.737 1.00 39.14  ? 523  GLU B O   1 
ATOM   1741 C CB  . GLU B 1 32  ? 58.179  58.567  24.174 1.00 41.10  ? 523  GLU B CB  1 
ATOM   1742 C CG  . GLU B 1 32  ? 59.323  59.534  24.348 1.00 44.91  ? 523  GLU B CG  1 
ATOM   1743 C CD  . GLU B 1 32  ? 60.629  58.836  24.692 1.00 46.21  ? 523  GLU B CD  1 
ATOM   1744 O OE1 . GLU B 1 32  ? 61.066  57.964  23.906 1.00 47.13  ? 523  GLU B OE1 1 
ATOM   1745 O OE2 . GLU B 1 32  ? 61.218  59.166  25.746 1.00 45.85  ? 523  GLU B OE2 1 
ATOM   1746 N N   . ALA B 1 33  ? 56.797  61.256  22.726 1.00 40.29  ? 524  ALA B N   1 
ATOM   1747 C CA  . ALA B 1 33  ? 56.652  62.026  21.487 1.00 41.07  ? 524  ALA B CA  1 
ATOM   1748 C C   . ALA B 1 33  ? 57.994  62.005  20.744 1.00 42.00  ? 524  ALA B C   1 
ATOM   1749 O O   . ALA B 1 33  ? 58.839  62.889  20.908 1.00 42.52  ? 524  ALA B O   1 
ATOM   1750 C CB  . ALA B 1 33  ? 56.233  63.457  21.799 1.00 38.20  ? 524  ALA B CB  1 
ATOM   1751 N N   . THR B 1 34  ? 58.177  60.977  19.926 1.00 42.34  ? 525  THR B N   1 
ATOM   1752 C CA  . THR B 1 34  ? 59.406  60.789  19.179 1.00 42.73  ? 525  THR B CA  1 
ATOM   1753 C C   . THR B 1 34  ? 59.324  61.357  17.776 1.00 42.75  ? 525  THR B C   1 
ATOM   1754 O O   . THR B 1 34  ? 58.237  61.649  17.275 1.00 43.14  ? 525  THR B O   1 
ATOM   1755 C CB  . THR B 1 34  ? 59.719  59.303  19.063 1.00 44.07  ? 525  THR B CB  1 
ATOM   1756 O OG1 . THR B 1 34  ? 58.551  58.628  18.576 1.00 43.25  ? 525  THR B OG1 1 
ATOM   1757 C CG2 . THR B 1 34  ? 60.128  58.723  20.427 1.00 44.76  ? 525  THR B CG2 1 
ATOM   1758 N N   . GLY B 1 35  ? 60.483  61.507  17.146 1.00 41.59  ? 526  GLY B N   1 
ATOM   1759 C CA  . GLY B 1 35  ? 60.514  62.010  15.789 1.00 41.12  ? 526  GLY B CA  1 
ATOM   1760 C C   . GLY B 1 35  ? 60.565  63.514  15.661 1.00 41.20  ? 526  GLY B C   1 
ATOM   1761 O O   . GLY B 1 35  ? 60.363  64.042  14.569 1.00 42.97  ? 526  GLY B O   1 
ATOM   1762 N N   . GLY B 1 36  ? 60.824  64.203  16.767 1.00 39.76  ? 527  GLY B N   1 
ATOM   1763 C CA  . GLY B 1 36  ? 60.908  65.649  16.742 1.00 37.39  ? 527  GLY B CA  1 
ATOM   1764 C C   . GLY B 1 36  ? 59.598  66.375  16.532 1.00 37.15  ? 527  GLY B C   1 
ATOM   1765 O O   . GLY B 1 36  ? 59.558  67.599  16.574 1.00 38.31  ? 527  GLY B O   1 
ATOM   1766 N N   . VAL B 1 37  ? 58.521  65.636  16.307 1.00 36.80  ? 528  VAL B N   1 
ATOM   1767 C CA  . VAL B 1 37  ? 57.221  66.259  16.083 1.00 36.46  ? 528  VAL B CA  1 
ATOM   1768 C C   . VAL B 1 37  ? 56.242  65.874  17.180 1.00 35.65  ? 528  VAL B C   1 
ATOM   1769 O O   . VAL B 1 37  ? 56.448  64.886  17.881 1.00 37.69  ? 528  VAL B O   1 
ATOM   1770 C CB  . VAL B 1 37  ? 56.642  65.852  14.717 1.00 35.83  ? 528  VAL B CB  1 
ATOM   1771 C CG1 . VAL B 1 37  ? 57.599  66.257  13.621 1.00 35.67  ? 528  VAL B CG1 1 
ATOM   1772 C CG2 . VAL B 1 37  ? 56.402  64.359  14.674 1.00 34.44  ? 528  VAL B CG2 1 
ATOM   1773 N N   . PRO B 1 38  ? 55.160  66.652  17.344 1.00 33.91  ? 529  PRO B N   1 
ATOM   1774 C CA  . PRO B 1 38  ? 54.150  66.383  18.371 1.00 32.70  ? 529  PRO B CA  1 
ATOM   1775 C C   . PRO B 1 38  ? 53.054  65.387  17.991 1.00 31.69  ? 529  PRO B C   1 
ATOM   1776 O O   . PRO B 1 38  ? 52.793  65.139  16.821 1.00 32.30  ? 529  PRO B O   1 
ATOM   1777 C CB  . PRO B 1 38  ? 53.583  67.769  18.644 1.00 30.33  ? 529  PRO B CB  1 
ATOM   1778 C CG  . PRO B 1 38  ? 53.556  68.353  17.293 1.00 33.03  ? 529  PRO B CG  1 
ATOM   1779 C CD  . PRO B 1 38  ? 54.914  67.962  16.714 1.00 32.78  ? 529  PRO B CD  1 
ATOM   1780 N N   . ILE B 1 39  ? 52.411  64.824  19.006 1.00 32.03  ? 530  ILE B N   1 
ATOM   1781 C CA  . ILE B 1 39  ? 51.316  63.889  18.798 1.00 32.16  ? 530  ILE B CA  1 
ATOM   1782 C C   . ILE B 1 39  ? 50.066  64.739  18.536 1.00 34.34  ? 530  ILE B C   1 
ATOM   1783 O O   . ILE B 1 39  ? 49.725  65.613  19.331 1.00 36.42  ? 530  ILE B O   1 
ATOM   1784 C CB  . ILE B 1 39  ? 51.147  63.008  20.045 1.00 29.24  ? 530  ILE B CB  1 
ATOM   1785 C CG1 . ILE B 1 39  ? 52.486  62.321  20.345 1.00 25.89  ? 530  ILE B CG1 1 
ATOM   1786 C CG2 . ILE B 1 39  ? 50.036  62.004  19.834 1.00 29.12  ? 530  ILE B CG2 1 
ATOM   1787 C CD1 . ILE B 1 39  ? 52.458  61.337  21.469 1.00 24.17  ? 530  ILE B CD1 1 
ATOM   1788 N N   . LEU B 1 40  ? 49.392  64.493  17.416 1.00 35.42  ? 531  LEU B N   1 
ATOM   1789 C CA  . LEU B 1 40  ? 48.220  65.282  17.034 1.00 35.79  ? 531  LEU B CA  1 
ATOM   1790 C C   . LEU B 1 40  ? 46.873  64.715  17.453 1.00 37.88  ? 531  LEU B C   1 
ATOM   1791 O O   . LEU B 1 40  ? 46.013  65.436  17.962 1.00 39.49  ? 531  LEU B O   1 
ATOM   1792 C CB  . LEU B 1 40  ? 48.196  65.471  15.513 1.00 33.33  ? 531  LEU B CB  1 
ATOM   1793 C CG  . LEU B 1 40  ? 49.505  65.885  14.834 1.00 33.18  ? 531  LEU B CG  1 
ATOM   1794 C CD1 . LEU B 1 40  ? 49.322  65.919  13.333 1.00 27.66  ? 531  LEU B CD1 1 
ATOM   1795 C CD2 . LEU B 1 40  ? 49.959  67.231  15.372 1.00 30.65  ? 531  LEU B CD2 1 
ATOM   1796 N N   . LYS B 1 41  ? 46.683  63.424  17.213 1.00 38.09  ? 532  LYS B N   1 
ATOM   1797 C CA  . LYS B 1 41  ? 45.422  62.774  17.526 1.00 37.67  ? 532  LYS B CA  1 
ATOM   1798 C C   . LYS B 1 41  ? 45.639  61.375  18.075 1.00 37.05  ? 532  LYS B C   1 
ATOM   1799 O O   . LYS B 1 41  ? 46.743  60.833  18.043 1.00 36.26  ? 532  LYS B O   1 
ATOM   1800 C CB  . LYS B 1 41  ? 44.565  62.653  16.257 1.00 40.52  ? 532  LYS B CB  1 
ATOM   1801 C CG  . LYS B 1 41  ? 44.319  63.938  15.484 1.00 43.33  ? 532  LYS B CG  1 
ATOM   1802 C CD  . LYS B 1 41  ? 43.386  64.874  16.246 1.00 47.13  ? 532  LYS B CD  1 
ATOM   1803 C CE  . LYS B 1 41  ? 43.131  66.177  15.487 1.00 45.88  ? 532  LYS B CE  1 
ATOM   1804 N NZ  . LYS B 1 41  ? 42.212  67.064  16.248 1.00 44.83  ? 532  LYS B NZ  1 
ATOM   1805 N N   . TYR B 1 42  ? 44.555  60.795  18.571 1.00 36.46  ? 533  TYR B N   1 
ATOM   1806 C CA  . TYR B 1 42  ? 44.567  59.439  19.093 1.00 35.45  ? 533  TYR B CA  1 
ATOM   1807 C C   . TYR B 1 42  ? 43.464  58.706  18.366 1.00 35.44  ? 533  TYR B C   1 
ATOM   1808 O O   . TYR B 1 42  ? 42.384  59.263  18.140 1.00 36.53  ? 533  TYR B O   1 
ATOM   1809 C CB  . TYR B 1 42  ? 44.310  59.433  20.596 1.00 33.03  ? 533  TYR B CB  1 
ATOM   1810 C CG  . TYR B 1 42  ? 45.524  59.825  21.379 1.00 32.16  ? 533  TYR B CG  1 
ATOM   1811 C CD1 . TYR B 1 42  ? 46.635  58.986  21.427 1.00 31.50  ? 533  TYR B CD1 1 
ATOM   1812 C CD2 . TYR B 1 42  ? 45.597  61.057  22.023 1.00 32.10  ? 533  TYR B CD2 1 
ATOM   1813 C CE1 . TYR B 1 42  ? 47.792  59.363  22.092 1.00 32.01  ? 533  TYR B CE1 1 
ATOM   1814 C CE2 . TYR B 1 42  ? 46.751  61.448  22.690 1.00 32.74  ? 533  TYR B CE2 1 
ATOM   1815 C CZ  . TYR B 1 42  ? 47.846  60.597  22.715 1.00 33.57  ? 533  TYR B CZ  1 
ATOM   1816 O OH  . TYR B 1 42  ? 49.010  60.993  23.324 1.00 36.93  ? 533  TYR B OH  1 
ATOM   1817 N N   . LYS B 1 43  ? 43.745  57.473  17.968 1.00 34.23  ? 534  LYS B N   1 
ATOM   1818 C CA  . LYS B 1 43  ? 42.751  56.676  17.266 1.00 35.31  ? 534  LYS B CA  1 
ATOM   1819 C C   . LYS B 1 43  ? 42.208  55.576  18.186 1.00 35.02  ? 534  LYS B C   1 
ATOM   1820 O O   . LYS B 1 43  ? 42.958  54.725  18.673 1.00 33.03  ? 534  LYS B O   1 
ATOM   1821 C CB  . LYS B 1 43  ? 43.371  56.062  16.006 1.00 36.14  ? 534  LYS B CB  1 
ATOM   1822 C CG  . LYS B 1 43  ? 42.396  55.337  15.096 1.00 35.88  ? 534  LYS B CG  1 
ATOM   1823 C CD  . LYS B 1 43  ? 43.111  54.887  13.830 1.00 39.65  ? 534  LYS B CD  1 
ATOM   1824 C CE  . LYS B 1 43  ? 42.183  54.141  12.896 1.00 39.48  ? 534  LYS B CE  1 
ATOM   1825 N NZ  . LYS B 1 43  ? 41.016  54.989  12.550 1.00 42.31  ? 534  LYS B NZ  1 
ATOM   1826 N N   . ALA B 1 44  ? 40.902  55.621  18.435 1.00 34.71  ? 535  ALA B N   1 
ATOM   1827 C CA  . ALA B 1 44  ? 40.247  54.632  19.274 1.00 33.93  ? 535  ALA B CA  1 
ATOM   1828 C C   . ALA B 1 44  ? 39.492  53.662  18.380 1.00 35.19  ? 535  ALA B C   1 
ATOM   1829 O O   . ALA B 1 44  ? 38.676  54.068  17.545 1.00 35.15  ? 535  ALA B O   1 
ATOM   1830 C CB  . ALA B 1 44  ? 39.290  55.306  20.230 1.00 30.95  ? 535  ALA B CB  1 
ATOM   1831 N N   . GLU B 1 45  ? 39.781  52.379  18.556 1.00 36.24  ? 536  GLU B N   1 
ATOM   1832 C CA  . GLU B 1 45  ? 39.136  51.322  17.787 1.00 37.33  ? 536  GLU B CA  1 
ATOM   1833 C C   . GLU B 1 45  ? 38.440  50.341  18.723 1.00 36.65  ? 536  GLU B C   1 
ATOM   1834 O O   . GLU B 1 45  ? 39.019  49.912  19.724 1.00 36.18  ? 536  GLU B O   1 
ATOM   1835 C CB  . GLU B 1 45  ? 40.166  50.552  16.972 1.00 38.46  ? 536  GLU B CB  1 
ATOM   1836 C CG  . GLU B 1 45  ? 40.803  51.317  15.852 1.00 42.56  ? 536  GLU B CG  1 
ATOM   1837 C CD  . GLU B 1 45  ? 41.946  50.541  15.234 1.00 44.94  ? 536  GLU B CD  1 
ATOM   1838 O OE1 . GLU B 1 45  ? 42.427  50.951  14.162 1.00 47.46  ? 536  GLU B OE1 1 
ATOM   1839 O OE2 . GLU B 1 45  ? 42.367  49.523  15.827 1.00 45.13  ? 536  GLU B OE2 1 
ATOM   1840 N N   . TRP B 1 46  ? 37.205  49.983  18.388 1.00 35.74  ? 537  TRP B N   1 
ATOM   1841 C CA  . TRP B 1 46  ? 36.444  49.032  19.193 1.00 35.97  ? 537  TRP B CA  1 
ATOM   1842 C C   . TRP B 1 46  ? 35.632  48.128  18.286 1.00 34.89  ? 537  TRP B C   1 
ATOM   1843 O O   . TRP B 1 46  ? 35.199  48.529  17.209 1.00 33.70  ? 537  TRP B O   1 
ATOM   1844 C CB  . TRP B 1 46  ? 35.520  49.754  20.187 1.00 34.38  ? 537  TRP B CB  1 
ATOM   1845 C CG  . TRP B 1 46  ? 34.455  50.598  19.559 1.00 33.83  ? 537  TRP B CG  1 
ATOM   1846 C CD1 . TRP B 1 46  ? 33.150  50.259  19.360 1.00 33.70  ? 537  TRP B CD1 1 
ATOM   1847 C CD2 . TRP B 1 46  ? 34.604  51.933  19.063 1.00 35.51  ? 537  TRP B CD2 1 
ATOM   1848 N NE1 . TRP B 1 46  ? 32.470  51.301  18.774 1.00 34.02  ? 537  TRP B NE1 1 
ATOM   1849 C CE2 . TRP B 1 46  ? 33.340  52.343  18.581 1.00 36.08  ? 537  TRP B CE2 1 
ATOM   1850 C CE3 . TRP B 1 46  ? 35.685  52.826  18.980 1.00 34.86  ? 537  TRP B CE3 1 
ATOM   1851 C CZ2 . TRP B 1 46  ? 33.126  53.611  18.024 1.00 35.44  ? 537  TRP B CZ2 1 
ATOM   1852 C CZ3 . TRP B 1 46  ? 35.474  54.081  18.427 1.00 34.12  ? 537  TRP B CZ3 1 
ATOM   1853 C CH2 . TRP B 1 46  ? 34.202  54.462  17.956 1.00 34.65  ? 537  TRP B CH2 1 
ATOM   1854 N N   . ARG B 1 47  ? 35.433  46.900  18.736 1.00 34.20  ? 538  ARG B N   1 
ATOM   1855 C CA  . ARG B 1 47  ? 34.688  45.923  17.966 1.00 33.36  ? 538  ARG B CA  1 
ATOM   1856 C C   . ARG B 1 47  ? 34.000  44.975  18.932 1.00 32.14  ? 538  ARG B C   1 
ATOM   1857 O O   . ARG B 1 47  ? 34.627  44.464  19.856 1.00 33.62  ? 538  ARG B O   1 
ATOM   1858 C CB  . ARG B 1 47  ? 35.657  45.156  17.073 1.00 35.49  ? 538  ARG B CB  1 
ATOM   1859 C CG  . ARG B 1 47  ? 35.027  44.148  16.148 1.00 38.47  ? 538  ARG B CG  1 
ATOM   1860 C CD  . ARG B 1 47  ? 36.093  43.507  15.272 1.00 40.17  ? 538  ARG B CD  1 
ATOM   1861 N NE  . ARG B 1 47  ? 37.072  42.757  16.054 1.00 41.05  ? 538  ARG B NE  1 
ATOM   1862 C CZ  . ARG B 1 47  ? 38.147  42.175  15.534 1.00 40.67  ? 538  ARG B CZ  1 
ATOM   1863 N NH1 . ARG B 1 47  ? 38.378  42.266  14.235 1.00 41.95  ? 538  ARG B NH1 1 
ATOM   1864 N NH2 . ARG B 1 47  ? 38.986  41.496  16.303 1.00 38.38  ? 538  ARG B NH2 1 
ATOM   1865 N N   . ALA B 1 48  ? 32.705  44.763  18.751 1.00 30.87  ? 539  ALA B N   1 
ATOM   1866 C CA  . ALA B 1 48  ? 32.003  43.845  19.626 1.00 30.12  ? 539  ALA B CA  1 
ATOM   1867 C C   . ALA B 1 48  ? 32.711  42.512  19.433 1.00 31.27  ? 539  ALA B C   1 
ATOM   1868 O O   . ALA B 1 48  ? 32.923  42.077  18.302 1.00 29.88  ? 539  ALA B O   1 
ATOM   1869 C CB  . ALA B 1 48  ? 30.553  43.735  19.222 1.00 25.98  ? 539  ALA B CB  1 
ATOM   1870 N N   . VAL B 1 49  ? 33.112  41.881  20.529 1.00 33.97  ? 540  VAL B N   1 
ATOM   1871 C CA  . VAL B 1 49  ? 33.791  40.600  20.430 1.00 36.06  ? 540  VAL B CA  1 
ATOM   1872 C C   . VAL B 1 49  ? 32.932  39.673  19.576 1.00 38.40  ? 540  VAL B C   1 
ATOM   1873 O O   . VAL B 1 49  ? 31.736  39.481  19.842 1.00 37.64  ? 540  VAL B O   1 
ATOM   1874 C CB  . VAL B 1 49  ? 34.000  39.977  21.814 1.00 36.27  ? 540  VAL B CB  1 
ATOM   1875 C CG1 . VAL B 1 49  ? 34.583  38.595  21.668 1.00 37.21  ? 540  VAL B CG1 1 
ATOM   1876 C CG2 . VAL B 1 49  ? 34.930  40.853  22.638 1.00 36.41  ? 540  VAL B CG2 1 
ATOM   1877 N N   . GLY B 1 50  ? 33.538  39.114  18.536 1.00 39.85  ? 541  GLY B N   1 
ATOM   1878 C CA  . GLY B 1 50  ? 32.792  38.234  17.659 1.00 42.60  ? 541  GLY B CA  1 
ATOM   1879 C C   . GLY B 1 50  ? 32.628  38.826  16.272 1.00 44.89  ? 541  GLY B C   1 
ATOM   1880 O O   . GLY B 1 50  ? 32.461  38.085  15.309 1.00 45.13  ? 541  GLY B O   1 
ATOM   1881 N N   . GLU B 1 51  ? 32.658  40.154  16.166 1.00 46.30  ? 542  GLU B N   1 
ATOM   1882 C CA  . GLU B 1 51  ? 32.539  40.810  14.867 1.00 47.74  ? 542  GLU B CA  1 
ATOM   1883 C C   . GLU B 1 51  ? 33.935  40.803  14.269 1.00 48.21  ? 542  GLU B C   1 
ATOM   1884 O O   . GLU B 1 51  ? 34.879  40.343  14.908 1.00 47.69  ? 542  GLU B O   1 
ATOM   1885 C CB  . GLU B 1 51  ? 32.092  42.270  15.007 1.00 49.08  ? 542  GLU B CB  1 
ATOM   1886 C CG  . GLU B 1 51  ? 30.917  42.538  15.931 1.00 51.29  ? 542  GLU B CG  1 
ATOM   1887 C CD  . GLU B 1 51  ? 29.605  42.023  15.398 1.00 52.96  ? 542  GLU B CD  1 
ATOM   1888 O OE1 . GLU B 1 51  ? 28.553  42.388  15.970 1.00 53.41  ? 542  GLU B OE1 1 
ATOM   1889 O OE2 . GLU B 1 51  ? 29.622  41.255  14.416 1.00 53.95  ? 542  GLU B OE2 1 
ATOM   1890 N N   . GLU B 1 52  ? 34.063  41.325  13.052 1.00 50.60  ? 543  GLU B N   1 
ATOM   1891 C CA  . GLU B 1 52  ? 35.356  41.401  12.365 1.00 51.70  ? 543  GLU B CA  1 
ATOM   1892 C C   . GLU B 1 52  ? 35.721  42.853  12.099 1.00 50.21  ? 543  GLU B C   1 
ATOM   1893 O O   . GLU B 1 52  ? 36.863  43.262  12.272 1.00 49.77  ? 543  GLU B O   1 
ATOM   1894 C CB  . GLU B 1 52  ? 35.311  40.676  11.018 1.00 53.98  ? 543  GLU B CB  1 
ATOM   1895 C CG  . GLU B 1 52  ? 35.506  39.174  11.061 1.00 57.90  ? 543  GLU B CG  1 
ATOM   1896 C CD  . GLU B 1 52  ? 35.435  38.554  9.665  1.00 60.80  ? 543  GLU B CD  1 
ATOM   1897 O OE1 . GLU B 1 52  ? 34.350  38.616  9.035  1.00 60.31  ? 543  GLU B OE1 1 
ATOM   1898 O OE2 . GLU B 1 52  ? 36.467  38.017  9.196  1.00 59.44  ? 543  GLU B OE2 1 
ATOM   1899 N N   . VAL B 1 53  ? 34.734  43.624  11.670 1.00 48.22  ? 544  VAL B N   1 
ATOM   1900 C CA  . VAL B 1 53  ? 34.945  45.025  11.353 1.00 48.26  ? 544  VAL B CA  1 
ATOM   1901 C C   . VAL B 1 53  ? 35.078  45.929  12.584 1.00 47.19  ? 544  VAL B C   1 
ATOM   1902 O O   . VAL B 1 53  ? 34.173  45.984  13.421 1.00 47.44  ? 544  VAL B O   1 
ATOM   1903 C CB  . VAL B 1 53  ? 33.788  45.546  10.460 1.00 49.04  ? 544  VAL B CB  1 
ATOM   1904 C CG1 . VAL B 1 53  ? 33.941  47.032  10.208 1.00 50.00  ? 544  VAL B CG1 1 
ATOM   1905 C CG2 . VAL B 1 53  ? 33.778  44.796  9.139  1.00 48.99  ? 544  VAL B CG2 1 
ATOM   1906 N N   . TRP B 1 54  ? 36.203  46.637  12.690 1.00 44.47  ? 545  TRP B N   1 
ATOM   1907 C CA  . TRP B 1 54  ? 36.416  47.556  13.810 1.00 43.77  ? 545  TRP B CA  1 
ATOM   1908 C C   . TRP B 1 54  ? 35.807  48.937  13.533 1.00 43.65  ? 545  TRP B C   1 
ATOM   1909 O O   . TRP B 1 54  ? 35.825  49.416  12.402 1.00 44.56  ? 545  TRP B O   1 
ATOM   1910 C CB  . TRP B 1 54  ? 37.906  47.771  14.090 1.00 42.21  ? 545  TRP B CB  1 
ATOM   1911 C CG  . TRP B 1 54  ? 38.672  46.570  14.508 1.00 40.82  ? 545  TRP B CG  1 
ATOM   1912 C CD1 . TRP B 1 54  ? 39.171  45.595  13.698 1.00 41.30  ? 545  TRP B CD1 1 
ATOM   1913 C CD2 . TRP B 1 54  ? 39.093  46.242  15.838 1.00 39.74  ? 545  TRP B CD2 1 
ATOM   1914 N NE1 . TRP B 1 54  ? 39.885  44.682  14.436 1.00 40.99  ? 545  TRP B NE1 1 
ATOM   1915 C CE2 . TRP B 1 54  ? 39.855  45.056  15.754 1.00 40.10  ? 545  TRP B CE2 1 
ATOM   1916 C CE3 . TRP B 1 54  ? 38.903  46.836  17.091 1.00 37.40  ? 545  TRP B CE3 1 
ATOM   1917 C CZ2 . TRP B 1 54  ? 40.429  44.455  16.875 1.00 37.59  ? 545  TRP B CZ2 1 
ATOM   1918 C CZ3 . TRP B 1 54  ? 39.469  46.238  18.199 1.00 37.06  ? 545  TRP B CZ3 1 
ATOM   1919 C CH2 . TRP B 1 54  ? 40.226  45.057  18.084 1.00 36.95  ? 545  TRP B CH2 1 
ATOM   1920 N N   . HIS B 1 55  ? 35.266  49.568  14.570 1.00 43.08  ? 546  HIS B N   1 
ATOM   1921 C CA  . HIS B 1 55  ? 34.705  50.909  14.454 1.00 42.15  ? 546  HIS B CA  1 
ATOM   1922 C C   . HIS B 1 55  ? 35.845  51.826  14.891 1.00 42.84  ? 546  HIS B C   1 
ATOM   1923 O O   . HIS B 1 55  ? 36.856  51.352  15.417 1.00 45.54  ? 546  HIS B O   1 
ATOM   1924 C CB  . HIS B 1 55  ? 33.539  51.104  15.419 1.00 42.34  ? 546  HIS B CB  1 
ATOM   1925 C CG  . HIS B 1 55  ? 32.366  50.211  15.162 1.00 44.70  ? 546  HIS B CG  1 
ATOM   1926 N ND1 . HIS B 1 55  ? 31.659  50.227  13.979 1.00 45.86  ? 546  HIS B ND1 1 
ATOM   1927 C CD2 . HIS B 1 55  ? 31.735  49.320  15.962 1.00 46.42  ? 546  HIS B CD2 1 
ATOM   1928 C CE1 . HIS B 1 55  ? 30.642  49.389  14.062 1.00 46.06  ? 546  HIS B CE1 1 
ATOM   1929 N NE2 . HIS B 1 55  ? 30.665  48.825  15.255 1.00 47.17  ? 546  HIS B NE2 1 
ATOM   1930 N N   . SER B 1 56  ? 35.708  53.128  14.681 1.00 40.81  ? 547  SER B N   1 
ATOM   1931 C CA  . SER B 1 56  ? 36.757  54.039  15.116 1.00 37.87  ? 547  SER B CA  1 
ATOM   1932 C C   . SER B 1 56  ? 36.310  55.489  15.186 1.00 36.56  ? 547  SER B C   1 
ATOM   1933 O O   . SER B 1 56  ? 35.250  55.866  14.684 1.00 34.75  ? 547  SER B O   1 
ATOM   1934 C CB  . SER B 1 56  ? 37.986  53.912  14.218 1.00 37.66  ? 547  SER B CB  1 
ATOM   1935 O OG  . SER B 1 56  ? 37.683  54.271  12.886 1.00 39.23  ? 547  SER B OG  1 
ATOM   1936 N N   . LYS B 1 57  ? 37.136  56.294  15.838 1.00 36.22  ? 548  LYS B N   1 
ATOM   1937 C CA  . LYS B 1 57  ? 36.868  57.709  16.026 1.00 35.08  ? 548  LYS B CA  1 
ATOM   1938 C C   . LYS B 1 57  ? 38.182  58.370  16.435 1.00 34.39  ? 548  LYS B C   1 
ATOM   1939 O O   . LYS B 1 57  ? 38.984  57.777  17.164 1.00 32.72  ? 548  LYS B O   1 
ATOM   1940 C CB  . LYS B 1 57  ? 35.812  57.895  17.129 1.00 35.49  ? 548  LYS B CB  1 
ATOM   1941 C CG  . LYS B 1 57  ? 35.410  59.348  17.406 1.00 37.22  ? 548  LYS B CG  1 
ATOM   1942 C CD  . LYS B 1 57  ? 34.663  59.954  16.214 1.00 40.72  ? 548  LYS B CD  1 
ATOM   1943 C CE  . LYS B 1 57  ? 34.325  61.417  16.448 1.00 41.79  ? 548  LYS B CE  1 
ATOM   1944 N NZ  . LYS B 1 57  ? 35.564  62.208  16.686 1.00 45.37  ? 548  LYS B NZ  1 
ATOM   1945 N N   . TRP B 1 58  ? 38.408  59.587  15.950 1.00 34.98  ? 549  TRP B N   1 
ATOM   1946 C CA  . TRP B 1 58  ? 39.621  60.314  16.288 1.00 35.83  ? 549  TRP B CA  1 
ATOM   1947 C C   . TRP B 1 58  ? 39.357  61.232  17.465 1.00 36.06  ? 549  TRP B C   1 
ATOM   1948 O O   . TRP B 1 58  ? 38.250  61.744  17.624 1.00 37.40  ? 549  TRP B O   1 
ATOM   1949 C CB  . TRP B 1 58  ? 40.114  61.149  15.105 1.00 36.06  ? 549  TRP B CB  1 
ATOM   1950 C CG  . TRP B 1 58  ? 40.655  60.342  13.963 1.00 36.17  ? 549  TRP B CG  1 
ATOM   1951 C CD1 . TRP B 1 58  ? 39.980  59.945  12.843 1.00 36.55  ? 549  TRP B CD1 1 
ATOM   1952 C CD2 . TRP B 1 58  ? 41.980  59.812  13.841 1.00 35.09  ? 549  TRP B CD2 1 
ATOM   1953 N NE1 . TRP B 1 58  ? 40.805  59.197  12.029 1.00 36.81  ? 549  TRP B NE1 1 
ATOM   1954 C CE2 . TRP B 1 58  ? 42.037  59.101  12.619 1.00 35.60  ? 549  TRP B CE2 1 
ATOM   1955 C CE3 . TRP B 1 58  ? 43.122  59.867  14.644 1.00 34.01  ? 549  TRP B CE3 1 
ATOM   1956 C CZ2 . TRP B 1 58  ? 43.192  58.450  12.184 1.00 34.12  ? 549  TRP B CZ2 1 
ATOM   1957 C CZ3 . TRP B 1 58  ? 44.271  59.221  14.211 1.00 35.03  ? 549  TRP B CZ3 1 
ATOM   1958 C CH2 . TRP B 1 58  ? 44.297  58.521  12.990 1.00 35.17  ? 549  TRP B CH2 1 
ATOM   1959 N N   . TYR B 1 59  ? 40.381  61.439  18.285 1.00 35.95  ? 550  TYR B N   1 
ATOM   1960 C CA  . TYR B 1 59  ? 40.270  62.304  19.451 1.00 34.61  ? 550  TYR B CA  1 
ATOM   1961 C C   . TYR B 1 59  ? 41.427  63.301  19.489 1.00 34.13  ? 550  TYR B C   1 
ATOM   1962 O O   . TYR B 1 59  ? 42.596  62.916  19.481 1.00 34.29  ? 550  TYR B O   1 
ATOM   1963 C CB  . TYR B 1 59  ? 40.269  61.453  20.724 1.00 34.81  ? 550  TYR B CB  1 
ATOM   1964 C CG  . TYR B 1 59  ? 39.062  60.554  20.837 1.00 35.88  ? 550  TYR B CG  1 
ATOM   1965 C CD1 . TYR B 1 59  ? 37.864  61.028  21.376 1.00 35.49  ? 550  TYR B CD1 1 
ATOM   1966 C CD2 . TYR B 1 59  ? 39.105  59.236  20.380 1.00 36.40  ? 550  TYR B CD2 1 
ATOM   1967 C CE1 . TYR B 1 59  ? 36.739  60.213  21.463 1.00 36.24  ? 550  TYR B CE1 1 
ATOM   1968 C CE2 . TYR B 1 59  ? 37.987  58.411  20.459 1.00 37.22  ? 550  TYR B CE2 1 
ATOM   1969 C CZ  . TYR B 1 59  ? 36.808  58.903  21.005 1.00 38.51  ? 550  TYR B CZ  1 
ATOM   1970 O OH  . TYR B 1 59  ? 35.711  58.073  21.132 1.00 40.49  ? 550  TYR B OH  1 
ATOM   1971 N N   . ASP B 1 60  ? 41.103  64.584  19.518 1.00 33.32  ? 551  ASP B N   1 
ATOM   1972 C CA  . ASP B 1 60  ? 42.145  65.590  19.571 1.00 33.99  ? 551  ASP B CA  1 
ATOM   1973 C C   . ASP B 1 60  ? 43.072  65.234  20.721 1.00 33.43  ? 551  ASP B C   1 
ATOM   1974 O O   . ASP B 1 60  ? 42.621  64.976  21.836 1.00 34.84  ? 551  ASP B O   1 
ATOM   1975 C CB  . ASP B 1 60  ? 41.558  66.977  19.810 1.00 34.22  ? 551  ASP B CB  1 
ATOM   1976 C CG  . ASP B 1 60  ? 42.628  68.032  19.909 1.00 37.54  ? 551  ASP B CG  1 
ATOM   1977 O OD1 . ASP B 1 60  ? 43.282  68.296  18.878 1.00 37.95  ? 551  ASP B OD1 1 
ATOM   1978 O OD2 . ASP B 1 60  ? 42.835  68.581  21.014 1.00 39.78  ? 551  ASP B OD2 1 
ATOM   1979 N N   . ALA B 1 61  ? 44.370  65.228  20.457 1.00 33.59  ? 552  ALA B N   1 
ATOM   1980 C CA  . ALA B 1 61  ? 45.341  64.875  21.481 1.00 33.61  ? 552  ALA B CA  1 
ATOM   1981 C C   . ALA B 1 61  ? 45.385  65.865  22.633 1.00 34.67  ? 552  ALA B C   1 
ATOM   1982 O O   . ALA B 1 61  ? 45.436  65.471  23.799 1.00 35.04  ? 552  ALA B O   1 
ATOM   1983 C CB  . ALA B 1 61  ? 46.720  64.743  20.860 1.00 32.04  ? 552  ALA B CB  1 
ATOM   1984 N N   . LYS B 1 62  ? 45.360  67.152  22.316 1.00 36.14  ? 553  LYS B N   1 
ATOM   1985 C CA  . LYS B 1 62  ? 45.430  68.169  23.354 1.00 38.13  ? 553  LYS B CA  1 
ATOM   1986 C C   . LYS B 1 62  ? 44.267  68.072  24.337 1.00 37.75  ? 553  LYS B C   1 
ATOM   1987 O O   . LYS B 1 62  ? 44.477  68.050  25.550 1.00 36.94  ? 553  LYS B O   1 
ATOM   1988 C CB  . LYS B 1 62  ? 45.469  69.559  22.718 1.00 41.76  ? 553  LYS B CB  1 
ATOM   1989 C CG  . LYS B 1 62  ? 46.070  70.633  23.622 1.00 45.58  ? 553  LYS B CG  1 
ATOM   1990 C CD  . LYS B 1 62  ? 46.324  71.927  22.851 1.00 49.57  ? 553  LYS B CD  1 
ATOM   1991 C CE  . LYS B 1 62  ? 47.105  71.682  21.549 1.00 51.01  ? 553  LYS B CE  1 
ATOM   1992 N NZ  . LYS B 1 62  ? 48.431  71.022  21.760 1.00 51.54  ? 553  LYS B NZ  1 
ATOM   1993 N N   . GLU B 1 63  ? 43.048  68.008  23.801 1.00 36.57  ? 554  GLU B N   1 
ATOM   1994 C CA  . GLU B 1 63  ? 41.830  67.909  24.602 1.00 35.20  ? 554  GLU B CA  1 
ATOM   1995 C C   . GLU B 1 63  ? 41.862  66.643  25.447 1.00 35.61  ? 554  GLU B C   1 
ATOM   1996 O O   . GLU B 1 63  ? 41.565  66.677  26.642 1.00 36.20  ? 554  GLU B O   1 
ATOM   1997 C CB  . GLU B 1 63  ? 40.612  67.904  23.682 1.00 34.11  ? 554  GLU B CB  1 
ATOM   1998 C CG  . GLU B 1 63  ? 39.266  67.815  24.366 1.00 34.75  ? 554  GLU B CG  1 
ATOM   1999 C CD  . GLU B 1 63  ? 38.123  68.230  23.435 1.00 37.06  ? 554  GLU B CD  1 
ATOM   2000 O OE1 . GLU B 1 63  ? 37.055  67.572  23.455 1.00 34.22  ? 554  GLU B OE1 1 
ATOM   2001 O OE2 . GLU B 1 63  ? 38.295  69.227  22.690 1.00 36.84  ? 554  GLU B OE2 1 
ATOM   2002 N N   . ALA B 1 64  ? 42.235  65.528  24.825 1.00 33.73  ? 555  ALA B N   1 
ATOM   2003 C CA  . ALA B 1 64  ? 42.321  64.264  25.542 1.00 32.98  ? 555  ALA B CA  1 
ATOM   2004 C C   . ALA B 1 64  ? 43.284  64.380  26.724 1.00 32.73  ? 555  ALA B C   1 
ATOM   2005 O O   . ALA B 1 64  ? 42.979  63.946  27.833 1.00 32.70  ? 555  ALA B O   1 
ATOM   2006 C CB  . ALA B 1 64  ? 42.781  63.156  24.592 1.00 30.95  ? 555  ALA B CB  1 
ATOM   2007 N N   . SER B 1 65  ? 44.441  64.981  26.480 1.00 32.31  ? 556  SER B N   1 
ATOM   2008 C CA  . SER B 1 65  ? 45.459  65.143  27.508 1.00 33.51  ? 556  SER B CA  1 
ATOM   2009 C C   . SER B 1 65  ? 45.014  65.965  28.710 1.00 33.26  ? 556  SER B C   1 
ATOM   2010 O O   . SER B 1 65  ? 45.483  65.750  29.828 1.00 32.12  ? 556  SER B O   1 
ATOM   2011 C CB  . SER B 1 65  ? 46.702  65.767  26.892 1.00 35.28  ? 556  SER B CB  1 
ATOM   2012 O OG  . SER B 1 65  ? 47.086  65.047  25.731 1.00 38.82  ? 556  SER B OG  1 
ATOM   2013 N N   . MET B 1 66  ? 44.110  66.907  28.486 1.00 33.84  ? 557  MET B N   1 
ATOM   2014 C CA  . MET B 1 66  ? 43.622  67.738  29.577 1.00 34.56  ? 557  MET B CA  1 
ATOM   2015 C C   . MET B 1 66  ? 42.445  67.033  30.256 1.00 32.54  ? 557  MET B C   1 
ATOM   2016 O O   . MET B 1 66  ? 42.219  67.189  31.443 1.00 30.89  ? 557  MET B O   1 
ATOM   2017 C CB  . MET B 1 66  ? 43.194  69.109  29.042 1.00 38.14  ? 557  MET B CB  1 
ATOM   2018 C CG  . MET B 1 66  ? 43.225  70.219  30.086 1.00 43.84  ? 557  MET B CG  1 
ATOM   2019 S SD  . MET B 1 66  ? 44.909  70.664  30.619 1.00 49.64  ? 557  MET B SD  1 
ATOM   2020 C CE  . MET B 1 66  ? 44.682  72.399  31.076 1.00 45.87  ? 557  MET B CE  1 
ATOM   2021 N N   . GLU B 1 67  ? 41.707  66.246  29.487 1.00 32.77  ? 558  GLU B N   1 
ATOM   2022 C CA  . GLU B 1 67  ? 40.569  65.509  30.006 1.00 32.99  ? 558  GLU B CA  1 
ATOM   2023 C C   . GLU B 1 67  ? 40.994  64.311  30.840 1.00 32.03  ? 558  GLU B C   1 
ATOM   2024 O O   . GLU B 1 67  ? 40.485  64.095  31.945 1.00 32.32  ? 558  GLU B O   1 
ATOM   2025 C CB  . GLU B 1 67  ? 39.685  65.036  28.855 1.00 35.89  ? 558  GLU B CB  1 
ATOM   2026 C CG  . GLU B 1 67  ? 38.716  66.093  28.367 1.00 42.59  ? 558  GLU B CG  1 
ATOM   2027 C CD  . GLU B 1 67  ? 37.566  66.330  29.343 1.00 46.41  ? 558  GLU B CD  1 
ATOM   2028 O OE1 . GLU B 1 67  ? 36.719  65.410  29.502 1.00 45.41  ? 558  GLU B OE1 1 
ATOM   2029 O OE2 . GLU B 1 67  ? 37.519  67.431  29.945 1.00 45.53  ? 558  GLU B OE2 1 
ATOM   2030 N N   . GLY B 1 68  ? 41.928  63.531  30.310 1.00 30.29  ? 559  GLY B N   1 
ATOM   2031 C CA  . GLY B 1 68  ? 42.390  62.356  31.025 1.00 28.27  ? 559  GLY B CA  1 
ATOM   2032 C C   . GLY B 1 68  ? 41.725  61.100  30.503 1.00 26.69  ? 559  GLY B C   1 
ATOM   2033 O O   . GLY B 1 68  ? 42.068  59.990  30.899 1.00 27.47  ? 559  GLY B O   1 
ATOM   2034 N N   . ILE B 1 69  ? 40.782  61.277  29.590 1.00 25.16  ? 560  ILE B N   1 
ATOM   2035 C CA  . ILE B 1 69  ? 40.064  60.154  29.025 1.00 25.72  ? 560  ILE B CA  1 
ATOM   2036 C C   . ILE B 1 69  ? 39.524  60.473  27.642 1.00 26.21  ? 560  ILE B C   1 
ATOM   2037 O O   . ILE B 1 69  ? 39.544  61.619  27.191 1.00 26.60  ? 560  ILE B O   1 
ATOM   2038 C CB  . ILE B 1 69  ? 38.825  59.757  29.895 1.00 25.97  ? 560  ILE B CB  1 
ATOM   2039 C CG1 . ILE B 1 69  ? 37.897  60.960  30.048 1.00 24.40  ? 560  ILE B CG1 1 
ATOM   2040 C CG2 . ILE B 1 69  ? 39.254  59.239  31.256 1.00 22.33  ? 560  ILE B CG2 1 
ATOM   2041 C CD1 . ILE B 1 69  ? 36.663  60.673  30.861 1.00 23.92  ? 560  ILE B CD1 1 
ATOM   2042 N N   . VAL B 1 70  ? 39.062  59.422  26.979 1.00 24.75  ? 561  VAL B N   1 
ATOM   2043 C CA  . VAL B 1 70  ? 38.429  59.514  25.680 1.00 26.11  ? 561  VAL B CA  1 
ATOM   2044 C C   . VAL B 1 70  ? 37.217  58.620  25.869 1.00 28.08  ? 561  VAL B C   1 
ATOM   2045 O O   . VAL B 1 70  ? 37.319  57.526  26.429 1.00 30.18  ? 561  VAL B O   1 
ATOM   2046 C CB  . VAL B 1 70  ? 39.294  58.976  24.550 1.00 25.94  ? 561  VAL B CB  1 
ATOM   2047 C CG1 . VAL B 1 70  ? 40.355  59.988  24.213 1.00 26.31  ? 561  VAL B CG1 1 
ATOM   2048 C CG2 . VAL B 1 70  ? 39.913  57.644  24.948 1.00 27.49  ? 561  VAL B CG2 1 
ATOM   2049 N N   . THR B 1 71  ? 36.065  59.101  25.429 1.00 27.57  ? 562  THR B N   1 
ATOM   2050 C CA  . THR B 1 71  ? 34.838  58.362  25.595 1.00 27.44  ? 562  THR B CA  1 
ATOM   2051 C C   . THR B 1 71  ? 34.312  57.825  24.275 1.00 28.61  ? 562  THR B C   1 
ATOM   2052 O O   . THR B 1 71  ? 34.018  58.589  23.356 1.00 29.24  ? 562  THR B O   1 
ATOM   2053 C CB  . THR B 1 71  ? 33.776  59.264  26.264 1.00 26.93  ? 562  THR B CB  1 
ATOM   2054 O OG1 . THR B 1 71  ? 34.291  59.744  27.514 1.00 24.84  ? 562  THR B OG1 1 
ATOM   2055 C CG2 . THR B 1 71  ? 32.475  58.494  26.509 1.00 26.11  ? 562  THR B CG2 1 
ATOM   2056 N N   . ILE B 1 72  ? 34.218  56.503  24.182 1.00 29.07  ? 563  ILE B N   1 
ATOM   2057 C CA  . ILE B 1 72  ? 33.703  55.869  22.984 1.00 30.01  ? 563  ILE B CA  1 
ATOM   2058 C C   . ILE B 1 72  ? 32.196  55.843  23.192 1.00 30.99  ? 563  ILE B C   1 
ATOM   2059 O O   . ILE B 1 72  ? 31.718  55.575  24.295 1.00 31.83  ? 563  ILE B O   1 
ATOM   2060 C CB  . ILE B 1 72  ? 34.252  54.445  22.823 1.00 30.30  ? 563  ILE B CB  1 
ATOM   2061 C CG1 . ILE B 1 72  ? 33.944  53.628  24.065 1.00 32.48  ? 563  ILE B CG1 1 
ATOM   2062 C CG2 . ILE B 1 72  ? 35.759  54.476  22.663 1.00 30.10  ? 563  ILE B CG2 1 
ATOM   2063 C CD1 . ILE B 1 72  ? 34.408  52.206  23.955 1.00 36.30  ? 563  ILE B CD1 1 
ATOM   2064 N N   . VAL B 1 73  ? 31.451  56.152  22.137 1.00 31.28  ? 564  VAL B N   1 
ATOM   2065 C CA  . VAL B 1 73  ? 30.001  56.202  22.210 1.00 29.99  ? 564  VAL B CA  1 
ATOM   2066 C C   . VAL B 1 73  ? 29.358  55.284  21.178 1.00 31.51  ? 564  VAL B C   1 
ATOM   2067 O O   . VAL B 1 73  ? 30.055  54.670  20.362 1.00 31.07  ? 564  VAL B O   1 
ATOM   2068 C CB  . VAL B 1 73  ? 29.498  57.653  21.992 1.00 28.39  ? 564  VAL B CB  1 
ATOM   2069 C CG1 . VAL B 1 73  ? 30.106  58.578  23.039 1.00 27.36  ? 564  VAL B CG1 1 
ATOM   2070 C CG2 . VAL B 1 73  ? 29.877  58.133  20.608 1.00 26.40  ? 564  VAL B CG2 1 
ATOM   2071 N N   . GLY B 1 74  ? 28.029  55.187  21.233 1.00 32.02  ? 565  GLY B N   1 
ATOM   2072 C CA  . GLY B 1 74  ? 27.297  54.355  20.296 1.00 31.80  ? 565  GLY B CA  1 
ATOM   2073 C C   . GLY B 1 74  ? 27.456  52.861  20.497 1.00 32.27  ? 565  GLY B C   1 
ATOM   2074 O O   . GLY B 1 74  ? 27.385  52.094  19.543 1.00 33.45  ? 565  GLY B O   1 
ATOM   2075 N N   . LEU B 1 75  ? 27.664  52.437  21.736 1.00 32.63  ? 566  LEU B N   1 
ATOM   2076 C CA  . LEU B 1 75  ? 27.821  51.016  22.037 1.00 33.15  ? 566  LEU B CA  1 
ATOM   2077 C C   . LEU B 1 75  ? 26.463  50.405  22.377 1.00 33.38  ? 566  LEU B C   1 
ATOM   2078 O O   . LEU B 1 75  ? 25.511  51.120  22.664 1.00 35.07  ? 566  LEU B O   1 
ATOM   2079 C CB  . LEU B 1 75  ? 28.774  50.839  23.225 1.00 32.77  ? 566  LEU B CB  1 
ATOM   2080 C CG  . LEU B 1 75  ? 30.113  51.577  23.147 1.00 33.34  ? 566  LEU B CG  1 
ATOM   2081 C CD1 . LEU B 1 75  ? 30.819  51.486  24.479 1.00 33.64  ? 566  LEU B CD1 1 
ATOM   2082 C CD2 . LEU B 1 75  ? 30.978  50.986  22.046 1.00 32.80  ? 566  LEU B CD2 1 
ATOM   2083 N N   . LYS B 1 76  ? 26.376  49.082  22.341 1.00 34.35  ? 567  LYS B N   1 
ATOM   2084 C CA  . LYS B 1 76  ? 25.139  48.385  22.671 1.00 35.65  ? 567  LYS B CA  1 
ATOM   2085 C C   . LYS B 1 76  ? 25.278  47.847  24.084 1.00 35.55  ? 567  LYS B C   1 
ATOM   2086 O O   . LYS B 1 76  ? 26.363  47.438  24.492 1.00 35.48  ? 567  LYS B O   1 
ATOM   2087 C CB  . LYS B 1 76  ? 24.906  47.205  21.721 1.00 38.29  ? 567  LYS B CB  1 
ATOM   2088 C CG  . LYS B 1 76  ? 24.687  47.572  20.266 1.00 42.04  ? 567  LYS B CG  1 
ATOM   2089 C CD  . LYS B 1 76  ? 24.730  46.317  19.405 1.00 47.58  ? 567  LYS B CD  1 
ATOM   2090 C CE  . LYS B 1 76  ? 24.614  46.633  17.920 1.00 49.83  ? 567  LYS B CE  1 
ATOM   2091 N NZ  . LYS B 1 76  ? 23.311  47.275  17.595 1.00 52.95  ? 567  LYS B NZ  1 
ATOM   2092 N N   . PRO B 1 77  ? 24.181  47.841  24.855 1.00 36.09  ? 568  PRO B N   1 
ATOM   2093 C CA  . PRO B 1 77  ? 24.204  47.339  26.234 1.00 35.19  ? 568  PRO B CA  1 
ATOM   2094 C C   . PRO B 1 77  ? 24.510  45.849  26.337 1.00 34.77  ? 568  PRO B C   1 
ATOM   2095 O O   . PRO B 1 77  ? 24.320  45.092  25.388 1.00 35.29  ? 568  PRO B O   1 
ATOM   2096 C CB  . PRO B 1 77  ? 22.801  47.669  26.744 1.00 33.87  ? 568  PRO B CB  1 
ATOM   2097 C CG  . PRO B 1 77  ? 22.467  48.912  25.999 1.00 34.78  ? 568  PRO B CG  1 
ATOM   2098 C CD  . PRO B 1 77  ? 22.934  48.582  24.598 1.00 35.75  ? 568  PRO B CD  1 
ATOM   2099 N N   . GLU B 1 78  ? 24.989  45.437  27.501 1.00 35.55  ? 569  GLU B N   1 
ATOM   2100 C CA  . GLU B 1 78  ? 25.300  44.041  27.749 1.00 35.82  ? 569  GLU B CA  1 
ATOM   2101 C C   . GLU B 1 78  ? 26.040  43.396  26.594 1.00 35.07  ? 569  GLU B C   1 
ATOM   2102 O O   . GLU B 1 78  ? 25.642  42.340  26.118 1.00 35.07  ? 569  GLU B O   1 
ATOM   2103 C CB  . GLU B 1 78  ? 24.014  43.267  28.005 1.00 37.84  ? 569  GLU B CB  1 
ATOM   2104 C CG  . GLU B 1 78  ? 23.205  43.783  29.166 1.00 42.19  ? 569  GLU B CG  1 
ATOM   2105 C CD  . GLU B 1 78  ? 22.378  42.692  29.810 1.00 45.08  ? 569  GLU B CD  1 
ATOM   2106 O OE1 . GLU B 1 78  ? 21.415  42.221  29.173 1.00 44.65  ? 569  GLU B OE1 1 
ATOM   2107 O OE2 . GLU B 1 78  ? 22.704  42.296  30.953 1.00 47.74  ? 569  GLU B OE2 1 
ATOM   2108 N N   . THR B 1 79  ? 27.120  44.023  26.148 1.00 33.70  ? 570  THR B N   1 
ATOM   2109 C CA  . THR B 1 79  ? 27.882  43.486  25.035 1.00 31.33  ? 570  THR B CA  1 
ATOM   2110 C C   . THR B 1 79  ? 29.354  43.515  25.365 1.00 31.27  ? 570  THR B C   1 
ATOM   2111 O O   . THR B 1 79  ? 29.820  44.443  26.021 1.00 33.12  ? 570  THR B O   1 
ATOM   2112 C CB  . THR B 1 79  ? 27.624  44.311  23.762 1.00 32.24  ? 570  THR B CB  1 
ATOM   2113 O OG1 . THR B 1 79  ? 26.233  44.231  23.429 1.00 32.80  ? 570  THR B OG1 1 
ATOM   2114 C CG2 . THR B 1 79  ? 28.458  43.802  22.597 1.00 27.81  ? 570  THR B CG2 1 
ATOM   2115 N N   . THR B 1 80  ? 30.078  42.488  24.924 1.00 30.26  ? 571  THR B N   1 
ATOM   2116 C CA  . THR B 1 80  ? 31.518  42.400  25.157 1.00 28.37  ? 571  THR B CA  1 
ATOM   2117 C C   . THR B 1 80  ? 32.246  43.054  23.981 1.00 29.08  ? 571  THR B C   1 
ATOM   2118 O O   . THR B 1 80  ? 32.010  42.730  22.814 1.00 28.37  ? 571  THR B O   1 
ATOM   2119 C CB  . THR B 1 80  ? 31.978  40.939  25.300 1.00 26.52  ? 571  THR B CB  1 
ATOM   2120 O OG1 . THR B 1 80  ? 31.204  40.301  26.315 1.00 25.97  ? 571  THR B OG1 1 
ATOM   2121 C CG2 . THR B 1 80  ? 33.439  40.872  25.698 1.00 26.05  ? 571  THR B CG2 1 
ATOM   2122 N N   . TYR B 1 81  ? 33.124  43.991  24.306 1.00 29.00  ? 572  TYR B N   1 
ATOM   2123 C CA  . TYR B 1 81  ? 33.880  44.719  23.304 1.00 29.25  ? 572  TYR B CA  1 
ATOM   2124 C C   . TYR B 1 81  ? 35.368  44.634  23.584 1.00 30.84  ? 572  TYR B C   1 
ATOM   2125 O O   . TYR B 1 81  ? 35.803  44.337  24.708 1.00 31.44  ? 572  TYR B O   1 
ATOM   2126 C CB  . TYR B 1 81  ? 33.487  46.197  23.316 1.00 27.88  ? 572  TYR B CB  1 
ATOM   2127 C CG  . TYR B 1 81  ? 32.117  46.518  22.778 1.00 26.48  ? 572  TYR B CG  1 
ATOM   2128 C CD1 . TYR B 1 81  ? 31.912  46.742  21.414 1.00 25.46  ? 572  TYR B CD1 1 
ATOM   2129 C CD2 . TYR B 1 81  ? 31.025  46.630  23.635 1.00 27.32  ? 572  TYR B CD2 1 
ATOM   2130 C CE1 . TYR B 1 81  ? 30.652  47.072  20.923 1.00 25.40  ? 572  TYR B CE1 1 
ATOM   2131 C CE2 . TYR B 1 81  ? 29.755  46.960  23.154 1.00 26.55  ? 572  TYR B CE2 1 
ATOM   2132 C CZ  . TYR B 1 81  ? 29.578  47.176  21.803 1.00 26.33  ? 572  TYR B CZ  1 
ATOM   2133 O OH  . TYR B 1 81  ? 28.326  47.463  21.335 1.00 25.35  ? 572  TYR B OH  1 
ATOM   2134 N N   . ALA B 1 82  ? 36.139  44.909  22.541 1.00 30.07  ? 573  ALA B N   1 
ATOM   2135 C CA  . ALA B 1 82  ? 37.587  44.937  22.624 1.00 28.50  ? 573  ALA B CA  1 
ATOM   2136 C C   . ALA B 1 82  ? 37.914  46.337  22.122 1.00 28.55  ? 573  ALA B C   1 
ATOM   2137 O O   . ALA B 1 82  ? 37.333  46.796  21.137 1.00 29.09  ? 573  ALA B O   1 
ATOM   2138 C CB  . ALA B 1 82  ? 38.194  43.888  21.714 1.00 25.42  ? 573  ALA B CB  1 
ATOM   2139 N N   . VAL B 1 83  ? 38.812  47.024  22.813 1.00 27.84  ? 574  VAL B N   1 
ATOM   2140 C CA  . VAL B 1 83  ? 39.193  48.370  22.425 1.00 28.37  ? 574  VAL B CA  1 
ATOM   2141 C C   . VAL B 1 83  ? 40.709  48.487  22.414 1.00 30.63  ? 574  VAL B C   1 
ATOM   2142 O O   . VAL B 1 83  ? 41.396  47.821  23.197 1.00 31.05  ? 574  VAL B O   1 
ATOM   2143 C CB  . VAL B 1 83  ? 38.591  49.425  23.401 1.00 27.13  ? 574  VAL B CB  1 
ATOM   2144 C CG1 . VAL B 1 83  ? 39.083  49.181  24.798 1.00 25.05  ? 574  VAL B CG1 1 
ATOM   2145 C CG2 . VAL B 1 83  ? 38.948  50.834  22.956 1.00 25.13  ? 574  VAL B CG2 1 
ATOM   2146 N N   . ARG B 1 84  ? 41.227  49.310  21.507 1.00 31.32  ? 575  ARG B N   1 
ATOM   2147 C CA  . ARG B 1 84  ? 42.663  49.530  21.399 1.00 32.55  ? 575  ARG B CA  1 
ATOM   2148 C C   . ARG B 1 84  ? 42.900  50.949  20.909 1.00 33.68  ? 575  ARG B C   1 
ATOM   2149 O O   . ARG B 1 84  ? 42.053  51.521  20.224 1.00 34.05  ? 575  ARG B O   1 
ATOM   2150 C CB  . ARG B 1 84  ? 43.296  48.512  20.449 1.00 33.36  ? 575  ARG B CB  1 
ATOM   2151 C CG  . ARG B 1 84  ? 42.627  48.402  19.090 1.00 35.72  ? 575  ARG B CG  1 
ATOM   2152 C CD  . ARG B 1 84  ? 43.342  47.373  18.231 1.00 36.30  ? 575  ARG B CD  1 
ATOM   2153 N NE  . ARG B 1 84  ? 42.709  47.188  16.927 1.00 38.87  ? 575  ARG B NE  1 
ATOM   2154 C CZ  . ARG B 1 84  ? 43.101  46.293  16.023 1.00 38.94  ? 575  ARG B CZ  1 
ATOM   2155 N NH1 . ARG B 1 84  ? 44.127  45.491  16.271 1.00 37.63  ? 575  ARG B NH1 1 
ATOM   2156 N NH2 . ARG B 1 84  ? 42.471  46.205  14.864 1.00 39.59  ? 575  ARG B NH2 1 
ATOM   2157 N N   . LEU B 1 85  ? 44.049  51.514  21.263 1.00 33.44  ? 576  LEU B N   1 
ATOM   2158 C CA  . LEU B 1 85  ? 44.366  52.881  20.887 1.00 33.59  ? 576  LEU B CA  1 
ATOM   2159 C C   . LEU B 1 85  ? 45.635  53.062  20.068 1.00 34.65  ? 576  LEU B C   1 
ATOM   2160 O O   . LEU B 1 85  ? 46.604  52.310  20.205 1.00 33.35  ? 576  LEU B O   1 
ATOM   2161 C CB  . LEU B 1 85  ? 44.486  53.748  22.138 1.00 34.02  ? 576  LEU B CB  1 
ATOM   2162 C CG  . LEU B 1 85  ? 43.291  53.859  23.078 1.00 37.10  ? 576  LEU B CG  1 
ATOM   2163 C CD1 . LEU B 1 85  ? 43.638  54.827  24.198 1.00 38.03  ? 576  LEU B CD1 1 
ATOM   2164 C CD2 . LEU B 1 85  ? 42.071  54.345  22.330 1.00 37.37  ? 576  LEU B CD2 1 
ATOM   2165 N N   . ALA B 1 86  ? 45.620  54.098  19.234 1.00 34.91  ? 577  ALA B N   1 
ATOM   2166 C CA  . ALA B 1 86  ? 46.760  54.448  18.402 1.00 35.81  ? 577  ALA B CA  1 
ATOM   2167 C C   . ALA B 1 86  ? 47.021  55.949  18.511 1.00 35.15  ? 577  ALA B C   1 
ATOM   2168 O O   . ALA B 1 86  ? 46.096  56.733  18.708 1.00 33.91  ? 577  ALA B O   1 
ATOM   2169 C CB  . ALA B 1 86  ? 46.493  54.064  16.953 1.00 36.10  ? 577  ALA B CB  1 
ATOM   2170 N N   . ALA B 1 87  ? 48.287  56.334  18.393 1.00 36.72  ? 578  ALA B N   1 
ATOM   2171 C CA  . ALA B 1 87  ? 48.681  57.740  18.455 1.00 38.14  ? 578  ALA B CA  1 
ATOM   2172 C C   . ALA B 1 87  ? 49.084  58.231  17.060 1.00 38.81  ? 578  ALA B C   1 
ATOM   2173 O O   . ALA B 1 87  ? 49.800  57.547  16.328 1.00 39.40  ? 578  ALA B O   1 
ATOM   2174 C CB  . ALA B 1 87  ? 49.846  57.923  19.438 1.00 37.94  ? 578  ALA B CB  1 
ATOM   2175 N N   . LEU B 1 88  ? 48.611  59.415  16.690 1.00 38.96  ? 579  LEU B N   1 
ATOM   2176 C CA  . LEU B 1 88  ? 48.927  59.991  15.388 1.00 37.84  ? 579  LEU B CA  1 
ATOM   2177 C C   . LEU B 1 88  ? 49.877  61.179  15.536 1.00 38.80  ? 579  LEU B C   1 
ATOM   2178 O O   . LEU B 1 88  ? 49.787  61.947  16.498 1.00 38.86  ? 579  LEU B O   1 
ATOM   2179 C CB  . LEU B 1 88  ? 47.644  60.457  14.706 1.00 36.75  ? 579  LEU B CB  1 
ATOM   2180 C CG  . LEU B 1 88  ? 47.798  61.296  13.438 1.00 35.74  ? 579  LEU B CG  1 
ATOM   2181 C CD1 . LEU B 1 88  ? 48.116  60.386  12.279 1.00 35.82  ? 579  LEU B CD1 1 
ATOM   2182 C CD2 . LEU B 1 88  ? 46.520  62.066  13.161 1.00 34.15  ? 579  LEU B CD2 1 
ATOM   2183 N N   . ASN B 1 89  ? 50.797  61.318  14.587 1.00 38.67  ? 580  ASN B N   1 
ATOM   2184 C CA  . ASN B 1 89  ? 51.736  62.433  14.595 1.00 38.84  ? 580  ASN B CA  1 
ATOM   2185 C C   . ASN B 1 89  ? 52.046  62.813  13.146 1.00 39.81  ? 580  ASN B C   1 
ATOM   2186 O O   . ASN B 1 89  ? 51.586  62.145  12.215 1.00 39.98  ? 580  ASN B O   1 
ATOM   2187 C CB  . ASN B 1 89  ? 53.009  62.062  15.369 1.00 37.71  ? 580  ASN B CB  1 
ATOM   2188 C CG  . ASN B 1 89  ? 54.030  61.333  14.525 1.00 38.88  ? 580  ASN B CG  1 
ATOM   2189 O OD1 . ASN B 1 89  ? 53.714  60.790  13.464 1.00 40.13  ? 580  ASN B OD1 1 
ATOM   2190 N ND2 . ASN B 1 89  ? 55.269  61.303  15.004 1.00 36.87  ? 580  ASN B ND2 1 
ATOM   2191 N N   . GLY B 1 90  ? 52.801  63.890  12.952 1.00 39.78  ? 581  GLY B N   1 
ATOM   2192 C CA  . GLY B 1 90  ? 53.131  64.327  11.606 1.00 39.75  ? 581  GLY B CA  1 
ATOM   2193 C C   . GLY B 1 90  ? 53.687  63.257  10.673 1.00 40.61  ? 581  GLY B C   1 
ATOM   2194 O O   . GLY B 1 90  ? 53.320  63.213  9.496  1.00 40.65  ? 581  GLY B O   1 
ATOM   2195 N N   . LYS B 1 91  ? 54.573  62.402  11.180 1.00 39.85  ? 582  LYS B N   1 
ATOM   2196 C CA  . LYS B 1 91  ? 55.165  61.343  10.362 1.00 39.33  ? 582  LYS B CA  1 
ATOM   2197 C C   . LYS B 1 91  ? 54.146  60.235  10.049 1.00 38.83  ? 582  LYS B C   1 
ATOM   2198 O O   . LYS B 1 91  ? 54.350  59.443  9.129  1.00 38.34  ? 582  LYS B O   1 
ATOM   2199 C CB  . LYS B 1 91  ? 56.381  60.723  11.070 1.00 38.32  ? 582  LYS B CB  1 
ATOM   2200 C CG  . LYS B 1 91  ? 57.467  61.702  11.498 1.00 38.14  ? 582  LYS B CG  1 
ATOM   2201 C CD  . LYS B 1 91  ? 58.250  62.257  10.315 1.00 40.38  ? 582  LYS B CD  1 
ATOM   2202 C CE  . LYS B 1 91  ? 59.356  63.251  10.741 1.00 42.00  ? 582  LYS B CE  1 
ATOM   2203 N NZ  . LYS B 1 91  ? 60.583  62.636  11.360 1.00 40.86  ? 582  LYS B NZ  1 
ATOM   2204 N N   . GLY B 1 92  ? 53.059  60.172  10.816 1.00 37.73  ? 583  GLY B N   1 
ATOM   2205 C CA  . GLY B 1 92  ? 52.057  59.145  10.571 1.00 38.50  ? 583  GLY B CA  1 
ATOM   2206 C C   . GLY B 1 92  ? 51.458  58.458  11.791 1.00 38.60  ? 583  GLY B C   1 
ATOM   2207 O O   . GLY B 1 92  ? 51.756  58.824  12.926 1.00 39.36  ? 583  GLY B O   1 
ATOM   2208 N N   . LEU B 1 93  ? 50.618  57.449  11.553 1.00 38.89  ? 584  LEU B N   1 
ATOM   2209 C CA  . LEU B 1 93  ? 49.949  56.712  12.630 1.00 39.58  ? 584  LEU B CA  1 
ATOM   2210 C C   . LEU B 1 93  ? 50.823  55.654  13.284 1.00 39.25  ? 584  LEU B C   1 
ATOM   2211 O O   . LEU B 1 93  ? 51.299  54.743  12.620 1.00 41.67  ? 584  LEU B O   1 
ATOM   2212 C CB  . LEU B 1 93  ? 48.667  56.045  12.108 1.00 38.15  ? 584  LEU B CB  1 
ATOM   2213 C CG  . LEU B 1 93  ? 47.832  55.343  13.190 1.00 39.15  ? 584  LEU B CG  1 
ATOM   2214 C CD1 . LEU B 1 93  ? 47.384  56.363  14.237 1.00 36.82  ? 584  LEU B CD1 1 
ATOM   2215 C CD2 . LEU B 1 93  ? 46.618  54.659  12.563 1.00 38.44  ? 584  LEU B CD2 1 
ATOM   2216 N N   . GLY B 1 94  ? 51.030  55.777  14.590 1.00 39.61  ? 585  GLY B N   1 
ATOM   2217 C CA  . GLY B 1 94  ? 51.845  54.812  15.307 1.00 40.01  ? 585  GLY B CA  1 
ATOM   2218 C C   . GLY B 1 94  ? 51.187  53.444  15.349 1.00 41.65  ? 585  GLY B C   1 
ATOM   2219 O O   . GLY B 1 94  ? 50.177  53.212  14.688 1.00 40.67  ? 585  GLY B O   1 
ATOM   2220 N N   . GLU B 1 95  ? 51.750  52.536  16.138 1.00 43.55  ? 586  GLU B N   1 
ATOM   2221 C CA  . GLU B 1 95  ? 51.222  51.176  16.256 1.00 44.57  ? 586  GLU B CA  1 
ATOM   2222 C C   . GLU B 1 95  ? 50.073  51.066  17.264 1.00 42.96  ? 586  GLU B C   1 
ATOM   2223 O O   . GLU B 1 95  ? 50.096  51.714  18.311 1.00 43.51  ? 586  GLU B O   1 
ATOM   2224 C CB  . GLU B 1 95  ? 52.353  50.241  16.676 1.00 48.11  ? 586  GLU B CB  1 
ATOM   2225 C CG  . GLU B 1 95  ? 52.953  50.612  18.020 1.00 52.64  ? 586  GLU B CG  1 
ATOM   2226 C CD  . GLU B 1 95  ? 54.387  50.142  18.180 1.00 56.26  ? 586  GLU B CD  1 
ATOM   2227 O OE1 . GLU B 1 95  ? 54.950  50.333  19.284 1.00 55.32  ? 586  GLU B OE1 1 
ATOM   2228 O OE2 . GLU B 1 95  ? 54.949  49.592  17.200 1.00 57.53  ? 586  GLU B OE2 1 
ATOM   2229 N N   . ILE B 1 96  ? 49.073  50.245  16.952 1.00 40.67  ? 587  ILE B N   1 
ATOM   2230 C CA  . ILE B 1 96  ? 47.951  50.066  17.864 1.00 38.68  ? 587  ILE B CA  1 
ATOM   2231 C C   . ILE B 1 96  ? 48.425  49.357  19.115 1.00 37.73  ? 587  ILE B C   1 
ATOM   2232 O O   . ILE B 1 96  ? 49.430  48.652  19.100 1.00 38.11  ? 587  ILE B O   1 
ATOM   2233 C CB  . ILE B 1 96  ? 46.809  49.211  17.267 1.00 38.22  ? 587  ILE B CB  1 
ATOM   2234 C CG1 . ILE B 1 96  ? 47.265  48.557  15.969 1.00 38.23  ? 587  ILE B CG1 1 
ATOM   2235 C CG2 . ILE B 1 96  ? 45.552  50.068  17.078 1.00 37.67  ? 587  ILE B CG2 1 
ATOM   2236 C CD1 . ILE B 1 96  ? 46.211  47.666  15.337 1.00 39.48  ? 587  ILE B CD1 1 
ATOM   2237 N N   . SER B 1 97  ? 47.695  49.560  20.203 1.00 36.10  ? 588  SER B N   1 
ATOM   2238 C CA  . SER B 1 97  ? 48.016  48.928  21.471 1.00 33.38  ? 588  SER B CA  1 
ATOM   2239 C C   . SER B 1 97  ? 47.311  47.579  21.463 1.00 32.31  ? 588  SER B C   1 
ATOM   2240 O O   . SER B 1 97  ? 46.588  47.252  20.517 1.00 32.86  ? 588  SER B O   1 
ATOM   2241 C CB  . SER B 1 97  ? 47.486  49.778  22.628 1.00 33.20  ? 588  SER B CB  1 
ATOM   2242 O OG  . SER B 1 97  ? 46.066  49.716  22.697 1.00 29.67  ? 588  SER B OG  1 
ATOM   2243 N N   . ALA B 1 98  ? 47.527  46.792  22.507 1.00 31.15  ? 589  ALA B N   1 
ATOM   2244 C CA  . ALA B 1 98  ? 46.879  45.490  22.625 1.00 29.86  ? 589  ALA B CA  1 
ATOM   2245 C C   . ALA B 1 98  ? 45.402  45.712  22.973 1.00 30.82  ? 589  ALA B C   1 
ATOM   2246 O O   . ALA B 1 98  ? 45.037  46.735  23.554 1.00 31.81  ? 589  ALA B O   1 
ATOM   2247 C CB  . ALA B 1 98  ? 47.551  44.679  23.712 1.00 27.27  ? 589  ALA B CB  1 
ATOM   2248 N N   . ALA B 1 99  ? 44.555  44.754  22.615 1.00 31.36  ? 590  ALA B N   1 
ATOM   2249 C CA  . ALA B 1 99  ? 43.128  44.858  22.893 1.00 31.15  ? 590  ALA B CA  1 
ATOM   2250 C C   . ALA B 1 99  ? 42.847  44.780  24.383 1.00 31.10  ? 590  ALA B C   1 
ATOM   2251 O O   . ALA B 1 99  ? 43.482  44.019  25.122 1.00 31.42  ? 590  ALA B O   1 
ATOM   2252 C CB  . ALA B 1 99  ? 42.352  43.750  22.159 1.00 29.61  ? 590  ALA B CB  1 
ATOM   2253 N N   . SER B 1 100 ? 41.889  45.589  24.811 1.00 30.94  ? 591  SER B N   1 
ATOM   2254 C CA  . SER B 1 100 ? 41.466  45.634  26.195 1.00 30.36  ? 591  SER B CA  1 
ATOM   2255 C C   . SER B 1 100 ? 39.999  45.251  26.091 1.00 30.33  ? 591  SER B C   1 
ATOM   2256 O O   . SER B 1 100 ? 39.241  45.911  25.382 1.00 31.12  ? 591  SER B O   1 
ATOM   2257 C CB  . SER B 1 100 ? 41.608  47.054  26.732 1.00 29.94  ? 591  SER B CB  1 
ATOM   2258 O OG  . SER B 1 100 ? 42.055  47.043  28.070 1.00 33.87  ? 591  SER B OG  1 
ATOM   2259 N N   . GLU B 1 101 ? 39.600  44.187  26.781 1.00 29.52  ? 592  GLU B N   1 
ATOM   2260 C CA  . GLU B 1 101 ? 38.217  43.723  26.721 1.00 28.64  ? 592  GLU B CA  1 
ATOM   2261 C C   . GLU B 1 101 ? 37.361  44.252  27.868 1.00 27.59  ? 592  GLU B C   1 
ATOM   2262 O O   . GLU B 1 101 ? 37.870  44.477  28.963 1.00 27.46  ? 592  GLU B O   1 
ATOM   2263 C CB  . GLU B 1 101 ? 38.196  42.201  26.724 1.00 28.74  ? 592  GLU B CB  1 
ATOM   2264 C CG  . GLU B 1 101 ? 37.304  41.605  25.676 1.00 29.19  ? 592  GLU B CG  1 
ATOM   2265 C CD  . GLU B 1 101 ? 37.402  40.108  25.649 1.00 29.83  ? 592  GLU B CD  1 
ATOM   2266 O OE1 . GLU B 1 101 ? 38.519  39.587  25.835 1.00 28.78  ? 592  GLU B OE1 1 
ATOM   2267 O OE2 . GLU B 1 101 ? 36.368  39.452  25.425 1.00 31.92  ? 592  GLU B OE2 1 
ATOM   2268 N N   . PHE B 1 102 ? 36.064  44.440  27.612 1.00 26.37  ? 593  PHE B N   1 
ATOM   2269 C CA  . PHE B 1 102 ? 35.144  44.946  28.633 1.00 27.09  ? 593  PHE B CA  1 
ATOM   2270 C C   . PHE B 1 102 ? 33.700  44.675  28.271 1.00 27.98  ? 593  PHE B C   1 
ATOM   2271 O O   . PHE B 1 102 ? 33.379  44.436  27.116 1.00 29.60  ? 593  PHE B O   1 
ATOM   2272 C CB  . PHE B 1 102 ? 35.324  46.455  28.822 1.00 26.19  ? 593  PHE B CB  1 
ATOM   2273 C CG  . PHE B 1 102 ? 34.869  47.283  27.640 1.00 25.77  ? 593  PHE B CG  1 
ATOM   2274 C CD1 . PHE B 1 102 ? 33.536  47.646  27.495 1.00 24.41  ? 593  PHE B CD1 1 
ATOM   2275 C CD2 . PHE B 1 102 ? 35.786  47.711  26.677 1.00 25.00  ? 593  PHE B CD2 1 
ATOM   2276 C CE1 . PHE B 1 102 ? 33.126  48.424  26.416 1.00 23.53  ? 593  PHE B CE1 1 
ATOM   2277 C CE2 . PHE B 1 102 ? 35.381  48.487  25.599 1.00 22.74  ? 593  PHE B CE2 1 
ATOM   2278 C CZ  . PHE B 1 102 ? 34.051  48.843  25.470 1.00 23.45  ? 593  PHE B CZ  1 
ATOM   2279 N N   . LYS B 1 103 ? 32.816  44.727  29.260 1.00 29.40  ? 594  LYS B N   1 
ATOM   2280 C CA  . LYS B 1 103 ? 31.408  44.492  28.986 1.00 30.09  ? 594  LYS B CA  1 
ATOM   2281 C C   . LYS B 1 103 ? 30.530  45.652  29.429 1.00 29.08  ? 594  LYS B C   1 
ATOM   2282 O O   . LYS B 1 103 ? 30.561  46.055  30.586 1.00 28.68  ? 594  LYS B O   1 
ATOM   2283 C CB  . LYS B 1 103 ? 30.931  43.206  29.662 1.00 30.50  ? 594  LYS B CB  1 
ATOM   2284 C CG  . LYS B 1 103 ? 29.577  42.761  29.154 1.00 30.57  ? 594  LYS B CG  1 
ATOM   2285 C CD  . LYS B 1 103 ? 29.103  41.515  29.846 1.00 34.83  ? 594  LYS B CD  1 
ATOM   2286 C CE  . LYS B 1 103 ? 27.758  41.069  29.282 1.00 36.24  ? 594  LYS B CE  1 
ATOM   2287 N NZ  . LYS B 1 103 ? 27.093  40.116  30.211 1.00 37.35  ? 594  LYS B NZ  1 
ATOM   2288 N N   . THR B 1 104 ? 29.744  46.178  28.495 1.00 28.93  ? 595  THR B N   1 
ATOM   2289 C CA  . THR B 1 104 ? 28.844  47.289  28.782 1.00 30.18  ? 595  THR B CA  1 
ATOM   2290 C C   . THR B 1 104 ? 27.766  46.883  29.774 1.00 30.78  ? 595  THR B C   1 
ATOM   2291 O O   . THR B 1 104 ? 27.343  45.729  29.817 1.00 31.40  ? 595  THR B O   1 
ATOM   2292 C CB  . THR B 1 104 ? 28.142  47.800  27.506 1.00 29.67  ? 595  THR B CB  1 
ATOM   2293 O OG1 . THR B 1 104 ? 27.540  46.696  26.821 1.00 29.68  ? 595  THR B OG1 1 
ATOM   2294 C CG2 . THR B 1 104 ? 29.134  48.497  26.590 1.00 29.75  ? 595  THR B CG2 1 
ATOM   2295 N N   . GLN B 1 105 ? 27.315  47.841  30.568 1.00 30.29  ? 596  GLN B N   1 
ATOM   2296 C CA  . GLN B 1 105 ? 26.278  47.567  31.549 1.00 30.81  ? 596  GLN B CA  1 
ATOM   2297 C C   . GLN B 1 105 ? 24.897  47.436  30.900 1.00 31.92  ? 596  GLN B C   1 
ATOM   2298 O O   . GLN B 1 105 ? 24.679  47.881  29.774 1.00 32.22  ? 596  GLN B O   1 
ATOM   2299 C CB  . GLN B 1 105 ? 26.238  48.685  32.595 1.00 27.48  ? 596  GLN B CB  1 
ATOM   2300 C CG  . GLN B 1 105 ? 27.512  48.834  33.397 1.00 25.08  ? 596  GLN B CG  1 
ATOM   2301 C CD  . GLN B 1 105 ? 27.361  49.818  34.534 1.00 25.17  ? 596  GLN B CD  1 
ATOM   2302 O OE1 . GLN B 1 105 ? 26.425  49.715  35.333 1.00 25.09  ? 596  GLN B OE1 1 
ATOM   2303 N NE2 . GLN B 1 105 ? 28.285  50.777  34.623 1.00 22.01  ? 596  GLN B NE2 1 
ATOM   2304 N N   . PRO B 1 106 ? 23.956  46.784  31.595 1.00 32.79  ? 597  PRO B N   1 
ATOM   2305 C CA  . PRO B 1 106 ? 22.606  46.636  31.048 1.00 33.53  ? 597  PRO B CA  1 
ATOM   2306 C C   . PRO B 1 106 ? 21.893  47.962  31.306 1.00 33.55  ? 597  PRO B C   1 
ATOM   2307 O O   . PRO B 1 106 ? 22.367  48.758  32.123 1.00 34.18  ? 597  PRO B O   1 
ATOM   2308 C CB  . PRO B 1 106 ? 22.026  45.486  31.873 1.00 31.39  ? 597  PRO B CB  1 
ATOM   2309 C CG  . PRO B 1 106 ? 22.689  45.652  33.178 1.00 30.55  ? 597  PRO B CG  1 
ATOM   2310 C CD  . PRO B 1 106 ? 24.126  45.947  32.794 1.00 32.23  ? 597  PRO B CD  1 
ATOM   2311 N N   . VAL B 1 107 ? 20.786  48.221  30.617 1.00 33.41  ? 598  VAL B N   1 
ATOM   2312 C CA  . VAL B 1 107 ? 20.077  49.475  30.851 1.00 35.26  ? 598  VAL B CA  1 
ATOM   2313 C C   . VAL B 1 107 ? 19.042  49.294  31.957 1.00 36.64  ? 598  VAL B C   1 
ATOM   2314 O O   . VAL B 1 107 ? 18.206  48.388  31.912 1.00 36.47  ? 598  VAL B O   1 
ATOM   2315 C CB  . VAL B 1 107 ? 19.386  49.997  29.577 1.00 34.53  ? 598  VAL B CB  1 
ATOM   2316 C CG1 . VAL B 1 107 ? 18.696  51.304  29.870 1.00 35.76  ? 598  VAL B CG1 1 
ATOM   2317 C CG2 . VAL B 1 107 ? 20.403  50.216  28.494 1.00 33.34  ? 598  VAL B CG2 1 
ATOM   2318 N N   . ARG B 1 108 ? 19.115  50.161  32.958 1.00 38.09  ? 599  ARG B N   1 
ATOM   2319 C CA  . ARG B 1 108 ? 18.214  50.101  34.096 1.00 40.33  ? 599  ARG B CA  1 
ATOM   2320 C C   . ARG B 1 108 ? 17.201  51.253  34.038 1.00 41.46  ? 599  ARG B C   1 
ATOM   2321 O O   . ARG B 1 108 ? 17.214  52.067  33.110 1.00 42.32  ? 599  ARG B O   1 
ATOM   2322 C CB  . ARG B 1 108 ? 19.050  50.160  35.380 1.00 41.44  ? 599  ARG B CB  1 
ATOM   2323 C CG  . ARG B 1 108 ? 18.293  50.011  36.708 1.00 50.03  ? 599  ARG B CG  1 
ATOM   2324 C CD  . ARG B 1 108 ? 17.496  48.691  36.825 1.00 53.59  ? 599  ARG B CD  1 
ATOM   2325 N NE  . ARG B 1 108 ? 16.136  48.813  36.295 1.00 55.29  ? 599  ARG B NE  1 
ATOM   2326 C CZ  . ARG B 1 108 ? 15.353  47.783  35.991 1.00 56.06  ? 599  ARG B CZ  1 
ATOM   2327 N NH1 . ARG B 1 108 ? 15.785  46.539  36.161 1.00 55.17  ? 599  ARG B NH1 1 
ATOM   2328 N NH2 . ARG B 1 108 ? 14.135  48.000  35.507 1.00 57.67  ? 599  ARG B NH2 1 
ATOM   2329 N N   . GLU B 1 109 ? 16.298  51.303  35.009 1.00 41.16  ? 600  GLU B N   1 
ATOM   2330 C CA  . GLU B 1 109 ? 15.317  52.375  35.066 1.00 39.62  ? 600  GLU B CA  1 
ATOM   2331 C C   . GLU B 1 109 ? 16.016  53.610  35.598 1.00 35.77  ? 600  GLU B C   1 
ATOM   2332 O O   . GLU B 1 109 ? 17.082  53.523  36.201 1.00 34.36  ? 600  GLU B O   1 
ATOM   2333 C CB  . GLU B 1 109 ? 14.172  52.010  36.009 1.00 42.64  ? 600  GLU B CB  1 
ATOM   2334 C CG  . GLU B 1 109 ? 13.061  51.209  35.374 1.00 47.08  ? 600  GLU B CG  1 
ATOM   2335 C CD  . GLU B 1 109 ? 12.032  50.775  36.398 1.00 50.94  ? 600  GLU B CD  1 
ATOM   2336 O OE1 . GLU B 1 109 ? 10.971  50.254  35.991 1.00 51.34  ? 600  GLU B OE1 1 
ATOM   2337 O OE2 . GLU B 1 109 ? 12.292  50.953  37.613 1.00 51.55  ? 600  GLU B OE2 1 
ATOM   2338 N N   . PRO B 1 110 ? 15.420  54.786  35.398 1.00 33.55  ? 601  PRO B N   1 
ATOM   2339 C CA  . PRO B 1 110 ? 16.128  55.948  35.929 1.00 32.76  ? 601  PRO B CA  1 
ATOM   2340 C C   . PRO B 1 110 ? 15.997  55.982  37.447 1.00 32.17  ? 601  PRO B C   1 
ATOM   2341 O O   . PRO B 1 110 ? 15.140  55.300  38.019 1.00 30.25  ? 601  PRO B O   1 
ATOM   2342 C CB  . PRO B 1 110 ? 15.400  57.134  35.282 1.00 30.21  ? 601  PRO B CB  1 
ATOM   2343 C CG  . PRO B 1 110 ? 14.629  56.528  34.137 1.00 31.16  ? 601  PRO B CG  1 
ATOM   2344 C CD  . PRO B 1 110 ? 14.220  55.189  34.650 1.00 32.10  ? 601  PRO B CD  1 
ATOM   2345 N N   . SER B 1 111 ? 16.859  56.763  38.088 1.00 31.47  ? 602  SER B N   1 
ATOM   2346 C CA  . SER B 1 111 ? 16.781  56.961  39.525 1.00 32.26  ? 602  SER B CA  1 
ATOM   2347 C C   . SER B 1 111 ? 15.851  58.165  39.640 1.00 32.34  ? 602  SER B C   1 
ATOM   2348 O O   . SER B 1 111 ? 15.791  58.993  38.725 1.00 31.30  ? 602  SER B O   1 
ATOM   2349 C CB  . SER B 1 111 ? 18.145  57.317  40.113 1.00 32.73  ? 602  SER B CB  1 
ATOM   2350 O OG  . SER B 1 111 ? 19.039  56.225  40.025 1.00 36.49  ? 602  SER B OG  1 
ATOM   2351 N N   . ALA B 1 112 ? 15.116  58.266  40.742 1.00 32.51  ? 603  ALA B N   1 
ATOM   2352 C CA  . ALA B 1 112 ? 14.209  59.394  40.913 1.00 31.47  ? 603  ALA B CA  1 
ATOM   2353 C C   . ALA B 1 112 ? 15.024  60.667  41.028 1.00 30.94  ? 603  ALA B C   1 
ATOM   2354 O O   . ALA B 1 112 ? 16.173  60.649  41.456 1.00 31.96  ? 603  ALA B O   1 
ATOM   2355 C CB  . ALA B 1 112 ? 13.364  59.210  42.154 1.00 29.83  ? 603  ALA B CB  1 
ATOM   2356 N N   . PRO B 1 113 ? 14.453  61.790  40.605 1.00 30.50  ? 604  PRO B N   1 
ATOM   2357 C CA  . PRO B 1 113 ? 15.212  63.032  40.712 1.00 31.41  ? 604  PRO B CA  1 
ATOM   2358 C C   . PRO B 1 113 ? 14.978  63.643  42.087 1.00 33.52  ? 604  PRO B C   1 
ATOM   2359 O O   . PRO B 1 113 ? 14.034  63.260  42.789 1.00 35.19  ? 604  PRO B O   1 
ATOM   2360 C CB  . PRO B 1 113 ? 14.621  63.883  39.597 1.00 30.90  ? 604  PRO B CB  1 
ATOM   2361 C CG  . PRO B 1 113 ? 13.171  63.468  39.618 1.00 31.67  ? 604  PRO B CG  1 
ATOM   2362 C CD  . PRO B 1 113 ? 13.273  61.955  39.737 1.00 30.51  ? 604  PRO B CD  1 
ATOM   2363 N N   . LYS B 1 114 ? 15.837  64.576  42.481 1.00 33.64  ? 605  LYS B N   1 
ATOM   2364 C CA  . LYS B 1 114 ? 15.674  65.240  43.760 1.00 34.21  ? 605  LYS B CA  1 
ATOM   2365 C C   . LYS B 1 114 ? 14.901  66.533  43.526 1.00 33.95  ? 605  LYS B C   1 
ATOM   2366 O O   . LYS B 1 114 ? 15.113  67.229  42.533 1.00 33.03  ? 605  LYS B O   1 
ATOM   2367 C CB  . LYS B 1 114 ? 17.031  65.541  44.402 1.00 36.42  ? 605  LYS B CB  1 
ATOM   2368 C CG  . LYS B 1 114 ? 17.636  64.391  45.214 1.00 39.97  ? 605  LYS B CG  1 
ATOM   2369 C CD  . LYS B 1 114 ? 18.945  64.833  45.911 1.00 43.69  ? 605  LYS B CD  1 
ATOM   2370 C CE  . LYS B 1 114 ? 18.709  66.031  46.861 1.00 45.58  ? 605  LYS B CE  1 
ATOM   2371 N NZ  . LYS B 1 114 ? 19.962  66.719  47.333 1.00 47.98  ? 605  LYS B NZ  1 
ATOM   2372 N N   . LEU B 1 115 ? 13.997  66.850  44.444 1.00 33.34  ? 606  LEU B N   1 
ATOM   2373 C CA  . LEU B 1 115 ? 13.196  68.052  44.313 1.00 32.92  ? 606  LEU B CA  1 
ATOM   2374 C C   . LEU B 1 115 ? 13.603  69.109  45.317 1.00 33.05  ? 606  LEU B C   1 
ATOM   2375 O O   . LEU B 1 115 ? 13.940  68.801  46.448 1.00 32.99  ? 606  LEU B O   1 
ATOM   2376 C CB  . LEU B 1 115 ? 11.720  67.717  44.508 1.00 33.15  ? 606  LEU B CB  1 
ATOM   2377 C CG  . LEU B 1 115 ? 11.147  66.538  43.722 1.00 33.03  ? 606  LEU B CG  1 
ATOM   2378 C CD1 . LEU B 1 115 ? 9.654   66.478  44.015 1.00 33.71  ? 606  LEU B CD1 1 
ATOM   2379 C CD2 . LEU B 1 115 ? 11.405  66.681  42.219 1.00 29.54  ? 606  LEU B CD2 1 
ATOM   2380 N N   . GLU B 1 116 ? 13.565  70.363  44.891 1.00 33.89  ? 607  GLU B N   1 
ATOM   2381 C CA  . GLU B 1 116 ? 13.914  71.478  45.756 1.00 34.82  ? 607  GLU B CA  1 
ATOM   2382 C C   . GLU B 1 116 ? 12.886  72.572  45.526 1.00 36.66  ? 607  GLU B C   1 
ATOM   2383 O O   . GLU B 1 116 ? 12.620  72.949  44.385 1.00 38.56  ? 607  GLU B O   1 
ATOM   2384 C CB  . GLU B 1 116 ? 15.308  71.999  45.412 1.00 33.59  ? 607  GLU B CB  1 
ATOM   2385 C CG  . GLU B 1 116 ? 15.656  73.326  46.064 1.00 32.24  ? 607  GLU B CG  1 
ATOM   2386 C CD  . GLU B 1 116 ? 16.911  73.950  45.485 1.00 32.68  ? 607  GLU B CD  1 
ATOM   2387 O OE1 . GLU B 1 116 ? 18.021  73.430  45.732 1.00 31.38  ? 607  GLU B OE1 1 
ATOM   2388 O OE2 . GLU B 1 116 ? 16.786  74.962  44.771 1.00 33.47  ? 607  GLU B OE2 1 
ATOM   2389 N N   . GLY B 1 117 ? 12.308  73.079  46.607 1.00 36.99  ? 608  GLY B N   1 
ATOM   2390 C CA  . GLY B 1 117 ? 11.315  74.124  46.481 1.00 37.14  ? 608  GLY B CA  1 
ATOM   2391 C C   . GLY B 1 117 ? 11.921  75.510  46.489 1.00 38.64  ? 608  GLY B C   1 
ATOM   2392 O O   . GLY B 1 117 ? 12.988  75.737  47.066 1.00 37.73  ? 608  GLY B O   1 
ATOM   2393 N N   . GLN B 1 118 ? 11.224  76.439  45.843 1.00 40.35  ? 609  GLN B N   1 
ATOM   2394 C CA  . GLN B 1 118 ? 11.653  77.826  45.752 1.00 43.48  ? 609  GLN B CA  1 
ATOM   2395 C C   . GLN B 1 118 ? 10.388  78.668  45.609 1.00 46.63  ? 609  GLN B C   1 
ATOM   2396 O O   . GLN B 1 118 ? 9.358   78.176  45.151 1.00 47.70  ? 609  GLN B O   1 
ATOM   2397 C CB  . GLN B 1 118 ? 12.537  78.016  44.520 1.00 42.68  ? 609  GLN B CB  1 
ATOM   2398 C CG  . GLN B 1 118 ? 13.391  79.273  44.530 1.00 42.97  ? 609  GLN B CG  1 
ATOM   2399 C CD  . GLN B 1 118 ? 14.108  79.500  43.202 1.00 43.42  ? 609  GLN B CD  1 
ATOM   2400 O OE1 . GLN B 1 118 ? 14.618  78.562  42.584 1.00 42.78  ? 609  GLN B OE1 1 
ATOM   2401 N NE2 . GLN B 1 118 ? 14.159  80.753  42.766 1.00 41.65  ? 609  GLN B NE2 1 
ATOM   2402 N N   . ARG B 1 119 ? 10.449  79.929  46.013 1.00 49.56  ? 610  ARG B N   1 
ATOM   2403 C CA  . ARG B 1 119 ? 9.286   80.790  45.878 1.00 53.02  ? 610  ARG B CA  1 
ATOM   2404 C C   . ARG B 1 119 ? 8.922   80.896  44.395 1.00 53.64  ? 610  ARG B C   1 
ATOM   2405 O O   . ARG B 1 119 ? 9.699   80.506  43.526 1.00 53.28  ? 610  ARG B O   1 
ATOM   2406 C CB  . ARG B 1 119 ? 9.588   82.188  46.425 1.00 56.38  ? 610  ARG B CB  1 
ATOM   2407 C CG  . ARG B 1 119 ? 9.603   82.295  47.944 1.00 62.70  ? 610  ARG B CG  1 
ATOM   2408 C CD  . ARG B 1 119 ? 9.820   83.746  48.380 1.00 66.48  ? 610  ARG B CD  1 
ATOM   2409 N NE  . ARG B 1 119 ? 9.389   83.991  49.756 1.00 69.95  ? 610  ARG B NE  1 
ATOM   2410 C CZ  . ARG B 1 119 ? 9.371   85.191  50.331 1.00 71.47  ? 610  ARG B CZ  1 
ATOM   2411 N NH1 . ARG B 1 119 ? 9.762   86.261  49.649 1.00 71.46  ? 610  ARG B NH1 1 
ATOM   2412 N NH2 . ARG B 1 119 ? 8.952   85.327  51.585 1.00 71.43  ? 610  ARG B NH2 1 
ATOM   2413 N N   . GLY B 1 120 ? 7.734   81.418  44.115 1.00 53.98  ? 611  GLY B N   1 
ATOM   2414 C CA  . GLY B 1 120 ? 7.305   81.593  42.741 1.00 54.82  ? 611  GLY B CA  1 
ATOM   2415 C C   . GLY B 1 120 ? 7.090   83.078  42.499 1.00 56.14  ? 611  GLY B C   1 
ATOM   2416 O O   . GLY B 1 120 ? 7.560   83.909  43.283 1.00 54.53  ? 611  GLY B O   1 
ATOM   2417 N N   . GLU B 1 121 ? 6.385   83.423  41.424 1.00 57.40  ? 612  GLU B N   1 
ATOM   2418 C CA  . GLU B 1 121 ? 6.128   84.825  41.133 1.00 59.08  ? 612  GLU B CA  1 
ATOM   2419 C C   . GLU B 1 121 ? 5.258   85.418  42.240 1.00 58.76  ? 612  GLU B C   1 
ATOM   2420 O O   . GLU B 1 121 ? 5.496   86.534  42.699 1.00 57.84  ? 612  GLU B O   1 
ATOM   2421 C CB  . GLU B 1 121 ? 5.425   84.984  39.778 1.00 62.71  ? 612  GLU B CB  1 
ATOM   2422 C CG  . GLU B 1 121 ? 3.975   84.469  39.716 1.00 67.16  ? 612  GLU B CG  1 
ATOM   2423 C CD  . GLU B 1 121 ? 3.196   85.042  38.518 1.00 69.48  ? 612  GLU B CD  1 
ATOM   2424 O OE1 . GLU B 1 121 ? 2.979   86.279  38.481 1.00 69.67  ? 612  GLU B OE1 1 
ATOM   2425 O OE2 . GLU B 1 121 ? 2.804   84.261  37.616 1.00 69.88  ? 612  GLU B OE2 1 
ATOM   2426 N N   . ASP B 1 122 ? 4.260   84.656  42.679 1.00 58.86  ? 613  ASP B N   1 
ATOM   2427 C CA  . ASP B 1 122 ? 3.352   85.111  43.727 1.00 58.09  ? 613  ASP B CA  1 
ATOM   2428 C C   . ASP B 1 122 ? 3.174   84.078  44.841 1.00 56.70  ? 613  ASP B C   1 
ATOM   2429 O O   . ASP B 1 122 ? 3.419   82.883  44.647 1.00 55.86  ? 613  ASP B O   1 
ATOM   2430 C CB  . ASP B 1 122 ? 1.991   85.455  43.113 1.00 60.54  ? 613  ASP B CB  1 
ATOM   2431 C CG  . ASP B 1 122 ? 2.095   86.493  42.004 1.00 61.98  ? 613  ASP B CG  1 
ATOM   2432 O OD1 . ASP B 1 122 ? 2.475   87.648  42.296 1.00 63.03  ? 613  ASP B OD1 1 
ATOM   2433 O OD2 . ASP B 1 122 ? 1.801   86.151  40.838 1.00 62.12  ? 613  ASP B OD2 1 
ATOM   2434 N N   . GLY B 1 123 ? 2.736   84.560  46.004 1.00 55.02  ? 614  GLY B N   1 
ATOM   2435 C CA  . GLY B 1 123 ? 2.528   83.709  47.165 1.00 51.30  ? 614  GLY B CA  1 
ATOM   2436 C C   . GLY B 1 123 ? 1.649   82.494  46.945 1.00 49.34  ? 614  GLY B C   1 
ATOM   2437 O O   . GLY B 1 123 ? 1.645   81.578  47.765 1.00 48.82  ? 614  GLY B O   1 
ATOM   2438 N N   . ASN B 1 124 ? 0.890   82.479  45.854 1.00 46.74  ? 615  ASN B N   1 
ATOM   2439 C CA  . ASN B 1 124 ? 0.032   81.344  45.565 1.00 44.08  ? 615  ASN B CA  1 
ATOM   2440 C C   . ASN B 1 124 ? 0.622   80.507  44.427 1.00 43.28  ? 615  ASN B C   1 
ATOM   2441 O O   . ASN B 1 124 ? -0.102  79.982  43.573 1.00 42.11  ? 615  ASN B O   1 
ATOM   2442 C CB  . ASN B 1 124 ? -1.377  81.810  45.204 1.00 43.32  ? 615  ASN B CB  1 
ATOM   2443 C CG  . ASN B 1 124 ? -1.433  82.504  43.865 1.00 43.43  ? 615  ASN B CG  1 
ATOM   2444 O OD1 . ASN B 1 124 ? -2.372  82.299  43.093 1.00 44.64  ? 615  ASN B OD1 1 
ATOM   2445 N ND2 . ASN B 1 124 ? -0.433  83.335  43.581 1.00 40.42  ? 615  ASN B ND2 1 
ATOM   2446 N N   . SER B 1 125 ? 1.948   80.395  44.430 1.00 42.95  ? 616  SER B N   1 
ATOM   2447 C CA  . SER B 1 125 ? 2.678   79.616  43.432 1.00 43.09  ? 616  SER B CA  1 
ATOM   2448 C C   . SER B 1 125 ? 4.030   79.209  44.001 1.00 41.22  ? 616  SER B C   1 
ATOM   2449 O O   . SER B 1 125 ? 4.554   79.861  44.901 1.00 41.23  ? 616  SER B O   1 
ATOM   2450 C CB  . SER B 1 125 ? 2.922   80.429  42.160 1.00 43.42  ? 616  SER B CB  1 
ATOM   2451 O OG  . SER B 1 125 ? 4.174   81.099  42.230 1.00 44.11  ? 616  SER B OG  1 
ATOM   2452 N N   . ILE B 1 126 ? 4.596   78.137  43.461 1.00 39.25  ? 617  ILE B N   1 
ATOM   2453 C CA  . ILE B 1 126 ? 5.895   77.674  43.918 1.00 38.82  ? 617  ILE B CA  1 
ATOM   2454 C C   . ILE B 1 126 ? 6.701   77.169  42.735 1.00 38.61  ? 617  ILE B C   1 
ATOM   2455 O O   . ILE B 1 126 ? 6.142   76.700  41.743 1.00 40.03  ? 617  ILE B O   1 
ATOM   2456 C CB  . ILE B 1 126 ? 5.766   76.541  44.995 1.00 37.62  ? 617  ILE B CB  1 
ATOM   2457 C CG1 . ILE B 1 126 ? 7.137   76.244  45.592 1.00 36.36  ? 617  ILE B CG1 1 
ATOM   2458 C CG2 . ILE B 1 126 ? 5.195   75.271  44.388 1.00 35.49  ? 617  ILE B CG2 1 
ATOM   2459 C CD1 . ILE B 1 126 ? 7.085   75.372  46.803 1.00 37.12  ? 617  ILE B CD1 1 
ATOM   2460 N N   . LYS B 1 127 ? 8.016   77.295  42.837 1.00 36.98  ? 618  LYS B N   1 
ATOM   2461 C CA  . LYS B 1 127 ? 8.909   76.841  41.786 1.00 36.82  ? 618  LYS B CA  1 
ATOM   2462 C C   . LYS B 1 127 ? 9.603   75.571  42.276 1.00 35.67  ? 618  LYS B C   1 
ATOM   2463 O O   . LYS B 1 127 ? 10.312  75.594  43.279 1.00 35.41  ? 618  LYS B O   1 
ATOM   2464 C CB  . LYS B 1 127 ? 9.952   77.918  41.474 1.00 37.49  ? 618  LYS B CB  1 
ATOM   2465 C CG  . LYS B 1 127 ? 10.813  77.593  40.270 1.00 39.41  ? 618  LYS B CG  1 
ATOM   2466 C CD  . LYS B 1 127 ? 11.858  78.657  40.008 1.00 42.00  ? 618  LYS B CD  1 
ATOM   2467 C CE  . LYS B 1 127 ? 12.673  78.300  38.775 1.00 44.25  ? 618  LYS B CE  1 
ATOM   2468 N NZ  . LYS B 1 127 ? 13.857  79.186  38.592 1.00 48.51  ? 618  LYS B NZ  1 
ATOM   2469 N N   . VAL B 1 128 ? 9.385   74.462  41.578 1.00 33.41  ? 619  VAL B N   1 
ATOM   2470 C CA  . VAL B 1 128 ? 9.995   73.206  41.973 1.00 32.27  ? 619  VAL B CA  1 
ATOM   2471 C C   . VAL B 1 128 ? 11.194  72.906  41.087 1.00 33.05  ? 619  VAL B C   1 
ATOM   2472 O O   . VAL B 1 128 ? 11.047  72.535  39.922 1.00 34.39  ? 619  VAL B O   1 
ATOM   2473 C CB  . VAL B 1 128 ? 8.973   72.048  41.897 1.00 31.39  ? 619  VAL B CB  1 
ATOM   2474 C CG1 . VAL B 1 128 ? 9.655   70.719  42.205 1.00 29.66  ? 619  VAL B CG1 1 
ATOM   2475 C CG2 . VAL B 1 128 ? 7.839   72.297  42.878 1.00 29.98  ? 619  VAL B CG2 1 
ATOM   2476 N N   . ASN B 1 129 ? 12.383  73.081  41.652 1.00 32.06  ? 620  ASN B N   1 
ATOM   2477 C CA  . ASN B 1 129 ? 13.628  72.843  40.936 1.00 32.64  ? 620  ASN B CA  1 
ATOM   2478 C C   . ASN B 1 129 ? 14.004  71.366  40.914 1.00 33.28  ? 620  ASN B C   1 
ATOM   2479 O O   . ASN B 1 129 ? 13.885  70.671  41.925 1.00 35.95  ? 620  ASN B O   1 
ATOM   2480 C CB  . ASN B 1 129 ? 14.763  73.619  41.604 1.00 33.49  ? 620  ASN B CB  1 
ATOM   2481 C CG  . ASN B 1 129 ? 14.620  75.105  41.453 1.00 31.90  ? 620  ASN B CG  1 
ATOM   2482 O OD1 . ASN B 1 129 ? 15.133  75.861  42.262 1.00 34.43  ? 620  ASN B OD1 1 
ATOM   2483 N ND2 . ASN B 1 129 ? 13.935  75.536  40.409 1.00 32.88  ? 620  ASN B ND2 1 
ATOM   2484 N N   . LEU B 1 130 ? 14.475  70.891  39.769 1.00 31.35  ? 621  LEU B N   1 
ATOM   2485 C CA  . LEU B 1 130 ? 14.878  69.496  39.648 1.00 31.39  ? 621  LEU B CA  1 
ATOM   2486 C C   . LEU B 1 130 ? 16.393  69.337  39.754 1.00 31.20  ? 621  LEU B C   1 
ATOM   2487 O O   . LEU B 1 130 ? 17.152  70.052  39.096 1.00 33.72  ? 621  LEU B O   1 
ATOM   2488 C CB  . LEU B 1 130 ? 14.440  68.923  38.298 1.00 29.63  ? 621  LEU B CB  1 
ATOM   2489 C CG  . LEU B 1 130 ? 12.977  69.039  37.893 1.00 28.49  ? 621  LEU B CG  1 
ATOM   2490 C CD1 . LEU B 1 130 ? 12.847  68.600  36.454 1.00 26.62  ? 621  LEU B CD1 1 
ATOM   2491 C CD2 . LEU B 1 130 ? 12.105  68.201  38.815 1.00 27.19  ? 621  LEU B CD2 1 
ATOM   2492 N N   . ILE B 1 131 ? 16.835  68.408  40.589 1.00 29.08  ? 622  ILE B N   1 
ATOM   2493 C CA  . ILE B 1 131 ? 18.256  68.132  40.710 1.00 29.02  ? 622  ILE B CA  1 
ATOM   2494 C C   . ILE B 1 131 ? 18.379  66.766  40.044 1.00 29.44  ? 622  ILE B C   1 
ATOM   2495 O O   . ILE B 1 131 ? 18.043  65.739  40.638 1.00 28.07  ? 622  ILE B O   1 
ATOM   2496 C CB  . ILE B 1 131 ? 18.691  68.071  42.178 1.00 29.54  ? 622  ILE B CB  1 
ATOM   2497 C CG1 . ILE B 1 131 ? 18.553  69.456  42.807 1.00 28.49  ? 622  ILE B CG1 1 
ATOM   2498 C CG2 . ILE B 1 131 ? 20.127  67.609  42.278 1.00 28.76  ? 622  ILE B CG2 1 
ATOM   2499 C CD1 . ILE B 1 131 ? 18.863  69.484  44.277 1.00 30.06  ? 622  ILE B CD1 1 
ATOM   2500 N N   . LYS B 1 132 ? 18.827  66.774  38.790 1.00 29.89  ? 623  LYS B N   1 
ATOM   2501 C CA  . LYS B 1 132 ? 18.953  65.558  37.988 1.00 29.91  ? 623  LYS B CA  1 
ATOM   2502 C C   . LYS B 1 132 ? 19.837  64.489  38.602 1.00 27.78  ? 623  LYS B C   1 
ATOM   2503 O O   . LYS B 1 132 ? 20.733  64.783  39.382 1.00 26.87  ? 623  LYS B O   1 
ATOM   2504 C CB  . LYS B 1 132 ? 19.445  65.917  36.585 1.00 33.09  ? 623  LYS B CB  1 
ATOM   2505 C CG  . LYS B 1 132 ? 18.486  66.809  35.800 1.00 34.23  ? 623  LYS B CG  1 
ATOM   2506 C CD  . LYS B 1 132 ? 19.096  67.235  34.473 1.00 36.47  ? 623  LYS B CD  1 
ATOM   2507 C CE  . LYS B 1 132 ? 18.073  67.886  33.535 1.00 39.57  ? 623  LYS B CE  1 
ATOM   2508 N NZ  . LYS B 1 132 ? 17.529  69.201  34.002 1.00 40.92  ? 623  LYS B NZ  1 
ATOM   2509 N N   . GLN B 1 133 ? 19.570  63.238  38.240 1.00 27.73  ? 624  GLN B N   1 
ATOM   2510 C CA  . GLN B 1 133 ? 20.316  62.099  38.770 1.00 26.98  ? 624  GLN B CA  1 
ATOM   2511 C C   . GLN B 1 133 ? 20.454  60.985  37.750 1.00 25.41  ? 624  GLN B C   1 
ATOM   2512 O O   . GLN B 1 133 ? 19.868  61.052  36.681 1.00 24.92  ? 624  GLN B O   1 
ATOM   2513 C CB  . GLN B 1 133 ? 19.621  61.577  40.021 1.00 26.82  ? 624  GLN B CB  1 
ATOM   2514 C CG  . GLN B 1 133 ? 19.422  62.667  41.029 1.00 31.62  ? 624  GLN B CG  1 
ATOM   2515 C CD  . GLN B 1 133 ? 19.847  62.266  42.414 1.00 35.01  ? 624  GLN B CD  1 
ATOM   2516 O OE1 . GLN B 1 133 ? 20.948  61.756  42.620 1.00 37.37  ? 624  GLN B OE1 1 
ATOM   2517 N NE2 . GLN B 1 133 ? 18.976  62.502  43.385 1.00 39.48  ? 624  GLN B NE2 1 
ATOM   2518 N N   . ASP B 1 134 ? 21.236  59.962  38.088 1.00 26.32  ? 625  ASP B N   1 
ATOM   2519 C CA  . ASP B 1 134 ? 21.467  58.833  37.191 1.00 26.18  ? 625  ASP B CA  1 
ATOM   2520 C C   . ASP B 1 134 ? 20.194  58.503  36.432 1.00 26.39  ? 625  ASP B C   1 
ATOM   2521 O O   . ASP B 1 134 ? 19.149  58.320  37.050 1.00 26.83  ? 625  ASP B O   1 
ATOM   2522 C CB  . ASP B 1 134 ? 21.932  57.612  37.993 1.00 24.87  ? 625  ASP B CB  1 
ATOM   2523 C CG  . ASP B 1 134 ? 22.258  56.400  37.109 1.00 28.55  ? 625  ASP B CG  1 
ATOM   2524 O OD1 . ASP B 1 134 ? 22.343  56.529  35.857 1.00 27.06  ? 625  ASP B OD1 1 
ATOM   2525 O OD2 . ASP B 1 134 ? 22.437  55.300  37.682 1.00 29.77  ? 625  ASP B OD2 1 
ATOM   2526 N N   . ASP B 1 135 ? 20.284  58.447  35.098 1.00 25.97  ? 626  ASP B N   1 
ATOM   2527 C CA  . ASP B 1 135 ? 19.132  58.128  34.247 1.00 26.13  ? 626  ASP B CA  1 
ATOM   2528 C C   . ASP B 1 135 ? 19.035  56.644  33.946 1.00 25.22  ? 626  ASP B C   1 
ATOM   2529 O O   . ASP B 1 135 ? 18.265  56.235  33.088 1.00 24.35  ? 626  ASP B O   1 
ATOM   2530 C CB  . ASP B 1 135 ? 19.182  58.897  32.908 1.00 27.36  ? 626  ASP B CB  1 
ATOM   2531 C CG  . ASP B 1 135 ? 20.480  58.641  32.104 1.00 30.83  ? 626  ASP B CG  1 
ATOM   2532 O OD1 . ASP B 1 135 ? 21.112  57.568  32.260 1.00 32.07  ? 626  ASP B OD1 1 
ATOM   2533 O OD2 . ASP B 1 135 ? 20.861  59.518  31.294 1.00 28.48  ? 626  ASP B OD2 1 
ATOM   2534 N N   . GLY B 1 136 ? 19.837  55.837  34.627 1.00 26.78  ? 627  GLY B N   1 
ATOM   2535 C CA  . GLY B 1 136 ? 19.794  54.402  34.388 1.00 30.10  ? 627  GLY B CA  1 
ATOM   2536 C C   . GLY B 1 136 ? 20.562  53.934  33.158 1.00 32.40  ? 627  GLY B C   1 
ATOM   2537 O O   . GLY B 1 136 ? 20.405  52.791  32.708 1.00 32.55  ? 627  GLY B O   1 
ATOM   2538 N N   . GLY B 1 137 ? 21.384  54.818  32.600 1.00 32.80  ? 628  GLY B N   1 
ATOM   2539 C CA  . GLY B 1 137 ? 22.175  54.449  31.444 1.00 33.51  ? 628  GLY B CA  1 
ATOM   2540 C C   . GLY B 1 137 ? 21.529  54.632  30.090 1.00 33.20  ? 628  GLY B C   1 
ATOM   2541 O O   . GLY B 1 137 ? 22.054  54.156  29.079 1.00 34.38  ? 628  GLY B O   1 
ATOM   2542 N N   . SER B 1 138 ? 20.391  55.314  30.066 1.00 32.03  ? 629  SER B N   1 
ATOM   2543 C CA  . SER B 1 138 ? 19.677  55.578  28.822 1.00 31.21  ? 629  SER B CA  1 
ATOM   2544 C C   . SER B 1 138 ? 18.986  56.918  28.983 1.00 29.90  ? 629  SER B C   1 
ATOM   2545 O O   . SER B 1 138 ? 18.470  57.223  30.045 1.00 30.91  ? 629  SER B O   1 
ATOM   2546 C CB  . SER B 1 138 ? 18.649  54.490  28.550 1.00 32.26  ? 629  SER B CB  1 
ATOM   2547 O OG  . SER B 1 138 ? 17.991  54.728  27.320 1.00 36.50  ? 629  SER B OG  1 
ATOM   2548 N N   . PRO B 1 139 ? 18.954  57.732  27.923 1.00 29.03  ? 630  PRO B N   1 
ATOM   2549 C CA  . PRO B 1 139 ? 18.326  59.057  27.963 1.00 29.21  ? 630  PRO B CA  1 
ATOM   2550 C C   . PRO B 1 139 ? 16.923  59.141  28.573 1.00 29.60  ? 630  PRO B C   1 
ATOM   2551 O O   . PRO B 1 139 ? 16.079  58.271  28.367 1.00 29.58  ? 630  PRO B O   1 
ATOM   2552 C CB  . PRO B 1 139 ? 18.332  59.487  26.492 1.00 28.37  ? 630  PRO B CB  1 
ATOM   2553 C CG  . PRO B 1 139 ? 19.484  58.775  25.931 1.00 27.33  ? 630  PRO B CG  1 
ATOM   2554 C CD  . PRO B 1 139 ? 19.374  57.405  26.552 1.00 27.48  ? 630  PRO B CD  1 
ATOM   2555 N N   . ILE B 1 140 ? 16.682  60.208  29.322 1.00 29.52  ? 631  ILE B N   1 
ATOM   2556 C CA  . ILE B 1 140 ? 15.378  60.415  29.913 1.00 31.18  ? 631  ILE B CA  1 
ATOM   2557 C C   . ILE B 1 140 ? 14.404  60.900  28.847 1.00 32.63  ? 631  ILE B C   1 
ATOM   2558 O O   . ILE B 1 140 ? 14.681  61.863  28.138 1.00 32.31  ? 631  ILE B O   1 
ATOM   2559 C CB  . ILE B 1 140 ? 15.440  61.445  31.044 1.00 29.99  ? 631  ILE B CB  1 
ATOM   2560 C CG1 . ILE B 1 140 ? 15.895  60.748  32.326 1.00 30.97  ? 631  ILE B CG1 1 
ATOM   2561 C CG2 . ILE B 1 140 ? 14.073  62.110  31.231 1.00 28.31  ? 631  ILE B CG2 1 
ATOM   2562 C CD1 . ILE B 1 140 ? 16.296  61.706  33.429 1.00 34.36  ? 631  ILE B CD1 1 
ATOM   2563 N N   . ARG B 1 141 ? 13.264  60.225  28.738 1.00 34.96  ? 632  ARG B N   1 
ATOM   2564 C CA  . ARG B 1 141 ? 12.254  60.599  27.759 1.00 35.50  ? 632  ARG B CA  1 
ATOM   2565 C C   . ARG B 1 141 ? 11.374  61.740  28.259 1.00 34.34  ? 632  ARG B C   1 
ATOM   2566 O O   . ARG B 1 141 ? 11.146  62.709  27.530 1.00 32.59  ? 632  ARG B O   1 
ATOM   2567 C CB  . ARG B 1 141 ? 11.388  59.383  27.374 1.00 38.26  ? 632  ARG B CB  1 
ATOM   2568 C CG  . ARG B 1 141 ? 12.068  58.423  26.377 1.00 43.27  ? 632  ARG B CG  1 
ATOM   2569 C CD  . ARG B 1 141 ? 11.113  57.367  25.767 1.00 50.68  ? 632  ARG B CD  1 
ATOM   2570 N NE  . ARG B 1 141 ? 9.971   57.932  25.030 1.00 56.47  ? 632  ARG B NE  1 
ATOM   2571 C CZ  . ARG B 1 141 ? 8.765   58.164  25.560 1.00 59.25  ? 632  ARG B CZ  1 
ATOM   2572 N NH1 . ARG B 1 141 ? 8.527   57.879  26.837 1.00 59.70  ? 632  ARG B NH1 1 
ATOM   2573 N NH2 . ARG B 1 141 ? 7.789   58.679  24.815 1.00 58.73  ? 632  ARG B NH2 1 
ATOM   2574 N N   . HIS B 1 142 ? 10.901  61.633  29.502 1.00 33.80  ? 633  HIS B N   1 
ATOM   2575 C CA  . HIS B 1 142 ? 10.025  62.649  30.095 1.00 31.76  ? 633  HIS B CA  1 
ATOM   2576 C C   . HIS B 1 142 ? 10.168  62.731  31.603 1.00 31.11  ? 633  HIS B C   1 
ATOM   2577 O O   . HIS B 1 142 ? 10.738  61.852  32.240 1.00 31.80  ? 633  HIS B O   1 
ATOM   2578 C CB  . HIS B 1 142 ? 8.545   62.325  29.839 1.00 31.61  ? 633  HIS B CB  1 
ATOM   2579 C CG  . HIS B 1 142 ? 8.225   61.971  28.425 1.00 33.39  ? 633  HIS B CG  1 
ATOM   2580 N ND1 . HIS B 1 142 ? 8.185   62.906  27.412 1.00 34.47  ? 633  HIS B ND1 1 
ATOM   2581 C CD2 . HIS B 1 142 ? 7.941   60.778  27.851 1.00 34.25  ? 633  HIS B CD2 1 
ATOM   2582 C CE1 . HIS B 1 142 ? 7.890   62.302  26.274 1.00 35.91  ? 633  HIS B CE1 1 
ATOM   2583 N NE2 . HIS B 1 142 ? 7.739   61.011  26.513 1.00 35.58  ? 633  HIS B NE2 1 
ATOM   2584 N N   . TYR B 1 143 ? 9.627   63.808  32.159 1.00 30.66  ? 634  TYR B N   1 
ATOM   2585 C CA  . TYR B 1 143 ? 9.573   64.005  33.598 1.00 30.18  ? 634  TYR B CA  1 
ATOM   2586 C C   . TYR B 1 143 ? 8.077   64.104  33.860 1.00 29.33  ? 634  TYR B C   1 
ATOM   2587 O O   . TYR B 1 143 ? 7.456   65.103  33.512 1.00 29.27  ? 634  TYR B O   1 
ATOM   2588 C CB  . TYR B 1 143 ? 10.274  65.297  34.029 1.00 28.94  ? 634  TYR B CB  1 
ATOM   2589 C CG  . TYR B 1 143 ? 11.727  65.087  34.378 1.00 29.59  ? 634  TYR B CG  1 
ATOM   2590 C CD1 . TYR B 1 143 ? 12.101  64.145  35.336 1.00 30.10  ? 634  TYR B CD1 1 
ATOM   2591 C CD2 . TYR B 1 143 ? 12.733  65.774  33.700 1.00 28.87  ? 634  TYR B CD2 1 
ATOM   2592 C CE1 . TYR B 1 143 ? 13.444  63.887  35.601 1.00 30.40  ? 634  TYR B CE1 1 
ATOM   2593 C CE2 . TYR B 1 143 ? 14.068  65.521  33.951 1.00 28.41  ? 634  TYR B CE2 1 
ATOM   2594 C CZ  . TYR B 1 143 ? 14.422  64.577  34.898 1.00 29.48  ? 634  TYR B CZ  1 
ATOM   2595 O OH  . TYR B 1 143 ? 15.754  64.311  35.118 1.00 28.77  ? 634  TYR B OH  1 
ATOM   2596 N N   . LEU B 1 144 ? 7.496   63.052  34.428 1.00 29.17  ? 635  LEU B N   1 
ATOM   2597 C CA  . LEU B 1 144 ? 6.061   63.042  34.711 1.00 29.50  ? 635  LEU B CA  1 
ATOM   2598 C C   . LEU B 1 144 ? 5.832   63.708  36.049 1.00 29.27  ? 635  LEU B C   1 
ATOM   2599 O O   . LEU B 1 144 ? 6.348   63.262  37.063 1.00 29.76  ? 635  LEU B O   1 
ATOM   2600 C CB  . LEU B 1 144 ? 5.513   61.607  34.729 1.00 27.52  ? 635  LEU B CB  1 
ATOM   2601 C CG  . LEU B 1 144 ? 5.851   60.758  33.488 1.00 29.60  ? 635  LEU B CG  1 
ATOM   2602 C CD1 . LEU B 1 144 ? 5.341   59.332  33.648 1.00 27.91  ? 635  LEU B CD1 1 
ATOM   2603 C CD2 . LEU B 1 144 ? 5.261   61.397  32.250 1.00 26.34  ? 635  LEU B CD2 1 
ATOM   2604 N N   . VAL B 1 145 ? 5.074   64.797  36.030 1.00 29.67  ? 636  VAL B N   1 
ATOM   2605 C CA  . VAL B 1 145 ? 4.761   65.553  37.235 1.00 30.82  ? 636  VAL B CA  1 
ATOM   2606 C C   . VAL B 1 145 ? 3.266   65.502  37.546 1.00 33.22  ? 636  VAL B C   1 
ATOM   2607 O O   . VAL B 1 145 ? 2.427   65.553  36.649 1.00 33.80  ? 636  VAL B O   1 
ATOM   2608 C CB  . VAL B 1 145 ? 5.158   67.042  37.086 1.00 28.69  ? 636  VAL B CB  1 
ATOM   2609 C CG1 . VAL B 1 145 ? 4.730   67.826  38.321 1.00 27.51  ? 636  VAL B CG1 1 
ATOM   2610 C CG2 . VAL B 1 145 ? 6.634   67.162  36.865 1.00 26.25  ? 636  VAL B CG2 1 
ATOM   2611 N N   . ARG B 1 146 ? 2.943   65.395  38.824 1.00 35.63  ? 637  ARG B N   1 
ATOM   2612 C CA  . ARG B 1 146 ? 1.559   65.374  39.260 1.00 40.07  ? 637  ARG B CA  1 
ATOM   2613 C C   . ARG B 1 146 ? 1.482   66.071  40.597 1.00 41.39  ? 637  ARG B C   1 
ATOM   2614 O O   . ARG B 1 146 ? 2.301   65.834  41.483 1.00 44.19  ? 637  ARG B O   1 
ATOM   2615 C CB  . ARG B 1 146 ? 1.022   63.945  39.397 1.00 41.53  ? 637  ARG B CB  1 
ATOM   2616 C CG  . ARG B 1 146 ? 0.677   63.270  38.076 1.00 45.83  ? 637  ARG B CG  1 
ATOM   2617 C CD  . ARG B 1 146 ? -0.276  62.101  38.295 1.00 48.96  ? 637  ARG B CD  1 
ATOM   2618 N NE  . ARG B 1 146 ? 0.199   61.214  39.355 1.00 53.06  ? 637  ARG B NE  1 
ATOM   2619 C CZ  . ARG B 1 146 ? -0.481  60.177  39.836 1.00 54.53  ? 637  ARG B CZ  1 
ATOM   2620 N NH1 . ARG B 1 146 ? -1.683  59.884  39.352 1.00 54.95  ? 637  ARG B NH1 1 
ATOM   2621 N NH2 . ARG B 1 146 ? 0.045   59.434  40.803 1.00 53.37  ? 637  ARG B NH2 1 
ATOM   2622 N N   . TYR B 1 147 ? 0.505   66.950  40.735 1.00 41.65  ? 638  TYR B N   1 
ATOM   2623 C CA  . TYR B 1 147 ? 0.337   67.671  41.976 1.00 43.03  ? 638  TYR B CA  1 
ATOM   2624 C C   . TYR B 1 147 ? -1.132  67.639  42.358 1.00 44.00  ? 638  TYR B C   1 
ATOM   2625 O O   . TYR B 1 147 ? -1.974  67.119  41.619 1.00 43.51  ? 638  TYR B O   1 
ATOM   2626 C CB  . TYR B 1 147 ? 0.826   69.118  41.819 1.00 43.45  ? 638  TYR B CB  1 
ATOM   2627 C CG  . TYR B 1 147 ? -0.045  69.996  40.949 1.00 42.88  ? 638  TYR B CG  1 
ATOM   2628 C CD1 . TYR B 1 147 ? -0.787  71.034  41.504 1.00 44.36  ? 638  TYR B CD1 1 
ATOM   2629 C CD2 . TYR B 1 147 ? -0.129  69.789  39.574 1.00 43.62  ? 638  TYR B CD2 1 
ATOM   2630 C CE1 . TYR B 1 147 ? -1.596  71.851  40.713 1.00 45.89  ? 638  TYR B CE1 1 
ATOM   2631 C CE2 . TYR B 1 147 ? -0.932  70.596  38.770 1.00 45.15  ? 638  TYR B CE2 1 
ATOM   2632 C CZ  . TYR B 1 147 ? -1.665  71.627  39.346 1.00 46.16  ? 638  TYR B CZ  1 
ATOM   2633 O OH  . TYR B 1 147 ? -2.475  72.428  38.563 1.00 47.16  ? 638  TYR B OH  1 
ATOM   2634 N N   . ARG B 1 148 ? -1.433  68.184  43.527 1.00 44.98  ? 639  ARG B N   1 
ATOM   2635 C CA  . ARG B 1 148 ? -2.801  68.230  44.002 1.00 45.05  ? 639  ARG B CA  1 
ATOM   2636 C C   . ARG B 1 148 ? -2.860  68.907  45.349 1.00 43.73  ? 639  ARG B C   1 
ATOM   2637 O O   . ARG B 1 148 ? -1.860  69.020  46.057 1.00 44.14  ? 639  ARG B O   1 
ATOM   2638 C CB  . ARG B 1 148 ? -3.367  66.823  44.151 1.00 47.81  ? 639  ARG B CB  1 
ATOM   2639 C CG  . ARG B 1 148 ? -2.654  66.015  45.220 1.00 53.57  ? 639  ARG B CG  1 
ATOM   2640 C CD  . ARG B 1 148 ? -3.381  64.723  45.531 1.00 57.11  ? 639  ARG B CD  1 
ATOM   2641 N NE  . ARG B 1 148 ? -2.735  63.999  46.620 1.00 60.55  ? 639  ARG B NE  1 
ATOM   2642 C CZ  . ARG B 1 148 ? -3.099  62.789  47.027 1.00 63.19  ? 639  ARG B CZ  1 
ATOM   2643 N NH1 . ARG B 1 148 ? -4.110  62.161  46.434 1.00 63.32  ? 639  ARG B NH1 1 
ATOM   2644 N NH2 . ARG B 1 148 ? -2.447  62.202  48.023 1.00 64.70  ? 639  ARG B NH2 1 
ATOM   2645 N N   . ALA B 1 149 ? -4.042  69.386  45.688 1.00 42.83  ? 640  ALA B N   1 
ATOM   2646 C CA  . ALA B 1 149 ? -4.239  69.982  46.982 1.00 42.04  ? 640  ALA B CA  1 
ATOM   2647 C C   . ALA B 1 149 ? -4.547  68.728  47.805 1.00 41.70  ? 640  ALA B C   1 
ATOM   2648 O O   . ALA B 1 149 ? -5.247  67.839  47.322 1.00 41.27  ? 640  ALA B O   1 
ATOM   2649 C CB  . ALA B 1 149 ? -5.427  70.916  46.943 1.00 40.37  ? 640  ALA B CB  1 
ATOM   2650 N N   . LEU B 1 150 ? -4.001  68.627  49.013 1.00 42.13  ? 641  LEU B N   1 
ATOM   2651 C CA  . LEU B 1 150 ? -4.257  67.460  49.856 1.00 43.24  ? 641  LEU B CA  1 
ATOM   2652 C C   . LEU B 1 150 ? -5.768  67.264  50.071 1.00 45.72  ? 641  LEU B C   1 
ATOM   2653 O O   . LEU B 1 150 ? -6.534  68.238  50.156 1.00 44.21  ? 641  LEU B O   1 
ATOM   2654 C CB  . LEU B 1 150 ? -3.546  67.615  51.208 1.00 41.64  ? 641  LEU B CB  1 
ATOM   2655 C CG  . LEU B 1 150 ? -2.014  67.789  51.237 1.00 40.24  ? 641  LEU B CG  1 
ATOM   2656 C CD1 . LEU B 1 150 ? -1.528  67.896  52.689 1.00 36.41  ? 641  LEU B CD1 1 
ATOM   2657 C CD2 . LEU B 1 150 ? -1.334  66.611  50.538 1.00 38.84  ? 641  LEU B CD2 1 
ATOM   2658 N N   . SER B 1 151 ? -6.185  65.999  50.141 1.00 48.37  ? 642  SER B N   1 
ATOM   2659 C CA  . SER B 1 151 ? -7.590  65.617  50.340 1.00 51.10  ? 642  SER B CA  1 
ATOM   2660 C C   . SER B 1 151 ? -8.465  65.999  49.142 1.00 53.11  ? 642  SER B C   1 
ATOM   2661 O O   . SER B 1 151 ? -9.598  66.472  49.296 1.00 55.17  ? 642  SER B O   1 
ATOM   2662 C CB  . SER B 1 151 ? -8.158  66.255  51.620 1.00 50.08  ? 642  SER B CB  1 
ATOM   2663 O OG  . SER B 1 151 ? -8.620  67.578  51.391 1.00 49.07  ? 642  SER B OG  1 
ATOM   2664 N N   . SER B 1 152 ? -7.928  65.787  47.947 1.00 53.78  ? 643  SER B N   1 
ATOM   2665 C CA  . SER B 1 152 ? -8.638  66.091  46.710 1.00 53.20  ? 643  SER B CA  1 
ATOM   2666 C C   . SER B 1 152 ? -8.018  65.207  45.633 1.00 52.85  ? 643  SER B C   1 
ATOM   2667 O O   . SER B 1 152 ? -7.031  64.521  45.897 1.00 51.81  ? 643  SER B O   1 
ATOM   2668 C CB  . SER B 1 152 ? -8.469  67.572  46.353 1.00 53.03  ? 643  SER B CB  1 
ATOM   2669 O OG  . SER B 1 152 ? -9.362  67.962  45.326 1.00 52.36  ? 643  SER B OG  1 
ATOM   2670 N N   . GLU B 1 153 ? -8.591  65.223  44.431 1.00 53.32  ? 644  GLU B N   1 
ATOM   2671 C CA  . GLU B 1 153 ? -8.087  64.407  43.326 1.00 53.66  ? 644  GLU B CA  1 
ATOM   2672 C C   . GLU B 1 153 ? -6.827  64.942  42.642 1.00 52.45  ? 644  GLU B C   1 
ATOM   2673 O O   . GLU B 1 153 ? -6.534  66.139  42.673 1.00 52.01  ? 644  GLU B O   1 
ATOM   2674 C CB  . GLU B 1 153 ? -9.178  64.223  42.275 1.00 55.94  ? 644  GLU B CB  1 
ATOM   2675 C CG  . GLU B 1 153 ? -10.140 63.094  42.563 1.00 60.23  ? 644  GLU B CG  1 
ATOM   2676 C CD  . GLU B 1 153 ? -11.202 62.953  41.485 1.00 63.65  ? 644  GLU B CD  1 
ATOM   2677 O OE1 . GLU B 1 153 ? -10.857 63.076  40.287 1.00 64.24  ? 644  GLU B OE1 1 
ATOM   2678 O OE2 . GLU B 1 153 ? -12.379 62.709  41.834 1.00 65.62  ? 644  GLU B OE2 1 
ATOM   2679 N N   . TRP B 1 154 ? -6.085  64.038  42.019 1.00 51.13  ? 645  TRP B N   1 
ATOM   2680 C CA  . TRP B 1 154 ? -4.866  64.405  41.318 1.00 50.58  ? 645  TRP B CA  1 
ATOM   2681 C C   . TRP B 1 154 ? -5.149  65.298  40.130 1.00 49.39  ? 645  TRP B C   1 
ATOM   2682 O O   . TRP B 1 154 ? -6.028  65.004  39.325 1.00 49.58  ? 645  TRP B O   1 
ATOM   2683 C CB  . TRP B 1 154 ? -4.145  63.162  40.801 1.00 51.63  ? 645  TRP B CB  1 
ATOM   2684 C CG  . TRP B 1 154 ? -3.417  62.422  41.842 1.00 54.00  ? 645  TRP B CG  1 
ATOM   2685 C CD1 . TRP B 1 154 ? -3.739  61.204  42.360 1.00 54.38  ? 645  TRP B CD1 1 
ATOM   2686 C CD2 . TRP B 1 154 ? -2.248  62.864  42.537 1.00 55.76  ? 645  TRP B CD2 1 
ATOM   2687 N NE1 . TRP B 1 154 ? -2.842  60.859  43.341 1.00 55.82  ? 645  TRP B NE1 1 
ATOM   2688 C CE2 . TRP B 1 154 ? -1.915  61.861  43.470 1.00 56.28  ? 645  TRP B CE2 1 
ATOM   2689 C CE3 . TRP B 1 154 ? -1.449  64.015  42.464 1.00 57.08  ? 645  TRP B CE3 1 
ATOM   2690 C CZ2 . TRP B 1 154 ? -0.813  61.973  44.331 1.00 56.76  ? 645  TRP B CZ2 1 
ATOM   2691 C CZ3 . TRP B 1 154 ? -0.352  64.126  43.323 1.00 56.68  ? 645  TRP B CZ3 1 
ATOM   2692 C CH2 . TRP B 1 154 ? -0.050  63.109  44.241 1.00 56.65  ? 645  TRP B CH2 1 
ATOM   2693 N N   . LYS B 1 155 ? -4.403  66.386  40.016 1.00 47.83  ? 646  LYS B N   1 
ATOM   2694 C CA  . LYS B 1 155 ? -4.566  67.266  38.874 1.00 46.94  ? 646  LYS B CA  1 
ATOM   2695 C C   . LYS B 1 155 ? -4.115  66.441  37.674 1.00 46.30  ? 646  LYS B C   1 
ATOM   2696 O O   . LYS B 1 155 ? -3.567  65.342  37.834 1.00 45.74  ? 646  LYS B O   1 
ATOM   2697 C CB  . LYS B 1 155 ? -3.668  68.492  39.017 1.00 48.46  ? 646  LYS B CB  1 
ATOM   2698 C CG  . LYS B 1 155 ? -4.097  69.448  40.110 1.00 50.34  ? 646  LYS B CG  1 
ATOM   2699 C CD  . LYS B 1 155 ? -5.364  70.177  39.715 1.00 52.19  ? 646  LYS B CD  1 
ATOM   2700 C CE  . LYS B 1 155 ? -5.850  71.085  40.827 1.00 53.55  ? 646  LYS B CE  1 
ATOM   2701 N NZ  . LYS B 1 155 ? -7.040  71.866  40.390 1.00 54.33  ? 646  LYS B NZ  1 
ATOM   2702 N N   . PRO B 1 156 ? -4.357  66.938  36.455 1.00 45.81  ? 647  PRO B N   1 
ATOM   2703 C CA  . PRO B 1 156 ? -3.936  66.184  35.267 1.00 45.65  ? 647  PRO B CA  1 
ATOM   2704 C C   . PRO B 1 156 ? -2.410  66.081  35.240 1.00 44.42  ? 647  PRO B C   1 
ATOM   2705 O O   . PRO B 1 156 ? -1.712  66.981  35.713 1.00 43.68  ? 647  PRO B O   1 
ATOM   2706 C CB  . PRO B 1 156 ? -4.482  67.022  34.115 1.00 46.65  ? 647  PRO B CB  1 
ATOM   2707 C CG  . PRO B 1 156 ? -5.712  67.643  34.718 1.00 47.76  ? 647  PRO B CG  1 
ATOM   2708 C CD  . PRO B 1 156 ? -5.231  68.061  36.084 1.00 46.07  ? 647  PRO B CD  1 
ATOM   2709 N N   . GLU B 1 157 ? -1.893  64.990  34.693 1.00 42.63  ? 648  GLU B N   1 
ATOM   2710 C CA  . GLU B 1 157 ? -0.452  64.808  34.650 1.00 42.42  ? 648  GLU B CA  1 
ATOM   2711 C C   . GLU B 1 157 ? 0.240   65.726  33.642 1.00 41.71  ? 648  GLU B C   1 
ATOM   2712 O O   . GLU B 1 157 ? -0.257  65.943  32.535 1.00 42.03  ? 648  GLU B O   1 
ATOM   2713 C CB  . GLU B 1 157 ? -0.108  63.356  34.339 1.00 42.20  ? 648  GLU B CB  1 
ATOM   2714 C CG  . GLU B 1 157 ? 1.335   63.019  34.630 1.00 45.43  ? 648  GLU B CG  1 
ATOM   2715 C CD  . GLU B 1 157 ? 1.670   61.584  34.301 1.00 47.70  ? 648  GLU B CD  1 
ATOM   2716 O OE1 . GLU B 1 157 ? 1.771   61.270  33.093 1.00 48.05  ? 648  GLU B OE1 1 
ATOM   2717 O OE2 . GLU B 1 157 ? 1.823   60.774  35.251 1.00 47.41  ? 648  GLU B OE2 1 
ATOM   2718 N N   . ILE B 1 158 ? 1.389   66.264  34.045 1.00 39.42  ? 649  ILE B N   1 
ATOM   2719 C CA  . ILE B 1 158 ? 2.175   67.158  33.204 1.00 38.59  ? 649  ILE B CA  1 
ATOM   2720 C C   . ILE B 1 158 ? 3.392   66.406  32.656 1.00 36.66  ? 649  ILE B C   1 
ATOM   2721 O O   . ILE B 1 158 ? 4.051   65.666  33.389 1.00 36.62  ? 649  ILE B O   1 
ATOM   2722 C CB  . ILE B 1 158 ? 2.679   68.379  34.019 1.00 39.52  ? 649  ILE B CB  1 
ATOM   2723 C CG1 . ILE B 1 158 ? 1.495   69.196  34.534 1.00 40.12  ? 649  ILE B CG1 1 
ATOM   2724 C CG2 . ILE B 1 158 ? 3.581   69.251  33.162 1.00 40.06  ? 649  ILE B CG2 1 
ATOM   2725 C CD1 . ILE B 1 158 ? 1.895   70.395  35.388 1.00 38.39  ? 649  ILE B CD1 1 
ATOM   2726 N N   . ARG B 1 159 ? 3.685   66.581  31.371 1.00 33.66  ? 650  ARG B N   1 
ATOM   2727 C CA  . ARG B 1 159 ? 4.847   65.922  30.782 1.00 32.25  ? 650  ARG B CA  1 
ATOM   2728 C C   . ARG B 1 159 ? 5.925   66.933  30.441 1.00 29.75  ? 650  ARG B C   1 
ATOM   2729 O O   . ARG B 1 159 ? 5.751   67.760  29.560 1.00 29.25  ? 650  ARG B O   1 
ATOM   2730 C CB  . ARG B 1 159 ? 4.453   65.139  29.529 1.00 33.33  ? 650  ARG B CB  1 
ATOM   2731 C CG  . ARG B 1 159 ? 4.127   63.689  29.798 1.00 33.85  ? 650  ARG B CG  1 
ATOM   2732 C CD  . ARG B 1 159 ? 3.106   63.174  28.823 1.00 35.67  ? 650  ARG B CD  1 
ATOM   2733 N NE  . ARG B 1 159 ? 3.612   63.151  27.458 1.00 40.44  ? 650  ARG B NE  1 
ATOM   2734 C CZ  . ARG B 1 159 ? 4.112   62.071  26.862 1.00 42.36  ? 650  ARG B CZ  1 
ATOM   2735 N NH1 . ARG B 1 159 ? 4.174   60.920  27.521 1.00 41.20  ? 650  ARG B NH1 1 
ATOM   2736 N NH2 . ARG B 1 159 ? 4.524   62.137  25.598 1.00 40.94  ? 650  ARG B NH2 1 
ATOM   2737 N N   . LEU B 1 160 ? 7.037   66.864  31.161 1.00 29.08  ? 651  LEU B N   1 
ATOM   2738 C CA  . LEU B 1 160 ? 8.163   67.765  30.942 1.00 29.12  ? 651  LEU B CA  1 
ATOM   2739 C C   . LEU B 1 160 ? 9.248   67.105  30.107 1.00 28.83  ? 651  LEU B C   1 
ATOM   2740 O O   . LEU B 1 160 ? 9.596   65.948  30.341 1.00 31.11  ? 651  LEU B O   1 
ATOM   2741 C CB  . LEU B 1 160 ? 8.783   68.167  32.275 1.00 28.26  ? 651  LEU B CB  1 
ATOM   2742 C CG  . LEU B 1 160 ? 7.938   69.019  33.206 1.00 29.49  ? 651  LEU B CG  1 
ATOM   2743 C CD1 . LEU B 1 160 ? 8.667   69.160  34.543 1.00 32.48  ? 651  LEU B CD1 1 
ATOM   2744 C CD2 . LEU B 1 160 ? 7.699   70.380  32.577 1.00 28.61  ? 651  LEU B CD2 1 
ATOM   2745 N N   . PRO B 1 161 ? 9.799   67.825  29.117 1.00 28.09  ? 652  PRO B N   1 
ATOM   2746 C CA  . PRO B 1 161 ? 10.857  67.212  28.308 1.00 26.91  ? 652  PRO B CA  1 
ATOM   2747 C C   . PRO B 1 161 ? 12.133  67.112  29.160 1.00 27.30  ? 652  PRO B C   1 
ATOM   2748 O O   . PRO B 1 161 ? 12.272  67.813  30.163 1.00 26.23  ? 652  PRO B O   1 
ATOM   2749 C CB  . PRO B 1 161 ? 10.976  68.168  27.123 1.00 24.35  ? 652  PRO B CB  1 
ATOM   2750 C CG  . PRO B 1 161 ? 10.662  69.482  27.722 1.00 25.95  ? 652  PRO B CG  1 
ATOM   2751 C CD  . PRO B 1 161 ? 9.467   69.169  28.614 1.00 27.76  ? 652  PRO B CD  1 
ATOM   2752 N N   . SER B 1 162 ? 13.052  66.236  28.768 1.00 28.87  ? 653  SER B N   1 
ATOM   2753 C CA  . SER B 1 162 ? 14.292  66.024  29.518 1.00 30.38  ? 653  SER B CA  1 
ATOM   2754 C C   . SER B 1 162 ? 15.137  67.261  29.821 1.00 31.03  ? 653  SER B C   1 
ATOM   2755 O O   . SER B 1 162 ? 15.882  67.273  30.796 1.00 31.39  ? 653  SER B O   1 
ATOM   2756 C CB  . SER B 1 162 ? 15.165  65.021  28.788 1.00 30.14  ? 653  SER B CB  1 
ATOM   2757 O OG  . SER B 1 162 ? 15.607  65.592  27.575 1.00 35.84  ? 653  SER B OG  1 
ATOM   2758 N N   . GLY B 1 163 ? 15.033  68.292  28.989 1.00 31.35  ? 654  GLY B N   1 
ATOM   2759 C CA  . GLY B 1 163 ? 15.820  69.493  29.209 1.00 31.76  ? 654  GLY B CA  1 
ATOM   2760 C C   . GLY B 1 163 ? 15.224  70.462  30.211 1.00 32.45  ? 654  GLY B C   1 
ATOM   2761 O O   . GLY B 1 163 ? 15.734  71.571  30.408 1.00 33.10  ? 654  GLY B O   1 
ATOM   2762 N N   . SER B 1 164 ? 14.141  70.046  30.849 1.00 31.45  ? 655  SER B N   1 
ATOM   2763 C CA  . SER B 1 164 ? 13.475  70.880  31.836 1.00 31.20  ? 655  SER B CA  1 
ATOM   2764 C C   . SER B 1 164 ? 14.273  70.897  33.134 1.00 31.50  ? 655  SER B C   1 
ATOM   2765 O O   . SER B 1 164 ? 14.857  69.881  33.538 1.00 31.33  ? 655  SER B O   1 
ATOM   2766 C CB  . SER B 1 164 ? 12.064  70.349  32.087 1.00 31.53  ? 655  SER B CB  1 
ATOM   2767 O OG  . SER B 1 164 ? 11.393  70.141  30.855 1.00 32.50  ? 655  SER B OG  1 
ATOM   2768 N N   . ASP B 1 165 ? 14.303  72.055  33.783 1.00 31.86  ? 656  ASP B N   1 
ATOM   2769 C CA  . ASP B 1 165 ? 15.047  72.201  35.033 1.00 32.39  ? 656  ASP B CA  1 
ATOM   2770 C C   . ASP B 1 165 ? 14.154  72.489  36.223 1.00 32.23  ? 656  ASP B C   1 
ATOM   2771 O O   . ASP B 1 165 ? 14.593  72.453  37.367 1.00 29.84  ? 656  ASP B O   1 
ATOM   2772 C CB  . ASP B 1 165 ? 16.102  73.306  34.907 1.00 33.59  ? 656  ASP B CB  1 
ATOM   2773 C CG  . ASP B 1 165 ? 17.178  72.972  33.891 1.00 33.84  ? 656  ASP B CG  1 
ATOM   2774 O OD1 . ASP B 1 165 ? 17.454  71.770  33.684 1.00 35.92  ? 656  ASP B OD1 1 
ATOM   2775 O OD2 . ASP B 1 165 ? 17.758  73.910  33.310 1.00 34.85  ? 656  ASP B OD2 1 
ATOM   2776 N N   . HIS B 1 166 ? 12.892  72.783  35.955 1.00 34.68  ? 657  HIS B N   1 
ATOM   2777 C CA  . HIS B 1 166 ? 11.962  73.057  37.032 1.00 36.30  ? 657  HIS B CA  1 
ATOM   2778 C C   . HIS B 1 166 ? 10.524  72.969  36.569 1.00 36.69  ? 657  HIS B C   1 
ATOM   2779 O O   . HIS B 1 166 ? 10.238  72.921  35.370 1.00 35.90  ? 657  HIS B O   1 
ATOM   2780 C CB  . HIS B 1 166 ? 12.219  74.447  37.631 1.00 36.58  ? 657  HIS B CB  1 
ATOM   2781 C CG  . HIS B 1 166 ? 12.046  75.572  36.657 1.00 39.36  ? 657  HIS B CG  1 
ATOM   2782 N ND1 . HIS B 1 166 ? 13.112  76.207  36.052 1.00 40.17  ? 657  HIS B ND1 1 
ATOM   2783 C CD2 . HIS B 1 166 ? 10.930  76.165  36.168 1.00 39.72  ? 657  HIS B CD2 1 
ATOM   2784 C CE1 . HIS B 1 166 ? 12.659  77.141  35.235 1.00 38.93  ? 657  HIS B CE1 1 
ATOM   2785 N NE2 . HIS B 1 166 ? 11.339  77.135  35.286 1.00 40.47  ? 657  HIS B NE2 1 
ATOM   2786 N N   . VAL B 1 167 ? 9.623   72.918  37.540 1.00 37.60  ? 658  VAL B N   1 
ATOM   2787 C CA  . VAL B 1 167 ? 8.203   72.889  37.252 1.00 39.41  ? 658  VAL B CA  1 
ATOM   2788 C C   . VAL B 1 167 ? 7.585   74.033  38.057 1.00 40.10  ? 658  VAL B C   1 
ATOM   2789 O O   . VAL B 1 167 ? 7.849   74.200  39.250 1.00 40.01  ? 658  VAL B O   1 
ATOM   2790 C CB  . VAL B 1 167 ? 7.562   71.505  37.599 1.00 38.89  ? 658  VAL B CB  1 
ATOM   2791 C CG1 . VAL B 1 167 ? 8.133   70.954  38.882 1.00 37.80  ? 658  VAL B CG1 1 
ATOM   2792 C CG2 . VAL B 1 167 ? 6.058   71.646  37.701 1.00 39.93  ? 658  VAL B CG2 1 
ATOM   2793 N N   . MET B 1 168 ? 6.797   74.848  37.373 1.00 41.43  ? 659  MET B N   1 
ATOM   2794 C CA  . MET B 1 168 ? 6.155   75.995  37.993 1.00 42.93  ? 659  MET B CA  1 
ATOM   2795 C C   . MET B 1 168 ? 4.671   75.719  38.153 1.00 42.58  ? 659  MET B C   1 
ATOM   2796 O O   . MET B 1 168 ? 3.994   75.348  37.193 1.00 41.01  ? 659  MET B O   1 
ATOM   2797 C CB  . MET B 1 168 ? 6.344   77.234  37.113 1.00 45.09  ? 659  MET B CB  1 
ATOM   2798 C CG  . MET B 1 168 ? 6.034   78.551  37.802 1.00 47.49  ? 659  MET B CG  1 
ATOM   2799 S SD  . MET B 1 168 ? 7.334   78.974  38.970 1.00 52.27  ? 659  MET B SD  1 
ATOM   2800 C CE  . MET B 1 168 ? 8.807   78.837  37.855 1.00 49.23  ? 659  MET B CE  1 
ATOM   2801 N N   . LEU B 1 169 ? 4.170   75.893  39.369 1.00 42.85  ? 660  LEU B N   1 
ATOM   2802 C CA  . LEU B 1 169 ? 2.755   75.674  39.640 1.00 42.81  ? 660  LEU B CA  1 
ATOM   2803 C C   . LEU B 1 169 ? 2.182   77.012  40.085 1.00 44.39  ? 660  LEU B C   1 
ATOM   2804 O O   . LEU B 1 169 ? 2.514   77.519  41.155 1.00 44.11  ? 660  LEU B O   1 
ATOM   2805 C CB  . LEU B 1 169 ? 2.584   74.606  40.724 1.00 40.92  ? 660  LEU B CB  1 
ATOM   2806 C CG  . LEU B 1 169 ? 3.151   73.232  40.358 1.00 38.04  ? 660  LEU B CG  1 
ATOM   2807 C CD1 . LEU B 1 169 ? 3.147   72.320  41.554 1.00 39.79  ? 660  LEU B CD1 1 
ATOM   2808 C CD2 . LEU B 1 169 ? 2.337   72.639  39.256 1.00 38.37  ? 660  LEU B CD2 1 
ATOM   2809 N N   . LYS B 1 170 ? 1.344   77.598  39.239 1.00 46.93  ? 661  LYS B N   1 
ATOM   2810 C CA  . LYS B 1 170 ? 0.759   78.890  39.554 1.00 50.28  ? 661  LYS B CA  1 
ATOM   2811 C C   . LYS B 1 170 ? -0.755  78.861  39.616 1.00 49.97  ? 661  LYS B C   1 
ATOM   2812 O O   . LYS B 1 170 ? -1.386  77.846  39.301 1.00 48.43  ? 661  LYS B O   1 
ATOM   2813 C CB  . LYS B 1 170 ? 1.224   79.940  38.542 1.00 53.21  ? 661  LYS B CB  1 
ATOM   2814 C CG  . LYS B 1 170 ? 2.704   80.269  38.657 1.00 57.59  ? 661  LYS B CG  1 
ATOM   2815 C CD  . LYS B 1 170 ? 3.135   81.320  37.644 1.00 62.80  ? 661  LYS B CD  1 
ATOM   2816 C CE  . LYS B 1 170 ? 4.624   81.657  37.783 1.00 64.89  ? 661  LYS B CE  1 
ATOM   2817 N NZ  . LYS B 1 170 ? 5.079   82.623  36.737 1.00 65.59  ? 661  LYS B NZ  1 
ATOM   2818 N N   . SER B 1 171 ? -1.325  79.988  40.039 1.00 49.79  ? 662  SER B N   1 
ATOM   2819 C CA  . SER B 1 171 ? -2.769  80.121  40.168 1.00 50.12  ? 662  SER B CA  1 
ATOM   2820 C C   . SER B 1 171 ? -3.311  79.018  41.083 1.00 49.83  ? 662  SER B C   1 
ATOM   2821 O O   . SER B 1 171 ? -4.240  78.284  40.732 1.00 49.11  ? 662  SER B O   1 
ATOM   2822 C CB  . SER B 1 171 ? -3.423  80.063  38.782 1.00 49.67  ? 662  SER B CB  1 
ATOM   2823 O OG  . SER B 1 171 ? -2.934  81.115  37.962 1.00 46.99  ? 662  SER B OG  1 
ATOM   2824 N N   . LEU B 1 172 ? -2.698  78.914  42.260 1.00 49.76  ? 663  LEU B N   1 
ATOM   2825 C CA  . LEU B 1 172 ? -3.075  77.932  43.274 1.00 49.64  ? 663  LEU B CA  1 
ATOM   2826 C C   . LEU B 1 172 ? -3.963  78.665  44.270 1.00 49.12  ? 663  LEU B C   1 
ATOM   2827 O O   . LEU B 1 172 ? -3.998  79.896  44.269 1.00 49.16  ? 663  LEU B O   1 
ATOM   2828 C CB  . LEU B 1 172 ? -1.829  77.418  44.020 1.00 48.04  ? 663  LEU B CB  1 
ATOM   2829 C CG  . LEU B 1 172 ? -0.647  76.790  43.277 1.00 45.70  ? 663  LEU B CG  1 
ATOM   2830 C CD1 . LEU B 1 172 ? 0.431   76.400  44.273 1.00 43.07  ? 663  LEU B CD1 1 
ATOM   2831 C CD2 . LEU B 1 172 ? -1.117  75.576  42.502 1.00 46.16  ? 663  LEU B CD2 1 
ATOM   2832 N N   . ASP B 1 173 ? -4.676  77.926  45.116 1.00 48.10  ? 664  ASP B N   1 
ATOM   2833 C CA  . ASP B 1 173 ? -5.504  78.575  46.122 1.00 48.61  ? 664  ASP B CA  1 
ATOM   2834 C C   . ASP B 1 173 ? -4.571  79.108  47.211 1.00 48.79  ? 664  ASP B C   1 
ATOM   2835 O O   . ASP B 1 173 ? -3.482  78.574  47.420 1.00 49.56  ? 664  ASP B O   1 
ATOM   2836 C CB  . ASP B 1 173 ? -6.509  77.595  46.732 1.00 48.84  ? 664  ASP B CB  1 
ATOM   2837 C CG  . ASP B 1 173 ? -7.482  77.034  45.705 1.00 48.80  ? 664  ASP B CG  1 
ATOM   2838 O OD1 . ASP B 1 173 ? -7.907  77.798  44.813 1.00 48.30  ? 664  ASP B OD1 1 
ATOM   2839 O OD2 . ASP B 1 173 ? -7.836  75.835  45.798 1.00 47.65  ? 664  ASP B OD2 1 
ATOM   2840 N N   . TRP B 1 174 ? -4.997  80.168  47.892 1.00 48.41  ? 665  TRP B N   1 
ATOM   2841 C CA  . TRP B 1 174 ? -4.202  80.778  48.956 1.00 46.62  ? 665  TRP B CA  1 
ATOM   2842 C C   . TRP B 1 174 ? -4.390  80.060  50.284 1.00 44.85  ? 665  TRP B C   1 
ATOM   2843 O O   . TRP B 1 174 ? -5.475  79.556  50.584 1.00 43.44  ? 665  TRP B O   1 
ATOM   2844 C CB  . TRP B 1 174 ? -4.583  82.256  49.124 1.00 48.60  ? 665  TRP B CB  1 
ATOM   2845 C CG  . TRP B 1 174 ? -4.282  83.092  47.912 1.00 50.38  ? 665  TRP B CG  1 
ATOM   2846 C CD1 . TRP B 1 174 ? -4.977  83.117  46.731 1.00 49.88  ? 665  TRP B CD1 1 
ATOM   2847 C CD2 . TRP B 1 174 ? -3.151  83.949  47.728 1.00 50.44  ? 665  TRP B CD2 1 
ATOM   2848 N NE1 . TRP B 1 174 ? -4.340  83.929  45.824 1.00 50.74  ? 665  TRP B NE1 1 
ATOM   2849 C CE2 . TRP B 1 174 ? -3.216  84.452  46.410 1.00 51.51  ? 665  TRP B CE2 1 
ATOM   2850 C CE3 . TRP B 1 174 ? -2.083  84.335  48.549 1.00 52.44  ? 665  TRP B CE3 1 
ATOM   2851 C CZ2 . TRP B 1 174 ? -2.251  85.323  45.891 1.00 53.73  ? 665  TRP B CZ2 1 
ATOM   2852 C CZ3 . TRP B 1 174 ? -1.120  85.202  48.035 1.00 54.81  ? 665  TRP B CZ3 1 
ATOM   2853 C CH2 . TRP B 1 174 ? -1.212  85.685  46.716 1.00 54.70  ? 665  TRP B CH2 1 
ATOM   2854 N N   . ASN B 1 175 ? -3.326  80.005  51.078 1.00 44.05  ? 666  ASN B N   1 
ATOM   2855 C CA  . ASN B 1 175 ? -3.397  79.356  52.382 1.00 42.53  ? 666  ASN B CA  1 
ATOM   2856 C C   . ASN B 1 175 ? -3.873  77.907  52.206 1.00 41.36  ? 666  ASN B C   1 
ATOM   2857 O O   . ASN B 1 175 ? -4.666  77.400  52.995 1.00 39.81  ? 666  ASN B O   1 
ATOM   2858 C CB  . ASN B 1 175 ? -4.364  80.154  53.267 1.00 42.59  ? 666  ASN B CB  1 
ATOM   2859 C CG  . ASN B 1 175 ? -4.497  79.589  54.662 1.00 43.56  ? 666  ASN B CG  1 
ATOM   2860 O OD1 . ASN B 1 175 ? -3.501  79.362  55.360 1.00 43.23  ? 666  ASN B OD1 1 
ATOM   2861 N ND2 . ASN B 1 175 ? -5.740  79.373  55.090 1.00 41.90  ? 666  ASN B ND2 1 
ATOM   2862 N N   . ALA B 1 176 ? -3.376  77.250  51.162 1.00 39.92  ? 667  ALA B N   1 
ATOM   2863 C CA  . ALA B 1 176 ? -3.752  75.875  50.869 1.00 38.71  ? 667  ALA B CA  1 
ATOM   2864 C C   . ALA B 1 176 ? -2.533  74.953  50.860 1.00 39.31  ? 667  ALA B C   1 
ATOM   2865 O O   . ALA B 1 176 ? -1.414  75.386  50.587 1.00 40.54  ? 667  ALA B O   1 
ATOM   2866 C CB  . ALA B 1 176 ? -4.465  75.816  49.533 1.00 38.47  ? 667  ALA B CB  1 
ATOM   2867 N N   . GLU B 1 177 ? -2.761  73.677  51.147 1.00 38.58  ? 668  GLU B N   1 
ATOM   2868 C CA  . GLU B 1 177 ? -1.694  72.692  51.205 1.00 37.85  ? 668  GLU B CA  1 
ATOM   2869 C C   . GLU B 1 177 ? -1.674  71.787  49.987 1.00 38.54  ? 668  GLU B C   1 
ATOM   2870 O O   . GLU B 1 177 ? -2.695  71.234  49.598 1.00 38.06  ? 668  GLU B O   1 
ATOM   2871 C CB  . GLU B 1 177 ? -1.848  71.868  52.475 1.00 37.05  ? 668  GLU B CB  1 
ATOM   2872 C CG  . GLU B 1 177 ? -1.891  72.736  53.715 1.00 37.25  ? 668  GLU B CG  1 
ATOM   2873 C CD  . GLU B 1 177 ? -2.095  71.944  54.981 1.00 36.79  ? 668  GLU B CD  1 
ATOM   2874 O OE1 . GLU B 1 177 ? -1.186  71.184  55.366 1.00 35.13  ? 668  GLU B OE1 1 
ATOM   2875 O OE2 . GLU B 1 177 ? -3.171  72.087  55.591 1.00 38.25  ? 668  GLU B OE2 1 
ATOM   2876 N N   . TYR B 1 178 ? -0.496  71.633  49.395 1.00 40.11  ? 669  TYR B N   1 
ATOM   2877 C CA  . TYR B 1 178 ? -0.338  70.813  48.203 1.00 40.85  ? 669  TYR B CA  1 
ATOM   2878 C C   . TYR B 1 178 ? 0.839   69.870  48.301 1.00 41.88  ? 669  TYR B C   1 
ATOM   2879 O O   . TYR B 1 178 ? 1.665   69.982  49.204 1.00 43.44  ? 669  TYR B O   1 
ATOM   2880 C CB  . TYR B 1 178 ? -0.080  71.691  46.984 1.00 40.66  ? 669  TYR B CB  1 
ATOM   2881 C CG  . TYR B 1 178 ? -1.229  72.532  46.511 1.00 39.49  ? 669  TYR B CG  1 
ATOM   2882 C CD1 . TYR B 1 178 ? -1.446  73.807  47.020 1.00 37.30  ? 669  TYR B CD1 1 
ATOM   2883 C CD2 . TYR B 1 178 ? -2.081  72.062  45.522 1.00 39.83  ? 669  TYR B CD2 1 
ATOM   2884 C CE1 . TYR B 1 178 ? -2.479  74.592  46.550 1.00 38.23  ? 669  TYR B CE1 1 
ATOM   2885 C CE2 . TYR B 1 178 ? -3.118  72.837  45.049 1.00 41.26  ? 669  TYR B CE2 1 
ATOM   2886 C CZ  . TYR B 1 178 ? -3.314  74.101  45.564 1.00 39.59  ? 669  TYR B CZ  1 
ATOM   2887 O OH  . TYR B 1 178 ? -4.354  74.860  45.079 1.00 40.84  ? 669  TYR B OH  1 
ATOM   2888 N N   . GLU B 1 179 ? 0.913   68.950  47.344 1.00 42.20  ? 670  GLU B N   1 
ATOM   2889 C CA  . GLU B 1 179 ? 2.028   68.018  47.243 1.00 43.20  ? 670  GLU B CA  1 
ATOM   2890 C C   . GLU B 1 179 ? 2.320   67.758  45.766 1.00 42.79  ? 670  GLU B C   1 
ATOM   2891 O O   . GLU B 1 179 ? 1.407   67.737  44.938 1.00 42.20  ? 670  GLU B O   1 
ATOM   2892 C CB  . GLU B 1 179 ? 1.736   66.706  47.974 1.00 44.68  ? 670  GLU B CB  1 
ATOM   2893 C CG  . GLU B 1 179 ? 0.483   65.979  47.552 1.00 47.46  ? 670  GLU B CG  1 
ATOM   2894 C CD  . GLU B 1 179 ? 0.364   64.621  48.227 1.00 49.15  ? 670  GLU B CD  1 
ATOM   2895 O OE1 . GLU B 1 179 ? -0.740  64.029  48.182 1.00 48.87  ? 670  GLU B OE1 1 
ATOM   2896 O OE2 . GLU B 1 179 ? 1.381   64.149  48.793 1.00 48.76  ? 670  GLU B OE2 1 
ATOM   2897 N N   . VAL B 1 180 ? 3.599   67.587  45.437 1.00 42.59  ? 671  VAL B N   1 
ATOM   2898 C CA  . VAL B 1 180 ? 4.014   67.342  44.061 1.00 40.47  ? 671  VAL B CA  1 
ATOM   2899 C C   . VAL B 1 180 ? 4.674   65.985  43.938 1.00 39.99  ? 671  VAL B C   1 
ATOM   2900 O O   . VAL B 1 180 ? 5.393   65.554  44.833 1.00 39.97  ? 671  VAL B O   1 
ATOM   2901 C CB  . VAL B 1 180 ? 5.038   68.378  43.580 1.00 40.25  ? 671  VAL B CB  1 
ATOM   2902 C CG1 . VAL B 1 180 ? 5.190   68.284  42.075 1.00 40.52  ? 671  VAL B CG1 1 
ATOM   2903 C CG2 . VAL B 1 180 ? 4.616   69.764  43.991 1.00 41.59  ? 671  VAL B CG2 1 
ATOM   2904 N N   . TYR B 1 181 ? 4.425   65.313  42.824 1.00 39.59  ? 672  TYR B N   1 
ATOM   2905 C CA  . TYR B 1 181 ? 5.029   64.016  42.565 1.00 40.24  ? 672  TYR B CA  1 
ATOM   2906 C C   . TYR B 1 181 ? 5.741   64.120  41.230 1.00 37.93  ? 672  TYR B C   1 
ATOM   2907 O O   . TYR B 1 181 ? 5.162   64.569  40.247 1.00 39.84  ? 672  TYR B O   1 
ATOM   2908 C CB  . TYR B 1 181 ? 3.963   62.910  42.524 1.00 44.10  ? 672  TYR B CB  1 
ATOM   2909 C CG  . TYR B 1 181 ? 3.517   62.461  43.899 1.00 48.42  ? 672  TYR B CG  1 
ATOM   2910 C CD1 . TYR B 1 181 ? 3.012   63.380  44.825 1.00 52.50  ? 672  TYR B CD1 1 
ATOM   2911 C CD2 . TYR B 1 181 ? 3.615   61.128  44.286 1.00 49.74  ? 672  TYR B CD2 1 
ATOM   2912 C CE1 . TYR B 1 181 ? 2.615   62.981  46.108 1.00 53.99  ? 672  TYR B CE1 1 
ATOM   2913 C CE2 . TYR B 1 181 ? 3.222   60.716  45.564 1.00 53.04  ? 672  TYR B CE2 1 
ATOM   2914 C CZ  . TYR B 1 181 ? 2.724   61.649  46.469 1.00 55.02  ? 672  TYR B CZ  1 
ATOM   2915 O OH  . TYR B 1 181 ? 2.338   61.258  47.734 1.00 57.26  ? 672  TYR B OH  1 
ATOM   2916 N N   . VAL B 1 182 ? 7.007   63.724  41.201 1.00 34.39  ? 673  VAL B N   1 
ATOM   2917 C CA  . VAL B 1 182 ? 7.790   63.792  39.979 1.00 28.79  ? 673  VAL B CA  1 
ATOM   2918 C C   . VAL B 1 182 ? 8.502   62.464  39.712 1.00 27.60  ? 673  VAL B C   1 
ATOM   2919 O O   . VAL B 1 182 ? 9.239   61.935  40.552 1.00 24.68  ? 673  VAL B O   1 
ATOM   2920 C CB  . VAL B 1 182 ? 8.814   64.937  40.060 1.00 28.61  ? 673  VAL B CB  1 
ATOM   2921 C CG1 . VAL B 1 182 ? 9.515   65.110  38.729 1.00 28.92  ? 673  VAL B CG1 1 
ATOM   2922 C CG2 . VAL B 1 182 ? 8.120   66.220  40.457 1.00 26.34  ? 673  VAL B CG2 1 
ATOM   2923 N N   . VAL B 1 183 ? 8.256   61.929  38.525 1.00 26.16  ? 674  VAL B N   1 
ATOM   2924 C CA  . VAL B 1 183 ? 8.829   60.666  38.107 1.00 25.84  ? 674  VAL B CA  1 
ATOM   2925 C C   . VAL B 1 183 ? 9.653   60.868  36.848 1.00 27.23  ? 674  VAL B C   1 
ATOM   2926 O O   . VAL B 1 183 ? 9.235   61.579  35.941 1.00 29.08  ? 674  VAL B O   1 
ATOM   2927 C CB  . VAL B 1 183 ? 7.703   59.629  37.832 1.00 23.74  ? 674  VAL B CB  1 
ATOM   2928 C CG1 . VAL B 1 183 ? 8.202   58.506  36.929 1.00 23.80  ? 674  VAL B CG1 1 
ATOM   2929 C CG2 . VAL B 1 183 ? 7.215   59.062  39.134 1.00 19.88  ? 674  VAL B CG2 1 
ATOM   2930 N N   . ALA B 1 184 ? 10.833  60.255  36.809 1.00 28.29  ? 675  ALA B N   1 
ATOM   2931 C CA  . ALA B 1 184 ? 11.711  60.339  35.643 1.00 28.83  ? 675  ALA B CA  1 
ATOM   2932 C C   . ALA B 1 184 ? 11.467  59.058  34.851 1.00 28.05  ? 675  ALA B C   1 
ATOM   2933 O O   . ALA B 1 184 ? 11.293  57.989  35.428 1.00 27.66  ? 675  ALA B O   1 
ATOM   2934 C CB  . ALA B 1 184 ? 13.180  60.446  36.079 1.00 26.38  ? 675  ALA B CB  1 
ATOM   2935 N N   . GLU B 1 185 ? 11.453  59.158  33.531 1.00 28.01  ? 676  GLU B N   1 
ATOM   2936 C CA  . GLU B 1 185 ? 11.168  57.988  32.727 1.00 30.63  ? 676  GLU B CA  1 
ATOM   2937 C C   . GLU B 1 185 ? 12.009  57.894  31.478 1.00 31.77  ? 676  GLU B C   1 
ATOM   2938 O O   . GLU B 1 185 ? 12.194  58.888  30.778 1.00 31.83  ? 676  GLU B O   1 
ATOM   2939 C CB  . GLU B 1 185 ? 9.692   58.011  32.338 1.00 31.66  ? 676  GLU B CB  1 
ATOM   2940 C CG  . GLU B 1 185 ? 9.244   56.910  31.417 1.00 36.92  ? 676  GLU B CG  1 
ATOM   2941 C CD  . GLU B 1 185 ? 7.864   57.189  30.834 1.00 43.16  ? 676  GLU B CD  1 
ATOM   2942 O OE1 . GLU B 1 185 ? 7.711   58.219  30.128 1.00 44.13  ? 676  GLU B OE1 1 
ATOM   2943 O OE2 . GLU B 1 185 ? 6.933   56.382  31.083 1.00 45.38  ? 676  GLU B OE2 1 
ATOM   2944 N N   . ASN B 1 186 ? 12.515  56.693  31.207 1.00 32.88  ? 677  ASN B N   1 
ATOM   2945 C CA  . ASN B 1 186 ? 13.304  56.438  30.011 1.00 35.37  ? 677  ASN B CA  1 
ATOM   2946 C C   . ASN B 1 186 ? 12.689  55.230  29.295 1.00 37.45  ? 677  ASN B C   1 
ATOM   2947 O O   . ASN B 1 186 ? 11.599  54.793  29.668 1.00 36.64  ? 677  ASN B O   1 
ATOM   2948 C CB  . ASN B 1 186 ? 14.785  56.205  30.355 1.00 34.79  ? 677  ASN B CB  1 
ATOM   2949 C CG  . ASN B 1 186 ? 15.021  54.940  31.145 1.00 36.05  ? 677  ASN B CG  1 
ATOM   2950 O OD1 . ASN B 1 186 ? 14.103  54.150  31.373 1.00 37.27  ? 677  ASN B OD1 1 
ATOM   2951 N ND2 . ASN B 1 186 ? 16.270  54.733  31.563 1.00 33.86  ? 677  ASN B ND2 1 
ATOM   2952 N N   . GLN B 1 187 ? 13.365  54.699  28.275 1.00 39.53  ? 678  GLN B N   1 
ATOM   2953 C CA  . GLN B 1 187 ? 12.825  53.566  27.521 1.00 41.74  ? 678  GLN B CA  1 
ATOM   2954 C C   . GLN B 1 187 ? 12.602  52.352  28.404 1.00 41.96  ? 678  GLN B C   1 
ATOM   2955 O O   . GLN B 1 187 ? 11.687  51.571  28.174 1.00 41.28  ? 678  GLN B O   1 
ATOM   2956 C CB  . GLN B 1 187 ? 13.763  53.148  26.385 1.00 44.40  ? 678  GLN B CB  1 
ATOM   2957 C CG  . GLN B 1 187 ? 14.430  54.287  25.630 1.00 52.20  ? 678  GLN B CG  1 
ATOM   2958 C CD  . GLN B 1 187 ? 13.469  55.128  24.808 1.00 54.33  ? 678  GLN B CD  1 
ATOM   2959 O OE1 . GLN B 1 187 ? 13.881  56.102  24.168 1.00 55.37  ? 678  GLN B OE1 1 
ATOM   2960 N NE2 . GLN B 1 187 ? 12.190  54.760  24.816 1.00 54.50  ? 678  GLN B NE2 1 
ATOM   2961 N N   . GLN B 1 188 ? 13.451  52.191  29.410 1.00 43.35  ? 679  GLN B N   1 
ATOM   2962 C CA  . GLN B 1 188 ? 13.360  51.050  30.306 1.00 44.04  ? 679  GLN B CA  1 
ATOM   2963 C C   . GLN B 1 188 ? 12.127  51.098  31.204 1.00 43.76  ? 679  GLN B C   1 
ATOM   2964 O O   . GLN B 1 188 ? 11.531  50.067  31.511 1.00 43.50  ? 679  GLN B O   1 
ATOM   2965 C CB  . GLN B 1 188 ? 14.619  50.974  31.164 1.00 47.19  ? 679  GLN B CB  1 
ATOM   2966 C CG  . GLN B 1 188 ? 14.968  49.571  31.601 1.00 52.19  ? 679  GLN B CG  1 
ATOM   2967 C CD  . GLN B 1 188 ? 15.131  48.643  30.414 1.00 55.09  ? 679  GLN B CD  1 
ATOM   2968 O OE1 . GLN B 1 188 ? 15.555  49.069  29.336 1.00 54.81  ? 679  GLN B OE1 1 
ATOM   2969 N NE2 . GLN B 1 188 ? 14.808  47.366  30.607 1.00 55.66  ? 679  GLN B NE2 1 
ATOM   2970 N N   . GLY B 1 189 ? 11.747  52.296  31.631 1.00 43.27  ? 680  GLY B N   1 
ATOM   2971 C CA  . GLY B 1 189 ? 10.587  52.418  32.490 1.00 42.37  ? 680  GLY B CA  1 
ATOM   2972 C C   . GLY B 1 189 ? 10.550  53.692  33.312 1.00 42.47  ? 680  GLY B C   1 
ATOM   2973 O O   . GLY B 1 189 ? 11.252  54.664  33.011 1.00 43.43  ? 680  GLY B O   1 
ATOM   2974 N N   . LYS B 1 190 ? 9.721   53.685  34.354 1.00 40.48  ? 681  LYS B N   1 
ATOM   2975 C CA  . LYS B 1 190 ? 9.579   54.836  35.229 1.00 38.49  ? 681  LYS B CA  1 
ATOM   2976 C C   . LYS B 1 190 ? 10.339  54.594  36.522 1.00 36.58  ? 681  LYS B C   1 
ATOM   2977 O O   . LYS B 1 190 ? 10.523  53.460  36.943 1.00 37.68  ? 681  LYS B O   1 
ATOM   2978 C CB  . LYS B 1 190 ? 8.101   55.093  35.536 1.00 39.19  ? 681  LYS B CB  1 
ATOM   2979 C CG  . LYS B 1 190 ? 7.241   55.332  34.299 1.00 41.04  ? 681  LYS B CG  1 
ATOM   2980 C CD  . LYS B 1 190 ? 5.809   55.755  34.656 1.00 42.22  ? 681  LYS B CD  1 
ATOM   2981 C CE  . LYS B 1 190 ? 5.079   54.684  35.465 1.00 44.64  ? 681  LYS B CE  1 
ATOM   2982 N NZ  . LYS B 1 190 ? 3.666   55.041  35.809 1.00 44.36  ? 681  LYS B NZ  1 
ATOM   2983 N N   . SER B 1 191 ? 10.797  55.671  37.138 1.00 33.69  ? 682  SER B N   1 
ATOM   2984 C CA  . SER B 1 191 ? 11.530  55.584  38.387 1.00 31.15  ? 682  SER B CA  1 
ATOM   2985 C C   . SER B 1 191 ? 10.511  55.660  39.514 1.00 31.51  ? 682  SER B C   1 
ATOM   2986 O O   . SER B 1 191 ? 9.312   55.793  39.270 1.00 30.03  ? 682  SER B O   1 
ATOM   2987 C CB  . SER B 1 191 ? 12.503  56.766  38.508 1.00 29.95  ? 682  SER B CB  1 
ATOM   2988 O OG  . SER B 1 191 ? 11.807  57.999  38.670 1.00 23.16  ? 682  SER B OG  1 
ATOM   2989 N N   . LYS B 1 192 ? 10.977  55.567  40.750 1.00 31.57  ? 683  LYS B N   1 
ATOM   2990 C CA  . LYS B 1 192 ? 10.051  55.698  41.850 1.00 32.88  ? 683  LYS B CA  1 
ATOM   2991 C C   . LYS B 1 192 ? 9.872   57.208  41.927 1.00 31.83  ? 683  LYS B C   1 
ATOM   2992 O O   . LYS B 1 192 ? 10.767  57.959  41.545 1.00 31.91  ? 683  LYS B O   1 
ATOM   2993 C CB  . LYS B 1 192 ? 10.637  55.118  43.143 1.00 35.69  ? 683  LYS B CB  1 
ATOM   2994 C CG  . LYS B 1 192 ? 11.805  55.869  43.739 1.00 43.01  ? 683  LYS B CG  1 
ATOM   2995 C CD  . LYS B 1 192 ? 12.341  55.114  44.952 1.00 48.60  ? 683  LYS B CD  1 
ATOM   2996 C CE  . LYS B 1 192 ? 13.328  55.957  45.761 1.00 52.12  ? 683  LYS B CE  1 
ATOM   2997 N NZ  . LYS B 1 192 ? 13.750  55.261  47.030 1.00 54.18  ? 683  LYS B NZ  1 
ATOM   2998 N N   . ALA B 1 193 ? 8.716   57.658  42.391 1.00 30.25  ? 684  ALA B N   1 
ATOM   2999 C CA  . ALA B 1 193 ? 8.451   59.079  42.469 1.00 28.66  ? 684  ALA B CA  1 
ATOM   3000 C C   . ALA B 1 193 ? 9.124   59.804  43.640 1.00 29.79  ? 684  ALA B C   1 
ATOM   3001 O O   . ALA B 1 193 ? 9.408   59.222  44.687 1.00 29.66  ? 684  ALA B O   1 
ATOM   3002 C CB  . ALA B 1 193 ? 6.947   59.307  42.506 1.00 24.93  ? 684  ALA B CB  1 
ATOM   3003 N N   . ALA B 1 194 ? 9.391   61.087  43.426 1.00 30.81  ? 685  ALA B N   1 
ATOM   3004 C CA  . ALA B 1 194 ? 9.976   61.962  44.430 1.00 30.62  ? 685  ALA B CA  1 
ATOM   3005 C C   . ALA B 1 194 ? 8.800   62.857  44.816 1.00 32.10  ? 685  ALA B C   1 
ATOM   3006 O O   . ALA B 1 194 ? 7.998   63.223  43.957 1.00 30.39  ? 685  ALA B O   1 
ATOM   3007 C CB  . ALA B 1 194 ? 11.108  62.787  43.824 1.00 30.34  ? 685  ALA B CB  1 
ATOM   3008 N N   . HIS B 1 195 ? 8.691   63.195  46.102 1.00 34.88  ? 686  HIS B N   1 
ATOM   3009 C CA  . HIS B 1 195 ? 7.585   64.011  46.593 1.00 36.40  ? 686  HIS B CA  1 
ATOM   3010 C C   . HIS B 1 195 ? 8.041   65.332  47.176 1.00 36.81  ? 686  HIS B C   1 
ATOM   3011 O O   . HIS B 1 195 ? 9.206   65.512  47.518 1.00 38.69  ? 686  HIS B O   1 
ATOM   3012 C CB  . HIS B 1 195 ? 6.815   63.255  47.671 1.00 40.20  ? 686  HIS B CB  1 
ATOM   3013 C CG  . HIS B 1 195 ? 6.694   61.787  47.407 1.00 46.01  ? 686  HIS B CG  1 
ATOM   3014 N ND1 . HIS B 1 195 ? 6.804   60.843  48.406 1.00 48.24  ? 686  HIS B ND1 1 
ATOM   3015 C CD2 . HIS B 1 195 ? 6.505   61.100  46.256 1.00 47.03  ? 686  HIS B CD2 1 
ATOM   3016 C CE1 . HIS B 1 195 ? 6.693   59.636  47.879 1.00 50.52  ? 686  HIS B CE1 1 
ATOM   3017 N NE2 . HIS B 1 195 ? 6.511   59.765  46.577 1.00 49.50  ? 686  HIS B NE2 1 
ATOM   3018 N N   . PHE B 1 196 ? 7.096   66.250  47.306 1.00 36.08  ? 687  PHE B N   1 
ATOM   3019 C CA  . PHE B 1 196 ? 7.364   67.567  47.849 1.00 36.37  ? 687  PHE B CA  1 
ATOM   3020 C C   . PHE B 1 196 ? 6.014   68.117  48.312 1.00 35.50  ? 687  PHE B C   1 
ATOM   3021 O O   . PHE B 1 196 ? 5.100   68.285  47.507 1.00 35.42  ? 687  PHE B O   1 
ATOM   3022 C CB  . PHE B 1 196 ? 7.968   68.457  46.753 1.00 38.15  ? 687  PHE B CB  1 
ATOM   3023 C CG  . PHE B 1 196 ? 8.394   69.813  47.234 1.00 38.40  ? 687  PHE B CG  1 
ATOM   3024 C CD1 . PHE B 1 196 ? 9.623   69.991  47.850 1.00 39.56  ? 687  PHE B CD1 1 
ATOM   3025 C CD2 . PHE B 1 196 ? 7.548   70.907  47.103 1.00 39.84  ? 687  PHE B CD2 1 
ATOM   3026 C CE1 . PHE B 1 196 ? 10.003  71.239  48.334 1.00 40.33  ? 687  PHE B CE1 1 
ATOM   3027 C CE2 . PHE B 1 196 ? 7.916   72.157  47.583 1.00 40.23  ? 687  PHE B CE2 1 
ATOM   3028 C CZ  . PHE B 1 196 ? 9.147   72.324  48.201 1.00 40.07  ? 687  PHE B CZ  1 
ATOM   3029 N N   . VAL B 1 197 ? 5.875   68.368  49.608 1.00 34.12  ? 688  VAL B N   1 
ATOM   3030 C CA  . VAL B 1 197 ? 4.623   68.899  50.140 1.00 32.36  ? 688  VAL B CA  1 
ATOM   3031 C C   . VAL B 1 197 ? 4.868   70.342  50.498 1.00 31.52  ? 688  VAL B C   1 
ATOM   3032 O O   . VAL B 1 197 ? 5.963   70.693  50.919 1.00 32.40  ? 688  VAL B O   1 
ATOM   3033 C CB  . VAL B 1 197 ? 4.156   68.149  51.418 1.00 32.22  ? 688  VAL B CB  1 
ATOM   3034 C CG1 . VAL B 1 197 ? 2.862   68.760  51.933 1.00 31.94  ? 688  VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 1 197 ? 3.940   66.675  51.120 1.00 30.38  ? 688  VAL B CG2 1 
ATOM   3036 N N   . PHE B 1 198 ? 3.860   71.185  50.326 1.00 31.64  ? 689  PHE B N   1 
ATOM   3037 C CA  . PHE B 1 198 ? 4.021   72.594  50.644 1.00 33.01  ? 689  PHE B CA  1 
ATOM   3038 C C   . PHE B 1 198 ? 2.698   73.296  50.876 1.00 34.07  ? 689  PHE B C   1 
ATOM   3039 O O   . PHE B 1 198 ? 1.632   72.741  50.631 1.00 33.26  ? 689  PHE B O   1 
ATOM   3040 C CB  . PHE B 1 198 ? 4.812   73.306  49.530 1.00 33.04  ? 689  PHE B CB  1 
ATOM   3041 C CG  . PHE B 1 198 ? 4.068   73.433  48.233 1.00 30.86  ? 689  PHE B CG  1 
ATOM   3042 C CD1 . PHE B 1 198 ? 3.402   74.611  47.911 1.00 29.43  ? 689  PHE B CD1 1 
ATOM   3043 C CD2 . PHE B 1 198 ? 4.003   72.363  47.344 1.00 30.28  ? 689  PHE B CD2 1 
ATOM   3044 C CE1 . PHE B 1 198 ? 2.678   74.718  46.718 1.00 29.40  ? 689  PHE B CE1 1 
ATOM   3045 C CE2 . PHE B 1 198 ? 3.279   72.464  46.149 1.00 29.46  ? 689  PHE B CE2 1 
ATOM   3046 C CZ  . PHE B 1 198 ? 2.619   73.638  45.839 1.00 27.94  ? 689  PHE B CZ  1 
ATOM   3047 N N   . ARG B 1 199 ? 2.787   74.532  51.344 1.00 37.45  ? 690  ARG B N   1 
ATOM   3048 C CA  . ARG B 1 199 ? 1.610   75.333  51.636 1.00 40.48  ? 690  ARG B CA  1 
ATOM   3049 C C   . ARG B 1 199 ? 1.752   76.764  51.122 1.00 41.87  ? 690  ARG B C   1 
ATOM   3050 O O   . ARG B 1 199 ? 2.723   77.461  51.427 1.00 42.26  ? 690  ARG B O   1 
ATOM   3051 C CB  . ARG B 1 199 ? 1.371   75.350  53.144 1.00 41.74  ? 690  ARG B CB  1 
ATOM   3052 C CG  . ARG B 1 199 ? 0.135   76.098  53.559 1.00 43.34  ? 690  ARG B CG  1 
ATOM   3053 C CD  . ARG B 1 199 ? -0.086  76.005  55.047 1.00 44.49  ? 690  ARG B CD  1 
ATOM   3054 N NE  . ARG B 1 199 ? -1.414  76.498  55.381 1.00 48.12  ? 690  ARG B NE  1 
ATOM   3055 C CZ  . ARG B 1 199 ? -2.142  76.062  56.401 1.00 48.88  ? 690  ARG B CZ  1 
ATOM   3056 N NH1 . ARG B 1 199 ? -1.667  75.118  57.203 1.00 51.42  ? 690  ARG B NH1 1 
ATOM   3057 N NH2 . ARG B 1 199 ? -3.356  76.552  56.598 1.00 48.57  ? 690  ARG B NH2 1 
ATOM   3058 N N   . THR B 1 200 ? 0.771   77.192  50.339 1.00 43.58  ? 691  THR B N   1 
ATOM   3059 C CA  . THR B 1 200 ? 0.756   78.534  49.778 1.00 45.05  ? 691  THR B CA  1 
ATOM   3060 C C   . THR B 1 200 ? 0.556   79.554  50.897 1.00 46.40  ? 691  THR B C   1 
ATOM   3061 O O   . THR B 1 200 ? 0.118   79.208  51.989 1.00 47.48  ? 691  THR B O   1 
ATOM   3062 C CB  . THR B 1 200 ? -0.388  78.675  48.759 1.00 44.42  ? 691  THR B CB  1 
ATOM   3063 O OG1 . THR B 1 200 ? -1.645  78.458  49.418 1.00 44.22  ? 691  THR B OG1 1 
ATOM   3064 C CG2 . THR B 1 200 ? -0.232  77.655  47.643 1.00 41.65  ? 691  THR B CG2 1 
ATOM   3065 N N   . ALA B 1 201 ? 0.872   80.814  50.625 1.00 48.83  ? 692  ALA B N   1 
ATOM   3066 C CA  . ALA B 1 201 ? 0.717   81.867  51.628 1.00 51.06  ? 692  ALA B CA  1 
ATOM   3067 C C   . ALA B 1 201 ? -0.730  82.378  51.740 1.00 52.06  ? 692  ALA B C   1 
ATOM   3068 O O   . ALA B 1 201 ? -1.582  82.069  50.904 1.00 50.97  ? 692  ALA B O   1 
ATOM   3069 C CB  . ALA B 1 201 ? 1.667   83.025  51.310 1.00 50.30  ? 692  ALA B CB  1 
ATOM   3070 N N   . ALA B 1 202 ? -0.993  83.163  52.785 1.00 54.39  ? 693  ALA B N   1 
ATOM   3071 C CA  . ALA B 1 202 ? -2.324  83.727  53.038 1.00 55.81  ? 693  ALA B CA  1 
ATOM   3072 C C   . ALA B 1 202 ? -2.744  84.771  52.002 1.00 56.24  ? 693  ALA B C   1 
ATOM   3073 O O   . ALA B 1 202 ? -3.856  84.618  51.454 1.00 56.68  ? 693  ALA B O   1 
ATOM   3074 C CB  . ALA B 1 202 ? -2.371  84.337  54.433 1.00 54.77  ? 693  ALA B CB  1 
ATOM   3075 N N   . ALA B 1 203 ? -1.974  85.728  51.753 1.00 56.39  ? 694  ALA B N   1 
ATOM   3076 N N   . ALA C 1 6   ? 32.537  -16.068 31.621 1.00 69.09  ? 497  ALA C N   1 
ATOM   3077 C CA  . ALA C 1 6   ? 32.535  -15.866 33.103 1.00 69.32  ? 497  ALA C CA  1 
ATOM   3078 C C   . ALA C 1 6   ? 33.836  -15.216 33.570 1.00 68.97  ? 497  ALA C C   1 
ATOM   3079 O O   . ALA C 1 6   ? 34.927  -15.681 33.233 1.00 69.78  ? 497  ALA C O   1 
ATOM   3080 C CB  . ALA C 1 6   ? 32.339  -17.208 33.813 1.00 68.67  ? 497  ALA C CB  1 
ATOM   3081 N N   . ASP C 1 7   ? 33.716  -14.142 34.347 1.00 67.66  ? 498  ASP C N   1 
ATOM   3082 C CA  . ASP C 1 7   ? 34.881  -13.429 34.869 1.00 66.18  ? 498  ASP C CA  1 
ATOM   3083 C C   . ASP C 1 7   ? 34.490  -12.244 35.765 1.00 64.11  ? 498  ASP C C   1 
ATOM   3084 O O   . ASP C 1 7   ? 33.444  -12.263 36.418 1.00 63.36  ? 498  ASP C O   1 
ATOM   3085 C CB  . ASP C 1 7   ? 35.772  -12.947 33.712 1.00 67.16  ? 498  ASP C CB  1 
ATOM   3086 C CG  . ASP C 1 7   ? 35.030  -12.052 32.732 1.00 68.64  ? 498  ASP C CG  1 
ATOM   3087 O OD1 . ASP C 1 7   ? 34.000  -12.491 32.170 1.00 67.95  ? 498  ASP C OD1 1 
ATOM   3088 O OD2 . ASP C 1 7   ? 35.485  -10.907 32.521 1.00 69.19  ? 498  ASP C OD2 1 
ATOM   3089 N N   . THR C 1 8   ? 35.337  -11.220 35.793 1.00 61.39  ? 499  THR C N   1 
ATOM   3090 C CA  . THR C 1 8   ? 35.090  -10.042 36.611 1.00 58.52  ? 499  THR C CA  1 
ATOM   3091 C C   . THR C 1 8   ? 33.976  -9.184  36.021 1.00 56.65  ? 499  THR C C   1 
ATOM   3092 O O   . THR C 1 8   ? 33.818  -9.103  34.797 1.00 56.36  ? 499  THR C O   1 
ATOM   3093 C CB  . THR C 1 8   ? 36.344  -9.188  36.726 1.00 58.90  ? 499  THR C CB  1 
ATOM   3094 O OG1 . THR C 1 8   ? 36.632  -8.599  35.453 1.00 60.12  ? 499  THR C OG1 1 
ATOM   3095 C CG2 . THR C 1 8   ? 37.524  -10.045 37.166 1.00 59.77  ? 499  THR C CG2 1 
ATOM   3096 N N   . PRO C 1 9   ? 33.188  -8.526  36.890 1.00 54.12  ? 500  PRO C N   1 
ATOM   3097 C CA  . PRO C 1 9   ? 32.077  -7.671  36.464 1.00 53.02  ? 500  PRO C CA  1 
ATOM   3098 C C   . PRO C 1 9   ? 32.554  -6.443  35.706 1.00 52.34  ? 500  PRO C C   1 
ATOM   3099 O O   . PRO C 1 9   ? 33.683  -5.990  35.899 1.00 52.50  ? 500  PRO C O   1 
ATOM   3100 C CB  . PRO C 1 9   ? 31.403  -7.290  37.784 1.00 52.55  ? 500  PRO C CB  1 
ATOM   3101 C CG  . PRO C 1 9   ? 31.814  -8.389  38.735 1.00 52.30  ? 500  PRO C CG  1 
ATOM   3102 C CD  . PRO C 1 9   ? 33.242  -8.616  38.359 1.00 53.10  ? 500  PRO C CD  1 
ATOM   3103 N N   . SER C 1 10  ? 31.703  -5.909  34.835 1.00 51.22  ? 501  SER C N   1 
ATOM   3104 C CA  . SER C 1 10  ? 32.071  -4.703  34.108 1.00 50.49  ? 501  SER C CA  1 
ATOM   3105 C C   . SER C 1 10  ? 31.989  -3.564  35.141 1.00 49.49  ? 501  SER C C   1 
ATOM   3106 O O   . SER C 1 10  ? 31.621  -3.796  36.299 1.00 47.17  ? 501  SER C O   1 
ATOM   3107 C CB  . SER C 1 10  ? 31.122  -4.459  32.920 1.00 50.75  ? 501  SER C CB  1 
ATOM   3108 O OG  . SER C 1 10  ? 29.800  -4.158  33.332 1.00 51.69  ? 501  SER C OG  1 
ATOM   3109 N N   . SER C 1 11  ? 32.333  -2.345  34.740 1.00 48.80  ? 502  SER C N   1 
ATOM   3110 C CA  . SER C 1 11  ? 32.316  -1.228  35.680 1.00 47.23  ? 502  SER C CA  1 
ATOM   3111 C C   . SER C 1 11  ? 30.920  -0.715  35.968 1.00 45.61  ? 502  SER C C   1 
ATOM   3112 O O   . SER C 1 11  ? 30.062  -0.671  35.085 1.00 44.45  ? 502  SER C O   1 
ATOM   3113 C CB  . SER C 1 11  ? 33.161  -0.063  35.158 1.00 47.69  ? 502  SER C CB  1 
ATOM   3114 O OG  . SER C 1 11  ? 32.460  0.660   34.155 1.00 48.26  ? 502  SER C OG  1 
ATOM   3115 N N   . PRO C 1 12  ? 30.668  -0.336  37.226 1.00 44.76  ? 503  PRO C N   1 
ATOM   3116 C CA  . PRO C 1 12  ? 29.347  0.180   37.577 1.00 43.64  ? 503  PRO C CA  1 
ATOM   3117 C C   . PRO C 1 12  ? 29.270  1.568   36.959 1.00 42.93  ? 503  PRO C C   1 
ATOM   3118 O O   . PRO C 1 12  ? 30.298  2.148   36.610 1.00 43.22  ? 503  PRO C O   1 
ATOM   3119 C CB  . PRO C 1 12  ? 29.390  0.243   39.102 1.00 42.69  ? 503  PRO C CB  1 
ATOM   3120 C CG  . PRO C 1 12  ? 30.415  -0.790  39.466 1.00 44.93  ? 503  PRO C CG  1 
ATOM   3121 C CD  . PRO C 1 12  ? 31.477  -0.565  38.432 1.00 44.66  ? 503  PRO C CD  1 
ATOM   3122 N N   . SER C 1 13  ? 28.063  2.096   36.809 1.00 41.25  ? 504  SER C N   1 
ATOM   3123 C CA  . SER C 1 13  ? 27.898  3.421   36.249 1.00 39.74  ? 504  SER C CA  1 
ATOM   3124 C C   . SER C 1 13  ? 27.204  4.269   37.293 1.00 38.29  ? 504  SER C C   1 
ATOM   3125 O O   . SER C 1 13  ? 26.094  3.954   37.695 1.00 38.61  ? 504  SER C O   1 
ATOM   3126 C CB  . SER C 1 13  ? 27.053  3.370   34.984 1.00 40.52  ? 504  SER C CB  1 
ATOM   3127 O OG  . SER C 1 13  ? 27.085  4.628   34.333 1.00 43.92  ? 504  SER C OG  1 
ATOM   3128 N N   . ILE C 1 14  ? 27.862  5.334   37.739 1.00 36.32  ? 505  ILE C N   1 
ATOM   3129 C CA  . ILE C 1 14  ? 27.285  6.211   38.749 1.00 34.30  ? 505  ILE C CA  1 
ATOM   3130 C C   . ILE C 1 14  ? 26.288  7.170   38.107 1.00 33.25  ? 505  ILE C C   1 
ATOM   3131 O O   . ILE C 1 14  ? 26.659  8.005   37.300 1.00 32.95  ? 505  ILE C O   1 
ATOM   3132 C CB  . ILE C 1 14  ? 28.387  7.000   39.480 1.00 32.18  ? 505  ILE C CB  1 
ATOM   3133 C CG1 . ILE C 1 14  ? 29.319  6.017   40.199 1.00 30.24  ? 505  ILE C CG1 1 
ATOM   3134 C CG2 . ILE C 1 14  ? 27.766  7.984   40.453 1.00 31.69  ? 505  ILE C CG2 1 
ATOM   3135 C CD1 . ILE C 1 14  ? 30.506  6.645   40.894 1.00 25.73  ? 505  ILE C CD1 1 
ATOM   3136 N N   . ASP C 1 15  ? 25.019  7.040   38.483 1.00 33.84  ? 506  ASP C N   1 
ATOM   3137 C CA  . ASP C 1 15  ? 23.949  7.869   37.931 1.00 33.24  ? 506  ASP C CA  1 
ATOM   3138 C C   . ASP C 1 15  ? 23.639  9.118   38.741 1.00 31.88  ? 506  ASP C C   1 
ATOM   3139 O O   . ASP C 1 15  ? 23.184  10.123  38.188 1.00 31.48  ? 506  ASP C O   1 
ATOM   3140 C CB  . ASP C 1 15  ? 22.667  7.052   37.800 1.00 34.75  ? 506  ASP C CB  1 
ATOM   3141 C CG  . ASP C 1 15  ? 22.878  5.771   37.047 1.00 36.74  ? 506  ASP C CG  1 
ATOM   3142 O OD1 . ASP C 1 15  ? 23.362  5.833   35.897 1.00 40.65  ? 506  ASP C OD1 1 
ATOM   3143 O OD2 . ASP C 1 15  ? 22.560  4.701   37.603 1.00 39.23  ? 506  ASP C OD2 1 
ATOM   3144 N N   . GLN C 1 16  ? 23.867  9.051   40.047 1.00 29.94  ? 507  GLN C N   1 
ATOM   3145 C CA  . GLN C 1 16  ? 23.592  10.192  40.911 1.00 28.88  ? 507  GLN C CA  1 
ATOM   3146 C C   . GLN C 1 16  ? 24.541  10.260  42.082 1.00 28.58  ? 507  GLN C C   1 
ATOM   3147 O O   . GLN C 1 16  ? 25.058  9.249   42.550 1.00 28.80  ? 507  GLN C O   1 
ATOM   3148 C CB  . GLN C 1 16  ? 22.167  10.114  41.481 1.00 26.36  ? 507  GLN C CB  1 
ATOM   3149 C CG  . GLN C 1 16  ? 21.060  9.989   40.451 1.00 24.65  ? 507  GLN C CG  1 
ATOM   3150 C CD  . GLN C 1 16  ? 20.722  11.303  39.785 1.00 24.28  ? 507  GLN C CD  1 
ATOM   3151 O OE1 . GLN C 1 16  ? 19.972  11.340  38.817 1.00 22.63  ? 507  GLN C OE1 1 
ATOM   3152 N NE2 . GLN C 1 16  ? 21.266  12.391  40.309 1.00 26.20  ? 507  GLN C NE2 1 
ATOM   3153 N N   . VAL C 1 17  ? 24.778  11.478  42.539 1.00 29.01  ? 508  VAL C N   1 
ATOM   3154 C CA  . VAL C 1 17  ? 25.576  11.694  43.727 1.00 28.72  ? 508  VAL C CA  1 
ATOM   3155 C C   . VAL C 1 17  ? 24.936  12.887  44.428 1.00 28.92  ? 508  VAL C C   1 
ATOM   3156 O O   . VAL C 1 17  ? 25.085  14.021  43.991 1.00 30.33  ? 508  VAL C O   1 
ATOM   3157 C CB  . VAL C 1 17  ? 27.035  11.994  43.408 1.00 28.96  ? 508  VAL C CB  1 
ATOM   3158 C CG1 . VAL C 1 17  ? 27.822  12.082  44.709 1.00 28.67  ? 508  VAL C CG1 1 
ATOM   3159 C CG2 . VAL C 1 17  ? 27.608  10.903  42.528 1.00 28.46  ? 508  VAL C CG2 1 
ATOM   3160 N N   . GLU C 1 18  ? 24.168  12.624  45.479 1.00 27.31  ? 509  GLU C N   1 
ATOM   3161 C CA  . GLU C 1 18  ? 23.527  13.701  46.219 1.00 27.45  ? 509  GLU C CA  1 
ATOM   3162 C C   . GLU C 1 18  ? 24.351  13.969  47.466 1.00 26.60  ? 509  GLU C C   1 
ATOM   3163 O O   . GLU C 1 18  ? 24.252  13.254  48.448 1.00 26.83  ? 509  GLU C O   1 
ATOM   3164 C CB  . GLU C 1 18  ? 22.095  13.316  46.599 1.00 27.67  ? 509  GLU C CB  1 
ATOM   3165 C CG  . GLU C 1 18  ? 21.426  14.273  47.586 1.00 26.95  ? 509  GLU C CG  1 
ATOM   3166 C CD  . GLU C 1 18  ? 21.406  15.720  47.119 1.00 28.16  ? 509  GLU C CD  1 
ATOM   3167 O OE1 . GLU C 1 18  ? 21.836  16.013  45.987 1.00 27.79  ? 509  GLU C OE1 1 
ATOM   3168 O OE2 . GLU C 1 18  ? 20.953  16.579  47.895 1.00 30.37  ? 509  GLU C OE2 1 
ATOM   3169 N N   . PRO C 1 19  ? 25.186  15.011  47.436 1.00 27.89  ? 510  PRO C N   1 
ATOM   3170 C CA  . PRO C 1 19  ? 26.035  15.358  48.578 1.00 29.39  ? 510  PRO C CA  1 
ATOM   3171 C C   . PRO C 1 19  ? 25.341  16.187  49.658 1.00 29.55  ? 510  PRO C C   1 
ATOM   3172 O O   . PRO C 1 19  ? 24.502  17.040  49.361 1.00 30.12  ? 510  PRO C O   1 
ATOM   3173 C CB  . PRO C 1 19  ? 27.172  16.125  47.922 1.00 27.85  ? 510  PRO C CB  1 
ATOM   3174 C CG  . PRO C 1 19  ? 26.437  16.919  46.901 1.00 28.74  ? 510  PRO C CG  1 
ATOM   3175 C CD  . PRO C 1 19  ? 25.449  15.918  46.303 1.00 28.67  ? 510  PRO C CD  1 
ATOM   3176 N N   . TYR C 1 20  ? 25.702  15.925  50.908 1.00 27.99  ? 511  TYR C N   1 
ATOM   3177 C CA  . TYR C 1 20  ? 25.151  16.658  52.031 1.00 28.29  ? 511  TYR C CA  1 
ATOM   3178 C C   . TYR C 1 20  ? 26.300  17.379  52.728 1.00 29.13  ? 511  TYR C C   1 
ATOM   3179 O O   . TYR C 1 20  ? 27.241  17.813  52.078 1.00 29.63  ? 511  TYR C O   1 
ATOM   3180 C CB  . TYR C 1 20  ? 24.426  15.696  52.973 1.00 27.87  ? 511  TYR C CB  1 
ATOM   3181 C CG  . TYR C 1 20  ? 23.180  15.107  52.344 1.00 29.67  ? 511  TYR C CG  1 
ATOM   3182 C CD1 . TYR C 1 20  ? 23.030  13.729  52.185 1.00 30.41  ? 511  TYR C CD1 1 
ATOM   3183 C CD2 . TYR C 1 20  ? 22.155  15.938  51.882 1.00 30.95  ? 511  TYR C CD2 1 
ATOM   3184 C CE1 . TYR C 1 20  ? 21.882  13.192  51.577 1.00 32.28  ? 511  TYR C CE1 1 
ATOM   3185 C CE2 . TYR C 1 20  ? 21.010  15.419  51.274 1.00 31.81  ? 511  TYR C CE2 1 
ATOM   3186 C CZ  . TYR C 1 20  ? 20.878  14.048  51.124 1.00 33.83  ? 511  TYR C CZ  1 
ATOM   3187 O OH  . TYR C 1 20  ? 19.740  13.546  50.530 1.00 36.39  ? 511  TYR C OH  1 
ATOM   3188 N N   . SER C 1 21  ? 26.231  17.527  54.040 1.00 30.68  ? 512  SER C N   1 
ATOM   3189 C CA  . SER C 1 21  ? 27.304  18.202  54.756 1.00 30.75  ? 512  SER C CA  1 
ATOM   3190 C C   . SER C 1 21  ? 28.489  17.268  54.954 1.00 30.69  ? 512  SER C C   1 
ATOM   3191 O O   . SER C 1 21  ? 29.628  17.613  54.636 1.00 33.31  ? 512  SER C O   1 
ATOM   3192 C CB  . SER C 1 21  ? 26.814  18.689  56.123 1.00 32.88  ? 512  SER C CB  1 
ATOM   3193 O OG  . SER C 1 21  ? 25.887  19.752  55.987 1.00 38.11  ? 512  SER C OG  1 
ATOM   3194 N N   . SER C 1 22  ? 28.222  16.078  55.476 1.00 28.44  ? 513  SER C N   1 
ATOM   3195 C CA  . SER C 1 22  ? 29.296  15.136  55.730 1.00 26.23  ? 513  SER C CA  1 
ATOM   3196 C C   . SER C 1 22  ? 29.017  13.737  55.205 1.00 25.25  ? 513  SER C C   1 
ATOM   3197 O O   . SER C 1 22  ? 29.671  12.781  55.623 1.00 25.63  ? 513  SER C O   1 
ATOM   3198 C CB  . SER C 1 22  ? 29.565  15.064  57.224 1.00 23.96  ? 513  SER C CB  1 
ATOM   3199 O OG  . SER C 1 22  ? 28.503  14.394  57.857 1.00 24.52  ? 513  SER C OG  1 
ATOM   3200 N N   . THR C 1 23  ? 28.048  13.618  54.299 1.00 22.67  ? 514  THR C N   1 
ATOM   3201 C CA  . THR C 1 23  ? 27.708  12.330  53.710 1.00 21.61  ? 514  THR C CA  1 
ATOM   3202 C C   . THR C 1 23  ? 27.183  12.570  52.308 1.00 22.55  ? 514  THR C C   1 
ATOM   3203 O O   . THR C 1 23  ? 26.881  13.703  51.942 1.00 22.80  ? 514  THR C O   1 
ATOM   3204 C CB  . THR C 1 23  ? 26.605  11.604  54.489 1.00 22.11  ? 514  THR C CB  1 
ATOM   3205 O OG1 . THR C 1 23  ? 25.376  12.329  54.346 1.00 23.05  ? 514  THR C OG1 1 
ATOM   3206 C CG2 . THR C 1 23  ? 26.969  11.475  55.966 1.00 18.26  ? 514  THR C CG2 1 
ATOM   3207 N N   . ALA C 1 24  ? 27.079  11.502  51.523 1.00 22.40  ? 515  ALA C N   1 
ATOM   3208 C CA  . ALA C 1 24  ? 26.580  11.597  50.156 1.00 22.53  ? 515  ALA C CA  1 
ATOM   3209 C C   . ALA C 1 24  ? 25.910  10.283  49.767 1.00 24.04  ? 515  ALA C C   1 
ATOM   3210 O O   . ALA C 1 24  ? 26.367  9.201   50.152 1.00 24.31  ? 515  ALA C O   1 
ATOM   3211 C CB  . ALA C 1 24  ? 27.718  11.906  49.205 1.00 19.64  ? 515  ALA C CB  1 
ATOM   3212 N N   . GLN C 1 25  ? 24.819  10.375  49.015 1.00 24.58  ? 516  GLN C N   1 
ATOM   3213 C CA  . GLN C 1 25  ? 24.108  9.177   48.587 1.00 26.72  ? 516  GLN C CA  1 
ATOM   3214 C C   . GLN C 1 25  ? 24.414  8.914   47.134 1.00 27.25  ? 516  GLN C C   1 
ATOM   3215 O O   . GLN C 1 25  ? 24.097  9.722   46.270 1.00 29.25  ? 516  GLN C O   1 
ATOM   3216 C CB  . GLN C 1 25  ? 22.595  9.334   48.810 1.00 25.32  ? 516  GLN C CB  1 
ATOM   3217 C CG  . GLN C 1 25  ? 22.247  9.421   50.297 1.00 28.77  ? 516  GLN C CG  1 
ATOM   3218 C CD  . GLN C 1 25  ? 20.777  9.705   50.578 1.00 29.82  ? 516  GLN C CD  1 
ATOM   3219 O OE1 . GLN C 1 25  ? 20.147  10.510  49.897 1.00 29.32  ? 516  GLN C OE1 1 
ATOM   3220 N NE2 . GLN C 1 25  ? 20.236  9.062   51.608 1.00 28.56  ? 516  GLN C NE2 1 
ATOM   3221 N N   . VAL C 1 26  ? 25.049  7.784   46.864 1.00 28.72  ? 517  VAL C N   1 
ATOM   3222 C CA  . VAL C 1 26  ? 25.399  7.454   45.492 1.00 31.12  ? 517  VAL C CA  1 
ATOM   3223 C C   . VAL C 1 26  ? 24.443  6.438   44.895 1.00 32.26  ? 517  VAL C C   1 
ATOM   3224 O O   . VAL C 1 26  ? 24.095  5.445   45.537 1.00 31.17  ? 517  VAL C O   1 
ATOM   3225 C CB  . VAL C 1 26  ? 26.853  6.900   45.380 1.00 30.14  ? 517  VAL C CB  1 
ATOM   3226 C CG1 . VAL C 1 26  ? 27.275  6.830   43.912 1.00 26.39  ? 517  VAL C CG1 1 
ATOM   3227 C CG2 . VAL C 1 26  ? 27.806  7.780   46.163 1.00 28.77  ? 517  VAL C CG2 1 
ATOM   3228 N N   . GLN C 1 27  ? 24.017  6.725   43.666 1.00 34.94  ? 518  GLN C N   1 
ATOM   3229 C CA  . GLN C 1 27  ? 23.118  5.872   42.891 1.00 38.05  ? 518  GLN C CA  1 
ATOM   3230 C C   . GLN C 1 27  ? 23.922  5.353   41.699 1.00 40.82  ? 518  GLN C C   1 
ATOM   3231 O O   . GLN C 1 27  ? 24.676  6.110   41.079 1.00 40.76  ? 518  GLN C O   1 
ATOM   3232 C CB  . GLN C 1 27  ? 21.930  6.669   42.357 1.00 36.13  ? 518  GLN C CB  1 
ATOM   3233 C CG  . GLN C 1 27  ? 20.647  6.533   43.133 1.00 35.69  ? 518  GLN C CG  1 
ATOM   3234 C CD  . GLN C 1 27  ? 19.452  7.049   42.341 1.00 37.21  ? 518  GLN C CD  1 
ATOM   3235 O OE1 . GLN C 1 27  ? 19.249  6.659   41.190 1.00 37.46  ? 518  GLN C OE1 1 
ATOM   3236 N NE2 . GLN C 1 27  ? 18.659  7.927   42.952 1.00 35.21  ? 518  GLN C NE2 1 
ATOM   3237 N N   . PHE C 1 28  ? 23.758  4.077   41.363 1.00 43.53  ? 519  PHE C N   1 
ATOM   3238 C CA  . PHE C 1 28  ? 24.501  3.523   40.240 1.00 46.79  ? 519  PHE C CA  1 
ATOM   3239 C C   . PHE C 1 28  ? 23.804  2.360   39.549 1.00 49.13  ? 519  PHE C C   1 
ATOM   3240 O O   . PHE C 1 28  ? 22.915  1.742   40.119 1.00 49.65  ? 519  PHE C O   1 
ATOM   3241 C CB  . PHE C 1 28  ? 25.884  3.091   40.722 1.00 45.82  ? 519  PHE C CB  1 
ATOM   3242 C CG  . PHE C 1 28  ? 25.849  2.062   41.808 1.00 43.82  ? 519  PHE C CG  1 
ATOM   3243 C CD1 . PHE C 1 28  ? 25.770  0.711   41.499 1.00 43.01  ? 519  PHE C CD1 1 
ATOM   3244 C CD2 . PHE C 1 28  ? 25.878  2.447   43.141 1.00 43.74  ? 519  PHE C CD2 1 
ATOM   3245 C CE1 . PHE C 1 28  ? 25.720  -0.240  42.498 1.00 42.47  ? 519  PHE C CE1 1 
ATOM   3246 C CE2 . PHE C 1 28  ? 25.828  1.503   44.153 1.00 43.09  ? 519  PHE C CE2 1 
ATOM   3247 C CZ  . PHE C 1 28  ? 25.749  0.156   43.830 1.00 43.86  ? 519  PHE C CZ  1 
ATOM   3248 N N   . ASP C 1 29  ? 24.212  2.082   38.313 1.00 53.40  ? 520  ASP C N   1 
ATOM   3249 C CA  . ASP C 1 29  ? 23.659  0.986   37.520 1.00 57.21  ? 520  ASP C CA  1 
ATOM   3250 C C   . ASP C 1 29  ? 24.533  -0.247  37.670 1.00 59.50  ? 520  ASP C C   1 
ATOM   3251 O O   . ASP C 1 29  ? 25.754  -0.134  37.665 1.00 58.10  ? 520  ASP C O   1 
ATOM   3252 C CB  . ASP C 1 29  ? 23.616  1.359   36.036 1.00 58.53  ? 520  ASP C CB  1 
ATOM   3253 C CG  . ASP C 1 29  ? 22.434  2.232   35.685 1.00 61.67  ? 520  ASP C CG  1 
ATOM   3254 O OD1 . ASP C 1 29  ? 21.291  1.833   36.002 1.00 62.40  ? 520  ASP C OD1 1 
ATOM   3255 O OD2 . ASP C 1 29  ? 22.644  3.310   35.083 1.00 62.02  ? 520  ASP C OD2 1 
ATOM   3256 N N   . GLU C 1 30  ? 23.913  -1.419  37.803 1.00 63.45  ? 521  GLU C N   1 
ATOM   3257 C CA  . GLU C 1 30  ? 24.675  -2.663  37.922 1.00 66.94  ? 521  GLU C CA  1 
ATOM   3258 C C   . GLU C 1 30  ? 25.484  -2.783  36.638 1.00 68.00  ? 521  GLU C C   1 
ATOM   3259 O O   . GLU C 1 30  ? 24.987  -2.483  35.548 1.00 68.02  ? 521  GLU C O   1 
ATOM   3260 C CB  . GLU C 1 30  ? 23.757  -3.888  38.017 1.00 69.39  ? 521  GLU C CB  1 
ATOM   3261 C CG  . GLU C 1 30  ? 22.529  -3.740  38.906 1.00 71.77  ? 521  GLU C CG  1 
ATOM   3262 C CD  . GLU C 1 30  ? 21.719  -5.033  38.981 1.00 72.58  ? 521  GLU C CD  1 
ATOM   3263 O OE1 . GLU C 1 30  ? 21.534  -5.681  37.925 1.00 71.85  ? 521  GLU C OE1 1 
ATOM   3264 O OE2 . GLU C 1 30  ? 21.262  -5.394  40.091 1.00 72.37  ? 521  GLU C OE2 1 
ATOM   3265 N N   . PRO C 1 31  ? 26.738  -3.231  36.742 1.00 69.24  ? 522  PRO C N   1 
ATOM   3266 C CA  . PRO C 1 31  ? 27.546  -3.359  35.527 1.00 70.89  ? 522  PRO C CA  1 
ATOM   3267 C C   . PRO C 1 31  ? 26.798  -4.042  34.378 1.00 73.03  ? 522  PRO C C   1 
ATOM   3268 O O   . PRO C 1 31  ? 26.163  -5.081  34.572 1.00 72.86  ? 522  PRO C O   1 
ATOM   3269 C CB  . PRO C 1 31  ? 28.765  -4.148  36.007 1.00 69.87  ? 522  PRO C CB  1 
ATOM   3270 C CG  . PRO C 1 31  ? 28.277  -4.857  37.238 1.00 69.22  ? 522  PRO C CG  1 
ATOM   3271 C CD  . PRO C 1 31  ? 27.425  -3.824  37.899 1.00 68.41  ? 522  PRO C CD  1 
ATOM   3272 N N   . GLU C 1 32  ? 26.865  -3.444  33.188 1.00 75.21  ? 523  GLU C N   1 
ATOM   3273 C CA  . GLU C 1 32  ? 26.199  -3.995  32.006 1.00 77.01  ? 523  GLU C CA  1 
ATOM   3274 C C   . GLU C 1 32  ? 26.811  -5.317  31.562 1.00 77.88  ? 523  GLU C C   1 
ATOM   3275 O O   . GLU C 1 32  ? 26.744  -5.684  30.388 1.00 77.81  ? 523  GLU C O   1 
ATOM   3276 C CB  . GLU C 1 32  ? 26.257  -3.007  30.840 1.00 77.28  ? 523  GLU C CB  1 
ATOM   3277 C CG  . GLU C 1 32  ? 25.292  -1.849  30.958 1.00 78.00  ? 523  GLU C CG  1 
ATOM   3278 C CD  . GLU C 1 32  ? 25.095  -1.134  29.638 1.00 78.74  ? 523  GLU C CD  1 
ATOM   3279 O OE1 . GLU C 1 32  ? 24.728  -1.808  28.651 1.00 79.01  ? 523  GLU C OE1 1 
ATOM   3280 O OE2 . GLU C 1 32  ? 25.303  0.097   29.586 1.00 78.73  ? 523  GLU C OE2 1 
ATOM   3281 N N   . ALA C 1 33  ? 27.407  -6.022  32.516 1.00 79.04  ? 524  ALA C N   1 
ATOM   3282 C CA  . ALA C 1 33  ? 28.041  -7.308  32.270 1.00 79.88  ? 524  ALA C CA  1 
ATOM   3283 C C   . ALA C 1 33  ? 28.382  -7.931  33.620 1.00 80.69  ? 524  ALA C C   1 
ATOM   3284 O O   . ALA C 1 33  ? 29.496  -7.782  34.127 1.00 80.35  ? 524  ALA C O   1 
ATOM   3285 C CB  . ALA C 1 33  ? 29.305  -7.119  31.437 1.00 79.65  ? 524  ALA C CB  1 
ATOM   3286 N N   . THR C 1 34  ? 27.407  -8.619  34.204 1.00 81.63  ? 525  THR C N   1 
ATOM   3287 C CA  . THR C 1 34  ? 27.591  -9.262  35.498 1.00 82.87  ? 525  THR C CA  1 
ATOM   3288 C C   . THR C 1 34  ? 28.767  -10.246 35.466 1.00 83.60  ? 525  THR C C   1 
ATOM   3289 O O   . THR C 1 34  ? 29.239  -10.710 36.512 1.00 83.18  ? 525  THR C O   1 
ATOM   3290 C CB  . THR C 1 34  ? 26.308  -10.011 35.920 1.00 83.00  ? 525  THR C CB  1 
ATOM   3291 O OG1 . THR C 1 34  ? 26.054  -11.085 35.007 1.00 83.06  ? 525  THR C OG1 1 
ATOM   3292 C CG2 . THR C 1 34  ? 25.116  -9.058  35.914 1.00 82.69  ? 525  THR C CG2 1 
ATOM   3293 N N   . GLY C 1 35  ? 29.237  -10.551 34.258 1.00 83.91  ? 526  GLY C N   1 
ATOM   3294 C CA  . GLY C 1 35  ? 30.346  -11.475 34.096 1.00 83.79  ? 526  GLY C CA  1 
ATOM   3295 C C   . GLY C 1 35  ? 29.881  -12.911 33.936 1.00 83.51  ? 526  GLY C C   1 
ATOM   3296 O O   . GLY C 1 35  ? 30.553  -13.729 33.305 1.00 83.61  ? 526  GLY C O   1 
ATOM   3297 N N   . GLY C 1 36  ? 28.721  -13.212 34.511 1.00 82.86  ? 527  GLY C N   1 
ATOM   3298 C CA  . GLY C 1 36  ? 28.170  -14.552 34.437 1.00 81.04  ? 527  GLY C CA  1 
ATOM   3299 C C   . GLY C 1 36  ? 27.503  -14.902 35.750 1.00 79.83  ? 527  GLY C C   1 
ATOM   3300 O O   . GLY C 1 36  ? 26.333  -15.277 35.782 1.00 79.60  ? 527  GLY C O   1 
ATOM   3301 N N   . VAL C 1 37  ? 28.252  -14.774 36.839 1.00 78.91  ? 528  VAL C N   1 
ATOM   3302 C CA  . VAL C 1 37  ? 27.727  -15.071 38.166 1.00 77.81  ? 528  VAL C CA  1 
ATOM   3303 C C   . VAL C 1 37  ? 27.141  -13.798 38.781 1.00 76.42  ? 528  VAL C C   1 
ATOM   3304 O O   . VAL C 1 37  ? 27.300  -12.699 38.235 1.00 76.30  ? 528  VAL C O   1 
ATOM   3305 C CB  . VAL C 1 37  ? 28.835  -15.623 39.103 1.00 78.03  ? 528  VAL C CB  1 
ATOM   3306 C CG1 . VAL C 1 37  ? 29.593  -16.746 38.412 1.00 77.95  ? 528  VAL C CG1 1 
ATOM   3307 C CG2 . VAL C 1 37  ? 29.777  -14.506 39.518 1.00 77.58  ? 528  VAL C CG2 1 
ATOM   3308 N N   . PRO C 1 38  ? 26.450  -13.930 39.925 1.00 74.39  ? 529  PRO C N   1 
ATOM   3309 C CA  . PRO C 1 38  ? 25.854  -12.766 40.584 1.00 72.26  ? 529  PRO C CA  1 
ATOM   3310 C C   . PRO C 1 38  ? 26.899  -11.882 41.262 1.00 69.73  ? 529  PRO C C   1 
ATOM   3311 O O   . PRO C 1 38  ? 28.021  -12.317 41.524 1.00 69.51  ? 529  PRO C O   1 
ATOM   3312 C CB  . PRO C 1 38  ? 24.899  -13.403 41.587 1.00 72.89  ? 529  PRO C CB  1 
ATOM   3313 C CG  . PRO C 1 38  ? 25.649  -14.632 41.999 1.00 72.89  ? 529  PRO C CG  1 
ATOM   3314 C CD  . PRO C 1 38  ? 26.132  -15.166 40.665 1.00 73.81  ? 529  PRO C CD  1 
ATOM   3315 N N   . ILE C 1 39  ? 26.522  -10.638 41.539 1.00 66.68  ? 530  ILE C N   1 
ATOM   3316 C CA  . ILE C 1 39  ? 27.422  -9.706  42.195 1.00 63.16  ? 530  ILE C CA  1 
ATOM   3317 C C   . ILE C 1 39  ? 27.227  -9.814  43.699 1.00 61.03  ? 530  ILE C C   1 
ATOM   3318 O O   . ILE C 1 39  ? 26.104  -9.787  44.193 1.00 60.61  ? 530  ILE C O   1 
ATOM   3319 C CB  . ILE C 1 39  ? 27.168  -8.268  41.721 1.00 62.57  ? 530  ILE C CB  1 
ATOM   3320 C CG1 . ILE C 1 39  ? 27.356  -8.198  40.205 1.00 62.04  ? 530  ILE C CG1 1 
ATOM   3321 C CG2 . ILE C 1 39  ? 28.133  -7.318  42.402 1.00 62.63  ? 530  ILE C CG2 1 
ATOM   3322 C CD1 . ILE C 1 39  ? 27.184  -6.831  39.625 1.00 62.37  ? 530  ILE C CD1 1 
ATOM   3323 N N   . LEU C 1 40  ? 28.336  -9.946  44.416 1.00 58.84  ? 531  LEU C N   1 
ATOM   3324 C CA  . LEU C 1 40  ? 28.313  -10.103 45.860 1.00 57.44  ? 531  LEU C CA  1 
ATOM   3325 C C   . LEU C 1 40  ? 28.458  -8.810  46.637 1.00 55.90  ? 531  LEU C C   1 
ATOM   3326 O O   . LEU C 1 40  ? 27.621  -8.475  47.476 1.00 56.02  ? 531  LEU C O   1 
ATOM   3327 C CB  . LEU C 1 40  ? 29.428  -11.058 46.283 1.00 58.92  ? 531  LEU C CB  1 
ATOM   3328 C CG  . LEU C 1 40  ? 29.400  -12.445 45.635 1.00 59.78  ? 531  LEU C CG  1 
ATOM   3329 C CD1 . LEU C 1 40  ? 30.601  -13.268 46.107 1.00 59.02  ? 531  LEU C CD1 1 
ATOM   3330 C CD2 . LEU C 1 40  ? 28.086  -13.132 45.993 1.00 59.30  ? 531  LEU C CD2 1 
ATOM   3331 N N   . LYS C 1 41  ? 29.538  -8.093  46.368 1.00 53.69  ? 532  LYS C N   1 
ATOM   3332 C CA  . LYS C 1 41  ? 29.806  -6.849  47.060 1.00 50.90  ? 532  LYS C CA  1 
ATOM   3333 C C   . LYS C 1 41  ? 30.195  -5.773  46.062 1.00 49.13  ? 532  LYS C C   1 
ATOM   3334 O O   . LYS C 1 41  ? 30.521  -6.060  44.912 1.00 48.17  ? 532  LYS C O   1 
ATOM   3335 C CB  . LYS C 1 41  ? 30.965  -7.042  48.049 1.00 52.37  ? 532  LYS C CB  1 
ATOM   3336 C CG  . LYS C 1 41  ? 30.902  -8.311  48.901 1.00 53.35  ? 532  LYS C CG  1 
ATOM   3337 C CD  . LYS C 1 41  ? 29.885  -8.193  50.039 1.00 56.25  ? 532  LYS C CD  1 
ATOM   3338 C CE  . LYS C 1 41  ? 30.341  -7.195  51.115 1.00 56.75  ? 532  LYS C CE  1 
ATOM   3339 N NZ  . LYS C 1 41  ? 29.361  -7.036  52.239 1.00 55.06  ? 532  LYS C NZ  1 
ATOM   3340 N N   . TYR C 1 42  ? 30.137  -4.525  46.511 1.00 47.54  ? 533  TYR C N   1 
ATOM   3341 C CA  . TYR C 1 42  ? 30.546  -3.387  45.700 1.00 43.88  ? 533  TYR C CA  1 
ATOM   3342 C C   . TYR C 1 42  ? 31.624  -2.737  46.546 1.00 43.08  ? 533  TYR C C   1 
ATOM   3343 O O   . TYR C 1 42  ? 31.538  -2.751  47.776 1.00 43.60  ? 533  TYR C O   1 
ATOM   3344 C CB  . TYR C 1 42  ? 29.397  -2.408  45.490 1.00 41.24  ? 533  TYR C CB  1 
ATOM   3345 C CG  . TYR C 1 42  ? 28.425  -2.813  44.415 1.00 40.02  ? 533  TYR C CG  1 
ATOM   3346 C CD1 . TYR C 1 42  ? 28.728  -2.632  43.068 1.00 38.19  ? 533  TYR C CD1 1 
ATOM   3347 C CD2 . TYR C 1 42  ? 27.194  -3.382  44.743 1.00 40.32  ? 533  TYR C CD2 1 
ATOM   3348 C CE1 . TYR C 1 42  ? 27.826  -3.004  42.074 1.00 37.28  ? 533  TYR C CE1 1 
ATOM   3349 C CE2 . TYR C 1 42  ? 26.285  -3.763  43.755 1.00 38.27  ? 533  TYR C CE2 1 
ATOM   3350 C CZ  . TYR C 1 42  ? 26.606  -3.570  42.426 1.00 38.15  ? 533  TYR C CZ  1 
ATOM   3351 O OH  . TYR C 1 42  ? 25.699  -3.936  41.457 1.00 39.64  ? 533  TYR C OH  1 
ATOM   3352 N N   . LYS C 1 43  ? 32.644  -2.193  45.894 1.00 41.57  ? 534  LYS C N   1 
ATOM   3353 C CA  . LYS C 1 43  ? 33.741  -1.526  46.589 1.00 39.28  ? 534  LYS C CA  1 
ATOM   3354 C C   . LYS C 1 43  ? 33.712  -0.049  46.222 1.00 37.94  ? 534  LYS C C   1 
ATOM   3355 O O   . LYS C 1 43  ? 33.782  0.298   45.045 1.00 37.33  ? 534  LYS C O   1 
ATOM   3356 C CB  . LYS C 1 43  ? 35.076  -2.126  46.157 1.00 40.74  ? 534  LYS C CB  1 
ATOM   3357 C CG  . LYS C 1 43  ? 36.295  -1.362  46.636 1.00 41.90  ? 534  LYS C CG  1 
ATOM   3358 C CD  . LYS C 1 43  ? 37.529  -1.809  45.870 1.00 44.15  ? 534  LYS C CD  1 
ATOM   3359 C CE  . LYS C 1 43  ? 38.775  -1.130  46.383 1.00 44.76  ? 534  LYS C CE  1 
ATOM   3360 N NZ  . LYS C 1 43  ? 39.036  -1.501  47.801 1.00 47.53  ? 534  LYS C NZ  1 
ATOM   3361 N N   . ALA C 1 44  ? 33.606  0.818   47.225 1.00 35.85  ? 535  ALA C N   1 
ATOM   3362 C CA  . ALA C 1 44  ? 33.576  2.248   46.971 1.00 33.44  ? 535  ALA C CA  1 
ATOM   3363 C C   . ALA C 1 44  ? 34.854  2.949   47.394 1.00 33.24  ? 535  ALA C C   1 
ATOM   3364 O O   . ALA C 1 44  ? 35.466  2.637   48.416 1.00 31.68  ? 535  ALA C O   1 
ATOM   3365 C CB  . ALA C 1 44  ? 32.395  2.881   47.671 1.00 34.47  ? 535  ALA C CB  1 
ATOM   3366 N N   . GLU C 1 45  ? 35.254  3.909   46.580 1.00 33.93  ? 536  GLU C N   1 
ATOM   3367 C CA  . GLU C 1 45  ? 36.440  4.691   46.850 1.00 33.86  ? 536  GLU C CA  1 
ATOM   3368 C C   . GLU C 1 45  ? 36.108  6.153   46.670 1.00 33.21  ? 536  GLU C C   1 
ATOM   3369 O O   . GLU C 1 45  ? 35.385  6.533   45.742 1.00 33.77  ? 536  GLU C O   1 
ATOM   3370 C CB  . GLU C 1 45  ? 37.576  4.285   45.910 1.00 35.43  ? 536  GLU C CB  1 
ATOM   3371 C CG  . GLU C 1 45  ? 38.273  2.998   46.350 1.00 38.32  ? 536  GLU C CG  1 
ATOM   3372 C CD  . GLU C 1 45  ? 39.413  2.604   45.442 1.00 38.56  ? 536  GLU C CD  1 
ATOM   3373 O OE1 . GLU C 1 45  ? 40.210  1.732   45.847 1.00 38.49  ? 536  GLU C OE1 1 
ATOM   3374 O OE2 . GLU C 1 45  ? 39.506  3.169   44.329 1.00 39.21  ? 536  GLU C OE2 1 
ATOM   3375 N N   . TRP C 1 46  ? 36.604  6.970   47.590 1.00 31.76  ? 537  TRP C N   1 
ATOM   3376 C CA  . TRP C 1 46  ? 36.384  8.403   47.513 1.00 30.33  ? 537  TRP C CA  1 
ATOM   3377 C C   . TRP C 1 46  ? 37.571  9.076   48.146 1.00 29.63  ? 537  TRP C C   1 
ATOM   3378 O O   . TRP C 1 46  ? 38.270  8.499   48.976 1.00 30.21  ? 537  TRP C O   1 
ATOM   3379 C CB  . TRP C 1 46  ? 35.073  8.811   48.213 1.00 29.70  ? 537  TRP C CB  1 
ATOM   3380 C CG  . TRP C 1 46  ? 35.042  8.641   49.706 1.00 27.18  ? 537  TRP C CG  1 
ATOM   3381 C CD1 . TRP C 1 46  ? 35.297  9.597   50.641 1.00 26.91  ? 537  TRP C CD1 1 
ATOM   3382 C CD2 . TRP C 1 46  ? 34.740  7.446   50.426 1.00 26.08  ? 537  TRP C CD2 1 
ATOM   3383 N NE1 . TRP C 1 46  ? 35.172  9.077   51.901 1.00 25.57  ? 537  TRP C NE1 1 
ATOM   3384 C CE2 . TRP C 1 46  ? 34.829  7.755   51.801 1.00 27.60  ? 537  TRP C CE2 1 
ATOM   3385 C CE3 . TRP C 1 46  ? 34.402  6.140   50.045 1.00 25.75  ? 537  TRP C CE3 1 
ATOM   3386 C CZ2 . TRP C 1 46  ? 34.590  6.806   52.804 1.00 26.38  ? 537  TRP C CZ2 1 
ATOM   3387 C CZ3 . TRP C 1 46  ? 34.164  5.196   51.037 1.00 25.00  ? 537  TRP C CZ3 1 
ATOM   3388 C CH2 . TRP C 1 46  ? 34.260  5.536   52.403 1.00 26.12  ? 537  TRP C CH2 1 
ATOM   3389 N N   . ARG C 1 47  ? 37.824  10.297  47.726 1.00 29.30  ? 538  ARG C N   1 
ATOM   3390 C CA  . ARG C 1 47  ? 38.945  11.021  48.271 1.00 29.09  ? 538  ARG C CA  1 
ATOM   3391 C C   . ARG C 1 47  ? 38.796  12.495  47.934 1.00 28.00  ? 538  ARG C C   1 
ATOM   3392 O O   . ARG C 1 47  ? 38.355  12.852  46.844 1.00 28.08  ? 538  ARG C O   1 
ATOM   3393 C CB  . ARG C 1 47  ? 40.254  10.454  47.708 1.00 28.47  ? 538  ARG C CB  1 
ATOM   3394 C CG  . ARG C 1 47  ? 40.488  10.762  46.255 1.00 30.09  ? 538  ARG C CG  1 
ATOM   3395 C CD  . ARG C 1 47  ? 41.732  11.595  46.099 1.00 31.90  ? 538  ARG C CD  1 
ATOM   3396 N NE  . ARG C 1 47  ? 42.944  10.811  45.873 1.00 31.80  ? 538  ARG C NE  1 
ATOM   3397 C CZ  . ARG C 1 47  ? 43.405  10.464  44.672 1.00 31.10  ? 538  ARG C CZ  1 
ATOM   3398 N NH1 . ARG C 1 47  ? 42.762  10.815  43.568 1.00 32.14  ? 538  ARG C NH1 1 
ATOM   3399 N NH2 . ARG C 1 47  ? 44.539  9.796   44.570 1.00 31.60  ? 538  ARG C NH2 1 
ATOM   3400 N N   . ALA C 1 48  ? 39.128  13.346  48.894 1.00 25.37  ? 539  ALA C N   1 
ATOM   3401 C CA  . ALA C 1 48  ? 39.040  14.769  48.669 1.00 24.22  ? 539  ALA C CA  1 
ATOM   3402 C C   . ALA C 1 48  ? 40.027  15.101  47.544 1.00 24.64  ? 539  ALA C C   1 
ATOM   3403 O O   . ALA C 1 48  ? 41.198  14.703  47.594 1.00 23.55  ? 539  ALA C O   1 
ATOM   3404 C CB  . ALA C 1 48  ? 39.394  15.515  49.945 1.00 23.53  ? 539  ALA C CB  1 
ATOM   3405 N N   . VAL C 1 49  ? 39.538  15.803  46.523 1.00 23.50  ? 540  VAL C N   1 
ATOM   3406 C CA  . VAL C 1 49  ? 40.357  16.192  45.387 1.00 24.27  ? 540  VAL C CA  1 
ATOM   3407 C C   . VAL C 1 49  ? 41.647  16.841  45.865 1.00 26.03  ? 540  VAL C C   1 
ATOM   3408 O O   . VAL C 1 49  ? 41.618  17.774  46.678 1.00 29.36  ? 540  VAL C O   1 
ATOM   3409 C CB  . VAL C 1 49  ? 39.595  17.179  44.480 1.00 24.76  ? 540  VAL C CB  1 
ATOM   3410 C CG1 . VAL C 1 49  ? 40.491  17.673  43.364 1.00 23.10  ? 540  VAL C CG1 1 
ATOM   3411 C CG2 . VAL C 1 49  ? 38.360  16.497  43.904 1.00 24.44  ? 540  VAL C CG2 1 
ATOM   3412 N N   . GLY C 1 50  ? 42.780  16.344  45.373 1.00 25.90  ? 541  GLY C N   1 
ATOM   3413 C CA  . GLY C 1 50  ? 44.061  16.900  45.776 1.00 25.55  ? 541  GLY C CA  1 
ATOM   3414 C C   . GLY C 1 50  ? 44.807  16.064  46.807 1.00 27.66  ? 541  GLY C C   1 
ATOM   3415 O O   . GLY C 1 50  ? 45.967  16.348  47.113 1.00 28.34  ? 541  GLY C O   1 
ATOM   3416 N N   . GLU C 1 51  ? 44.135  15.058  47.367 1.00 28.12  ? 542  GLU C N   1 
ATOM   3417 C CA  . GLU C 1 51  ? 44.749  14.157  48.338 1.00 28.08  ? 542  GLU C CA  1 
ATOM   3418 C C   . GLU C 1 51  ? 45.281  12.978  47.521 1.00 28.52  ? 542  GLU C C   1 
ATOM   3419 O O   . GLU C 1 51  ? 44.906  12.803  46.359 1.00 27.71  ? 542  GLU C O   1 
ATOM   3420 C CB  . GLU C 1 51  ? 43.711  13.632  49.338 1.00 29.61  ? 542  GLU C CB  1 
ATOM   3421 C CG  . GLU C 1 51  ? 43.047  14.664  50.234 1.00 30.92  ? 542  GLU C CG  1 
ATOM   3422 C CD  . GLU C 1 51  ? 44.001  15.334  51.208 1.00 33.09  ? 542  GLU C CD  1 
ATOM   3423 O OE1 . GLU C 1 51  ? 43.513  16.029  52.123 1.00 32.82  ? 542  GLU C OE1 1 
ATOM   3424 O OE2 . GLU C 1 51  ? 45.233  15.184  51.060 1.00 35.85  ? 542  GLU C OE2 1 
ATOM   3425 N N   . GLU C 1 52  ? 46.142  12.159  48.111 1.00 28.37  ? 543  GLU C N   1 
ATOM   3426 C CA  . GLU C 1 52  ? 46.673  11.020  47.366 1.00 27.38  ? 543  GLU C CA  1 
ATOM   3427 C C   . GLU C 1 52  ? 45.993  9.702   47.703 1.00 26.20  ? 543  GLU C C   1 
ATOM   3428 O O   . GLU C 1 52  ? 45.531  8.989   46.807 1.00 25.17  ? 543  GLU C O   1 
ATOM   3429 C CB  . GLU C 1 52  ? 48.187  10.885  47.575 1.00 26.99  ? 543  GLU C CB  1 
ATOM   3430 C CG  . GLU C 1 52  ? 49.033  11.824  46.718 1.00 27.47  ? 543  GLU C CG  1 
ATOM   3431 C CD  . GLU C 1 52  ? 48.657  11.785  45.232 1.00 29.60  ? 543  GLU C CD  1 
ATOM   3432 O OE1 . GLU C 1 52  ? 48.206  10.728  44.729 1.00 28.90  ? 543  GLU C OE1 1 
ATOM   3433 O OE2 . GLU C 1 52  ? 48.827  12.821  44.555 1.00 30.07  ? 543  GLU C OE2 1 
ATOM   3434 N N   . VAL C 1 53  ? 45.924  9.376   48.989 1.00 24.95  ? 544  VAL C N   1 
ATOM   3435 C CA  . VAL C 1 53  ? 45.305  8.120   49.392 1.00 26.07  ? 544  VAL C CA  1 
ATOM   3436 C C   . VAL C 1 53  ? 43.780  8.186   49.384 1.00 25.68  ? 544  VAL C C   1 
ATOM   3437 O O   . VAL C 1 53  ? 43.191  9.211   49.710 1.00 26.29  ? 544  VAL C O   1 
ATOM   3438 C CB  . VAL C 1 53  ? 45.832  7.639   50.792 1.00 24.91  ? 544  VAL C CB  1 
ATOM   3439 C CG1 . VAL C 1 53  ? 46.815  8.634   51.359 1.00 24.86  ? 544  VAL C CG1 1 
ATOM   3440 C CG2 . VAL C 1 53  ? 44.697  7.407   51.742 1.00 21.92  ? 544  VAL C CG2 1 
ATOM   3441 N N   . TRP C 1 54  ? 43.155  7.080   48.990 1.00 26.81  ? 545  TRP C N   1 
ATOM   3442 C CA  . TRP C 1 54  ? 41.703  6.984   48.936 1.00 27.55  ? 545  TRP C CA  1 
ATOM   3443 C C   . TRP C 1 54  ? 41.144  6.316   50.178 1.00 28.49  ? 545  TRP C C   1 
ATOM   3444 O O   . TRP C 1 54  ? 41.875  5.725   50.966 1.00 28.67  ? 545  TRP C O   1 
ATOM   3445 C CB  . TRP C 1 54  ? 41.242  6.140   47.752 1.00 27.20  ? 545  TRP C CB  1 
ATOM   3446 C CG  . TRP C 1 54  ? 41.648  6.622   46.411 1.00 26.82  ? 545  TRP C CG  1 
ATOM   3447 C CD1 . TRP C 1 54  ? 42.889  6.562   45.863 1.00 27.02  ? 545  TRP C CD1 1 
ATOM   3448 C CD2 . TRP C 1 54  ? 40.796  7.201   45.419 1.00 26.69  ? 545  TRP C CD2 1 
ATOM   3449 N NE1 . TRP C 1 54  ? 42.869  7.061   44.587 1.00 27.98  ? 545  TRP C NE1 1 
ATOM   3450 C CE2 . TRP C 1 54  ? 41.595  7.463   44.286 1.00 27.16  ? 545  TRP C CE2 1 
ATOM   3451 C CE3 . TRP C 1 54  ? 39.433  7.527   45.377 1.00 26.21  ? 545  TRP C CE3 1 
ATOM   3452 C CZ2 . TRP C 1 54  ? 41.080  8.038   43.120 1.00 25.33  ? 545  TRP C CZ2 1 
ATOM   3453 C CZ3 . TRP C 1 54  ? 38.919  8.102   44.219 1.00 25.27  ? 545  TRP C CZ3 1 
ATOM   3454 C CH2 . TRP C 1 54  ? 39.745  8.351   43.106 1.00 25.58  ? 545  TRP C CH2 1 
ATOM   3455 N N   . HIS C 1 55  ? 39.828  6.412   50.316 1.00 29.76  ? 546  HIS C N   1 
ATOM   3456 C CA  . HIS C 1 55  ? 39.077  5.794   51.400 1.00 30.73  ? 546  HIS C CA  1 
ATOM   3457 C C   . HIS C 1 55  ? 38.375  4.639   50.695 1.00 32.08  ? 546  HIS C C   1 
ATOM   3458 O O   . HIS C 1 55  ? 38.011  4.759   49.532 1.00 34.13  ? 546  HIS C O   1 
ATOM   3459 C CB  . HIS C 1 55  ? 37.998  6.743   51.928 1.00 29.47  ? 546  HIS C CB  1 
ATOM   3460 C CG  . HIS C 1 55  ? 38.514  7.882   52.752 1.00 29.08  ? 546  HIS C CG  1 
ATOM   3461 N ND1 . HIS C 1 55  ? 38.712  7.787   54.114 1.00 28.34  ? 546  HIS C ND1 1 
ATOM   3462 C CD2 . HIS C 1 55  ? 38.793  9.166   52.419 1.00 26.19  ? 546  HIS C CD2 1 
ATOM   3463 C CE1 . HIS C 1 55  ? 39.082  8.966   54.585 1.00 28.40  ? 546  HIS C CE1 1 
ATOM   3464 N NE2 . HIS C 1 55  ? 39.138  9.819   53.577 1.00 25.63  ? 546  HIS C NE2 1 
ATOM   3465 N N   . SER C 1 56  ? 38.182  3.524   51.378 1.00 34.48  ? 547  SER C N   1 
ATOM   3466 C CA  . SER C 1 56  ? 37.495  2.391   50.768 1.00 37.29  ? 547  SER C CA  1 
ATOM   3467 C C   . SER C 1 56  ? 36.434  1.860   51.724 1.00 39.00  ? 547  SER C C   1 
ATOM   3468 O O   . SER C 1 56  ? 36.472  2.126   52.924 1.00 40.60  ? 547  SER C O   1 
ATOM   3469 C CB  . SER C 1 56  ? 38.480  1.257   50.442 1.00 36.39  ? 547  SER C CB  1 
ATOM   3470 O OG  . SER C 1 56  ? 39.372  1.615   49.405 1.00 37.97  ? 547  SER C OG  1 
ATOM   3471 N N   . LYS C 1 57  ? 35.484  1.116   51.179 1.00 39.63  ? 548  LYS C N   1 
ATOM   3472 C CA  . LYS C 1 57  ? 34.437  0.507   51.973 1.00 40.38  ? 548  LYS C CA  1 
ATOM   3473 C C   . LYS C 1 57  ? 33.612  -0.379  51.069 1.00 40.47  ? 548  LYS C C   1 
ATOM   3474 O O   . LYS C 1 57  ? 33.207  0.038   49.982 1.00 41.86  ? 548  LYS C O   1 
ATOM   3475 C CB  . LYS C 1 57  ? 33.534  1.561   52.617 1.00 42.78  ? 548  LYS C CB  1 
ATOM   3476 C CG  . LYS C 1 57  ? 32.290  0.950   53.263 1.00 45.26  ? 548  LYS C CG  1 
ATOM   3477 C CD  . LYS C 1 57  ? 31.517  1.940   54.110 1.00 46.91  ? 548  LYS C CD  1 
ATOM   3478 C CE  . LYS C 1 57  ? 30.257  1.309   54.687 1.00 47.85  ? 548  LYS C CE  1 
ATOM   3479 N NZ  . LYS C 1 57  ? 30.555  0.139   55.560 1.00 48.71  ? 548  LYS C NZ  1 
ATOM   3480 N N   . TRP C 1 58  ? 33.381  -1.609  51.508 1.00 39.18  ? 549  TRP C N   1 
ATOM   3481 C CA  . TRP C 1 58  ? 32.583  -2.536  50.730 1.00 37.87  ? 549  TRP C CA  1 
ATOM   3482 C C   . TRP C 1 58  ? 31.120  -2.424  51.136 1.00 37.64  ? 549  TRP C C   1 
ATOM   3483 O O   . TRP C 1 58  ? 30.788  -2.233  52.305 1.00 35.08  ? 549  TRP C O   1 
ATOM   3484 C CB  . TRP C 1 58  ? 33.046  -3.978  50.937 1.00 37.38  ? 549  TRP C CB  1 
ATOM   3485 C CG  . TRP C 1 58  ? 34.466  -4.248  50.540 1.00 37.13  ? 549  TRP C CG  1 
ATOM   3486 C CD1 . TRP C 1 58  ? 35.578  -4.117  51.327 1.00 35.69  ? 549  TRP C CD1 1 
ATOM   3487 C CD2 . TRP C 1 58  ? 34.927  -4.720  49.268 1.00 35.74  ? 549  TRP C CD2 1 
ATOM   3488 N NE1 . TRP C 1 58  ? 36.700  -4.485  50.625 1.00 35.84  ? 549  TRP C NE1 1 
ATOM   3489 C CE2 . TRP C 1 58  ? 36.334  -4.858  49.359 1.00 35.12  ? 549  TRP C CE2 1 
ATOM   3490 C CE3 . TRP C 1 58  ? 34.292  -5.039  48.061 1.00 35.42  ? 549  TRP C CE3 1 
ATOM   3491 C CZ2 . TRP C 1 58  ? 37.116  -5.303  48.290 1.00 33.15  ? 549  TRP C CZ2 1 
ATOM   3492 C CZ3 . TRP C 1 58  ? 35.075  -5.485  46.991 1.00 35.24  ? 549  TRP C CZ3 1 
ATOM   3493 C CH2 . TRP C 1 58  ? 36.471  -5.611  47.118 1.00 34.49  ? 549  TRP C CH2 1 
ATOM   3494 N N   . TYR C 1 59  ? 30.247  -2.539  50.150 1.00 39.48  ? 550  TYR C N   1 
ATOM   3495 C CA  . TYR C 1 59  ? 28.822  -2.470  50.393 1.00 40.72  ? 550  TYR C CA  1 
ATOM   3496 C C   . TYR C 1 59  ? 28.243  -3.761  49.874 1.00 42.01  ? 550  TYR C C   1 
ATOM   3497 O O   . TYR C 1 59  ? 28.641  -4.235  48.812 1.00 41.47  ? 550  TYR C O   1 
ATOM   3498 C CB  . TYR C 1 59  ? 28.226  -1.269  49.663 1.00 40.51  ? 550  TYR C CB  1 
ATOM   3499 C CG  . TYR C 1 59  ? 28.713  0.042   50.236 1.00 41.64  ? 550  TYR C CG  1 
ATOM   3500 C CD1 . TYR C 1 59  ? 27.987  0.701   51.219 1.00 40.30  ? 550  TYR C CD1 1 
ATOM   3501 C CD2 . TYR C 1 59  ? 29.940  0.583   49.851 1.00 41.30  ? 550  TYR C CD2 1 
ATOM   3502 C CE1 . TYR C 1 59  ? 28.463  1.859   51.806 1.00 41.72  ? 550  TYR C CE1 1 
ATOM   3503 C CE2 . TYR C 1 59  ? 30.427  1.743   50.439 1.00 41.79  ? 550  TYR C CE2 1 
ATOM   3504 C CZ  . TYR C 1 59  ? 29.682  2.375   51.416 1.00 42.55  ? 550  TYR C CZ  1 
ATOM   3505 O OH  . TYR C 1 59  ? 30.152  3.522   52.018 1.00 43.71  ? 550  TYR C OH  1 
ATOM   3506 N N   . ASP C 1 60  ? 27.333  -4.342  50.649 1.00 44.19  ? 551  ASP C N   1 
ATOM   3507 C CA  . ASP C 1 60  ? 26.685  -5.584  50.269 1.00 46.31  ? 551  ASP C CA  1 
ATOM   3508 C C   . ASP C 1 60  ? 25.759  -5.304  49.090 1.00 46.20  ? 551  ASP C C   1 
ATOM   3509 O O   . ASP C 1 60  ? 24.868  -4.463  49.171 1.00 46.01  ? 551  ASP C O   1 
ATOM   3510 C CB  . ASP C 1 60  ? 25.883  -6.138  51.442 1.00 49.57  ? 551  ASP C CB  1 
ATOM   3511 C CG  . ASP C 1 60  ? 25.262  -7.479  51.134 1.00 52.59  ? 551  ASP C CG  1 
ATOM   3512 O OD1 . ASP C 1 60  ? 26.008  -8.483  51.070 1.00 53.19  ? 551  ASP C OD1 1 
ATOM   3513 O OD2 . ASP C 1 60  ? 24.027  -7.522  50.943 1.00 54.65  ? 551  ASP C OD2 1 
ATOM   3514 N N   . ALA C 1 61  ? 25.985  -6.019  47.995 1.00 46.96  ? 552  ALA C N   1 
ATOM   3515 C CA  . ALA C 1 61  ? 25.212  -5.852  46.771 1.00 47.25  ? 552  ALA C CA  1 
ATOM   3516 C C   . ALA C 1 61  ? 23.703  -5.985  46.945 1.00 48.00  ? 552  ALA C C   1 
ATOM   3517 O O   . ALA C 1 61  ? 22.930  -5.315  46.259 1.00 47.85  ? 552  ALA C O   1 
ATOM   3518 C CB  . ALA C 1 61  ? 25.700  -6.846  45.723 1.00 45.96  ? 552  ALA C CB  1 
ATOM   3519 N N   . LYS C 1 62  ? 23.277  -6.842  47.863 1.00 49.23  ? 553  LYS C N   1 
ATOM   3520 C CA  . LYS C 1 62  ? 21.856  -7.052  48.061 1.00 50.52  ? 553  LYS C CA  1 
ATOM   3521 C C   . LYS C 1 62  ? 21.202  -5.900  48.820 1.00 50.91  ? 553  LYS C C   1 
ATOM   3522 O O   . LYS C 1 62  ? 20.096  -5.472  48.486 1.00 50.66  ? 553  LYS C O   1 
ATOM   3523 C CB  . LYS C 1 62  ? 21.634  -8.385  48.779 1.00 51.82  ? 553  LYS C CB  1 
ATOM   3524 C CG  . LYS C 1 62  ? 20.224  -8.941  48.627 1.00 55.46  ? 553  LYS C CG  1 
ATOM   3525 C CD  . LYS C 1 62  ? 20.169  -10.453 48.883 1.00 57.18  ? 553  LYS C CD  1 
ATOM   3526 C CE  . LYS C 1 62  ? 20.789  -11.270 47.736 1.00 57.74  ? 553  LYS C CE  1 
ATOM   3527 N NZ  . LYS C 1 62  ? 22.247  -11.014 47.533 1.00 57.21  ? 553  LYS C NZ  1 
ATOM   3528 N N   . GLU C 1 63  ? 21.884  -5.386  49.835 1.00 51.28  ? 554  GLU C N   1 
ATOM   3529 C CA  . GLU C 1 63  ? 21.328  -4.284  50.602 1.00 51.39  ? 554  GLU C CA  1 
ATOM   3530 C C   . GLU C 1 63  ? 21.313  -3.058  49.713 1.00 51.19  ? 554  GLU C C   1 
ATOM   3531 O O   . GLU C 1 63  ? 20.312  -2.355  49.633 1.00 52.53  ? 554  GLU C O   1 
ATOM   3532 C CB  . GLU C 1 63  ? 22.160  -4.022  51.863 1.00 51.54  ? 554  GLU C CB  1 
ATOM   3533 C CG  . GLU C 1 63  ? 21.620  -2.898  52.744 1.00 53.88  ? 554  GLU C CG  1 
ATOM   3534 C CD  . GLU C 1 63  ? 22.148  -2.950  54.178 1.00 56.78  ? 554  GLU C CD  1 
ATOM   3535 O OE1 . GLU C 1 63  ? 22.417  -1.872  54.753 1.00 57.01  ? 554  GLU C OE1 1 
ATOM   3536 O OE2 . GLU C 1 63  ? 22.283  -4.061  54.742 1.00 58.15  ? 554  GLU C OE2 1 
ATOM   3537 N N   . ALA C 1 64  ? 22.425  -2.821  49.028 1.00 51.03  ? 555  ALA C N   1 
ATOM   3538 C CA  . ALA C 1 64  ? 22.547  -1.677  48.139 1.00 51.76  ? 555  ALA C CA  1 
ATOM   3539 C C   . ALA C 1 64  ? 21.400  -1.633  47.135 1.00 52.70  ? 555  ALA C C   1 
ATOM   3540 O O   . ALA C 1 64  ? 20.804  -0.585  46.907 1.00 52.66  ? 555  ALA C O   1 
ATOM   3541 C CB  . ALA C 1 64  ? 23.883  -1.729  47.404 1.00 49.49  ? 555  ALA C CB  1 
ATOM   3542 N N   . SER C 1 65  ? 21.093  -2.783  46.547 1.00 53.86  ? 556  SER C N   1 
ATOM   3543 C CA  . SER C 1 65  ? 20.036  -2.885  45.551 1.00 55.46  ? 556  SER C CA  1 
ATOM   3544 C C   . SER C 1 65  ? 18.654  -2.580  46.103 1.00 56.67  ? 556  SER C C   1 
ATOM   3545 O O   . SER C 1 65  ? 17.870  -1.865  45.476 1.00 56.63  ? 556  SER C O   1 
ATOM   3546 C CB  . SER C 1 65  ? 20.039  -4.283  44.938 1.00 56.20  ? 556  SER C CB  1 
ATOM   3547 O OG  . SER C 1 65  ? 19.963  -5.274  45.948 1.00 57.23  ? 556  SER C OG  1 
ATOM   3548 N N   . MET C 1 66  ? 18.349  -3.129  47.273 1.00 57.51  ? 557  MET C N   1 
ATOM   3549 C CA  . MET C 1 66  ? 17.048  -2.906  47.887 1.00 58.38  ? 557  MET C CA  1 
ATOM   3550 C C   . MET C 1 66  ? 16.943  -1.497  48.472 1.00 56.51  ? 557  MET C C   1 
ATOM   3551 O O   . MET C 1 66  ? 15.937  -1.130  49.082 1.00 56.95  ? 557  MET C O   1 
ATOM   3552 C CB  . MET C 1 66  ? 16.786  -3.979  48.948 1.00 61.99  ? 557  MET C CB  1 
ATOM   3553 C CG  . MET C 1 66  ? 16.637  -5.371  48.335 1.00 68.13  ? 557  MET C CG  1 
ATOM   3554 S SD  . MET C 1 66  ? 16.609  -6.747  49.513 1.00 76.28  ? 557  MET C SD  1 
ATOM   3555 C CE  . MET C 1 66  ? 14.817  -6.913  49.816 1.00 73.54  ? 557  MET C CE  1 
ATOM   3556 N N   . GLU C 1 67  ? 17.991  -0.705  48.270 1.00 53.24  ? 558  GLU C N   1 
ATOM   3557 C CA  . GLU C 1 67  ? 18.005  0.669   48.740 1.00 49.34  ? 558  GLU C CA  1 
ATOM   3558 C C   . GLU C 1 67  ? 18.110  1.600   47.546 1.00 46.95  ? 558  GLU C C   1 
ATOM   3559 O O   . GLU C 1 67  ? 17.581  2.714   47.563 1.00 46.80  ? 558  GLU C O   1 
ATOM   3560 C CB  . GLU C 1 67  ? 19.175  0.907   49.691 1.00 49.26  ? 558  GLU C CB  1 
ATOM   3561 C CG  . GLU C 1 67  ? 18.938  0.371   51.089 1.00 49.90  ? 558  GLU C CG  1 
ATOM   3562 C CD  . GLU C 1 67  ? 19.763  1.097   52.136 1.00 50.06  ? 558  GLU C CD  1 
ATOM   3563 O OE1 . GLU C 1 67  ? 19.706  2.346   52.176 1.00 46.82  ? 558  GLU C OE1 1 
ATOM   3564 O OE2 . GLU C 1 67  ? 20.460  0.419   52.921 1.00 51.42  ? 558  GLU C OE2 1 
ATOM   3565 N N   . GLY C 1 68  ? 18.784  1.121   46.503 1.00 44.97  ? 559  GLY C N   1 
ATOM   3566 C CA  . GLY C 1 68  ? 18.962  1.905   45.293 1.00 41.32  ? 559  GLY C CA  1 
ATOM   3567 C C   . GLY C 1 68  ? 20.128  2.866   45.402 1.00 38.54  ? 559  GLY C C   1 
ATOM   3568 O O   . GLY C 1 68  ? 20.451  3.569   44.454 1.00 38.50  ? 559  GLY C O   1 
ATOM   3569 N N   . ILE C 1 69  ? 20.775  2.886   46.558 1.00 35.74  ? 560  ILE C N   1 
ATOM   3570 C CA  . ILE C 1 69  ? 21.901  3.778   46.760 1.00 34.97  ? 560  ILE C CA  1 
ATOM   3571 C C   . ILE C 1 69  ? 22.916  3.214   47.756 1.00 33.97  ? 560  ILE C C   1 
ATOM   3572 O O   . ILE C 1 69  ? 22.691  2.162   48.362 1.00 35.29  ? 560  ILE C O   1 
ATOM   3573 C CB  . ILE C 1 69  ? 21.397  5.143   47.293 1.00 35.54  ? 560  ILE C CB  1 
ATOM   3574 C CG1 . ILE C 1 69  ? 20.565  4.940   48.562 1.00 36.34  ? 560  ILE C CG1 1 
ATOM   3575 C CG2 . ILE C 1 69  ? 20.518  5.819   46.269 1.00 33.81  ? 560  ILE C CG2 1 
ATOM   3576 C CD1 . ILE C 1 69  ? 21.381  4.689   49.812 1.00 39.99  ? 560  ILE C CD1 1 
ATOM   3577 N N   . VAL C 1 70  ? 24.046  3.905   47.889 1.00 31.18  ? 561  VAL C N   1 
ATOM   3578 C CA  . VAL C 1 70  ? 25.062  3.560   48.883 1.00 29.43  ? 561  VAL C CA  1 
ATOM   3579 C C   . VAL C 1 70  ? 25.427  4.907   49.506 1.00 28.10  ? 561  VAL C C   1 
ATOM   3580 O O   . VAL C 1 70  ? 25.475  5.928   48.819 1.00 27.11  ? 561  VAL C O   1 
ATOM   3581 C CB  . VAL C 1 70  ? 26.329  2.891   48.298 1.00 29.93  ? 561  VAL C CB  1 
ATOM   3582 C CG1 . VAL C 1 70  ? 25.962  1.586   47.631 1.00 29.94  ? 561  VAL C CG1 1 
ATOM   3583 C CG2 . VAL C 1 70  ? 27.038  3.837   47.335 1.00 33.28  ? 561  VAL C CG2 1 
ATOM   3584 N N   . THR C 1 71  ? 25.656  4.917   50.813 1.00 27.09  ? 562  THR C N   1 
ATOM   3585 C CA  . THR C 1 71  ? 25.971  6.155   51.500 1.00 26.26  ? 562  THR C CA  1 
ATOM   3586 C C   . THR C 1 71  ? 27.339  6.118   52.130 1.00 26.72  ? 562  THR C C   1 
ATOM   3587 O O   . THR C 1 71  ? 27.629  5.230   52.936 1.00 25.97  ? 562  THR C O   1 
ATOM   3588 C CB  . THR C 1 71  ? 24.941  6.452   52.621 1.00 26.66  ? 562  THR C CB  1 
ATOM   3589 O OG1 . THR C 1 71  ? 23.618  6.487   52.067 1.00 30.00  ? 562  THR C OG1 1 
ATOM   3590 C CG2 . THR C 1 71  ? 25.243  7.784   53.287 1.00 22.71  ? 562  THR C CG2 1 
ATOM   3591 N N   . ILE C 1 72  ? 28.181  7.079   51.754 1.00 26.86  ? 563  ILE C N   1 
ATOM   3592 C CA  . ILE C 1 72  ? 29.511  7.177   52.331 1.00 28.49  ? 563  ILE C CA  1 
ATOM   3593 C C   . ILE C 1 72  ? 29.424  8.299   53.363 1.00 30.22  ? 563  ILE C C   1 
ATOM   3594 O O   . ILE C 1 72  ? 28.739  9.303   53.141 1.00 32.26  ? 563  ILE C O   1 
ATOM   3595 C CB  . ILE C 1 72  ? 30.597  7.470   51.254 1.00 28.31  ? 563  ILE C CB  1 
ATOM   3596 C CG1 . ILE C 1 72  ? 30.455  8.875   50.702 1.00 31.27  ? 563  ILE C CG1 1 
ATOM   3597 C CG2 . ILE C 1 72  ? 30.460  6.489   50.096 1.00 24.81  ? 563  ILE C CG2 1 
ATOM   3598 C CD1 . ILE C 1 72  ? 31.381  9.134   49.517 1.00 37.33  ? 563  ILE C CD1 1 
ATOM   3599 N N   . VAL C 1 73  ? 30.078  8.119   54.508 1.00 30.48  ? 564  VAL C N   1 
ATOM   3600 C CA  . VAL C 1 73  ? 30.023  9.128   55.564 1.00 28.53  ? 564  VAL C CA  1 
ATOM   3601 C C   . VAL C 1 73  ? 31.407  9.522   56.069 1.00 27.73  ? 564  VAL C C   1 
ATOM   3602 O O   . VAL C 1 73  ? 32.408  8.917   55.698 1.00 27.94  ? 564  VAL C O   1 
ATOM   3603 C CB  . VAL C 1 73  ? 29.168  8.621   56.755 1.00 28.60  ? 564  VAL C CB  1 
ATOM   3604 C CG1 . VAL C 1 73  ? 27.823  8.125   56.250 1.00 23.93  ? 564  VAL C CG1 1 
ATOM   3605 C CG2 . VAL C 1 73  ? 29.903  7.510   57.496 1.00 26.71  ? 564  VAL C CG2 1 
ATOM   3606 N N   . GLY C 1 74  ? 31.454  10.541  56.918 1.00 26.00  ? 565  GLY C N   1 
ATOM   3607 C CA  . GLY C 1 74  ? 32.725  10.997  57.441 1.00 24.78  ? 565  GLY C CA  1 
ATOM   3608 C C   . GLY C 1 74  ? 33.379  12.020  56.536 1.00 26.01  ? 565  GLY C C   1 
ATOM   3609 O O   . GLY C 1 74  ? 34.593  12.209  56.582 1.00 26.52  ? 565  GLY C O   1 
ATOM   3610 N N   . LEU C 1 75  ? 32.580  12.689  55.711 1.00 27.33  ? 566  LEU C N   1 
ATOM   3611 C CA  . LEU C 1 75  ? 33.101  13.698  54.785 1.00 29.40  ? 566  LEU C CA  1 
ATOM   3612 C C   . LEU C 1 75  ? 33.149  15.084  55.432 1.00 29.47  ? 566  LEU C C   1 
ATOM   3613 O O   . LEU C 1 75  ? 32.500  15.323  56.448 1.00 28.06  ? 566  LEU C O   1 
ATOM   3614 C CB  . LEU C 1 75  ? 32.219  13.767  53.526 1.00 28.91  ? 566  LEU C CB  1 
ATOM   3615 C CG  . LEU C 1 75  ? 31.886  12.447  52.808 1.00 28.77  ? 566  LEU C CG  1 
ATOM   3616 C CD1 . LEU C 1 75  ? 30.721  12.655  51.847 1.00 26.25  ? 566  LEU C CD1 1 
ATOM   3617 C CD2 . LEU C 1 75  ? 33.107  11.937  52.068 1.00 26.92  ? 566  LEU C CD2 1 
ATOM   3618 N N   . LYS C 1 76  ? 33.927  15.987  54.838 1.00 31.01  ? 567  LYS C N   1 
ATOM   3619 C CA  . LYS C 1 76  ? 34.035  17.368  55.322 1.00 32.51  ? 567  LYS C CA  1 
ATOM   3620 C C   . LYS C 1 76  ? 33.079  18.283  54.549 1.00 31.18  ? 567  LYS C C   1 
ATOM   3621 O O   . LYS C 1 76  ? 32.887  18.116  53.351 1.00 30.71  ? 567  LYS C O   1 
ATOM   3622 C CB  . LYS C 1 76  ? 35.458  17.904  55.136 1.00 34.38  ? 567  LYS C CB  1 
ATOM   3623 C CG  . LYS C 1 76  ? 36.516  17.225  55.983 1.00 38.12  ? 567  LYS C CG  1 
ATOM   3624 C CD  . LYS C 1 76  ? 37.906  17.782  55.679 1.00 40.57  ? 567  LYS C CD  1 
ATOM   3625 C CE  . LYS C 1 76  ? 38.950  17.210  56.637 1.00 44.61  ? 567  LYS C CE  1 
ATOM   3626 N NZ  . LYS C 1 76  ? 38.709  17.570  58.081 1.00 44.97  ? 567  LYS C NZ  1 
ATOM   3627 N N   . PRO C 1 77  ? 32.465  19.261  55.231 1.00 31.07  ? 568  PRO C N   1 
ATOM   3628 C CA  . PRO C 1 77  ? 31.537  20.205  54.598 1.00 29.52  ? 568  PRO C CA  1 
ATOM   3629 C C   . PRO C 1 77  ? 32.287  21.077  53.608 1.00 29.47  ? 568  PRO C C   1 
ATOM   3630 O O   . PRO C 1 77  ? 33.457  21.397  53.826 1.00 29.68  ? 568  PRO C O   1 
ATOM   3631 C CB  . PRO C 1 77  ? 31.037  21.046  55.769 1.00 28.92  ? 568  PRO C CB  1 
ATOM   3632 C CG  . PRO C 1 77  ? 31.159  20.147  56.925 1.00 31.54  ? 568  PRO C CG  1 
ATOM   3633 C CD  . PRO C 1 77  ? 32.479  19.453  56.690 1.00 31.33  ? 568  PRO C CD  1 
ATOM   3634 N N   . GLU C 1 78  ? 31.629  21.463  52.524 1.00 28.90  ? 569  GLU C N   1 
ATOM   3635 C CA  . GLU C 1 78  ? 32.264  22.336  51.547 1.00 30.73  ? 569  GLU C CA  1 
ATOM   3636 C C   . GLU C 1 78  ? 33.597  21.811  51.004 1.00 31.48  ? 569  GLU C C   1 
ATOM   3637 O O   . GLU C 1 78  ? 34.540  22.571  50.792 1.00 31.77  ? 569  GLU C O   1 
ATOM   3638 C CB  . GLU C 1 78  ? 32.462  23.716  52.180 1.00 30.96  ? 569  GLU C CB  1 
ATOM   3639 C CG  . GLU C 1 78  ? 31.180  24.245  52.778 1.00 35.51  ? 569  GLU C CG  1 
ATOM   3640 C CD  . GLU C 1 78  ? 31.277  25.664  53.275 1.00 38.19  ? 569  GLU C CD  1 
ATOM   3641 O OE1 . GLU C 1 78  ? 31.817  25.891  54.379 1.00 39.00  ? 569  GLU C OE1 1 
ATOM   3642 O OE2 . GLU C 1 78  ? 30.803  26.560  52.551 1.00 42.43  ? 569  GLU C OE2 1 
ATOM   3643 N N   . THR C 1 79  ? 33.682  20.509  50.779 1.00 30.40  ? 570  THR C N   1 
ATOM   3644 C CA  . THR C 1 79  ? 34.904  19.943  50.250 1.00 30.25  ? 570  THR C CA  1 
ATOM   3645 C C   . THR C 1 79  ? 34.607  19.238  48.931 1.00 29.89  ? 570  THR C C   1 
ATOM   3646 O O   . THR C 1 79  ? 33.566  18.604  48.774 1.00 30.65  ? 570  THR C O   1 
ATOM   3647 C CB  . THR C 1 79  ? 35.519  18.941  51.241 1.00 31.64  ? 570  THR C CB  1 
ATOM   3648 O OG1 . THR C 1 79  ? 35.759  19.597  52.492 1.00 31.90  ? 570  THR C OG1 1 
ATOM   3649 C CG2 . THR C 1 79  ? 36.836  18.385  50.698 1.00 30.00  ? 570  THR C CG2 1 
ATOM   3650 N N   . THR C 1 80  ? 35.515  19.367  47.973 1.00 28.47  ? 571  THR C N   1 
ATOM   3651 C CA  . THR C 1 80  ? 35.322  18.716  46.693 1.00 27.01  ? 571  THR C CA  1 
ATOM   3652 C C   . THR C 1 80  ? 35.924  17.326  46.768 1.00 25.80  ? 571  THR C C   1 
ATOM   3653 O O   . THR C 1 80  ? 37.098  17.163  47.086 1.00 25.75  ? 571  THR C O   1 
ATOM   3654 C CB  . THR C 1 80  ? 35.980  19.508  45.559 1.00 28.28  ? 571  THR C CB  1 
ATOM   3655 O OG1 . THR C 1 80  ? 35.423  20.833  45.520 1.00 27.00  ? 571  THR C OG1 1 
ATOM   3656 C CG2 . THR C 1 80  ? 35.729  18.814  44.219 1.00 27.03  ? 571  THR C CG2 1 
ATOM   3657 N N   . TYR C 1 81  ? 35.094  16.328  46.491 1.00 25.50  ? 572  TYR C N   1 
ATOM   3658 C CA  . TYR C 1 81  ? 35.491  14.926  46.532 1.00 25.02  ? 572  TYR C CA  1 
ATOM   3659 C C   . TYR C 1 81  ? 35.317  14.247  45.176 1.00 25.18  ? 572  TYR C C   1 
ATOM   3660 O O   . TYR C 1 81  ? 34.637  14.762  44.288 1.00 23.32  ? 572  TYR C O   1 
ATOM   3661 C CB  . TYR C 1 81  ? 34.628  14.169  47.542 1.00 23.10  ? 572  TYR C CB  1 
ATOM   3662 C CG  . TYR C 1 81  ? 34.990  14.370  48.987 1.00 21.05  ? 572  TYR C CG  1 
ATOM   3663 C CD1 . TYR C 1 81  ? 35.982  13.593  49.597 1.00 20.42  ? 572  TYR C CD1 1 
ATOM   3664 C CD2 . TYR C 1 81  ? 34.323  15.317  49.763 1.00 20.98  ? 572  TYR C CD2 1 
ATOM   3665 C CE1 . TYR C 1 81  ? 36.298  13.756  50.957 1.00 18.79  ? 572  TYR C CE1 1 
ATOM   3666 C CE2 . TYR C 1 81  ? 34.634  15.489  51.115 1.00 21.26  ? 572  TYR C CE2 1 
ATOM   3667 C CZ  . TYR C 1 81  ? 35.620  14.707  51.704 1.00 19.32  ? 572  TYR C CZ  1 
ATOM   3668 O OH  . TYR C 1 81  ? 35.918  14.891  53.032 1.00 21.17  ? 572  TYR C OH  1 
ATOM   3669 N N   . ALA C 1 82  ? 35.939  13.078  45.041 1.00 25.69  ? 573  ALA C N   1 
ATOM   3670 C CA  . ALA C 1 82  ? 35.832  12.261  43.834 1.00 25.70  ? 573  ALA C CA  1 
ATOM   3671 C C   . ALA C 1 82  ? 35.449  10.860  44.335 1.00 26.90  ? 573  ALA C C   1 
ATOM   3672 O O   . ALA C 1 82  ? 35.982  10.385  45.343 1.00 26.57  ? 573  ALA C O   1 
ATOM   3673 C CB  . ALA C 1 82  ? 37.164  12.222  43.092 1.00 20.59  ? 573  ALA C CB  1 
ATOM   3674 N N   . VAL C 1 83  ? 34.511  10.209  43.657 1.00 28.37  ? 574  VAL C N   1 
ATOM   3675 C CA  . VAL C 1 83  ? 34.097  8.863   44.070 1.00 30.38  ? 574  VAL C CA  1 
ATOM   3676 C C   . VAL C 1 83  ? 34.069  7.912   42.872 1.00 31.41  ? 574  VAL C C   1 
ATOM   3677 O O   . VAL C 1 83  ? 33.815  8.329   41.735 1.00 31.86  ? 574  VAL C O   1 
ATOM   3678 C CB  . VAL C 1 83  ? 32.690  8.874   44.751 1.00 28.35  ? 574  VAL C CB  1 
ATOM   3679 C CG1 . VAL C 1 83  ? 31.602  9.083   43.721 1.00 25.80  ? 574  VAL C CG1 1 
ATOM   3680 C CG2 . VAL C 1 83  ? 32.471  7.589   45.507 1.00 27.78  ? 574  VAL C CG2 1 
ATOM   3681 N N   . ARG C 1 84  ? 34.346  6.640   43.131 1.00 32.23  ? 575  ARG C N   1 
ATOM   3682 C CA  . ARG C 1 84  ? 34.347  5.631   42.076 1.00 34.86  ? 575  ARG C CA  1 
ATOM   3683 C C   . ARG C 1 84  ? 34.055  4.261   42.679 1.00 34.53  ? 575  ARG C C   1 
ATOM   3684 O O   . ARG C 1 84  ? 34.494  3.958   43.786 1.00 32.80  ? 575  ARG C O   1 
ATOM   3685 C CB  . ARG C 1 84  ? 35.693  5.622   41.345 1.00 35.79  ? 575  ARG C CB  1 
ATOM   3686 C CG  . ARG C 1 84  ? 36.871  5.289   42.227 1.00 38.00  ? 575  ARG C CG  1 
ATOM   3687 C CD  . ARG C 1 84  ? 38.161  5.396   41.454 1.00 40.53  ? 575  ARG C CD  1 
ATOM   3688 N NE  . ARG C 1 84  ? 39.302  4.939   42.240 1.00 44.12  ? 575  ARG C NE  1 
ATOM   3689 C CZ  . ARG C 1 84  ? 40.564  5.067   41.847 1.00 44.97  ? 575  ARG C CZ  1 
ATOM   3690 N NH1 . ARG C 1 84  ? 40.836  5.640   40.681 1.00 45.81  ? 575  ARG C NH1 1 
ATOM   3691 N NH2 . ARG C 1 84  ? 41.550  4.627   42.614 1.00 43.76  ? 575  ARG C NH2 1 
ATOM   3692 N N   . LEU C 1 85  ? 33.314  3.443   41.935 1.00 36.33  ? 576  LEU C N   1 
ATOM   3693 C CA  . LEU C 1 85  ? 32.913  2.113   42.389 1.00 37.48  ? 576  LEU C CA  1 
ATOM   3694 C C   . LEU C 1 85  ? 33.408  0.970   41.515 1.00 38.40  ? 576  LEU C C   1 
ATOM   3695 O O   . LEU C 1 85  ? 33.746  1.151   40.345 1.00 39.41  ? 576  LEU C O   1 
ATOM   3696 C CB  . LEU C 1 85  ? 31.383  2.026   42.463 1.00 37.55  ? 576  LEU C CB  1 
ATOM   3697 C CG  . LEU C 1 85  ? 30.651  3.130   43.224 1.00 38.28  ? 576  LEU C CG  1 
ATOM   3698 C CD1 . LEU C 1 85  ? 29.161  2.912   43.130 1.00 38.30  ? 576  LEU C CD1 1 
ATOM   3699 C CD2 . LEU C 1 85  ? 31.095  3.133   44.669 1.00 38.11  ? 576  LEU C CD2 1 
ATOM   3700 N N   . ALA C 1 86  ? 33.422  -0.217  42.108 1.00 39.38  ? 577  ALA C N   1 
ATOM   3701 C CA  . ALA C 1 86  ? 33.828  -1.440  41.433 1.00 39.85  ? 577  ALA C CA  1 
ATOM   3702 C C   . ALA C 1 86  ? 32.944  -2.579  41.955 1.00 40.50  ? 577  ALA C C   1 
ATOM   3703 O O   . ALA C 1 86  ? 32.591  -2.603  43.135 1.00 39.86  ? 577  ALA C O   1 
ATOM   3704 C CB  . ALA C 1 86  ? 35.286  -1.734  41.724 1.00 39.76  ? 577  ALA C CB  1 
ATOM   3705 N N   . ALA C 1 87  ? 32.574  -3.508  41.076 1.00 40.58  ? 578  ALA C N   1 
ATOM   3706 C CA  . ALA C 1 87  ? 31.749  -4.640  41.481 1.00 40.30  ? 578  ALA C CA  1 
ATOM   3707 C C   . ALA C 1 87  ? 32.600  -5.892  41.726 1.00 41.02  ? 578  ALA C C   1 
ATOM   3708 O O   . ALA C 1 87  ? 33.624  -6.101  41.076 1.00 41.64  ? 578  ALA C O   1 
ATOM   3709 C CB  . ALA C 1 87  ? 30.700  -4.920  40.421 1.00 38.29  ? 578  ALA C CB  1 
ATOM   3710 N N   . LEU C 1 88  ? 32.177  -6.719  42.673 1.00 42.23  ? 579  LEU C N   1 
ATOM   3711 C CA  . LEU C 1 88  ? 32.891  -7.956  42.984 1.00 43.87  ? 579  LEU C CA  1 
ATOM   3712 C C   . LEU C 1 88  ? 31.975  -9.182  42.870 1.00 46.66  ? 579  LEU C C   1 
ATOM   3713 O O   . LEU C 1 88  ? 30.869  -9.194  43.415 1.00 47.46  ? 579  LEU C O   1 
ATOM   3714 C CB  . LEU C 1 88  ? 33.469  -7.897  44.405 1.00 40.99  ? 579  LEU C CB  1 
ATOM   3715 C CG  . LEU C 1 88  ? 34.131  -9.168  44.954 1.00 39.05  ? 579  LEU C CG  1 
ATOM   3716 C CD1 . LEU C 1 88  ? 35.378  -9.472  44.157 1.00 38.26  ? 579  LEU C CD1 1 
ATOM   3717 C CD2 . LEU C 1 88  ? 34.497  -8.984  46.410 1.00 38.24  ? 579  LEU C CD2 1 
ATOM   3718 N N   . ASN C 1 89  ? 32.427  -10.205 42.149 1.00 49.07  ? 580  ASN C N   1 
ATOM   3719 C CA  . ASN C 1 89  ? 31.657  -11.442 42.029 1.00 49.74  ? 580  ASN C CA  1 
ATOM   3720 C C   . ASN C 1 89  ? 32.555  -12.619 42.387 1.00 51.00  ? 580  ASN C C   1 
ATOM   3721 O O   . ASN C 1 89  ? 33.680  -12.431 42.862 1.00 49.92  ? 580  ASN C O   1 
ATOM   3722 C CB  . ASN C 1 89  ? 31.087  -11.629 40.614 1.00 48.47  ? 580  ASN C CB  1 
ATOM   3723 C CG  . ASN C 1 89  ? 32.158  -11.841 39.566 1.00 48.16  ? 580  ASN C CG  1 
ATOM   3724 O OD1 . ASN C 1 89  ? 33.220  -12.385 39.841 1.00 48.11  ? 580  ASN C OD1 1 
ATOM   3725 N ND2 . ASN C 1 89  ? 31.866  -11.431 38.341 1.00 49.18  ? 580  ASN C ND2 1 
ATOM   3726 N N   . GLY C 1 90  ? 32.052  -13.831 42.158 1.00 52.38  ? 581  GLY C N   1 
ATOM   3727 C CA  . GLY C 1 90  ? 32.822  -15.023 42.459 1.00 52.68  ? 581  GLY C CA  1 
ATOM   3728 C C   . GLY C 1 90  ? 34.192  -14.984 41.813 1.00 53.56  ? 581  GLY C C   1 
ATOM   3729 O O   . GLY C 1 90  ? 35.208  -15.119 42.489 1.00 53.53  ? 581  GLY C O   1 
ATOM   3730 N N   . LYS C 1 91  ? 34.220  -14.795 40.498 1.00 54.93  ? 582  LYS C N   1 
ATOM   3731 C CA  . LYS C 1 91  ? 35.477  -14.730 39.766 1.00 56.70  ? 582  LYS C CA  1 
ATOM   3732 C C   . LYS C 1 91  ? 36.426  -13.742 40.454 1.00 57.71  ? 582  LYS C C   1 
ATOM   3733 O O   . LYS C 1 91  ? 37.600  -14.051 40.684 1.00 58.84  ? 582  LYS C O   1 
ATOM   3734 C CB  . LYS C 1 91  ? 35.211  -14.294 38.324 1.00 57.37  ? 582  LYS C CB  1 
ATOM   3735 C CG  . LYS C 1 91  ? 34.107  -15.095 37.638 1.00 59.38  ? 582  LYS C CG  1 
ATOM   3736 C CD  . LYS C 1 91  ? 34.525  -16.526 37.286 1.00 61.59  ? 582  LYS C CD  1 
ATOM   3737 C CE  . LYS C 1 91  ? 35.485  -16.557 36.095 1.00 62.75  ? 582  LYS C CE  1 
ATOM   3738 N NZ  . LYS C 1 91  ? 35.680  -17.932 35.531 1.00 63.20  ? 582  LYS C NZ  1 
ATOM   3739 N N   . GLY C 1 92  ? 35.913  -12.560 40.791 1.00 57.48  ? 583  GLY C N   1 
ATOM   3740 C CA  . GLY C 1 92  ? 36.739  -11.567 41.454 1.00 56.38  ? 583  GLY C CA  1 
ATOM   3741 C C   . GLY C 1 92  ? 36.328  -10.119 41.242 1.00 55.40  ? 583  GLY C C   1 
ATOM   3742 O O   . GLY C 1 92  ? 35.284  -9.831  40.659 1.00 55.58  ? 583  GLY C O   1 
ATOM   3743 N N   . LEU C 1 93  ? 37.172  -9.208  41.721 1.00 53.77  ? 584  LEU C N   1 
ATOM   3744 C CA  . LEU C 1 93  ? 36.940  -7.771  41.621 1.00 52.47  ? 584  LEU C CA  1 
ATOM   3745 C C   . LEU C 1 93  ? 37.015  -7.249  40.193 1.00 51.09  ? 584  LEU C C   1 
ATOM   3746 O O   . LEU C 1 93  ? 37.984  -7.495  39.483 1.00 49.69  ? 584  LEU C O   1 
ATOM   3747 C CB  . LEU C 1 93  ? 37.959  -7.025  42.486 1.00 52.40  ? 584  LEU C CB  1 
ATOM   3748 C CG  . LEU C 1 93  ? 37.915  -5.497  42.442 1.00 51.76  ? 584  LEU C CG  1 
ATOM   3749 C CD1 . LEU C 1 93  ? 36.515  -5.015  42.820 1.00 50.83  ? 584  LEU C CD1 1 
ATOM   3750 C CD2 . LEU C 1 93  ? 38.967  -4.931  43.383 1.00 49.34  ? 584  LEU C CD2 1 
ATOM   3751 N N   . GLY C 1 94  ? 35.990  -6.511  39.786 1.00 50.94  ? 585  GLY C N   1 
ATOM   3752 C CA  . GLY C 1 94  ? 35.961  -5.967  38.440 1.00 52.37  ? 585  GLY C CA  1 
ATOM   3753 C C   . GLY C 1 94  ? 36.737  -4.671  38.295 1.00 53.26  ? 585  GLY C C   1 
ATOM   3754 O O   . GLY C 1 94  ? 37.628  -4.363  39.090 1.00 54.49  ? 585  GLY C O   1 
ATOM   3755 N N   . GLU C 1 95  ? 36.402  -3.899  37.272 1.00 53.35  ? 586  GLU C N   1 
ATOM   3756 C CA  . GLU C 1 95  ? 37.086  -2.637  37.049 1.00 53.41  ? 586  GLU C CA  1 
ATOM   3757 C C   . GLU C 1 95  ? 36.261  -1.467  37.532 1.00 51.81  ? 586  GLU C C   1 
ATOM   3758 O O   . GLU C 1 95  ? 35.027  -1.469  37.411 1.00 52.42  ? 586  GLU C O   1 
ATOM   3759 C CB  . GLU C 1 95  ? 37.421  -2.486  35.570 1.00 56.00  ? 586  GLU C CB  1 
ATOM   3760 C CG  . GLU C 1 95  ? 38.522  -3.440  35.156 1.00 61.02  ? 586  GLU C CG  1 
ATOM   3761 C CD  . GLU C 1 95  ? 38.534  -3.715  33.678 1.00 63.36  ? 586  GLU C CD  1 
ATOM   3762 O OE1 . GLU C 1 95  ? 38.659  -2.739  32.905 1.00 65.31  ? 586  GLU C OE1 1 
ATOM   3763 O OE2 . GLU C 1 95  ? 38.421  -4.906  33.298 1.00 63.70  ? 586  GLU C OE2 1 
ATOM   3764 N N   . ILE C 1 96  ? 36.957  -0.473  38.083 1.00 47.77  ? 587  ILE C N   1 
ATOM   3765 C CA  . ILE C 1 96  ? 36.329  0.728   38.613 1.00 42.86  ? 587  ILE C CA  1 
ATOM   3766 C C   . ILE C 1 96  ? 35.747  1.645   37.548 1.00 40.81  ? 587  ILE C C   1 
ATOM   3767 O O   . ILE C 1 96  ? 36.231  1.714   36.426 1.00 39.44  ? 587  ILE C O   1 
ATOM   3768 C CB  . ILE C 1 96  ? 37.323  1.539   39.470 1.00 42.25  ? 587  ILE C CB  1 
ATOM   3769 C CG1 . ILE C 1 96  ? 38.727  1.400   38.893 1.00 40.77  ? 587  ILE C CG1 1 
ATOM   3770 C CG2 . ILE C 1 96  ? 37.257  1.096   40.926 1.00 39.81  ? 587  ILE C CG2 1 
ATOM   3771 C CD1 . ILE C 1 96  ? 39.823  1.816   39.854 1.00 41.73  ? 587  ILE C CD1 1 
ATOM   3772 N N   . SER C 1 97  ? 34.687  2.345   37.923 1.00 39.45  ? 588  SER C N   1 
ATOM   3773 C CA  . SER C 1 97  ? 34.026  3.280   37.029 1.00 38.49  ? 588  SER C CA  1 
ATOM   3774 C C   . SER C 1 97  ? 34.875  4.537   36.971 1.00 37.42  ? 588  SER C C   1 
ATOM   3775 O O   . SER C 1 97  ? 35.885  4.649   37.668 1.00 36.57  ? 588  SER C O   1 
ATOM   3776 C CB  . SER C 1 97  ? 32.655  3.658   37.592 1.00 38.69  ? 588  SER C CB  1 
ATOM   3777 O OG  . SER C 1 97  ? 32.807  4.430   38.778 1.00 37.31  ? 588  SER C OG  1 
ATOM   3778 N N   . ALA C 1 98  ? 34.451  5.484   36.143 1.00 35.86  ? 589  ALA C N   1 
ATOM   3779 C CA  . ALA C 1 98  ? 35.141  6.757   36.031 1.00 34.42  ? 589  ALA C CA  1 
ATOM   3780 C C   . ALA C 1 98  ? 34.877  7.509   37.338 1.00 34.37  ? 589  ALA C C   1 
ATOM   3781 O O   . ALA C 1 98  ? 33.856  7.287   37.992 1.00 34.21  ? 589  ALA C O   1 
ATOM   3782 C CB  . ALA C 1 98  ? 34.585  7.543   34.858 1.00 34.33  ? 589  ALA C CB  1 
ATOM   3783 N N   . ALA C 1 99  ? 35.792  8.390   37.725 1.00 33.73  ? 590  ALA C N   1 
ATOM   3784 C CA  . ALA C 1 99  ? 35.605  9.153   38.946 1.00 33.24  ? 590  ALA C CA  1 
ATOM   3785 C C   . ALA C 1 99  ? 34.517  10.196  38.739 1.00 33.41  ? 590  ALA C C   1 
ATOM   3786 O O   . ALA C 1 99  ? 34.512  10.919  37.735 1.00 33.49  ? 590  ALA C O   1 
ATOM   3787 C CB  . ALA C 1 99  ? 36.896  9.825   39.354 1.00 33.22  ? 590  ALA C CB  1 
ATOM   3788 N N   . SER C 1 100 ? 33.590  10.245  39.692 1.00 32.03  ? 591  SER C N   1 
ATOM   3789 C CA  . SER C 1 100 ? 32.475  11.186  39.682 1.00 31.44  ? 591  SER C CA  1 
ATOM   3790 C C   . SER C 1 100 ? 32.800  12.257  40.739 1.00 30.76  ? 591  SER C C   1 
ATOM   3791 O O   . SER C 1 100 ? 33.036  11.947  41.914 1.00 30.96  ? 591  SER C O   1 
ATOM   3792 C CB  . SER C 1 100 ? 31.181  10.439  40.030 1.00 32.53  ? 591  SER C CB  1 
ATOM   3793 O OG  . SER C 1 100 ? 30.066  11.300  40.074 1.00 30.84  ? 591  SER C OG  1 
ATOM   3794 N N   . GLU C 1 101 ? 32.815  13.515  40.313 1.00 28.96  ? 592  GLU C N   1 
ATOM   3795 C CA  . GLU C 1 101 ? 33.156  14.627  41.194 1.00 26.72  ? 592  GLU C CA  1 
ATOM   3796 C C   . GLU C 1 101 ? 31.962  15.383  41.785 1.00 24.53  ? 592  GLU C C   1 
ATOM   3797 O O   . GLU C 1 101 ? 30.972  15.673  41.106 1.00 23.08  ? 592  GLU C O   1 
ATOM   3798 C CB  . GLU C 1 101 ? 34.067  15.588  40.431 1.00 27.44  ? 592  GLU C CB  1 
ATOM   3799 C CG  . GLU C 1 101 ? 35.017  16.398  41.284 1.00 30.58  ? 592  GLU C CG  1 
ATOM   3800 C CD  . GLU C 1 101 ? 36.095  17.043  40.446 1.00 33.25  ? 592  GLU C CD  1 
ATOM   3801 O OE1 . GLU C 1 101 ? 36.122  16.773  39.228 1.00 35.57  ? 592  GLU C OE1 1 
ATOM   3802 O OE2 . GLU C 1 101 ? 36.916  17.809  40.991 1.00 35.24  ? 592  GLU C OE2 1 
ATOM   3803 N N   . PHE C 1 102 ? 32.073  15.706  43.063 1.00 22.81  ? 593  PHE C N   1 
ATOM   3804 C CA  . PHE C 1 102 ? 31.013  16.415  43.748 1.00 25.41  ? 593  PHE C CA  1 
ATOM   3805 C C   . PHE C 1 102 ? 31.588  17.255  44.878 1.00 28.48  ? 593  PHE C C   1 
ATOM   3806 O O   . PHE C 1 102 ? 32.749  17.085  45.265 1.00 30.87  ? 593  PHE C O   1 
ATOM   3807 C CB  . PHE C 1 102 ? 29.994  15.412  44.303 1.00 25.30  ? 593  PHE C CB  1 
ATOM   3808 C CG  . PHE C 1 102 ? 30.497  14.600  45.477 1.00 23.79  ? 593  PHE C CG  1 
ATOM   3809 C CD1 . PHE C 1 102 ? 30.304  15.046  46.787 1.00 23.38  ? 593  PHE C CD1 1 
ATOM   3810 C CD2 . PHE C 1 102 ? 31.125  13.371  45.275 1.00 22.84  ? 593  PHE C CD2 1 
ATOM   3811 C CE1 . PHE C 1 102 ? 30.721  14.279  47.882 1.00 21.46  ? 593  PHE C CE1 1 
ATOM   3812 C CE2 . PHE C 1 102 ? 31.544  12.600  46.360 1.00 22.58  ? 593  PHE C CE2 1 
ATOM   3813 C CZ  . PHE C 1 102 ? 31.339  13.055  47.665 1.00 22.46  ? 593  PHE C CZ  1 
ATOM   3814 N N   . LYS C 1 103 ? 30.776  18.166  45.402 1.00 28.68  ? 594  LYS C N   1 
ATOM   3815 C CA  . LYS C 1 103 ? 31.204  19.018  46.503 1.00 28.22  ? 594  LYS C CA  1 
ATOM   3816 C C   . LYS C 1 103 ? 30.132  18.957  47.580 1.00 28.23  ? 594  LYS C C   1 
ATOM   3817 O O   . LYS C 1 103 ? 28.948  19.142  47.295 1.00 29.18  ? 594  LYS C O   1 
ATOM   3818 C CB  . LYS C 1 103 ? 31.389  20.461  46.030 1.00 26.94  ? 594  LYS C CB  1 
ATOM   3819 C CG  . LYS C 1 103 ? 31.802  21.407  47.136 1.00 24.43  ? 594  LYS C CG  1 
ATOM   3820 C CD  . LYS C 1 103 ? 31.878  22.824  46.645 1.00 22.60  ? 594  LYS C CD  1 
ATOM   3821 C CE  . LYS C 1 103 ? 32.471  23.737  47.708 1.00 23.37  ? 594  LYS C CE  1 
ATOM   3822 N NZ  . LYS C 1 103 ? 32.433  25.173  47.290 1.00 23.71  ? 594  LYS C NZ  1 
ATOM   3823 N N   . THR C 1 104 ? 30.544  18.683  48.812 1.00 27.10  ? 595  THR C N   1 
ATOM   3824 C CA  . THR C 1 104 ? 29.599  18.590  49.914 1.00 26.98  ? 595  THR C CA  1 
ATOM   3825 C C   . THR C 1 104 ? 29.017  19.958  50.236 1.00 27.06  ? 595  THR C C   1 
ATOM   3826 O O   . THR C 1 104 ? 29.505  20.976  49.755 1.00 28.82  ? 595  THR C O   1 
ATOM   3827 C CB  . THR C 1 104 ? 30.260  17.993  51.178 1.00 25.50  ? 595  THR C CB  1 
ATOM   3828 O OG1 . THR C 1 104 ? 31.390  18.781  51.557 1.00 26.68  ? 595  THR C OG1 1 
ATOM   3829 C CG2 . THR C 1 104 ? 30.713  16.580  50.916 1.00 25.29  ? 595  THR C CG2 1 
ATOM   3830 N N   . GLN C 1 105 ? 27.965  19.971  51.043 1.00 26.26  ? 596  GLN C N   1 
ATOM   3831 C CA  . GLN C 1 105 ? 27.299  21.204  51.420 1.00 27.42  ? 596  GLN C CA  1 
ATOM   3832 C C   . GLN C 1 105 ? 27.861  21.730  52.723 1.00 29.68  ? 596  GLN C C   1 
ATOM   3833 O O   . GLN C 1 105 ? 28.564  21.016  53.443 1.00 32.24  ? 596  GLN C O   1 
ATOM   3834 C CB  . GLN C 1 105 ? 25.814  20.951  51.626 1.00 26.41  ? 596  GLN C CB  1 
ATOM   3835 C CG  . GLN C 1 105 ? 25.096  20.342  50.455 1.00 27.35  ? 596  GLN C CG  1 
ATOM   3836 C CD  . GLN C 1 105 ? 23.640  20.114  50.769 1.00 29.16  ? 596  GLN C CD  1 
ATOM   3837 O OE1 . GLN C 1 105 ? 22.996  20.972  51.361 1.00 32.19  ? 596  GLN C OE1 1 
ATOM   3838 N NE2 . GLN C 1 105 ? 23.108  18.961  50.373 1.00 28.42  ? 596  GLN C NE2 1 
ATOM   3839 N N   . PRO C 1 106 ? 27.567  22.997  53.046 1.00 29.80  ? 597  PRO C N   1 
ATOM   3840 C CA  . PRO C 1 106 ? 28.061  23.573  54.299 1.00 29.83  ? 597  PRO C CA  1 
ATOM   3841 C C   . PRO C 1 106 ? 27.071  23.184  55.401 1.00 30.03  ? 597  PRO C C   1 
ATOM   3842 O O   . PRO C 1 106 ? 25.916  22.881  55.107 1.00 30.29  ? 597  PRO C O   1 
ATOM   3843 C CB  . PRO C 1 106 ? 28.040  25.071  54.010 1.00 28.02  ? 597  PRO C CB  1 
ATOM   3844 C CG  . PRO C 1 106 ? 26.831  25.205  53.159 1.00 26.87  ? 597  PRO C CG  1 
ATOM   3845 C CD  . PRO C 1 106 ? 26.957  24.037  52.198 1.00 28.17  ? 597  PRO C CD  1 
ATOM   3846 N N   . VAL C 1 107 ? 27.518  23.162  56.652 1.00 30.18  ? 598  VAL C N   1 
ATOM   3847 C CA  . VAL C 1 107 ? 26.626  22.843  57.759 1.00 31.61  ? 598  VAL C CA  1 
ATOM   3848 C C   . VAL C 1 107 ? 25.830  24.101  58.081 1.00 32.24  ? 598  VAL C C   1 
ATOM   3849 O O   . VAL C 1 107 ? 26.379  25.198  58.105 1.00 31.67  ? 598  VAL C O   1 
ATOM   3850 C CB  . VAL C 1 107 ? 27.408  22.395  59.006 1.00 33.17  ? 598  VAL C CB  1 
ATOM   3851 C CG1 . VAL C 1 107 ? 27.913  20.984  58.810 1.00 33.94  ? 598  VAL C CG1 1 
ATOM   3852 C CG2 . VAL C 1 107 ? 28.585  23.331  59.250 1.00 34.60  ? 598  VAL C CG2 1 
ATOM   3853 N N   . ARG C 1 108 ? 24.533  23.936  58.312 1.00 34.46  ? 599  ARG C N   1 
ATOM   3854 C CA  . ARG C 1 108 ? 23.646  25.059  58.601 1.00 36.38  ? 599  ARG C CA  1 
ATOM   3855 C C   . ARG C 1 108 ? 22.975  24.894  59.964 1.00 34.93  ? 599  ARG C C   1 
ATOM   3856 O O   . ARG C 1 108 ? 23.106  23.849  60.604 1.00 34.74  ? 599  ARG C O   1 
ATOM   3857 C CB  . ARG C 1 108 ? 22.600  25.171  57.474 1.00 39.14  ? 599  ARG C CB  1 
ATOM   3858 C CG  . ARG C 1 108 ? 21.216  25.732  57.874 1.00 48.06  ? 599  ARG C CG  1 
ATOM   3859 C CD  . ARG C 1 108 ? 21.067  27.274  57.763 1.00 52.45  ? 599  ARG C CD  1 
ATOM   3860 N NE  . ARG C 1 108 ? 21.883  28.017  58.727 1.00 53.51  ? 599  ARG C NE  1 
ATOM   3861 C CZ  . ARG C 1 108 ? 22.949  28.743  58.403 1.00 54.01  ? 599  ARG C CZ  1 
ATOM   3862 N NH1 . ARG C 1 108 ? 23.335  28.833  57.133 1.00 51.53  ? 599  ARG C NH1 1 
ATOM   3863 N NH2 . ARG C 1 108 ? 23.636  29.368  59.354 1.00 54.42  ? 599  ARG C NH2 1 
ATOM   3864 N N   . GLU C 1 109 ? 22.288  25.939  60.420 1.00 33.46  ? 600  GLU C N   1 
ATOM   3865 C CA  . GLU C 1 109 ? 21.586  25.888  61.698 1.00 32.54  ? 600  GLU C CA  1 
ATOM   3866 C C   . GLU C 1 109 ? 20.402  24.955  61.516 1.00 29.89  ? 600  GLU C C   1 
ATOM   3867 O O   . GLU C 1 109 ? 19.780  24.925  60.454 1.00 30.54  ? 600  GLU C O   1 
ATOM   3868 C CB  . GLU C 1 109 ? 21.091  27.273  62.106 1.00 34.10  ? 600  GLU C CB  1 
ATOM   3869 C CG  . GLU C 1 109 ? 22.150  28.350  62.015 1.00 39.92  ? 600  GLU C CG  1 
ATOM   3870 C CD  . GLU C 1 109 ? 22.071  29.347  63.156 1.00 43.29  ? 600  GLU C CD  1 
ATOM   3871 O OE1 . GLU C 1 109 ? 22.604  29.045  64.251 1.00 44.79  ? 600  GLU C OE1 1 
ATOM   3872 O OE2 . GLU C 1 109 ? 21.470  30.427  62.959 1.00 44.49  ? 600  GLU C OE2 1 
ATOM   3873 N N   . PRO C 1 110 ? 20.067  24.188  62.555 1.00 27.07  ? 601  PRO C N   1 
ATOM   3874 C CA  . PRO C 1 110 ? 18.949  23.255  62.466 1.00 26.59  ? 601  PRO C CA  1 
ATOM   3875 C C   . PRO C 1 110 ? 17.636  23.998  62.342 1.00 27.97  ? 601  PRO C C   1 
ATOM   3876 O O   . PRO C 1 110 ? 17.563  25.193  62.623 1.00 28.25  ? 601  PRO C O   1 
ATOM   3877 C CB  . PRO C 1 110 ? 19.056  22.490  63.779 1.00 27.24  ? 601  PRO C CB  1 
ATOM   3878 C CG  . PRO C 1 110 ? 19.462  23.562  64.729 1.00 25.35  ? 601  PRO C CG  1 
ATOM   3879 C CD  . PRO C 1 110 ? 20.544  24.301  63.946 1.00 26.74  ? 601  PRO C CD  1 
ATOM   3880 N N   . SER C 1 111 ? 16.593  23.310  61.901 1.00 28.25  ? 602  SER C N   1 
ATOM   3881 C CA  . SER C 1 111 ? 15.304  23.972  61.813 1.00 29.16  ? 602  SER C CA  1 
ATOM   3882 C C   . SER C 1 111 ? 14.565  23.582  63.076 1.00 27.76  ? 602  SER C C   1 
ATOM   3883 O O   . SER C 1 111 ? 14.909  22.592  63.706 1.00 27.92  ? 602  SER C O   1 
ATOM   3884 C CB  . SER C 1 111 ? 14.547  23.546  60.554 1.00 28.31  ? 602  SER C CB  1 
ATOM   3885 O OG  . SER C 1 111 ? 14.645  22.155  60.350 1.00 35.47  ? 602  SER C OG  1 
ATOM   3886 N N   . ALA C 1 112 ? 13.575  24.375  63.462 1.00 28.59  ? 603  ALA C N   1 
ATOM   3887 C CA  . ALA C 1 112 ? 12.811  24.103  64.673 1.00 27.95  ? 603  ALA C CA  1 
ATOM   3888 C C   . ALA C 1 112 ? 11.913  22.906  64.478 1.00 28.95  ? 603  ALA C C   1 
ATOM   3889 O O   . ALA C 1 112 ? 11.448  22.646  63.374 1.00 30.84  ? 603  ALA C O   1 
ATOM   3890 C CB  . ALA C 1 112 ? 11.976  25.309  65.038 1.00 24.55  ? 603  ALA C CB  1 
ATOM   3891 N N   . PRO C 1 113 ? 11.666  22.144  65.545 1.00 29.30  ? 604  PRO C N   1 
ATOM   3892 C CA  . PRO C 1 113 ? 10.792  20.979  65.408 1.00 29.56  ? 604  PRO C CA  1 
ATOM   3893 C C   . PRO C 1 113 ? 9.328   21.420  65.451 1.00 30.85  ? 604  PRO C C   1 
ATOM   3894 O O   . PRO C 1 113 ? 9.012   22.571  65.769 1.00 29.62  ? 604  PRO C O   1 
ATOM   3895 C CB  . PRO C 1 113 ? 11.162  20.134  66.616 1.00 28.92  ? 604  PRO C CB  1 
ATOM   3896 C CG  . PRO C 1 113 ? 11.418  21.168  67.649 1.00 29.60  ? 604  PRO C CG  1 
ATOM   3897 C CD  . PRO C 1 113 ? 12.269  22.188  66.886 1.00 29.55  ? 604  PRO C CD  1 
ATOM   3898 N N   . LYS C 1 114 ? 8.434   20.501  65.114 1.00 32.02  ? 605  LYS C N   1 
ATOM   3899 C CA  . LYS C 1 114 ? 7.016   20.793  65.148 1.00 31.56  ? 605  LYS C CA  1 
ATOM   3900 C C   . LYS C 1 114 ? 6.532   20.319  66.507 1.00 30.78  ? 605  LYS C C   1 
ATOM   3901 O O   . LYS C 1 114 ? 7.019   19.317  67.025 1.00 29.52  ? 605  LYS C O   1 
ATOM   3902 C CB  . LYS C 1 114 ? 6.294   20.040  64.031 1.00 34.64  ? 605  LYS C CB  1 
ATOM   3903 C CG  . LYS C 1 114 ? 6.548   20.601  62.636 1.00 37.57  ? 605  LYS C CG  1 
ATOM   3904 C CD  . LYS C 1 114 ? 5.868   21.956  62.468 1.00 39.79  ? 605  LYS C CD  1 
ATOM   3905 C CE  . LYS C 1 114 ? 6.214   22.585  61.132 1.00 39.97  ? 605  LYS C CE  1 
ATOM   3906 N NZ  . LYS C 1 114 ? 5.690   23.977  61.055 1.00 40.46  ? 605  LYS C NZ  1 
ATOM   3907 N N   . LEU C 1 115 ? 5.597   21.060  67.095 1.00 29.72  ? 606  LEU C N   1 
ATOM   3908 C CA  . LEU C 1 115 ? 5.052   20.702  68.396 1.00 27.34  ? 606  LEU C CA  1 
ATOM   3909 C C   . LEU C 1 115 ? 3.606   20.262  68.251 1.00 27.38  ? 606  LEU C C   1 
ATOM   3910 O O   . LEU C 1 115 ? 2.821   20.884  67.530 1.00 26.85  ? 606  LEU C O   1 
ATOM   3911 C CB  . LEU C 1 115 ? 5.157   21.884  69.365 1.00 25.73  ? 606  LEU C CB  1 
ATOM   3912 C CG  . LEU C 1 115 ? 6.574   22.446  69.485 1.00 24.20  ? 606  LEU C CG  1 
ATOM   3913 C CD1 . LEU C 1 115 ? 6.644   23.457  70.620 1.00 24.43  ? 606  LEU C CD1 1 
ATOM   3914 C CD2 . LEU C 1 115 ? 7.541   21.309  69.727 1.00 22.54  ? 606  LEU C CD2 1 
ATOM   3915 N N   . GLU C 1 116 ? 3.273   19.168  68.929 1.00 27.67  ? 607  GLU C N   1 
ATOM   3916 C CA  . GLU C 1 116 ? 1.932   18.604  68.899 1.00 28.45  ? 607  GLU C CA  1 
ATOM   3917 C C   . GLU C 1 116 ? 1.444   18.342  70.320 1.00 28.89  ? 607  GLU C C   1 
ATOM   3918 O O   . GLU C 1 116 ? 2.108   17.674  71.104 1.00 30.61  ? 607  GLU C O   1 
ATOM   3919 C CB  . GLU C 1 116 ? 1.938   17.304  68.089 1.00 29.09  ? 607  GLU C CB  1 
ATOM   3920 C CG  . GLU C 1 116 ? 0.735   16.413  68.326 1.00 28.94  ? 607  GLU C CG  1 
ATOM   3921 C CD  . GLU C 1 116 ? 0.770   15.172  67.471 1.00 30.18  ? 607  GLU C CD  1 
ATOM   3922 O OE1 . GLU C 1 116 ? 0.582   15.287  66.242 1.00 30.83  ? 607  GLU C OE1 1 
ATOM   3923 O OE2 . GLU C 1 116 ? 0.993   14.077  68.025 1.00 32.72  ? 607  GLU C OE2 1 
ATOM   3924 N N   . GLY C 1 117 ? 0.276   18.873  70.650 1.00 29.16  ? 608  GLY C N   1 
ATOM   3925 C CA  . GLY C 1 117 ? -0.256  18.685  71.984 1.00 29.03  ? 608  GLY C CA  1 
ATOM   3926 C C   . GLY C 1 117 ? -1.138  17.463  72.128 1.00 30.19  ? 608  GLY C C   1 
ATOM   3927 O O   . GLY C 1 117 ? -1.811  17.032  71.189 1.00 29.57  ? 608  GLY C O   1 
ATOM   3928 N N   . GLN C 1 118 ? -1.140  16.902  73.327 1.00 31.13  ? 609  GLN C N   1 
ATOM   3929 C CA  . GLN C 1 118 ? -1.949  15.734  73.594 1.00 32.38  ? 609  GLN C CA  1 
ATOM   3930 C C   . GLN C 1 118 ? -2.319  15.725  75.061 1.00 33.51  ? 609  GLN C C   1 
ATOM   3931 O O   . GLN C 1 118 ? -1.580  16.231  75.886 1.00 34.90  ? 609  GLN C O   1 
ATOM   3932 C CB  . GLN C 1 118 ? -1.168  14.481  73.258 1.00 31.15  ? 609  GLN C CB  1 
ATOM   3933 C CG  . GLN C 1 118 ? -1.976  13.229  73.341 1.00 31.77  ? 609  GLN C CG  1 
ATOM   3934 C CD  . GLN C 1 118 ? -1.110  12.010  73.219 1.00 31.95  ? 609  GLN C CD  1 
ATOM   3935 O OE1 . GLN C 1 118 ? -0.174  11.984  72.417 1.00 33.41  ? 609  GLN C OE1 1 
ATOM   3936 N NE2 . GLN C 1 118 ? -1.414  10.983  74.007 1.00 30.59  ? 609  GLN C NE2 1 
ATOM   3937 N N   . ARG C 1 119 ? -3.474  15.165  75.380 1.00 35.23  ? 610  ARG C N   1 
ATOM   3938 C CA  . ARG C 1 119 ? -3.915  15.092  76.753 1.00 37.16  ? 610  ARG C CA  1 
ATOM   3939 C C   . ARG C 1 119 ? -2.872  14.408  77.605 1.00 38.26  ? 610  ARG C C   1 
ATOM   3940 O O   . ARG C 1 119 ? -2.202  13.482  77.150 1.00 38.09  ? 610  ARG C O   1 
ATOM   3941 C CB  . ARG C 1 119 ? -5.198  14.279  76.860 1.00 39.63  ? 610  ARG C CB  1 
ATOM   3942 C CG  . ARG C 1 119 ? -6.446  15.011  76.473 1.00 44.23  ? 610  ARG C CG  1 
ATOM   3943 C CD  . ARG C 1 119 ? -7.659  14.169  76.791 1.00 46.73  ? 610  ARG C CD  1 
ATOM   3944 N NE  . ARG C 1 119 ? -8.816  15.013  77.053 1.00 51.15  ? 610  ARG C NE  1 
ATOM   3945 C CZ  . ARG C 1 119 ? -10.000 14.550  77.434 1.00 53.15  ? 610  ARG C CZ  1 
ATOM   3946 N NH1 . ARG C 1 119 ? -10.175 13.246  77.593 1.00 55.18  ? 610  ARG C NH1 1 
ATOM   3947 N NH2 . ARG C 1 119 ? -11.001 15.390  77.662 1.00 53.62  ? 610  ARG C NH2 1 
ATOM   3948 N N   . GLY C 1 120 ? -2.747  14.866  78.846 1.00 40.01  ? 611  GLY C N   1 
ATOM   3949 C CA  . GLY C 1 120 ? -1.828  14.249  79.782 1.00 41.39  ? 611  GLY C CA  1 
ATOM   3950 C C   . GLY C 1 120 ? -2.686  13.270  80.561 1.00 42.84  ? 611  GLY C C   1 
ATOM   3951 O O   . GLY C 1 120 ? -3.849  13.061  80.206 1.00 42.18  ? 611  GLY C O   1 
ATOM   3952 N N   . GLU C 1 121 ? -2.147  12.655  81.607 1.00 45.46  ? 612  GLU C N   1 
ATOM   3953 C CA  . GLU C 1 121 ? -2.962  11.727  82.379 1.00 47.84  ? 612  GLU C CA  1 
ATOM   3954 C C   . GLU C 1 121 ? -4.058  12.501  83.121 1.00 47.14  ? 612  GLU C C   1 
ATOM   3955 O O   . GLU C 1 121 ? -5.155  11.990  83.323 1.00 47.30  ? 612  GLU C O   1 
ATOM   3956 C CB  . GLU C 1 121 ? -2.096  10.917  83.356 1.00 50.94  ? 612  GLU C CB  1 
ATOM   3957 C CG  . GLU C 1 121 ? -1.168  11.734  84.256 1.00 57.39  ? 612  GLU C CG  1 
ATOM   3958 C CD  . GLU C 1 121 ? -0.263  10.849  85.138 1.00 59.63  ? 612  GLU C CD  1 
ATOM   3959 O OE1 . GLU C 1 121 ? -0.804  10.023  85.918 1.00 59.12  ? 612  GLU C OE1 1 
ATOM   3960 O OE2 . GLU C 1 121 ? 0.987   10.987  85.048 1.00 60.36  ? 612  GLU C OE2 1 
ATOM   3961 N N   . ASP C 1 122 ? -3.766  13.747  83.490 1.00 46.17  ? 613  ASP C N   1 
ATOM   3962 C CA  . ASP C 1 122 ? -4.725  14.594  84.196 1.00 44.95  ? 613  ASP C CA  1 
ATOM   3963 C C   . ASP C 1 122 ? -5.109  15.827  83.377 1.00 43.19  ? 613  ASP C C   1 
ATOM   3964 O O   . ASP C 1 122 ? -4.528  16.101  82.330 1.00 42.07  ? 613  ASP C O   1 
ATOM   3965 C CB  . ASP C 1 122 ? -4.142  15.059  85.533 1.00 47.93  ? 613  ASP C CB  1 
ATOM   3966 C CG  . ASP C 1 122 ? -3.643  13.915  86.385 1.00 49.16  ? 613  ASP C CG  1 
ATOM   3967 O OD1 . ASP C 1 122 ? -4.467  13.084  86.823 1.00 47.82  ? 613  ASP C OD1 1 
ATOM   3968 O OD2 . ASP C 1 122 ? -2.417  13.852  86.612 1.00 52.32  ? 613  ASP C OD2 1 
ATOM   3969 N N   . GLY C 1 123 ? -6.086  16.573  83.879 1.00 41.61  ? 614  GLY C N   1 
ATOM   3970 C CA  . GLY C 1 123 ? -6.538  17.767  83.193 1.00 40.53  ? 614  GLY C CA  1 
ATOM   3971 C C   . GLY C 1 123 ? -5.641  18.967  83.416 1.00 40.55  ? 614  GLY C C   1 
ATOM   3972 O O   . GLY C 1 123 ? -5.806  20.002  82.772 1.00 40.58  ? 614  GLY C O   1 
ATOM   3973 N N   . ASN C 1 124 ? -4.704  18.850  84.348 1.00 40.26  ? 615  ASN C N   1 
ATOM   3974 C CA  . ASN C 1 124 ? -3.774  19.943  84.603 1.00 40.57  ? 615  ASN C CA  1 
ATOM   3975 C C   . ASN C 1 124 ? -2.397  19.499  84.141 1.00 39.68  ? 615  ASN C C   1 
ATOM   3976 O O   . ASN C 1 124 ? -1.370  19.859  84.725 1.00 37.77  ? 615  ASN C O   1 
ATOM   3977 C CB  . ASN C 1 124 ? -3.727  20.312  86.084 1.00 41.39  ? 615  ASN C CB  1 
ATOM   3978 C CG  . ASN C 1 124 ? -3.194  19.198  86.944 1.00 41.03  ? 615  ASN C CG  1 
ATOM   3979 O OD1 . ASN C 1 124 ? -2.730  19.439  88.054 1.00 41.76  ? 615  ASN C OD1 1 
ATOM   3980 N ND2 . ASN C 1 124 ? -3.268  17.968  86.447 1.00 41.71  ? 615  ASN C ND2 1 
ATOM   3981 N N   . SER C 1 125 ? -2.398  18.694  83.085 1.00 38.86  ? 616  SER C N   1 
ATOM   3982 C CA  . SER C 1 125 ? -1.166  18.194  82.500 1.00 38.87  ? 616  SER C CA  1 
ATOM   3983 C C   . SER C 1 125 ? -1.329  18.175  80.993 1.00 38.22  ? 616  SER C C   1 
ATOM   3984 O O   . SER C 1 125 ? -2.445  18.217  80.477 1.00 39.28  ? 616  SER C O   1 
ATOM   3985 C CB  . SER C 1 125 ? -0.876  16.776  82.981 1.00 38.17  ? 616  SER C CB  1 
ATOM   3986 O OG  . SER C 1 125 ? -1.757  15.858  82.357 1.00 39.32  ? 616  SER C OG  1 
ATOM   3987 N N   . ILE C 1 126 ? -0.211  18.104  80.286 1.00 38.06  ? 617  ILE C N   1 
ATOM   3988 C CA  . ILE C 1 126 ? -0.240  18.056  78.835 1.00 36.39  ? 617  ILE C CA  1 
ATOM   3989 C C   . ILE C 1 126 ? 0.944   17.239  78.389 1.00 35.32  ? 617  ILE C C   1 
ATOM   3990 O O   . ILE C 1 126 ? 1.917   17.088  79.126 1.00 34.67  ? 617  ILE C O   1 
ATOM   3991 C CB  . ILE C 1 126 ? -0.108  19.460  78.220 1.00 37.48  ? 617  ILE C CB  1 
ATOM   3992 C CG1 . ILE C 1 126 ? -0.365  19.407  76.719 1.00 36.43  ? 617  ILE C CG1 1 
ATOM   3993 C CG2 . ILE C 1 126 ? 1.297   20.015  78.473 1.00 37.71  ? 617  ILE C CG2 1 
ATOM   3994 C CD1 . ILE C 1 126 ? -0.046  20.725  76.025 1.00 35.59  ? 617  ILE C CD1 1 
ATOM   3995 N N   . LYS C 1 127 ? 0.849   16.712  77.178 1.00 34.84  ? 618  LYS C N   1 
ATOM   3996 C CA  . LYS C 1 127 ? 1.923   15.937  76.589 1.00 32.90  ? 618  LYS C CA  1 
ATOM   3997 C C   . LYS C 1 127 ? 2.260   16.604  75.262 1.00 32.90  ? 618  LYS C C   1 
ATOM   3998 O O   . LYS C 1 127 ? 1.404   16.720  74.390 1.00 33.38  ? 618  LYS C O   1 
ATOM   3999 C CB  . LYS C 1 127 ? 1.478   14.498  76.346 1.00 31.45  ? 618  LYS C CB  1 
ATOM   4000 C CG  . LYS C 1 127 ? 2.583   13.590  75.849 1.00 32.79  ? 618  LYS C CG  1 
ATOM   4001 C CD  . LYS C 1 127 ? 2.070   12.193  75.568 1.00 34.18  ? 618  LYS C CD  1 
ATOM   4002 C CE  . LYS C 1 127 ? 3.179   11.322  75.000 1.00 37.30  ? 618  LYS C CE  1 
ATOM   4003 N NZ  . LYS C 1 127 ? 2.707   9.981   74.564 1.00 38.50  ? 618  LYS C NZ  1 
ATOM   4004 N N   . VAL C 1 128 ? 3.495   17.075  75.128 1.00 32.27  ? 619  VAL C N   1 
ATOM   4005 C CA  . VAL C 1 128 ? 3.945   17.709  73.891 1.00 31.40  ? 619  VAL C CA  1 
ATOM   4006 C C   . VAL C 1 128 ? 4.814   16.714  73.111 1.00 31.84  ? 619  VAL C C   1 
ATOM   4007 O O   . VAL C 1 128 ? 5.900   16.338  73.562 1.00 33.16  ? 619  VAL C O   1 
ATOM   4008 C CB  . VAL C 1 128 ? 4.784   18.961  74.170 1.00 29.80  ? 619  VAL C CB  1 
ATOM   4009 C CG1 . VAL C 1 128 ? 5.144   19.629  72.863 1.00 30.63  ? 619  VAL C CG1 1 
ATOM   4010 C CG2 . VAL C 1 128 ? 4.024   19.908  75.068 1.00 28.94  ? 619  VAL C CG2 1 
ATOM   4011 N N   . ASN C 1 129 ? 4.323   16.285  71.951 1.00 29.38  ? 620  ASN C N   1 
ATOM   4012 C CA  . ASN C 1 129 ? 5.033   15.343  71.104 1.00 27.90  ? 620  ASN C CA  1 
ATOM   4013 C C   . ASN C 1 129 ? 5.895   16.127  70.130 1.00 29.60  ? 620  ASN C C   1 
ATOM   4014 O O   . ASN C 1 129 ? 5.432   17.116  69.556 1.00 30.00  ? 620  ASN C O   1 
ATOM   4015 C CB  . ASN C 1 129 ? 4.038   14.508  70.310 1.00 28.54  ? 620  ASN C CB  1 
ATOM   4016 C CG  . ASN C 1 129 ? 3.037   13.796  71.191 1.00 29.50  ? 620  ASN C CG  1 
ATOM   4017 O OD1 . ASN C 1 129 ? 1.843   13.795  70.905 1.00 30.62  ? 620  ASN C OD1 1 
ATOM   4018 N ND2 . ASN C 1 129 ? 3.517   13.177  72.261 1.00 27.73  ? 620  ASN C ND2 1 
ATOM   4019 N N   . LEU C 1 130 ? 7.136   15.688  69.931 1.00 28.71  ? 621  LEU C N   1 
ATOM   4020 C CA  . LEU C 1 130 ? 8.041   16.371  69.011 1.00 29.62  ? 621  LEU C CA  1 
ATOM   4021 C C   . LEU C 1 130 ? 8.170   15.687  67.630 1.00 30.09  ? 621  LEU C C   1 
ATOM   4022 O O   . LEU C 1 130 ? 8.495   14.498  67.532 1.00 28.51  ? 621  LEU C O   1 
ATOM   4023 C CB  . LEU C 1 130 ? 9.437   16.484  69.630 1.00 31.10  ? 621  LEU C CB  1 
ATOM   4024 C CG  . LEU C 1 130 ? 9.640   17.143  71.002 1.00 33.28  ? 621  LEU C CG  1 
ATOM   4025 C CD1 . LEU C 1 130 ? 11.071  16.940  71.447 1.00 31.18  ? 621  LEU C CD1 1 
ATOM   4026 C CD2 . LEU C 1 130 ? 9.318   18.625  70.936 1.00 35.97  ? 621  LEU C CD2 1 
ATOM   4027 N N   . ILE C 1 131 ? 7.905   16.449  66.568 1.00 29.17  ? 622  ILE C N   1 
ATOM   4028 C CA  . ILE C 1 131 ? 8.048   15.957  65.199 1.00 27.31  ? 622  ILE C CA  1 
ATOM   4029 C C   . ILE C 1 131 ? 9.379   16.540  64.681 1.00 26.72  ? 622  ILE C C   1 
ATOM   4030 O O   . ILE C 1 131 ? 9.477   17.739  64.413 1.00 25.68  ? 622  ILE C O   1 
ATOM   4031 C CB  . ILE C 1 131 ? 6.862   16.415  64.314 1.00 26.87  ? 622  ILE C CB  1 
ATOM   4032 C CG1 . ILE C 1 131 ? 5.552   15.830  64.871 1.00 24.28  ? 622  ILE C CG1 1 
ATOM   4033 C CG2 . ILE C 1 131 ? 7.084   15.978  62.865 1.00 23.71  ? 622  ILE C CG2 1 
ATOM   4034 C CD1 . ILE C 1 131 ? 4.289   16.425  64.282 1.00 15.76  ? 622  ILE C CD1 1 
ATOM   4035 N N   . LYS C 1 132 ? 10.398  15.678  64.586 1.00 25.47  ? 623  LYS C N   1 
ATOM   4036 C CA  . LYS C 1 132 ? 11.751  16.054  64.150 1.00 24.53  ? 623  LYS C CA  1 
ATOM   4037 C C   . LYS C 1 132 ? 11.879  16.582  62.721 1.00 22.58  ? 623  LYS C C   1 
ATOM   4038 O O   . LYS C 1 132 ? 11.209  16.125  61.800 1.00 21.40  ? 623  LYS C O   1 
ATOM   4039 C CB  . LYS C 1 132 ? 12.723  14.871  64.318 1.00 25.75  ? 623  LYS C CB  1 
ATOM   4040 C CG  . LYS C 1 132 ? 13.371  14.707  65.690 1.00 27.84  ? 623  LYS C CG  1 
ATOM   4041 C CD  . LYS C 1 132 ? 12.352  14.449  66.789 1.00 33.04  ? 623  LYS C CD  1 
ATOM   4042 C CE  . LYS C 1 132 ? 12.742  13.256  67.683 1.00 34.27  ? 623  LYS C CE  1 
ATOM   4043 N NZ  . LYS C 1 132 ? 13.934  13.510  68.528 1.00 34.56  ? 623  LYS C NZ  1 
ATOM   4044 N N   . GLN C 1 133 ? 12.778  17.537  62.547 1.00 22.34  ? 624  GLN C N   1 
ATOM   4045 C CA  . GLN C 1 133 ? 13.000  18.134  61.248 1.00 23.65  ? 624  GLN C CA  1 
ATOM   4046 C C   . GLN C 1 133 ? 14.474  18.277  60.910 1.00 24.91  ? 624  GLN C C   1 
ATOM   4047 O O   . GLN C 1 133 ? 15.340  17.922  61.692 1.00 26.89  ? 624  GLN C O   1 
ATOM   4048 C CB  . GLN C 1 133 ? 12.312  19.487  61.177 1.00 22.75  ? 624  GLN C CB  1 
ATOM   4049 C CG  . GLN C 1 133 ? 10.829  19.391  61.419 1.00 24.14  ? 624  GLN C CG  1 
ATOM   4050 C CD  . GLN C 1 133 ? 10.059  20.445  60.674 1.00 25.83  ? 624  GLN C CD  1 
ATOM   4051 O OE1 . GLN C 1 133 ? 9.424   20.166  59.655 1.00 25.29  ? 624  GLN C OE1 1 
ATOM   4052 N NE2 . GLN C 1 133 ? 10.116  21.676  61.169 1.00 28.67  ? 624  GLN C NE2 1 
ATOM   4053 N N   . ASP C 1 134 ? 14.748  18.798  59.726 1.00 26.45  ? 625  ASP C N   1 
ATOM   4054 C CA  . ASP C 1 134 ? 16.104  18.962  59.253 1.00 26.42  ? 625  ASP C CA  1 
ATOM   4055 C C   . ASP C 1 134 ? 17.006  19.554  60.323 1.00 26.04  ? 625  ASP C C   1 
ATOM   4056 O O   . ASP C 1 134 ? 16.725  20.630  60.860 1.00 24.55  ? 625  ASP C O   1 
ATOM   4057 C CB  . ASP C 1 134 ? 16.087  19.840  58.001 1.00 28.24  ? 625  ASP C CB  1 
ATOM   4058 C CG  . ASP C 1 134 ? 17.452  20.015  57.390 1.00 29.69  ? 625  ASP C CG  1 
ATOM   4059 O OD1 . ASP C 1 134 ? 18.398  19.281  57.774 1.00 29.02  ? 625  ASP C OD1 1 
ATOM   4060 O OD2 . ASP C 1 134 ? 17.566  20.890  56.508 1.00 30.50  ? 625  ASP C OD2 1 
ATOM   4061 N N   . ASP C 1 135 ? 18.092  18.843  60.631 1.00 25.96  ? 626  ASP C N   1 
ATOM   4062 C CA  . ASP C 1 135 ? 19.026  19.304  61.643 1.00 25.37  ? 626  ASP C CA  1 
ATOM   4063 C C   . ASP C 1 135 ? 20.102  20.205  61.075 1.00 26.06  ? 626  ASP C C   1 
ATOM   4064 O O   . ASP C 1 135 ? 20.991  20.638  61.812 1.00 28.76  ? 626  ASP C O   1 
ATOM   4065 C CB  . ASP C 1 135 ? 19.672  18.125  62.389 1.00 24.74  ? 626  ASP C CB  1 
ATOM   4066 C CG  . ASP C 1 135 ? 20.573  17.270  61.505 1.00 27.69  ? 626  ASP C CG  1 
ATOM   4067 O OD1 . ASP C 1 135 ? 21.087  17.775  60.477 1.00 25.39  ? 626  ASP C OD1 1 
ATOM   4068 O OD2 . ASP C 1 135 ? 20.781  16.084  61.862 1.00 26.08  ? 626  ASP C OD2 1 
ATOM   4069 N N   . GLY C 1 136 ? 20.032  20.481  59.772 1.00 24.61  ? 627  GLY C N   1 
ATOM   4070 C CA  . GLY C 1 136 ? 21.007  21.364  59.147 1.00 24.81  ? 627  GLY C CA  1 
ATOM   4071 C C   . GLY C 1 136 ? 22.293  20.756  58.591 1.00 26.38  ? 627  GLY C C   1 
ATOM   4072 O O   . GLY C 1 136 ? 23.125  21.471  58.024 1.00 26.77  ? 627  GLY C O   1 
ATOM   4073 N N   . GLY C 1 137 ? 22.477  19.450  58.745 1.00 25.63  ? 628  GLY C N   1 
ATOM   4074 C CA  . GLY C 1 137 ? 23.678  18.824  58.229 1.00 26.37  ? 628  GLY C CA  1 
ATOM   4075 C C   . GLY C 1 137 ? 24.652  18.426  59.317 1.00 27.39  ? 628  GLY C C   1 
ATOM   4076 O O   . GLY C 1 137 ? 25.743  17.930  59.035 1.00 26.92  ? 628  GLY C O   1 
ATOM   4077 N N   . SER C 1 138 ? 24.241  18.653  60.560 1.00 26.54  ? 629  SER C N   1 
ATOM   4078 C CA  . SER C 1 138 ? 25.028  18.332  61.740 1.00 27.18  ? 629  SER C CA  1 
ATOM   4079 C C   . SER C 1 138 ? 24.064  17.754  62.784 1.00 28.44  ? 629  SER C C   1 
ATOM   4080 O O   . SER C 1 138 ? 22.897  18.141  62.848 1.00 28.07  ? 629  SER C O   1 
ATOM   4081 C CB  . SER C 1 138 ? 25.696  19.596  62.274 1.00 29.76  ? 629  SER C CB  1 
ATOM   4082 O OG  . SER C 1 138 ? 26.251  19.389  63.563 1.00 36.43  ? 629  SER C OG  1 
ATOM   4083 N N   . PRO C 1 139 ? 24.539  16.824  63.622 1.00 27.84  ? 630  PRO C N   1 
ATOM   4084 C CA  . PRO C 1 139 ? 23.670  16.222  64.638 1.00 28.35  ? 630  PRO C CA  1 
ATOM   4085 C C   . PRO C 1 139 ? 23.085  17.220  65.628 1.00 29.70  ? 630  PRO C C   1 
ATOM   4086 O O   . PRO C 1 139 ? 23.673  18.263  65.896 1.00 30.03  ? 630  PRO C O   1 
ATOM   4087 C CB  . PRO C 1 139 ? 24.587  15.218  65.328 1.00 28.07  ? 630  PRO C CB  1 
ATOM   4088 C CG  . PRO C 1 139 ? 25.606  14.900  64.273 1.00 28.30  ? 630  PRO C CG  1 
ATOM   4089 C CD  . PRO C 1 139 ? 25.890  16.251  63.686 1.00 25.63  ? 630  PRO C CD  1 
ATOM   4090 N N   . ILE C 1 140 ? 21.912  16.890  66.157 1.00 30.85  ? 631  ILE C N   1 
ATOM   4091 C CA  . ILE C 1 140 ? 21.266  17.734  67.135 1.00 29.09  ? 631  ILE C CA  1 
ATOM   4092 C C   . ILE C 1 140 ? 21.963  17.463  68.443 1.00 30.58  ? 631  ILE C C   1 
ATOM   4093 O O   . ILE C 1 140 ? 22.158  16.313  68.835 1.00 29.81  ? 631  ILE C O   1 
ATOM   4094 C CB  . ILE C 1 140 ? 19.768  17.406  67.289 1.00 29.02  ? 631  ILE C CB  1 
ATOM   4095 C CG1 . ILE C 1 140 ? 19.007  17.901  66.062 1.00 27.70  ? 631  ILE C CG1 1 
ATOM   4096 C CG2 . ILE C 1 140 ? 19.199  18.086  68.540 1.00 27.07  ? 631  ILE C CG2 1 
ATOM   4097 C CD1 . ILE C 1 140 ? 19.146  19.390  65.821 1.00 27.61  ? 631  ILE C CD1 1 
ATOM   4098 N N   . ARG C 1 141 ? 22.339  18.537  69.115 1.00 32.53  ? 632  ARG C N   1 
ATOM   4099 C CA  . ARG C 1 141 ? 23.028  18.453  70.388 1.00 33.51  ? 632  ARG C CA  1 
ATOM   4100 C C   . ARG C 1 141 ? 21.995  18.367  71.514 1.00 32.35  ? 632  ARG C C   1 
ATOM   4101 O O   . ARG C 1 141 ? 22.034  17.457  72.343 1.00 32.29  ? 632  ARG C O   1 
ATOM   4102 C CB  . ARG C 1 141 ? 23.931  19.688  70.537 1.00 36.49  ? 632  ARG C CB  1 
ATOM   4103 C CG  . ARG C 1 141 ? 24.789  19.731  71.783 1.00 42.42  ? 632  ARG C CG  1 
ATOM   4104 C CD  . ARG C 1 141 ? 25.529  21.057  71.872 1.00 46.93  ? 632  ARG C CD  1 
ATOM   4105 N NE  . ARG C 1 141 ? 26.033  21.324  73.219 1.00 50.69  ? 632  ARG C NE  1 
ATOM   4106 C CZ  . ARG C 1 141 ? 26.311  22.542  73.678 1.00 52.09  ? 632  ARG C CZ  1 
ATOM   4107 N NH1 . ARG C 1 141 ? 26.131  23.598  72.893 1.00 52.21  ? 632  ARG C NH1 1 
ATOM   4108 N NH2 . ARG C 1 141 ? 26.754  22.708  74.922 1.00 51.82  ? 632  ARG C NH2 1 
ATOM   4109 N N   . HIS C 1 142 ? 21.055  19.302  71.526 1.00 31.83  ? 633  HIS C N   1 
ATOM   4110 C CA  . HIS C 1 142 ? 20.021  19.320  72.552 1.00 32.94  ? 633  HIS C CA  1 
ATOM   4111 C C   . HIS C 1 142 ? 18.743  19.987  72.052 1.00 31.57  ? 633  HIS C C   1 
ATOM   4112 O O   . HIS C 1 142 ? 18.731  20.648  71.015 1.00 30.60  ? 633  HIS C O   1 
ATOM   4113 C CB  . HIS C 1 142 ? 20.474  20.125  73.779 1.00 37.11  ? 633  HIS C CB  1 
ATOM   4114 C CG  . HIS C 1 142 ? 21.718  19.619  74.438 1.00 41.41  ? 633  HIS C CG  1 
ATOM   4115 N ND1 . HIS C 1 142 ? 21.769  18.420  75.116 1.00 42.85  ? 633  HIS C ND1 1 
ATOM   4116 C CD2 . HIS C 1 142 ? 22.950  20.174  74.557 1.00 42.55  ? 633  HIS C CD2 1 
ATOM   4117 C CE1 . HIS C 1 142 ? 22.979  18.259  75.625 1.00 44.85  ? 633  HIS C CE1 1 
ATOM   4118 N NE2 . HIS C 1 142 ? 23.715  19.308  75.300 1.00 43.76  ? 633  HIS C NE2 1 
ATOM   4119 N N   . TYR C 1 143 ? 17.669  19.792  72.807 1.00 30.29  ? 634  TYR C N   1 
ATOM   4120 C CA  . TYR C 1 143 ? 16.397  20.453  72.536 1.00 31.32  ? 634  TYR C CA  1 
ATOM   4121 C C   . TYR C 1 143 ? 16.230  21.313  73.800 1.00 30.73  ? 634  TYR C C   1 
ATOM   4122 O O   . TYR C 1 143 ? 16.185  20.786  74.905 1.00 31.79  ? 634  TYR C O   1 
ATOM   4123 C CB  . TYR C 1 143 ? 15.250  19.438  72.408 1.00 30.34  ? 634  TYR C CB  1 
ATOM   4124 C CG  . TYR C 1 143 ? 15.166  18.760  71.050 1.00 28.83  ? 634  TYR C CG  1 
ATOM   4125 C CD1 . TYR C 1 143 ? 14.744  19.461  69.921 1.00 27.45  ? 634  TYR C CD1 1 
ATOM   4126 C CD2 . TYR C 1 143 ? 15.537  17.423  70.893 1.00 26.32  ? 634  TYR C CD2 1 
ATOM   4127 C CE1 . TYR C 1 143 ? 14.697  18.850  68.674 1.00 26.86  ? 634  TYR C CE1 1 
ATOM   4128 C CE2 . TYR C 1 143 ? 15.495  16.808  69.663 1.00 25.52  ? 634  TYR C CE2 1 
ATOM   4129 C CZ  . TYR C 1 143 ? 15.077  17.520  68.553 1.00 27.22  ? 634  TYR C CZ  1 
ATOM   4130 O OH  . TYR C 1 143 ? 15.050  16.899  67.328 1.00 24.95  ? 634  TYR C OH  1 
ATOM   4131 N N   . LEU C 1 144 ? 16.192  22.631  73.642 1.00 30.16  ? 635  LEU C N   1 
ATOM   4132 C CA  . LEU C 1 144 ? 16.059  23.536  74.782 1.00 30.34  ? 635  LEU C CA  1 
ATOM   4133 C C   . LEU C 1 144 ? 14.606  23.920  75.017 1.00 30.97  ? 635  LEU C C   1 
ATOM   4134 O O   . LEU C 1 144 ? 14.012  24.653  74.230 1.00 32.37  ? 635  LEU C O   1 
ATOM   4135 C CB  . LEU C 1 144 ? 16.924  24.784  74.558 1.00 30.21  ? 635  LEU C CB  1 
ATOM   4136 C CG  . LEU C 1 144 ? 18.387  24.403  74.278 1.00 32.19  ? 635  LEU C CG  1 
ATOM   4137 C CD1 . LEU C 1 144 ? 19.227  25.618  73.899 1.00 29.61  ? 635  LEU C CD1 1 
ATOM   4138 C CD2 . LEU C 1 144 ? 18.950  23.709  75.514 1.00 31.82  ? 635  LEU C CD2 1 
ATOM   4139 N N   . VAL C 1 145 ? 14.051  23.412  76.114 1.00 31.55  ? 636  VAL C N   1 
ATOM   4140 C CA  . VAL C 1 145 ? 12.661  23.642  76.492 1.00 32.52  ? 636  VAL C CA  1 
ATOM   4141 C C   . VAL C 1 145 ? 12.425  24.714  77.551 1.00 34.29  ? 636  VAL C C   1 
ATOM   4142 O O   . VAL C 1 145 ? 13.195  24.867  78.505 1.00 34.24  ? 636  VAL C O   1 
ATOM   4143 C CB  . VAL C 1 145 ? 12.032  22.342  77.023 1.00 32.45  ? 636  VAL C CB  1 
ATOM   4144 C CG1 . VAL C 1 145 ? 10.592  22.587  77.441 1.00 29.11  ? 636  VAL C CG1 1 
ATOM   4145 C CG2 . VAL C 1 145 ? 12.120  21.262  75.965 1.00 32.35  ? 636  VAL C CG2 1 
ATOM   4146 N N   . ARG C 1 146 ? 11.342  25.457  77.373 1.00 35.86  ? 637  ARG C N   1 
ATOM   4147 C CA  . ARG C 1 146 ? 10.953  26.483  78.331 1.00 38.97  ? 637  ARG C CA  1 
ATOM   4148 C C   . ARG C 1 146 ? 9.441   26.533  78.333 1.00 39.65  ? 637  ARG C C   1 
ATOM   4149 O O   . ARG C 1 146 ? 8.815   26.287  77.306 1.00 42.34  ? 637  ARG C O   1 
ATOM   4150 C CB  . ARG C 1 146 ? 11.539  27.847  77.964 1.00 40.56  ? 637  ARG C CB  1 
ATOM   4151 C CG  . ARG C 1 146 ? 12.877  28.119  78.636 1.00 43.33  ? 637  ARG C CG  1 
ATOM   4152 C CD  . ARG C 1 146 ? 13.258  29.567  78.505 1.00 47.59  ? 637  ARG C CD  1 
ATOM   4153 N NE  . ARG C 1 146 ? 13.968  29.849  77.263 1.00 52.69  ? 637  ARG C NE  1 
ATOM   4154 C CZ  . ARG C 1 146 ? 14.142  31.072  76.762 1.00 56.17  ? 637  ARG C CZ  1 
ATOM   4155 N NH1 . ARG C 1 146 ? 13.644  32.134  77.397 1.00 55.98  ? 637  ARG C NH1 1 
ATOM   4156 N NH2 . ARG C 1 146 ? 14.831  31.237  75.636 1.00 56.35  ? 637  ARG C NH2 1 
ATOM   4157 N N   . TYR C 1 147 ? 8.850   26.810  79.488 1.00 39.81  ? 638  TYR C N   1 
ATOM   4158 C CA  . TYR C 1 147 ? 7.399   26.871  79.588 1.00 40.74  ? 638  TYR C CA  1 
ATOM   4159 C C   . TYR C 1 147 ? 6.989   27.821  80.707 1.00 41.90  ? 638  TYR C C   1 
ATOM   4160 O O   . TYR C 1 147 ? 7.788   28.137  81.593 1.00 42.21  ? 638  TYR C O   1 
ATOM   4161 C CB  . TYR C 1 147 ? 6.835   25.472  79.844 1.00 40.46  ? 638  TYR C CB  1 
ATOM   4162 C CG  . TYR C 1 147 ? 7.013   24.978  81.259 1.00 40.85  ? 638  TYR C CG  1 
ATOM   4163 C CD1 . TYR C 1 147 ? 6.004   25.134  82.197 1.00 41.28  ? 638  TYR C CD1 1 
ATOM   4164 C CD2 . TYR C 1 147 ? 8.196   24.366  81.664 1.00 41.79  ? 638  TYR C CD2 1 
ATOM   4165 C CE1 . TYR C 1 147 ? 6.165   24.695  83.501 1.00 42.37  ? 638  TYR C CE1 1 
ATOM   4166 C CE2 . TYR C 1 147 ? 8.368   23.925  82.969 1.00 41.58  ? 638  TYR C CE2 1 
ATOM   4167 C CZ  . TYR C 1 147 ? 7.347   24.092  83.881 1.00 42.41  ? 638  TYR C CZ  1 
ATOM   4168 O OH  . TYR C 1 147 ? 7.496   23.660  85.180 1.00 44.50  ? 638  TYR C OH  1 
ATOM   4169 N N   . ARG C 1 148 ? 5.747   28.284  80.671 1.00 41.45  ? 639  ARG C N   1 
ATOM   4170 C CA  . ARG C 1 148 ? 5.292   29.194  81.701 1.00 41.31  ? 639  ARG C CA  1 
ATOM   4171 C C   . ARG C 1 148 ? 3.810   29.483  81.622 1.00 41.88  ? 639  ARG C C   1 
ATOM   4172 O O   . ARG C 1 148 ? 3.162   29.255  80.595 1.00 41.74  ? 639  ARG C O   1 
ATOM   4173 C CB  . ARG C 1 148 ? 6.054   30.511  81.600 1.00 41.26  ? 639  ARG C CB  1 
ATOM   4174 C CG  . ARG C 1 148 ? 5.755   31.298  80.340 1.00 43.28  ? 639  ARG C CG  1 
ATOM   4175 C CD  . ARG C 1 148 ? 6.609   32.547  80.282 1.00 46.41  ? 639  ARG C CD  1 
ATOM   4176 N NE  . ARG C 1 148 ? 6.325   33.371  79.111 1.00 48.22  ? 639  ARG C NE  1 
ATOM   4177 C CZ  . ARG C 1 148 ? 5.172   33.995  78.901 1.00 49.16  ? 639  ARG C CZ  1 
ATOM   4178 N NH1 . ARG C 1 148 ? 4.191   33.885  79.788 1.00 50.36  ? 639  ARG C NH1 1 
ATOM   4179 N NH2 . ARG C 1 148 ? 5.001   34.733  77.812 1.00 47.04  ? 639  ARG C NH2 1 
ATOM   4180 N N   . ALA C 1 149 ? 3.279   29.981  82.732 1.00 41.84  ? 640  ALA C N   1 
ATOM   4181 C CA  . ALA C 1 149 ? 1.885   30.360  82.807 1.00 40.33  ? 640  ALA C CA  1 
ATOM   4182 C C   . ALA C 1 149 ? 1.876   31.721  82.137 1.00 39.90  ? 640  ALA C C   1 
ATOM   4183 O O   . ALA C 1 149 ? 2.730   32.547  82.433 1.00 40.04  ? 640  ALA C O   1 
ATOM   4184 C CB  . ALA C 1 149 ? 1.467   30.486  84.249 1.00 40.09  ? 640  ALA C CB  1 
ATOM   4185 N N   . LEU C 1 150 ? 0.949   31.964  81.219 1.00 39.93  ? 641  LEU C N   1 
ATOM   4186 C CA  . LEU C 1 150 ? 0.926   33.266  80.571 1.00 40.77  ? 641  LEU C CA  1 
ATOM   4187 C C   . LEU C 1 150 ? 0.885   34.361  81.638 1.00 42.13  ? 641  LEU C C   1 
ATOM   4188 O O   . LEU C 1 150 ? 0.320   34.172  82.721 1.00 40.12  ? 641  LEU C O   1 
ATOM   4189 C CB  . LEU C 1 150 ? -0.285  33.409  79.647 1.00 39.41  ? 641  LEU C CB  1 
ATOM   4190 C CG  . LEU C 1 150 ? -0.390  32.512  78.420 1.00 38.35  ? 641  LEU C CG  1 
ATOM   4191 C CD1 . LEU C 1 150 ? -1.556  32.990  77.563 1.00 37.19  ? 641  LEU C CD1 1 
ATOM   4192 C CD2 . LEU C 1 150 ? 0.905   32.555  77.635 1.00 37.85  ? 641  LEU C CD2 1 
ATOM   4193 N N   . SER C 1 151 ? 1.492   35.498  81.314 1.00 44.23  ? 642  SER C N   1 
ATOM   4194 C CA  . SER C 1 151 ? 1.562   36.647  82.210 1.00 47.75  ? 642  SER C CA  1 
ATOM   4195 C C   . SER C 1 151 ? 2.347   36.297  83.465 1.00 48.26  ? 642  SER C C   1 
ATOM   4196 O O   . SER C 1 151 ? 2.004   36.713  84.564 1.00 47.84  ? 642  SER C O   1 
ATOM   4197 C CB  . SER C 1 151 ? 0.156   37.141  82.585 1.00 49.02  ? 642  SER C CB  1 
ATOM   4198 O OG  . SER C 1 151 ? -0.515  36.223  83.428 1.00 51.84  ? 642  SER C OG  1 
ATOM   4199 N N   . SER C 1 152 ? 3.411   35.527  83.285 1.00 50.18  ? 643  SER C N   1 
ATOM   4200 C CA  . SER C 1 152 ? 4.252   35.126  84.398 1.00 51.99  ? 643  SER C CA  1 
ATOM   4201 C C   . SER C 1 152 ? 5.666   34.829  83.904 1.00 53.26  ? 643  SER C C   1 
ATOM   4202 O O   . SER C 1 152 ? 5.913   34.810  82.698 1.00 51.97  ? 643  SER C O   1 
ATOM   4203 C CB  . SER C 1 152 ? 3.660   33.904  85.088 1.00 51.13  ? 643  SER C CB  1 
ATOM   4204 O OG  . SER C 1 152 ? 4.355   33.643  86.290 1.00 53.85  ? 643  SER C OG  1 
ATOM   4205 N N   . GLU C 1 153 ? 6.586   34.603  84.841 1.00 55.84  ? 644  GLU C N   1 
ATOM   4206 C CA  . GLU C 1 153 ? 7.987   34.334  84.509 1.00 58.60  ? 644  GLU C CA  1 
ATOM   4207 C C   . GLU C 1 153 ? 8.251   32.889  84.078 1.00 58.00  ? 644  GLU C C   1 
ATOM   4208 O O   . GLU C 1 153 ? 7.658   31.953  84.618 1.00 57.82  ? 644  GLU C O   1 
ATOM   4209 C CB  . GLU C 1 153 ? 8.887   34.678  85.707 1.00 60.82  ? 644  GLU C CB  1 
ATOM   4210 C CG  . GLU C 1 153 ? 8.753   36.112  86.209 1.00 63.96  ? 644  GLU C CG  1 
ATOM   4211 C CD  . GLU C 1 153 ? 9.048   37.139  85.130 1.00 67.28  ? 644  GLU C CD  1 
ATOM   4212 O OE1 . GLU C 1 153 ? 10.157  37.087  84.548 1.00 69.40  ? 644  GLU C OE1 1 
ATOM   4213 O OE2 . GLU C 1 153 ? 8.174   37.997  84.865 1.00 67.90  ? 644  GLU C OE2 1 
ATOM   4214 N N   . TRP C 1 154 ? 9.144   32.716  83.103 1.00 56.99  ? 645  TRP C N   1 
ATOM   4215 C CA  . TRP C 1 154 ? 9.488   31.387  82.616 1.00 56.44  ? 645  TRP C CA  1 
ATOM   4216 C C   . TRP C 1 154 ? 10.061  30.585  83.762 1.00 55.30  ? 645  TRP C C   1 
ATOM   4217 O O   . TRP C 1 154 ? 10.748  31.131  84.617 1.00 56.64  ? 645  TRP C O   1 
ATOM   4218 C CB  . TRP C 1 154 ? 10.549  31.450  81.519 1.00 57.84  ? 645  TRP C CB  1 
ATOM   4219 C CG  . TRP C 1 154 ? 10.168  32.212  80.284 1.00 60.49  ? 645  TRP C CG  1 
ATOM   4220 C CD1 . TRP C 1 154 ? 10.412  33.532  80.023 1.00 60.70  ? 645  TRP C CD1 1 
ATOM   4221 C CD2 . TRP C 1 154 ? 9.522   31.686  79.120 1.00 60.42  ? 645  TRP C CD2 1 
ATOM   4222 N NE1 . TRP C 1 154 ? 9.966   33.857  78.766 1.00 61.18  ? 645  TRP C NE1 1 
ATOM   4223 C CE2 . TRP C 1 154 ? 9.414   32.744  78.188 1.00 61.14  ? 645  TRP C CE2 1 
ATOM   4224 C CE3 . TRP C 1 154 ? 9.024   30.422  78.772 1.00 60.57  ? 645  TRP C CE3 1 
ATOM   4225 C CZ2 . TRP C 1 154 ? 8.828   32.578  76.928 1.00 61.31  ? 645  TRP C CZ2 1 
ATOM   4226 C CZ3 . TRP C 1 154 ? 8.440   30.255  77.517 1.00 61.48  ? 645  TRP C CZ3 1 
ATOM   4227 C CH2 . TRP C 1 154 ? 8.348   31.331  76.610 1.00 61.82  ? 645  TRP C CH2 1 
ATOM   4228 N N   . LYS C 1 155 ? 9.780   29.290  83.784 1.00 54.31  ? 646  LYS C N   1 
ATOM   4229 C CA  . LYS C 1 155 ? 10.317  28.425  84.825 1.00 53.08  ? 646  LYS C CA  1 
ATOM   4230 C C   . LYS C 1 155 ? 11.770  28.172  84.406 1.00 52.26  ? 646  LYS C C   1 
ATOM   4231 O O   . LYS C 1 155 ? 12.215  28.665  83.367 1.00 51.49  ? 646  LYS C O   1 
ATOM   4232 C CB  . LYS C 1 155 ? 9.544   27.100  84.873 1.00 53.89  ? 646  LYS C CB  1 
ATOM   4233 C CG  . LYS C 1 155 ? 8.027   27.221  84.746 1.00 54.41  ? 646  LYS C CG  1 
ATOM   4234 C CD  . LYS C 1 155 ? 7.377   27.961  85.905 1.00 56.15  ? 646  LYS C CD  1 
ATOM   4235 C CE  . LYS C 1 155 ? 5.863   28.016  85.711 1.00 57.20  ? 646  LYS C CE  1 
ATOM   4236 N NZ  . LYS C 1 155 ? 5.173   28.899  86.693 1.00 58.44  ? 646  LYS C NZ  1 
ATOM   4237 N N   . PRO C 1 156 ? 12.536  27.411  85.205 1.00 52.35  ? 647  PRO C N   1 
ATOM   4238 C CA  . PRO C 1 156 ? 13.924  27.175  84.791 1.00 51.31  ? 647  PRO C CA  1 
ATOM   4239 C C   . PRO C 1 156 ? 13.938  26.415  83.466 1.00 50.23  ? 647  PRO C C   1 
ATOM   4240 O O   . PRO C 1 156 ? 13.071  25.578  83.222 1.00 50.06  ? 647  PRO C O   1 
ATOM   4241 C CB  . PRO C 1 156 ? 14.493  26.337  85.934 1.00 51.87  ? 647  PRO C CB  1 
ATOM   4242 C CG  . PRO C 1 156 ? 13.630  26.712  87.114 1.00 52.83  ? 647  PRO C CG  1 
ATOM   4243 C CD  . PRO C 1 156 ? 12.258  26.783  86.509 1.00 52.07  ? 647  PRO C CD  1 
ATOM   4244 N N   . GLU C 1 157 ? 14.914  26.705  82.615 1.00 48.50  ? 648  GLU C N   1 
ATOM   4245 C CA  . GLU C 1 157 ? 15.007  26.034  81.328 1.00 47.70  ? 648  GLU C CA  1 
ATOM   4246 C C   . GLU C 1 157 ? 15.244  24.544  81.522 1.00 47.12  ? 648  GLU C C   1 
ATOM   4247 O O   . GLU C 1 157 ? 15.638  24.103  82.596 1.00 48.84  ? 648  GLU C O   1 
ATOM   4248 C CB  . GLU C 1 157 ? 16.145  26.628  80.502 1.00 48.60  ? 648  GLU C CB  1 
ATOM   4249 C CG  . GLU C 1 157 ? 16.140  26.184  79.051 1.00 51.32  ? 648  GLU C CG  1 
ATOM   4250 C CD  . GLU C 1 157 ? 17.259  26.813  78.242 1.00 52.99  ? 648  GLU C CD  1 
ATOM   4251 O OE1 . GLU C 1 157 ? 18.435  26.435  78.446 1.00 53.52  ? 648  GLU C OE1 1 
ATOM   4252 O OE2 . GLU C 1 157 ? 16.957  27.693  77.403 1.00 54.35  ? 648  GLU C OE2 1 
ATOM   4253 N N   . ILE C 1 158 ? 15.003  23.768  80.476 1.00 45.51  ? 649  ILE C N   1 
ATOM   4254 C CA  . ILE C 1 158 ? 15.191  22.325  80.533 1.00 42.88  ? 649  ILE C CA  1 
ATOM   4255 C C   . ILE C 1 158 ? 15.997  21.899  79.312 1.00 43.21  ? 649  ILE C C   1 
ATOM   4256 O O   . ILE C 1 158 ? 15.709  22.329  78.198 1.00 42.42  ? 649  ILE C O   1 
ATOM   4257 C CB  . ILE C 1 158 ? 13.834  21.602  80.496 1.00 40.89  ? 649  ILE C CB  1 
ATOM   4258 C CG1 . ILE C 1 158 ? 12.924  22.180  81.575 1.00 40.83  ? 649  ILE C CG1 1 
ATOM   4259 C CG2 . ILE C 1 158 ? 14.016  20.116  80.699 1.00 35.77  ? 649  ILE C CG2 1 
ATOM   4260 C CD1 . ILE C 1 158 ? 11.509  21.634  81.544 1.00 41.27  ? 649  ILE C CD1 1 
ATOM   4261 N N   . ARG C 1 159 ? 17.018  21.075  79.516 1.00 42.73  ? 650  ARG C N   1 
ATOM   4262 C CA  . ARG C 1 159 ? 17.814  20.596  78.394 1.00 41.87  ? 650  ARG C CA  1 
ATOM   4263 C C   . ARG C 1 159 ? 17.502  19.126  78.136 1.00 39.80  ? 650  ARG C C   1 
ATOM   4264 O O   . ARG C 1 159 ? 17.579  18.289  79.033 1.00 38.76  ? 650  ARG C O   1 
ATOM   4265 C CB  . ARG C 1 159 ? 19.304  20.821  78.664 1.00 43.48  ? 650  ARG C CB  1 
ATOM   4266 C CG  . ARG C 1 159 ? 19.675  22.285  78.507 1.00 47.91  ? 650  ARG C CG  1 
ATOM   4267 C CD  . ARG C 1 159 ? 21.036  22.636  79.074 1.00 52.35  ? 650  ARG C CD  1 
ATOM   4268 N NE  . ARG C 1 159 ? 22.140  21.929  78.428 1.00 55.98  ? 650  ARG C NE  1 
ATOM   4269 C CZ  . ARG C 1 159 ? 23.426  22.185  78.670 1.00 58.02  ? 650  ARG C CZ  1 
ATOM   4270 N NH1 . ARG C 1 159 ? 23.767  23.134  79.539 1.00 57.71  ? 650  ARG C NH1 1 
ATOM   4271 N NH2 . ARG C 1 159 ? 24.374  21.488  78.057 1.00 58.21  ? 650  ARG C NH2 1 
ATOM   4272 N N   . LEU C 1 160 ? 17.113  18.832  76.902 1.00 37.92  ? 651  LEU C N   1 
ATOM   4273 C CA  . LEU C 1 160 ? 16.766  17.476  76.507 1.00 36.76  ? 651  LEU C CA  1 
ATOM   4274 C C   . LEU C 1 160 ? 17.760  16.884  75.510 1.00 36.40  ? 651  LEU C C   1 
ATOM   4275 O O   . LEU C 1 160 ? 18.430  17.609  74.770 1.00 34.98  ? 651  LEU C O   1 
ATOM   4276 C CB  . LEU C 1 160 ? 15.373  17.455  75.881 1.00 37.62  ? 651  LEU C CB  1 
ATOM   4277 C CG  . LEU C 1 160 ? 14.217  17.994  76.724 1.00 37.67  ? 651  LEU C CG  1 
ATOM   4278 C CD1 . LEU C 1 160 ? 12.907  17.770  75.980 1.00 35.94  ? 651  LEU C CD1 1 
ATOM   4279 C CD2 . LEU C 1 160 ? 14.192  17.284  78.076 1.00 38.06  ? 651  LEU C CD2 1 
ATOM   4280 N N   . PRO C 1 161 ? 17.874  15.547  75.496 1.00 35.43  ? 652  PRO C N   1 
ATOM   4281 C CA  . PRO C 1 161 ? 18.780  14.845  74.589 1.00 33.39  ? 652  PRO C CA  1 
ATOM   4282 C C   . PRO C 1 161 ? 18.167  14.865  73.197 1.00 33.61  ? 652  PRO C C   1 
ATOM   4283 O O   . PRO C 1 161 ? 16.971  15.122  73.036 1.00 32.44  ? 652  PRO C O   1 
ATOM   4284 C CB  . PRO C 1 161 ? 18.819  13.424  75.152 1.00 33.40  ? 652  PRO C CB  1 
ATOM   4285 C CG  . PRO C 1 161 ? 18.361  13.566  76.560 1.00 34.51  ? 652  PRO C CG  1 
ATOM   4286 C CD  . PRO C 1 161 ? 17.293  14.609  76.471 1.00 36.46  ? 652  PRO C CD  1 
ATOM   4287 N N   . SER C 1 162 ? 18.994  14.578  72.200 1.00 33.75  ? 653  SER C N   1 
ATOM   4288 C CA  . SER C 1 162 ? 18.566  14.542  70.813 1.00 32.64  ? 653  SER C CA  1 
ATOM   4289 C C   . SER C 1 162 ? 17.569  13.407  70.601 1.00 32.94  ? 653  SER C C   1 
ATOM   4290 O O   . SER C 1 162 ? 16.752  13.442  69.678 1.00 32.43  ? 653  SER C O   1 
ATOM   4291 C CB  . SER C 1 162 ? 19.775  14.310  69.918 1.00 31.23  ? 653  SER C CB  1 
ATOM   4292 O OG  . SER C 1 162 ? 20.346  13.048  70.212 1.00 27.77  ? 653  SER C OG  1 
ATOM   4293 N N   . GLY C 1 163 ? 17.649  12.399  71.460 1.00 32.80  ? 654  GLY C N   1 
ATOM   4294 C CA  . GLY C 1 163 ? 16.770  11.254  71.336 1.00 33.81  ? 654  GLY C CA  1 
ATOM   4295 C C   . GLY C 1 163 ? 15.416  11.376  72.001 1.00 34.40  ? 654  GLY C C   1 
ATOM   4296 O O   . GLY C 1 163 ? 14.679  10.396  72.059 1.00 35.56  ? 654  GLY C O   1 
ATOM   4297 N N   . SER C 1 164 ? 15.077  12.555  72.509 1.00 35.09  ? 655  SER C N   1 
ATOM   4298 C CA  . SER C 1 164 ? 13.779  12.734  73.153 1.00 37.04  ? 655  SER C CA  1 
ATOM   4299 C C   . SER C 1 164 ? 12.702  12.867  72.091 1.00 37.36  ? 655  SER C C   1 
ATOM   4300 O O   . SER C 1 164 ? 12.977  13.337  70.986 1.00 39.15  ? 655  SER C O   1 
ATOM   4301 C CB  . SER C 1 164 ? 13.773  13.985  74.037 1.00 37.40  ? 655  SER C CB  1 
ATOM   4302 O OG  . SER C 1 164 ? 14.654  13.839  75.135 1.00 38.35  ? 655  SER C OG  1 
ATOM   4303 N N   . ASP C 1 165 ? 11.482  12.449  72.425 1.00 36.92  ? 656  ASP C N   1 
ATOM   4304 C CA  . ASP C 1 165 ? 10.355  12.536  71.500 1.00 35.45  ? 656  ASP C CA  1 
ATOM   4305 C C   . ASP C 1 165 ? 9.136   13.211  72.113 1.00 34.52  ? 656  ASP C C   1 
ATOM   4306 O O   . ASP C 1 165 ? 8.279   13.731  71.393 1.00 32.96  ? 656  ASP C O   1 
ATOM   4307 C CB  . ASP C 1 165 ? 9.960   11.146  71.011 1.00 35.88  ? 656  ASP C CB  1 
ATOM   4308 C CG  . ASP C 1 165 ? 11.057  10.481  70.225 1.00 37.50  ? 656  ASP C CG  1 
ATOM   4309 O OD1 . ASP C 1 165 ? 11.523  11.065  69.221 1.00 39.38  ? 656  ASP C OD1 1 
ATOM   4310 O OD2 . ASP C 1 165 ? 11.458  9.371   70.612 1.00 38.89  ? 656  ASP C OD2 1 
ATOM   4311 N N   . HIS C 1 166 ? 9.070   13.200  73.443 1.00 34.75  ? 657  HIS C N   1 
ATOM   4312 C CA  . HIS C 1 166 ? 7.953   13.786  74.184 1.00 34.61  ? 657  HIS C CA  1 
ATOM   4313 C C   . HIS C 1 166 ? 8.415   14.504  75.439 1.00 34.57  ? 657  HIS C C   1 
ATOM   4314 O O   . HIS C 1 166 ? 9.340   14.052  76.116 1.00 33.89  ? 657  HIS C O   1 
ATOM   4315 C CB  . HIS C 1 166 ? 6.968   12.697  74.646 1.00 34.00  ? 657  HIS C CB  1 
ATOM   4316 C CG  . HIS C 1 166 ? 6.614   11.705  73.590 1.00 33.92  ? 657  HIS C CG  1 
ATOM   4317 N ND1 . HIS C 1 166 ? 5.801   12.013  72.522 1.00 34.71  ? 657  HIS C ND1 1 
ATOM   4318 C CD2 . HIS C 1 166 ? 6.985   10.416  73.422 1.00 34.32  ? 657  HIS C CD2 1 
ATOM   4319 C CE1 . HIS C 1 166 ? 5.688   10.955  71.741 1.00 35.69  ? 657  HIS C CE1 1 
ATOM   4320 N NE2 . HIS C 1 166 ? 6.398   9.972   72.264 1.00 34.71  ? 657  HIS C NE2 1 
ATOM   4321 N N   . VAL C 1 167 ? 7.752   15.611  75.756 1.00 35.40  ? 658  VAL C N   1 
ATOM   4322 C CA  . VAL C 1 167 ? 8.041   16.351  76.979 1.00 35.94  ? 658  VAL C CA  1 
ATOM   4323 C C   . VAL C 1 167 ? 6.676   16.485  77.661 1.00 35.19  ? 658  VAL C C   1 
ATOM   4324 O O   . VAL C 1 167 ? 5.729   16.982  77.064 1.00 33.82  ? 658  VAL C O   1 
ATOM   4325 C CB  . VAL C 1 167 ? 8.671   17.749  76.702 1.00 34.64  ? 658  VAL C CB  1 
ATOM   4326 C CG1 . VAL C 1 167 ? 7.720   18.612  75.903 1.00 37.14  ? 658  VAL C CG1 1 
ATOM   4327 C CG2 . VAL C 1 167 ? 9.007   18.431  78.024 1.00 35.31  ? 658  VAL C CG2 1 
ATOM   4328 N N   . MET C 1 168 ? 6.578   16.010  78.898 1.00 36.76  ? 659  MET C N   1 
ATOM   4329 C CA  . MET C 1 168 ? 5.322   16.044  79.643 1.00 39.08  ? 659  MET C CA  1 
ATOM   4330 C C   . MET C 1 168 ? 5.342   17.090  80.754 1.00 38.13  ? 659  MET C C   1 
ATOM   4331 O O   . MET C 1 168 ? 6.343   17.231  81.453 1.00 38.13  ? 659  MET C O   1 
ATOM   4332 C CB  . MET C 1 168 ? 5.049   14.647  80.225 1.00 43.02  ? 659  MET C CB  1 
ATOM   4333 C CG  . MET C 1 168 ? 3.767   14.495  81.051 1.00 48.74  ? 659  MET C CG  1 
ATOM   4334 S SD  . MET C 1 168 ? 2.227   14.126  80.122 1.00 56.54  ? 659  MET C SD  1 
ATOM   4335 C CE  . MET C 1 168 ? 2.402   12.332  79.785 1.00 50.93  ? 659  MET C CE  1 
ATOM   4336 N N   . LEU C 1 169 ? 4.242   17.834  80.894 1.00 38.22  ? 660  LEU C N   1 
ATOM   4337 C CA  . LEU C 1 169 ? 4.109   18.869  81.933 1.00 37.86  ? 660  LEU C CA  1 
ATOM   4338 C C   . LEU C 1 169 ? 2.932   18.510  82.845 1.00 38.06  ? 660  LEU C C   1 
ATOM   4339 O O   . LEU C 1 169 ? 1.774   18.553  82.429 1.00 36.19  ? 660  LEU C O   1 
ATOM   4340 C CB  . LEU C 1 169 ? 3.877   20.252  81.306 1.00 35.54  ? 660  LEU C CB  1 
ATOM   4341 C CG  . LEU C 1 169 ? 4.984   20.776  80.383 1.00 34.25  ? 660  LEU C CG  1 
ATOM   4342 C CD1 . LEU C 1 169 ? 4.536   22.058  79.707 1.00 33.21  ? 660  LEU C CD1 1 
ATOM   4343 C CD2 . LEU C 1 169 ? 6.248   21.020  81.184 1.00 33.11  ? 660  LEU C CD2 1 
ATOM   4344 N N   . LYS C 1 170 ? 3.244   18.152  84.088 1.00 39.22  ? 661  LYS C N   1 
ATOM   4345 C CA  . LYS C 1 170 ? 2.233   17.754  85.064 1.00 40.09  ? 661  LYS C CA  1 
ATOM   4346 C C   . LYS C 1 170 ? 2.139   18.749  86.218 1.00 39.63  ? 661  LYS C C   1 
ATOM   4347 O O   . LYS C 1 170 ? 2.900   19.714  86.291 1.00 40.19  ? 661  LYS C O   1 
ATOM   4348 C CB  . LYS C 1 170 ? 2.578   16.371  85.621 1.00 41.06  ? 661  LYS C CB  1 
ATOM   4349 C CG  . LYS C 1 170 ? 3.038   15.385  84.564 1.00 44.25  ? 661  LYS C CG  1 
ATOM   4350 C CD  . LYS C 1 170 ? 3.282   13.992  85.125 1.00 46.23  ? 661  LYS C CD  1 
ATOM   4351 C CE  . LYS C 1 170 ? 3.874   13.076  84.046 1.00 48.26  ? 661  LYS C CE  1 
ATOM   4352 N NZ  . LYS C 1 170 ? 3.880   11.632  84.437 1.00 50.11  ? 661  LYS C NZ  1 
ATOM   4353 N N   . SER C 1 171 ? 1.199   18.508  87.122 1.00 38.28  ? 662  SER C N   1 
ATOM   4354 C CA  . SER C 1 171 ? 1.028   19.369  88.281 1.00 38.15  ? 662  SER C CA  1 
ATOM   4355 C C   . SER C 1 171 ? 0.901   20.837  87.931 1.00 38.17  ? 662  SER C C   1 
ATOM   4356 O O   . SER C 1 171 ? 1.495   21.678  88.597 1.00 38.74  ? 662  SER C O   1 
ATOM   4357 C CB  . SER C 1 171 ? 2.204   19.206  89.254 1.00 39.37  ? 662  SER C CB  1 
ATOM   4358 O OG  . SER C 1 171 ? 2.231   17.927  89.865 1.00 40.59  ? 662  SER C OG  1 
ATOM   4359 N N   . LEU C 1 172 ? 0.137   21.156  86.892 1.00 39.34  ? 663  LEU C N   1 
ATOM   4360 C CA  . LEU C 1 172 ? -0.064  22.553  86.498 1.00 38.51  ? 663  LEU C CA  1 
ATOM   4361 C C   . LEU C 1 172 ? -1.284  23.109  87.226 1.00 38.12  ? 663  LEU C C   1 
ATOM   4362 O O   . LEU C 1 172 ? -2.065  22.344  87.795 1.00 36.98  ? 663  LEU C O   1 
ATOM   4363 C CB  . LEU C 1 172 ? -0.290  22.658  84.988 1.00 38.36  ? 663  LEU C CB  1 
ATOM   4364 C CG  . LEU C 1 172 ? 0.824   22.145  84.073 1.00 38.21  ? 663  LEU C CG  1 
ATOM   4365 C CD1 . LEU C 1 172 ? 0.458   22.413  82.617 1.00 36.48  ? 663  LEU C CD1 1 
ATOM   4366 C CD2 . LEU C 1 172 ? 2.135   22.832  84.432 1.00 37.47  ? 663  LEU C CD2 1 
ATOM   4367 N N   . ASP C 1 173 ? -1.443  24.433  87.221 1.00 37.33  ? 664  ASP C N   1 
ATOM   4368 C CA  . ASP C 1 173 ? -2.602  25.044  87.864 1.00 37.66  ? 664  ASP C CA  1 
ATOM   4369 C C   . ASP C 1 173 ? -3.819  24.673  87.041 1.00 37.60  ? 664  ASP C C   1 
ATOM   4370 O O   . ASP C 1 173 ? -3.707  24.321  85.864 1.00 37.56  ? 664  ASP C O   1 
ATOM   4371 C CB  . ASP C 1 173 ? -2.507  26.569  87.892 1.00 39.78  ? 664  ASP C CB  1 
ATOM   4372 C CG  . ASP C 1 173 ? -1.336  27.070  88.696 1.00 41.70  ? 664  ASP C CG  1 
ATOM   4373 O OD1 . ASP C 1 173 ? -1.105  26.576  89.823 1.00 41.02  ? 664  ASP C OD1 1 
ATOM   4374 O OD2 . ASP C 1 173 ? -0.650  27.982  88.194 1.00 45.39  ? 664  ASP C OD2 1 
ATOM   4375 N N   . TRP C 1 174 ? -4.987  24.762  87.653 1.00 36.40  ? 665  TRP C N   1 
ATOM   4376 C CA  . TRP C 1 174 ? -6.200  24.430  86.938 1.00 36.55  ? 665  TRP C CA  1 
ATOM   4377 C C   . TRP C 1 174 ? -6.773  25.649  86.244 1.00 35.89  ? 665  TRP C C   1 
ATOM   4378 O O   . TRP C 1 174 ? -6.600  26.775  86.701 1.00 36.14  ? 665  TRP C O   1 
ATOM   4379 C CB  . TRP C 1 174 ? -7.242  23.842  87.890 1.00 34.97  ? 665  TRP C CB  1 
ATOM   4380 C CG  . TRP C 1 174 ? -6.846  22.517  88.425 1.00 34.76  ? 665  TRP C CG  1 
ATOM   4381 C CD1 . TRP C 1 174 ? -6.093  22.271  89.539 1.00 34.19  ? 665  TRP C CD1 1 
ATOM   4382 C CD2 . TRP C 1 174 ? -7.144  21.242  87.849 1.00 33.00  ? 665  TRP C CD2 1 
ATOM   4383 N NE1 . TRP C 1 174 ? -5.905  20.915  89.692 1.00 33.25  ? 665  TRP C NE1 1 
ATOM   4384 C CE2 . TRP C 1 174 ? -6.540  20.261  88.670 1.00 32.90  ? 665  TRP C CE2 1 
ATOM   4385 C CE3 . TRP C 1 174 ? -7.864  20.831  86.719 1.00 33.03  ? 665  TRP C CE3 1 
ATOM   4386 C CZ2 . TRP C 1 174 ? -6.633  18.896  88.398 1.00 31.94  ? 665  TRP C CZ2 1 
ATOM   4387 C CZ3 . TRP C 1 174 ? -7.959  19.471  86.446 1.00 33.84  ? 665  TRP C CZ3 1 
ATOM   4388 C CH2 . TRP C 1 174 ? -7.345  18.519  87.285 1.00 34.38  ? 665  TRP C CH2 1 
ATOM   4389 N N   . ASN C 1 175 ? -7.429  25.419  85.116 1.00 35.05  ? 666  ASN C N   1 
ATOM   4390 C CA  . ASN C 1 175 ? -8.060  26.500  84.393 1.00 36.27  ? 666  ASN C CA  1 
ATOM   4391 C C   . ASN C 1 175 ? -7.071  27.628  84.081 1.00 35.10  ? 666  ASN C C   1 
ATOM   4392 O O   . ASN C 1 175 ? -7.415  28.803  84.155 1.00 35.32  ? 666  ASN C O   1 
ATOM   4393 C CB  . ASN C 1 175 ? -9.238  27.004  85.242 1.00 37.67  ? 666  ASN C CB  1 
ATOM   4394 C CG  . ASN C 1 175 ? -10.099 28.009  84.518 1.00 39.99  ? 666  ASN C CG  1 
ATOM   4395 O OD1 . ASN C 1 175 ? -10.486 27.798  83.365 1.00 42.36  ? 666  ASN C OD1 1 
ATOM   4396 N ND2 . ASN C 1 175 ? -10.416 29.111  85.195 1.00 38.83  ? 666  ASN C ND2 1 
ATOM   4397 N N   . ALA C 1 176 ? -5.846  27.266  83.713 1.00 33.89  ? 667  ALA C N   1 
ATOM   4398 C CA  . ALA C 1 176 ? -4.824  28.259  83.411 1.00 32.82  ? 667  ALA C CA  1 
ATOM   4399 C C   . ALA C 1 176 ? -4.179  28.089  82.039 1.00 33.62  ? 667  ALA C C   1 
ATOM   4400 O O   . ALA C 1 176 ? -4.001  26.973  81.552 1.00 34.77  ? 667  ALA C O   1 
ATOM   4401 C CB  . ALA C 1 176 ? -3.753  28.236  84.490 1.00 32.25  ? 667  ALA C CB  1 
ATOM   4402 N N   . GLU C 1 177 ? -3.820  29.216  81.431 1.00 33.39  ? 668  GLU C N   1 
ATOM   4403 C CA  . GLU C 1 177 ? -3.185  29.245  80.119 1.00 32.85  ? 668  GLU C CA  1 
ATOM   4404 C C   . GLU C 1 177 ? -1.658  29.215  80.235 1.00 33.96  ? 668  GLU C C   1 
ATOM   4405 O O   . GLU C 1 177 ? -1.055  30.013  80.955 1.00 33.36  ? 668  GLU C O   1 
ATOM   4406 C CB  . GLU C 1 177 ? -3.614  30.501  79.366 1.00 30.34  ? 668  GLU C CB  1 
ATOM   4407 C CG  . GLU C 1 177 ? -5.114  30.639  79.217 1.00 30.06  ? 668  GLU C CG  1 
ATOM   4408 C CD  . GLU C 1 177 ? -5.504  31.828  78.364 1.00 30.26  ? 668  GLU C CD  1 
ATOM   4409 O OE1 . GLU C 1 177 ? -5.036  31.900  77.217 1.00 32.32  ? 668  GLU C OE1 1 
ATOM   4410 O OE2 . GLU C 1 177 ? -6.272  32.691  78.826 1.00 28.88  ? 668  GLU C OE2 1 
ATOM   4411 N N   . TYR C 1 178 ? -1.038  28.280  79.524 1.00 35.82  ? 669  TYR C N   1 
ATOM   4412 C CA  . TYR C 1 178 ? 0.415   28.145  79.548 1.00 36.41  ? 669  TYR C CA  1 
ATOM   4413 C C   . TYR C 1 178 ? 1.012   28.278  78.155 1.00 35.96  ? 669  TYR C C   1 
ATOM   4414 O O   . TYR C 1 178 ? 0.304   28.380  77.164 1.00 36.14  ? 669  TYR C O   1 
ATOM   4415 C CB  . TYR C 1 178 ? 0.823   26.794  80.148 1.00 37.13  ? 669  TYR C CB  1 
ATOM   4416 C CG  . TYR C 1 178 ? 0.622   26.672  81.648 1.00 37.35  ? 669  TYR C CG  1 
ATOM   4417 C CD1 . TYR C 1 178 ? -0.577  26.186  82.185 1.00 37.21  ? 669  TYR C CD1 1 
ATOM   4418 C CD2 . TYR C 1 178 ? 1.637   27.037  82.528 1.00 35.92  ? 669  TYR C CD2 1 
ATOM   4419 C CE1 . TYR C 1 178 ? -0.750  26.067  83.563 1.00 35.24  ? 669  TYR C CE1 1 
ATOM   4420 C CE2 . TYR C 1 178 ? 1.473   26.924  83.896 1.00 36.18  ? 669  TYR C CE2 1 
ATOM   4421 C CZ  . TYR C 1 178 ? 0.284   26.441  84.413 1.00 35.62  ? 669  TYR C CZ  1 
ATOM   4422 O OH  . TYR C 1 178 ? 0.146   26.346  85.779 1.00 33.71  ? 669  TYR C OH  1 
ATOM   4423 N N   . GLU C 1 179 ? 2.329   28.264  78.082 1.00 36.96  ? 670  GLU C N   1 
ATOM   4424 C CA  . GLU C 1 179 ? 2.999   28.400  76.799 1.00 37.45  ? 670  GLU C CA  1 
ATOM   4425 C C   . GLU C 1 179 ? 4.341   27.681  76.826 1.00 36.66  ? 670  GLU C C   1 
ATOM   4426 O O   . GLU C 1 179 ? 5.133   27.865  77.747 1.00 36.34  ? 670  GLU C O   1 
ATOM   4427 C CB  . GLU C 1 179 ? 3.192   29.885  76.495 1.00 37.85  ? 670  GLU C CB  1 
ATOM   4428 C CG  . GLU C 1 179 ? 4.105   30.197  75.342 1.00 39.76  ? 670  GLU C CG  1 
ATOM   4429 C CD  . GLU C 1 179 ? 4.238   31.694  75.115 1.00 42.63  ? 670  GLU C CD  1 
ATOM   4430 O OE1 . GLU C 1 179 ? 4.493   32.426  76.101 1.00 41.96  ? 670  GLU C OE1 1 
ATOM   4431 O OE2 . GLU C 1 179 ? 4.091   32.136  73.952 1.00 44.38  ? 670  GLU C OE2 1 
ATOM   4432 N N   . VAL C 1 180 ? 4.584   26.855  75.816 1.00 36.38  ? 671  VAL C N   1 
ATOM   4433 C CA  . VAL C 1 180 ? 5.833   26.112  75.715 1.00 35.46  ? 671  VAL C CA  1 
ATOM   4434 C C   . VAL C 1 180 ? 6.680   26.566  74.529 1.00 35.37  ? 671  VAL C C   1 
ATOM   4435 O O   . VAL C 1 180 ? 6.163   26.936  73.479 1.00 34.60  ? 671  VAL C O   1 
ATOM   4436 C CB  . VAL C 1 180 ? 5.567   24.604  75.596 1.00 34.00  ? 671  VAL C CB  1 
ATOM   4437 C CG1 . VAL C 1 180 ? 6.834   23.881  75.227 1.00 32.52  ? 671  VAL C CG1 1 
ATOM   4438 C CG2 . VAL C 1 180 ? 5.043   24.079  76.915 1.00 34.63  ? 671  VAL C CG2 1 
ATOM   4439 N N   . TYR C 1 181 ? 7.992   26.533  74.719 1.00 36.56  ? 672  TYR C N   1 
ATOM   4440 C CA  . TYR C 1 181 ? 8.950   26.924  73.699 1.00 37.83  ? 672  TYR C CA  1 
ATOM   4441 C C   . TYR C 1 181 ? 10.001  25.835  73.571 1.00 36.02  ? 672  TYR C C   1 
ATOM   4442 O O   . TYR C 1 181 ? 10.541  25.369  74.571 1.00 36.78  ? 672  TYR C O   1 
ATOM   4443 C CB  . TYR C 1 181 ? 9.624   28.245  74.087 1.00 42.39  ? 672  TYR C CB  1 
ATOM   4444 C CG  . TYR C 1 181 ? 8.855   29.482  73.672 1.00 49.99  ? 672  TYR C CG  1 
ATOM   4445 C CD1 . TYR C 1 181 ? 7.470   29.554  73.827 1.00 55.02  ? 672  TYR C CD1 1 
ATOM   4446 C CD2 . TYR C 1 181 ? 9.512   30.590  73.140 1.00 53.66  ? 672  TYR C CD2 1 
ATOM   4447 C CE1 . TYR C 1 181 ? 6.751   30.701  73.460 1.00 56.51  ? 672  TYR C CE1 1 
ATOM   4448 C CE2 . TYR C 1 181 ? 8.804   31.748  72.772 1.00 56.44  ? 672  TYR C CE2 1 
ATOM   4449 C CZ  . TYR C 1 181 ? 7.422   31.792  72.935 1.00 57.39  ? 672  TYR C CZ  1 
ATOM   4450 O OH  . TYR C 1 181 ? 6.708   32.917  72.567 1.00 58.97  ? 672  TYR C OH  1 
ATOM   4451 N N   . VAL C 1 182 ? 10.276  25.416  72.342 1.00 33.62  ? 673  VAL C N   1 
ATOM   4452 C CA  . VAL C 1 182 ? 11.284  24.392  72.104 1.00 31.45  ? 673  VAL C CA  1 
ATOM   4453 C C   . VAL C 1 182 ? 12.241  24.860  71.003 1.00 30.11  ? 673  VAL C C   1 
ATOM   4454 O O   . VAL C 1 182 ? 11.811  25.366  69.961 1.00 26.81  ? 673  VAL C O   1 
ATOM   4455 C CB  . VAL C 1 182 ? 10.635  23.052  71.694 1.00 32.03  ? 673  VAL C CB  1 
ATOM   4456 C CG1 . VAL C 1 182 ? 11.707  21.988  71.512 1.00 31.68  ? 673  VAL C CG1 1 
ATOM   4457 C CG2 . VAL C 1 182 ? 9.641   22.611  72.756 1.00 32.23  ? 673  VAL C CG2 1 
ATOM   4458 N N   . VAL C 1 183 ? 13.540  24.696  71.249 1.00 28.02  ? 674  VAL C N   1 
ATOM   4459 C CA  . VAL C 1 183 ? 14.553  25.110  70.287 1.00 28.17  ? 674  VAL C CA  1 
ATOM   4460 C C   . VAL C 1 183 ? 15.525  23.979  70.005 1.00 28.21  ? 674  VAL C C   1 
ATOM   4461 O O   . VAL C 1 183 ? 16.039  23.356  70.921 1.00 28.27  ? 674  VAL C O   1 
ATOM   4462 C CB  . VAL C 1 183 ? 15.332  26.357  70.805 1.00 28.04  ? 674  VAL C CB  1 
ATOM   4463 C CG1 . VAL C 1 183 ? 16.609  26.576  70.010 1.00 26.70  ? 674  VAL C CG1 1 
ATOM   4464 C CG2 . VAL C 1 183 ? 14.453  27.584  70.694 1.00 24.92  ? 674  VAL C CG2 1 
ATOM   4465 N N   . ALA C 1 184 ? 15.764  23.713  68.726 1.00 28.28  ? 675  ALA C N   1 
ATOM   4466 C CA  . ALA C 1 184 ? 16.685  22.659  68.325 1.00 28.61  ? 675  ALA C CA  1 
ATOM   4467 C C   . ALA C 1 184 ? 18.094  23.223  68.292 1.00 30.35  ? 675  ALA C C   1 
ATOM   4468 O O   . ALA C 1 184 ? 18.313  24.335  67.809 1.00 32.90  ? 675  ALA C O   1 
ATOM   4469 C CB  . ALA C 1 184 ? 16.303  22.134  66.960 1.00 26.56  ? 675  ALA C CB  1 
ATOM   4470 N N   . GLU C 1 185 ? 19.058  22.459  68.790 1.00 30.91  ? 676  GLU C N   1 
ATOM   4471 C CA  . GLU C 1 185 ? 20.434  22.926  68.813 1.00 31.84  ? 676  GLU C CA  1 
ATOM   4472 C C   . GLU C 1 185 ? 21.450  21.940  68.226 1.00 31.63  ? 676  GLU C C   1 
ATOM   4473 O O   . GLU C 1 185 ? 21.342  20.739  68.437 1.00 31.73  ? 676  GLU C O   1 
ATOM   4474 C CB  . GLU C 1 185 ? 20.813  23.240  70.252 1.00 33.87  ? 676  GLU C CB  1 
ATOM   4475 C CG  . GLU C 1 185 ? 22.127  23.964  70.410 1.00 38.83  ? 676  GLU C CG  1 
ATOM   4476 C CD  . GLU C 1 185 ? 22.565  24.028  71.858 1.00 39.61  ? 676  GLU C CD  1 
ATOM   4477 O OE1 . GLU C 1 185 ? 22.907  22.968  72.423 1.00 39.35  ? 676  GLU C OE1 1 
ATOM   4478 O OE2 . GLU C 1 185 ? 22.556  25.135  72.429 1.00 39.63  ? 676  GLU C OE2 1 
ATOM   4479 N N   . ASN C 1 186 ? 22.425  22.452  67.481 1.00 31.55  ? 677  ASN C N   1 
ATOM   4480 C CA  . ASN C 1 186 ? 23.489  21.620  66.921 1.00 31.59  ? 677  ASN C CA  1 
ATOM   4481 C C   . ASN C 1 186 ? 24.801  22.398  67.039 1.00 32.30  ? 677  ASN C C   1 
ATOM   4482 O O   . ASN C 1 186 ? 24.810  23.505  67.558 1.00 31.76  ? 677  ASN C O   1 
ATOM   4483 C CB  . ASN C 1 186 ? 23.203  21.226  65.464 1.00 31.01  ? 677  ASN C CB  1 
ATOM   4484 C CG  . ASN C 1 186 ? 23.316  22.385  64.502 1.00 33.68  ? 677  ASN C CG  1 
ATOM   4485 O OD1 . ASN C 1 186 ? 23.811  23.454  64.857 1.00 32.69  ? 677  ASN C OD1 1 
ATOM   4486 N ND2 . ASN C 1 186 ? 22.869  22.173  63.260 1.00 30.36  ? 677  ASN C ND2 1 
ATOM   4487 N N   . GLN C 1 187 ? 25.903  21.819  66.578 1.00 34.81  ? 678  GLN C N   1 
ATOM   4488 C CA  . GLN C 1 187 ? 27.220  22.464  66.671 1.00 38.50  ? 678  GLN C CA  1 
ATOM   4489 C C   . GLN C 1 187 ? 27.244  23.884  66.095 1.00 38.83  ? 678  GLN C C   1 
ATOM   4490 O O   . GLN C 1 187 ? 27.879  24.779  66.637 1.00 37.32  ? 678  GLN C O   1 
ATOM   4491 C CB  . GLN C 1 187 ? 28.272  21.620  65.933 1.00 43.32  ? 678  GLN C CB  1 
ATOM   4492 C CG  . GLN C 1 187 ? 27.925  20.125  65.790 1.00 50.55  ? 678  GLN C CG  1 
ATOM   4493 C CD  . GLN C 1 187 ? 28.247  19.295  67.032 1.00 54.00  ? 678  GLN C CD  1 
ATOM   4494 O OE1 . GLN C 1 187 ? 27.831  18.129  67.142 1.00 54.42  ? 678  GLN C OE1 1 
ATOM   4495 N NE2 . GLN C 1 187 ? 29.003  19.886  67.967 1.00 53.90  ? 678  GLN C NE2 1 
ATOM   4496 N N   . GLN C 1 188 ? 26.550  24.061  64.979 1.00 40.64  ? 679  GLN C N   1 
ATOM   4497 C CA  . GLN C 1 188 ? 26.458  25.324  64.262 1.00 40.04  ? 679  GLN C CA  1 
ATOM   4498 C C   . GLN C 1 188 ? 25.663  26.392  65.018 1.00 39.63  ? 679  GLN C C   1 
ATOM   4499 O O   . GLN C 1 188 ? 25.865  27.584  64.817 1.00 40.39  ? 679  GLN C O   1 
ATOM   4500 C CB  . GLN C 1 188 ? 25.808  25.051  62.903 1.00 42.71  ? 679  GLN C CB  1 
ATOM   4501 C CG  . GLN C 1 188 ? 25.639  26.247  61.991 1.00 46.17  ? 679  GLN C CG  1 
ATOM   4502 C CD  . GLN C 1 188 ? 26.955  26.725  61.411 1.00 49.07  ? 679  GLN C CD  1 
ATOM   4503 O OE1 . GLN C 1 188 ? 27.831  25.920  61.079 1.00 50.95  ? 679  GLN C OE1 1 
ATOM   4504 N NE2 . GLN C 1 188 ? 27.095  28.038  61.266 1.00 49.87  ? 679  GLN C NE2 1 
ATOM   4505 N N   . GLY C 1 189 ? 24.744  25.971  65.880 1.00 38.73  ? 680  GLY C N   1 
ATOM   4506 C CA  . GLY C 1 189 ? 23.964  26.943  66.622 1.00 36.41  ? 680  GLY C CA  1 
ATOM   4507 C C   . GLY C 1 189 ? 22.549  26.525  66.963 1.00 36.49  ? 680  GLY C C   1 
ATOM   4508 O O   . GLY C 1 189 ? 22.205  25.346  66.917 1.00 36.90  ? 680  GLY C O   1 
ATOM   4509 N N   . LYS C 1 190 ? 21.720  27.506  67.305 1.00 35.52  ? 681  LYS C N   1 
ATOM   4510 C CA  . LYS C 1 190 ? 20.339  27.242  67.677 1.00 33.83  ? 681  LYS C CA  1 
ATOM   4511 C C   . LYS C 1 190 ? 19.389  27.577  66.541 1.00 32.54  ? 681  LYS C C   1 
ATOM   4512 O O   . LYS C 1 190 ? 19.736  28.320  65.631 1.00 32.65  ? 681  LYS C O   1 
ATOM   4513 C CB  . LYS C 1 190 ? 19.964  28.061  68.920 1.00 34.57  ? 681  LYS C CB  1 
ATOM   4514 C CG  . LYS C 1 190 ? 20.859  27.794  70.115 1.00 36.87  ? 681  LYS C CG  1 
ATOM   4515 C CD  . LYS C 1 190 ? 20.322  28.385  71.412 1.00 37.73  ? 681  LYS C CD  1 
ATOM   4516 C CE  . LYS C 1 190 ? 20.379  29.897  71.413 1.00 41.37  ? 681  LYS C CE  1 
ATOM   4517 N NZ  . LYS C 1 190 ? 19.990  30.481  72.738 1.00 43.40  ? 681  LYS C NZ  1 
ATOM   4518 N N   . SER C 1 191 ? 18.189  27.016  66.600 1.00 30.43  ? 682  SER C N   1 
ATOM   4519 C CA  . SER C 1 191 ? 17.172  27.270  65.594 1.00 29.65  ? 682  SER C CA  1 
ATOM   4520 C C   . SER C 1 191 ? 16.129  28.225  66.178 1.00 30.36  ? 682  SER C C   1 
ATOM   4521 O O   . SER C 1 191 ? 16.210  28.627  67.342 1.00 29.44  ? 682  SER C O   1 
ATOM   4522 C CB  . SER C 1 191 ? 16.462  25.976  65.229 1.00 29.09  ? 682  SER C CB  1 
ATOM   4523 O OG  . SER C 1 191 ? 15.668  25.557  66.321 1.00 27.61  ? 682  SER C OG  1 
ATOM   4524 N N   . LYS C 1 192 ? 15.151  28.579  65.356 1.00 29.94  ? 683  LYS C N   1 
ATOM   4525 C CA  . LYS C 1 192 ? 14.066  29.445  65.777 1.00 31.69  ? 683  LYS C CA  1 
ATOM   4526 C C   . LYS C 1 192 ? 13.237  28.641  66.779 1.00 31.88  ? 683  LYS C C   1 
ATOM   4527 O O   . LYS C 1 192 ? 13.207  27.412  66.725 1.00 32.46  ? 683  LYS C O   1 
ATOM   4528 C CB  . LYS C 1 192 ? 13.228  29.854  64.558 1.00 33.90  ? 683  LYS C CB  1 
ATOM   4529 C CG  . LYS C 1 192 ? 13.220  28.813  63.426 1.00 40.77  ? 683  LYS C CG  1 
ATOM   4530 C CD  . LYS C 1 192 ? 12.623  29.357  62.123 1.00 45.42  ? 683  LYS C CD  1 
ATOM   4531 C CE  . LYS C 1 192 ? 13.422  30.556  61.579 1.00 47.53  ? 683  LYS C CE  1 
ATOM   4532 N NZ  . LYS C 1 192 ? 12.895  31.097  60.281 1.00 46.80  ? 683  LYS C NZ  1 
ATOM   4533 N N   . ALA C 1 193 ? 12.576  29.324  67.706 1.00 30.97  ? 684  ALA C N   1 
ATOM   4534 C CA  . ALA C 1 193 ? 11.783  28.629  68.707 1.00 30.80  ? 684  ALA C CA  1 
ATOM   4535 C C   . ALA C 1 193 ? 10.410  28.217  68.209 1.00 31.04  ? 684  ALA C C   1 
ATOM   4536 O O   . ALA C 1 193 ? 9.760   28.949  67.468 1.00 32.62  ? 684  ALA C O   1 
ATOM   4537 C CB  . ALA C 1 193 ? 11.638  29.497  69.949 1.00 29.24  ? 684  ALA C CB  1 
ATOM   4538 N N   . ALA C 1 194 ? 9.983   27.027  68.611 1.00 30.74  ? 685  ALA C N   1 
ATOM   4539 C CA  . ALA C 1 194 ? 8.664   26.532  68.263 1.00 30.67  ? 685  ALA C CA  1 
ATOM   4540 C C   . ALA C 1 194 ? 7.799   26.976  69.439 1.00 31.98  ? 685  ALA C C   1 
ATOM   4541 O O   . ALA C 1 194 ? 8.308   27.150  70.543 1.00 32.93  ? 685  ALA C O   1 
ATOM   4542 C CB  . ALA C 1 194 ? 8.679   25.034  68.150 1.00 30.08  ? 685  ALA C CB  1 
ATOM   4543 N N   . HIS C 1 195 ? 6.505   27.168  69.210 1.00 32.88  ? 686  HIS C N   1 
ATOM   4544 C CA  . HIS C 1 195 ? 5.608   27.630  70.259 1.00 33.58  ? 686  HIS C CA  1 
ATOM   4545 C C   . HIS C 1 195 ? 4.392   26.764  70.404 1.00 33.46  ? 686  HIS C C   1 
ATOM   4546 O O   . HIS C 1 195 ? 3.816   26.322  69.414 1.00 33.47  ? 686  HIS C O   1 
ATOM   4547 C CB  . HIS C 1 195 ? 5.077   29.020  69.944 1.00 39.01  ? 686  HIS C CB  1 
ATOM   4548 C CG  . HIS C 1 195 ? 6.129   30.069  69.835 1.00 44.82  ? 686  HIS C CG  1 
ATOM   4549 N ND1 . HIS C 1 195 ? 5.921   31.254  69.161 1.00 47.60  ? 686  HIS C ND1 1 
ATOM   4550 C CD2 . HIS C 1 195 ? 7.382   30.134  70.341 1.00 46.35  ? 686  HIS C CD2 1 
ATOM   4551 C CE1 . HIS C 1 195 ? 7.003   32.005  69.259 1.00 48.67  ? 686  HIS C CE1 1 
ATOM   4552 N NE2 . HIS C 1 195 ? 7.904   31.350  69.971 1.00 47.77  ? 686  HIS C NE2 1 
ATOM   4553 N N   . PHE C 1 196 ? 3.973   26.556  71.642 1.00 33.30  ? 687  PHE C N   1 
ATOM   4554 C CA  . PHE C 1 196 ? 2.769   25.795  71.891 1.00 33.25  ? 687  PHE C CA  1 
ATOM   4555 C C   . PHE C 1 196 ? 2.010   26.446  73.037 1.00 33.79  ? 687  PHE C C   1 
ATOM   4556 O O   . PHE C 1 196 ? 2.504   26.526  74.162 1.00 36.23  ? 687  PHE C O   1 
ATOM   4557 C CB  . PHE C 1 196 ? 3.075   24.346  72.238 1.00 32.94  ? 687  PHE C CB  1 
ATOM   4558 C CG  . PHE C 1 196 ? 1.872   23.470  72.170 1.00 34.28  ? 687  PHE C CG  1 
ATOM   4559 C CD1 . PHE C 1 196 ? 1.349   23.095  70.940 1.00 35.95  ? 687  PHE C CD1 1 
ATOM   4560 C CD2 . PHE C 1 196 ? 1.197   23.101  73.327 1.00 37.16  ? 687  PHE C CD2 1 
ATOM   4561 C CE1 . PHE C 1 196 ? 0.159   22.366  70.853 1.00 37.37  ? 687  PHE C CE1 1 
ATOM   4562 C CE2 . PHE C 1 196 ? 0.003   22.371  73.255 1.00 38.61  ? 687  PHE C CE2 1 
ATOM   4563 C CZ  . PHE C 1 196 ? -0.516  22.005  72.012 1.00 38.12  ? 687  PHE C CZ  1 
ATOM   4564 N N   . VAL C 1 197 ? 0.805   26.916  72.747 1.00 31.30  ? 688  VAL C N   1 
ATOM   4565 C CA  . VAL C 1 197 ? -0.002  27.561  73.759 1.00 29.75  ? 688  VAL C CA  1 
ATOM   4566 C C   . VAL C 1 197 ? -1.231  26.712  74.078 1.00 29.52  ? 688  VAL C C   1 
ATOM   4567 O O   . VAL C 1 197 ? -2.022  26.383  73.196 1.00 30.67  ? 688  VAL C O   1 
ATOM   4568 C CB  . VAL C 1 197 ? -0.430  28.955  73.282 1.00 29.08  ? 688  VAL C CB  1 
ATOM   4569 C CG1 . VAL C 1 197 ? -1.043  29.740  74.427 1.00 29.78  ? 688  VAL C CG1 1 
ATOM   4570 C CG2 . VAL C 1 197 ? 0.761   29.679  72.724 1.00 28.91  ? 688  VAL C CG2 1 
ATOM   4571 N N   . PHE C 1 198 ? -1.394  26.364  75.346 1.00 28.28  ? 689  PHE C N   1 
ATOM   4572 C CA  . PHE C 1 198 ? -2.516  25.547  75.754 1.00 28.61  ? 689  PHE C CA  1 
ATOM   4573 C C   . PHE C 1 198 ? -3.162  26.038  77.046 1.00 30.88  ? 689  PHE C C   1 
ATOM   4574 O O   . PHE C 1 198 ? -2.639  26.923  77.727 1.00 31.63  ? 689  PHE C O   1 
ATOM   4575 C CB  . PHE C 1 198 ? -2.052  24.103  75.916 1.00 26.81  ? 689  PHE C CB  1 
ATOM   4576 C CG  . PHE C 1 198 ? -1.173  23.886  77.097 1.00 26.53  ? 689  PHE C CG  1 
ATOM   4577 C CD1 . PHE C 1 198 ? -1.697  23.379  78.279 1.00 25.52  ? 689  PHE C CD1 1 
ATOM   4578 C CD2 . PHE C 1 198 ? 0.189   24.189  77.033 1.00 27.16  ? 689  PHE C CD2 1 
ATOM   4579 C CE1 . PHE C 1 198 ? -0.879  23.170  79.385 1.00 27.87  ? 689  PHE C CE1 1 
ATOM   4580 C CE2 . PHE C 1 198 ? 1.022   23.984  78.133 1.00 27.34  ? 689  PHE C CE2 1 
ATOM   4581 C CZ  . PHE C 1 198 ? 0.487   23.473  79.313 1.00 28.90  ? 689  PHE C CZ  1 
ATOM   4582 N N   . ARG C 1 199 ? -4.303  25.445  77.379 1.00 31.76  ? 690  ARG C N   1 
ATOM   4583 C CA  . ARG C 1 199 ? -5.049  25.812  78.573 1.00 32.63  ? 690  ARG C CA  1 
ATOM   4584 C C   . ARG C 1 199 ? -5.579  24.562  79.268 1.00 32.21  ? 690  ARG C C   1 
ATOM   4585 O O   . ARG C 1 199 ? -6.204  23.711  78.649 1.00 33.51  ? 690  ARG C O   1 
ATOM   4586 C CB  . ARG C 1 199 ? -6.215  26.729  78.189 1.00 33.41  ? 690  ARG C CB  1 
ATOM   4587 C CG  . ARG C 1 199 ? -7.051  27.203  79.370 1.00 35.20  ? 690  ARG C CG  1 
ATOM   4588 C CD  . ARG C 1 199 ? -8.316  27.910  78.918 1.00 33.36  ? 690  ARG C CD  1 
ATOM   4589 N NE  . ARG C 1 199 ? -9.153  28.295  80.049 1.00 35.42  ? 690  ARG C NE  1 
ATOM   4590 C CZ  . ARG C 1 199 ? -9.512  29.546  80.325 1.00 36.61  ? 690  ARG C CZ  1 
ATOM   4591 N NH1 . ARG C 1 199 ? -9.104  30.539  79.547 1.00 36.80  ? 690  ARG C NH1 1 
ATOM   4592 N NH2 . ARG C 1 199 ? -10.273 29.807  81.381 1.00 35.68  ? 690  ARG C NH2 1 
ATOM   4593 N N   . THR C 1 200 ? -5.341  24.463  80.565 1.00 32.71  ? 691  THR C N   1 
ATOM   4594 C CA  . THR C 1 200 ? -5.781  23.309  81.333 1.00 33.70  ? 691  THR C CA  1 
ATOM   4595 C C   . THR C 1 200 ? -7.274  23.287  81.663 1.00 35.29  ? 691  THR C C   1 
ATOM   4596 O O   . THR C 1 200 ? -7.973  24.293  81.544 1.00 34.88  ? 691  THR C O   1 
ATOM   4597 C CB  . THR C 1 200 ? -4.984  23.214  82.642 1.00 34.07  ? 691  THR C CB  1 
ATOM   4598 O OG1 . THR C 1 200 ? -5.095  24.454  83.362 1.00 32.42  ? 691  THR C OG1 1 
ATOM   4599 C CG2 . THR C 1 200 ? -3.505  22.918  82.343 1.00 33.52  ? 691  THR C CG2 1 
ATOM   4600 N N   . ALA C 1 201 ? -7.743  22.119  82.092 1.00 37.64  ? 692  ALA C N   1 
ATOM   4601 C CA  . ALA C 1 201 ? -9.142  21.911  82.461 1.00 38.71  ? 692  ALA C CA  1 
ATOM   4602 C C   . ALA C 1 201 ? -9.529  22.739  83.697 1.00 39.61  ? 692  ALA C C   1 
ATOM   4603 O O   . ALA C 1 201 ? -8.665  23.218  84.429 1.00 36.95  ? 692  ALA C O   1 
ATOM   4604 C CB  . ALA C 1 201 ? -9.389  20.420  82.710 1.00 37.88  ? 692  ALA C CB  1 
ATOM   4605 N N   . ALA C 1 202 ? -10.835 22.884  83.923 1.00 42.73  ? 693  ALA C N   1 
ATOM   4606 C CA  . ALA C 1 202 ? -11.381 23.678  85.028 1.00 44.22  ? 693  ALA C CA  1 
ATOM   4607 C C   . ALA C 1 202 ? -11.035 23.223  86.445 1.00 45.82  ? 693  ALA C C   1 
ATOM   4608 O O   . ALA C 1 202 ? -10.585 24.024  87.269 1.00 46.43  ? 693  ALA C O   1 
ATOM   4609 C CB  . ALA C 1 202 ? -12.882 23.770  84.879 1.00 45.49  ? 693  ALA C CB  1 
ATOM   4610 N N   . ALA C 1 203 ? -11.273 21.950  86.745 1.00 47.34  ? 694  ALA C N   1 
ATOM   4611 C CA  . ALA C 1 203 ? -10.961 21.415  88.082 1.00 49.39  ? 694  ALA C CA  1 
ATOM   4612 C C   . ALA C 1 203 ? -10.797 19.906  87.979 1.00 51.02  ? 694  ALA C C   1 
ATOM   4613 O O   . ALA C 1 203 ? -11.234 19.360  86.922 1.00 50.91  ? 694  ALA C O   1 
ATOM   4614 C CB  . ALA C 1 203 ? -12.091 21.747  89.079 1.00 48.42  ? 694  ALA C CB  1 
ATOM   4615 N N   . HIS C 1 204 ? -10.254 19.299  88.945 1.00 52.80  ? 695  HIS C N   1 
ATOM   4616 N N   . ALA D 1 6   ? 19.387  -18.253 76.220 1.00 82.06  ? 497  ALA D N   1 
ATOM   4617 C CA  . ALA D 1 6   ? 18.399  -17.774 75.214 1.00 82.00  ? 497  ALA D CA  1 
ATOM   4618 C C   . ALA D 1 6   ? 17.920  -16.362 75.549 1.00 82.13  ? 497  ALA D C   1 
ATOM   4619 O O   . ALA D 1 6   ? 17.405  -16.114 76.642 1.00 81.80  ? 497  ALA D O   1 
ATOM   4620 C CB  . ALA D 1 6   ? 17.210  -18.734 75.158 1.00 81.32  ? 497  ALA D CB  1 
ATOM   4621 N N   . ASP D 1 7   ? 18.106  -15.444 74.603 1.00 81.95  ? 498  ASP D N   1 
ATOM   4622 C CA  . ASP D 1 7   ? 17.689  -14.049 74.758 1.00 81.59  ? 498  ASP D CA  1 
ATOM   4623 C C   . ASP D 1 7   ? 17.890  -13.256 73.469 1.00 80.67  ? 498  ASP D C   1 
ATOM   4624 O O   . ASP D 1 7   ? 18.959  -13.303 72.860 1.00 80.59  ? 498  ASP D O   1 
ATOM   4625 C CB  . ASP D 1 7   ? 18.459  -13.363 75.897 1.00 82.15  ? 498  ASP D CB  1 
ATOM   4626 C CG  . ASP D 1 7   ? 17.724  -13.429 77.231 1.00 82.90  ? 498  ASP D CG  1 
ATOM   4627 O OD1 . ASP D 1 7   ? 16.581  -12.928 77.314 1.00 82.08  ? 498  ASP D OD1 1 
ATOM   4628 O OD2 . ASP D 1 7   ? 18.291  -13.979 78.199 1.00 83.23  ? 498  ASP D OD2 1 
ATOM   4629 N N   . THR D 1 8   ? 16.852  -12.535 73.054 1.00 79.77  ? 499  THR D N   1 
ATOM   4630 C CA  . THR D 1 8   ? 16.914  -11.711 71.850 1.00 78.09  ? 499  THR D CA  1 
ATOM   4631 C C   . THR D 1 8   ? 17.348  -10.311 72.275 1.00 77.13  ? 499  THR D C   1 
ATOM   4632 O O   . THR D 1 8   ? 17.227  -9.953  73.448 1.00 77.63  ? 499  THR D O   1 
ATOM   4633 C CB  . THR D 1 8   ? 15.545  -11.632 71.162 1.00 77.50  ? 499  THR D CB  1 
ATOM   4634 O OG1 . THR D 1 8   ? 14.556  -11.250 72.123 1.00 76.32  ? 499  THR D OG1 1 
ATOM   4635 C CG2 . THR D 1 8   ? 15.174  -12.981 70.557 1.00 76.58  ? 499  THR D CG2 1 
ATOM   4636 N N   . PRO D 1 9   ? 17.855  -9.497  71.332 1.00 75.62  ? 500  PRO D N   1 
ATOM   4637 C CA  . PRO D 1 9   ? 18.290  -8.149  71.708 1.00 73.32  ? 500  PRO D CA  1 
ATOM   4638 C C   . PRO D 1 9   ? 17.151  -7.287  72.230 1.00 71.72  ? 500  PRO D C   1 
ATOM   4639 O O   . PRO D 1 9   ? 15.970  -7.613  72.069 1.00 70.90  ? 500  PRO D O   1 
ATOM   4640 C CB  . PRO D 1 9   ? 18.876  -7.589  70.411 1.00 73.83  ? 500  PRO D CB  1 
ATOM   4641 C CG  . PRO D 1 9   ? 19.216  -8.819  69.604 1.00 74.42  ? 500  PRO D CG  1 
ATOM   4642 C CD  . PRO D 1 9   ? 18.053  -9.725  69.891 1.00 75.09  ? 500  PRO D CD  1 
ATOM   4643 N N   . SER D 1 10  ? 17.523  -6.186  72.865 1.00 69.55  ? 501  SER D N   1 
ATOM   4644 C CA  . SER D 1 10  ? 16.555  -5.248  73.401 1.00 67.19  ? 501  SER D CA  1 
ATOM   4645 C C   . SER D 1 10  ? 16.392  -4.138  72.371 1.00 65.19  ? 501  SER D C   1 
ATOM   4646 O O   . SER D 1 10  ? 17.264  -3.938  71.525 1.00 65.07  ? 501  SER D O   1 
ATOM   4647 C CB  . SER D 1 10  ? 17.060  -4.688  74.729 1.00 67.45  ? 501  SER D CB  1 
ATOM   4648 O OG  . SER D 1 10  ? 18.442  -4.391  74.643 1.00 68.37  ? 501  SER D OG  1 
ATOM   4649 N N   . SER D 1 11  ? 15.273  -3.426  72.443 1.00 62.77  ? 502  SER D N   1 
ATOM   4650 C CA  . SER D 1 11  ? 14.970  -2.349  71.505 1.00 59.39  ? 502  SER D CA  1 
ATOM   4651 C C   . SER D 1 11  ? 16.062  -1.297  71.400 1.00 56.93  ? 502  SER D C   1 
ATOM   4652 O O   . SER D 1 11  ? 16.464  -0.709  72.401 1.00 57.80  ? 502  SER D O   1 
ATOM   4653 C CB  . SER D 1 11  ? 13.666  -1.661  71.906 1.00 59.82  ? 502  SER D CB  1 
ATOM   4654 O OG  . SER D 1 11  ? 13.783  -1.057  73.184 1.00 60.05  ? 502  SER D OG  1 
ATOM   4655 N N   . PRO D 1 12  ? 16.566  -1.051  70.181 1.00 53.55  ? 503  PRO D N   1 
ATOM   4656 C CA  . PRO D 1 12  ? 17.613  -0.045  70.003 1.00 50.46  ? 503  PRO D CA  1 
ATOM   4657 C C   . PRO D 1 12  ? 17.130  1.312   70.506 1.00 48.19  ? 503  PRO D C   1 
ATOM   4658 O O   . PRO D 1 12  ? 15.975  1.461   70.902 1.00 47.48  ? 503  PRO D O   1 
ATOM   4659 C CB  . PRO D 1 12  ? 17.844  -0.056  68.495 1.00 50.81  ? 503  PRO D CB  1 
ATOM   4660 C CG  . PRO D 1 12  ? 17.615  -1.497  68.147 1.00 51.55  ? 503  PRO D CG  1 
ATOM   4661 C CD  . PRO D 1 12  ? 16.364  -1.825  68.942 1.00 52.61  ? 503  PRO D CD  1 
ATOM   4662 N N   . SER D 1 13  ? 18.021  2.294   70.492 1.00 45.80  ? 504  SER D N   1 
ATOM   4663 C CA  . SER D 1 13  ? 17.694  3.635   70.947 1.00 43.27  ? 504  SER D CA  1 
ATOM   4664 C C   . SER D 1 13  ? 17.978  4.623   69.821 1.00 42.76  ? 504  SER D C   1 
ATOM   4665 O O   . SER D 1 13  ? 19.120  4.755   69.389 1.00 44.93  ? 504  SER D O   1 
ATOM   4666 C CB  . SER D 1 13  ? 18.537  3.973   72.177 1.00 42.68  ? 504  SER D CB  1 
ATOM   4667 O OG  . SER D 1 13  ? 18.456  5.347   72.504 1.00 45.68  ? 504  SER D OG  1 
ATOM   4668 N N   . ILE D 1 14  ? 16.943  5.317   69.349 1.00 40.21  ? 505  ILE D N   1 
ATOM   4669 C CA  . ILE D 1 14  ? 17.086  6.285   68.260 1.00 37.96  ? 505  ILE D CA  1 
ATOM   4670 C C   . ILE D 1 14  ? 17.500  7.684   68.723 1.00 38.36  ? 505  ILE D C   1 
ATOM   4671 O O   . ILE D 1 14  ? 16.692  8.420   69.291 1.00 37.56  ? 505  ILE D O   1 
ATOM   4672 C CB  . ILE D 1 14  ? 15.777  6.407   67.476 1.00 35.93  ? 505  ILE D CB  1 
ATOM   4673 C CG1 . ILE D 1 14  ? 15.332  5.026   67.005 1.00 33.27  ? 505  ILE D CG1 1 
ATOM   4674 C CG2 . ILE D 1 14  ? 15.961  7.343   66.299 1.00 36.40  ? 505  ILE D CG2 1 
ATOM   4675 C CD1 . ILE D 1 14  ? 14.060  5.037   66.219 1.00 32.10  ? 505  ILE D CD1 1 
ATOM   4676 N N   . ASP D 1 15  ? 18.756  8.052   68.454 1.00 39.66  ? 506  ASP D N   1 
ATOM   4677 C CA  . ASP D 1 15  ? 19.293  9.358   68.848 1.00 39.53  ? 506  ASP D CA  1 
ATOM   4678 C C   . ASP D 1 15  ? 19.105  10.428  67.789 1.00 38.46  ? 506  ASP D C   1 
ATOM   4679 O O   . ASP D 1 15  ? 18.911  11.599  68.110 1.00 38.40  ? 506  ASP D O   1 
ATOM   4680 C CB  . ASP D 1 15  ? 20.793  9.284   69.137 1.00 42.58  ? 506  ASP D CB  1 
ATOM   4681 C CG  . ASP D 1 15  ? 21.164  8.141   70.051 1.00 46.64  ? 506  ASP D CG  1 
ATOM   4682 O OD1 . ASP D 1 15  ? 20.454  7.910   71.058 1.00 47.92  ? 506  ASP D OD1 1 
ATOM   4683 O OD2 . ASP D 1 15  ? 22.186  7.480   69.763 1.00 49.70  ? 506  ASP D OD2 1 
ATOM   4684 N N   . GLN D 1 16  ? 19.185  10.037  66.524 1.00 35.66  ? 507  GLN D N   1 
ATOM   4685 C CA  . GLN D 1 16  ? 19.048  11.011  65.455 1.00 34.28  ? 507  GLN D CA  1 
ATOM   4686 C C   . GLN D 1 16  ? 18.194  10.535  64.314 1.00 31.13  ? 507  GLN D C   1 
ATOM   4687 O O   . GLN D 1 16  ? 18.191  9.363   63.977 1.00 30.83  ? 507  GLN D O   1 
ATOM   4688 C CB  . GLN D 1 16  ? 20.427  11.388  64.884 1.00 35.94  ? 507  GLN D CB  1 
ATOM   4689 C CG  . GLN D 1 16  ? 21.398  12.016  65.876 1.00 37.19  ? 507  GLN D CG  1 
ATOM   4690 C CD  . GLN D 1 16  ? 21.114  13.483  66.153 1.00 39.76  ? 507  GLN D CD  1 
ATOM   4691 O OE1 . GLN D 1 16  ? 21.478  13.999  67.210 1.00 41.80  ? 507  GLN D OE1 1 
ATOM   4692 N NE2 . GLN D 1 16  ? 20.480  14.166  65.201 1.00 37.97  ? 507  GLN D NE2 1 
ATOM   4693 N N   . VAL D 1 17  ? 17.457  11.465  63.730 1.00 29.12  ? 508  VAL D N   1 
ATOM   4694 C CA  . VAL D 1 17  ? 16.659  11.165  62.563 1.00 28.12  ? 508  VAL D CA  1 
ATOM   4695 C C   . VAL D 1 17  ? 16.786  12.411  61.720 1.00 27.69  ? 508  VAL D C   1 
ATOM   4696 O O   . VAL D 1 17  ? 16.155  13.419  62.004 1.00 29.16  ? 508  VAL D O   1 
ATOM   4697 C CB  . VAL D 1 17  ? 15.168  10.919  62.877 1.00 28.26  ? 508  VAL D CB  1 
ATOM   4698 C CG1 . VAL D 1 17  ? 14.423  10.639  61.571 1.00 26.75  ? 508  VAL D CG1 1 
ATOM   4699 C CG2 . VAL D 1 17  ? 15.006  9.732   63.821 1.00 26.99  ? 508  VAL D CG2 1 
ATOM   4700 N N   . GLU D 1 18  ? 17.654  12.363  60.720 1.00 26.09  ? 509  GLU D N   1 
ATOM   4701 C CA  . GLU D 1 18  ? 17.845  13.503  59.835 1.00 26.04  ? 509  GLU D CA  1 
ATOM   4702 C C   . GLU D 1 18  ? 17.042  13.189  58.591 1.00 25.10  ? 509  GLU D C   1 
ATOM   4703 O O   . GLU D 1 18  ? 17.404  12.311  57.823 1.00 26.31  ? 509  GLU D O   1 
ATOM   4704 C CB  . GLU D 1 18  ? 19.334  13.675  59.491 1.00 26.82  ? 509  GLU D CB  1 
ATOM   4705 C CG  . GLU D 1 18  ? 19.623  14.615  58.314 1.00 24.77  ? 509  GLU D CG  1 
ATOM   4706 C CD  . GLU D 1 18  ? 18.981  15.970  58.474 1.00 25.88  ? 509  GLU D CD  1 
ATOM   4707 O OE1 . GLU D 1 18  ? 18.463  16.258  59.569 1.00 27.49  ? 509  GLU D OE1 1 
ATOM   4708 O OE2 . GLU D 1 18  ? 18.988  16.758  57.507 1.00 26.12  ? 509  GLU D OE2 1 
ATOM   4709 N N   . PRO D 1 19  ? 15.919  13.882  58.390 1.00 25.63  ? 510  PRO D N   1 
ATOM   4710 C CA  . PRO D 1 19  ? 15.144  13.571  57.189 1.00 24.69  ? 510  PRO D CA  1 
ATOM   4711 C C   . PRO D 1 19  ? 15.454  14.449  55.994 1.00 24.26  ? 510  PRO D C   1 
ATOM   4712 O O   . PRO D 1 19  ? 15.751  15.633  56.127 1.00 23.02  ? 510  PRO D O   1 
ATOM   4713 C CB  . PRO D 1 19  ? 13.704  13.751  57.658 1.00 25.02  ? 510  PRO D CB  1 
ATOM   4714 C CG  . PRO D 1 19  ? 13.816  14.910  58.585 1.00 24.15  ? 510  PRO D CG  1 
ATOM   4715 C CD  . PRO D 1 19  ? 15.110  14.657  59.351 1.00 25.26  ? 510  PRO D CD  1 
ATOM   4716 N N   . TYR D 1 20  ? 15.386  13.845  54.820 1.00 23.77  ? 511  TYR D N   1 
ATOM   4717 C CA  . TYR D 1 20  ? 15.593  14.563  53.585 1.00 24.36  ? 511  TYR D CA  1 
ATOM   4718 C C   . TYR D 1 20  ? 14.239  14.473  52.882 1.00 25.29  ? 511  TYR D C   1 
ATOM   4719 O O   . TYR D 1 20  ? 13.217  14.323  53.540 1.00 23.48  ? 511  TYR D O   1 
ATOM   4720 C CB  . TYR D 1 20  ? 16.701  13.890  52.770 1.00 23.77  ? 511  TYR D CB  1 
ATOM   4721 C CG  . TYR D 1 20  ? 18.031  13.848  53.486 1.00 23.65  ? 511  TYR D CG  1 
ATOM   4722 C CD1 . TYR D 1 20  ? 18.575  12.642  53.927 1.00 23.75  ? 511  TYR D CD1 1 
ATOM   4723 C CD2 . TYR D 1 20  ? 18.733  15.019  53.749 1.00 22.32  ? 511  TYR D CD2 1 
ATOM   4724 C CE1 . TYR D 1 20  ? 19.791  12.613  54.613 1.00 24.08  ? 511  TYR D CE1 1 
ATOM   4725 C CE2 . TYR D 1 20  ? 19.936  15.001  54.432 1.00 22.59  ? 511  TYR D CE2 1 
ATOM   4726 C CZ  . TYR D 1 20  ? 20.465  13.802  54.863 1.00 25.20  ? 511  TYR D CZ  1 
ATOM   4727 O OH  . TYR D 1 20  ? 21.671  13.799  55.547 1.00 28.65  ? 511  TYR D OH  1 
ATOM   4728 N N   . SER D 1 21  ? 14.229  14.549  51.557 1.00 27.97  ? 512  SER D N   1 
ATOM   4729 C CA  . SER D 1 21  ? 12.992  14.465  50.791 1.00 29.88  ? 512  SER D CA  1 
ATOM   4730 C C   . SER D 1 21  ? 12.422  13.044  50.701 1.00 30.86  ? 512  SER D C   1 
ATOM   4731 O O   . SER D 1 21  ? 11.264  12.811  51.045 1.00 33.97  ? 512  SER D O   1 
ATOM   4732 C CB  . SER D 1 21  ? 13.217  14.987  49.376 1.00 32.14  ? 512  SER D CB  1 
ATOM   4733 O OG  . SER D 1 21  ? 13.671  16.326  49.391 1.00 40.11  ? 512  SER D OG  1 
ATOM   4734 N N   . SER D 1 22  ? 13.226  12.094  50.240 1.00 28.27  ? 513  SER D N   1 
ATOM   4735 C CA  . SER D 1 22  ? 12.742  10.730  50.093 1.00 25.90  ? 513  SER D CA  1 
ATOM   4736 C C   . SER D 1 22  ? 13.483  9.706   50.944 1.00 26.00  ? 513  SER D C   1 
ATOM   4737 O O   . SER D 1 22  ? 13.193  8.513   50.891 1.00 25.12  ? 513  SER D O   1 
ATOM   4738 C CB  . SER D 1 22  ? 12.820  10.317  48.624 1.00 26.55  ? 513  SER D CB  1 
ATOM   4739 O OG  . SER D 1 22  ? 14.167  10.245  48.181 1.00 27.87  ? 513  SER D OG  1 
ATOM   4740 N N   . THR D 1 23  ? 14.431  10.163  51.747 1.00 25.82  ? 514  THR D N   1 
ATOM   4741 C CA  . THR D 1 23  ? 15.184  9.229   52.570 1.00 25.48  ? 514  THR D CA  1 
ATOM   4742 C C   . THR D 1 23  ? 15.329  9.804   53.963 1.00 25.18  ? 514  THR D C   1 
ATOM   4743 O O   . THR D 1 23  ? 15.012  10.965  54.180 1.00 24.84  ? 514  THR D O   1 
ATOM   4744 C CB  . THR D 1 23  ? 16.584  8.962   51.951 1.00 25.65  ? 514  THR D CB  1 
ATOM   4745 O OG1 . THR D 1 23  ? 17.297  10.198  51.817 1.00 24.50  ? 514  THR D OG1 1 
ATOM   4746 C CG2 . THR D 1 23  ? 16.443  8.333   50.573 1.00 23.10  ? 514  THR D CG2 1 
ATOM   4747 N N   . ALA D 1 24  ? 15.782  8.985   54.906 1.00 26.14  ? 515  ALA D N   1 
ATOM   4748 C CA  . ALA D 1 24  ? 15.976  9.437   56.279 1.00 29.30  ? 515  ALA D CA  1 
ATOM   4749 C C   . ALA D 1 24  ? 17.093  8.662   56.985 1.00 31.13  ? 515  ALA D C   1 
ATOM   4750 O O   . ALA D 1 24  ? 17.087  7.427   57.019 1.00 31.34  ? 515  ALA D O   1 
ATOM   4751 C CB  . ALA D 1 24  ? 14.674  9.311   57.064 1.00 30.29  ? 515  ALA D CB  1 
ATOM   4752 N N   . GLN D 1 25  ? 18.049  9.398   57.547 1.00 31.58  ? 516  GLN D N   1 
ATOM   4753 C CA  . GLN D 1 25  ? 19.167  8.788   58.253 1.00 32.86  ? 516  GLN D CA  1 
ATOM   4754 C C   . GLN D 1 25  ? 18.845  8.657   59.741 1.00 32.34  ? 516  GLN D C   1 
ATOM   4755 O O   . GLN D 1 25  ? 18.673  9.649   60.447 1.00 33.08  ? 516  GLN D O   1 
ATOM   4756 C CB  . GLN D 1 25  ? 20.431  9.627   58.036 1.00 33.57  ? 516  GLN D CB  1 
ATOM   4757 C CG  . GLN D 1 25  ? 20.685  9.939   56.569 1.00 36.36  ? 516  GLN D CG  1 
ATOM   4758 C CD  . GLN D 1 25  ? 21.957  10.738  56.330 1.00 37.73  ? 516  GLN D CD  1 
ATOM   4759 O OE1 . GLN D 1 25  ? 22.241  11.702  57.040 1.00 37.16  ? 516  GLN D OE1 1 
ATOM   4760 N NE2 . GLN D 1 25  ? 22.720  10.349  55.312 1.00 36.98  ? 516  GLN D NE2 1 
ATOM   4761 N N   . VAL D 1 26  ? 18.756  7.421   60.210 1.00 32.67  ? 517  VAL D N   1 
ATOM   4762 C CA  . VAL D 1 26  ? 18.432  7.146   61.602 1.00 33.61  ? 517  VAL D CA  1 
ATOM   4763 C C   . VAL D 1 26  ? 19.648  6.684   62.385 1.00 35.03  ? 517  VAL D C   1 
ATOM   4764 O O   . VAL D 1 26  ? 20.215  5.646   62.079 1.00 35.06  ? 517  VAL D O   1 
ATOM   4765 C CB  . VAL D 1 26  ? 17.359  6.040   61.700 1.00 33.38  ? 517  VAL D CB  1 
ATOM   4766 C CG1 . VAL D 1 26  ? 16.872  5.901   63.137 1.00 30.83  ? 517  VAL D CG1 1 
ATOM   4767 C CG2 . VAL D 1 26  ? 16.217  6.344   60.740 1.00 30.73  ? 517  VAL D CG2 1 
ATOM   4768 N N   . GLN D 1 27  ? 20.051  7.459   63.387 1.00 37.83  ? 518  GLN D N   1 
ATOM   4769 C CA  . GLN D 1 27  ? 21.184  7.097   64.224 1.00 41.11  ? 518  GLN D CA  1 
ATOM   4770 C C   . GLN D 1 27  ? 20.636  6.416   65.459 1.00 44.68  ? 518  GLN D C   1 
ATOM   4771 O O   . GLN D 1 27  ? 19.677  6.893   66.064 1.00 46.27  ? 518  GLN D O   1 
ATOM   4772 C CB  . GLN D 1 27  ? 21.983  8.329   64.641 1.00 41.57  ? 518  GLN D CB  1 
ATOM   4773 C CG  . GLN D 1 27  ? 22.949  8.837   63.595 1.00 44.16  ? 518  GLN D CG  1 
ATOM   4774 C CD  . GLN D 1 27  ? 24.031  9.710   64.194 1.00 45.32  ? 518  GLN D CD  1 
ATOM   4775 O OE1 . GLN D 1 27  ? 24.752  9.277   65.089 1.00 46.49  ? 518  GLN D OE1 1 
ATOM   4776 N NE2 . GLN D 1 27  ? 24.155  10.944  63.704 1.00 45.24  ? 518  GLN D NE2 1 
ATOM   4777 N N   . PHE D 1 28  ? 21.257  5.310   65.846 1.00 48.65  ? 519  PHE D N   1 
ATOM   4778 C CA  . PHE D 1 28  ? 20.805  4.542   67.002 1.00 52.47  ? 519  PHE D CA  1 
ATOM   4779 C C   . PHE D 1 28  ? 21.958  4.009   67.848 1.00 54.61  ? 519  PHE D C   1 
ATOM   4780 O O   . PHE D 1 28  ? 23.091  3.936   67.384 1.00 53.20  ? 519  PHE D O   1 
ATOM   4781 C CB  . PHE D 1 28  ? 19.965  3.361   66.518 1.00 53.49  ? 519  PHE D CB  1 
ATOM   4782 C CG  . PHE D 1 28  ? 20.689  2.470   65.542 1.00 54.35  ? 519  PHE D CG  1 
ATOM   4783 C CD1 . PHE D 1 28  ? 20.682  1.093   65.703 1.00 53.96  ? 519  PHE D CD1 1 
ATOM   4784 C CD2 . PHE D 1 28  ? 21.403  3.014   64.476 1.00 55.06  ? 519  PHE D CD2 1 
ATOM   4785 C CE1 . PHE D 1 28  ? 21.376  0.274   64.823 1.00 55.67  ? 519  PHE D CE1 1 
ATOM   4786 C CE2 . PHE D 1 28  ? 22.102  2.202   63.589 1.00 56.04  ? 519  PHE D CE2 1 
ATOM   4787 C CZ  . PHE D 1 28  ? 22.090  0.829   63.762 1.00 55.90  ? 519  PHE D CZ  1 
ATOM   4788 N N   . ASP D 1 29  ? 21.649  3.627   69.084 1.00 58.72  ? 520  ASP D N   1 
ATOM   4789 C CA  . ASP D 1 29  ? 22.638  3.070   70.004 1.00 64.20  ? 520  ASP D CA  1 
ATOM   4790 C C   . ASP D 1 29  ? 22.506  1.546   70.060 1.00 68.68  ? 520  ASP D C   1 
ATOM   4791 O O   . ASP D 1 29  ? 21.433  1.018   70.367 1.00 68.46  ? 520  ASP D O   1 
ATOM   4792 C CB  . ASP D 1 29  ? 22.451  3.640   71.414 1.00 62.91  ? 520  ASP D CB  1 
ATOM   4793 C CG  . ASP D 1 29  ? 22.960  5.063   71.547 1.00 63.21  ? 520  ASP D CG  1 
ATOM   4794 O OD1 . ASP D 1 29  ? 24.162  5.297   71.291 1.00 61.95  ? 520  ASP D OD1 1 
ATOM   4795 O OD2 . ASP D 1 29  ? 22.159  5.948   71.917 1.00 62.51  ? 520  ASP D OD2 1 
ATOM   4796 N N   . GLU D 1 30  ? 23.607  0.851   69.769 1.00 74.12  ? 521  GLU D N   1 
ATOM   4797 C CA  . GLU D 1 30  ? 23.645  -0.614  69.769 1.00 78.92  ? 521  GLU D CA  1 
ATOM   4798 C C   . GLU D 1 30  ? 23.146  -1.252  71.058 1.00 81.53  ? 521  GLU D C   1 
ATOM   4799 O O   . GLU D 1 30  ? 23.587  -0.893  72.158 1.00 81.51  ? 521  GLU D O   1 
ATOM   4800 C CB  . GLU D 1 30  ? 25.071  -1.123  69.510 1.00 80.83  ? 521  GLU D CB  1 
ATOM   4801 C CG  . GLU D 1 30  ? 25.536  -1.045  68.061 1.00 83.85  ? 521  GLU D CG  1 
ATOM   4802 C CD  . GLU D 1 30  ? 26.854  -1.775  67.829 1.00 84.63  ? 521  GLU D CD  1 
ATOM   4803 O OE1 . GLU D 1 30  ? 27.898  -1.312  68.343 1.00 84.08  ? 521  GLU D OE1 1 
ATOM   4804 O OE2 . GLU D 1 30  ? 26.838  -2.817  67.136 1.00 84.05  ? 521  GLU D OE2 1 
ATOM   4805 N N   . PRO D 1 31  ? 22.214  -2.214  70.937 1.00 84.07  ? 522  PRO D N   1 
ATOM   4806 C CA  . PRO D 1 31  ? 21.665  -2.907  72.110 1.00 86.24  ? 522  PRO D CA  1 
ATOM   4807 C C   . PRO D 1 31  ? 22.608  -4.015  72.624 1.00 88.31  ? 522  PRO D C   1 
ATOM   4808 O O   . PRO D 1 31  ? 22.432  -5.192  72.302 1.00 89.49  ? 522  PRO D O   1 
ATOM   4809 C CB  . PRO D 1 31  ? 20.332  -3.449  71.590 1.00 85.30  ? 522  PRO D CB  1 
ATOM   4810 C CG  . PRO D 1 31  ? 20.630  -3.739  70.157 1.00 84.30  ? 522  PRO D CG  1 
ATOM   4811 C CD  . PRO D 1 31  ? 21.429  -2.527  69.726 1.00 83.44  ? 522  PRO D CD  1 
ATOM   4812 N N   . GLU D 1 32  ? 23.607  -3.623  73.418 1.00 89.87  ? 523  GLU D N   1 
ATOM   4813 C CA  . GLU D 1 32  ? 24.589  -4.554  73.989 1.00 91.40  ? 523  GLU D CA  1 
ATOM   4814 C C   . GLU D 1 32  ? 23.951  -5.774  74.671 1.00 92.66  ? 523  GLU D C   1 
ATOM   4815 O O   . GLU D 1 32  ? 24.614  -6.792  74.882 1.00 92.27  ? 523  GLU D O   1 
ATOM   4816 C CB  . GLU D 1 32  ? 25.485  -3.813  75.001 1.00 91.07  ? 523  GLU D CB  1 
ATOM   4817 C CG  . GLU D 1 32  ? 26.364  -4.721  75.875 1.00 90.66  ? 523  GLU D CG  1 
ATOM   4818 C CD  . GLU D 1 32  ? 26.852  -4.042  77.155 1.00 89.78  ? 523  GLU D CD  1 
ATOM   4819 O OE1 . GLU D 1 32  ? 26.027  -3.414  77.853 1.00 89.20  ? 523  GLU D OE1 1 
ATOM   4820 O OE2 . GLU D 1 32  ? 28.056  -4.149  77.475 1.00 88.86  ? 523  GLU D OE2 1 
ATOM   4821 N N   . ALA D 1 33  ? 22.669  -5.667  75.013 1.00 94.55  ? 524  ALA D N   1 
ATOM   4822 C CA  . ALA D 1 33  ? 21.953  -6.753  75.679 1.00 96.35  ? 524  ALA D CA  1 
ATOM   4823 C C   . ALA D 1 33  ? 21.583  -7.907  74.742 1.00 97.67  ? 524  ALA D C   1 
ATOM   4824 O O   . ALA D 1 33  ? 20.443  -8.013  74.283 1.00 97.87  ? 524  ALA D O   1 
ATOM   4825 C CB  . ALA D 1 33  ? 20.699  -6.208  76.361 1.00 95.51  ? 524  ALA D CB  1 
ATOM   4826 N N   . THR D 1 34  ? 22.562  -8.766  74.466 1.00 98.94  ? 525  THR D N   1 
ATOM   4827 C CA  . THR D 1 34  ? 22.371  -9.932  73.607 1.00 99.65  ? 525  THR D CA  1 
ATOM   4828 C C   . THR D 1 34  ? 23.175  -11.091 74.184 1.00 100.05 ? 525  THR D C   1 
ATOM   4829 O O   . THR D 1 34  ? 24.166  -10.879 74.889 1.00 100.27 ? 525  THR D O   1 
ATOM   4830 C CB  . THR D 1 34  ? 22.850  -9.675  72.167 1.00 100.01 ? 525  THR D CB  1 
ATOM   4831 O OG1 . THR D 1 34  ? 24.255  -9.388  72.173 1.00 99.94  ? 525  THR D OG1 1 
ATOM   4832 C CG2 . THR D 1 34  ? 22.084  -8.508  71.552 1.00 99.78  ? 525  THR D CG2 1 
ATOM   4833 N N   . GLY D 1 35  ? 22.745  -12.310 73.871 1.00 100.04 ? 526  GLY D N   1 
ATOM   4834 C CA  . GLY D 1 35  ? 23.397  -13.507 74.378 1.00 100.16 ? 526  GLY D CA  1 
ATOM   4835 C C   . GLY D 1 35  ? 24.906  -13.619 74.236 1.00 100.70 ? 526  GLY D C   1 
ATOM   4836 O O   . GLY D 1 35  ? 25.670  -12.851 74.839 1.00 100.84 ? 526  GLY D O   1 
ATOM   4837 N N   . GLY D 1 36  ? 25.335  -14.602 73.449 1.00 100.17 ? 527  GLY D N   1 
ATOM   4838 C CA  . GLY D 1 36  ? 26.753  -14.822 73.242 1.00 99.38  ? 527  GLY D CA  1 
ATOM   4839 C C   . GLY D 1 36  ? 27.341  -13.892 72.203 1.00 99.07  ? 527  GLY D C   1 
ATOM   4840 O O   . GLY D 1 36  ? 28.134  -14.315 71.359 1.00 99.18  ? 527  GLY D O   1 
ATOM   4841 N N   . VAL D 1 37  ? 26.952  -12.620 72.272 1.00 98.34  ? 528  VAL D N   1 
ATOM   4842 C CA  . VAL D 1 37  ? 27.428  -11.602 71.339 1.00 97.34  ? 528  VAL D CA  1 
ATOM   4843 C C   . VAL D 1 37  ? 26.768  -11.721 69.953 1.00 96.20  ? 528  VAL D C   1 
ATOM   4844 O O   . VAL D 1 37  ? 27.414  -11.488 68.930 1.00 95.95  ? 528  VAL D O   1 
ATOM   4845 C CB  . VAL D 1 37  ? 28.975  -11.691 71.163 1.00 97.87  ? 528  VAL D CB  1 
ATOM   4846 C CG1 . VAL D 1 37  ? 29.517  -10.391 70.577 1.00 97.36  ? 528  VAL D CG1 1 
ATOM   4847 C CG2 . VAL D 1 37  ? 29.639  -12.010 72.498 1.00 97.27  ? 528  VAL D CG2 1 
ATOM   4848 N N   . PRO D 1 38  ? 25.477  -12.091 69.896 1.00 94.84  ? 529  PRO D N   1 
ATOM   4849 C CA  . PRO D 1 38  ? 24.889  -12.192 68.558 1.00 93.61  ? 529  PRO D CA  1 
ATOM   4850 C C   . PRO D 1 38  ? 23.973  -11.025 68.174 1.00 91.92  ? 529  PRO D C   1 
ATOM   4851 O O   . PRO D 1 38  ? 22.965  -10.772 68.832 1.00 92.02  ? 529  PRO D O   1 
ATOM   4852 C CB  . PRO D 1 38  ? 24.136  -13.511 68.630 1.00 94.12  ? 529  PRO D CB  1 
ATOM   4853 C CG  . PRO D 1 38  ? 23.555  -13.450 70.010 1.00 94.59  ? 529  PRO D CG  1 
ATOM   4854 C CD  . PRO D 1 38  ? 24.677  -12.860 70.870 1.00 94.64  ? 529  PRO D CD  1 
ATOM   4855 N N   . ILE D 1 39  ? 24.338  -10.312 67.113 1.00 89.43  ? 530  ILE D N   1 
ATOM   4856 C CA  . ILE D 1 39  ? 23.539  -9.195  66.612 1.00 86.47  ? 530  ILE D CA  1 
ATOM   4857 C C   . ILE D 1 39  ? 23.663  -9.185  65.097 1.00 84.37  ? 530  ILE D C   1 
ATOM   4858 O O   . ILE D 1 39  ? 24.574  -8.577  64.532 1.00 83.36  ? 530  ILE D O   1 
ATOM   4859 C CB  . ILE D 1 39  ? 24.016  -7.826  67.152 1.00 86.95  ? 530  ILE D CB  1 
ATOM   4860 C CG1 . ILE D 1 39  ? 23.989  -7.821  68.681 1.00 86.99  ? 530  ILE D CG1 1 
ATOM   4861 C CG2 . ILE D 1 39  ? 23.105  -6.718  66.626 1.00 85.39  ? 530  ILE D CG2 1 
ATOM   4862 C CD1 . ILE D 1 39  ? 24.498  -6.531  69.294 1.00 87.63  ? 530  ILE D CD1 1 
ATOM   4863 N N   . LEU D 1 40  ? 22.740  -9.882  64.450 1.00 82.10  ? 531  LEU D N   1 
ATOM   4864 C CA  . LEU D 1 40  ? 22.717  -9.989  63.003 1.00 80.48  ? 531  LEU D CA  1 
ATOM   4865 C C   . LEU D 1 40  ? 21.448  -9.340  62.462 1.00 79.63  ? 531  LEU D C   1 
ATOM   4866 O O   . LEU D 1 40  ? 20.340  -9.672  62.888 1.00 81.57  ? 531  LEU D O   1 
ATOM   4867 C CB  . LEU D 1 40  ? 22.781  -11.469 62.591 1.00 80.02  ? 531  LEU D CB  1 
ATOM   4868 C CG  . LEU D 1 40  ? 21.941  -12.497 63.371 1.00 79.73  ? 531  LEU D CG  1 
ATOM   4869 C CD1 . LEU D 1 40  ? 21.900  -13.802 62.602 1.00 79.19  ? 531  LEU D CD1 1 
ATOM   4870 C CD2 . LEU D 1 40  ? 22.526  -12.733 64.761 1.00 79.56  ? 531  LEU D CD2 1 
ATOM   4871 N N   . LYS D 1 41  ? 21.614  -8.401  61.536 1.00 76.34  ? 532  LYS D N   1 
ATOM   4872 C CA  . LYS D 1 41  ? 20.484  -7.701  60.927 1.00 72.87  ? 532  LYS D CA  1 
ATOM   4873 C C   . LYS D 1 41  ? 19.667  -6.831  61.891 1.00 69.12  ? 532  LYS D C   1 
ATOM   4874 O O   . LYS D 1 41  ? 19.484  -7.164  63.066 1.00 67.96  ? 532  LYS D O   1 
ATOM   4875 C CB  . LYS D 1 41  ? 19.536  -8.700  60.240 1.00 74.66  ? 532  LYS D CB  1 
ATOM   4876 C CG  . LYS D 1 41  ? 20.213  -9.681  59.287 1.00 75.61  ? 532  LYS D CG  1 
ATOM   4877 C CD  . LYS D 1 41  ? 21.013  -8.970  58.204 1.00 77.37  ? 532  LYS D CD  1 
ATOM   4878 C CE  . LYS D 1 41  ? 21.768  -9.971  57.332 1.00 78.07  ? 532  LYS D CE  1 
ATOM   4879 N NZ  . LYS D 1 41  ? 22.714  -9.309  56.384 1.00 78.52  ? 532  LYS D NZ  1 
ATOM   4880 N N   . TYR D 1 42  ? 19.183  -5.709  61.361 1.00 65.40  ? 533  TYR D N   1 
ATOM   4881 C CA  . TYR D 1 42  ? 18.356  -4.756  62.095 1.00 60.84  ? 533  TYR D CA  1 
ATOM   4882 C C   . TYR D 1 42  ? 17.043  -4.596  61.328 1.00 58.82  ? 533  TYR D C   1 
ATOM   4883 O O   . TYR D 1 42  ? 17.042  -4.534  60.093 1.00 57.60  ? 533  TYR D O   1 
ATOM   4884 C CB  . TYR D 1 42  ? 19.055  -3.397  62.190 1.00 59.55  ? 533  TYR D CB  1 
ATOM   4885 C CG  . TYR D 1 42  ? 20.067  -3.265  63.312 1.00 58.57  ? 533  TYR D CG  1 
ATOM   4886 C CD1 . TYR D 1 42  ? 19.664  -3.263  64.647 1.00 56.81  ? 533  TYR D CD1 1 
ATOM   4887 C CD2 . TYR D 1 42  ? 21.425  -3.107  63.035 1.00 58.28  ? 533  TYR D CD2 1 
ATOM   4888 C CE1 . TYR D 1 42  ? 20.587  -3.102  65.673 1.00 56.20  ? 533  TYR D CE1 1 
ATOM   4889 C CE2 . TYR D 1 42  ? 22.354  -2.945  64.054 1.00 57.02  ? 533  TYR D CE2 1 
ATOM   4890 C CZ  . TYR D 1 42  ? 21.930  -2.941  65.368 1.00 56.76  ? 533  TYR D CZ  1 
ATOM   4891 O OH  . TYR D 1 42  ? 22.851  -2.754  66.374 1.00 58.51  ? 533  TYR D OH  1 
ATOM   4892 N N   . LYS D 1 43  ? 15.932  -4.538  62.059 1.00 55.82  ? 534  LYS D N   1 
ATOM   4893 C CA  . LYS D 1 43  ? 14.613  -4.383  61.450 1.00 53.91  ? 534  LYS D CA  1 
ATOM   4894 C C   . LYS D 1 43  ? 14.093  -2.965  61.664 1.00 51.48  ? 534  LYS D C   1 
ATOM   4895 O O   . LYS D 1 43  ? 13.893  -2.538  62.801 1.00 51.10  ? 534  LYS D O   1 
ATOM   4896 C CB  . LYS D 1 43  ? 13.635  -5.388  62.063 1.00 55.87  ? 534  LYS D CB  1 
ATOM   4897 C CG  . LYS D 1 43  ? 12.188  -5.271  61.581 1.00 57.76  ? 534  LYS D CG  1 
ATOM   4898 C CD  . LYS D 1 43  ? 11.286  -6.213  62.386 1.00 59.61  ? 534  LYS D CD  1 
ATOM   4899 C CE  . LYS D 1 43  ? 9.801   -6.011  62.092 1.00 60.21  ? 534  LYS D CE  1 
ATOM   4900 N NZ  . LYS D 1 43  ? 9.424   -6.334  60.688 1.00 59.79  ? 534  LYS D NZ  1 
ATOM   4901 N N   . ALA D 1 44  ? 13.881  -2.241  60.569 1.00 47.91  ? 535  ALA D N   1 
ATOM   4902 C CA  . ALA D 1 44  ? 13.384  -0.872  60.636 1.00 45.34  ? 535  ALA D CA  1 
ATOM   4903 C C   . ALA D 1 44  ? 11.935  -0.823  60.176 1.00 44.18  ? 535  ALA D C   1 
ATOM   4904 O O   . ALA D 1 44  ? 11.549  -1.528  59.251 1.00 44.64  ? 535  ALA D O   1 
ATOM   4905 C CB  . ALA D 1 44  ? 14.245  0.040   59.762 1.00 43.80  ? 535  ALA D CB  1 
ATOM   4906 N N   . GLU D 1 45  ? 11.136  0.015   60.824 1.00 44.20  ? 536  GLU D N   1 
ATOM   4907 C CA  . GLU D 1 45  ? 9.722   0.153   60.481 1.00 43.33  ? 536  GLU D CA  1 
ATOM   4908 C C   . GLU D 1 45  ? 9.263   1.594   60.437 1.00 41.49  ? 536  GLU D C   1 
ATOM   4909 O O   . GLU D 1 45  ? 9.490   2.346   61.379 1.00 42.37  ? 536  GLU D O   1 
ATOM   4910 C CB  . GLU D 1 45  ? 8.846   -0.562  61.501 1.00 45.23  ? 536  GLU D CB  1 
ATOM   4911 C CG  . GLU D 1 45  ? 8.851   -2.061  61.420 1.00 48.33  ? 536  GLU D CG  1 
ATOM   4912 C CD  . GLU D 1 45  ? 7.782   -2.655  62.300 1.00 48.97  ? 536  GLU D CD  1 
ATOM   4913 O OE1 . GLU D 1 45  ? 7.605   -3.893  62.277 1.00 49.85  ? 536  GLU D OE1 1 
ATOM   4914 O OE2 . GLU D 1 45  ? 7.117   -1.869  63.012 1.00 48.79  ? 536  GLU D OE2 1 
ATOM   4915 N N   . TRP D 1 46  ? 8.597   1.972   59.354 1.00 38.70  ? 537  TRP D N   1 
ATOM   4916 C CA  . TRP D 1 46  ? 8.080   3.325   59.227 1.00 36.92  ? 537  TRP D CA  1 
ATOM   4917 C C   . TRP D 1 46  ? 6.700   3.331   58.591 1.00 37.07  ? 537  TRP D C   1 
ATOM   4918 O O   . TRP D 1 46  ? 6.355   2.483   57.756 1.00 37.34  ? 537  TRP D O   1 
ATOM   4919 C CB  . TRP D 1 46  ? 9.035   4.205   58.422 1.00 35.89  ? 537  TRP D CB  1 
ATOM   4920 C CG  . TRP D 1 46  ? 9.213   3.772   57.031 1.00 35.38  ? 537  TRP D CG  1 
ATOM   4921 C CD1 . TRP D 1 46  ? 8.646   4.319   55.922 1.00 36.12  ? 537  TRP D CD1 1 
ATOM   4922 C CD2 . TRP D 1 46  ? 10.016  2.684   56.582 1.00 37.13  ? 537  TRP D CD2 1 
ATOM   4923 N NE1 . TRP D 1 46  ? 9.048   3.640   54.799 1.00 37.25  ? 537  TRP D NE1 1 
ATOM   4924 C CE2 . TRP D 1 46  ? 9.893   2.629   55.175 1.00 37.66  ? 537  TRP D CE2 1 
ATOM   4925 C CE3 . TRP D 1 46  ? 10.831  1.746   57.232 1.00 36.92  ? 537  TRP D CE3 1 
ATOM   4926 C CZ2 . TRP D 1 46  ? 10.556  1.673   54.403 1.00 36.89  ? 537  TRP D CZ2 1 
ATOM   4927 C CZ3 . TRP D 1 46  ? 11.489  0.794   56.466 1.00 38.63  ? 537  TRP D CZ3 1 
ATOM   4928 C CH2 . TRP D 1 46  ? 11.347  0.765   55.062 1.00 38.35  ? 537  TRP D CH2 1 
ATOM   4929 N N   . ARG D 1 47  ? 5.905   4.311   58.986 1.00 35.77  ? 538  ARG D N   1 
ATOM   4930 C CA  . ARG D 1 47  ? 4.558   4.415   58.477 1.00 35.00  ? 538  ARG D CA  1 
ATOM   4931 C C   . ARG D 1 47  ? 4.133   5.869   58.463 1.00 33.84  ? 538  ARG D C   1 
ATOM   4932 O O   . ARG D 1 47  ? 4.097   6.514   59.504 1.00 34.48  ? 538  ARG D O   1 
ATOM   4933 C CB  . ARG D 1 47  ? 3.635   3.592   59.380 1.00 36.73  ? 538  ARG D CB  1 
ATOM   4934 C CG  . ARG D 1 47  ? 2.167   3.621   59.026 1.00 36.25  ? 538  ARG D CG  1 
ATOM   4935 C CD  . ARG D 1 47  ? 1.371   2.916   60.099 1.00 36.46  ? 538  ARG D CD  1 
ATOM   4936 N NE  . ARG D 1 47  ? 1.510   3.585   61.387 1.00 38.45  ? 538  ARG D NE  1 
ATOM   4937 C CZ  . ARG D 1 47  ? 0.822   3.253   62.476 1.00 40.27  ? 538  ARG D CZ  1 
ATOM   4938 N NH1 . ARG D 1 47  ? -0.053  2.253   62.428 1.00 39.62  ? 538  ARG D NH1 1 
ATOM   4939 N NH2 . ARG D 1 47  ? 1.003   3.926   63.608 1.00 38.86  ? 538  ARG D NH2 1 
ATOM   4940 N N   . ALA D 1 48  ? 3.828   6.393   57.285 1.00 33.02  ? 539  ALA D N   1 
ATOM   4941 C CA  . ALA D 1 48  ? 3.390   7.774   57.195 1.00 33.66  ? 539  ALA D CA  1 
ATOM   4942 C C   . ALA D 1 48  ? 2.312   7.976   58.253 1.00 34.53  ? 539  ALA D C   1 
ATOM   4943 O O   . ALA D 1 48  ? 1.281   7.309   58.243 1.00 33.95  ? 539  ALA D O   1 
ATOM   4944 C CB  . ALA D 1 48  ? 2.829   8.055   55.818 1.00 32.54  ? 539  ALA D CB  1 
ATOM   4945 N N   . VAL D 1 49  ? 2.569   8.882   59.185 1.00 36.47  ? 540  VAL D N   1 
ATOM   4946 C CA  . VAL D 1 49  ? 1.622   9.168   60.253 1.00 37.37  ? 540  VAL D CA  1 
ATOM   4947 C C   . VAL D 1 49  ? 0.199   9.223   59.704 1.00 39.54  ? 540  VAL D C   1 
ATOM   4948 O O   . VAL D 1 49  ? -0.052  9.839   58.667 1.00 40.73  ? 540  VAL D O   1 
ATOM   4949 C CB  . VAL D 1 49  ? 1.977   10.513  60.938 1.00 36.48  ? 540  VAL D CB  1 
ATOM   4950 C CG1 . VAL D 1 49  ? 0.779   11.072  61.682 1.00 34.23  ? 540  VAL D CG1 1 
ATOM   4951 C CG2 . VAL D 1 49  ? 3.139   10.304  61.884 1.00 34.28  ? 540  VAL D CG2 1 
ATOM   4952 N N   . GLY D 1 50  ? -0.729  8.559   60.380 1.00 40.16  ? 541  GLY D N   1 
ATOM   4953 C CA  . GLY D 1 50  ? -2.102  8.597   59.915 1.00 42.23  ? 541  GLY D CA  1 
ATOM   4954 C C   . GLY D 1 50  ? -2.462  7.551   58.879 1.00 43.43  ? 541  GLY D C   1 
ATOM   4955 O O   . GLY D 1 50  ? -3.595  7.524   58.392 1.00 43.13  ? 541  GLY D O   1 
ATOM   4956 N N   . GLU D 1 51  ? -1.504  6.701   58.519 1.00 44.19  ? 542  GLU D N   1 
ATOM   4957 C CA  . GLU D 1 51  ? -1.782  5.641   57.563 1.00 44.70  ? 542  GLU D CA  1 
ATOM   4958 C C   . GLU D 1 51  ? -1.888  4.293   58.268 1.00 47.10  ? 542  GLU D C   1 
ATOM   4959 O O   . GLU D 1 51  ? -1.515  4.153   59.433 1.00 45.89  ? 542  GLU D O   1 
ATOM   4960 C CB  . GLU D 1 51  ? -0.739  5.615   56.444 1.00 42.22  ? 542  GLU D CB  1 
ATOM   4961 C CG  . GLU D 1 51  ? -1.135  6.512   55.286 1.00 40.25  ? 542  GLU D CG  1 
ATOM   4962 C CD  . GLU D 1 51  ? -0.149  6.503   54.149 1.00 39.62  ? 542  GLU D CD  1 
ATOM   4963 O OE1 . GLU D 1 51  ? 0.315   5.413   53.776 1.00 41.64  ? 542  GLU D OE1 1 
ATOM   4964 O OE2 . GLU D 1 51  ? 0.154   7.586   53.610 1.00 41.22  ? 542  GLU D OE2 1 
ATOM   4965 N N   . GLU D 1 52  ? -2.408  3.309   57.546 1.00 51.09  ? 543  GLU D N   1 
ATOM   4966 C CA  . GLU D 1 52  ? -2.663  1.976   58.077 1.00 54.24  ? 543  GLU D CA  1 
ATOM   4967 C C   . GLU D 1 52  ? -1.505  1.086   58.526 1.00 54.14  ? 543  GLU D C   1 
ATOM   4968 O O   . GLU D 1 52  ? -1.152  1.054   59.705 1.00 53.74  ? 543  GLU D O   1 
ATOM   4969 C CB  . GLU D 1 52  ? -3.516  1.201   57.069 1.00 57.92  ? 543  GLU D CB  1 
ATOM   4970 C CG  . GLU D 1 52  ? -4.275  0.048   57.685 1.00 62.73  ? 543  GLU D CG  1 
ATOM   4971 C CD  . GLU D 1 52  ? -5.244  0.523   58.743 1.00 66.01  ? 543  GLU D CD  1 
ATOM   4972 O OE1 . GLU D 1 52  ? -6.233  1.200   58.379 1.00 67.76  ? 543  GLU D OE1 1 
ATOM   4973 O OE2 . GLU D 1 52  ? -5.011  0.230   59.936 1.00 66.69  ? 543  GLU D OE2 1 
ATOM   4974 N N   . VAL D 1 53  ? -0.935  0.345   57.584 1.00 53.95  ? 544  VAL D N   1 
ATOM   4975 C CA  . VAL D 1 53  ? 0.139   -0.584  57.900 1.00 54.52  ? 544  VAL D CA  1 
ATOM   4976 C C   . VAL D 1 53  ? 1.533   0.015   57.837 1.00 53.75  ? 544  VAL D C   1 
ATOM   4977 O O   . VAL D 1 53  ? 1.774   0.998   57.137 1.00 53.75  ? 544  VAL D O   1 
ATOM   4978 C CB  . VAL D 1 53  ? 0.097   -1.822  56.964 1.00 55.90  ? 544  VAL D CB  1 
ATOM   4979 C CG1 . VAL D 1 53  ? 1.115   -2.863  57.419 1.00 55.15  ? 544  VAL D CG1 1 
ATOM   4980 C CG2 . VAL D 1 53  ? -1.304  -2.418  56.956 1.00 56.32  ? 544  VAL D CG2 1 
ATOM   4981 N N   . TRP D 1 54  ? 2.443   -0.614  58.576 1.00 52.16  ? 545  TRP D N   1 
ATOM   4982 C CA  . TRP D 1 54  ? 3.833   -0.208  58.658 1.00 50.02  ? 545  TRP D CA  1 
ATOM   4983 C C   . TRP D 1 54  ? 4.692   -0.815  57.566 1.00 48.55  ? 545  TRP D C   1 
ATOM   4984 O O   . TRP D 1 54  ? 4.522   -1.976  57.219 1.00 47.75  ? 545  TRP D O   1 
ATOM   4985 C CB  . TRP D 1 54  ? 4.427   -0.655  59.984 1.00 51.32  ? 545  TRP D CB  1 
ATOM   4986 C CG  . TRP D 1 54  ? 3.859   -0.005  61.175 1.00 53.58  ? 545  TRP D CG  1 
ATOM   4987 C CD1 . TRP D 1 54  ? 2.639   -0.230  61.726 1.00 54.12  ? 545  TRP D CD1 1 
ATOM   4988 C CD2 . TRP D 1 54  ? 4.507   0.964   62.002 1.00 54.79  ? 545  TRP D CD2 1 
ATOM   4989 N NE1 . TRP D 1 54  ? 2.482   0.535   62.857 1.00 55.32  ? 545  TRP D NE1 1 
ATOM   4990 C CE2 . TRP D 1 54  ? 3.616   1.280   63.049 1.00 55.28  ? 545  TRP D CE2 1 
ATOM   4991 C CE3 . TRP D 1 54  ? 5.756   1.596   61.961 1.00 54.82  ? 545  TRP D CE3 1 
ATOM   4992 C CZ2 . TRP D 1 54  ? 3.933   2.202   64.050 1.00 55.38  ? 545  TRP D CZ2 1 
ATOM   4993 C CZ3 . TRP D 1 54  ? 6.072   2.513   62.955 1.00 55.59  ? 545  TRP D CZ3 1 
ATOM   4994 C CH2 . TRP D 1 54  ? 5.161   2.806   63.987 1.00 55.75  ? 545  TRP D CH2 1 
ATOM   4995 N N   . HIS D 1 55  ? 5.623   -0.028  57.037 1.00 47.44  ? 546  HIS D N   1 
ATOM   4996 C CA  . HIS D 1 55  ? 6.558   -0.521  56.035 1.00 46.60  ? 546  HIS D CA  1 
ATOM   4997 C C   . HIS D 1 55  ? 7.734   -1.071  56.836 1.00 45.90  ? 546  HIS D C   1 
ATOM   4998 O O   . HIS D 1 55  ? 7.766   -0.948  58.059 1.00 46.05  ? 546  HIS D O   1 
ATOM   4999 C CB  . HIS D 1 55  ? 7.058   0.614   55.140 1.00 47.27  ? 546  HIS D CB  1 
ATOM   5000 C CG  . HIS D 1 55  ? 6.018   1.154   54.210 1.00 49.87  ? 546  HIS D CG  1 
ATOM   5001 N ND1 . HIS D 1 55  ? 5.267   0.347   53.383 1.00 49.52  ? 546  HIS D ND1 1 
ATOM   5002 C CD2 . HIS D 1 55  ? 5.620   2.423   53.958 1.00 50.33  ? 546  HIS D CD2 1 
ATOM   5003 C CE1 . HIS D 1 55  ? 4.452   1.095   52.662 1.00 49.05  ? 546  HIS D CE1 1 
ATOM   5004 N NE2 . HIS D 1 55  ? 4.646   2.359   52.992 1.00 48.96  ? 546  HIS D NE2 1 
ATOM   5005 N N   . SER D 1 56  ? 8.700   -1.681  56.165 1.00 45.64  ? 547  SER D N   1 
ATOM   5006 C CA  . SER D 1 56  ? 9.863   -2.197  56.876 1.00 45.32  ? 547  SER D CA  1 
ATOM   5007 C C   . SER D 1 56  ? 10.926  -2.750  55.950 1.00 44.91  ? 547  SER D C   1 
ATOM   5008 O O   . SER D 1 56  ? 10.660  -3.081  54.796 1.00 44.39  ? 547  SER D O   1 
ATOM   5009 C CB  . SER D 1 56  ? 9.457   -3.280  57.878 1.00 44.91  ? 547  SER D CB  1 
ATOM   5010 O OG  . SER D 1 56  ? 9.036   -4.459  57.222 1.00 43.65  ? 547  SER D OG  1 
ATOM   5011 N N   . LYS D 1 57  ? 12.141  -2.832  56.469 1.00 44.35  ? 548  LYS D N   1 
ATOM   5012 C CA  . LYS D 1 57  ? 13.258  -3.359  55.712 1.00 44.44  ? 548  LYS D CA  1 
ATOM   5013 C C   . LYS D 1 57  ? 14.332  -3.827  56.669 1.00 45.13  ? 548  LYS D C   1 
ATOM   5014 O O   . LYS D 1 57  ? 14.482  -3.287  57.762 1.00 45.43  ? 548  LYS D O   1 
ATOM   5015 C CB  . LYS D 1 57  ? 13.835  -2.303  54.769 1.00 43.03  ? 548  LYS D CB  1 
ATOM   5016 C CG  . LYS D 1 57  ? 15.131  -2.752  54.136 1.00 44.17  ? 548  LYS D CG  1 
ATOM   5017 C CD  . LYS D 1 57  ? 15.572  -1.872  52.995 1.00 45.51  ? 548  LYS D CD  1 
ATOM   5018 C CE  . LYS D 1 57  ? 16.843  -2.444  52.377 1.00 48.22  ? 548  LYS D CE  1 
ATOM   5019 N NZ  . LYS D 1 57  ? 16.725  -3.915  52.117 1.00 46.50  ? 548  LYS D NZ  1 
ATOM   5020 N N   . TRP D 1 58  ? 15.079  -4.840  56.255 1.00 46.57  ? 549  TRP D N   1 
ATOM   5021 C CA  . TRP D 1 58  ? 16.141  -5.372  57.087 1.00 47.18  ? 549  TRP D CA  1 
ATOM   5022 C C   . TRP D 1 58  ? 17.484  -4.793  56.670 1.00 48.07  ? 549  TRP D C   1 
ATOM   5023 O O   . TRP D 1 58  ? 17.705  -4.501  55.495 1.00 47.52  ? 549  TRP D O   1 
ATOM   5024 C CB  . TRP D 1 58  ? 16.173  -6.899  56.988 1.00 47.40  ? 549  TRP D CB  1 
ATOM   5025 C CG  . TRP D 1 58  ? 14.918  -7.557  57.480 1.00 46.67  ? 549  TRP D CG  1 
ATOM   5026 C CD1 . TRP D 1 58  ? 13.749  -7.725  56.790 1.00 46.11  ? 549  TRP D CD1 1 
ATOM   5027 C CD2 . TRP D 1 58  ? 14.698  -8.106  58.784 1.00 46.65  ? 549  TRP D CD2 1 
ATOM   5028 N NE1 . TRP D 1 58  ? 12.817  -8.345  57.584 1.00 47.09  ? 549  TRP D NE1 1 
ATOM   5029 C CE2 . TRP D 1 58  ? 13.371  -8.591  58.814 1.00 47.52  ? 549  TRP D CE2 1 
ATOM   5030 C CE3 . TRP D 1 58  ? 15.492  -8.233  59.932 1.00 44.61  ? 549  TRP D CE3 1 
ATOM   5031 C CZ2 . TRP D 1 58  ? 12.821  -9.197  59.950 1.00 47.25  ? 549  TRP D CZ2 1 
ATOM   5032 C CZ3 . TRP D 1 58  ? 14.946  -8.832  61.056 1.00 44.90  ? 549  TRP D CZ3 1 
ATOM   5033 C CH2 . TRP D 1 58  ? 13.622  -9.307  61.058 1.00 45.74  ? 549  TRP D CH2 1 
ATOM   5034 N N   . TYR D 1 59  ? 18.371  -4.622  57.645 1.00 50.03  ? 550  TYR D N   1 
ATOM   5035 C CA  . TYR D 1 59  ? 19.704  -4.078  57.401 1.00 51.54  ? 550  TYR D CA  1 
ATOM   5036 C C   . TYR D 1 59  ? 20.750  -4.977  58.049 1.00 54.71  ? 550  TYR D C   1 
ATOM   5037 O O   . TYR D 1 59  ? 20.537  -5.501  59.141 1.00 53.77  ? 550  TYR D O   1 
ATOM   5038 C CB  . TYR D 1 59  ? 19.814  -2.672  57.994 1.00 48.80  ? 550  TYR D CB  1 
ATOM   5039 C CG  . TYR D 1 59  ? 18.909  -1.656  57.341 1.00 45.05  ? 550  TYR D CG  1 
ATOM   5040 C CD1 . TYR D 1 59  ? 19.340  -0.921  56.246 1.00 43.05  ? 550  TYR D CD1 1 
ATOM   5041 C CD2 . TYR D 1 59  ? 17.614  -1.449  57.807 1.00 43.36  ? 550  TYR D CD2 1 
ATOM   5042 C CE1 . TYR D 1 59  ? 18.512  -0.005  55.633 1.00 43.17  ? 550  TYR D CE1 1 
ATOM   5043 C CE2 . TYR D 1 59  ? 16.774  -0.538  57.200 1.00 42.71  ? 550  TYR D CE2 1 
ATOM   5044 C CZ  . TYR D 1 59  ? 17.227  0.185   56.111 1.00 43.34  ? 550  TYR D CZ  1 
ATOM   5045 O OH  . TYR D 1 59  ? 16.400  1.109   55.497 1.00 42.97  ? 550  TYR D OH  1 
ATOM   5046 N N   . ASP D 1 60  ? 21.880  -5.153  57.372 1.00 58.38  ? 551  ASP D N   1 
ATOM   5047 C CA  . ASP D 1 60  ? 22.951  -5.982  57.905 1.00 61.54  ? 551  ASP D CA  1 
ATOM   5048 C C   . ASP D 1 60  ? 23.558  -5.341  59.157 1.00 62.06  ? 551  ASP D C   1 
ATOM   5049 O O   . ASP D 1 60  ? 24.196  -4.291  59.089 1.00 62.48  ? 551  ASP D O   1 
ATOM   5050 C CB  . ASP D 1 60  ? 24.021  -6.206  56.828 1.00 63.57  ? 551  ASP D CB  1 
ATOM   5051 C CG  . ASP D 1 60  ? 25.337  -6.708  57.403 1.00 66.22  ? 551  ASP D CG  1 
ATOM   5052 O OD1 . ASP D 1 60  ? 25.316  -7.562  58.326 1.00 65.55  ? 551  ASP D OD1 1 
ATOM   5053 O OD2 . ASP D 1 60  ? 26.394  -6.245  56.918 1.00 67.56  ? 551  ASP D OD2 1 
ATOM   5054 N N   . ALA D 1 61  ? 23.346  -5.984  60.300 1.00 62.75  ? 552  ALA D N   1 
ATOM   5055 C CA  . ALA D 1 61  ? 23.851  -5.487  61.572 1.00 63.82  ? 552  ALA D CA  1 
ATOM   5056 C C   . ALA D 1 61  ? 25.306  -5.067  61.480 1.00 64.88  ? 552  ALA D C   1 
ATOM   5057 O O   . ALA D 1 61  ? 25.697  -4.036  62.021 1.00 65.46  ? 552  ALA D O   1 
ATOM   5058 C CB  . ALA D 1 61  ? 23.688  -6.552  62.645 1.00 63.59  ? 552  ALA D CB  1 
ATOM   5059 N N   . LYS D 1 62  ? 26.107  -5.873  60.795 1.00 66.33  ? 553  LYS D N   1 
ATOM   5060 C CA  . LYS D 1 62  ? 27.525  -5.584  60.645 1.00 67.52  ? 553  LYS D CA  1 
ATOM   5061 C C   . LYS D 1 62  ? 27.739  -4.235  59.972 1.00 67.28  ? 553  LYS D C   1 
ATOM   5062 O O   . LYS D 1 62  ? 28.330  -3.329  60.555 1.00 67.56  ? 553  LYS D O   1 
ATOM   5063 C CB  . LYS D 1 62  ? 28.197  -6.690  59.825 1.00 69.40  ? 553  LYS D CB  1 
ATOM   5064 C CG  . LYS D 1 62  ? 29.687  -6.471  59.559 1.00 70.86  ? 553  LYS D CG  1 
ATOM   5065 C CD  . LYS D 1 62  ? 30.560  -7.578  60.163 1.00 71.88  ? 553  LYS D CD  1 
ATOM   5066 C CE  . LYS D 1 62  ? 30.642  -7.506  61.694 1.00 72.22  ? 553  LYS D CE  1 
ATOM   5067 N NZ  . LYS D 1 62  ? 29.333  -7.747  62.382 1.00 72.41  ? 553  LYS D NZ  1 
ATOM   5068 N N   . GLU D 1 63  ? 27.247  -4.109  58.746 1.00 67.40  ? 554  GLU D N   1 
ATOM   5069 C CA  . GLU D 1 63  ? 27.389  -2.879  57.974 1.00 68.32  ? 554  GLU D CA  1 
ATOM   5070 C C   . GLU D 1 63  ? 26.847  -1.658  58.710 1.00 67.48  ? 554  GLU D C   1 
ATOM   5071 O O   . GLU D 1 63  ? 27.462  -0.592  58.694 1.00 67.52  ? 554  GLU D O   1 
ATOM   5072 C CB  . GLU D 1 63  ? 26.663  -3.019  56.638 1.00 70.03  ? 554  GLU D CB  1 
ATOM   5073 C CG  . GLU D 1 63  ? 26.962  -1.908  55.641 1.00 73.04  ? 554  GLU D CG  1 
ATOM   5074 C CD  . GLU D 1 63  ? 26.024  -1.950  54.444 1.00 75.46  ? 554  GLU D CD  1 
ATOM   5075 O OE1 . GLU D 1 63  ? 24.845  -1.564  54.604 1.00 74.82  ? 554  GLU D OE1 1 
ATOM   5076 O OE2 . GLU D 1 63  ? 26.459  -2.382  53.350 1.00 76.72  ? 554  GLU D OE2 1 
ATOM   5077 N N   . ALA D 1 64  ? 25.690  -1.819  59.344 1.00 66.61  ? 555  ALA D N   1 
ATOM   5078 C CA  . ALA D 1 64  ? 25.053  -0.731  60.082 1.00 66.25  ? 555  ALA D CA  1 
ATOM   5079 C C   . ALA D 1 64  ? 25.860  -0.329  61.315 1.00 66.33  ? 555  ALA D C   1 
ATOM   5080 O O   . ALA D 1 64  ? 26.076  0.856   61.573 1.00 65.17  ? 555  ALA D O   1 
ATOM   5081 C CB  . ALA D 1 64  ? 23.649  -1.143  60.491 1.00 66.14  ? 555  ALA D CB  1 
ATOM   5082 N N   . SER D 1 65  ? 26.298  -1.327  62.075 1.00 66.42  ? 556  SER D N   1 
ATOM   5083 C CA  . SER D 1 65  ? 27.084  -1.087  63.274 1.00 67.09  ? 556  SER D CA  1 
ATOM   5084 C C   . SER D 1 65  ? 28.303  -0.225  62.985 1.00 67.04  ? 556  SER D C   1 
ATOM   5085 O O   . SER D 1 65  ? 28.673  0.625   63.791 1.00 67.02  ? 556  SER D O   1 
ATOM   5086 C CB  . SER D 1 65  ? 27.522  -2.416  63.879 1.00 68.59  ? 556  SER D CB  1 
ATOM   5087 O OG  . SER D 1 65  ? 26.395  -3.188  64.260 1.00 70.50  ? 556  SER D OG  1 
ATOM   5088 N N   . MET D 1 66  ? 28.936  -0.442  61.836 1.00 67.24  ? 557  MET D N   1 
ATOM   5089 C CA  . MET D 1 66  ? 30.102  0.352   61.482 1.00 67.33  ? 557  MET D CA  1 
ATOM   5090 C C   . MET D 1 66  ? 29.698  1.817   61.433 1.00 67.00  ? 557  MET D C   1 
ATOM   5091 O O   . MET D 1 66  ? 30.131  2.612   62.263 1.00 68.07  ? 557  MET D O   1 
ATOM   5092 C CB  . MET D 1 66  ? 30.662  -0.068  60.123 1.00 68.48  ? 557  MET D CB  1 
ATOM   5093 C CG  . MET D 1 66  ? 31.111  -1.514  60.046 1.00 70.96  ? 557  MET D CG  1 
ATOM   5094 S SD  . MET D 1 66  ? 31.809  -1.949  58.426 1.00 75.03  ? 557  MET D SD  1 
ATOM   5095 C CE  . MET D 1 66  ? 33.471  -2.522  58.887 1.00 73.77  ? 557  MET D CE  1 
ATOM   5096 N N   . GLU D 1 67  ? 28.847  2.162   60.471 1.00 65.85  ? 558  GLU D N   1 
ATOM   5097 C CA  . GLU D 1 67  ? 28.390  3.540   60.300 1.00 64.46  ? 558  GLU D CA  1 
ATOM   5098 C C   . GLU D 1 67  ? 27.524  4.084   61.441 1.00 62.30  ? 558  GLU D C   1 
ATOM   5099 O O   . GLU D 1 67  ? 27.458  5.293   61.651 1.00 62.40  ? 558  GLU D O   1 
ATOM   5100 C CB  . GLU D 1 67  ? 27.618  3.671   58.985 1.00 64.97  ? 558  GLU D CB  1 
ATOM   5101 C CG  . GLU D 1 67  ? 28.396  3.239   57.756 1.00 66.99  ? 558  GLU D CG  1 
ATOM   5102 C CD  . GLU D 1 67  ? 27.589  3.408   56.486 1.00 68.21  ? 558  GLU D CD  1 
ATOM   5103 O OE1 . GLU D 1 67  ? 26.450  2.892   56.438 1.00 68.83  ? 558  GLU D OE1 1 
ATOM   5104 O OE2 . GLU D 1 67  ? 28.088  4.053   55.538 1.00 67.97  ? 558  GLU D OE2 1 
ATOM   5105 N N   . GLY D 1 68  ? 26.853  3.201   62.171 1.00 59.77  ? 559  GLY D N   1 
ATOM   5106 C CA  . GLY D 1 68  ? 26.002  3.658   63.256 1.00 56.42  ? 559  GLY D CA  1 
ATOM   5107 C C   . GLY D 1 68  ? 24.668  4.234   62.793 1.00 53.98  ? 559  GLY D C   1 
ATOM   5108 O O   . GLY D 1 68  ? 23.930  4.819   63.590 1.00 54.00  ? 559  GLY D O   1 
ATOM   5109 N N   . ILE D 1 69  ? 24.357  4.078   61.506 1.00 50.10  ? 560  ILE D N   1 
ATOM   5110 C CA  . ILE D 1 69  ? 23.099  4.574   60.955 1.00 45.81  ? 560  ILE D CA  1 
ATOM   5111 C C   . ILE D 1 69  ? 22.515  3.632   59.901 1.00 44.89  ? 560  ILE D C   1 
ATOM   5112 O O   . ILE D 1 69  ? 23.241  2.853   59.280 1.00 45.88  ? 560  ILE D O   1 
ATOM   5113 C CB  . ILE D 1 69  ? 23.270  5.939   60.265 1.00 43.45  ? 560  ILE D CB  1 
ATOM   5114 C CG1 . ILE D 1 69  ? 23.993  5.749   58.934 1.00 42.28  ? 560  ILE D CG1 1 
ATOM   5115 C CG2 . ILE D 1 69  ? 24.044  6.886   61.148 1.00 42.38  ? 560  ILE D CG2 1 
ATOM   5116 C CD1 . ILE D 1 69  ? 23.978  6.973   58.041 1.00 42.28  ? 560  ILE D CD1 1 
ATOM   5117 N N   . VAL D 1 70  ? 21.196  3.707   59.722 1.00 41.54  ? 561  VAL D N   1 
ATOM   5118 C CA  . VAL D 1 70  ? 20.480  2.941   58.702 1.00 38.00  ? 561  VAL D CA  1 
ATOM   5119 C C   . VAL D 1 70  ? 19.733  4.031   57.950 1.00 37.15  ? 561  VAL D C   1 
ATOM   5120 O O   . VAL D 1 70  ? 19.378  5.046   58.542 1.00 37.87  ? 561  VAL D O   1 
ATOM   5121 C CB  . VAL D 1 70  ? 19.442  1.959   59.291 1.00 38.22  ? 561  VAL D CB  1 
ATOM   5122 C CG1 . VAL D 1 70  ? 20.143  0.793   59.960 1.00 36.17  ? 561  VAL D CG1 1 
ATOM   5123 C CG2 . VAL D 1 70  ? 18.526  2.690   60.267 1.00 36.64  ? 561  VAL D CG2 1 
ATOM   5124 N N   . THR D 1 71  ? 19.499  3.850   56.659 1.00 34.97  ? 562  THR D N   1 
ATOM   5125 C CA  . THR D 1 71  ? 18.797  4.881   55.905 1.00 34.92  ? 562  THR D CA  1 
ATOM   5126 C C   . THR D 1 71  ? 17.537  4.331   55.266 1.00 34.96  ? 562  THR D C   1 
ATOM   5127 O O   . THR D 1 71  ? 17.627  3.460   54.404 1.00 36.58  ? 562  THR D O   1 
ATOM   5128 C CB  . THR D 1 71  ? 19.685  5.463   54.770 1.00 36.44  ? 562  THR D CB  1 
ATOM   5129 O OG1 . THR D 1 71  ? 20.887  6.025   55.323 1.00 36.19  ? 562  THR D OG1 1 
ATOM   5130 C CG2 . THR D 1 71  ? 18.921  6.532   53.992 1.00 34.31  ? 562  THR D CG2 1 
ATOM   5131 N N   . ILE D 1 72  ? 16.369  4.827   55.678 1.00 34.35  ? 563  ILE D N   1 
ATOM   5132 C CA  . ILE D 1 72  ? 15.115  4.365   55.082 1.00 34.33  ? 563  ILE D CA  1 
ATOM   5133 C C   . ILE D 1 72  ? 14.869  5.181   53.819 1.00 34.64  ? 563  ILE D C   1 
ATOM   5134 O O   . ILE D 1 72  ? 15.145  6.384   53.784 1.00 36.45  ? 563  ILE D O   1 
ATOM   5135 C CB  . ILE D 1 72  ? 13.912  4.504   56.048 1.00 34.14  ? 563  ILE D CB  1 
ATOM   5136 C CG1 . ILE D 1 72  ? 13.957  5.848   56.752 1.00 36.17  ? 563  ILE D CG1 1 
ATOM   5137 C CG2 . ILE D 1 72  ? 13.935  3.397   57.092 1.00 31.32  ? 563  ILE D CG2 1 
ATOM   5138 C CD1 . ILE D 1 72  ? 12.764  6.074   57.648 1.00 38.52  ? 563  ILE D CD1 1 
ATOM   5139 N N   . VAL D 1 73  ? 14.361  4.521   52.778 1.00 34.68  ? 564  VAL D N   1 
ATOM   5140 C CA  . VAL D 1 73  ? 14.113  5.170   51.484 1.00 32.82  ? 564  VAL D CA  1 
ATOM   5141 C C   . VAL D 1 73  ? 12.688  5.047   50.972 1.00 30.69  ? 564  VAL D C   1 
ATOM   5142 O O   . VAL D 1 73  ? 11.855  4.385   51.571 1.00 29.57  ? 564  VAL D O   1 
ATOM   5143 C CB  . VAL D 1 73  ? 15.055  4.600   50.391 1.00 33.06  ? 564  VAL D CB  1 
ATOM   5144 C CG1 . VAL D 1 73  ? 16.495  4.580   50.912 1.00 32.75  ? 564  VAL D CG1 1 
ATOM   5145 C CG2 . VAL D 1 73  ? 14.616  3.196   49.987 1.00 30.22  ? 564  VAL D CG2 1 
ATOM   5146 N N   . GLY D 1 74  ? 12.429  5.696   49.843 1.00 31.65  ? 565  GLY D N   1 
ATOM   5147 C CA  . GLY D 1 74  ? 11.112  5.661   49.236 1.00 30.01  ? 565  GLY D CA  1 
ATOM   5148 C C   . GLY D 1 74  ? 10.089  6.472   49.988 1.00 30.44  ? 565  GLY D C   1 
ATOM   5149 O O   . GLY D 1 74  ? 8.898   6.167   49.950 1.00 33.61  ? 565  GLY D O   1 
ATOM   5150 N N   . LEU D 1 75  ? 10.537  7.514   50.671 1.00 29.53  ? 566  LEU D N   1 
ATOM   5151 C CA  . LEU D 1 75  ? 9.620   8.342   51.442 1.00 29.38  ? 566  LEU D CA  1 
ATOM   5152 C C   . LEU D 1 75  ? 9.029   9.462   50.586 1.00 28.95  ? 566  LEU D C   1 
ATOM   5153 O O   . LEU D 1 75  ? 9.578   9.807   49.539 1.00 26.74  ? 566  LEU D O   1 
ATOM   5154 C CB  . LEU D 1 75  ? 10.356  8.947   52.645 1.00 28.37  ? 566  LEU D CB  1 
ATOM   5155 C CG  . LEU D 1 75  ? 11.127  7.999   53.562 1.00 28.76  ? 566  LEU D CG  1 
ATOM   5156 C CD1 . LEU D 1 75  ? 11.771  8.792   54.700 1.00 28.09  ? 566  LEU D CD1 1 
ATOM   5157 C CD2 . LEU D 1 75  ? 10.186  6.944   54.111 1.00 27.95  ? 566  LEU D CD2 1 
ATOM   5158 N N   . LYS D 1 76  ? 7.901   10.014  51.029 1.00 29.23  ? 567  LYS D N   1 
ATOM   5159 C CA  . LYS D 1 76  ? 7.274   11.125  50.318 1.00 32.01  ? 567  LYS D CA  1 
ATOM   5160 C C   . LYS D 1 76  ? 7.761   12.432  50.950 1.00 31.56  ? 567  LYS D C   1 
ATOM   5161 O O   . LYS D 1 76  ? 7.930   12.514  52.169 1.00 31.11  ? 567  LYS D O   1 
ATOM   5162 C CB  . LYS D 1 76  ? 5.741   11.091  50.444 1.00 34.33  ? 567  LYS D CB  1 
ATOM   5163 C CG  . LYS D 1 76  ? 5.041   9.868   49.906 1.00 37.58  ? 567  LYS D CG  1 
ATOM   5164 C CD  . LYS D 1 76  ? 3.518   10.018  50.037 1.00 40.93  ? 567  LYS D CD  1 
ATOM   5165 C CE  . LYS D 1 76  ? 2.810   8.667   49.899 1.00 43.99  ? 567  LYS D CE  1 
ATOM   5166 N NZ  . LYS D 1 76  ? 3.132   7.964   48.608 1.00 45.96  ? 567  LYS D NZ  1 
ATOM   5167 N N   . PRO D 1 77  ? 7.994   13.468  50.134 1.00 31.56  ? 568  PRO D N   1 
ATOM   5168 C CA  . PRO D 1 77  ? 8.450   14.753  50.676 1.00 31.71  ? 568  PRO D CA  1 
ATOM   5169 C C   . PRO D 1 77  ? 7.330   15.414  51.476 1.00 32.72  ? 568  PRO D C   1 
ATOM   5170 O O   . PRO D 1 77  ? 6.153   15.097  51.285 1.00 32.17  ? 568  PRO D O   1 
ATOM   5171 C CB  . PRO D 1 77  ? 8.792   15.550  49.426 1.00 29.95  ? 568  PRO D CB  1 
ATOM   5172 C CG  . PRO D 1 77  ? 9.199   14.497  48.461 1.00 31.18  ? 568  PRO D CG  1 
ATOM   5173 C CD  . PRO D 1 77  ? 8.157   13.440  48.672 1.00 31.27  ? 568  PRO D CD  1 
ATOM   5174 N N   . GLU D 1 78  ? 7.705   16.325  52.370 1.00 33.69  ? 569  GLU D N   1 
ATOM   5175 C CA  . GLU D 1 78  ? 6.753   17.053  53.205 1.00 33.99  ? 569  GLU D CA  1 
ATOM   5176 C C   . GLU D 1 78  ? 5.699   16.186  53.886 1.00 31.92  ? 569  GLU D C   1 
ATOM   5177 O O   . GLU D 1 78  ? 4.559   16.603  54.054 1.00 30.63  ? 569  GLU D O   1 
ATOM   5178 C CB  . GLU D 1 78  ? 6.042   18.121  52.378 1.00 38.03  ? 569  GLU D CB  1 
ATOM   5179 C CG  . GLU D 1 78  ? 6.948   19.203  51.870 1.00 42.71  ? 569  GLU D CG  1 
ATOM   5180 C CD  . GLU D 1 78  ? 6.213   20.511  51.685 1.00 46.48  ? 569  GLU D CD  1 
ATOM   5181 O OE1 . GLU D 1 78  ? 5.202   20.518  50.947 1.00 47.61  ? 569  GLU D OE1 1 
ATOM   5182 O OE2 . GLU D 1 78  ? 6.647   21.527  52.282 1.00 46.84  ? 569  GLU D OE2 1 
ATOM   5183 N N   . THR D 1 79  ? 6.088   14.989  54.288 1.00 30.32  ? 570  THR D N   1 
ATOM   5184 C CA  . THR D 1 79  ? 5.168   14.076  54.934 1.00 28.93  ? 570  THR D CA  1 
ATOM   5185 C C   . THR D 1 79  ? 5.709   13.690  56.317 1.00 30.07  ? 570  THR D C   1 
ATOM   5186 O O   . THR D 1 79  ? 6.922   13.552  56.507 1.00 30.16  ? 570  THR D O   1 
ATOM   5187 C CB  . THR D 1 79  ? 4.972   12.812  54.056 1.00 28.23  ? 570  THR D CB  1 
ATOM   5188 O OG1 . THR D 1 79  ? 4.562   13.207  52.740 1.00 26.04  ? 570  THR D OG1 1 
ATOM   5189 C CG2 . THR D 1 79  ? 3.913   11.894  54.646 1.00 25.47  ? 570  THR D CG2 1 
ATOM   5190 N N   . THR D 1 80  ? 4.802   13.544  57.284 1.00 29.25  ? 571  THR D N   1 
ATOM   5191 C CA  . THR D 1 80  ? 5.171   13.168  58.641 1.00 26.41  ? 571  THR D CA  1 
ATOM   5192 C C   . THR D 1 80  ? 5.238   11.655  58.714 1.00 26.51  ? 571  THR D C   1 
ATOM   5193 O O   . THR D 1 80  ? 4.394   10.959  58.159 1.00 25.73  ? 571  THR D O   1 
ATOM   5194 C CB  . THR D 1 80  ? 4.144   13.678  59.658 1.00 25.64  ? 571  THR D CB  1 
ATOM   5195 O OG1 . THR D 1 80  ? 4.035   15.097  59.552 1.00 29.01  ? 571  THR D OG1 1 
ATOM   5196 C CG2 . THR D 1 80  ? 4.582   13.353  61.062 1.00 26.17  ? 571  THR D CG2 1 
ATOM   5197 N N   . TYR D 1 81  ? 6.253   11.150  59.405 1.00 27.44  ? 572  TYR D N   1 
ATOM   5198 C CA  . TYR D 1 81  ? 6.456   9.715   59.545 1.00 27.31  ? 572  TYR D CA  1 
ATOM   5199 C C   . TYR D 1 81  ? 6.758   9.301   60.976 1.00 28.36  ? 572  TYR D C   1 
ATOM   5200 O O   . TYR D 1 81  ? 7.071   10.125  61.841 1.00 29.76  ? 572  TYR D O   1 
ATOM   5201 C CB  . TYR D 1 81  ? 7.623   9.256   58.656 1.00 26.35  ? 572  TYR D CB  1 
ATOM   5202 C CG  . TYR D 1 81  ? 7.297   9.159   57.187 1.00 26.17  ? 572  TYR D CG  1 
ATOM   5203 C CD1 . TYR D 1 81  ? 6.817   7.971   56.634 1.00 25.16  ? 572  TYR D CD1 1 
ATOM   5204 C CD2 . TYR D 1 81  ? 7.432   10.263  56.353 1.00 24.75  ? 572  TYR D CD2 1 
ATOM   5205 C CE1 . TYR D 1 81  ? 6.480   7.891   55.292 1.00 23.37  ? 572  TYR D CE1 1 
ATOM   5206 C CE2 . TYR D 1 81  ? 7.098   10.191  55.011 1.00 25.22  ? 572  TYR D CE2 1 
ATOM   5207 C CZ  . TYR D 1 81  ? 6.623   9.004   54.486 1.00 24.49  ? 572  TYR D CZ  1 
ATOM   5208 O OH  . TYR D 1 81  ? 6.300   8.940   53.151 1.00 27.24  ? 572  TYR D OH  1 
ATOM   5209 N N   . ALA D 1 82  ? 6.661   7.999   61.202 1.00 28.28  ? 573  ALA D N   1 
ATOM   5210 C CA  . ALA D 1 82  ? 6.958   7.402   62.484 1.00 29.45  ? 573  ALA D CA  1 
ATOM   5211 C C   . ALA D 1 82  ? 7.889   6.254   62.120 1.00 31.04  ? 573  ALA D C   1 
ATOM   5212 O O   . ALA D 1 82  ? 7.630   5.520   61.172 1.00 30.87  ? 573  ALA D O   1 
ATOM   5213 C CB  . ALA D 1 82  ? 5.697   6.875   63.131 1.00 27.67  ? 573  ALA D CB  1 
ATOM   5214 N N   . VAL D 1 83  ? 8.988   6.128   62.852 1.00 32.61  ? 574  VAL D N   1 
ATOM   5215 C CA  . VAL D 1 83  ? 9.951   5.067   62.611 1.00 32.67  ? 574  VAL D CA  1 
ATOM   5216 C C   . VAL D 1 83  ? 10.368  4.470   63.949 1.00 33.18  ? 574  VAL D C   1 
ATOM   5217 O O   . VAL D 1 83  ? 10.439  5.161   64.957 1.00 33.06  ? 574  VAL D O   1 
ATOM   5218 C CB  . VAL D 1 83  ? 11.198  5.603   61.846 1.00 31.67  ? 574  VAL D CB  1 
ATOM   5219 C CG1 . VAL D 1 83  ? 11.924  6.634   62.676 1.00 29.32  ? 574  VAL D CG1 1 
ATOM   5220 C CG2 . VAL D 1 83  ? 12.119  4.460   61.492 1.00 31.19  ? 574  VAL D CG2 1 
ATOM   5221 N N   . ARG D 1 84  ? 10.604  3.170   63.959 1.00 36.22  ? 575  ARG D N   1 
ATOM   5222 C CA  . ARG D 1 84  ? 11.025  2.486   65.170 1.00 39.59  ? 575  ARG D CA  1 
ATOM   5223 C C   . ARG D 1 84  ? 11.962  1.361   64.769 1.00 39.89  ? 575  ARG D C   1 
ATOM   5224 O O   . ARG D 1 84  ? 11.868  0.845   63.662 1.00 39.17  ? 575  ARG D O   1 
ATOM   5225 C CB  . ARG D 1 84  ? 9.809   1.962   65.943 1.00 40.80  ? 575  ARG D CB  1 
ATOM   5226 C CG  . ARG D 1 84  ? 8.817   1.153   65.134 1.00 44.86  ? 575  ARG D CG  1 
ATOM   5227 C CD  . ARG D 1 84  ? 7.556   0.909   65.959 1.00 48.86  ? 575  ARG D CD  1 
ATOM   5228 N NE  . ARG D 1 84  ? 6.571   0.079   65.269 1.00 52.52  ? 575  ARG D NE  1 
ATOM   5229 C CZ  . ARG D 1 84  ? 5.368   -0.207  65.758 1.00 54.25  ? 575  ARG D CZ  1 
ATOM   5230 N NH1 . ARG D 1 84  ? 5.003   0.276   66.939 1.00 55.52  ? 575  ARG D NH1 1 
ATOM   5231 N NH2 . ARG D 1 84  ? 4.532   -0.980  65.075 1.00 53.87  ? 575  ARG D NH2 1 
ATOM   5232 N N   . LEU D 1 85  ? 12.881  0.997   65.653 1.00 42.30  ? 576  LEU D N   1 
ATOM   5233 C CA  . LEU D 1 85  ? 13.847  -0.049  65.337 1.00 45.77  ? 576  LEU D CA  1 
ATOM   5234 C C   . LEU D 1 85  ? 13.798  -1.274  66.233 1.00 47.78  ? 576  LEU D C   1 
ATOM   5235 O O   . LEU D 1 85  ? 13.420  -1.197  67.404 1.00 47.40  ? 576  LEU D O   1 
ATOM   5236 C CB  . LEU D 1 85  ? 15.263  0.524   65.364 1.00 45.74  ? 576  LEU D CB  1 
ATOM   5237 C CG  . LEU D 1 85  ? 15.561  1.643   64.372 1.00 46.52  ? 576  LEU D CG  1 
ATOM   5238 C CD1 . LEU D 1 85  ? 17.023  2.023   64.484 1.00 47.64  ? 576  LEU D CD1 1 
ATOM   5239 C CD2 . LEU D 1 85  ? 15.237  1.189   62.960 1.00 45.84  ? 576  LEU D CD2 1 
ATOM   5240 N N   . ALA D 1 86  ? 14.202  -2.406  65.663 1.00 50.00  ? 577  ALA D N   1 
ATOM   5241 C CA  . ALA D 1 86  ? 14.225  -3.673  66.379 1.00 53.02  ? 577  ALA D CA  1 
ATOM   5242 C C   . ALA D 1 86  ? 15.450  -4.482  65.975 1.00 54.61  ? 577  ALA D C   1 
ATOM   5243 O O   . ALA D 1 86  ? 15.758  -4.604  64.790 1.00 54.03  ? 577  ALA D O   1 
ATOM   5244 C CB  . ALA D 1 86  ? 12.959  -4.456  66.089 1.00 52.34  ? 577  ALA D CB  1 
ATOM   5245 N N   . ALA D 1 87  ? 16.143  -5.028  66.971 1.00 58.27  ? 578  ALA D N   1 
ATOM   5246 C CA  . ALA D 1 87  ? 17.343  -5.834  66.745 1.00 61.02  ? 578  ALA D CA  1 
ATOM   5247 C C   . ALA D 1 87  ? 17.008  -7.325  66.713 1.00 62.87  ? 578  ALA D C   1 
ATOM   5248 O O   . ALA D 1 87  ? 15.990  -7.759  67.257 1.00 62.03  ? 578  ALA D O   1 
ATOM   5249 C CB  . ALA D 1 87  ? 18.374  -5.553  67.838 1.00 60.08  ? 578  ALA D CB  1 
ATOM   5250 N N   . LEU D 1 88  ? 17.872  -8.111  66.080 1.00 66.32  ? 579  LEU D N   1 
ATOM   5251 C CA  . LEU D 1 88  ? 17.631  -9.544  65.985 1.00 69.54  ? 579  LEU D CA  1 
ATOM   5252 C C   . LEU D 1 88  ? 18.882  -10.423 65.962 1.00 71.72  ? 579  LEU D C   1 
ATOM   5253 O O   . LEU D 1 88  ? 19.786  -10.225 65.148 1.00 72.04  ? 579  LEU D O   1 
ATOM   5254 C CB  . LEU D 1 88  ? 16.768  -9.830  64.751 1.00 69.11  ? 579  LEU D CB  1 
ATOM   5255 C CG  . LEU D 1 88  ? 16.683  -11.265 64.231 1.00 69.68  ? 579  LEU D CG  1 
ATOM   5256 C CD1 . LEU D 1 88  ? 15.263  -11.559 63.769 1.00 69.39  ? 579  LEU D CD1 1 
ATOM   5257 C CD2 . LEU D 1 88  ? 17.690  -11.461 63.097 1.00 69.52  ? 579  LEU D CD2 1 
ATOM   5258 N N   . ASN D 1 89  ? 18.924  -11.386 66.882 1.00 74.07  ? 580  ASN D N   1 
ATOM   5259 C CA  . ASN D 1 89  ? 20.026  -12.342 66.978 1.00 74.89  ? 580  ASN D CA  1 
ATOM   5260 C C   . ASN D 1 89  ? 19.446  -13.737 66.770 1.00 76.09  ? 580  ASN D C   1 
ATOM   5261 O O   . ASN D 1 89  ? 18.226  -13.916 66.795 1.00 76.12  ? 580  ASN D O   1 
ATOM   5262 C CB  . ASN D 1 89  ? 20.698  -12.276 68.349 1.00 74.07  ? 580  ASN D CB  1 
ATOM   5263 C CG  . ASN D 1 89  ? 19.716  -12.425 69.488 1.00 74.12  ? 580  ASN D CG  1 
ATOM   5264 O OD1 . ASN D 1 89  ? 18.741  -13.170 69.391 1.00 74.25  ? 580  ASN D OD1 1 
ATOM   5265 N ND2 . ASN D 1 89  ? 19.977  -11.727 70.586 1.00 74.21  ? 580  ASN D ND2 1 
ATOM   5266 N N   . GLY D 1 90  ? 20.321  -14.720 66.576 1.00 76.98  ? 581  GLY D N   1 
ATOM   5267 C CA  . GLY D 1 90  ? 19.881  -16.089 66.352 1.00 75.84  ? 581  GLY D CA  1 
ATOM   5268 C C   . GLY D 1 90  ? 18.645  -16.554 67.107 1.00 75.26  ? 581  GLY D C   1 
ATOM   5269 O O   . GLY D 1 90  ? 17.878  -17.374 66.598 1.00 74.76  ? 581  GLY D O   1 
ATOM   5270 N N   . LYS D 1 91  ? 18.436  -16.030 68.312 1.00 74.59  ? 582  LYS D N   1 
ATOM   5271 C CA  . LYS D 1 91  ? 17.293  -16.435 69.123 1.00 74.10  ? 582  LYS D CA  1 
ATOM   5272 C C   . LYS D 1 91  ? 15.941  -15.899 68.647 1.00 73.70  ? 582  LYS D C   1 
ATOM   5273 O O   . LYS D 1 91  ? 14.896  -16.376 69.085 1.00 73.65  ? 582  LYS D O   1 
ATOM   5274 C CB  . LYS D 1 91  ? 17.523  -16.033 70.585 1.00 74.45  ? 582  LYS D CB  1 
ATOM   5275 C CG  . LYS D 1 91  ? 18.890  -16.448 71.147 1.00 74.63  ? 582  LYS D CG  1 
ATOM   5276 C CD  . LYS D 1 91  ? 19.254  -17.903 70.816 1.00 74.69  ? 582  LYS D CD  1 
ATOM   5277 C CE  . LYS D 1 91  ? 18.258  -18.904 71.393 1.00 73.99  ? 582  LYS D CE  1 
ATOM   5278 N NZ  . LYS D 1 91  ? 18.568  -20.297 70.966 1.00 71.97  ? 582  LYS D NZ  1 
ATOM   5279 N N   . GLY D 1 92  ? 15.959  -14.916 67.752 1.00 73.49  ? 583  GLY D N   1 
ATOM   5280 C CA  . GLY D 1 92  ? 14.713  -14.352 67.252 1.00 72.57  ? 583  GLY D CA  1 
ATOM   5281 C C   . GLY D 1 92  ? 14.758  -12.849 67.005 1.00 71.59  ? 583  GLY D C   1 
ATOM   5282 O O   . GLY D 1 92  ? 15.784  -12.312 66.590 1.00 71.68  ? 583  GLY D O   1 
ATOM   5283 N N   . LEU D 1 93  ? 13.645  -12.167 67.266 1.00 69.61  ? 584  LEU D N   1 
ATOM   5284 C CA  . LEU D 1 93  ? 13.563  -10.724 67.057 1.00 67.60  ? 584  LEU D CA  1 
ATOM   5285 C C   . LEU D 1 93  ? 13.345  -9.990  68.373 1.00 66.82  ? 584  LEU D C   1 
ATOM   5286 O O   . LEU D 1 93  ? 12.450  -10.341 69.142 1.00 67.39  ? 584  LEU D O   1 
ATOM   5287 C CB  . LEU D 1 93  ? 12.415  -10.403 66.096 1.00 67.27  ? 584  LEU D CB  1 
ATOM   5288 C CG  . LEU D 1 93  ? 12.228  -8.955  65.639 1.00 66.64  ? 584  LEU D CG  1 
ATOM   5289 C CD1 . LEU D 1 93  ? 13.462  -8.487  64.877 1.00 65.94  ? 584  LEU D CD1 1 
ATOM   5290 C CD2 . LEU D 1 93  ? 10.993  -8.862  64.760 1.00 65.04  ? 584  LEU D CD2 1 
ATOM   5291 N N   . GLY D 1 94  ? 14.157  -8.966  68.625 1.00 65.48  ? 585  GLY D N   1 
ATOM   5292 C CA  . GLY D 1 94  ? 14.030  -8.201  69.855 1.00 64.36  ? 585  GLY D CA  1 
ATOM   5293 C C   . GLY D 1 94  ? 12.847  -7.239  69.901 1.00 63.26  ? 585  GLY D C   1 
ATOM   5294 O O   . GLY D 1 94  ? 12.076  -7.133  68.942 1.00 62.45  ? 585  GLY D O   1 
ATOM   5295 N N   . GLU D 1 95  ? 12.708  -6.533  71.022 1.00 61.59  ? 586  GLU D N   1 
ATOM   5296 C CA  . GLU D 1 95  ? 11.622  -5.577  71.211 1.00 60.81  ? 586  GLU D CA  1 
ATOM   5297 C C   . GLU D 1 95  ? 11.756  -4.375  70.289 1.00 58.87  ? 586  GLU D C   1 
ATOM   5298 O O   . GLU D 1 95  ? 12.863  -3.977  69.920 1.00 59.40  ? 586  GLU D O   1 
ATOM   5299 C CB  . GLU D 1 95  ? 11.591  -5.082  72.660 1.00 63.64  ? 586  GLU D CB  1 
ATOM   5300 C CG  . GLU D 1 95  ? 11.260  -6.151  73.691 1.00 68.26  ? 586  GLU D CG  1 
ATOM   5301 C CD  . GLU D 1 95  ? 11.388  -5.645  75.127 1.00 70.52  ? 586  GLU D CD  1 
ATOM   5302 O OE1 . GLU D 1 95  ? 10.645  -4.705  75.501 1.00 70.75  ? 586  GLU D OE1 1 
ATOM   5303 O OE2 . GLU D 1 95  ? 12.233  -6.190  75.878 1.00 69.53  ? 586  GLU D OE2 1 
ATOM   5304 N N   . ILE D 1 96  ? 10.617  -3.799  69.920 1.00 55.66  ? 587  ILE D N   1 
ATOM   5305 C CA  . ILE D 1 96  ? 10.595  -2.629  69.053 1.00 51.68  ? 587  ILE D CA  1 
ATOM   5306 C C   . ILE D 1 96  ? 10.829  -1.388  69.905 1.00 48.55  ? 587  ILE D C   1 
ATOM   5307 O O   . ILE D 1 96  ? 10.295  -1.267  71.007 1.00 47.90  ? 587  ILE D O   1 
ATOM   5308 C CB  . ILE D 1 96  ? 9.233   -2.479  68.338 1.00 51.94  ? 587  ILE D CB  1 
ATOM   5309 C CG1 . ILE D 1 96  ? 8.111   -2.353  69.380 1.00 52.64  ? 587  ILE D CG1 1 
ATOM   5310 C CG2 . ILE D 1 96  ? 9.001   -3.658  67.413 1.00 50.24  ? 587  ILE D CG2 1 
ATOM   5311 C CD1 . ILE D 1 96  ? 6.728   -2.071  68.801 1.00 52.78  ? 587  ILE D CD1 1 
ATOM   5312 N N   . SER D 1 97  ? 11.630  -0.466  69.390 1.00 44.65  ? 588  SER D N   1 
ATOM   5313 C CA  . SER D 1 97  ? 11.920  0.759   70.109 1.00 40.88  ? 588  SER D CA  1 
ATOM   5314 C C   . SER D 1 97  ? 10.698  1.653   70.112 1.00 40.51  ? 588  SER D C   1 
ATOM   5315 O O   . SER D 1 97  ? 9.675   1.343   69.490 1.00 40.92  ? 588  SER D O   1 
ATOM   5316 C CB  . SER D 1 97  ? 13.065  1.507   69.439 1.00 39.48  ? 588  SER D CB  1 
ATOM   5317 O OG  . SER D 1 97  ? 12.628  2.096   68.227 1.00 37.04  ? 588  SER D OG  1 
ATOM   5318 N N   . ALA D 1 98  ? 10.808  2.766   70.826 1.00 39.05  ? 589  ALA D N   1 
ATOM   5319 C CA  . ALA D 1 98  ? 9.729   3.735   70.880 1.00 37.34  ? 589  ALA D CA  1 
ATOM   5320 C C   . ALA D 1 98  ? 9.679   4.371   69.484 1.00 37.03  ? 589  ALA D C   1 
ATOM   5321 O O   . ALA D 1 98  ? 10.678  4.393   68.760 1.00 36.44  ? 589  ALA D O   1 
ATOM   5322 C CB  . ALA D 1 98  ? 10.028  4.787   71.940 1.00 34.19  ? 589  ALA D CB  1 
ATOM   5323 N N   . ALA D 1 99  ? 8.517   4.876   69.098 1.00 36.91  ? 590  ALA D N   1 
ATOM   5324 C CA  . ALA D 1 99  ? 8.383   5.496   67.792 1.00 36.23  ? 590  ALA D CA  1 
ATOM   5325 C C   . ALA D 1 99  ? 8.983   6.889   67.823 1.00 35.51  ? 590  ALA D C   1 
ATOM   5326 O O   . ALA D 1 99  ? 8.819   7.624   68.795 1.00 36.82  ? 590  ALA D O   1 
ATOM   5327 C CB  . ALA D 1 99  ? 6.910   5.570   67.390 1.00 35.14  ? 590  ALA D CB  1 
ATOM   5328 N N   . SER D 1 100 ? 9.687   7.238   66.756 1.00 34.19  ? 591  SER D N   1 
ATOM   5329 C CA  . SER D 1 100 ? 10.301  8.553   66.631 1.00 32.20  ? 591  SER D CA  1 
ATOM   5330 C C   . SER D 1 100 ? 9.627   9.219   65.433 1.00 30.36  ? 591  SER D C   1 
ATOM   5331 O O   . SER D 1 100 ? 9.641   8.666   64.332 1.00 31.02  ? 591  SER D O   1 
ATOM   5332 C CB  . SER D 1 100 ? 11.802  8.402   66.391 1.00 32.17  ? 591  SER D CB  1 
ATOM   5333 O OG  . SER D 1 100 ? 12.432  9.662   66.374 1.00 31.81  ? 591  SER D OG  1 
ATOM   5334 N N   . GLU D 1 101 ? 9.037   10.395  65.651 1.00 28.64  ? 592  GLU D N   1 
ATOM   5335 C CA  . GLU D 1 101 ? 8.313   11.129  64.601 1.00 27.91  ? 592  GLU D CA  1 
ATOM   5336 C C   . GLU D 1 101 ? 9.111   12.272  63.968 1.00 28.08  ? 592  GLU D C   1 
ATOM   5337 O O   . GLU D 1 101 ? 9.796   13.033  64.664 1.00 27.84  ? 592  GLU D O   1 
ATOM   5338 C CB  . GLU D 1 101 ? 7.004   11.694  65.167 1.00 27.13  ? 592  GLU D CB  1 
ATOM   5339 C CG  . GLU D 1 101 ? 5.774   11.438  64.314 1.00 25.71  ? 592  GLU D CG  1 
ATOM   5340 C CD  . GLU D 1 101 ? 4.503   12.060  64.895 1.00 27.65  ? 592  GLU D CD  1 
ATOM   5341 O OE1 . GLU D 1 101 ? 4.253   11.912  66.111 1.00 26.76  ? 592  GLU D OE1 1 
ATOM   5342 O OE2 . GLU D 1 101 ? 3.738   12.692  64.134 1.00 26.94  ? 592  GLU D OE2 1 
ATOM   5343 N N   . PHE D 1 102 ? 8.997   12.395  62.646 1.00 25.38  ? 593  PHE D N   1 
ATOM   5344 C CA  . PHE D 1 102 ? 9.697   13.432  61.897 1.00 23.53  ? 593  PHE D CA  1 
ATOM   5345 C C   . PHE D 1 102 ? 8.889   13.767  60.657 1.00 25.23  ? 593  PHE D C   1 
ATOM   5346 O O   . PHE D 1 102 ? 7.925   13.068  60.339 1.00 25.98  ? 593  PHE D O   1 
ATOM   5347 C CB  . PHE D 1 102 ? 11.077  12.933  61.479 1.00 20.78  ? 593  PHE D CB  1 
ATOM   5348 C CG  . PHE D 1 102 ? 11.040  11.708  60.592 1.00 18.83  ? 593  PHE D CG  1 
ATOM   5349 C CD1 . PHE D 1 102 ? 11.152  11.830  59.210 1.00 14.48  ? 593  PHE D CD1 1 
ATOM   5350 C CD2 . PHE D 1 102 ? 10.905  10.434  61.146 1.00 16.08  ? 593  PHE D CD2 1 
ATOM   5351 C CE1 . PHE D 1 102 ? 11.139  10.718  58.403 1.00 15.20  ? 593  PHE D CE1 1 
ATOM   5352 C CE2 . PHE D 1 102 ? 10.890  9.315   60.352 1.00 15.23  ? 593  PHE D CE2 1 
ATOM   5353 C CZ  . PHE D 1 102 ? 11.009  9.450   58.974 1.00 17.57  ? 593  PHE D CZ  1 
ATOM   5354 N N   . LYS D 1 103 ? 9.282   14.833  59.963 1.00 24.95  ? 594  LYS D N   1 
ATOM   5355 C CA  . LYS D 1 103 ? 8.603   15.255  58.744 1.00 27.06  ? 594  LYS D CA  1 
ATOM   5356 C C   . LYS D 1 103 ? 9.669   15.454  57.677 1.00 28.15  ? 594  LYS D C   1 
ATOM   5357 O O   . LYS D 1 103 ? 10.635  16.178  57.895 1.00 28.72  ? 594  LYS D O   1 
ATOM   5358 C CB  . LYS D 1 103 ? 7.858   16.573  58.974 1.00 28.72  ? 594  LYS D CB  1 
ATOM   5359 C CG  . LYS D 1 103 ? 7.058   17.083  57.767 1.00 30.76  ? 594  LYS D CG  1 
ATOM   5360 C CD  . LYS D 1 103 ? 6.630   18.538  57.969 1.00 34.41  ? 594  LYS D CD  1 
ATOM   5361 C CE  . LYS D 1 103 ? 5.779   19.079  56.813 1.00 35.64  ? 594  LYS D CE  1 
ATOM   5362 N NZ  . LYS D 1 103 ? 4.407   18.489  56.774 1.00 38.50  ? 594  LYS D NZ  1 
ATOM   5363 N N   . THR D 1 104 ? 9.493   14.819  56.524 1.00 28.70  ? 595  THR D N   1 
ATOM   5364 C CA  . THR D 1 104 ? 10.471  14.941  55.448 1.00 29.67  ? 595  THR D CA  1 
ATOM   5365 C C   . THR D 1 104 ? 10.457  16.319  54.795 1.00 28.86  ? 595  THR D C   1 
ATOM   5366 O O   . THR D 1 104 ? 9.449   17.013  54.809 1.00 29.61  ? 595  THR D O   1 
ATOM   5367 C CB  . THR D 1 104 ? 10.240  13.886  54.347 1.00 29.03  ? 595  THR D CB  1 
ATOM   5368 O OG1 . THR D 1 104 ? 9.041   14.195  53.633 1.00 30.17  ? 595  THR D OG1 1 
ATOM   5369 C CG2 . THR D 1 104 ? 10.116  12.513  54.955 1.00 27.82  ? 595  THR D CG2 1 
ATOM   5370 N N   . GLN D 1 105 ? 11.593  16.697  54.221 1.00 29.28  ? 596  GLN D N   1 
ATOM   5371 C CA  . GLN D 1 105 ? 11.747  17.982  53.553 1.00 29.34  ? 596  GLN D CA  1 
ATOM   5372 C C   . GLN D 1 105 ? 11.055  17.936  52.209 1.00 28.60  ? 596  GLN D C   1 
ATOM   5373 O O   . GLN D 1 105 ? 10.752  16.857  51.705 1.00 30.42  ? 596  GLN D O   1 
ATOM   5374 C CB  . GLN D 1 105 ? 13.227  18.295  53.300 1.00 28.50  ? 596  GLN D CB  1 
ATOM   5375 C CG  . GLN D 1 105 ? 14.116  18.211  54.495 1.00 28.75  ? 596  GLN D CG  1 
ATOM   5376 C CD  . GLN D 1 105 ? 15.493  18.739  54.192 1.00 31.83  ? 596  GLN D CD  1 
ATOM   5377 O OE1 . GLN D 1 105 ? 15.634  19.819  53.627 1.00 35.26  ? 596  GLN D OE1 1 
ATOM   5378 N NE2 . GLN D 1 105 ? 16.522  17.988  54.571 1.00 32.93  ? 596  GLN D NE2 1 
ATOM   5379 N N   . PRO D 1 106 ? 10.782  19.111  51.620 1.00 28.30  ? 597  PRO D N   1 
ATOM   5380 C CA  . PRO D 1 106 ? 10.131  19.200  50.311 1.00 28.37  ? 597  PRO D CA  1 
ATOM   5381 C C   . PRO D 1 106 ? 11.254  19.165  49.266 1.00 29.43  ? 597  PRO D C   1 
ATOM   5382 O O   . PRO D 1 106 ? 12.398  19.480  49.590 1.00 31.75  ? 597  PRO D O   1 
ATOM   5383 C CB  . PRO D 1 106 ? 9.446   20.562  50.374 1.00 26.61  ? 597  PRO D CB  1 
ATOM   5384 C CG  . PRO D 1 106 ? 10.432  21.376  51.147 1.00 25.00  ? 597  PRO D CG  1 
ATOM   5385 C CD  . PRO D 1 106 ? 10.826  20.437  52.270 1.00 25.94  ? 597  PRO D CD  1 
ATOM   5386 N N   . VAL D 1 107 ? 10.956  18.779  48.030 1.00 29.81  ? 598  VAL D N   1 
ATOM   5387 C CA  . VAL D 1 107 ? 12.000  18.759  47.009 1.00 30.19  ? 598  VAL D CA  1 
ATOM   5388 C C   . VAL D 1 107 ? 12.167  20.192  46.504 1.00 30.84  ? 598  VAL D C   1 
ATOM   5389 O O   . VAL D 1 107 ? 11.206  20.944  46.466 1.00 30.20  ? 598  VAL D O   1 
ATOM   5390 C CB  . VAL D 1 107 ? 11.634  17.839  45.829 1.00 28.81  ? 598  VAL D CB  1 
ATOM   5391 C CG1 . VAL D 1 107 ? 11.052  16.536  46.349 1.00 25.79  ? 598  VAL D CG1 1 
ATOM   5392 C CG2 . VAL D 1 107 ? 10.670  18.536  44.912 1.00 30.32  ? 598  VAL D CG2 1 
ATOM   5393 N N   . ARG D 1 108 ? 13.383  20.570  46.123 1.00 32.36  ? 599  ARG D N   1 
ATOM   5394 C CA  . ARG D 1 108 ? 13.628  21.926  45.642 1.00 32.84  ? 599  ARG D CA  1 
ATOM   5395 C C   . ARG D 1 108 ? 14.331  21.964  44.296 1.00 33.76  ? 599  ARG D C   1 
ATOM   5396 O O   . ARG D 1 108 ? 14.721  20.932  43.747 1.00 34.78  ? 599  ARG D O   1 
ATOM   5397 C CB  . ARG D 1 108 ? 14.486  22.690  46.651 1.00 32.73  ? 599  ARG D CB  1 
ATOM   5398 C CG  . ARG D 1 108 ? 13.952  22.678  48.081 1.00 34.64  ? 599  ARG D CG  1 
ATOM   5399 C CD  . ARG D 1 108 ? 14.765  23.598  48.973 1.00 32.57  ? 599  ARG D CD  1 
ATOM   5400 N NE  . ARG D 1 108 ? 14.201  23.735  50.312 1.00 35.67  ? 599  ARG D NE  1 
ATOM   5401 C CZ  . ARG D 1 108 ? 14.161  22.765  51.222 1.00 36.39  ? 599  ARG D CZ  1 
ATOM   5402 N NH1 . ARG D 1 108 ? 14.648  21.564  50.953 1.00 34.42  ? 599  ARG D NH1 1 
ATOM   5403 N NH2 . ARG D 1 108 ? 13.647  23.008  52.416 1.00 37.18  ? 599  ARG D NH2 1 
ATOM   5404 N N   . GLU D 1 109 ? 14.484  23.169  43.761 1.00 33.72  ? 600  GLU D N   1 
ATOM   5405 C CA  . GLU D 1 109 ? 15.189  23.339  42.504 1.00 34.01  ? 600  GLU D CA  1 
ATOM   5406 C C   . GLU D 1 109 ? 16.598  22.915  42.856 1.00 32.60  ? 600  GLU D C   1 
ATOM   5407 O O   . GLU D 1 109 ? 17.117  23.312  43.892 1.00 33.33  ? 600  GLU D O   1 
ATOM   5408 C CB  . GLU D 1 109 ? 15.212  24.809  42.093 1.00 37.38  ? 600  GLU D CB  1 
ATOM   5409 C CG  . GLU D 1 109 ? 13.860  25.414  41.802 1.00 43.79  ? 600  GLU D CG  1 
ATOM   5410 C CD  . GLU D 1 109 ? 13.291  24.931  40.487 1.00 48.02  ? 600  GLU D CD  1 
ATOM   5411 O OE1 . GLU D 1 109 ? 13.274  23.698  40.272 1.00 50.33  ? 600  GLU D OE1 1 
ATOM   5412 O OE2 . GLU D 1 109 ? 12.860  25.783  39.674 1.00 49.56  ? 600  GLU D OE2 1 
ATOM   5413 N N   . PRO D 1 110 ? 17.241  22.105  42.012 1.00 31.57  ? 601  PRO D N   1 
ATOM   5414 C CA  . PRO D 1 110 ? 18.606  21.687  42.336 1.00 30.80  ? 601  PRO D CA  1 
ATOM   5415 C C   . PRO D 1 110 ? 19.594  22.831  42.137 1.00 30.01  ? 601  PRO D C   1 
ATOM   5416 O O   . PRO D 1 110 ? 19.290  23.804  41.459 1.00 26.84  ? 601  PRO D O   1 
ATOM   5417 C CB  . PRO D 1 110 ? 18.849  20.556  41.355 1.00 30.42  ? 601  PRO D CB  1 
ATOM   5418 C CG  . PRO D 1 110 ? 18.133  21.063  40.133 1.00 31.29  ? 601  PRO D CG  1 
ATOM   5419 C CD  . PRO D 1 110 ? 16.819  21.552  40.716 1.00 32.31  ? 601  PRO D CD  1 
ATOM   5420 N N   . SER D 1 111 ? 20.772  22.712  42.740 1.00 31.12  ? 602  SER D N   1 
ATOM   5421 C CA  . SER D 1 111 ? 21.806  23.726  42.591 1.00 30.29  ? 602  SER D CA  1 
ATOM   5422 C C   . SER D 1 111 ? 22.518  23.460  41.279 1.00 30.67  ? 602  SER D C   1 
ATOM   5423 O O   . SER D 1 111 ? 22.564  22.324  40.818 1.00 29.95  ? 602  SER D O   1 
ATOM   5424 C CB  . SER D 1 111 ? 22.813  23.624  43.726 1.00 30.82  ? 602  SER D CB  1 
ATOM   5425 O OG  . SER D 1 111 ? 22.174  23.757  44.975 1.00 35.28  ? 602  SER D OG  1 
ATOM   5426 N N   . ALA D 1 112 ? 23.068  24.507  40.673 1.00 32.27  ? 603  ALA D N   1 
ATOM   5427 C CA  . ALA D 1 112 ? 23.794  24.355  39.415 1.00 31.11  ? 603  ALA D CA  1 
ATOM   5428 C C   . ALA D 1 112 ? 25.127  23.661  39.700 1.00 30.61  ? 603  ALA D C   1 
ATOM   5429 O O   . ALA D 1 112 ? 25.665  23.750  40.806 1.00 30.25  ? 603  ALA D O   1 
ATOM   5430 C CB  . ALA D 1 112 ? 24.036  25.711  38.785 1.00 28.28  ? 603  ALA D CB  1 
ATOM   5431 N N   . PRO D 1 113 ? 25.664  22.938  38.713 1.00 29.23  ? 604  PRO D N   1 
ATOM   5432 C CA  . PRO D 1 113 ? 26.939  22.255  38.923 1.00 28.67  ? 604  PRO D CA  1 
ATOM   5433 C C   . PRO D 1 113 ? 28.100  23.225  38.826 1.00 28.98  ? 604  PRO D C   1 
ATOM   5434 O O   . PRO D 1 113 ? 27.967  24.308  38.272 1.00 30.27  ? 604  PRO D O   1 
ATOM   5435 C CB  . PRO D 1 113 ? 26.967  21.237  37.794 1.00 27.65  ? 604  PRO D CB  1 
ATOM   5436 C CG  . PRO D 1 113 ? 26.275  21.969  36.694 1.00 27.83  ? 604  PRO D CG  1 
ATOM   5437 C CD  . PRO D 1 113 ? 25.089  22.587  37.405 1.00 28.98  ? 604  PRO D CD  1 
ATOM   5438 N N   . LYS D 1 114 ? 29.241  22.844  39.379 1.00 29.28  ? 605  LYS D N   1 
ATOM   5439 C CA  . LYS D 1 114 ? 30.407  23.696  39.279 1.00 29.39  ? 605  LYS D CA  1 
ATOM   5440 C C   . LYS D 1 114 ? 31.101  23.230  38.009 1.00 28.50  ? 605  LYS D C   1 
ATOM   5441 O O   . LYS D 1 114 ? 31.221  22.024  37.766 1.00 28.48  ? 605  LYS D O   1 
ATOM   5442 C CB  . LYS D 1 114 ? 31.326  23.530  40.493 1.00 31.81  ? 605  LYS D CB  1 
ATOM   5443 C CG  . LYS D 1 114 ? 30.775  24.131  41.776 1.00 35.67  ? 605  LYS D CG  1 
ATOM   5444 C CD  . LYS D 1 114 ? 30.367  25.582  41.564 1.00 40.46  ? 605  LYS D CD  1 
ATOM   5445 C CE  . LYS D 1 114 ? 29.766  26.196  42.821 1.00 42.99  ? 605  LYS D CE  1 
ATOM   5446 N NZ  . LYS D 1 114 ? 28.982  27.434  42.508 1.00 44.76  ? 605  LYS D NZ  1 
ATOM   5447 N N   . LEU D 1 115 ? 31.535  24.187  37.196 1.00 25.82  ? 606  LEU D N   1 
ATOM   5448 C CA  . LEU D 1 115 ? 32.198  23.876  35.942 1.00 23.60  ? 606  LEU D CA  1 
ATOM   5449 C C   . LEU D 1 115 ? 33.684  24.080  36.077 1.00 24.76  ? 606  LEU D C   1 
ATOM   5450 O O   . LEU D 1 115 ? 34.133  25.063  36.668 1.00 27.34  ? 606  LEU D O   1 
ATOM   5451 C CB  . LEU D 1 115 ? 31.649  24.756  34.817 1.00 19.35  ? 606  LEU D CB  1 
ATOM   5452 C CG  . LEU D 1 115 ? 30.120  24.715  34.677 1.00 18.52  ? 606  LEU D CG  1 
ATOM   5453 C CD1 . LEU D 1 115 ? 29.682  25.608  33.523 1.00 14.33  ? 606  LEU D CD1 1 
ATOM   5454 C CD2 . LEU D 1 115 ? 29.661  23.286  34.472 1.00 14.24  ? 606  LEU D CD2 1 
ATOM   5455 N N   . GLU D 1 116 ? 34.442  23.137  35.527 1.00 24.46  ? 607  GLU D N   1 
ATOM   5456 C CA  . GLU D 1 116 ? 35.897  23.173  35.559 1.00 23.97  ? 607  GLU D CA  1 
ATOM   5457 C C   . GLU D 1 116 ? 36.429  22.990  34.134 1.00 25.65  ? 607  GLU D C   1 
ATOM   5458 O O   . GLU D 1 116 ? 36.113  22.004  33.462 1.00 25.55  ? 607  GLU D O   1 
ATOM   5459 C CB  . GLU D 1 116 ? 36.401  22.061  36.484 1.00 22.29  ? 607  GLU D CB  1 
ATOM   5460 C CG  . GLU D 1 116 ? 37.888  21.778  36.440 1.00 22.06  ? 607  GLU D CG  1 
ATOM   5461 C CD  . GLU D 1 116 ? 38.260  20.585  37.309 1.00 22.05  ? 607  GLU D CD  1 
ATOM   5462 O OE1 . GLU D 1 116 ? 38.394  20.740  38.535 1.00 21.72  ? 607  GLU D OE1 1 
ATOM   5463 O OE2 . GLU D 1 116 ? 38.404  19.474  36.768 1.00 24.66  ? 607  GLU D OE2 1 
ATOM   5464 N N   . GLY D 1 117 ? 37.227  23.948  33.670 1.00 25.61  ? 608  GLY D N   1 
ATOM   5465 C CA  . GLY D 1 117 ? 37.772  23.856  32.331 1.00 24.52  ? 608  GLY D CA  1 
ATOM   5466 C C   . GLY D 1 117 ? 39.001  22.971  32.213 1.00 26.31  ? 608  GLY D C   1 
ATOM   5467 O O   . GLY D 1 117 ? 39.827  22.918  33.112 1.00 24.02  ? 608  GLY D O   1 
ATOM   5468 N N   . GLN D 1 118 ? 39.109  22.265  31.091 1.00 28.39  ? 609  GLN D N   1 
ATOM   5469 C CA  . GLN D 1 118 ? 40.238  21.393  30.822 1.00 29.65  ? 609  GLN D CA  1 
ATOM   5470 C C   . GLN D 1 118 ? 40.450  21.385  29.315 1.00 32.28  ? 609  GLN D C   1 
ATOM   5471 O O   . GLN D 1 118 ? 39.504  21.562  28.555 1.00 33.30  ? 609  GLN D O   1 
ATOM   5472 C CB  . GLN D 1 118 ? 39.945  19.975  31.304 1.00 30.76  ? 609  GLN D CB  1 
ATOM   5473 C CG  . GLN D 1 118 ? 41.178  19.072  31.355 1.00 31.87  ? 609  GLN D CG  1 
ATOM   5474 C CD  . GLN D 1 118 ? 40.880  17.682  31.906 1.00 32.62  ? 609  GLN D CD  1 
ATOM   5475 O OE1 . GLN D 1 118 ? 40.107  17.515  32.855 1.00 33.37  ? 609  GLN D OE1 1 
ATOM   5476 N NE2 . GLN D 1 118 ? 41.510  16.682  31.324 1.00 33.33  ? 609  GLN D NE2 1 
ATOM   5477 N N   . ARG D 1 119 ? 41.689  21.189  28.883 1.00 34.74  ? 610  ARG D N   1 
ATOM   5478 C CA  . ARG D 1 119 ? 42.005  21.153  27.463 1.00 38.02  ? 610  ARG D CA  1 
ATOM   5479 C C   . ARG D 1 119 ? 41.369  19.976  26.726 1.00 40.17  ? 610  ARG D C   1 
ATOM   5480 O O   . ARG D 1 119 ? 41.361  18.852  27.225 1.00 40.85  ? 610  ARG D O   1 
ATOM   5481 C CB  . ARG D 1 119 ? 43.507  21.045  27.266 1.00 40.39  ? 610  ARG D CB  1 
ATOM   5482 C CG  . ARG D 1 119 ? 44.319  22.217  27.742 1.00 45.01  ? 610  ARG D CG  1 
ATOM   5483 C CD  . ARG D 1 119 ? 45.791  21.882  27.576 1.00 47.93  ? 610  ARG D CD  1 
ATOM   5484 N NE  . ARG D 1 119 ? 46.561  23.001  27.048 1.00 52.74  ? 610  ARG D NE  1 
ATOM   5485 C CZ  . ARG D 1 119 ? 47.740  22.873  26.446 1.00 54.88  ? 610  ARG D CZ  1 
ATOM   5486 N NH1 . ARG D 1 119 ? 48.286  21.670  26.292 1.00 56.12  ? 610  ARG D NH1 1 
ATOM   5487 N NH2 . ARG D 1 119 ? 48.375  23.948  26.000 1.00 56.40  ? 610  ARG D NH2 1 
ATOM   5488 N N   . GLY D 1 120 ? 40.848  20.237  25.530 1.00 42.20  ? 611  GLY D N   1 
ATOM   5489 C CA  . GLY D 1 120 ? 40.271  19.176  24.718 1.00 44.71  ? 611  GLY D CA  1 
ATOM   5490 C C   . GLY D 1 120 ? 41.402  18.581  23.888 1.00 47.01  ? 611  GLY D C   1 
ATOM   5491 O O   . GLY D 1 120 ? 42.571  18.861  24.156 1.00 46.92  ? 611  GLY D O   1 
ATOM   5492 N N   . GLU D 1 121 ? 41.093  17.778  22.875 1.00 49.55  ? 612  GLU D N   1 
ATOM   5493 C CA  . GLU D 1 121 ? 42.170  17.195  22.084 1.00 52.96  ? 612  GLU D CA  1 
ATOM   5494 C C   . GLU D 1 121 ? 42.945  18.222  21.249 1.00 52.91  ? 612  GLU D C   1 
ATOM   5495 O O   . GLU D 1 121 ? 44.163  18.110  21.105 1.00 52.67  ? 612  GLU D O   1 
ATOM   5496 C CB  . GLU D 1 121 ? 41.642  16.080  21.171 1.00 56.87  ? 612  GLU D CB  1 
ATOM   5497 C CG  . GLU D 1 121 ? 40.979  16.551  19.875 1.00 62.92  ? 612  GLU D CG  1 
ATOM   5498 C CD  . GLU D 1 121 ? 40.640  15.383  18.936 1.00 66.04  ? 612  GLU D CD  1 
ATOM   5499 O OE1 . GLU D 1 121 ? 41.579  14.647  18.529 1.00 65.51  ? 612  GLU D OE1 1 
ATOM   5500 O OE2 . GLU D 1 121 ? 39.435  15.205  18.613 1.00 66.72  ? 612  GLU D OE2 1 
ATOM   5501 N N   . ASP D 1 122 ? 42.256  19.227  20.714 1.00 52.04  ? 613  ASP D N   1 
ATOM   5502 C CA  . ASP D 1 122 ? 42.927  20.233  19.893 1.00 51.36  ? 613  ASP D CA  1 
ATOM   5503 C C   . ASP D 1 122 ? 42.798  21.672  20.397 1.00 49.80  ? 613  ASP D C   1 
ATOM   5504 O O   . ASP D 1 122 ? 42.145  21.935  21.407 1.00 50.41  ? 613  ASP D O   1 
ATOM   5505 C CB  . ASP D 1 122 ? 42.425  20.138  18.450 1.00 53.74  ? 613  ASP D CB  1 
ATOM   5506 C CG  . ASP D 1 122 ? 42.729  18.787  17.816 1.00 56.26  ? 613  ASP D CG  1 
ATOM   5507 O OD1 . ASP D 1 122 ? 43.908  18.370  17.847 1.00 58.70  ? 613  ASP D OD1 1 
ATOM   5508 O OD2 . ASP D 1 122 ? 41.797  18.145  17.287 1.00 55.46  ? 613  ASP D OD2 1 
ATOM   5509 N N   . GLY D 1 123 ? 43.424  22.603  19.681 1.00 46.96  ? 614  GLY D N   1 
ATOM   5510 C CA  . GLY D 1 123 ? 43.389  23.997  20.082 1.00 43.98  ? 614  GLY D CA  1 
ATOM   5511 C C   . GLY D 1 123 ? 42.024  24.655  20.041 1.00 42.43  ? 614  GLY D C   1 
ATOM   5512 O O   . GLY D 1 123 ? 41.826  25.709  20.640 1.00 42.06  ? 614  GLY D O   1 
ATOM   5513 N N   . ASN D 1 124 ? 41.080  24.045  19.334 1.00 40.31  ? 615  ASN D N   1 
ATOM   5514 C CA  . ASN D 1 124 ? 39.741  24.604  19.231 1.00 38.65  ? 615  ASN D CA  1 
ATOM   5515 C C   . ASN D 1 124 ? 38.693  23.687  19.852 1.00 37.65  ? 615  ASN D C   1 
ATOM   5516 O O   . ASN D 1 124 ? 37.599  23.494  19.305 1.00 36.50  ? 615  ASN D O   1 
ATOM   5517 C CB  . ASN D 1 124 ? 39.382  24.867  17.773 1.00 38.99  ? 615  ASN D CB  1 
ATOM   5518 C CG  . ASN D 1 124 ? 39.357  23.600  16.941 1.00 39.32  ? 615  ASN D CG  1 
ATOM   5519 O OD1 . ASN D 1 124 ? 38.618  23.516  15.959 1.00 39.79  ? 615  ASN D OD1 1 
ATOM   5520 N ND2 . ASN D 1 124 ? 40.170  22.615  17.319 1.00 35.26  ? 615  ASN D ND2 1 
ATOM   5521 N N   . SER D 1 125 ? 39.044  23.118  20.998 1.00 35.66  ? 616  SER D N   1 
ATOM   5522 C CA  . SER D 1 125 ? 38.142  22.241  21.723 1.00 34.41  ? 616  SER D CA  1 
ATOM   5523 C C   . SER D 1 125 ? 38.353  22.499  23.202 1.00 32.25  ? 616  SER D C   1 
ATOM   5524 O O   . SER D 1 125 ? 39.319  23.150  23.590 1.00 33.56  ? 616  SER D O   1 
ATOM   5525 C CB  . SER D 1 125 ? 38.445  20.775  21.405 1.00 34.68  ? 616  SER D CB  1 
ATOM   5526 O OG  . SER D 1 125 ? 39.739  20.411  21.848 1.00 34.99  ? 616  SER D OG  1 
ATOM   5527 N N   . ILE D 1 126 ? 37.452  21.988  24.028 1.00 29.97  ? 617  ILE D N   1 
ATOM   5528 C CA  . ILE D 1 126 ? 37.567  22.172  25.461 1.00 26.85  ? 617  ILE D CA  1 
ATOM   5529 C C   . ILE D 1 126 ? 36.731  21.136  26.175 1.00 26.35  ? 617  ILE D C   1 
ATOM   5530 O O   . ILE D 1 126 ? 35.650  20.769  25.724 1.00 25.67  ? 617  ILE D O   1 
ATOM   5531 C CB  . ILE D 1 126 ? 37.086  23.580  25.894 1.00 26.09  ? 617  ILE D CB  1 
ATOM   5532 C CG1 . ILE D 1 126 ? 37.376  23.801  27.377 1.00 23.46  ? 617  ILE D CG1 1 
ATOM   5533 C CG2 . ILE D 1 126 ? 35.592  23.731  25.638 1.00 24.73  ? 617  ILE D CG2 1 
ATOM   5534 C CD1 . ILE D 1 126 ? 36.878  25.132  27.895 1.00 23.58  ? 617  ILE D CD1 1 
ATOM   5535 N N   . LYS D 1 127 ? 37.258  20.656  27.288 1.00 27.03  ? 618  LYS D N   1 
ATOM   5536 C CA  . LYS D 1 127 ? 36.572  19.675  28.110 1.00 28.68  ? 618  LYS D CA  1 
ATOM   5537 C C   . LYS D 1 127 ? 36.030  20.453  29.313 1.00 29.14  ? 618  LYS D C   1 
ATOM   5538 O O   . LYS D 1 127 ? 36.788  21.146  30.004 1.00 30.00  ? 618  LYS D O   1 
ATOM   5539 C CB  . LYS D 1 127 ? 37.575  18.598  28.548 1.00 29.50  ? 618  LYS D CB  1 
ATOM   5540 C CG  . LYS D 1 127 ? 37.040  17.505  29.471 1.00 32.46  ? 618  LYS D CG  1 
ATOM   5541 C CD  . LYS D 1 127 ? 37.982  16.286  29.454 1.00 32.77  ? 618  LYS D CD  1 
ATOM   5542 C CE  . LYS D 1 127 ? 37.503  15.138  30.339 1.00 32.16  ? 618  LYS D CE  1 
ATOM   5543 N NZ  . LYS D 1 127 ? 37.875  15.304  31.774 1.00 33.82  ? 618  LYS D NZ  1 
ATOM   5544 N N   . VAL D 1 128 ? 34.722  20.386  29.539 1.00 27.43  ? 619  VAL D N   1 
ATOM   5545 C CA  . VAL D 1 128 ? 34.132  21.084  30.677 1.00 27.62  ? 619  VAL D CA  1 
ATOM   5546 C C   . VAL D 1 128 ? 33.704  20.065  31.727 1.00 27.92  ? 619  VAL D C   1 
ATOM   5547 O O   . VAL D 1 128 ? 32.633  19.464  31.623 1.00 31.42  ? 619  VAL D O   1 
ATOM   5548 C CB  . VAL D 1 128 ? 32.910  21.925  30.256 1.00 26.94  ? 619  VAL D CB  1 
ATOM   5549 C CG1 . VAL D 1 128 ? 32.281  22.584  31.474 1.00 25.70  ? 619  VAL D CG1 1 
ATOM   5550 C CG2 . VAL D 1 128 ? 33.332  22.973  29.256 1.00 27.24  ? 619  VAL D CG2 1 
ATOM   5551 N N   . ASN D 1 129 ? 34.551  19.867  32.728 1.00 26.22  ? 620  ASN D N   1 
ATOM   5552 C CA  . ASN D 1 129 ? 34.286  18.919  33.805 1.00 25.50  ? 620  ASN D CA  1 
ATOM   5553 C C   . ASN D 1 129 ? 33.133  19.366  34.709 1.00 25.26  ? 620  ASN D C   1 
ATOM   5554 O O   . ASN D 1 129 ? 33.002  20.549  35.036 1.00 24.13  ? 620  ASN D O   1 
ATOM   5555 C CB  . ASN D 1 129 ? 35.549  18.732  34.651 1.00 26.21  ? 620  ASN D CB  1 
ATOM   5556 C CG  . ASN D 1 129 ? 36.669  18.031  33.895 1.00 27.45  ? 620  ASN D CG  1 
ATOM   5557 O OD1 . ASN D 1 129 ? 37.849  18.244  34.180 1.00 32.10  ? 620  ASN D OD1 1 
ATOM   5558 N ND2 . ASN D 1 129 ? 36.309  17.185  32.944 1.00 26.07  ? 620  ASN D ND2 1 
ATOM   5559 N N   . LEU D 1 130 ? 32.303  18.411  35.121 1.00 25.54  ? 621  LEU D N   1 
ATOM   5560 C CA  . LEU D 1 130 ? 31.165  18.710  35.990 1.00 25.23  ? 621  LEU D CA  1 
ATOM   5561 C C   . LEU D 1 130 ? 31.367  18.272  37.427 1.00 23.50  ? 621  LEU D C   1 
ATOM   5562 O O   . LEU D 1 130 ? 31.488  17.085  37.700 1.00 24.90  ? 621  LEU D O   1 
ATOM   5563 C CB  . LEU D 1 130 ? 29.889  18.039  35.475 1.00 25.88  ? 621  LEU D CB  1 
ATOM   5564 C CG  . LEU D 1 130 ? 29.249  18.512  34.173 1.00 26.89  ? 621  LEU D CG  1 
ATOM   5565 C CD1 . LEU D 1 130 ? 27.890  17.851  34.019 1.00 27.64  ? 621  LEU D CD1 1 
ATOM   5566 C CD2 . LEU D 1 130 ? 29.083  20.007  34.201 1.00 29.72  ? 621  LEU D CD2 1 
ATOM   5567 N N   . ILE D 1 131 ? 31.412  19.234  38.338 1.00 22.82  ? 622  ILE D N   1 
ATOM   5568 C CA  . ILE D 1 131 ? 31.536  18.946  39.768 1.00 22.42  ? 622  ILE D CA  1 
ATOM   5569 C C   . ILE D 1 131 ? 30.087  19.063  40.254 1.00 24.55  ? 622  ILE D C   1 
ATOM   5570 O O   . ILE D 1 131 ? 29.541  20.167  40.309 1.00 25.01  ? 622  ILE D O   1 
ATOM   5571 C CB  . ILE D 1 131 ? 32.398  20.009  40.486 1.00 21.74  ? 622  ILE D CB  1 
ATOM   5572 C CG1 . ILE D 1 131 ? 33.806  20.044  39.868 1.00 19.98  ? 622  ILE D CG1 1 
ATOM   5573 C CG2 . ILE D 1 131 ? 32.436  19.721  41.969 1.00 15.23  ? 622  ILE D CG2 1 
ATOM   5574 C CD1 . ILE D 1 131 ? 34.712  21.139  40.405 1.00 16.82  ? 622  ILE D CD1 1 
ATOM   5575 N N   . LYS D 1 132 ? 29.467  17.929  40.586 1.00 25.39  ? 623  LYS D N   1 
ATOM   5576 C CA  . LYS D 1 132 ? 28.066  17.900  41.007 1.00 26.41  ? 623  LYS D CA  1 
ATOM   5577 C C   . LYS D 1 132 ? 27.807  18.460  42.394 1.00 25.66  ? 623  LYS D C   1 
ATOM   5578 O O   . LYS D 1 132 ? 28.674  18.429  43.263 1.00 26.51  ? 623  LYS D O   1 
ATOM   5579 C CB  . LYS D 1 132 ? 27.529  16.468  40.923 1.00 27.70  ? 623  LYS D CB  1 
ATOM   5580 C CG  . LYS D 1 132 ? 27.709  15.816  39.557 1.00 31.72  ? 623  LYS D CG  1 
ATOM   5581 C CD  . LYS D 1 132 ? 27.373  14.324  39.624 1.00 35.99  ? 623  LYS D CD  1 
ATOM   5582 C CE  . LYS D 1 132 ? 27.155  13.697  38.237 1.00 37.64  ? 623  LYS D CE  1 
ATOM   5583 N NZ  . LYS D 1 132 ? 28.395  13.533  37.426 1.00 35.69  ? 623  LYS D NZ  1 
ATOM   5584 N N   . GLN D 1 133 ? 26.600  18.975  42.593 1.00 25.49  ? 624  GLN D N   1 
ATOM   5585 C CA  . GLN D 1 133 ? 26.221  19.547  43.871 1.00 25.58  ? 624  GLN D CA  1 
ATOM   5586 C C   . GLN D 1 133 ? 24.803  19.171  44.261 1.00 26.64  ? 624  GLN D C   1 
ATOM   5587 O O   . GLN D 1 133 ? 24.147  18.404  43.566 1.00 27.16  ? 624  GLN D O   1 
ATOM   5588 C CB  . GLN D 1 133 ? 26.342  21.061  43.817 1.00 27.01  ? 624  GLN D CB  1 
ATOM   5589 C CG  . GLN D 1 133 ? 27.663  21.554  43.273 1.00 28.22  ? 624  GLN D CG  1 
ATOM   5590 C CD  . GLN D 1 133 ? 27.971  22.957  43.726 1.00 28.36  ? 624  GLN D CD  1 
ATOM   5591 O OE1 . GLN D 1 133 ? 28.480  23.165  44.826 1.00 30.26  ? 624  GLN D OE1 1 
ATOM   5592 N NE2 . GLN D 1 133 ? 27.648  23.936  42.891 1.00 29.58  ? 624  GLN D NE2 1 
ATOM   5593 N N   . ASP D 1 134 ? 24.334  19.727  45.375 1.00 28.30  ? 625  ASP D N   1 
ATOM   5594 C CA  . ASP D 1 134 ? 22.995  19.454  45.887 1.00 28.88  ? 625  ASP D CA  1 
ATOM   5595 C C   . ASP D 1 134 ? 21.930  19.463  44.793 1.00 27.99  ? 625  ASP D C   1 
ATOM   5596 O O   . ASP D 1 134 ? 21.728  20.478  44.127 1.00 25.63  ? 625  ASP D O   1 
ATOM   5597 C CB  . ASP D 1 134 ? 22.644  20.477  46.970 1.00 31.50  ? 625  ASP D CB  1 
ATOM   5598 C CG  . ASP D 1 134 ? 21.263  20.250  47.571 1.00 33.18  ? 625  ASP D CG  1 
ATOM   5599 O OD1 . ASP D 1 134 ? 20.992  19.132  48.054 1.00 34.94  ? 625  ASP D OD1 1 
ATOM   5600 O OD2 . ASP D 1 134 ? 20.451  21.198  47.565 1.00 34.14  ? 625  ASP D OD2 1 
ATOM   5601 N N   . ASP D 1 135 ? 21.245  18.330  44.623 1.00 28.27  ? 626  ASP D N   1 
ATOM   5602 C CA  . ASP D 1 135 ? 20.212  18.208  43.587 1.00 30.22  ? 626  ASP D CA  1 
ATOM   5603 C C   . ASP D 1 135 ? 18.805  18.584  44.025 1.00 30.98  ? 626  ASP D C   1 
ATOM   5604 O O   . ASP D 1 135 ? 17.845  18.320  43.306 1.00 31.47  ? 626  ASP D O   1 
ATOM   5605 C CB  . ASP D 1 135 ? 20.181  16.792  42.985 1.00 28.04  ? 626  ASP D CB  1 
ATOM   5606 C CG  . ASP D 1 135 ? 19.737  15.731  43.976 1.00 28.03  ? 626  ASP D CG  1 
ATOM   5607 O OD1 . ASP D 1 135 ? 18.942  16.032  44.889 1.00 29.65  ? 626  ASP D OD1 1 
ATOM   5608 O OD2 . ASP D 1 135 ? 20.169  14.573  43.824 1.00 26.37  ? 626  ASP D OD2 1 
ATOM   5609 N N   . GLY D 1 136 ? 18.684  19.178  45.210 1.00 31.27  ? 627  GLY D N   1 
ATOM   5610 C CA  . GLY D 1 136 ? 17.383  19.605  45.688 1.00 31.57  ? 627  GLY D CA  1 
ATOM   5611 C C   . GLY D 1 136 ? 16.451  18.578  46.297 1.00 31.46  ? 627  GLY D C   1 
ATOM   5612 O O   . GLY D 1 136 ? 15.300  18.894  46.609 1.00 31.87  ? 627  GLY D O   1 
ATOM   5613 N N   . GLY D 1 137 ? 16.927  17.356  46.481 1.00 30.94  ? 628  GLY D N   1 
ATOM   5614 C CA  . GLY D 1 137 ? 16.074  16.341  47.073 1.00 32.03  ? 628  GLY D CA  1 
ATOM   5615 C C   . GLY D 1 137 ? 15.467  15.387  46.064 1.00 31.58  ? 628  GLY D C   1 
ATOM   5616 O O   . GLY D 1 137 ? 14.709  14.498  46.427 1.00 32.68  ? 628  GLY D O   1 
ATOM   5617 N N   . SER D 1 138 ? 15.789  15.579  44.793 1.00 30.95  ? 629  SER D N   1 
ATOM   5618 C CA  . SER D 1 138 ? 15.283  14.716  43.741 1.00 31.12  ? 629  SER D CA  1 
ATOM   5619 C C   . SER D 1 138 ? 16.369  14.428  42.705 1.00 30.37  ? 629  SER D C   1 
ATOM   5620 O O   . SER D 1 138 ? 17.099  15.324  42.272 1.00 27.68  ? 629  SER D O   1 
ATOM   5621 C CB  . SER D 1 138 ? 14.080  15.350  43.046 1.00 31.66  ? 629  SER D CB  1 
ATOM   5622 O OG  . SER D 1 138 ? 13.668  14.531  41.963 1.00 33.98  ? 629  SER D OG  1 
ATOM   5623 N N   . PRO D 1 139 ? 16.460  13.170  42.265 1.00 29.73  ? 630  PRO D N   1 
ATOM   5624 C CA  . PRO D 1 139 ? 17.471  12.806  41.282 1.00 29.95  ? 630  PRO D CA  1 
ATOM   5625 C C   . PRO D 1 139 ? 17.429  13.740  40.086 1.00 31.21  ? 630  PRO D C   1 
ATOM   5626 O O   . PRO D 1 139 ? 16.378  14.272  39.716 1.00 32.41  ? 630  PRO D O   1 
ATOM   5627 C CB  . PRO D 1 139 ? 17.088  11.377  40.907 1.00 29.55  ? 630  PRO D CB  1 
ATOM   5628 C CG  . PRO D 1 139 ? 16.358  10.883  42.112 1.00 29.22  ? 630  PRO D CG  1 
ATOM   5629 C CD  . PRO D 1 139 ? 15.503  12.071  42.442 1.00 29.19  ? 630  PRO D CD  1 
ATOM   5630 N N   . ILE D 1 140 ? 18.586  13.937  39.481 1.00 30.83  ? 631  ILE D N   1 
ATOM   5631 C CA  . ILE D 1 140 ? 18.668  14.787  38.327 1.00 29.72  ? 631  ILE D CA  1 
ATOM   5632 C C   . ILE D 1 140 ? 18.312  13.983  37.075 1.00 29.48  ? 631  ILE D C   1 
ATOM   5633 O O   . ILE D 1 140 ? 18.804  12.869  36.858 1.00 24.70  ? 631  ILE D O   1 
ATOM   5634 C CB  . ILE D 1 140 ? 20.077  15.418  38.249 1.00 30.37  ? 631  ILE D CB  1 
ATOM   5635 C CG1 . ILE D 1 140 ? 20.269  16.317  39.473 1.00 29.31  ? 631  ILE D CG1 1 
ATOM   5636 C CG2 . ILE D 1 140 ? 20.250  16.223  36.955 1.00 29.92  ? 631  ILE D CG2 1 
ATOM   5637 C CD1 . ILE D 1 140 ? 21.492  17.170  39.421 1.00 32.71  ? 631  ILE D CD1 1 
ATOM   5638 N N   . ARG D 1 141 ? 17.421  14.555  36.271 1.00 30.50  ? 632  ARG D N   1 
ATOM   5639 C CA  . ARG D 1 141 ? 16.971  13.928  35.036 1.00 32.64  ? 632  ARG D CA  1 
ATOM   5640 C C   . ARG D 1 141 ? 18.092  13.970  34.016 1.00 33.19  ? 632  ARG D C   1 
ATOM   5641 O O   . ARG D 1 141 ? 18.386  12.986  33.334 1.00 31.99  ? 632  ARG D O   1 
ATOM   5642 C CB  . ARG D 1 141 ? 15.753  14.674  34.488 1.00 35.78  ? 632  ARG D CB  1 
ATOM   5643 C CG  . ARG D 1 141 ? 14.483  14.526  35.337 1.00 42.44  ? 632  ARG D CG  1 
ATOM   5644 C CD  . ARG D 1 141 ? 13.345  15.422  34.825 1.00 46.34  ? 632  ARG D CD  1 
ATOM   5645 N NE  . ARG D 1 141 ? 13.086  15.227  33.399 1.00 50.54  ? 632  ARG D NE  1 
ATOM   5646 C CZ  . ARG D 1 141 ? 12.315  16.019  32.659 1.00 53.18  ? 632  ARG D CZ  1 
ATOM   5647 N NH1 . ARG D 1 141 ? 11.718  17.066  33.209 1.00 55.37  ? 632  ARG D NH1 1 
ATOM   5648 N NH2 . ARG D 1 141 ? 12.158  15.781  31.362 1.00 55.68  ? 632  ARG D NH2 1 
ATOM   5649 N N   . HIS D 1 142 ? 18.725  15.131  33.927 1.00 34.23  ? 633  HIS D N   1 
ATOM   5650 C CA  . HIS D 1 142 ? 19.813  15.343  32.988 1.00 33.74  ? 633  HIS D CA  1 
ATOM   5651 C C   . HIS D 1 142 ? 20.319  16.772  33.118 1.00 33.95  ? 633  HIS D C   1 
ATOM   5652 O O   . HIS D 1 142 ? 19.783  17.571  33.899 1.00 33.93  ? 633  HIS D O   1 
ATOM   5653 C CB  . HIS D 1 142 ? 19.312  15.130  31.557 1.00 32.21  ? 633  HIS D CB  1 
ATOM   5654 C CG  . HIS D 1 142 ? 18.096  15.935  31.223 1.00 31.11  ? 633  HIS D CG  1 
ATOM   5655 N ND1 . HIS D 1 142 ? 16.822  15.411  31.262 1.00 33.04  ? 633  HIS D ND1 1 
ATOM   5656 C CD2 . HIS D 1 142 ? 17.956  17.237  30.880 1.00 30.99  ? 633  HIS D CD2 1 
ATOM   5657 C CE1 . HIS D 1 142 ? 15.949  16.356  30.957 1.00 32.40  ? 633  HIS D CE1 1 
ATOM   5658 N NE2 . HIS D 1 142 ? 16.612  17.474  30.721 1.00 31.19  ? 633  HIS D NE2 1 
ATOM   5659 N N   . TYR D 1 143 ? 21.356  17.082  32.346 1.00 31.94  ? 634  TYR D N   1 
ATOM   5660 C CA  . TYR D 1 143 ? 21.918  18.419  32.316 1.00 30.17  ? 634  TYR D CA  1 
ATOM   5661 C C   . TYR D 1 143 ? 21.626  18.975  30.919 1.00 30.13  ? 634  TYR D C   1 
ATOM   5662 O O   . TYR D 1 143 ? 21.582  18.229  29.935 1.00 28.49  ? 634  TYR D O   1 
ATOM   5663 C CB  . TYR D 1 143 ? 23.427  18.375  32.571 1.00 29.31  ? 634  TYR D CB  1 
ATOM   5664 C CG  . TYR D 1 143 ? 23.807  17.941  33.974 1.00 27.19  ? 634  TYR D CG  1 
ATOM   5665 C CD1 . TYR D 1 143 ? 23.756  18.836  35.043 1.00 25.96  ? 634  TYR D CD1 1 
ATOM   5666 C CD2 . TYR D 1 143 ? 24.178  16.625  34.234 1.00 25.22  ? 634  TYR D CD2 1 
ATOM   5667 C CE1 . TYR D 1 143 ? 24.062  18.425  36.336 1.00 26.30  ? 634  TYR D CE1 1 
ATOM   5668 C CE2 . TYR D 1 143 ? 24.480  16.202  35.516 1.00 24.76  ? 634  TYR D CE2 1 
ATOM   5669 C CZ  . TYR D 1 143 ? 24.420  17.101  36.567 1.00 26.63  ? 634  TYR D CZ  1 
ATOM   5670 O OH  . TYR D 1 143 ? 24.690  16.659  37.843 1.00 26.02  ? 634  TYR D OH  1 
ATOM   5671 N N   . LEU D 1 144 ? 21.396  20.281  30.845 1.00 30.15  ? 635  LEU D N   1 
ATOM   5672 C CA  . LEU D 1 144 ? 21.118  20.936  29.581 1.00 29.88  ? 635  LEU D CA  1 
ATOM   5673 C C   . LEU D 1 144 ? 22.237  21.913  29.260 1.00 29.73  ? 635  LEU D C   1 
ATOM   5674 O O   . LEU D 1 144 ? 22.360  22.960  29.897 1.00 29.88  ? 635  LEU D O   1 
ATOM   5675 C CB  . LEU D 1 144 ? 19.784  21.673  29.654 1.00 31.22  ? 635  LEU D CB  1 
ATOM   5676 C CG  . LEU D 1 144 ? 18.556  20.787  29.864 1.00 30.80  ? 635  LEU D CG  1 
ATOM   5677 C CD1 . LEU D 1 144 ? 17.315  21.646  30.048 1.00 29.38  ? 635  LEU D CD1 1 
ATOM   5678 C CD2 . LEU D 1 144 ? 18.399  19.868  28.668 1.00 31.58  ? 635  LEU D CD2 1 
ATOM   5679 N N   . VAL D 1 145 ? 23.050  21.548  28.272 1.00 30.42  ? 636  VAL D N   1 
ATOM   5680 C CA  . VAL D 1 145 ? 24.185  22.356  27.819 1.00 30.52  ? 636  VAL D CA  1 
ATOM   5681 C C   . VAL D 1 145 ? 23.821  23.244  26.626 1.00 32.49  ? 636  VAL D C   1 
ATOM   5682 O O   . VAL D 1 145 ? 23.318  22.769  25.608 1.00 32.14  ? 636  VAL D O   1 
ATOM   5683 C CB  . VAL D 1 145 ? 25.382  21.450  27.398 1.00 28.62  ? 636  VAL D CB  1 
ATOM   5684 C CG1 . VAL D 1 145 ? 26.460  22.277  26.714 1.00 26.31  ? 636  VAL D CG1 1 
ATOM   5685 C CG2 . VAL D 1 145 ? 25.954  20.745  28.615 1.00 28.22  ? 636  VAL D CG2 1 
ATOM   5686 N N   . ARG D 1 146 ? 24.073  24.537  26.759 1.00 34.81  ? 637  ARG D N   1 
ATOM   5687 C CA  . ARG D 1 146 ? 23.802  25.468  25.674 1.00 37.85  ? 637  ARG D CA  1 
ATOM   5688 C C   . ARG D 1 146 ? 25.001  26.402  25.561 1.00 36.89  ? 637  ARG D C   1 
ATOM   5689 O O   . ARG D 1 146 ? 25.381  27.048  26.529 1.00 37.58  ? 637  ARG D O   1 
ATOM   5690 C CB  . ARG D 1 146 ? 22.527  26.267  25.947 1.00 40.61  ? 637  ARG D CB  1 
ATOM   5691 C CG  . ARG D 1 146 ? 21.646  26.412  24.715 1.00 46.12  ? 637  ARG D CG  1 
ATOM   5692 C CD  . ARG D 1 146 ? 20.634  27.531  24.863 1.00 50.35  ? 637  ARG D CD  1 
ATOM   5693 N NE  . ARG D 1 146 ? 19.779  27.356  26.032 1.00 54.76  ? 637  ARG D NE  1 
ATOM   5694 C CZ  . ARG D 1 146 ? 18.847  28.231  26.404 1.00 58.09  ? 637  ARG D CZ  1 
ATOM   5695 N NH1 . ARG D 1 146 ? 18.661  29.340  25.690 1.00 58.59  ? 637  ARG D NH1 1 
ATOM   5696 N NH2 . ARG D 1 146 ? 18.095  27.995  27.479 1.00 57.73  ? 637  ARG D NH2 1 
ATOM   5697 N N   . TYR D 1 147 ? 25.603  26.462  24.380 1.00 36.98  ? 638  TYR D N   1 
ATOM   5698 C CA  . TYR D 1 147 ? 26.772  27.308  24.173 1.00 37.41  ? 638  TYR D CA  1 
ATOM   5699 C C   . TYR D 1 147 ? 26.713  28.099  22.864 1.00 37.30  ? 638  TYR D C   1 
ATOM   5700 O O   . TYR D 1 147 ? 25.821  27.890  22.043 1.00 36.23  ? 638  TYR D O   1 
ATOM   5701 C CB  . TYR D 1 147 ? 28.040  26.450  24.216 1.00 36.53  ? 638  TYR D CB  1 
ATOM   5702 C CG  . TYR D 1 147 ? 28.274  25.625  22.978 1.00 38.05  ? 638  TYR D CG  1 
ATOM   5703 C CD1 . TYR D 1 147 ? 29.191  26.036  22.020 1.00 39.95  ? 638  TYR D CD1 1 
ATOM   5704 C CD2 . TYR D 1 147 ? 27.571  24.439  22.752 1.00 39.26  ? 638  TYR D CD2 1 
ATOM   5705 C CE1 . TYR D 1 147 ? 29.409  25.295  20.866 1.00 41.99  ? 638  TYR D CE1 1 
ATOM   5706 C CE2 . TYR D 1 147 ? 27.778  23.687  21.596 1.00 39.36  ? 638  TYR D CE2 1 
ATOM   5707 C CZ  . TYR D 1 147 ? 28.700  24.125  20.656 1.00 41.80  ? 638  TYR D CZ  1 
ATOM   5708 O OH  . TYR D 1 147 ? 28.908  23.429  19.486 1.00 43.55  ? 638  TYR D OH  1 
ATOM   5709 N N   . ARG D 1 148 ? 27.666  29.015  22.690 1.00 38.32  ? 639  ARG D N   1 
ATOM   5710 C CA  . ARG D 1 148 ? 27.747  29.851  21.489 1.00 38.38  ? 639  ARG D CA  1 
ATOM   5711 C C   . ARG D 1 148 ? 29.035  30.653  21.442 1.00 36.31  ? 639  ARG D C   1 
ATOM   5712 O O   . ARG D 1 148 ? 29.790  30.701  22.403 1.00 36.18  ? 639  ARG D O   1 
ATOM   5713 C CB  . ARG D 1 148 ? 26.594  30.852  21.451 1.00 41.50  ? 639  ARG D CB  1 
ATOM   5714 C CG  . ARG D 1 148 ? 26.762  31.973  22.468 1.00 44.32  ? 639  ARG D CG  1 
ATOM   5715 C CD  . ARG D 1 148 ? 25.585  32.912  22.481 1.00 46.20  ? 639  ARG D CD  1 
ATOM   5716 N NE  . ARG D 1 148 ? 25.518  33.638  23.745 1.00 49.73  ? 639  ARG D NE  1 
ATOM   5717 C CZ  . ARG D 1 148 ? 24.489  34.394  24.119 1.00 52.89  ? 639  ARG D CZ  1 
ATOM   5718 N NH1 . ARG D 1 148 ? 23.433  34.531  23.322 1.00 53.79  ? 639  ARG D NH1 1 
ATOM   5719 N NH2 . ARG D 1 148 ? 24.504  34.998  25.301 1.00 53.47  ? 639  ARG D NH2 1 
ATOM   5720 N N   . ALA D 1 149 ? 29.276  31.284  20.304 1.00 35.40  ? 640  ALA D N   1 
ATOM   5721 C CA  . ALA D 1 149 ? 30.436  32.138  20.152 1.00 35.74  ? 640  ALA D CA  1 
ATOM   5722 C C   . ALA D 1 149 ? 29.824  33.459  20.562 1.00 36.43  ? 640  ALA D C   1 
ATOM   5723 O O   . ALA D 1 149 ? 28.650  33.686  20.284 1.00 35.99  ? 640  ALA D O   1 
ATOM   5724 C CB  . ALA D 1 149 ? 30.877  32.186  18.704 1.00 33.72  ? 640  ALA D CB  1 
ATOM   5725 N N   . LEU D 1 150 ? 30.579  34.315  21.244 1.00 37.98  ? 641  LEU D N   1 
ATOM   5726 C CA  . LEU D 1 150 ? 30.029  35.601  21.660 1.00 39.97  ? 641  LEU D CA  1 
ATOM   5727 C C   . LEU D 1 150 ? 29.636  36.395  20.422 1.00 43.08  ? 641  LEU D C   1 
ATOM   5728 O O   . LEU D 1 150 ? 30.387  36.440  19.442 1.00 43.72  ? 641  LEU D O   1 
ATOM   5729 C CB  . LEU D 1 150 ? 31.044  36.396  22.484 1.00 37.92  ? 641  LEU D CB  1 
ATOM   5730 C CG  . LEU D 1 150 ? 31.541  35.781  23.793 1.00 35.36  ? 641  LEU D CG  1 
ATOM   5731 C CD1 . LEU D 1 150 ? 32.401  36.791  24.509 1.00 33.96  ? 641  LEU D CD1 1 
ATOM   5732 C CD2 . LEU D 1 150 ? 30.373  35.373  24.666 1.00 33.58  ? 641  LEU D CD2 1 
ATOM   5733 N N   . SER D 1 151 ? 28.449  36.998  20.482 1.00 46.53  ? 642  SER D N   1 
ATOM   5734 C CA  . SER D 1 151 ? 27.863  37.807  19.403 1.00 50.65  ? 642  SER D CA  1 
ATOM   5735 C C   . SER D 1 151 ? 27.276  36.945  18.290 1.00 51.43  ? 642  SER D C   1 
ATOM   5736 O O   . SER D 1 151 ? 26.354  37.369  17.594 1.00 52.61  ? 642  SER D O   1 
ATOM   5737 C CB  . SER D 1 151 ? 28.887  38.787  18.804 1.00 51.27  ? 642  SER D CB  1 
ATOM   5738 O OG  . SER D 1 151 ? 29.557  38.221  17.691 1.00 54.32  ? 642  SER D OG  1 
ATOM   5739 N N   . SER D 1 152 ? 27.815  35.741  18.121 1.00 52.10  ? 643  SER D N   1 
ATOM   5740 C CA  . SER D 1 152 ? 27.321  34.826  17.100 1.00 53.16  ? 643  SER D CA  1 
ATOM   5741 C C   . SER D 1 152 ? 26.013  34.226  17.628 1.00 53.94  ? 643  SER D C   1 
ATOM   5742 O O   . SER D 1 152 ? 25.544  34.619  18.691 1.00 54.67  ? 643  SER D O   1 
ATOM   5743 C CB  . SER D 1 152 ? 28.365  33.734  16.833 1.00 52.82  ? 643  SER D CB  1 
ATOM   5744 O OG  . SER D 1 152 ? 28.010  32.918  15.728 1.00 53.36  ? 643  SER D OG  1 
ATOM   5745 N N   . GLU D 1 153 ? 25.423  33.285  16.898 1.00 56.09  ? 644  GLU D N   1 
ATOM   5746 C CA  . GLU D 1 153 ? 24.162  32.667  17.326 1.00 57.56  ? 644  GLU D CA  1 
ATOM   5747 C C   . GLU D 1 153 ? 24.365  31.413  18.179 1.00 56.35  ? 644  GLU D C   1 
ATOM   5748 O O   . GLU D 1 153 ? 25.462  30.851  18.226 1.00 55.92  ? 644  GLU D O   1 
ATOM   5749 C CB  . GLU D 1 153 ? 23.297  32.307  16.106 1.00 60.40  ? 644  GLU D CB  1 
ATOM   5750 C CG  . GLU D 1 153 ? 22.893  33.489  15.226 1.00 65.75  ? 644  GLU D CG  1 
ATOM   5751 C CD  . GLU D 1 153 ? 22.120  34.558  15.987 1.00 69.56  ? 644  GLU D CD  1 
ATOM   5752 O OE1 . GLU D 1 153 ? 21.095  34.212  16.617 1.00 71.61  ? 644  GLU D OE1 1 
ATOM   5753 O OE2 . GLU D 1 153 ? 22.532  35.743  15.955 1.00 71.01  ? 644  GLU D OE2 1 
ATOM   5754 N N   . TRP D 1 154 ? 23.293  30.987  18.847 1.00 54.56  ? 645  TRP D N   1 
ATOM   5755 C CA  . TRP D 1 154 ? 23.300  29.797  19.701 1.00 53.51  ? 645  TRP D CA  1 
ATOM   5756 C C   . TRP D 1 154 ? 23.472  28.493  18.924 1.00 51.78  ? 645  TRP D C   1 
ATOM   5757 O O   . TRP D 1 154 ? 22.787  28.246  17.935 1.00 51.31  ? 645  TRP D O   1 
ATOM   5758 C CB  . TRP D 1 154 ? 21.993  29.699  20.487 1.00 54.79  ? 645  TRP D CB  1 
ATOM   5759 C CG  . TRP D 1 154 ? 21.894  30.603  21.660 1.00 56.86  ? 645  TRP D CG  1 
ATOM   5760 C CD1 . TRP D 1 154 ? 20.999  31.617  21.841 1.00 57.91  ? 645  TRP D CD1 1 
ATOM   5761 C CD2 . TRP D 1 154 ? 22.692  30.551  22.848 1.00 57.46  ? 645  TRP D CD2 1 
ATOM   5762 N NE1 . TRP D 1 154 ? 21.187  32.199  23.073 1.00 58.72  ? 645  TRP D NE1 1 
ATOM   5763 C CE2 . TRP D 1 154 ? 22.220  31.563  23.711 1.00 57.86  ? 645  TRP D CE2 1 
ATOM   5764 C CE3 . TRP D 1 154 ? 23.758  29.747  23.266 1.00 56.37  ? 645  TRP D CE3 1 
ATOM   5765 C CZ2 . TRP D 1 154 ? 22.780  31.791  24.971 1.00 57.59  ? 645  TRP D CZ2 1 
ATOM   5766 C CZ3 . TRP D 1 154 ? 24.313  29.974  24.514 1.00 56.71  ? 645  TRP D CZ3 1 
ATOM   5767 C CH2 . TRP D 1 154 ? 23.822  30.989  25.354 1.00 57.16  ? 645  TRP D CH2 1 
ATOM   5768 N N   . LYS D 1 155 ? 24.382  27.650  19.388 1.00 50.23  ? 646  LYS D N   1 
ATOM   5769 C CA  . LYS D 1 155 ? 24.615  26.368  18.744 1.00 49.84  ? 646  LYS D CA  1 
ATOM   5770 C C   . LYS D 1 155 ? 23.511  25.411  19.184 1.00 49.51  ? 646  LYS D C   1 
ATOM   5771 O O   . LYS D 1 155 ? 22.705  25.733  20.058 1.00 49.50  ? 646  LYS D O   1 
ATOM   5772 C CB  . LYS D 1 155 ? 25.980  25.808  19.157 1.00 51.37  ? 646  LYS D CB  1 
ATOM   5773 C CG  . LYS D 1 155 ? 27.175  26.517  18.544 1.00 51.65  ? 646  LYS D CG  1 
ATOM   5774 C CD  . LYS D 1 155 ? 27.316  26.171  17.072 1.00 53.79  ? 646  LYS D CD  1 
ATOM   5775 C CE  . LYS D 1 155 ? 28.646  26.651  16.516 1.00 55.89  ? 646  LYS D CE  1 
ATOM   5776 N NZ  . LYS D 1 155 ? 28.867  26.157  15.128 1.00 57.16  ? 646  LYS D NZ  1 
ATOM   5777 N N   . PRO D 1 156 ? 23.449  24.221  18.573 1.00 49.03  ? 647  PRO D N   1 
ATOM   5778 C CA  . PRO D 1 156 ? 22.404  23.278  18.973 1.00 47.93  ? 647  PRO D CA  1 
ATOM   5779 C C   . PRO D 1 156 ? 22.599  22.855  20.428 1.00 46.71  ? 647  PRO D C   1 
ATOM   5780 O O   . PRO D 1 156 ? 23.687  22.432  20.821 1.00 46.46  ? 647  PRO D O   1 
ATOM   5781 C CB  . PRO D 1 156 ? 22.593  22.117  17.997 1.00 47.78  ? 647  PRO D CB  1 
ATOM   5782 C CG  . PRO D 1 156 ? 23.144  22.800  16.774 1.00 48.60  ? 647  PRO D CG  1 
ATOM   5783 C CD  . PRO D 1 156 ? 24.155  23.745  17.371 1.00 49.48  ? 647  PRO D CD  1 
ATOM   5784 N N   . GLU D 1 157 ? 21.535  22.979  21.214 1.00 45.20  ? 648  GLU D N   1 
ATOM   5785 C CA  . GLU D 1 157 ? 21.549  22.624  22.625 1.00 42.95  ? 648  GLU D CA  1 
ATOM   5786 C C   . GLU D 1 157 ? 21.792  21.126  22.804 1.00 41.28  ? 648  GLU D C   1 
ATOM   5787 O O   . GLU D 1 157 ? 21.273  20.306  22.054 1.00 40.94  ? 648  GLU D O   1 
ATOM   5788 C CB  . GLU D 1 157 ? 20.226  23.052  23.255 1.00 43.60  ? 648  GLU D CB  1 
ATOM   5789 C CG  . GLU D 1 157 ? 20.019  22.629  24.683 1.00 46.82  ? 648  GLU D CG  1 
ATOM   5790 C CD  . GLU D 1 157 ? 18.708  23.155  25.238 1.00 48.43  ? 648  GLU D CD  1 
ATOM   5791 O OE1 . GLU D 1 157 ? 17.778  23.378  24.431 1.00 49.67  ? 648  GLU D OE1 1 
ATOM   5792 O OE2 . GLU D 1 157 ? 18.600  23.332  26.473 1.00 49.06  ? 648  GLU D OE2 1 
ATOM   5793 N N   . ILE D 1 158 ? 22.601  20.786  23.801 1.00 40.00  ? 649  ILE D N   1 
ATOM   5794 C CA  . ILE D 1 158 ? 22.962  19.400  24.096 1.00 38.32  ? 649  ILE D CA  1 
ATOM   5795 C C   . ILE D 1 158 ? 22.236  18.902  25.341 1.00 38.14  ? 649  ILE D C   1 
ATOM   5796 O O   . ILE D 1 158 ? 21.846  19.698  26.190 1.00 36.83  ? 649  ILE D O   1 
ATOM   5797 C CB  . ILE D 1 158 ? 24.490  19.281  24.356 1.00 36.44  ? 649  ILE D CB  1 
ATOM   5798 C CG1 . ILE D 1 158 ? 25.262  19.774  23.136 1.00 34.71  ? 649  ILE D CG1 1 
ATOM   5799 C CG2 . ILE D 1 158 ? 24.864  17.850  24.709 1.00 34.48  ? 649  ILE D CG2 1 
ATOM   5800 C CD1 . ILE D 1 158 ? 26.761  19.849  23.342 1.00 32.06  ? 649  ILE D CD1 1 
ATOM   5801 N N   . ARG D 1 159 ? 22.056  17.589  25.444 1.00 38.68  ? 650  ARG D N   1 
ATOM   5802 C CA  . ARG D 1 159 ? 21.413  16.999  26.615 1.00 40.87  ? 650  ARG D CA  1 
ATOM   5803 C C   . ARG D 1 159 ? 22.366  15.984  27.236 1.00 40.41  ? 650  ARG D C   1 
ATOM   5804 O O   . ARG D 1 159 ? 22.766  15.024  26.586 1.00 41.94  ? 650  ARG D O   1 
ATOM   5805 C CB  . ARG D 1 159 ? 20.105  16.312  26.231 1.00 43.23  ? 650  ARG D CB  1 
ATOM   5806 C CG  . ARG D 1 159 ? 19.445  15.568  27.378 1.00 46.80  ? 650  ARG D CG  1 
ATOM   5807 C CD  . ARG D 1 159 ? 18.328  14.669  26.882 1.00 52.13  ? 650  ARG D CD  1 
ATOM   5808 N NE  . ARG D 1 159 ? 17.679  13.951  27.974 1.00 56.92  ? 650  ARG D NE  1 
ATOM   5809 C CZ  . ARG D 1 159 ? 16.732  13.030  27.813 1.00 59.44  ? 650  ARG D CZ  1 
ATOM   5810 N NH1 . ARG D 1 159 ? 16.315  12.702  26.593 1.00 58.50  ? 650  ARG D NH1 1 
ATOM   5811 N NH2 . ARG D 1 159 ? 16.201  12.439  28.878 1.00 59.95  ? 650  ARG D NH2 1 
ATOM   5812 N N   . LEU D 1 160 ? 22.723  16.196  28.498 1.00 40.11  ? 651  LEU D N   1 
ATOM   5813 C CA  . LEU D 1 160 ? 23.657  15.311  29.193 1.00 39.52  ? 651  LEU D CA  1 
ATOM   5814 C C   . LEU D 1 160 ? 23.027  14.385  30.218 1.00 39.77  ? 651  LEU D C   1 
ATOM   5815 O O   . LEU D 1 160 ? 22.256  14.815  31.074 1.00 41.25  ? 651  LEU D O   1 
ATOM   5816 C CB  . LEU D 1 160 ? 24.727  16.129  29.921 1.00 38.08  ? 651  LEU D CB  1 
ATOM   5817 C CG  . LEU D 1 160 ? 25.764  16.907  29.120 1.00 37.74  ? 651  LEU D CG  1 
ATOM   5818 C CD1 . LEU D 1 160 ? 26.704  17.625  30.083 1.00 38.14  ? 651  LEU D CD1 1 
ATOM   5819 C CD2 . LEU D 1 160 ? 26.540  15.951  28.229 1.00 37.50  ? 651  LEU D CD2 1 
ATOM   5820 N N   . PRO D 1 161 ? 23.360  13.094  30.151 1.00 39.43  ? 652  PRO D N   1 
ATOM   5821 C CA  . PRO D 1 161 ? 22.826  12.109  31.098 1.00 37.44  ? 652  PRO D CA  1 
ATOM   5822 C C   . PRO D 1 161 ? 23.243  12.514  32.515 1.00 35.10  ? 652  PRO D C   1 
ATOM   5823 O O   . PRO D 1 161 ? 24.338  13.030  32.724 1.00 34.41  ? 652  PRO D O   1 
ATOM   5824 C CB  . PRO D 1 161 ? 23.506  10.810  30.661 1.00 36.98  ? 652  PRO D CB  1 
ATOM   5825 C CG  . PRO D 1 161 ? 23.674  11.000  29.187 1.00 38.04  ? 652  PRO D CG  1 
ATOM   5826 C CD  . PRO D 1 161 ? 24.133  12.439  29.080 1.00 38.77  ? 652  PRO D CD  1 
ATOM   5827 N N   . SER D 1 162 ? 22.380  12.266  33.486 1.00 34.65  ? 653  SER D N   1 
ATOM   5828 C CA  . SER D 1 162 ? 22.673  12.615  34.874 1.00 33.57  ? 653  SER D CA  1 
ATOM   5829 C C   . SER D 1 162 ? 24.031  12.094  35.314 1.00 33.12  ? 653  SER D C   1 
ATOM   5830 O O   . SER D 1 162 ? 24.645  12.642  36.228 1.00 35.65  ? 653  SER D O   1 
ATOM   5831 C CB  . SER D 1 162 ? 21.617  12.025  35.801 1.00 32.87  ? 653  SER D CB  1 
ATOM   5832 O OG  . SER D 1 162 ? 21.765  10.617  35.862 1.00 30.77  ? 653  SER D OG  1 
ATOM   5833 N N   . GLY D 1 163 ? 24.487  11.025  34.673 1.00 31.89  ? 654  GLY D N   1 
ATOM   5834 C CA  . GLY D 1 163 ? 25.758  10.435  35.031 1.00 30.33  ? 654  GLY D CA  1 
ATOM   5835 C C   . GLY D 1 163 ? 26.959  11.041  34.342 1.00 30.83  ? 654  GLY D C   1 
ATOM   5836 O O   . GLY D 1 163 ? 28.088  10.691  34.678 1.00 31.11  ? 654  GLY D O   1 
ATOM   5837 N N   . SER D 1 164 ? 26.736  11.937  33.383 1.00 30.64  ? 655  SER D N   1 
ATOM   5838 C CA  . SER D 1 164 ? 27.850  12.567  32.677 1.00 31.81  ? 655  SER D CA  1 
ATOM   5839 C C   . SER D 1 164 ? 28.743  13.248  33.680 1.00 33.46  ? 655  SER D C   1 
ATOM   5840 O O   . SER D 1 164 ? 28.263  13.771  34.694 1.00 35.06  ? 655  SER D O   1 
ATOM   5841 C CB  . SER D 1 164 ? 27.366  13.631  31.704 1.00 31.70  ? 655  SER D CB  1 
ATOM   5842 O OG  . SER D 1 164 ? 26.398  13.114  30.828 1.00 36.12  ? 655  SER D OG  1 
ATOM   5843 N N   . ASP D 1 165 ? 30.039  13.255  33.394 1.00 34.29  ? 656  ASP D N   1 
ATOM   5844 C CA  . ASP D 1 165 ? 31.004  13.896  34.274 1.00 34.50  ? 656  ASP D CA  1 
ATOM   5845 C C   . ASP D 1 165 ? 31.589  15.125  33.591 1.00 34.26  ? 656  ASP D C   1 
ATOM   5846 O O   . ASP D 1 165 ? 32.226  15.955  34.233 1.00 33.52  ? 656  ASP D O   1 
ATOM   5847 C CB  . ASP D 1 165 ? 32.121  12.916  34.659 1.00 34.91  ? 656  ASP D CB  1 
ATOM   5848 C CG  . ASP D 1 165 ? 31.638  11.814  35.607 1.00 38.67  ? 656  ASP D CG  1 
ATOM   5849 O OD1 . ASP D 1 165 ? 30.924  12.123  36.591 1.00 40.82  ? 656  ASP D OD1 1 
ATOM   5850 O OD2 . ASP D 1 165 ? 31.983  10.635  35.385 1.00 40.68  ? 656  ASP D OD2 1 
ATOM   5851 N N   . HIS D 1 166 ? 31.356  15.243  32.287 1.00 34.05  ? 657  HIS D N   1 
ATOM   5852 C CA  . HIS D 1 166 ? 31.862  16.375  31.525 1.00 35.58  ? 657  HIS D CA  1 
ATOM   5853 C C   . HIS D 1 166 ? 31.148  16.526  30.183 1.00 36.14  ? 657  HIS D C   1 
ATOM   5854 O O   . HIS D 1 166 ? 30.405  15.643  29.753 1.00 35.45  ? 657  HIS D O   1 
ATOM   5855 C CB  . HIS D 1 166 ? 33.350  16.201  31.257 1.00 36.37  ? 657  HIS D CB  1 
ATOM   5856 C CG  . HIS D 1 166 ? 33.667  14.956  30.492 1.00 40.50  ? 657  HIS D CG  1 
ATOM   5857 N ND1 . HIS D 1 166 ? 33.895  13.742  31.106 1.00 41.84  ? 657  HIS D ND1 1 
ATOM   5858 C CD2 . HIS D 1 166 ? 33.706  14.717  29.159 1.00 39.95  ? 657  HIS D CD2 1 
ATOM   5859 C CE1 . HIS D 1 166 ? 34.057  12.810  30.185 1.00 40.77  ? 657  HIS D CE1 1 
ATOM   5860 N NE2 . HIS D 1 166 ? 33.945  13.375  28.996 1.00 39.92  ? 657  HIS D NE2 1 
ATOM   5861 N N   . VAL D 1 167 ? 31.382  17.660  29.530 1.00 36.18  ? 658  VAL D N   1 
ATOM   5862 C CA  . VAL D 1 167 ? 30.811  17.934  28.221 1.00 36.49  ? 658  VAL D CA  1 
ATOM   5863 C C   . VAL D 1 167 ? 31.970  18.380  27.356 1.00 38.17  ? 658  VAL D C   1 
ATOM   5864 O O   . VAL D 1 167 ? 32.749  19.252  27.745 1.00 38.95  ? 658  VAL D O   1 
ATOM   5865 C CB  . VAL D 1 167 ? 29.748  19.061  28.248 1.00 36.06  ? 658  VAL D CB  1 
ATOM   5866 C CG1 . VAL D 1 167 ? 30.288  20.298  28.950 1.00 33.68  ? 658  VAL D CG1 1 
ATOM   5867 C CG2 . VAL D 1 167 ? 29.347  19.407  26.832 1.00 34.41  ? 658  VAL D CG2 1 
ATOM   5868 N N   . MET D 1 168 ? 32.088  17.772  26.185 1.00 39.42  ? 659  MET D N   1 
ATOM   5869 C CA  . MET D 1 168 ? 33.162  18.096  25.267 1.00 38.63  ? 659  MET D CA  1 
ATOM   5870 C C   . MET D 1 168 ? 32.639  18.976  24.146 1.00 38.09  ? 659  MET D C   1 
ATOM   5871 O O   . MET D 1 168 ? 31.612  18.679  23.548 1.00 38.44  ? 659  MET D O   1 
ATOM   5872 C CB  . MET D 1 168 ? 33.735  16.806  24.685 1.00 39.39  ? 659  MET D CB  1 
ATOM   5873 C CG  . MET D 1 168 ? 34.953  16.989  23.805 1.00 42.07  ? 659  MET D CG  1 
ATOM   5874 S SD  . MET D 1 168 ? 36.415  17.409  24.756 1.00 47.20  ? 659  MET D SD  1 
ATOM   5875 C CE  . MET D 1 168 ? 36.539  15.979  25.858 1.00 43.09  ? 659  MET D CE  1 
ATOM   5876 N N   . LEU D 1 169 ? 33.337  20.073  23.882 1.00 37.82  ? 660  LEU D N   1 
ATOM   5877 C CA  . LEU D 1 169 ? 32.965  20.974  22.798 1.00 37.60  ? 660  LEU D CA  1 
ATOM   5878 C C   . LEU D 1 169 ? 34.156  20.936  21.837 1.00 38.71  ? 660  LEU D C   1 
ATOM   5879 O O   . LEU D 1 169 ? 35.278  21.291  22.207 1.00 38.52  ? 660  LEU D O   1 
ATOM   5880 C CB  . LEU D 1 169 ? 32.731  22.395  23.324 1.00 36.48  ? 660  LEU D CB  1 
ATOM   5881 C CG  . LEU D 1 169 ? 31.752  22.561  24.497 1.00 35.64  ? 660  LEU D CG  1 
ATOM   5882 C CD1 . LEU D 1 169 ? 31.669  24.029  24.872 1.00 34.46  ? 660  LEU D CD1 1 
ATOM   5883 C CD2 . LEU D 1 169 ? 30.378  22.027  24.132 1.00 32.84  ? 660  LEU D CD2 1 
ATOM   5884 N N   . LYS D 1 170 ? 33.916  20.471  20.616 1.00 39.36  ? 661  LYS D N   1 
ATOM   5885 C CA  . LYS D 1 170 ? 34.973  20.356  19.619 1.00 39.92  ? 661  LYS D CA  1 
ATOM   5886 C C   . LYS D 1 170 ? 34.594  21.022  18.311 1.00 39.15  ? 661  LYS D C   1 
ATOM   5887 O O   . LYS D 1 170 ? 33.501  21.571  18.177 1.00 39.25  ? 661  LYS D O   1 
ATOM   5888 C CB  . LYS D 1 170 ? 35.302  18.879  19.363 1.00 42.85  ? 661  LYS D CB  1 
ATOM   5889 C CG  . LYS D 1 170 ? 36.027  18.198  20.528 1.00 47.94  ? 661  LYS D CG  1 
ATOM   5890 C CD  . LYS D 1 170 ? 36.591  16.811  20.175 1.00 50.44  ? 661  LYS D CD  1 
ATOM   5891 C CE  . LYS D 1 170 ? 37.596  16.339  21.255 1.00 51.67  ? 661  LYS D CE  1 
ATOM   5892 N NZ  . LYS D 1 170 ? 38.126  14.949  21.073 1.00 48.26  ? 661  LYS D NZ  1 
ATOM   5893 N N   . SER D 1 171 ? 35.511  20.975  17.351 1.00 38.31  ? 662  SER D N   1 
ATOM   5894 C CA  . SER D 1 171 ? 35.288  21.559  16.029 1.00 36.90  ? 662  SER D CA  1 
ATOM   5895 C C   . SER D 1 171 ? 34.790  22.993  16.121 1.00 35.70  ? 662  SER D C   1 
ATOM   5896 O O   . SER D 1 171 ? 33.837  23.380  15.434 1.00 34.93  ? 662  SER D O   1 
ATOM   5897 C CB  . SER D 1 171 ? 34.277  20.716  15.241 1.00 36.91  ? 662  SER D CB  1 
ATOM   5898 O OG  . SER D 1 171 ? 34.726  19.376  15.094 1.00 38.23  ? 662  SER D OG  1 
ATOM   5899 N N   . LEU D 1 172 ? 35.432  23.783  16.970 1.00 33.01  ? 663  LEU D N   1 
ATOM   5900 C CA  . LEU D 1 172 ? 35.027  25.170  17.126 1.00 32.62  ? 663  LEU D CA  1 
ATOM   5901 C C   . LEU D 1 172 ? 35.855  26.081  16.236 1.00 33.09  ? 663  LEU D C   1 
ATOM   5902 O O   . LEU D 1 172 ? 36.907  25.675  15.729 1.00 32.87  ? 663  LEU D O   1 
ATOM   5903 C CB  . LEU D 1 172 ? 35.178  25.597  18.582 1.00 29.14  ? 663  LEU D CB  1 
ATOM   5904 C CG  . LEU D 1 172 ? 34.310  24.805  19.554 1.00 26.15  ? 663  LEU D CG  1 
ATOM   5905 C CD1 . LEU D 1 172 ? 34.767  25.050  20.985 1.00 25.36  ? 663  LEU D CD1 1 
ATOM   5906 C CD2 . LEU D 1 172 ? 32.865  25.197  19.348 1.00 22.76  ? 663  LEU D CD2 1 
ATOM   5907 N N   . ASP D 1 173 ? 35.374  27.306  16.039 1.00 33.41  ? 664  ASP D N   1 
ATOM   5908 C CA  . ASP D 1 173 ? 36.093  28.282  15.231 1.00 34.02  ? 664  ASP D CA  1 
ATOM   5909 C C   . ASP D 1 173 ? 37.421  28.537  15.934 1.00 34.72  ? 664  ASP D C   1 
ATOM   5910 O O   . ASP D 1 173 ? 37.532  28.324  17.141 1.00 36.17  ? 664  ASP D O   1 
ATOM   5911 C CB  . ASP D 1 173 ? 35.306  29.592  15.132 1.00 34.23  ? 664  ASP D CB  1 
ATOM   5912 C CG  . ASP D 1 173 ? 33.984  29.435  14.396 1.00 36.09  ? 664  ASP D CG  1 
ATOM   5913 O OD1 . ASP D 1 173 ? 33.999  29.071  13.205 1.00 36.37  ? 664  ASP D OD1 1 
ATOM   5914 O OD2 . ASP D 1 173 ? 32.924  29.684  15.007 1.00 38.47  ? 664  ASP D OD2 1 
ATOM   5915 N N   . TRP D 1 174 ? 38.423  28.987  15.186 1.00 35.51  ? 665  TRP D N   1 
ATOM   5916 C CA  . TRP D 1 174 ? 39.736  29.268  15.758 1.00 35.53  ? 665  TRP D CA  1 
ATOM   5917 C C   . TRP D 1 174 ? 39.823  30.694  16.260 1.00 36.19  ? 665  TRP D C   1 
ATOM   5918 O O   . TRP D 1 174 ? 39.140  31.575  15.752 1.00 36.09  ? 665  TRP D O   1 
ATOM   5919 C CB  . TRP D 1 174 ? 40.839  29.014  14.729 1.00 34.70  ? 665  TRP D CB  1 
ATOM   5920 C CG  . TRP D 1 174 ? 41.007  27.572  14.445 1.00 34.04  ? 665  TRP D CG  1 
ATOM   5921 C CD1 . TRP D 1 174 ? 40.335  26.836  13.518 1.00 31.78  ? 665  TRP D CD1 1 
ATOM   5922 C CD2 . TRP D 1 174 ? 41.828  26.656  15.171 1.00 32.82  ? 665  TRP D CD2 1 
ATOM   5923 N NE1 . TRP D 1 174 ? 40.683  25.515  13.624 1.00 33.02  ? 665  TRP D NE1 1 
ATOM   5924 C CE2 . TRP D 1 174 ? 41.599  25.375  14.633 1.00 32.75  ? 665  TRP D CE2 1 
ATOM   5925 C CE3 . TRP D 1 174 ? 42.735  26.794  16.229 1.00 34.00  ? 665  TRP D CE3 1 
ATOM   5926 C CZ2 . TRP D 1 174 ? 42.243  24.233  15.115 1.00 32.91  ? 665  TRP D CZ2 1 
ATOM   5927 C CZ3 . TRP D 1 174 ? 43.381  25.657  16.710 1.00 33.90  ? 665  TRP D CZ3 1 
ATOM   5928 C CH2 . TRP D 1 174 ? 43.129  24.394  16.151 1.00 33.32  ? 665  TRP D CH2 1 
ATOM   5929 N N   . ASN D 1 175 ? 40.667  30.906  17.267 1.00 36.41  ? 666  ASN D N   1 
ATOM   5930 C CA  . ASN D 1 175 ? 40.850  32.222  17.863 1.00 35.38  ? 666  ASN D CA  1 
ATOM   5931 C C   . ASN D 1 175 ? 39.516  32.936  18.078 1.00 34.64  ? 666  ASN D C   1 
ATOM   5932 O O   . ASN D 1 175 ? 39.341  34.085  17.679 1.00 33.28  ? 666  ASN D O   1 
ATOM   5933 C CB  . ASN D 1 175 ? 41.765  33.063  16.981 1.00 36.75  ? 666  ASN D CB  1 
ATOM   5934 C CG  . ASN D 1 175 ? 42.088  34.412  17.596 1.00 40.18  ? 666  ASN D CG  1 
ATOM   5935 O OD1 . ASN D 1 175 ? 42.341  34.519  18.803 1.00 41.75  ? 666  ASN D OD1 1 
ATOM   5936 N ND2 . ASN D 1 175 ? 42.094  35.452  16.766 1.00 38.87  ? 666  ASN D ND2 1 
ATOM   5937 N N   . ALA D 1 176 ? 38.578  32.240  18.718 1.00 34.68  ? 667  ALA D N   1 
ATOM   5938 C CA  . ALA D 1 176 ? 37.253  32.781  18.988 1.00 34.19  ? 667  ALA D CA  1 
ATOM   5939 C C   . ALA D 1 176 ? 36.857  32.591  20.451 1.00 34.12  ? 667  ALA D C   1 
ATOM   5940 O O   . ALA D 1 176 ? 37.328  31.665  21.117 1.00 35.87  ? 667  ALA D O   1 
ATOM   5941 C CB  . ALA D 1 176 ? 36.233  32.108  18.082 1.00 33.50  ? 667  ALA D CB  1 
ATOM   5942 N N   . GLU D 1 177 ? 35.987  33.469  20.942 1.00 33.22  ? 668  GLU D N   1 
ATOM   5943 C CA  . GLU D 1 177 ? 35.517  33.412  22.323 1.00 32.45  ? 668  GLU D CA  1 
ATOM   5944 C C   . GLU D 1 177 ? 34.094  32.865  22.452 1.00 31.78  ? 668  GLU D C   1 
ATOM   5945 O O   . GLU D 1 177 ? 33.173  33.325  21.771 1.00 29.92  ? 668  GLU D O   1 
ATOM   5946 C CB  . GLU D 1 177 ? 35.591  34.806  22.955 1.00 32.24  ? 668  GLU D CB  1 
ATOM   5947 C CG  . GLU D 1 177 ? 37.011  35.265  23.257 1.00 34.06  ? 668  GLU D CG  1 
ATOM   5948 C CD  . GLU D 1 177 ? 37.093  36.729  23.673 1.00 36.64  ? 668  GLU D CD  1 
ATOM   5949 O OE1 . GLU D 1 177 ? 36.459  37.115  24.678 1.00 36.38  ? 668  GLU D OE1 1 
ATOM   5950 O OE2 . GLU D 1 177 ? 37.800  37.496  22.988 1.00 37.86  ? 668  GLU D OE2 1 
ATOM   5951 N N   . TYR D 1 178 ? 33.925  31.877  23.330 1.00 32.03  ? 669  TYR D N   1 
ATOM   5952 C CA  . TYR D 1 178 ? 32.612  31.270  23.565 1.00 32.30  ? 669  TYR D CA  1 
ATOM   5953 C C   . TYR D 1 178 ? 32.212  31.348  25.029 1.00 31.72  ? 669  TYR D C   1 
ATOM   5954 O O   . TYR D 1 178 ? 33.009  31.697  25.891 1.00 30.88  ? 669  TYR D O   1 
ATOM   5955 C CB  . TYR D 1 178 ? 32.602  29.784  23.190 1.00 32.71  ? 669  TYR D CB  1 
ATOM   5956 C CG  . TYR D 1 178 ? 32.917  29.445  21.753 1.00 33.55  ? 669  TYR D CG  1 
ATOM   5957 C CD1 . TYR D 1 178 ? 34.229  29.474  21.280 1.00 33.66  ? 669  TYR D CD1 1 
ATOM   5958 C CD2 . TYR D 1 178 ? 31.904  29.061  20.876 1.00 32.45  ? 669  TYR D CD2 1 
ATOM   5959 C CE1 . TYR D 1 178 ? 34.524  29.124  19.974 1.00 35.20  ? 669  TYR D CE1 1 
ATOM   5960 C CE2 . TYR D 1 178 ? 32.182  28.711  19.571 1.00 33.39  ? 669  TYR D CE2 1 
ATOM   5961 C CZ  . TYR D 1 178 ? 33.494  28.741  19.118 1.00 36.05  ? 669  TYR D CZ  1 
ATOM   5962 O OH  . TYR D 1 178 ? 33.779  28.383  17.812 1.00 36.49  ? 669  TYR D OH  1 
ATOM   5963 N N   . GLU D 1 179 ? 30.960  31.008  25.297 1.00 33.61  ? 670  GLU D N   1 
ATOM   5964 C CA  . GLU D 1 179 ? 30.447  30.960  26.663 1.00 35.24  ? 670  GLU D CA  1 
ATOM   5965 C C   . GLU D 1 179 ? 29.489  29.776  26.750 1.00 33.22  ? 670  GLU D C   1 
ATOM   5966 O O   . GLU D 1 179 ? 28.699  29.543  25.847 1.00 31.89  ? 670  GLU D O   1 
ATOM   5967 C CB  . GLU D 1 179 ? 29.755  32.274  27.068 1.00 37.87  ? 670  GLU D CB  1 
ATOM   5968 C CG  . GLU D 1 179 ? 28.578  32.711  26.225 1.00 41.10  ? 670  GLU D CG  1 
ATOM   5969 C CD  . GLU D 1 179 ? 27.996  34.043  26.698 1.00 44.87  ? 670  GLU D CD  1 
ATOM   5970 O OE1 . GLU D 1 179 ? 27.093  34.576  26.015 1.00 47.49  ? 670  GLU D OE1 1 
ATOM   5971 O OE2 . GLU D 1 179 ? 28.438  34.561  27.751 1.00 45.22  ? 670  GLU D OE2 1 
ATOM   5972 N N   . VAL D 1 180 ? 29.594  29.004  27.823 1.00 32.89  ? 671  VAL D N   1 
ATOM   5973 C CA  . VAL D 1 180 ? 28.741  27.840  27.990 1.00 31.27  ? 671  VAL D CA  1 
ATOM   5974 C C   . VAL D 1 180 ? 27.814  28.065  29.167 1.00 32.10  ? 671  VAL D C   1 
ATOM   5975 O O   . VAL D 1 180 ? 28.171  28.746  30.129 1.00 33.40  ? 671  VAL D O   1 
ATOM   5976 C CB  . VAL D 1 180 ? 29.561  26.565  28.295 1.00 29.54  ? 671  VAL D CB  1 
ATOM   5977 C CG1 . VAL D 1 180 ? 28.802  25.341  27.836 1.00 28.94  ? 671  VAL D CG1 1 
ATOM   5978 C CG2 . VAL D 1 180 ? 30.917  26.640  27.646 1.00 30.10  ? 671  VAL D CG2 1 
ATOM   5979 N N   . TYR D 1 181 ? 26.613  27.508  29.075 1.00 31.66  ? 672  TYR D N   1 
ATOM   5980 C CA  . TYR D 1 181 ? 25.655  27.586  30.163 1.00 31.48  ? 672  TYR D CA  1 
ATOM   5981 C C   . TYR D 1 181 ? 25.225  26.155  30.442 1.00 30.52  ? 672  TYR D C   1 
ATOM   5982 O O   . TYR D 1 181 ? 24.822  25.431  29.537 1.00 30.92  ? 672  TYR D O   1 
ATOM   5983 C CB  . TYR D 1 181 ? 24.439  28.429  29.789 1.00 32.43  ? 672  TYR D CB  1 
ATOM   5984 C CG  . TYR D 1 181 ? 24.698  29.912  29.759 1.00 34.22  ? 672  TYR D CG  1 
ATOM   5985 C CD1 . TYR D 1 181 ? 25.254  30.520  28.637 1.00 36.76  ? 672  TYR D CD1 1 
ATOM   5986 C CD2 . TYR D 1 181 ? 24.382  30.712  30.850 1.00 35.53  ? 672  TYR D CD2 1 
ATOM   5987 C CE1 . TYR D 1 181 ? 25.485  31.892  28.598 1.00 37.44  ? 672  TYR D CE1 1 
ATOM   5988 C CE2 . TYR D 1 181 ? 24.612  32.083  30.826 1.00 36.89  ? 672  TYR D CE2 1 
ATOM   5989 C CZ  . TYR D 1 181 ? 25.163  32.664  29.695 1.00 37.43  ? 672  TYR D CZ  1 
ATOM   5990 O OH  . TYR D 1 181 ? 25.398  34.016  29.661 1.00 38.95  ? 672  TYR D OH  1 
ATOM   5991 N N   . VAL D 1 182 ? 25.349  25.733  31.691 1.00 28.93  ? 673  VAL D N   1 
ATOM   5992 C CA  . VAL D 1 182 ? 24.957  24.388  32.053 1.00 26.84  ? 673  VAL D CA  1 
ATOM   5993 C C   . VAL D 1 182 ? 23.901  24.470  33.141 1.00 26.93  ? 673  VAL D C   1 
ATOM   5994 O O   . VAL D 1 182 ? 24.077  25.152  34.150 1.00 25.30  ? 673  VAL D O   1 
ATOM   5995 C CB  . VAL D 1 182 ? 26.157  23.560  32.554 1.00 25.94  ? 673  VAL D CB  1 
ATOM   5996 C CG1 . VAL D 1 182 ? 25.716  22.113  32.818 1.00 23.44  ? 673  VAL D CG1 1 
ATOM   5997 C CG2 . VAL D 1 182 ? 27.282  23.602  31.520 1.00 23.67  ? 673  VAL D CG2 1 
ATOM   5998 N N   . VAL D 1 183 ? 22.796  23.774  32.915 1.00 26.58  ? 674  VAL D N   1 
ATOM   5999 C CA  . VAL D 1 183 ? 21.695  23.766  33.860 1.00 26.46  ? 674  VAL D CA  1 
ATOM   6000 C C   . VAL D 1 183 ? 21.417  22.343  34.323 1.00 26.43  ? 674  VAL D C   1 
ATOM   6001 O O   . VAL D 1 183 ? 21.579  21.396  33.560 1.00 27.85  ? 674  VAL D O   1 
ATOM   6002 C CB  . VAL D 1 183 ? 20.406  24.348  33.211 1.00 26.12  ? 674  VAL D CB  1 
ATOM   6003 C CG1 . VAL D 1 183 ? 19.240  24.273  34.194 1.00 24.38  ? 674  VAL D CG1 1 
ATOM   6004 C CG2 . VAL D 1 183 ? 20.647  25.792  32.767 1.00 22.53  ? 674  VAL D CG2 1 
ATOM   6005 N N   . ALA D 1 184 ? 21.023  22.197  35.582 1.00 25.50  ? 675  ALA D N   1 
ATOM   6006 C CA  . ALA D 1 184 ? 20.682  20.890  36.123 1.00 26.43  ? 675  ALA D CA  1 
ATOM   6007 C C   . ALA D 1 184 ? 19.169  20.868  36.274 1.00 27.94  ? 675  ALA D C   1 
ATOM   6008 O O   . ALA D 1 184 ? 18.562  21.831  36.761 1.00 27.45  ? 675  ALA D O   1 
ATOM   6009 C CB  . ALA D 1 184 ? 21.347  20.672  37.472 1.00 23.73  ? 675  ALA D CB  1 
ATOM   6010 N N   . GLU D 1 185 ? 18.560  19.773  35.848 1.00 29.19  ? 676  GLU D N   1 
ATOM   6011 C CA  . GLU D 1 185 ? 17.118  19.645  35.943 1.00 32.33  ? 676  GLU D CA  1 
ATOM   6012 C C   . GLU D 1 185 ? 16.718  18.368  36.684 1.00 33.90  ? 676  GLU D C   1 
ATOM   6013 O O   . GLU D 1 185 ? 17.283  17.289  36.441 1.00 33.24  ? 676  GLU D O   1 
ATOM   6014 C CB  . GLU D 1 185 ? 16.519  19.670  34.533 1.00 32.92  ? 676  GLU D CB  1 
ATOM   6015 C CG  . GLU D 1 185 ? 15.010  19.594  34.451 1.00 35.30  ? 676  GLU D CG  1 
ATOM   6016 C CD  . GLU D 1 185 ? 14.501  19.884  33.036 1.00 39.73  ? 676  GLU D CD  1 
ATOM   6017 O OE1 . GLU D 1 185 ? 15.025  19.292  32.062 1.00 41.38  ? 676  GLU D OE1 1 
ATOM   6018 O OE2 . GLU D 1 185 ? 13.573  20.706  32.893 1.00 39.87  ? 676  GLU D OE2 1 
ATOM   6019 N N   . ASN D 1 186 ? 15.778  18.515  37.624 1.00 35.06  ? 677  ASN D N   1 
ATOM   6020 C CA  . ASN D 1 186 ? 15.253  17.383  38.379 1.00 34.40  ? 677  ASN D CA  1 
ATOM   6021 C C   . ASN D 1 186 ? 13.746  17.354  38.168 1.00 35.73  ? 677  ASN D C   1 
ATOM   6022 O O   . ASN D 1 186 ? 13.225  18.040  37.289 1.00 35.41  ? 677  ASN D O   1 
ATOM   6023 C CB  . ASN D 1 186 ? 15.593  17.481  39.877 1.00 33.97  ? 677  ASN D CB  1 
ATOM   6024 C CG  . ASN D 1 186 ? 14.934  18.665  40.570 1.00 33.20  ? 677  ASN D CG  1 
ATOM   6025 O OD1 . ASN D 1 186 ? 13.974  19.246  40.065 1.00 32.15  ? 677  ASN D OD1 1 
ATOM   6026 N ND2 . ASN D 1 186 ? 15.441  19.011  41.754 1.00 27.42  ? 677  ASN D ND2 1 
ATOM   6027 N N   . GLN D 1 187 ? 13.042  16.564  38.967 1.00 38.28  ? 678  GLN D N   1 
ATOM   6028 C CA  . GLN D 1 187 ? 11.595  16.453  38.826 1.00 39.59  ? 678  GLN D CA  1 
ATOM   6029 C C   . GLN D 1 187 ? 10.877  17.747  39.215 1.00 40.38  ? 678  GLN D C   1 
ATOM   6030 O O   . GLN D 1 187 ? 9.746   17.978  38.817 1.00 39.76  ? 678  GLN D O   1 
ATOM   6031 C CB  . GLN D 1 187 ? 11.092  15.278  39.672 1.00 41.80  ? 678  GLN D CB  1 
ATOM   6032 C CG  . GLN D 1 187 ? 11.828  13.945  39.406 1.00 42.92  ? 678  GLN D CG  1 
ATOM   6033 C CD  . GLN D 1 187 ? 11.342  13.215  38.153 1.00 44.79  ? 678  GLN D CD  1 
ATOM   6034 O OE1 . GLN D 1 187 ? 11.959  12.251  37.703 1.00 43.96  ? 678  GLN D OE1 1 
ATOM   6035 N NE2 . GLN D 1 187 ? 10.224  13.667  37.598 1.00 45.94  ? 678  GLN D NE2 1 
ATOM   6036 N N   . GLN D 1 188 ? 11.545  18.599  39.980 1.00 42.30  ? 679  GLN D N   1 
ATOM   6037 C CA  . GLN D 1 188 ? 10.961  19.863  40.421 1.00 43.98  ? 679  GLN D CA  1 
ATOM   6038 C C   . GLN D 1 188 ? 11.080  20.991  39.395 1.00 44.05  ? 679  GLN D C   1 
ATOM   6039 O O   . GLN D 1 188 ? 10.098  21.667  39.087 1.00 44.92  ? 679  GLN D O   1 
ATOM   6040 C CB  . GLN D 1 188 ? 11.627  20.307  41.725 1.00 47.90  ? 679  GLN D CB  1 
ATOM   6041 C CG  . GLN D 1 188 ? 11.213  21.689  42.216 1.00 51.85  ? 679  GLN D CG  1 
ATOM   6042 C CD  . GLN D 1 188 ? 9.768   21.736  42.660 1.00 55.43  ? 679  GLN D CD  1 
ATOM   6043 O OE1 . GLN D 1 188 ? 9.369   21.017  43.580 1.00 57.68  ? 679  GLN D OE1 1 
ATOM   6044 N NE2 . GLN D 1 188 ? 8.970   22.582  42.008 1.00 56.52  ? 679  GLN D NE2 1 
ATOM   6045 N N   . GLY D 1 189 ? 12.289  21.209  38.882 1.00 42.78  ? 680  GLY D N   1 
ATOM   6046 C CA  . GLY D 1 189 ? 12.491  22.267  37.909 1.00 40.14  ? 680  GLY D CA  1 
ATOM   6047 C C   . GLY D 1 189 ? 13.946  22.425  37.523 1.00 39.55  ? 680  GLY D C   1 
ATOM   6048 O O   . GLY D 1 189 ? 14.756  21.515  37.742 1.00 40.19  ? 680  GLY D O   1 
ATOM   6049 N N   . LYS D 1 190 ? 14.285  23.581  36.958 1.00 36.70  ? 681  LYS D N   1 
ATOM   6050 C CA  . LYS D 1 190 ? 15.653  23.844  36.520 1.00 34.70  ? 681  LYS D CA  1 
ATOM   6051 C C   . LYS D 1 190 ? 16.442  24.731  37.467 1.00 33.62  ? 681  LYS D C   1 
ATOM   6052 O O   . LYS D 1 190 ? 15.894  25.610  38.120 1.00 35.14  ? 681  LYS D O   1 
ATOM   6053 C CB  . LYS D 1 190 ? 15.648  24.453  35.110 1.00 33.82  ? 681  LYS D CB  1 
ATOM   6054 C CG  . LYS D 1 190 ? 15.219  23.461  34.031 1.00 36.33  ? 681  LYS D CG  1 
ATOM   6055 C CD  . LYS D 1 190 ? 15.194  24.059  32.640 1.00 37.15  ? 681  LYS D CD  1 
ATOM   6056 C CE  . LYS D 1 190 ? 14.068  25.053  32.487 1.00 40.26  ? 681  LYS D CE  1 
ATOM   6057 N NZ  . LYS D 1 190 ? 14.126  25.740  31.164 1.00 44.44  ? 681  LYS D NZ  1 
ATOM   6058 N N   . SER D 1 191 ? 17.741  24.483  37.547 1.00 31.94  ? 682  SER D N   1 
ATOM   6059 C CA  . SER D 1 191 ? 18.598  25.267  38.410 1.00 31.13  ? 682  SER D CA  1 
ATOM   6060 C C   . SER D 1 191 ? 18.986  26.537  37.674 1.00 30.68  ? 682  SER D C   1 
ATOM   6061 O O   . SER D 1 191 ? 18.632  26.710  36.508 1.00 29.75  ? 682  SER D O   1 
ATOM   6062 C CB  . SER D 1 191 ? 19.862  24.480  38.755 1.00 31.19  ? 682  SER D CB  1 
ATOM   6063 O OG  . SER D 1 191 ? 20.826  24.597  37.729 1.00 32.40  ? 682  SER D OG  1 
ATOM   6064 N N   . LYS D 1 192 ? 19.685  27.438  38.358 1.00 31.46  ? 683  LYS D N   1 
ATOM   6065 C CA  . LYS D 1 192 ? 20.146  28.656  37.711 1.00 33.17  ? 683  LYS D CA  1 
ATOM   6066 C C   . LYS D 1 192 ? 21.282  28.126  36.840 1.00 33.25  ? 683  LYS D C   1 
ATOM   6067 O O   . LYS D 1 192 ? 21.842  27.062  37.131 1.00 32.49  ? 683  LYS D O   1 
ATOM   6068 C CB  . LYS D 1 192 ? 20.651  29.677  38.742 1.00 36.10  ? 683  LYS D CB  1 
ATOM   6069 C CG  . LYS D 1 192 ? 21.714  29.152  39.699 1.00 44.30  ? 683  LYS D CG  1 
ATOM   6070 C CD  . LYS D 1 192 ? 22.118  30.179  40.772 1.00 46.82  ? 683  LYS D CD  1 
ATOM   6071 C CE  . LYS D 1 192 ? 20.941  30.556  41.681 1.00 49.03  ? 683  LYS D CE  1 
ATOM   6072 N NZ  . LYS D 1 192 ? 21.371  31.362  42.871 1.00 48.69  ? 683  LYS D NZ  1 
ATOM   6073 N N   . ALA D 1 193 ? 21.612  28.831  35.766 1.00 31.16  ? 684  ALA D N   1 
ATOM   6074 C CA  . ALA D 1 193 ? 22.658  28.351  34.879 1.00 29.93  ? 684  ALA D CA  1 
ATOM   6075 C C   . ALA D 1 193 ? 24.102  28.608  35.308 1.00 31.34  ? 684  ALA D C   1 
ATOM   6076 O O   . ALA D 1 193 ? 24.450  29.703  35.765 1.00 29.95  ? 684  ALA D O   1 
ATOM   6077 C CB  . ALA D 1 193 ? 22.444  28.915  33.514 1.00 28.71  ? 684  ALA D CB  1 
ATOM   6078 N N   . ALA D 1 194 ? 24.936  27.580  35.158 1.00 31.77  ? 685  ALA D N   1 
ATOM   6079 C CA  . ALA D 1 194 ? 26.354  27.697  35.455 1.00 32.77  ? 685  ALA D CA  1 
ATOM   6080 C C   . ALA D 1 194 ? 26.942  28.315  34.181 1.00 34.83  ? 685  ALA D C   1 
ATOM   6081 O O   . ALA D 1 194 ? 26.580  27.923  33.066 1.00 33.37  ? 685  ALA D O   1 
ATOM   6082 C CB  . ALA D 1 194 ? 26.954  26.342  35.716 1.00 34.08  ? 685  ALA D CB  1 
ATOM   6083 N N   . HIS D 1 195 ? 27.833  29.288  34.362 1.00 36.80  ? 686  HIS D N   1 
ATOM   6084 C CA  . HIS D 1 195 ? 28.453  30.032  33.266 1.00 37.07  ? 686  HIS D CA  1 
ATOM   6085 C C   . HIS D 1 195 ? 29.949  29.733  33.182 1.00 36.84  ? 686  HIS D C   1 
ATOM   6086 O O   . HIS D 1 195 ? 30.616  29.520  34.202 1.00 35.85  ? 686  HIS D O   1 
ATOM   6087 C CB  . HIS D 1 195 ? 28.211  31.529  33.513 1.00 41.76  ? 686  HIS D CB  1 
ATOM   6088 C CG  . HIS D 1 195 ? 28.484  32.413  32.335 1.00 46.57  ? 686  HIS D CG  1 
ATOM   6089 N ND1 . HIS D 1 195 ? 27.898  32.221  31.101 1.00 48.15  ? 686  HIS D ND1 1 
ATOM   6090 C CD2 . HIS D 1 195 ? 29.221  33.547  32.226 1.00 48.99  ? 686  HIS D CD2 1 
ATOM   6091 C CE1 . HIS D 1 195 ? 28.261  33.196  30.286 1.00 48.85  ? 686  HIS D CE1 1 
ATOM   6092 N NE2 . HIS D 1 195 ? 29.062  34.015  30.944 1.00 49.40  ? 686  HIS D NE2 1 
ATOM   6093 N N   . PHE D 1 196 ? 30.467  29.700  31.957 1.00 36.73  ? 687  PHE D N   1 
ATOM   6094 C CA  . PHE D 1 196 ? 31.884  29.434  31.711 1.00 34.19  ? 687  PHE D CA  1 
ATOM   6095 C C   . PHE D 1 196 ? 32.257  30.075  30.382 1.00 33.35  ? 687  PHE D C   1 
ATOM   6096 O O   . PHE D 1 196 ? 31.653  29.764  29.354 1.00 33.06  ? 687  PHE D O   1 
ATOM   6097 C CB  . PHE D 1 196 ? 32.143  27.933  31.634 1.00 33.26  ? 687  PHE D CB  1 
ATOM   6098 C CG  . PHE D 1 196 ? 33.591  27.577  31.646 1.00 33.43  ? 687  PHE D CG  1 
ATOM   6099 C CD1 . PHE D 1 196 ? 34.290  27.515  32.843 1.00 34.67  ? 687  PHE D CD1 1 
ATOM   6100 C CD2 . PHE D 1 196 ? 34.271  27.341  30.458 1.00 35.21  ? 687  PHE D CD2 1 
ATOM   6101 C CE1 . PHE D 1 196 ? 35.654  27.224  32.860 1.00 37.06  ? 687  PHE D CE1 1 
ATOM   6102 C CE2 . PHE D 1 196 ? 35.637  27.051  30.456 1.00 35.84  ? 687  PHE D CE2 1 
ATOM   6103 C CZ  . PHE D 1 196 ? 36.332  26.992  31.660 1.00 37.36  ? 687  PHE D CZ  1 
ATOM   6104 N N   . VAL D 1 197 ? 33.245  30.968  30.411 1.00 31.88  ? 688  VAL D N   1 
ATOM   6105 C CA  . VAL D 1 197 ? 33.702  31.675  29.217 1.00 29.49  ? 688  VAL D CA  1 
ATOM   6106 C C   . VAL D 1 197 ? 35.125  31.263  28.876 1.00 29.23  ? 688  VAL D C   1 
ATOM   6107 O O   . VAL D 1 197 ? 35.985  31.240  29.746 1.00 29.70  ? 688  VAL D O   1 
ATOM   6108 C CB  . VAL D 1 197 ? 33.649  33.190  29.435 1.00 28.54  ? 688  VAL D CB  1 
ATOM   6109 C CG1 . VAL D 1 197 ? 34.022  33.923  28.157 1.00 29.51  ? 688  VAL D CG1 1 
ATOM   6110 C CG2 . VAL D 1 197 ? 32.256  33.584  29.879 1.00 30.19  ? 688  VAL D CG2 1 
ATOM   6111 N N   . PHE D 1 198 ? 35.373  30.941  27.610 1.00 29.16  ? 689  PHE D N   1 
ATOM   6112 C CA  . PHE D 1 198 ? 36.702  30.502  27.200 1.00 29.98  ? 689  PHE D CA  1 
ATOM   6113 C C   . PHE D 1 198 ? 37.100  30.968  25.801 1.00 30.80  ? 689  PHE D C   1 
ATOM   6114 O O   . PHE D 1 198 ? 36.263  31.417  25.011 1.00 30.36  ? 689  PHE D O   1 
ATOM   6115 C CB  . PHE D 1 198 ? 36.794  28.967  27.284 1.00 28.07  ? 689  PHE D CB  1 
ATOM   6116 C CG  . PHE D 1 198 ? 35.940  28.256  26.284 1.00 26.24  ? 689  PHE D CG  1 
ATOM   6117 C CD1 . PHE D 1 198 ? 36.460  27.869  25.055 1.00 26.34  ? 689  PHE D CD1 1 
ATOM   6118 C CD2 . PHE D 1 198 ? 34.598  28.012  26.547 1.00 27.13  ? 689  PHE D CD2 1 
ATOM   6119 C CE1 . PHE D 1 198 ? 35.650  27.248  24.101 1.00 26.05  ? 689  PHE D CE1 1 
ATOM   6120 C CE2 . PHE D 1 198 ? 33.776  27.390  25.593 1.00 26.97  ? 689  PHE D CE2 1 
ATOM   6121 C CZ  . PHE D 1 198 ? 34.303  27.010  24.373 1.00 24.64  ? 689  PHE D CZ  1 
ATOM   6122 N N   . ARG D 1 199 ? 38.390  30.831  25.500 1.00 31.17  ? 690  ARG D N   1 
ATOM   6123 C CA  . ARG D 1 199 ? 38.928  31.250  24.219 1.00 31.77  ? 690  ARG D CA  1 
ATOM   6124 C C   . ARG D 1 199 ? 39.815  30.207  23.555 1.00 33.54  ? 690  ARG D C   1 
ATOM   6125 O O   . ARG D 1 199 ? 40.758  29.702  24.165 1.00 33.13  ? 690  ARG D O   1 
ATOM   6126 C CB  . ARG D 1 199 ? 39.719  32.525  24.415 1.00 31.25  ? 690  ARG D CB  1 
ATOM   6127 C CG  . ARG D 1 199 ? 40.415  32.992  23.186 1.00 32.08  ? 690  ARG D CG  1 
ATOM   6128 C CD  . ARG D 1 199 ? 40.642  34.454  23.288 1.00 33.21  ? 690  ARG D CD  1 
ATOM   6129 N NE  . ARG D 1 199 ? 41.238  34.990  22.080 1.00 35.59  ? 690  ARG D NE  1 
ATOM   6130 C CZ  . ARG D 1 199 ? 41.188  36.272  21.755 1.00 36.19  ? 690  ARG D CZ  1 
ATOM   6131 N NH1 . ARG D 1 199 ? 40.561  37.122  22.557 1.00 36.39  ? 690  ARG D NH1 1 
ATOM   6132 N NH2 . ARG D 1 199 ? 41.765  36.696  20.641 1.00 35.48  ? 690  ARG D NH2 1 
ATOM   6133 N N   . THR D 1 200 ? 39.528  29.899  22.295 1.00 34.70  ? 691  THR D N   1 
ATOM   6134 C CA  . THR D 1 200 ? 40.326  28.910  21.579 1.00 36.02  ? 691  THR D CA  1 
ATOM   6135 C C   . THR D 1 200 ? 41.670  29.474  21.135 1.00 36.98  ? 691  THR D C   1 
ATOM   6136 O O   . THR D 1 200 ? 41.858  30.693  21.039 1.00 36.95  ? 691  THR D O   1 
ATOM   6137 C CB  . THR D 1 200 ? 39.582  28.371  20.344 1.00 35.62  ? 691  THR D CB  1 
ATOM   6138 O OG1 . THR D 1 200 ? 39.389  29.430  19.402 1.00 36.05  ? 691  THR D OG1 1 
ATOM   6139 C CG2 . THR D 1 200 ? 38.229  27.810  20.746 1.00 36.40  ? 691  THR D CG2 1 
ATOM   6140 N N   . ALA D 1 201 ? 42.610  28.574  20.868 1.00 38.74  ? 692  ALA D N   1 
ATOM   6141 C CA  . ALA D 1 201 ? 43.940  28.975  20.439 1.00 41.43  ? 692  ALA D CA  1 
ATOM   6142 C C   . ALA D 1 201 ? 43.849  29.529  19.020 1.00 43.90  ? 692  ALA D C   1 
ATOM   6143 O O   . ALA D 1 201 ? 42.748  29.758  18.517 1.00 44.43  ? 692  ALA D O   1 
ATOM   6144 C CB  . ALA D 1 201 ? 44.868  27.788  20.504 1.00 40.00  ? 692  ALA D CB  1 
ATOM   6145 N N   . ALA D 1 202 ? 44.991  29.749  18.372 1.00 47.67  ? 693  ALA D N   1 
ATOM   6146 C CA  . ALA D 1 202 ? 44.991  30.288  17.008 1.00 50.87  ? 693  ALA D CA  1 
ATOM   6147 C C   . ALA D 1 202 ? 45.246  29.262  15.894 1.00 52.75  ? 693  ALA D C   1 
ATOM   6148 O O   . ALA D 1 202 ? 44.814  29.460  14.755 1.00 53.63  ? 693  ALA D O   1 
ATOM   6149 C CB  . ALA D 1 202 ? 45.997  31.423  16.899 1.00 49.43  ? 693  ALA D CB  1 
ATOM   6150 N N   . ALA D 1 203 ? 45.943  28.169  16.194 1.00 54.01  ? 694  ALA D N   1 
ATOM   6151 C CA  . ALA D 1 203 ? 46.192  27.189  15.139 1.00 56.84  ? 694  ALA D CA  1 
ATOM   6152 C C   . ALA D 1 203 ? 46.376  25.762  15.660 1.00 58.63  ? 694  ALA D C   1 
ATOM   6153 O O   . ALA D 1 203 ? 46.597  25.594  16.897 1.00 59.24  ? 694  ALA D O   1 
ATOM   6154 C CB  . ALA D 1 203 ? 47.424  27.609  14.320 1.00 56.88  ? 694  ALA D CB  1 
ATOM   6155 N N   . HIS D 1 204 ? 46.313  24.829  14.812 1.00 60.88  ? 695  HIS D N   1 
ATOM   6156 N N   . ALA E 1 1   ? -40.442 30.040  69.310 1.00 45.05  ? 492  ALA E N   1 
ATOM   6157 C CA  . ALA E 1 1   ? -41.374 31.199  69.205 1.00 45.88  ? 492  ALA E CA  1 
ATOM   6158 C C   . ALA E 1 1   ? -41.491 31.872  70.557 1.00 46.38  ? 492  ALA E C   1 
ATOM   6159 O O   . ALA E 1 1   ? -41.465 33.099  70.655 1.00 46.57  ? 492  ALA E O   1 
ATOM   6160 C CB  . ALA E 1 1   ? -42.755 30.736  68.739 1.00 43.95  ? 492  ALA E CB  1 
ATOM   6161 N N   . PRO E 1 2   ? -41.621 31.072  71.628 1.00 47.16  ? 493  PRO E N   1 
ATOM   6162 C CA  . PRO E 1 2   ? -41.739 31.698  72.938 1.00 47.43  ? 493  PRO E CA  1 
ATOM   6163 C C   . PRO E 1 2   ? -40.481 32.502  73.198 1.00 49.00  ? 493  PRO E C   1 
ATOM   6164 O O   . PRO E 1 2   ? -39.363 32.062  72.898 1.00 49.03  ? 493  PRO E O   1 
ATOM   6165 C CB  . PRO E 1 2   ? -41.886 30.507  73.871 1.00 47.37  ? 493  PRO E CB  1 
ATOM   6166 C CG  . PRO E 1 2   ? -41.017 29.492  73.225 1.00 45.66  ? 493  PRO E CG  1 
ATOM   6167 C CD  . PRO E 1 2   ? -41.421 29.618  71.769 1.00 45.70  ? 493  PRO E CD  1 
ATOM   6168 N N   . LEU E 1 3   ? -40.679 33.692  73.744 1.00 49.62  ? 494  LEU E N   1 
ATOM   6169 C CA  . LEU E 1 3   ? -39.586 34.596  74.047 1.00 49.07  ? 494  LEU E CA  1 
ATOM   6170 C C   . LEU E 1 3   ? -39.420 34.704  75.560 1.00 48.89  ? 494  LEU E C   1 
ATOM   6171 O O   . LEU E 1 3   ? -40.402 34.879  76.292 1.00 48.16  ? 494  LEU E O   1 
ATOM   6172 C CB  . LEU E 1 3   ? -39.894 35.958  73.433 1.00 48.09  ? 494  LEU E CB  1 
ATOM   6173 C CG  . LEU E 1 3   ? -39.178 37.157  74.018 1.00 48.69  ? 494  LEU E CG  1 
ATOM   6174 C CD1 . LEU E 1 3   ? -37.667 36.960  73.905 1.00 47.76  ? 494  LEU E CD1 1 
ATOM   6175 C CD2 . LEU E 1 3   ? -39.651 38.411  73.274 1.00 48.62  ? 494  LEU E CD2 1 
ATOM   6176 N N   . ALA E 1 4   ? -38.174 34.586  76.014 1.00 49.14  ? 495  ALA E N   1 
ATOM   6177 C CA  . ALA E 1 4   ? -37.843 34.650  77.434 1.00 48.57  ? 495  ALA E CA  1 
ATOM   6178 C C   . ALA E 1 4   ? -36.735 35.659  77.663 1.00 49.23  ? 495  ALA E C   1 
ATOM   6179 O O   . ALA E 1 4   ? -35.558 35.367  77.416 1.00 49.57  ? 495  ALA E O   1 
ATOM   6180 C CB  . ALA E 1 4   ? -37.397 33.286  77.927 1.00 46.55  ? 495  ALA E CB  1 
ATOM   6181 N N   . GLN E 1 5   ? -37.104 36.851  78.121 1.00 48.62  ? 496  GLN E N   1 
ATOM   6182 C CA  . GLN E 1 5   ? -36.108 37.871  78.386 1.00 47.84  ? 496  GLN E CA  1 
ATOM   6183 C C   . GLN E 1 5   ? -36.172 38.270  79.845 1.00 46.99  ? 496  GLN E C   1 
ATOM   6184 O O   . GLN E 1 5   ? -36.987 37.755  80.613 1.00 47.72  ? 496  GLN E O   1 
ATOM   6185 C CB  . GLN E 1 5   ? -36.332 39.085  77.494 1.00 49.51  ? 496  GLN E CB  1 
ATOM   6186 C CG  . GLN E 1 5   ? -37.586 39.863  77.794 1.00 51.25  ? 496  GLN E CG  1 
ATOM   6187 C CD  . GLN E 1 5   ? -37.965 40.786  76.635 1.00 54.18  ? 496  GLN E CD  1 
ATOM   6188 O OE1 . GLN E 1 5   ? -38.916 41.595  76.744 1.00 56.13  ? 496  GLN E OE1 1 
ATOM   6189 N NE2 . GLN E 1 5   ? -37.235 40.663  75.502 1.00 53.11  ? 496  GLN E NE2 1 
ATOM   6190 N N   . ALA E 1 6   ? -35.318 39.197  80.241 1.00 45.69  ? 497  ALA E N   1 
ATOM   6191 C CA  . ALA E 1 6   ? -35.308 39.593  81.626 1.00 43.44  ? 497  ALA E CA  1 
ATOM   6192 C C   . ALA E 1 6   ? -35.421 41.075  81.861 1.00 42.77  ? 497  ALA E C   1 
ATOM   6193 O O   . ALA E 1 6   ? -35.379 41.902  80.954 1.00 41.69  ? 497  ALA E O   1 
ATOM   6194 C CB  . ALA E 1 6   ? -34.050 39.069  82.304 1.00 42.39  ? 497  ALA E CB  1 
ATOM   6195 N N   . ASP E 1 7   ? -35.578 41.372  83.134 1.00 43.02  ? 498  ASP E N   1 
ATOM   6196 C CA  . ASP E 1 7   ? -35.673 42.708  83.654 1.00 42.57  ? 498  ASP E CA  1 
ATOM   6197 C C   . ASP E 1 7   ? -34.609 43.586  82.963 1.00 42.32  ? 498  ASP E C   1 
ATOM   6198 O O   . ASP E 1 7   ? -34.916 44.563  82.275 1.00 41.29  ? 498  ASP E O   1 
ATOM   6199 C CB  . ASP E 1 7   ? -35.395 42.606  85.155 1.00 42.97  ? 498  ASP E CB  1 
ATOM   6200 C CG  . ASP E 1 7   ? -35.637 43.880  85.868 1.00 46.19  ? 498  ASP E CG  1 
ATOM   6201 O OD1 . ASP E 1 7   ? -34.955 44.124  86.886 1.00 48.88  ? 498  ASP E OD1 1 
ATOM   6202 O OD2 . ASP E 1 7   ? -36.521 44.634  85.411 1.00 49.90  ? 498  ASP E OD2 1 
ATOM   6203 N N   . THR E 1 8   ? -33.355 43.191  83.157 1.00 40.88  ? 499  THR E N   1 
ATOM   6204 C CA  . THR E 1 8   ? -32.187 43.881  82.636 1.00 40.10  ? 499  THR E CA  1 
ATOM   6205 C C   . THR E 1 8   ? -31.879 43.526  81.188 1.00 39.28  ? 499  THR E C   1 
ATOM   6206 O O   . THR E 1 8   ? -32.462 42.590  80.645 1.00 38.85  ? 499  THR E O   1 
ATOM   6207 C CB  . THR E 1 8   ? -30.976 43.513  83.482 1.00 41.24  ? 499  THR E CB  1 
ATOM   6208 O OG1 . THR E 1 8   ? -30.977 42.094  83.687 1.00 43.05  ? 499  THR E OG1 1 
ATOM   6209 C CG2 . THR E 1 8   ? -31.020 44.218  84.833 1.00 41.90  ? 499  THR E CG2 1 
ATOM   6210 N N   . PRO E 1 9   ? -30.942 44.269  80.547 1.00 38.33  ? 500  PRO E N   1 
ATOM   6211 C CA  . PRO E 1 9   ? -30.513 44.067  79.151 1.00 37.42  ? 500  PRO E CA  1 
ATOM   6212 C C   . PRO E 1 9   ? -29.827 42.718  78.906 1.00 37.26  ? 500  PRO E C   1 
ATOM   6213 O O   . PRO E 1 9   ? -29.374 42.048  79.843 1.00 37.43  ? 500  PRO E O   1 
ATOM   6214 C CB  . PRO E 1 9   ? -29.535 45.217  78.913 1.00 35.75  ? 500  PRO E CB  1 
ATOM   6215 C CG  . PRO E 1 9   ? -29.976 46.255  79.857 1.00 36.81  ? 500  PRO E CG  1 
ATOM   6216 C CD  . PRO E 1 9   ? -30.295 45.470  81.103 1.00 37.24  ? 500  PRO E CD  1 
ATOM   6217 N N   . SER E 1 10  ? -29.757 42.319  77.644 1.00 37.72  ? 501  SER E N   1 
ATOM   6218 C CA  . SER E 1 10  ? -29.081 41.072  77.291 1.00 38.07  ? 501  SER E CA  1 
ATOM   6219 C C   . SER E 1 10  ? -27.623 41.459  77.072 1.00 37.43  ? 501  SER E C   1 
ATOM   6220 O O   . SER E 1 10  ? -27.319 42.626  76.801 1.00 36.74  ? 501  SER E O   1 
ATOM   6221 C CB  . SER E 1 10  ? -29.681 40.462  76.018 1.00 39.01  ? 501  SER E CB  1 
ATOM   6222 O OG  . SER E 1 10  ? -29.923 41.454  75.035 1.00 40.18  ? 501  SER E OG  1 
ATOM   6223 N N   . SER E 1 11  ? -26.716 40.498  77.204 1.00 36.83  ? 502  SER E N   1 
ATOM   6224 C CA  . SER E 1 11  ? -25.300 40.807  77.041 1.00 36.41  ? 502  SER E CA  1 
ATOM   6225 C C   . SER E 1 11  ? -24.991 41.378  75.668 1.00 35.56  ? 502  SER E C   1 
ATOM   6226 O O   . SER E 1 11  ? -25.628 41.030  74.673 1.00 35.05  ? 502  SER E O   1 
ATOM   6227 C CB  . SER E 1 11  ? -24.446 39.560  77.261 1.00 35.70  ? 502  SER E CB  1 
ATOM   6228 O OG  . SER E 1 11  ? -24.601 38.659  76.181 1.00 35.61  ? 502  SER E OG  1 
ATOM   6229 N N   . PRO E 1 12  ? -24.025 42.299  75.601 1.00 35.63  ? 503  PRO E N   1 
ATOM   6230 C CA  . PRO E 1 12  ? -23.673 42.876  74.302 1.00 35.99  ? 503  PRO E CA  1 
ATOM   6231 C C   . PRO E 1 12  ? -22.793 41.832  73.600 1.00 35.39  ? 503  PRO E C   1 
ATOM   6232 O O   . PRO E 1 12  ? -22.377 40.846  74.216 1.00 34.61  ? 503  PRO E O   1 
ATOM   6233 C CB  . PRO E 1 12  ? -22.864 44.126  74.676 1.00 35.90  ? 503  PRO E CB  1 
ATOM   6234 C CG  . PRO E 1 12  ? -23.170 44.358  76.129 1.00 35.39  ? 503  PRO E CG  1 
ATOM   6235 C CD  . PRO E 1 12  ? -23.310 42.983  76.688 1.00 35.16  ? 503  PRO E CD  1 
ATOM   6236 N N   . SER E 1 13  ? -22.502 42.026  72.326 1.00 34.02  ? 504  SER E N   1 
ATOM   6237 C CA  . SER E 1 13  ? -21.643 41.067  71.656 1.00 35.03  ? 504  SER E CA  1 
ATOM   6238 C C   . SER E 1 13  ? -20.392 41.732  71.134 1.00 33.82  ? 504  SER E C   1 
ATOM   6239 O O   . SER E 1 13  ? -20.456 42.691  70.368 1.00 34.64  ? 504  SER E O   1 
ATOM   6240 C CB  . SER E 1 13  ? -22.384 40.382  70.511 1.00 36.77  ? 504  SER E CB  1 
ATOM   6241 O OG  . SER E 1 13  ? -23.427 39.568  71.016 1.00 41.66  ? 504  SER E OG  1 
ATOM   6242 N N   . ILE E 1 14  ? -19.244 41.231  71.562 1.00 32.94  ? 505  ILE E N   1 
ATOM   6243 C CA  . ILE E 1 14  ? -17.982 41.787  71.110 1.00 31.96  ? 505  ILE E CA  1 
ATOM   6244 C C   . ILE E 1 14  ? -17.720 41.292  69.695 1.00 31.76  ? 505  ILE E C   1 
ATOM   6245 O O   . ILE E 1 14  ? -17.470 40.117  69.473 1.00 31.64  ? 505  ILE E O   1 
ATOM   6246 C CB  . ILE E 1 14  ? -16.848 41.366  72.043 1.00 31.02  ? 505  ILE E CB  1 
ATOM   6247 C CG1 . ILE E 1 14  ? -17.111 41.949  73.438 1.00 29.04  ? 505  ILE E CG1 1 
ATOM   6248 C CG2 . ILE E 1 14  ? -15.511 41.803  71.463 1.00 31.29  ? 505  ILE E CG2 1 
ATOM   6249 C CD1 . ILE E 1 14  ? -16.039 41.651  74.440 1.00 29.12  ? 505  ILE E CD1 1 
ATOM   6250 N N   . ASP E 1 15  ? -17.799 42.195  68.728 1.00 32.69  ? 506  ASP E N   1 
ATOM   6251 C CA  . ASP E 1 15  ? -17.588 41.815  67.342 1.00 33.20  ? 506  ASP E CA  1 
ATOM   6252 C C   . ASP E 1 15  ? -16.149 42.022  66.888 1.00 33.34  ? 506  ASP E C   1 
ATOM   6253 O O   . ASP E 1 15  ? -15.659 41.304  66.021 1.00 32.56  ? 506  ASP E O   1 
ATOM   6254 C CB  . ASP E 1 15  ? -18.512 42.618  66.435 1.00 35.16  ? 506  ASP E CB  1 
ATOM   6255 C CG  . ASP E 1 15  ? -19.973 42.483  66.813 1.00 38.62  ? 506  ASP E CG  1 
ATOM   6256 O OD1 . ASP E 1 15  ? -20.454 41.342  67.005 1.00 38.93  ? 506  ASP E OD1 1 
ATOM   6257 O OD2 . ASP E 1 15  ? -20.650 43.530  66.904 1.00 41.51  ? 506  ASP E OD2 1 
ATOM   6258 N N   . GLN E 1 16  ? -15.478 43.006  67.480 1.00 32.99  ? 507  GLN E N   1 
ATOM   6259 C CA  . GLN E 1 16  ? -14.106 43.326  67.115 1.00 31.02  ? 507  GLN E CA  1 
ATOM   6260 C C   . GLN E 1 16  ? -13.276 43.777  68.308 1.00 30.50  ? 507  GLN E C   1 
ATOM   6261 O O   . GLN E 1 16  ? -13.790 44.400  69.232 1.00 30.74  ? 507  GLN E O   1 
ATOM   6262 C CB  . GLN E 1 16  ? -14.089 44.461  66.079 1.00 30.68  ? 507  GLN E CB  1 
ATOM   6263 C CG  . GLN E 1 16  ? -14.779 44.173  64.762 1.00 31.17  ? 507  GLN E CG  1 
ATOM   6264 C CD  . GLN E 1 16  ? -13.992 43.225  63.889 1.00 33.61  ? 507  GLN E CD  1 
ATOM   6265 O OE1 . GLN E 1 16  ? -14.484 42.761  62.863 1.00 34.74  ? 507  GLN E OE1 1 
ATOM   6266 N NE2 . GLN E 1 16  ? -12.757 42.930  64.292 1.00 33.08  ? 507  GLN E NE2 1 
ATOM   6267 N N   . VAL E 1 17  ? -11.987 43.451  68.266 1.00 29.78  ? 508  VAL E N   1 
ATOM   6268 C CA  . VAL E 1 17  ? -11.026 43.868  69.280 1.00 27.62  ? 508  VAL E CA  1 
ATOM   6269 C C   . VAL E 1 17  ? -9.727  44.184  68.540 1.00 26.47  ? 508  VAL E C   1 
ATOM   6270 O O   . VAL E 1 17  ? -9.009  43.281  68.131 1.00 26.84  ? 508  VAL E O   1 
ATOM   6271 C CB  . VAL E 1 17  ? -10.741 42.771  70.332 1.00 27.00  ? 508  VAL E CB  1 
ATOM   6272 C CG1 . VAL E 1 17  ? -9.730  43.288  71.349 1.00 25.15  ? 508  VAL E CG1 1 
ATOM   6273 C CG2 . VAL E 1 17  ? -12.013 42.378  71.039 1.00 24.84  ? 508  VAL E CG2 1 
ATOM   6274 N N   . GLU E 1 18  ? -9.454  45.467  68.329 1.00 25.56  ? 509  GLU E N   1 
ATOM   6275 C CA  . GLU E 1 18  ? -8.231  45.887  67.652 1.00 25.29  ? 509  GLU E CA  1 
ATOM   6276 C C   . GLU E 1 18  ? -7.223  46.249  68.740 1.00 24.98  ? 509  GLU E C   1 
ATOM   6277 O O   . GLU E 1 18  ? -7.390  47.235  69.448 1.00 27.22  ? 509  GLU E O   1 
ATOM   6278 C CB  . GLU E 1 18  ? -8.508  47.097  66.758 1.00 24.77  ? 509  GLU E CB  1 
ATOM   6279 C CG  . GLU E 1 18  ? -7.268  47.821  66.306 1.00 26.21  ? 509  GLU E CG  1 
ATOM   6280 C CD  . GLU E 1 18  ? -6.312  46.941  65.515 1.00 27.78  ? 509  GLU E CD  1 
ATOM   6281 O OE1 . GLU E 1 18  ? -6.450  45.697  65.536 1.00 27.53  ? 509  GLU E OE1 1 
ATOM   6282 O OE2 . GLU E 1 18  ? -5.403  47.503  64.877 1.00 27.39  ? 509  GLU E OE2 1 
ATOM   6283 N N   . PRO E 1 19  ? -6.167  45.444  68.897 1.00 23.99  ? 510  PRO E N   1 
ATOM   6284 C CA  . PRO E 1 19  ? -5.192  45.759  69.943 1.00 23.19  ? 510  PRO E CA  1 
ATOM   6285 C C   . PRO E 1 19  ? -3.962  46.542  69.522 1.00 24.02  ? 510  PRO E C   1 
ATOM   6286 O O   . PRO E 1 19  ? -3.344  46.250  68.494 1.00 24.80  ? 510  PRO E O   1 
ATOM   6287 C CB  . PRO E 1 19  ? -4.816  44.384  70.463 1.00 22.08  ? 510  PRO E CB  1 
ATOM   6288 C CG  . PRO E 1 19  ? -4.771  43.581  69.178 1.00 20.92  ? 510  PRO E CG  1 
ATOM   6289 C CD  . PRO E 1 19  ? -6.012  44.049  68.434 1.00 22.39  ? 510  PRO E CD  1 
ATOM   6290 N N   . TYR E 1 20  ? -3.597  47.525  70.342 1.00 23.86  ? 511  TYR E N   1 
ATOM   6291 C CA  . TYR E 1 20  ? -2.415  48.331  70.097 1.00 23.56  ? 511  TYR E CA  1 
ATOM   6292 C C   . TYR E 1 20  ? -1.368  47.990  71.168 1.00 26.18  ? 511  TYR E C   1 
ATOM   6293 O O   . TYR E 1 20  ? -1.454  46.941  71.808 1.00 25.26  ? 511  TYR E O   1 
ATOM   6294 C CB  . TYR E 1 20  ? -2.791  49.805  70.112 1.00 23.00  ? 511  TYR E CB  1 
ATOM   6295 C CG  . TYR E 1 20  ? -3.753  50.171  68.997 1.00 22.62  ? 511  TYR E CG  1 
ATOM   6296 C CD1 . TYR E 1 20  ? -4.937  50.838  69.266 1.00 23.57  ? 511  TYR E CD1 1 
ATOM   6297 C CD2 . TYR E 1 20  ? -3.487  49.819  67.677 1.00 22.06  ? 511  TYR E CD2 1 
ATOM   6298 C CE1 . TYR E 1 20  ? -5.832  51.142  68.252 1.00 25.69  ? 511  TYR E CE1 1 
ATOM   6299 C CE2 . TYR E 1 20  ? -4.371  50.117  66.658 1.00 21.58  ? 511  TYR E CE2 1 
ATOM   6300 C CZ  . TYR E 1 20  ? -5.543  50.779  66.950 1.00 25.80  ? 511  TYR E CZ  1 
ATOM   6301 O OH  . TYR E 1 20  ? -6.430  51.092  65.943 1.00 28.27  ? 511  TYR E OH  1 
ATOM   6302 N N   . SER E 1 21  ? -0.378  48.852  71.370 1.00 28.09  ? 512  SER E N   1 
ATOM   6303 C CA  . SER E 1 21  ? 0.665   48.553  72.349 1.00 28.73  ? 512  SER E CA  1 
ATOM   6304 C C   . SER E 1 21  ? 0.220   48.734  73.797 1.00 29.73  ? 512  SER E C   1 
ATOM   6305 O O   . SER E 1 21  ? 0.635   47.980  74.676 1.00 30.22  ? 512  SER E O   1 
ATOM   6306 C CB  . SER E 1 21  ? 1.901   49.416  72.095 1.00 28.91  ? 512  SER E CB  1 
ATOM   6307 O OG  . SER E 1 21  ? 1.645   50.766  72.445 1.00 29.60  ? 512  SER E OG  1 
ATOM   6308 N N   . SER E 1 22  ? -0.626  49.724  74.050 1.00 29.85  ? 513  SER E N   1 
ATOM   6309 C CA  . SER E 1 22  ? -1.075  49.969  75.410 1.00 30.90  ? 513  SER E CA  1 
ATOM   6310 C C   . SER E 1 22  ? -2.564  50.267  75.514 1.00 31.81  ? 513  SER E C   1 
ATOM   6311 O O   . SER E 1 22  ? -3.086  50.501  76.602 1.00 32.48  ? 513  SER E O   1 
ATOM   6312 C CB  . SER E 1 22  ? -0.283  51.126  76.002 1.00 30.69  ? 513  SER E CB  1 
ATOM   6313 O OG  . SER E 1 22  ? -0.499  52.301  75.252 1.00 30.73  ? 513  SER E OG  1 
ATOM   6314 N N   . THR E 1 23  ? -3.246  50.261  74.378 1.00 32.31  ? 514  THR E N   1 
ATOM   6315 C CA  . THR E 1 23  ? -4.675  50.520  74.344 1.00 31.89  ? 514  THR E CA  1 
ATOM   6316 C C   . THR E 1 23  ? -5.312  49.438  73.491 1.00 32.23  ? 514  THR E C   1 
ATOM   6317 O O   . THR E 1 23  ? -4.609  48.650  72.858 1.00 32.33  ? 514  THR E O   1 
ATOM   6318 C CB  . THR E 1 23  ? -4.976  51.888  73.701 1.00 33.31  ? 514  THR E CB  1 
ATOM   6319 O OG1 . THR E 1 23  ? -4.416  51.932  72.382 1.00 33.99  ? 514  THR E OG1 1 
ATOM   6320 C CG2 . THR E 1 23  ? -4.377  53.013  74.530 1.00 34.06  ? 514  THR E CG2 1 
ATOM   6321 N N   . ALA E 1 24  ? -6.641  49.396  73.481 1.00 32.03  ? 515  ALA E N   1 
ATOM   6322 C CA  . ALA E 1 24  ? -7.379  48.424  72.677 1.00 31.18  ? 515  ALA E CA  1 
ATOM   6323 C C   . ALA E 1 24  ? -8.758  48.997  72.327 1.00 30.97  ? 515  ALA E C   1 
ATOM   6324 O O   . ALA E 1 24  ? -9.434  49.562  73.181 1.00 32.03  ? 515  ALA E O   1 
ATOM   6325 C CB  . ALA E 1 24  ? -7.521  47.116  73.438 1.00 29.38  ? 515  ALA E CB  1 
ATOM   6326 N N   . GLN E 1 25  ? -9.159  48.876  71.067 1.00 29.84  ? 516  GLN E N   1 
ATOM   6327 C CA  . GLN E 1 25  ? -10.457 49.377  70.630 1.00 29.33  ? 516  GLN E CA  1 
ATOM   6328 C C   . GLN E 1 25  ? -11.407 48.201  70.466 1.00 28.72  ? 516  GLN E C   1 
ATOM   6329 O O   . GLN E 1 25  ? -11.112 47.264  69.725 1.00 29.86  ? 516  GLN E O   1 
ATOM   6330 C CB  . GLN E 1 25  ? -10.322 50.132  69.299 1.00 28.56  ? 516  GLN E CB  1 
ATOM   6331 C CG  . GLN E 1 25  ? -9.448  51.378  69.396 1.00 30.91  ? 516  GLN E CG  1 
ATOM   6332 C CD  . GLN E 1 25  ? -9.142  52.015  68.050 1.00 32.21  ? 516  GLN E CD  1 
ATOM   6333 O OE1 . GLN E 1 25  ? -8.973  51.326  67.040 1.00 31.81  ? 516  GLN E OE1 1 
ATOM   6334 N NE2 . GLN E 1 25  ? -9.043  53.337  68.036 1.00 31.03  ? 516  GLN E NE2 1 
ATOM   6335 N N   . VAL E 1 26  ? -12.549 48.259  71.147 1.00 27.34  ? 517  VAL E N   1 
ATOM   6336 C CA  . VAL E 1 26  ? -13.543 47.187  71.087 1.00 26.35  ? 517  VAL E CA  1 
ATOM   6337 C C   . VAL E 1 26  ? -14.829 47.571  70.341 1.00 27.34  ? 517  VAL E C   1 
ATOM   6338 O O   . VAL E 1 26  ? -15.419 48.616  70.610 1.00 26.10  ? 517  VAL E O   1 
ATOM   6339 C CB  . VAL E 1 26  ? -13.928 46.736  72.514 1.00 25.20  ? 517  VAL E CB  1 
ATOM   6340 C CG1 . VAL E 1 26  ? -14.946 45.622  72.459 1.00 22.55  ? 517  VAL E CG1 1 
ATOM   6341 C CG2 . VAL E 1 26  ? -12.691 46.296  73.270 1.00 23.03  ? 517  VAL E CG2 1 
ATOM   6342 N N   . GLN E 1 27  ? -15.250 46.727  69.400 1.00 29.05  ? 518  GLN E N   1 
ATOM   6343 C CA  . GLN E 1 27  ? -16.482 46.962  68.643 1.00 33.47  ? 518  GLN E CA  1 
ATOM   6344 C C   . GLN E 1 27  ? -17.560 45.963  69.064 1.00 34.94  ? 518  GLN E C   1 
ATOM   6345 O O   . GLN E 1 27  ? -17.317 44.758  69.086 1.00 35.35  ? 518  GLN E O   1 
ATOM   6346 C CB  . GLN E 1 27  ? -16.232 46.832  67.144 1.00 35.47  ? 518  GLN E CB  1 
ATOM   6347 C CG  . GLN E 1 27  ? -16.015 48.148  66.423 1.00 39.03  ? 518  GLN E CG  1 
ATOM   6348 C CD  . GLN E 1 27  ? -15.909 47.973  64.918 1.00 45.40  ? 518  GLN E CD  1 
ATOM   6349 O OE1 . GLN E 1 27  ? -16.799 47.380  64.286 1.00 48.80  ? 518  GLN E OE1 1 
ATOM   6350 N NE2 . GLN E 1 27  ? -14.822 48.487  64.329 1.00 43.95  ? 518  GLN E NE2 1 
ATOM   6351 N N   . PHE E 1 28  ? -18.755 46.462  69.373 1.00 37.29  ? 519  PHE E N   1 
ATOM   6352 C CA  . PHE E 1 28  ? -19.851 45.598  69.829 1.00 40.59  ? 519  PHE E CA  1 
ATOM   6353 C C   . PHE E 1 28  ? -21.238 46.067  69.387 1.00 42.39  ? 519  PHE E C   1 
ATOM   6354 O O   . PHE E 1 28  ? -21.406 47.206  68.978 1.00 42.09  ? 519  PHE E O   1 
ATOM   6355 C CB  . PHE E 1 28  ? -19.821 45.542  71.351 1.00 39.83  ? 519  PHE E CB  1 
ATOM   6356 C CG  . PHE E 1 28  ? -20.045 46.877  71.989 1.00 38.86  ? 519  PHE E CG  1 
ATOM   6357 C CD1 . PHE E 1 28  ? -21.332 47.332  72.241 1.00 39.28  ? 519  PHE E CD1 1 
ATOM   6358 C CD2 . PHE E 1 28  ? -18.974 47.713  72.267 1.00 38.56  ? 519  PHE E CD2 1 
ATOM   6359 C CE1 . PHE E 1 28  ? -21.550 48.598  72.755 1.00 38.03  ? 519  PHE E CE1 1 
ATOM   6360 C CE2 . PHE E 1 28  ? -19.182 48.979  72.779 1.00 38.49  ? 519  PHE E CE2 1 
ATOM   6361 C CZ  . PHE E 1 28  ? -20.474 49.422  73.023 1.00 38.89  ? 519  PHE E CZ  1 
ATOM   6362 N N   . ASP E 1 29  ? -22.226 45.181  69.507 1.00 47.44  ? 520  ASP E N   1 
ATOM   6363 C CA  . ASP E 1 29  ? -23.620 45.472  69.150 1.00 52.84  ? 520  ASP E CA  1 
ATOM   6364 C C   . ASP E 1 29  ? -24.468 45.777  70.374 1.00 55.54  ? 520  ASP E C   1 
ATOM   6365 O O   . ASP E 1 29  ? -24.356 45.088  71.381 1.00 54.71  ? 520  ASP E O   1 
ATOM   6366 C CB  . ASP E 1 29  ? -24.264 44.269  68.470 1.00 54.46  ? 520  ASP E CB  1 
ATOM   6367 C CG  . ASP E 1 29  ? -23.658 43.966  67.139 1.00 57.93  ? 520  ASP E CG  1 
ATOM   6368 O OD1 . ASP E 1 29  ? -23.788 44.814  66.230 1.00 59.56  ? 520  ASP E OD1 1 
ATOM   6369 O OD2 . ASP E 1 29  ? -23.051 42.881  67.003 1.00 60.05  ? 520  ASP E OD2 1 
ATOM   6370 N N   . GLU E 1 30  ? -25.327 46.792  70.286 1.00 59.99  ? 521  GLU E N   1 
ATOM   6371 C CA  . GLU E 1 30  ? -26.213 47.117  71.402 1.00 64.20  ? 521  GLU E CA  1 
ATOM   6372 C C   . GLU E 1 30  ? -27.027 45.862  71.668 1.00 65.91  ? 521  GLU E C   1 
ATOM   6373 O O   . GLU E 1 30  ? -27.496 45.213  70.737 1.00 65.78  ? 521  GLU E O   1 
ATOM   6374 C CB  . GLU E 1 30  ? -27.167 48.267  71.052 1.00 66.11  ? 521  GLU E CB  1 
ATOM   6375 C CG  . GLU E 1 30  ? -26.519 49.647  71.049 1.00 70.29  ? 521  GLU E CG  1 
ATOM   6376 C CD  . GLU E 1 30  ? -26.265 50.181  69.648 1.00 71.94  ? 521  GLU E CD  1 
ATOM   6377 O OE1 . GLU E 1 30  ? -27.259 50.425  68.927 1.00 72.26  ? 521  GLU E OE1 1 
ATOM   6378 O OE2 . GLU E 1 30  ? -25.078 50.356  69.274 1.00 71.23  ? 521  GLU E OE2 1 
ATOM   6379 N N   . PRO E 1 31  ? -27.203 45.501  72.946 1.00 68.31  ? 522  PRO E N   1 
ATOM   6380 C CA  . PRO E 1 31  ? -27.960 44.312  73.353 1.00 70.64  ? 522  PRO E CA  1 
ATOM   6381 C C   . PRO E 1 31  ? -29.243 43.997  72.555 1.00 72.41  ? 522  PRO E C   1 
ATOM   6382 O O   . PRO E 1 31  ? -30.070 44.884  72.309 1.00 71.82  ? 522  PRO E O   1 
ATOM   6383 C CB  . PRO E 1 31  ? -28.239 44.594  74.827 1.00 69.92  ? 522  PRO E CB  1 
ATOM   6384 C CG  . PRO E 1 31  ? -26.980 45.269  75.254 1.00 67.84  ? 522  PRO E CG  1 
ATOM   6385 C CD  . PRO E 1 31  ? -26.748 46.255  74.129 1.00 67.77  ? 522  PRO E CD  1 
ATOM   6386 N N   . GLU E 1 32  ? -29.389 42.729  72.154 1.00 74.30  ? 523  GLU E N   1 
ATOM   6387 C CA  . GLU E 1 32  ? -30.570 42.263  71.417 1.00 76.70  ? 523  GLU E CA  1 
ATOM   6388 C C   . GLU E 1 32  ? -31.823 42.589  72.233 1.00 78.19  ? 523  GLU E C   1 
ATOM   6389 O O   . GLU E 1 32  ? -32.741 43.260  71.750 1.00 77.74  ? 523  GLU E O   1 
ATOM   6390 C CB  . GLU E 1 32  ? -30.510 40.744  71.184 1.00 77.57  ? 523  GLU E CB  1 
ATOM   6391 C CG  . GLU E 1 32  ? -29.794 40.293  69.906 1.00 78.40  ? 523  GLU E CG  1 
ATOM   6392 C CD  . GLU E 1 32  ? -29.921 38.788  69.655 1.00 78.48  ? 523  GLU E CD  1 
ATOM   6393 O OE1 . GLU E 1 32  ? -29.440 38.310  68.604 1.00 77.68  ? 523  GLU E OE1 1 
ATOM   6394 O OE2 . GLU E 1 32  ? -30.499 38.083  70.511 1.00 78.21  ? 523  GLU E OE2 1 
ATOM   6395 N N   . ALA E 1 33  ? -31.855 42.094  73.470 1.00 79.15  ? 524  ALA E N   1 
ATOM   6396 C CA  . ALA E 1 33  ? -32.969 42.347  74.375 1.00 80.03  ? 524  ALA E CA  1 
ATOM   6397 C C   . ALA E 1 33  ? -32.580 43.520  75.271 1.00 80.73  ? 524  ALA E C   1 
ATOM   6398 O O   . ALA E 1 33  ? -31.817 43.363  76.226 1.00 80.37  ? 524  ALA E O   1 
ATOM   6399 C CB  . ALA E 1 33  ? -33.261 41.114  75.218 1.00 80.14  ? 524  ALA E CB  1 
ATOM   6400 N N   . THR E 1 34  ? -33.097 44.698  74.937 1.00 81.36  ? 525  THR E N   1 
ATOM   6401 C CA  . THR E 1 34  ? -32.816 45.916  75.691 1.00 81.08  ? 525  THR E CA  1 
ATOM   6402 C C   . THR E 1 34  ? -33.793 46.044  76.859 1.00 80.35  ? 525  THR E C   1 
ATOM   6403 O O   . THR E 1 34  ? -33.483 46.655  77.882 1.00 80.14  ? 525  THR E O   1 
ATOM   6404 C CB  . THR E 1 34  ? -32.934 47.178  74.776 1.00 81.57  ? 525  THR E CB  1 
ATOM   6405 O OG1 . THR E 1 34  ? -34.253 47.255  74.216 1.00 81.57  ? 525  THR E OG1 1 
ATOM   6406 C CG2 . THR E 1 34  ? -31.923 47.110  73.634 1.00 81.46  ? 525  THR E CG2 1 
ATOM   6407 N N   . GLY E 1 35  ? -34.968 45.444  76.696 1.00 79.62  ? 526  GLY E N   1 
ATOM   6408 C CA  . GLY E 1 35  ? -35.987 45.507  77.725 1.00 78.08  ? 526  GLY E CA  1 
ATOM   6409 C C   . GLY E 1 35  ? -36.913 46.674  77.451 1.00 77.06  ? 526  GLY E C   1 
ATOM   6410 O O   . GLY E 1 35  ? -37.605 47.151  78.352 1.00 77.40  ? 526  GLY E O   1 
ATOM   6411 N N   . GLY E 1 36  ? -36.924 47.130  76.198 1.00 75.59  ? 527  GLY E N   1 
ATOM   6412 C CA  . GLY E 1 36  ? -37.763 48.253  75.811 1.00 73.04  ? 527  GLY E CA  1 
ATOM   6413 C C   . GLY E 1 36  ? -37.392 49.515  76.568 1.00 71.81  ? 527  GLY E C   1 
ATOM   6414 O O   . GLY E 1 36  ? -38.257 50.337  76.875 1.00 72.73  ? 527  GLY E O   1 
ATOM   6415 N N   . VAL E 1 37  ? -36.101 49.662  76.869 1.00 69.01  ? 528  VAL E N   1 
ATOM   6416 C CA  . VAL E 1 37  ? -35.566 50.808  77.607 1.00 65.18  ? 528  VAL E CA  1 
ATOM   6417 C C   . VAL E 1 37  ? -34.214 51.170  76.991 1.00 62.34  ? 528  VAL E C   1 
ATOM   6418 O O   . VAL E 1 37  ? -33.527 50.300  76.462 1.00 63.79  ? 528  VAL E O   1 
ATOM   6419 C CB  . VAL E 1 37  ? -35.355 50.444  79.098 1.00 65.65  ? 528  VAL E CB  1 
ATOM   6420 C CG1 . VAL E 1 37  ? -34.731 51.607  79.846 1.00 66.47  ? 528  VAL E CG1 1 
ATOM   6421 C CG2 . VAL E 1 37  ? -36.676 50.062  79.729 1.00 65.24  ? 528  VAL E CG2 1 
ATOM   6422 N N   . PRO E 1 38  ? -33.812 52.452  77.053 1.00 59.01  ? 529  PRO E N   1 
ATOM   6423 C CA  . PRO E 1 38  ? -32.528 52.899  76.487 1.00 55.70  ? 529  PRO E CA  1 
ATOM   6424 C C   . PRO E 1 38  ? -31.302 52.473  77.297 1.00 52.72  ? 529  PRO E C   1 
ATOM   6425 O O   . PRO E 1 38  ? -31.295 52.603  78.521 1.00 53.37  ? 529  PRO E O   1 
ATOM   6426 C CB  . PRO E 1 38  ? -32.657 54.428  76.477 1.00 55.78  ? 529  PRO E CB  1 
ATOM   6427 C CG  . PRO E 1 38  ? -34.124 54.688  76.583 1.00 57.72  ? 529  PRO E CG  1 
ATOM   6428 C CD  . PRO E 1 38  ? -34.607 53.606  77.504 1.00 58.96  ? 529  PRO E CD  1 
ATOM   6429 N N   . ILE E 1 39  ? -30.262 51.982  76.621 1.00 48.78  ? 530  ILE E N   1 
ATOM   6430 C CA  . ILE E 1 39  ? -29.035 51.596  77.317 1.00 44.25  ? 530  ILE E CA  1 
ATOM   6431 C C   . ILE E 1 39  ? -28.372 52.897  77.792 1.00 42.98  ? 530  ILE E C   1 
ATOM   6432 O O   . ILE E 1 39  ? -28.200 53.839  77.017 1.00 41.57  ? 530  ILE E O   1 
ATOM   6433 C CB  . ILE E 1 39  ? -28.043 50.827  76.390 1.00 42.82  ? 530  ILE E CB  1 
ATOM   6434 C CG1 . ILE E 1 39  ? -28.533 49.400  76.128 1.00 40.47  ? 530  ILE E CG1 1 
ATOM   6435 C CG2 . ILE E 1 39  ? -26.677 50.733  77.057 1.00 40.83  ? 530  ILE E CG2 1 
ATOM   6436 C CD1 . ILE E 1 39  ? -29.862 49.310  75.479 1.00 39.64  ? 530  ILE E CD1 1 
ATOM   6437 N N   . LEU E 1 40  ? -28.004 52.946  79.066 1.00 41.12  ? 531  LEU E N   1 
ATOM   6438 C CA  . LEU E 1 40  ? -27.387 54.140  79.635 1.00 39.61  ? 531  LEU E CA  1 
ATOM   6439 C C   . LEU E 1 40  ? -25.870 54.108  79.591 1.00 38.86  ? 531  LEU E C   1 
ATOM   6440 O O   . LEU E 1 40  ? -25.234 55.080  79.190 1.00 38.45  ? 531  LEU E O   1 
ATOM   6441 C CB  . LEU E 1 40  ? -27.836 54.321  81.090 1.00 39.22  ? 531  LEU E CB  1 
ATOM   6442 C CG  . LEU E 1 40  ? -29.349 54.273  81.342 1.00 40.29  ? 531  LEU E CG  1 
ATOM   6443 C CD1 . LEU E 1 40  ? -29.620 54.346  82.837 1.00 38.80  ? 531  LEU E CD1 1 
ATOM   6444 C CD2 . LEU E 1 40  ? -30.042 55.410  80.597 1.00 36.48  ? 531  LEU E CD2 1 
ATOM   6445 N N   . LYS E 1 41  ? -25.294 52.990  80.019 1.00 38.24  ? 532  LYS E N   1 
ATOM   6446 C CA  . LYS E 1 41  ? -23.846 52.844  80.052 1.00 37.40  ? 532  LYS E CA  1 
ATOM   6447 C C   . LYS E 1 41  ? -23.447 51.425  79.704 1.00 34.95  ? 532  LYS E C   1 
ATOM   6448 O O   . LYS E 1 41  ? -24.292 50.543  79.569 1.00 34.05  ? 532  LYS E O   1 
ATOM   6449 C CB  . LYS E 1 41  ? -23.297 53.151  81.452 1.00 39.52  ? 532  LYS E CB  1 
ATOM   6450 C CG  . LYS E 1 41  ? -23.762 54.451  82.080 1.00 44.21  ? 532  LYS E CG  1 
ATOM   6451 C CD  . LYS E 1 41  ? -23.177 55.668  81.376 1.00 49.87  ? 532  LYS E CD  1 
ATOM   6452 C CE  . LYS E 1 41  ? -23.444 56.950  82.167 1.00 52.16  ? 532  LYS E CE  1 
ATOM   6453 N NZ  . LYS E 1 41  ? -22.852 58.146  81.500 1.00 53.68  ? 532  LYS E NZ  1 
ATOM   6454 N N   . TYR E 1 42  ? -22.140 51.229  79.574 1.00 32.41  ? 533  TYR E N   1 
ATOM   6455 C CA  . TYR E 1 42  ? -21.555 49.931  79.282 1.00 30.29  ? 533  TYR E CA  1 
ATOM   6456 C C   . TYR E 1 42  ? -20.402 49.755  80.259 1.00 30.42  ? 533  TYR E C   1 
ATOM   6457 O O   . TYR E 1 42  ? -19.548 50.629  80.369 1.00 31.43  ? 533  TYR E O   1 
ATOM   6458 C CB  . TYR E 1 42  ? -21.006 49.883  77.854 1.00 26.87  ? 533  TYR E CB  1 
ATOM   6459 C CG  . TYR E 1 42  ? -22.049 49.793  76.760 1.00 24.86  ? 533  TYR E CG  1 
ATOM   6460 C CD1 . TYR E 1 42  ? -22.716 48.597  76.504 1.00 21.06  ? 533  TYR E CD1 1 
ATOM   6461 C CD2 . TYR E 1 42  ? -22.368 50.912  75.973 1.00 22.28  ? 533  TYR E CD2 1 
ATOM   6462 C CE1 . TYR E 1 42  ? -23.667 48.509  75.502 1.00 19.51  ? 533  TYR E CE1 1 
ATOM   6463 C CE2 . TYR E 1 42  ? -23.321 50.833  74.967 1.00 20.23  ? 533  TYR E CE2 1 
ATOM   6464 C CZ  . TYR E 1 42  ? -23.966 49.627  74.736 1.00 20.80  ? 533  TYR E CZ  1 
ATOM   6465 O OH  . TYR E 1 42  ? -24.909 49.538  73.736 1.00 22.81  ? 533  TYR E OH  1 
ATOM   6466 N N   . LYS E 1 43  ? -20.387 48.643  80.983 1.00 30.51  ? 534  LYS E N   1 
ATOM   6467 C CA  . LYS E 1 43  ? -19.295 48.369  81.910 1.00 31.07  ? 534  LYS E CA  1 
ATOM   6468 C C   . LYS E 1 43  ? -18.367 47.384  81.204 1.00 32.91  ? 534  LYS E C   1 
ATOM   6469 O O   . LYS E 1 43  ? -18.806 46.334  80.730 1.00 33.34  ? 534  LYS E O   1 
ATOM   6470 C CB  . LYS E 1 43  ? -19.822 47.751  83.203 1.00 30.18  ? 534  LYS E CB  1 
ATOM   6471 C CG  . LYS E 1 43  ? -18.770 47.417  84.260 1.00 28.85  ? 534  LYS E CG  1 
ATOM   6472 C CD  . LYS E 1 43  ? -19.461 46.735  85.447 1.00 31.28  ? 534  LYS E CD  1 
ATOM   6473 C CE  . LYS E 1 43  ? -18.508 46.135  86.472 1.00 32.79  ? 534  LYS E CE  1 
ATOM   6474 N NZ  . LYS E 1 43  ? -17.868 47.160  87.348 1.00 37.73  ? 534  LYS E NZ  1 
ATOM   6475 N N   . ALA E 1 44  ? -17.091 47.741  81.108 1.00 33.03  ? 535  ALA E N   1 
ATOM   6476 C CA  . ALA E 1 44  ? -16.112 46.881  80.466 1.00 31.51  ? 535  ALA E CA  1 
ATOM   6477 C C   . ALA E 1 44  ? -15.158 46.340  81.522 1.00 31.31  ? 535  ALA E C   1 
ATOM   6478 O O   . ALA E 1 44  ? -14.749 47.052  82.435 1.00 31.51  ? 535  ALA E O   1 
ATOM   6479 C CB  . ALA E 1 44  ? -15.348 47.655  79.412 1.00 30.45  ? 535  ALA E CB  1 
ATOM   6480 N N   . GLU E 1 45  ? -14.823 45.066  81.394 1.00 31.34  ? 536  GLU E N   1 
ATOM   6481 C CA  . GLU E 1 45  ? -13.920 44.410  82.318 1.00 31.66  ? 536  GLU E CA  1 
ATOM   6482 C C   . GLU E 1 45  ? -12.845 43.717  81.506 1.00 32.06  ? 536  GLU E C   1 
ATOM   6483 O O   . GLU E 1 45  ? -13.148 43.032  80.527 1.00 32.84  ? 536  GLU E O   1 
ATOM   6484 C CB  . GLU E 1 45  ? -14.666 43.373  83.150 1.00 32.51  ? 536  GLU E CB  1 
ATOM   6485 C CG  . GLU E 1 45  ? -15.762 43.940  84.013 1.00 35.46  ? 536  GLU E CG  1 
ATOM   6486 C CD  . GLU E 1 45  ? -16.409 42.887  84.885 1.00 36.06  ? 536  GLU E CD  1 
ATOM   6487 O OE1 . GLU E 1 45  ? -17.124 43.269  85.830 1.00 37.10  ? 536  GLU E OE1 1 
ATOM   6488 O OE2 . GLU E 1 45  ? -16.210 41.680  84.628 1.00 35.62  ? 536  GLU E OE2 1 
ATOM   6489 N N   . TRP E 1 46  ? -11.593 43.900  81.910 1.00 30.79  ? 537  TRP E N   1 
ATOM   6490 C CA  . TRP E 1 46  ? -10.484 43.280  81.211 1.00 30.46  ? 537  TRP E CA  1 
ATOM   6491 C C   . TRP E 1 46  ? -9.438  42.872  82.229 1.00 32.07  ? 537  TRP E C   1 
ATOM   6492 O O   . TRP E 1 46  ? -9.437  43.359  83.368 1.00 32.68  ? 537  TRP E O   1 
ATOM   6493 C CB  . TRP E 1 46  ? -9.877  44.257  80.203 1.00 28.11  ? 537  TRP E CB  1 
ATOM   6494 C CG  . TRP E 1 46  ? -9.221  45.419  80.849 1.00 26.10  ? 537  TRP E CG  1 
ATOM   6495 C CD1 . TRP E 1 46  ? -7.884  45.572  81.112 1.00 25.25  ? 537  TRP E CD1 1 
ATOM   6496 C CD2 . TRP E 1 46  ? -9.867  46.583  81.365 1.00 24.93  ? 537  TRP E CD2 1 
ATOM   6497 N NE1 . TRP E 1 46  ? -7.663  46.761  81.763 1.00 22.69  ? 537  TRP E NE1 1 
ATOM   6498 C CE2 . TRP E 1 46  ? -8.862  47.403  81.931 1.00 24.97  ? 537  TRP E CE2 1 
ATOM   6499 C CE3 . TRP E 1 46  ? -11.197 47.017  81.403 1.00 23.79  ? 537  TRP E CE3 1 
ATOM   6500 C CZ2 . TRP E 1 46  ? -9.150  48.636  82.529 1.00 23.29  ? 537  TRP E CZ2 1 
ATOM   6501 C CZ3 . TRP E 1 46  ? -11.483 48.247  81.996 1.00 25.23  ? 537  TRP E CZ3 1 
ATOM   6502 C CH2 . TRP E 1 46  ? -10.460 49.041  82.551 1.00 24.43  ? 537  TRP E CH2 1 
ATOM   6503 N N   . ARG E 1 47  ? -8.550  41.973  81.825 1.00 30.91  ? 538  ARG E N   1 
ATOM   6504 C CA  . ARG E 1 47  ? -7.510  41.531  82.725 1.00 30.51  ? 538  ARG E CA  1 
ATOM   6505 C C   . ARG E 1 47  ? -6.425  40.733  82.031 1.00 28.96  ? 538  ARG E C   1 
ATOM   6506 O O   . ARG E 1 47  ? -6.662  40.087  81.022 1.00 29.25  ? 538  ARG E O   1 
ATOM   6507 C CB  . ARG E 1 47  ? -8.113  40.711  83.872 1.00 31.47  ? 538  ARG E CB  1 
ATOM   6508 C CG  . ARG E 1 47  ? -8.753  39.365  83.499 1.00 35.89  ? 538  ARG E CG  1 
ATOM   6509 C CD  . ARG E 1 47  ? -8.463  38.361  84.617 1.00 39.13  ? 538  ARG E CD  1 
ATOM   6510 N NE  . ARG E 1 47  ? -9.543  37.418  84.913 1.00 41.63  ? 538  ARG E NE  1 
ATOM   6511 C CZ  . ARG E 1 47  ? -9.859  36.365  84.164 1.00 43.99  ? 538  ARG E CZ  1 
ATOM   6512 N NH1 . ARG E 1 47  ? -9.183  36.107  83.048 1.00 43.96  ? 538  ARG E NH1 1 
ATOM   6513 N NH2 . ARG E 1 47  ? -10.829 35.547  84.555 1.00 41.89  ? 538  ARG E NH2 1 
ATOM   6514 N N   . ALA E 1 48  ? -5.217  40.801  82.566 1.00 28.28  ? 539  ALA E N   1 
ATOM   6515 C CA  . ALA E 1 48  ? -4.128  40.038  81.996 1.00 29.07  ? 539  ALA E CA  1 
ATOM   6516 C C   . ALA E 1 48  ? -4.491  38.577  82.227 1.00 30.25  ? 539  ALA E C   1 
ATOM   6517 O O   . ALA E 1 48  ? -4.851  38.185  83.338 1.00 30.69  ? 539  ALA E O   1 
ATOM   6518 C CB  . ALA E 1 48  ? -2.837  40.368  82.699 1.00 25.16  ? 539  ALA E CB  1 
ATOM   6519 N N   . VAL E 1 49  ? -4.442  37.779  81.174 1.00 32.06  ? 540  VAL E N   1 
ATOM   6520 C CA  . VAL E 1 49  ? -4.740  36.358  81.300 1.00 34.84  ? 540  VAL E CA  1 
ATOM   6521 C C   . VAL E 1 49  ? -3.834  35.877  82.437 1.00 37.74  ? 540  VAL E C   1 
ATOM   6522 O O   . VAL E 1 49  ? -2.640  36.202  82.458 1.00 39.03  ? 540  VAL E O   1 
ATOM   6523 C CB  . VAL E 1 49  ? -4.415  35.637  79.963 1.00 33.21  ? 540  VAL E CB  1 
ATOM   6524 C CG1 . VAL E 1 49  ? -3.966  34.222  80.203 1.00 33.16  ? 540  VAL E CG1 1 
ATOM   6525 C CG2 . VAL E 1 49  ? -5.635  35.660  79.074 1.00 33.18  ? 540  VAL E CG2 1 
ATOM   6526 N N   . GLY E 1 50  ? -4.385  35.129  83.389 1.00 37.55  ? 541  GLY E N   1 
ATOM   6527 C CA  . GLY E 1 50  ? -3.564  34.690  84.506 1.00 39.93  ? 541  GLY E CA  1 
ATOM   6528 C C   . GLY E 1 50  ? -3.988  35.333  85.825 1.00 42.03  ? 541  GLY E C   1 
ATOM   6529 O O   . GLY E 1 50  ? -3.951  34.686  86.870 1.00 42.79  ? 541  GLY E O   1 
ATOM   6530 N N   . GLU E 1 51  ? -4.384  36.603  85.784 1.00 42.68  ? 542  GLU E N   1 
ATOM   6531 C CA  . GLU E 1 51  ? -4.843  37.300  86.978 1.00 44.24  ? 542  GLU E CA  1 
ATOM   6532 C C   . GLU E 1 51  ? -6.238  36.772  87.256 1.00 44.51  ? 542  GLU E C   1 
ATOM   6533 O O   . GLU E 1 51  ? -6.851  36.200  86.365 1.00 45.21  ? 542  GLU E O   1 
ATOM   6534 C CB  . GLU E 1 51  ? -4.901  38.804  86.730 1.00 46.20  ? 542  GLU E CB  1 
ATOM   6535 C CG  . GLU E 1 51  ? -3.575  39.415  86.313 1.00 51.00  ? 542  GLU E CG  1 
ATOM   6536 C CD  . GLU E 1 51  ? -2.507  39.315  87.397 1.00 55.55  ? 542  GLU E CD  1 
ATOM   6537 O OE1 . GLU E 1 51  ? -1.347  39.700  87.119 1.00 56.66  ? 542  GLU E OE1 1 
ATOM   6538 O OE2 . GLU E 1 51  ? -2.821  38.858  88.525 1.00 58.31  ? 542  GLU E OE2 1 
ATOM   6539 N N   . GLU E 1 52  ? -6.738  36.961  88.476 1.00 45.59  ? 543  GLU E N   1 
ATOM   6540 C CA  . GLU E 1 52  ? -8.069  36.473  88.849 1.00 46.95  ? 543  GLU E CA  1 
ATOM   6541 C C   . GLU E 1 52  ? -9.092  37.593  88.955 1.00 45.74  ? 543  GLU E C   1 
ATOM   6542 O O   . GLU E 1 52  ? -10.295 37.355  88.864 1.00 46.86  ? 543  GLU E O   1 
ATOM   6543 C CB  . GLU E 1 52  ? -8.037  35.768  90.206 1.00 50.41  ? 543  GLU E CB  1 
ATOM   6544 C CG  . GLU E 1 52  ? -6.950  34.733  90.390 1.00 57.14  ? 543  GLU E CG  1 
ATOM   6545 C CD  . GLU E 1 52  ? -6.870  34.250  91.834 1.00 61.85  ? 543  GLU E CD  1 
ATOM   6546 O OE1 . GLU E 1 52  ? -5.869  33.585  92.191 1.00 64.11  ? 543  GLU E OE1 1 
ATOM   6547 O OE2 . GLU E 1 52  ? -7.811  34.537  92.612 1.00 62.90  ? 543  GLU E OE2 1 
ATOM   6548 N N   . VAL E 1 53  ? -8.621  38.811  89.177 1.00 42.62  ? 544  VAL E N   1 
ATOM   6549 C CA  . VAL E 1 53  ? -9.532  39.929  89.318 1.00 40.37  ? 544  VAL E CA  1 
ATOM   6550 C C   . VAL E 1 53  ? -9.616  40.742  88.040 1.00 39.40  ? 544  VAL E C   1 
ATOM   6551 O O   . VAL E 1 53  ? -8.620  40.936  87.348 1.00 38.78  ? 544  VAL E O   1 
ATOM   6552 C CB  . VAL E 1 53  ? -9.097  40.839  90.492 1.00 40.86  ? 544  VAL E CB  1 
ATOM   6553 C CG1 . VAL E 1 53  ? -10.046 42.022  90.629 1.00 39.46  ? 544  VAL E CG1 1 
ATOM   6554 C CG2 . VAL E 1 53  ? -9.073  40.033  91.781 1.00 38.68  ? 544  VAL E CG2 1 
ATOM   6555 N N   . TRP E 1 54  ? -10.815 41.218  87.729 1.00 37.78  ? 545  TRP E N   1 
ATOM   6556 C CA  . TRP E 1 54  ? -11.019 42.009  86.530 1.00 36.21  ? 545  TRP E CA  1 
ATOM   6557 C C   . TRP E 1 54  ? -10.934 43.490  86.849 1.00 35.65  ? 545  TRP E C   1 
ATOM   6558 O O   . TRP E 1 54  ? -11.398 43.921  87.901 1.00 36.11  ? 545  TRP E O   1 
ATOM   6559 C CB  . TRP E 1 54  ? -12.412 41.759  85.925 1.00 36.08  ? 545  TRP E CB  1 
ATOM   6560 C CG  . TRP E 1 54  ? -12.703 40.367  85.457 1.00 36.15  ? 545  TRP E CG  1 
ATOM   6561 C CD1 . TRP E 1 54  ? -13.089 39.303  86.224 1.00 35.12  ? 545  TRP E CD1 1 
ATOM   6562 C CD2 . TRP E 1 54  ? -12.628 39.883  84.111 1.00 36.34  ? 545  TRP E CD2 1 
ATOM   6563 N NE1 . TRP E 1 54  ? -13.259 38.189  85.440 1.00 34.15  ? 545  TRP E NE1 1 
ATOM   6564 C CE2 . TRP E 1 54  ? -12.981 38.513  84.138 1.00 35.59  ? 545  TRP E CE2 1 
ATOM   6565 C CE3 . TRP E 1 54  ? -12.293 40.473  82.882 1.00 34.54  ? 545  TRP E CE3 1 
ATOM   6566 C CZ2 . TRP E 1 54  ? -13.008 37.723  82.987 1.00 33.38  ? 545  TRP E CZ2 1 
ATOM   6567 C CZ3 . TRP E 1 54  ? -12.321 39.685  81.735 1.00 34.66  ? 545  TRP E CZ3 1 
ATOM   6568 C CH2 . TRP E 1 54  ? -12.676 38.324  81.798 1.00 34.49  ? 545  TRP E CH2 1 
ATOM   6569 N N   . HIS E 1 55  ? -10.332 44.263  85.950 1.00 34.59  ? 546  HIS E N   1 
ATOM   6570 C CA  . HIS E 1 55  ? -10.297 45.711  86.107 1.00 34.82  ? 546  HIS E CA  1 
ATOM   6571 C C   . HIS E 1 55  ? -11.584 46.122  85.391 1.00 35.18  ? 546  HIS E C   1 
ATOM   6572 O O   . HIS E 1 55  ? -12.198 45.313  84.698 1.00 35.06  ? 546  HIS E O   1 
ATOM   6573 C CB  . HIS E 1 55  ? -9.116  46.343  85.370 1.00 36.77  ? 546  HIS E CB  1 
ATOM   6574 C CG  . HIS E 1 55  ? -7.812  46.213  86.086 1.00 38.84  ? 546  HIS E CG  1 
ATOM   6575 N ND1 . HIS E 1 55  ? -7.581  46.784  87.316 1.00 40.70  ? 546  HIS E ND1 1 
ATOM   6576 C CD2 . HIS E 1 55  ? -6.663  45.585  85.741 1.00 40.63  ? 546  HIS E CD2 1 
ATOM   6577 C CE1 . HIS E 1 55  ? -6.346  46.515  87.699 1.00 41.12  ? 546  HIS E CE1 1 
ATOM   6578 N NE2 . HIS E 1 55  ? -5.768  45.788  86.761 1.00 40.46  ? 546  HIS E NE2 1 
ATOM   6579 N N   . SER E 1 56  ? -12.004 47.365  85.541 1.00 34.74  ? 547  SER E N   1 
ATOM   6580 C CA  . SER E 1 56  ? -13.215 47.786  84.867 1.00 34.94  ? 547  SER E CA  1 
ATOM   6581 C C   . SER E 1 56  ? -13.250 49.289  84.683 1.00 35.01  ? 547  SER E C   1 
ATOM   6582 O O   . SER E 1 56  ? -12.410 50.011  85.219 1.00 35.25  ? 547  SER E O   1 
ATOM   6583 C CB  . SER E 1 56  ? -14.456 47.291  85.626 1.00 33.29  ? 547  SER E CB  1 
ATOM   6584 O OG  . SER E 1 56  ? -14.372 47.575  87.010 1.00 34.28  ? 547  SER E OG  1 
ATOM   6585 N N   . LYS E 1 57  ? -14.221 49.746  83.904 1.00 35.57  ? 548  LYS E N   1 
ATOM   6586 C CA  . LYS E 1 57  ? -14.381 51.157  83.614 1.00 36.35  ? 548  LYS E CA  1 
ATOM   6587 C C   . LYS E 1 57  ? -15.769 51.297  82.995 1.00 35.89  ? 548  LYS E C   1 
ATOM   6588 O O   . LYS E 1 57  ? -16.205 50.407  82.264 1.00 34.55  ? 548  LYS E O   1 
ATOM   6589 C CB  . LYS E 1 57  ? -13.289 51.571  82.620 1.00 39.22  ? 548  LYS E CB  1 
ATOM   6590 C CG  . LYS E 1 57  ? -13.335 53.001  82.108 1.00 42.88  ? 548  LYS E CG  1 
ATOM   6591 C CD  . LYS E 1 57  ? -12.690 53.975  83.080 1.00 47.40  ? 548  LYS E CD  1 
ATOM   6592 C CE  . LYS E 1 57  ? -12.492 55.351  82.428 1.00 50.47  ? 548  LYS E CE  1 
ATOM   6593 N NZ  . LYS E 1 57  ? -13.771 55.947  81.910 1.00 51.86  ? 548  LYS E NZ  1 
ATOM   6594 N N   . TRP E 1 58  ? -16.477 52.381  83.313 1.00 36.03  ? 549  TRP E N   1 
ATOM   6595 C CA  . TRP E 1 58  ? -17.803 52.608  82.730 1.00 35.76  ? 549  TRP E CA  1 
ATOM   6596 C C   . TRP E 1 58  ? -17.681 53.488  81.492 1.00 36.24  ? 549  TRP E C   1 
ATOM   6597 O O   . TRP E 1 58  ? -16.812 54.362  81.405 1.00 37.87  ? 549  TRP E O   1 
ATOM   6598 C CB  . TRP E 1 58  ? -18.756 53.269  83.730 1.00 36.07  ? 549  TRP E CB  1 
ATOM   6599 C CG  . TRP E 1 58  ? -19.175 52.375  84.855 1.00 35.96  ? 549  TRP E CG  1 
ATOM   6600 C CD1 . TRP E 1 58  ? -18.505 52.163  86.024 1.00 37.17  ? 549  TRP E CD1 1 
ATOM   6601 C CD2 . TRP E 1 58  ? -20.343 51.537  84.903 1.00 35.37  ? 549  TRP E CD2 1 
ATOM   6602 N NE1 . TRP E 1 58  ? -19.181 51.243  86.800 1.00 37.91  ? 549  TRP E NE1 1 
ATOM   6603 C CE2 . TRP E 1 58  ? -20.310 50.842  86.137 1.00 35.31  ? 549  TRP E CE2 1 
ATOM   6604 C CE3 . TRP E 1 58  ? -21.412 51.305  84.024 1.00 34.69  ? 549  TRP E CE3 1 
ATOM   6605 C CZ2 . TRP E 1 58  ? -21.304 49.931  86.516 1.00 33.05  ? 549  TRP E CZ2 1 
ATOM   6606 C CZ3 . TRP E 1 58  ? -22.405 50.396  84.402 1.00 35.59  ? 549  TRP E CZ3 1 
ATOM   6607 C CH2 . TRP E 1 58  ? -22.340 49.721  85.641 1.00 33.92  ? 549  TRP E CH2 1 
ATOM   6608 N N   . TYR E 1 59  ? -18.558 53.251  80.530 1.00 36.10  ? 550  TYR E N   1 
ATOM   6609 C CA  . TYR E 1 59  ? -18.543 53.997  79.280 1.00 36.15  ? 550  TYR E CA  1 
ATOM   6610 C C   . TYR E 1 59  ? -19.935 54.498  78.932 1.00 36.68  ? 550  TYR E C   1 
ATOM   6611 O O   . TYR E 1 59  ? -20.898 53.732  78.931 1.00 36.21  ? 550  TYR E O   1 
ATOM   6612 C CB  . TYR E 1 59  ? -18.025 53.096  78.153 1.00 36.17  ? 550  TYR E CB  1 
ATOM   6613 C CG  . TYR E 1 59  ? -16.556 52.753  78.266 1.00 34.85  ? 550  TYR E CG  1 
ATOM   6614 C CD1 . TYR E 1 59  ? -15.577 53.584  77.715 1.00 32.96  ? 550  TYR E CD1 1 
ATOM   6615 C CD2 . TYR E 1 59  ? -16.145 51.601  78.928 1.00 33.35  ? 550  TYR E CD2 1 
ATOM   6616 C CE1 . TYR E 1 59  ? -14.227 53.274  77.813 1.00 32.64  ? 550  TYR E CE1 1 
ATOM   6617 C CE2 . TYR E 1 59  ? -14.800 51.282  79.038 1.00 34.62  ? 550  TYR E CE2 1 
ATOM   6618 C CZ  . TYR E 1 59  ? -13.844 52.119  78.477 1.00 34.53  ? 550  TYR E CZ  1 
ATOM   6619 O OH  . TYR E 1 59  ? -12.515 51.778  78.576 1.00 32.04  ? 550  TYR E OH  1 
ATOM   6620 N N   . ASP E 1 60  ? -20.037 55.789  78.638 1.00 37.60  ? 551  ASP E N   1 
ATOM   6621 C CA  . ASP E 1 60  ? -21.317 56.378  78.287 1.00 38.37  ? 551  ASP E CA  1 
ATOM   6622 C C   . ASP E 1 60  ? -21.827 55.681  77.037 1.00 38.65  ? 551  ASP E C   1 
ATOM   6623 O O   . ASP E 1 60  ? -21.095 55.536  76.057 1.00 38.65  ? 551  ASP E O   1 
ATOM   6624 C CB  . ASP E 1 60  ? -21.153 57.869  78.027 1.00 40.37  ? 551  ASP E CB  1 
ATOM   6625 C CG  . ASP E 1 60  ? -22.454 58.537  77.656 1.00 42.62  ? 551  ASP E CG  1 
ATOM   6626 O OD1 . ASP E 1 60  ? -23.394 58.485  78.483 1.00 42.30  ? 551  ASP E OD1 1 
ATOM   6627 O OD2 . ASP E 1 60  ? -22.532 59.107  76.541 1.00 43.69  ? 551  ASP E OD2 1 
ATOM   6628 N N   . ALA E 1 61  ? -23.080 55.250  77.068 1.00 38.79  ? 552  ALA E N   1 
ATOM   6629 C CA  . ALA E 1 61  ? -23.650 54.542  75.934 1.00 39.61  ? 552  ALA E CA  1 
ATOM   6630 C C   . ALA E 1 61  ? -23.736 55.419  74.710 1.00 40.17  ? 552  ALA E C   1 
ATOM   6631 O O   . ALA E 1 61  ? -23.395 54.994  73.612 1.00 39.31  ? 552  ALA E O   1 
ATOM   6632 C CB  . ALA E 1 61  ? -25.038 53.999  76.282 1.00 39.30  ? 552  ALA E CB  1 
ATOM   6633 N N   . LYS E 1 62  ? -24.189 56.649  74.896 1.00 42.91  ? 553  LYS E N   1 
ATOM   6634 C CA  . LYS E 1 62  ? -24.332 57.548  73.770 1.00 45.94  ? 553  LYS E CA  1 
ATOM   6635 C C   . LYS E 1 62  ? -22.993 57.850  73.096 1.00 46.87  ? 553  LYS E C   1 
ATOM   6636 O O   . LYS E 1 62  ? -22.890 57.820  71.867 1.00 46.88  ? 553  LYS E O   1 
ATOM   6637 C CB  . LYS E 1 62  ? -25.021 58.841  74.210 1.00 48.03  ? 553  LYS E CB  1 
ATOM   6638 C CG  . LYS E 1 62  ? -25.570 59.669  73.051 1.00 52.31  ? 553  LYS E CG  1 
ATOM   6639 C CD  . LYS E 1 62  ? -26.420 60.845  73.540 1.00 57.14  ? 553  LYS E CD  1 
ATOM   6640 C CE  . LYS E 1 62  ? -27.738 60.388  74.186 1.00 58.11  ? 553  LYS E CE  1 
ATOM   6641 N NZ  . LYS E 1 62  ? -27.546 59.478  75.353 1.00 57.86  ? 553  LYS E NZ  1 
ATOM   6642 N N   . GLU E 1 63  ? -21.961 58.122  73.884 1.00 46.96  ? 554  GLU E N   1 
ATOM   6643 C CA  . GLU E 1 63  ? -20.670 58.416  73.289 1.00 48.85  ? 554  GLU E CA  1 
ATOM   6644 C C   . GLU E 1 63  ? -20.101 57.181  72.596 1.00 49.99  ? 554  GLU E C   1 
ATOM   6645 O O   . GLU E 1 63  ? -19.299 57.296  71.669 1.00 51.13  ? 554  GLU E O   1 
ATOM   6646 C CB  . GLU E 1 63  ? -19.685 58.899  74.348 1.00 49.73  ? 554  GLU E CB  1 
ATOM   6647 C CG  . GLU E 1 63  ? -18.531 59.702  73.781 1.00 50.92  ? 554  GLU E CG  1 
ATOM   6648 C CD  . GLU E 1 63  ? -17.445 59.951  74.806 1.00 53.49  ? 554  GLU E CD  1 
ATOM   6649 O OE1 . GLU E 1 63  ? -16.615 59.038  75.009 1.00 53.90  ? 554  GLU E OE1 1 
ATOM   6650 O OE2 . GLU E 1 63  ? -17.426 61.049  75.415 1.00 53.99  ? 554  GLU E OE2 1 
ATOM   6651 N N   . ALA E 1 64  ? -20.516 56.002  73.043 1.00 50.35  ? 555  ALA E N   1 
ATOM   6652 C CA  . ALA E 1 64  ? -20.024 54.757  72.460 1.00 51.98  ? 555  ALA E CA  1 
ATOM   6653 C C   . ALA E 1 64  ? -20.697 54.443  71.135 1.00 53.20  ? 555  ALA E C   1 
ATOM   6654 O O   . ALA E 1 64  ? -20.071 53.898  70.230 1.00 51.95  ? 555  ALA E O   1 
ATOM   6655 C CB  . ALA E 1 64  ? -20.239 53.599  73.429 1.00 51.81  ? 555  ALA E CB  1 
ATOM   6656 N N   . SER E 1 65  ? -21.976 54.782  71.031 1.00 55.59  ? 556  SER E N   1 
ATOM   6657 C CA  . SER E 1 65  ? -22.724 54.527  69.810 1.00 58.14  ? 556  SER E CA  1 
ATOM   6658 C C   . SER E 1 65  ? -22.284 55.510  68.731 1.00 59.29  ? 556  SER E C   1 
ATOM   6659 O O   . SER E 1 65  ? -22.338 55.195  67.539 1.00 59.65  ? 556  SER E O   1 
ATOM   6660 C CB  . SER E 1 65  ? -24.229 54.659  70.067 1.00 59.41  ? 556  SER E CB  1 
ATOM   6661 O OG  . SER E 1 65  ? -24.977 54.061  69.018 1.00 60.41  ? 556  SER E OG  1 
ATOM   6662 N N   . MET E 1 66  ? -21.846 56.696  69.152 1.00 60.17  ? 557  MET E N   1 
ATOM   6663 C CA  . MET E 1 66  ? -21.375 57.716  68.219 1.00 61.07  ? 557  MET E CA  1 
ATOM   6664 C C   . MET E 1 66  ? -19.942 57.434  67.773 1.00 60.40  ? 557  MET E C   1 
ATOM   6665 O O   . MET E 1 66  ? -19.564 57.756  66.645 1.00 61.51  ? 557  MET E O   1 
ATOM   6666 C CB  . MET E 1 66  ? -21.461 59.107  68.849 1.00 64.31  ? 557  MET E CB  1 
ATOM   6667 C CG  . MET E 1 66  ? -22.856 59.711  68.817 1.00 68.73  ? 557  MET E CG  1 
ATOM   6668 S SD  . MET E 1 66  ? -22.940 61.320  69.649 1.00 75.34  ? 557  MET E SD  1 
ATOM   6669 C CE  . MET E 1 66  ? -22.298 62.415  68.354 1.00 74.29  ? 557  MET E CE  1 
ATOM   6670 N N   . GLU E 1 67  ? -19.142 56.845  68.661 1.00 58.56  ? 558  GLU E N   1 
ATOM   6671 C CA  . GLU E 1 67  ? -17.763 56.493  68.325 1.00 55.47  ? 558  GLU E CA  1 
ATOM   6672 C C   . GLU E 1 67  ? -17.778 55.163  67.582 1.00 53.00  ? 558  GLU E C   1 
ATOM   6673 O O   . GLU E 1 67  ? -17.087 54.993  66.578 1.00 52.71  ? 558  GLU E O   1 
ATOM   6674 C CB  . GLU E 1 67  ? -16.898 56.354  69.584 1.00 55.67  ? 558  GLU E CB  1 
ATOM   6675 C CG  . GLU E 1 67  ? -16.386 57.668  70.153 1.00 57.36  ? 558  GLU E CG  1 
ATOM   6676 C CD  . GLU E 1 67  ? -15.271 57.467  71.171 1.00 58.73  ? 558  GLU E CD  1 
ATOM   6677 O OE1 . GLU E 1 67  ? -14.293 56.757  70.843 1.00 58.13  ? 558  GLU E OE1 1 
ATOM   6678 O OE2 . GLU E 1 67  ? -15.366 58.021  72.292 1.00 58.54  ? 558  GLU E OE2 1 
ATOM   6679 N N   . GLY E 1 68  ? -18.580 54.229  68.091 1.00 50.53  ? 559  GLY E N   1 
ATOM   6680 C CA  . GLY E 1 68  ? -18.698 52.909  67.492 1.00 46.78  ? 559  GLY E CA  1 
ATOM   6681 C C   . GLY E 1 68  ? -17.992 51.869  68.336 1.00 44.81  ? 559  GLY E C   1 
ATOM   6682 O O   . GLY E 1 68  ? -18.390 50.700  68.384 1.00 44.62  ? 559  GLY E O   1 
ATOM   6683 N N   . ILE E 1 69  ? -16.959 52.321  69.037 1.00 41.54  ? 560  ILE E N   1 
ATOM   6684 C CA  . ILE E 1 69  ? -16.135 51.464  69.871 1.00 39.78  ? 560  ILE E CA  1 
ATOM   6685 C C   . ILE E 1 69  ? -15.925 52.046  71.262 1.00 38.66  ? 560  ILE E C   1 
ATOM   6686 O O   . ILE E 1 69  ? -16.268 53.198  71.516 1.00 39.30  ? 560  ILE E O   1 
ATOM   6687 C CB  . ILE E 1 69  ? -14.710 51.297  69.241 1.00 39.74  ? 560  ILE E CB  1 
ATOM   6688 C CG1 . ILE E 1 69  ? -14.206 52.636  68.687 1.00 38.90  ? 560  ILE E CG1 1 
ATOM   6689 C CG2 . ILE E 1 69  ? -14.737 50.341  68.089 1.00 38.36  ? 560  ILE E CG2 1 
ATOM   6690 C CD1 . ILE E 1 69  ? -14.010 53.728  69.707 1.00 38.30  ? 560  ILE E CD1 1 
ATOM   6691 N N   . VAL E 1 70  ? -15.364 51.231  72.154 1.00 36.23  ? 561  VAL E N   1 
ATOM   6692 C CA  . VAL E 1 70  ? -14.992 51.674  73.494 1.00 33.47  ? 561  VAL E CA  1 
ATOM   6693 C C   . VAL E 1 70  ? -13.504 51.324  73.585 1.00 32.62  ? 561  VAL E C   1 
ATOM   6694 O O   . VAL E 1 70  ? -13.073 50.246  73.168 1.00 32.13  ? 561  VAL E O   1 
ATOM   6695 C CB  . VAL E 1 70  ? -15.766 50.962  74.634 1.00 33.34  ? 561  VAL E CB  1 
ATOM   6696 C CG1 . VAL E 1 70  ? -17.252 51.185  74.456 1.00 32.80  ? 561  VAL E CG1 1 
ATOM   6697 C CG2 . VAL E 1 70  ? -15.412 49.484  74.696 1.00 31.65  ? 561  VAL E CG2 1 
ATOM   6698 N N   . THR E 1 71  ? -12.708 52.245  74.100 1.00 30.81  ? 562  THR E N   1 
ATOM   6699 C CA  . THR E 1 71  ? -11.290 51.991  74.195 1.00 30.98  ? 562  THR E CA  1 
ATOM   6700 C C   . THR E 1 71  ? -10.846 51.724  75.626 1.00 31.30  ? 562  THR E C   1 
ATOM   6701 O O   . THR E 1 71  ? -11.128 52.516  76.522 1.00 33.49  ? 562  THR E O   1 
ATOM   6702 C CB  . THR E 1 71  ? -10.487 53.181  73.626 1.00 30.47  ? 562  THR E CB  1 
ATOM   6703 O OG1 . THR E 1 71  ? -10.879 53.411  72.265 1.00 28.99  ? 562  THR E OG1 1 
ATOM   6704 C CG2 . THR E 1 71  ? -8.987  52.896  73.682 1.00 28.03  ? 562  THR E CG2 1 
ATOM   6705 N N   . ILE E 1 72  ? -10.172 50.599  75.842 1.00 29.56  ? 563  ILE E N   1 
ATOM   6706 C CA  . ILE E 1 72  ? -9.671  50.283  77.163 1.00 32.14  ? 563  ILE E CA  1 
ATOM   6707 C C   . ILE E 1 72  ? -8.230  50.787  77.151 1.00 32.51  ? 563  ILE E C   1 
ATOM   6708 O O   . ILE E 1 72  ? -7.527  50.652  76.147 1.00 33.38  ? 563  ILE E O   1 
ATOM   6709 C CB  . ILE E 1 72  ? -9.711  48.755  77.461 1.00 33.66  ? 563  ILE E CB  1 
ATOM   6710 C CG1 . ILE E 1 72  ? -8.828  48.005  76.470 1.00 36.63  ? 563  ILE E CG1 1 
ATOM   6711 C CG2 . ILE E 1 72  ? -11.152 48.231  77.376 1.00 33.25  ? 563  ILE E CG2 1 
ATOM   6712 C CD1 . ILE E 1 72  ? -8.750  46.515  76.729 1.00 41.30  ? 563  ILE E CD1 1 
ATOM   6713 N N   . VAL E 1 73  ? -7.790  51.372  78.259 1.00 32.20  ? 564  VAL E N   1 
ATOM   6714 C CA  . VAL E 1 73  ? -6.443  51.919  78.328 1.00 31.08  ? 564  VAL E CA  1 
ATOM   6715 C C   . VAL E 1 73  ? -5.581  51.354  79.454 1.00 31.98  ? 564  VAL E C   1 
ATOM   6716 O O   . VAL E 1 73  ? -6.028  50.512  80.235 1.00 31.03  ? 564  VAL E O   1 
ATOM   6717 C CB  . VAL E 1 73  ? -6.510  53.443  78.471 1.00 30.28  ? 564  VAL E CB  1 
ATOM   6718 C CG1 . VAL E 1 73  ? -7.261  54.041  77.276 1.00 30.04  ? 564  VAL E CG1 1 
ATOM   6719 C CG2 . VAL E 1 73  ? -7.212  53.808  79.769 1.00 27.40  ? 564  VAL E CG2 1 
ATOM   6720 N N   . GLY E 1 74  ? -4.334  51.820  79.512 1.00 31.93  ? 565  GLY E N   1 
ATOM   6721 C CA  . GLY E 1 74  ? -3.405  51.377  80.536 1.00 31.89  ? 565  GLY E CA  1 
ATOM   6722 C C   . GLY E 1 74  ? -2.944  49.937  80.412 1.00 32.54  ? 565  GLY E C   1 
ATOM   6723 O O   . GLY E 1 74  ? -2.799  49.239  81.412 1.00 32.63  ? 565  GLY E O   1 
ATOM   6724 N N   . LEU E 1 75  ? -2.706  49.489  79.186 1.00 32.81  ? 566  LEU E N   1 
ATOM   6725 C CA  . LEU E 1 75  ? -2.263  48.123  78.949 1.00 31.87  ? 566  LEU E CA  1 
ATOM   6726 C C   . LEU E 1 75  ? -0.760  48.099  78.682 1.00 33.25  ? 566  LEU E C   1 
ATOM   6727 O O   . LEU E 1 75  ? -0.166  49.115  78.309 1.00 32.14  ? 566  LEU E O   1 
ATOM   6728 C CB  . LEU E 1 75  ? -3.003  47.544  77.743 1.00 31.20  ? 566  LEU E CB  1 
ATOM   6729 C CG  . LEU E 1 75  ? -4.533  47.624  77.694 1.00 29.14  ? 566  LEU E CG  1 
ATOM   6730 C CD1 . LEU E 1 75  ? -4.999  47.153  76.340 1.00 27.90  ? 566  LEU E CD1 1 
ATOM   6731 C CD2 . LEU E 1 75  ? -5.153  46.781  78.781 1.00 27.96  ? 566  LEU E CD2 1 
ATOM   6732 N N   . LYS E 1 76  ? -0.148  46.935  78.880 1.00 34.28  ? 567  LYS E N   1 
ATOM   6733 C CA  . LYS E 1 76  ? 1.282   46.765  78.637 1.00 35.51  ? 567  LYS E CA  1 
ATOM   6734 C C   . LYS E 1 76  ? 1.456   46.131  77.260 1.00 35.15  ? 567  LYS E C   1 
ATOM   6735 O O   . LYS E 1 76  ? 0.611   45.353  76.820 1.00 34.91  ? 567  LYS E O   1 
ATOM   6736 C CB  . LYS E 1 76  ? 1.905   45.832  79.683 1.00 37.70  ? 567  LYS E CB  1 
ATOM   6737 C CG  . LYS E 1 76  ? 1.819   46.300  81.123 1.00 41.52  ? 567  LYS E CG  1 
ATOM   6738 C CD  . LYS E 1 76  ? 2.491   45.280  82.053 1.00 44.89  ? 567  LYS E CD  1 
ATOM   6739 C CE  . LYS E 1 76  ? 2.672   45.816  83.484 1.00 47.70  ? 567  LYS E CE  1 
ATOM   6740 N NZ  . LYS E 1 76  ? 3.680   46.929  83.595 1.00 48.30  ? 567  LYS E NZ  1 
ATOM   6741 N N   . PRO E 1 77  ? 2.555   46.451  76.561 1.00 34.86  ? 568  PRO E N   1 
ATOM   6742 C CA  . PRO E 1 77  ? 2.800   45.879  75.232 1.00 34.93  ? 568  PRO E CA  1 
ATOM   6743 C C   . PRO E 1 77  ? 2.971   44.355  75.313 1.00 36.11  ? 568  PRO E C   1 
ATOM   6744 O O   . PRO E 1 77  ? 3.167   43.811  76.401 1.00 36.88  ? 568  PRO E O   1 
ATOM   6745 C CB  . PRO E 1 77  ? 4.084   46.580  74.791 1.00 33.31  ? 568  PRO E CB  1 
ATOM   6746 C CG  . PRO E 1 77  ? 3.998   47.897  75.464 1.00 33.37  ? 568  PRO E CG  1 
ATOM   6747 C CD  . PRO E 1 77  ? 3.518   47.525  76.849 1.00 34.05  ? 568  PRO E CD  1 
ATOM   6748 N N   . GLU E 1 78  ? 2.889   43.682  74.166 1.00 35.73  ? 569  GLU E N   1 
ATOM   6749 C CA  . GLU E 1 78  ? 3.039   42.230  74.079 1.00 35.98  ? 569  GLU E CA  1 
ATOM   6750 C C   . GLU E 1 78  ? 2.427   41.406  75.208 1.00 35.47  ? 569  GLU E C   1 
ATOM   6751 O O   . GLU E 1 78  ? 2.996   40.386  75.612 1.00 35.57  ? 569  GLU E O   1 
ATOM   6752 C CB  . GLU E 1 78  ? 4.513   41.871  73.977 1.00 38.06  ? 569  GLU E CB  1 
ATOM   6753 C CG  . GLU E 1 78  ? 5.119   42.136  72.635 1.00 43.24  ? 569  GLU E CG  1 
ATOM   6754 C CD  . GLU E 1 78  ? 6.599   41.862  72.636 1.00 47.33  ? 569  GLU E CD  1 
ATOM   6755 O OE1 . GLU E 1 78  ? 7.335   42.583  73.350 1.00 48.52  ? 569  GLU E OE1 1 
ATOM   6756 O OE2 . GLU E 1 78  ? 7.024   40.921  71.933 1.00 50.92  ? 569  GLU E OE2 1 
ATOM   6757 N N   . THR E 1 79  ? 1.270   41.826  75.705 1.00 33.80  ? 570  THR E N   1 
ATOM   6758 C CA  . THR E 1 79  ? 0.618   41.116  76.795 1.00 32.26  ? 570  THR E CA  1 
ATOM   6759 C C   . THR E 1 79  ? -0.757  40.570  76.401 1.00 33.49  ? 570  THR E C   1 
ATOM   6760 O O   . THR E 1 79  ? -1.538  41.226  75.706 1.00 33.59  ? 570  THR E O   1 
ATOM   6761 C CB  . THR E 1 79  ? 0.468   42.041  78.020 1.00 31.73  ? 570  THR E CB  1 
ATOM   6762 O OG1 . THR E 1 79  ? 1.760   42.514  78.414 1.00 30.52  ? 570  THR E OG1 1 
ATOM   6763 C CG2 . THR E 1 79  ? -0.182  41.304  79.186 1.00 29.99  ? 570  THR E CG2 1 
ATOM   6764 N N   . THR E 1 80  ? -1.047  39.359  76.854 1.00 33.86  ? 571  THR E N   1 
ATOM   6765 C CA  . THR E 1 80  ? -2.320  38.733  76.555 1.00 34.64  ? 571  THR E CA  1 
ATOM   6766 C C   . THR E 1 80  ? -3.364  39.111  77.611 1.00 35.53  ? 571  THR E C   1 
ATOM   6767 O O   . THR E 1 80  ? -3.142  38.945  78.812 1.00 35.55  ? 571  THR E O   1 
ATOM   6768 C CB  . THR E 1 80  ? -2.152  37.198  76.469 1.00 34.42  ? 571  THR E CB  1 
ATOM   6769 O OG1 . THR E 1 80  ? -1.199  36.887  75.439 1.00 35.80  ? 571  THR E OG1 1 
ATOM   6770 C CG2 . THR E 1 80  ? -3.480  36.519  76.139 1.00 33.29  ? 571  THR E CG2 1 
ATOM   6771 N N   . TYR E 1 81  ? -4.497  39.633  77.139 1.00 35.10  ? 572  TYR E N   1 
ATOM   6772 C CA  . TYR E 1 81  ? -5.604  40.060  77.993 1.00 33.30  ? 572  TYR E CA  1 
ATOM   6773 C C   . TYR E 1 81  ? -6.941  39.447  77.568 1.00 34.17  ? 572  TYR E C   1 
ATOM   6774 O O   . TYR E 1 81  ? -7.091  38.913  76.463 1.00 36.25  ? 572  TYR E O   1 
ATOM   6775 C CB  . TYR E 1 81  ? -5.763  41.583  77.931 1.00 31.16  ? 572  TYR E CB  1 
ATOM   6776 C CG  . TYR E 1 81  ? -4.592  42.390  78.444 1.00 30.20  ? 572  TYR E CG  1 
ATOM   6777 C CD1 . TYR E 1 81  ? -4.516  42.781  79.779 1.00 28.89  ? 572  TYR E CD1 1 
ATOM   6778 C CD2 . TYR E 1 81  ? -3.567  42.777  77.586 1.00 30.66  ? 572  TYR E CD2 1 
ATOM   6779 C CE1 . TYR E 1 81  ? -3.445  43.545  80.245 1.00 29.17  ? 572  TYR E CE1 1 
ATOM   6780 C CE2 . TYR E 1 81  ? -2.493  43.539  78.037 1.00 31.01  ? 572  TYR E CE2 1 
ATOM   6781 C CZ  . TYR E 1 81  ? -2.434  43.922  79.366 1.00 31.28  ? 572  TYR E CZ  1 
ATOM   6782 O OH  . TYR E 1 81  ? -1.361  44.680  79.804 1.00 30.43  ? 572  TYR E OH  1 
ATOM   6783 N N   . ALA E 1 82  ? -7.915  39.542  78.464 1.00 32.10  ? 573  ALA E N   1 
ATOM   6784 C CA  . ALA E 1 82  ? -9.266  39.074  78.212 1.00 29.11  ? 573  ALA E CA  1 
ATOM   6785 C C   . ALA E 1 82  ? -10.124 40.310  78.468 1.00 29.54  ? 573  ALA E C   1 
ATOM   6786 O O   . ALA E 1 82  ? -9.766  41.175  79.277 1.00 29.48  ? 573  ALA E O   1 
ATOM   6787 C CB  . ALA E 1 82  ? -9.642  37.968  79.178 1.00 27.08  ? 573  ALA E CB  1 
ATOM   6788 N N   . VAL E 1 83  ? -11.246 40.408  77.775 1.00 27.66  ? 574  VAL E N   1 
ATOM   6789 C CA  . VAL E 1 83  ? -12.122 41.544  77.958 1.00 26.99  ? 574  VAL E CA  1 
ATOM   6790 C C   . VAL E 1 83  ? -13.567 41.103  77.749 1.00 28.20  ? 574  VAL E C   1 
ATOM   6791 O O   . VAL E 1 83  ? -13.843 40.167  76.994 1.00 29.10  ? 574  VAL E O   1 
ATOM   6792 C CB  . VAL E 1 83  ? -11.755 42.701  76.969 1.00 26.61  ? 574  VAL E CB  1 
ATOM   6793 C CG1 . VAL E 1 83  ? -11.823 42.213  75.530 1.00 23.14  ? 574  VAL E CG1 1 
ATOM   6794 C CG2 . VAL E 1 83  ? -12.695 43.888  77.178 1.00 25.11  ? 574  VAL E CG2 1 
ATOM   6795 N N   . ARG E 1 84  ? -14.483 41.752  78.454 1.00 27.52  ? 575  ARG E N   1 
ATOM   6796 C CA  . ARG E 1 84  ? -15.885 41.441  78.312 1.00 27.42  ? 575  ARG E CA  1 
ATOM   6797 C C   . ARG E 1 84  ? -16.706 42.686  78.582 1.00 28.13  ? 575  ARG E C   1 
ATOM   6798 O O   . ARG E 1 84  ? -16.252 43.610  79.254 1.00 26.25  ? 575  ARG E O   1 
ATOM   6799 C CB  . ARG E 1 84  ? -16.276 40.304  79.245 1.00 29.78  ? 575  ARG E CB  1 
ATOM   6800 C CG  . ARG E 1 84  ? -15.868 40.491  80.689 1.00 30.61  ? 575  ARG E CG  1 
ATOM   6801 C CD  . ARG E 1 84  ? -16.236 39.263  81.501 1.00 28.57  ? 575  ARG E CD  1 
ATOM   6802 N NE  . ARG E 1 84  ? -16.229 39.545  82.932 1.00 31.23  ? 575  ARG E NE  1 
ATOM   6803 C CZ  . ARG E 1 84  ? -16.450 38.641  83.884 1.00 30.70  ? 575  ARG E CZ  1 
ATOM   6804 N NH1 . ARG E 1 84  ? -16.699 37.375  83.574 1.00 28.60  ? 575  ARG E NH1 1 
ATOM   6805 N NH2 . ARG E 1 84  ? -16.420 39.009  85.153 1.00 29.95  ? 575  ARG E NH2 1 
ATOM   6806 N N   . LEU E 1 85  ? -17.910 42.719  78.025 1.00 28.31  ? 576  LEU E N   1 
ATOM   6807 C CA  . LEU E 1 85  ? -18.789 43.864  78.186 1.00 28.41  ? 576  LEU E CA  1 
ATOM   6808 C C   . LEU E 1 85  ? -20.148 43.515  78.757 1.00 28.80  ? 576  LEU E C   1 
ATOM   6809 O O   . LEU E 1 85  ? -20.646 42.402  78.588 1.00 29.74  ? 576  LEU E O   1 
ATOM   6810 C CB  . LEU E 1 85  ? -19.000 44.563  76.843 1.00 28.81  ? 576  LEU E CB  1 
ATOM   6811 C CG  . LEU E 1 85  ? -17.899 45.490  76.352 1.00 30.97  ? 576  LEU E CG  1 
ATOM   6812 C CD1 . LEU E 1 85  ? -18.228 45.975  74.962 1.00 31.89  ? 576  LEU E CD1 1 
ATOM   6813 C CD2 . LEU E 1 85  ? -17.767 46.669  77.311 1.00 32.97  ? 576  LEU E CD2 1 
ATOM   6814 N N   . ALA E 1 86  ? -20.737 44.493  79.435 1.00 27.58  ? 577  ALA E N   1 
ATOM   6815 C CA  . ALA E 1 86  ? -22.061 44.373  80.019 1.00 26.48  ? 577  ALA E CA  1 
ATOM   6816 C C   . ALA E 1 86  ? -22.708 45.725  79.781 1.00 26.04  ? 577  ALA E C   1 
ATOM   6817 O O   . ALA E 1 86  ? -22.020 46.750  79.790 1.00 23.90  ? 577  ALA E O   1 
ATOM   6818 C CB  . ALA E 1 86  ? -21.972 44.085  81.503 1.00 26.26  ? 577  ALA E CB  1 
ATOM   6819 N N   . ALA E 1 87  ? -24.022 45.716  79.549 1.00 26.73  ? 578  ALA E N   1 
ATOM   6820 C CA  . ALA E 1 87  ? -24.791 46.940  79.297 1.00 26.35  ? 578  ALA E CA  1 
ATOM   6821 C C   . ALA E 1 87  ? -25.702 47.252  80.475 1.00 26.40  ? 578  ALA E C   1 
ATOM   6822 O O   . ALA E 1 87  ? -26.214 46.348  81.131 1.00 26.76  ? 578  ALA E O   1 
ATOM   6823 C CB  . ALA E 1 87  ? -25.621 46.792  78.008 1.00 20.69  ? 578  ALA E CB  1 
ATOM   6824 N N   . LEU E 1 88  ? -25.902 48.537  80.739 1.00 29.17  ? 579  LEU E N   1 
ATOM   6825 C CA  . LEU E 1 88  ? -26.749 48.963  81.846 1.00 31.66  ? 579  LEU E CA  1 
ATOM   6826 C C   . LEU E 1 88  ? -27.893 49.866  81.418 1.00 32.67  ? 579  LEU E C   1 
ATOM   6827 O O   . LEU E 1 88  ? -27.687 50.782  80.628 1.00 34.45  ? 579  LEU E O   1 
ATOM   6828 C CB  . LEU E 1 88  ? -25.905 49.691  82.893 1.00 32.66  ? 579  LEU E CB  1 
ATOM   6829 C CG  . LEU E 1 88  ? -26.669 50.480  83.961 1.00 33.22  ? 579  LEU E CG  1 
ATOM   6830 C CD1 . LEU E 1 88  ? -26.035 50.252  85.317 1.00 32.71  ? 579  LEU E CD1 1 
ATOM   6831 C CD2 . LEU E 1 88  ? -26.674 51.959  83.609 1.00 31.87  ? 579  LEU E CD2 1 
ATOM   6832 N N   . ASN E 1 89  ? -29.095 49.592  81.931 1.00 33.42  ? 580  ASN E N   1 
ATOM   6833 C CA  . ASN E 1 89  ? -30.285 50.414  81.645 1.00 33.24  ? 580  ASN E CA  1 
ATOM   6834 C C   . ASN E 1 89  ? -30.937 50.883  82.957 1.00 34.81  ? 580  ASN E C   1 
ATOM   6835 O O   . ASN E 1 89  ? -30.352 50.737  84.037 1.00 36.01  ? 580  ASN E O   1 
ATOM   6836 C CB  . ASN E 1 89  ? -31.317 49.647  80.790 1.00 30.03  ? 580  ASN E CB  1 
ATOM   6837 C CG  . ASN E 1 89  ? -32.038 48.535  81.553 1.00 28.71  ? 580  ASN E CG  1 
ATOM   6838 O OD1 . ASN E 1 89  ? -31.955 48.432  82.773 1.00 26.03  ? 580  ASN E OD1 1 
ATOM   6839 N ND2 . ASN E 1 89  ? -32.763 47.702  80.817 1.00 27.12  ? 580  ASN E ND2 1 
ATOM   6840 N N   . GLY E 1 90  ? -32.140 51.443  82.869 1.00 35.24  ? 581  GLY E N   1 
ATOM   6841 C CA  . GLY E 1 90  ? -32.818 51.904  84.069 1.00 35.54  ? 581  GLY E CA  1 
ATOM   6842 C C   . GLY E 1 90  ? -33.109 50.799  85.077 1.00 37.68  ? 581  GLY E C   1 
ATOM   6843 O O   . GLY E 1 90  ? -33.115 51.029  86.293 1.00 38.61  ? 581  GLY E O   1 
ATOM   6844 N N   . LYS E 1 91  ? -33.346 49.590  84.577 1.00 37.45  ? 582  LYS E N   1 
ATOM   6845 C CA  . LYS E 1 91  ? -33.647 48.442  85.428 1.00 36.81  ? 582  LYS E CA  1 
ATOM   6846 C C   . LYS E 1 91  ? -32.434 47.803  86.089 1.00 35.70  ? 582  LYS E C   1 
ATOM   6847 O O   . LYS E 1 91  ? -32.587 46.880  86.888 1.00 36.73  ? 582  LYS E O   1 
ATOM   6848 C CB  . LYS E 1 91  ? -34.383 47.371  84.618 1.00 37.56  ? 582  LYS E CB  1 
ATOM   6849 C CG  . LYS E 1 91  ? -35.859 47.608  84.482 1.00 39.10  ? 582  LYS E CG  1 
ATOM   6850 C CD  . LYS E 1 91  ? -36.162 49.018  84.035 1.00 43.55  ? 582  LYS E CD  1 
ATOM   6851 C CE  . LYS E 1 91  ? -37.643 49.313  84.179 1.00 44.10  ? 582  LYS E CE  1 
ATOM   6852 N NZ  . LYS E 1 91  ? -38.439 48.332  83.399 1.00 46.81  ? 582  LYS E NZ  1 
ATOM   6853 N N   . GLY E 1 92  ? -31.236 48.273  85.752 1.00 33.56  ? 583  GLY E N   1 
ATOM   6854 C CA  . GLY E 1 92  ? -30.038 47.704  86.344 1.00 31.36  ? 583  GLY E CA  1 
ATOM   6855 C C   . GLY E 1 92  ? -29.016 47.207  85.340 1.00 30.57  ? 583  GLY E C   1 
ATOM   6856 O O   . GLY E 1 92  ? -29.148 47.407  84.131 1.00 31.07  ? 583  GLY E O   1 
ATOM   6857 N N   . LEU E 1 93  ? -27.984 46.540  85.839 1.00 29.50  ? 584  LEU E N   1 
ATOM   6858 C CA  . LEU E 1 93  ? -26.919 46.038  84.974 1.00 27.47  ? 584  LEU E CA  1 
ATOM   6859 C C   . LEU E 1 93  ? -27.227 44.663  84.397 1.00 26.97  ? 584  LEU E C   1 
ATOM   6860 O O   . LEU E 1 93  ? -27.620 43.749  85.121 1.00 26.59  ? 584  LEU E O   1 
ATOM   6861 C CB  . LEU E 1 93  ? -25.605 45.992  85.752 1.00 23.26  ? 584  LEU E CB  1 
ATOM   6862 C CG  . LEU E 1 93  ? -24.356 45.629  84.970 1.00 22.56  ? 584  LEU E CG  1 
ATOM   6863 C CD1 . LEU E 1 93  ? -24.152 46.642  83.854 1.00 24.89  ? 584  LEU E CD1 1 
ATOM   6864 C CD2 . LEU E 1 93  ? -23.165 45.619  85.901 1.00 19.48  ? 584  LEU E CD2 1 
ATOM   6865 N N   . GLY E 1 94  ? -27.038 44.523  83.089 1.00 26.88  ? 585  GLY E N   1 
ATOM   6866 C CA  . GLY E 1 94  ? -27.304 43.258  82.437 1.00 28.44  ? 585  GLY E CA  1 
ATOM   6867 C C   . GLY E 1 94  ? -26.231 42.197  82.601 1.00 30.00  ? 585  GLY E C   1 
ATOM   6868 O O   . GLY E 1 94  ? -25.293 42.330  83.386 1.00 31.77  ? 585  GLY E O   1 
ATOM   6869 N N   . GLU E 1 95  ? -26.389 41.130  81.835 1.00 31.08  ? 586  GLU E N   1 
ATOM   6870 C CA  . GLU E 1 95  ? -25.480 39.994  81.829 1.00 33.09  ? 586  GLU E CA  1 
ATOM   6871 C C   . GLU E 1 95  ? -24.174 40.324  81.092 1.00 33.62  ? 586  GLU E C   1 
ATOM   6872 O O   . GLU E 1 95  ? -24.197 41.021  80.074 1.00 34.04  ? 586  GLU E O   1 
ATOM   6873 C CB  . GLU E 1 95  ? -26.182 38.830  81.124 1.00 35.09  ? 586  GLU E CB  1 
ATOM   6874 C CG  . GLU E 1 95  ? -25.448 37.510  81.139 1.00 38.78  ? 586  GLU E CG  1 
ATOM   6875 C CD  . GLU E 1 95  ? -25.336 36.947  82.531 1.00 41.22  ? 586  GLU E CD  1 
ATOM   6876 O OE1 . GLU E 1 95  ? -26.165 37.327  83.384 1.00 41.89  ? 586  GLU E OE1 1 
ATOM   6877 O OE2 . GLU E 1 95  ? -24.431 36.123  82.769 1.00 43.43  ? 586  GLU E OE2 1 
ATOM   6878 N N   . ILE E 1 96  ? -23.043 39.830  81.597 1.00 32.23  ? 587  ILE E N   1 
ATOM   6879 C CA  . ILE E 1 96  ? -21.762 40.067  80.930 1.00 32.21  ? 587  ILE E CA  1 
ATOM   6880 C C   . ILE E 1 96  ? -21.594 39.144  79.730 1.00 31.89  ? 587  ILE E C   1 
ATOM   6881 O O   . ILE E 1 96  ? -21.978 37.973  79.762 1.00 33.20  ? 587  ILE E O   1 
ATOM   6882 C CB  . ILE E 1 96  ? -20.543 39.836  81.849 1.00 32.87  ? 587  ILE E CB  1 
ATOM   6883 C CG1 . ILE E 1 96  ? -20.940 38.992  83.058 1.00 36.86  ? 587  ILE E CG1 1 
ATOM   6884 C CG2 . ILE E 1 96  ? -19.928 41.167  82.242 1.00 33.32  ? 587  ILE E CG2 1 
ATOM   6885 C CD1 . ILE E 1 96  ? -21.341 37.553  82.724 1.00 39.49  ? 587  ILE E CD1 1 
ATOM   6886 N N   . SER E 1 97  ? -21.020 39.679  78.664 1.00 30.14  ? 588  SER E N   1 
ATOM   6887 C CA  . SER E 1 97  ? -20.791 38.899  77.462 1.00 27.42  ? 588  SER E CA  1 
ATOM   6888 C C   . SER E 1 97  ? -19.696 37.867  77.712 1.00 27.09  ? 588  SER E C   1 
ATOM   6889 O O   . SER E 1 97  ? -19.105 37.806  78.784 1.00 25.79  ? 588  SER E O   1 
ATOM   6890 C CB  . SER E 1 97  ? -20.357 39.818  76.325 1.00 24.66  ? 588  SER E CB  1 
ATOM   6891 O OG  . SER E 1 97  ? -19.032 40.272  76.532 1.00 22.75  ? 588  SER E OG  1 
ATOM   6892 N N   . ALA E 1 98  ? -19.436 37.040  76.712 1.00 29.40  ? 589  ALA E N   1 
ATOM   6893 C CA  . ALA E 1 98  ? -18.381 36.052  76.830 1.00 30.11  ? 589  ALA E CA  1 
ATOM   6894 C C   . ALA E 1 98  ? -17.098 36.867  76.761 1.00 31.19  ? 589  ALA E C   1 
ATOM   6895 O O   . ALA E 1 98  ? -17.100 37.994  76.272 1.00 30.05  ? 589  ALA E O   1 
ATOM   6896 C CB  . ALA E 1 98  ? -18.447 35.074  75.676 1.00 28.95  ? 589  ALA E CB  1 
ATOM   6897 N N   . ALA E 1 99  ? -16.002 36.304  77.246 1.00 33.34  ? 590  ALA E N   1 
ATOM   6898 C CA  . ALA E 1 99  ? -14.732 37.017  77.229 1.00 34.53  ? 590  ALA E CA  1 
ATOM   6899 C C   . ALA E 1 99  ? -13.992 36.857  75.904 1.00 34.43  ? 590  ALA E C   1 
ATOM   6900 O O   . ALA E 1 99  ? -13.928 35.758  75.349 1.00 35.41  ? 590  ALA E O   1 
ATOM   6901 C CB  . ALA E 1 99  ? -13.852 36.525  78.377 1.00 34.42  ? 590  ALA E CB  1 
ATOM   6902 N N   . SER E 1 100 ? -13.452 37.959  75.393 1.00 33.56  ? 591  SER E N   1 
ATOM   6903 C CA  . SER E 1 100 ? -12.675 37.915  74.157 1.00 34.65  ? 591  SER E CA  1 
ATOM   6904 C C   . SER E 1 100 ? -11.214 37.996  74.578 1.00 34.29  ? 591  SER E C   1 
ATOM   6905 O O   . SER E 1 100 ? -10.870 38.785  75.461 1.00 36.10  ? 591  SER E O   1 
ATOM   6906 C CB  . SER E 1 100 ? -13.012 39.093  73.239 1.00 33.90  ? 591  SER E CB  1 
ATOM   6907 O OG  . SER E 1 100 ? -14.304 38.954  72.683 1.00 36.31  ? 591  SER E OG  1 
ATOM   6908 N N   . GLU E 1 101 ? -10.356 37.181  73.973 1.00 32.56  ? 592  GLU E N   1 
ATOM   6909 C CA  . GLU E 1 101 ? -8.948  37.212  74.337 1.00 32.83  ? 592  GLU E CA  1 
ATOM   6910 C C   . GLU E 1 101 ? -8.103  37.852  73.248 1.00 32.82  ? 592  GLU E C   1 
ATOM   6911 O O   . GLU E 1 101 ? -8.322  37.616  72.060 1.00 34.18  ? 592  GLU E O   1 
ATOM   6912 C CB  . GLU E 1 101 ? -8.437  35.807  74.625 1.00 31.39  ? 592  GLU E CB  1 
ATOM   6913 C CG  . GLU E 1 101 ? -7.223  35.818  75.513 1.00 33.64  ? 592  GLU E CG  1 
ATOM   6914 C CD  . GLU E 1 101 ? -6.760  34.433  75.885 1.00 35.08  ? 592  GLU E CD  1 
ATOM   6915 O OE1 . GLU E 1 101 ? -7.616  33.540  76.041 1.00 36.58  ? 592  GLU E OE1 1 
ATOM   6916 O OE2 . GLU E 1 101 ? -5.537  34.240  76.038 1.00 36.93  ? 592  GLU E OE2 1 
ATOM   6917 N N   . PHE E 1 102 ? -7.139  38.671  73.651 1.00 31.42  ? 593  PHE E N   1 
ATOM   6918 C CA  . PHE E 1 102 ? -6.281  39.336  72.677 1.00 31.19  ? 593  PHE E CA  1 
ATOM   6919 C C   . PHE E 1 102 ? -4.880  39.596  73.219 1.00 31.28  ? 593  PHE E C   1 
ATOM   6920 O O   . PHE E 1 102 ? -4.615  39.478  74.417 1.00 30.42  ? 593  PHE E O   1 
ATOM   6921 C CB  . PHE E 1 102 ? -6.913  40.665  72.225 1.00 29.08  ? 593  PHE E CB  1 
ATOM   6922 C CG  . PHE E 1 102 ? -6.916  41.728  73.286 1.00 26.74  ? 593  PHE E CG  1 
ATOM   6923 C CD1 . PHE E 1 102 ? -5.866  42.628  73.388 1.00 27.07  ? 593  PHE E CD1 1 
ATOM   6924 C CD2 . PHE E 1 102 ? -7.961  41.814  74.197 1.00 26.89  ? 593  PHE E CD2 1 
ATOM   6925 C CE1 . PHE E 1 102 ? -5.852  43.610  74.388 1.00 27.95  ? 593  PHE E CE1 1 
ATOM   6926 C CE2 . PHE E 1 102 ? -7.964  42.789  75.201 1.00 28.19  ? 593  PHE E CE2 1 
ATOM   6927 C CZ  . PHE E 1 102 ? -6.906  43.691  75.298 1.00 28.15  ? 593  PHE E CZ  1 
ATOM   6928 N N   . LYS E 1 103 ? -3.978  39.948  72.316 1.00 30.94  ? 594  LYS E N   1 
ATOM   6929 C CA  . LYS E 1 103 ? -2.617  40.241  72.707 1.00 30.56  ? 594  LYS E CA  1 
ATOM   6930 C C   . LYS E 1 103 ? -2.214  41.586  72.115 1.00 29.83  ? 594  LYS E C   1 
ATOM   6931 O O   . LYS E 1 103 ? -2.393  41.830  70.924 1.00 30.02  ? 594  LYS E O   1 
ATOM   6932 C CB  . LYS E 1 103 ? -1.672  39.141  72.228 1.00 27.77  ? 594  LYS E CB  1 
ATOM   6933 C CG  . LYS E 1 103 ? -0.267  39.289  72.768 1.00 28.79  ? 594  LYS E CG  1 
ATOM   6934 C CD  . LYS E 1 103 ? 0.602   38.141  72.317 1.00 33.59  ? 594  LYS E CD  1 
ATOM   6935 C CE  . LYS E 1 103 ? 1.969   38.173  72.978 1.00 33.18  ? 594  LYS E CE  1 
ATOM   6936 N NZ  . LYS E 1 103 ? 2.701   36.906  72.705 1.00 34.78  ? 594  LYS E NZ  1 
ATOM   6937 N N   . THR E 1 104 ? -1.685  42.459  72.961 1.00 28.77  ? 595  THR E N   1 
ATOM   6938 C CA  . THR E 1 104 ? -1.262  43.773  72.520 1.00 28.80  ? 595  THR E CA  1 
ATOM   6939 C C   . THR E 1 104 ? 0.014   43.678  71.689 1.00 28.78  ? 595  THR E C   1 
ATOM   6940 O O   . THR E 1 104 ? 0.720   42.682  71.721 1.00 30.68  ? 595  THR E O   1 
ATOM   6941 C CB  . THR E 1 104 ? -1.034  44.708  73.727 1.00 27.94  ? 595  THR E CB  1 
ATOM   6942 O OG1 . THR E 1 104 ? -0.291  44.009  74.728 1.00 29.55  ? 595  THR E OG1 1 
ATOM   6943 C CG2 . THR E 1 104 ? -2.361  45.168  74.318 1.00 25.60  ? 595  THR E CG2 1 
ATOM   6944 N N   . GLN E 1 105 ? 0.292   44.731  70.938 1.00 29.35  ? 596  GLN E N   1 
ATOM   6945 C CA  . GLN E 1 105 ? 1.456   44.797  70.080 1.00 28.07  ? 596  GLN E CA  1 
ATOM   6946 C C   . GLN E 1 105 ? 2.681   45.313  70.810 1.00 28.63  ? 596  GLN E C   1 
ATOM   6947 O O   . GLN E 1 105 ? 2.566   45.979  71.830 1.00 29.70  ? 596  GLN E O   1 
ATOM   6948 C CB  . GLN E 1 105 ? 1.167   45.731  68.917 1.00 28.75  ? 596  GLN E CB  1 
ATOM   6949 C CG  . GLN E 1 105 ? 0.005   45.316  68.051 1.00 29.44  ? 596  GLN E CG  1 
ATOM   6950 C CD  . GLN E 1 105 ? -0.239  46.301  66.935 1.00 28.92  ? 596  GLN E CD  1 
ATOM   6951 O OE1 . GLN E 1 105 ? 0.704   46.827  66.351 1.00 28.27  ? 596  GLN E OE1 1 
ATOM   6952 N NE2 . GLN E 1 105 ? -1.504  46.545  66.620 1.00 30.38  ? 596  GLN E NE2 1 
ATOM   6953 N N   . PRO E 1 106 ? 3.880   45.015  70.281 1.00 29.78  ? 597  PRO E N   1 
ATOM   6954 C CA  . PRO E 1 106 ? 5.151   45.453  70.867 1.00 29.68  ? 597  PRO E CA  1 
ATOM   6955 C C   . PRO E 1 106 ? 5.393   46.908  70.462 1.00 30.92  ? 597  PRO E C   1 
ATOM   6956 O O   . PRO E 1 106 ? 5.029   47.296  69.361 1.00 32.29  ? 597  PRO E O   1 
ATOM   6957 C CB  . PRO E 1 106 ? 6.151   44.522  70.205 1.00 28.64  ? 597  PRO E CB  1 
ATOM   6958 C CG  . PRO E 1 106 ? 5.594   44.400  68.824 1.00 25.22  ? 597  PRO E CG  1 
ATOM   6959 C CD  . PRO E 1 106 ? 4.123   44.181  69.085 1.00 27.43  ? 597  PRO E CD  1 
ATOM   6960 N N   . VAL E 1 107 ? 5.985   47.726  71.323 1.00 31.69  ? 598  VAL E N   1 
ATOM   6961 C CA  . VAL E 1 107 ? 6.229   49.102  70.910 1.00 33.19  ? 598  VAL E CA  1 
ATOM   6962 C C   . VAL E 1 107 ? 7.373   49.111  69.890 1.00 34.41  ? 598  VAL E C   1 
ATOM   6963 O O   . VAL E 1 107 ? 8.284   48.293  69.969 1.00 35.45  ? 598  VAL E O   1 
ATOM   6964 C CB  . VAL E 1 107 ? 6.574   50.015  72.115 1.00 32.23  ? 598  VAL E CB  1 
ATOM   6965 C CG1 . VAL E 1 107 ? 5.449   49.959  73.140 1.00 32.79  ? 598  VAL E CG1 1 
ATOM   6966 C CG2 . VAL E 1 107 ? 7.878   49.600  72.738 1.00 31.81  ? 598  VAL E CG2 1 
ATOM   6967 N N   . ARG E 1 108 ? 7.308   50.016  68.921 1.00 37.17  ? 599  ARG E N   1 
ATOM   6968 C CA  . ARG E 1 108 ? 8.337   50.127  67.886 1.00 39.85  ? 599  ARG E CA  1 
ATOM   6969 C C   . ARG E 1 108 ? 8.839   51.568  67.769 1.00 39.99  ? 599  ARG E C   1 
ATOM   6970 O O   . ARG E 1 108 ? 8.388   52.459  68.486 1.00 40.57  ? 599  ARG E O   1 
ATOM   6971 C CB  . ARG E 1 108 ? 7.771   49.653  66.537 1.00 42.65  ? 599  ARG E CB  1 
ATOM   6972 C CG  . ARG E 1 108 ? 8.691   49.862  65.313 1.00 49.02  ? 599  ARG E CG  1 
ATOM   6973 C CD  . ARG E 1 108 ? 9.961   48.971  65.307 1.00 52.35  ? 599  ARG E CD  1 
ATOM   6974 N NE  . ARG E 1 108 ? 10.889  49.265  66.401 1.00 53.92  ? 599  ARG E NE  1 
ATOM   6975 C CZ  . ARG E 1 108 ? 12.019  48.599  66.625 1.00 54.54  ? 599  ARG E CZ  1 
ATOM   6976 N NH1 . ARG E 1 108 ? 12.367  47.596  65.830 1.00 54.18  ? 599  ARG E NH1 1 
ATOM   6977 N NH2 . ARG E 1 108 ? 12.798  48.931  67.646 1.00 53.71  ? 599  ARG E NH2 1 
ATOM   6978 N N   . GLU E 1 109 ? 9.789   51.792  66.872 1.00 41.42  ? 600  GLU E N   1 
ATOM   6979 C CA  . GLU E 1 109 ? 10.338  53.127  66.662 1.00 42.67  ? 600  GLU E CA  1 
ATOM   6980 C C   . GLU E 1 109 ? 9.308   53.956  65.898 1.00 40.66  ? 600  GLU E C   1 
ATOM   6981 O O   . GLU E 1 109 ? 8.578   53.433  65.059 1.00 42.17  ? 600  GLU E O   1 
ATOM   6982 C CB  . GLU E 1 109 ? 11.642  53.017  65.877 1.00 44.63  ? 600  GLU E CB  1 
ATOM   6983 C CG  . GLU E 1 109 ? 12.444  51.802  66.294 1.00 51.66  ? 600  GLU E CG  1 
ATOM   6984 C CD  . GLU E 1 109 ? 13.872  51.829  65.799 1.00 56.32  ? 600  GLU E CD  1 
ATOM   6985 O OE1 . GLU E 1 109 ? 14.671  52.633  66.341 1.00 56.89  ? 600  GLU E OE1 1 
ATOM   6986 O OE2 . GLU E 1 109 ? 14.190  51.046  64.868 1.00 57.52  ? 600  GLU E OE2 1 
ATOM   6987 N N   . PRO E 1 110 ? 9.234   55.262  66.175 1.00 38.88  ? 601  PRO E N   1 
ATOM   6988 C CA  . PRO E 1 110 ? 8.260   56.108  65.480 1.00 37.69  ? 601  PRO E CA  1 
ATOM   6989 C C   . PRO E 1 110 ? 8.506   56.146  63.983 1.00 37.34  ? 601  PRO E C   1 
ATOM   6990 O O   . PRO E 1 110 ? 9.565   55.739  63.500 1.00 39.17  ? 601  PRO E O   1 
ATOM   6991 C CB  . PRO E 1 110 ? 8.479   57.494  66.094 1.00 37.69  ? 601  PRO E CB  1 
ATOM   6992 C CG  . PRO E 1 110 ? 9.289   57.250  67.335 1.00 40.44  ? 601  PRO E CG  1 
ATOM   6993 C CD  . PRO E 1 110 ? 10.158  56.078  66.977 1.00 40.43  ? 601  PRO E CD  1 
ATOM   6994 N N   . SER E 1 111 ? 7.513   56.618  63.243 1.00 35.71  ? 602  SER E N   1 
ATOM   6995 C CA  . SER E 1 111 ? 7.671   56.769  61.809 1.00 33.55  ? 602  SER E CA  1 
ATOM   6996 C C   . SER E 1 111 ? 8.191   58.185  61.699 1.00 31.87  ? 602  SER E C   1 
ATOM   6997 O O   . SER E 1 111 ? 8.145   58.939  62.663 1.00 31.24  ? 602  SER E O   1 
ATOM   6998 C CB  . SER E 1 111 ? 6.332   56.665  61.082 1.00 33.99  ? 602  SER E CB  1 
ATOM   6999 O OG  . SER E 1 111 ? 5.791   55.368  61.210 1.00 36.67  ? 602  SER E OG  1 
ATOM   7000 N N   . ALA E 1 112 ? 8.695   58.558  60.538 1.00 30.50  ? 603  ALA E N   1 
ATOM   7001 C CA  . ALA E 1 112 ? 9.180   59.907  60.395 1.00 28.97  ? 603  ALA E CA  1 
ATOM   7002 C C   . ALA E 1 112 ? 7.962   60.799  60.201 1.00 29.21  ? 603  ALA E C   1 
ATOM   7003 O O   . ALA E 1 112 ? 6.915   60.361  59.711 1.00 27.60  ? 603  ALA E O   1 
ATOM   7004 C CB  . ALA E 1 112 ? 10.104  59.998  59.200 1.00 27.82  ? 603  ALA E CB  1 
ATOM   7005 N N   . PRO E 1 113 ? 8.056   62.057  60.627 1.00 28.97  ? 604  PRO E N   1 
ATOM   7006 C CA  . PRO E 1 113 ? 6.861   62.863  60.396 1.00 29.35  ? 604  PRO E CA  1 
ATOM   7007 C C   . PRO E 1 113 ? 6.905   63.205  58.917 1.00 30.92  ? 604  PRO E C   1 
ATOM   7008 O O   . PRO E 1 113 ? 7.824   62.787  58.206 1.00 31.04  ? 604  PRO E O   1 
ATOM   7009 C CB  . PRO E 1 113 ? 7.105   64.085  61.268 1.00 29.54  ? 604  PRO E CB  1 
ATOM   7010 C CG  . PRO E 1 113 ? 8.599   64.241  61.202 1.00 27.76  ? 604  PRO E CG  1 
ATOM   7011 C CD  . PRO E 1 113 ? 9.086   62.814  61.356 1.00 27.88  ? 604  PRO E CD  1 
ATOM   7012 N N   . LYS E 1 114 ? 5.915   63.939  58.436 1.00 31.83  ? 605  LYS E N   1 
ATOM   7013 C CA  . LYS E 1 114 ? 5.948   64.339  57.046 1.00 33.22  ? 605  LYS E CA  1 
ATOM   7014 C C   . LYS E 1 114 ? 6.267   65.824  57.087 1.00 34.14  ? 605  LYS E C   1 
ATOM   7015 O O   . LYS E 1 114 ? 5.773   66.546  57.954 1.00 34.29  ? 605  LYS E O   1 
ATOM   7016 C CB  . LYS E 1 114 ? 4.610   64.074  56.352 1.00 33.72  ? 605  LYS E CB  1 
ATOM   7017 C CG  . LYS E 1 114 ? 4.722   63.129  55.161 1.00 35.76  ? 605  LYS E CG  1 
ATOM   7018 C CD  . LYS E 1 114 ? 3.537   63.313  54.233 1.00 42.44  ? 605  LYS E CD  1 
ATOM   7019 C CE  . LYS E 1 114 ? 3.727   62.625  52.881 1.00 44.17  ? 605  LYS E CE  1 
ATOM   7020 N NZ  . LYS E 1 114 ? 2.559   62.910  51.983 1.00 45.95  ? 605  LYS E NZ  1 
ATOM   7021 N N   . LEU E 1 115 ? 7.112   66.280  56.172 1.00 34.63  ? 606  LEU E N   1 
ATOM   7022 C CA  . LEU E 1 115 ? 7.490   67.683  56.155 1.00 34.24  ? 606  LEU E CA  1 
ATOM   7023 C C   . LEU E 1 115 ? 6.795   68.479  55.058 1.00 35.29  ? 606  LEU E C   1 
ATOM   7024 O O   . LEU E 1 115 ? 6.723   68.061  53.902 1.00 34.79  ? 606  LEU E O   1 
ATOM   7025 C CB  . LEU E 1 115 ? 9.011   67.808  56.017 1.00 33.02  ? 606  LEU E CB  1 
ATOM   7026 C CG  . LEU E 1 115 ? 9.856   66.984  57.002 1.00 32.47  ? 606  LEU E CG  1 
ATOM   7027 C CD1 . LEU E 1 115 ? 11.318  67.304  56.777 1.00 32.79  ? 606  LEU E CD1 1 
ATOM   7028 C CD2 . LEU E 1 115 ? 9.472   67.287  58.446 1.00 31.99  ? 606  LEU E CD2 1 
ATOM   7029 N N   . GLU E 1 116 ? 6.280   69.640  55.444 1.00 36.57  ? 607  GLU E N   1 
ATOM   7030 C CA  . GLU E 1 116 ? 5.592   70.534  54.528 1.00 36.07  ? 607  GLU E CA  1 
ATOM   7031 C C   . GLU E 1 116 ? 6.274   71.886  54.569 1.00 37.07  ? 607  GLU E C   1 
ATOM   7032 O O   . GLU E 1 116 ? 6.422   72.467  55.641 1.00 38.52  ? 607  GLU E O   1 
ATOM   7033 C CB  . GLU E 1 116 ? 4.137   70.681  54.951 1.00 35.24  ? 607  GLU E CB  1 
ATOM   7034 C CG  . GLU E 1 116 ? 3.370   71.743  54.201 1.00 34.03  ? 607  GLU E CG  1 
ATOM   7035 C CD  . GLU E 1 116 ? 1.911   71.763  54.594 1.00 35.26  ? 607  GLU E CD  1 
ATOM   7036 O OE1 . GLU E 1 116 ? 1.169   70.857  54.156 1.00 33.98  ? 607  GLU E OE1 1 
ATOM   7037 O OE2 . GLU E 1 116 ? 1.509   72.672  55.354 1.00 36.93  ? 607  GLU E OE2 1 
ATOM   7038 N N   . GLY E 1 117 ? 6.692   72.381  53.406 1.00 37.88  ? 608  GLY E N   1 
ATOM   7039 C CA  . GLY E 1 117 ? 7.358   73.672  53.339 1.00 38.60  ? 608  GLY E CA  1 
ATOM   7040 C C   . GLY E 1 117 ? 6.401   74.827  53.103 1.00 40.72  ? 608  GLY E C   1 
ATOM   7041 O O   . GLY E 1 117 ? 5.499   74.733  52.273 1.00 39.47  ? 608  GLY E O   1 
ATOM   7042 N N   . GLN E 1 118 ? 6.601   75.920  53.838 1.00 43.24  ? 609  GLN E N   1 
ATOM   7043 C CA  . GLN E 1 118 ? 5.762   77.109  53.725 1.00 45.24  ? 609  GLN E CA  1 
ATOM   7044 C C   . GLN E 1 118 ? 6.639   78.360  53.754 1.00 47.34  ? 609  GLN E C   1 
ATOM   7045 O O   . GLN E 1 118 ? 7.791   78.301  54.181 1.00 47.34  ? 609  GLN E O   1 
ATOM   7046 C CB  . GLN E 1 118 ? 4.777   77.156  54.893 1.00 45.40  ? 609  GLN E CB  1 
ATOM   7047 C CG  . GLN E 1 118 ? 3.654   78.175  54.745 1.00 44.70  ? 609  GLN E CG  1 
ATOM   7048 C CD  . GLN E 1 118 ? 2.839   78.310  56.012 1.00 43.27  ? 609  GLN E CD  1 
ATOM   7049 O OE1 . GLN E 1 118 ? 2.713   77.356  56.777 1.00 43.17  ? 609  GLN E OE1 1 
ATOM   7050 N NE2 . GLN E 1 118 ? 2.270   79.491  56.234 1.00 41.23  ? 609  GLN E NE2 1 
ATOM   7051 N N   . ARG E 1 119 ? 6.096   79.490  53.305 1.00 49.76  ? 610  ARG E N   1 
ATOM   7052 C CA  . ARG E 1 119 ? 6.849   80.745  53.313 1.00 52.85  ? 610  ARG E CA  1 
ATOM   7053 C C   . ARG E 1 119 ? 6.990   81.317  54.723 1.00 54.90  ? 610  ARG E C   1 
ATOM   7054 O O   . ARG E 1 119 ? 6.010   81.385  55.470 1.00 55.96  ? 610  ARG E O   1 
ATOM   7055 C CB  . ARG E 1 119 ? 6.152   81.804  52.466 1.00 54.67  ? 610  ARG E CB  1 
ATOM   7056 C CG  . ARG E 1 119 ? 6.238   81.631  50.973 1.00 58.00  ? 610  ARG E CG  1 
ATOM   7057 C CD  . ARG E 1 119 ? 6.536   82.980  50.346 1.00 59.96  ? 610  ARG E CD  1 
ATOM   7058 N NE  . ARG E 1 119 ? 6.088   83.077  48.962 1.00 62.39  ? 610  ARG E NE  1 
ATOM   7059 C CZ  . ARG E 1 119 ? 6.339   84.118  48.172 1.00 62.53  ? 610  ARG E CZ  1 
ATOM   7060 N NH1 . ARG E 1 119 ? 7.041   85.145  48.638 1.00 60.36  ? 610  ARG E NH1 1 
ATOM   7061 N NH2 . ARG E 1 119 ? 5.887   84.136  46.921 1.00 62.07  ? 610  ARG E NH2 1 
ATOM   7062 N N   . GLY E 1 120 ? 8.201   81.739  55.081 1.00 56.21  ? 611  GLY E N   1 
ATOM   7063 C CA  . GLY E 1 120 ? 8.424   82.337  56.389 1.00 57.48  ? 611  GLY E CA  1 
ATOM   7064 C C   . GLY E 1 120 ? 8.082   83.814  56.292 1.00 58.81  ? 611  GLY E C   1 
ATOM   7065 O O   . GLY E 1 120 ? 7.393   84.216  55.354 1.00 57.96  ? 611  GLY E O   1 
ATOM   7066 N N   . GLU E 1 121 ? 8.545   84.635  57.231 1.00 60.93  ? 612  GLU E N   1 
ATOM   7067 C CA  . GLU E 1 121 ? 8.236   86.065  57.155 1.00 63.22  ? 612  GLU E CA  1 
ATOM   7068 C C   . GLU E 1 121 ? 9.241   86.816  56.291 1.00 62.45  ? 612  GLU E C   1 
ATOM   7069 O O   . GLU E 1 121 ? 9.023   87.968  55.937 1.00 61.87  ? 612  GLU E O   1 
ATOM   7070 C CB  . GLU E 1 121 ? 8.187   86.702  58.552 1.00 66.68  ? 612  GLU E CB  1 
ATOM   7071 C CG  . GLU E 1 121 ? 9.508   86.695  59.327 1.00 72.43  ? 612  GLU E CG  1 
ATOM   7072 C CD  . GLU E 1 121 ? 9.420   87.487  60.641 1.00 75.63  ? 612  GLU E CD  1 
ATOM   7073 O OE1 . GLU E 1 121 ? 9.240   88.730  60.581 1.00 76.54  ? 612  GLU E OE1 1 
ATOM   7074 O OE2 . GLU E 1 121 ? 9.526   86.868  61.732 1.00 77.31  ? 612  GLU E OE2 1 
ATOM   7075 N N   . ASP E 1 122 ? 10.335  86.147  55.940 1.00 62.73  ? 613  ASP E N   1 
ATOM   7076 C CA  . ASP E 1 122 ? 11.384  86.750  55.123 1.00 61.51  ? 613  ASP E CA  1 
ATOM   7077 C C   . ASP E 1 122 ? 11.868  85.773  54.058 1.00 60.12  ? 613  ASP E C   1 
ATOM   7078 O O   . ASP E 1 122 ? 11.841  84.559  54.257 1.00 60.04  ? 613  ASP E O   1 
ATOM   7079 C CB  . ASP E 1 122 ? 12.557  87.153  56.012 1.00 62.83  ? 613  ASP E CB  1 
ATOM   7080 C CG  . ASP E 1 122 ? 12.115  87.938  57.230 1.00 64.11  ? 613  ASP E CG  1 
ATOM   7081 O OD1 . ASP E 1 122 ? 11.650  89.083  57.053 1.00 63.91  ? 613  ASP E OD1 1 
ATOM   7082 O OD2 . ASP E 1 122 ? 12.225  87.405  58.359 1.00 64.28  ? 613  ASP E OD2 1 
ATOM   7083 N N   . GLY E 1 123 ? 12.314  86.309  52.929 1.00 58.24  ? 614  GLY E N   1 
ATOM   7084 C CA  . GLY E 1 123 ? 12.794  85.467  51.854 1.00 56.58  ? 614  GLY E CA  1 
ATOM   7085 C C   . GLY E 1 123 ? 13.968  84.602  52.275 1.00 55.25  ? 614  GLY E C   1 
ATOM   7086 O O   . GLY E 1 123 ? 14.277  83.604  51.625 1.00 54.94  ? 614  GLY E O   1 
ATOM   7087 N N   . ASN E 1 124 ? 14.628  84.983  53.361 1.00 54.03  ? 615  ASN E N   1 
ATOM   7088 C CA  . ASN E 1 124 ? 15.770  84.222  53.848 1.00 52.91  ? 615  ASN E CA  1 
ATOM   7089 C C   . ASN E 1 124 ? 15.355  83.331  55.016 1.00 52.03  ? 615  ASN E C   1 
ATOM   7090 O O   . ASN E 1 124 ? 16.143  83.075  55.931 1.00 51.31  ? 615  ASN E O   1 
ATOM   7091 C CB  . ASN E 1 124 ? 16.904  85.164  54.287 1.00 54.07  ? 615  ASN E CB  1 
ATOM   7092 C CG  . ASN E 1 124 ? 16.665  85.783  55.658 1.00 54.68  ? 615  ASN E CG  1 
ATOM   7093 O OD1 . ASN E 1 124 ? 17.596  85.926  56.450 1.00 54.47  ? 615  ASN E OD1 1 
ATOM   7094 N ND2 . ASN E 1 124 ? 15.419  86.154  55.943 1.00 55.09  ? 615  ASN E ND2 1 
ATOM   7095 N N   . SER E 1 125 ? 14.113  82.859  54.982 1.00 50.68  ? 616  SER E N   1 
ATOM   7096 C CA  . SER E 1 125 ? 13.606  81.999  56.044 1.00 49.80  ? 616  SER E CA  1 
ATOM   7097 C C   . SER E 1 125 ? 12.578  81.023  55.495 1.00 48.17  ? 616  SER E C   1 
ATOM   7098 O O   . SER E 1 125 ? 12.152  81.146  54.348 1.00 47.69  ? 616  SER E O   1 
ATOM   7099 C CB  . SER E 1 125 ? 12.954  82.840  57.139 1.00 50.22  ? 616  SER E CB  1 
ATOM   7100 O OG  . SER E 1 125 ? 11.755  83.430  56.660 1.00 51.17  ? 616  SER E OG  1 
ATOM   7101 N N   . ILE E 1 126 ? 12.191  80.052  56.318 1.00 46.29  ? 617  ILE E N   1 
ATOM   7102 C CA  . ILE E 1 126 ? 11.183  79.070  55.928 1.00 44.54  ? 617  ILE E CA  1 
ATOM   7103 C C   . ILE E 1 126 ? 10.487  78.492  57.149 1.00 44.09  ? 617  ILE E C   1 
ATOM   7104 O O   . ILE E 1 126 ? 11.085  78.360  58.223 1.00 44.26  ? 617  ILE E O   1 
ATOM   7105 C CB  . ILE E 1 126 ? 11.781  77.882  55.125 1.00 43.46  ? 617  ILE E CB  1 
ATOM   7106 C CG1 . ILE E 1 126 ? 10.641  77.054  54.509 1.00 41.49  ? 617  ILE E CG1 1 
ATOM   7107 C CG2 . ILE E 1 126 ? 12.620  76.986  56.046 1.00 42.45  ? 617  ILE E CG2 1 
ATOM   7108 C CD1 . ILE E 1 126 ? 11.090  76.019  53.492 1.00 38.83  ? 617  ILE E CD1 1 
ATOM   7109 N N   . LYS E 1 127 ? 9.217   78.151  56.976 1.00 42.74  ? 618  LYS E N   1 
ATOM   7110 C CA  . LYS E 1 127 ? 8.444   77.559  58.054 1.00 41.98  ? 618  LYS E CA  1 
ATOM   7111 C C   . LYS E 1 127 ? 8.131   76.127  57.650 1.00 40.69  ? 618  LYS E C   1 
ATOM   7112 O O   . LYS E 1 127 ? 7.287   75.884  56.783 1.00 38.67  ? 618  LYS E O   1 
ATOM   7113 C CB  . LYS E 1 127 ? 7.148   78.337  58.272 1.00 43.67  ? 618  LYS E CB  1 
ATOM   7114 C CG  . LYS E 1 127 ? 6.303   77.827  59.418 1.00 45.34  ? 618  LYS E CG  1 
ATOM   7115 C CD  . LYS E 1 127 ? 4.902   78.413  59.332 1.00 47.63  ? 618  LYS E CD  1 
ATOM   7116 C CE  . LYS E 1 127 ? 3.970   77.776  60.342 1.00 47.71  ? 618  LYS E CE  1 
ATOM   7117 N NZ  . LYS E 1 127 ? 2.552   78.051  59.989 1.00 50.25  ? 618  LYS E NZ  1 
ATOM   7118 N N   . VAL E 1 128 ? 8.837   75.184  58.263 1.00 39.78  ? 619  VAL E N   1 
ATOM   7119 C CA  . VAL E 1 128 ? 8.625   73.771  57.969 1.00 38.57  ? 619  VAL E CA  1 
ATOM   7120 C C   . VAL E 1 128 ? 7.580   73.189  58.917 1.00 37.82  ? 619  VAL E C   1 
ATOM   7121 O O   . VAL E 1 128 ? 7.810   73.070  60.119 1.00 36.15  ? 619  VAL E O   1 
ATOM   7122 C CB  . VAL E 1 128 ? 9.927   72.965  58.112 1.00 37.65  ? 619  VAL E CB  1 
ATOM   7123 C CG1 . VAL E 1 128 ? 9.710   71.541  57.614 1.00 36.48  ? 619  VAL E CG1 1 
ATOM   7124 C CG2 . VAL E 1 128 ? 11.039  73.646  57.342 1.00 36.94  ? 619  VAL E CG2 1 
ATOM   7125 N N   . ASN E 1 129 ? 6.431   72.834  58.357 1.00 36.63  ? 620  ASN E N   1 
ATOM   7126 C CA  . ASN E 1 129 ? 5.331   72.268  59.119 1.00 37.20  ? 620  ASN E CA  1 
ATOM   7127 C C   . ASN E 1 129 ? 5.495   70.765  59.326 1.00 38.28  ? 620  ASN E C   1 
ATOM   7128 O O   . ASN E 1 129 ? 5.881   70.049  58.402 1.00 40.52  ? 620  ASN E O   1 
ATOM   7129 C CB  . ASN E 1 129 ? 4.019   72.531  58.383 1.00 35.92  ? 620  ASN E CB  1 
ATOM   7130 C CG  . ASN E 1 129 ? 3.656   73.993  58.353 1.00 35.33  ? 620  ASN E CG  1 
ATOM   7131 O OD1 . ASN E 1 129 ? 2.953   74.443  57.453 1.00 37.22  ? 620  ASN E OD1 1 
ATOM   7132 N ND2 . ASN E 1 129 ? 4.125   74.744  59.341 1.00 34.00  ? 620  ASN E ND2 1 
ATOM   7133 N N   . LEU E 1 130 ? 5.201   70.285  60.532 1.00 37.66  ? 621  LEU E N   1 
ATOM   7134 C CA  . LEU E 1 130 ? 5.304   68.861  60.816 1.00 37.99  ? 621  LEU E CA  1 
ATOM   7135 C C   . LEU E 1 130 ? 3.947   68.205  60.674 1.00 37.62  ? 621  LEU E C   1 
ATOM   7136 O O   . LEU E 1 130 ? 2.976   68.673  61.250 1.00 40.09  ? 621  LEU E O   1 
ATOM   7137 C CB  . LEU E 1 130 ? 5.799   68.612  62.238 1.00 38.82  ? 621  LEU E CB  1 
ATOM   7138 C CG  . LEU E 1 130 ? 7.224   69.005  62.621 1.00 41.45  ? 621  LEU E CG  1 
ATOM   7139 C CD1 . LEU E 1 130 ? 7.447   68.637  64.084 1.00 40.38  ? 621  LEU E CD1 1 
ATOM   7140 C CD2 . LEU E 1 130 ? 8.235   68.297  61.715 1.00 41.48  ? 621  LEU E CD2 1 
ATOM   7141 N N   . ILE E 1 131 ? 3.877   67.130  59.898 1.00 36.05  ? 622  ILE E N   1 
ATOM   7142 C CA  . ILE E 1 131 ? 2.632   66.396  59.734 1.00 32.97  ? 622  ILE E CA  1 
ATOM   7143 C C   . ILE E 1 131 ? 2.826   65.067  60.462 1.00 34.21  ? 622  ILE E C   1 
ATOM   7144 O O   . ILE E 1 131 ? 3.550   64.191  59.984 1.00 32.45  ? 622  ILE E O   1 
ATOM   7145 C CB  . ILE E 1 131 ? 2.310   66.133  58.258 1.00 29.57  ? 622  ILE E CB  1 
ATOM   7146 C CG1 . ILE E 1 131 ? 2.078   67.470  57.543 1.00 27.05  ? 622  ILE E CG1 1 
ATOM   7147 C CG2 . ILE E 1 131 ? 1.101   65.211  58.154 1.00 24.05  ? 622  ILE E CG2 1 
ATOM   7148 C CD1 . ILE E 1 131 ? 1.727   67.362  56.065 1.00 20.68  ? 622  ILE E CD1 1 
ATOM   7149 N N   . LYS E 1 132 ? 2.183   64.940  61.623 1.00 34.10  ? 623  LYS E N   1 
ATOM   7150 C CA  . LYS E 1 132 ? 2.287   63.749  62.459 1.00 34.83  ? 623  LYS E CA  1 
ATOM   7151 C C   . LYS E 1 132 ? 1.863   62.419  61.836 1.00 33.37  ? 623  LYS E C   1 
ATOM   7152 O O   . LYS E 1 132 ? 0.892   62.343  61.085 1.00 32.94  ? 623  LYS E O   1 
ATOM   7153 C CB  . LYS E 1 132 ? 1.507   63.950  63.763 1.00 37.14  ? 623  LYS E CB  1 
ATOM   7154 C CG  . LYS E 1 132 ? 2.194   64.797  64.830 1.00 39.62  ? 623  LYS E CG  1 
ATOM   7155 C CD  . LYS E 1 132 ? 2.370   66.240  64.387 1.00 44.73  ? 623  LYS E CD  1 
ATOM   7156 C CE  . LYS E 1 132 ? 2.337   67.213  65.575 1.00 45.80  ? 623  LYS E CE  1 
ATOM   7157 N NZ  . LYS E 1 132 ? 3.402   66.962  66.574 1.00 45.34  ? 623  LYS E NZ  1 
ATOM   7158 N N   . GLN E 1 133 ? 2.612   61.374  62.184 1.00 32.26  ? 624  GLN E N   1 
ATOM   7159 C CA  . GLN E 1 133 ? 2.354   60.017  61.719 1.00 32.25  ? 624  GLN E CA  1 
ATOM   7160 C C   . GLN E 1 133 ? 2.603   58.997  62.828 1.00 31.39  ? 624  GLN E C   1 
ATOM   7161 O O   . GLN E 1 133 ? 3.082   59.345  63.907 1.00 31.12  ? 624  GLN E O   1 
ATOM   7162 C CB  . GLN E 1 133 ? 3.234   59.686  60.525 1.00 32.87  ? 624  GLN E CB  1 
ATOM   7163 C CG  . GLN E 1 133 ? 3.164   60.711  59.426 1.00 35.22  ? 624  GLN E CG  1 
ATOM   7164 C CD  . GLN E 1 133 ? 3.699   60.175  58.123 1.00 37.08  ? 624  GLN E CD  1 
ATOM   7165 O OE1 . GLN E 1 133 ? 3.032   59.393  57.439 1.00 37.41  ? 624  GLN E OE1 1 
ATOM   7166 N NE2 . GLN E 1 133 ? 4.917   60.577  57.775 1.00 38.10  ? 624  GLN E NE2 1 
ATOM   7167 N N   . ASP E 1 134 ? 2.273   57.739  62.548 1.00 31.51  ? 625  ASP E N   1 
ATOM   7168 C CA  . ASP E 1 134 ? 2.420   56.632  63.499 1.00 31.61  ? 625  ASP E CA  1 
ATOM   7169 C C   . ASP E 1 134 ? 3.599   56.821  64.460 1.00 31.33  ? 625  ASP E C   1 
ATOM   7170 O O   . ASP E 1 134 ? 4.749   56.929  64.020 1.00 31.04  ? 625  ASP E O   1 
ATOM   7171 C CB  . ASP E 1 134 ? 2.597   55.322  62.722 1.00 31.78  ? 625  ASP E CB  1 
ATOM   7172 C CG  . ASP E 1 134 ? 2.455   54.084  63.599 1.00 31.27  ? 625  ASP E CG  1 
ATOM   7173 O OD1 . ASP E 1 134 ? 2.649   54.176  64.830 1.00 28.93  ? 625  ASP E OD1 1 
ATOM   7174 O OD2 . ASP E 1 134 ? 2.162   53.007  63.038 1.00 31.61  ? 625  ASP E OD2 1 
ATOM   7175 N N   . ASP E 1 135 ? 3.323   56.849  65.763 1.00 28.93  ? 626  ASP E N   1 
ATOM   7176 C CA  . ASP E 1 135 ? 4.396   57.026  66.738 1.00 29.27  ? 626  ASP E CA  1 
ATOM   7177 C C   . ASP E 1 135 ? 5.014   55.725  67.272 1.00 29.52  ? 626  ASP E C   1 
ATOM   7178 O O   . ASP E 1 135 ? 5.720   55.742  68.283 1.00 28.51  ? 626  ASP E O   1 
ATOM   7179 C CB  . ASP E 1 135 ? 3.922   57.881  67.920 1.00 28.36  ? 626  ASP E CB  1 
ATOM   7180 C CG  . ASP E 1 135 ? 2.880   57.184  68.780 1.00 29.53  ? 626  ASP E CG  1 
ATOM   7181 O OD1 . ASP E 1 135 ? 2.682   55.956  68.628 1.00 26.27  ? 626  ASP E OD1 1 
ATOM   7182 O OD2 . ASP E 1 135 ? 2.263   57.877  69.627 1.00 31.83  ? 626  ASP E OD2 1 
ATOM   7183 N N   . GLY E 1 136 ? 4.752   54.608  66.597 1.00 28.88  ? 627  GLY E N   1 
ATOM   7184 C CA  . GLY E 1 136 ? 5.301   53.336  67.030 1.00 30.34  ? 627  GLY E CA  1 
ATOM   7185 C C   . GLY E 1 136 ? 4.630   52.709  68.248 1.00 33.54  ? 627  GLY E C   1 
ATOM   7186 O O   . GLY E 1 136 ? 5.077   51.665  68.729 1.00 34.18  ? 627  GLY E O   1 
ATOM   7187 N N   . GLY E 1 137 ? 3.567   53.333  68.753 1.00 33.34  ? 628  GLY E N   1 
ATOM   7188 C CA  . GLY E 1 137 ? 2.875   52.792  69.910 1.00 34.53  ? 628  GLY E CA  1 
ATOM   7189 C C   . GLY E 1 137 ? 3.493   53.195  71.234 1.00 36.31  ? 628  GLY E C   1 
ATOM   7190 O O   . GLY E 1 137 ? 3.484   52.429  72.199 1.00 37.78  ? 628  GLY E O   1 
ATOM   7191 N N   . SER E 1 138 ? 4.032   54.407  71.278 1.00 36.96  ? 629  SER E N   1 
ATOM   7192 C CA  . SER E 1 138 ? 4.677   54.949  72.467 1.00 36.88  ? 629  SER E CA  1 
ATOM   7193 C C   . SER E 1 138 ? 4.875   56.436  72.214 1.00 37.71  ? 629  SER E C   1 
ATOM   7194 O O   . SER E 1 138 ? 5.325   56.837  71.137 1.00 36.59  ? 629  SER E O   1 
ATOM   7195 C CB  . SER E 1 138 ? 6.034   54.270  72.702 1.00 37.86  ? 629  SER E CB  1 
ATOM   7196 O OG  . SER E 1 138 ? 6.745   54.855  73.787 1.00 38.41  ? 629  SER E OG  1 
ATOM   7197 N N   . PRO E 1 139 ? 4.561   57.273  73.212 1.00 38.92  ? 630  PRO E N   1 
ATOM   7198 C CA  . PRO E 1 139 ? 4.698   58.727  73.093 1.00 39.64  ? 630  PRO E CA  1 
ATOM   7199 C C   . PRO E 1 139 ? 6.041   59.173  72.520 1.00 40.46  ? 630  PRO E C   1 
ATOM   7200 O O   . PRO E 1 139 ? 7.088   58.558  72.770 1.00 39.26  ? 630  PRO E O   1 
ATOM   7201 C CB  . PRO E 1 139 ? 4.501   59.209  74.528 1.00 39.54  ? 630  PRO E CB  1 
ATOM   7202 C CG  . PRO E 1 139 ? 3.623   58.147  75.129 1.00 38.77  ? 630  PRO E CG  1 
ATOM   7203 C CD  . PRO E 1 139 ? 4.269   56.898  74.606 1.00 38.26  ? 630  PRO E CD  1 
ATOM   7204 N N   . ILE E 1 140 ? 5.995   60.251  71.747 1.00 40.80  ? 631  ILE E N   1 
ATOM   7205 C CA  . ILE E 1 140 ? 7.189   60.815  71.140 1.00 41.12  ? 631  ILE E CA  1 
ATOM   7206 C C   . ILE E 1 140 ? 7.864   61.771  72.119 1.00 41.10  ? 631  ILE E C   1 
ATOM   7207 O O   . ILE E 1 140 ? 7.252   62.739  72.573 1.00 41.05  ? 631  ILE E O   1 
ATOM   7208 C CB  . ILE E 1 140 ? 6.827   61.541  69.814 1.00 41.39  ? 631  ILE E CB  1 
ATOM   7209 C CG1 . ILE E 1 140 ? 6.723   60.500  68.697 1.00 40.92  ? 631  ILE E CG1 1 
ATOM   7210 C CG2 . ILE E 1 140 ? 7.856   62.624  69.470 1.00 39.29  ? 631  ILE E CG2 1 
ATOM   7211 C CD1 . ILE E 1 140 ? 6.384   61.081  67.351 1.00 42.12  ? 631  ILE E CD1 1 
ATOM   7212 N N   . ARG E 1 141 ? 9.118   61.481  72.457 1.00 41.12  ? 632  ARG E N   1 
ATOM   7213 C CA  . ARG E 1 141 ? 9.864   62.324  73.380 1.00 41.79  ? 632  ARG E CA  1 
ATOM   7214 C C   . ARG E 1 141 ? 10.297  63.624  72.714 1.00 41.77  ? 632  ARG E C   1 
ATOM   7215 O O   . ARG E 1 141 ? 9.965   64.705  73.187 1.00 41.78  ? 632  ARG E O   1 
ATOM   7216 C CB  . ARG E 1 141 ? 11.107  61.595  73.929 1.00 44.34  ? 632  ARG E CB  1 
ATOM   7217 C CG  . ARG E 1 141 ? 10.861  60.592  75.080 1.00 47.41  ? 632  ARG E CG  1 
ATOM   7218 C CD  . ARG E 1 141 ? 12.184  60.185  75.801 1.00 51.32  ? 632  ARG E CD  1 
ATOM   7219 N NE  . ARG E 1 141 ? 12.815  61.294  76.540 1.00 53.18  ? 632  ARG E NE  1 
ATOM   7220 C CZ  . ARG E 1 141 ? 14.071  61.717  76.362 1.00 54.33  ? 632  ARG E CZ  1 
ATOM   7221 N NH1 . ARG E 1 141 ? 14.862  61.134  75.468 1.00 55.10  ? 632  ARG E NH1 1 
ATOM   7222 N NH2 . ARG E 1 141 ? 14.543  62.738  77.066 1.00 54.11  ? 632  ARG E NH2 1 
ATOM   7223 N N   . HIS E 1 142 ? 11.033  63.521  71.609 1.00 43.86  ? 633  HIS E N   1 
ATOM   7224 C CA  . HIS E 1 142 ? 11.528  64.710  70.903 1.00 44.32  ? 633  HIS E CA  1 
ATOM   7225 C C   . HIS E 1 142 ? 11.551  64.590  69.384 1.00 42.17  ? 633  HIS E C   1 
ATOM   7226 O O   . HIS E 1 142 ? 11.480  63.496  68.828 1.00 40.73  ? 633  HIS E O   1 
ATOM   7227 C CB  . HIS E 1 142 ? 12.963  65.045  71.351 1.00 46.78  ? 633  HIS E CB  1 
ATOM   7228 C CG  . HIS E 1 142 ? 13.086  65.378  72.803 1.00 51.18  ? 633  HIS E CG  1 
ATOM   7229 N ND1 . HIS E 1 142 ? 12.564  66.531  73.349 1.00 52.80  ? 633  HIS E ND1 1 
ATOM   7230 C CD2 . HIS E 1 142 ? 13.653  64.698  73.827 1.00 52.31  ? 633  HIS E CD2 1 
ATOM   7231 C CE1 . HIS E 1 142 ? 12.803  66.547  74.649 1.00 52.71  ? 633  HIS E CE1 1 
ATOM   7232 N NE2 . HIS E 1 142 ? 13.462  65.446  74.964 1.00 54.06  ? 633  HIS E NE2 1 
ATOM   7233 N N   . TYR E 1 143 ? 11.656  65.746  68.738 1.00 40.58  ? 634  TYR E N   1 
ATOM   7234 C CA  . TYR E 1 143 ? 11.779  65.849  67.293 1.00 40.79  ? 634  TYR E CA  1 
ATOM   7235 C C   . TYR E 1 143 ? 13.194  66.403  67.122 1.00 42.06  ? 634  TYR E C   1 
ATOM   7236 O O   . TYR E 1 143 ? 13.557  67.382  67.766 1.00 42.86  ? 634  TYR E O   1 
ATOM   7237 C CB  . TYR E 1 143 ? 10.760  66.842  66.706 1.00 39.39  ? 634  TYR E CB  1 
ATOM   7238 C CG  . TYR E 1 143 ? 9.394   66.249  66.428 1.00 37.40  ? 634  TYR E CG  1 
ATOM   7239 C CD1 . TYR E 1 143 ? 9.233   65.212  65.506 1.00 35.59  ? 634  TYR E CD1 1 
ATOM   7240 C CD2 . TYR E 1 143 ? 8.266   66.697  67.116 1.00 36.74  ? 634  TYR E CD2 1 
ATOM   7241 C CE1 . TYR E 1 143 ? 7.987   64.637  65.283 1.00 34.11  ? 634  TYR E CE1 1 
ATOM   7242 C CE2 . TYR E 1 143 ? 7.014   66.124  66.901 1.00 34.37  ? 634  TYR E CE2 1 
ATOM   7243 C CZ  . TYR E 1 143 ? 6.884   65.099  65.991 1.00 33.69  ? 634  TYR E CZ  1 
ATOM   7244 O OH  . TYR E 1 143 ? 5.658   64.516  65.817 1.00 32.81  ? 634  TYR E OH  1 
ATOM   7245 N N   . LEU E 1 144 ? 14.004  65.772  66.283 1.00 43.11  ? 635  LEU E N   1 
ATOM   7246 C CA  . LEU E 1 144 ? 15.361  66.254  66.083 1.00 43.99  ? 635  LEU E CA  1 
ATOM   7247 C C   . LEU E 1 144 ? 15.552  66.866  64.709 1.00 43.68  ? 635  LEU E C   1 
ATOM   7248 O O   . LEU E 1 144 ? 15.382  66.193  63.696 1.00 44.85  ? 635  LEU E O   1 
ATOM   7249 C CB  . LEU E 1 144 ? 16.363  65.118  66.272 1.00 45.47  ? 635  LEU E CB  1 
ATOM   7250 C CG  . LEU E 1 144 ? 16.468  64.538  67.677 1.00 46.07  ? 635  LEU E CG  1 
ATOM   7251 C CD1 . LEU E 1 144 ? 17.607  63.535  67.705 1.00 46.38  ? 635  LEU E CD1 1 
ATOM   7252 C CD2 . LEU E 1 144 ? 16.705  65.649  68.683 1.00 45.80  ? 635  LEU E CD2 1 
ATOM   7253 N N   . VAL E 1 145 ? 15.920  68.140  64.683 1.00 43.18  ? 636  VAL E N   1 
ATOM   7254 C CA  . VAL E 1 145 ? 16.142  68.842  63.431 1.00 43.73  ? 636  VAL E CA  1 
ATOM   7255 C C   . VAL E 1 145 ? 17.617  69.119  63.168 1.00 44.72  ? 636  VAL E C   1 
ATOM   7256 O O   . VAL E 1 145 ? 18.353  69.521  64.059 1.00 45.32  ? 636  VAL E O   1 
ATOM   7257 C CB  . VAL E 1 145 ? 15.388  70.179  63.409 1.00 43.88  ? 636  VAL E CB  1 
ATOM   7258 C CG1 . VAL E 1 145 ? 15.616  70.882  62.084 1.00 43.89  ? 636  VAL E CG1 1 
ATOM   7259 C CG2 . VAL E 1 145 ? 13.908  69.939  63.632 1.00 43.61  ? 636  VAL E CG2 1 
ATOM   7260 N N   . ARG E 1 146 ? 18.035  68.883  61.932 1.00 46.16  ? 637  ARG E N   1 
ATOM   7261 C CA  . ARG E 1 146 ? 19.401  69.117  61.488 1.00 47.86  ? 637  ARG E CA  1 
ATOM   7262 C C   . ARG E 1 146 ? 19.273  69.759  60.114 1.00 49.31  ? 637  ARG E C   1 
ATOM   7263 O O   . ARG E 1 146 ? 18.488  69.308  59.286 1.00 48.93  ? 637  ARG E O   1 
ATOM   7264 C CB  . ARG E 1 146 ? 20.174  67.797  61.376 1.00 49.08  ? 637  ARG E CB  1 
ATOM   7265 C CG  . ARG E 1 146 ? 21.030  67.449  62.594 1.00 51.89  ? 637  ARG E CG  1 
ATOM   7266 C CD  . ARG E 1 146 ? 21.497  65.987  62.572 1.00 54.13  ? 637  ARG E CD  1 
ATOM   7267 N NE  . ARG E 1 146 ? 22.267  65.648  61.374 1.00 57.64  ? 637  ARG E NE  1 
ATOM   7268 C CZ  . ARG E 1 146 ? 21.948  64.681  60.511 1.00 57.96  ? 637  ARG E CZ  1 
ATOM   7269 N NH1 . ARG E 1 146 ? 20.865  63.936  60.696 1.00 56.79  ? 637  ARG E NH1 1 
ATOM   7270 N NH2 . ARG E 1 146 ? 22.716  64.456  59.455 1.00 57.56  ? 637  ARG E NH2 1 
ATOM   7271 N N   . TYR E 1 147 ? 20.029  70.821  59.871 1.00 51.74  ? 638  TYR E N   1 
ATOM   7272 C CA  . TYR E 1 147 ? 19.961  71.488  58.579 1.00 53.03  ? 638  TYR E CA  1 
ATOM   7273 C C   . TYR E 1 147 ? 21.255  72.214  58.224 1.00 53.30  ? 638  TYR E C   1 
ATOM   7274 O O   . TYR E 1 147 ? 22.124  72.430  59.069 1.00 53.39  ? 638  TYR E O   1 
ATOM   7275 C CB  . TYR E 1 147 ? 18.799  72.478  58.571 1.00 53.29  ? 638  TYR E CB  1 
ATOM   7276 C CG  . TYR E 1 147 ? 19.086  73.770  59.301 1.00 54.97  ? 638  TYR E CG  1 
ATOM   7277 C CD1 . TYR E 1 147 ? 19.563  74.883  58.617 1.00 55.13  ? 638  TYR E CD1 1 
ATOM   7278 C CD2 . TYR E 1 147 ? 18.882  73.880  60.678 1.00 56.74  ? 638  TYR E CD2 1 
ATOM   7279 C CE1 . TYR E 1 147 ? 19.829  76.074  59.278 1.00 56.39  ? 638  TYR E CE1 1 
ATOM   7280 C CE2 . TYR E 1 147 ? 19.146  75.071  61.352 1.00 57.00  ? 638  TYR E CE2 1 
ATOM   7281 C CZ  . TYR E 1 147 ? 19.620  76.161  60.641 1.00 57.04  ? 638  TYR E CZ  1 
ATOM   7282 O OH  . TYR E 1 147 ? 19.891  77.341  61.287 1.00 59.35  ? 638  TYR E OH  1 
ATOM   7283 N N   . ARG E 1 148 ? 21.371  72.591  56.960 1.00 53.68  ? 639  ARG E N   1 
ATOM   7284 C CA  . ARG E 1 148 ? 22.542  73.300  56.489 1.00 54.48  ? 639  ARG E CA  1 
ATOM   7285 C C   . ARG E 1 148 ? 22.352  73.711  55.049 1.00 54.81  ? 639  ARG E C   1 
ATOM   7286 O O   . ARG E 1 148 ? 21.387  73.320  54.394 1.00 54.94  ? 639  ARG E O   1 
ATOM   7287 C CB  . ARG E 1 148 ? 23.782  72.414  56.589 1.00 55.30  ? 639  ARG E CB  1 
ATOM   7288 C CG  . ARG E 1 148 ? 23.736  71.169  55.722 1.00 56.69  ? 639  ARG E CG  1 
ATOM   7289 C CD  . ARG E 1 148 ? 25.040  70.401  55.857 1.00 60.39  ? 639  ARG E CD  1 
ATOM   7290 N NE  . ARG E 1 148 ? 25.025  69.115  55.163 1.00 62.83  ? 639  ARG E NE  1 
ATOM   7291 C CZ  . ARG E 1 148 ? 25.009  68.964  53.842 1.00 63.23  ? 639  ARG E CZ  1 
ATOM   7292 N NH1 . ARG E 1 148 ? 25.005  70.024  53.044 1.00 63.46  ? 639  ARG E NH1 1 
ATOM   7293 N NH2 . ARG E 1 148 ? 25.004  67.744  53.319 1.00 62.92  ? 639  ARG E NH2 1 
ATOM   7294 N N   . ALA E 1 149 ? 23.279  74.523  54.564 1.00 55.34  ? 640  ALA E N   1 
ATOM   7295 C CA  . ALA E 1 149 ? 23.244  74.961  53.184 1.00 54.79  ? 640  ALA E CA  1 
ATOM   7296 C C   . ALA E 1 149 ? 24.041  73.880  52.481 1.00 54.64  ? 640  ALA E C   1 
ATOM   7297 O O   . ALA E 1 149 ? 25.104  73.488  52.965 1.00 52.97  ? 640  ALA E O   1 
ATOM   7298 C CB  . ALA E 1 149 ? 23.922  76.305  53.042 1.00 53.52  ? 640  ALA E CB  1 
ATOM   7299 N N   . LEU E 1 150 ? 23.514  73.374  51.368 1.00 55.99  ? 641  LEU E N   1 
ATOM   7300 C CA  . LEU E 1 150 ? 24.193  72.322  50.621 1.00 56.42  ? 641  LEU E CA  1 
ATOM   7301 C C   . LEU E 1 150 ? 25.625  72.762  50.389 1.00 58.04  ? 641  LEU E C   1 
ATOM   7302 O O   . LEU E 1 150 ? 25.867  73.781  49.741 1.00 56.96  ? 641  LEU E O   1 
ATOM   7303 C CB  . LEU E 1 150 ? 23.493  72.068  49.283 1.00 54.43  ? 641  LEU E CB  1 
ATOM   7304 C CG  . LEU E 1 150 ? 22.005  71.702  49.339 1.00 53.53  ? 641  LEU E CG  1 
ATOM   7305 C CD1 . LEU E 1 150 ? 21.509  71.369  47.939 1.00 52.05  ? 641  LEU E CD1 1 
ATOM   7306 C CD2 . LEU E 1 150 ? 21.792  70.525  50.276 1.00 52.28  ? 641  LEU E CD2 1 
ATOM   7307 N N   . SER E 1 151 ? 26.553  71.991  50.951 1.00 60.28  ? 642  SER E N   1 
ATOM   7308 C CA  . SER E 1 151 ? 27.995  72.230  50.872 1.00 63.14  ? 642  SER E CA  1 
ATOM   7309 C C   . SER E 1 151 ? 28.557  72.426  52.267 1.00 64.43  ? 642  SER E C   1 
ATOM   7310 O O   . SER E 1 151 ? 29.208  71.537  52.807 1.00 65.03  ? 642  SER E O   1 
ATOM   7311 C CB  . SER E 1 151 ? 28.331  73.464  50.031 1.00 64.09  ? 642  SER E CB  1 
ATOM   7312 O OG  . SER E 1 151 ? 29.726  73.717  50.040 1.00 65.66  ? 642  SER E OG  1 
ATOM   7313 N N   . SER E 1 152 ? 28.295  73.593  52.848 1.00 66.21  ? 643  SER E N   1 
ATOM   7314 C CA  . SER E 1 152 ? 28.784  73.912  54.182 1.00 68.53  ? 643  SER E CA  1 
ATOM   7315 C C   . SER E 1 152 ? 28.473  72.808  55.198 1.00 69.84  ? 643  SER E C   1 
ATOM   7316 O O   . SER E 1 152 ? 27.802  71.818  54.880 1.00 70.28  ? 643  SER E O   1 
ATOM   7317 C CB  . SER E 1 152 ? 28.188  75.240  54.652 1.00 69.31  ? 643  SER E CB  1 
ATOM   7318 O OG  . SER E 1 152 ? 28.771  75.651  55.879 1.00 72.84  ? 643  SER E OG  1 
ATOM   7319 N N   . GLU E 1 153 ? 28.965  72.978  56.422 1.00 70.29  ? 644  GLU E N   1 
ATOM   7320 C CA  . GLU E 1 153 ? 28.746  71.984  57.466 1.00 70.51  ? 644  GLU E CA  1 
ATOM   7321 C C   . GLU E 1 153 ? 27.456  72.187  58.258 1.00 69.14  ? 644  GLU E C   1 
ATOM   7322 O O   . GLU E 1 153 ? 26.866  73.271  58.256 1.00 69.43  ? 644  GLU E O   1 
ATOM   7323 C CB  . GLU E 1 153 ? 29.955  71.945  58.409 1.00 72.41  ? 644  GLU E CB  1 
ATOM   7324 C CG  . GLU E 1 153 ? 31.197  71.304  57.775 1.00 75.58  ? 644  GLU E CG  1 
ATOM   7325 C CD  . GLU E 1 153 ? 32.402  71.250  58.713 1.00 77.24  ? 644  GLU E CD  1 
ATOM   7326 O OE1 . GLU E 1 153 ? 32.286  70.671  59.817 1.00 77.95  ? 644  GLU E OE1 1 
ATOM   7327 O OE2 . GLU E 1 153 ? 33.469  71.783  58.338 1.00 77.16  ? 644  GLU E OE2 1 
ATOM   7328 N N   . TRP E 1 154 ? 27.029  71.119  58.929 1.00 66.80  ? 645  TRP E N   1 
ATOM   7329 C CA  . TRP E 1 154 ? 25.809  71.110  59.727 1.00 64.09  ? 645  TRP E CA  1 
ATOM   7330 C C   . TRP E 1 154 ? 25.716  72.200  60.775 1.00 63.25  ? 645  TRP E C   1 
ATOM   7331 O O   . TRP E 1 154 ? 26.724  72.635  61.323 1.00 63.66  ? 645  TRP E O   1 
ATOM   7332 C CB  . TRP E 1 154 ? 25.649  69.760  60.423 1.00 62.00  ? 645  TRP E CB  1 
ATOM   7333 C CG  . TRP E 1 154 ? 25.341  68.647  59.487 1.00 61.20  ? 645  TRP E CG  1 
ATOM   7334 C CD1 . TRP E 1 154 ? 26.173  67.634  59.111 1.00 61.14  ? 645  TRP E CD1 1 
ATOM   7335 C CD2 . TRP E 1 154 ? 24.110  68.436  58.792 1.00 60.24  ? 645  TRP E CD2 1 
ATOM   7336 N NE1 . TRP E 1 154 ? 25.535  66.801  58.224 1.00 60.63  ? 645  TRP E NE1 1 
ATOM   7337 C CE2 . TRP E 1 154 ? 24.266  67.272  58.011 1.00 59.97  ? 645  TRP E CE2 1 
ATOM   7338 C CE3 . TRP E 1 154 ? 22.889  69.119  58.751 1.00 58.98  ? 645  TRP E CE3 1 
ATOM   7339 C CZ2 . TRP E 1 154 ? 23.246  66.775  57.198 1.00 59.66  ? 645  TRP E CZ2 1 
ATOM   7340 C CZ3 . TRP E 1 154 ? 21.876  68.625  57.942 1.00 59.63  ? 645  TRP E CZ3 1 
ATOM   7341 C CH2 . TRP E 1 154 ? 22.063  67.464  57.176 1.00 58.73  ? 645  TRP E CH2 1 
ATOM   7342 N N   . LYS E 1 155 ? 24.488  72.631  61.045 1.00 62.35  ? 646  LYS E N   1 
ATOM   7343 C CA  . LYS E 1 155 ? 24.216  73.648  62.051 1.00 61.19  ? 646  LYS E CA  1 
ATOM   7344 C C   . LYS E 1 155 ? 24.091  72.938  63.398 1.00 61.78  ? 646  LYS E C   1 
ATOM   7345 O O   . LYS E 1 155 ? 24.236  71.715  63.485 1.00 59.66  ? 646  LYS E O   1 
ATOM   7346 C CB  . LYS E 1 155 ? 22.901  74.364  61.745 1.00 60.13  ? 646  LYS E CB  1 
ATOM   7347 C CG  . LYS E 1 155 ? 22.949  75.343  60.592 1.00 59.97  ? 646  LYS E CG  1 
ATOM   7348 C CD  . LYS E 1 155 ? 23.629  76.635  60.989 1.00 59.19  ? 646  LYS E CD  1 
ATOM   7349 C CE  . LYS E 1 155 ? 23.388  77.722  59.959 1.00 58.26  ? 646  LYS E CE  1 
ATOM   7350 N NZ  . LYS E 1 155 ? 24.075  78.983  60.336 1.00 57.82  ? 646  LYS E NZ  1 
ATOM   7351 N N   . PRO E 1 156 ? 23.840  73.701  64.473 1.00 62.76  ? 647  PRO E N   1 
ATOM   7352 C CA  . PRO E 1 156 ? 23.699  73.083  65.795 1.00 62.73  ? 647  PRO E CA  1 
ATOM   7353 C C   . PRO E 1 156 ? 22.327  72.416  65.862 1.00 62.38  ? 647  PRO E C   1 
ATOM   7354 O O   . PRO E 1 156 ? 21.310  73.070  65.625 1.00 62.58  ? 647  PRO E O   1 
ATOM   7355 C CB  . PRO E 1 156 ? 23.801  74.273  66.746 1.00 62.85  ? 647  PRO E CB  1 
ATOM   7356 C CG  . PRO E 1 156 ? 24.586  75.287  65.960 1.00 62.45  ? 647  PRO E CG  1 
ATOM   7357 C CD  . PRO E 1 156 ? 23.977  75.162  64.599 1.00 62.42  ? 647  PRO E CD  1 
ATOM   7358 N N   . GLU E 1 157 ? 22.299  71.125  66.180 1.00 61.60  ? 648  GLU E N   1 
ATOM   7359 C CA  . GLU E 1 157 ? 21.043  70.388  66.251 1.00 61.03  ? 648  GLU E CA  1 
ATOM   7360 C C   . GLU E 1 157 ? 19.988  71.062  67.117 1.00 59.96  ? 648  GLU E C   1 
ATOM   7361 O O   . GLU E 1 157 ? 20.306  71.740  68.088 1.00 59.63  ? 648  GLU E O   1 
ATOM   7362 C CB  . GLU E 1 157 ? 21.285  68.964  66.753 1.00 62.23  ? 648  GLU E CB  1 
ATOM   7363 C CG  . GLU E 1 157 ? 20.025  68.124  66.796 1.00 64.02  ? 648  GLU E CG  1 
ATOM   7364 C CD  . GLU E 1 157 ? 20.310  66.641  66.804 1.00 65.82  ? 648  GLU E CD  1 
ATOM   7365 O OE1 . GLU E 1 157 ? 20.843  66.137  67.813 1.00 67.79  ? 648  GLU E OE1 1 
ATOM   7366 O OE2 . GLU E 1 157 ? 20.003  65.978  65.792 1.00 67.14  ? 648  GLU E OE2 1 
ATOM   7367 N N   . ILE E 1 158 ? 18.726  70.857  66.751 1.00 59.40  ? 649  ILE E N   1 
ATOM   7368 C CA  . ILE E 1 158 ? 17.589  71.436  67.460 1.00 58.20  ? 649  ILE E CA  1 
ATOM   7369 C C   . ILE E 1 158 ? 16.620  70.362  67.948 1.00 58.16  ? 649  ILE E C   1 
ATOM   7370 O O   . ILE E 1 158 ? 16.118  69.559  67.164 1.00 58.15  ? 649  ILE E O   1 
ATOM   7371 C CB  . ILE E 1 158 ? 16.819  72.392  66.545 1.00 57.86  ? 649  ILE E CB  1 
ATOM   7372 C CG1 . ILE E 1 158 ? 17.752  73.501  66.071 1.00 57.58  ? 649  ILE E CG1 1 
ATOM   7373 C CG2 . ILE E 1 158 ? 15.616  72.955  67.271 1.00 56.35  ? 649  ILE E CG2 1 
ATOM   7374 C CD1 . ILE E 1 158 ? 17.164  74.358  64.985 1.00 59.09  ? 649  ILE E CD1 1 
ATOM   7375 N N   . ARG E 1 159 ? 16.363  70.356  69.250 1.00 57.70  ? 650  ARG E N   1 
ATOM   7376 C CA  . ARG E 1 159 ? 15.450  69.396  69.847 1.00 56.68  ? 650  ARG E CA  1 
ATOM   7377 C C   . ARG E 1 159 ? 14.129  70.110  70.117 1.00 55.33  ? 650  ARG E C   1 
ATOM   7378 O O   . ARG E 1 159 ? 14.090  71.072  70.874 1.00 55.09  ? 650  ARG E O   1 
ATOM   7379 C CB  . ARG E 1 159 ? 16.054  68.855  71.146 1.00 58.48  ? 650  ARG E CB  1 
ATOM   7380 C CG  . ARG E 1 159 ? 17.431  68.215  70.940 1.00 61.29  ? 650  ARG E CG  1 
ATOM   7381 C CD  . ARG E 1 159 ? 18.158  67.880  72.246 1.00 63.22  ? 650  ARG E CD  1 
ATOM   7382 N NE  . ARG E 1 159 ? 17.439  66.923  73.086 1.00 65.11  ? 650  ARG E NE  1 
ATOM   7383 C CZ  . ARG E 1 159 ? 16.626  67.261  74.085 1.00 66.97  ? 650  ARG E CZ  1 
ATOM   7384 N NH1 . ARG E 1 159 ? 16.422  68.541  74.381 1.00 66.56  ? 650  ARG E NH1 1 
ATOM   7385 N NH2 . ARG E 1 159 ? 16.020  66.317  74.796 1.00 66.28  ? 650  ARG E NH2 1 
ATOM   7386 N N   . LEU E 1 160 ? 13.059  69.647  69.475 1.00 54.49  ? 651  LEU E N   1 
ATOM   7387 C CA  . LEU E 1 160 ? 11.724  70.231  69.628 1.00 53.27  ? 651  LEU E CA  1 
ATOM   7388 C C   . LEU E 1 160 ? 10.808  69.301  70.414 1.00 52.38  ? 651  LEU E C   1 
ATOM   7389 O O   . LEU E 1 160 ? 10.948  68.082  70.353 1.00 53.69  ? 651  LEU E O   1 
ATOM   7390 C CB  . LEU E 1 160 ? 11.100  70.495  68.253 1.00 53.21  ? 651  LEU E CB  1 
ATOM   7391 C CG  . LEU E 1 160 ? 11.652  71.645  67.407 1.00 52.46  ? 651  LEU E CG  1 
ATOM   7392 C CD1 . LEU E 1 160 ? 11.224  71.466  65.969 1.00 52.52  ? 651  LEU E CD1 1 
ATOM   7393 C CD2 . LEU E 1 160 ? 11.148  72.970  67.943 1.00 51.82  ? 651  LEU E CD2 1 
ATOM   7394 N N   . PRO E 1 161 ? 9.856   69.867  71.169 1.00 51.30  ? 652  PRO E N   1 
ATOM   7395 C CA  . PRO E 1 161 ? 8.913   69.074  71.968 1.00 50.21  ? 652  PRO E CA  1 
ATOM   7396 C C   . PRO E 1 161 ? 7.891   68.338  71.099 1.00 49.64  ? 652  PRO E C   1 
ATOM   7397 O O   . PRO E 1 161 ? 7.552   68.789  70.003 1.00 48.83  ? 652  PRO E O   1 
ATOM   7398 C CB  . PRO E 1 161 ? 8.253   70.118  72.863 1.00 49.17  ? 652  PRO E CB  1 
ATOM   7399 C CG  . PRO E 1 161 ? 9.286   71.177  72.969 1.00 50.36  ? 652  PRO E CG  1 
ATOM   7400 C CD  . PRO E 1 161 ? 9.788   71.282  71.556 1.00 51.01  ? 652  PRO E CD  1 
ATOM   7401 N N   . SER E 1 162 ? 7.401   67.212  71.609 1.00 48.82  ? 653  SER E N   1 
ATOM   7402 C CA  . SER E 1 162 ? 6.428   66.378  70.907 1.00 46.98  ? 653  SER E CA  1 
ATOM   7403 C C   . SER E 1 162 ? 5.220   67.156  70.399 1.00 45.96  ? 653  SER E C   1 
ATOM   7404 O O   . SER E 1 162 ? 4.563   66.737  69.445 1.00 43.10  ? 653  SER E O   1 
ATOM   7405 C CB  . SER E 1 162 ? 5.936   65.271  71.831 1.00 46.28  ? 653  SER E CB  1 
ATOM   7406 O OG  . SER E 1 162 ? 5.121   65.825  72.846 1.00 48.22  ? 653  SER E OG  1 
ATOM   7407 N N   . GLY E 1 163 ? 4.930   68.283  71.043 1.00 45.57  ? 654  GLY E N   1 
ATOM   7408 C CA  . GLY E 1 163 ? 3.784   69.081  70.647 1.00 45.74  ? 654  GLY E CA  1 
ATOM   7409 C C   . GLY E 1 163 ? 4.028   70.078  69.534 1.00 45.90  ? 654  GLY E C   1 
ATOM   7410 O O   . GLY E 1 163 ? 3.107   70.775  69.115 1.00 45.56  ? 654  GLY E O   1 
ATOM   7411 N N   . SER E 1 164 ? 5.266   70.152  69.057 1.00 47.45  ? 655  SER E N   1 
ATOM   7412 C CA  . SER E 1 164 ? 5.619   71.074  67.983 1.00 48.19  ? 655  SER E CA  1 
ATOM   7413 C C   . SER E 1 164 ? 4.771   70.796  66.752 1.00 48.33  ? 655  SER E C   1 
ATOM   7414 O O   . SER E 1 164 ? 4.426   69.649  66.470 1.00 48.22  ? 655  SER E O   1 
ATOM   7415 C CB  . SER E 1 164 ? 7.098   70.926  67.605 1.00 49.25  ? 655  SER E CB  1 
ATOM   7416 O OG  . SER E 1 164 ? 7.958   71.148  68.712 1.00 52.36  ? 655  SER E OG  1 
ATOM   7417 N N   . ASP E 1 165 ? 4.425   71.852  66.030 1.00 49.37  ? 656  ASP E N   1 
ATOM   7418 C CA  . ASP E 1 165 ? 3.642   71.715  64.809 1.00 51.19  ? 656  ASP E CA  1 
ATOM   7419 C C   . ASP E 1 165 ? 4.435   72.296  63.646 1.00 51.45  ? 656  ASP E C   1 
ATOM   7420 O O   . ASP E 1 165 ? 3.955   72.356  62.513 1.00 50.43  ? 656  ASP E O   1 
ATOM   7421 C CB  . ASP E 1 165 ? 2.296   72.426  64.943 1.00 51.31  ? 656  ASP E CB  1 
ATOM   7422 C CG  . ASP E 1 165 ? 1.307   71.634  65.774 1.00 53.96  ? 656  ASP E CG  1 
ATOM   7423 O OD1 . ASP E 1 165 ? 1.147   70.420  65.509 1.00 55.44  ? 656  ASP E OD1 1 
ATOM   7424 O OD2 . ASP E 1 165 ? 0.684   72.221  66.685 1.00 55.05  ? 656  ASP E OD2 1 
ATOM   7425 N N   . HIS E 1 166 ? 5.661   72.709  63.950 1.00 51.71  ? 657  HIS E N   1 
ATOM   7426 C CA  . HIS E 1 166 ? 6.551   73.287  62.959 1.00 52.54  ? 657  HIS E CA  1 
ATOM   7427 C C   . HIS E 1 166 ? 7.859   73.786  63.573 1.00 52.01  ? 657  HIS E C   1 
ATOM   7428 O O   . HIS E 1 166 ? 7.966   73.982  64.781 1.00 51.24  ? 657  HIS E O   1 
ATOM   7429 C CB  . HIS E 1 166 ? 5.872   74.459  62.257 1.00 52.62  ? 657  HIS E CB  1 
ATOM   7430 C CG  . HIS E 1 166 ? 5.540   75.585  63.176 1.00 54.20  ? 657  HIS E CG  1 
ATOM   7431 N ND1 . HIS E 1 166 ? 4.281   75.765  63.707 1.00 55.76  ? 657  HIS E ND1 1 
ATOM   7432 C CD2 . HIS E 1 166 ? 6.318   76.557  63.710 1.00 55.06  ? 657  HIS E CD2 1 
ATOM   7433 C CE1 . HIS E 1 166 ? 4.298   76.799  64.530 1.00 56.41  ? 657  HIS E CE1 1 
ATOM   7434 N NE2 . HIS E 1 166 ? 5.522   77.297  64.550 1.00 55.64  ? 657  HIS E NE2 1 
ATOM   7435 N N   . VAL E 1 167 ? 8.847   73.979  62.707 1.00 51.79  ? 658  VAL E N   1 
ATOM   7436 C CA  . VAL E 1 167 ? 10.154  74.490  63.085 1.00 51.51  ? 658  VAL E CA  1 
ATOM   7437 C C   . VAL E 1 167 ? 10.447  75.635  62.118 1.00 51.53  ? 658  VAL E C   1 
ATOM   7438 O O   . VAL E 1 167 ? 10.375  75.468  60.895 1.00 50.83  ? 658  VAL E O   1 
ATOM   7439 C CB  . VAL E 1 167 ? 11.253  73.415  62.954 1.00 51.48  ? 658  VAL E CB  1 
ATOM   7440 C CG1 . VAL E 1 167 ? 11.254  72.830  61.543 1.00 50.13  ? 658  VAL E CG1 1 
ATOM   7441 C CG2 . VAL E 1 167 ? 12.608  74.024  63.286 1.00 49.06  ? 658  VAL E CG2 1 
ATOM   7442 N N   . MET E 1 168 ? 10.759  76.800  62.672 1.00 51.06  ? 659  MET E N   1 
ATOM   7443 C CA  . MET E 1 168 ? 11.045  77.981  61.872 1.00 50.16  ? 659  MET E CA  1 
ATOM   7444 C C   . MET E 1 168 ? 12.548  78.134  61.688 1.00 49.02  ? 659  MET E C   1 
ATOM   7445 O O   . MET E 1 168 ? 13.305  78.001  62.640 1.00 46.90  ? 659  MET E O   1 
ATOM   7446 C CB  . MET E 1 168 ? 10.469  79.214  62.570 1.00 50.48  ? 659  MET E CB  1 
ATOM   7447 C CG  . MET E 1 168 ? 10.555  80.495  61.776 1.00 52.58  ? 659  MET E CG  1 
ATOM   7448 S SD  . MET E 1 168 ? 9.486   80.498  60.326 1.00 55.43  ? 659  MET E SD  1 
ATOM   7449 C CE  . MET E 1 168 ? 7.872   80.500  61.100 1.00 53.98  ? 659  MET E CE  1 
ATOM   7450 N N   . LEU E 1 169 ? 12.978  78.386  60.455 1.00 49.80  ? 660  LEU E N   1 
ATOM   7451 C CA  . LEU E 1 169 ? 14.398  78.573  60.161 1.00 51.07  ? 660  LEU E CA  1 
ATOM   7452 C C   . LEU E 1 169 ? 14.565  79.998  59.632 1.00 52.16  ? 660  LEU E C   1 
ATOM   7453 O O   . LEU E 1 169 ? 14.221  80.290  58.486 1.00 51.51  ? 660  LEU E O   1 
ATOM   7454 C CB  . LEU E 1 169 ? 14.878  77.548  59.122 1.00 50.39  ? 660  LEU E CB  1 
ATOM   7455 C CG  . LEU E 1 169 ? 14.749  76.061  59.489 1.00 50.23  ? 660  LEU E CG  1 
ATOM   7456 C CD1 . LEU E 1 169 ? 15.301  75.198  58.367 1.00 50.49  ? 660  LEU E CD1 1 
ATOM   7457 C CD2 . LEU E 1 169 ? 15.505  75.773  60.769 1.00 49.36  ? 660  LEU E CD2 1 
ATOM   7458 N N   . LYS E 1 170 ? 15.080  80.880  60.487 1.00 53.75  ? 661  LYS E N   1 
ATOM   7459 C CA  . LYS E 1 170 ? 15.267  82.288  60.150 1.00 55.92  ? 661  LYS E CA  1 
ATOM   7460 C C   . LYS E 1 170 ? 16.715  82.675  59.873 1.00 56.20  ? 661  LYS E C   1 
ATOM   7461 O O   . LYS E 1 170 ? 17.645  81.920  60.160 1.00 55.13  ? 661  LYS E O   1 
ATOM   7462 C CB  . LYS E 1 170 ? 14.766  83.179  61.290 1.00 58.25  ? 661  LYS E CB  1 
ATOM   7463 C CG  . LYS E 1 170 ? 13.340  82.946  61.746 1.00 61.52  ? 661  LYS E CG  1 
ATOM   7464 C CD  . LYS E 1 170 ? 12.984  83.922  62.875 1.00 63.45  ? 661  LYS E CD  1 
ATOM   7465 C CE  . LYS E 1 170 ? 11.548  83.741  63.368 1.00 63.83  ? 661  LYS E CE  1 
ATOM   7466 N NZ  . LYS E 1 170 ? 11.178  84.761  64.392 1.00 63.90  ? 661  LYS E NZ  1 
ATOM   7467 N N   . SER E 1 171 ? 16.881  83.883  59.338 1.00 57.11  ? 662  SER E N   1 
ATOM   7468 C CA  . SER E 1 171 ? 18.191  84.434  59.017 1.00 57.47  ? 662  SER E CA  1 
ATOM   7469 C C   . SER E 1 171 ? 19.072  83.426  58.301 1.00 57.61  ? 662  SER E C   1 
ATOM   7470 O O   . SER E 1 171 ? 19.961  82.821  58.902 1.00 59.04  ? 662  SER E O   1 
ATOM   7471 C CB  . SER E 1 171 ? 18.893  84.913  60.291 1.00 58.19  ? 662  SER E CB  1 
ATOM   7472 O OG  . SER E 1 171 ? 18.186  85.986  60.893 1.00 59.78  ? 662  SER E OG  1 
ATOM   7473 N N   . LEU E 1 172 ? 18.816  83.239  57.015 1.00 56.10  ? 663  LEU E N   1 
ATOM   7474 C CA  . LEU E 1 172 ? 19.602  82.311  56.226 1.00 54.83  ? 663  LEU E CA  1 
ATOM   7475 C C   . LEU E 1 172 ? 20.191  83.097  55.074 1.00 55.17  ? 663  LEU E C   1 
ATOM   7476 O O   . LEU E 1 172 ? 19.637  84.121  54.664 1.00 54.75  ? 663  LEU E O   1 
ATOM   7477 C CB  . LEU E 1 172 ? 18.722  81.196  55.671 1.00 53.52  ? 663  LEU E CB  1 
ATOM   7478 C CG  . LEU E 1 172 ? 17.873  80.392  56.650 1.00 51.03  ? 663  LEU E CG  1 
ATOM   7479 C CD1 . LEU E 1 172 ? 16.884  79.567  55.852 1.00 51.18  ? 663  LEU E CD1 1 
ATOM   7480 C CD2 . LEU E 1 172 ? 18.744  79.514  57.523 1.00 49.22  ? 663  LEU E CD2 1 
ATOM   7481 N N   . ASP E 1 173 ? 21.314  82.619  54.550 1.00 54.80  ? 664  ASP E N   1 
ATOM   7482 C CA  . ASP E 1 173 ? 21.951  83.288  53.435 1.00 54.25  ? 664  ASP E CA  1 
ATOM   7483 C C   . ASP E 1 173 ? 20.890  83.442  52.356 1.00 54.46  ? 664  ASP E C   1 
ATOM   7484 O O   . ASP E 1 173 ? 19.979  82.618  52.243 1.00 54.29  ? 664  ASP E O   1 
ATOM   7485 C CB  . ASP E 1 173 ? 23.131  82.459  52.922 1.00 54.27  ? 664  ASP E CB  1 
ATOM   7486 C CG  . ASP E 1 173 ? 24.107  82.077  54.033 1.00 56.56  ? 664  ASP E CG  1 
ATOM   7487 O OD1 . ASP E 1 173 ? 24.478  82.952  54.850 1.00 56.32  ? 664  ASP E OD1 1 
ATOM   7488 O OD2 . ASP E 1 173 ? 24.513  80.895  54.088 1.00 58.53  ? 664  ASP E OD2 1 
ATOM   7489 N N   . TRP E 1 174 ? 20.987  84.515  51.583 1.00 54.57  ? 665  TRP E N   1 
ATOM   7490 C CA  . TRP E 1 174 ? 20.025  84.752  50.516 1.00 53.74  ? 665  TRP E CA  1 
ATOM   7491 C C   . TRP E 1 174 ? 20.501  84.056  49.263 1.00 51.48  ? 665  TRP E C   1 
ATOM   7492 O O   . TRP E 1 174 ? 21.693  83.805  49.107 1.00 50.39  ? 665  TRP E O   1 
ATOM   7493 C CB  . TRP E 1 174 ? 19.886  86.253  50.228 1.00 55.95  ? 665  TRP E CB  1 
ATOM   7494 C CG  . TRP E 1 174 ? 19.216  87.031  51.318 1.00 56.79  ? 665  TRP E CG  1 
ATOM   7495 C CD1 . TRP E 1 174 ? 19.757  87.413  52.512 1.00 55.60  ? 665  TRP E CD1 1 
ATOM   7496 C CD2 . TRP E 1 174 ? 17.862  87.489  51.322 1.00 56.84  ? 665  TRP E CD2 1 
ATOM   7497 N NE1 . TRP E 1 174 ? 18.819  88.080  53.260 1.00 56.22  ? 665  TRP E NE1 1 
ATOM   7498 C CE2 . TRP E 1 174 ? 17.646  88.141  52.553 1.00 56.68  ? 665  TRP E CE2 1 
ATOM   7499 C CE3 . TRP E 1 174 ? 16.806  87.408  50.402 1.00 57.88  ? 665  TRP E CE3 1 
ATOM   7500 C CZ2 . TRP E 1 174 ? 16.418  88.710  52.891 1.00 57.80  ? 665  TRP E CZ2 1 
ATOM   7501 C CZ3 . TRP E 1 174 ? 15.584  87.974  50.736 1.00 58.56  ? 665  TRP E CZ3 1 
ATOM   7502 C CH2 . TRP E 1 174 ? 15.401  88.617  51.972 1.00 59.04  ? 665  TRP E CH2 1 
ATOM   7503 N N   . ASN E 1 175 ? 19.567  83.744  48.373 1.00 50.53  ? 666  ASN E N   1 
ATOM   7504 C CA  . ASN E 1 175 ? 19.913  83.093  47.117 1.00 50.09  ? 666  ASN E CA  1 
ATOM   7505 C C   . ASN E 1 175 ? 20.762  81.835  47.374 1.00 49.73  ? 666  ASN E C   1 
ATOM   7506 O O   . ASN E 1 175 ? 21.725  81.563  46.659 1.00 49.65  ? 666  ASN E O   1 
ATOM   7507 C CB  . ASN E 1 175 ? 20.666  84.105  46.244 1.00 49.01  ? 666  ASN E CB  1 
ATOM   7508 C CG  . ASN E 1 175 ? 20.952  83.592  44.849 1.00 49.35  ? 666  ASN E CG  1 
ATOM   7509 O OD1 . ASN E 1 175 ? 20.051  83.125  44.150 1.00 48.79  ? 666  ASN E OD1 1 
ATOM   7510 N ND2 . ASN E 1 175 ? 22.213  83.695  44.428 1.00 47.58  ? 666  ASN E ND2 1 
ATOM   7511 N N   . ALA E 1 176 ? 20.387  81.071  48.400 1.00 49.29  ? 667  ALA E N   1 
ATOM   7512 C CA  . ALA E 1 176 ? 21.101  79.848  48.776 1.00 48.15  ? 667  ALA E CA  1 
ATOM   7513 C C   . ALA E 1 176 ? 20.196  78.614  48.803 1.00 48.45  ? 667  ALA E C   1 
ATOM   7514 O O   . ALA E 1 176 ? 18.971  78.720  48.939 1.00 49.14  ? 667  ALA E O   1 
ATOM   7515 C CB  . ALA E 1 176 ? 21.757  80.029  50.147 1.00 47.22  ? 667  ALA E CB  1 
ATOM   7516 N N   . GLU E 1 177 ? 20.809  77.441  48.680 1.00 47.10  ? 668  GLU E N   1 
ATOM   7517 C CA  . GLU E 1 177 ? 20.069  76.188  48.701 1.00 46.41  ? 668  GLU E CA  1 
ATOM   7518 C C   . GLU E 1 177 ? 20.348  75.475  50.017 1.00 45.26  ? 668  GLU E C   1 
ATOM   7519 O O   . GLU E 1 177 ? 21.508  75.304  50.404 1.00 43.59  ? 668  GLU E O   1 
ATOM   7520 C CB  . GLU E 1 177 ? 20.485  75.308  47.517 1.00 48.32  ? 668  GLU E CB  1 
ATOM   7521 C CG  . GLU E 1 177 ? 20.173  75.928  46.159 1.00 51.23  ? 668  GLU E CG  1 
ATOM   7522 C CD  . GLU E 1 177 ? 20.642  75.082  44.980 1.00 53.55  ? 668  GLU E CD  1 
ATOM   7523 O OE1 . GLU E 1 177 ? 20.035  74.016  44.715 1.00 52.71  ? 668  GLU E OE1 1 
ATOM   7524 O OE2 . GLU E 1 177 ? 21.624  75.494  44.318 1.00 54.03  ? 668  GLU E OE2 1 
ATOM   7525 N N   . TYR E 1 178 ? 19.278  75.073  50.703 1.00 44.48  ? 669  TYR E N   1 
ATOM   7526 C CA  . TYR E 1 178 ? 19.385  74.386  51.991 1.00 43.95  ? 669  TYR E CA  1 
ATOM   7527 C C   . TYR E 1 178 ? 18.694  73.028  52.018 1.00 43.60  ? 669  TYR E C   1 
ATOM   7528 O O   . TYR E 1 178 ? 17.993  72.650  51.083 1.00 44.64  ? 669  TYR E O   1 
ATOM   7529 C CB  . TYR E 1 178 ? 18.772  75.235  53.102 1.00 43.37  ? 669  TYR E CB  1 
ATOM   7530 C CG  . TYR E 1 178 ? 19.580  76.433  53.528 1.00 43.34  ? 669  TYR E CG  1 
ATOM   7531 C CD1 . TYR E 1 178 ? 19.402  77.678  52.921 1.00 42.03  ? 669  TYR E CD1 1 
ATOM   7532 C CD2 . TYR E 1 178 ? 20.496  76.331  54.579 1.00 44.08  ? 669  TYR E CD2 1 
ATOM   7533 C CE1 . TYR E 1 178 ? 20.109  78.801  53.354 1.00 42.75  ? 669  TYR E CE1 1 
ATOM   7534 C CE2 . TYR E 1 178 ? 21.214  77.441  55.021 1.00 45.30  ? 669  TYR E CE2 1 
ATOM   7535 C CZ  . TYR E 1 178 ? 21.014  78.677  54.408 1.00 45.19  ? 669  TYR E CZ  1 
ATOM   7536 O OH  . TYR E 1 178 ? 21.714  79.774  54.865 1.00 44.40  ? 669  TYR E OH  1 
ATOM   7537 N N   . GLU E 1 179 ? 18.891  72.304  53.113 1.00 43.47  ? 670  GLU E N   1 
ATOM   7538 C CA  . GLU E 1 179 ? 18.264  71.000  53.307 1.00 43.89  ? 670  GLU E CA  1 
ATOM   7539 C C   . GLU E 1 179 ? 18.035  70.772  54.795 1.00 43.09  ? 670  GLU E C   1 
ATOM   7540 O O   . GLU E 1 179 ? 18.854  71.160  55.623 1.00 42.82  ? 670  GLU E O   1 
ATOM   7541 C CB  . GLU E 1 179 ? 19.142  69.875  52.761 1.00 45.35  ? 670  GLU E CB  1 
ATOM   7542 C CG  . GLU E 1 179 ? 20.481  69.738  53.465 1.00 49.44  ? 670  GLU E CG  1 
ATOM   7543 C CD  . GLU E 1 179 ? 21.255  68.511  53.021 1.00 51.90  ? 670  GLU E CD  1 
ATOM   7544 O OE1 . GLU E 1 179 ? 22.388  68.319  53.510 1.00 55.21  ? 670  GLU E OE1 1 
ATOM   7545 O OE2 . GLU E 1 179 ? 20.734  67.738  52.192 1.00 51.41  ? 670  GLU E OE2 1 
ATOM   7546 N N   . VAL E 1 180 ? 16.914  70.154  55.138 1.00 42.83  ? 671  VAL E N   1 
ATOM   7547 C CA  . VAL E 1 180 ? 16.625  69.881  56.533 1.00 42.14  ? 671  VAL E CA  1 
ATOM   7548 C C   . VAL E 1 180 ? 16.311  68.414  56.706 1.00 41.26  ? 671  VAL E C   1 
ATOM   7549 O O   . VAL E 1 180 ? 15.776  67.770  55.805 1.00 39.37  ? 671  VAL E O   1 
ATOM   7550 C CB  . VAL E 1 180 ? 15.403  70.668  57.056 1.00 43.52  ? 671  VAL E CB  1 
ATOM   7551 C CG1 . VAL E 1 180 ? 15.402  70.652  58.574 1.00 42.18  ? 671  VAL E CG1 1 
ATOM   7552 C CG2 . VAL E 1 180 ? 15.419  72.090  56.535 1.00 46.70  ? 671  VAL E CG2 1 
ATOM   7553 N N   . TYR E 1 181 ? 16.667  67.898  57.876 1.00 42.11  ? 672  TYR E N   1 
ATOM   7554 C CA  . TYR E 1 181 ? 16.405  66.519  58.245 1.00 41.61  ? 672  TYR E CA  1 
ATOM   7555 C C   . TYR E 1 181 ? 15.683  66.559  59.590 1.00 39.88  ? 672  TYR E C   1 
ATOM   7556 O O   . TYR E 1 181 ? 16.146  67.181  60.531 1.00 39.10  ? 672  TYR E O   1 
ATOM   7557 C CB  . TYR E 1 181 ? 17.708  65.726  58.369 1.00 42.92  ? 672  TYR E CB  1 
ATOM   7558 C CG  . TYR E 1 181 ? 18.328  65.305  57.053 1.00 45.01  ? 672  TYR E CG  1 
ATOM   7559 C CD1 . TYR E 1 181 ? 19.374  66.027  56.492 1.00 46.86  ? 672  TYR E CD1 1 
ATOM   7560 C CD2 . TYR E 1 181 ? 17.893  64.159  56.388 1.00 46.42  ? 672  TYR E CD2 1 
ATOM   7561 C CE1 . TYR E 1 181 ? 19.984  65.619  55.304 1.00 47.92  ? 672  TYR E CE1 1 
ATOM   7562 C CE2 . TYR E 1 181 ? 18.494  63.740  55.198 1.00 47.73  ? 672  TYR E CE2 1 
ATOM   7563 C CZ  . TYR E 1 181 ? 19.544  64.474  54.664 1.00 48.30  ? 672  TYR E CZ  1 
ATOM   7564 O OH  . TYR E 1 181 ? 20.170  64.058  53.509 1.00 48.22  ? 672  TYR E OH  1 
ATOM   7565 N N   . VAL E 1 182 ? 14.530  65.917  59.670 1.00 39.45  ? 673  VAL E N   1 
ATOM   7566 C CA  . VAL E 1 182 ? 13.778  65.898  60.914 1.00 38.94  ? 673  VAL E CA  1 
ATOM   7567 C C   . VAL E 1 182 ? 13.597  64.451  61.328 1.00 39.59  ? 673  VAL E C   1 
ATOM   7568 O O   . VAL E 1 182 ? 13.190  63.611  60.526 1.00 40.97  ? 673  VAL E O   1 
ATOM   7569 C CB  . VAL E 1 182 ? 12.395  66.568  60.745 1.00 37.43  ? 673  VAL E CB  1 
ATOM   7570 C CG1 . VAL E 1 182 ? 11.671  66.620  62.070 1.00 34.70  ? 673  VAL E CG1 1 
ATOM   7571 C CG2 . VAL E 1 182 ? 12.570  67.971  60.201 1.00 37.46  ? 673  VAL E CG2 1 
ATOM   7572 N N   . VAL E 1 183 ? 13.918  64.155  62.578 1.00 39.27  ? 674  VAL E N   1 
ATOM   7573 C CA  . VAL E 1 183 ? 13.786  62.799  63.079 1.00 39.83  ? 674  VAL E CA  1 
ATOM   7574 C C   . VAL E 1 183 ? 12.895  62.779  64.299 1.00 40.80  ? 674  VAL E C   1 
ATOM   7575 O O   . VAL E 1 183 ? 13.020  63.632  65.175 1.00 41.90  ? 674  VAL E O   1 
ATOM   7576 C CB  . VAL E 1 183 ? 15.165  62.192  63.462 1.00 39.29  ? 674  VAL E CB  1 
ATOM   7577 C CG1 . VAL E 1 183 ? 15.000  61.130  64.539 1.00 37.34  ? 674  VAL E CG1 1 
ATOM   7578 C CG2 . VAL E 1 183 ? 15.818  61.563  62.237 1.00 38.89  ? 674  VAL E CG2 1 
ATOM   7579 N N   . ALA E 1 184 ? 11.990  61.805  64.340 1.00 40.86  ? 675  ALA E N   1 
ATOM   7580 C CA  . ALA E 1 184 ? 11.090  61.630  65.470 1.00 40.27  ? 675  ALA E CA  1 
ATOM   7581 C C   . ALA E 1 184 ? 11.737  60.590  66.386 1.00 41.08  ? 675  ALA E C   1 
ATOM   7582 O O   . ALA E 1 184 ? 12.358  59.634  65.917 1.00 40.80  ? 675  ALA E O   1 
ATOM   7583 C CB  . ALA E 1 184 ? 9.742   61.151  64.991 1.00 38.25  ? 675  ALA E CB  1 
ATOM   7584 N N   . GLU E 1 185 ? 11.587  60.772  67.690 1.00 42.69  ? 676  GLU E N   1 
ATOM   7585 C CA  . GLU E 1 185 ? 12.194  59.858  68.647 1.00 45.23  ? 676  GLU E CA  1 
ATOM   7586 C C   . GLU E 1 185 ? 11.276  59.532  69.827 1.00 44.49  ? 676  GLU E C   1 
ATOM   7587 O O   . GLU E 1 185 ? 10.539  60.397  70.304 1.00 43.92  ? 676  GLU E O   1 
ATOM   7588 C CB  . GLU E 1 185 ? 13.499  60.489  69.137 1.00 48.13  ? 676  GLU E CB  1 
ATOM   7589 C CG  . GLU E 1 185 ? 14.199  59.775  70.263 1.00 52.42  ? 676  GLU E CG  1 
ATOM   7590 C CD  . GLU E 1 185 ? 15.478  60.487  70.665 1.00 55.57  ? 676  GLU E CD  1 
ATOM   7591 O OE1 . GLU E 1 185 ? 15.407  61.707  70.946 1.00 56.71  ? 676  GLU E OE1 1 
ATOM   7592 O OE2 . GLU E 1 185 ? 16.546  59.831  70.698 1.00 56.62  ? 676  GLU E OE2 1 
ATOM   7593 N N   . ASN E 1 186 ? 11.308  58.282  70.282 1.00 43.46  ? 677  ASN E N   1 
ATOM   7594 C CA  . ASN E 1 186 ? 10.494  57.871  71.425 1.00 44.54  ? 677  ASN E CA  1 
ATOM   7595 C C   . ASN E 1 186 ? 11.289  56.962  72.362 1.00 46.76  ? 677  ASN E C   1 
ATOM   7596 O O   . ASN E 1 186 ? 12.424  56.599  72.070 1.00 47.73  ? 677  ASN E O   1 
ATOM   7597 C CB  . ASN E 1 186 ? 9.217   57.153  70.974 1.00 41.69  ? 677  ASN E CB  1 
ATOM   7598 C CG  . ASN E 1 186 ? 9.487   55.796  70.367 1.00 39.29  ? 677  ASN E CG  1 
ATOM   7599 O OD1 . ASN E 1 186 ? 10.555  55.229  70.539 1.00 38.31  ? 677  ASN E OD1 1 
ATOM   7600 N ND2 . ASN E 1 186 ? 8.504   55.260  69.665 1.00 39.53  ? 677  ASN E ND2 1 
ATOM   7601 N N   . GLN E 1 187 ? 10.683  56.591  73.484 1.00 49.33  ? 678  GLN E N   1 
ATOM   7602 C CA  . GLN E 1 187 ? 11.336  55.734  74.475 1.00 50.74  ? 678  GLN E CA  1 
ATOM   7603 C C   . GLN E 1 187 ? 11.958  54.480  73.872 1.00 48.91  ? 678  GLN E C   1 
ATOM   7604 O O   . GLN E 1 187 ? 12.810  53.858  74.487 1.00 49.20  ? 678  GLN E O   1 
ATOM   7605 C CB  . GLN E 1 187 ? 10.324  55.319  75.562 1.00 54.56  ? 678  GLN E CB  1 
ATOM   7606 C CG  . GLN E 1 187 ? 9.599   56.500  76.245 1.00 60.48  ? 678  GLN E CG  1 
ATOM   7607 C CD  . GLN E 1 187 ? 8.432   56.074  77.149 1.00 61.99  ? 678  GLN E CD  1 
ATOM   7608 O OE1 . GLN E 1 187 ? 7.777   56.912  77.783 1.00 61.42  ? 678  GLN E OE1 1 
ATOM   7609 N NE2 . GLN E 1 187 ? 8.170   54.771  77.203 1.00 63.51  ? 678  GLN E NE2 1 
ATOM   7610 N N   . GLN E 1 188 ? 11.541  54.121  72.663 1.00 48.59  ? 679  GLN E N   1 
ATOM   7611 C CA  . GLN E 1 188 ? 12.022  52.910  71.993 1.00 48.23  ? 679  GLN E CA  1 
ATOM   7612 C C   . GLN E 1 188 ? 13.094  53.147  70.917 1.00 47.70  ? 679  GLN E C   1 
ATOM   7613 O O   . GLN E 1 188 ? 13.764  52.210  70.478 1.00 48.55  ? 679  GLN E O   1 
ATOM   7614 C CB  . GLN E 1 188 ? 10.808  52.171  71.406 1.00 48.82  ? 679  GLN E CB  1 
ATOM   7615 C CG  . GLN E 1 188 ? 11.096  51.063  70.409 1.00 50.99  ? 679  GLN E CG  1 
ATOM   7616 C CD  . GLN E 1 188 ? 11.546  49.768  71.057 1.00 53.17  ? 679  GLN E CD  1 
ATOM   7617 O OE1 . GLN E 1 188 ? 10.942  49.291  72.024 1.00 53.05  ? 679  GLN E OE1 1 
ATOM   7618 N NE2 . GLN E 1 188 ? 12.601  49.175  70.509 1.00 54.70  ? 679  GLN E NE2 1 
ATOM   7619 N N   . GLY E 1 189 ? 13.271  54.395  70.496 1.00 46.22  ? 680  GLY E N   1 
ATOM   7620 C CA  . GLY E 1 189 ? 14.274  54.674  69.481 1.00 43.84  ? 680  GLY E CA  1 
ATOM   7621 C C   . GLY E 1 189 ? 13.981  55.890  68.625 1.00 42.60  ? 680  GLY E C   1 
ATOM   7622 O O   . GLY E 1 189 ? 13.186  56.751  69.009 1.00 43.61  ? 680  GLY E O   1 
ATOM   7623 N N   . LYS E 1 190 ? 14.621  55.962  67.458 1.00 41.70  ? 681  LYS E N   1 
ATOM   7624 C CA  . LYS E 1 190 ? 14.433  57.090  66.541 1.00 40.31  ? 681  LYS E CA  1 
ATOM   7625 C C   . LYS E 1 190 ? 13.998  56.649  65.146 1.00 38.14  ? 681  LYS E C   1 
ATOM   7626 O O   . LYS E 1 190 ? 14.264  55.523  64.729 1.00 36.92  ? 681  LYS E O   1 
ATOM   7627 C CB  . LYS E 1 190 ? 15.724  57.910  66.444 1.00 40.52  ? 681  LYS E CB  1 
ATOM   7628 C CG  . LYS E 1 190 ? 16.228  58.374  67.794 1.00 44.08  ? 681  LYS E CG  1 
ATOM   7629 C CD  . LYS E 1 190 ? 17.219  59.515  67.679 1.00 47.78  ? 681  LYS E CD  1 
ATOM   7630 C CE  . LYS E 1 190 ? 18.479  59.118  66.938 1.00 47.48  ? 681  LYS E CE  1 
ATOM   7631 N NZ  . LYS E 1 190 ? 19.383  60.298  66.841 1.00 48.43  ? 681  LYS E NZ  1 
ATOM   7632 N N   . SER E 1 191 ? 13.326  57.545  64.429 1.00 36.07  ? 682  SER E N   1 
ATOM   7633 C CA  . SER E 1 191 ? 12.853  57.242  63.083 1.00 34.29  ? 682  SER E CA  1 
ATOM   7634 C C   . SER E 1 191 ? 13.887  57.552  62.004 1.00 33.27  ? 682  SER E C   1 
ATOM   7635 O O   . SER E 1 191 ? 14.910  58.187  62.263 1.00 32.57  ? 682  SER E O   1 
ATOM   7636 C CB  . SER E 1 191 ? 11.584  58.044  62.776 1.00 33.50  ? 682  SER E CB  1 
ATOM   7637 O OG  . SER E 1 191 ? 11.881  59.410  62.520 1.00 30.38  ? 682  SER E OG  1 
ATOM   7638 N N   . LYS E 1 192 ? 13.612  57.078  60.795 1.00 32.68  ? 683  LYS E N   1 
ATOM   7639 C CA  . LYS E 1 192 ? 14.462  57.366  59.653 1.00 32.90  ? 683  LYS E CA  1 
ATOM   7640 C C   . LYS E 1 192 ? 14.249  58.869  59.514 1.00 33.48  ? 683  LYS E C   1 
ATOM   7641 O O   . LYS E 1 192 ? 13.257  59.390  60.017 1.00 33.96  ? 683  LYS E O   1 
ATOM   7642 C CB  . LYS E 1 192 ? 13.941  56.628  58.422 1.00 33.69  ? 683  LYS E CB  1 
ATOM   7643 C CG  . LYS E 1 192 ? 14.257  55.137  58.433 1.00 35.46  ? 683  LYS E CG  1 
ATOM   7644 C CD  . LYS E 1 192 ? 13.331  54.358  57.515 1.00 37.07  ? 683  LYS E CD  1 
ATOM   7645 C CE  . LYS E 1 192 ? 13.887  52.978  57.190 1.00 38.93  ? 683  LYS E CE  1 
ATOM   7646 N NZ  . LYS E 1 192 ? 14.211  52.151  58.391 1.00 41.03  ? 683  LYS E NZ  1 
ATOM   7647 N N   . ALA E 1 193 ? 15.152  59.580  58.853 1.00 33.20  ? 684  ALA E N   1 
ATOM   7648 C CA  . ALA E 1 193 ? 14.977  61.020  58.745 1.00 33.51  ? 684  ALA E CA  1 
ATOM   7649 C C   . ALA E 1 193 ? 14.146  61.464  57.556 1.00 34.50  ? 684  ALA E C   1 
ATOM   7650 O O   . ALA E 1 193 ? 14.287  60.929  56.457 1.00 35.62  ? 684  ALA E O   1 
ATOM   7651 C CB  . ALA E 1 193 ? 16.324  61.703  58.701 1.00 32.39  ? 684  ALA E CB  1 
ATOM   7652 N N   . ALA E 1 194 ? 13.259  62.427  57.790 1.00 33.65  ? 685  ALA E N   1 
ATOM   7653 C CA  . ALA E 1 194 ? 12.454  62.991  56.714 1.00 34.39  ? 685  ALA E CA  1 
ATOM   7654 C C   . ALA E 1 194 ? 13.365  64.102  56.155 1.00 35.36  ? 685  ALA E C   1 
ATOM   7655 O O   . ALA E 1 194 ? 14.033  64.803  56.918 1.00 35.38  ? 685  ALA E O   1 
ATOM   7656 C CB  . ALA E 1 194 ? 11.160  63.570  57.265 1.00 33.69  ? 685  ALA E CB  1 
ATOM   7657 N N   . HIS E 1 195 ? 13.397  64.260  54.837 1.00 36.18  ? 686  HIS E N   1 
ATOM   7658 C CA  . HIS E 1 195 ? 14.281  65.235  54.206 1.00 37.31  ? 686  HIS E CA  1 
ATOM   7659 C C   . HIS E 1 195 ? 13.509  66.310  53.461 1.00 37.10  ? 686  HIS E C   1 
ATOM   7660 O O   . HIS E 1 195 ? 12.467  66.038  52.884 1.00 36.72  ? 686  HIS E O   1 
ATOM   7661 C CB  . HIS E 1 195 ? 15.223  64.478  53.259 1.00 40.79  ? 686  HIS E CB  1 
ATOM   7662 C CG  . HIS E 1 195 ? 16.391  65.278  52.772 1.00 46.07  ? 686  HIS E CG  1 
ATOM   7663 N ND1 . HIS E 1 195 ? 17.081  66.164  53.576 1.00 48.27  ? 686  HIS E ND1 1 
ATOM   7664 C CD2 . HIS E 1 195 ? 17.033  65.274  51.578 1.00 46.44  ? 686  HIS E CD2 1 
ATOM   7665 C CE1 . HIS E 1 195 ? 18.096  66.671  52.897 1.00 47.96  ? 686  HIS E CE1 1 
ATOM   7666 N NE2 . HIS E 1 195 ? 18.090  66.147  51.683 1.00 47.90  ? 686  HIS E NE2 1 
ATOM   7667 N N   . PHE E 1 196 ? 14.017  67.537  53.489 1.00 38.06  ? 687  PHE E N   1 
ATOM   7668 C CA  . PHE E 1 196 ? 13.366  68.656  52.806 1.00 37.98  ? 687  PHE E CA  1 
ATOM   7669 C C   . PHE E 1 196 ? 14.421  69.606  52.237 1.00 38.30  ? 687  PHE E C   1 
ATOM   7670 O O   . PHE E 1 196 ? 15.281  70.091  52.969 1.00 39.82  ? 687  PHE E O   1 
ATOM   7671 C CB  . PHE E 1 196 ? 12.473  69.418  53.779 1.00 36.83  ? 687  PHE E CB  1 
ATOM   7672 C CG  . PHE E 1 196 ? 11.504  70.338  53.108 1.00 36.47  ? 687  PHE E CG  1 
ATOM   7673 C CD1 . PHE E 1 196 ? 10.417  69.825  52.404 1.00 38.52  ? 687  PHE E CD1 1 
ATOM   7674 C CD2 . PHE E 1 196 ? 11.679  71.714  53.163 1.00 35.98  ? 687  PHE E CD2 1 
ATOM   7675 C CE1 . PHE E 1 196 ? 9.510   70.672  51.756 1.00 37.73  ? 687  PHE E CE1 1 
ATOM   7676 C CE2 . PHE E 1 196 ? 10.786  72.570  52.525 1.00 36.96  ? 687  PHE E CE2 1 
ATOM   7677 C CZ  . PHE E 1 196 ? 9.695   72.047  51.817 1.00 37.65  ? 687  PHE E CZ  1 
ATOM   7678 N N   . VAL E 1 197 ? 14.348  69.881  50.939 1.00 37.03  ? 688  VAL E N   1 
ATOM   7679 C CA  . VAL E 1 197 ? 15.320  70.751  50.288 1.00 36.89  ? 688  VAL E CA  1 
ATOM   7680 C C   . VAL E 1 197 ? 14.669  72.008  49.711 1.00 37.44  ? 688  VAL E C   1 
ATOM   7681 O O   . VAL E 1 197 ? 13.705  71.931  48.944 1.00 37.36  ? 688  VAL E O   1 
ATOM   7682 C CB  . VAL E 1 197 ? 16.043  69.991  49.156 1.00 37.08  ? 688  VAL E CB  1 
ATOM   7683 C CG1 . VAL E 1 197 ? 17.133  70.856  48.543 1.00 37.66  ? 688  VAL E CG1 1 
ATOM   7684 C CG2 . VAL E 1 197 ? 16.621  68.706  49.697 1.00 37.10  ? 688  VAL E CG2 1 
ATOM   7685 N N   . PHE E 1 198 ? 15.205  73.168  50.071 1.00 36.64  ? 689  PHE E N   1 
ATOM   7686 C CA  . PHE E 1 198 ? 14.650  74.424  49.588 1.00 37.12  ? 689  PHE E CA  1 
ATOM   7687 C C   . PHE E 1 198 ? 15.728  75.468  49.279 1.00 38.53  ? 689  PHE E C   1 
ATOM   7688 O O   . PHE E 1 198 ? 16.882  75.350  49.705 1.00 37.26  ? 689  PHE E O   1 
ATOM   7689 C CB  . PHE E 1 198 ? 13.664  74.979  50.622 1.00 35.10  ? 689  PHE E CB  1 
ATOM   7690 C CG  . PHE E 1 198 ? 14.318  75.452  51.880 1.00 33.51  ? 689  PHE E CG  1 
ATOM   7691 C CD1 . PHE E 1 198 ? 14.544  76.810  52.094 1.00 33.87  ? 689  PHE E CD1 1 
ATOM   7692 C CD2 . PHE E 1 198 ? 14.744  74.544  52.840 1.00 33.25  ? 689  PHE E CD2 1 
ATOM   7693 C CE1 . PHE E 1 198 ? 15.186  77.254  53.248 1.00 32.65  ? 689  PHE E CE1 1 
ATOM   7694 C CE2 . PHE E 1 198 ? 15.388  74.975  53.996 1.00 32.66  ? 689  PHE E CE2 1 
ATOM   7695 C CZ  . PHE E 1 198 ? 15.608  76.333  54.200 1.00 33.27  ? 689  PHE E CZ  1 
ATOM   7696 N N   . ARG E 1 199 ? 15.331  76.490  48.529 1.00 39.73  ? 690  ARG E N   1 
ATOM   7697 C CA  . ARG E 1 199 ? 16.231  77.566  48.152 1.00 41.48  ? 690  ARG E CA  1 
ATOM   7698 C C   . ARG E 1 199 ? 15.631  78.911  48.544 1.00 42.37  ? 690  ARG E C   1 
ATOM   7699 O O   . ARG E 1 199 ? 14.458  79.168  48.282 1.00 43.38  ? 690  ARG E O   1 
ATOM   7700 C CB  . ARG E 1 199 ? 16.474  77.522  46.648 1.00 42.70  ? 690  ARG E CB  1 
ATOM   7701 C CG  . ARG E 1 199 ? 17.343  78.637  46.140 1.00 42.81  ? 690  ARG E CG  1 
ATOM   7702 C CD  . ARG E 1 199 ? 17.807  78.346  44.741 1.00 43.87  ? 690  ARG E CD  1 
ATOM   7703 N NE  . ARG E 1 199 ? 18.507  79.492  44.181 1.00 46.53  ? 690  ARG E NE  1 
ATOM   7704 C CZ  . ARG E 1 199 ? 19.375  79.420  43.182 1.00 45.79  ? 690  ARG E CZ  1 
ATOM   7705 N NH1 . ARG E 1 199 ? 19.654  78.245  42.635 1.00 46.30  ? 690  ARG E NH1 1 
ATOM   7706 N NH2 . ARG E 1 199 ? 19.952  80.523  42.728 1.00 45.57  ? 690  ARG E NH2 1 
ATOM   7707 N N   . THR E 1 200 ? 16.437  79.766  49.169 1.00 43.23  ? 691  THR E N   1 
ATOM   7708 C CA  . THR E 1 200 ? 15.977  81.080  49.607 1.00 42.58  ? 691  THR E CA  1 
ATOM   7709 C C   . THR E 1 200 ? 15.949  82.087  48.467 1.00 43.97  ? 691  THR E C   1 
ATOM   7710 O O   . THR E 1 200 ? 16.685  81.959  47.492 1.00 43.92  ? 691  THR E O   1 
ATOM   7711 C CB  . THR E 1 200 ? 16.864  81.634  50.736 1.00 42.65  ? 691  THR E CB  1 
ATOM   7712 O OG1 . THR E 1 200 ? 18.224  81.711  50.292 1.00 43.16  ? 691  THR E OG1 1 
ATOM   7713 C CG2 . THR E 1 200 ? 16.787  80.738  51.957 1.00 40.80  ? 691  THR E CG2 1 
ATOM   7714 N N   . ALA E 1 201 ? 15.092  83.093  48.604 1.00 46.05  ? 692  ALA E N   1 
ATOM   7715 C CA  . ALA E 1 201 ? 14.929  84.131  47.590 1.00 47.50  ? 692  ALA E CA  1 
ATOM   7716 C C   . ALA E 1 201 ? 16.184  84.984  47.396 1.00 48.92  ? 692  ALA E C   1 
ATOM   7717 O O   . ALA E 1 201 ? 17.131  84.906  48.178 1.00 49.67  ? 692  ALA E O   1 
ATOM   7718 C CB  . ALA E 1 201 ? 13.736  85.018  47.948 1.00 46.62  ? 692  ALA E CB  1 
ATOM   7719 N N   . ALA E 1 202 ? 16.176  85.798  46.344 1.00 50.21  ? 693  ALA E N   1 
ATOM   7720 C CA  . ALA E 1 202 ? 17.304  86.664  46.017 1.00 51.53  ? 693  ALA E CA  1 
ATOM   7721 C C   . ALA E 1 202 ? 17.447  87.839  46.983 1.00 51.96  ? 693  ALA E C   1 
ATOM   7722 O O   . ALA E 1 202 ? 18.527  87.949  47.603 1.00 51.61  ? 693  ALA E O   1 
ATOM   7723 C CB  . ALA E 1 202 ? 17.159  87.179  44.596 1.00 50.96  ? 693  ALA E CB  1 
ATOM   7724 N N   . ALA E 1 203 ? 16.488  88.636  47.104 1.00 52.12  ? 694  ALA E N   1 
ATOM   7725 N N   . ALA F 1 6   ? -14.841 85.347  86.281 1.00 94.18  ? 497  ALA F N   1 
ATOM   7726 C CA  . ALA F 1 6   ? -14.483 83.934  85.961 1.00 94.35  ? 497  ALA F CA  1 
ATOM   7727 C C   . ALA F 1 6   ? -14.785 83.606  84.498 1.00 94.41  ? 497  ALA F C   1 
ATOM   7728 O O   . ALA F 1 6   ? -15.870 83.119  84.168 1.00 94.69  ? 497  ALA F O   1 
ATOM   7729 C CB  . ALA F 1 6   ? -15.246 82.986  86.880 1.00 94.06  ? 497  ALA F CB  1 
ATOM   7730 N N   . ASP F 1 7   ? -13.818 83.876  83.626 1.00 93.82  ? 498  ASP F N   1 
ATOM   7731 C CA  . ASP F 1 7   ? -13.975 83.611  82.200 1.00 92.68  ? 498  ASP F CA  1 
ATOM   7732 C C   . ASP F 1 7   ? -14.008 82.113  81.899 1.00 91.48  ? 498  ASP F C   1 
ATOM   7733 O O   . ASP F 1 7   ? -13.948 81.283  82.808 1.00 91.36  ? 498  ASP F O   1 
ATOM   7734 C CB  . ASP F 1 7   ? -12.848 84.287  81.409 1.00 92.90  ? 498  ASP F CB  1 
ATOM   7735 C CG  . ASP F 1 7   ? -11.484 84.104  82.055 1.00 92.97  ? 498  ASP F CG  1 
ATOM   7736 O OD1 . ASP F 1 7   ? -11.265 84.657  83.153 1.00 92.18  ? 498  ASP F OD1 1 
ATOM   7737 O OD2 . ASP F 1 7   ? -10.631 83.408  81.466 1.00 93.33  ? 498  ASP F OD2 1 
ATOM   7738 N N   . THR F 1 8   ? -14.111 81.778  80.616 1.00 89.99  ? 499  THR F N   1 
ATOM   7739 C CA  . THR F 1 8   ? -14.165 80.388  80.175 1.00 88.19  ? 499  THR F CA  1 
ATOM   7740 C C   . THR F 1 8   ? -12.796 79.721  80.249 1.00 86.55  ? 499  THR F C   1 
ATOM   7741 O O   . THR F 1 8   ? -11.773 80.400  80.343 1.00 86.69  ? 499  THR F O   1 
ATOM   7742 C CB  . THR F 1 8   ? -14.699 80.293  78.733 1.00 88.88  ? 499  THR F CB  1 
ATOM   7743 O OG1 . THR F 1 8   ? -14.053 81.279  77.917 1.00 89.25  ? 499  THR F OG1 1 
ATOM   7744 C CG2 . THR F 1 8   ? -16.206 80.515  78.708 1.00 88.72  ? 499  THR F CG2 1 
ATOM   7745 N N   . PRO F 1 9   ? -12.762 78.376  80.206 1.00 84.78  ? 500  PRO F N   1 
ATOM   7746 C CA  . PRO F 1 9   ? -11.500 77.631  80.274 1.00 82.95  ? 500  PRO F CA  1 
ATOM   7747 C C   . PRO F 1 9   ? -10.561 78.048  79.153 1.00 81.46  ? 500  PRO F C   1 
ATOM   7748 O O   . PRO F 1 9   ? -11.019 78.439  78.074 1.00 81.62  ? 500  PRO F O   1 
ATOM   7749 C CB  . PRO F 1 9   ? -11.946 76.175  80.127 1.00 83.16  ? 500  PRO F CB  1 
ATOM   7750 C CG  . PRO F 1 9   ? -13.362 76.186  80.625 1.00 83.02  ? 500  PRO F CG  1 
ATOM   7751 C CD  . PRO F 1 9   ? -13.897 77.455  80.030 1.00 84.06  ? 500  PRO F CD  1 
ATOM   7752 N N   . SER F 1 10  ? -9.256  77.966  79.407 1.00 79.06  ? 501  SER F N   1 
ATOM   7753 C CA  . SER F 1 10  ? -8.256  78.327  78.404 1.00 76.54  ? 501  SER F CA  1 
ATOM   7754 C C   . SER F 1 10  ? -8.180  77.232  77.344 1.00 74.89  ? 501  SER F C   1 
ATOM   7755 O O   . SER F 1 10  ? -8.909  76.237  77.412 1.00 74.43  ? 501  SER F O   1 
ATOM   7756 C CB  . SER F 1 10  ? -6.880  78.520  79.051 1.00 76.87  ? 501  SER F CB  1 
ATOM   7757 O OG  . SER F 1 10  ? -6.433  77.336  79.691 1.00 77.50  ? 501  SER F OG  1 
ATOM   7758 N N   . SER F 1 11  ? -7.303  77.409  76.363 1.00 72.47  ? 502  SER F N   1 
ATOM   7759 C CA  . SER F 1 11  ? -7.183  76.414  75.309 1.00 70.42  ? 502  SER F CA  1 
ATOM   7760 C C   . SER F 1 11  ? -6.382  75.201  75.769 1.00 68.29  ? 502  SER F C   1 
ATOM   7761 O O   . SER F 1 11  ? -5.311  75.341  76.361 1.00 68.48  ? 502  SER F O   1 
ATOM   7762 C CB  . SER F 1 11  ? -6.528  77.022  74.061 1.00 69.68  ? 502  SER F CB  1 
ATOM   7763 O OG  . SER F 1 11  ? -5.177  77.372  74.299 1.00 68.58  ? 502  SER F OG  1 
ATOM   7764 N N   . PRO F 1 12  ? -6.914  73.990  75.535 1.00 65.61  ? 503  PRO F N   1 
ATOM   7765 C CA  . PRO F 1 12  ? -6.204  72.777  75.935 1.00 64.16  ? 503  PRO F CA  1 
ATOM   7766 C C   . PRO F 1 12  ? -4.967  72.669  75.056 1.00 63.48  ? 503  PRO F C   1 
ATOM   7767 O O   . PRO F 1 12  ? -4.854  73.371  74.048 1.00 63.26  ? 503  PRO F O   1 
ATOM   7768 C CB  . PRO F 1 12  ? -7.217  71.678  75.649 1.00 64.16  ? 503  PRO F CB  1 
ATOM   7769 C CG  . PRO F 1 12  ? -8.518  72.361  75.877 1.00 64.36  ? 503  PRO F CG  1 
ATOM   7770 C CD  . PRO F 1 12  ? -8.302  73.673  75.166 1.00 65.18  ? 503  PRO F CD  1 
ATOM   7771 N N   . SER F 1 13  ? -4.042  71.794  75.420 1.00 62.47  ? 504  SER F N   1 
ATOM   7772 C CA  . SER F 1 13  ? -2.826  71.666  74.633 1.00 62.13  ? 504  SER F CA  1 
ATOM   7773 C C   . SER F 1 13  ? -2.538  70.228  74.201 1.00 61.42  ? 504  SER F C   1 
ATOM   7774 O O   . SER F 1 13  ? -2.181  69.381  75.020 1.00 62.18  ? 504  SER F O   1 
ATOM   7775 C CB  . SER F 1 13  ? -1.646  72.231  75.430 1.00 61.68  ? 504  SER F CB  1 
ATOM   7776 O OG  . SER F 1 13  ? -0.462  72.250  74.655 1.00 61.52  ? 504  SER F OG  1 
ATOM   7777 N N   . ILE F 1 14  ? -2.694  69.965  72.907 1.00 59.09  ? 505  ILE F N   1 
ATOM   7778 C CA  . ILE F 1 14  ? -2.450  68.639  72.350 1.00 57.36  ? 505  ILE F CA  1 
ATOM   7779 C C   . ILE F 1 14  ? -0.952  68.325  72.366 1.00 56.61  ? 505  ILE F C   1 
ATOM   7780 O O   . ILE F 1 14  ? -0.157  69.067  71.786 1.00 56.61  ? 505  ILE F O   1 
ATOM   7781 C CB  . ILE F 1 14  ? -2.938  68.558  70.894 1.00 56.74  ? 505  ILE F CB  1 
ATOM   7782 C CG1 . ILE F 1 14  ? -4.395  69.015  70.804 1.00 57.92  ? 505  ILE F CG1 1 
ATOM   7783 C CG2 . ILE F 1 14  ? -2.791  67.144  70.380 1.00 57.42  ? 505  ILE F CG2 1 
ATOM   7784 C CD1 . ILE F 1 14  ? -4.920  69.163  69.370 1.00 57.17  ? 505  ILE F CD1 1 
ATOM   7785 N N   . ASP F 1 15  ? -0.564  67.234  73.022 1.00 54.97  ? 506  ASP F N   1 
ATOM   7786 C CA  . ASP F 1 15  ? 0.850   66.868  73.073 1.00 54.24  ? 506  ASP F CA  1 
ATOM   7787 C C   . ASP F 1 15  ? 1.135   65.723  72.131 1.00 52.45  ? 506  ASP F C   1 
ATOM   7788 O O   . ASP F 1 15  ? 2.267   65.544  71.686 1.00 52.64  ? 506  ASP F O   1 
ATOM   7789 C CB  . ASP F 1 15  ? 1.277   66.410  74.469 1.00 56.18  ? 506  ASP F CB  1 
ATOM   7790 C CG  . ASP F 1 15  ? 0.692   67.250  75.569 1.00 58.23  ? 506  ASP F CG  1 
ATOM   7791 O OD1 . ASP F 1 15  ? 0.761   68.497  75.483 1.00 59.30  ? 506  ASP F OD1 1 
ATOM   7792 O OD2 . ASP F 1 15  ? 0.172   66.645  76.530 1.00 59.02  ? 506  ASP F OD2 1 
ATOM   7793 N N   . GLN F 1 16  ? 0.105   64.937  71.844 1.00 49.88  ? 507  GLN F N   1 
ATOM   7794 C CA  . GLN F 1 16  ? 0.259   63.777  70.984 1.00 47.58  ? 507  GLN F CA  1 
ATOM   7795 C C   . GLN F 1 16  ? -0.981  63.490  70.170 1.00 44.99  ? 507  GLN F C   1 
ATOM   7796 O O   . GLN F 1 16  ? -2.098  63.827  70.563 1.00 45.66  ? 507  GLN F O   1 
ATOM   7797 C CB  . GLN F 1 16  ? 0.564   62.532  71.833 1.00 48.70  ? 507  GLN F CB  1 
ATOM   7798 C CG  . GLN F 1 16  ? 1.915   62.533  72.528 1.00 52.53  ? 507  GLN F CG  1 
ATOM   7799 C CD  . GLN F 1 16  ? 2.999   61.865  71.700 1.00 55.49  ? 507  GLN F CD  1 
ATOM   7800 O OE1 . GLN F 1 16  ? 4.192   62.051  71.951 1.00 55.86  ? 507  GLN F OE1 1 
ATOM   7801 N NE2 . GLN F 1 16  ? 2.588   61.070  70.713 1.00 56.54  ? 507  GLN F NE2 1 
ATOM   7802 N N   . VAL F 1 17  ? -0.766  62.864  69.023 1.00 41.49  ? 508  VAL F N   1 
ATOM   7803 C CA  . VAL F 1 17  ? -1.847  62.441  68.152 1.00 37.71  ? 508  VAL F CA  1 
ATOM   7804 C C   . VAL F 1 17  ? -1.320  61.209  67.451 1.00 36.28  ? 508  VAL F C   1 
ATOM   7805 O O   . VAL F 1 17  ? -0.427  61.299  66.606 1.00 36.50  ? 508  VAL F O   1 
ATOM   7806 C CB  . VAL F 1 17  ? -2.234  63.487  67.090 1.00 36.63  ? 508  VAL F CB  1 
ATOM   7807 C CG1 . VAL F 1 17  ? -3.263  62.876  66.144 1.00 34.85  ? 508  VAL F CG1 1 
ATOM   7808 C CG2 . VAL F 1 17  ? -2.819  64.731  67.752 1.00 34.91  ? 508  VAL F CG2 1 
ATOM   7809 N N   . GLU F 1 18  ? -1.840  60.051  67.843 1.00 33.59  ? 509  GLU F N   1 
ATOM   7810 C CA  . GLU F 1 18  ? -1.434  58.796  67.240 1.00 31.91  ? 509  GLU F CA  1 
ATOM   7811 C C   . GLU F 1 18  ? -2.523  58.409  66.252 1.00 29.92  ? 509  GLU F C   1 
ATOM   7812 O O   . GLU F 1 18  ? -3.623  58.055  66.647 1.00 28.82  ? 509  GLU F O   1 
ATOM   7813 C CB  . GLU F 1 18  ? -1.276  57.720  68.313 1.00 31.74  ? 509  GLU F CB  1 
ATOM   7814 C CG  . GLU F 1 18  ? -1.116  56.311  67.754 1.00 32.91  ? 509  GLU F CG  1 
ATOM   7815 C CD  . GLU F 1 18  ? 0.132   56.133  66.907 1.00 33.13  ? 509  GLU F CD  1 
ATOM   7816 O OE1 . GLU F 1 18  ? 0.814   57.134  66.594 1.00 34.76  ? 509  GLU F OE1 1 
ATOM   7817 O OE2 . GLU F 1 18  ? 0.425   54.979  66.543 1.00 32.24  ? 509  GLU F OE2 1 
ATOM   7818 N N   . PRO F 1 19  ? -2.227  58.490  64.946 1.00 29.84  ? 510  PRO F N   1 
ATOM   7819 C CA  . PRO F 1 19  ? -3.216  58.144  63.924 1.00 28.86  ? 510  PRO F CA  1 
ATOM   7820 C C   . PRO F 1 19  ? -3.203  56.688  63.518 1.00 27.66  ? 510  PRO F C   1 
ATOM   7821 O O   . PRO F 1 19  ? -2.160  56.052  63.477 1.00 28.30  ? 510  PRO F O   1 
ATOM   7822 C CB  . PRO F 1 19  ? -2.830  59.047  62.764 1.00 27.61  ? 510  PRO F CB  1 
ATOM   7823 C CG  . PRO F 1 19  ? -1.339  58.989  62.828 1.00 28.85  ? 510  PRO F CG  1 
ATOM   7824 C CD  . PRO F 1 19  ? -1.046  59.125  64.327 1.00 28.90  ? 510  PRO F CD  1 
ATOM   7825 N N   . TYR F 1 20  ? -4.382  56.169  63.220 1.00 27.16  ? 511  TYR F N   1 
ATOM   7826 C CA  . TYR F 1 20  ? -4.526  54.803  62.767 1.00 27.38  ? 511  TYR F CA  1 
ATOM   7827 C C   . TYR F 1 20  ? -5.218  54.911  61.414 1.00 28.44  ? 511  TYR F C   1 
ATOM   7828 O O   . TYR F 1 20  ? -5.206  55.969  60.800 1.00 28.57  ? 511  TYR F O   1 
ATOM   7829 C CB  . TYR F 1 20  ? -5.370  54.005  63.754 1.00 26.39  ? 511  TYR F CB  1 
ATOM   7830 C CG  . TYR F 1 20  ? -4.752  53.903  65.125 1.00 26.46  ? 511  TYR F CG  1 
ATOM   7831 C CD1 . TYR F 1 20  ? -5.392  54.446  66.233 1.00 27.34  ? 511  TYR F CD1 1 
ATOM   7832 C CD2 . TYR F 1 20  ? -3.520  53.262  65.322 1.00 27.15  ? 511  TYR F CD2 1 
ATOM   7833 C CE1 . TYR F 1 20  ? -4.828  54.358  67.509 1.00 28.00  ? 511  TYR F CE1 1 
ATOM   7834 C CE2 . TYR F 1 20  ? -2.942  53.169  66.600 1.00 26.44  ? 511  TYR F CE2 1 
ATOM   7835 C CZ  . TYR F 1 20  ? -3.612  53.722  67.686 1.00 27.89  ? 511  TYR F CZ  1 
ATOM   7836 O OH  . TYR F 1 20  ? -3.099  53.636  68.954 1.00 28.62  ? 511  TYR F OH  1 
ATOM   7837 N N   . SER F 1 21  ? -5.829  53.836  60.949 1.00 30.16  ? 512  SER F N   1 
ATOM   7838 C CA  . SER F 1 21  ? -6.500  53.870  59.660 1.00 32.67  ? 512  SER F CA  1 
ATOM   7839 C C   . SER F 1 21  ? -7.772  54.718  59.635 1.00 33.56  ? 512  SER F C   1 
ATOM   7840 O O   . SER F 1 21  ? -7.960  55.534  58.728 1.00 33.76  ? 512  SER F O   1 
ATOM   7841 C CB  . SER F 1 21  ? -6.834  52.450  59.227 1.00 34.64  ? 512  SER F CB  1 
ATOM   7842 O OG  . SER F 1 21  ? -5.665  51.653  59.258 1.00 41.13  ? 512  SER F OG  1 
ATOM   7843 N N   . SER F 1 22  ? -8.646  54.532  60.623 1.00 32.06  ? 513  SER F N   1 
ATOM   7844 C CA  . SER F 1 22  ? -9.899  55.275  60.649 1.00 30.36  ? 513  SER F CA  1 
ATOM   7845 C C   . SER F 1 22  ? -10.192 56.031  61.937 1.00 30.34  ? 513  SER F C   1 
ATOM   7846 O O   . SER F 1 22  ? -11.229 56.678  62.054 1.00 29.39  ? 513  SER F O   1 
ATOM   7847 C CB  . SER F 1 22  ? -11.047 54.326  60.353 1.00 29.39  ? 513  SER F CB  1 
ATOM   7848 O OG  . SER F 1 22  ? -11.056 53.281  61.300 1.00 29.49  ? 513  SER F OG  1 
ATOM   7849 N N   . THR F 1 23  ? -9.277  55.950  62.898 1.00 30.23  ? 514  THR F N   1 
ATOM   7850 C CA  . THR F 1 23  ? -9.431  56.629  64.181 1.00 28.68  ? 514  THR F CA  1 
ATOM   7851 C C   . THR F 1 23  ? -8.078  57.194  64.588 1.00 29.61  ? 514  THR F C   1 
ATOM   7852 O O   . THR F 1 23  ? -7.046  56.749  64.108 1.00 31.85  ? 514  THR F O   1 
ATOM   7853 C CB  . THR F 1 23  ? -9.873  55.654  65.294 1.00 28.42  ? 514  THR F CB  1 
ATOM   7854 O OG1 . THR F 1 23  ? -8.794  54.764  65.597 1.00 27.34  ? 514  THR F OG1 1 
ATOM   7855 C CG2 . THR F 1 23  ? -11.081 54.829  64.858 1.00 26.00  ? 514  THR F CG2 1 
ATOM   7856 N N   . ALA F 1 24  ? -8.080  58.178  65.472 1.00 29.98  ? 515  ALA F N   1 
ATOM   7857 C CA  . ALA F 1 24  ? -6.840  58.763  65.946 1.00 28.22  ? 515  ALA F CA  1 
ATOM   7858 C C   . ALA F 1 24  ? -7.005  59.031  67.438 1.00 29.13  ? 515  ALA F C   1 
ATOM   7859 O O   . ALA F 1 24  ? -8.090  59.411  67.882 1.00 28.47  ? 515  ALA F O   1 
ATOM   7860 C CB  . ALA F 1 24  ? -6.559  60.046  65.207 1.00 27.42  ? 515  ALA F CB  1 
ATOM   7861 N N   . GLN F 1 25  ? -5.941  58.827  68.212 1.00 29.32  ? 516  GLN F N   1 
ATOM   7862 C CA  . GLN F 1 25  ? -6.003  59.059  69.651 1.00 31.01  ? 516  GLN F CA  1 
ATOM   7863 C C   . GLN F 1 25  ? -5.256  60.330  70.001 1.00 32.81  ? 516  GLN F C   1 
ATOM   7864 O O   . GLN F 1 25  ? -4.039  60.388  69.862 1.00 34.58  ? 516  GLN F O   1 
ATOM   7865 C CB  . GLN F 1 25  ? -5.382  57.891  70.408 1.00 29.85  ? 516  GLN F CB  1 
ATOM   7866 C CG  . GLN F 1 25  ? -5.913  56.543  69.997 1.00 29.78  ? 516  GLN F CG  1 
ATOM   7867 C CD  . GLN F 1 25  ? -5.246  55.420  70.740 1.00 29.16  ? 516  GLN F CD  1 
ATOM   7868 O OE1 . GLN F 1 25  ? -4.028  55.419  70.894 1.00 29.57  ? 516  GLN F OE1 1 
ATOM   7869 N NE2 . GLN F 1 25  ? -6.035  54.447  71.198 1.00 26.74  ? 516  GLN F NE2 1 
ATOM   7870 N N   . VAL F 1 26  ? -5.982  61.341  70.466 1.00 35.45  ? 517  VAL F N   1 
ATOM   7871 C CA  . VAL F 1 26  ? -5.370  62.618  70.824 1.00 38.06  ? 517  VAL F CA  1 
ATOM   7872 C C   . VAL F 1 26  ? -5.060  62.740  72.315 1.00 42.21  ? 517  VAL F C   1 
ATOM   7873 O O   . VAL F 1 26  ? -5.932  62.535  73.164 1.00 40.61  ? 517  VAL F O   1 
ATOM   7874 C CB  . VAL F 1 26  ? -6.271  63.805  70.417 1.00 35.96  ? 517  VAL F CB  1 
ATOM   7875 C CG1 . VAL F 1 26  ? -5.553  65.115  70.684 1.00 33.29  ? 517  VAL F CG1 1 
ATOM   7876 C CG2 . VAL F 1 26  ? -6.655  63.688  68.947 1.00 34.09  ? 517  VAL F CG2 1 
ATOM   7877 N N   . GLN F 1 27  ? -3.807  63.086  72.613 1.00 47.08  ? 518  GLN F N   1 
ATOM   7878 C CA  . GLN F 1 27  ? -3.326  63.257  73.983 1.00 51.32  ? 518  GLN F CA  1 
ATOM   7879 C C   . GLN F 1 27  ? -3.064  64.741  74.212 1.00 53.80  ? 518  GLN F C   1 
ATOM   7880 O O   . GLN F 1 27  ? -2.192  65.333  73.576 1.00 53.61  ? 518  GLN F O   1 
ATOM   7881 C CB  . GLN F 1 27  ? -2.037  62.459  74.175 1.00 52.17  ? 518  GLN F CB  1 
ATOM   7882 C CG  . GLN F 1 27  ? -1.651  62.183  75.620 1.00 54.76  ? 518  GLN F CG  1 
ATOM   7883 C CD  . GLN F 1 27  ? -0.786  60.931  75.745 1.00 56.80  ? 518  GLN F CD  1 
ATOM   7884 O OE1 . GLN F 1 27  ? -0.375  60.549  76.842 1.00 57.03  ? 518  GLN F OE1 1 
ATOM   7885 N NE2 . GLN F 1 27  ? -0.512  60.282  74.611 1.00 58.01  ? 518  GLN F NE2 1 
ATOM   7886 N N   . PHE F 1 28  ? -3.818  65.343  75.124 1.00 57.27  ? 519  PHE F N   1 
ATOM   7887 C CA  . PHE F 1 28  ? -3.671  66.768  75.393 1.00 60.22  ? 519  PHE F CA  1 
ATOM   7888 C C   . PHE F 1 28  ? -3.522  67.115  76.867 1.00 62.31  ? 519  PHE F C   1 
ATOM   7889 O O   . PHE F 1 28  ? -3.451  66.239  77.725 1.00 61.54  ? 519  PHE F O   1 
ATOM   7890 C CB  . PHE F 1 28  ? -4.871  67.518  74.811 1.00 60.09  ? 519  PHE F CB  1 
ATOM   7891 C CG  . PHE F 1 28  ? -6.192  67.054  75.353 1.00 60.52  ? 519  PHE F CG  1 
ATOM   7892 C CD1 . PHE F 1 28  ? -6.882  67.816  76.291 1.00 60.52  ? 519  PHE F CD1 1 
ATOM   7893 C CD2 . PHE F 1 28  ? -6.740  65.843  74.941 1.00 60.47  ? 519  PHE F CD2 1 
ATOM   7894 C CE1 . PHE F 1 28  ? -8.103  67.376  76.811 1.00 61.48  ? 519  PHE F CE1 1 
ATOM   7895 C CE2 . PHE F 1 28  ? -7.958  65.394  75.455 1.00 60.83  ? 519  PHE F CE2 1 
ATOM   7896 C CZ  . PHE F 1 28  ? -8.641  66.162  76.392 1.00 60.49  ? 519  PHE F CZ  1 
ATOM   7897 N N   . ASP F 1 29  ? -3.475  68.417  77.139 1.00 66.27  ? 520  ASP F N   1 
ATOM   7898 C CA  . ASP F 1 29  ? -3.345  68.944  78.492 1.00 69.37  ? 520  ASP F CA  1 
ATOM   7899 C C   . ASP F 1 29  ? -4.562  69.771  78.863 1.00 71.18  ? 520  ASP F C   1 
ATOM   7900 O O   . ASP F 1 29  ? -4.899  70.729  78.165 1.00 71.33  ? 520  ASP F O   1 
ATOM   7901 C CB  . ASP F 1 29  ? -2.104  69.829  78.602 1.00 70.01  ? 520  ASP F CB  1 
ATOM   7902 C CG  . ASP F 1 29  ? -0.829  69.054  78.420 1.00 71.42  ? 520  ASP F CG  1 
ATOM   7903 O OD1 . ASP F 1 29  ? 0.262   69.662  78.483 1.00 72.17  ? 520  ASP F OD1 1 
ATOM   7904 O OD2 . ASP F 1 29  ? -0.927  67.827  78.215 1.00 72.29  ? 520  ASP F OD2 1 
ATOM   7905 N N   . GLU F 1 30  ? -5.213  69.399  79.962 1.00 73.52  ? 521  GLU F N   1 
ATOM   7906 C CA  . GLU F 1 30  ? -6.385  70.122  80.445 1.00 75.91  ? 521  GLU F CA  1 
ATOM   7907 C C   . GLU F 1 30  ? -6.099  71.620  80.420 1.00 77.37  ? 521  GLU F C   1 
ATOM   7908 O O   . GLU F 1 30  ? -4.959  72.047  80.625 1.00 77.14  ? 521  GLU F O   1 
ATOM   7909 C CB  . GLU F 1 30  ? -6.711  69.710  81.879 1.00 76.30  ? 521  GLU F CB  1 
ATOM   7910 C CG  . GLU F 1 30  ? -7.093  68.259  82.059 1.00 77.91  ? 521  GLU F CG  1 
ATOM   7911 C CD  . GLU F 1 30  ? -7.250  67.887  83.522 1.00 79.18  ? 521  GLU F CD  1 
ATOM   7912 O OE1 . GLU F 1 30  ? -6.217  67.740  84.214 1.00 79.05  ? 521  GLU F OE1 1 
ATOM   7913 O OE2 . GLU F 1 30  ? -8.407  67.752  83.979 1.00 79.57  ? 521  GLU F OE2 1 
ATOM   7914 N N   . PRO F 1 31  ? -7.129  72.439  80.165 1.00 79.02  ? 522  PRO F N   1 
ATOM   7915 C CA  . PRO F 1 31  ? -6.932  73.889  80.128 1.00 81.13  ? 522  PRO F CA  1 
ATOM   7916 C C   . PRO F 1 31  ? -6.217  74.382  81.385 1.00 83.33  ? 522  PRO F C   1 
ATOM   7917 O O   . PRO F 1 31  ? -6.718  74.223  82.502 1.00 83.39  ? 522  PRO F O   1 
ATOM   7918 C CB  . PRO F 1 31  ? -8.358  74.420  80.020 1.00 80.91  ? 522  PRO F CB  1 
ATOM   7919 C CG  . PRO F 1 31  ? -9.028  73.366  79.208 1.00 79.11  ? 522  PRO F CG  1 
ATOM   7920 C CD  . PRO F 1 31  ? -8.524  72.093  79.841 1.00 78.53  ? 522  PRO F CD  1 
ATOM   7921 N N   . GLU F 1 32  ? -5.038  74.966  81.192 1.00 85.53  ? 523  GLU F N   1 
ATOM   7922 C CA  . GLU F 1 32  ? -4.240  75.490  82.297 1.00 88.02  ? 523  GLU F CA  1 
ATOM   7923 C C   . GLU F 1 32  ? -5.149  76.140  83.358 1.00 88.82  ? 523  GLU F C   1 
ATOM   7924 O O   . GLU F 1 32  ? -5.089  75.796  84.544 1.00 88.31  ? 523  GLU F O   1 
ATOM   7925 C CB  . GLU F 1 32  ? -3.222  76.501  81.745 1.00 88.61  ? 523  GLU F CB  1 
ATOM   7926 C CG  . GLU F 1 32  ? -2.223  77.022  82.758 1.00 90.36  ? 523  GLU F CG  1 
ATOM   7927 C CD  . GLU F 1 32  ? -2.884  77.841  83.847 1.00 92.32  ? 523  GLU F CD  1 
ATOM   7928 O OE1 . GLU F 1 32  ? -3.533  78.855  83.510 1.00 93.37  ? 523  GLU F OE1 1 
ATOM   7929 O OE2 . GLU F 1 32  ? -2.764  77.469  85.036 1.00 92.66  ? 523  GLU F OE2 1 
ATOM   7930 N N   . ALA F 1 33  ? -5.993  77.070  82.918 1.00 89.69  ? 524  ALA F N   1 
ATOM   7931 C CA  . ALA F 1 33  ? -6.924  77.759  83.806 1.00 90.32  ? 524  ALA F CA  1 
ATOM   7932 C C   . ALA F 1 33  ? -8.348  77.521  83.317 1.00 91.03  ? 524  ALA F C   1 
ATOM   7933 O O   . ALA F 1 33  ? -8.610  77.555  82.115 1.00 91.22  ? 524  ALA F O   1 
ATOM   7934 C CB  . ALA F 1 33  ? -6.622  79.253  83.827 1.00 89.61  ? 524  ALA F CB  1 
ATOM   7935 N N   . THR F 1 34  ? -9.267  77.270  84.245 1.00 91.99  ? 525  THR F N   1 
ATOM   7936 C CA  . THR F 1 34  ? -10.660 77.032  83.880 1.00 92.83  ? 525  THR F CA  1 
ATOM   7937 C C   . THR F 1 34  ? -11.515 78.233  84.274 1.00 93.45  ? 525  THR F C   1 
ATOM   7938 O O   . THR F 1 34  ? -12.586 78.467  83.700 1.00 92.95  ? 525  THR F O   1 
ATOM   7939 C CB  . THR F 1 34  ? -11.225 75.770  84.578 1.00 92.86  ? 525  THR F CB  1 
ATOM   7940 O OG1 . THR F 1 34  ? -11.506 76.059  85.953 1.00 93.33  ? 525  THR F OG1 1 
ATOM   7941 C CG2 . THR F 1 34  ? -10.219 74.629  84.504 1.00 92.95  ? 525  THR F CG2 1 
ATOM   7942 N N   . GLY F 1 35  ? -11.023 78.993  85.253 1.00 93.83  ? 526  GLY F N   1 
ATOM   7943 C CA  . GLY F 1 35  ? -11.738 80.165  85.731 1.00 93.47  ? 526  GLY F CA  1 
ATOM   7944 C C   . GLY F 1 35  ? -12.752 79.817  86.808 1.00 93.05  ? 526  GLY F C   1 
ATOM   7945 O O   . GLY F 1 35  ? -13.715 80.556  87.030 1.00 93.00  ? 526  GLY F O   1 
ATOM   7946 N N   . GLY F 1 36  ? -12.536 78.687  87.477 1.00 91.80  ? 527  GLY F N   1 
ATOM   7947 C CA  . GLY F 1 36  ? -13.446 78.260  88.524 1.00 90.64  ? 527  GLY F CA  1 
ATOM   7948 C C   . GLY F 1 36  ? -14.242 77.030  88.135 1.00 89.91  ? 527  GLY F C   1 
ATOM   7949 O O   . GLY F 1 36  ? -13.721 75.912  88.164 1.00 90.15  ? 527  GLY F O   1 
ATOM   7950 N N   . VAL F 1 37  ? -15.505 77.239  87.767 1.00 88.70  ? 528  VAL F N   1 
ATOM   7951 C CA  . VAL F 1 37  ? -16.391 76.146  87.371 1.00 87.53  ? 528  VAL F CA  1 
ATOM   7952 C C   . VAL F 1 37  ? -15.650 75.044  86.610 1.00 86.69  ? 528  VAL F C   1 
ATOM   7953 O O   . VAL F 1 37  ? -14.911 75.311  85.658 1.00 86.67  ? 528  VAL F O   1 
ATOM   7954 C CB  . VAL F 1 37  ? -17.562 76.655  86.494 1.00 87.60  ? 528  VAL F CB  1 
ATOM   7955 C CG1 . VAL F 1 37  ? -18.432 75.481  86.053 1.00 87.45  ? 528  VAL F CG1 1 
ATOM   7956 C CG2 . VAL F 1 37  ? -18.395 77.667  87.271 1.00 86.38  ? 528  VAL F CG2 1 
ATOM   7957 N N   . PRO F 1 38  ? -15.840 73.785  87.036 1.00 85.33  ? 529  PRO F N   1 
ATOM   7958 C CA  . PRO F 1 38  ? -15.221 72.594  86.444 1.00 83.91  ? 529  PRO F CA  1 
ATOM   7959 C C   . PRO F 1 38  ? -15.542 72.386  84.963 1.00 82.45  ? 529  PRO F C   1 
ATOM   7960 O O   . PRO F 1 38  ? -16.625 72.738  84.492 1.00 83.17  ? 529  PRO F O   1 
ATOM   7961 C CB  . PRO F 1 38  ? -15.765 71.463  87.311 1.00 83.95  ? 529  PRO F CB  1 
ATOM   7962 C CG  . PRO F 1 38  ? -15.954 72.120  88.636 1.00 84.75  ? 529  PRO F CG  1 
ATOM   7963 C CD  . PRO F 1 38  ? -16.593 73.424  88.249 1.00 84.80  ? 529  PRO F CD  1 
ATOM   7964 N N   . ILE F 1 39  ? -14.591 71.802  84.242 1.00 80.11  ? 530  ILE F N   1 
ATOM   7965 C CA  . ILE F 1 39  ? -14.746 71.527  82.819 1.00 77.70  ? 530  ILE F CA  1 
ATOM   7966 C C   . ILE F 1 39  ? -15.699 70.347  82.648 1.00 76.95  ? 530  ILE F C   1 
ATOM   7967 O O   . ILE F 1 39  ? -15.360 69.218  82.996 1.00 76.91  ? 530  ILE F O   1 
ATOM   7968 C CB  . ILE F 1 39  ? -13.384 71.183  82.195 1.00 76.73  ? 530  ILE F CB  1 
ATOM   7969 C CG1 . ILE F 1 39  ? -12.379 72.283  82.538 1.00 75.50  ? 530  ILE F CG1 1 
ATOM   7970 C CG2 . ILE F 1 39  ? -13.516 71.034  80.693 1.00 76.33  ? 530  ILE F CG2 1 
ATOM   7971 C CD1 . ILE F 1 39  ? -10.965 71.959  82.158 1.00 75.63  ? 530  ILE F CD1 1 
ATOM   7972 N N   . LEU F 1 40  ? -16.890 70.612  82.115 1.00 75.78  ? 531  LEU F N   1 
ATOM   7973 C CA  . LEU F 1 40  ? -17.899 69.567  81.928 1.00 74.63  ? 531  LEU F CA  1 
ATOM   7974 C C   . LEU F 1 40  ? -17.613 68.661  80.731 1.00 73.48  ? 531  LEU F C   1 
ATOM   7975 O O   . LEU F 1 40  ? -17.439 67.447  80.878 1.00 73.57  ? 531  LEU F O   1 
ATOM   7976 C CB  . LEU F 1 40  ? -19.291 70.191  81.753 1.00 74.64  ? 531  LEU F CB  1 
ATOM   7977 C CG  . LEU F 1 40  ? -19.720 71.343  82.670 1.00 74.31  ? 531  LEU F CG  1 
ATOM   7978 C CD1 . LEU F 1 40  ? -21.167 71.694  82.373 1.00 72.81  ? 531  LEU F CD1 1 
ATOM   7979 C CD2 . LEU F 1 40  ? -19.553 70.952  84.129 1.00 74.15  ? 531  LEU F CD2 1 
ATOM   7980 N N   . LYS F 1 41  ? -17.577 69.259  79.545 1.00 71.64  ? 532  LYS F N   1 
ATOM   7981 C CA  . LYS F 1 41  ? -17.327 68.516  78.317 1.00 68.47  ? 532  LYS F CA  1 
ATOM   7982 C C   . LYS F 1 41  ? -16.215 69.166  77.497 1.00 65.93  ? 532  LYS F C   1 
ATOM   7983 O O   . LYS F 1 41  ? -15.904 70.347  77.662 1.00 65.49  ? 532  LYS F O   1 
ATOM   7984 C CB  . LYS F 1 41  ? -18.604 68.458  77.466 1.00 69.17  ? 532  LYS F CB  1 
ATOM   7985 C CG  . LYS F 1 41  ? -19.799 67.782  78.124 1.00 69.78  ? 532  LYS F CG  1 
ATOM   7986 C CD  . LYS F 1 41  ? -19.612 66.272  78.231 1.00 70.68  ? 532  LYS F CD  1 
ATOM   7987 C CE  . LYS F 1 41  ? -20.806 65.608  78.914 1.00 69.95  ? 532  LYS F CE  1 
ATOM   7988 N NZ  . LYS F 1 41  ? -20.629 64.138  79.099 1.00 68.36  ? 532  LYS F NZ  1 
ATOM   7989 N N   . TYR F 1 42  ? -15.619 68.373  76.616 1.00 62.88  ? 533  TYR F N   1 
ATOM   7990 C CA  . TYR F 1 42  ? -14.565 68.838  75.728 1.00 59.82  ? 533  TYR F CA  1 
ATOM   7991 C C   . TYR F 1 42  ? -15.104 68.797  74.309 1.00 58.22  ? 533  TYR F C   1 
ATOM   7992 O O   . TYR F 1 42  ? -15.843 67.874  73.942 1.00 56.51  ? 533  TYR F O   1 
ATOM   7993 C CB  . TYR F 1 42  ? -13.348 67.927  75.814 1.00 59.11  ? 533  TYR F CB  1 
ATOM   7994 C CG  . TYR F 1 42  ? -12.349 68.312  76.872 1.00 58.56  ? 533  TYR F CG  1 
ATOM   7995 C CD1 . TYR F 1 42  ? -11.595 69.477  76.753 1.00 57.80  ? 533  TYR F CD1 1 
ATOM   7996 C CD2 . TYR F 1 42  ? -12.122 67.491  77.971 1.00 57.76  ? 533  TYR F CD2 1 
ATOM   7997 C CE1 . TYR F 1 42  ? -10.638 69.812  77.695 1.00 56.40  ? 533  TYR F CE1 1 
ATOM   7998 C CE2 . TYR F 1 42  ? -11.166 67.819  78.923 1.00 57.87  ? 533  TYR F CE2 1 
ATOM   7999 C CZ  . TYR F 1 42  ? -10.430 68.979  78.775 1.00 56.56  ? 533  TYR F CZ  1 
ATOM   8000 O OH  . TYR F 1 42  ? -9.478  69.296  79.707 1.00 58.18  ? 533  TYR F OH  1 
ATOM   8001 N N   . LYS F 1 43  ? -14.741 69.797  73.513 1.00 56.77  ? 534  LYS F N   1 
ATOM   8002 C CA  . LYS F 1 43  ? -15.182 69.857  72.125 1.00 54.97  ? 534  LYS F CA  1 
ATOM   8003 C C   . LYS F 1 43  ? -14.011 69.529  71.205 1.00 53.02  ? 534  LYS F C   1 
ATOM   8004 O O   . LYS F 1 43  ? -12.942 70.134  71.305 1.00 52.16  ? 534  LYS F O   1 
ATOM   8005 C CB  . LYS F 1 43  ? -15.713 71.248  71.793 1.00 55.86  ? 534  LYS F CB  1 
ATOM   8006 C CG  . LYS F 1 43  ? -16.285 71.368  70.386 1.00 57.53  ? 534  LYS F CG  1 
ATOM   8007 C CD  . LYS F 1 43  ? -16.685 72.805  70.068 1.00 58.29  ? 534  LYS F CD  1 
ATOM   8008 C CE  . LYS F 1 43  ? -17.482 72.876  68.782 1.00 58.47  ? 534  LYS F CE  1 
ATOM   8009 N NZ  . LYS F 1 43  ? -18.686 72.003  68.868 1.00 59.10  ? 534  LYS F NZ  1 
ATOM   8010 N N   . ALA F 1 44  ? -14.214 68.565  70.315 1.00 50.93  ? 535  ALA F N   1 
ATOM   8011 C CA  . ALA F 1 44  ? -13.173 68.174  69.372 1.00 49.02  ? 535  ALA F CA  1 
ATOM   8012 C C   . ALA F 1 44  ? -13.566 68.484  67.916 1.00 48.25  ? 535  ALA F C   1 
ATOM   8013 O O   . ALA F 1 44  ? -14.626 68.066  67.433 1.00 47.43  ? 535  ALA F O   1 
ATOM   8014 C CB  . ALA F 1 44  ? -12.863 66.688  69.529 1.00 46.72  ? 535  ALA F CB  1 
ATOM   8015 N N   . GLU F 1 45  ? -12.708 69.230  67.225 1.00 46.33  ? 536  GLU F N   1 
ATOM   8016 C CA  . GLU F 1 45  ? -12.945 69.571  65.829 1.00 44.79  ? 536  GLU F CA  1 
ATOM   8017 C C   . GLU F 1 45  ? -11.850 69.035  64.918 1.00 42.81  ? 536  GLU F C   1 
ATOM   8018 O O   . GLU F 1 45  ? -10.658 69.212  65.168 1.00 43.03  ? 536  GLU F O   1 
ATOM   8019 C CB  . GLU F 1 45  ? -13.047 71.077  65.667 1.00 46.37  ? 536  GLU F CB  1 
ATOM   8020 C CG  . GLU F 1 45  ? -14.325 71.640  66.213 1.00 48.39  ? 536  GLU F CG  1 
ATOM   8021 C CD  . GLU F 1 45  ? -14.337 73.142  66.187 1.00 49.87  ? 536  GLU F CD  1 
ATOM   8022 O OE1 . GLU F 1 45  ? -15.335 73.721  66.656 1.00 52.99  ? 536  GLU F OE1 1 
ATOM   8023 O OE2 . GLU F 1 45  ? -13.351 73.744  65.703 1.00 50.51  ? 536  GLU F OE2 1 
ATOM   8024 N N   . TRP F 1 46  ? -12.257 68.377  63.848 1.00 40.97  ? 537  TRP F N   1 
ATOM   8025 C CA  . TRP F 1 46  ? -11.285 67.828  62.923 1.00 39.76  ? 537  TRP F CA  1 
ATOM   8026 C C   . TRP F 1 46  ? -11.851 67.827  61.517 1.00 38.80  ? 537  TRP F C   1 
ATOM   8027 O O   . TRP F 1 46  ? -13.070 67.778  61.322 1.00 38.36  ? 537  TRP F O   1 
ATOM   8028 C CB  . TRP F 1 46  ? -10.937 66.397  63.330 1.00 37.23  ? 537  TRP F CB  1 
ATOM   8029 C CG  . TRP F 1 46  ? -12.014 65.431  62.981 1.00 33.92  ? 537  TRP F CG  1 
ATOM   8030 C CD1 . TRP F 1 46  ? -12.124 64.703  61.833 1.00 32.30  ? 537  TRP F CD1 1 
ATOM   8031 C CD2 . TRP F 1 46  ? -13.153 65.103  63.776 1.00 33.29  ? 537  TRP F CD2 1 
ATOM   8032 N NE1 . TRP F 1 46  ? -13.260 63.936  61.862 1.00 31.80  ? 537  TRP F NE1 1 
ATOM   8033 C CE2 . TRP F 1 46  ? -13.913 64.160  63.046 1.00 32.91  ? 537  TRP F CE2 1 
ATOM   8034 C CE3 . TRP F 1 46  ? -13.609 65.513  65.036 1.00 32.51  ? 537  TRP F CE3 1 
ATOM   8035 C CZ2 . TRP F 1 46  ? -15.103 63.617  63.537 1.00 30.85  ? 537  TRP F CZ2 1 
ATOM   8036 C CZ3 . TRP F 1 46  ? -14.792 64.975  65.522 1.00 31.73  ? 537  TRP F CZ3 1 
ATOM   8037 C CH2 . TRP F 1 46  ? -15.524 64.036  64.773 1.00 31.86  ? 537  TRP F CH2 1 
ATOM   8038 N N   . ARG F 1 47  ? -10.961 67.879  60.538 1.00 37.48  ? 538  ARG F N   1 
ATOM   8039 C CA  . ARG F 1 47  ? -11.387 67.853  59.155 1.00 38.59  ? 538  ARG F CA  1 
ATOM   8040 C C   . ARG F 1 47  ? -10.242 67.530  58.227 1.00 37.63  ? 538  ARG F C   1 
ATOM   8041 O O   . ARG F 1 47  ? -9.101  67.939  58.458 1.00 38.09  ? 538  ARG F O   1 
ATOM   8042 C CB  . ARG F 1 47  ? -12.022 69.188  58.742 1.00 40.81  ? 538  ARG F CB  1 
ATOM   8043 C CG  . ARG F 1 47  ? -11.086 70.401  58.667 1.00 42.54  ? 538  ARG F CG  1 
ATOM   8044 C CD  . ARG F 1 47  ? -11.817 71.550  57.972 1.00 43.61  ? 538  ARG F CD  1 
ATOM   8045 N NE  . ARG F 1 47  ? -11.418 72.881  58.421 1.00 45.44  ? 538  ARG F NE  1 
ATOM   8046 C CZ  . ARG F 1 47  ? -10.254 73.463  58.152 1.00 46.62  ? 538  ARG F CZ  1 
ATOM   8047 N NH1 . ARG F 1 47  ? -9.336  72.838  57.426 1.00 48.96  ? 538  ARG F NH1 1 
ATOM   8048 N NH2 . ARG F 1 47  ? -10.012 74.684  58.607 1.00 46.12  ? 538  ARG F NH2 1 
ATOM   8049 N N   . ALA F 1 48  ? -10.545 66.764  57.186 1.00 36.61  ? 539  ALA F N   1 
ATOM   8050 C CA  . ALA F 1 48  ? -9.529  66.425  56.212 1.00 35.66  ? 539  ALA F CA  1 
ATOM   8051 C C   . ALA F 1 48  ? -8.998  67.779  55.771 1.00 35.76  ? 539  ALA F C   1 
ATOM   8052 O O   . ALA F 1 48  ? -9.775  68.677  55.441 1.00 34.70  ? 539  ALA F O   1 
ATOM   8053 C CB  . ALA F 1 48  ? -10.142 65.687  55.045 1.00 33.23  ? 539  ALA F CB  1 
ATOM   8054 N N   . VAL F 1 49  ? -7.681  67.941  55.827 1.00 36.77  ? 540  VAL F N   1 
ATOM   8055 C CA  . VAL F 1 49  ? -7.050  69.191  55.427 1.00 36.30  ? 540  VAL F CA  1 
ATOM   8056 C C   . VAL F 1 49  ? -7.597  69.567  54.052 1.00 36.43  ? 540  VAL F C   1 
ATOM   8057 O O   . VAL F 1 49  ? -7.731  68.714  53.181 1.00 36.37  ? 540  VAL F O   1 
ATOM   8058 C CB  . VAL F 1 49  ? -5.513  69.025  55.403 1.00 34.86  ? 540  VAL F CB  1 
ATOM   8059 C CG1 . VAL F 1 49  ? -4.876  70.116  54.595 1.00 34.94  ? 540  VAL F CG1 1 
ATOM   8060 C CG2 . VAL F 1 49  ? -4.978  69.072  56.827 1.00 33.43  ? 540  VAL F CG2 1 
ATOM   8061 N N   . GLY F 1 50  ? -7.947  70.833  53.864 1.00 36.31  ? 541  GLY F N   1 
ATOM   8062 C CA  . GLY F 1 50  ? -8.495  71.237  52.581 1.00 37.73  ? 541  GLY F CA  1 
ATOM   8063 C C   . GLY F 1 50  ? -9.962  71.608  52.690 1.00 39.11  ? 541  GLY F C   1 
ATOM   8064 O O   . GLY F 1 50  ? -10.375 72.687  52.258 1.00 41.86  ? 541  GLY F O   1 
ATOM   8065 N N   . GLU F 1 51  ? -10.751 70.712  53.270 1.00 38.65  ? 542  GLU F N   1 
ATOM   8066 C CA  . GLU F 1 51  ? -12.174 70.946  53.465 1.00 38.19  ? 542  GLU F CA  1 
ATOM   8067 C C   . GLU F 1 51  ? -12.377 72.276  54.185 1.00 38.15  ? 542  GLU F C   1 
ATOM   8068 O O   . GLU F 1 51  ? -11.443 72.808  54.779 1.00 36.24  ? 542  GLU F O   1 
ATOM   8069 C CB  . GLU F 1 51  ? -12.772 69.808  54.285 1.00 36.95  ? 542  GLU F CB  1 
ATOM   8070 C CG  . GLU F 1 51  ? -12.627 68.452  53.620 1.00 36.80  ? 542  GLU F CG  1 
ATOM   8071 C CD  . GLU F 1 51  ? -13.600 68.241  52.472 1.00 37.94  ? 542  GLU F CD  1 
ATOM   8072 O OE1 . GLU F 1 51  ? -13.319 67.376  51.616 1.00 37.88  ? 542  GLU F OE1 1 
ATOM   8073 O OE2 . GLU F 1 51  ? -14.650 68.923  52.436 1.00 37.77  ? 542  GLU F OE2 1 
ATOM   8074 N N   . GLU F 1 52  ? -13.597 72.809  54.119 1.00 39.12  ? 543  GLU F N   1 
ATOM   8075 C CA  . GLU F 1 52  ? -13.921 74.086  54.757 1.00 39.18  ? 543  GLU F CA  1 
ATOM   8076 C C   . GLU F 1 52  ? -14.616 73.869  56.099 1.00 38.69  ? 543  GLU F C   1 
ATOM   8077 O O   . GLU F 1 52  ? -14.298 74.515  57.091 1.00 38.28  ? 543  GLU F O   1 
ATOM   8078 C CB  . GLU F 1 52  ? -14.847 74.925  53.858 1.00 41.24  ? 543  GLU F CB  1 
ATOM   8079 C CG  . GLU F 1 52  ? -14.318 75.289  52.468 1.00 44.34  ? 543  GLU F CG  1 
ATOM   8080 C CD  . GLU F 1 52  ? -14.190 74.083  51.536 1.00 48.90  ? 543  GLU F CD  1 
ATOM   8081 O OE1 . GLU F 1 52  ? -14.855 73.049  51.791 1.00 52.17  ? 543  GLU F OE1 1 
ATOM   8082 O OE2 . GLU F 1 52  ? -13.437 74.175  50.538 1.00 48.18  ? 543  GLU F OE2 1 
ATOM   8083 N N   . VAL F 1 53  ? -15.561 72.939  56.112 1.00 38.69  ? 544  VAL F N   1 
ATOM   8084 C CA  . VAL F 1 53  ? -16.345 72.625  57.298 1.00 39.17  ? 544  VAL F CA  1 
ATOM   8085 C C   . VAL F 1 53  ? -15.648 71.702  58.299 1.00 40.16  ? 544  VAL F C   1 
ATOM   8086 O O   . VAL F 1 53  ? -15.120 70.652  57.922 1.00 41.48  ? 544  VAL F O   1 
ATOM   8087 C CB  . VAL F 1 53  ? -17.685 71.969  56.877 1.00 38.78  ? 544  VAL F CB  1 
ATOM   8088 C CG1 . VAL F 1 53  ? -18.546 71.671  58.094 1.00 36.40  ? 544  VAL F CG1 1 
ATOM   8089 C CG2 . VAL F 1 53  ? -18.408 72.873  55.906 1.00 38.68  ? 544  VAL F CG2 1 
ATOM   8090 N N   . TRP F 1 54  ? -15.650 72.093  59.574 1.00 40.38  ? 545  TRP F N   1 
ATOM   8091 C CA  . TRP F 1 54  ? -15.052 71.260  60.622 1.00 40.37  ? 545  TRP F CA  1 
ATOM   8092 C C   . TRP F 1 54  ? -16.098 70.282  61.142 1.00 40.16  ? 545  TRP F C   1 
ATOM   8093 O O   . TRP F 1 54  ? -17.263 70.628  61.271 1.00 39.46  ? 545  TRP F O   1 
ATOM   8094 C CB  . TRP F 1 54  ? -14.574 72.092  61.823 1.00 39.66  ? 545  TRP F CB  1 
ATOM   8095 C CG  . TRP F 1 54  ? -13.395 72.981  61.578 1.00 40.85  ? 545  TRP F CG  1 
ATOM   8096 C CD1 . TRP F 1 54  ? -13.410 74.218  61.008 1.00 40.23  ? 545  TRP F CD1 1 
ATOM   8097 C CD2 . TRP F 1 54  ? -12.017 72.697  61.886 1.00 40.35  ? 545  TRP F CD2 1 
ATOM   8098 N NE1 . TRP F 1 54  ? -12.133 74.726  60.939 1.00 41.57  ? 545  TRP F NE1 1 
ATOM   8099 C CE2 . TRP F 1 54  ? -11.258 73.816  61.470 1.00 40.42  ? 545  TRP F CE2 1 
ATOM   8100 C CE3 . TRP F 1 54  ? -11.355 71.609  62.467 1.00 37.67  ? 545  TRP F CE3 1 
ATOM   8101 C CZ2 . TRP F 1 54  ? -9.863  73.879  61.618 1.00 38.34  ? 545  TRP F CZ2 1 
ATOM   8102 C CZ3 . TRP F 1 54  ? -9.966  71.671  62.612 1.00 39.29  ? 545  TRP F CZ3 1 
ATOM   8103 C CH2 . TRP F 1 54  ? -9.238  72.800  62.188 1.00 38.49  ? 545  TRP F CH2 1 
ATOM   8104 N N   . HIS F 1 55  ? -15.686 69.056  61.427 1.00 41.60  ? 546  HIS F N   1 
ATOM   8105 C CA  . HIS F 1 55  ? -16.599 68.077  61.987 1.00 42.48  ? 546  HIS F CA  1 
ATOM   8106 C C   . HIS F 1 55  ? -16.610 68.363  63.484 1.00 43.76  ? 546  HIS F C   1 
ATOM   8107 O O   . HIS F 1 55  ? -15.658 68.940  64.009 1.00 42.26  ? 546  HIS F O   1 
ATOM   8108 C CB  . HIS F 1 55  ? -16.085 66.670  61.741 1.00 42.83  ? 546  HIS F CB  1 
ATOM   8109 C CG  . HIS F 1 55  ? -16.377 66.153  60.371 1.00 43.94  ? 546  HIS F CG  1 
ATOM   8110 N ND1 . HIS F 1 55  ? -17.632 65.736  59.988 1.00 44.33  ? 546  HIS F ND1 1 
ATOM   8111 C CD2 . HIS F 1 55  ? -15.578 65.978  59.293 1.00 44.36  ? 546  HIS F CD2 1 
ATOM   8112 C CE1 . HIS F 1 55  ? -17.594 65.324  58.734 1.00 42.69  ? 546  HIS F CE1 1 
ATOM   8113 N NE2 . HIS F 1 55  ? -16.360 65.461  58.288 1.00 42.65  ? 546  HIS F NE2 1 
ATOM   8114 N N   . SER F 1 56  ? -17.681 67.973  64.167 1.00 46.45  ? 547  SER F N   1 
ATOM   8115 C CA  . SER F 1 56  ? -17.779 68.206  65.608 1.00 49.07  ? 547  SER F CA  1 
ATOM   8116 C C   . SER F 1 56  ? -18.175 66.955  66.401 1.00 49.29  ? 547  SER F C   1 
ATOM   8117 O O   . SER F 1 56  ? -18.882 66.073  65.904 1.00 48.14  ? 547  SER F O   1 
ATOM   8118 C CB  . SER F 1 56  ? -18.775 69.338  65.896 1.00 50.14  ? 547  SER F CB  1 
ATOM   8119 O OG  . SER F 1 56  ? -20.091 68.981  65.493 1.00 53.94  ? 547  SER F OG  1 
ATOM   8120 N N   . LYS F 1 57  ? -17.692 66.892  67.638 1.00 51.04  ? 548  LYS F N   1 
ATOM   8121 C CA  . LYS F 1 57  ? -17.974 65.786  68.547 1.00 52.75  ? 548  LYS F CA  1 
ATOM   8122 C C   . LYS F 1 57  ? -17.602 66.195  69.972 1.00 53.87  ? 548  LYS F C   1 
ATOM   8123 O O   . LYS F 1 57  ? -16.518 66.745  70.212 1.00 52.28  ? 548  LYS F O   1 
ATOM   8124 C CB  . LYS F 1 57  ? -17.179 64.543  68.147 1.00 53.88  ? 548  LYS F CB  1 
ATOM   8125 C CG  . LYS F 1 57  ? -17.427 63.323  69.031 1.00 54.44  ? 548  LYS F CG  1 
ATOM   8126 C CD  . LYS F 1 57  ? -18.879 62.873  68.956 1.00 57.12  ? 548  LYS F CD  1 
ATOM   8127 C CE  . LYS F 1 57  ? -19.076 61.491  69.569 1.00 58.00  ? 548  LYS F CE  1 
ATOM   8128 N NZ  . LYS F 1 57  ? -18.690 61.442  71.011 1.00 61.03  ? 548  LYS F NZ  1 
ATOM   8129 N N   . TRP F 1 58  ? -18.511 65.932  70.911 1.00 55.47  ? 549  TRP F N   1 
ATOM   8130 C CA  . TRP F 1 58  ? -18.283 66.267  72.315 1.00 55.51  ? 549  TRP F CA  1 
ATOM   8131 C C   . TRP F 1 58  ? -17.717 65.078  73.083 1.00 56.05  ? 549  TRP F C   1 
ATOM   8132 O O   . TRP F 1 58  ? -18.039 63.925  72.788 1.00 54.67  ? 549  TRP F O   1 
ATOM   8133 C CB  . TRP F 1 58  ? -19.586 66.712  72.990 1.00 55.44  ? 549  TRP F CB  1 
ATOM   8134 C CG  . TRP F 1 58  ? -20.100 68.076  72.596 1.00 54.09  ? 549  TRP F CG  1 
ATOM   8135 C CD1 . TRP F 1 58  ? -21.170 68.344  71.793 1.00 54.49  ? 549  TRP F CD1 1 
ATOM   8136 C CD2 . TRP F 1 58  ? -19.579 69.348  73.007 1.00 52.57  ? 549  TRP F CD2 1 
ATOM   8137 N NE1 . TRP F 1 58  ? -21.350 69.702  71.680 1.00 53.68  ? 549  TRP F NE1 1 
ATOM   8138 C CE2 . TRP F 1 58  ? -20.386 70.341  72.413 1.00 53.20  ? 549  TRP F CE2 1 
ATOM   8139 C CE3 . TRP F 1 58  ? -18.510 69.743  73.817 1.00 53.83  ? 549  TRP F CE3 1 
ATOM   8140 C CZ2 . TRP F 1 58  ? -20.156 71.709  72.603 1.00 53.48  ? 549  TRP F CZ2 1 
ATOM   8141 C CZ3 . TRP F 1 58  ? -18.279 71.107  74.006 1.00 54.52  ? 549  TRP F CZ3 1 
ATOM   8142 C CH2 . TRP F 1 58  ? -19.102 72.071  73.399 1.00 54.32  ? 549  TRP F CH2 1 
ATOM   8143 N N   . TYR F 1 59  ? -16.873 65.374  74.070 1.00 57.16  ? 550  TYR F N   1 
ATOM   8144 C CA  . TYR F 1 59  ? -16.260 64.356  74.919 1.00 57.86  ? 550  TYR F CA  1 
ATOM   8145 C C   . TYR F 1 59  ? -16.352 64.811  76.375 1.00 59.05  ? 550  TYR F C   1 
ATOM   8146 O O   . TYR F 1 59  ? -16.016 65.952  76.695 1.00 59.08  ? 550  TYR F O   1 
ATOM   8147 C CB  . TYR F 1 59  ? -14.786 64.154  74.538 1.00 58.04  ? 550  TYR F CB  1 
ATOM   8148 C CG  . TYR F 1 59  ? -14.575 63.549  73.166 1.00 57.57  ? 550  TYR F CG  1 
ATOM   8149 C CD1 . TYR F 1 59  ? -14.829 62.199  72.933 1.00 56.39  ? 550  TYR F CD1 1 
ATOM   8150 C CD2 . TYR F 1 59  ? -14.165 64.338  72.089 1.00 56.62  ? 550  TYR F CD2 1 
ATOM   8151 C CE1 . TYR F 1 59  ? -14.683 61.648  71.662 1.00 56.64  ? 550  TYR F CE1 1 
ATOM   8152 C CE2 . TYR F 1 59  ? -14.019 63.799  70.817 1.00 56.32  ? 550  TYR F CE2 1 
ATOM   8153 C CZ  . TYR F 1 59  ? -14.280 62.454  70.608 1.00 56.12  ? 550  TYR F CZ  1 
ATOM   8154 O OH  . TYR F 1 59  ? -14.146 61.918  69.349 1.00 54.73  ? 550  TYR F OH  1 
ATOM   8155 N N   . ASP F 1 60  ? -16.809 63.923  77.254 1.00 60.04  ? 551  ASP F N   1 
ATOM   8156 C CA  . ASP F 1 60  ? -16.927 64.252  78.674 1.00 60.70  ? 551  ASP F CA  1 
ATOM   8157 C C   . ASP F 1 60  ? -15.561 64.347  79.334 1.00 60.71  ? 551  ASP F C   1 
ATOM   8158 O O   . ASP F 1 60  ? -14.854 63.349  79.434 1.00 61.19  ? 551  ASP F O   1 
ATOM   8159 C CB  . ASP F 1 60  ? -17.761 63.195  79.393 1.00 61.92  ? 551  ASP F CB  1 
ATOM   8160 C CG  . ASP F 1 60  ? -17.713 63.341  80.900 1.00 63.22  ? 551  ASP F CG  1 
ATOM   8161 O OD1 . ASP F 1 60  ? -18.075 64.421  81.417 1.00 63.59  ? 551  ASP F OD1 1 
ATOM   8162 O OD2 . ASP F 1 60  ? -17.308 62.366  81.566 1.00 64.32  ? 551  ASP F OD2 1 
ATOM   8163 N N   . ALA F 1 61  ? -15.204 65.544  79.794 1.00 61.56  ? 552  ALA F N   1 
ATOM   8164 C CA  . ALA F 1 61  ? -13.910 65.789  80.440 1.00 62.45  ? 552  ALA F CA  1 
ATOM   8165 C C   . ALA F 1 61  ? -13.561 64.745  81.488 1.00 63.04  ? 552  ALA F C   1 
ATOM   8166 O O   . ALA F 1 61  ? -12.399 64.360  81.632 1.00 62.96  ? 552  ALA F O   1 
ATOM   8167 C CB  . ALA F 1 61  ? -13.893 67.177  81.077 1.00 61.53  ? 552  ALA F CB  1 
ATOM   8168 N N   . LYS F 1 62  ? -14.568 64.297  82.227 1.00 64.26  ? 553  LYS F N   1 
ATOM   8169 C CA  . LYS F 1 62  ? -14.358 63.295  83.261 1.00 64.95  ? 553  LYS F CA  1 
ATOM   8170 C C   . LYS F 1 62  ? -13.680 62.074  82.645 1.00 64.50  ? 553  LYS F C   1 
ATOM   8171 O O   . LYS F 1 62  ? -12.490 61.829  82.875 1.00 63.46  ? 553  LYS F O   1 
ATOM   8172 C CB  . LYS F 1 62  ? -15.699 62.893  83.881 1.00 66.17  ? 553  LYS F CB  1 
ATOM   8173 C CG  . LYS F 1 62  ? -15.595 61.827  84.958 1.00 69.05  ? 553  LYS F CG  1 
ATOM   8174 C CD  . LYS F 1 62  ? -14.928 62.359  86.219 1.00 70.68  ? 553  LYS F CD  1 
ATOM   8175 C CE  . LYS F 1 62  ? -15.860 63.284  86.987 1.00 71.60  ? 553  LYS F CE  1 
ATOM   8176 N NZ  . LYS F 1 62  ? -17.047 62.570  87.542 1.00 71.87  ? 553  LYS F NZ  1 
ATOM   8177 N N   . GLU F 1 63  ? -14.448 61.325  81.856 1.00 64.08  ? 554  GLU F N   1 
ATOM   8178 C CA  . GLU F 1 63  ? -13.961 60.122  81.187 1.00 63.80  ? 554  GLU F CA  1 
ATOM   8179 C C   . GLU F 1 63  ? -12.745 60.406  80.307 1.00 62.67  ? 554  GLU F C   1 
ATOM   8180 O O   . GLU F 1 63  ? -11.917 59.524  80.073 1.00 62.50  ? 554  GLU F O   1 
ATOM   8181 C CB  . GLU F 1 63  ? -15.084 59.508  80.343 1.00 64.84  ? 554  GLU F CB  1 
ATOM   8182 C CG  . GLU F 1 63  ? -14.657 58.333  79.476 1.00 66.64  ? 554  GLU F CG  1 
ATOM   8183 C CD  . GLU F 1 63  ? -15.800 57.776  78.636 1.00 68.36  ? 554  GLU F CD  1 
ATOM   8184 O OE1 . GLU F 1 63  ? -15.513 57.051  77.658 1.00 67.55  ? 554  GLU F OE1 1 
ATOM   8185 O OE2 . GLU F 1 63  ? -16.979 58.057  78.957 1.00 68.29  ? 554  GLU F OE2 1 
ATOM   8186 N N   . ALA F 1 64  ? -12.632 61.638  79.828 1.00 61.06  ? 555  ALA F N   1 
ATOM   8187 C CA  . ALA F 1 64  ? -11.513 62.009  78.976 1.00 60.91  ? 555  ALA F CA  1 
ATOM   8188 C C   . ALA F 1 64  ? -10.216 62.037  79.770 1.00 60.69  ? 555  ALA F C   1 
ATOM   8189 O O   . ALA F 1 64  ? -9.148  61.721  79.242 1.00 59.93  ? 555  ALA F O   1 
ATOM   8190 C CB  . ALA F 1 64  ? -11.769 63.369  78.332 1.00 60.94  ? 555  ALA F CB  1 
ATOM   8191 N N   . SER F 1 65  ? -10.309 62.414  81.042 1.00 61.24  ? 556  SER F N   1 
ATOM   8192 C CA  . SER F 1 65  ? -9.129  62.475  81.895 1.00 60.74  ? 556  SER F CA  1 
ATOM   8193 C C   . SER F 1 65  ? -8.760  61.079  82.396 1.00 59.60  ? 556  SER F C   1 
ATOM   8194 O O   . SER F 1 65  ? -7.581  60.763  82.564 1.00 58.38  ? 556  SER F O   1 
ATOM   8195 C CB  . SER F 1 65  ? -9.372  63.417  83.072 1.00 61.89  ? 556  SER F CB  1 
ATOM   8196 O OG  . SER F 1 65  ? -8.156  63.687  83.751 1.00 63.52  ? 556  SER F OG  1 
ATOM   8197 N N   . MET F 1 66  ? -9.769  60.248  82.640 1.00 58.82  ? 557  MET F N   1 
ATOM   8198 C CA  . MET F 1 66  ? -9.513  58.885  83.079 1.00 59.79  ? 557  MET F CA  1 
ATOM   8199 C C   . MET F 1 66  ? -8.737  58.228  81.948 1.00 59.11  ? 557  MET F C   1 
ATOM   8200 O O   . MET F 1 66  ? -7.667  57.667  82.158 1.00 59.78  ? 557  MET F O   1 
ATOM   8201 C CB  . MET F 1 66  ? -10.822 58.128  83.303 1.00 62.37  ? 557  MET F CB  1 
ATOM   8202 C CG  . MET F 1 66  ? -11.664 58.650  84.451 1.00 66.71  ? 557  MET F CG  1 
ATOM   8203 S SD  . MET F 1 66  ? -13.227 57.751  84.646 1.00 70.03  ? 557  MET F SD  1 
ATOM   8204 C CE  . MET F 1 66  ? -12.712 56.409  85.741 1.00 69.67  ? 557  MET F CE  1 
ATOM   8205 N N   . GLU F 1 67  ? -9.296  58.317  80.744 1.00 58.03  ? 558  GLU F N   1 
ATOM   8206 C CA  . GLU F 1 67  ? -8.686  57.759  79.540 1.00 56.05  ? 558  GLU F CA  1 
ATOM   8207 C C   . GLU F 1 67  ? -7.288  58.325  79.295 1.00 53.63  ? 558  GLU F C   1 
ATOM   8208 O O   . GLU F 1 67  ? -6.333  57.584  79.055 1.00 51.65  ? 558  GLU F O   1 
ATOM   8209 C CB  . GLU F 1 67  ? -9.561  58.075  78.321 1.00 57.81  ? 558  GLU F CB  1 
ATOM   8210 C CG  . GLU F 1 67  ? -10.739 57.148  78.100 1.00 61.71  ? 558  GLU F CG  1 
ATOM   8211 C CD  . GLU F 1 67  ? -10.339 55.868  77.391 1.00 64.84  ? 558  GLU F CD  1 
ATOM   8212 O OE1 . GLU F 1 67  ? -9.722  55.967  76.308 1.00 66.41  ? 558  GLU F OE1 1 
ATOM   8213 O OE2 . GLU F 1 67  ? -10.640 54.766  77.910 1.00 65.84  ? 558  GLU F OE2 1 
ATOM   8214 N N   . GLY F 1 68  ? -7.183  59.649  79.348 1.00 51.50  ? 559  GLY F N   1 
ATOM   8215 C CA  . GLY F 1 68  ? -5.914  60.309  79.098 1.00 50.30  ? 559  GLY F CA  1 
ATOM   8216 C C   . GLY F 1 68  ? -5.896  60.839  77.675 1.00 48.80  ? 559  GLY F C   1 
ATOM   8217 O O   . GLY F 1 68  ? -5.168  61.782  77.348 1.00 49.49  ? 559  GLY F O   1 
ATOM   8218 N N   . ILE F 1 69  ? -6.719  60.226  76.829 1.00 46.60  ? 560  ILE F N   1 
ATOM   8219 C CA  . ILE F 1 69  ? -6.832  60.607  75.426 1.00 43.82  ? 560  ILE F CA  1 
ATOM   8220 C C   . ILE F 1 69  ? -8.296  60.720  75.012 1.00 41.74  ? 560  ILE F C   1 
ATOM   8221 O O   . ILE F 1 69  ? -9.193  60.395  75.790 1.00 41.42  ? 560  ILE F O   1 
ATOM   8222 C CB  . ILE F 1 69  ? -6.137  59.558  74.500 1.00 42.98  ? 560  ILE F CB  1 
ATOM   8223 C CG1 . ILE F 1 69  ? -6.498  58.132  74.930 1.00 43.15  ? 560  ILE F CG1 1 
ATOM   8224 C CG2 . ILE F 1 69  ? -4.634  59.716  74.564 1.00 41.52  ? 560  ILE F CG2 1 
ATOM   8225 C CD1 . ILE F 1 69  ? -7.970  57.771  74.828 1.00 43.87  ? 560  ILE F CD1 1 
ATOM   8226 N N   . VAL F 1 70  ? -8.522  61.222  73.801 1.00 39.21  ? 561  VAL F N   1 
ATOM   8227 C CA  . VAL F 1 70  ? -9.859  61.313  73.230 1.00 38.02  ? 561  VAL F CA  1 
ATOM   8228 C C   . VAL F 1 70  ? -9.674  60.678  71.875 1.00 36.98  ? 561  VAL F C   1 
ATOM   8229 O O   . VAL F 1 70  ? -8.595  60.762  71.299 1.00 36.90  ? 561  VAL F O   1 
ATOM   8230 C CB  . VAL F 1 70  ? -10.367 62.754  73.038 1.00 38.09  ? 561  VAL F CB  1 
ATOM   8231 C CG1 . VAL F 1 70  ? -10.486 63.436  74.378 1.00 40.13  ? 561  VAL F CG1 1 
ATOM   8232 C CG2 . VAL F 1 70  ? -9.457  63.520  72.105 1.00 38.02  ? 561  VAL F CG2 1 
ATOM   8233 N N   . THR F 1 71  ? -10.710 60.028  71.364 1.00 36.28  ? 562  THR F N   1 
ATOM   8234 C CA  . THR F 1 71  ? -10.584 59.373  70.081 1.00 36.06  ? 562  THR F CA  1 
ATOM   8235 C C   . THR F 1 71  ? -11.589 59.844  69.057 1.00 37.65  ? 562  THR F C   1 
ATOM   8236 O O   . THR F 1 71  ? -12.789 59.693  69.248 1.00 40.08  ? 562  THR F O   1 
ATOM   8237 C CB  . THR F 1 71  ? -10.712 57.858  70.239 1.00 35.65  ? 562  THR F CB  1 
ATOM   8238 O OG1 . THR F 1 71  ? -9.618  57.379  71.032 1.00 34.70  ? 562  THR F OG1 1 
ATOM   8239 C CG2 . THR F 1 71  ? -10.719 57.166  68.875 1.00 32.47  ? 562  THR F CG2 1 
ATOM   8240 N N   . ILE F 1 72  ? -11.087 60.429  67.974 1.00 37.86  ? 563  ILE F N   1 
ATOM   8241 C CA  . ILE F 1 72  ? -11.938 60.890  66.892 1.00 37.86  ? 563  ILE F CA  1 
ATOM   8242 C C   . ILE F 1 72  ? -12.097 59.658  66.012 1.00 37.67  ? 563  ILE F C   1 
ATOM   8243 O O   . ILE F 1 72  ? -11.145 58.903  65.830 1.00 36.73  ? 563  ILE F O   1 
ATOM   8244 C CB  . ILE F 1 72  ? -11.272 62.055  66.124 1.00 38.20  ? 563  ILE F CB  1 
ATOM   8245 C CG1 . ILE F 1 72  ? -9.880  61.650  65.656 1.00 40.59  ? 563  ILE F CG1 1 
ATOM   8246 C CG2 . ILE F 1 72  ? -11.132 63.276  67.041 1.00 35.95  ? 563  ILE F CG2 1 
ATOM   8247 C CD1 . ILE F 1 72  ? -9.064  62.820  65.091 1.00 43.15  ? 563  ILE F CD1 1 
ATOM   8248 N N   . VAL F 1 73  ? -13.302 59.427  65.499 1.00 38.48  ? 564  VAL F N   1 
ATOM   8249 C CA  . VAL F 1 73  ? -13.538 58.243  64.674 1.00 37.46  ? 564  VAL F CA  1 
ATOM   8250 C C   . VAL F 1 73  ? -14.106 58.556  63.305 1.00 37.42  ? 564  VAL F C   1 
ATOM   8251 O O   . VAL F 1 73  ? -14.406 59.705  62.996 1.00 36.55  ? 564  VAL F O   1 
ATOM   8252 C CB  . VAL F 1 73  ? -14.494 57.249  65.368 1.00 35.96  ? 564  VAL F CB  1 
ATOM   8253 C CG1 . VAL F 1 73  ? -13.945 56.870  66.722 1.00 35.64  ? 564  VAL F CG1 1 
ATOM   8254 C CG2 . VAL F 1 73  ? -15.882 57.859  65.503 1.00 36.62  ? 564  VAL F CG2 1 
ATOM   8255 N N   . GLY F 1 74  ? -14.245 57.513  62.490 1.00 38.30  ? 565  GLY F N   1 
ATOM   8256 C CA  . GLY F 1 74  ? -14.777 57.669  61.149 1.00 38.76  ? 565  GLY F CA  1 
ATOM   8257 C C   . GLY F 1 74  ? -13.846 58.325  60.146 1.00 38.04  ? 565  GLY F C   1 
ATOM   8258 O O   . GLY F 1 74  ? -14.306 58.876  59.155 1.00 38.80  ? 565  GLY F O   1 
ATOM   8259 N N   . LEU F 1 75  ? -12.542 58.272  60.389 1.00 38.13  ? 566  LEU F N   1 
ATOM   8260 C CA  . LEU F 1 75  ? -11.580 58.879  59.470 1.00 37.43  ? 566  LEU F CA  1 
ATOM   8261 C C   . LEU F 1 75  ? -11.320 57.933  58.300 1.00 37.77  ? 566  LEU F C   1 
ATOM   8262 O O   . LEU F 1 75  ? -11.744 56.774  58.313 1.00 38.20  ? 566  LEU F O   1 
ATOM   8263 C CB  . LEU F 1 75  ? -10.257 59.175  60.196 1.00 35.07  ? 566  LEU F CB  1 
ATOM   8264 C CG  . LEU F 1 75  ? -10.329 59.920  61.541 1.00 34.80  ? 566  LEU F CG  1 
ATOM   8265 C CD1 . LEU F 1 75  ? -8.928  60.127  62.091 1.00 32.14  ? 566  LEU F CD1 1 
ATOM   8266 C CD2 . LEU F 1 75  ? -11.033 61.265  61.373 1.00 32.10  ? 566  LEU F CD2 1 
ATOM   8267 N N   . LYS F 1 76  ? -10.630 58.437  57.284 1.00 38.61  ? 567  LYS F N   1 
ATOM   8268 C CA  . LYS F 1 76  ? -10.291 57.633  56.117 1.00 38.50  ? 567  LYS F CA  1 
ATOM   8269 C C   . LYS F 1 76  ? -8.790  57.355  56.093 1.00 37.71  ? 567  LYS F C   1 
ATOM   8270 O O   . LYS F 1 76  ? -7.981  58.190  56.498 1.00 35.34  ? 567  LYS F O   1 
ATOM   8271 C CB  . LYS F 1 76  ? -10.699 58.351  54.836 1.00 39.82  ? 567  LYS F CB  1 
ATOM   8272 C CG  . LYS F 1 76  ? -12.191 58.462  54.649 1.00 45.06  ? 567  LYS F CG  1 
ATOM   8273 C CD  . LYS F 1 76  ? -12.537 59.223  53.374 1.00 49.80  ? 567  LYS F CD  1 
ATOM   8274 C CE  . LYS F 1 76  ? -14.050 59.285  53.148 1.00 52.73  ? 567  LYS F CE  1 
ATOM   8275 N NZ  . LYS F 1 76  ? -14.673 57.929  53.027 1.00 54.10  ? 567  LYS F NZ  1 
ATOM   8276 N N   . PRO F 1 77  ? -8.402  56.158  55.627 1.00 37.65  ? 568  PRO F N   1 
ATOM   8277 C CA  . PRO F 1 77  ? -6.997  55.752  55.545 1.00 36.76  ? 568  PRO F CA  1 
ATOM   8278 C C   . PRO F 1 77  ? -6.165  56.647  54.647 1.00 36.78  ? 568  PRO F C   1 
ATOM   8279 O O   . PRO F 1 77  ? -6.657  57.182  53.657 1.00 36.43  ? 568  PRO F O   1 
ATOM   8280 C CB  . PRO F 1 77  ? -7.080  54.333  54.998 1.00 35.62  ? 568  PRO F CB  1 
ATOM   8281 C CG  . PRO F 1 77  ? -8.379  53.845  55.540 1.00 37.48  ? 568  PRO F CG  1 
ATOM   8282 C CD  . PRO F 1 77  ? -9.289  55.025  55.314 1.00 37.33  ? 568  PRO F CD  1 
ATOM   8283 N N   . GLU F 1 78  ? -4.902  56.817  55.008 1.00 36.65  ? 569  GLU F N   1 
ATOM   8284 C CA  . GLU F 1 78  ? -4.006  57.614  54.198 1.00 36.34  ? 569  GLU F CA  1 
ATOM   8285 C C   . GLU F 1 78  ? -4.527  58.997  53.862 1.00 35.69  ? 569  GLU F C   1 
ATOM   8286 O O   . GLU F 1 78  ? -4.369  59.461  52.733 1.00 35.52  ? 569  GLU F O   1 
ATOM   8287 C CB  . GLU F 1 78  ? -3.708  56.872  52.904 1.00 37.22  ? 569  GLU F CB  1 
ATOM   8288 C CG  . GLU F 1 78  ? -2.732  55.740  53.073 1.00 40.93  ? 569  GLU F CG  1 
ATOM   8289 C CD  . GLU F 1 78  ? -2.698  54.839  51.866 1.00 44.23  ? 569  GLU F CD  1 
ATOM   8290 O OE1 . GLU F 1 78  ? -3.648  54.032  51.697 1.00 46.44  ? 569  GLU F OE1 1 
ATOM   8291 O OE2 . GLU F 1 78  ? -1.726  54.948  51.089 1.00 42.75  ? 569  GLU F OE2 1 
ATOM   8292 N N   . THR F 1 79  ? -5.140  59.654  54.839 1.00 33.22  ? 570  THR F N   1 
ATOM   8293 C CA  . THR F 1 79  ? -5.659  60.990  54.625 1.00 30.98  ? 570  THR F CA  1 
ATOM   8294 C C   . THR F 1 79  ? -5.022  61.905  55.663 1.00 31.01  ? 570  THR F C   1 
ATOM   8295 O O   . THR F 1 79  ? -4.692  61.465  56.759 1.00 32.12  ? 570  THR F O   1 
ATOM   8296 C CB  . THR F 1 79  ? -7.196  61.002  54.745 1.00 30.86  ? 570  THR F CB  1 
ATOM   8297 O OG1 . THR F 1 79  ? -7.750  60.090  53.788 1.00 30.95  ? 570  THR F OG1 1 
ATOM   8298 C CG2 . THR F 1 79  ? -7.750  62.379  54.468 1.00 29.58  ? 570  THR F CG2 1 
ATOM   8299 N N   . THR F 1 80  ? -4.821  63.167  55.297 1.00 30.66  ? 571  THR F N   1 
ATOM   8300 C CA  . THR F 1 80  ? -4.215  64.151  56.183 1.00 30.63  ? 571  THR F CA  1 
ATOM   8301 C C   . THR F 1 80  ? -5.299  65.009  56.832 1.00 31.08  ? 571  THR F C   1 
ATOM   8302 O O   . THR F 1 80  ? -6.094  65.641  56.144 1.00 31.08  ? 571  THR F O   1 
ATOM   8303 C CB  . THR F 1 80  ? -3.242  65.058  55.404 1.00 31.53  ? 571  THR F CB  1 
ATOM   8304 O OG1 . THR F 1 80  ? -2.270  64.245  54.727 1.00 32.33  ? 571  THR F OG1 1 
ATOM   8305 C CG2 . THR F 1 80  ? -2.531  66.023  56.349 1.00 29.88  ? 571  THR F CG2 1 
ATOM   8306 N N   . TYR F 1 81  ? -5.316  65.027  58.162 1.00 31.28  ? 572  TYR F N   1 
ATOM   8307 C CA  . TYR F 1 81  ? -6.312  65.776  58.920 1.00 31.53  ? 572  TYR F CA  1 
ATOM   8308 C C   . TYR F 1 81  ? -5.709  66.837  59.841 1.00 32.71  ? 572  TYR F C   1 
ATOM   8309 O O   . TYR F 1 81  ? -4.502  66.848  60.105 1.00 32.26  ? 572  TYR F O   1 
ATOM   8310 C CB  . TYR F 1 81  ? -7.133  64.809  59.775 1.00 31.25  ? 572  TYR F CB  1 
ATOM   8311 C CG  . TYR F 1 81  ? -7.943  63.801  58.997 1.00 31.92  ? 572  TYR F CG  1 
ATOM   8312 C CD1 . TYR F 1 81  ? -9.234  64.103  58.559 1.00 31.95  ? 572  TYR F CD1 1 
ATOM   8313 C CD2 . TYR F 1 81  ? -7.422  62.547  58.687 1.00 31.46  ? 572  TYR F CD2 1 
ATOM   8314 C CE1 . TYR F 1 81  ? -9.988  63.189  57.836 1.00 30.20  ? 572  TYR F CE1 1 
ATOM   8315 C CE2 . TYR F 1 81  ? -8.167  61.623  57.958 1.00 31.84  ? 572  TYR F CE2 1 
ATOM   8316 C CZ  . TYR F 1 81  ? -9.449  61.953  57.536 1.00 32.61  ? 572  TYR F CZ  1 
ATOM   8317 O OH  . TYR F 1 81  ? -10.189 61.054  56.804 1.00 33.94  ? 572  TYR F OH  1 
ATOM   8318 N N   . ALA F 1 82  ? -6.576  67.725  60.328 1.00 32.88  ? 573  ALA F N   1 
ATOM   8319 C CA  . ALA F 1 82  ? -6.196  68.784  61.257 1.00 31.97  ? 573  ALA F CA  1 
ATOM   8320 C C   . ALA F 1 82  ? -7.133  68.653  62.450 1.00 32.46  ? 573  ALA F C   1 
ATOM   8321 O O   . ALA F 1 82  ? -8.341  68.499  62.273 1.00 31.67  ? 573  ALA F O   1 
ATOM   8322 C CB  . ALA F 1 82  ? -6.369  70.136  60.615 1.00 32.30  ? 573  ALA F CB  1 
ATOM   8323 N N   . VAL F 1 83  ? -6.582  68.700  63.660 1.00 32.04  ? 574  VAL F N   1 
ATOM   8324 C CA  . VAL F 1 83  ? -7.405  68.580  64.855 1.00 33.07  ? 574  VAL F CA  1 
ATOM   8325 C C   . VAL F 1 83  ? -7.085  69.627  65.921 1.00 35.23  ? 574  VAL F C   1 
ATOM   8326 O O   . VAL F 1 83  ? -5.921  69.972  66.153 1.00 34.35  ? 574  VAL F O   1 
ATOM   8327 C CB  . VAL F 1 83  ? -7.291  67.150  65.475 1.00 31.40  ? 574  VAL F CB  1 
ATOM   8328 C CG1 . VAL F 1 83  ? -5.863  66.847  65.859 1.00 27.32  ? 574  VAL F CG1 1 
ATOM   8329 C CG2 . VAL F 1 83  ? -8.218  67.022  66.673 1.00 28.74  ? 574  VAL F CG2 1 
ATOM   8330 N N   . ARG F 1 84  ? -8.138  70.136  66.552 1.00 37.06  ? 575  ARG F N   1 
ATOM   8331 C CA  . ARG F 1 84  ? -7.998  71.132  67.602 1.00 41.48  ? 575  ARG F CA  1 
ATOM   8332 C C   . ARG F 1 84  ? -9.042  70.898  68.695 1.00 43.49  ? 575  ARG F C   1 
ATOM   8333 O O   . ARG F 1 84  ? -10.135 70.394  68.425 1.00 42.87  ? 575  ARG F O   1 
ATOM   8334 C CB  . ARG F 1 84  ? -8.140  72.537  67.018 1.00 43.71  ? 575  ARG F CB  1 
ATOM   8335 C CG  . ARG F 1 84  ? -9.415  72.761  66.226 1.00 44.65  ? 575  ARG F CG  1 
ATOM   8336 C CD  . ARG F 1 84  ? -9.543  74.209  65.780 1.00 45.97  ? 575  ARG F CD  1 
ATOM   8337 N NE  . ARG F 1 84  ? -10.822 74.435  65.114 1.00 49.34  ? 575  ARG F NE  1 
ATOM   8338 C CZ  . ARG F 1 84  ? -11.173 75.570  64.517 1.00 50.04  ? 575  ARG F CZ  1 
ATOM   8339 N NH1 . ARG F 1 84  ? -10.339 76.604  64.496 1.00 49.62  ? 575  ARG F NH1 1 
ATOM   8340 N NH2 . ARG F 1 84  ? -12.359 75.663  63.927 1.00 49.37  ? 575  ARG F NH2 1 
ATOM   8341 N N   . LEU F 1 85  ? -8.699  71.267  69.926 1.00 45.70  ? 576  LEU F N   1 
ATOM   8342 C CA  . LEU F 1 85  ? -9.586  71.068  71.069 1.00 48.20  ? 576  LEU F CA  1 
ATOM   8343 C C   . LEU F 1 85  ? -9.988  72.354  71.800 1.00 50.59  ? 576  LEU F C   1 
ATOM   8344 O O   . LEU F 1 85  ? -9.252  73.351  71.813 1.00 49.12  ? 576  LEU F O   1 
ATOM   8345 C CB  . LEU F 1 85  ? -8.919  70.127  72.072 1.00 48.26  ? 576  LEU F CB  1 
ATOM   8346 C CG  . LEU F 1 85  ? -8.494  68.737  71.600 1.00 49.37  ? 576  LEU F CG  1 
ATOM   8347 C CD1 . LEU F 1 85  ? -7.346  68.221  72.464 1.00 47.88  ? 576  LEU F CD1 1 
ATOM   8348 C CD2 . LEU F 1 85  ? -9.688  67.801  71.645 1.00 47.83  ? 576  LEU F CD2 1 
ATOM   8349 N N   . ALA F 1 86  ? -11.162 72.306  72.423 1.00 53.13  ? 577  ALA F N   1 
ATOM   8350 C CA  . ALA F 1 86  ? -11.687 73.432  73.189 1.00 56.74  ? 577  ALA F CA  1 
ATOM   8351 C C   . ALA F 1 86  ? -12.368 72.899  74.447 1.00 57.61  ? 577  ALA F C   1 
ATOM   8352 O O   . ALA F 1 86  ? -13.002 71.843  74.415 1.00 56.76  ? 577  ALA F O   1 
ATOM   8353 C CB  . ALA F 1 86  ? -12.680 74.237  72.344 1.00 57.08  ? 577  ALA F CB  1 
ATOM   8354 N N   . ALA F 1 87  ? -12.234 73.633  75.548 1.00 59.88  ? 578  ALA F N   1 
ATOM   8355 C CA  . ALA F 1 87  ? -12.826 73.227  76.820 1.00 62.82  ? 578  ALA F CA  1 
ATOM   8356 C C   . ALA F 1 87  ? -14.055 74.048  77.212 1.00 64.42  ? 578  ALA F C   1 
ATOM   8357 O O   . ALA F 1 87  ? -14.044 75.275  77.131 1.00 65.19  ? 578  ALA F O   1 
ATOM   8358 C CB  . ALA F 1 87  ? -11.786 73.319  77.912 1.00 63.16  ? 578  ALA F CB  1 
ATOM   8359 N N   . LEU F 1 88  ? -15.103 73.359  77.654 1.00 65.99  ? 579  LEU F N   1 
ATOM   8360 C CA  . LEU F 1 88  ? -16.349 74.004  78.062 1.00 69.00  ? 579  LEU F CA  1 
ATOM   8361 C C   . LEU F 1 88  ? -16.564 73.930  79.575 1.00 71.83  ? 579  LEU F C   1 
ATOM   8362 O O   . LEU F 1 88  ? -16.141 72.969  80.222 1.00 73.57  ? 579  LEU F O   1 
ATOM   8363 C CB  . LEU F 1 88  ? -17.531 73.334  77.357 1.00 68.61  ? 579  LEU F CB  1 
ATOM   8364 C CG  . LEU F 1 88  ? -18.945 73.792  77.731 1.00 67.94  ? 579  LEU F CG  1 
ATOM   8365 C CD1 . LEU F 1 88  ? -19.099 75.265  77.409 1.00 67.60  ? 579  LEU F CD1 1 
ATOM   8366 C CD2 . LEU F 1 88  ? -19.978 72.971  76.971 1.00 66.17  ? 579  LEU F CD2 1 
ATOM   8367 N N   . ASN F 1 89  ? -17.226 74.939  80.136 1.00 73.40  ? 580  ASN F N   1 
ATOM   8368 C CA  . ASN F 1 89  ? -17.508 74.958  81.569 1.00 74.61  ? 580  ASN F CA  1 
ATOM   8369 C C   . ASN F 1 89  ? -18.832 75.651  81.848 1.00 76.13  ? 580  ASN F C   1 
ATOM   8370 O O   . ASN F 1 89  ? -19.651 75.826  80.943 1.00 76.59  ? 580  ASN F O   1 
ATOM   8371 C CB  . ASN F 1 89  ? -16.385 75.660  82.343 1.00 74.22  ? 580  ASN F CB  1 
ATOM   8372 C CG  . ASN F 1 89  ? -16.233 77.122  81.970 1.00 74.72  ? 580  ASN F CG  1 
ATOM   8373 O OD1 . ASN F 1 89  ? -15.420 77.839  82.557 1.00 73.78  ? 580  ASN F OD1 1 
ATOM   8374 N ND2 . ASN F 1 89  ? -17.007 77.572  80.988 1.00 75.32  ? 580  ASN F ND2 1 
ATOM   8375 N N   . GLY F 1 90  ? -19.040 76.040  83.104 1.00 77.58  ? 581  GLY F N   1 
ATOM   8376 C CA  . GLY F 1 90  ? -20.270 76.714  83.479 1.00 78.92  ? 581  GLY F CA  1 
ATOM   8377 C C   . GLY F 1 90  ? -20.539 77.915  82.594 1.00 80.09  ? 581  GLY F C   1 
ATOM   8378 O O   . GLY F 1 90  ? -21.653 78.089  82.102 1.00 79.35  ? 581  GLY F O   1 
ATOM   8379 N N   . LYS F 1 91  ? -19.510 78.737  82.392 1.00 81.20  ? 582  LYS F N   1 
ATOM   8380 C CA  . LYS F 1 91  ? -19.608 79.935  81.558 1.00 82.23  ? 582  LYS F CA  1 
ATOM   8381 C C   . LYS F 1 91  ? -20.063 79.565  80.144 1.00 83.02  ? 582  LYS F C   1 
ATOM   8382 O O   . LYS F 1 91  ? -21.260 79.475  79.862 1.00 83.04  ? 582  LYS F O   1 
ATOM   8383 C CB  . LYS F 1 91  ? -18.247 80.638  81.480 1.00 81.77  ? 582  LYS F CB  1 
ATOM   8384 C CG  . LYS F 1 91  ? -17.526 80.776  82.812 1.00 81.98  ? 582  LYS F CG  1 
ATOM   8385 C CD  . LYS F 1 91  ? -18.423 81.394  83.873 1.00 83.19  ? 582  LYS F CD  1 
ATOM   8386 C CE  . LYS F 1 91  ? -18.927 82.770  83.458 1.00 83.92  ? 582  LYS F CE  1 
ATOM   8387 N NZ  . LYS F 1 91  ? -19.913 83.321  84.433 1.00 83.43  ? 582  LYS F NZ  1 
ATOM   8388 N N   . GLY F 1 92  ? -19.088 79.356  79.262 1.00 83.54  ? 583  GLY F N   1 
ATOM   8389 C CA  . GLY F 1 92  ? -19.375 78.987  77.886 1.00 82.80  ? 583  GLY F CA  1 
ATOM   8390 C C   . GLY F 1 92  ? -18.207 78.220  77.290 1.00 82.18  ? 583  GLY F C   1 
ATOM   8391 O O   . GLY F 1 92  ? -17.300 77.803  78.019 1.00 82.84  ? 583  GLY F O   1 
ATOM   8392 N N   . LEU F 1 93  ? -18.221 78.027  75.973 1.00 80.38  ? 584  LEU F N   1 
ATOM   8393 C CA  . LEU F 1 93  ? -17.141 77.308  75.302 1.00 78.27  ? 584  LEU F CA  1 
ATOM   8394 C C   . LEU F 1 93  ? -15.891 78.187  75.302 1.00 77.38  ? 584  LEU F C   1 
ATOM   8395 O O   . LEU F 1 93  ? -15.910 79.318  74.805 1.00 75.99  ? 584  LEU F O   1 
ATOM   8396 C CB  . LEU F 1 93  ? -17.544 76.955  73.865 1.00 77.35  ? 584  LEU F CB  1 
ATOM   8397 C CG  . LEU F 1 93  ? -16.823 75.765  73.224 1.00 75.59  ? 584  LEU F CG  1 
ATOM   8398 C CD1 . LEU F 1 93  ? -17.166 74.500  73.987 1.00 74.05  ? 584  LEU F CD1 1 
ATOM   8399 C CD2 . LEU F 1 93  ? -17.242 75.624  71.775 1.00 74.72  ? 584  LEU F CD2 1 
ATOM   8400 N N   . GLY F 1 94  ? -14.813 77.654  75.871 1.00 76.76  ? 585  GLY F N   1 
ATOM   8401 C CA  . GLY F 1 94  ? -13.565 78.389  75.964 1.00 76.53  ? 585  GLY F CA  1 
ATOM   8402 C C   . GLY F 1 94  ? -12.786 78.555  74.674 1.00 76.57  ? 585  GLY F C   1 
ATOM   8403 O O   . GLY F 1 94  ? -13.302 78.356  73.573 1.00 77.28  ? 585  GLY F O   1 
ATOM   8404 N N   . GLU F 1 95  ? -11.523 78.930  74.821 1.00 75.75  ? 586  GLU F N   1 
ATOM   8405 C CA  . GLU F 1 95  ? -10.644 79.139  73.683 1.00 75.55  ? 586  GLU F CA  1 
ATOM   8406 C C   . GLU F 1 95  ? -10.275 77.807  73.026 1.00 74.51  ? 586  GLU F C   1 
ATOM   8407 O O   . GLU F 1 95  ? -10.188 76.779  73.702 1.00 74.78  ? 586  GLU F O   1 
ATOM   8408 C CB  . GLU F 1 95  ? -9.384  79.859  74.157 1.00 76.88  ? 586  GLU F CB  1 
ATOM   8409 C CG  . GLU F 1 95  ? -8.484  80.353  73.049 1.00 79.41  ? 586  GLU F CG  1 
ATOM   8410 C CD  . GLU F 1 95  ? -7.304  81.133  73.591 1.00 81.16  ? 586  GLU F CD  1 
ATOM   8411 O OE1 . GLU F 1 95  ? -6.483  80.536  74.324 1.00 81.63  ? 586  GLU F OE1 1 
ATOM   8412 O OE2 . GLU F 1 95  ? -7.202  82.343  73.292 1.00 82.55  ? 586  GLU F OE2 1 
ATOM   8413 N N   . ILE F 1 96  ? -10.067 77.826  71.710 1.00 72.35  ? 587  ILE F N   1 
ATOM   8414 C CA  . ILE F 1 96  ? -9.696  76.614  70.978 1.00 69.64  ? 587  ILE F CA  1 
ATOM   8415 C C   . ILE F 1 96  ? -8.182  76.521  70.847 1.00 67.68  ? 587  ILE F C   1 
ATOM   8416 O O   . ILE F 1 96  ? -7.493  77.534  70.687 1.00 67.32  ? 587  ILE F O   1 
ATOM   8417 C CB  . ILE F 1 96  ? -10.307 76.576  69.551 1.00 69.55  ? 587  ILE F CB  1 
ATOM   8418 C CG1 . ILE F 1 96  ? -9.814  77.776  68.740 1.00 69.18  ? 587  ILE F CG1 1 
ATOM   8419 C CG2 . ILE F 1 96  ? -11.825 76.554  69.632 1.00 69.97  ? 587  ILE F CG2 1 
ATOM   8420 C CD1 . ILE F 1 96  ? -10.334 77.819  67.319 1.00 69.52  ? 587  ILE F CD1 1 
ATOM   8421 N N   . SER F 1 97  ? -7.673  75.297  70.910 1.00 64.70  ? 588  SER F N   1 
ATOM   8422 C CA  . SER F 1 97  ? -6.241  75.053  70.813 1.00 62.26  ? 588  SER F CA  1 
ATOM   8423 C C   . SER F 1 97  ? -5.760  75.189  69.383 1.00 59.89  ? 588  SER F C   1 
ATOM   8424 O O   . SER F 1 97  ? -6.559  75.199  68.451 1.00 59.63  ? 588  SER F O   1 
ATOM   8425 C CB  . SER F 1 97  ? -5.922  73.642  71.285 1.00 63.06  ? 588  SER F CB  1 
ATOM   8426 O OG  . SER F 1 97  ? -6.466  72.699  70.375 1.00 64.08  ? 588  SER F OG  1 
ATOM   8427 N N   . ALA F 1 98  ? -4.446  75.287  69.214 1.00 57.32  ? 589  ALA F N   1 
ATOM   8428 C CA  . ALA F 1 98  ? -3.864  75.380  67.884 1.00 55.38  ? 589  ALA F CA  1 
ATOM   8429 C C   . ALA F 1 98  ? -4.204  74.071  67.179 1.00 54.45  ? 589  ALA F C   1 
ATOM   8430 O O   . ALA F 1 98  ? -4.505  73.071  67.825 1.00 54.60  ? 589  ALA F O   1 
ATOM   8431 C CB  . ALA F 1 98  ? -2.354  75.548  67.977 1.00 53.31  ? 589  ALA F CB  1 
ATOM   8432 N N   . ALA F 1 99  ? -4.167  74.074  65.855 1.00 53.05  ? 590  ALA F N   1 
ATOM   8433 C CA  . ALA F 1 99  ? -4.475  72.865  65.113 1.00 50.13  ? 590  ALA F CA  1 
ATOM   8434 C C   . ALA F 1 99  ? -3.249  71.969  65.060 1.00 48.24  ? 590  ALA F C   1 
ATOM   8435 O O   . ALA F 1 99  ? -2.120  72.447  64.904 1.00 47.64  ? 590  ALA F O   1 
ATOM   8436 C CB  . ALA F 1 99  ? -4.927  73.214  63.706 1.00 50.11  ? 590  ALA F CB  1 
ATOM   8437 N N   . SER F 1 100 ? -3.485  70.670  65.207 1.00 45.34  ? 591  SER F N   1 
ATOM   8438 C CA  . SER F 1 100 ? -2.427  69.672  65.165 1.00 43.23  ? 591  SER F CA  1 
ATOM   8439 C C   . SER F 1 100 ? -2.677  68.861  63.897 1.00 41.16  ? 591  SER F C   1 
ATOM   8440 O O   . SER F 1 100 ? -3.787  68.387  63.678 1.00 40.60  ? 591  SER F O   1 
ATOM   8441 C CB  . SER F 1 100 ? -2.518  68.771  66.399 1.00 43.97  ? 591  SER F CB  1 
ATOM   8442 O OG  . SER F 1 100 ? -1.315  68.061  66.614 1.00 45.07  ? 591  SER F OG  1 
ATOM   8443 N N   . GLU F 1 101 ? -1.660  68.697  63.059 1.00 39.42  ? 592  GLU F N   1 
ATOM   8444 C CA  . GLU F 1 101 ? -1.855  67.955  61.823 1.00 36.60  ? 592  GLU F CA  1 
ATOM   8445 C C   . GLU F 1 101 ? -1.287  66.546  61.818 1.00 34.32  ? 592  GLU F C   1 
ATOM   8446 O O   . GLU F 1 101 ? -0.213  66.287  62.352 1.00 32.68  ? 592  GLU F O   1 
ATOM   8447 C CB  . GLU F 1 101 ? -1.287  68.734  60.640 1.00 36.48  ? 592  GLU F CB  1 
ATOM   8448 C CG  . GLU F 1 101 ? -2.206  68.687  59.445 1.00 38.31  ? 592  GLU F CG  1 
ATOM   8449 C CD  . GLU F 1 101 ? -1.656  69.403  58.239 1.00 39.41  ? 592  GLU F CD  1 
ATOM   8450 O OE1 . GLU F 1 101 ? -1.020  70.464  58.408 1.00 37.82  ? 592  GLU F OE1 1 
ATOM   8451 O OE2 . GLU F 1 101 ? -1.879  68.909  57.114 1.00 41.38  ? 592  GLU F OE2 1 
ATOM   8452 N N   . PHE F 1 102 ? -2.023  65.636  61.194 1.00 32.24  ? 593  PHE F N   1 
ATOM   8453 C CA  . PHE F 1 102 ? -1.603  64.253  61.125 1.00 31.76  ? 593  PHE F CA  1 
ATOM   8454 C C   . PHE F 1 102 ? -2.103  63.544  59.876 1.00 32.33  ? 593  PHE F C   1 
ATOM   8455 O O   . PHE F 1 102 ? -2.942  64.056  59.138 1.00 32.41  ? 593  PHE F O   1 
ATOM   8456 C CB  . PHE F 1 102 ? -2.089  63.512  62.369 1.00 30.50  ? 593  PHE F CB  1 
ATOM   8457 C CG  . PHE F 1 102 ? -3.592  63.435  62.496 1.00 27.14  ? 593  PHE F CG  1 
ATOM   8458 C CD1 . PHE F 1 102 ? -4.290  62.335  62.004 1.00 25.01  ? 593  PHE F CD1 1 
ATOM   8459 C CD2 . PHE F 1 102 ? -4.300  64.437  63.159 1.00 25.67  ? 593  PHE F CD2 1 
ATOM   8460 C CE1 . PHE F 1 102 ? -5.673  62.228  62.174 1.00 23.88  ? 593  PHE F CE1 1 
ATOM   8461 C CE2 . PHE F 1 102 ? -5.676  64.340  63.334 1.00 23.93  ? 593  PHE F CE2 1 
ATOM   8462 C CZ  . PHE F 1 102 ? -6.367  63.230  62.842 1.00 23.06  ? 593  PHE F CZ  1 
ATOM   8463 N N   . LYS F 1 103 ? -1.569  62.357  59.638 1.00 32.11  ? 594  LYS F N   1 
ATOM   8464 C CA  . LYS F 1 103 ? -1.974  61.575  58.483 1.00 32.36  ? 594  LYS F CA  1 
ATOM   8465 C C   . LYS F 1 103 ? -2.284  60.152  58.929 1.00 32.43  ? 594  LYS F C   1 
ATOM   8466 O O   . LYS F 1 103 ? -1.423  59.452  59.465 1.00 33.21  ? 594  LYS F O   1 
ATOM   8467 C CB  . LYS F 1 103 ? -0.862  61.561  57.434 1.00 30.84  ? 594  LYS F CB  1 
ATOM   8468 C CG  . LYS F 1 103 ? -1.257  60.868  56.161 1.00 30.54  ? 594  LYS F CG  1 
ATOM   8469 C CD  . LYS F 1 103 ? -0.140  60.881  55.151 1.00 31.24  ? 594  LYS F CD  1 
ATOM   8470 C CE  . LYS F 1 103 ? -0.531  60.076  53.928 1.00 31.87  ? 594  LYS F CE  1 
ATOM   8471 N NZ  . LYS F 1 103 ? 0.574   59.973  52.944 1.00 32.98  ? 594  LYS F NZ  1 
ATOM   8472 N N   . THR F 1 104 ? -3.517  59.726  58.715 1.00 30.96  ? 595  THR F N   1 
ATOM   8473 C CA  . THR F 1 104 ? -3.903  58.385  59.102 1.00 30.87  ? 595  THR F CA  1 
ATOM   8474 C C   . THR F 1 104 ? -3.056  57.350  58.380 1.00 30.05  ? 595  THR F C   1 
ATOM   8475 O O   . THR F 1 104 ? -2.381  57.655  57.402 1.00 29.63  ? 595  THR F O   1 
ATOM   8476 C CB  . THR F 1 104 ? -5.390  58.135  58.809 1.00 29.72  ? 595  THR F CB  1 
ATOM   8477 O OG1 . THR F 1 104 ? -5.666  58.372  57.422 1.00 29.42  ? 595  THR F OG1 1 
ATOM   8478 C CG2 . THR F 1 104 ? -6.233  59.054  59.658 1.00 30.52  ? 595  THR F CG2 1 
ATOM   8479 N N   . GLN F 1 105 ? -3.091  56.124  58.877 1.00 30.18  ? 596  GLN F N   1 
ATOM   8480 C CA  . GLN F 1 105 ? -2.326  55.041  58.280 1.00 31.94  ? 596  GLN F CA  1 
ATOM   8481 C C   . GLN F 1 105 ? -3.124  54.356  57.180 1.00 32.44  ? 596  GLN F C   1 
ATOM   8482 O O   . GLN F 1 105 ? -4.294  54.665  56.967 1.00 32.28  ? 596  GLN F O   1 
ATOM   8483 C CB  . GLN F 1 105 ? -1.950  54.013  59.357 1.00 30.32  ? 596  GLN F CB  1 
ATOM   8484 C CG  . GLN F 1 105 ? -1.125  54.595  60.498 1.00 30.60  ? 596  GLN F CG  1 
ATOM   8485 C CD  . GLN F 1 105 ? -0.753  53.559  61.531 1.00 30.77  ? 596  GLN F CD  1 
ATOM   8486 O OE1 . GLN F 1 105 ? -0.288  52.473  61.190 1.00 31.39  ? 596  GLN F OE1 1 
ATOM   8487 N NE2 . GLN F 1 105 ? -0.951  53.888  62.804 1.00 28.14  ? 596  GLN F NE2 1 
ATOM   8488 N N   . PRO F 1 106 ? -2.481  53.444  56.436 1.00 33.83  ? 597  PRO F N   1 
ATOM   8489 C CA  . PRO F 1 106 ? -3.162  52.715  55.362 1.00 34.52  ? 597  PRO F CA  1 
ATOM   8490 C C   . PRO F 1 106 ? -3.735  51.435  55.977 1.00 34.37  ? 597  PRO F C   1 
ATOM   8491 O O   . PRO F 1 106 ? -3.430  51.115  57.121 1.00 34.94  ? 597  PRO F O   1 
ATOM   8492 C CB  . PRO F 1 106 ? -2.027  52.417  54.393 1.00 32.66  ? 597  PRO F CB  1 
ATOM   8493 C CG  . PRO F 1 106 ? -0.896  52.142  55.324 1.00 31.49  ? 597  PRO F CG  1 
ATOM   8494 C CD  . PRO F 1 106 ? -1.019  53.273  56.322 1.00 32.92  ? 597  PRO F CD  1 
ATOM   8495 N N   . VAL F 1 107 ? -4.569  50.713  55.237 1.00 35.17  ? 598  VAL F N   1 
ATOM   8496 C CA  . VAL F 1 107 ? -5.122  49.465  55.753 1.00 34.92  ? 598  VAL F CA  1 
ATOM   8497 C C   . VAL F 1 107 ? -4.266  48.320  55.236 1.00 36.19  ? 598  VAL F C   1 
ATOM   8498 O O   . VAL F 1 107 ? -3.770  48.354  54.112 1.00 37.04  ? 598  VAL F O   1 
ATOM   8499 C CB  . VAL F 1 107 ? -6.582  49.252  55.307 1.00 34.10  ? 598  VAL F CB  1 
ATOM   8500 C CG1 . VAL F 1 107 ? -7.497  50.215  56.043 1.00 30.77  ? 598  VAL F CG1 1 
ATOM   8501 C CG2 . VAL F 1 107 ? -6.696  49.451  53.808 1.00 33.19  ? 598  VAL F CG2 1 
ATOM   8502 N N   . ARG F 1 108 ? -4.088  47.306  56.066 1.00 37.60  ? 599  ARG F N   1 
ATOM   8503 C CA  . ARG F 1 108 ? -3.278  46.157  55.700 1.00 37.89  ? 599  ARG F CA  1 
ATOM   8504 C C   . ARG F 1 108 ? -4.077  44.893  55.957 1.00 37.85  ? 599  ARG F C   1 
ATOM   8505 O O   . ARG F 1 108 ? -5.212  44.951  56.424 1.00 36.65  ? 599  ARG F O   1 
ATOM   8506 C CB  . ARG F 1 108 ? -2.004  46.144  56.546 1.00 39.60  ? 599  ARG F CB  1 
ATOM   8507 C CG  . ARG F 1 108 ? -1.320  47.508  56.644 1.00 44.24  ? 599  ARG F CG  1 
ATOM   8508 C CD  . ARG F 1 108 ? -0.074  47.438  57.510 1.00 48.87  ? 599  ARG F CD  1 
ATOM   8509 N NE  . ARG F 1 108 ? 1.030   48.220  56.953 1.00 53.24  ? 599  ARG F NE  1 
ATOM   8510 C CZ  . ARG F 1 108 ? 1.237   49.519  57.167 1.00 55.11  ? 599  ARG F CZ  1 
ATOM   8511 N NH1 . ARG F 1 108 ? 0.413   50.221  57.944 1.00 54.87  ? 599  ARG F NH1 1 
ATOM   8512 N NH2 . ARG F 1 108 ? 2.282   50.115  56.597 1.00 55.36  ? 599  ARG F NH2 1 
ATOM   8513 N N   . GLU F 1 109 ? -3.485  43.748  55.644 1.00 39.43  ? 600  GLU F N   1 
ATOM   8514 C CA  . GLU F 1 109 ? -4.155  42.475  55.869 1.00 40.57  ? 600  GLU F CA  1 
ATOM   8515 C C   . GLU F 1 109 ? -4.070  42.189  57.361 1.00 39.22  ? 600  GLU F C   1 
ATOM   8516 O O   . GLU F 1 109 ? -3.182  42.696  58.050 1.00 40.11  ? 600  GLU F O   1 
ATOM   8517 C CB  . GLU F 1 109 ? -3.464  41.359  55.093 1.00 42.14  ? 600  GLU F CB  1 
ATOM   8518 C CG  . GLU F 1 109 ? -3.038  41.760  53.701 1.00 44.88  ? 600  GLU F CG  1 
ATOM   8519 C CD  . GLU F 1 109 ? -2.830  40.562  52.795 1.00 46.89  ? 600  GLU F CD  1 
ATOM   8520 O OE1 . GLU F 1 109 ? -3.824  40.064  52.216 1.00 46.92  ? 600  GLU F OE1 1 
ATOM   8521 O OE2 . GLU F 1 109 ? -1.670  40.114  52.670 1.00 48.54  ? 600  GLU F OE2 1 
ATOM   8522 N N   . PRO F 1 110 ? -4.992  41.376  57.885 1.00 37.35  ? 601  PRO F N   1 
ATOM   8523 C CA  . PRO F 1 110 ? -4.948  41.078  59.314 1.00 35.11  ? 601  PRO F CA  1 
ATOM   8524 C C   . PRO F 1 110 ? -3.742  40.216  59.662 1.00 33.38  ? 601  PRO F C   1 
ATOM   8525 O O   . PRO F 1 110 ? -3.105  39.635  58.790 1.00 31.06  ? 601  PRO F O   1 
ATOM   8526 C CB  . PRO F 1 110 ? -6.255  40.314  59.554 1.00 35.46  ? 601  PRO F CB  1 
ATOM   8527 C CG  . PRO F 1 110 ? -7.122  40.677  58.392 1.00 35.42  ? 601  PRO F CG  1 
ATOM   8528 C CD  . PRO F 1 110 ? -6.158  40.737  57.253 1.00 37.51  ? 601  PRO F CD  1 
ATOM   8529 N N   . SER F 1 111 ? -3.425  40.156  60.946 1.00 33.27  ? 602  SER F N   1 
ATOM   8530 C CA  . SER F 1 111 ? -2.348  39.298  61.408 1.00 34.16  ? 602  SER F CA  1 
ATOM   8531 C C   . SER F 1 111 ? -3.075  37.997  61.716 1.00 33.27  ? 602  SER F C   1 
ATOM   8532 O O   . SER F 1 111 ? -4.289  37.998  61.920 1.00 32.82  ? 602  SER F O   1 
ATOM   8533 C CB  . SER F 1 111 ? -1.709  39.844  62.690 1.00 33.55  ? 602  SER F CB  1 
ATOM   8534 O OG  . SER F 1 111 ? -0.995  41.036  62.425 1.00 34.96  ? 602  SER F OG  1 
ATOM   8535 N N   . ALA F 1 112 ? -2.352  36.888  61.741 1.00 33.15  ? 603  ALA F N   1 
ATOM   8536 C CA  . ALA F 1 112 ? -2.990  35.621  62.038 1.00 32.70  ? 603  ALA F CA  1 
ATOM   8537 C C   . ALA F 1 112 ? -3.277  35.610  63.529 1.00 32.66  ? 603  ALA F C   1 
ATOM   8538 O O   . ALA F 1 112 ? -2.550  36.202  64.312 1.00 34.91  ? 603  ALA F O   1 
ATOM   8539 C CB  . ALA F 1 112 ? -2.072  34.480  61.666 1.00 30.40  ? 603  ALA F CB  1 
ATOM   8540 N N   . PRO F 1 113 ? -4.365  34.976  63.945 1.00 32.05  ? 604  PRO F N   1 
ATOM   8541 C CA  . PRO F 1 113 ? -4.595  34.980  65.388 1.00 33.37  ? 604  PRO F CA  1 
ATOM   8542 C C   . PRO F 1 113 ? -3.746  33.877  66.020 1.00 33.89  ? 604  PRO F C   1 
ATOM   8543 O O   . PRO F 1 113 ? -3.288  32.975  65.324 1.00 35.69  ? 604  PRO F O   1 
ATOM   8544 C CB  . PRO F 1 113 ? -6.084  34.686  65.487 1.00 32.56  ? 604  PRO F CB  1 
ATOM   8545 C CG  . PRO F 1 113 ? -6.295  33.756  64.350 1.00 32.06  ? 604  PRO F CG  1 
ATOM   8546 C CD  . PRO F 1 113 ? -5.519  34.416  63.226 1.00 31.80  ? 604  PRO F CD  1 
ATOM   8547 N N   . LYS F 1 114 ? -3.516  33.944  67.325 1.00 33.58  ? 605  LYS F N   1 
ATOM   8548 C CA  . LYS F 1 114 ? -2.746  32.894  67.969 1.00 32.91  ? 605  LYS F CA  1 
ATOM   8549 C C   . LYS F 1 114 ? -3.746  31.824  68.327 1.00 31.67  ? 605  LYS F C   1 
ATOM   8550 O O   . LYS F 1 114 ? -4.886  32.145  68.658 1.00 31.88  ? 605  LYS F O   1 
ATOM   8551 C CB  . LYS F 1 114 ? -2.048  33.408  69.224 1.00 35.71  ? 605  LYS F CB  1 
ATOM   8552 C CG  . LYS F 1 114 ? -0.843  34.258  68.909 1.00 41.85  ? 605  LYS F CG  1 
ATOM   8553 C CD  . LYS F 1 114 ? 0.120   34.315  70.077 1.00 48.16  ? 605  LYS F CD  1 
ATOM   8554 C CE  . LYS F 1 114 ? 1.463   34.900  69.646 1.00 51.34  ? 605  LYS F CE  1 
ATOM   8555 N NZ  . LYS F 1 114 ? 2.479   34.764  70.743 1.00 54.22  ? 605  LYS F NZ  1 
ATOM   8556 N N   . LEU F 1 115 ? -3.334  30.560  68.239 1.00 29.38  ? 606  LEU F N   1 
ATOM   8557 C CA  . LEU F 1 115 ? -4.230  29.453  68.554 1.00 28.15  ? 606  LEU F CA  1 
ATOM   8558 C C   . LEU F 1 115 ? -3.798  28.759  69.825 1.00 27.86  ? 606  LEU F C   1 
ATOM   8559 O O   . LEU F 1 115 ? -2.635  28.407  69.986 1.00 27.21  ? 606  LEU F O   1 
ATOM   8560 C CB  . LEU F 1 115 ? -4.271  28.421  67.421 1.00 27.23  ? 606  LEU F CB  1 
ATOM   8561 C CG  . LEU F 1 115 ? -4.566  28.906  66.005 1.00 27.39  ? 606  LEU F CG  1 
ATOM   8562 C CD1 . LEU F 1 115 ? -4.583  27.705  65.073 1.00 25.51  ? 606  LEU F CD1 1 
ATOM   8563 C CD2 . LEU F 1 115 ? -5.885  29.672  65.965 1.00 27.20  ? 606  LEU F CD2 1 
ATOM   8564 N N   . GLU F 1 116 ? -4.754  28.559  70.723 1.00 27.65  ? 607  GLU F N   1 
ATOM   8565 C CA  . GLU F 1 116 ? -4.498  27.906  71.991 1.00 27.44  ? 607  GLU F CA  1 
ATOM   8566 C C   . GLU F 1 116 ? -5.363  26.663  72.075 1.00 26.60  ? 607  GLU F C   1 
ATOM   8567 O O   . GLU F 1 116 ? -6.564  26.735  71.884 1.00 26.94  ? 607  GLU F O   1 
ATOM   8568 C CB  . GLU F 1 116 ? -4.834  28.865  73.133 1.00 26.57  ? 607  GLU F CB  1 
ATOM   8569 C CG  . GLU F 1 116 ? -4.963  28.215  74.485 1.00 24.97  ? 607  GLU F CG  1 
ATOM   8570 C CD  . GLU F 1 116 ? -5.345  29.214  75.553 1.00 27.93  ? 607  GLU F CD  1 
ATOM   8571 O OE1 . GLU F 1 116 ? -4.443  29.872  76.115 1.00 26.01  ? 607  GLU F OE1 1 
ATOM   8572 O OE2 . GLU F 1 116 ? -6.558  29.353  75.822 1.00 30.55  ? 607  GLU F OE2 1 
ATOM   8573 N N   . GLY F 1 117 ? -4.750  25.523  72.355 1.00 25.68  ? 608  GLY F N   1 
ATOM   8574 C CA  . GLY F 1 117 ? -5.513  24.297  72.444 1.00 26.25  ? 608  GLY F CA  1 
ATOM   8575 C C   . GLY F 1 117 ? -6.046  24.028  73.834 1.00 27.94  ? 608  GLY F C   1 
ATOM   8576 O O   . GLY F 1 117 ? -5.428  24.378  74.830 1.00 27.10  ? 608  GLY F O   1 
ATOM   8577 N N   . GLN F 1 118 ? -7.212  23.404  73.901 1.00 30.10  ? 609  GLN F N   1 
ATOM   8578 C CA  . GLN F 1 118 ? -7.825  23.075  75.176 1.00 32.07  ? 609  GLN F CA  1 
ATOM   8579 C C   . GLN F 1 118 ? -8.744  21.869  75.030 1.00 35.10  ? 609  GLN F C   1 
ATOM   8580 O O   . GLN F 1 118 ? -9.489  21.758  74.059 1.00 35.01  ? 609  GLN F O   1 
ATOM   8581 C CB  . GLN F 1 118 ? -8.611  24.269  75.715 1.00 29.88  ? 609  GLN F CB  1 
ATOM   8582 C CG  . GLN F 1 118 ? -9.646  23.885  76.746 1.00 29.08  ? 609  GLN F CG  1 
ATOM   8583 C CD  . GLN F 1 118 ? -10.284 25.077  77.421 1.00 28.20  ? 609  GLN F CD  1 
ATOM   8584 O OE1 . GLN F 1 118 ? -10.682 26.045  76.770 1.00 27.13  ? 609  GLN F OE1 1 
ATOM   8585 N NE2 . GLN F 1 118 ? -10.399 25.006  78.735 1.00 26.36  ? 609  GLN F NE2 1 
ATOM   8586 N N   . ARG F 1 119 ? -8.674  20.972  76.008 1.00 37.94  ? 610  ARG F N   1 
ATOM   8587 C CA  . ARG F 1 119 ? -9.482  19.765  76.028 1.00 40.88  ? 610  ARG F CA  1 
ATOM   8588 C C   . ARG F 1 119 ? -10.947 19.925  75.648 1.00 42.41  ? 610  ARG F C   1 
ATOM   8589 O O   . ARG F 1 119 ? -11.619 20.871  76.058 1.00 41.08  ? 610  ARG F O   1 
ATOM   8590 C CB  . ARG F 1 119 ? -9.435  19.124  77.410 1.00 42.85  ? 610  ARG F CB  1 
ATOM   8591 C CG  . ARG F 1 119 ? -8.170  18.364  77.724 1.00 45.63  ? 610  ARG F CG  1 
ATOM   8592 C CD  . ARG F 1 119 ? -8.400  17.499  78.955 1.00 49.08  ? 610  ARG F CD  1 
ATOM   8593 N NE  . ARG F 1 119 ? -7.249  16.655  79.251 1.00 51.50  ? 610  ARG F NE  1 
ATOM   8594 C CZ  . ARG F 1 119 ? -7.282  15.616  80.076 1.00 50.76  ? 610  ARG F CZ  1 
ATOM   8595 N NH1 . ARG F 1 119 ? -8.417  15.297  80.688 1.00 47.71  ? 610  ARG F NH1 1 
ATOM   8596 N NH2 . ARG F 1 119 ? -6.182  14.896  80.278 1.00 49.17  ? 610  ARG F NH2 1 
ATOM   8597 N N   . GLY F 1 120 ? -11.434 18.975  74.857 1.00 45.13  ? 611  GLY F N   1 
ATOM   8598 C CA  . GLY F 1 120 ? -12.829 18.976  74.472 1.00 46.80  ? 611  GLY F CA  1 
ATOM   8599 C C   . GLY F 1 120 ? -13.462 18.242  75.633 1.00 48.10  ? 611  GLY F C   1 
ATOM   8600 O O   . GLY F 1 120 ? -12.787 17.982  76.628 1.00 48.28  ? 611  GLY F O   1 
ATOM   8601 N N   . GLU F 1 121 ? -14.732 17.889  75.537 1.00 49.81  ? 612  GLU F N   1 
ATOM   8602 C CA  . GLU F 1 121 ? -15.350 17.186  76.648 1.00 51.90  ? 612  GLU F CA  1 
ATOM   8603 C C   . GLU F 1 121 ? -15.071 15.697  76.544 1.00 51.86  ? 612  GLU F C   1 
ATOM   8604 O O   . GLU F 1 121 ? -15.300 14.957  77.492 1.00 52.47  ? 612  GLU F O   1 
ATOM   8605 C CB  . GLU F 1 121 ? -16.851 17.412  76.652 1.00 54.05  ? 612  GLU F CB  1 
ATOM   8606 C CG  . GLU F 1 121 ? -17.582 16.452  75.753 1.00 58.59  ? 612  GLU F CG  1 
ATOM   8607 C CD  . GLU F 1 121 ? -19.047 16.781  75.651 1.00 61.61  ? 612  GLU F CD  1 
ATOM   8608 O OE1 . GLU F 1 121 ? -19.811 15.929  75.137 1.00 63.44  ? 612  GLU F OE1 1 
ATOM   8609 O OE2 . GLU F 1 121 ? -19.427 17.899  76.080 1.00 61.62  ? 612  GLU F OE2 1 
ATOM   8610 N N   . ASP F 1 122 ? -14.590 15.263  75.384 1.00 52.44  ? 613  ASP F N   1 
ATOM   8611 C CA  . ASP F 1 122 ? -14.277 13.853  75.161 1.00 52.92  ? 613  ASP F CA  1 
ATOM   8612 C C   . ASP F 1 122 ? -12.871 13.713  74.596 1.00 52.38  ? 613  ASP F C   1 
ATOM   8613 O O   . ASP F 1 122 ? -12.403 14.581  73.854 1.00 52.71  ? 613  ASP F O   1 
ATOM   8614 C CB  . ASP F 1 122 ? -15.266 13.230  74.175 1.00 54.43  ? 613  ASP F CB  1 
ATOM   8615 C CG  . ASP F 1 122 ? -16.702 13.512  74.538 1.00 55.89  ? 613  ASP F CG  1 
ATOM   8616 O OD1 . ASP F 1 122 ? -17.127 13.092  75.636 1.00 55.90  ? 613  ASP F OD1 1 
ATOM   8617 O OD2 . ASP F 1 122 ? -17.402 14.158  73.725 1.00 56.99  ? 613  ASP F OD2 1 
ATOM   8618 N N   . GLY F 1 123 ? -12.210 12.611  74.937 1.00 49.93  ? 614  GLY F N   1 
ATOM   8619 C CA  . GLY F 1 123 ? -10.863 12.380  74.451 1.00 46.36  ? 614  GLY F CA  1 
ATOM   8620 C C   . GLY F 1 123 ? -10.694 12.528  72.947 1.00 44.01  ? 614  GLY F C   1 
ATOM   8621 O O   . GLY F 1 123 ? -9.569  12.675  72.467 1.00 43.17  ? 614  GLY F O   1 
ATOM   8622 N N   . ASN F 1 124 ? -11.794 12.493  72.196 1.00 40.55  ? 615  ASN F N   1 
ATOM   8623 C CA  . ASN F 1 124 ? -11.699 12.618  70.745 1.00 38.55  ? 615  ASN F CA  1 
ATOM   8624 C C   . ASN F 1 124 ? -12.232 13.935  70.194 1.00 36.29  ? 615  ASN F C   1 
ATOM   8625 O O   . ASN F 1 124 ? -12.832 13.980  69.124 1.00 35.12  ? 615  ASN F O   1 
ATOM   8626 C CB  . ASN F 1 124 ? -12.409 11.450  70.052 1.00 40.20  ? 615  ASN F CB  1 
ATOM   8627 C CG  . ASN F 1 124 ? -13.922 11.526  70.158 1.00 41.90  ? 615  ASN F CG  1 
ATOM   8628 O OD1 . ASN F 1 124 ? -14.618 10.783  69.483 1.00 42.30  ? 615  ASN F OD1 1 
ATOM   8629 N ND2 . ASN F 1 124 ? -14.434 12.414  71.009 1.00 42.12  ? 615  ASN F ND2 1 
ATOM   8630 N N   . SER F 1 125 ? -11.992 15.011  70.928 1.00 34.91  ? 616  SER F N   1 
ATOM   8631 C CA  . SER F 1 125 ? -12.432 16.333  70.517 1.00 31.52  ? 616  SER F CA  1 
ATOM   8632 C C   . SER F 1 125 ? -11.396 17.314  71.006 1.00 30.68  ? 616  SER F C   1 
ATOM   8633 O O   . SER F 1 125 ? -10.550 16.969  71.834 1.00 27.96  ? 616  SER F O   1 
ATOM   8634 C CB  . SER F 1 125 ? -13.780 16.676  71.155 1.00 30.89  ? 616  SER F CB  1 
ATOM   8635 O OG  . SER F 1 125 ? -13.688 16.656  72.576 1.00 29.84  ? 616  SER F OG  1 
ATOM   8636 N N   . ILE F 1 126 ? -11.464 18.536  70.495 1.00 30.73  ? 617  ILE F N   1 
ATOM   8637 C CA  . ILE F 1 126 ? -10.543 19.572  70.923 1.00 31.17  ? 617  ILE F CA  1 
ATOM   8638 C C   . ILE F 1 126 ? -11.218 20.926  70.851 1.00 32.12  ? 617  ILE F C   1 
ATOM   8639 O O   . ILE F 1 126 ? -12.099 21.151  70.022 1.00 34.01  ? 617  ILE F O   1 
ATOM   8640 C CB  . ILE F 1 126 ? -9.249  19.603  70.061 1.00 30.87  ? 617  ILE F CB  1 
ATOM   8641 C CG1 . ILE F 1 126 ? -8.261  20.590  70.680 1.00 31.63  ? 617  ILE F CG1 1 
ATOM   8642 C CG2 . ILE F 1 126 ? -9.556  20.017  68.630 1.00 29.16  ? 617  ILE F CG2 1 
ATOM   8643 C CD1 . ILE F 1 126 ? -6.907  20.576  70.053 1.00 32.73  ? 617  ILE F CD1 1 
ATOM   8644 N N   . LYS F 1 127 ? -10.818 21.818  71.745 1.00 32.50  ? 618  LYS F N   1 
ATOM   8645 C CA  . LYS F 1 127 ? -11.354 23.166  71.772 1.00 32.32  ? 618  LYS F CA  1 
ATOM   8646 C C   . LYS F 1 127 ? -10.168 24.042  71.413 1.00 32.02  ? 618  LYS F C   1 
ATOM   8647 O O   . LYS F 1 127 ? -9.093  23.895  71.984 1.00 32.09  ? 618  LYS F O   1 
ATOM   8648 C CB  . LYS F 1 127 ? -11.879 23.506  73.172 1.00 33.44  ? 618  LYS F CB  1 
ATOM   8649 C CG  . LYS F 1 127 ? -12.535 24.880  73.287 1.00 34.65  ? 618  LYS F CG  1 
ATOM   8650 C CD  . LYS F 1 127 ? -13.460 24.926  74.498 1.00 35.94  ? 618  LYS F CD  1 
ATOM   8651 C CE  . LYS F 1 127 ? -14.077 26.309  74.706 1.00 36.24  ? 618  LYS F CE  1 
ATOM   8652 N NZ  . LYS F 1 127 ? -13.101 27.304  75.249 1.00 35.99  ? 618  LYS F NZ  1 
ATOM   8653 N N   . VAL F 1 128 ? -10.355 24.920  70.437 1.00 31.67  ? 619  VAL F N   1 
ATOM   8654 C CA  . VAL F 1 128 ? -9.294  25.808  69.995 1.00 30.77  ? 619  VAL F CA  1 
ATOM   8655 C C   . VAL F 1 128 ? -9.706  27.247  70.239 1.00 29.83  ? 619  VAL F C   1 
ATOM   8656 O O   . VAL F 1 128 ? -10.573 27.777  69.550 1.00 31.04  ? 619  VAL F O   1 
ATOM   8657 C CB  . VAL F 1 128 ? -9.008  25.620  68.496 1.00 32.07  ? 619  VAL F CB  1 
ATOM   8658 C CG1 . VAL F 1 128 ? -8.007  26.661  68.016 1.00 32.51  ? 619  VAL F CG1 1 
ATOM   8659 C CG2 . VAL F 1 128 ? -8.489  24.220  68.249 1.00 32.85  ? 619  VAL F CG2 1 
ATOM   8660 N N   . ASN F 1 129 ? -9.070  27.867  71.225 1.00 28.28  ? 620  ASN F N   1 
ATOM   8661 C CA  . ASN F 1 129 ? -9.339  29.245  71.603 1.00 25.95  ? 620  ASN F CA  1 
ATOM   8662 C C   . ASN F 1 129 ? -8.548  30.232  70.756 1.00 26.52  ? 620  ASN F C   1 
ATOM   8663 O O   . ASN F 1 129 ? -7.358  30.048  70.520 1.00 27.69  ? 620  ASN F O   1 
ATOM   8664 C CB  . ASN F 1 129 ? -8.992  29.431  73.071 1.00 22.95  ? 620  ASN F CB  1 
ATOM   8665 C CG  . ASN F 1 129 ? -9.784  28.511  73.969 1.00 22.49  ? 620  ASN F CG  1 
ATOM   8666 O OD1 . ASN F 1 129 ? -9.277  28.003  74.971 1.00 23.92  ? 620  ASN F OD1 1 
ATOM   8667 N ND2 . ASN F 1 129 ? -11.037 28.293  73.620 1.00 21.51  ? 620  ASN F ND2 1 
ATOM   8668 N N   . LEU F 1 130 ? -9.221  31.285  70.307 1.00 27.24  ? 621  LEU F N   1 
ATOM   8669 C CA  . LEU F 1 130 ? -8.591  32.315  69.486 1.00 27.48  ? 621  LEU F CA  1 
ATOM   8670 C C   . LEU F 1 130 ? -8.154  33.528  70.303 1.00 27.82  ? 621  LEU F C   1 
ATOM   8671 O O   . LEU F 1 130 ? -8.942  34.126  71.032 1.00 29.94  ? 621  LEU F O   1 
ATOM   8672 C CB  . LEU F 1 130 ? -9.554  32.774  68.381 1.00 26.05  ? 621  LEU F CB  1 
ATOM   8673 C CG  . LEU F 1 130 ? -10.119 31.672  67.473 1.00 28.13  ? 621  LEU F CG  1 
ATOM   8674 C CD1 . LEU F 1 130 ? -11.185 32.248  66.564 1.00 29.06  ? 621  LEU F CD1 1 
ATOM   8675 C CD2 . LEU F 1 130 ? -9.007  31.049  66.653 1.00 26.43  ? 621  LEU F CD2 1 
ATOM   8676 N N   . ILE F 1 131 ? -6.884  33.881  70.192 1.00 29.54  ? 622  ILE F N   1 
ATOM   8677 C CA  . ILE F 1 131 ? -6.357  35.054  70.876 1.00 28.66  ? 622  ILE F CA  1 
ATOM   8678 C C   . ILE F 1 131 ? -6.229  36.080  69.753 1.00 28.84  ? 622  ILE F C   1 
ATOM   8679 O O   . ILE F 1 131 ? -5.289  36.033  68.960 1.00 28.24  ? 622  ILE F O   1 
ATOM   8680 C CB  . ILE F 1 131 ? -4.973  34.757  71.500 1.00 29.56  ? 622  ILE F CB  1 
ATOM   8681 C CG1 . ILE F 1 131 ? -5.119  33.689  72.593 1.00 27.81  ? 622  ILE F CG1 1 
ATOM   8682 C CG2 . ILE F 1 131 ? -4.354  36.040  72.035 1.00 26.04  ? 622  ILE F CG2 1 
ATOM   8683 C CD1 . ILE F 1 131 ? -3.805  33.212  73.169 1.00 27.00  ? 622  ILE F CD1 1 
ATOM   8684 N N   . LYS F 1 132 ? -7.202  36.982  69.664 1.00 28.86  ? 623  LYS F N   1 
ATOM   8685 C CA  . LYS F 1 132 ? -7.205  37.992  68.612 1.00 29.67  ? 623  LYS F CA  1 
ATOM   8686 C C   . LYS F 1 132 ? -5.948  38.846  68.517 1.00 28.42  ? 623  LYS F C   1 
ATOM   8687 O O   . LYS F 1 132 ? -5.270  39.114  69.501 1.00 27.88  ? 623  LYS F O   1 
ATOM   8688 C CB  . LYS F 1 132 ? -8.421  38.914  68.750 1.00 31.62  ? 623  LYS F CB  1 
ATOM   8689 C CG  . LYS F 1 132 ? -9.645  38.505  67.929 1.00 32.34  ? 623  LYS F CG  1 
ATOM   8690 C CD  . LYS F 1 132 ? -10.640 37.698  68.729 1.00 33.94  ? 623  LYS F CD  1 
ATOM   8691 C CE  . LYS F 1 132 ? -12.007 37.708  68.050 1.00 36.67  ? 623  LYS F CE  1 
ATOM   8692 N NZ  . LYS F 1 132 ? -13.106 37.228  68.948 1.00 37.24  ? 623  LYS F NZ  1 
ATOM   8693 N N   . GLN F 1 133 ? -5.657  39.280  67.302 1.00 29.35  ? 624  GLN F N   1 
ATOM   8694 C CA  . GLN F 1 133 ? -4.500  40.113  67.038 1.00 28.83  ? 624  GLN F CA  1 
ATOM   8695 C C   . GLN F 1 133 ? -4.847  41.199  66.028 1.00 27.72  ? 624  GLN F C   1 
ATOM   8696 O O   . GLN F 1 133 ? -5.962  41.252  65.510 1.00 27.00  ? 624  GLN F O   1 
ATOM   8697 C CB  . GLN F 1 133 ? -3.345  39.251  66.535 1.00 29.57  ? 624  GLN F CB  1 
ATOM   8698 C CG  . GLN F 1 133 ? -2.975  38.150  67.510 1.00 34.14  ? 624  GLN F CG  1 
ATOM   8699 C CD  . GLN F 1 133 ? -1.481  38.028  67.724 1.00 36.74  ? 624  GLN F CD  1 
ATOM   8700 O OE1 . GLN F 1 133 ? -0.823  38.979  68.132 1.00 41.01  ? 624  GLN F OE1 1 
ATOM   8701 N NE2 . GLN F 1 133 ? -0.938  36.853  67.453 1.00 39.72  ? 624  GLN F NE2 1 
ATOM   8702 N N   . ASP F 1 134 ? -3.883  42.071  65.769 1.00 28.13  ? 625  ASP F N   1 
ATOM   8703 C CA  . ASP F 1 134 ? -4.048  43.188  64.848 1.00 27.62  ? 625  ASP F CA  1 
ATOM   8704 C C   . ASP F 1 134 ? -4.761  42.764  63.566 1.00 27.26  ? 625  ASP F C   1 
ATOM   8705 O O   . ASP F 1 134 ? -4.316  41.846  62.879 1.00 27.47  ? 625  ASP F O   1 
ATOM   8706 C CB  . ASP F 1 134 ? -2.660  43.782  64.552 1.00 28.90  ? 625  ASP F CB  1 
ATOM   8707 C CG  . ASP F 1 134 ? -2.719  45.051  63.722 1.00 29.14  ? 625  ASP F CG  1 
ATOM   8708 O OD1 . ASP F 1 134 ? -3.746  45.757  63.742 1.00 28.80  ? 625  ASP F OD1 1 
ATOM   8709 O OD2 . ASP F 1 134 ? -1.714  45.351  63.055 1.00 30.76  ? 625  ASP F OD2 1 
ATOM   8710 N N   . ASP F 1 135 ? -5.878  43.425  63.262 1.00 26.82  ? 626  ASP F N   1 
ATOM   8711 C CA  . ASP F 1 135 ? -6.656  43.120  62.063 1.00 26.73  ? 626  ASP F CA  1 
ATOM   8712 C C   . ASP F 1 135 ? -6.237  43.994  60.881 1.00 27.80  ? 626  ASP F C   1 
ATOM   8713 O O   . ASP F 1 135 ? -6.962  44.105  59.879 1.00 27.10  ? 626  ASP F O   1 
ATOM   8714 C CB  . ASP F 1 135 ? -8.157  43.304  62.322 1.00 25.99  ? 626  ASP F CB  1 
ATOM   8715 C CG  . ASP F 1 135 ? -8.521  44.726  62.723 1.00 26.63  ? 626  ASP F CG  1 
ATOM   8716 O OD1 . ASP F 1 135 ? -7.747  45.662  62.423 1.00 26.84  ? 626  ASP F OD1 1 
ATOM   8717 O OD2 . ASP F 1 135 ? -9.602  44.912  63.326 1.00 24.61  ? 626  ASP F OD2 1 
ATOM   8718 N N   . GLY F 1 136 ? -5.070  44.626  61.012 1.00 27.65  ? 627  GLY F N   1 
ATOM   8719 C CA  . GLY F 1 136 ? -4.557  45.469  59.949 1.00 27.63  ? 627  GLY F CA  1 
ATOM   8720 C C   . GLY F 1 136 ? -5.243  46.810  59.804 1.00 28.21  ? 627  GLY F C   1 
ATOM   8721 O O   . GLY F 1 136 ? -5.136  47.449  58.762 1.00 29.87  ? 627  GLY F O   1 
ATOM   8722 N N   . GLY F 1 137 ? -5.952  47.243  60.840 1.00 28.52  ? 628  GLY F N   1 
ATOM   8723 C CA  . GLY F 1 137 ? -6.623  48.527  60.780 1.00 26.78  ? 628  GLY F CA  1 
ATOM   8724 C C   . GLY F 1 137 ? -7.937  48.533  60.027 1.00 26.46  ? 628  GLY F C   1 
ATOM   8725 O O   . GLY F 1 137 ? -8.384  49.581  59.578 1.00 27.13  ? 628  GLY F O   1 
ATOM   8726 N N   . SER F 1 138 ? -8.555  47.366  59.887 1.00 25.95  ? 629  SER F N   1 
ATOM   8727 C CA  . SER F 1 138 ? -9.835  47.242  59.198 1.00 25.27  ? 629  SER F CA  1 
ATOM   8728 C C   . SER F 1 138 ? -10.602 46.094  59.841 1.00 24.31  ? 629  SER F C   1 
ATOM   8729 O O   . SER F 1 138 ? -10.034 45.051  60.141 1.00 24.65  ? 629  SER F O   1 
ATOM   8730 C CB  . SER F 1 138 ? -9.623  46.953  57.714 1.00 27.33  ? 629  SER F CB  1 
ATOM   8731 O OG  . SER F 1 138 ? -10.849 46.577  57.103 1.00 34.05  ? 629  SER F OG  1 
ATOM   8732 N N   . PRO F 1 139 ? -11.911 46.256  60.038 1.00 24.12  ? 630  PRO F N   1 
ATOM   8733 C CA  . PRO F 1 139 ? -12.682 45.181  60.663 1.00 25.94  ? 630  PRO F CA  1 
ATOM   8734 C C   . PRO F 1 139 ? -12.469 43.818  60.014 1.00 27.53  ? 630  PRO F C   1 
ATOM   8735 O O   . PRO F 1 139 ? -12.325 43.699  58.793 1.00 29.04  ? 630  PRO F O   1 
ATOM   8736 C CB  . PRO F 1 139 ? -14.128 45.652  60.512 1.00 23.15  ? 630  PRO F CB  1 
ATOM   8737 C CG  . PRO F 1 139 ? -13.993 47.124  60.367 1.00 24.31  ? 630  PRO F CG  1 
ATOM   8738 C CD  . PRO F 1 139 ? -12.811 47.270  59.480 1.00 23.85  ? 630  PRO F CD  1 
ATOM   8739 N N   . ILE F 1 140 ? -12.439 42.792  60.847 1.00 27.81  ? 631  ILE F N   1 
ATOM   8740 C CA  . ILE F 1 140 ? -12.297 41.452  60.347 1.00 28.15  ? 631  ILE F CA  1 
ATOM   8741 C C   . ILE F 1 140 ? -13.685 41.023  59.900 1.00 28.84  ? 631  ILE F C   1 
ATOM   8742 O O   . ILE F 1 140 ? -14.672 41.230  60.610 1.00 27.60  ? 631  ILE F O   1 
ATOM   8743 C CB  . ILE F 1 140 ? -11.732 40.518  61.437 1.00 27.83  ? 631  ILE F CB  1 
ATOM   8744 C CG1 . ILE F 1 140 ? -10.238 40.809  61.583 1.00 26.76  ? 631  ILE F CG1 1 
ATOM   8745 C CG2 . ILE F 1 140 ? -12.001 39.044  61.089 1.00 26.02  ? 631  ILE F CG2 1 
ATOM   8746 C CD1 . ILE F 1 140 ? -9.445  39.695  62.190 1.00 29.66  ? 631  ILE F CD1 1 
ATOM   8747 N N   . ARG F 1 141 ? -13.752 40.451  58.705 1.00 29.85  ? 632  ARG F N   1 
ATOM   8748 C CA  . ARG F 1 141 ? -15.009 40.000  58.124 1.00 31.04  ? 632  ARG F CA  1 
ATOM   8749 C C   . ARG F 1 141 ? -15.288 38.540  58.434 1.00 30.45  ? 632  ARG F C   1 
ATOM   8750 O O   . ARG F 1 141 ? -16.441 38.152  58.595 1.00 29.94  ? 632  ARG F O   1 
ATOM   8751 C CB  . ARG F 1 141 ? -14.977 40.161  56.608 1.00 34.06  ? 632  ARG F CB  1 
ATOM   8752 C CG  . ARG F 1 141 ? -15.258 41.536  56.044 1.00 39.85  ? 632  ARG F CG  1 
ATOM   8753 C CD  . ARG F 1 141 ? -14.865 41.493  54.570 1.00 47.39  ? 632  ARG F CD  1 
ATOM   8754 N NE  . ARG F 1 141 ? -15.479 42.503  53.709 1.00 52.85  ? 632  ARG F NE  1 
ATOM   8755 C CZ  . ARG F 1 141 ? -15.429 43.816  53.914 1.00 55.76  ? 632  ARG F CZ  1 
ATOM   8756 N NH1 . ARG F 1 141 ? -14.799 44.316  54.975 1.00 56.01  ? 632  ARG F NH1 1 
ATOM   8757 N NH2 . ARG F 1 141 ? -15.979 44.636  53.026 1.00 55.99  ? 632  ARG F NH2 1 
ATOM   8758 N N   . HIS F 1 142 ? -14.231 37.732  58.498 1.00 30.61  ? 633  HIS F N   1 
ATOM   8759 C CA  . HIS F 1 142 ? -14.372 36.298  58.756 1.00 30.16  ? 633  HIS F CA  1 
ATOM   8760 C C   . HIS F 1 142 ? -13.089 35.639  59.263 1.00 30.18  ? 633  HIS F C   1 
ATOM   8761 O O   . HIS F 1 142 ? -11.979 36.102  59.005 1.00 30.31  ? 633  HIS F O   1 
ATOM   8762 C CB  . HIS F 1 142 ? -14.729 35.531  57.466 1.00 31.39  ? 633  HIS F CB  1 
ATOM   8763 C CG  . HIS F 1 142 ? -15.946 36.025  56.750 1.00 33.25  ? 633  HIS F CG  1 
ATOM   8764 N ND1 . HIS F 1 142 ? -17.225 35.832  57.229 1.00 34.46  ? 633  HIS F ND1 1 
ATOM   8765 C CD2 . HIS F 1 142 ? -16.078 36.690  55.578 1.00 33.32  ? 633  HIS F CD2 1 
ATOM   8766 C CE1 . HIS F 1 142 ? -18.092 36.358  56.382 1.00 34.96  ? 633  HIS F CE1 1 
ATOM   8767 N NE2 . HIS F 1 142 ? -17.421 36.885  55.372 1.00 35.65  ? 633  HIS F NE2 1 
ATOM   8768 N N   . TYR F 1 143 ? -13.262 34.534  59.976 1.00 30.04  ? 634  TYR F N   1 
ATOM   8769 C CA  . TYR F 1 143 ? -12.138 33.715  60.407 1.00 29.51  ? 634  TYR F CA  1 
ATOM   8770 C C   . TYR F 1 143 ? -12.386 32.482  59.529 1.00 30.58  ? 634  TYR F C   1 
ATOM   8771 O O   . TYR F 1 143 ? -13.500 31.937  59.516 1.00 29.67  ? 634  TYR F O   1 
ATOM   8772 C CB  . TYR F 1 143 ? -12.232 33.346  61.891 1.00 28.31  ? 634  TYR F CB  1 
ATOM   8773 C CG  . TYR F 1 143 ? -11.656 34.398  62.811 1.00 25.93  ? 634  TYR F CG  1 
ATOM   8774 C CD1 . TYR F 1 143 ? -10.282 34.629  62.860 1.00 25.51  ? 634  TYR F CD1 1 
ATOM   8775 C CD2 . TYR F 1 143 ? -12.493 35.219  63.576 1.00 25.35  ? 634  TYR F CD2 1 
ATOM   8776 C CE1 . TYR F 1 143 ? -9.753  35.661  63.638 1.00 25.27  ? 634  TYR F CE1 1 
ATOM   8777 C CE2 . TYR F 1 143 ? -11.980 36.248  64.352 1.00 24.80  ? 634  TYR F CE2 1 
ATOM   8778 C CZ  . TYR F 1 143 ? -10.613 36.466  64.376 1.00 25.04  ? 634  TYR F CZ  1 
ATOM   8779 O OH  . TYR F 1 143 ? -10.115 37.508  65.108 1.00 25.60  ? 634  TYR F OH  1 
ATOM   8780 N N   . LEU F 1 144 ? -11.382 32.087  58.749 1.00 30.08  ? 635  LEU F N   1 
ATOM   8781 C CA  . LEU F 1 144 ? -11.506 30.923  57.871 1.00 29.96  ? 635  LEU F CA  1 
ATOM   8782 C C   . LEU F 1 144 ? -10.844 29.757  58.597 1.00 30.60  ? 635  LEU F C   1 
ATOM   8783 O O   . LEU F 1 144 ? -9.667  29.823  58.933 1.00 32.95  ? 635  LEU F O   1 
ATOM   8784 C CB  . LEU F 1 144 ? -10.807 31.194  56.534 1.00 26.69  ? 635  LEU F CB  1 
ATOM   8785 C CG  . LEU F 1 144 ? -11.279 32.443  55.780 1.00 26.78  ? 635  LEU F CG  1 
ATOM   8786 C CD1 . LEU F 1 144 ? -10.391 32.693  54.564 1.00 23.59  ? 635  LEU F CD1 1 
ATOM   8787 C CD2 . LEU F 1 144 ? -12.732 32.277  55.361 1.00 25.43  ? 635  LEU F CD2 1 
ATOM   8788 N N   . VAL F 1 145 ? -11.598 28.693  58.843 1.00 31.14  ? 636  VAL F N   1 
ATOM   8789 C CA  . VAL F 1 145 ? -11.070 27.544  59.569 1.00 31.51  ? 636  VAL F CA  1 
ATOM   8790 C C   . VAL F 1 145 ? -11.099 26.240  58.781 1.00 32.14  ? 636  VAL F C   1 
ATOM   8791 O O   . VAL F 1 145 ? -12.068 25.951  58.079 1.00 33.38  ? 636  VAL F O   1 
ATOM   8792 C CB  . VAL F 1 145 ? -11.874 27.317  60.866 1.00 31.65  ? 636  VAL F CB  1 
ATOM   8793 C CG1 . VAL F 1 145 ? -11.209 26.254  61.724 1.00 29.74  ? 636  VAL F CG1 1 
ATOM   8794 C CG2 . VAL F 1 145 ? -12.013 28.620  61.621 1.00 31.61  ? 636  VAL F CG2 1 
ATOM   8795 N N   . ARG F 1 146 ? -10.038 25.451  58.910 1.00 31.36  ? 637  ARG F N   1 
ATOM   8796 C CA  . ARG F 1 146 ? -9.956  24.155  58.249 1.00 31.00  ? 637  ARG F CA  1 
ATOM   8797 C C   . ARG F 1 146 ? -9.162  23.225  59.134 1.00 31.25  ? 637  ARG F C   1 
ATOM   8798 O O   . ARG F 1 146 ? -8.300  23.663  59.887 1.00 31.10  ? 637  ARG F O   1 
ATOM   8799 C CB  . ARG F 1 146 ? -9.262  24.262  56.892 1.00 31.77  ? 637  ARG F CB  1 
ATOM   8800 C CG  . ARG F 1 146 ? -9.930  25.246  55.983 1.00 36.05  ? 637  ARG F CG  1 
ATOM   8801 C CD  . ARG F 1 146 ? -9.525  25.099  54.546 1.00 37.13  ? 637  ARG F CD  1 
ATOM   8802 N NE  . ARG F 1 146 ? -8.101  25.300  54.323 1.00 39.92  ? 637  ARG F NE  1 
ATOM   8803 C CZ  . ARG F 1 146 ? -7.605  26.013  53.313 1.00 40.75  ? 637  ARG F CZ  1 
ATOM   8804 N NH1 . ARG F 1 146 ? -8.426  26.602  52.453 1.00 36.51  ? 637  ARG F NH1 1 
ATOM   8805 N NH2 . ARG F 1 146 ? -6.289  26.100  53.138 1.00 41.00  ? 637  ARG F NH2 1 
ATOM   8806 N N   . TYR F 1 147 ? -9.469  21.939  59.071 1.00 31.99  ? 638  TYR F N   1 
ATOM   8807 C CA  . TYR F 1 147 ? -8.719  20.980  59.856 1.00 32.80  ? 638  TYR F CA  1 
ATOM   8808 C C   . TYR F 1 147 ? -8.481  19.753  58.976 1.00 33.51  ? 638  TYR F C   1 
ATOM   8809 O O   . TYR F 1 147 ? -9.139  19.581  57.943 1.00 34.76  ? 638  TYR F O   1 
ATOM   8810 C CB  . TYR F 1 147 ? -9.451  20.663  61.177 1.00 31.68  ? 638  TYR F CB  1 
ATOM   8811 C CG  . TYR F 1 147 ? -10.589 19.677  61.109 1.00 33.06  ? 638  TYR F CG  1 
ATOM   8812 C CD1 . TYR F 1 147 ? -10.430 18.382  61.602 1.00 34.74  ? 638  TYR F CD1 1 
ATOM   8813 C CD2 . TYR F 1 147 ? -11.818 20.023  60.552 1.00 33.18  ? 638  TYR F CD2 1 
ATOM   8814 C CE1 . TYR F 1 147 ? -11.460 17.458  61.541 1.00 35.34  ? 638  TYR F CE1 1 
ATOM   8815 C CE2 . TYR F 1 147 ? -12.859 19.098  60.484 1.00 34.07  ? 638  TYR F CE2 1 
ATOM   8816 C CZ  . TYR F 1 147 ? -12.664 17.820  60.978 1.00 35.08  ? 638  TYR F CZ  1 
ATOM   8817 O OH  . TYR F 1 147 ? -13.654 16.879  60.888 1.00 37.75  ? 638  TYR F OH  1 
ATOM   8818 N N   . ARG F 1 148 ? -7.511  18.926  59.349 1.00 32.39  ? 639  ARG F N   1 
ATOM   8819 C CA  . ARG F 1 148 ? -7.201  17.756  58.551 1.00 29.92  ? 639  ARG F CA  1 
ATOM   8820 C C   . ARG F 1 148 ? -6.470  16.738  59.381 1.00 29.22  ? 639  ARG F C   1 
ATOM   8821 O O   . ARG F 1 148 ? -5.822  17.075  60.364 1.00 31.06  ? 639  ARG F O   1 
ATOM   8822 C CB  . ARG F 1 148 ? -6.306  18.148  57.382 1.00 29.46  ? 639  ARG F CB  1 
ATOM   8823 C CG  . ARG F 1 148 ? -4.881  18.435  57.813 1.00 29.68  ? 639  ARG F CG  1 
ATOM   8824 C CD  . ARG F 1 148 ? -4.101  19.188  56.740 1.00 30.70  ? 639  ARG F CD  1 
ATOM   8825 N NE  . ARG F 1 148 ? -2.705  19.379  57.118 1.00 28.69  ? 639  ARG F NE  1 
ATOM   8826 C CZ  . ARG F 1 148 ? -1.778  18.429  57.043 1.00 30.27  ? 639  ARG F CZ  1 
ATOM   8827 N NH1 . ARG F 1 148 ? -2.100  17.220  56.599 1.00 29.22  ? 639  ARG F NH1 1 
ATOM   8828 N NH2 . ARG F 1 148 ? -0.529  18.683  57.415 1.00 29.89  ? 639  ARG F NH2 1 
ATOM   8829 N N   . ALA F 1 149 ? -6.577  15.482  58.973 1.00 28.10  ? 640  ALA F N   1 
ATOM   8830 C CA  . ALA F 1 149 ? -5.892  14.403  59.655 1.00 24.99  ? 640  ALA F CA  1 
ATOM   8831 C C   . ALA F 1 149 ? -4.563  14.297  58.931 1.00 24.51  ? 640  ALA F C   1 
ATOM   8832 O O   . ALA F 1 149 ? -4.520  14.333  57.699 1.00 23.40  ? 640  ALA F O   1 
ATOM   8833 C CB  . ALA F 1 149 ? -6.676  13.123  59.513 1.00 22.47  ? 640  ALA F CB  1 
ATOM   8834 N N   . LEU F 1 150 ? -3.473  14.206  59.684 1.00 24.94  ? 641  LEU F N   1 
ATOM   8835 C CA  . LEU F 1 150 ? -2.162  14.092  59.054 1.00 25.02  ? 641  LEU F CA  1 
ATOM   8836 C C   . LEU F 1 150 ? -2.227  12.971  57.998 1.00 27.27  ? 641  LEU F C   1 
ATOM   8837 O O   . LEU F 1 150 ? -2.987  12.001  58.157 1.00 27.48  ? 641  LEU F O   1 
ATOM   8838 C CB  . LEU F 1 150 ? -1.086  13.818  60.110 1.00 18.77  ? 641  LEU F CB  1 
ATOM   8839 C CG  . LEU F 1 150 ? -1.007  14.893  61.202 1.00 18.44  ? 641  LEU F CG  1 
ATOM   8840 C CD1 . LEU F 1 150 ? 0.279   14.739  62.000 1.00 14.59  ? 641  LEU F CD1 1 
ATOM   8841 C CD2 . LEU F 1 150 ? -1.061  16.284  60.584 1.00 14.73  ? 641  LEU F CD2 1 
ATOM   8842 N N   . SER F 1 151 ? -1.454  13.143  56.922 1.00 27.90  ? 642  SER F N   1 
ATOM   8843 C CA  . SER F 1 151 ? -1.386  12.223  55.784 1.00 28.83  ? 642  SER F CA  1 
ATOM   8844 C C   . SER F 1 151 ? -2.557  12.475  54.833 1.00 29.31  ? 642  SER F C   1 
ATOM   8845 O O   . SER F 1 151 ? -2.739  11.746  53.858 1.00 28.78  ? 642  SER F O   1 
ATOM   8846 C CB  . SER F 1 151 ? -1.427  10.758  56.226 1.00 31.04  ? 642  SER F CB  1 
ATOM   8847 O OG  . SER F 1 151 ? -2.703  10.183  55.947 1.00 35.45  ? 642  SER F OG  1 
ATOM   8848 N N   . SER F 1 152 ? -3.351  13.502  55.126 1.00 30.05  ? 643  SER F N   1 
ATOM   8849 C CA  . SER F 1 152 ? -4.502  13.843  54.295 1.00 29.65  ? 643  SER F CA  1 
ATOM   8850 C C   . SER F 1 152 ? -4.578  15.329  54.020 1.00 29.33  ? 643  SER F C   1 
ATOM   8851 O O   . SER F 1 152 ? -3.982  16.140  54.724 1.00 30.16  ? 643  SER F O   1 
ATOM   8852 C CB  . SER F 1 152 ? -5.800  13.395  54.970 1.00 31.04  ? 643  SER F CB  1 
ATOM   8853 O OG  . SER F 1 152 ? -5.850  11.985  55.090 1.00 35.42  ? 643  SER F OG  1 
ATOM   8854 N N   . GLU F 1 153 ? -5.338  15.680  52.995 1.00 30.66  ? 644  GLU F N   1 
ATOM   8855 C CA  . GLU F 1 153 ? -5.513  17.068  52.596 1.00 32.29  ? 644  GLU F CA  1 
ATOM   8856 C C   . GLU F 1 153 ? -6.595  17.716  53.472 1.00 31.60  ? 644  GLU F C   1 
ATOM   8857 O O   . GLU F 1 153 ? -7.283  17.033  54.231 1.00 30.61  ? 644  GLU F O   1 
ATOM   8858 C CB  . GLU F 1 153 ? -5.918  17.105  51.121 1.00 36.71  ? 644  GLU F CB  1 
ATOM   8859 C CG  . GLU F 1 153 ? -5.781  18.453  50.432 1.00 43.05  ? 644  GLU F CG  1 
ATOM   8860 C CD  . GLU F 1 153 ? -4.336  18.924  50.333 1.00 45.86  ? 644  GLU F CD  1 
ATOM   8861 O OE1 . GLU F 1 153 ? -3.424  18.067  50.180 1.00 43.64  ? 644  GLU F OE1 1 
ATOM   8862 O OE2 . GLU F 1 153 ? -4.130  20.159  50.392 1.00 46.77  ? 644  GLU F OE2 1 
ATOM   8863 N N   . TRP F 1 154 ? -6.744  19.031  53.360 1.00 31.12  ? 645  TRP F N   1 
ATOM   8864 C CA  . TRP F 1 154 ? -7.728  19.772  54.149 1.00 30.98  ? 645  TRP F CA  1 
ATOM   8865 C C   . TRP F 1 154 ? -9.175  19.332  53.920 1.00 30.74  ? 645  TRP F C   1 
ATOM   8866 O O   . TRP F 1 154 ? -9.533  18.925  52.819 1.00 31.43  ? 645  TRP F O   1 
ATOM   8867 C CB  . TRP F 1 154 ? -7.643  21.273  53.834 1.00 28.94  ? 645  TRP F CB  1 
ATOM   8868 C CG  . TRP F 1 154 ? -6.398  21.932  54.269 1.00 28.68  ? 645  TRP F CG  1 
ATOM   8869 C CD1 . TRP F 1 154 ? -5.504  22.581  53.478 1.00 28.20  ? 645  TRP F CD1 1 
ATOM   8870 C CD2 . TRP F 1 154 ? -5.896  22.028  55.610 1.00 30.58  ? 645  TRP F CD2 1 
ATOM   8871 N NE1 . TRP F 1 154 ? -4.471  23.079  54.235 1.00 29.79  ? 645  TRP F NE1 1 
ATOM   8872 C CE2 . TRP F 1 154 ? -4.684  22.756  55.549 1.00 29.44  ? 645  TRP F CE2 1 
ATOM   8873 C CE3 . TRP F 1 154 ? -6.352  21.572  56.859 1.00 30.30  ? 645  TRP F CE3 1 
ATOM   8874 C CZ2 . TRP F 1 154 ? -3.915  23.041  56.688 1.00 28.15  ? 645  TRP F CZ2 1 
ATOM   8875 C CZ3 . TRP F 1 154 ? -5.585  21.858  57.998 1.00 29.03  ? 645  TRP F CZ3 1 
ATOM   8876 C CH2 . TRP F 1 154 ? -4.379  22.586  57.899 1.00 28.47  ? 645  TRP F CH2 1 
ATOM   8877 N N   . LYS F 1 155 ? -9.997  19.416  54.968 1.00 29.04  ? 646  LYS F N   1 
ATOM   8878 C CA  . LYS F 1 155 ? -11.414 19.093  54.856 1.00 28.58  ? 646  LYS F CA  1 
ATOM   8879 C C   . LYS F 1 155 ? -12.119 20.399  54.489 1.00 29.17  ? 646  LYS F C   1 
ATOM   8880 O O   . LYS F 1 155 ? -11.501 21.462  54.481 1.00 30.24  ? 646  LYS F O   1 
ATOM   8881 C CB  . LYS F 1 155 ? -11.964 18.564  56.175 1.00 27.36  ? 646  LYS F CB  1 
ATOM   8882 C CG  . LYS F 1 155 ? -11.663 17.113  56.442 1.00 27.27  ? 646  LYS F CG  1 
ATOM   8883 C CD  . LYS F 1 155 ? -12.187 16.701  57.797 1.00 28.48  ? 646  LYS F CD  1 
ATOM   8884 C CE  . LYS F 1 155 ? -11.793 15.274  58.143 1.00 31.88  ? 646  LYS F CE  1 
ATOM   8885 N NZ  . LYS F 1 155 ? -12.389 14.290  57.196 1.00 33.13  ? 646  LYS F NZ  1 
ATOM   8886 N N   . PRO F 1 156 ? -13.420 20.341  54.178 1.00 28.97  ? 647  PRO F N   1 
ATOM   8887 C CA  . PRO F 1 156 ? -14.181 21.543  53.809 1.00 28.84  ? 647  PRO F CA  1 
ATOM   8888 C C   . PRO F 1 156 ? -14.077 22.727  54.770 1.00 28.20  ? 647  PRO F C   1 
ATOM   8889 O O   . PRO F 1 156 ? -14.460 22.642  55.934 1.00 28.07  ? 647  PRO F O   1 
ATOM   8890 C CB  . PRO F 1 156 ? -15.603 21.014  53.686 1.00 28.35  ? 647  PRO F CB  1 
ATOM   8891 C CG  . PRO F 1 156 ? -15.369 19.648  53.129 1.00 27.69  ? 647  PRO F CG  1 
ATOM   8892 C CD  . PRO F 1 156 ? -14.245 19.137  54.005 1.00 28.35  ? 647  PRO F CD  1 
ATOM   8893 N N   . GLU F 1 157 ? -13.572 23.834  54.243 1.00 29.09  ? 648  GLU F N   1 
ATOM   8894 C CA  . GLU F 1 157 ? -13.382 25.074  54.988 1.00 31.06  ? 648  GLU F CA  1 
ATOM   8895 C C   . GLU F 1 157 ? -14.628 25.579  55.713 1.00 33.07  ? 648  GLU F C   1 
ATOM   8896 O O   . GLU F 1 157 ? -15.728 25.545  55.175 1.00 34.34  ? 648  GLU F O   1 
ATOM   8897 C CB  . GLU F 1 157 ? -12.864 26.151  54.037 1.00 29.02  ? 648  GLU F CB  1 
ATOM   8898 C CG  . GLU F 1 157 ? -12.688 27.509  54.658 1.00 32.22  ? 648  GLU F CG  1 
ATOM   8899 C CD  . GLU F 1 157 ? -11.747 28.391  53.860 1.00 33.28  ? 648  GLU F CD  1 
ATOM   8900 O OE1 . GLU F 1 157 ? -10.552 28.036  53.735 1.00 32.86  ? 648  GLU F OE1 1 
ATOM   8901 O OE2 . GLU F 1 157 ? -12.203 29.440  53.359 1.00 35.74  ? 648  GLU F OE2 1 
ATOM   8902 N N   . ILE F 1 158 ? -14.427 26.073  56.931 1.00 34.67  ? 649  ILE F N   1 
ATOM   8903 C CA  . ILE F 1 158 ? -15.504 26.589  57.774 1.00 36.65  ? 649  ILE F CA  1 
ATOM   8904 C C   . ILE F 1 158 ? -15.380 28.106  57.914 1.00 37.36  ? 649  ILE F C   1 
ATOM   8905 O O   . ILE F 1 158 ? -14.316 28.598  58.280 1.00 39.97  ? 649  ILE F O   1 
ATOM   8906 C CB  . ILE F 1 158 ? -15.414 25.985  59.205 1.00 37.82  ? 649  ILE F CB  1 
ATOM   8907 C CG1 . ILE F 1 158 ? -15.203 24.465  59.122 1.00 38.40  ? 649  ILE F CG1 1 
ATOM   8908 C CG2 . ILE F 1 158 ? -16.661 26.331  60.010 1.00 36.13  ? 649  ILE F CG2 1 
ATOM   8909 C CD1 . ILE F 1 158 ? -15.042 23.772  60.473 1.00 35.07  ? 649  ILE F CD1 1 
ATOM   8910 N N   . ARG F 1 159 ? -16.450 28.843  57.624 1.00 36.63  ? 650  ARG F N   1 
ATOM   8911 C CA  . ARG F 1 159 ? -16.441 30.300  57.774 1.00 37.27  ? 650  ARG F CA  1 
ATOM   8912 C C   . ARG F 1 159 ? -17.116 30.670  59.098 1.00 36.31  ? 650  ARG F C   1 
ATOM   8913 O O   . ARG F 1 159 ? -18.195 30.174  59.404 1.00 37.65  ? 650  ARG F O   1 
ATOM   8914 C CB  . ARG F 1 159 ? -17.183 30.981  56.620 1.00 38.69  ? 650  ARG F CB  1 
ATOM   8915 C CG  . ARG F 1 159 ? -16.399 31.033  55.331 1.00 42.95  ? 650  ARG F CG  1 
ATOM   8916 C CD  . ARG F 1 159 ? -17.224 31.550  54.159 1.00 46.15  ? 650  ARG F CD  1 
ATOM   8917 N NE  . ARG F 1 159 ? -17.691 32.922  54.347 1.00 50.71  ? 650  ARG F NE  1 
ATOM   8918 C CZ  . ARG F 1 159 ? -18.113 33.708  53.358 1.00 52.83  ? 650  ARG F CZ  1 
ATOM   8919 N NH1 . ARG F 1 159 ? -18.126 33.263  52.107 1.00 53.69  ? 650  ARG F NH1 1 
ATOM   8920 N NH2 . ARG F 1 159 ? -18.525 34.943  53.615 1.00 54.26  ? 650  ARG F NH2 1 
ATOM   8921 N N   . LEU F 1 160 ? -16.479 31.534  59.882 1.00 33.44  ? 651  LEU F N   1 
ATOM   8922 C CA  . LEU F 1 160 ? -17.031 31.947  61.163 1.00 30.53  ? 651  LEU F CA  1 
ATOM   8923 C C   . LEU F 1 160 ? -17.047 33.463  61.264 1.00 29.85  ? 651  LEU F C   1 
ATOM   8924 O O   . LEU F 1 160 ? -16.279 34.139  60.584 1.00 30.95  ? 651  LEU F O   1 
ATOM   8925 C CB  . LEU F 1 160 ? -16.205 31.347  62.294 1.00 30.96  ? 651  LEU F CB  1 
ATOM   8926 C CG  . LEU F 1 160 ? -16.136 29.817  62.237 1.00 31.35  ? 651  LEU F CG  1 
ATOM   8927 C CD1 . LEU F 1 160 ? -15.141 29.290  63.275 1.00 31.09  ? 651  LEU F CD1 1 
ATOM   8928 C CD2 . LEU F 1 160 ? -17.530 29.239  62.467 1.00 30.31  ? 651  LEU F CD2 1 
ATOM   8929 N N   . PRO F 1 161 ? -17.931 34.019  62.110 1.00 28.72  ? 652  PRO F N   1 
ATOM   8930 C CA  . PRO F 1 161 ? -18.055 35.468  62.302 1.00 28.42  ? 652  PRO F CA  1 
ATOM   8931 C C   . PRO F 1 161 ? -16.845 36.067  63.013 1.00 29.23  ? 652  PRO F C   1 
ATOM   8932 O O   . PRO F 1 161 ? -16.094 35.355  63.674 1.00 31.07  ? 652  PRO F O   1 
ATOM   8933 C CB  . PRO F 1 161 ? -19.323 35.596  63.144 1.00 26.79  ? 652  PRO F CB  1 
ATOM   8934 C CG  . PRO F 1 161 ? -20.057 34.329  62.894 1.00 24.73  ? 652  PRO F CG  1 
ATOM   8935 C CD  . PRO F 1 161 ? -18.959 33.321  62.893 1.00 26.86  ? 652  PRO F CD  1 
ATOM   8936 N N   . SER F 1 162 ? -16.661 37.378  62.889 1.00 28.73  ? 653  SER F N   1 
ATOM   8937 C CA  . SER F 1 162 ? -15.535 38.035  63.541 1.00 28.23  ? 653  SER F CA  1 
ATOM   8938 C C   . SER F 1 162 ? -15.632 37.923  65.051 1.00 29.05  ? 653  SER F C   1 
ATOM   8939 O O   . SER F 1 162 ? -14.635 38.084  65.755 1.00 31.61  ? 653  SER F O   1 
ATOM   8940 C CB  . SER F 1 162 ? -15.502 39.510  63.190 1.00 27.69  ? 653  SER F CB  1 
ATOM   8941 O OG  . SER F 1 162 ? -16.554 40.170  63.856 1.00 26.70  ? 653  SER F OG  1 
ATOM   8942 N N   . GLY F 1 163 ? -16.834 37.657  65.548 1.00 29.02  ? 654  GLY F N   1 
ATOM   8943 C CA  . GLY F 1 163 ? -17.033 37.570  66.983 1.00 29.72  ? 654  GLY F CA  1 
ATOM   8944 C C   . GLY F 1 163 ? -16.658 36.244  67.592 1.00 30.17  ? 654  GLY F C   1 
ATOM   8945 O O   . GLY F 1 163 ? -16.711 36.062  68.814 1.00 30.26  ? 654  GLY F O   1 
ATOM   8946 N N   . SER F 1 164 ? -16.268 35.315  66.734 1.00 30.57  ? 655  SER F N   1 
ATOM   8947 C CA  . SER F 1 164 ? -15.891 33.987  67.176 1.00 31.58  ? 655  SER F CA  1 
ATOM   8948 C C   . SER F 1 164 ? -14.741 34.039  68.176 1.00 31.19  ? 655  SER F C   1 
ATOM   8949 O O   . SER F 1 164 ? -13.812 34.826  68.011 1.00 32.61  ? 655  SER F O   1 
ATOM   8950 C CB  . SER F 1 164 ? -15.516 33.140  65.958 1.00 31.46  ? 655  SER F CB  1 
ATOM   8951 O OG  . SER F 1 164 ? -16.622 33.049  65.071 1.00 32.67  ? 655  SER F OG  1 
ATOM   8952 N N   . ASP F 1 165 ? -14.821 33.212  69.217 1.00 29.55  ? 656  ASP F N   1 
ATOM   8953 C CA  . ASP F 1 165 ? -13.782 33.150  70.236 1.00 29.02  ? 656  ASP F CA  1 
ATOM   8954 C C   . ASP F 1 165 ? -13.195 31.743  70.294 1.00 28.97  ? 656  ASP F C   1 
ATOM   8955 O O   . ASP F 1 165 ? -12.069 31.531  70.755 1.00 26.16  ? 656  ASP F O   1 
ATOM   8956 C CB  . ASP F 1 165 ? -14.346 33.535  71.614 1.00 30.29  ? 656  ASP F CB  1 
ATOM   8957 C CG  . ASP F 1 165 ? -14.784 35.004  71.696 1.00 32.16  ? 656  ASP F CG  1 
ATOM   8958 O OD1 . ASP F 1 165 ? -14.068 35.888  71.164 1.00 34.25  ? 656  ASP F OD1 1 
ATOM   8959 O OD2 . ASP F 1 165 ? -15.836 35.279  72.317 1.00 30.67  ? 656  ASP F OD2 1 
ATOM   8960 N N   . HIS F 1 166 ? -13.967 30.779  69.815 1.00 30.44  ? 657  HIS F N   1 
ATOM   8961 C CA  . HIS F 1 166 ? -13.526 29.392  69.812 1.00 33.98  ? 657  HIS F CA  1 
ATOM   8962 C C   . HIS F 1 166 ? -13.963 28.632  68.563 1.00 35.17  ? 657  HIS F C   1 
ATOM   8963 O O   . HIS F 1 166 ? -14.822 29.075  67.789 1.00 34.87  ? 657  HIS F O   1 
ATOM   8964 C CB  . HIS F 1 166 ? -14.103 28.638  71.015 1.00 36.34  ? 657  HIS F CB  1 
ATOM   8965 C CG  . HIS F 1 166 ? -14.145 29.440  72.277 1.00 39.99  ? 657  HIS F CG  1 
ATOM   8966 N ND1 . HIS F 1 166 ? -13.009 29.849  72.941 1.00 42.17  ? 657  HIS F ND1 1 
ATOM   8967 C CD2 . HIS F 1 166 ? -15.192 29.915  72.993 1.00 41.00  ? 657  HIS F CD2 1 
ATOM   8968 C CE1 . HIS F 1 166 ? -13.353 30.543  74.012 1.00 41.86  ? 657  HIS F CE1 1 
ATOM   8969 N NE2 . HIS F 1 166 ? -14.672 30.598  74.066 1.00 42.37  ? 657  HIS F NE2 1 
ATOM   8970 N N   . VAL F 1 167 ? -13.351 27.473  68.384 1.00 35.79  ? 658  VAL F N   1 
ATOM   8971 C CA  . VAL F 1 167 ? -13.697 26.578  67.298 1.00 38.06  ? 658  VAL F CA  1 
ATOM   8972 C C   . VAL F 1 167 ? -13.636 25.195  67.957 1.00 38.58  ? 658  VAL F C   1 
ATOM   8973 O O   . VAL F 1 167 ? -12.603 24.772  68.484 1.00 39.56  ? 658  VAL F O   1 
ATOM   8974 C CB  . VAL F 1 167 ? -12.729 26.709  66.095 1.00 37.33  ? 658  VAL F CB  1 
ATOM   8975 C CG1 . VAL F 1 167 ? -11.307 26.486  66.531 1.00 41.53  ? 658  VAL F CG1 1 
ATOM   8976 C CG2 . VAL F 1 167 ? -13.111 25.717  65.024 1.00 37.49  ? 658  VAL F CG2 1 
ATOM   8977 N N   . MET F 1 168 ? -14.777 24.522  67.969 1.00 39.01  ? 659  MET F N   1 
ATOM   8978 C CA  . MET F 1 168 ? -14.906 23.213  68.594 1.00 39.50  ? 659  MET F CA  1 
ATOM   8979 C C   . MET F 1 168 ? -14.971 22.087  67.563 1.00 37.94  ? 659  MET F C   1 
ATOM   8980 O O   . MET F 1 168 ? -15.821 22.098  66.673 1.00 37.35  ? 659  MET F O   1 
ATOM   8981 C CB  . MET F 1 168 ? -16.174 23.211  69.456 1.00 41.59  ? 659  MET F CB  1 
ATOM   8982 C CG  . MET F 1 168 ? -16.503 21.895  70.119 1.00 44.38  ? 659  MET F CG  1 
ATOM   8983 S SD  . MET F 1 168 ? -15.356 21.515  71.436 1.00 48.87  ? 659  MET F SD  1 
ATOM   8984 C CE  . MET F 1 168 ? -15.526 23.012  72.422 1.00 44.78  ? 659  MET F CE  1 
ATOM   8985 N N   . LEU F 1 169 ? -14.074 21.116  67.683 1.00 37.07  ? 660  LEU F N   1 
ATOM   8986 C CA  . LEU F 1 169 ? -14.066 19.991  66.758 1.00 37.51  ? 660  LEU F CA  1 
ATOM   8987 C C   . LEU F 1 169 ? -14.425 18.688  67.488 1.00 38.37  ? 660  LEU F C   1 
ATOM   8988 O O   . LEU F 1 169 ? -13.690 18.237  68.357 1.00 38.30  ? 660  LEU F O   1 
ATOM   8989 C CB  . LEU F 1 169 ? -12.696 19.890  66.093 1.00 37.33  ? 660  LEU F CB  1 
ATOM   8990 C CG  . LEU F 1 169 ? -12.258 21.120  65.290 1.00 36.75  ? 660  LEU F CG  1 
ATOM   8991 C CD1 . LEU F 1 169 ? -10.838 20.927  64.790 1.00 37.44  ? 660  LEU F CD1 1 
ATOM   8992 C CD2 . LEU F 1 169 ? -13.201 21.352  64.132 1.00 35.55  ? 660  LEU F CD2 1 
ATOM   8993 N N   . LYS F 1 170 ? -15.575 18.107  67.140 1.00 41.15  ? 661  LYS F N   1 
ATOM   8994 C CA  . LYS F 1 170 ? -16.063 16.871  67.764 1.00 43.64  ? 661  LYS F CA  1 
ATOM   8995 C C   . LYS F 1 170 ? -16.072 15.661  66.831 1.00 43.91  ? 661  LYS F C   1 
ATOM   8996 O O   . LYS F 1 170 ? -15.938 15.786  65.615 1.00 43.43  ? 661  LYS F O   1 
ATOM   8997 C CB  . LYS F 1 170 ? -17.499 17.048  68.272 1.00 46.14  ? 661  LYS F CB  1 
ATOM   8998 C CG  . LYS F 1 170 ? -17.684 17.889  69.521 1.00 51.50  ? 661  LYS F CG  1 
ATOM   8999 C CD  . LYS F 1 170 ? -19.126 17.772  70.039 1.00 53.61  ? 661  LYS F CD  1 
ATOM   9000 C CE  . LYS F 1 170 ? -19.337 18.569  71.328 1.00 56.65  ? 661  LYS F CE  1 
ATOM   9001 N NZ  . LYS F 1 170 ? -20.624 18.233  72.028 1.00 57.90  ? 661  LYS F NZ  1 
ATOM   9002 N N   . SER F 1 171 ? -16.250 14.485  67.425 1.00 44.62  ? 662  SER F N   1 
ATOM   9003 C CA  . SER F 1 171 ? -16.333 13.240  66.670 1.00 45.28  ? 662  SER F CA  1 
ATOM   9004 C C   . SER F 1 171 ? -15.126 12.977  65.791 1.00 45.04  ? 662  SER F C   1 
ATOM   9005 O O   . SER F 1 171 ? -15.269 12.613  64.621 1.00 45.94  ? 662  SER F O   1 
ATOM   9006 C CB  . SER F 1 171 ? -17.594 13.247  65.796 1.00 45.25  ? 662  SER F CB  1 
ATOM   9007 O OG  . SER F 1 171 ? -18.753 13.489  66.578 1.00 45.97  ? 662  SER F OG  1 
ATOM   9008 N N   . LEU F 1 172 ? -13.937 13.177  66.345 1.00 43.56  ? 663  LEU F N   1 
ATOM   9009 C CA  . LEU F 1 172 ? -12.709 12.936  65.598 1.00 40.72  ? 663  LEU F CA  1 
ATOM   9010 C C   . LEU F 1 172 ? -12.415 11.457  65.772 1.00 40.11  ? 663  LEU F C   1 
ATOM   9011 O O   . LEU F 1 172 ? -13.146 10.752  66.470 1.00 39.92  ? 663  LEU F O   1 
ATOM   9012 C CB  . LEU F 1 172 ? -11.553 13.763  66.181 1.00 38.97  ? 663  LEU F CB  1 
ATOM   9013 C CG  . LEU F 1 172 ? -11.700 15.288  66.183 1.00 37.31  ? 663  LEU F CG  1 
ATOM   9014 C CD1 . LEU F 1 172 ? -10.534 15.918  66.901 1.00 34.23  ? 663  LEU F CD1 1 
ATOM   9015 C CD2 . LEU F 1 172 ? -11.779 15.798  64.756 1.00 37.49  ? 663  LEU F CD2 1 
ATOM   9016 N N   . ASP F 1 173 ? -11.356 10.984  65.131 1.00 39.09  ? 664  ASP F N   1 
ATOM   9017 C CA  . ASP F 1 173 ? -10.963 9.593   65.270 1.00 38.49  ? 664  ASP F CA  1 
ATOM   9018 C C   . ASP F 1 173 ? -10.126 9.475   66.535 1.00 37.80  ? 664  ASP F C   1 
ATOM   9019 O O   . ASP F 1 173 ? -9.518  10.452  66.980 1.00 38.42  ? 664  ASP F O   1 
ATOM   9020 C CB  . ASP F 1 173 ? -10.156 9.137   64.053 1.00 39.77  ? 664  ASP F CB  1 
ATOM   9021 C CG  . ASP F 1 173 ? -11.036 8.877   62.846 1.00 41.36  ? 664  ASP F CG  1 
ATOM   9022 O OD1 . ASP F 1 173 ? -12.088 8.240   63.033 1.00 42.97  ? 664  ASP F OD1 1 
ATOM   9023 O OD2 . ASP F 1 173 ? -10.689 9.293   61.718 1.00 43.02  ? 664  ASP F OD2 1 
ATOM   9024 N N   . TRP F 1 174 ? -10.118 8.292   67.130 1.00 36.49  ? 665  TRP F N   1 
ATOM   9025 C CA  . TRP F 1 174 ? -9.346  8.069   68.340 1.00 36.15  ? 665  TRP F CA  1 
ATOM   9026 C C   . TRP F 1 174 ? -7.934  7.759   67.932 1.00 35.07  ? 665  TRP F C   1 
ATOM   9027 O O   . TRP F 1 174 ? -7.700  7.331   66.805 1.00 34.91  ? 665  TRP F O   1 
ATOM   9028 C CB  . TRP F 1 174 ? -9.904  6.884   69.141 1.00 38.55  ? 665  TRP F CB  1 
ATOM   9029 C CG  . TRP F 1 174 ? -11.287 7.123   69.634 1.00 41.05  ? 665  TRP F CG  1 
ATOM   9030 C CD1 . TRP F 1 174 ? -12.457 6.878   68.965 1.00 40.60  ? 665  TRP F CD1 1 
ATOM   9031 C CD2 . TRP F 1 174 ? -11.648 7.810   70.836 1.00 41.54  ? 665  TRP F CD2 1 
ATOM   9032 N NE1 . TRP F 1 174 ? -13.519 7.385   69.674 1.00 41.90  ? 665  TRP F NE1 1 
ATOM   9033 C CE2 . TRP F 1 174 ? -13.051 7.965   70.824 1.00 41.14  ? 665  TRP F CE2 1 
ATOM   9034 C CE3 . TRP F 1 174 ? -10.917 8.318   71.920 1.00 41.98  ? 665  TRP F CE3 1 
ATOM   9035 C CZ2 . TRP F 1 174 ? -13.739 8.609   71.850 1.00 40.58  ? 665  TRP F CZ2 1 
ATOM   9036 C CZ3 . TRP F 1 174 ? -11.602 8.956   72.939 1.00 42.76  ? 665  TRP F CZ3 1 
ATOM   9037 C CH2 . TRP F 1 174 ? -13.000 9.098   72.897 1.00 41.61  ? 665  TRP F CH2 1 
ATOM   9038 N N   . ASN F 1 175 ? -6.994  8.001   68.842 1.00 34.62  ? 666  ASN F N   1 
ATOM   9039 C CA  . ASN F 1 175 ? -5.587  7.693   68.592 1.00 33.66  ? 666  ASN F CA  1 
ATOM   9040 C C   . ASN F 1 175 ? -5.121  8.226   67.234 1.00 33.50  ? 666  ASN F C   1 
ATOM   9041 O O   . ASN F 1 175 ? -4.408  7.533   66.504 1.00 32.03  ? 666  ASN F O   1 
ATOM   9042 C CB  . ASN F 1 175 ? -5.430  6.172   68.640 1.00 31.61  ? 666  ASN F CB  1 
ATOM   9043 C CG  . ASN F 1 175 ? -4.019  5.741   68.864 1.00 32.24  ? 666  ASN F CG  1 
ATOM   9044 O OD1 . ASN F 1 175 ? -3.328  6.282   69.719 1.00 35.17  ? 666  ASN F OD1 1 
ATOM   9045 N ND2 . ASN F 1 175 ? -3.579  4.744   68.112 1.00 31.90  ? 666  ASN F ND2 1 
ATOM   9046 N N   . ALA F 1 176 ? -5.525  9.453   66.903 1.00 33.07  ? 667  ALA F N   1 
ATOM   9047 C CA  . ALA F 1 176 ? -5.183  10.059  65.614 1.00 32.91  ? 667  ALA F CA  1 
ATOM   9048 C C   . ALA F 1 176 ? -4.550  11.449  65.720 1.00 32.04  ? 667  ALA F C   1 
ATOM   9049 O O   . ALA F 1 176 ? -4.804  12.184  66.668 1.00 34.84  ? 667  ALA F O   1 
ATOM   9050 C CB  . ALA F 1 176 ? -6.436  10.129  64.747 1.00 32.03  ? 667  ALA F CB  1 
ATOM   9051 N N   . GLU F 1 177 ? -3.734  11.806  64.735 1.00 29.88  ? 668  GLU F N   1 
ATOM   9052 C CA  . GLU F 1 177 ? -3.069  13.108  64.711 1.00 28.35  ? 668  GLU F CA  1 
ATOM   9053 C C   . GLU F 1 177 ? -3.737  14.039  63.712 1.00 28.06  ? 668  GLU F C   1 
ATOM   9054 O O   . GLU F 1 177 ? -3.964  13.663  62.568 1.00 28.29  ? 668  GLU F O   1 
ATOM   9055 C CB  . GLU F 1 177 ? -1.592  12.951  64.339 1.00 26.34  ? 668  GLU F CB  1 
ATOM   9056 C CG  . GLU F 1 177 ? -0.764  12.250  65.388 1.00 26.12  ? 668  GLU F CG  1 
ATOM   9057 C CD  . GLU F 1 177 ? 0.668   12.039  64.951 1.00 28.08  ? 668  GLU F CD  1 
ATOM   9058 O OE1 . GLU F 1 177 ? 1.377   13.044  64.725 1.00 28.68  ? 668  GLU F OE1 1 
ATOM   9059 O OE2 . GLU F 1 177 ? 1.088   10.871  64.829 1.00 26.40  ? 668  GLU F OE2 1 
ATOM   9060 N N   . TYR F 1 178 ? -4.043  15.259  64.143 1.00 28.51  ? 669  TYR F N   1 
ATOM   9061 C CA  . TYR F 1 178 ? -4.692  16.232  63.268 1.00 28.04  ? 669  TYR F CA  1 
ATOM   9062 C C   . TYR F 1 178 ? -3.956  17.547  63.258 1.00 28.57  ? 669  TYR F C   1 
ATOM   9063 O O   . TYR F 1 178 ? -3.000  17.736  63.997 1.00 31.05  ? 669  TYR F O   1 
ATOM   9064 C CB  . TYR F 1 178 ? -6.117  16.528  63.731 1.00 26.97  ? 669  TYR F CB  1 
ATOM   9065 C CG  . TYR F 1 178 ? -7.090  15.392  63.609 1.00 25.08  ? 669  TYR F CG  1 
ATOM   9066 C CD1 . TYR F 1 178 ? -7.244  14.456  64.638 1.00 24.34  ? 669  TYR F CD1 1 
ATOM   9067 C CD2 . TYR F 1 178 ? -7.860  15.254  62.468 1.00 24.38  ? 669  TYR F CD2 1 
ATOM   9068 C CE1 . TYR F 1 178 ? -8.144  13.412  64.520 1.00 26.07  ? 669  TYR F CE1 1 
ATOM   9069 C CE2 . TYR F 1 178 ? -8.760  14.217  62.336 1.00 25.02  ? 669  TYR F CE2 1 
ATOM   9070 C CZ  . TYR F 1 178 ? -8.900  13.298  63.355 1.00 26.60  ? 669  TYR F CZ  1 
ATOM   9071 O OH  . TYR F 1 178 ? -9.775  12.251  63.176 1.00 29.23  ? 669  TYR F OH  1 
ATOM   9072 N N   . GLU F 1 179 ? -4.424  18.455  62.408 1.00 29.00  ? 670  GLU F N   1 
ATOM   9073 C CA  . GLU F 1 179 ? -3.882  19.801  62.315 1.00 29.63  ? 670  GLU F CA  1 
ATOM   9074 C C   . GLU F 1 179 ? -4.998  20.787  61.977 1.00 29.96  ? 670  GLU F C   1 
ATOM   9075 O O   . GLU F 1 179 ? -5.750  20.576  61.021 1.00 29.96  ? 670  GLU F O   1 
ATOM   9076 C CB  . GLU F 1 179 ? -2.797  19.904  61.254 1.00 30.00  ? 670  GLU F CB  1 
ATOM   9077 C CG  . GLU F 1 179 ? -2.492  21.349  60.912 1.00 32.31  ? 670  GLU F CG  1 
ATOM   9078 C CD  . GLU F 1 179 ? -1.314  21.510  59.992 1.00 33.45  ? 670  GLU F CD  1 
ATOM   9079 O OE1 . GLU F 1 179 ? -1.274  20.825  58.950 1.00 33.48  ? 670  GLU F OE1 1 
ATOM   9080 O OE2 . GLU F 1 179 ? -0.433  22.335  60.314 1.00 35.14  ? 670  GLU F OE2 1 
ATOM   9081 N N   . VAL F 1 180 ? -5.106  21.851  62.774 1.00 28.80  ? 671  VAL F N   1 
ATOM   9082 C CA  . VAL F 1 180 ? -6.112  22.886  62.557 1.00 27.27  ? 671  VAL F CA  1 
ATOM   9083 C C   . VAL F 1 180 ? -5.464  24.049  61.809 1.00 27.84  ? 671  VAL F C   1 
ATOM   9084 O O   . VAL F 1 180 ? -4.254  24.280  61.908 1.00 26.46  ? 671  VAL F O   1 
ATOM   9085 C CB  . VAL F 1 180 ? -6.698  23.400  63.893 1.00 26.71  ? 671  VAL F CB  1 
ATOM   9086 C CG1 . VAL F 1 180 ? -7.704  24.508  63.637 1.00 24.87  ? 671  VAL F CG1 1 
ATOM   9087 C CG2 . VAL F 1 180 ? -7.366  22.265  64.626 1.00 28.59  ? 671  VAL F CG2 1 
ATOM   9088 N N   . TYR F 1 181 ? -6.288  24.788  61.078 1.00 29.20  ? 672  TYR F N   1 
ATOM   9089 C CA  . TYR F 1 181 ? -5.850  25.915  60.264 1.00 29.76  ? 672  TYR F CA  1 
ATOM   9090 C C   . TYR F 1 181 ? -6.807  27.079  60.474 1.00 29.50  ? 672  TYR F C   1 
ATOM   9091 O O   . TYR F 1 181 ? -8.028  26.910  60.355 1.00 28.98  ? 672  TYR F O   1 
ATOM   9092 C CB  . TYR F 1 181 ? -5.849  25.449  58.807 1.00 32.93  ? 672  TYR F CB  1 
ATOM   9093 C CG  . TYR F 1 181 ? -5.840  26.495  57.714 1.00 37.83  ? 672  TYR F CG  1 
ATOM   9094 C CD1 . TYR F 1 181 ? -4.721  26.653  56.889 1.00 39.42  ? 672  TYR F CD1 1 
ATOM   9095 C CD2 . TYR F 1 181 ? -6.989  27.235  57.413 1.00 38.01  ? 672  TYR F CD2 1 
ATOM   9096 C CE1 . TYR F 1 181 ? -4.749  27.508  55.785 1.00 39.87  ? 672  TYR F CE1 1 
ATOM   9097 C CE2 . TYR F 1 181 ? -7.028  28.093  56.317 1.00 39.81  ? 672  TYR F CE2 1 
ATOM   9098 C CZ  . TYR F 1 181 ? -5.904  28.221  55.503 1.00 41.99  ? 672  TYR F CZ  1 
ATOM   9099 O OH  . TYR F 1 181 ? -5.945  29.041  54.393 1.00 43.44  ? 672  TYR F OH  1 
ATOM   9100 N N   . VAL F 1 182 ? -6.270  28.251  60.811 1.00 28.52  ? 673  VAL F N   1 
ATOM   9101 C CA  . VAL F 1 182 ? -7.128  29.422  61.008 1.00 27.60  ? 673  VAL F CA  1 
ATOM   9102 C C   . VAL F 1 182 ? -6.585  30.667  60.314 1.00 28.14  ? 673  VAL F C   1 
ATOM   9103 O O   . VAL F 1 182 ? -5.425  31.037  60.498 1.00 27.59  ? 673  VAL F O   1 
ATOM   9104 C CB  . VAL F 1 182 ? -7.336  29.763  62.508 1.00 27.32  ? 673  VAL F CB  1 
ATOM   9105 C CG1 . VAL F 1 182 ? -8.325  30.924  62.630 1.00 22.44  ? 673  VAL F CG1 1 
ATOM   9106 C CG2 . VAL F 1 182 ? -7.845  28.537  63.280 1.00 25.71  ? 673  VAL F CG2 1 
ATOM   9107 N N   . VAL F 1 183 ? -7.435  31.304  59.511 1.00 27.63  ? 674  VAL F N   1 
ATOM   9108 C CA  . VAL F 1 183 ? -7.057  32.514  58.795 1.00 28.67  ? 674  VAL F CA  1 
ATOM   9109 C C   . VAL F 1 183 ? -7.974  33.663  59.152 1.00 30.49  ? 674  VAL F C   1 
ATOM   9110 O O   . VAL F 1 183 ? -9.174  33.466  59.327 1.00 33.03  ? 674  VAL F O   1 
ATOM   9111 C CB  . VAL F 1 183 ? -7.107  32.314  57.264 1.00 27.54  ? 674  VAL F CB  1 
ATOM   9112 C CG1 . VAL F 1 183 ? -7.038  33.673  56.547 1.00 24.72  ? 674  VAL F CG1 1 
ATOM   9113 C CG2 . VAL F 1 183 ? -5.947  31.434  56.828 1.00 24.75  ? 674  VAL F CG2 1 
ATOM   9114 N N   . ALA F 1 184 ? -7.405  34.861  59.269 1.00 31.73  ? 675  ALA F N   1 
ATOM   9115 C CA  . ALA F 1 184 ? -8.187  36.056  59.583 1.00 32.46  ? 675  ALA F CA  1 
ATOM   9116 C C   . ALA F 1 184 ? -8.355  36.807  58.281 1.00 32.90  ? 675  ALA F C   1 
ATOM   9117 O O   . ALA F 1 184 ? -7.387  37.010  57.551 1.00 33.11  ? 675  ALA F O   1 
ATOM   9118 C CB  . ALA F 1 184 ? -7.466  36.924  60.607 1.00 30.92  ? 675  ALA F CB  1 
ATOM   9119 N N   . GLU F 1 185 ? -9.582  37.222  57.990 1.00 35.12  ? 676  GLU F N   1 
ATOM   9120 C CA  . GLU F 1 185 ? -9.860  37.923  56.742 1.00 37.17  ? 676  GLU F CA  1 
ATOM   9121 C C   . GLU F 1 185 ? -10.641 39.210  56.892 1.00 36.40  ? 676  GLU F C   1 
ATOM   9122 O O   . GLU F 1 185 ? -11.676 39.237  57.555 1.00 36.74  ? 676  GLU F O   1 
ATOM   9123 C CB  . GLU F 1 185 ? -10.621 36.997  55.790 1.00 39.86  ? 676  GLU F CB  1 
ATOM   9124 C CG  . GLU F 1 185 ? -11.075 37.666  54.504 1.00 44.01  ? 676  GLU F CG  1 
ATOM   9125 C CD  . GLU F 1 185 ? -11.920 36.745  53.649 1.00 47.65  ? 676  GLU F CD  1 
ATOM   9126 O OE1 . GLU F 1 185 ? -13.011 36.348  54.112 1.00 48.31  ? 676  GLU F OE1 1 
ATOM   9127 O OE2 . GLU F 1 185 ? -11.491 36.416  52.518 1.00 49.37  ? 676  GLU F OE2 1 
ATOM   9128 N N   . ASN F 1 186 ? -10.132 40.270  56.263 1.00 36.54  ? 677  ASN F N   1 
ATOM   9129 C CA  . ASN F 1 186 ? -10.774 41.589  56.259 1.00 36.20  ? 677  ASN F CA  1 
ATOM   9130 C C   . ASN F 1 186 ? -10.870 42.047  54.805 1.00 36.55  ? 677  ASN F C   1 
ATOM   9131 O O   . ASN F 1 186 ? -10.514 41.297  53.904 1.00 35.73  ? 677  ASN F O   1 
ATOM   9132 C CB  . ASN F 1 186 ? -9.978  42.607  57.101 1.00 35.38  ? 677  ASN F CB  1 
ATOM   9133 C CG  . ASN F 1 186 ? -8.606  42.950  56.511 1.00 34.60  ? 677  ASN F CG  1 
ATOM   9134 O OD1 . ASN F 1 186 ? -8.196  42.429  55.471 1.00 33.23  ? 677  ASN F OD1 1 
ATOM   9135 N ND2 . ASN F 1 186 ? -7.891  43.839  57.193 1.00 33.29  ? 677  ASN F ND2 1 
ATOM   9136 N N   . GLN F 1 187 ? -11.340 43.264  54.565 1.00 38.26  ? 678  GLN F N   1 
ATOM   9137 C CA  . GLN F 1 187 ? -11.468 43.730  53.188 1.00 41.77  ? 678  GLN F CA  1 
ATOM   9138 C C   . GLN F 1 187 ? -10.145 43.789  52.434 1.00 40.73  ? 678  GLN F C   1 
ATOM   9139 O O   . GLN F 1 187 ? -10.114 43.738  51.209 1.00 38.88  ? 678  GLN F O   1 
ATOM   9140 C CB  . GLN F 1 187 ? -12.118 45.103  53.136 1.00 45.65  ? 678  GLN F CB  1 
ATOM   9141 C CG  . GLN F 1 187 ? -12.614 45.440  51.747 1.00 53.23  ? 678  GLN F CG  1 
ATOM   9142 C CD  . GLN F 1 187 ? -13.266 46.803  51.671 1.00 58.48  ? 678  GLN F CD  1 
ATOM   9143 O OE1 . GLN F 1 187 ? -13.877 47.267  52.638 1.00 61.51  ? 678  GLN F OE1 1 
ATOM   9144 N NE2 . GLN F 1 187 ? -13.158 47.448  50.511 1.00 59.29  ? 678  GLN F NE2 1 
ATOM   9145 N N   . GLN F 1 188 ? -9.055  43.897  53.176 1.00 40.75  ? 679  GLN F N   1 
ATOM   9146 C CA  . GLN F 1 188 ? -7.731  43.972  52.584 1.00 40.34  ? 679  GLN F CA  1 
ATOM   9147 C C   . GLN F 1 188 ? -7.260  42.589  52.110 1.00 39.90  ? 679  GLN F C   1 
ATOM   9148 O O   . GLN F 1 188 ? -6.478  42.480  51.161 1.00 38.58  ? 679  GLN F O   1 
ATOM   9149 C CB  . GLN F 1 188 ? -6.759  44.531  53.621 1.00 42.07  ? 679  GLN F CB  1 
ATOM   9150 C CG  . GLN F 1 188 ? -5.541  45.210  53.042 1.00 46.17  ? 679  GLN F CG  1 
ATOM   9151 C CD  . GLN F 1 188 ? -5.915  46.307  52.069 1.00 48.91  ? 679  GLN F CD  1 
ATOM   9152 O OE1 . GLN F 1 188 ? -6.885  47.045  52.286 1.00 50.67  ? 679  GLN F OE1 1 
ATOM   9153 N NE2 . GLN F 1 188 ? -5.144  46.429  50.992 1.00 48.86  ? 679  GLN F NE2 1 
ATOM   9154 N N   . GLY F 1 189 ? -7.735  41.538  52.779 1.00 37.76  ? 680  GLY F N   1 
ATOM   9155 C CA  . GLY F 1 189 ? -7.349  40.188  52.412 1.00 34.19  ? 680  GLY F CA  1 
ATOM   9156 C C   . GLY F 1 189 ? -7.204  39.240  53.589 1.00 33.36  ? 680  GLY F C   1 
ATOM   9157 O O   . GLY F 1 189 ? -7.703  39.504  54.683 1.00 33.95  ? 680  GLY F O   1 
ATOM   9158 N N   . LYS F 1 190 ? -6.513  38.128  53.358 1.00 31.64  ? 681  LYS F N   1 
ATOM   9159 C CA  . LYS F 1 190 ? -6.288  37.123  54.385 1.00 30.61  ? 681  LYS F CA  1 
ATOM   9160 C C   . LYS F 1 190 ? -4.899  37.236  54.989 1.00 31.04  ? 681  LYS F C   1 
ATOM   9161 O O   . LYS F 1 190 ? -3.949  37.620  54.314 1.00 30.74  ? 681  LYS F O   1 
ATOM   9162 C CB  . LYS F 1 190 ? -6.400  35.721  53.803 1.00 29.67  ? 681  LYS F CB  1 
ATOM   9163 C CG  . LYS F 1 190 ? -7.464  35.527  52.775 1.00 28.48  ? 681  LYS F CG  1 
ATOM   9164 C CD  . LYS F 1 190 ? -7.545  34.062  52.436 1.00 29.16  ? 681  LYS F CD  1 
ATOM   9165 C CE  . LYS F 1 190 ? -8.609  33.779  51.418 1.00 28.54  ? 681  LYS F CE  1 
ATOM   9166 N NZ  . LYS F 1 190 ? -8.768  32.312  51.296 1.00 32.15  ? 681  LYS F NZ  1 
ATOM   9167 N N   . SER F 1 191 ? -4.794  36.868  56.262 1.00 31.66  ? 682  SER F N   1 
ATOM   9168 C CA  . SER F 1 191 ? -3.530  36.868  56.992 1.00 31.39  ? 682  SER F CA  1 
ATOM   9169 C C   . SER F 1 191 ? -2.848  35.558  56.630 1.00 32.59  ? 682  SER F C   1 
ATOM   9170 O O   . SER F 1 191 ? -3.376  34.775  55.843 1.00 33.38  ? 682  SER F O   1 
ATOM   9171 C CB  . SER F 1 191 ? -3.797  36.857  58.494 1.00 31.52  ? 682  SER F CB  1 
ATOM   9172 O OG  . SER F 1 191 ? -4.414  35.633  58.891 1.00 28.73  ? 682  SER F OG  1 
ATOM   9173 N N   . LYS F 1 192 ? -1.673  35.308  57.185 1.00 32.87  ? 683  LYS F N   1 
ATOM   9174 C CA  . LYS F 1 192 ? -1.053  34.029  56.910 1.00 35.40  ? 683  LYS F CA  1 
ATOM   9175 C C   . LYS F 1 192 ? -1.804  33.086  57.845 1.00 35.71  ? 683  LYS F C   1 
ATOM   9176 O O   . LYS F 1 192 ? -2.411  33.532  58.824 1.00 36.01  ? 683  LYS F O   1 
ATOM   9177 C CB  . LYS F 1 192 ? 0.446   34.062  57.205 1.00 36.63  ? 683  LYS F CB  1 
ATOM   9178 C CG  . LYS F 1 192 ? 0.860   34.947  58.364 1.00 43.08  ? 683  LYS F CG  1 
ATOM   9179 C CD  . LYS F 1 192 ? 2.360   35.289  58.292 1.00 46.15  ? 683  LYS F CD  1 
ATOM   9180 C CE  . LYS F 1 192 ? 2.691   36.171  57.070 1.00 47.04  ? 683  LYS F CE  1 
ATOM   9181 N NZ  . LYS F 1 192 ? 4.135   36.564  57.022 1.00 47.63  ? 683  LYS F NZ  1 
ATOM   9182 N N   . ALA F 1 193 ? -1.801  31.797  57.542 1.00 34.76  ? 684  ALA F N   1 
ATOM   9183 C CA  . ALA F 1 193 ? -2.527  30.850  58.379 1.00 34.87  ? 684  ALA F CA  1 
ATOM   9184 C C   . ALA F 1 193 ? -1.811  30.488  59.664 1.00 34.31  ? 684  ALA F C   1 
ATOM   9185 O O   . ALA F 1 193 ? -0.591  30.341  59.688 1.00 35.69  ? 684  ALA F O   1 
ATOM   9186 C CB  . ALA F 1 193 ? -2.826  29.573  57.590 1.00 33.82  ? 684  ALA F CB  1 
ATOM   9187 N N   . ALA F 1 194 ? -2.580  30.351  60.736 1.00 33.18  ? 685  ALA F N   1 
ATOM   9188 C CA  . ALA F 1 194 ? -2.034  29.943  62.021 1.00 31.94  ? 685  ALA F CA  1 
ATOM   9189 C C   . ALA F 1 194 ? -2.303  28.444  62.068 1.00 31.85  ? 685  ALA F C   1 
ATOM   9190 O O   . ALA F 1 194 ? -3.366  27.996  61.643 1.00 32.22  ? 685  ALA F O   1 
ATOM   9191 C CB  . ALA F 1 194 ? -2.758  30.653  63.163 1.00 28.45  ? 685  ALA F CB  1 
ATOM   9192 N N   . HIS F 1 195 ? -1.340  27.667  62.548 1.00 33.28  ? 686  HIS F N   1 
ATOM   9193 C CA  . HIS F 1 195 ? -1.511  26.222  62.625 1.00 34.88  ? 686  HIS F CA  1 
ATOM   9194 C C   . HIS F 1 195 ? -1.484  25.696  64.048 1.00 34.53  ? 686  HIS F C   1 
ATOM   9195 O O   . HIS F 1 195 ? -0.971  26.335  64.955 1.00 35.46  ? 686  HIS F O   1 
ATOM   9196 C CB  . HIS F 1 195 ? -0.430  25.504  61.823 1.00 38.65  ? 686  HIS F CB  1 
ATOM   9197 C CG  . HIS F 1 195 ? -0.454  25.822  60.365 1.00 44.00  ? 686  HIS F CG  1 
ATOM   9198 N ND1 . HIS F 1 195 ? 0.069   26.988  59.851 1.00 45.13  ? 686  HIS F ND1 1 
ATOM   9199 C CD2 . HIS F 1 195 ? -0.990  25.151  59.315 1.00 46.11  ? 686  HIS F CD2 1 
ATOM   9200 C CE1 . HIS F 1 195 ? -0.146  27.025  58.546 1.00 47.38  ? 686  HIS F CE1 1 
ATOM   9201 N NE2 . HIS F 1 195 ? -0.787  25.923  58.197 1.00 46.99  ? 686  HIS F NE2 1 
ATOM   9202 N N   . PHE F 1 196 ? -2.038  24.510  64.226 1.00 34.33  ? 687  PHE F N   1 
ATOM   9203 C CA  . PHE F 1 196 ? -2.094  23.872  65.525 1.00 33.81  ? 687  PHE F CA  1 
ATOM   9204 C C   . PHE F 1 196 ? -2.186  22.374  65.241 1.00 32.84  ? 687  PHE F C   1 
ATOM   9205 O O   . PHE F 1 196 ? -3.096  21.932  64.532 1.00 33.40  ? 687  PHE F O   1 
ATOM   9206 C CB  . PHE F 1 196 ? -3.341  24.356  66.276 1.00 36.53  ? 687  PHE F CB  1 
ATOM   9207 C CG  . PHE F 1 196 ? -3.428  23.870  67.689 1.00 37.37  ? 687  PHE F CG  1 
ATOM   9208 C CD1 . PHE F 1 196 ? -2.741  24.520  68.703 1.00 39.65  ? 687  PHE F CD1 1 
ATOM   9209 C CD2 . PHE F 1 196 ? -4.156  22.726  67.999 1.00 38.18  ? 687  PHE F CD2 1 
ATOM   9210 C CE1 . PHE F 1 196 ? -2.772  24.026  70.019 1.00 42.34  ? 687  PHE F CE1 1 
ATOM   9211 C CE2 . PHE F 1 196 ? -4.196  22.226  69.299 1.00 39.07  ? 687  PHE F CE2 1 
ATOM   9212 C CZ  . PHE F 1 196 ? -3.504  22.872  70.312 1.00 40.71  ? 687  PHE F CZ  1 
ATOM   9213 N N   . VAL F 1 197 ? -1.237  21.601  65.765 1.00 29.63  ? 688  VAL F N   1 
ATOM   9214 C CA  . VAL F 1 197 ? -1.238  20.154  65.559 1.00 26.92  ? 688  VAL F CA  1 
ATOM   9215 C C   . VAL F 1 197 ? -1.553  19.473  66.877 1.00 26.18  ? 688  VAL F C   1 
ATOM   9216 O O   . VAL F 1 197 ? -1.010  19.841  67.913 1.00 26.48  ? 688  VAL F O   1 
ATOM   9217 C CB  . VAL F 1 197 ? 0.134   19.660  65.046 1.00 27.63  ? 688  VAL F CB  1 
ATOM   9218 C CG1 . VAL F 1 197 ? 0.072   18.179  64.668 1.00 26.18  ? 688  VAL F CG1 1 
ATOM   9219 C CG2 . VAL F 1 197 ? 0.545   20.479  63.842 1.00 30.20  ? 688  VAL F CG2 1 
ATOM   9220 N N   . PHE F 1 198 ? -2.438  18.488  66.851 1.00 25.25  ? 689  PHE F N   1 
ATOM   9221 C CA  . PHE F 1 198 ? -2.789  17.788  68.076 1.00 26.18  ? 689  PHE F CA  1 
ATOM   9222 C C   . PHE F 1 198 ? -3.089  16.318  67.813 1.00 28.87  ? 689  PHE F C   1 
ATOM   9223 O O   . PHE F 1 198 ? -3.187  15.886  66.660 1.00 28.42  ? 689  PHE F O   1 
ATOM   9224 C CB  . PHE F 1 198 ? -3.996  18.456  68.726 1.00 23.89  ? 689  PHE F CB  1 
ATOM   9225 C CG  . PHE F 1 198 ? -5.250  18.344  67.919 1.00 24.46  ? 689  PHE F CG  1 
ATOM   9226 C CD1 . PHE F 1 198 ? -6.114  17.263  68.095 1.00 24.23  ? 689  PHE F CD1 1 
ATOM   9227 C CD2 . PHE F 1 198 ? -5.547  19.287  66.938 1.00 24.63  ? 689  PHE F CD2 1 
ATOM   9228 C CE1 . PHE F 1 198 ? -7.256  17.121  67.301 1.00 22.83  ? 689  PHE F CE1 1 
ATOM   9229 C CE2 . PHE F 1 198 ? -6.683  19.151  66.139 1.00 24.49  ? 689  PHE F CE2 1 
ATOM   9230 C CZ  . PHE F 1 198 ? -7.538  18.063  66.324 1.00 23.21  ? 689  PHE F CZ  1 
ATOM   9231 N N   . ARG F 1 199 ? -3.240  15.557  68.896 1.00 30.83  ? 690  ARG F N   1 
ATOM   9232 C CA  . ARG F 1 199 ? -3.534  14.133  68.806 1.00 31.56  ? 690  ARG F CA  1 
ATOM   9233 C C   . ARG F 1 199 ? -4.593  13.701  69.820 1.00 33.18  ? 690  ARG F C   1 
ATOM   9234 O O   . ARG F 1 199 ? -4.483  13.998  71.012 1.00 34.34  ? 690  ARG F O   1 
ATOM   9235 C CB  . ARG F 1 199 ? -2.253  13.333  69.022 1.00 30.62  ? 690  ARG F CB  1 
ATOM   9236 C CG  . ARG F 1 199 ? -2.439  11.823  69.006 1.00 29.92  ? 690  ARG F CG  1 
ATOM   9237 C CD  . ARG F 1 199 ? -1.086  11.115  69.016 1.00 26.00  ? 690  ARG F CD  1 
ATOM   9238 N NE  . ARG F 1 199 ? -1.247  9.671   69.069 1.00 25.19  ? 690  ARG F NE  1 
ATOM   9239 C CZ  . ARG F 1 199 ? -0.325  8.797   68.682 1.00 24.19  ? 690  ARG F CZ  1 
ATOM   9240 N NH1 . ARG F 1 199 ? 0.837   9.217   68.207 1.00 23.89  ? 690  ARG F NH1 1 
ATOM   9241 N NH2 . ARG F 1 199 ? -0.578  7.501   68.759 1.00 20.76  ? 690  ARG F NH2 1 
ATOM   9242 N N   . THR F 1 200 ? -5.618  13.000  69.340 1.00 34.62  ? 691  THR F N   1 
ATOM   9243 C CA  . THR F 1 200 ? -6.694  12.519  70.203 1.00 36.23  ? 691  THR F CA  1 
ATOM   9244 C C   . THR F 1 200 ? -6.196  11.406  71.125 1.00 37.94  ? 691  THR F C   1 
ATOM   9245 O O   . THR F 1 200 ? -5.158  10.795  70.875 1.00 39.16  ? 691  THR F O   1 
ATOM   9246 C CB  . THR F 1 200 ? -7.871  11.975  69.380 1.00 34.32  ? 691  THR F CB  1 
ATOM   9247 O OG1 . THR F 1 200 ? -7.425  10.883  68.576 1.00 34.99  ? 691  THR F OG1 1 
ATOM   9248 C CG2 . THR F 1 200 ? -8.432  13.049  68.480 1.00 33.90  ? 691  THR F CG2 1 
ATOM   9249 N N   . ALA F 1 201 ? -6.934  11.146  72.195 1.00 39.92  ? 692  ALA F N   1 
ATOM   9250 C CA  . ALA F 1 201 ? -6.538  10.111  73.135 1.00 42.00  ? 692  ALA F CA  1 
ATOM   9251 C C   . ALA F 1 201 ? -6.695  8.746   72.456 1.00 44.20  ? 692  ALA F C   1 
ATOM   9252 O O   . ALA F 1 201 ? -7.431  8.616   71.475 1.00 43.42  ? 692  ALA F O   1 
ATOM   9253 C CB  . ALA F 1 201 ? -7.399  10.201  74.404 1.00 41.44  ? 692  ALA F CB  1 
ATOM   9254 N N   . ALA F 1 202 ? -5.991  7.739   72.972 1.00 47.48  ? 693  ALA F N   1 
ATOM   9255 C CA  . ALA F 1 202 ? -6.039  6.390   72.412 1.00 49.93  ? 693  ALA F CA  1 
ATOM   9256 C C   . ALA F 1 202 ? -7.435  5.791   72.481 1.00 52.44  ? 693  ALA F C   1 
ATOM   9257 O O   . ALA F 1 202 ? -7.868  5.093   71.556 1.00 53.82  ? 693  ALA F O   1 
ATOM   9258 C CB  . ALA F 1 202 ? -5.062  5.491   73.132 1.00 48.63  ? 693  ALA F CB  1 
ATOM   9259 N N   . ALA F 1 203 ? -8.142  6.052   73.577 1.00 53.50  ? 694  ALA F N   1 
ATOM   9260 C CA  . ALA F 1 203 ? -9.503  5.525   73.724 1.00 55.56  ? 694  ALA F CA  1 
ATOM   9261 C C   . ALA F 1 203 ? -10.322 6.361   74.711 1.00 56.71  ? 694  ALA F C   1 
ATOM   9262 O O   . ALA F 1 203 ? -11.529 6.036   74.892 1.00 56.47  ? 694  ALA F O   1 
ATOM   9263 C CB  . ALA F 1 203 ? -9.457  4.061   74.187 1.00 54.11  ? 694  ALA F CB  1 
ATOM   9264 N N   . HIS F 1 204 ? -9.743  7.319   75.288 1.00 58.56  ? 695  HIS F N   1 
HETATM 9265 S S   . SO4 G 2 .   ? 39.038  76.725  36.072 1.00 69.41  ? 1696 SO4 A S   1 
HETATM 9266 O O1  . SO4 G 2 .   ? 38.721  75.298  35.846 1.00 68.58  ? 1696 SO4 A O1  1 
HETATM 9267 O O2  . SO4 G 2 .   ? 38.774  77.485  34.836 1.00 69.48  ? 1696 SO4 A O2  1 
HETATM 9268 O O3  . SO4 G 2 .   ? 40.459  76.860  36.450 1.00 69.15  ? 1696 SO4 A O3  1 
HETATM 9269 O O4  . SO4 G 2 .   ? 38.197  77.269  37.152 1.00 69.16  ? 1696 SO4 A O4  1 
HETATM 9270 S S   . SO4 H 2 .   ? 45.837  14.923  28.520 1.00 84.52  ? 1697 SO4 A S   1 
HETATM 9271 O O1  . SO4 H 2 .   ? 45.547  14.648  29.941 1.00 83.96  ? 1697 SO4 A O1  1 
HETATM 9272 O O2  . SO4 H 2 .   ? 47.052  15.752  28.407 1.00 84.51  ? 1697 SO4 A O2  1 
HETATM 9273 O O3  . SO4 H 2 .   ? 44.693  15.644  27.927 1.00 84.45  ? 1697 SO4 A O3  1 
HETATM 9274 O O4  . SO4 H 2 .   ? 46.054  13.653  27.800 1.00 84.05  ? 1697 SO4 A O4  1 
HETATM 9275 S S   . SO4 I 2 .   ? 39.092  13.470  54.287 1.00 40.79  ? 1696 SO4 C S   1 
HETATM 9276 O O1  . SO4 I 2 .   ? 39.856  12.364  54.898 1.00 38.06  ? 1696 SO4 C O1  1 
HETATM 9277 O O2  . SO4 I 2 .   ? 39.931  14.160  53.289 1.00 41.12  ? 1696 SO4 C O2  1 
HETATM 9278 O O3  . SO4 I 2 .   ? 38.693  14.447  55.319 1.00 37.63  ? 1696 SO4 C O3  1 
HETATM 9279 O O4  . SO4 I 2 .   ? 37.893  12.920  53.626 1.00 39.41  ? 1696 SO4 C O4  1 
HETATM 9280 S S   . SO4 J 2 .   ? 1.964   36.950  78.177 1.00 76.86  ? 1697 SO4 C S   1 
HETATM 9281 O O1  . SO4 J 2 .   ? 2.446   37.790  77.062 1.00 76.77  ? 1697 SO4 C O1  1 
HETATM 9282 O O2  . SO4 J 2 .   ? 1.341   35.731  77.631 1.00 77.57  ? 1697 SO4 C O2  1 
HETATM 9283 O O3  . SO4 J 2 .   ? 0.964   37.694  78.968 1.00 77.81  ? 1697 SO4 C O3  1 
HETATM 9284 O O4  . SO4 J 2 .   ? 3.093   36.575  79.048 1.00 76.70  ? 1697 SO4 C O4  1 
HETATM 9285 S S   . SO4 K 2 .   ? 48.018  30.245  20.501 1.00 97.84  ? 1696 SO4 D S   1 
HETATM 9286 O O1  . SO4 K 2 .   ? 48.976  31.258  20.984 1.00 96.70  ? 1696 SO4 D O1  1 
HETATM 9287 O O2  . SO4 K 2 .   ? 46.667  30.838  20.411 1.00 97.19  ? 1696 SO4 D O2  1 
HETATM 9288 O O3  . SO4 K 2 .   ? 47.993  29.112  21.445 1.00 97.81  ? 1696 SO4 D O3  1 
HETATM 9289 O O4  . SO4 K 2 .   ? 48.431  29.762  19.168 1.00 97.20  ? 1696 SO4 D O4  1 
HETATM 9290 S S   . SO4 L 2 .   ? 22.665  81.992  40.867 1.00 88.45  ? 1695 SO4 E S   1 
HETATM 9291 O O1  . SO4 L 2 .   ? 22.945  83.007  41.902 1.00 88.08  ? 1695 SO4 E O1  1 
HETATM 9292 O O2  . SO4 L 2 .   ? 23.588  82.191  39.732 1.00 88.15  ? 1695 SO4 E O2  1 
HETATM 9293 O O3  . SO4 L 2 .   ? 21.271  82.133  40.408 1.00 88.21  ? 1695 SO4 E O3  1 
HETATM 9294 O O4  . SO4 L 2 .   ? 22.859  80.641  41.428 1.00 87.82  ? 1695 SO4 E O4  1 
HETATM 9295 S S   . SO4 M 2 .   ? 1.367   15.440  56.786 1.00 39.10  ? 1696 SO4 F S   1 
HETATM 9296 O O1  . SO4 M 2 .   ? 1.930   16.515  55.953 1.00 39.05  ? 1696 SO4 F O1  1 
HETATM 9297 O O2  . SO4 M 2 .   ? -0.044  15.242  56.413 1.00 38.49  ? 1696 SO4 F O2  1 
HETATM 9298 O O3  . SO4 M 2 .   ? 1.455   15.840  58.201 1.00 38.77  ? 1696 SO4 F O3  1 
HETATM 9299 O O4  . SO4 M 2 .   ? 2.121   14.187  56.562 1.00 37.54  ? 1696 SO4 F O4  1 
HETATM 9300 S S   . SO4 N 2 .   ? -4.550  7.844   76.257 1.00 79.51  ? 1697 SO4 F S   1 
HETATM 9301 O O1  . SO4 N 2 .   ? -4.160  6.640   77.017 1.00 79.09  ? 1697 SO4 F O1  1 
HETATM 9302 O O2  . SO4 N 2 .   ? -3.895  7.799   74.936 1.00 79.22  ? 1697 SO4 F O2  1 
HETATM 9303 O O3  . SO4 N 2 .   ? -4.121  9.058   76.979 1.00 79.02  ? 1697 SO4 F O3  1 
HETATM 9304 O O4  . SO4 N 2 .   ? -6.017  7.868   76.089 1.00 79.02  ? 1697 SO4 F O4  1 
HETATM 9305 S S   . SO4 O 2 .   ? -13.688 64.914  55.881 1.00 93.77  ? 1698 SO4 F S   1 
HETATM 9306 O O1  . SO4 O 2 .   ? -13.102 65.959  56.744 1.00 91.91  ? 1698 SO4 F O1  1 
HETATM 9307 O O2  . SO4 O 2 .   ? -13.149 65.044  54.513 1.00 93.19  ? 1698 SO4 F O2  1 
HETATM 9308 O O3  . SO4 O 2 .   ? -15.155 65.083  55.836 1.00 93.07  ? 1698 SO4 F O3  1 
HETATM 9309 O O4  . SO4 O 2 .   ? -13.357 63.572  56.412 1.00 92.70  ? 1698 SO4 F O4  1 
HETATM 9310 S S   . SO4 P 2 .   ? -10.463 11.634  56.835 1.00 91.87  ? 1699 SO4 F S   1 
HETATM 9311 O O1  . SO4 P 2 .   ? -9.221  12.177  56.253 1.00 91.18  ? 1699 SO4 F O1  1 
HETATM 9312 O O2  . SO4 P 2 .   ? -11.584 11.928  55.919 1.00 91.11  ? 1699 SO4 F O2  1 
HETATM 9313 O O3  . SO4 P 2 .   ? -10.716 12.249  58.152 1.00 91.30  ? 1699 SO4 F O3  1 
HETATM 9314 O O4  . SO4 P 2 .   ? -10.329 10.175  57.014 1.00 91.33  ? 1699 SO4 F O4  1 
HETATM 9315 S S   . SO4 Q 2 .   ? -17.529 38.973  52.551 1.00 80.56  ? 1700 SO4 F S   1 
HETATM 9316 O O1  . SO4 Q 2 .   ? -17.688 40.260  53.323 1.00 78.86  ? 1700 SO4 F O1  1 
HETATM 9317 O O2  . SO4 Q 2 .   ? -17.959 39.201  51.124 1.00 80.00  ? 1700 SO4 F O2  1 
HETATM 9318 O O3  . SO4 Q 2 .   ? -18.401 37.905  53.154 1.00 78.82  ? 1700 SO4 F O3  1 
HETATM 9319 O O4  . SO4 Q 2 .   ? -16.083 38.518  52.570 1.00 78.75  ? 1700 SO4 F O4  1 
HETATM 9320 O O   . HOH R 3 .   ? 40.364  74.967  28.729 1.00 20.25  ? 2001 HOH A O   1 
HETATM 9321 O O   . HOH R 3 .   ? 52.360  20.382  26.436 1.00 20.81  ? 2002 HOH A O   1 
HETATM 9322 O O   . HOH R 3 .   ? 30.606  29.793  41.261 1.00 22.99  ? 2003 HOH A O   1 
HETATM 9323 O O   . HOH S 3 .   ? 53.244  66.451  14.477 1.00 30.18  ? 2001 HOH B O   1 
HETATM 9324 O O   . HOH S 3 .   ? 36.157  59.951  12.986 1.00 21.71  ? 2002 HOH B O   1 
HETATM 9325 O O   . HOH S 3 .   ? 32.452  60.161  29.113 1.00 26.39  ? 2003 HOH B O   1 
HETATM 9326 O O   . HOH S 3 .   ? 15.554  55.798  43.036 1.00 33.17  ? 2004 HOH B O   1 
HETATM 9327 O O   . HOH S 3 .   ? -4.284  63.465  50.938 1.00 27.01  ? 2005 HOH B O   1 
HETATM 9328 O O   . HOH S 3 .   ? 8.548   60.677  51.541 1.00 22.24  ? 2006 HOH B O   1 
HETATM 9329 O O   . HOH T 3 .   ? 37.705  21.775  48.007 1.00 20.92  ? 2001 HOH C O   1 
HETATM 9330 O O   . HOH T 3 .   ? 3.831   26.011  61.861 1.00 33.46  ? 2002 HOH C O   1 
HETATM 9331 O O   . HOH T 3 .   ? -4.869  19.475  74.006 1.00 24.62  ? 2003 HOH C O   1 
HETATM 9332 O O   . HOH T 3 .   ? -9.081  14.539  85.324 1.00 23.70  ? 2004 HOH C O   1 
HETATM 9333 O O   . HOH T 3 .   ? 9.689   12.160  67.807 1.00 25.69  ? 2005 HOH C O   1 
HETATM 9334 O O   . HOH T 3 .   ? 3.753   31.608  67.191 1.00 28.62  ? 2006 HOH C O   1 
HETATM 9335 O O   . HOH T 3 .   ? -13.620 21.414  82.043 1.00 24.88  ? 2007 HOH C O   1 
HETATM 9336 O O   . HOH U 3 .   ? 3.685   5.602   51.917 1.00 29.69  ? 2001 HOH D O   1 
HETATM 9337 O O   . HOH U 3 .   ? 21.766  8.017   53.810 1.00 21.54  ? 2002 HOH D O   1 
HETATM 9338 O O   . HOH U 3 .   ? 6.287   4.651   71.520 1.00 32.55  ? 2003 HOH D O   1 
HETATM 9339 O O   . HOH U 3 .   ? 46.362  21.599  17.962 1.00 26.21  ? 2004 HOH D O   1 
HETATM 9340 O O   . HOH U 3 .   ? 29.205  35.270  35.762 1.00 15.25  ? 2005 HOH D O   1 
HETATM 9341 O O   . HOH V 3 .   ? -5.028  39.258  90.373 1.00 30.04  ? 2001 HOH E O   1 
HETATM 9342 O O   . HOH V 3 .   ? -12.931 40.339  89.617 1.00 22.10  ? 2002 HOH E O   1 
HETATM 9343 O O   . HOH V 3 .   ? -15.668 54.165  85.965 1.00 24.88  ? 2003 HOH E O   1 
HETATM 9344 O O   . HOH V 3 .   ? -16.392 33.051  78.630 1.00 16.00  ? 2004 HOH E O   1 
HETATM 9345 O O   . HOH V 3 .   ? 1.528   34.385  73.677 1.00 34.30  ? 2005 HOH E O   1 
HETATM 9346 O O   . HOH W 3 .   ? -8.752  54.743  70.735 1.00 33.71  ? 2001 HOH F O   1 
HETATM 9347 O O   . HOH W 3 .   ? -20.165 66.713  62.072 1.00 21.68  ? 2002 HOH F O   1 
HETATM 9348 O O   . HOH W 3 .   ? -6.051  39.741  62.965 1.00 15.02  ? 2003 HOH F O   1 
HETATM 9349 O O   . HOH W 3 .   ? -12.918 10.409  77.741 1.00 30.66  ? 2004 HOH F O   1 
HETATM 9350 O O   . HOH W 3 .   ? 2.313   19.001  59.721 1.00 34.29  ? 2005 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   492 ?   ?   ?   A . n 
A 1 2   PRO 2   493 ?   ?   ?   A . n 
A 1 3   LEU 3   494 ?   ?   ?   A . n 
A 1 4   ALA 4   495 ?   ?   ?   A . n 
A 1 5   GLN 5   496 ?   ?   ?   A . n 
A 1 6   ALA 6   497 497 ALA ALA A . n 
A 1 7   ASP 7   498 498 ASP ASP A . n 
A 1 8   THR 8   499 499 THR THR A . n 
A 1 9   PRO 9   500 500 PRO PRO A . n 
A 1 10  SER 10  501 501 SER SER A . n 
A 1 11  SER 11  502 502 SER SER A . n 
A 1 12  PRO 12  503 503 PRO PRO A . n 
A 1 13  SER 13  504 504 SER SER A . n 
A 1 14  ILE 14  505 505 ILE ILE A . n 
A 1 15  ASP 15  506 506 ASP ASP A . n 
A 1 16  GLN 16  507 507 GLN GLN A . n 
A 1 17  VAL 17  508 508 VAL VAL A . n 
A 1 18  GLU 18  509 509 GLU GLU A . n 
A 1 19  PRO 19  510 510 PRO PRO A . n 
A 1 20  TYR 20  511 511 TYR TYR A . n 
A 1 21  SER 21  512 512 SER SER A . n 
A 1 22  SER 22  513 513 SER SER A . n 
A 1 23  THR 23  514 514 THR THR A . n 
A 1 24  ALA 24  515 515 ALA ALA A . n 
A 1 25  GLN 25  516 516 GLN GLN A . n 
A 1 26  VAL 26  517 517 VAL VAL A . n 
A 1 27  GLN 27  518 518 GLN GLN A . n 
A 1 28  PHE 28  519 519 PHE PHE A . n 
A 1 29  ASP 29  520 520 ASP ASP A . n 
A 1 30  GLU 30  521 521 GLU GLU A . n 
A 1 31  PRO 31  522 522 PRO PRO A . n 
A 1 32  GLU 32  523 523 GLU GLU A . n 
A 1 33  ALA 33  524 524 ALA ALA A . n 
A 1 34  THR 34  525 525 THR THR A . n 
A 1 35  GLY 35  526 526 GLY GLY A . n 
A 1 36  GLY 36  527 527 GLY GLY A . n 
A 1 37  VAL 37  528 528 VAL VAL A . n 
A 1 38  PRO 38  529 529 PRO PRO A . n 
A 1 39  ILE 39  530 530 ILE ILE A . n 
A 1 40  LEU 40  531 531 LEU LEU A . n 
A 1 41  LYS 41  532 532 LYS LYS A . n 
A 1 42  TYR 42  533 533 TYR TYR A . n 
A 1 43  LYS 43  534 534 LYS LYS A . n 
A 1 44  ALA 44  535 535 ALA ALA A . n 
A 1 45  GLU 45  536 536 GLU GLU A . n 
A 1 46  TRP 46  537 537 TRP TRP A . n 
A 1 47  ARG 47  538 538 ARG ARG A . n 
A 1 48  ALA 48  539 539 ALA ALA A . n 
A 1 49  VAL 49  540 540 VAL VAL A . n 
A 1 50  GLY 50  541 541 GLY GLY A . n 
A 1 51  GLU 51  542 542 GLU GLU A . n 
A 1 52  GLU 52  543 543 GLU GLU A . n 
A 1 53  VAL 53  544 544 VAL VAL A . n 
A 1 54  TRP 54  545 545 TRP TRP A . n 
A 1 55  HIS 55  546 546 HIS HIS A . n 
A 1 56  SER 56  547 547 SER SER A . n 
A 1 57  LYS 57  548 548 LYS LYS A . n 
A 1 58  TRP 58  549 549 TRP TRP A . n 
A 1 59  TYR 59  550 550 TYR TYR A . n 
A 1 60  ASP 60  551 551 ASP ASP A . n 
A 1 61  ALA 61  552 552 ALA ALA A . n 
A 1 62  LYS 62  553 553 LYS LYS A . n 
A 1 63  GLU 63  554 554 GLU GLU A . n 
A 1 64  ALA 64  555 555 ALA ALA A . n 
A 1 65  SER 65  556 556 SER SER A . n 
A 1 66  MET 66  557 557 MET MET A . n 
A 1 67  GLU 67  558 558 GLU GLU A . n 
A 1 68  GLY 68  559 559 GLY GLY A . n 
A 1 69  ILE 69  560 560 ILE ILE A . n 
A 1 70  VAL 70  561 561 VAL VAL A . n 
A 1 71  THR 71  562 562 THR THR A . n 
A 1 72  ILE 72  563 563 ILE ILE A . n 
A 1 73  VAL 73  564 564 VAL VAL A . n 
A 1 74  GLY 74  565 565 GLY GLY A . n 
A 1 75  LEU 75  566 566 LEU LEU A . n 
A 1 76  LYS 76  567 567 LYS LYS A . n 
A 1 77  PRO 77  568 568 PRO PRO A . n 
A 1 78  GLU 78  569 569 GLU GLU A . n 
A 1 79  THR 79  570 570 THR THR A . n 
A 1 80  THR 80  571 571 THR THR A . n 
A 1 81  TYR 81  572 572 TYR TYR A . n 
A 1 82  ALA 82  573 573 ALA ALA A . n 
A 1 83  VAL 83  574 574 VAL VAL A . n 
A 1 84  ARG 84  575 575 ARG ARG A . n 
A 1 85  LEU 85  576 576 LEU LEU A . n 
A 1 86  ALA 86  577 577 ALA ALA A . n 
A 1 87  ALA 87  578 578 ALA ALA A . n 
A 1 88  LEU 88  579 579 LEU LEU A . n 
A 1 89  ASN 89  580 580 ASN ASN A . n 
A 1 90  GLY 90  581 581 GLY GLY A . n 
A 1 91  LYS 91  582 582 LYS LYS A . n 
A 1 92  GLY 92  583 583 GLY GLY A . n 
A 1 93  LEU 93  584 584 LEU LEU A . n 
A 1 94  GLY 94  585 585 GLY GLY A . n 
A 1 95  GLU 95  586 586 GLU GLU A . n 
A 1 96  ILE 96  587 587 ILE ILE A . n 
A 1 97  SER 97  588 588 SER SER A . n 
A 1 98  ALA 98  589 589 ALA ALA A . n 
A 1 99  ALA 99  590 590 ALA ALA A . n 
A 1 100 SER 100 591 591 SER SER A . n 
A 1 101 GLU 101 592 592 GLU GLU A . n 
A 1 102 PHE 102 593 593 PHE PHE A . n 
A 1 103 LYS 103 594 594 LYS LYS A . n 
A 1 104 THR 104 595 595 THR THR A . n 
A 1 105 GLN 105 596 596 GLN GLN A . n 
A 1 106 PRO 106 597 597 PRO PRO A . n 
A 1 107 VAL 107 598 598 VAL VAL A . n 
A 1 108 ARG 108 599 599 ARG ARG A . n 
A 1 109 GLU 109 600 600 GLU GLU A . n 
A 1 110 PRO 110 601 601 PRO PRO A . n 
A 1 111 SER 111 602 602 SER SER A . n 
A 1 112 ALA 112 603 603 ALA ALA A . n 
A 1 113 PRO 113 604 604 PRO PRO A . n 
A 1 114 LYS 114 605 605 LYS LYS A . n 
A 1 115 LEU 115 606 606 LEU LEU A . n 
A 1 116 GLU 116 607 607 GLU GLU A . n 
A 1 117 GLY 117 608 608 GLY GLY A . n 
A 1 118 GLN 118 609 609 GLN GLN A . n 
A 1 119 ARG 119 610 610 ARG ARG A . n 
A 1 120 GLY 120 611 611 GLY GLY A . n 
A 1 121 GLU 121 612 612 GLU GLU A . n 
A 1 122 ASP 122 613 613 ASP ASP A . n 
A 1 123 GLY 123 614 614 GLY GLY A . n 
A 1 124 ASN 124 615 615 ASN ASN A . n 
A 1 125 SER 125 616 616 SER SER A . n 
A 1 126 ILE 126 617 617 ILE ILE A . n 
A 1 127 LYS 127 618 618 LYS LYS A . n 
A 1 128 VAL 128 619 619 VAL VAL A . n 
A 1 129 ASN 129 620 620 ASN ASN A . n 
A 1 130 LEU 130 621 621 LEU LEU A . n 
A 1 131 ILE 131 622 622 ILE ILE A . n 
A 1 132 LYS 132 623 623 LYS LYS A . n 
A 1 133 GLN 133 624 624 GLN GLN A . n 
A 1 134 ASP 134 625 625 ASP ASP A . n 
A 1 135 ASP 135 626 626 ASP ASP A . n 
A 1 136 GLY 136 627 627 GLY GLY A . n 
A 1 137 GLY 137 628 628 GLY GLY A . n 
A 1 138 SER 138 629 629 SER SER A . n 
A 1 139 PRO 139 630 630 PRO PRO A . n 
A 1 140 ILE 140 631 631 ILE ILE A . n 
A 1 141 ARG 141 632 632 ARG ARG A . n 
A 1 142 HIS 142 633 633 HIS HIS A . n 
A 1 143 TYR 143 634 634 TYR TYR A . n 
A 1 144 LEU 144 635 635 LEU LEU A . n 
A 1 145 VAL 145 636 636 VAL VAL A . n 
A 1 146 ARG 146 637 637 ARG ARG A . n 
A 1 147 TYR 147 638 638 TYR TYR A . n 
A 1 148 ARG 148 639 639 ARG ARG A . n 
A 1 149 ALA 149 640 640 ALA ALA A . n 
A 1 150 LEU 150 641 641 LEU LEU A . n 
A 1 151 SER 151 642 642 SER SER A . n 
A 1 152 SER 152 643 643 SER SER A . n 
A 1 153 GLU 153 644 644 GLU GLU A . n 
A 1 154 TRP 154 645 645 TRP TRP A . n 
A 1 155 LYS 155 646 646 LYS LYS A . n 
A 1 156 PRO 156 647 647 PRO PRO A . n 
A 1 157 GLU 157 648 648 GLU GLU A . n 
A 1 158 ILE 158 649 649 ILE ILE A . n 
A 1 159 ARG 159 650 650 ARG ARG A . n 
A 1 160 LEU 160 651 651 LEU LEU A . n 
A 1 161 PRO 161 652 652 PRO PRO A . n 
A 1 162 SER 162 653 653 SER SER A . n 
A 1 163 GLY 163 654 654 GLY GLY A . n 
A 1 164 SER 164 655 655 SER SER A . n 
A 1 165 ASP 165 656 656 ASP ASP A . n 
A 1 166 HIS 166 657 657 HIS HIS A . n 
A 1 167 VAL 167 658 658 VAL VAL A . n 
A 1 168 MET 168 659 659 MET MET A . n 
A 1 169 LEU 169 660 660 LEU LEU A . n 
A 1 170 LYS 170 661 661 LYS LYS A . n 
A 1 171 SER 171 662 662 SER SER A . n 
A 1 172 LEU 172 663 663 LEU LEU A . n 
A 1 173 ASP 173 664 664 ASP ASP A . n 
A 1 174 TRP 174 665 665 TRP TRP A . n 
A 1 175 ASN 175 666 666 ASN ASN A . n 
A 1 176 ALA 176 667 667 ALA ALA A . n 
A 1 177 GLU 177 668 668 GLU GLU A . n 
A 1 178 TYR 178 669 669 TYR TYR A . n 
A 1 179 GLU 179 670 670 GLU GLU A . n 
A 1 180 VAL 180 671 671 VAL VAL A . n 
A 1 181 TYR 181 672 672 TYR TYR A . n 
A 1 182 VAL 182 673 673 VAL VAL A . n 
A 1 183 VAL 183 674 674 VAL VAL A . n 
A 1 184 ALA 184 675 675 ALA ALA A . n 
A 1 185 GLU 185 676 676 GLU GLU A . n 
A 1 186 ASN 186 677 677 ASN ASN A . n 
A 1 187 GLN 187 678 678 GLN GLN A . n 
A 1 188 GLN 188 679 679 GLN GLN A . n 
A 1 189 GLY 189 680 680 GLY GLY A . n 
A 1 190 LYS 190 681 681 LYS LYS A . n 
A 1 191 SER 191 682 682 SER SER A . n 
A 1 192 LYS 192 683 683 LYS LYS A . n 
A 1 193 ALA 193 684 684 ALA ALA A . n 
A 1 194 ALA 194 685 685 ALA ALA A . n 
A 1 195 HIS 195 686 686 HIS HIS A . n 
A 1 196 PHE 196 687 687 PHE PHE A . n 
A 1 197 VAL 197 688 688 VAL VAL A . n 
A 1 198 PHE 198 689 689 PHE PHE A . n 
A 1 199 ARG 199 690 690 ARG ARG A . n 
A 1 200 THR 200 691 691 THR THR A . n 
A 1 201 ALA 201 692 692 ALA ALA A . n 
A 1 202 ALA 202 693 693 ALA ALA A . n 
A 1 203 ALA 203 694 694 ALA ALA A . n 
A 1 204 HIS 204 695 695 HIS HIS A . n 
A 1 205 HIS 205 696 ?   ?   ?   A . n 
A 1 206 HIS 206 697 ?   ?   ?   A . n 
A 1 207 HIS 207 698 ?   ?   ?   A . n 
A 1 208 HIS 208 699 ?   ?   ?   A . n 
A 1 209 HIS 209 700 ?   ?   ?   A . n 
B 1 1   ALA 1   492 ?   ?   ?   B . n 
B 1 2   PRO 2   493 ?   ?   ?   B . n 
B 1 3   LEU 3   494 ?   ?   ?   B . n 
B 1 4   ALA 4   495 ?   ?   ?   B . n 
B 1 5   GLN 5   496 ?   ?   ?   B . n 
B 1 6   ALA 6   497 497 ALA ALA B . n 
B 1 7   ASP 7   498 498 ASP ASP B . n 
B 1 8   THR 8   499 499 THR THR B . n 
B 1 9   PRO 9   500 500 PRO PRO B . n 
B 1 10  SER 10  501 501 SER SER B . n 
B 1 11  SER 11  502 502 SER SER B . n 
B 1 12  PRO 12  503 503 PRO PRO B . n 
B 1 13  SER 13  504 504 SER SER B . n 
B 1 14  ILE 14  505 505 ILE ILE B . n 
B 1 15  ASP 15  506 506 ASP ASP B . n 
B 1 16  GLN 16  507 507 GLN GLN B . n 
B 1 17  VAL 17  508 508 VAL VAL B . n 
B 1 18  GLU 18  509 509 GLU GLU B . n 
B 1 19  PRO 19  510 510 PRO PRO B . n 
B 1 20  TYR 20  511 511 TYR TYR B . n 
B 1 21  SER 21  512 512 SER SER B . n 
B 1 22  SER 22  513 513 SER SER B . n 
B 1 23  THR 23  514 514 THR THR B . n 
B 1 24  ALA 24  515 515 ALA ALA B . n 
B 1 25  GLN 25  516 516 GLN GLN B . n 
B 1 26  VAL 26  517 517 VAL VAL B . n 
B 1 27  GLN 27  518 518 GLN GLN B . n 
B 1 28  PHE 28  519 519 PHE PHE B . n 
B 1 29  ASP 29  520 520 ASP ASP B . n 
B 1 30  GLU 30  521 521 GLU GLU B . n 
B 1 31  PRO 31  522 522 PRO PRO B . n 
B 1 32  GLU 32  523 523 GLU GLU B . n 
B 1 33  ALA 33  524 524 ALA ALA B . n 
B 1 34  THR 34  525 525 THR THR B . n 
B 1 35  GLY 35  526 526 GLY GLY B . n 
B 1 36  GLY 36  527 527 GLY GLY B . n 
B 1 37  VAL 37  528 528 VAL VAL B . n 
B 1 38  PRO 38  529 529 PRO PRO B . n 
B 1 39  ILE 39  530 530 ILE ILE B . n 
B 1 40  LEU 40  531 531 LEU LEU B . n 
B 1 41  LYS 41  532 532 LYS LYS B . n 
B 1 42  TYR 42  533 533 TYR TYR B . n 
B 1 43  LYS 43  534 534 LYS LYS B . n 
B 1 44  ALA 44  535 535 ALA ALA B . n 
B 1 45  GLU 45  536 536 GLU GLU B . n 
B 1 46  TRP 46  537 537 TRP TRP B . n 
B 1 47  ARG 47  538 538 ARG ARG B . n 
B 1 48  ALA 48  539 539 ALA ALA B . n 
B 1 49  VAL 49  540 540 VAL VAL B . n 
B 1 50  GLY 50  541 541 GLY GLY B . n 
B 1 51  GLU 51  542 542 GLU GLU B . n 
B 1 52  GLU 52  543 543 GLU GLU B . n 
B 1 53  VAL 53  544 544 VAL VAL B . n 
B 1 54  TRP 54  545 545 TRP TRP B . n 
B 1 55  HIS 55  546 546 HIS HIS B . n 
B 1 56  SER 56  547 547 SER SER B . n 
B 1 57  LYS 57  548 548 LYS LYS B . n 
B 1 58  TRP 58  549 549 TRP TRP B . n 
B 1 59  TYR 59  550 550 TYR TYR B . n 
B 1 60  ASP 60  551 551 ASP ASP B . n 
B 1 61  ALA 61  552 552 ALA ALA B . n 
B 1 62  LYS 62  553 553 LYS LYS B . n 
B 1 63  GLU 63  554 554 GLU GLU B . n 
B 1 64  ALA 64  555 555 ALA ALA B . n 
B 1 65  SER 65  556 556 SER SER B . n 
B 1 66  MET 66  557 557 MET MET B . n 
B 1 67  GLU 67  558 558 GLU GLU B . n 
B 1 68  GLY 68  559 559 GLY GLY B . n 
B 1 69  ILE 69  560 560 ILE ILE B . n 
B 1 70  VAL 70  561 561 VAL VAL B . n 
B 1 71  THR 71  562 562 THR THR B . n 
B 1 72  ILE 72  563 563 ILE ILE B . n 
B 1 73  VAL 73  564 564 VAL VAL B . n 
B 1 74  GLY 74  565 565 GLY GLY B . n 
B 1 75  LEU 75  566 566 LEU LEU B . n 
B 1 76  LYS 76  567 567 LYS LYS B . n 
B 1 77  PRO 77  568 568 PRO PRO B . n 
B 1 78  GLU 78  569 569 GLU GLU B . n 
B 1 79  THR 79  570 570 THR THR B . n 
B 1 80  THR 80  571 571 THR THR B . n 
B 1 81  TYR 81  572 572 TYR TYR B . n 
B 1 82  ALA 82  573 573 ALA ALA B . n 
B 1 83  VAL 83  574 574 VAL VAL B . n 
B 1 84  ARG 84  575 575 ARG ARG B . n 
B 1 85  LEU 85  576 576 LEU LEU B . n 
B 1 86  ALA 86  577 577 ALA ALA B . n 
B 1 87  ALA 87  578 578 ALA ALA B . n 
B 1 88  LEU 88  579 579 LEU LEU B . n 
B 1 89  ASN 89  580 580 ASN ASN B . n 
B 1 90  GLY 90  581 581 GLY GLY B . n 
B 1 91  LYS 91  582 582 LYS LYS B . n 
B 1 92  GLY 92  583 583 GLY GLY B . n 
B 1 93  LEU 93  584 584 LEU LEU B . n 
B 1 94  GLY 94  585 585 GLY GLY B . n 
B 1 95  GLU 95  586 586 GLU GLU B . n 
B 1 96  ILE 96  587 587 ILE ILE B . n 
B 1 97  SER 97  588 588 SER SER B . n 
B 1 98  ALA 98  589 589 ALA ALA B . n 
B 1 99  ALA 99  590 590 ALA ALA B . n 
B 1 100 SER 100 591 591 SER SER B . n 
B 1 101 GLU 101 592 592 GLU GLU B . n 
B 1 102 PHE 102 593 593 PHE PHE B . n 
B 1 103 LYS 103 594 594 LYS LYS B . n 
B 1 104 THR 104 595 595 THR THR B . n 
B 1 105 GLN 105 596 596 GLN GLN B . n 
B 1 106 PRO 106 597 597 PRO PRO B . n 
B 1 107 VAL 107 598 598 VAL VAL B . n 
B 1 108 ARG 108 599 599 ARG ARG B . n 
B 1 109 GLU 109 600 600 GLU GLU B . n 
B 1 110 PRO 110 601 601 PRO PRO B . n 
B 1 111 SER 111 602 602 SER SER B . n 
B 1 112 ALA 112 603 603 ALA ALA B . n 
B 1 113 PRO 113 604 604 PRO PRO B . n 
B 1 114 LYS 114 605 605 LYS LYS B . n 
B 1 115 LEU 115 606 606 LEU LEU B . n 
B 1 116 GLU 116 607 607 GLU GLU B . n 
B 1 117 GLY 117 608 608 GLY GLY B . n 
B 1 118 GLN 118 609 609 GLN GLN B . n 
B 1 119 ARG 119 610 610 ARG ARG B . n 
B 1 120 GLY 120 611 611 GLY GLY B . n 
B 1 121 GLU 121 612 612 GLU GLU B . n 
B 1 122 ASP 122 613 613 ASP ASP B . n 
B 1 123 GLY 123 614 614 GLY GLY B . n 
B 1 124 ASN 124 615 615 ASN ASN B . n 
B 1 125 SER 125 616 616 SER SER B . n 
B 1 126 ILE 126 617 617 ILE ILE B . n 
B 1 127 LYS 127 618 618 LYS LYS B . n 
B 1 128 VAL 128 619 619 VAL VAL B . n 
B 1 129 ASN 129 620 620 ASN ASN B . n 
B 1 130 LEU 130 621 621 LEU LEU B . n 
B 1 131 ILE 131 622 622 ILE ILE B . n 
B 1 132 LYS 132 623 623 LYS LYS B . n 
B 1 133 GLN 133 624 624 GLN GLN B . n 
B 1 134 ASP 134 625 625 ASP ASP B . n 
B 1 135 ASP 135 626 626 ASP ASP B . n 
B 1 136 GLY 136 627 627 GLY GLY B . n 
B 1 137 GLY 137 628 628 GLY GLY B . n 
B 1 138 SER 138 629 629 SER SER B . n 
B 1 139 PRO 139 630 630 PRO PRO B . n 
B 1 140 ILE 140 631 631 ILE ILE B . n 
B 1 141 ARG 141 632 632 ARG ARG B . n 
B 1 142 HIS 142 633 633 HIS HIS B . n 
B 1 143 TYR 143 634 634 TYR TYR B . n 
B 1 144 LEU 144 635 635 LEU LEU B . n 
B 1 145 VAL 145 636 636 VAL VAL B . n 
B 1 146 ARG 146 637 637 ARG ARG B . n 
B 1 147 TYR 147 638 638 TYR TYR B . n 
B 1 148 ARG 148 639 639 ARG ARG B . n 
B 1 149 ALA 149 640 640 ALA ALA B . n 
B 1 150 LEU 150 641 641 LEU LEU B . n 
B 1 151 SER 151 642 642 SER SER B . n 
B 1 152 SER 152 643 643 SER SER B . n 
B 1 153 GLU 153 644 644 GLU GLU B . n 
B 1 154 TRP 154 645 645 TRP TRP B . n 
B 1 155 LYS 155 646 646 LYS LYS B . n 
B 1 156 PRO 156 647 647 PRO PRO B . n 
B 1 157 GLU 157 648 648 GLU GLU B . n 
B 1 158 ILE 158 649 649 ILE ILE B . n 
B 1 159 ARG 159 650 650 ARG ARG B . n 
B 1 160 LEU 160 651 651 LEU LEU B . n 
B 1 161 PRO 161 652 652 PRO PRO B . n 
B 1 162 SER 162 653 653 SER SER B . n 
B 1 163 GLY 163 654 654 GLY GLY B . n 
B 1 164 SER 164 655 655 SER SER B . n 
B 1 165 ASP 165 656 656 ASP ASP B . n 
B 1 166 HIS 166 657 657 HIS HIS B . n 
B 1 167 VAL 167 658 658 VAL VAL B . n 
B 1 168 MET 168 659 659 MET MET B . n 
B 1 169 LEU 169 660 660 LEU LEU B . n 
B 1 170 LYS 170 661 661 LYS LYS B . n 
B 1 171 SER 171 662 662 SER SER B . n 
B 1 172 LEU 172 663 663 LEU LEU B . n 
B 1 173 ASP 173 664 664 ASP ASP B . n 
B 1 174 TRP 174 665 665 TRP TRP B . n 
B 1 175 ASN 175 666 666 ASN ASN B . n 
B 1 176 ALA 176 667 667 ALA ALA B . n 
B 1 177 GLU 177 668 668 GLU GLU B . n 
B 1 178 TYR 178 669 669 TYR TYR B . n 
B 1 179 GLU 179 670 670 GLU GLU B . n 
B 1 180 VAL 180 671 671 VAL VAL B . n 
B 1 181 TYR 181 672 672 TYR TYR B . n 
B 1 182 VAL 182 673 673 VAL VAL B . n 
B 1 183 VAL 183 674 674 VAL VAL B . n 
B 1 184 ALA 184 675 675 ALA ALA B . n 
B 1 185 GLU 185 676 676 GLU GLU B . n 
B 1 186 ASN 186 677 677 ASN ASN B . n 
B 1 187 GLN 187 678 678 GLN GLN B . n 
B 1 188 GLN 188 679 679 GLN GLN B . n 
B 1 189 GLY 189 680 680 GLY GLY B . n 
B 1 190 LYS 190 681 681 LYS LYS B . n 
B 1 191 SER 191 682 682 SER SER B . n 
B 1 192 LYS 192 683 683 LYS LYS B . n 
B 1 193 ALA 193 684 684 ALA ALA B . n 
B 1 194 ALA 194 685 685 ALA ALA B . n 
B 1 195 HIS 195 686 686 HIS HIS B . n 
B 1 196 PHE 196 687 687 PHE PHE B . n 
B 1 197 VAL 197 688 688 VAL VAL B . n 
B 1 198 PHE 198 689 689 PHE PHE B . n 
B 1 199 ARG 199 690 690 ARG ARG B . n 
B 1 200 THR 200 691 691 THR THR B . n 
B 1 201 ALA 201 692 692 ALA ALA B . n 
B 1 202 ALA 202 693 693 ALA ALA B . n 
B 1 203 ALA 203 694 694 ALA ALA B . n 
B 1 204 HIS 204 695 ?   ?   ?   B . n 
B 1 205 HIS 205 696 ?   ?   ?   B . n 
B 1 206 HIS 206 697 ?   ?   ?   B . n 
B 1 207 HIS 207 698 ?   ?   ?   B . n 
B 1 208 HIS 208 699 ?   ?   ?   B . n 
B 1 209 HIS 209 700 ?   ?   ?   B . n 
C 1 1   ALA 1   492 ?   ?   ?   C . n 
C 1 2   PRO 2   493 ?   ?   ?   C . n 
C 1 3   LEU 3   494 ?   ?   ?   C . n 
C 1 4   ALA 4   495 ?   ?   ?   C . n 
C 1 5   GLN 5   496 ?   ?   ?   C . n 
C 1 6   ALA 6   497 497 ALA ALA C . n 
C 1 7   ASP 7   498 498 ASP ASP C . n 
C 1 8   THR 8   499 499 THR THR C . n 
C 1 9   PRO 9   500 500 PRO PRO C . n 
C 1 10  SER 10  501 501 SER SER C . n 
C 1 11  SER 11  502 502 SER SER C . n 
C 1 12  PRO 12  503 503 PRO PRO C . n 
C 1 13  SER 13  504 504 SER SER C . n 
C 1 14  ILE 14  505 505 ILE ILE C . n 
C 1 15  ASP 15  506 506 ASP ASP C . n 
C 1 16  GLN 16  507 507 GLN GLN C . n 
C 1 17  VAL 17  508 508 VAL VAL C . n 
C 1 18  GLU 18  509 509 GLU GLU C . n 
C 1 19  PRO 19  510 510 PRO PRO C . n 
C 1 20  TYR 20  511 511 TYR TYR C . n 
C 1 21  SER 21  512 512 SER SER C . n 
C 1 22  SER 22  513 513 SER SER C . n 
C 1 23  THR 23  514 514 THR THR C . n 
C 1 24  ALA 24  515 515 ALA ALA C . n 
C 1 25  GLN 25  516 516 GLN GLN C . n 
C 1 26  VAL 26  517 517 VAL VAL C . n 
C 1 27  GLN 27  518 518 GLN GLN C . n 
C 1 28  PHE 28  519 519 PHE PHE C . n 
C 1 29  ASP 29  520 520 ASP ASP C . n 
C 1 30  GLU 30  521 521 GLU GLU C . n 
C 1 31  PRO 31  522 522 PRO PRO C . n 
C 1 32  GLU 32  523 523 GLU GLU C . n 
C 1 33  ALA 33  524 524 ALA ALA C . n 
C 1 34  THR 34  525 525 THR THR C . n 
C 1 35  GLY 35  526 526 GLY GLY C . n 
C 1 36  GLY 36  527 527 GLY GLY C . n 
C 1 37  VAL 37  528 528 VAL VAL C . n 
C 1 38  PRO 38  529 529 PRO PRO C . n 
C 1 39  ILE 39  530 530 ILE ILE C . n 
C 1 40  LEU 40  531 531 LEU LEU C . n 
C 1 41  LYS 41  532 532 LYS LYS C . n 
C 1 42  TYR 42  533 533 TYR TYR C . n 
C 1 43  LYS 43  534 534 LYS LYS C . n 
C 1 44  ALA 44  535 535 ALA ALA C . n 
C 1 45  GLU 45  536 536 GLU GLU C . n 
C 1 46  TRP 46  537 537 TRP TRP C . n 
C 1 47  ARG 47  538 538 ARG ARG C . n 
C 1 48  ALA 48  539 539 ALA ALA C . n 
C 1 49  VAL 49  540 540 VAL VAL C . n 
C 1 50  GLY 50  541 541 GLY GLY C . n 
C 1 51  GLU 51  542 542 GLU GLU C . n 
C 1 52  GLU 52  543 543 GLU GLU C . n 
C 1 53  VAL 53  544 544 VAL VAL C . n 
C 1 54  TRP 54  545 545 TRP TRP C . n 
C 1 55  HIS 55  546 546 HIS HIS C . n 
C 1 56  SER 56  547 547 SER SER C . n 
C 1 57  LYS 57  548 548 LYS LYS C . n 
C 1 58  TRP 58  549 549 TRP TRP C . n 
C 1 59  TYR 59  550 550 TYR TYR C . n 
C 1 60  ASP 60  551 551 ASP ASP C . n 
C 1 61  ALA 61  552 552 ALA ALA C . n 
C 1 62  LYS 62  553 553 LYS LYS C . n 
C 1 63  GLU 63  554 554 GLU GLU C . n 
C 1 64  ALA 64  555 555 ALA ALA C . n 
C 1 65  SER 65  556 556 SER SER C . n 
C 1 66  MET 66  557 557 MET MET C . n 
C 1 67  GLU 67  558 558 GLU GLU C . n 
C 1 68  GLY 68  559 559 GLY GLY C . n 
C 1 69  ILE 69  560 560 ILE ILE C . n 
C 1 70  VAL 70  561 561 VAL VAL C . n 
C 1 71  THR 71  562 562 THR THR C . n 
C 1 72  ILE 72  563 563 ILE ILE C . n 
C 1 73  VAL 73  564 564 VAL VAL C . n 
C 1 74  GLY 74  565 565 GLY GLY C . n 
C 1 75  LEU 75  566 566 LEU LEU C . n 
C 1 76  LYS 76  567 567 LYS LYS C . n 
C 1 77  PRO 77  568 568 PRO PRO C . n 
C 1 78  GLU 78  569 569 GLU GLU C . n 
C 1 79  THR 79  570 570 THR THR C . n 
C 1 80  THR 80  571 571 THR THR C . n 
C 1 81  TYR 81  572 572 TYR TYR C . n 
C 1 82  ALA 82  573 573 ALA ALA C . n 
C 1 83  VAL 83  574 574 VAL VAL C . n 
C 1 84  ARG 84  575 575 ARG ARG C . n 
C 1 85  LEU 85  576 576 LEU LEU C . n 
C 1 86  ALA 86  577 577 ALA ALA C . n 
C 1 87  ALA 87  578 578 ALA ALA C . n 
C 1 88  LEU 88  579 579 LEU LEU C . n 
C 1 89  ASN 89  580 580 ASN ASN C . n 
C 1 90  GLY 90  581 581 GLY GLY C . n 
C 1 91  LYS 91  582 582 LYS LYS C . n 
C 1 92  GLY 92  583 583 GLY GLY C . n 
C 1 93  LEU 93  584 584 LEU LEU C . n 
C 1 94  GLY 94  585 585 GLY GLY C . n 
C 1 95  GLU 95  586 586 GLU GLU C . n 
C 1 96  ILE 96  587 587 ILE ILE C . n 
C 1 97  SER 97  588 588 SER SER C . n 
C 1 98  ALA 98  589 589 ALA ALA C . n 
C 1 99  ALA 99  590 590 ALA ALA C . n 
C 1 100 SER 100 591 591 SER SER C . n 
C 1 101 GLU 101 592 592 GLU GLU C . n 
C 1 102 PHE 102 593 593 PHE PHE C . n 
C 1 103 LYS 103 594 594 LYS LYS C . n 
C 1 104 THR 104 595 595 THR THR C . n 
C 1 105 GLN 105 596 596 GLN GLN C . n 
C 1 106 PRO 106 597 597 PRO PRO C . n 
C 1 107 VAL 107 598 598 VAL VAL C . n 
C 1 108 ARG 108 599 599 ARG ARG C . n 
C 1 109 GLU 109 600 600 GLU GLU C . n 
C 1 110 PRO 110 601 601 PRO PRO C . n 
C 1 111 SER 111 602 602 SER SER C . n 
C 1 112 ALA 112 603 603 ALA ALA C . n 
C 1 113 PRO 113 604 604 PRO PRO C . n 
C 1 114 LYS 114 605 605 LYS LYS C . n 
C 1 115 LEU 115 606 606 LEU LEU C . n 
C 1 116 GLU 116 607 607 GLU GLU C . n 
C 1 117 GLY 117 608 608 GLY GLY C . n 
C 1 118 GLN 118 609 609 GLN GLN C . n 
C 1 119 ARG 119 610 610 ARG ARG C . n 
C 1 120 GLY 120 611 611 GLY GLY C . n 
C 1 121 GLU 121 612 612 GLU GLU C . n 
C 1 122 ASP 122 613 613 ASP ASP C . n 
C 1 123 GLY 123 614 614 GLY GLY C . n 
C 1 124 ASN 124 615 615 ASN ASN C . n 
C 1 125 SER 125 616 616 SER SER C . n 
C 1 126 ILE 126 617 617 ILE ILE C . n 
C 1 127 LYS 127 618 618 LYS LYS C . n 
C 1 128 VAL 128 619 619 VAL VAL C . n 
C 1 129 ASN 129 620 620 ASN ASN C . n 
C 1 130 LEU 130 621 621 LEU LEU C . n 
C 1 131 ILE 131 622 622 ILE ILE C . n 
C 1 132 LYS 132 623 623 LYS LYS C . n 
C 1 133 GLN 133 624 624 GLN GLN C . n 
C 1 134 ASP 134 625 625 ASP ASP C . n 
C 1 135 ASP 135 626 626 ASP ASP C . n 
C 1 136 GLY 136 627 627 GLY GLY C . n 
C 1 137 GLY 137 628 628 GLY GLY C . n 
C 1 138 SER 138 629 629 SER SER C . n 
C 1 139 PRO 139 630 630 PRO PRO C . n 
C 1 140 ILE 140 631 631 ILE ILE C . n 
C 1 141 ARG 141 632 632 ARG ARG C . n 
C 1 142 HIS 142 633 633 HIS HIS C . n 
C 1 143 TYR 143 634 634 TYR TYR C . n 
C 1 144 LEU 144 635 635 LEU LEU C . n 
C 1 145 VAL 145 636 636 VAL VAL C . n 
C 1 146 ARG 146 637 637 ARG ARG C . n 
C 1 147 TYR 147 638 638 TYR TYR C . n 
C 1 148 ARG 148 639 639 ARG ARG C . n 
C 1 149 ALA 149 640 640 ALA ALA C . n 
C 1 150 LEU 150 641 641 LEU LEU C . n 
C 1 151 SER 151 642 642 SER SER C . n 
C 1 152 SER 152 643 643 SER SER C . n 
C 1 153 GLU 153 644 644 GLU GLU C . n 
C 1 154 TRP 154 645 645 TRP TRP C . n 
C 1 155 LYS 155 646 646 LYS LYS C . n 
C 1 156 PRO 156 647 647 PRO PRO C . n 
C 1 157 GLU 157 648 648 GLU GLU C . n 
C 1 158 ILE 158 649 649 ILE ILE C . n 
C 1 159 ARG 159 650 650 ARG ARG C . n 
C 1 160 LEU 160 651 651 LEU LEU C . n 
C 1 161 PRO 161 652 652 PRO PRO C . n 
C 1 162 SER 162 653 653 SER SER C . n 
C 1 163 GLY 163 654 654 GLY GLY C . n 
C 1 164 SER 164 655 655 SER SER C . n 
C 1 165 ASP 165 656 656 ASP ASP C . n 
C 1 166 HIS 166 657 657 HIS HIS C . n 
C 1 167 VAL 167 658 658 VAL VAL C . n 
C 1 168 MET 168 659 659 MET MET C . n 
C 1 169 LEU 169 660 660 LEU LEU C . n 
C 1 170 LYS 170 661 661 LYS LYS C . n 
C 1 171 SER 171 662 662 SER SER C . n 
C 1 172 LEU 172 663 663 LEU LEU C . n 
C 1 173 ASP 173 664 664 ASP ASP C . n 
C 1 174 TRP 174 665 665 TRP TRP C . n 
C 1 175 ASN 175 666 666 ASN ASN C . n 
C 1 176 ALA 176 667 667 ALA ALA C . n 
C 1 177 GLU 177 668 668 GLU GLU C . n 
C 1 178 TYR 178 669 669 TYR TYR C . n 
C 1 179 GLU 179 670 670 GLU GLU C . n 
C 1 180 VAL 180 671 671 VAL VAL C . n 
C 1 181 TYR 181 672 672 TYR TYR C . n 
C 1 182 VAL 182 673 673 VAL VAL C . n 
C 1 183 VAL 183 674 674 VAL VAL C . n 
C 1 184 ALA 184 675 675 ALA ALA C . n 
C 1 185 GLU 185 676 676 GLU GLU C . n 
C 1 186 ASN 186 677 677 ASN ASN C . n 
C 1 187 GLN 187 678 678 GLN GLN C . n 
C 1 188 GLN 188 679 679 GLN GLN C . n 
C 1 189 GLY 189 680 680 GLY GLY C . n 
C 1 190 LYS 190 681 681 LYS LYS C . n 
C 1 191 SER 191 682 682 SER SER C . n 
C 1 192 LYS 192 683 683 LYS LYS C . n 
C 1 193 ALA 193 684 684 ALA ALA C . n 
C 1 194 ALA 194 685 685 ALA ALA C . n 
C 1 195 HIS 195 686 686 HIS HIS C . n 
C 1 196 PHE 196 687 687 PHE PHE C . n 
C 1 197 VAL 197 688 688 VAL VAL C . n 
C 1 198 PHE 198 689 689 PHE PHE C . n 
C 1 199 ARG 199 690 690 ARG ARG C . n 
C 1 200 THR 200 691 691 THR THR C . n 
C 1 201 ALA 201 692 692 ALA ALA C . n 
C 1 202 ALA 202 693 693 ALA ALA C . n 
C 1 203 ALA 203 694 694 ALA ALA C . n 
C 1 204 HIS 204 695 695 HIS HIS C . n 
C 1 205 HIS 205 696 ?   ?   ?   C . n 
C 1 206 HIS 206 697 ?   ?   ?   C . n 
C 1 207 HIS 207 698 ?   ?   ?   C . n 
C 1 208 HIS 208 699 ?   ?   ?   C . n 
C 1 209 HIS 209 700 ?   ?   ?   C . n 
D 1 1   ALA 1   492 ?   ?   ?   D . n 
D 1 2   PRO 2   493 ?   ?   ?   D . n 
D 1 3   LEU 3   494 ?   ?   ?   D . n 
D 1 4   ALA 4   495 ?   ?   ?   D . n 
D 1 5   GLN 5   496 ?   ?   ?   D . n 
D 1 6   ALA 6   497 497 ALA ALA D . n 
D 1 7   ASP 7   498 498 ASP ASP D . n 
D 1 8   THR 8   499 499 THR THR D . n 
D 1 9   PRO 9   500 500 PRO PRO D . n 
D 1 10  SER 10  501 501 SER SER D . n 
D 1 11  SER 11  502 502 SER SER D . n 
D 1 12  PRO 12  503 503 PRO PRO D . n 
D 1 13  SER 13  504 504 SER SER D . n 
D 1 14  ILE 14  505 505 ILE ILE D . n 
D 1 15  ASP 15  506 506 ASP ASP D . n 
D 1 16  GLN 16  507 507 GLN GLN D . n 
D 1 17  VAL 17  508 508 VAL VAL D . n 
D 1 18  GLU 18  509 509 GLU GLU D . n 
D 1 19  PRO 19  510 510 PRO PRO D . n 
D 1 20  TYR 20  511 511 TYR TYR D . n 
D 1 21  SER 21  512 512 SER SER D . n 
D 1 22  SER 22  513 513 SER SER D . n 
D 1 23  THR 23  514 514 THR THR D . n 
D 1 24  ALA 24  515 515 ALA ALA D . n 
D 1 25  GLN 25  516 516 GLN GLN D . n 
D 1 26  VAL 26  517 517 VAL VAL D . n 
D 1 27  GLN 27  518 518 GLN GLN D . n 
D 1 28  PHE 28  519 519 PHE PHE D . n 
D 1 29  ASP 29  520 520 ASP ASP D . n 
D 1 30  GLU 30  521 521 GLU GLU D . n 
D 1 31  PRO 31  522 522 PRO PRO D . n 
D 1 32  GLU 32  523 523 GLU GLU D . n 
D 1 33  ALA 33  524 524 ALA ALA D . n 
D 1 34  THR 34  525 525 THR THR D . n 
D 1 35  GLY 35  526 526 GLY GLY D . n 
D 1 36  GLY 36  527 527 GLY GLY D . n 
D 1 37  VAL 37  528 528 VAL VAL D . n 
D 1 38  PRO 38  529 529 PRO PRO D . n 
D 1 39  ILE 39  530 530 ILE ILE D . n 
D 1 40  LEU 40  531 531 LEU LEU D . n 
D 1 41  LYS 41  532 532 LYS LYS D . n 
D 1 42  TYR 42  533 533 TYR TYR D . n 
D 1 43  LYS 43  534 534 LYS LYS D . n 
D 1 44  ALA 44  535 535 ALA ALA D . n 
D 1 45  GLU 45  536 536 GLU GLU D . n 
D 1 46  TRP 46  537 537 TRP TRP D . n 
D 1 47  ARG 47  538 538 ARG ARG D . n 
D 1 48  ALA 48  539 539 ALA ALA D . n 
D 1 49  VAL 49  540 540 VAL VAL D . n 
D 1 50  GLY 50  541 541 GLY GLY D . n 
D 1 51  GLU 51  542 542 GLU GLU D . n 
D 1 52  GLU 52  543 543 GLU GLU D . n 
D 1 53  VAL 53  544 544 VAL VAL D . n 
D 1 54  TRP 54  545 545 TRP TRP D . n 
D 1 55  HIS 55  546 546 HIS HIS D . n 
D 1 56  SER 56  547 547 SER SER D . n 
D 1 57  LYS 57  548 548 LYS LYS D . n 
D 1 58  TRP 58  549 549 TRP TRP D . n 
D 1 59  TYR 59  550 550 TYR TYR D . n 
D 1 60  ASP 60  551 551 ASP ASP D . n 
D 1 61  ALA 61  552 552 ALA ALA D . n 
D 1 62  LYS 62  553 553 LYS LYS D . n 
D 1 63  GLU 63  554 554 GLU GLU D . n 
D 1 64  ALA 64  555 555 ALA ALA D . n 
D 1 65  SER 65  556 556 SER SER D . n 
D 1 66  MET 66  557 557 MET MET D . n 
D 1 67  GLU 67  558 558 GLU GLU D . n 
D 1 68  GLY 68  559 559 GLY GLY D . n 
D 1 69  ILE 69  560 560 ILE ILE D . n 
D 1 70  VAL 70  561 561 VAL VAL D . n 
D 1 71  THR 71  562 562 THR THR D . n 
D 1 72  ILE 72  563 563 ILE ILE D . n 
D 1 73  VAL 73  564 564 VAL VAL D . n 
D 1 74  GLY 74  565 565 GLY GLY D . n 
D 1 75  LEU 75  566 566 LEU LEU D . n 
D 1 76  LYS 76  567 567 LYS LYS D . n 
D 1 77  PRO 77  568 568 PRO PRO D . n 
D 1 78  GLU 78  569 569 GLU GLU D . n 
D 1 79  THR 79  570 570 THR THR D . n 
D 1 80  THR 80  571 571 THR THR D . n 
D 1 81  TYR 81  572 572 TYR TYR D . n 
D 1 82  ALA 82  573 573 ALA ALA D . n 
D 1 83  VAL 83  574 574 VAL VAL D . n 
D 1 84  ARG 84  575 575 ARG ARG D . n 
D 1 85  LEU 85  576 576 LEU LEU D . n 
D 1 86  ALA 86  577 577 ALA ALA D . n 
D 1 87  ALA 87  578 578 ALA ALA D . n 
D 1 88  LEU 88  579 579 LEU LEU D . n 
D 1 89  ASN 89  580 580 ASN ASN D . n 
D 1 90  GLY 90  581 581 GLY GLY D . n 
D 1 91  LYS 91  582 582 LYS LYS D . n 
D 1 92  GLY 92  583 583 GLY GLY D . n 
D 1 93  LEU 93  584 584 LEU LEU D . n 
D 1 94  GLY 94  585 585 GLY GLY D . n 
D 1 95  GLU 95  586 586 GLU GLU D . n 
D 1 96  ILE 96  587 587 ILE ILE D . n 
D 1 97  SER 97  588 588 SER SER D . n 
D 1 98  ALA 98  589 589 ALA ALA D . n 
D 1 99  ALA 99  590 590 ALA ALA D . n 
D 1 100 SER 100 591 591 SER SER D . n 
D 1 101 GLU 101 592 592 GLU GLU D . n 
D 1 102 PHE 102 593 593 PHE PHE D . n 
D 1 103 LYS 103 594 594 LYS LYS D . n 
D 1 104 THR 104 595 595 THR THR D . n 
D 1 105 GLN 105 596 596 GLN GLN D . n 
D 1 106 PRO 106 597 597 PRO PRO D . n 
D 1 107 VAL 107 598 598 VAL VAL D . n 
D 1 108 ARG 108 599 599 ARG ARG D . n 
D 1 109 GLU 109 600 600 GLU GLU D . n 
D 1 110 PRO 110 601 601 PRO PRO D . n 
D 1 111 SER 111 602 602 SER SER D . n 
D 1 112 ALA 112 603 603 ALA ALA D . n 
D 1 113 PRO 113 604 604 PRO PRO D . n 
D 1 114 LYS 114 605 605 LYS LYS D . n 
D 1 115 LEU 115 606 606 LEU LEU D . n 
D 1 116 GLU 116 607 607 GLU GLU D . n 
D 1 117 GLY 117 608 608 GLY GLY D . n 
D 1 118 GLN 118 609 609 GLN GLN D . n 
D 1 119 ARG 119 610 610 ARG ARG D . n 
D 1 120 GLY 120 611 611 GLY GLY D . n 
D 1 121 GLU 121 612 612 GLU GLU D . n 
D 1 122 ASP 122 613 613 ASP ASP D . n 
D 1 123 GLY 123 614 614 GLY GLY D . n 
D 1 124 ASN 124 615 615 ASN ASN D . n 
D 1 125 SER 125 616 616 SER SER D . n 
D 1 126 ILE 126 617 617 ILE ILE D . n 
D 1 127 LYS 127 618 618 LYS LYS D . n 
D 1 128 VAL 128 619 619 VAL VAL D . n 
D 1 129 ASN 129 620 620 ASN ASN D . n 
D 1 130 LEU 130 621 621 LEU LEU D . n 
D 1 131 ILE 131 622 622 ILE ILE D . n 
D 1 132 LYS 132 623 623 LYS LYS D . n 
D 1 133 GLN 133 624 624 GLN GLN D . n 
D 1 134 ASP 134 625 625 ASP ASP D . n 
D 1 135 ASP 135 626 626 ASP ASP D . n 
D 1 136 GLY 136 627 627 GLY GLY D . n 
D 1 137 GLY 137 628 628 GLY GLY D . n 
D 1 138 SER 138 629 629 SER SER D . n 
D 1 139 PRO 139 630 630 PRO PRO D . n 
D 1 140 ILE 140 631 631 ILE ILE D . n 
D 1 141 ARG 141 632 632 ARG ARG D . n 
D 1 142 HIS 142 633 633 HIS HIS D . n 
D 1 143 TYR 143 634 634 TYR TYR D . n 
D 1 144 LEU 144 635 635 LEU LEU D . n 
D 1 145 VAL 145 636 636 VAL VAL D . n 
D 1 146 ARG 146 637 637 ARG ARG D . n 
D 1 147 TYR 147 638 638 TYR TYR D . n 
D 1 148 ARG 148 639 639 ARG ARG D . n 
D 1 149 ALA 149 640 640 ALA ALA D . n 
D 1 150 LEU 150 641 641 LEU LEU D . n 
D 1 151 SER 151 642 642 SER SER D . n 
D 1 152 SER 152 643 643 SER SER D . n 
D 1 153 GLU 153 644 644 GLU GLU D . n 
D 1 154 TRP 154 645 645 TRP TRP D . n 
D 1 155 LYS 155 646 646 LYS LYS D . n 
D 1 156 PRO 156 647 647 PRO PRO D . n 
D 1 157 GLU 157 648 648 GLU GLU D . n 
D 1 158 ILE 158 649 649 ILE ILE D . n 
D 1 159 ARG 159 650 650 ARG ARG D . n 
D 1 160 LEU 160 651 651 LEU LEU D . n 
D 1 161 PRO 161 652 652 PRO PRO D . n 
D 1 162 SER 162 653 653 SER SER D . n 
D 1 163 GLY 163 654 654 GLY GLY D . n 
D 1 164 SER 164 655 655 SER SER D . n 
D 1 165 ASP 165 656 656 ASP ASP D . n 
D 1 166 HIS 166 657 657 HIS HIS D . n 
D 1 167 VAL 167 658 658 VAL VAL D . n 
D 1 168 MET 168 659 659 MET MET D . n 
D 1 169 LEU 169 660 660 LEU LEU D . n 
D 1 170 LYS 170 661 661 LYS LYS D . n 
D 1 171 SER 171 662 662 SER SER D . n 
D 1 172 LEU 172 663 663 LEU LEU D . n 
D 1 173 ASP 173 664 664 ASP ASP D . n 
D 1 174 TRP 174 665 665 TRP TRP D . n 
D 1 175 ASN 175 666 666 ASN ASN D . n 
D 1 176 ALA 176 667 667 ALA ALA D . n 
D 1 177 GLU 177 668 668 GLU GLU D . n 
D 1 178 TYR 178 669 669 TYR TYR D . n 
D 1 179 GLU 179 670 670 GLU GLU D . n 
D 1 180 VAL 180 671 671 VAL VAL D . n 
D 1 181 TYR 181 672 672 TYR TYR D . n 
D 1 182 VAL 182 673 673 VAL VAL D . n 
D 1 183 VAL 183 674 674 VAL VAL D . n 
D 1 184 ALA 184 675 675 ALA ALA D . n 
D 1 185 GLU 185 676 676 GLU GLU D . n 
D 1 186 ASN 186 677 677 ASN ASN D . n 
D 1 187 GLN 187 678 678 GLN GLN D . n 
D 1 188 GLN 188 679 679 GLN GLN D . n 
D 1 189 GLY 189 680 680 GLY GLY D . n 
D 1 190 LYS 190 681 681 LYS LYS D . n 
D 1 191 SER 191 682 682 SER SER D . n 
D 1 192 LYS 192 683 683 LYS LYS D . n 
D 1 193 ALA 193 684 684 ALA ALA D . n 
D 1 194 ALA 194 685 685 ALA ALA D . n 
D 1 195 HIS 195 686 686 HIS HIS D . n 
D 1 196 PHE 196 687 687 PHE PHE D . n 
D 1 197 VAL 197 688 688 VAL VAL D . n 
D 1 198 PHE 198 689 689 PHE PHE D . n 
D 1 199 ARG 199 690 690 ARG ARG D . n 
D 1 200 THR 200 691 691 THR THR D . n 
D 1 201 ALA 201 692 692 ALA ALA D . n 
D 1 202 ALA 202 693 693 ALA ALA D . n 
D 1 203 ALA 203 694 694 ALA ALA D . n 
D 1 204 HIS 204 695 695 HIS HIS D . n 
D 1 205 HIS 205 696 ?   ?   ?   D . n 
D 1 206 HIS 206 697 ?   ?   ?   D . n 
D 1 207 HIS 207 698 ?   ?   ?   D . n 
D 1 208 HIS 208 699 ?   ?   ?   D . n 
D 1 209 HIS 209 700 ?   ?   ?   D . n 
E 1 1   ALA 1   492 492 ALA ALA E . n 
E 1 2   PRO 2   493 493 PRO PRO E . n 
E 1 3   LEU 3   494 494 LEU LEU E . n 
E 1 4   ALA 4   495 495 ALA ALA E . n 
E 1 5   GLN 5   496 496 GLN GLN E . n 
E 1 6   ALA 6   497 497 ALA ALA E . n 
E 1 7   ASP 7   498 498 ASP ASP E . n 
E 1 8   THR 8   499 499 THR THR E . n 
E 1 9   PRO 9   500 500 PRO PRO E . n 
E 1 10  SER 10  501 501 SER SER E . n 
E 1 11  SER 11  502 502 SER SER E . n 
E 1 12  PRO 12  503 503 PRO PRO E . n 
E 1 13  SER 13  504 504 SER SER E . n 
E 1 14  ILE 14  505 505 ILE ILE E . n 
E 1 15  ASP 15  506 506 ASP ASP E . n 
E 1 16  GLN 16  507 507 GLN GLN E . n 
E 1 17  VAL 17  508 508 VAL VAL E . n 
E 1 18  GLU 18  509 509 GLU GLU E . n 
E 1 19  PRO 19  510 510 PRO PRO E . n 
E 1 20  TYR 20  511 511 TYR TYR E . n 
E 1 21  SER 21  512 512 SER SER E . n 
E 1 22  SER 22  513 513 SER SER E . n 
E 1 23  THR 23  514 514 THR THR E . n 
E 1 24  ALA 24  515 515 ALA ALA E . n 
E 1 25  GLN 25  516 516 GLN GLN E . n 
E 1 26  VAL 26  517 517 VAL VAL E . n 
E 1 27  GLN 27  518 518 GLN GLN E . n 
E 1 28  PHE 28  519 519 PHE PHE E . n 
E 1 29  ASP 29  520 520 ASP ASP E . n 
E 1 30  GLU 30  521 521 GLU GLU E . n 
E 1 31  PRO 31  522 522 PRO PRO E . n 
E 1 32  GLU 32  523 523 GLU GLU E . n 
E 1 33  ALA 33  524 524 ALA ALA E . n 
E 1 34  THR 34  525 525 THR THR E . n 
E 1 35  GLY 35  526 526 GLY GLY E . n 
E 1 36  GLY 36  527 527 GLY GLY E . n 
E 1 37  VAL 37  528 528 VAL VAL E . n 
E 1 38  PRO 38  529 529 PRO PRO E . n 
E 1 39  ILE 39  530 530 ILE ILE E . n 
E 1 40  LEU 40  531 531 LEU LEU E . n 
E 1 41  LYS 41  532 532 LYS LYS E . n 
E 1 42  TYR 42  533 533 TYR TYR E . n 
E 1 43  LYS 43  534 534 LYS LYS E . n 
E 1 44  ALA 44  535 535 ALA ALA E . n 
E 1 45  GLU 45  536 536 GLU GLU E . n 
E 1 46  TRP 46  537 537 TRP TRP E . n 
E 1 47  ARG 47  538 538 ARG ARG E . n 
E 1 48  ALA 48  539 539 ALA ALA E . n 
E 1 49  VAL 49  540 540 VAL VAL E . n 
E 1 50  GLY 50  541 541 GLY GLY E . n 
E 1 51  GLU 51  542 542 GLU GLU E . n 
E 1 52  GLU 52  543 543 GLU GLU E . n 
E 1 53  VAL 53  544 544 VAL VAL E . n 
E 1 54  TRP 54  545 545 TRP TRP E . n 
E 1 55  HIS 55  546 546 HIS HIS E . n 
E 1 56  SER 56  547 547 SER SER E . n 
E 1 57  LYS 57  548 548 LYS LYS E . n 
E 1 58  TRP 58  549 549 TRP TRP E . n 
E 1 59  TYR 59  550 550 TYR TYR E . n 
E 1 60  ASP 60  551 551 ASP ASP E . n 
E 1 61  ALA 61  552 552 ALA ALA E . n 
E 1 62  LYS 62  553 553 LYS LYS E . n 
E 1 63  GLU 63  554 554 GLU GLU E . n 
E 1 64  ALA 64  555 555 ALA ALA E . n 
E 1 65  SER 65  556 556 SER SER E . n 
E 1 66  MET 66  557 557 MET MET E . n 
E 1 67  GLU 67  558 558 GLU GLU E . n 
E 1 68  GLY 68  559 559 GLY GLY E . n 
E 1 69  ILE 69  560 560 ILE ILE E . n 
E 1 70  VAL 70  561 561 VAL VAL E . n 
E 1 71  THR 71  562 562 THR THR E . n 
E 1 72  ILE 72  563 563 ILE ILE E . n 
E 1 73  VAL 73  564 564 VAL VAL E . n 
E 1 74  GLY 74  565 565 GLY GLY E . n 
E 1 75  LEU 75  566 566 LEU LEU E . n 
E 1 76  LYS 76  567 567 LYS LYS E . n 
E 1 77  PRO 77  568 568 PRO PRO E . n 
E 1 78  GLU 78  569 569 GLU GLU E . n 
E 1 79  THR 79  570 570 THR THR E . n 
E 1 80  THR 80  571 571 THR THR E . n 
E 1 81  TYR 81  572 572 TYR TYR E . n 
E 1 82  ALA 82  573 573 ALA ALA E . n 
E 1 83  VAL 83  574 574 VAL VAL E . n 
E 1 84  ARG 84  575 575 ARG ARG E . n 
E 1 85  LEU 85  576 576 LEU LEU E . n 
E 1 86  ALA 86  577 577 ALA ALA E . n 
E 1 87  ALA 87  578 578 ALA ALA E . n 
E 1 88  LEU 88  579 579 LEU LEU E . n 
E 1 89  ASN 89  580 580 ASN ASN E . n 
E 1 90  GLY 90  581 581 GLY GLY E . n 
E 1 91  LYS 91  582 582 LYS LYS E . n 
E 1 92  GLY 92  583 583 GLY GLY E . n 
E 1 93  LEU 93  584 584 LEU LEU E . n 
E 1 94  GLY 94  585 585 GLY GLY E . n 
E 1 95  GLU 95  586 586 GLU GLU E . n 
E 1 96  ILE 96  587 587 ILE ILE E . n 
E 1 97  SER 97  588 588 SER SER E . n 
E 1 98  ALA 98  589 589 ALA ALA E . n 
E 1 99  ALA 99  590 590 ALA ALA E . n 
E 1 100 SER 100 591 591 SER SER E . n 
E 1 101 GLU 101 592 592 GLU GLU E . n 
E 1 102 PHE 102 593 593 PHE PHE E . n 
E 1 103 LYS 103 594 594 LYS LYS E . n 
E 1 104 THR 104 595 595 THR THR E . n 
E 1 105 GLN 105 596 596 GLN GLN E . n 
E 1 106 PRO 106 597 597 PRO PRO E . n 
E 1 107 VAL 107 598 598 VAL VAL E . n 
E 1 108 ARG 108 599 599 ARG ARG E . n 
E 1 109 GLU 109 600 600 GLU GLU E . n 
E 1 110 PRO 110 601 601 PRO PRO E . n 
E 1 111 SER 111 602 602 SER SER E . n 
E 1 112 ALA 112 603 603 ALA ALA E . n 
E 1 113 PRO 113 604 604 PRO PRO E . n 
E 1 114 LYS 114 605 605 LYS LYS E . n 
E 1 115 LEU 115 606 606 LEU LEU E . n 
E 1 116 GLU 116 607 607 GLU GLU E . n 
E 1 117 GLY 117 608 608 GLY GLY E . n 
E 1 118 GLN 118 609 609 GLN GLN E . n 
E 1 119 ARG 119 610 610 ARG ARG E . n 
E 1 120 GLY 120 611 611 GLY GLY E . n 
E 1 121 GLU 121 612 612 GLU GLU E . n 
E 1 122 ASP 122 613 613 ASP ASP E . n 
E 1 123 GLY 123 614 614 GLY GLY E . n 
E 1 124 ASN 124 615 615 ASN ASN E . n 
E 1 125 SER 125 616 616 SER SER E . n 
E 1 126 ILE 126 617 617 ILE ILE E . n 
E 1 127 LYS 127 618 618 LYS LYS E . n 
E 1 128 VAL 128 619 619 VAL VAL E . n 
E 1 129 ASN 129 620 620 ASN ASN E . n 
E 1 130 LEU 130 621 621 LEU LEU E . n 
E 1 131 ILE 131 622 622 ILE ILE E . n 
E 1 132 LYS 132 623 623 LYS LYS E . n 
E 1 133 GLN 133 624 624 GLN GLN E . n 
E 1 134 ASP 134 625 625 ASP ASP E . n 
E 1 135 ASP 135 626 626 ASP ASP E . n 
E 1 136 GLY 136 627 627 GLY GLY E . n 
E 1 137 GLY 137 628 628 GLY GLY E . n 
E 1 138 SER 138 629 629 SER SER E . n 
E 1 139 PRO 139 630 630 PRO PRO E . n 
E 1 140 ILE 140 631 631 ILE ILE E . n 
E 1 141 ARG 141 632 632 ARG ARG E . n 
E 1 142 HIS 142 633 633 HIS HIS E . n 
E 1 143 TYR 143 634 634 TYR TYR E . n 
E 1 144 LEU 144 635 635 LEU LEU E . n 
E 1 145 VAL 145 636 636 VAL VAL E . n 
E 1 146 ARG 146 637 637 ARG ARG E . n 
E 1 147 TYR 147 638 638 TYR TYR E . n 
E 1 148 ARG 148 639 639 ARG ARG E . n 
E 1 149 ALA 149 640 640 ALA ALA E . n 
E 1 150 LEU 150 641 641 LEU LEU E . n 
E 1 151 SER 151 642 642 SER SER E . n 
E 1 152 SER 152 643 643 SER SER E . n 
E 1 153 GLU 153 644 644 GLU GLU E . n 
E 1 154 TRP 154 645 645 TRP TRP E . n 
E 1 155 LYS 155 646 646 LYS LYS E . n 
E 1 156 PRO 156 647 647 PRO PRO E . n 
E 1 157 GLU 157 648 648 GLU GLU E . n 
E 1 158 ILE 158 649 649 ILE ILE E . n 
E 1 159 ARG 159 650 650 ARG ARG E . n 
E 1 160 LEU 160 651 651 LEU LEU E . n 
E 1 161 PRO 161 652 652 PRO PRO E . n 
E 1 162 SER 162 653 653 SER SER E . n 
E 1 163 GLY 163 654 654 GLY GLY E . n 
E 1 164 SER 164 655 655 SER SER E . n 
E 1 165 ASP 165 656 656 ASP ASP E . n 
E 1 166 HIS 166 657 657 HIS HIS E . n 
E 1 167 VAL 167 658 658 VAL VAL E . n 
E 1 168 MET 168 659 659 MET MET E . n 
E 1 169 LEU 169 660 660 LEU LEU E . n 
E 1 170 LYS 170 661 661 LYS LYS E . n 
E 1 171 SER 171 662 662 SER SER E . n 
E 1 172 LEU 172 663 663 LEU LEU E . n 
E 1 173 ASP 173 664 664 ASP ASP E . n 
E 1 174 TRP 174 665 665 TRP TRP E . n 
E 1 175 ASN 175 666 666 ASN ASN E . n 
E 1 176 ALA 176 667 667 ALA ALA E . n 
E 1 177 GLU 177 668 668 GLU GLU E . n 
E 1 178 TYR 178 669 669 TYR TYR E . n 
E 1 179 GLU 179 670 670 GLU GLU E . n 
E 1 180 VAL 180 671 671 VAL VAL E . n 
E 1 181 TYR 181 672 672 TYR TYR E . n 
E 1 182 VAL 182 673 673 VAL VAL E . n 
E 1 183 VAL 183 674 674 VAL VAL E . n 
E 1 184 ALA 184 675 675 ALA ALA E . n 
E 1 185 GLU 185 676 676 GLU GLU E . n 
E 1 186 ASN 186 677 677 ASN ASN E . n 
E 1 187 GLN 187 678 678 GLN GLN E . n 
E 1 188 GLN 188 679 679 GLN GLN E . n 
E 1 189 GLY 189 680 680 GLY GLY E . n 
E 1 190 LYS 190 681 681 LYS LYS E . n 
E 1 191 SER 191 682 682 SER SER E . n 
E 1 192 LYS 192 683 683 LYS LYS E . n 
E 1 193 ALA 193 684 684 ALA ALA E . n 
E 1 194 ALA 194 685 685 ALA ALA E . n 
E 1 195 HIS 195 686 686 HIS HIS E . n 
E 1 196 PHE 196 687 687 PHE PHE E . n 
E 1 197 VAL 197 688 688 VAL VAL E . n 
E 1 198 PHE 198 689 689 PHE PHE E . n 
E 1 199 ARG 199 690 690 ARG ARG E . n 
E 1 200 THR 200 691 691 THR THR E . n 
E 1 201 ALA 201 692 692 ALA ALA E . n 
E 1 202 ALA 202 693 693 ALA ALA E . n 
E 1 203 ALA 203 694 694 ALA ALA E . n 
E 1 204 HIS 204 695 ?   ?   ?   E . n 
E 1 205 HIS 205 696 ?   ?   ?   E . n 
E 1 206 HIS 206 697 ?   ?   ?   E . n 
E 1 207 HIS 207 698 ?   ?   ?   E . n 
E 1 208 HIS 208 699 ?   ?   ?   E . n 
E 1 209 HIS 209 700 ?   ?   ?   E . n 
F 1 1   ALA 1   492 ?   ?   ?   F . n 
F 1 2   PRO 2   493 ?   ?   ?   F . n 
F 1 3   LEU 3   494 ?   ?   ?   F . n 
F 1 4   ALA 4   495 ?   ?   ?   F . n 
F 1 5   GLN 5   496 ?   ?   ?   F . n 
F 1 6   ALA 6   497 497 ALA ALA F . n 
F 1 7   ASP 7   498 498 ASP ASP F . n 
F 1 8   THR 8   499 499 THR THR F . n 
F 1 9   PRO 9   500 500 PRO PRO F . n 
F 1 10  SER 10  501 501 SER SER F . n 
F 1 11  SER 11  502 502 SER SER F . n 
F 1 12  PRO 12  503 503 PRO PRO F . n 
F 1 13  SER 13  504 504 SER SER F . n 
F 1 14  ILE 14  505 505 ILE ILE F . n 
F 1 15  ASP 15  506 506 ASP ASP F . n 
F 1 16  GLN 16  507 507 GLN GLN F . n 
F 1 17  VAL 17  508 508 VAL VAL F . n 
F 1 18  GLU 18  509 509 GLU GLU F . n 
F 1 19  PRO 19  510 510 PRO PRO F . n 
F 1 20  TYR 20  511 511 TYR TYR F . n 
F 1 21  SER 21  512 512 SER SER F . n 
F 1 22  SER 22  513 513 SER SER F . n 
F 1 23  THR 23  514 514 THR THR F . n 
F 1 24  ALA 24  515 515 ALA ALA F . n 
F 1 25  GLN 25  516 516 GLN GLN F . n 
F 1 26  VAL 26  517 517 VAL VAL F . n 
F 1 27  GLN 27  518 518 GLN GLN F . n 
F 1 28  PHE 28  519 519 PHE PHE F . n 
F 1 29  ASP 29  520 520 ASP ASP F . n 
F 1 30  GLU 30  521 521 GLU GLU F . n 
F 1 31  PRO 31  522 522 PRO PRO F . n 
F 1 32  GLU 32  523 523 GLU GLU F . n 
F 1 33  ALA 33  524 524 ALA ALA F . n 
F 1 34  THR 34  525 525 THR THR F . n 
F 1 35  GLY 35  526 526 GLY GLY F . n 
F 1 36  GLY 36  527 527 GLY GLY F . n 
F 1 37  VAL 37  528 528 VAL VAL F . n 
F 1 38  PRO 38  529 529 PRO PRO F . n 
F 1 39  ILE 39  530 530 ILE ILE F . n 
F 1 40  LEU 40  531 531 LEU LEU F . n 
F 1 41  LYS 41  532 532 LYS LYS F . n 
F 1 42  TYR 42  533 533 TYR TYR F . n 
F 1 43  LYS 43  534 534 LYS LYS F . n 
F 1 44  ALA 44  535 535 ALA ALA F . n 
F 1 45  GLU 45  536 536 GLU GLU F . n 
F 1 46  TRP 46  537 537 TRP TRP F . n 
F 1 47  ARG 47  538 538 ARG ARG F . n 
F 1 48  ALA 48  539 539 ALA ALA F . n 
F 1 49  VAL 49  540 540 VAL VAL F . n 
F 1 50  GLY 50  541 541 GLY GLY F . n 
F 1 51  GLU 51  542 542 GLU GLU F . n 
F 1 52  GLU 52  543 543 GLU GLU F . n 
F 1 53  VAL 53  544 544 VAL VAL F . n 
F 1 54  TRP 54  545 545 TRP TRP F . n 
F 1 55  HIS 55  546 546 HIS HIS F . n 
F 1 56  SER 56  547 547 SER SER F . n 
F 1 57  LYS 57  548 548 LYS LYS F . n 
F 1 58  TRP 58  549 549 TRP TRP F . n 
F 1 59  TYR 59  550 550 TYR TYR F . n 
F 1 60  ASP 60  551 551 ASP ASP F . n 
F 1 61  ALA 61  552 552 ALA ALA F . n 
F 1 62  LYS 62  553 553 LYS LYS F . n 
F 1 63  GLU 63  554 554 GLU GLU F . n 
F 1 64  ALA 64  555 555 ALA ALA F . n 
F 1 65  SER 65  556 556 SER SER F . n 
F 1 66  MET 66  557 557 MET MET F . n 
F 1 67  GLU 67  558 558 GLU GLU F . n 
F 1 68  GLY 68  559 559 GLY GLY F . n 
F 1 69  ILE 69  560 560 ILE ILE F . n 
F 1 70  VAL 70  561 561 VAL VAL F . n 
F 1 71  THR 71  562 562 THR THR F . n 
F 1 72  ILE 72  563 563 ILE ILE F . n 
F 1 73  VAL 73  564 564 VAL VAL F . n 
F 1 74  GLY 74  565 565 GLY GLY F . n 
F 1 75  LEU 75  566 566 LEU LEU F . n 
F 1 76  LYS 76  567 567 LYS LYS F . n 
F 1 77  PRO 77  568 568 PRO PRO F . n 
F 1 78  GLU 78  569 569 GLU GLU F . n 
F 1 79  THR 79  570 570 THR THR F . n 
F 1 80  THR 80  571 571 THR THR F . n 
F 1 81  TYR 81  572 572 TYR TYR F . n 
F 1 82  ALA 82  573 573 ALA ALA F . n 
F 1 83  VAL 83  574 574 VAL VAL F . n 
F 1 84  ARG 84  575 575 ARG ARG F . n 
F 1 85  LEU 85  576 576 LEU LEU F . n 
F 1 86  ALA 86  577 577 ALA ALA F . n 
F 1 87  ALA 87  578 578 ALA ALA F . n 
F 1 88  LEU 88  579 579 LEU LEU F . n 
F 1 89  ASN 89  580 580 ASN ASN F . n 
F 1 90  GLY 90  581 581 GLY GLY F . n 
F 1 91  LYS 91  582 582 LYS LYS F . n 
F 1 92  GLY 92  583 583 GLY GLY F . n 
F 1 93  LEU 93  584 584 LEU LEU F . n 
F 1 94  GLY 94  585 585 GLY GLY F . n 
F 1 95  GLU 95  586 586 GLU GLU F . n 
F 1 96  ILE 96  587 587 ILE ILE F . n 
F 1 97  SER 97  588 588 SER SER F . n 
F 1 98  ALA 98  589 589 ALA ALA F . n 
F 1 99  ALA 99  590 590 ALA ALA F . n 
F 1 100 SER 100 591 591 SER SER F . n 
F 1 101 GLU 101 592 592 GLU GLU F . n 
F 1 102 PHE 102 593 593 PHE PHE F . n 
F 1 103 LYS 103 594 594 LYS LYS F . n 
F 1 104 THR 104 595 595 THR THR F . n 
F 1 105 GLN 105 596 596 GLN GLN F . n 
F 1 106 PRO 106 597 597 PRO PRO F . n 
F 1 107 VAL 107 598 598 VAL VAL F . n 
F 1 108 ARG 108 599 599 ARG ARG F . n 
F 1 109 GLU 109 600 600 GLU GLU F . n 
F 1 110 PRO 110 601 601 PRO PRO F . n 
F 1 111 SER 111 602 602 SER SER F . n 
F 1 112 ALA 112 603 603 ALA ALA F . n 
F 1 113 PRO 113 604 604 PRO PRO F . n 
F 1 114 LYS 114 605 605 LYS LYS F . n 
F 1 115 LEU 115 606 606 LEU LEU F . n 
F 1 116 GLU 116 607 607 GLU GLU F . n 
F 1 117 GLY 117 608 608 GLY GLY F . n 
F 1 118 GLN 118 609 609 GLN GLN F . n 
F 1 119 ARG 119 610 610 ARG ARG F . n 
F 1 120 GLY 120 611 611 GLY GLY F . n 
F 1 121 GLU 121 612 612 GLU GLU F . n 
F 1 122 ASP 122 613 613 ASP ASP F . n 
F 1 123 GLY 123 614 614 GLY GLY F . n 
F 1 124 ASN 124 615 615 ASN ASN F . n 
F 1 125 SER 125 616 616 SER SER F . n 
F 1 126 ILE 126 617 617 ILE ILE F . n 
F 1 127 LYS 127 618 618 LYS LYS F . n 
F 1 128 VAL 128 619 619 VAL VAL F . n 
F 1 129 ASN 129 620 620 ASN ASN F . n 
F 1 130 LEU 130 621 621 LEU LEU F . n 
F 1 131 ILE 131 622 622 ILE ILE F . n 
F 1 132 LYS 132 623 623 LYS LYS F . n 
F 1 133 GLN 133 624 624 GLN GLN F . n 
F 1 134 ASP 134 625 625 ASP ASP F . n 
F 1 135 ASP 135 626 626 ASP ASP F . n 
F 1 136 GLY 136 627 627 GLY GLY F . n 
F 1 137 GLY 137 628 628 GLY GLY F . n 
F 1 138 SER 138 629 629 SER SER F . n 
F 1 139 PRO 139 630 630 PRO PRO F . n 
F 1 140 ILE 140 631 631 ILE ILE F . n 
F 1 141 ARG 141 632 632 ARG ARG F . n 
F 1 142 HIS 142 633 633 HIS HIS F . n 
F 1 143 TYR 143 634 634 TYR TYR F . n 
F 1 144 LEU 144 635 635 LEU LEU F . n 
F 1 145 VAL 145 636 636 VAL VAL F . n 
F 1 146 ARG 146 637 637 ARG ARG F . n 
F 1 147 TYR 147 638 638 TYR TYR F . n 
F 1 148 ARG 148 639 639 ARG ARG F . n 
F 1 149 ALA 149 640 640 ALA ALA F . n 
F 1 150 LEU 150 641 641 LEU LEU F . n 
F 1 151 SER 151 642 642 SER SER F . n 
F 1 152 SER 152 643 643 SER SER F . n 
F 1 153 GLU 153 644 644 GLU GLU F . n 
F 1 154 TRP 154 645 645 TRP TRP F . n 
F 1 155 LYS 155 646 646 LYS LYS F . n 
F 1 156 PRO 156 647 647 PRO PRO F . n 
F 1 157 GLU 157 648 648 GLU GLU F . n 
F 1 158 ILE 158 649 649 ILE ILE F . n 
F 1 159 ARG 159 650 650 ARG ARG F . n 
F 1 160 LEU 160 651 651 LEU LEU F . n 
F 1 161 PRO 161 652 652 PRO PRO F . n 
F 1 162 SER 162 653 653 SER SER F . n 
F 1 163 GLY 163 654 654 GLY GLY F . n 
F 1 164 SER 164 655 655 SER SER F . n 
F 1 165 ASP 165 656 656 ASP ASP F . n 
F 1 166 HIS 166 657 657 HIS HIS F . n 
F 1 167 VAL 167 658 658 VAL VAL F . n 
F 1 168 MET 168 659 659 MET MET F . n 
F 1 169 LEU 169 660 660 LEU LEU F . n 
F 1 170 LYS 170 661 661 LYS LYS F . n 
F 1 171 SER 171 662 662 SER SER F . n 
F 1 172 LEU 172 663 663 LEU LEU F . n 
F 1 173 ASP 173 664 664 ASP ASP F . n 
F 1 174 TRP 174 665 665 TRP TRP F . n 
F 1 175 ASN 175 666 666 ASN ASN F . n 
F 1 176 ALA 176 667 667 ALA ALA F . n 
F 1 177 GLU 177 668 668 GLU GLU F . n 
F 1 178 TYR 178 669 669 TYR TYR F . n 
F 1 179 GLU 179 670 670 GLU GLU F . n 
F 1 180 VAL 180 671 671 VAL VAL F . n 
F 1 181 TYR 181 672 672 TYR TYR F . n 
F 1 182 VAL 182 673 673 VAL VAL F . n 
F 1 183 VAL 183 674 674 VAL VAL F . n 
F 1 184 ALA 184 675 675 ALA ALA F . n 
F 1 185 GLU 185 676 676 GLU GLU F . n 
F 1 186 ASN 186 677 677 ASN ASN F . n 
F 1 187 GLN 187 678 678 GLN GLN F . n 
F 1 188 GLN 188 679 679 GLN GLN F . n 
F 1 189 GLY 189 680 680 GLY GLY F . n 
F 1 190 LYS 190 681 681 LYS LYS F . n 
F 1 191 SER 191 682 682 SER SER F . n 
F 1 192 LYS 192 683 683 LYS LYS F . n 
F 1 193 ALA 193 684 684 ALA ALA F . n 
F 1 194 ALA 194 685 685 ALA ALA F . n 
F 1 195 HIS 195 686 686 HIS HIS F . n 
F 1 196 PHE 196 687 687 PHE PHE F . n 
F 1 197 VAL 197 688 688 VAL VAL F . n 
F 1 198 PHE 198 689 689 PHE PHE F . n 
F 1 199 ARG 199 690 690 ARG ARG F . n 
F 1 200 THR 200 691 691 THR THR F . n 
F 1 201 ALA 201 692 692 ALA ALA F . n 
F 1 202 ALA 202 693 693 ALA ALA F . n 
F 1 203 ALA 203 694 694 ALA ALA F . n 
F 1 204 HIS 204 695 695 HIS HIS F . n 
F 1 205 HIS 205 696 ?   ?   ?   F . n 
F 1 206 HIS 206 697 ?   ?   ?   F . n 
F 1 207 HIS 207 698 ?   ?   ?   F . n 
F 1 208 HIS 208 699 ?   ?   ?   F . n 
F 1 209 HIS 209 700 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 2 SO4 1 1696 1696 SO4 SO4 A . 
H 2 SO4 1 1697 1697 SO4 SO4 A . 
I 2 SO4 1 1696 1696 SO4 SO4 C . 
J 2 SO4 1 1697 1697 SO4 SO4 C . 
K 2 SO4 1 1696 1696 SO4 SO4 D . 
L 2 SO4 1 1695 1695 SO4 SO4 E . 
M 2 SO4 1 1696 1696 SO4 SO4 F . 
N 2 SO4 1 1697 1697 SO4 SO4 F . 
O 2 SO4 1 1698 1698 SO4 SO4 F . 
P 2 SO4 1 1699 1699 SO4 SO4 F . 
Q 2 SO4 1 1700 1700 SO4 SO4 F . 
R 3 HOH 1 2001 2001 HOH HOH A . 
R 3 HOH 2 2002 2002 HOH HOH A . 
R 3 HOH 3 2003 2003 HOH HOH A . 
S 3 HOH 1 2001 2001 HOH HOH B . 
S 3 HOH 2 2002 2002 HOH HOH B . 
S 3 HOH 3 2003 2003 HOH HOH B . 
S 3 HOH 4 2004 2004 HOH HOH B . 
S 3 HOH 5 2005 2005 HOH HOH B . 
S 3 HOH 6 2006 2006 HOH HOH B . 
T 3 HOH 1 2001 2001 HOH HOH C . 
T 3 HOH 2 2002 2002 HOH HOH C . 
T 3 HOH 3 2003 2003 HOH HOH C . 
T 3 HOH 4 2004 2004 HOH HOH C . 
T 3 HOH 5 2005 2005 HOH HOH C . 
T 3 HOH 6 2006 2006 HOH HOH C . 
T 3 HOH 7 2007 2007 HOH HOH C . 
U 3 HOH 1 2001 2001 HOH HOH D . 
U 3 HOH 2 2002 2002 HOH HOH D . 
U 3 HOH 3 2003 2003 HOH HOH D . 
U 3 HOH 4 2004 2004 HOH HOH D . 
U 3 HOH 5 2005 2005 HOH HOH D . 
V 3 HOH 1 2001 2001 HOH HOH E . 
V 3 HOH 2 2002 2002 HOH HOH E . 
V 3 HOH 3 2003 2003 HOH HOH E . 
V 3 HOH 4 2004 2004 HOH HOH E . 
V 3 HOH 5 2005 2005 HOH HOH E . 
W 3 HOH 1 2001 2001 HOH HOH F . 
W 3 HOH 2 2002 2002 HOH HOH F . 
W 3 HOH 3 2003 2003 HOH HOH F . 
W 3 HOH 4 2004 2004 HOH HOH F . 
W 3 HOH 5 2005 2005 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
3 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,G,H,R,S         
2 1 C,D,I,J,K,T,U       
3 1 E,F,L,M,N,O,P,Q,V,W 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4270  ? 
1 MORE         -9.9  ? 
1 'SSA (A^2)'  23640 ? 
2 'ABSA (A^2)' 3520  ? 
2 MORE         -16.7 ? 
2 'SSA (A^2)'  23490 ? 
3 'ABSA (A^2)' 4400  ? 
3 MORE         -8.5  ? 
3 'SSA (A^2)'  23940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-26 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
PHASER phasing          .   ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2VKX 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, MET 611 TO ARG
ENGINEERED RESIDUE IN CHAIN B, MET 611 TO ARG
ENGINEERED RESIDUE IN CHAIN C, MET 611 TO ARG
ENGINEERED RESIDUE IN CHAIN D, MET 611 TO ARG
ENGINEERED RESIDUE IN CHAIN E, MET 611 TO ARG
ENGINEERED RESIDUE IN CHAIN F, MET 611 TO ARG
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;N-TERMINAL APLA AND C-TERMINAL AAAHHHHHH ARE VECTOR-
DERIVED. QG (POSITIONS 599-600) OF P13591 REPLACED BY R (
NATURAL MUSCLE- AND BRAIN-SPECIFIC SPLICE VARIANT). M610
REPLACED BY R (DESIGNED MUTATION).
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 511 ? ? -125.99 -166.04 
2  1 LYS A 548 ? ? -170.21 140.32  
3  1 PRO A 630 ? ? -44.47  150.63  
4  1 LEU A 641 ? ? -32.80  146.37  
5  1 SER A 662 ? ? 36.71   53.54   
6  1 ALA A 694 ? ? -171.17 -26.77  
7  1 ASP B 498 ? ? -173.04 -167.06 
8  1 TYR B 511 ? ? -112.27 -148.39 
9  1 ASP B 625 ? ? -37.19  126.68  
10 1 ASP C 498 ? ? -178.69 -150.59 
11 1 TYR C 511 ? ? -118.05 -146.50 
12 1 GLU C 523 ? ? -66.80  26.30   
13 1 ALA C 524 ? ? -169.66 85.23   
14 1 LYS C 548 ? ? -174.31 131.00  
15 1 ASP D 498 ? ? -173.98 130.61  
16 1 PRO D 503 ? ? -57.95  175.24  
17 1 TYR D 511 ? ? -115.54 -153.65 
18 1 GLU D 523 ? ? -49.71  -19.04  
19 1 VAL D 528 ? ? 75.12   36.26   
20 1 LYS D 532 ? ? 64.74   144.83  
21 1 GLU D 543 ? ? -65.11  -86.49  
22 1 HIS D 633 ? ? 179.46  177.45  
23 1 SER D 642 ? ? 77.73   -27.23  
24 1 ASN D 677 ? ? -122.75 -167.35 
25 1 ALA D 692 ? ? -70.70  -169.42 
26 1 TYR E 511 ? ? -110.81 -161.38 
27 1 PRO E 522 ? ? -39.19  132.65  
28 1 GLU E 569 ? ? 38.37   37.36   
29 1 ASN E 580 ? ? -125.59 -169.06 
30 1 ASP E 625 ? ? -31.39  120.79  
31 1 SER E 642 ? ? 119.42  -74.67  
32 1 SER E 643 ? ? -50.17  175.58  
33 1 HIS E 657 ? ? 175.39  162.24  
34 1 SER E 662 ? ? 45.63   77.67   
35 1 GLN E 678 ? ? -49.87  -18.04  
36 1 ASP F 498 ? ? -69.09  -178.18 
37 1 TYR F 511 ? ? -122.59 -160.30 
38 1 VAL F 528 ? ? -35.61  129.93  
39 1 LYS F 553 ? ? -55.11  -72.29  
40 1 LYS F 582 ? ? -57.25  -93.35  
41 1 SER F 642 ? ? 81.22   4.63    
42 1 ALA F 694 ? ? -156.78 -2.61   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 695 ? CA  ? A HIS 204 CA  
2  1 Y 1 A HIS 695 ? C   ? A HIS 204 C   
3  1 Y 1 A HIS 695 ? O   ? A HIS 204 O   
4  1 Y 1 A HIS 695 ? CB  ? A HIS 204 CB  
5  1 Y 1 A HIS 695 ? CG  ? A HIS 204 CG  
6  1 Y 1 A HIS 695 ? ND1 ? A HIS 204 ND1 
7  1 Y 1 A HIS 695 ? CD2 ? A HIS 204 CD2 
8  1 Y 1 A HIS 695 ? CE1 ? A HIS 204 CE1 
9  1 Y 1 A HIS 695 ? NE2 ? A HIS 204 NE2 
10 1 Y 1 B ALA 694 ? CA  ? B ALA 203 CA  
11 1 Y 1 B ALA 694 ? C   ? B ALA 203 C   
12 1 Y 1 B ALA 694 ? O   ? B ALA 203 O   
13 1 Y 1 B ALA 694 ? CB  ? B ALA 203 CB  
14 1 Y 1 C HIS 695 ? CA  ? C HIS 204 CA  
15 1 Y 1 C HIS 695 ? C   ? C HIS 204 C   
16 1 Y 1 C HIS 695 ? O   ? C HIS 204 O   
17 1 Y 1 C HIS 695 ? CB  ? C HIS 204 CB  
18 1 Y 1 C HIS 695 ? CG  ? C HIS 204 CG  
19 1 Y 1 C HIS 695 ? ND1 ? C HIS 204 ND1 
20 1 Y 1 C HIS 695 ? CD2 ? C HIS 204 CD2 
21 1 Y 1 C HIS 695 ? CE1 ? C HIS 204 CE1 
22 1 Y 1 C HIS 695 ? NE2 ? C HIS 204 NE2 
23 1 Y 1 D HIS 695 ? CA  ? D HIS 204 CA  
24 1 Y 1 D HIS 695 ? C   ? D HIS 204 C   
25 1 Y 1 D HIS 695 ? O   ? D HIS 204 O   
26 1 Y 1 D HIS 695 ? CB  ? D HIS 204 CB  
27 1 Y 1 D HIS 695 ? CG  ? D HIS 204 CG  
28 1 Y 1 D HIS 695 ? ND1 ? D HIS 204 ND1 
29 1 Y 1 D HIS 695 ? CD2 ? D HIS 204 CD2 
30 1 Y 1 D HIS 695 ? CE1 ? D HIS 204 CE1 
31 1 Y 1 D HIS 695 ? NE2 ? D HIS 204 NE2 
32 1 Y 1 E ALA 694 ? CA  ? E ALA 203 CA  
33 1 Y 1 E ALA 694 ? C   ? E ALA 203 C   
34 1 Y 1 E ALA 694 ? O   ? E ALA 203 O   
35 1 Y 1 E ALA 694 ? CB  ? E ALA 203 CB  
36 1 Y 1 F HIS 695 ? CA  ? F HIS 204 CA  
37 1 Y 1 F HIS 695 ? C   ? F HIS 204 C   
38 1 Y 1 F HIS 695 ? O   ? F HIS 204 O   
39 1 Y 1 F HIS 695 ? CB  ? F HIS 204 CB  
40 1 Y 1 F HIS 695 ? CG  ? F HIS 204 CG  
41 1 Y 1 F HIS 695 ? ND1 ? F HIS 204 ND1 
42 1 Y 1 F HIS 695 ? CD2 ? F HIS 204 CD2 
43 1 Y 1 F HIS 695 ? CE1 ? F HIS 204 CE1 
44 1 Y 1 F HIS 695 ? NE2 ? F HIS 204 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 492 ? A ALA 1   
2  1 Y 1 A PRO 493 ? A PRO 2   
3  1 Y 1 A LEU 494 ? A LEU 3   
4  1 Y 1 A ALA 495 ? A ALA 4   
5  1 Y 1 A GLN 496 ? A GLN 5   
6  1 Y 1 A HIS 696 ? A HIS 205 
7  1 Y 1 A HIS 697 ? A HIS 206 
8  1 Y 1 A HIS 698 ? A HIS 207 
9  1 Y 1 A HIS 699 ? A HIS 208 
10 1 Y 1 A HIS 700 ? A HIS 209 
11 1 Y 1 B ALA 492 ? B ALA 1   
12 1 Y 1 B PRO 493 ? B PRO 2   
13 1 Y 1 B LEU 494 ? B LEU 3   
14 1 Y 1 B ALA 495 ? B ALA 4   
15 1 Y 1 B GLN 496 ? B GLN 5   
16 1 Y 1 B HIS 695 ? B HIS 204 
17 1 Y 1 B HIS 696 ? B HIS 205 
18 1 Y 1 B HIS 697 ? B HIS 206 
19 1 Y 1 B HIS 698 ? B HIS 207 
20 1 Y 1 B HIS 699 ? B HIS 208 
21 1 Y 1 B HIS 700 ? B HIS 209 
22 1 Y 1 C ALA 492 ? C ALA 1   
23 1 Y 1 C PRO 493 ? C PRO 2   
24 1 Y 1 C LEU 494 ? C LEU 3   
25 1 Y 1 C ALA 495 ? C ALA 4   
26 1 Y 1 C GLN 496 ? C GLN 5   
27 1 Y 1 C HIS 696 ? C HIS 205 
28 1 Y 1 C HIS 697 ? C HIS 206 
29 1 Y 1 C HIS 698 ? C HIS 207 
30 1 Y 1 C HIS 699 ? C HIS 208 
31 1 Y 1 C HIS 700 ? C HIS 209 
32 1 Y 1 D ALA 492 ? D ALA 1   
33 1 Y 1 D PRO 493 ? D PRO 2   
34 1 Y 1 D LEU 494 ? D LEU 3   
35 1 Y 1 D ALA 495 ? D ALA 4   
36 1 Y 1 D GLN 496 ? D GLN 5   
37 1 Y 1 D HIS 696 ? D HIS 205 
38 1 Y 1 D HIS 697 ? D HIS 206 
39 1 Y 1 D HIS 698 ? D HIS 207 
40 1 Y 1 D HIS 699 ? D HIS 208 
41 1 Y 1 D HIS 700 ? D HIS 209 
42 1 Y 1 E HIS 695 ? E HIS 204 
43 1 Y 1 E HIS 696 ? E HIS 205 
44 1 Y 1 E HIS 697 ? E HIS 206 
45 1 Y 1 E HIS 698 ? E HIS 207 
46 1 Y 1 E HIS 699 ? E HIS 208 
47 1 Y 1 E HIS 700 ? E HIS 209 
48 1 Y 1 F ALA 492 ? F ALA 1   
49 1 Y 1 F PRO 493 ? F PRO 2   
50 1 Y 1 F LEU 494 ? F LEU 3   
51 1 Y 1 F ALA 495 ? F ALA 4   
52 1 Y 1 F GLN 496 ? F GLN 5   
53 1 Y 1 F HIS 696 ? F HIS 205 
54 1 Y 1 F HIS 697 ? F HIS 206 
55 1 Y 1 F HIS 698 ? F HIS 207 
56 1 Y 1 F HIS 699 ? F HIS 208 
57 1 Y 1 F HIS 700 ? F HIS 209 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#